data_6AH0
# 
_entry.id   6AH0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.299 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6AH0         
WWPDB D_1300008743 
EMDB  EMD-9621     
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        'The Cryo-EM Structure of the Precusor of Human Pre-catalytic Spliceosome (pre-B complex)' 
_pdbx_database_related.db_id          EMD-9621 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6AH0 
_pdbx_database_status.recvd_initial_deposition_date   2018-08-15 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Zhan, X.'  1 0000-0001-5198-6461 
'Yan, C.'   2 0000-0001-9338-8048 
'Zhang, X.' 3 0000-0002-8690-8823 
'Shi, Y.'   4 0000-0003-2030-168X 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   CN 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Cell Res.' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1748-7838 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            28 
_citation.language                  ? 
_citation.page_first                1129 
_citation.page_last                 1140 
_citation.title                     'Structures of the human pre-catalytic spliceosome and its precursor spliceosome.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41422-018-0094-7 
_citation.pdbx_database_id_PubMed   30315277 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Zhan, X.'  1 0000-0001-5198-6461 
primary 'Yan, C.'   2 ?                   
primary 'Zhang, X.' 3 ?                   
primary 'Lei, J.'   4 0000-0002-9384-8742 
primary 'Shi, Y.'   5 ?                   
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat U5snRNA                                                        37254.855  1 ?        ? ? ? 
2  polymer     nat 'U5 small nuclear ribonucleoprotein 200 kDa helicase'          244823.422 1 3.6.4.13 ? ? ? 
3  polymer     nat 'U5 small nuclear ribonucleoprotein 40 kDa protein'            39359.492  1 ?        ? ? ? 
4  polymer     nat 'Small nuclear ribonucleoprotein Sm D2'                        13551.928  3 ?        ? ? ? 
5  polymer     nat 'Small nuclear ribonucleoprotein F'                            9734.171   3 ?        ? ? ? 
6  polymer     nat 'Small nuclear ribonucleoprotein E'                            10817.601  3 ?        ? ? ? 
7  polymer     nat 'Small nuclear ribonucleoprotein G'                            8508.084   3 ?        ? ? ? 
8  polymer     nat 'Small nuclear ribonucleoprotein Sm D3'                        13940.308  3 ?        ? ? ? 
9  polymer     nat 
;Small nuclear ribonucleoprotein-associated proteins B and B'
;
23686.004  3 ?        ? ? ? 
10 polymer     nat 'Small nuclear ribonucleoprotein Sm D1'                        13310.653  3 ?        ? ? ? 
11 polymer     nat U6snRNA                                                        34404.438  1 ?        ? ? ? 
12 polymer     nat 'U6 snRNA-associated Sm-like protein LSm2'                     10847.495  1 ?        ? ? ? 
13 polymer     nat 'U6 snRNA-associated Sm-like protein LSm3'                     11859.390  1 ?        ? ? ? 
14 polymer     nat 'U6 snRNA-associated Sm-like protein LSm4'                     15375.775  1 ?        ? ? ? 
15 polymer     nat 'U6 snRNA-associated Sm-like protein LSm5'                     9945.448   1 ?        ? ? ? 
16 polymer     nat 'U6 snRNA-associated Sm-like protein LSm6'                     9139.571   1 ?        ? ? ? 
17 polymer     nat 'U6 snRNA-associated Sm-like protein LSm7'                     11617.363  1 ?        ? ? ? 
18 polymer     nat 'U6 snRNA-associated Sm-like protein LSm8'                     10410.589  1 ?        ? ? ? 
19 polymer     syn pre-mRNA                                                       87892.727  1 ?        ? ? ? 
20 polymer     nat U2snRNA                                                        60186.445  1 ?        ? ? ? 
21 polymer     nat 
;U2 small nuclear ribonucleoprotein A'
;
28456.584  1 ?        ? ? ? 
22 polymer     nat 
;U2 small nuclear ribonucleoprotein B''
;
25524.367  1 ?        ? ? ? 
23 polymer     nat 'Splicing factor 3A subunit 1'                                 88991.094  1 ?        ? ? ? 
24 polymer     nat 'Splicing factor 3A subunit 2'                                 49327.355  1 ?        ? ? ? 
25 polymer     nat 'Splicing factor 3A subunit 3'                                 58934.844  1 ?        ? ? ? 
26 polymer     nat 'Splicing factor 3B subunit 1'                                 146024.938 1 ?        ? ? ? 
27 polymer     nat 'Splicing factor 3B subunit 2'                                 100377.812 1 ?        ? ? ? 
28 polymer     nat 'Splicing factor 3B subunit 3'                                 135718.844 1 ?        ? ? ? 
29 polymer     nat 'Splicing factor 3B subunit 4'                                 44436.570  1 ?        ? ? ? 
30 polymer     nat 'Splicing factor 3B subunit 6'                                 14606.900  1 ?        ? ? ? 
31 polymer     nat 'PHD finger-like domain-containing protein 5A'                 12427.524  1 ?        ? ? ? 
32 polymer     nat 'Splicing factor 3B subunit 5'                                 10149.369  1 ?        ? ? ? 
33 polymer     nat 'U4/U6 small nuclear ribonucleoprotein Prp3'                   77669.188  1 ?        ? ? ? 
34 polymer     nat 'U4/U6 small nuclear ribonucleoprotein Prp4'                   58536.105  1 ?        ? ? ? 
35 polymer     nat 'Pre-mRNA-processing factor 6'                                 107092.242 1 ?        ? ? ? 
36 polymer     nat 'U4/U6 small nuclear ribonucleoprotein Prp31'                  55528.969  1 ?        ? ? ? 
37 polymer     nat 'NHP2-like protein 1'                                          14191.524  1 ?        ? ? ? 
38 polymer     nat 'Thioredoxin-like protein 4A'                                  16807.346  1 ?        ? ? ? 
39 polymer     nat 'U4/U6.U5 tri-snRNP-associated protein 2'                      65481.426  1 ?        ? ? ? 
40 polymer     nat U4snRNA                                                        46181.289  1 ?        ? ? ? 
41 polymer     nat 'Probable ATP-dependent RNA helicase DDX23'                    95785.148  1 3.6.4.13 ? ? ? 
42 polymer     nat 'Pre-mRNA-processing-splicing factor 8'                        273974.250 1 ?        ? ? ? 
43 polymer     nat '116 kDa U5 small nuclear ribonucleoprotein component'         109560.625 1 ?        ? ? ? 
44 non-polymer syn 'INOSITOL HEXAKISPHOSPHATE'                                    660.035    1 ?        ? ? ? 
45 non-polymer syn "GUANOSINE-5'-TRIPHOSPHATE"                                    523.180    1 ?        ? ? ? 
46 non-polymer syn 'MAGNESIUM ION'                                                24.305     1 ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
2  'Activating signal cointegrator 1 complex subunit 3-like 1,BRR2 homolog,U5 snRNP-specific 200 kDa protein,U5-200KD' 
3  'U5-40K,38 kDa-splicing factor,Prp8-binding protein,hPRP8BP,U5 snRNP-specific 40 kDa protein,WD repeat-containing protein 57' 
4  'Sm-D2,snRNP core protein D2' 
5  'snRNP-F,Sm protein F,SmF' 
6  'snRNP-E,Sm protein E,SmE' 
7  'snRNP-G,Sm protein G,SmG' 
8  'Sm-D3,snRNP core protein D3' 
9  
;snRNP-B,Sm protein B/B',SmB/B'
;
10 'Sm-D1,Sm-D autoantigen,snRNP core protein D1' 
12 'Protein G7b,Small nuclear ribonuclear protein D homolog,snRNP core Sm-like protein Sm-x5' 
14 'Glycine-rich protein,GRP' 
21 
;U2-A, U2 snRNP A'
;
22 
;U2 snRNP B''
;
23 'SF3a120,Spliceosome-associated protein 114,SAP 114' 
24 'SF3a66,Spliceosome-associated protein 62,SAP 62' 
25 'SF3a60,Spliceosome-associated protein 61,SAP 61' 
26 'Pre-mRNA-splicing factor SF3b 155 kDa subunit,SF3b155,Spliceosome-associated protein 155,SAP 155' 
27 'Pre-mRNA-splicing factor SF3b 145 kDa subunit,SF3b145,Spliceosome-associated protein 145,SAP 145' 
28 'Pre-mRNA-splicing factor SF3b 130 kDa subunit,SF3b130,STAF130,Spliceosome-associated protein 130,SAP 130' 
29 'Pre-mRNA-splicing factor SF3b 49 kDa subunit,Spliceosome-associated protein 49,SAP 49' 
30 
;Pre-mRNA branch site protein p14,SF3b 14 kDa subunit,SF3B14a,Spliceosome-associated protein,14-kDa,Splicing factor 3b,subunit 6,14kDa
;
31 'PHD finger-like domain protein 5A,Splicing factor 3B-associated 14 kDa protein,SF3b14b' 
32 'SF3b5,Pre-mRNA-splicing factor SF3b 10 kDa subunit' 
33 'Pre-mRNA-splicing factor 3,hPrp3,U4/U6 snRNP 90 kDa protein' 
34 'PRP4 homolog,hPrp4,U4/U6 snRNP 60 kDa protein,WD splicing factor Prp4' 
35 
;Androgen receptor N-terminal domain-transactivating protein 1,ANT-1,PRP6 homolog,U5 snRNP-associated 102 kDa protein,U5-102 kDa protein
;
36 'Pre-mRNA-processing factor 31,Serologically defined breast cancer antigen NY-BR-99,U4/U6 snRNP 61 kDa protein,hPrp31' 
37 
;High mobility group-like nuclear protein 2 homolog 1,OTK27,SNU13 homolog,hSNU13,U4/U6.U5 small nuclear ribonucleoprotein SNU13,U4/U6.U5 tri-snRNP 15.5 kDa protein
;
38 'DIM1 protein homolog,Spliceosomal U5 snRNP-specific 15 kDa protein,Thioredoxin-like U5 snRNP protein U5-15kD' 
39 'Inactive ubiquitin-specific peptidase 39,SAD1 homolog,U4/U6.U5 tri-snRNP-associated 65 kDa protein,65K' 
41 '100 kDa U5 snRNP-specific protein,DEAD box protein 23,PRP28 homolog,U5-100kD' 
42 '220 kDa U5 snRNP-specific protein,PRP8 homolog,Splicing factor Prp8,p220' 
43 
'Elongation factor Tu GTP-binding domain-containing protein 2,SNU114 homolog,hSNU114,U5 snRNP-specific protein,116 kDa,U5-116 kDa' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  polyribonucleotide no no 
;AUACUCUGGUUUCUCUUCAGAUCGCAUAAAUCUUUCGCCUUUUACUAAAGAUUUCCGUGGAGAGGAACAACUCUGAGUCU
UAACCCAAUUUUUUGAGGCCUUGCUUUGGCAAGGCUA
;
;AUACUCUGGUUUCUCUUCAGAUCGCAUAAAUCUUUCGCCUUUUACUAAAGAUUUCCGUGGAGAGGAACAACUCUGAGUCU
UAACCCAAUUUUUUGAGGCCUUGCUUUGGCAAGGCUA
;
B     ? 
2  'polypeptide(L)'   no no 
;MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTKPQMQEERRAKRRKRDEDRHD
INKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFIQAALGDQPRDILCGAADEVLAVLKNEKLRDKERRKEIDLL
LGQTDDTRYHVLVNLGKKITDYGGDKEIQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASDDDMEGDEAVVRCTL
SANLVASGELMSSKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDRECENQLVLLLGFNTFDFIKV
LRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFLYQLHETEKEDLIREERSRRERVRQSRMDTDLETMDLDQGG
EALAPRQVLDLEDLVFTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLLPVEKLPKYAQAGFEGFKT
LNRIQSKLYRAALETDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDDFKIIYIAPMRSLVQEMVGSFGKRLA
TYGITVAELTGDHQLCKEEISATQIIVCTPEKWDIITRKGGERTYTQLVRLIILDEIHLLHDDRGPVLEALVARAIRNIE
MTQEDVRLIGLSATLPNYEDVATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQ
VLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELKDLLPYGFAIHHAGMTRVDRTLVEDL
FADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYL
SLLNQQLPIESQMVSKLPDMLNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLDLVHTA
ALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELFRVFSLSSEFKNITVREEEKLELQKL
LERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDK
RMWQSMCPLRQFRKLPEEVVKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITRSTLKV
ELTITPDFQWDEKVHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLITFFVPVFEPLPPQYFIRVVSDRWLSCET
QLPVSFRHLILPEKYPPPTELLDLQPLPVSALRNSAFESLYQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICA
EFAILRMLLQSSEGRCVYITPMEALAEQVYMDWYEKFQDRLNKKVVLLTGETSTDLKLLGKGNIIISTPEKWDILSRRWK
QRKNVQNINLFVVDEVHLIGGENGPVLEVICSRMRYISSQIERPIRIVALSSSLSNAKDVAHWLGCSATSTFNFHPNVRP
VPLELHIQGFNISHTQTRLLSMAKPVYHAITKHSPKKPVIVFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKDLIPY
LEKLSDSTLKETLLNGVGYLHEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVIIMDTQYYNGKIHAYVDYP
IYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCMHDHFNAEIVTKTIENKQDAVDYLTWTFL
YRRMTQNPNYYNLQGISHRHLSDHLSELVEQTLSDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKT
KVRGLIEIISNAAEYENIPIRHHEDNLLRQLAQKVPHKLNNPKFNDPHVKTNLLLQAHLSRMQLSAELQSDTEEILSKAI
RLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPHFTSEHIKRCTDKGVESVFDIMEMEDEERNALLQLT
DSQIADVARFCNRYPNIELSYEVVDKDSIRSGGPVVVLVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDAKSNSLISIK
RLTLQQKAKVKLDFVAPATGAHNYTLYFMSDAYMGCDQEYKFSVDVKEAETDSDSD
;
;MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTKPQMQEERRAKRRKRDEDRHD
INKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFIQAALGDQPRDILCGAADEVLAVLKNEKLRDKERRKEIDLL
LGQTDDTRYHVLVNLGKKITDYGGDKEIQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASDDDMEGDEAVVRCTL
SANLVASGELMSSKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDRECENQLVLLLGFNTFDFIKV
LRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFLYQLHETEKEDLIREERSRRERVRQSRMDTDLETMDLDQGG
EALAPRQVLDLEDLVFTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLLPVEKLPKYAQAGFEGFKT
LNRIQSKLYRAALETDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDDFKIIYIAPMRSLVQEMVGSFGKRLA
TYGITVAELTGDHQLCKEEISATQIIVCTPEKWDIITRKGGERTYTQLVRLIILDEIHLLHDDRGPVLEALVARAIRNIE
MTQEDVRLIGLSATLPNYEDVATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQ
VLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELKDLLPYGFAIHHAGMTRVDRTLVEDL
FADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYL
SLLNQQLPIESQMVSKLPDMLNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLDLVHTA
ALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELFRVFSLSSEFKNITVREEEKLELQKL
LERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDK
RMWQSMCPLRQFRKLPEEVVKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITRSTLKV
ELTITPDFQWDEKVHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLITFFVPVFEPLPPQYFIRVVSDRWLSCET
QLPVSFRHLILPEKYPPPTELLDLQPLPVSALRNSAFESLYQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICA
EFAILRMLLQSSEGRCVYITPMEALAEQVYMDWYEKFQDRLNKKVVLLTGETSTDLKLLGKGNIIISTPEKWDILSRRWK
QRKNVQNINLFVVDEVHLIGGENGPVLEVICSRMRYISSQIERPIRIVALSSSLSNAKDVAHWLGCSATSTFNFHPNVRP
VPLELHIQGFNISHTQTRLLSMAKPVYHAITKHSPKKPVIVFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKDLIPY
LEKLSDSTLKETLLNGVGYLHEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVIIMDTQYYNGKIHAYVDYP
IYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCMHDHFNAEIVTKTIENKQDAVDYLTWTFL
YRRMTQNPNYYNLQGISHRHLSDHLSELVEQTLSDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKT
KVRGLIEIISNAAEYENIPIRHHEDNLLRQLAQKVPHKLNNPKFNDPHVKTNLLLQAHLSRMQLSAELQSDTEEILSKAI
RLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPHFTSEHIKRCTDKGVESVFDIMEMEDEERNALLQLT
DSQIADVARFCNRYPNIELSYEVVDKDSIRSGGPVVVLVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDAKSNSLISIK
RLTLQQKAKVKLDFVAPATGAHNYTLYFMSDAYMGCDQEYKFSVDVKEAETDSDSD
;
D     ? 
3  'polypeptide(L)'   no no 
;MIEQQKRKGPELPLVPVKRQRHELLLGAGSGPGAGQQQATPGALLQAGPPRCSSLQAPIMLLSGHEGEVYCCKFHPNGST
LASAGFDRLILLWNVYGDCDNYATLKGHSGAVMELHYNTDGSMLFSASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPA
RRGPQLVCTGSDDGTVKLWDIRKKAAIQTFQNTYQVLAVTFNDTSDQIISGGIDNDIKVWDLRQNKLTYTMRGHADSVTG
LSLSSEGSYLLSNAMDNTVRVWDVRPFAPKERCVKIFQGNVHNFEKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRIL
YKLPGHAGSINEVAFHPDEPIIISASSDKRLYMGEIQ
;
;MIEQQKRKGPELPLVPVKRQRHELLLGAGSGPGAGQQQATPGALLQAGPPRCSSLQAPIMLLSGHEGEVYCCKFHPNGST
LASAGFDRLILLWNVYGDCDNYATLKGHSGAVMELHYNTDGSMLFSASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPA
RRGPQLVCTGSDDGTVKLWDIRKKAAIQTFQNTYQVLAVTFNDTSDQIISGGIDNDIKVWDLRQNKLTYTMRGHADSVTG
LSLSSEGSYLLSNAMDNTVRVWDVRPFAPKERCVKIFQGNVHNFEKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRIL
YKLPGHAGSINEVAFHPDEPIIISASSDKRLYMGEIQ
;
E     ? 
4  'polypeptide(L)'   no no 
;MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKS
GKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK
;
;MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKS
GKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK
;
a,k,P ? 
5  'polypeptide(L)'   no no 
;MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEE
DGEMRE
;
;MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEE
DGEMRE
;
b,m,Q ? 
6  'polypeptide(L)'   no no 
;MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLK
GDNITLLQSVSN
;
;MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLK
GDNITLLQSVSN
;
c,l,R ? 
7  'polypeptide(L)'   no no MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV 
MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV d,n,S ? 
8  'polypeptide(L)'   no no 
;MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNA
PMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR
;
;MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNA
PMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR
;
e,h,T ? 
9  'polypeptide(L)'   no no 
;MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSM
TVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATAS
IAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGLL
;
;MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSM
TVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATAS
IAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGLL
;
f,i,U ? 
10 'polypeptide(L)'   no no 
;MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLL
VDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR
;
;MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLL
VDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR
;
g,j,V ? 
11 polyribonucleotide no no 
;GUGCUCGCUUCGGCAGCACAUAUACUAAAAUUGGAACGAUACAGAGAAGAUUAGCAUGGCCCCUGCGCAAGGAUGACACG
CAAAUUCGUGAAGCGUUCCAUAUUUUU
;
;GUGCUCGCUUCGGCAGCACAUAUACUAAAAUUGGAACGAUACAGAGAAGAUUAGCAUGGCCCCUGCGCAAGGAUGACACG
CAAAUUCGUGAAGCGUUCCAUAUUUUU
;
F     ? 
12 'polypeptide(L)'   no no 
;MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQ
LLQDAARKEALQQKQ
;
;MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQ
LLQDAARKEALQQKQ
;
q     ? 
13 'polypeptide(L)'   no no 
;MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKR
NIPMLFVRGDGVVLVAPPLRVG
;
;MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKR
NIPMLFVRGDGVVLVAPPLRVG
;
r     ? 
14 'polypeptide(L)'   no no 
;MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVK
EEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ
;
;MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVK
EEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ
;
s     ? 
15 'polypeptide(L)'   no no 
;MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNIT
MLVPGGEGPEV
;
;MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNIT
MLVPGGEGPEV
;
t     ? 
16 'polypeptide(L)'   no no MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRM 
MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRM x     ? 
17 'polypeptide(L)'   no no 
;MADKEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQLGLVVCRGTS
VVLICPQDGMEAIPNPFIQQQDA
;
;MADKEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQLGLVVCRGTS
VVLICPQDGMEAIPNPFIQQQDA
;
y     ? 
18 'polypeptide(L)'   no no 
;MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNVAVIGEIDEETDSA
LDLGNIRAEPLNSVAH
;
;MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNVAVIGEIDEETDSA
LDLGNIRAEPLNSVAH
;
z     ? 
19 polyribonucleotide no no 
;GGGAAUACACGGAAUUCGAGCUCGCCCACUCUUGGAUCGGAAACCCGUCGGCCUCCGAACGGUAAGAGCCUAGCAUGUAG
AACUGGUUACCUGCAGCCCAAGCUUGCGUACACCAUCAGGGUACGUACUAGUACGUACACCAUCAGGGUACGGCUGCACG
UCUAGGGCGCAGUAGUCCAGGGUUUCCUUGAUGAUGUCAUACUUAUCCUGUCCCUUUUUUUUCCACGGCUCGCGGUUGAG
GACAAACUCUUCGCGGUCUUUCCAGUGGGGAUCC
;
;GGGAAUACACGGAAUUCGAGCUCGCCCACUCUUGGAUCGGAAACCCGUCGGCCUCCGAACGGUAAGAGCCUAGCAUGUAG
AACUGGUUACCUGCAGCCCAAGCUUGCGUACACCAUCAGGGUACGUACUAGUACGUACACCAUCAGGGUACGGCUGCACG
UCUAGGGCGCAGUAGUCCAGGGUUUCCUUGAUGAUGUCAUACUUAUCCUGUCCCUUUUUUUUCCACGGCUCGCGGUUGAG
GACAAACUCUUCGCGGUCUUUCCAGUGGGGAUCC
;
G     ? 
20 polyribonucleotide no no 
;AUCGCUUCUCGGCCUUUUGGCUAAGAUCAAGUGUAGUAUCUGUUCUUAUCAGUUUAAUAUCUGAUACGUCCUCUAUCCGA
GGACAAUAUAUUAAAUGGAUUUUUGGAGCAGGGAGAUGGAAUAGGAGCUUGCUCCGUCCACUCCACGCAUCGACCUGGUA
UUGCAGUACCUCCAGGAACGGUGCACCC
;
;AUCGCUUCUCGGCCUUUUGGCUAAGAUCAAGUGUAGUAUCUGUUCUUAUCAGUUUAAUAUCUGAUACGUCCUCUAUCCGA
GGACAAUAUAUUAAAUGGAUUUUUGGAGCAGGGAGAUGGAAUAGGAGCUUGCUCCGUCCACUCCACGCAUCGACCUGGUA
UUGCAGUACCUCCAGGAACGGUGCACCC
;
H     ? 
21 'polypeptide(L)'   no no 
;MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIG
EGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEK
MFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTD
DGEEEMEEDTVTNGS
;
;MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIG
EGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEK
MFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTD
DGEEEMEEDTVTNGS
;
o     ? 
22 'polypeptide(L)'   no no 
;MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMR
IQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPE
ETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK
;
;MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMR
IQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPE
ETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK
;
p     ? 
23 'polypeptide(L)'   no no 
;MPAGPVQAVPPPPPVPTEPKQPTEEEASSKEDSAPSKPVVGIIYPPPEVRNIVDKTASFVARNGPEFEARIRQNEINNPK
FNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQQQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSIS
AFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKILIPPKGLFSKLKKEAENPREVL
DQVCYRVEWAKFQERERKKEEEEKEKERVAYAQIDWHDFVVVETVDFQPNEQGNFPPPTTPEELGARILIQERYEKFGES
EEVEMEVESDEEDDKQEKAEEPPSQLDQDTQVQDMDEGSDDEEEGQKVPPPPETPMPPPLPPTPDQVIVRKDYDPKASKP
LPPAPAPDEYLVSPITGEKIPASKMQEHMRIGLLDPRWLEQRDRSIREKQSDDEVYAPGLDIESSLKQLAERRTDIFGVE
ETAIGKKIGEEEIQKPEEKVTWDGHSGSMARTQQAAQANITLQEQIEAIHKAKGLVPEDDTKEKIGPSKPNEIPQQPPPP
SSATNIPSSAPPITSVPRPPTMPPPVRTTVVSAVPVMPRPPMASVVRLPPGSVIAPMPPIIHAPRINVVPMPPSAPPIMA
PRPPPMIVPTAFVPAPPVAPVPAPAPMPPVHPPPPMEDEPTSKKLKTEDSLMPEEEFLRRNKGPVSIKVQVPNMQDKTEW
KLNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHLALKERGGRKK
;
;MPAGPVQAVPPPPPVPTEPKQPTEEEASSKEDSAPSKPVVGIIYPPPEVRNIVDKTASFVARNGPEFEARIRQNEINNPK
FNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQQQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSIS
AFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKILIPPKGLFSKLKKEAENPREVL
DQVCYRVEWAKFQERERKKEEEEKEKERVAYAQIDWHDFVVVETVDFQPNEQGNFPPPTTPEELGARILIQERYEKFGES
EEVEMEVESDEEDDKQEKAEEPPSQLDQDTQVQDMDEGSDDEEEGQKVPPPPETPMPPPLPPTPDQVIVRKDYDPKASKP
LPPAPAPDEYLVSPITGEKIPASKMQEHMRIGLLDPRWLEQRDRSIREKQSDDEVYAPGLDIESSLKQLAERRTDIFGVE
ETAIGKKIGEEEIQKPEEKVTWDGHSGSMARTQQAAQANITLQEQIEAIHKAKGLVPEDDTKEKIGPSKPNEIPQQPPPP
SSATNIPSSAPPITSVPRPPTMPPPVRTTVVSAVPVMPRPPMASVVRLPPGSVIAPMPPIIHAPRINVVPMPPSAPPIMA
PRPPPMIVPTAFVPAPPVAPVPAPAPMPPVHPPPPMEDEPTSKKLKTEDSLMPEEEFLRRNKGPVSIKVQVPNMQDKTEW
KLNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHLALKERGGRKK
;
u     ? 
24 'polypeptide(L)'   no no 
;MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQT
NLARRAAKEAKEAPAQPAPEKVKVEVKKFVKIGRPGYKVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIE
PPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKPPAPPSLPAGPPGVKRPPPPLMNG
LPPRPPLPESLPPPPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAPVVHPPASGVHPPAPGVHPPAPGVHPPAP
GVHPPTSGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPPSAGVHPQAPGVHPAAPAVHPQAPGVHPPAPGM
HPQAPGVHPQPPGVHPSAPGVHPQPPGVHPSNPGVHPPTPMPPMLRPPLPSEGPGNIPPPPPTN
;
;MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQT
NLARRAAKEAKEAPAQPAPEKVKVEVKKFVKIGRPGYKVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIE
PPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKPPAPPSLPAGPPGVKRPPPPLMNG
LPPRPPLPESLPPPPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAPVVHPPASGVHPPAPGVHPPAPGVHPPAP
GVHPPTSGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPPSAGVHPQAPGVHPAAPAVHPQAPGVHPPAPGM
HPQAPGVHPQPPGVHPSAPGVHPQPPGVHPSNPGVHPPTPMPPMLRPPLPSEGPGNIPPPPPTN
;
v     ? 
25 'polypeptide(L)'   no no 
;METILEQQRRYHEEKERLMDVMAKEMLTKKSTLRDQINSDHRTRAMQDRYMEVSGNLRDLYDDKDGLRKEELNAISGPNE
FAEFYNRLKQIKEFHRKHPNEICVPMSVEFEELLKARENPSEEAQNLVEFTDEEGYGRYLDLHDCYLKYINLKASEKLDY
ITYLSIFDQLFDIPKERKNAEYKRYLEMLLEYLQDYTDRVKPLQDQNELFGKIQAEFEKKWENGTFPGWPKETSSALTHA
GAHLDLSAFSSWEELASLGLDRLKSALLALGLKCGGTLEERAQRLFSTKGKSLESLDTSLFAKNPKSKGTKRDTERNKDI
AFLEAQIYEYVEILGEQRHLTHENVQRKQARTGEEREEEEEEQISESESEDEENEIIYNPKNLPLGWDGKPIPYWLYKLH
GLNINYNCEICGNYTYRGPKAFQRHFAEWRHAHGMRCLGIPNTAHFANVTQIEDAVSLWAKLKLQKASERWQPDTEEEYE
DSSGNVVNKKTYEDLKRQGLL
;
;METILEQQRRYHEEKERLMDVMAKEMLTKKSTLRDQINSDHRTRAMQDRYMEVSGNLRDLYDDKDGLRKEELNAISGPNE
FAEFYNRLKQIKEFHRKHPNEICVPMSVEFEELLKARENPSEEAQNLVEFTDEEGYGRYLDLHDCYLKYINLKASEKLDY
ITYLSIFDQLFDIPKERKNAEYKRYLEMLLEYLQDYTDRVKPLQDQNELFGKIQAEFEKKWENGTFPGWPKETSSALTHA
GAHLDLSAFSSWEELASLGLDRLKSALLALGLKCGGTLEERAQRLFSTKGKSLESLDTSLFAKNPKSKGTKRDTERNKDI
AFLEAQIYEYVEILGEQRHLTHENVQRKQARTGEEREEEEEEQISESESEDEENEIIYNPKNLPLGWDGKPIPYWLYKLH
GLNINYNCEICGNYTYRGPKAFQRHFAEWRHAHGMRCLGIPNTAHFANVTQIEDAVSLWAKLKLQKASERWQPDTEEEYE
DSSGNVVNKKTYEDLKRQGLL
;
w     ? 
26 'polypeptide(L)'   no no 
;MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSRFAGYVTSIAATELEDDDDDYSSSTSLLGQK
KPGYHAPVALLNDIPQSTEQYDPFAEHRPPKIADREDEYKKHRRTMIISPERLDPFADGGKTPDPKMNARTYMDVMREQH
LTKEEREIRQQLAEKAKAGELKVVNGAAASQPPSKRKRRWDQTADQTPGATPKKLSSWDQAETPGHTPSLRWDETPGRAK
GSETPGATPGSKIWDPTPSHTPAGAATPGRGDTPGHATPGHGGATSSARKNRWDETPKTERDTPGHGSGWAETPRTDRGG
DSIGETPTPGASKRKSRWDETPASQMGGSTPVLTPGKTPIGTPAMNMATPTPGHIMSMTPEQLQAWRWEREIDERNRPLS
DEELDAMFPEGYKVLPPPAGYVPIRTPARKLTATPTPLGGMTGFHMQTEDRTMKSVNDQPSGNLPFLKPDDIQYFDKLLV
DVDESTLSPEEQKERKIMKLLLKIKNGTPPMRKAALRQITDKAREFGAGPLFNQILPLLMSPTLEDQERHLLVKVIDRIL
YKLDDLVRPYVHKILVVIEPLLIDEDYYARVEGREIISNLAKAAGLATMISTMRPDIDNMDEYVRNTTARAFAVVASALG
IPSLLPFLKAVCKSKKSWQARHTGIKIVQQIAILMGCAILPHLRSLVEIIEHGLVDEQQKVRTISALAIAALAEAATPYG
IESFDSVLKPLWKGIRQHRGKGLAAFLKAIGYLIPLMDAEYANYYTREVMLILIREFQSPDEEMKKIVLKVVKQCCGTDG
VEANYIKTEILPPFFKHFWQHRMALDRRNYRQLVDTTVELANKVGAAEIISRIVDDLKDEAEQYRKMVMETIEKIMGNLG
AADIDHKLEEQLIDGILYAFQEQTTEDSVMLNGFGTVVNALGKRVKPYLPQICGTVLWRLNNKSAKVRQQAADLISRTAV
VMKTCQEEKLMGHLGVVLYEYLGEEYPEVLGSILGALKAIVNVIGMHKMTPPIKDLLPRLTPILKNRHEKVQENCIDLVG
RIADRGAEYVSAREWMRICFELLELLKAHKKAIRRATVNTFGYIAKAIGPHDVLATLLNNLKVQERQNRVCTTVAIAIVA
ETCSPFTVLPALMNEYRVPELNVQNGVLKSLSFLFEYIGEMGKDYIYAVTPLLEDALMDRDLVHRQTASAVVQHMSLGVY
GFGCEDSLNHLLNYVWPNVFETSPHVIQAVMGALEGLRVAIGPCRMLQYCLQGLFHPARKVRDVYWKIYNSIYIGSQDAL
IAHYPRIYNDDKNTYIRYELDYIL
;
;MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSRFAGYVTSIAATELEDDDDDYSSSTSLLGQK
KPGYHAPVALLNDIPQSTEQYDPFAEHRPPKIADREDEYKKHRRTMIISPERLDPFADGGKTPDPKMNARTYMDVMREQH
LTKEEREIRQQLAEKAKAGELKVVNGAAASQPPSKRKRRWDQTADQTPGATPKKLSSWDQAETPGHTPSLRWDETPGRAK
GSETPGATPGSKIWDPTPSHTPAGAATPGRGDTPGHATPGHGGATSSARKNRWDETPKTERDTPGHGSGWAETPRTDRGG
DSIGETPTPGASKRKSRWDETPASQMGGSTPVLTPGKTPIGTPAMNMATPTPGHIMSMTPEQLQAWRWEREIDERNRPLS
DEELDAMFPEGYKVLPPPAGYVPIRTPARKLTATPTPLGGMTGFHMQTEDRTMKSVNDQPSGNLPFLKPDDIQYFDKLLV
DVDESTLSPEEQKERKIMKLLLKIKNGTPPMRKAALRQITDKAREFGAGPLFNQILPLLMSPTLEDQERHLLVKVIDRIL
YKLDDLVRPYVHKILVVIEPLLIDEDYYARVEGREIISNLAKAAGLATMISTMRPDIDNMDEYVRNTTARAFAVVASALG
IPSLLPFLKAVCKSKKSWQARHTGIKIVQQIAILMGCAILPHLRSLVEIIEHGLVDEQQKVRTISALAIAALAEAATPYG
IESFDSVLKPLWKGIRQHRGKGLAAFLKAIGYLIPLMDAEYANYYTREVMLILIREFQSPDEEMKKIVLKVVKQCCGTDG
VEANYIKTEILPPFFKHFWQHRMALDRRNYRQLVDTTVELANKVGAAEIISRIVDDLKDEAEQYRKMVMETIEKIMGNLG
AADIDHKLEEQLIDGILYAFQEQTTEDSVMLNGFGTVVNALGKRVKPYLPQICGTVLWRLNNKSAKVRQQAADLISRTAV
VMKTCQEEKLMGHLGVVLYEYLGEEYPEVLGSILGALKAIVNVIGMHKMTPPIKDLLPRLTPILKNRHEKVQENCIDLVG
RIADRGAEYVSAREWMRICFELLELLKAHKKAIRRATVNTFGYIAKAIGPHDVLATLLNNLKVQERQNRVCTTVAIAIVA
ETCSPFTVLPALMNEYRVPELNVQNGVLKSLSFLFEYIGEMGKDYIYAVTPLLEDALMDRDLVHRQTASAVVQHMSLGVY
GFGCEDSLNHLLNYVWPNVFETSPHVIQAVMGALEGLRVAIGPCRMLQYCLQGLFHPARKVRDVYWKIYNSIYIGSQDAL
IAHYPRIYNDDKNTYIRYELDYIL
;
1     ? 
27 'polypeptide(L)'   no no 
;MATEHPEPPKAELQLPPPPPPGHYGAWAAQELQAKLAEIGAPIQGNREELVERLQSYTRQTGIVLNRPVLRGEDGDKAAP
PPMSAQLPGIPMPPPPLGLPPLQPPPPPPPPPPGLGLGFPMAHPPNLGPPPPLRVGEPVALSEEERLKLAQQQAALLMQQ
EERAKQQGDHSLKEHELLEQQKRAAVLLEQERQQEIAKMGTPVPRPPQDMGQIGVRTPLGPRVAAPVGPVGPTPTVLPMG
APVPRPRGPPPPPGDENREMDDPSVGPKIPQALEKILQLKESRQEEMNSQQEEEEMETDARSSLGQSASETEEDTVSVSK
KEKNRKRRNRKKKKKPQRVRGVSSESSGDREKDSTRSRGSDSPAADVEIEYVTEEPEIYEPNFIFFKRIFEAFKLTDDVK
KEKEKEPEKLDKLENSAAPKKKGFEEEHKDSDDDSSDDEQEKKPEAPKLSKKKLRRMNRFTVAELKQLVARPDVVEMHDV
TAQDPKLLVHLKATRNSVPVPRHWCFKRKYLQGKRGIEKPPFELPDFIKRTGIQEMREALQEKEEQKTMKSKMREKVRPK
MGKIDIDYQKLHDAFFKWQTKPKLTIHGDLYYEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYG
PPPSYPNLKIPGLNSPIPESCSFGYHAGGWGKPPVDETGKPLYGDVFGTNAAEFQTKTEEEEIDRTPWGELEPSDEESSE
EEEEEESDEDKPDETGFITPADSGLITPGGFSSVPAGMETPELIELRKKKIEEAMDGSETPQLFTVLPEKRTATVGGAMM
GSTHIYDMSTVMSRKGPAPELQGVEVALAPEELELDPMAMTQKYEEHVREQQAQVEKEDFSDMVAEHAAKQKQKKRKAQP
QDSRGGSKKYKEFKF
;
;MATEHPEPPKAELQLPPPPPPGHYGAWAAQELQAKLAEIGAPIQGNREELVERLQSYTRQTGIVLNRPVLRGEDGDKAAP
PPMSAQLPGIPMPPPPLGLPPLQPPPPPPPPPPGLGLGFPMAHPPNLGPPPPLRVGEPVALSEEERLKLAQQQAALLMQQ
EERAKQQGDHSLKEHELLEQQKRAAVLLEQERQQEIAKMGTPVPRPPQDMGQIGVRTPLGPRVAAPVGPVGPTPTVLPMG
APVPRPRGPPPPPGDENREMDDPSVGPKIPQALEKILQLKESRQEEMNSQQEEEEMETDARSSLGQSASETEEDTVSVSK
KEKNRKRRNRKKKKKPQRVRGVSSESSGDREKDSTRSRGSDSPAADVEIEYVTEEPEIYEPNFIFFKRIFEAFKLTDDVK
KEKEKEPEKLDKLENSAAPKKKGFEEEHKDSDDDSSDDEQEKKPEAPKLSKKKLRRMNRFTVAELKQLVARPDVVEMHDV
TAQDPKLLVHLKATRNSVPVPRHWCFKRKYLQGKRGIEKPPFELPDFIKRTGIQEMREALQEKEEQKTMKSKMREKVRPK
MGKIDIDYQKLHDAFFKWQTKPKLTIHGDLYYEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYG
PPPSYPNLKIPGLNSPIPESCSFGYHAGGWGKPPVDETGKPLYGDVFGTNAAEFQTKTEEEEIDRTPWGELEPSDEESSE
EEEEEESDEDKPDETGFITPADSGLITPGGFSSVPAGMETPELIELRKKKIEEAMDGSETPQLFTVLPEKRTATVGGAMM
GSTHIYDMSTVMSRKGPAPELQGVEVALAPEELELDPMAMTQKYEEHVREQQAQVEKEDFSDMVAEHAAKQKQKKRKAQP
QDSRGGSKKYKEFKF
;
2     ? 
28 'polypeptide(L)'   no no 
;MFLYNLTLQRATGISFAIHGNFSGTKQQEIVVSRGKILELLRPDPNTGKVHTLLTVEVFGVIRSLMAFRLTGGTKDYIVV
GSDSGRIVILEYQPSKNMFEKIHQETFGKSGCRRIVPGQFLAVDPKGRAVMISAIEKQKLVYILNRDAAARLTISSPLEA
HKANTLVYHVVGVDVGFENPMFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEPLEEHGNFLITVPG
GSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKSMFFFLAQTEQGDIFKITLETDED
MVTEIRLKYFDTVPVAAAMCVLKTGFLFVASEFGNHYLYQIAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDE
LDSLSPILFCQIADLANEDTPQLYVACGRGPRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHIEDEFDAYIIVSFVN
ATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGDDALVQVYPDGIRHIRADKRVNEWKTPGKKTIVKCAVNQRQVVIALTG
GELVYFEMDPSGQLNEYTERKEMSADVVCMSLANVPPGEQRSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPESL
CIVEMGGTEKQDELGERGSIGFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSW
LSYSYQSRFHLTPLSYETLEFASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFPLQYTPRKFVIHPESNNLIII
ETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLV
QLEQNEAAFSVAVCRFSNTGEDWYVLVGVAKDLILNPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVL
IGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRYKRNENQLIIFADDTYPRWVTTASLLD
YDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYT
TLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRT
PPEVSKKLEDIRTRYAF
;
;MFLYNLTLQRATGISFAIHGNFSGTKQQEIVVSRGKILELLRPDPNTGKVHTLLTVEVFGVIRSLMAFRLTGGTKDYIVV
GSDSGRIVILEYQPSKNMFEKIHQETFGKSGCRRIVPGQFLAVDPKGRAVMISAIEKQKLVYILNRDAAARLTISSPLEA
HKANTLVYHVVGVDVGFENPMFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEPLEEHGNFLITVPG
GSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKSMFFFLAQTEQGDIFKITLETDED
MVTEIRLKYFDTVPVAAAMCVLKTGFLFVASEFGNHYLYQIAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDE
LDSLSPILFCQIADLANEDTPQLYVACGRGPRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHIEDEFDAYIIVSFVN
ATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGDDALVQVYPDGIRHIRADKRVNEWKTPGKKTIVKCAVNQRQVVIALTG
GELVYFEMDPSGQLNEYTERKEMSADVVCMSLANVPPGEQRSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPESL
CIVEMGGTEKQDELGERGSIGFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSW
LSYSYQSRFHLTPLSYETLEFASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFPLQYTPRKFVIHPESNNLIII
ETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLV
QLEQNEAAFSVAVCRFSNTGEDWYVLVGVAKDLILNPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVL
IGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRYKRNENQLIIFADDTYPRWVTTASLLD
YDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYT
TLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRT
PPEVSKKLEDIRTRYAF
;
3     ? 
29 'polypeptide(L)'   no no 
;MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLY
GKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIE
AMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFADAPPPPSAPNPVVSSLGSGLPPPGMPPP
GSFPPPVPPPGALPPGIPPAMPPPPMPPGAAGHGPPSAGTPGAGHPGHGHSHPHPFPPGGMPHPGMSQMQLAHHGPHGLG
HPHAGPPGSGGQPPPRPPPGMPHPGPPPMGMPPRGPPFGSPMGHPGPMPPHGMRGPPPLMPPHGYTGPPRPPPYGYQRGP
LPPPRPTPRPPVPPRGPLRGPLPQ
;
;MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLY
GKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIE
AMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFADAPPPPSAPNPVVSSLGSGLPPPGMPPP
GSFPPPVPPPGALPPGIPPAMPPPPMPPGAAGHGPPSAGTPGAGHPGHGHSHPHPFPPGGMPHPGMSQMQLAHHGPHGLG
HPHAGPPGSGGQPPPRPPPGMPHPGPPPMGMPPRGPPFGSPMGHPGPMPPHGMRGPPPLMPPHGYTGPPRPPPYGYQRGP
LPPPRPTPRPPVPPRGPLRGPLPQ
;
4     ? 
30 'polypeptide(L)'   no no 
;MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGF
NVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK
;
;MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGF
NVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK
;
5     ? 
31 'polypeptide(L)'   no no 
;MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEK
DRDGCPKIVNLGSSKTDLFYERKKYGFKKR
;
;MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEK
DRDGCPKIVNLGSSKTDLFYERKKYGFKKR
;
6     ? 
32 'polypeptide(L)'   no no 
;MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPA
DKPEEN
;
;MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPA
DKPEEN
;
7     ? 
33 'polypeptide(L)'   no no 
;MALSKRELDELKPWIEKTVKRVLGFSEPTVVTAALNCVGKGMDKKKAADHLKPFLDDSTLRFVDKLFEAVEEGRSSRHSK
SSSDRSRKRELKEVFGDDSEISKESSGVKKRRIPRFEEVEEEPEVIPGPPSESPGMLTKLQIKQMMEAATRQIEERKKQL
SFISPPTPQPKTPSSSQPERLPIGNTIQPSQAATFMNDAIEKARKAAELQARIQAQLALKPGLIGNANMVGLANLHAMGI
APPKVELKDQTKPTPLILDEQGRTVDATGKEIELTHRMPTLKANIRAVKREQFKQQLKEKPSEDMESNTFFDPRVSIAPS
QRQRRTFKFHDKGKFEKIAQRLRTKAQLEKLQAEISQAARKTGIHTSTRLALIAPKKELKEGDIPEIEWWDSYIIPNGFD
LTEENPKREDYFGITNLVEHPAQLNPPVDNDTPVTLGVYLTKKEQKKLRRQTRREAQKELQEKVRLGLMPPPEPKVRISN
LMRVLGTEAVQDPTKVEAHVRAQMAKRQKAHEEANAARKLTAEQRKVKKIKKLKEDISQGVHISVYRVRNLSNPAKKFKI
EANAGQLYLTGVVVLHKDVNVVVVEGGPKAQKKFKRLMLHRIKWDEQTSNTKGDDDEESDEEAVKKTNKCVLVWEGTAKD
RSFGEMKFKQCPTENMAREHFKKHGAEHYWDLALSESVLESTD
;
;MALSKRELDELKPWIEKTVKRVLGFSEPTVVTAALNCVGKGMDKKKAADHLKPFLDDSTLRFVDKLFEAVEEGRSSRHSK
SSSDRSRKRELKEVFGDDSEISKESSGVKKRRIPRFEEVEEEPEVIPGPPSESPGMLTKLQIKQMMEAATRQIEERKKQL
SFISPPTPQPKTPSSSQPERLPIGNTIQPSQAATFMNDAIEKARKAAELQARIQAQLALKPGLIGNANMVGLANLHAMGI
APPKVELKDQTKPTPLILDEQGRTVDATGKEIELTHRMPTLKANIRAVKREQFKQQLKEKPSEDMESNTFFDPRVSIAPS
QRQRRTFKFHDKGKFEKIAQRLRTKAQLEKLQAEISQAARKTGIHTSTRLALIAPKKELKEGDIPEIEWWDSYIIPNGFD
LTEENPKREDYFGITNLVEHPAQLNPPVDNDTPVTLGVYLTKKEQKKLRRQTRREAQKELQEKVRLGLMPPPEPKVRISN
LMRVLGTEAVQDPTKVEAHVRAQMAKRQKAHEEANAARKLTAEQRKVKKIKKLKEDISQGVHISVYRVRNLSNPAKKFKI
EANAGQLYLTGVVVLHKDVNVVVVEGGPKAQKKFKRLMLHRIKWDEQTSNTKGDDDEESDEEAVKKTNKCVLVWEGTAKD
RSFGEMKFKQCPTENMAREHFKKHGAEHYWDLALSESVLESTD
;
J     ? 
34 'polypeptide(L)'   no no 
;MASSRASSTQATKTKAPDDLVAPVVKKPHIYYGSLEEKERERLAKGESGILGKDGLKAGIEAGNINITSGEVFEIEEHIS
ERQAEVLAEFERRKRARQINVSTDDSEVKACLRALGEPITLFGEGPAERRERLRNILSVVGTDALKKTKKDDEKSKKSKE
EYQQTWYHEGPNSLKVARLWIANYSLPRAMKRLEEARLHKEIPETTRTSQMQELHKSLRSLNNFCSQIGDDRPISYCHFS
PNSKMLATACWSGLCKLWSVPDCNLLHTLRGHNTNVGAIVFHPKSTVSLDPKDVNLASCAADGSVKLWSLDSDEPVADIE
GHTVRVARVMWHPSGRFLGTTCYDRSWRLWDLEAQEEILHQEGHSMGVYDIAFHQDGSLAGTGGLDAFGRVWDLRTGRCI
MFLEGHLKEIYGINFSPNGYHIATGSGDNTCKVWDLRQRRCVYTIPAHQNLVTGVKFEPIHGNFLLTGAYDNTAKIWTHP
GWSPLKTLAGHEGKVMGLDISSDGQLIATCSYDRTFKLWMAE
;
;MASSRASSTQATKTKAPDDLVAPVVKKPHIYYGSLEEKERERLAKGESGILGKDGLKAGIEAGNINITSGEVFEIEEHIS
ERQAEVLAEFERRKRARQINVSTDDSEVKACLRALGEPITLFGEGPAERRERLRNILSVVGTDALKKTKKDDEKSKKSKE
EYQQTWYHEGPNSLKVARLWIANYSLPRAMKRLEEARLHKEIPETTRTSQMQELHKSLRSLNNFCSQIGDDRPISYCHFS
PNSKMLATACWSGLCKLWSVPDCNLLHTLRGHNTNVGAIVFHPKSTVSLDPKDVNLASCAADGSVKLWSLDSDEPVADIE
GHTVRVARVMWHPSGRFLGTTCYDRSWRLWDLEAQEEILHQEGHSMGVYDIAFHQDGSLAGTGGLDAFGRVWDLRTGRCI
MFLEGHLKEIYGINFSPNGYHIATGSGDNTCKVWDLRQRRCVYTIPAHQNLVTGVKFEPIHGNFLLTGAYDNTAKIWTHP
GWSPLKTLAGHEGKVMGLDISSDGQLIATCSYDRTFKLWMAE
;
K     ? 
35 'polypeptide(L)'   no no 
;MNKKKKPFLGMPAPLGYVPGLGRGATGFTTRSDIGPARDANDPVDDRHAPPGKRTVGDQMKKNQAADDDDEDLNDTNYDE
FNGYAGSLFSSGPYEKDDEEADAIYAALDKRMDERRKERREQREKEEIEKYRMERPKIQQQFSDLKRKLAEVTEEEWLSI
PEVGDARNKRQRNPRYEKLTPVPDSFFAKHLQTGENHTSVDPRQTQFGGLNTPYPGGLNTPYPGGMTPGLMTPGTGELDM
RKIGQARNTLMDMRLSQVSDSVSGQTVVDPKGYLTDLNSMIPTHGGDINDIKKARLLLKSVRETNPHHPPAWIASARLEE
VTGKLQVARNLIMKGTEMCPKSEDVWLEAARLQPGDTAKAVVAQAVRHLPQSVRIYIRAAELETDIRAKKRVLRKALEHV
PNSVRLWKAAVELEEPEDARIMLSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDRHIWITAAKLEEANGNT
QMVEKIIDRAITSLRANGVEINREQWIQDAEECDRAGSVATCQAVMRAVIGIGIEEEDRKHTWMEDADSCVAHNALECAR
AIYAYALQVFPSKKSVWLRAAYFEKNHGTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPN
SEEIWLAAVKLESENDEYERARRLLAKARSSAPTARVFMKSVKLEWVQDNIRAAQDLCEEALRHYEDFPKLWMMKGQIEE
QKEMMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESVRLEYRAGLKNIANTLM
AKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHDPHVLLAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAF
FYKFELQHGTEEQQEEVRKRCESAEPRHGELWCAVSKDIANWQKKIGDILRLVAGRIKNTF
;
;MNKKKKPFLGMPAPLGYVPGLGRGATGFTTRSDIGPARDANDPVDDRHAPPGKRTVGDQMKKNQAADDDDEDLNDTNYDE
FNGYAGSLFSSGPYEKDDEEADAIYAALDKRMDERRKERREQREKEEIEKYRMERPKIQQQFSDLKRKLAEVTEEEWLSI
PEVGDARNKRQRNPRYEKLTPVPDSFFAKHLQTGENHTSVDPRQTQFGGLNTPYPGGLNTPYPGGMTPGLMTPGTGELDM
RKIGQARNTLMDMRLSQVSDSVSGQTVVDPKGYLTDLNSMIPTHGGDINDIKKARLLLKSVRETNPHHPPAWIASARLEE
VTGKLQVARNLIMKGTEMCPKSEDVWLEAARLQPGDTAKAVVAQAVRHLPQSVRIYIRAAELETDIRAKKRVLRKALEHV
PNSVRLWKAAVELEEPEDARIMLSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDRHIWITAAKLEEANGNT
QMVEKIIDRAITSLRANGVEINREQWIQDAEECDRAGSVATCQAVMRAVIGIGIEEEDRKHTWMEDADSCVAHNALECAR
AIYAYALQVFPSKKSVWLRAAYFEKNHGTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPN
SEEIWLAAVKLESENDEYERARRLLAKARSSAPTARVFMKSVKLEWVQDNIRAAQDLCEEALRHYEDFPKLWMMKGQIEE
QKEMMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESVRLEYRAGLKNIANTLM
AKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHDPHVLLAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAF
FYKFELQHGTEEQQEEVRKRCESAEPRHGELWCAVSKDIANWQKKIGDILRLVAGRIKNTF
;
N     ? 
36 'polypeptide(L)'   no no 
;MSLADELLADLEEAAEEEEGGSYGEEEEEPAIEDVQEETQLDLSGDSVKTIAKLWDSKMFAEIMMKIEEYISKQAKASEV
MGPVEAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGNSLDKCKNNENLQQILT
NATIMVVSVTASTTQGQQLSEEELERLEEACDMALELNASKHRIYEYVESRMSFIAPNLSIIIGASTAAKIMGVAGGLTN
LSKMPACNIMLLGAQRKTLSGFSSTSVLPHTGYIYHSDIVQSLPPDLRRKAARLVAAKCTLAARVDSFHESTEGKVGYEL
KDEIERKFDKWQEPPPVKQVKPLPAPLDGQRKKRGGRRYRKMKERLGLTEIRKQANRMSFGEIEEDAYQEDLGFSLGHLG
KSGSGRVRQTQVNEATKARISKTLQRTLQKQSVVYGGKSTIRDRSSGTASSVAFTPLQGLEIVNPQAAEKKVAEANQKYF
SSMAEFLKVKGEKSGLMST
;
;MSLADELLADLEEAAEEEEGGSYGEEEEEPAIEDVQEETQLDLSGDSVKTIAKLWDSKMFAEIMMKIEEYISKQAKASEV
MGPVEAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGNSLDKCKNNENLQQILT
NATIMVVSVTASTTQGQQLSEEELERLEEACDMALELNASKHRIYEYVESRMSFIAPNLSIIIGASTAAKIMGVAGGLTN
LSKMPACNIMLLGAQRKTLSGFSSTSVLPHTGYIYHSDIVQSLPPDLRRKAARLVAAKCTLAARVDSFHESTEGKVGYEL
KDEIERKFDKWQEPPPVKQVKPLPAPLDGQRKKRGGRRYRKMKERLGLTEIRKQANRMSFGEIEEDAYQEDLGFSLGHLG
KSGSGRVRQTQVNEATKARISKTLQRTLQKQSVVYGGKSTIRDRSSGTASSVAFTPLQGLEIVNPQAAEKKVAEANQKYF
SSMAEFLKVKGEKSGLMST
;
L     ? 
37 'polypeptide(L)'   no no 
;MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPY
VFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
;
;MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPY
VFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
;
M     ? 
38 'polypeptide(L)'   no no 
;MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCT
VMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY
;
;MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCT
VMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY
;
O     ? 
39 'polypeptide(L)'   no no 
;MSGRSKRESRGSTRGKRESESRGSSGRVKRERDREREPEAASSRGSPVRVKREFEPASAREAPASVVPFVRVKREREVDE
DSEPEREVRAKNGRVDSEDRRSRHCPYLDTINRSVLDFDFEKLCSISLSHINAYACLVCGKYFQGRGLKSHAYIHSVQFS
HHVFLNLHTLKFYCLPDNYEIIDSSLEDITYVLKPTFTKQQIANLDKQAKLSRAYDGTTYLPGIVGLNNIKANDYANAVL
QALSNVPPLRNYFLEEDNYKNIKRPPGDIMFLLVQRFGELMRKLWNPRNFKAHVSPHEMLQAVVLCSKKTFQITKQGDGV
DFLSWFLNALHSALGGTKKKKKTIVTDVFQGSMRIFTKKLPHPDLPAEEKEQLLHNDEYQETMVESTFMYLTLDLPTAPL
YKDEKEQLIIPQVPLFNILAKFNGITEKEYKTYKENFLKRFQLTKLPPYLIFCIKRFTKNNFFVEKNPTIVNFPITNVDL
REYLSEEVQAVHKNTTYDLIANIVHDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRRDNDET
NQQGA
;
;MSGRSKRESRGSTRGKRESESRGSSGRVKRERDREREPEAASSRGSPVRVKREFEPASAREAPASVVPFVRVKREREVDE
DSEPEREVRAKNGRVDSEDRRSRHCPYLDTINRSVLDFDFEKLCSISLSHINAYACLVCGKYFQGRGLKSHAYIHSVQFS
HHVFLNLHTLKFYCLPDNYEIIDSSLEDITYVLKPTFTKQQIANLDKQAKLSRAYDGTTYLPGIVGLNNIKANDYANAVL
QALSNVPPLRNYFLEEDNYKNIKRPPGDIMFLLVQRFGELMRKLWNPRNFKAHVSPHEMLQAVVLCSKKTFQITKQGDGV
DFLSWFLNALHSALGGTKKKKKTIVTDVFQGSMRIFTKKLPHPDLPAEEKEQLLHNDEYQETMVESTFMYLTLDLPTAPL
YKDEKEQLIIPQVPLFNILAKFNGITEKEYKTYKENFLKRFQLTKLPPYLIFCIKRFTKNNFFVEKNPTIVNFPITNVDL
REYLSEEVQAVHKNTTYDLIANIVHDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRRDNDET
NQQGA
;
W     ? 
40 polyribonucleotide no no 
;AGCUUUGCGCAGUGGCAGUAUCGUAGCCAAUGAGGUCUAUCCGAGGCGCGAUUAUUGCUAAUUGAAAACUUUUCCCAAUA
CCCCGCCGUGACGACUUGCAAUAUAGUCGGCACUGGCAAUUUUUGACAGUCUCUACGGAGACUG
;
;AGCUUUGCGCAGUGGCAGUAUCGUAGCCAAUGAGGUCUAUCCGAGGCGCGAUUAUUGCUAAUUGAAAACUUUUCCCAAUA
CCCCGCCGUGACGACUUGCAAUAUAGUCGGCACUGGCAAUUUUUGACAGUCUCUACGGAGACUG
;
I     ? 
41 'polypeptide(L)'   no no 
;MAGELADKKDRDASPSKEERKRSRTPDRERDRDRDRKSSPSKDRKRHRSRDRRRGGSRSRSRSRSKSAERERRHKERERD
KERDRNKKDRDRDKDGHRRDKDRKRSSLSPGRGKDFKSRKDRDSKKDEEDEHGDKKPKAQPLSLEELLAKKKAEEEAEAK
PKFLSKAEREAEALKRRQQEVEERQRMLEEERKKRKQFQDLGRKMLEDPQERERRERRERMERETNGNEDEEGRQKIREE
KDKSKELHAIKERYLGGIKKRRRTRHLNDRKFVFEWDASEDTSIDYNPLYKERHQVQLLGRGFIAGIDLKQQKREQSRFY
GDLMEKRRTLEEKEQEEARLRKLRKKEAKQRWDDRHWSQKKLDEMTDRDWRIFREDYSITTKGGKIPNPIRSWKDSSLPP
HILEVIDKCGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLVWITTLPKIDRIEESDQGPYAIILAPTREL
AQQIEEETIKFGKPLGIRTVAVIGGISREDQGFRLRMGCEIVIATPGRLIDVLENRYLVLSRCTYVVLDEADRMIDMGFE
PDVQKILEHMPVSNQKPDTDEAEDPEKMLANFESGKHKYRQTVMFTATMPPAVERLARSYLRRPAVVYIGSAGKPHERVE
QKVFLMSESEKRKKLLAILEQGFDPPIIIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQEQREFALSNLKAGAKDILVA
TDVAGRGIDIQDVSMVVNYDMAKNIEDYIHRIGRTGRAGKSGVAITFLTKEDSAVFYELKQAILESPVSSCPPELANHPD
AQHKPGTILTKKRREETIFA
;
;MAGELADKKDRDASPSKEERKRSRTPDRERDRDRDRKSSPSKDRKRHRSRDRRRGGSRSRSRSRSKSAERERRHKERERD
KERDRNKKDRDRDKDGHRRDKDRKRSSLSPGRGKDFKSRKDRDSKKDEEDEHGDKKPKAQPLSLEELLAKKKAEEEAEAK
PKFLSKAEREAEALKRRQQEVEERQRMLEEERKKRKQFQDLGRKMLEDPQERERRERRERMERETNGNEDEEGRQKIREE
KDKSKELHAIKERYLGGIKKRRRTRHLNDRKFVFEWDASEDTSIDYNPLYKERHQVQLLGRGFIAGIDLKQQKREQSRFY
GDLMEKRRTLEEKEQEEARLRKLRKKEAKQRWDDRHWSQKKLDEMTDRDWRIFREDYSITTKGGKIPNPIRSWKDSSLPP
HILEVIDKCGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLVWITTLPKIDRIEESDQGPYAIILAPTREL
AQQIEEETIKFGKPLGIRTVAVIGGISREDQGFRLRMGCEIVIATPGRLIDVLENRYLVLSRCTYVVLDEADRMIDMGFE
PDVQKILEHMPVSNQKPDTDEAEDPEKMLANFESGKHKYRQTVMFTATMPPAVERLARSYLRRPAVVYIGSAGKPHERVE
QKVFLMSESEKRKKLLAILEQGFDPPIIIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQEQREFALSNLKAGAKDILVA
TDVAGRGIDIQDVSMVVNYDMAKNIEDYIHRIGRTGRAGKSGVAITFLTKEDSAVFYELKQAILESPVSSCPPELANHPD
AQHKPGTILTKKRREETIFA
;
X     ? 
42 'polypeptide(L)'   no no 
;MAGVFPYRGPGNPVPGPLAPLPDYMSEEKLQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRK
FRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYISQWGSMWIMMRREKRDRRH
FKRMRFPPFDDEEPPLDYADNILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSTLYR
LANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLY
NNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTAN
GIALLWAPRPFNLRSGRTRRALDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATK
FFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLTKLVVDS
HVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFF
MRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCW
KANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPY
ITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSR
IKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGIN
NLQDVWETSEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFI
VQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDIATEAAHPIRLFCRYIDRIHIFFRFTADEARDLIQRYLTEHPDP
NNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKC
RTSYEEFTHKDGVWNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVN
TQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHE
EDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRT
DFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTN
AQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQE
LDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYA
RAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTE
PYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWK
TAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLY
DDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVA
SLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISA
ANLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFICISDLRAQIAGYLYGVSPPDNPQVKEIRCIVMVPQWGTHQTVHLP
GQLPQHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKIMADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQ
NTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQSSWNYNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALL
QEGEVYSADREDLYA
;
;MAGVFPYRGPGNPVPGPLAPLPDYMSEEKLQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRK
FRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYISQWGSMWIMMRREKRDRRH
FKRMRFPPFDDEEPPLDYADNILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSTLYR
LANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLY
NNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTAN
GIALLWAPRPFNLRSGRTRRALDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATK
FFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLTKLVVDS
HVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFF
MRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCW
KANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPY
ITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSR
IKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGIN
NLQDVWETSEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFI
VQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDIATEAAHPIRLFCRYIDRIHIFFRFTADEARDLIQRYLTEHPDP
NNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKC
RTSYEEFTHKDGVWNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVN
TQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHE
EDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRT
DFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTN
AQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQE
LDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYA
RAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTE
PYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWK
TAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLY
DDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVA
SLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISA
ANLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFICISDLRAQIAGYLYGVSPPDNPQVKEIRCIVMVPQWGTHQTVHLP
GQLPQHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKIMADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQ
NTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQSSWNYNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALL
QEGEVYSADREDLYA
;
A     ? 
43 'polypeptide(L)'   no no 
;MDTDLYDEFGNYIGPELDSDEDDDELGRETKDLDEMDDDDDDDDVGDHDDDHPGMEVVLHEDKKYYPTAEEVYGPEVETI
VQEEDTQPLTEPIIKPVKTKKFTLMEQTLPVTVYEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKR
YDQDLCYTDILFTEQERGVGIKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTE
RLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTDENLILSPLLGNVCFSSSQYSICFTL
GSFAKIYADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKAPTSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDELG
IHLTKEELKLNIRPLLRLVCKKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTK
MYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIEVNRVPAGNWVLIEGVDQPIV
KTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSELPKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCV
MHDLRKMYSEIDIKVADPVVTFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQT
KYDWDLLAARSIWAFGPDATGPNILVDDTLPSEVDKALLGSVKDSIVQGFQWGTREGPLCDELIRNVKFKILDAVVAQEP
LHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDS
FGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPMLLE
LAKQDVVLNYPM
;
;MDTDLYDEFGNYIGPELDSDEDDDELGRETKDLDEMDDDDDDDDVGDHDDDHPGMEVVLHEDKKYYPTAEEVYGPEVETI
VQEEDTQPLTEPIIKPVKTKKFTLMEQTLPVTVYEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKR
YDQDLCYTDILFTEQERGVGIKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTE
RLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTDENLILSPLLGNVCFSSSQYSICFTL
GSFAKIYADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKAPTSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDELG
IHLTKEELKLNIRPLLRLVCKKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTK
MYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIEVNRVPAGNWVLIEGVDQPIV
KTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSELPKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCV
MHDLRKMYSEIDIKVADPVVTFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQT
KYDWDLLAARSIWAFGPDATGPNILVDDTLPSEVDKALLGSVKDSIVQGFQWGTREGPLCDELIRNVKFKILDAVVAQEP
LHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDS
FGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPMLLE
LAKQDVVLNYPM
;
C     ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    A   n 
1  2    U   n 
1  3    A   n 
1  4    C   n 
1  5    U   n 
1  6    C   n 
1  7    U   n 
1  8    G   n 
1  9    G   n 
1  10   U   n 
1  11   U   n 
1  12   U   n 
1  13   C   n 
1  14   U   n 
1  15   C   n 
1  16   U   n 
1  17   U   n 
1  18   C   n 
1  19   A   n 
1  20   G   n 
1  21   A   n 
1  22   U   n 
1  23   C   n 
1  24   G   n 
1  25   C   n 
1  26   A   n 
1  27   U   n 
1  28   A   n 
1  29   A   n 
1  30   A   n 
1  31   U   n 
1  32   C   n 
1  33   U   n 
1  34   U   n 
1  35   U   n 
1  36   C   n 
1  37   G   n 
1  38   C   n 
1  39   C   n 
1  40   U   n 
1  41   U   n 
1  42   U   n 
1  43   U   n 
1  44   A   n 
1  45   C   n 
1  46   U   n 
1  47   A   n 
1  48   A   n 
1  49   A   n 
1  50   G   n 
1  51   A   n 
1  52   U   n 
1  53   U   n 
1  54   U   n 
1  55   C   n 
1  56   C   n 
1  57   G   n 
1  58   U   n 
1  59   G   n 
1  60   G   n 
1  61   A   n 
1  62   G   n 
1  63   A   n 
1  64   G   n 
1  65   G   n 
1  66   A   n 
1  67   A   n 
1  68   C   n 
1  69   A   n 
1  70   A   n 
1  71   C   n 
1  72   U   n 
1  73   C   n 
1  74   U   n 
1  75   G   n 
1  76   A   n 
1  77   G   n 
1  78   U   n 
1  79   C   n 
1  80   U   n 
1  81   U   n 
1  82   A   n 
1  83   A   n 
1  84   C   n 
1  85   C   n 
1  86   C   n 
1  87   A   n 
1  88   A   n 
1  89   U   n 
1  90   U   n 
1  91   U   n 
1  92   U   n 
1  93   U   n 
1  94   U   n 
1  95   G   n 
1  96   A   n 
1  97   G   n 
1  98   G   n 
1  99   C   n 
1  100  C   n 
1  101  U   n 
1  102  U   n 
1  103  G   n 
1  104  C   n 
1  105  U   n 
1  106  U   n 
1  107  U   n 
1  108  G   n 
1  109  G   n 
1  110  C   n 
1  111  A   n 
1  112  A   n 
1  113  G   n 
1  114  G   n 
1  115  C   n 
1  116  U   n 
1  117  A   n 
2  1    MET n 
2  2    ALA n 
2  3    ASP n 
2  4    VAL n 
2  5    THR n 
2  6    ALA n 
2  7    ARG n 
2  8    SER n 
2  9    LEU n 
2  10   GLN n 
2  11   TYR n 
2  12   GLU n 
2  13   TYR n 
2  14   LYS n 
2  15   ALA n 
2  16   ASN n 
2  17   SER n 
2  18   ASN n 
2  19   LEU n 
2  20   VAL n 
2  21   LEU n 
2  22   GLN n 
2  23   ALA n 
2  24   ASP n 
2  25   ARG n 
2  26   SER n 
2  27   LEU n 
2  28   ILE n 
2  29   ASP n 
2  30   ARG n 
2  31   THR n 
2  32   ARG n 
2  33   ARG n 
2  34   ASP n 
2  35   GLU n 
2  36   PRO n 
2  37   THR n 
2  38   GLY n 
2  39   GLU n 
2  40   VAL n 
2  41   LEU n 
2  42   SER n 
2  43   LEU n 
2  44   VAL n 
2  45   GLY n 
2  46   LYS n 
2  47   LEU n 
2  48   GLU n 
2  49   GLY n 
2  50   THR n 
2  51   ARG n 
2  52   MET n 
2  53   GLY n 
2  54   ASP n 
2  55   LYS n 
2  56   ALA n 
2  57   GLN n 
2  58   ARG n 
2  59   THR n 
2  60   LYS n 
2  61   PRO n 
2  62   GLN n 
2  63   MET n 
2  64   GLN n 
2  65   GLU n 
2  66   GLU n 
2  67   ARG n 
2  68   ARG n 
2  69   ALA n 
2  70   LYS n 
2  71   ARG n 
2  72   ARG n 
2  73   LYS n 
2  74   ARG n 
2  75   ASP n 
2  76   GLU n 
2  77   ASP n 
2  78   ARG n 
2  79   HIS n 
2  80   ASP n 
2  81   ILE n 
2  82   ASN n 
2  83   LYS n 
2  84   MET n 
2  85   LYS n 
2  86   GLY n 
2  87   TYR n 
2  88   THR n 
2  89   LEU n 
2  90   LEU n 
2  91   SER n 
2  92   GLU n 
2  93   GLY n 
2  94   ILE n 
2  95   ASP n 
2  96   GLU n 
2  97   MET n 
2  98   VAL n 
2  99   GLY n 
2  100  ILE n 
2  101  ILE n 
2  102  TYR n 
2  103  LYS n 
2  104  PRO n 
2  105  LYS n 
2  106  THR n 
2  107  LYS n 
2  108  GLU n 
2  109  THR n 
2  110  ARG n 
2  111  GLU n 
2  112  THR n 
2  113  TYR n 
2  114  GLU n 
2  115  VAL n 
2  116  LEU n 
2  117  LEU n 
2  118  SER n 
2  119  PHE n 
2  120  ILE n 
2  121  GLN n 
2  122  ALA n 
2  123  ALA n 
2  124  LEU n 
2  125  GLY n 
2  126  ASP n 
2  127  GLN n 
2  128  PRO n 
2  129  ARG n 
2  130  ASP n 
2  131  ILE n 
2  132  LEU n 
2  133  CYS n 
2  134  GLY n 
2  135  ALA n 
2  136  ALA n 
2  137  ASP n 
2  138  GLU n 
2  139  VAL n 
2  140  LEU n 
2  141  ALA n 
2  142  VAL n 
2  143  LEU n 
2  144  LYS n 
2  145  ASN n 
2  146  GLU n 
2  147  LYS n 
2  148  LEU n 
2  149  ARG n 
2  150  ASP n 
2  151  LYS n 
2  152  GLU n 
2  153  ARG n 
2  154  ARG n 
2  155  LYS n 
2  156  GLU n 
2  157  ILE n 
2  158  ASP n 
2  159  LEU n 
2  160  LEU n 
2  161  LEU n 
2  162  GLY n 
2  163  GLN n 
2  164  THR n 
2  165  ASP n 
2  166  ASP n 
2  167  THR n 
2  168  ARG n 
2  169  TYR n 
2  170  HIS n 
2  171  VAL n 
2  172  LEU n 
2  173  VAL n 
2  174  ASN n 
2  175  LEU n 
2  176  GLY n 
2  177  LYS n 
2  178  LYS n 
2  179  ILE n 
2  180  THR n 
2  181  ASP n 
2  182  TYR n 
2  183  GLY n 
2  184  GLY n 
2  185  ASP n 
2  186  LYS n 
2  187  GLU n 
2  188  ILE n 
2  189  GLN n 
2  190  ASN n 
2  191  MET n 
2  192  ASP n 
2  193  ASP n 
2  194  ASN n 
2  195  ILE n 
2  196  ASP n 
2  197  GLU n 
2  198  THR n 
2  199  TYR n 
2  200  GLY n 
2  201  VAL n 
2  202  ASN n 
2  203  VAL n 
2  204  GLN n 
2  205  PHE n 
2  206  GLU n 
2  207  SER n 
2  208  ASP n 
2  209  GLU n 
2  210  GLU n 
2  211  GLU n 
2  212  GLY n 
2  213  ASP n 
2  214  GLU n 
2  215  ASP n 
2  216  VAL n 
2  217  TYR n 
2  218  GLY n 
2  219  GLU n 
2  220  VAL n 
2  221  ARG n 
2  222  GLU n 
2  223  GLU n 
2  224  ALA n 
2  225  SER n 
2  226  ASP n 
2  227  ASP n 
2  228  ASP n 
2  229  MET n 
2  230  GLU n 
2  231  GLY n 
2  232  ASP n 
2  233  GLU n 
2  234  ALA n 
2  235  VAL n 
2  236  VAL n 
2  237  ARG n 
2  238  CYS n 
2  239  THR n 
2  240  LEU n 
2  241  SER n 
2  242  ALA n 
2  243  ASN n 
2  244  LEU n 
2  245  VAL n 
2  246  ALA n 
2  247  SER n 
2  248  GLY n 
2  249  GLU n 
2  250  LEU n 
2  251  MET n 
2  252  SER n 
2  253  SER n 
2  254  LYS n 
2  255  LYS n 
2  256  LYS n 
2  257  ASP n 
2  258  LEU n 
2  259  HIS n 
2  260  PRO n 
2  261  ARG n 
2  262  ASP n 
2  263  ILE n 
2  264  ASP n 
2  265  ALA n 
2  266  PHE n 
2  267  TRP n 
2  268  LEU n 
2  269  GLN n 
2  270  ARG n 
2  271  GLN n 
2  272  LEU n 
2  273  SER n 
2  274  ARG n 
2  275  PHE n 
2  276  TYR n 
2  277  ASP n 
2  278  ASP n 
2  279  ALA n 
2  280  ILE n 
2  281  VAL n 
2  282  SER n 
2  283  GLN n 
2  284  LYS n 
2  285  LYS n 
2  286  ALA n 
2  287  ASP n 
2  288  GLU n 
2  289  VAL n 
2  290  LEU n 
2  291  GLU n 
2  292  ILE n 
2  293  LEU n 
2  294  LYS n 
2  295  THR n 
2  296  ALA n 
2  297  SER n 
2  298  ASP n 
2  299  ASP n 
2  300  ARG n 
2  301  GLU n 
2  302  CYS n 
2  303  GLU n 
2  304  ASN n 
2  305  GLN n 
2  306  LEU n 
2  307  VAL n 
2  308  LEU n 
2  309  LEU n 
2  310  LEU n 
2  311  GLY n 
2  312  PHE n 
2  313  ASN n 
2  314  THR n 
2  315  PHE n 
2  316  ASP n 
2  317  PHE n 
2  318  ILE n 
2  319  LYS n 
2  320  VAL n 
2  321  LEU n 
2  322  ARG n 
2  323  GLN n 
2  324  HIS n 
2  325  ARG n 
2  326  MET n 
2  327  MET n 
2  328  ILE n 
2  329  LEU n 
2  330  TYR n 
2  331  CYS n 
2  332  THR n 
2  333  LEU n 
2  334  LEU n 
2  335  ALA n 
2  336  SER n 
2  337  ALA n 
2  338  GLN n 
2  339  SER n 
2  340  GLU n 
2  341  ALA n 
2  342  GLU n 
2  343  LYS n 
2  344  GLU n 
2  345  ARG n 
2  346  ILE n 
2  347  MET n 
2  348  GLY n 
2  349  LYS n 
2  350  MET n 
2  351  GLU n 
2  352  ALA n 
2  353  ASP n 
2  354  PRO n 
2  355  GLU n 
2  356  LEU n 
2  357  SER n 
2  358  LYS n 
2  359  PHE n 
2  360  LEU n 
2  361  TYR n 
2  362  GLN n 
2  363  LEU n 
2  364  HIS n 
2  365  GLU n 
2  366  THR n 
2  367  GLU n 
2  368  LYS n 
2  369  GLU n 
2  370  ASP n 
2  371  LEU n 
2  372  ILE n 
2  373  ARG n 
2  374  GLU n 
2  375  GLU n 
2  376  ARG n 
2  377  SER n 
2  378  ARG n 
2  379  ARG n 
2  380  GLU n 
2  381  ARG n 
2  382  VAL n 
2  383  ARG n 
2  384  GLN n 
2  385  SER n 
2  386  ARG n 
2  387  MET n 
2  388  ASP n 
2  389  THR n 
2  390  ASP n 
2  391  LEU n 
2  392  GLU n 
2  393  THR n 
2  394  MET n 
2  395  ASP n 
2  396  LEU n 
2  397  ASP n 
2  398  GLN n 
2  399  GLY n 
2  400  GLY n 
2  401  GLU n 
2  402  ALA n 
2  403  LEU n 
2  404  ALA n 
2  405  PRO n 
2  406  ARG n 
2  407  GLN n 
2  408  VAL n 
2  409  LEU n 
2  410  ASP n 
2  411  LEU n 
2  412  GLU n 
2  413  ASP n 
2  414  LEU n 
2  415  VAL n 
2  416  PHE n 
2  417  THR n 
2  418  GLN n 
2  419  GLY n 
2  420  SER n 
2  421  HIS n 
2  422  PHE n 
2  423  MET n 
2  424  ALA n 
2  425  ASN n 
2  426  LYS n 
2  427  ARG n 
2  428  CYS n 
2  429  GLN n 
2  430  LEU n 
2  431  PRO n 
2  432  ASP n 
2  433  GLY n 
2  434  SER n 
2  435  PHE n 
2  436  ARG n 
2  437  ARG n 
2  438  GLN n 
2  439  ARG n 
2  440  LYS n 
2  441  GLY n 
2  442  TYR n 
2  443  GLU n 
2  444  GLU n 
2  445  VAL n 
2  446  HIS n 
2  447  VAL n 
2  448  PRO n 
2  449  ALA n 
2  450  LEU n 
2  451  LYS n 
2  452  PRO n 
2  453  LYS n 
2  454  PRO n 
2  455  PHE n 
2  456  GLY n 
2  457  SER n 
2  458  GLU n 
2  459  GLU n 
2  460  GLN n 
2  461  LEU n 
2  462  LEU n 
2  463  PRO n 
2  464  VAL n 
2  465  GLU n 
2  466  LYS n 
2  467  LEU n 
2  468  PRO n 
2  469  LYS n 
2  470  TYR n 
2  471  ALA n 
2  472  GLN n 
2  473  ALA n 
2  474  GLY n 
2  475  PHE n 
2  476  GLU n 
2  477  GLY n 
2  478  PHE n 
2  479  LYS n 
2  480  THR n 
2  481  LEU n 
2  482  ASN n 
2  483  ARG n 
2  484  ILE n 
2  485  GLN n 
2  486  SER n 
2  487  LYS n 
2  488  LEU n 
2  489  TYR n 
2  490  ARG n 
2  491  ALA n 
2  492  ALA n 
2  493  LEU n 
2  494  GLU n 
2  495  THR n 
2  496  ASP n 
2  497  GLU n 
2  498  ASN n 
2  499  LEU n 
2  500  LEU n 
2  501  LEU n 
2  502  CYS n 
2  503  ALA n 
2  504  PRO n 
2  505  THR n 
2  506  GLY n 
2  507  ALA n 
2  508  GLY n 
2  509  LYS n 
2  510  THR n 
2  511  ASN n 
2  512  VAL n 
2  513  ALA n 
2  514  LEU n 
2  515  MET n 
2  516  CYS n 
2  517  MET n 
2  518  LEU n 
2  519  ARG n 
2  520  GLU n 
2  521  ILE n 
2  522  GLY n 
2  523  LYS n 
2  524  HIS n 
2  525  ILE n 
2  526  ASN n 
2  527  MET n 
2  528  ASP n 
2  529  GLY n 
2  530  THR n 
2  531  ILE n 
2  532  ASN n 
2  533  VAL n 
2  534  ASP n 
2  535  ASP n 
2  536  PHE n 
2  537  LYS n 
2  538  ILE n 
2  539  ILE n 
2  540  TYR n 
2  541  ILE n 
2  542  ALA n 
2  543  PRO n 
2  544  MET n 
2  545  ARG n 
2  546  SER n 
2  547  LEU n 
2  548  VAL n 
2  549  GLN n 
2  550  GLU n 
2  551  MET n 
2  552  VAL n 
2  553  GLY n 
2  554  SER n 
2  555  PHE n 
2  556  GLY n 
2  557  LYS n 
2  558  ARG n 
2  559  LEU n 
2  560  ALA n 
2  561  THR n 
2  562  TYR n 
2  563  GLY n 
2  564  ILE n 
2  565  THR n 
2  566  VAL n 
2  567  ALA n 
2  568  GLU n 
2  569  LEU n 
2  570  THR n 
2  571  GLY n 
2  572  ASP n 
2  573  HIS n 
2  574  GLN n 
2  575  LEU n 
2  576  CYS n 
2  577  LYS n 
2  578  GLU n 
2  579  GLU n 
2  580  ILE n 
2  581  SER n 
2  582  ALA n 
2  583  THR n 
2  584  GLN n 
2  585  ILE n 
2  586  ILE n 
2  587  VAL n 
2  588  CYS n 
2  589  THR n 
2  590  PRO n 
2  591  GLU n 
2  592  LYS n 
2  593  TRP n 
2  594  ASP n 
2  595  ILE n 
2  596  ILE n 
2  597  THR n 
2  598  ARG n 
2  599  LYS n 
2  600  GLY n 
2  601  GLY n 
2  602  GLU n 
2  603  ARG n 
2  604  THR n 
2  605  TYR n 
2  606  THR n 
2  607  GLN n 
2  608  LEU n 
2  609  VAL n 
2  610  ARG n 
2  611  LEU n 
2  612  ILE n 
2  613  ILE n 
2  614  LEU n 
2  615  ASP n 
2  616  GLU n 
2  617  ILE n 
2  618  HIS n 
2  619  LEU n 
2  620  LEU n 
2  621  HIS n 
2  622  ASP n 
2  623  ASP n 
2  624  ARG n 
2  625  GLY n 
2  626  PRO n 
2  627  VAL n 
2  628  LEU n 
2  629  GLU n 
2  630  ALA n 
2  631  LEU n 
2  632  VAL n 
2  633  ALA n 
2  634  ARG n 
2  635  ALA n 
2  636  ILE n 
2  637  ARG n 
2  638  ASN n 
2  639  ILE n 
2  640  GLU n 
2  641  MET n 
2  642  THR n 
2  643  GLN n 
2  644  GLU n 
2  645  ASP n 
2  646  VAL n 
2  647  ARG n 
2  648  LEU n 
2  649  ILE n 
2  650  GLY n 
2  651  LEU n 
2  652  SER n 
2  653  ALA n 
2  654  THR n 
2  655  LEU n 
2  656  PRO n 
2  657  ASN n 
2  658  TYR n 
2  659  GLU n 
2  660  ASP n 
2  661  VAL n 
2  662  ALA n 
2  663  THR n 
2  664  PHE n 
2  665  LEU n 
2  666  ARG n 
2  667  VAL n 
2  668  ASP n 
2  669  PRO n 
2  670  ALA n 
2  671  LYS n 
2  672  GLY n 
2  673  LEU n 
2  674  PHE n 
2  675  TYR n 
2  676  PHE n 
2  677  ASP n 
2  678  ASN n 
2  679  SER n 
2  680  PHE n 
2  681  ARG n 
2  682  PRO n 
2  683  VAL n 
2  684  PRO n 
2  685  LEU n 
2  686  GLU n 
2  687  GLN n 
2  688  THR n 
2  689  TYR n 
2  690  VAL n 
2  691  GLY n 
2  692  ILE n 
2  693  THR n 
2  694  GLU n 
2  695  LYS n 
2  696  LYS n 
2  697  ALA n 
2  698  ILE n 
2  699  LYS n 
2  700  ARG n 
2  701  PHE n 
2  702  GLN n 
2  703  ILE n 
2  704  MET n 
2  705  ASN n 
2  706  GLU n 
2  707  ILE n 
2  708  VAL n 
2  709  TYR n 
2  710  GLU n 
2  711  LYS n 
2  712  ILE n 
2  713  MET n 
2  714  GLU n 
2  715  HIS n 
2  716  ALA n 
2  717  GLY n 
2  718  LYS n 
2  719  ASN n 
2  720  GLN n 
2  721  VAL n 
2  722  LEU n 
2  723  VAL n 
2  724  PHE n 
2  725  VAL n 
2  726  HIS n 
2  727  SER n 
2  728  ARG n 
2  729  LYS n 
2  730  GLU n 
2  731  THR n 
2  732  GLY n 
2  733  LYS n 
2  734  THR n 
2  735  ALA n 
2  736  ARG n 
2  737  ALA n 
2  738  ILE n 
2  739  ARG n 
2  740  ASP n 
2  741  MET n 
2  742  CYS n 
2  743  LEU n 
2  744  GLU n 
2  745  LYS n 
2  746  ASP n 
2  747  THR n 
2  748  LEU n 
2  749  GLY n 
2  750  LEU n 
2  751  PHE n 
2  752  LEU n 
2  753  ARG n 
2  754  GLU n 
2  755  GLY n 
2  756  SER n 
2  757  ALA n 
2  758  SER n 
2  759  THR n 
2  760  GLU n 
2  761  VAL n 
2  762  LEU n 
2  763  ARG n 
2  764  THR n 
2  765  GLU n 
2  766  ALA n 
2  767  GLU n 
2  768  GLN n 
2  769  CYS n 
2  770  LYS n 
2  771  ASN n 
2  772  LEU n 
2  773  GLU n 
2  774  LEU n 
2  775  LYS n 
2  776  ASP n 
2  777  LEU n 
2  778  LEU n 
2  779  PRO n 
2  780  TYR n 
2  781  GLY n 
2  782  PHE n 
2  783  ALA n 
2  784  ILE n 
2  785  HIS n 
2  786  HIS n 
2  787  ALA n 
2  788  GLY n 
2  789  MET n 
2  790  THR n 
2  791  ARG n 
2  792  VAL n 
2  793  ASP n 
2  794  ARG n 
2  795  THR n 
2  796  LEU n 
2  797  VAL n 
2  798  GLU n 
2  799  ASP n 
2  800  LEU n 
2  801  PHE n 
2  802  ALA n 
2  803  ASP n 
2  804  LYS n 
2  805  HIS n 
2  806  ILE n 
2  807  GLN n 
2  808  VAL n 
2  809  LEU n 
2  810  VAL n 
2  811  SER n 
2  812  THR n 
2  813  ALA n 
2  814  THR n 
2  815  LEU n 
2  816  ALA n 
2  817  TRP n 
2  818  GLY n 
2  819  VAL n 
2  820  ASN n 
2  821  LEU n 
2  822  PRO n 
2  823  ALA n 
2  824  HIS n 
2  825  THR n 
2  826  VAL n 
2  827  ILE n 
2  828  ILE n 
2  829  LYS n 
2  830  GLY n 
2  831  THR n 
2  832  GLN n 
2  833  VAL n 
2  834  TYR n 
2  835  SER n 
2  836  PRO n 
2  837  GLU n 
2  838  LYS n 
2  839  GLY n 
2  840  ARG n 
2  841  TRP n 
2  842  THR n 
2  843  GLU n 
2  844  LEU n 
2  845  GLY n 
2  846  ALA n 
2  847  LEU n 
2  848  ASP n 
2  849  ILE n 
2  850  LEU n 
2  851  GLN n 
2  852  MET n 
2  853  LEU n 
2  854  GLY n 
2  855  ARG n 
2  856  ALA n 
2  857  GLY n 
2  858  ARG n 
2  859  PRO n 
2  860  GLN n 
2  861  TYR n 
2  862  ASP n 
2  863  THR n 
2  864  LYS n 
2  865  GLY n 
2  866  GLU n 
2  867  GLY n 
2  868  ILE n 
2  869  LEU n 
2  870  ILE n 
2  871  THR n 
2  872  SER n 
2  873  HIS n 
2  874  GLY n 
2  875  GLU n 
2  876  LEU n 
2  877  GLN n 
2  878  TYR n 
2  879  TYR n 
2  880  LEU n 
2  881  SER n 
2  882  LEU n 
2  883  LEU n 
2  884  ASN n 
2  885  GLN n 
2  886  GLN n 
2  887  LEU n 
2  888  PRO n 
2  889  ILE n 
2  890  GLU n 
2  891  SER n 
2  892  GLN n 
2  893  MET n 
2  894  VAL n 
2  895  SER n 
2  896  LYS n 
2  897  LEU n 
2  898  PRO n 
2  899  ASP n 
2  900  MET n 
2  901  LEU n 
2  902  ASN n 
2  903  ALA n 
2  904  GLU n 
2  905  ILE n 
2  906  VAL n 
2  907  LEU n 
2  908  GLY n 
2  909  ASN n 
2  910  VAL n 
2  911  GLN n 
2  912  ASN n 
2  913  ALA n 
2  914  LYS n 
2  915  ASP n 
2  916  ALA n 
2  917  VAL n 
2  918  ASN n 
2  919  TRP n 
2  920  LEU n 
2  921  GLY n 
2  922  TYR n 
2  923  ALA n 
2  924  TYR n 
2  925  LEU n 
2  926  TYR n 
2  927  ILE n 
2  928  ARG n 
2  929  MET n 
2  930  LEU n 
2  931  ARG n 
2  932  SER n 
2  933  PRO n 
2  934  THR n 
2  935  LEU n 
2  936  TYR n 
2  937  GLY n 
2  938  ILE n 
2  939  SER n 
2  940  HIS n 
2  941  ASP n 
2  942  ASP n 
2  943  LEU n 
2  944  LYS n 
2  945  GLY n 
2  946  ASP n 
2  947  PRO n 
2  948  LEU n 
2  949  LEU n 
2  950  ASP n 
2  951  GLN n 
2  952  ARG n 
2  953  ARG n 
2  954  LEU n 
2  955  ASP n 
2  956  LEU n 
2  957  VAL n 
2  958  HIS n 
2  959  THR n 
2  960  ALA n 
2  961  ALA n 
2  962  LEU n 
2  963  MET n 
2  964  LEU n 
2  965  ASP n 
2  966  LYS n 
2  967  ASN n 
2  968  ASN n 
2  969  LEU n 
2  970  VAL n 
2  971  LYS n 
2  972  TYR n 
2  973  ASP n 
2  974  LYS n 
2  975  LYS n 
2  976  THR n 
2  977  GLY n 
2  978  ASN n 
2  979  PHE n 
2  980  GLN n 
2  981  VAL n 
2  982  THR n 
2  983  GLU n 
2  984  LEU n 
2  985  GLY n 
2  986  ARG n 
2  987  ILE n 
2  988  ALA n 
2  989  SER n 
2  990  HIS n 
2  991  TYR n 
2  992  TYR n 
2  993  ILE n 
2  994  THR n 
2  995  ASN n 
2  996  ASP n 
2  997  THR n 
2  998  VAL n 
2  999  GLN n 
2  1000 THR n 
2  1001 TYR n 
2  1002 ASN n 
2  1003 GLN n 
2  1004 LEU n 
2  1005 LEU n 
2  1006 LYS n 
2  1007 PRO n 
2  1008 THR n 
2  1009 LEU n 
2  1010 SER n 
2  1011 GLU n 
2  1012 ILE n 
2  1013 GLU n 
2  1014 LEU n 
2  1015 PHE n 
2  1016 ARG n 
2  1017 VAL n 
2  1018 PHE n 
2  1019 SER n 
2  1020 LEU n 
2  1021 SER n 
2  1022 SER n 
2  1023 GLU n 
2  1024 PHE n 
2  1025 LYS n 
2  1026 ASN n 
2  1027 ILE n 
2  1028 THR n 
2  1029 VAL n 
2  1030 ARG n 
2  1031 GLU n 
2  1032 GLU n 
2  1033 GLU n 
2  1034 LYS n 
2  1035 LEU n 
2  1036 GLU n 
2  1037 LEU n 
2  1038 GLN n 
2  1039 LYS n 
2  1040 LEU n 
2  1041 LEU n 
2  1042 GLU n 
2  1043 ARG n 
2  1044 VAL n 
2  1045 PRO n 
2  1046 ILE n 
2  1047 PRO n 
2  1048 VAL n 
2  1049 LYS n 
2  1050 GLU n 
2  1051 SER n 
2  1052 ILE n 
2  1053 GLU n 
2  1054 GLU n 
2  1055 PRO n 
2  1056 SER n 
2  1057 ALA n 
2  1058 LYS n 
2  1059 ILE n 
2  1060 ASN n 
2  1061 VAL n 
2  1062 LEU n 
2  1063 LEU n 
2  1064 GLN n 
2  1065 ALA n 
2  1066 PHE n 
2  1067 ILE n 
2  1068 SER n 
2  1069 GLN n 
2  1070 LEU n 
2  1071 LYS n 
2  1072 LEU n 
2  1073 GLU n 
2  1074 GLY n 
2  1075 PHE n 
2  1076 ALA n 
2  1077 LEU n 
2  1078 MET n 
2  1079 ALA n 
2  1080 ASP n 
2  1081 MET n 
2  1082 VAL n 
2  1083 TYR n 
2  1084 VAL n 
2  1085 THR n 
2  1086 GLN n 
2  1087 SER n 
2  1088 ALA n 
2  1089 GLY n 
2  1090 ARG n 
2  1091 LEU n 
2  1092 MET n 
2  1093 ARG n 
2  1094 ALA n 
2  1095 ILE n 
2  1096 PHE n 
2  1097 GLU n 
2  1098 ILE n 
2  1099 VAL n 
2  1100 LEU n 
2  1101 ASN n 
2  1102 ARG n 
2  1103 GLY n 
2  1104 TRP n 
2  1105 ALA n 
2  1106 GLN n 
2  1107 LEU n 
2  1108 THR n 
2  1109 ASP n 
2  1110 LYS n 
2  1111 THR n 
2  1112 LEU n 
2  1113 ASN n 
2  1114 LEU n 
2  1115 CYS n 
2  1116 LYS n 
2  1117 MET n 
2  1118 ILE n 
2  1119 ASP n 
2  1120 LYS n 
2  1121 ARG n 
2  1122 MET n 
2  1123 TRP n 
2  1124 GLN n 
2  1125 SER n 
2  1126 MET n 
2  1127 CYS n 
2  1128 PRO n 
2  1129 LEU n 
2  1130 ARG n 
2  1131 GLN n 
2  1132 PHE n 
2  1133 ARG n 
2  1134 LYS n 
2  1135 LEU n 
2  1136 PRO n 
2  1137 GLU n 
2  1138 GLU n 
2  1139 VAL n 
2  1140 VAL n 
2  1141 LYS n 
2  1142 LYS n 
2  1143 ILE n 
2  1144 GLU n 
2  1145 LYS n 
2  1146 LYS n 
2  1147 ASN n 
2  1148 PHE n 
2  1149 PRO n 
2  1150 PHE n 
2  1151 GLU n 
2  1152 ARG n 
2  1153 LEU n 
2  1154 TYR n 
2  1155 ASP n 
2  1156 LEU n 
2  1157 ASN n 
2  1158 HIS n 
2  1159 ASN n 
2  1160 GLU n 
2  1161 ILE n 
2  1162 GLY n 
2  1163 GLU n 
2  1164 LEU n 
2  1165 ILE n 
2  1166 ARG n 
2  1167 MET n 
2  1168 PRO n 
2  1169 LYS n 
2  1170 MET n 
2  1171 GLY n 
2  1172 LYS n 
2  1173 THR n 
2  1174 ILE n 
2  1175 HIS n 
2  1176 LYS n 
2  1177 TYR n 
2  1178 VAL n 
2  1179 HIS n 
2  1180 LEU n 
2  1181 PHE n 
2  1182 PRO n 
2  1183 LYS n 
2  1184 LEU n 
2  1185 GLU n 
2  1186 LEU n 
2  1187 SER n 
2  1188 VAL n 
2  1189 HIS n 
2  1190 LEU n 
2  1191 GLN n 
2  1192 PRO n 
2  1193 ILE n 
2  1194 THR n 
2  1195 ARG n 
2  1196 SER n 
2  1197 THR n 
2  1198 LEU n 
2  1199 LYS n 
2  1200 VAL n 
2  1201 GLU n 
2  1202 LEU n 
2  1203 THR n 
2  1204 ILE n 
2  1205 THR n 
2  1206 PRO n 
2  1207 ASP n 
2  1208 PHE n 
2  1209 GLN n 
2  1210 TRP n 
2  1211 ASP n 
2  1212 GLU n 
2  1213 LYS n 
2  1214 VAL n 
2  1215 HIS n 
2  1216 GLY n 
2  1217 SER n 
2  1218 SER n 
2  1219 GLU n 
2  1220 ALA n 
2  1221 PHE n 
2  1222 TRP n 
2  1223 ILE n 
2  1224 LEU n 
2  1225 VAL n 
2  1226 GLU n 
2  1227 ASP n 
2  1228 VAL n 
2  1229 ASP n 
2  1230 SER n 
2  1231 GLU n 
2  1232 VAL n 
2  1233 ILE n 
2  1234 LEU n 
2  1235 HIS n 
2  1236 HIS n 
2  1237 GLU n 
2  1238 TYR n 
2  1239 PHE n 
2  1240 LEU n 
2  1241 LEU n 
2  1242 LYS n 
2  1243 ALA n 
2  1244 LYS n 
2  1245 TYR n 
2  1246 ALA n 
2  1247 GLN n 
2  1248 ASP n 
2  1249 GLU n 
2  1250 HIS n 
2  1251 LEU n 
2  1252 ILE n 
2  1253 THR n 
2  1254 PHE n 
2  1255 PHE n 
2  1256 VAL n 
2  1257 PRO n 
2  1258 VAL n 
2  1259 PHE n 
2  1260 GLU n 
2  1261 PRO n 
2  1262 LEU n 
2  1263 PRO n 
2  1264 PRO n 
2  1265 GLN n 
2  1266 TYR n 
2  1267 PHE n 
2  1268 ILE n 
2  1269 ARG n 
2  1270 VAL n 
2  1271 VAL n 
2  1272 SER n 
2  1273 ASP n 
2  1274 ARG n 
2  1275 TRP n 
2  1276 LEU n 
2  1277 SER n 
2  1278 CYS n 
2  1279 GLU n 
2  1280 THR n 
2  1281 GLN n 
2  1282 LEU n 
2  1283 PRO n 
2  1284 VAL n 
2  1285 SER n 
2  1286 PHE n 
2  1287 ARG n 
2  1288 HIS n 
2  1289 LEU n 
2  1290 ILE n 
2  1291 LEU n 
2  1292 PRO n 
2  1293 GLU n 
2  1294 LYS n 
2  1295 TYR n 
2  1296 PRO n 
2  1297 PRO n 
2  1298 PRO n 
2  1299 THR n 
2  1300 GLU n 
2  1301 LEU n 
2  1302 LEU n 
2  1303 ASP n 
2  1304 LEU n 
2  1305 GLN n 
2  1306 PRO n 
2  1307 LEU n 
2  1308 PRO n 
2  1309 VAL n 
2  1310 SER n 
2  1311 ALA n 
2  1312 LEU n 
2  1313 ARG n 
2  1314 ASN n 
2  1315 SER n 
2  1316 ALA n 
2  1317 PHE n 
2  1318 GLU n 
2  1319 SER n 
2  1320 LEU n 
2  1321 TYR n 
2  1322 GLN n 
2  1323 ASP n 
2  1324 LYS n 
2  1325 PHE n 
2  1326 PRO n 
2  1327 PHE n 
2  1328 PHE n 
2  1329 ASN n 
2  1330 PRO n 
2  1331 ILE n 
2  1332 GLN n 
2  1333 THR n 
2  1334 GLN n 
2  1335 VAL n 
2  1336 PHE n 
2  1337 ASN n 
2  1338 THR n 
2  1339 VAL n 
2  1340 TYR n 
2  1341 ASN n 
2  1342 SER n 
2  1343 ASP n 
2  1344 ASP n 
2  1345 ASN n 
2  1346 VAL n 
2  1347 PHE n 
2  1348 VAL n 
2  1349 GLY n 
2  1350 ALA n 
2  1351 PRO n 
2  1352 THR n 
2  1353 GLY n 
2  1354 SER n 
2  1355 GLY n 
2  1356 LYS n 
2  1357 THR n 
2  1358 ILE n 
2  1359 CYS n 
2  1360 ALA n 
2  1361 GLU n 
2  1362 PHE n 
2  1363 ALA n 
2  1364 ILE n 
2  1365 LEU n 
2  1366 ARG n 
2  1367 MET n 
2  1368 LEU n 
2  1369 LEU n 
2  1370 GLN n 
2  1371 SER n 
2  1372 SER n 
2  1373 GLU n 
2  1374 GLY n 
2  1375 ARG n 
2  1376 CYS n 
2  1377 VAL n 
2  1378 TYR n 
2  1379 ILE n 
2  1380 THR n 
2  1381 PRO n 
2  1382 MET n 
2  1383 GLU n 
2  1384 ALA n 
2  1385 LEU n 
2  1386 ALA n 
2  1387 GLU n 
2  1388 GLN n 
2  1389 VAL n 
2  1390 TYR n 
2  1391 MET n 
2  1392 ASP n 
2  1393 TRP n 
2  1394 TYR n 
2  1395 GLU n 
2  1396 LYS n 
2  1397 PHE n 
2  1398 GLN n 
2  1399 ASP n 
2  1400 ARG n 
2  1401 LEU n 
2  1402 ASN n 
2  1403 LYS n 
2  1404 LYS n 
2  1405 VAL n 
2  1406 VAL n 
2  1407 LEU n 
2  1408 LEU n 
2  1409 THR n 
2  1410 GLY n 
2  1411 GLU n 
2  1412 THR n 
2  1413 SER n 
2  1414 THR n 
2  1415 ASP n 
2  1416 LEU n 
2  1417 LYS n 
2  1418 LEU n 
2  1419 LEU n 
2  1420 GLY n 
2  1421 LYS n 
2  1422 GLY n 
2  1423 ASN n 
2  1424 ILE n 
2  1425 ILE n 
2  1426 ILE n 
2  1427 SER n 
2  1428 THR n 
2  1429 PRO n 
2  1430 GLU n 
2  1431 LYS n 
2  1432 TRP n 
2  1433 ASP n 
2  1434 ILE n 
2  1435 LEU n 
2  1436 SER n 
2  1437 ARG n 
2  1438 ARG n 
2  1439 TRP n 
2  1440 LYS n 
2  1441 GLN n 
2  1442 ARG n 
2  1443 LYS n 
2  1444 ASN n 
2  1445 VAL n 
2  1446 GLN n 
2  1447 ASN n 
2  1448 ILE n 
2  1449 ASN n 
2  1450 LEU n 
2  1451 PHE n 
2  1452 VAL n 
2  1453 VAL n 
2  1454 ASP n 
2  1455 GLU n 
2  1456 VAL n 
2  1457 HIS n 
2  1458 LEU n 
2  1459 ILE n 
2  1460 GLY n 
2  1461 GLY n 
2  1462 GLU n 
2  1463 ASN n 
2  1464 GLY n 
2  1465 PRO n 
2  1466 VAL n 
2  1467 LEU n 
2  1468 GLU n 
2  1469 VAL n 
2  1470 ILE n 
2  1471 CYS n 
2  1472 SER n 
2  1473 ARG n 
2  1474 MET n 
2  1475 ARG n 
2  1476 TYR n 
2  1477 ILE n 
2  1478 SER n 
2  1479 SER n 
2  1480 GLN n 
2  1481 ILE n 
2  1482 GLU n 
2  1483 ARG n 
2  1484 PRO n 
2  1485 ILE n 
2  1486 ARG n 
2  1487 ILE n 
2  1488 VAL n 
2  1489 ALA n 
2  1490 LEU n 
2  1491 SER n 
2  1492 SER n 
2  1493 SER n 
2  1494 LEU n 
2  1495 SER n 
2  1496 ASN n 
2  1497 ALA n 
2  1498 LYS n 
2  1499 ASP n 
2  1500 VAL n 
2  1501 ALA n 
2  1502 HIS n 
2  1503 TRP n 
2  1504 LEU n 
2  1505 GLY n 
2  1506 CYS n 
2  1507 SER n 
2  1508 ALA n 
2  1509 THR n 
2  1510 SER n 
2  1511 THR n 
2  1512 PHE n 
2  1513 ASN n 
2  1514 PHE n 
2  1515 HIS n 
2  1516 PRO n 
2  1517 ASN n 
2  1518 VAL n 
2  1519 ARG n 
2  1520 PRO n 
2  1521 VAL n 
2  1522 PRO n 
2  1523 LEU n 
2  1524 GLU n 
2  1525 LEU n 
2  1526 HIS n 
2  1527 ILE n 
2  1528 GLN n 
2  1529 GLY n 
2  1530 PHE n 
2  1531 ASN n 
2  1532 ILE n 
2  1533 SER n 
2  1534 HIS n 
2  1535 THR n 
2  1536 GLN n 
2  1537 THR n 
2  1538 ARG n 
2  1539 LEU n 
2  1540 LEU n 
2  1541 SER n 
2  1542 MET n 
2  1543 ALA n 
2  1544 LYS n 
2  1545 PRO n 
2  1546 VAL n 
2  1547 TYR n 
2  1548 HIS n 
2  1549 ALA n 
2  1550 ILE n 
2  1551 THR n 
2  1552 LYS n 
2  1553 HIS n 
2  1554 SER n 
2  1555 PRO n 
2  1556 LYS n 
2  1557 LYS n 
2  1558 PRO n 
2  1559 VAL n 
2  1560 ILE n 
2  1561 VAL n 
2  1562 PHE n 
2  1563 VAL n 
2  1564 PRO n 
2  1565 SER n 
2  1566 ARG n 
2  1567 LYS n 
2  1568 GLN n 
2  1569 THR n 
2  1570 ARG n 
2  1571 LEU n 
2  1572 THR n 
2  1573 ALA n 
2  1574 ILE n 
2  1575 ASP n 
2  1576 ILE n 
2  1577 LEU n 
2  1578 THR n 
2  1579 THR n 
2  1580 CYS n 
2  1581 ALA n 
2  1582 ALA n 
2  1583 ASP n 
2  1584 ILE n 
2  1585 GLN n 
2  1586 ARG n 
2  1587 GLN n 
2  1588 ARG n 
2  1589 PHE n 
2  1590 LEU n 
2  1591 HIS n 
2  1592 CYS n 
2  1593 THR n 
2  1594 GLU n 
2  1595 LYS n 
2  1596 ASP n 
2  1597 LEU n 
2  1598 ILE n 
2  1599 PRO n 
2  1600 TYR n 
2  1601 LEU n 
2  1602 GLU n 
2  1603 LYS n 
2  1604 LEU n 
2  1605 SER n 
2  1606 ASP n 
2  1607 SER n 
2  1608 THR n 
2  1609 LEU n 
2  1610 LYS n 
2  1611 GLU n 
2  1612 THR n 
2  1613 LEU n 
2  1614 LEU n 
2  1615 ASN n 
2  1616 GLY n 
2  1617 VAL n 
2  1618 GLY n 
2  1619 TYR n 
2  1620 LEU n 
2  1621 HIS n 
2  1622 GLU n 
2  1623 GLY n 
2  1624 LEU n 
2  1625 SER n 
2  1626 PRO n 
2  1627 MET n 
2  1628 GLU n 
2  1629 ARG n 
2  1630 ARG n 
2  1631 LEU n 
2  1632 VAL n 
2  1633 GLU n 
2  1634 GLN n 
2  1635 LEU n 
2  1636 PHE n 
2  1637 SER n 
2  1638 SER n 
2  1639 GLY n 
2  1640 ALA n 
2  1641 ILE n 
2  1642 GLN n 
2  1643 VAL n 
2  1644 VAL n 
2  1645 VAL n 
2  1646 ALA n 
2  1647 SER n 
2  1648 ARG n 
2  1649 SER n 
2  1650 LEU n 
2  1651 CYS n 
2  1652 TRP n 
2  1653 GLY n 
2  1654 MET n 
2  1655 ASN n 
2  1656 VAL n 
2  1657 ALA n 
2  1658 ALA n 
2  1659 HIS n 
2  1660 LEU n 
2  1661 VAL n 
2  1662 ILE n 
2  1663 ILE n 
2  1664 MET n 
2  1665 ASP n 
2  1666 THR n 
2  1667 GLN n 
2  1668 TYR n 
2  1669 TYR n 
2  1670 ASN n 
2  1671 GLY n 
2  1672 LYS n 
2  1673 ILE n 
2  1674 HIS n 
2  1675 ALA n 
2  1676 TYR n 
2  1677 VAL n 
2  1678 ASP n 
2  1679 TYR n 
2  1680 PRO n 
2  1681 ILE n 
2  1682 TYR n 
2  1683 ASP n 
2  1684 VAL n 
2  1685 LEU n 
2  1686 GLN n 
2  1687 MET n 
2  1688 VAL n 
2  1689 GLY n 
2  1690 HIS n 
2  1691 ALA n 
2  1692 ASN n 
2  1693 ARG n 
2  1694 PRO n 
2  1695 LEU n 
2  1696 GLN n 
2  1697 ASP n 
2  1698 ASP n 
2  1699 GLU n 
2  1700 GLY n 
2  1701 ARG n 
2  1702 CYS n 
2  1703 VAL n 
2  1704 ILE n 
2  1705 MET n 
2  1706 CYS n 
2  1707 GLN n 
2  1708 GLY n 
2  1709 SER n 
2  1710 LYS n 
2  1711 LYS n 
2  1712 ASP n 
2  1713 PHE n 
2  1714 PHE n 
2  1715 LYS n 
2  1716 LYS n 
2  1717 PHE n 
2  1718 LEU n 
2  1719 TYR n 
2  1720 GLU n 
2  1721 PRO n 
2  1722 LEU n 
2  1723 PRO n 
2  1724 VAL n 
2  1725 GLU n 
2  1726 SER n 
2  1727 HIS n 
2  1728 LEU n 
2  1729 ASP n 
2  1730 HIS n 
2  1731 CYS n 
2  1732 MET n 
2  1733 HIS n 
2  1734 ASP n 
2  1735 HIS n 
2  1736 PHE n 
2  1737 ASN n 
2  1738 ALA n 
2  1739 GLU n 
2  1740 ILE n 
2  1741 VAL n 
2  1742 THR n 
2  1743 LYS n 
2  1744 THR n 
2  1745 ILE n 
2  1746 GLU n 
2  1747 ASN n 
2  1748 LYS n 
2  1749 GLN n 
2  1750 ASP n 
2  1751 ALA n 
2  1752 VAL n 
2  1753 ASP n 
2  1754 TYR n 
2  1755 LEU n 
2  1756 THR n 
2  1757 TRP n 
2  1758 THR n 
2  1759 PHE n 
2  1760 LEU n 
2  1761 TYR n 
2  1762 ARG n 
2  1763 ARG n 
2  1764 MET n 
2  1765 THR n 
2  1766 GLN n 
2  1767 ASN n 
2  1768 PRO n 
2  1769 ASN n 
2  1770 TYR n 
2  1771 TYR n 
2  1772 ASN n 
2  1773 LEU n 
2  1774 GLN n 
2  1775 GLY n 
2  1776 ILE n 
2  1777 SER n 
2  1778 HIS n 
2  1779 ARG n 
2  1780 HIS n 
2  1781 LEU n 
2  1782 SER n 
2  1783 ASP n 
2  1784 HIS n 
2  1785 LEU n 
2  1786 SER n 
2  1787 GLU n 
2  1788 LEU n 
2  1789 VAL n 
2  1790 GLU n 
2  1791 GLN n 
2  1792 THR n 
2  1793 LEU n 
2  1794 SER n 
2  1795 ASP n 
2  1796 LEU n 
2  1797 GLU n 
2  1798 GLN n 
2  1799 SER n 
2  1800 LYS n 
2  1801 CYS n 
2  1802 ILE n 
2  1803 SER n 
2  1804 ILE n 
2  1805 GLU n 
2  1806 ASP n 
2  1807 GLU n 
2  1808 MET n 
2  1809 ASP n 
2  1810 VAL n 
2  1811 ALA n 
2  1812 PRO n 
2  1813 LEU n 
2  1814 ASN n 
2  1815 LEU n 
2  1816 GLY n 
2  1817 MET n 
2  1818 ILE n 
2  1819 ALA n 
2  1820 ALA n 
2  1821 TYR n 
2  1822 TYR n 
2  1823 TYR n 
2  1824 ILE n 
2  1825 ASN n 
2  1826 TYR n 
2  1827 THR n 
2  1828 THR n 
2  1829 ILE n 
2  1830 GLU n 
2  1831 LEU n 
2  1832 PHE n 
2  1833 SER n 
2  1834 MET n 
2  1835 SER n 
2  1836 LEU n 
2  1837 ASN n 
2  1838 ALA n 
2  1839 LYS n 
2  1840 THR n 
2  1841 LYS n 
2  1842 VAL n 
2  1843 ARG n 
2  1844 GLY n 
2  1845 LEU n 
2  1846 ILE n 
2  1847 GLU n 
2  1848 ILE n 
2  1849 ILE n 
2  1850 SER n 
2  1851 ASN n 
2  1852 ALA n 
2  1853 ALA n 
2  1854 GLU n 
2  1855 TYR n 
2  1856 GLU n 
2  1857 ASN n 
2  1858 ILE n 
2  1859 PRO n 
2  1860 ILE n 
2  1861 ARG n 
2  1862 HIS n 
2  1863 HIS n 
2  1864 GLU n 
2  1865 ASP n 
2  1866 ASN n 
2  1867 LEU n 
2  1868 LEU n 
2  1869 ARG n 
2  1870 GLN n 
2  1871 LEU n 
2  1872 ALA n 
2  1873 GLN n 
2  1874 LYS n 
2  1875 VAL n 
2  1876 PRO n 
2  1877 HIS n 
2  1878 LYS n 
2  1879 LEU n 
2  1880 ASN n 
2  1881 ASN n 
2  1882 PRO n 
2  1883 LYS n 
2  1884 PHE n 
2  1885 ASN n 
2  1886 ASP n 
2  1887 PRO n 
2  1888 HIS n 
2  1889 VAL n 
2  1890 LYS n 
2  1891 THR n 
2  1892 ASN n 
2  1893 LEU n 
2  1894 LEU n 
2  1895 LEU n 
2  1896 GLN n 
2  1897 ALA n 
2  1898 HIS n 
2  1899 LEU n 
2  1900 SER n 
2  1901 ARG n 
2  1902 MET n 
2  1903 GLN n 
2  1904 LEU n 
2  1905 SER n 
2  1906 ALA n 
2  1907 GLU n 
2  1908 LEU n 
2  1909 GLN n 
2  1910 SER n 
2  1911 ASP n 
2  1912 THR n 
2  1913 GLU n 
2  1914 GLU n 
2  1915 ILE n 
2  1916 LEU n 
2  1917 SER n 
2  1918 LYS n 
2  1919 ALA n 
2  1920 ILE n 
2  1921 ARG n 
2  1922 LEU n 
2  1923 ILE n 
2  1924 GLN n 
2  1925 ALA n 
2  1926 CYS n 
2  1927 VAL n 
2  1928 ASP n 
2  1929 VAL n 
2  1930 LEU n 
2  1931 SER n 
2  1932 SER n 
2  1933 ASN n 
2  1934 GLY n 
2  1935 TRP n 
2  1936 LEU n 
2  1937 SER n 
2  1938 PRO n 
2  1939 ALA n 
2  1940 LEU n 
2  1941 ALA n 
2  1942 ALA n 
2  1943 MET n 
2  1944 GLU n 
2  1945 LEU n 
2  1946 ALA n 
2  1947 GLN n 
2  1948 MET n 
2  1949 VAL n 
2  1950 THR n 
2  1951 GLN n 
2  1952 ALA n 
2  1953 MET n 
2  1954 TRP n 
2  1955 SER n 
2  1956 LYS n 
2  1957 ASP n 
2  1958 SER n 
2  1959 TYR n 
2  1960 LEU n 
2  1961 LYS n 
2  1962 GLN n 
2  1963 LEU n 
2  1964 PRO n 
2  1965 HIS n 
2  1966 PHE n 
2  1967 THR n 
2  1968 SER n 
2  1969 GLU n 
2  1970 HIS n 
2  1971 ILE n 
2  1972 LYS n 
2  1973 ARG n 
2  1974 CYS n 
2  1975 THR n 
2  1976 ASP n 
2  1977 LYS n 
2  1978 GLY n 
2  1979 VAL n 
2  1980 GLU n 
2  1981 SER n 
2  1982 VAL n 
2  1983 PHE n 
2  1984 ASP n 
2  1985 ILE n 
2  1986 MET n 
2  1987 GLU n 
2  1988 MET n 
2  1989 GLU n 
2  1990 ASP n 
2  1991 GLU n 
2  1992 GLU n 
2  1993 ARG n 
2  1994 ASN n 
2  1995 ALA n 
2  1996 LEU n 
2  1997 LEU n 
2  1998 GLN n 
2  1999 LEU n 
2  2000 THR n 
2  2001 ASP n 
2  2002 SER n 
2  2003 GLN n 
2  2004 ILE n 
2  2005 ALA n 
2  2006 ASP n 
2  2007 VAL n 
2  2008 ALA n 
2  2009 ARG n 
2  2010 PHE n 
2  2011 CYS n 
2  2012 ASN n 
2  2013 ARG n 
2  2014 TYR n 
2  2015 PRO n 
2  2016 ASN n 
2  2017 ILE n 
2  2018 GLU n 
2  2019 LEU n 
2  2020 SER n 
2  2021 TYR n 
2  2022 GLU n 
2  2023 VAL n 
2  2024 VAL n 
2  2025 ASP n 
2  2026 LYS n 
2  2027 ASP n 
2  2028 SER n 
2  2029 ILE n 
2  2030 ARG n 
2  2031 SER n 
2  2032 GLY n 
2  2033 GLY n 
2  2034 PRO n 
2  2035 VAL n 
2  2036 VAL n 
2  2037 VAL n 
2  2038 LEU n 
2  2039 VAL n 
2  2040 GLN n 
2  2041 LEU n 
2  2042 GLU n 
2  2043 ARG n 
2  2044 GLU n 
2  2045 GLU n 
2  2046 GLU n 
2  2047 VAL n 
2  2048 THR n 
2  2049 GLY n 
2  2050 PRO n 
2  2051 VAL n 
2  2052 ILE n 
2  2053 ALA n 
2  2054 PRO n 
2  2055 LEU n 
2  2056 PHE n 
2  2057 PRO n 
2  2058 GLN n 
2  2059 LYS n 
2  2060 ARG n 
2  2061 GLU n 
2  2062 GLU n 
2  2063 GLY n 
2  2064 TRP n 
2  2065 TRP n 
2  2066 VAL n 
2  2067 VAL n 
2  2068 ILE n 
2  2069 GLY n 
2  2070 ASP n 
2  2071 ALA n 
2  2072 LYS n 
2  2073 SER n 
2  2074 ASN n 
2  2075 SER n 
2  2076 LEU n 
2  2077 ILE n 
2  2078 SER n 
2  2079 ILE n 
2  2080 LYS n 
2  2081 ARG n 
2  2082 LEU n 
2  2083 THR n 
2  2084 LEU n 
2  2085 GLN n 
2  2086 GLN n 
2  2087 LYS n 
2  2088 ALA n 
2  2089 LYS n 
2  2090 VAL n 
2  2091 LYS n 
2  2092 LEU n 
2  2093 ASP n 
2  2094 PHE n 
2  2095 VAL n 
2  2096 ALA n 
2  2097 PRO n 
2  2098 ALA n 
2  2099 THR n 
2  2100 GLY n 
2  2101 ALA n 
2  2102 HIS n 
2  2103 ASN n 
2  2104 TYR n 
2  2105 THR n 
2  2106 LEU n 
2  2107 TYR n 
2  2108 PHE n 
2  2109 MET n 
2  2110 SER n 
2  2111 ASP n 
2  2112 ALA n 
2  2113 TYR n 
2  2114 MET n 
2  2115 GLY n 
2  2116 CYS n 
2  2117 ASP n 
2  2118 GLN n 
2  2119 GLU n 
2  2120 TYR n 
2  2121 LYS n 
2  2122 PHE n 
2  2123 SER n 
2  2124 VAL n 
2  2125 ASP n 
2  2126 VAL n 
2  2127 LYS n 
2  2128 GLU n 
2  2129 ALA n 
2  2130 GLU n 
2  2131 THR n 
2  2132 ASP n 
2  2133 SER n 
2  2134 ASP n 
2  2135 SER n 
2  2136 ASP n 
3  1    MET n 
3  2    ILE n 
3  3    GLU n 
3  4    GLN n 
3  5    GLN n 
3  6    LYS n 
3  7    ARG n 
3  8    LYS n 
3  9    GLY n 
3  10   PRO n 
3  11   GLU n 
3  12   LEU n 
3  13   PRO n 
3  14   LEU n 
3  15   VAL n 
3  16   PRO n 
3  17   VAL n 
3  18   LYS n 
3  19   ARG n 
3  20   GLN n 
3  21   ARG n 
3  22   HIS n 
3  23   GLU n 
3  24   LEU n 
3  25   LEU n 
3  26   LEU n 
3  27   GLY n 
3  28   ALA n 
3  29   GLY n 
3  30   SER n 
3  31   GLY n 
3  32   PRO n 
3  33   GLY n 
3  34   ALA n 
3  35   GLY n 
3  36   GLN n 
3  37   GLN n 
3  38   GLN n 
3  39   ALA n 
3  40   THR n 
3  41   PRO n 
3  42   GLY n 
3  43   ALA n 
3  44   LEU n 
3  45   LEU n 
3  46   GLN n 
3  47   ALA n 
3  48   GLY n 
3  49   PRO n 
3  50   PRO n 
3  51   ARG n 
3  52   CYS n 
3  53   SER n 
3  54   SER n 
3  55   LEU n 
3  56   GLN n 
3  57   ALA n 
3  58   PRO n 
3  59   ILE n 
3  60   MET n 
3  61   LEU n 
3  62   LEU n 
3  63   SER n 
3  64   GLY n 
3  65   HIS n 
3  66   GLU n 
3  67   GLY n 
3  68   GLU n 
3  69   VAL n 
3  70   TYR n 
3  71   CYS n 
3  72   CYS n 
3  73   LYS n 
3  74   PHE n 
3  75   HIS n 
3  76   PRO n 
3  77   ASN n 
3  78   GLY n 
3  79   SER n 
3  80   THR n 
3  81   LEU n 
3  82   ALA n 
3  83   SER n 
3  84   ALA n 
3  85   GLY n 
3  86   PHE n 
3  87   ASP n 
3  88   ARG n 
3  89   LEU n 
3  90   ILE n 
3  91   LEU n 
3  92   LEU n 
3  93   TRP n 
3  94   ASN n 
3  95   VAL n 
3  96   TYR n 
3  97   GLY n 
3  98   ASP n 
3  99   CYS n 
3  100  ASP n 
3  101  ASN n 
3  102  TYR n 
3  103  ALA n 
3  104  THR n 
3  105  LEU n 
3  106  LYS n 
3  107  GLY n 
3  108  HIS n 
3  109  SER n 
3  110  GLY n 
3  111  ALA n 
3  112  VAL n 
3  113  MET n 
3  114  GLU n 
3  115  LEU n 
3  116  HIS n 
3  117  TYR n 
3  118  ASN n 
3  119  THR n 
3  120  ASP n 
3  121  GLY n 
3  122  SER n 
3  123  MET n 
3  124  LEU n 
3  125  PHE n 
3  126  SER n 
3  127  ALA n 
3  128  SER n 
3  129  THR n 
3  130  ASP n 
3  131  LYS n 
3  132  THR n 
3  133  VAL n 
3  134  ALA n 
3  135  VAL n 
3  136  TRP n 
3  137  ASP n 
3  138  SER n 
3  139  GLU n 
3  140  THR n 
3  141  GLY n 
3  142  GLU n 
3  143  ARG n 
3  144  VAL n 
3  145  LYS n 
3  146  ARG n 
3  147  LEU n 
3  148  LYS n 
3  149  GLY n 
3  150  HIS n 
3  151  THR n 
3  152  SER n 
3  153  PHE n 
3  154  VAL n 
3  155  ASN n 
3  156  SER n 
3  157  CYS n 
3  158  TYR n 
3  159  PRO n 
3  160  ALA n 
3  161  ARG n 
3  162  ARG n 
3  163  GLY n 
3  164  PRO n 
3  165  GLN n 
3  166  LEU n 
3  167  VAL n 
3  168  CYS n 
3  169  THR n 
3  170  GLY n 
3  171  SER n 
3  172  ASP n 
3  173  ASP n 
3  174  GLY n 
3  175  THR n 
3  176  VAL n 
3  177  LYS n 
3  178  LEU n 
3  179  TRP n 
3  180  ASP n 
3  181  ILE n 
3  182  ARG n 
3  183  LYS n 
3  184  LYS n 
3  185  ALA n 
3  186  ALA n 
3  187  ILE n 
3  188  GLN n 
3  189  THR n 
3  190  PHE n 
3  191  GLN n 
3  192  ASN n 
3  193  THR n 
3  194  TYR n 
3  195  GLN n 
3  196  VAL n 
3  197  LEU n 
3  198  ALA n 
3  199  VAL n 
3  200  THR n 
3  201  PHE n 
3  202  ASN n 
3  203  ASP n 
3  204  THR n 
3  205  SER n 
3  206  ASP n 
3  207  GLN n 
3  208  ILE n 
3  209  ILE n 
3  210  SER n 
3  211  GLY n 
3  212  GLY n 
3  213  ILE n 
3  214  ASP n 
3  215  ASN n 
3  216  ASP n 
3  217  ILE n 
3  218  LYS n 
3  219  VAL n 
3  220  TRP n 
3  221  ASP n 
3  222  LEU n 
3  223  ARG n 
3  224  GLN n 
3  225  ASN n 
3  226  LYS n 
3  227  LEU n 
3  228  THR n 
3  229  TYR n 
3  230  THR n 
3  231  MET n 
3  232  ARG n 
3  233  GLY n 
3  234  HIS n 
3  235  ALA n 
3  236  ASP n 
3  237  SER n 
3  238  VAL n 
3  239  THR n 
3  240  GLY n 
3  241  LEU n 
3  242  SER n 
3  243  LEU n 
3  244  SER n 
3  245  SER n 
3  246  GLU n 
3  247  GLY n 
3  248  SER n 
3  249  TYR n 
3  250  LEU n 
3  251  LEU n 
3  252  SER n 
3  253  ASN n 
3  254  ALA n 
3  255  MET n 
3  256  ASP n 
3  257  ASN n 
3  258  THR n 
3  259  VAL n 
3  260  ARG n 
3  261  VAL n 
3  262  TRP n 
3  263  ASP n 
3  264  VAL n 
3  265  ARG n 
3  266  PRO n 
3  267  PHE n 
3  268  ALA n 
3  269  PRO n 
3  270  LYS n 
3  271  GLU n 
3  272  ARG n 
3  273  CYS n 
3  274  VAL n 
3  275  LYS n 
3  276  ILE n 
3  277  PHE n 
3  278  GLN n 
3  279  GLY n 
3  280  ASN n 
3  281  VAL n 
3  282  HIS n 
3  283  ASN n 
3  284  PHE n 
3  285  GLU n 
3  286  LYS n 
3  287  ASN n 
3  288  LEU n 
3  289  LEU n 
3  290  ARG n 
3  291  CYS n 
3  292  SER n 
3  293  TRP n 
3  294  SER n 
3  295  PRO n 
3  296  ASP n 
3  297  GLY n 
3  298  SER n 
3  299  LYS n 
3  300  ILE n 
3  301  ALA n 
3  302  ALA n 
3  303  GLY n 
3  304  SER n 
3  305  ALA n 
3  306  ASP n 
3  307  ARG n 
3  308  PHE n 
3  309  VAL n 
3  310  TYR n 
3  311  VAL n 
3  312  TRP n 
3  313  ASP n 
3  314  THR n 
3  315  THR n 
3  316  SER n 
3  317  ARG n 
3  318  ARG n 
3  319  ILE n 
3  320  LEU n 
3  321  TYR n 
3  322  LYS n 
3  323  LEU n 
3  324  PRO n 
3  325  GLY n 
3  326  HIS n 
3  327  ALA n 
3  328  GLY n 
3  329  SER n 
3  330  ILE n 
3  331  ASN n 
3  332  GLU n 
3  333  VAL n 
3  334  ALA n 
3  335  PHE n 
3  336  HIS n 
3  337  PRO n 
3  338  ASP n 
3  339  GLU n 
3  340  PRO n 
3  341  ILE n 
3  342  ILE n 
3  343  ILE n 
3  344  SER n 
3  345  ALA n 
3  346  SER n 
3  347  SER n 
3  348  ASP n 
3  349  LYS n 
3  350  ARG n 
3  351  LEU n 
3  352  TYR n 
3  353  MET n 
3  354  GLY n 
3  355  GLU n 
3  356  ILE n 
3  357  GLN n 
4  1    MET n 
4  2    SER n 
4  3    LEU n 
4  4    LEU n 
4  5    ASN n 
4  6    LYS n 
4  7    PRO n 
4  8    LYS n 
4  9    SER n 
4  10   GLU n 
4  11   MET n 
4  12   THR n 
4  13   PRO n 
4  14   GLU n 
4  15   GLU n 
4  16   LEU n 
4  17   GLN n 
4  18   LYS n 
4  19   ARG n 
4  20   GLU n 
4  21   GLU n 
4  22   GLU n 
4  23   GLU n 
4  24   PHE n 
4  25   ASN n 
4  26   THR n 
4  27   GLY n 
4  28   PRO n 
4  29   LEU n 
4  30   SER n 
4  31   VAL n 
4  32   LEU n 
4  33   THR n 
4  34   GLN n 
4  35   SER n 
4  36   VAL n 
4  37   LYS n 
4  38   ASN n 
4  39   ASN n 
4  40   THR n 
4  41   GLN n 
4  42   VAL n 
4  43   LEU n 
4  44   ILE n 
4  45   ASN n 
4  46   CYS n 
4  47   ARG n 
4  48   ASN n 
4  49   ASN n 
4  50   LYS n 
4  51   LYS n 
4  52   LEU n 
4  53   LEU n 
4  54   GLY n 
4  55   ARG n 
4  56   VAL n 
4  57   LYS n 
4  58   ALA n 
4  59   PHE n 
4  60   ASP n 
4  61   ARG n 
4  62   HIS n 
4  63   CYS n 
4  64   ASN n 
4  65   MET n 
4  66   VAL n 
4  67   LEU n 
4  68   GLU n 
4  69   ASN n 
4  70   VAL n 
4  71   LYS n 
4  72   GLU n 
4  73   MET n 
4  74   TRP n 
4  75   THR n 
4  76   GLU n 
4  77   VAL n 
4  78   PRO n 
4  79   LYS n 
4  80   SER n 
4  81   GLY n 
4  82   LYS n 
4  83   GLY n 
4  84   LYS n 
4  85   LYS n 
4  86   LYS n 
4  87   SER n 
4  88   LYS n 
4  89   PRO n 
4  90   VAL n 
4  91   ASN n 
4  92   LYS n 
4  93   ASP n 
4  94   ARG n 
4  95   TYR n 
4  96   ILE n 
4  97   SER n 
4  98   LYS n 
4  99   MET n 
4  100  PHE n 
4  101  LEU n 
4  102  ARG n 
4  103  GLY n 
4  104  ASP n 
4  105  SER n 
4  106  VAL n 
4  107  ILE n 
4  108  VAL n 
4  109  VAL n 
4  110  LEU n 
4  111  ARG n 
4  112  ASN n 
4  113  PRO n 
4  114  LEU n 
4  115  ILE n 
4  116  ALA n 
4  117  GLY n 
4  118  LYS n 
5  1    MET n 
5  2    SER n 
5  3    LEU n 
5  4    PRO n 
5  5    LEU n 
5  6    ASN n 
5  7    PRO n 
5  8    LYS n 
5  9    PRO n 
5  10   PHE n 
5  11   LEU n 
5  12   ASN n 
5  13   GLY n 
5  14   LEU n 
5  15   THR n 
5  16   GLY n 
5  17   LYS n 
5  18   PRO n 
5  19   VAL n 
5  20   MET n 
5  21   VAL n 
5  22   LYS n 
5  23   LEU n 
5  24   LYS n 
5  25   TRP n 
5  26   GLY n 
5  27   MET n 
5  28   GLU n 
5  29   TYR n 
5  30   LYS n 
5  31   GLY n 
5  32   TYR n 
5  33   LEU n 
5  34   VAL n 
5  35   SER n 
5  36   VAL n 
5  37   ASP n 
5  38   GLY n 
5  39   TYR n 
5  40   MET n 
5  41   ASN n 
5  42   MET n 
5  43   GLN n 
5  44   LEU n 
5  45   ALA n 
5  46   ASN n 
5  47   THR n 
5  48   GLU n 
5  49   GLU n 
5  50   TYR n 
5  51   ILE n 
5  52   ASP n 
5  53   GLY n 
5  54   ALA n 
5  55   LEU n 
5  56   SER n 
5  57   GLY n 
5  58   HIS n 
5  59   LEU n 
5  60   GLY n 
5  61   GLU n 
5  62   VAL n 
5  63   LEU n 
5  64   ILE n 
5  65   ARG n 
5  66   CYS n 
5  67   ASN n 
5  68   ASN n 
5  69   VAL n 
5  70   LEU n 
5  71   TYR n 
5  72   ILE n 
5  73   ARG n 
5  74   GLY n 
5  75   VAL n 
5  76   GLU n 
5  77   GLU n 
5  78   GLU n 
5  79   GLU n 
5  80   GLU n 
5  81   ASP n 
5  82   GLY n 
5  83   GLU n 
5  84   MET n 
5  85   ARG n 
5  86   GLU n 
6  1    MET n 
6  2    ALA n 
6  3    TYR n 
6  4    ARG n 
6  5    GLY n 
6  6    GLN n 
6  7    GLY n 
6  8    GLN n 
6  9    LYS n 
6  10   VAL n 
6  11   GLN n 
6  12   LYS n 
6  13   VAL n 
6  14   MET n 
6  15   VAL n 
6  16   GLN n 
6  17   PRO n 
6  18   ILE n 
6  19   ASN n 
6  20   LEU n 
6  21   ILE n 
6  22   PHE n 
6  23   ARG n 
6  24   TYR n 
6  25   LEU n 
6  26   GLN n 
6  27   ASN n 
6  28   ARG n 
6  29   SER n 
6  30   ARG n 
6  31   ILE n 
6  32   GLN n 
6  33   VAL n 
6  34   TRP n 
6  35   LEU n 
6  36   TYR n 
6  37   GLU n 
6  38   GLN n 
6  39   VAL n 
6  40   ASN n 
6  41   MET n 
6  42   ARG n 
6  43   ILE n 
6  44   GLU n 
6  45   GLY n 
6  46   CYS n 
6  47   ILE n 
6  48   ILE n 
6  49   GLY n 
6  50   PHE n 
6  51   ASP n 
6  52   GLU n 
6  53   TYR n 
6  54   MET n 
6  55   ASN n 
6  56   LEU n 
6  57   VAL n 
6  58   LEU n 
6  59   ASP n 
6  60   ASP n 
6  61   ALA n 
6  62   GLU n 
6  63   GLU n 
6  64   ILE n 
6  65   HIS n 
6  66   SER n 
6  67   LYS n 
6  68   THR n 
6  69   LYS n 
6  70   SER n 
6  71   ARG n 
6  72   LYS n 
6  73   GLN n 
6  74   LEU n 
6  75   GLY n 
6  76   ARG n 
6  77   ILE n 
6  78   MET n 
6  79   LEU n 
6  80   LYS n 
6  81   GLY n 
6  82   ASP n 
6  83   ASN n 
6  84   ILE n 
6  85   THR n 
6  86   LEU n 
6  87   LEU n 
6  88   GLN n 
6  89   SER n 
6  90   VAL n 
6  91   SER n 
6  92   ASN n 
7  1    MET n 
7  2    SER n 
7  3    LYS n 
7  4    ALA n 
7  5    HIS n 
7  6    PRO n 
7  7    PRO n 
7  8    GLU n 
7  9    LEU n 
7  10   LYS n 
7  11   LYS n 
7  12   PHE n 
7  13   MET n 
7  14   ASP n 
7  15   LYS n 
7  16   LYS n 
7  17   LEU n 
7  18   SER n 
7  19   LEU n 
7  20   LYS n 
7  21   LEU n 
7  22   ASN n 
7  23   GLY n 
7  24   GLY n 
7  25   ARG n 
7  26   HIS n 
7  27   VAL n 
7  28   GLN n 
7  29   GLY n 
7  30   ILE n 
7  31   LEU n 
7  32   ARG n 
7  33   GLY n 
7  34   PHE n 
7  35   ASP n 
7  36   PRO n 
7  37   PHE n 
7  38   MET n 
7  39   ASN n 
7  40   LEU n 
7  41   VAL n 
7  42   ILE n 
7  43   ASP n 
7  44   GLU n 
7  45   CYS n 
7  46   VAL n 
7  47   GLU n 
7  48   MET n 
7  49   ALA n 
7  50   THR n 
7  51   SER n 
7  52   GLY n 
7  53   GLN n 
7  54   GLN n 
7  55   ASN n 
7  56   ASN n 
7  57   ILE n 
7  58   GLY n 
7  59   MET n 
7  60   VAL n 
7  61   VAL n 
7  62   ILE n 
7  63   ARG n 
7  64   GLY n 
7  65   ASN n 
7  66   SER n 
7  67   ILE n 
7  68   ILE n 
7  69   MET n 
7  70   LEU n 
7  71   GLU n 
7  72   ALA n 
7  73   LEU n 
7  74   GLU n 
7  75   ARG n 
7  76   VAL n 
8  1    MET n 
8  2    SER n 
8  3    ILE n 
8  4    GLY n 
8  5    VAL n 
8  6    PRO n 
8  7    ILE n 
8  8    LYS n 
8  9    VAL n 
8  10   LEU n 
8  11   HIS n 
8  12   GLU n 
8  13   ALA n 
8  14   GLU n 
8  15   GLY n 
8  16   HIS n 
8  17   ILE n 
8  18   VAL n 
8  19   THR n 
8  20   CYS n 
8  21   GLU n 
8  22   THR n 
8  23   ASN n 
8  24   THR n 
8  25   GLY n 
8  26   GLU n 
8  27   VAL n 
8  28   TYR n 
8  29   ARG n 
8  30   GLY n 
8  31   LYS n 
8  32   LEU n 
8  33   ILE n 
8  34   GLU n 
8  35   ALA n 
8  36   GLU n 
8  37   ASP n 
8  38   ASN n 
8  39   MET n 
8  40   ASN n 
8  41   CYS n 
8  42   GLN n 
8  43   MET n 
8  44   SER n 
8  45   ASN n 
8  46   ILE n 
8  47   THR n 
8  48   VAL n 
8  49   THR n 
8  50   TYR n 
8  51   ARG n 
8  52   ASP n 
8  53   GLY n 
8  54   ARG n 
8  55   VAL n 
8  56   ALA n 
8  57   GLN n 
8  58   LEU n 
8  59   GLU n 
8  60   GLN n 
8  61   VAL n 
8  62   TYR n 
8  63   ILE n 
8  64   ARG n 
8  65   GLY n 
8  66   SER n 
8  67   LYS n 
8  68   ILE n 
8  69   ARG n 
8  70   PHE n 
8  71   LEU n 
8  72   ILE n 
8  73   LEU n 
8  74   PRO n 
8  75   ASP n 
8  76   MET n 
8  77   LEU n 
8  78   LYS n 
8  79   ASN n 
8  80   ALA n 
8  81   PRO n 
8  82   MET n 
8  83   LEU n 
8  84   LYS n 
8  85   SER n 
8  86   MET n 
8  87   LYS n 
8  88   ASN n 
8  89   LYS n 
8  90   ASN n 
8  91   GLN n 
8  92   GLY n 
8  93   SER n 
8  94   GLY n 
8  95   ALA n 
8  96   GLY n 
8  97   ARG n 
8  98   GLY n 
8  99   LYS n 
8  100  ALA n 
8  101  ALA n 
8  102  ILE n 
8  103  LEU n 
8  104  LYS n 
8  105  ALA n 
8  106  GLN n 
8  107  VAL n 
8  108  ALA n 
8  109  ALA n 
8  110  ARG n 
8  111  GLY n 
8  112  ARG n 
8  113  GLY n 
8  114  ARG n 
8  115  GLY n 
8  116  MET n 
8  117  GLY n 
8  118  ARG n 
8  119  GLY n 
8  120  ASN n 
8  121  ILE n 
8  122  PHE n 
8  123  GLN n 
8  124  LYS n 
8  125  ARG n 
8  126  ARG n 
9  1    MET n 
9  2    THR n 
9  3    VAL n 
9  4    GLY n 
9  5    LYS n 
9  6    SER n 
9  7    SER n 
9  8    LYS n 
9  9    MET n 
9  10   LEU n 
9  11   GLN n 
9  12   HIS n 
9  13   ILE n 
9  14   ASP n 
9  15   TYR n 
9  16   ARG n 
9  17   MET n 
9  18   ARG n 
9  19   CYS n 
9  20   ILE n 
9  21   LEU n 
9  22   GLN n 
9  23   ASP n 
9  24   GLY n 
9  25   ARG n 
9  26   ILE n 
9  27   PHE n 
9  28   ILE n 
9  29   GLY n 
9  30   THR n 
9  31   PHE n 
9  32   LYS n 
9  33   ALA n 
9  34   PHE n 
9  35   ASP n 
9  36   LYS n 
9  37   HIS n 
9  38   MET n 
9  39   ASN n 
9  40   LEU n 
9  41   ILE n 
9  42   LEU n 
9  43   CYS n 
9  44   ASP n 
9  45   CYS n 
9  46   ASP n 
9  47   GLU n 
9  48   PHE n 
9  49   ARG n 
9  50   LYS n 
9  51   ILE n 
9  52   LYS n 
9  53   PRO n 
9  54   LYS n 
9  55   ASN n 
9  56   SER n 
9  57   LYS n 
9  58   GLN n 
9  59   ALA n 
9  60   GLU n 
9  61   ARG n 
9  62   GLU n 
9  63   GLU n 
9  64   LYS n 
9  65   ARG n 
9  66   VAL n 
9  67   LEU n 
9  68   GLY n 
9  69   LEU n 
9  70   VAL n 
9  71   LEU n 
9  72   LEU n 
9  73   ARG n 
9  74   GLY n 
9  75   GLU n 
9  76   ASN n 
9  77   LEU n 
9  78   VAL n 
9  79   SER n 
9  80   MET n 
9  81   THR n 
9  82   VAL n 
9  83   GLU n 
9  84   GLY n 
9  85   PRO n 
9  86   PRO n 
9  87   PRO n 
9  88   LYS n 
9  89   ASP n 
9  90   THR n 
9  91   GLY n 
9  92   ILE n 
9  93   ALA n 
9  94   ARG n 
9  95   VAL n 
9  96   PRO n 
9  97   LEU n 
9  98   ALA n 
9  99   GLY n 
9  100  ALA n 
9  101  ALA n 
9  102  GLY n 
9  103  GLY n 
9  104  PRO n 
9  105  GLY n 
9  106  ILE n 
9  107  GLY n 
9  108  ARG n 
9  109  ALA n 
9  110  ALA n 
9  111  GLY n 
9  112  ARG n 
9  113  GLY n 
9  114  ILE n 
9  115  PRO n 
9  116  ALA n 
9  117  GLY n 
9  118  VAL n 
9  119  PRO n 
9  120  MET n 
9  121  PRO n 
9  122  GLN n 
9  123  ALA n 
9  124  PRO n 
9  125  ALA n 
9  126  GLY n 
9  127  LEU n 
9  128  ALA n 
9  129  GLY n 
9  130  PRO n 
9  131  VAL n 
9  132  ARG n 
9  133  GLY n 
9  134  VAL n 
9  135  GLY n 
9  136  GLY n 
9  137  PRO n 
9  138  SER n 
9  139  GLN n 
9  140  GLN n 
9  141  VAL n 
9  142  MET n 
9  143  THR n 
9  144  PRO n 
9  145  GLN n 
9  146  GLY n 
9  147  ARG n 
9  148  GLY n 
9  149  THR n 
9  150  VAL n 
9  151  ALA n 
9  152  ALA n 
9  153  ALA n 
9  154  ALA n 
9  155  ALA n 
9  156  ALA n 
9  157  ALA n 
9  158  THR n 
9  159  ALA n 
9  160  SER n 
9  161  ILE n 
9  162  ALA n 
9  163  GLY n 
9  164  ALA n 
9  165  PRO n 
9  166  THR n 
9  167  GLN n 
9  168  TYR n 
9  169  PRO n 
9  170  PRO n 
9  171  GLY n 
9  172  ARG n 
9  173  GLY n 
9  174  GLY n 
9  175  PRO n 
9  176  PRO n 
9  177  PRO n 
9  178  PRO n 
9  179  MET n 
9  180  GLY n 
9  181  ARG n 
9  182  GLY n 
9  183  ALA n 
9  184  PRO n 
9  185  PRO n 
9  186  PRO n 
9  187  GLY n 
9  188  MET n 
9  189  MET n 
9  190  GLY n 
9  191  PRO n 
9  192  PRO n 
9  193  PRO n 
9  194  GLY n 
9  195  MET n 
9  196  ARG n 
9  197  PRO n 
9  198  PRO n 
9  199  MET n 
9  200  GLY n 
9  201  PRO n 
9  202  PRO n 
9  203  MET n 
9  204  GLY n 
9  205  ILE n 
9  206  PRO n 
9  207  PRO n 
9  208  GLY n 
9  209  ARG n 
9  210  GLY n 
9  211  THR n 
9  212  PRO n 
9  213  MET n 
9  214  GLY n 
9  215  MET n 
9  216  PRO n 
9  217  PRO n 
9  218  PRO n 
9  219  GLY n 
9  220  MET n 
9  221  ARG n 
9  222  PRO n 
9  223  PRO n 
9  224  PRO n 
9  225  PRO n 
9  226  GLY n 
9  227  MET n 
9  228  ARG n 
9  229  GLY n 
9  230  LEU n 
9  231  LEU n 
10 1    MET n 
10 2    LYS n 
10 3    LEU n 
10 4    VAL n 
10 5    ARG n 
10 6    PHE n 
10 7    LEU n 
10 8    MET n 
10 9    LYS n 
10 10   LEU n 
10 11   SER n 
10 12   HIS n 
10 13   GLU n 
10 14   THR n 
10 15   VAL n 
10 16   THR n 
10 17   ILE n 
10 18   GLU n 
10 19   LEU n 
10 20   LYS n 
10 21   ASN n 
10 22   GLY n 
10 23   THR n 
10 24   GLN n 
10 25   VAL n 
10 26   HIS n 
10 27   GLY n 
10 28   THR n 
10 29   ILE n 
10 30   THR n 
10 31   GLY n 
10 32   VAL n 
10 33   ASP n 
10 34   VAL n 
10 35   SER n 
10 36   MET n 
10 37   ASN n 
10 38   THR n 
10 39   HIS n 
10 40   LEU n 
10 41   LYS n 
10 42   ALA n 
10 43   VAL n 
10 44   LYS n 
10 45   MET n 
10 46   THR n 
10 47   LEU n 
10 48   LYS n 
10 49   ASN n 
10 50   ARG n 
10 51   GLU n 
10 52   PRO n 
10 53   VAL n 
10 54   GLN n 
10 55   LEU n 
10 56   GLU n 
10 57   THR n 
10 58   LEU n 
10 59   SER n 
10 60   ILE n 
10 61   ARG n 
10 62   GLY n 
10 63   ASN n 
10 64   ASN n 
10 65   ILE n 
10 66   ARG n 
10 67   TYR n 
10 68   PHE n 
10 69   ILE n 
10 70   LEU n 
10 71   PRO n 
10 72   ASP n 
10 73   SER n 
10 74   LEU n 
10 75   PRO n 
10 76   LEU n 
10 77   ASP n 
10 78   THR n 
10 79   LEU n 
10 80   LEU n 
10 81   VAL n 
10 82   ASP n 
10 83   VAL n 
10 84   GLU n 
10 85   PRO n 
10 86   LYS n 
10 87   VAL n 
10 88   LYS n 
10 89   SER n 
10 90   LYS n 
10 91   LYS n 
10 92   ARG n 
10 93   GLU n 
10 94   ALA n 
10 95   VAL n 
10 96   ALA n 
10 97   GLY n 
10 98   ARG n 
10 99   GLY n 
10 100  ARG n 
10 101  GLY n 
10 102  ARG n 
10 103  GLY n 
10 104  ARG n 
10 105  GLY n 
10 106  ARG n 
10 107  GLY n 
10 108  ARG n 
10 109  GLY n 
10 110  ARG n 
10 111  GLY n 
10 112  ARG n 
10 113  GLY n 
10 114  ARG n 
10 115  GLY n 
10 116  GLY n 
10 117  PRO n 
10 118  ARG n 
10 119  ARG n 
11 1    G   n 
11 2    U   n 
11 3    G   n 
11 4    C   n 
11 5    U   n 
11 6    C   n 
11 7    G   n 
11 8    C   n 
11 9    U   n 
11 10   U   n 
11 11   C   n 
11 12   G   n 
11 13   G   n 
11 14   C   n 
11 15   A   n 
11 16   G   n 
11 17   C   n 
11 18   A   n 
11 19   C   n 
11 20   A   n 
11 21   U   n 
11 22   A   n 
11 23   U   n 
11 24   A   n 
11 25   C   n 
11 26   U   n 
11 27   A   n 
11 28   A   n 
11 29   A   n 
11 30   A   n 
11 31   U   n 
11 32   U   n 
11 33   G   n 
11 34   G   n 
11 35   A   n 
11 36   A   n 
11 37   C   n 
11 38   G   n 
11 39   A   n 
11 40   U   n 
11 41   A   n 
11 42   C   n 
11 43   A   n 
11 44   G   n 
11 45   A   n 
11 46   G   n 
11 47   A   n 
11 48   A   n 
11 49   G   n 
11 50   A   n 
11 51   U   n 
11 52   U   n 
11 53   A   n 
11 54   G   n 
11 55   C   n 
11 56   A   n 
11 57   U   n 
11 58   G   n 
11 59   G   n 
11 60   C   n 
11 61   C   n 
11 62   C   n 
11 63   C   n 
11 64   U   n 
11 65   G   n 
11 66   C   n 
11 67   G   n 
11 68   C   n 
11 69   A   n 
11 70   A   n 
11 71   G   n 
11 72   G   n 
11 73   A   n 
11 74   U   n 
11 75   G   n 
11 76   A   n 
11 77   C   n 
11 78   A   n 
11 79   C   n 
11 80   G   n 
11 81   C   n 
11 82   A   n 
11 83   A   n 
11 84   A   n 
11 85   U   n 
11 86   U   n 
11 87   C   n 
11 88   G   n 
11 89   U   n 
11 90   G   n 
11 91   A   n 
11 92   A   n 
11 93   G   n 
11 94   C   n 
11 95   G   n 
11 96   U   n 
11 97   U   n 
11 98   C   n 
11 99   C   n 
11 100  A   n 
11 101  U   n 
11 102  A   n 
11 103  U   n 
11 104  U   n 
11 105  U   n 
11 106  U   n 
11 107  U   n 
12 1    MET n 
12 2    LEU n 
12 3    PHE n 
12 4    TYR n 
12 5    SER n 
12 6    PHE n 
12 7    PHE n 
12 8    LYS n 
12 9    SER n 
12 10   LEU n 
12 11   VAL n 
12 12   GLY n 
12 13   LYS n 
12 14   ASP n 
12 15   VAL n 
12 16   VAL n 
12 17   VAL n 
12 18   GLU n 
12 19   LEU n 
12 20   LYS n 
12 21   ASN n 
12 22   ASP n 
12 23   LEU n 
12 24   SER n 
12 25   ILE n 
12 26   CYS n 
12 27   GLY n 
12 28   THR n 
12 29   LEU n 
12 30   HIS n 
12 31   SER n 
12 32   VAL n 
12 33   ASP n 
12 34   GLN n 
12 35   TYR n 
12 36   LEU n 
12 37   ASN n 
12 38   ILE n 
12 39   LYS n 
12 40   LEU n 
12 41   THR n 
12 42   ASP n 
12 43   ILE n 
12 44   SER n 
12 45   VAL n 
12 46   THR n 
12 47   ASP n 
12 48   PRO n 
12 49   GLU n 
12 50   LYS n 
12 51   TYR n 
12 52   PRO n 
12 53   HIS n 
12 54   MET n 
12 55   LEU n 
12 56   SER n 
12 57   VAL n 
12 58   LYS n 
12 59   ASN n 
12 60   CYS n 
12 61   PHE n 
12 62   ILE n 
12 63   ARG n 
12 64   GLY n 
12 65   SER n 
12 66   VAL n 
12 67   VAL n 
12 68   ARG n 
12 69   TYR n 
12 70   VAL n 
12 71   GLN n 
12 72   LEU n 
12 73   PRO n 
12 74   ALA n 
12 75   ASP n 
12 76   GLU n 
12 77   VAL n 
12 78   ASP n 
12 79   THR n 
12 80   GLN n 
12 81   LEU n 
12 82   LEU n 
12 83   GLN n 
12 84   ASP n 
12 85   ALA n 
12 86   ALA n 
12 87   ARG n 
12 88   LYS n 
12 89   GLU n 
12 90   ALA n 
12 91   LEU n 
12 92   GLN n 
12 93   GLN n 
12 94   LYS n 
12 95   GLN n 
13 1    MET n 
13 2    ALA n 
13 3    ASP n 
13 4    ASP n 
13 5    VAL n 
13 6    ASP n 
13 7    GLN n 
13 8    GLN n 
13 9    GLN n 
13 10   THR n 
13 11   THR n 
13 12   ASN n 
13 13   THR n 
13 14   VAL n 
13 15   GLU n 
13 16   GLU n 
13 17   PRO n 
13 18   LEU n 
13 19   ASP n 
13 20   LEU n 
13 21   ILE n 
13 22   ARG n 
13 23   LEU n 
13 24   SER n 
13 25   LEU n 
13 26   ASP n 
13 27   GLU n 
13 28   ARG n 
13 29   ILE n 
13 30   TYR n 
13 31   VAL n 
13 32   LYS n 
13 33   MET n 
13 34   ARG n 
13 35   ASN n 
13 36   ASP n 
13 37   ARG n 
13 38   GLU n 
13 39   LEU n 
13 40   ARG n 
13 41   GLY n 
13 42   ARG n 
13 43   LEU n 
13 44   HIS n 
13 45   ALA n 
13 46   TYR n 
13 47   ASP n 
13 48   GLN n 
13 49   HIS n 
13 50   LEU n 
13 51   ASN n 
13 52   MET n 
13 53   ILE n 
13 54   LEU n 
13 55   GLY n 
13 56   ASP n 
13 57   VAL n 
13 58   GLU n 
13 59   GLU n 
13 60   THR n 
13 61   VAL n 
13 62   THR n 
13 63   THR n 
13 64   ILE n 
13 65   GLU n 
13 66   ILE n 
13 67   ASP n 
13 68   GLU n 
13 69   GLU n 
13 70   THR n 
13 71   TYR n 
13 72   GLU n 
13 73   GLU n 
13 74   ILE n 
13 75   TYR n 
13 76   LYS n 
13 77   SER n 
13 78   THR n 
13 79   LYS n 
13 80   ARG n 
13 81   ASN n 
13 82   ILE n 
13 83   PRO n 
13 84   MET n 
13 85   LEU n 
13 86   PHE n 
13 87   VAL n 
13 88   ARG n 
13 89   GLY n 
13 90   ASP n 
13 91   GLY n 
13 92   VAL n 
13 93   VAL n 
13 94   LEU n 
13 95   VAL n 
13 96   ALA n 
13 97   PRO n 
13 98   PRO n 
13 99   LEU n 
13 100  ARG n 
13 101  VAL n 
13 102  GLY n 
14 1    MET n 
14 2    LEU n 
14 3    PRO n 
14 4    LEU n 
14 5    SER n 
14 6    LEU n 
14 7    LEU n 
14 8    LYS n 
14 9    THR n 
14 10   ALA n 
14 11   GLN n 
14 12   ASN n 
14 13   HIS n 
14 14   PRO n 
14 15   MET n 
14 16   LEU n 
14 17   VAL n 
14 18   GLU n 
14 19   LEU n 
14 20   LYS n 
14 21   ASN n 
14 22   GLY n 
14 23   GLU n 
14 24   THR n 
14 25   TYR n 
14 26   ASN n 
14 27   GLY n 
14 28   HIS n 
14 29   LEU n 
14 30   VAL n 
14 31   SER n 
14 32   CYS n 
14 33   ASP n 
14 34   ASN n 
14 35   TRP n 
14 36   MET n 
14 37   ASN n 
14 38   ILE n 
14 39   ASN n 
14 40   LEU n 
14 41   ARG n 
14 42   GLU n 
14 43   VAL n 
14 44   ILE n 
14 45   CYS n 
14 46   THR n 
14 47   SER n 
14 48   ARG n 
14 49   ASP n 
14 50   GLY n 
14 51   ASP n 
14 52   LYS n 
14 53   PHE n 
14 54   TRP n 
14 55   ARG n 
14 56   MET n 
14 57   PRO n 
14 58   GLU n 
14 59   CYS n 
14 60   TYR n 
14 61   ILE n 
14 62   ARG n 
14 63   GLY n 
14 64   SER n 
14 65   THR n 
14 66   ILE n 
14 67   LYS n 
14 68   TYR n 
14 69   LEU n 
14 70   ARG n 
14 71   ILE n 
14 72   PRO n 
14 73   ASP n 
14 74   GLU n 
14 75   ILE n 
14 76   ILE n 
14 77   ASP n 
14 78   MET n 
14 79   VAL n 
14 80   LYS n 
14 81   GLU n 
14 82   GLU n 
14 83   VAL n 
14 84   VAL n 
14 85   ALA n 
14 86   LYS n 
14 87   GLY n 
14 88   ARG n 
14 89   GLY n 
14 90   ARG n 
14 91   GLY n 
14 92   GLY n 
14 93   LEU n 
14 94   GLN n 
14 95   GLN n 
14 96   GLN n 
14 97   LYS n 
14 98   GLN n 
14 99   GLN n 
14 100  LYS n 
14 101  GLY n 
14 102  ARG n 
14 103  GLY n 
14 104  MET n 
14 105  GLY n 
14 106  GLY n 
14 107  ALA n 
14 108  GLY n 
14 109  ARG n 
14 110  GLY n 
14 111  VAL n 
14 112  PHE n 
14 113  GLY n 
14 114  GLY n 
14 115  ARG n 
14 116  GLY n 
14 117  ARG n 
14 118  GLY n 
14 119  GLY n 
14 120  ILE n 
14 121  PRO n 
14 122  GLY n 
14 123  THR n 
14 124  GLY n 
14 125  ARG n 
14 126  GLY n 
14 127  GLN n 
14 128  PRO n 
14 129  GLU n 
14 130  LYS n 
14 131  LYS n 
14 132  PRO n 
14 133  GLY n 
14 134  ARG n 
14 135  GLN n 
14 136  ALA n 
14 137  GLY n 
14 138  LYS n 
14 139  GLN n 
15 1    MET n 
15 2    ALA n 
15 3    ALA n 
15 4    ASN n 
15 5    ALA n 
15 6    THR n 
15 7    THR n 
15 8    ASN n 
15 9    PRO n 
15 10   SER n 
15 11   GLN n 
15 12   LEU n 
15 13   LEU n 
15 14   PRO n 
15 15   LEU n 
15 16   GLU n 
15 17   LEU n 
15 18   VAL n 
15 19   ASP n 
15 20   LYS n 
15 21   CYS n 
15 22   ILE n 
15 23   GLY n 
15 24   SER n 
15 25   ARG n 
15 26   ILE n 
15 27   HIS n 
15 28   ILE n 
15 29   VAL n 
15 30   MET n 
15 31   LYS n 
15 32   SER n 
15 33   ASP n 
15 34   LYS n 
15 35   GLU n 
15 36   ILE n 
15 37   VAL n 
15 38   GLY n 
15 39   THR n 
15 40   LEU n 
15 41   LEU n 
15 42   GLY n 
15 43   PHE n 
15 44   ASP n 
15 45   ASP n 
15 46   PHE n 
15 47   VAL n 
15 48   ASN n 
15 49   MET n 
15 50   VAL n 
15 51   LEU n 
15 52   GLU n 
15 53   ASP n 
15 54   VAL n 
15 55   THR n 
15 56   GLU n 
15 57   PHE n 
15 58   GLU n 
15 59   ILE n 
15 60   THR n 
15 61   PRO n 
15 62   GLU n 
15 63   GLY n 
15 64   ARG n 
15 65   ARG n 
15 66   ILE n 
15 67   THR n 
15 68   LYS n 
15 69   LEU n 
15 70   ASP n 
15 71   GLN n 
15 72   ILE n 
15 73   LEU n 
15 74   LEU n 
15 75   ASN n 
15 76   GLY n 
15 77   ASN n 
15 78   ASN n 
15 79   ILE n 
15 80   THR n 
15 81   MET n 
15 82   LEU n 
15 83   VAL n 
15 84   PRO n 
15 85   GLY n 
15 86   GLY n 
15 87   GLU n 
15 88   GLY n 
15 89   PRO n 
15 90   GLU n 
15 91   VAL n 
16 1    MET n 
16 2    SER n 
16 3    LEU n 
16 4    ARG n 
16 5    LYS n 
16 6    GLN n 
16 7    THR n 
16 8    PRO n 
16 9    SER n 
16 10   ASP n 
16 11   PHE n 
16 12   LEU n 
16 13   LYS n 
16 14   GLN n 
16 15   ILE n 
16 16   ILE n 
16 17   GLY n 
16 18   ARG n 
16 19   PRO n 
16 20   VAL n 
16 21   VAL n 
16 22   VAL n 
16 23   LYS n 
16 24   LEU n 
16 25   ASN n 
16 26   SER n 
16 27   GLY n 
16 28   VAL n 
16 29   ASP n 
16 30   TYR n 
16 31   ARG n 
16 32   GLY n 
16 33   VAL n 
16 34   LEU n 
16 35   ALA n 
16 36   CYS n 
16 37   LEU n 
16 38   ASP n 
16 39   GLY n 
16 40   TYR n 
16 41   MET n 
16 42   ASN n 
16 43   ILE n 
16 44   ALA n 
16 45   LEU n 
16 46   GLU n 
16 47   GLN n 
16 48   THR n 
16 49   GLU n 
16 50   GLU n 
16 51   TYR n 
16 52   VAL n 
16 53   ASN n 
16 54   GLY n 
16 55   GLN n 
16 56   LEU n 
16 57   LYS n 
16 58   ASN n 
16 59   LYS n 
16 60   TYR n 
16 61   GLY n 
16 62   ASP n 
16 63   ALA n 
16 64   PHE n 
16 65   ILE n 
16 66   ARG n 
16 67   GLY n 
16 68   ASN n 
16 69   ASN n 
16 70   VAL n 
16 71   LEU n 
16 72   TYR n 
16 73   ILE n 
16 74   SER n 
16 75   THR n 
16 76   GLN n 
16 77   LYS n 
16 78   ARG n 
16 79   ARG n 
16 80   MET n 
17 1    MET n 
17 2    ALA n 
17 3    ASP n 
17 4    LYS n 
17 5    GLU n 
17 6    LYS n 
17 7    LYS n 
17 8    LYS n 
17 9    LYS n 
17 10   GLU n 
17 11   SER n 
17 12   ILE n 
17 13   LEU n 
17 14   ASP n 
17 15   LEU n 
17 16   SER n 
17 17   LYS n 
17 18   TYR n 
17 19   ILE n 
17 20   ASP n 
17 21   LYS n 
17 22   THR n 
17 23   ILE n 
17 24   ARG n 
17 25   VAL n 
17 26   LYS n 
17 27   PHE n 
17 28   GLN n 
17 29   GLY n 
17 30   GLY n 
17 31   ARG n 
17 32   GLU n 
17 33   ALA n 
17 34   SER n 
17 35   GLY n 
17 36   ILE n 
17 37   LEU n 
17 38   LYS n 
17 39   GLY n 
17 40   PHE n 
17 41   ASP n 
17 42   PRO n 
17 43   LEU n 
17 44   LEU n 
17 45   ASN n 
17 46   LEU n 
17 47   VAL n 
17 48   LEU n 
17 49   ASP n 
17 50   GLY n 
17 51   THR n 
17 52   ILE n 
17 53   GLU n 
17 54   TYR n 
17 55   MET n 
17 56   ARG n 
17 57   ASP n 
17 58   PRO n 
17 59   ASP n 
17 60   ASP n 
17 61   GLN n 
17 62   TYR n 
17 63   LYS n 
17 64   LEU n 
17 65   THR n 
17 66   GLU n 
17 67   ASP n 
17 68   THR n 
17 69   ARG n 
17 70   GLN n 
17 71   LEU n 
17 72   GLY n 
17 73   LEU n 
17 74   VAL n 
17 75   VAL n 
17 76   CYS n 
17 77   ARG n 
17 78   GLY n 
17 79   THR n 
17 80   SER n 
17 81   VAL n 
17 82   VAL n 
17 83   LEU n 
17 84   ILE n 
17 85   CYS n 
17 86   PRO n 
17 87   GLN n 
17 88   ASP n 
17 89   GLY n 
17 90   MET n 
17 91   GLU n 
17 92   ALA n 
17 93   ILE n 
17 94   PRO n 
17 95   ASN n 
17 96   PRO n 
17 97   PHE n 
17 98   ILE n 
17 99   GLN n 
17 100  GLN n 
17 101  GLN n 
17 102  ASP n 
17 103  ALA n 
18 1    MET n 
18 2    THR n 
18 3    SER n 
18 4    ALA n 
18 5    LEU n 
18 6    GLU n 
18 7    ASN n 
18 8    TYR n 
18 9    ILE n 
18 10   ASN n 
18 11   ARG n 
18 12   THR n 
18 13   VAL n 
18 14   ALA n 
18 15   VAL n 
18 16   ILE n 
18 17   THR n 
18 18   SER n 
18 19   ASP n 
18 20   GLY n 
18 21   ARG n 
18 22   MET n 
18 23   ILE n 
18 24   VAL n 
18 25   GLY n 
18 26   THR n 
18 27   LEU n 
18 28   LYS n 
18 29   GLY n 
18 30   PHE n 
18 31   ASP n 
18 32   GLN n 
18 33   THR n 
18 34   ILE n 
18 35   ASN n 
18 36   LEU n 
18 37   ILE n 
18 38   LEU n 
18 39   ASP n 
18 40   GLU n 
18 41   SER n 
18 42   HIS n 
18 43   GLU n 
18 44   ARG n 
18 45   VAL n 
18 46   PHE n 
18 47   SER n 
18 48   SER n 
18 49   SER n 
18 50   GLN n 
18 51   GLY n 
18 52   VAL n 
18 53   GLU n 
18 54   GLN n 
18 55   VAL n 
18 56   VAL n 
18 57   LEU n 
18 58   GLY n 
18 59   LEU n 
18 60   TYR n 
18 61   ILE n 
18 62   VAL n 
18 63   ARG n 
18 64   GLY n 
18 65   ASP n 
18 66   ASN n 
18 67   VAL n 
18 68   ALA n 
18 69   VAL n 
18 70   ILE n 
18 71   GLY n 
18 72   GLU n 
18 73   ILE n 
18 74   ASP n 
18 75   GLU n 
18 76   GLU n 
18 77   THR n 
18 78   ASP n 
18 79   SER n 
18 80   ALA n 
18 81   LEU n 
18 82   ASP n 
18 83   LEU n 
18 84   GLY n 
18 85   ASN n 
18 86   ILE n 
18 87   ARG n 
18 88   ALA n 
18 89   GLU n 
18 90   PRO n 
18 91   LEU n 
18 92   ASN n 
18 93   SER n 
18 94   VAL n 
18 95   ALA n 
18 96   HIS n 
19 1    G   n 
19 2    G   n 
19 3    G   n 
19 4    A   n 
19 5    A   n 
19 6    U   n 
19 7    A   n 
19 8    C   n 
19 9    A   n 
19 10   C   n 
19 11   G   n 
19 12   G   n 
19 13   A   n 
19 14   A   n 
19 15   U   n 
19 16   U   n 
19 17   C   n 
19 18   G   n 
19 19   A   n 
19 20   G   n 
19 21   C   n 
19 22   U   n 
19 23   C   n 
19 24   G   n 
19 25   C   n 
19 26   C   n 
19 27   C   n 
19 28   A   n 
19 29   C   n 
19 30   U   n 
19 31   C   n 
19 32   U   n 
19 33   U   n 
19 34   G   n 
19 35   G   n 
19 36   A   n 
19 37   U   n 
19 38   C   n 
19 39   G   n 
19 40   G   n 
19 41   A   n 
19 42   A   n 
19 43   A   n 
19 44   C   n 
19 45   C   n 
19 46   C   n 
19 47   G   n 
19 48   U   n 
19 49   C   n 
19 50   G   n 
19 51   G   n 
19 52   C   n 
19 53   C   n 
19 54   U   n 
19 55   C   n 
19 56   C   n 
19 57   G   n 
19 58   A   n 
19 59   A   n 
19 60   C   n 
19 61   G   n 
19 62   G   n 
19 63   U   n 
19 64   A   n 
19 65   A   n 
19 66   G   n 
19 67   A   n 
19 68   G   n 
19 69   C   n 
19 70   C   n 
19 71   U   n 
19 72   A   n 
19 73   G   n 
19 74   C   n 
19 75   A   n 
19 76   U   n 
19 77   G   n 
19 78   U   n 
19 79   A   n 
19 80   G   n 
19 81   A   n 
19 82   A   n 
19 83   C   n 
19 84   U   n 
19 85   G   n 
19 86   G   n 
19 87   U   n 
19 88   U   n 
19 89   A   n 
19 90   C   n 
19 91   C   n 
19 92   U   n 
19 93   G   n 
19 94   C   n 
19 95   A   n 
19 96   G   n 
19 97   C   n 
19 98   C   n 
19 99   C   n 
19 100  A   n 
19 101  A   n 
19 102  G   n 
19 103  C   n 
19 104  U   n 
19 105  U   n 
19 106  G   n 
19 107  C   n 
19 108  G   n 
19 109  U   n 
19 110  A   n 
19 111  C   n 
19 112  A   n 
19 113  C   n 
19 114  C   n 
19 115  A   n 
19 116  U   n 
19 117  C   n 
19 118  A   n 
19 119  G   n 
19 120  G   n 
19 121  G   n 
19 122  U   n 
19 123  A   n 
19 124  C   n 
19 125  G   n 
19 126  U   n 
19 127  A   n 
19 128  C   n 
19 129  U   n 
19 130  A   n 
19 131  G   n 
19 132  U   n 
19 133  A   n 
19 134  C   n 
19 135  G   n 
19 136  U   n 
19 137  A   n 
19 138  C   n 
19 139  A   n 
19 140  C   n 
19 141  C   n 
19 142  A   n 
19 143  U   n 
19 144  C   n 
19 145  A   n 
19 146  G   n 
19 147  G   n 
19 148  G   n 
19 149  U   n 
19 150  A   n 
19 151  C   n 
19 152  G   n 
19 153  G   n 
19 154  C   n 
19 155  U   n 
19 156  G   n 
19 157  C   n 
19 158  A   n 
19 159  C   n 
19 160  G   n 
19 161  U   n 
19 162  C   n 
19 163  U   n 
19 164  A   n 
19 165  G   n 
19 166  G   n 
19 167  G   n 
19 168  C   n 
19 169  G   n 
19 170  C   n 
19 171  A   n 
19 172  G   n 
19 173  U   n 
19 174  A   n 
19 175  G   n 
19 176  U   n 
19 177  C   n 
19 178  C   n 
19 179  A   n 
19 180  G   n 
19 181  G   n 
19 182  G   n 
19 183  U   n 
19 184  U   n 
19 185  U   n 
19 186  C   n 
19 187  C   n 
19 188  U   n 
19 189  U   n 
19 190  G   n 
19 191  A   n 
19 192  U   n 
19 193  G   n 
19 194  A   n 
19 195  U   n 
19 196  G   n 
19 197  U   n 
19 198  C   n 
19 199  A   n 
19 200  U   n 
19 201  A   n 
19 202  C   n 
19 203  U   n 
19 204  U   n 
19 205  A   n 
19 206  U   n 
19 207  C   n 
19 208  C   n 
19 209  U   n 
19 210  G   n 
19 211  U   n 
19 212  C   n 
19 213  C   n 
19 214  C   n 
19 215  U   n 
19 216  U   n 
19 217  U   n 
19 218  U   n 
19 219  U   n 
19 220  U   n 
19 221  U   n 
19 222  U   n 
19 223  C   n 
19 224  C   n 
19 225  A   n 
19 226  C   n 
19 227  G   n 
19 228  G   n 
19 229  C   n 
19 230  U   n 
19 231  C   n 
19 232  G   n 
19 233  C   n 
19 234  G   n 
19 235  G   n 
19 236  U   n 
19 237  U   n 
19 238  G   n 
19 239  A   n 
19 240  G   n 
19 241  G   n 
19 242  A   n 
19 243  C   n 
19 244  A   n 
19 245  A   n 
19 246  A   n 
19 247  C   n 
19 248  U   n 
19 249  C   n 
19 250  U   n 
19 251  U   n 
19 252  C   n 
19 253  G   n 
19 254  C   n 
19 255  G   n 
19 256  G   n 
19 257  U   n 
19 258  C   n 
19 259  U   n 
19 260  U   n 
19 261  U   n 
19 262  C   n 
19 263  C   n 
19 264  A   n 
19 265  G   n 
19 266  U   n 
19 267  G   n 
19 268  G   n 
19 269  G   n 
19 270  G   n 
19 271  A   n 
19 272  U   n 
19 273  C   n 
19 274  C   n 
20 1    A   n 
20 2    U   n 
20 3    C   n 
20 4    G   n 
20 5    C   n 
20 6    U   n 
20 7    U   n 
20 8    C   n 
20 9    U   n 
20 10   C   n 
20 11   G   n 
20 12   G   n 
20 13   C   n 
20 14   C   n 
20 15   U   n 
20 16   U   n 
20 17   U   n 
20 18   U   n 
20 19   G   n 
20 20   G   n 
20 21   C   n 
20 22   U   n 
20 23   A   n 
20 24   A   n 
20 25   G   n 
20 26   A   n 
20 27   U   n 
20 28   C   n 
20 29   A   n 
20 30   A   n 
20 31   G   n 
20 32   U   n 
20 33   G   n 
20 34   U   n 
20 35   A   n 
20 36   G   n 
20 37   U   n 
20 38   A   n 
20 39   U   n 
20 40   C   n 
20 41   U   n 
20 42   G   n 
20 43   U   n 
20 44   U   n 
20 45   C   n 
20 46   U   n 
20 47   U   n 
20 48   A   n 
20 49   U   n 
20 50   C   n 
20 51   A   n 
20 52   G   n 
20 53   U   n 
20 54   U   n 
20 55   U   n 
20 56   A   n 
20 57   A   n 
20 58   U   n 
20 59   A   n 
20 60   U   n 
20 61   C   n 
20 62   U   n 
20 63   G   n 
20 64   A   n 
20 65   U   n 
20 66   A   n 
20 67   C   n 
20 68   G   n 
20 69   U   n 
20 70   C   n 
20 71   C   n 
20 72   U   n 
20 73   C   n 
20 74   U   n 
20 75   A   n 
20 76   U   n 
20 77   C   n 
20 78   C   n 
20 79   G   n 
20 80   A   n 
20 81   G   n 
20 82   G   n 
20 83   A   n 
20 84   C   n 
20 85   A   n 
20 86   A   n 
20 87   U   n 
20 88   A   n 
20 89   U   n 
20 90   A   n 
20 91   U   n 
20 92   U   n 
20 93   A   n 
20 94   A   n 
20 95   A   n 
20 96   U   n 
20 97   G   n 
20 98   G   n 
20 99   A   n 
20 100  U   n 
20 101  U   n 
20 102  U   n 
20 103  U   n 
20 104  U   n 
20 105  G   n 
20 106  G   n 
20 107  A   n 
20 108  G   n 
20 109  C   n 
20 110  A   n 
20 111  G   n 
20 112  G   n 
20 113  G   n 
20 114  A   n 
20 115  G   n 
20 116  A   n 
20 117  U   n 
20 118  G   n 
20 119  G   n 
20 120  A   n 
20 121  A   n 
20 122  U   n 
20 123  A   n 
20 124  G   n 
20 125  G   n 
20 126  A   n 
20 127  G   n 
20 128  C   n 
20 129  U   n 
20 130  U   n 
20 131  G   n 
20 132  C   n 
20 133  U   n 
20 134  C   n 
20 135  C   n 
20 136  G   n 
20 137  U   n 
20 138  C   n 
20 139  C   n 
20 140  A   n 
20 141  C   n 
20 142  U   n 
20 143  C   n 
20 144  C   n 
20 145  A   n 
20 146  C   n 
20 147  G   n 
20 148  C   n 
20 149  A   n 
20 150  U   n 
20 151  C   n 
20 152  G   n 
20 153  A   n 
20 154  C   n 
20 155  C   n 
20 156  U   n 
20 157  G   n 
20 158  G   n 
20 159  U   n 
20 160  A   n 
20 161  U   n 
20 162  U   n 
20 163  G   n 
20 164  C   n 
20 165  A   n 
20 166  G   n 
20 167  U   n 
20 168  A   n 
20 169  C   n 
20 170  C   n 
20 171  U   n 
20 172  C   n 
20 173  C   n 
20 174  A   n 
20 175  G   n 
20 176  G   n 
20 177  A   n 
20 178  A   n 
20 179  C   n 
20 180  G   n 
20 181  G   n 
20 182  U   n 
20 183  G   n 
20 184  C   n 
20 185  A   n 
20 186  C   n 
20 187  C   n 
20 188  C   n 
21 1    MET n 
21 2    VAL n 
21 3    LYS n 
21 4    LEU n 
21 5    THR n 
21 6    ALA n 
21 7    GLU n 
21 8    LEU n 
21 9    ILE n 
21 10   GLU n 
21 11   GLN n 
21 12   ALA n 
21 13   ALA n 
21 14   GLN n 
21 15   TYR n 
21 16   THR n 
21 17   ASN n 
21 18   ALA n 
21 19   VAL n 
21 20   ARG n 
21 21   ASP n 
21 22   ARG n 
21 23   GLU n 
21 24   LEU n 
21 25   ASP n 
21 26   LEU n 
21 27   ARG n 
21 28   GLY n 
21 29   TYR n 
21 30   LYS n 
21 31   ILE n 
21 32   PRO n 
21 33   VAL n 
21 34   ILE n 
21 35   GLU n 
21 36   ASN n 
21 37   LEU n 
21 38   GLY n 
21 39   ALA n 
21 40   THR n 
21 41   LEU n 
21 42   ASP n 
21 43   GLN n 
21 44   PHE n 
21 45   ASP n 
21 46   ALA n 
21 47   ILE n 
21 48   ASP n 
21 49   PHE n 
21 50   SER n 
21 51   ASP n 
21 52   ASN n 
21 53   GLU n 
21 54   ILE n 
21 55   ARG n 
21 56   LYS n 
21 57   LEU n 
21 58   ASP n 
21 59   GLY n 
21 60   PHE n 
21 61   PRO n 
21 62   LEU n 
21 63   LEU n 
21 64   ARG n 
21 65   ARG n 
21 66   LEU n 
21 67   LYS n 
21 68   THR n 
21 69   LEU n 
21 70   LEU n 
21 71   VAL n 
21 72   ASN n 
21 73   ASN n 
21 74   ASN n 
21 75   ARG n 
21 76   ILE n 
21 77   CYS n 
21 78   ARG n 
21 79   ILE n 
21 80   GLY n 
21 81   GLU n 
21 82   GLY n 
21 83   LEU n 
21 84   ASP n 
21 85   GLN n 
21 86   ALA n 
21 87   LEU n 
21 88   PRO n 
21 89   CYS n 
21 90   LEU n 
21 91   THR n 
21 92   GLU n 
21 93   LEU n 
21 94   ILE n 
21 95   LEU n 
21 96   THR n 
21 97   ASN n 
21 98   ASN n 
21 99   SER n 
21 100  LEU n 
21 101  VAL n 
21 102  GLU n 
21 103  LEU n 
21 104  GLY n 
21 105  ASP n 
21 106  LEU n 
21 107  ASP n 
21 108  PRO n 
21 109  LEU n 
21 110  ALA n 
21 111  SER n 
21 112  LEU n 
21 113  LYS n 
21 114  SER n 
21 115  LEU n 
21 116  THR n 
21 117  TYR n 
21 118  LEU n 
21 119  SER n 
21 120  ILE n 
21 121  LEU n 
21 122  ARG n 
21 123  ASN n 
21 124  PRO n 
21 125  VAL n 
21 126  THR n 
21 127  ASN n 
21 128  LYS n 
21 129  LYS n 
21 130  HIS n 
21 131  TYR n 
21 132  ARG n 
21 133  LEU n 
21 134  TYR n 
21 135  VAL n 
21 136  ILE n 
21 137  TYR n 
21 138  LYS n 
21 139  VAL n 
21 140  PRO n 
21 141  GLN n 
21 142  VAL n 
21 143  ARG n 
21 144  VAL n 
21 145  LEU n 
21 146  ASP n 
21 147  PHE n 
21 148  GLN n 
21 149  LYS n 
21 150  VAL n 
21 151  LYS n 
21 152  LEU n 
21 153  LYS n 
21 154  GLU n 
21 155  ARG n 
21 156  GLN n 
21 157  GLU n 
21 158  ALA n 
21 159  GLU n 
21 160  LYS n 
21 161  MET n 
21 162  PHE n 
21 163  LYS n 
21 164  GLY n 
21 165  LYS n 
21 166  ARG n 
21 167  GLY n 
21 168  ALA n 
21 169  GLN n 
21 170  LEU n 
21 171  ALA n 
21 172  LYS n 
21 173  ASP n 
21 174  ILE n 
21 175  ALA n 
21 176  ARG n 
21 177  ARG n 
21 178  SER n 
21 179  LYS n 
21 180  THR n 
21 181  PHE n 
21 182  ASN n 
21 183  PRO n 
21 184  GLY n 
21 185  ALA n 
21 186  GLY n 
21 187  LEU n 
21 188  PRO n 
21 189  THR n 
21 190  ASP n 
21 191  LYS n 
21 192  LYS n 
21 193  LYS n 
21 194  GLY n 
21 195  GLY n 
21 196  PRO n 
21 197  SER n 
21 198  PRO n 
21 199  GLY n 
21 200  ASP n 
21 201  VAL n 
21 202  GLU n 
21 203  ALA n 
21 204  ILE n 
21 205  LYS n 
21 206  ASN n 
21 207  ALA n 
21 208  ILE n 
21 209  ALA n 
21 210  ASN n 
21 211  ALA n 
21 212  SER n 
21 213  THR n 
21 214  LEU n 
21 215  ALA n 
21 216  GLU n 
21 217  VAL n 
21 218  GLU n 
21 219  ARG n 
21 220  LEU n 
21 221  LYS n 
21 222  GLY n 
21 223  LEU n 
21 224  LEU n 
21 225  GLN n 
21 226  SER n 
21 227  GLY n 
21 228  GLN n 
21 229  ILE n 
21 230  PRO n 
21 231  GLY n 
21 232  ARG n 
21 233  GLU n 
21 234  ARG n 
21 235  ARG n 
21 236  SER n 
21 237  GLY n 
21 238  PRO n 
21 239  THR n 
21 240  ASP n 
21 241  ASP n 
21 242  GLY n 
21 243  GLU n 
21 244  GLU n 
21 245  GLU n 
21 246  MET n 
21 247  GLU n 
21 248  GLU n 
21 249  ASP n 
21 250  THR n 
21 251  VAL n 
21 252  THR n 
21 253  ASN n 
21 254  GLY n 
21 255  SER n 
22 1    MET n 
22 2    ASP n 
22 3    ILE n 
22 4    ARG n 
22 5    PRO n 
22 6    ASN n 
22 7    HIS n 
22 8    THR n 
22 9    ILE n 
22 10   TYR n 
22 11   ILE n 
22 12   ASN n 
22 13   ASN n 
22 14   MET n 
22 15   ASN n 
22 16   ASP n 
22 17   LYS n 
22 18   ILE n 
22 19   LYS n 
22 20   LYS n 
22 21   GLU n 
22 22   GLU n 
22 23   LEU n 
22 24   LYS n 
22 25   ARG n 
22 26   SER n 
22 27   LEU n 
22 28   TYR n 
22 29   ALA n 
22 30   LEU n 
22 31   PHE n 
22 32   SER n 
22 33   GLN n 
22 34   PHE n 
22 35   GLY n 
22 36   HIS n 
22 37   VAL n 
22 38   VAL n 
22 39   ASP n 
22 40   ILE n 
22 41   VAL n 
22 42   ALA n 
22 43   LEU n 
22 44   LYS n 
22 45   THR n 
22 46   MET n 
22 47   LYS n 
22 48   MET n 
22 49   ARG n 
22 50   GLY n 
22 51   GLN n 
22 52   ALA n 
22 53   PHE n 
22 54   VAL n 
22 55   ILE n 
22 56   PHE n 
22 57   LYS n 
22 58   GLU n 
22 59   LEU n 
22 60   GLY n 
22 61   SER n 
22 62   SER n 
22 63   THR n 
22 64   ASN n 
22 65   ALA n 
22 66   LEU n 
22 67   ARG n 
22 68   GLN n 
22 69   LEU n 
22 70   GLN n 
22 71   GLY n 
22 72   PHE n 
22 73   PRO n 
22 74   PHE n 
22 75   TYR n 
22 76   GLY n 
22 77   LYS n 
22 78   PRO n 
22 79   MET n 
22 80   ARG n 
22 81   ILE n 
22 82   GLN n 
22 83   TYR n 
22 84   ALA n 
22 85   LYS n 
22 86   THR n 
22 87   ASP n 
22 88   SER n 
22 89   ASP n 
22 90   ILE n 
22 91   ILE n 
22 92   SER n 
22 93   LYS n 
22 94   MET n 
22 95   ARG n 
22 96   GLY n 
22 97   THR n 
22 98   PHE n 
22 99   ALA n 
22 100  ASP n 
22 101  LYS n 
22 102  GLU n 
22 103  LYS n 
22 104  LYS n 
22 105  LYS n 
22 106  GLU n 
22 107  LYS n 
22 108  LYS n 
22 109  LYS n 
22 110  ALA n 
22 111  LYS n 
22 112  THR n 
22 113  VAL n 
22 114  GLU n 
22 115  GLN n 
22 116  THR n 
22 117  ALA n 
22 118  THR n 
22 119  THR n 
22 120  THR n 
22 121  ASN n 
22 122  LYS n 
22 123  LYS n 
22 124  PRO n 
22 125  GLY n 
22 126  GLN n 
22 127  GLY n 
22 128  THR n 
22 129  PRO n 
22 130  ASN n 
22 131  SER n 
22 132  ALA n 
22 133  ASN n 
22 134  THR n 
22 135  GLN n 
22 136  GLY n 
22 137  ASN n 
22 138  SER n 
22 139  THR n 
22 140  PRO n 
22 141  ASN n 
22 142  PRO n 
22 143  GLN n 
22 144  VAL n 
22 145  PRO n 
22 146  ASP n 
22 147  TYR n 
22 148  PRO n 
22 149  PRO n 
22 150  ASN n 
22 151  TYR n 
22 152  ILE n 
22 153  LEU n 
22 154  PHE n 
22 155  LEU n 
22 156  ASN n 
22 157  ASN n 
22 158  LEU n 
22 159  PRO n 
22 160  GLU n 
22 161  GLU n 
22 162  THR n 
22 163  ASN n 
22 164  GLU n 
22 165  MET n 
22 166  MET n 
22 167  LEU n 
22 168  SER n 
22 169  MET n 
22 170  LEU n 
22 171  PHE n 
22 172  ASN n 
22 173  GLN n 
22 174  PHE n 
22 175  PRO n 
22 176  GLY n 
22 177  PHE n 
22 178  LYS n 
22 179  GLU n 
22 180  VAL n 
22 181  ARG n 
22 182  LEU n 
22 183  VAL n 
22 184  PRO n 
22 185  GLY n 
22 186  ARG n 
22 187  HIS n 
22 188  ASP n 
22 189  ILE n 
22 190  ALA n 
22 191  PHE n 
22 192  VAL n 
22 193  GLU n 
22 194  PHE n 
22 195  GLU n 
22 196  ASN n 
22 197  ASP n 
22 198  GLY n 
22 199  GLN n 
22 200  ALA n 
22 201  GLY n 
22 202  ALA n 
22 203  ALA n 
22 204  ARG n 
22 205  ASP n 
22 206  ALA n 
22 207  LEU n 
22 208  GLN n 
22 209  GLY n 
22 210  PHE n 
22 211  LYS n 
22 212  ILE n 
22 213  THR n 
22 214  PRO n 
22 215  SER n 
22 216  HIS n 
22 217  ALA n 
22 218  MET n 
22 219  LYS n 
22 220  ILE n 
22 221  THR n 
22 222  TYR n 
22 223  ALA n 
22 224  LYS n 
22 225  LYS n 
23 1    MET n 
23 2    PRO n 
23 3    ALA n 
23 4    GLY n 
23 5    PRO n 
23 6    VAL n 
23 7    GLN n 
23 8    ALA n 
23 9    VAL n 
23 10   PRO n 
23 11   PRO n 
23 12   PRO n 
23 13   PRO n 
23 14   PRO n 
23 15   VAL n 
23 16   PRO n 
23 17   THR n 
23 18   GLU n 
23 19   PRO n 
23 20   LYS n 
23 21   GLN n 
23 22   PRO n 
23 23   THR n 
23 24   GLU n 
23 25   GLU n 
23 26   GLU n 
23 27   ALA n 
23 28   SER n 
23 29   SER n 
23 30   LYS n 
23 31   GLU n 
23 32   ASP n 
23 33   SER n 
23 34   ALA n 
23 35   PRO n 
23 36   SER n 
23 37   LYS n 
23 38   PRO n 
23 39   VAL n 
23 40   VAL n 
23 41   GLY n 
23 42   ILE n 
23 43   ILE n 
23 44   TYR n 
23 45   PRO n 
23 46   PRO n 
23 47   PRO n 
23 48   GLU n 
23 49   VAL n 
23 50   ARG n 
23 51   ASN n 
23 52   ILE n 
23 53   VAL n 
23 54   ASP n 
23 55   LYS n 
23 56   THR n 
23 57   ALA n 
23 58   SER n 
23 59   PHE n 
23 60   VAL n 
23 61   ALA n 
23 62   ARG n 
23 63   ASN n 
23 64   GLY n 
23 65   PRO n 
23 66   GLU n 
23 67   PHE n 
23 68   GLU n 
23 69   ALA n 
23 70   ARG n 
23 71   ILE n 
23 72   ARG n 
23 73   GLN n 
23 74   ASN n 
23 75   GLU n 
23 76   ILE n 
23 77   ASN n 
23 78   ASN n 
23 79   PRO n 
23 80   LYS n 
23 81   PHE n 
23 82   ASN n 
23 83   PHE n 
23 84   LEU n 
23 85   ASN n 
23 86   PRO n 
23 87   ASN n 
23 88   ASP n 
23 89   PRO n 
23 90   TYR n 
23 91   HIS n 
23 92   ALA n 
23 93   TYR n 
23 94   TYR n 
23 95   ARG n 
23 96   HIS n 
23 97   LYS n 
23 98   VAL n 
23 99   SER n 
23 100  GLU n 
23 101  PHE n 
23 102  LYS n 
23 103  GLU n 
23 104  GLY n 
23 105  LYS n 
23 106  ALA n 
23 107  GLN n 
23 108  GLU n 
23 109  PRO n 
23 110  SER n 
23 111  ALA n 
23 112  ALA n 
23 113  ILE n 
23 114  PRO n 
23 115  LYS n 
23 116  VAL n 
23 117  MET n 
23 118  GLN n 
23 119  GLN n 
23 120  GLN n 
23 121  GLN n 
23 122  GLN n 
23 123  THR n 
23 124  THR n 
23 125  GLN n 
23 126  GLN n 
23 127  GLN n 
23 128  LEU n 
23 129  PRO n 
23 130  GLN n 
23 131  LYS n 
23 132  VAL n 
23 133  GLN n 
23 134  ALA n 
23 135  GLN n 
23 136  VAL n 
23 137  ILE n 
23 138  GLN n 
23 139  GLU n 
23 140  THR n 
23 141  ILE n 
23 142  VAL n 
23 143  PRO n 
23 144  LYS n 
23 145  GLU n 
23 146  PRO n 
23 147  PRO n 
23 148  PRO n 
23 149  GLU n 
23 150  PHE n 
23 151  GLU n 
23 152  PHE n 
23 153  ILE n 
23 154  ALA n 
23 155  ASP n 
23 156  PRO n 
23 157  PRO n 
23 158  SER n 
23 159  ILE n 
23 160  SER n 
23 161  ALA n 
23 162  PHE n 
23 163  ASP n 
23 164  LEU n 
23 165  ASP n 
23 166  VAL n 
23 167  VAL n 
23 168  LYS n 
23 169  LEU n 
23 170  THR n 
23 171  ALA n 
23 172  GLN n 
23 173  PHE n 
23 174  VAL n 
23 175  ALA n 
23 176  ARG n 
23 177  ASN n 
23 178  GLY n 
23 179  ARG n 
23 180  GLN n 
23 181  PHE n 
23 182  LEU n 
23 183  THR n 
23 184  GLN n 
23 185  LEU n 
23 186  MET n 
23 187  GLN n 
23 188  LYS n 
23 189  GLU n 
23 190  GLN n 
23 191  ARG n 
23 192  ASN n 
23 193  TYR n 
23 194  GLN n 
23 195  PHE n 
23 196  ASP n 
23 197  PHE n 
23 198  LEU n 
23 199  ARG n 
23 200  PRO n 
23 201  GLN n 
23 202  HIS n 
23 203  SER n 
23 204  LEU n 
23 205  PHE n 
23 206  ASN n 
23 207  TYR n 
23 208  PHE n 
23 209  THR n 
23 210  LYS n 
23 211  LEU n 
23 212  VAL n 
23 213  GLU n 
23 214  GLN n 
23 215  TYR n 
23 216  THR n 
23 217  LYS n 
23 218  ILE n 
23 219  LEU n 
23 220  ILE n 
23 221  PRO n 
23 222  PRO n 
23 223  LYS n 
23 224  GLY n 
23 225  LEU n 
23 226  PHE n 
23 227  SER n 
23 228  LYS n 
23 229  LEU n 
23 230  LYS n 
23 231  LYS n 
23 232  GLU n 
23 233  ALA n 
23 234  GLU n 
23 235  ASN n 
23 236  PRO n 
23 237  ARG n 
23 238  GLU n 
23 239  VAL n 
23 240  LEU n 
23 241  ASP n 
23 242  GLN n 
23 243  VAL n 
23 244  CYS n 
23 245  TYR n 
23 246  ARG n 
23 247  VAL n 
23 248  GLU n 
23 249  TRP n 
23 250  ALA n 
23 251  LYS n 
23 252  PHE n 
23 253  GLN n 
23 254  GLU n 
23 255  ARG n 
23 256  GLU n 
23 257  ARG n 
23 258  LYS n 
23 259  LYS n 
23 260  GLU n 
23 261  GLU n 
23 262  GLU n 
23 263  GLU n 
23 264  LYS n 
23 265  GLU n 
23 266  LYS n 
23 267  GLU n 
23 268  ARG n 
23 269  VAL n 
23 270  ALA n 
23 271  TYR n 
23 272  ALA n 
23 273  GLN n 
23 274  ILE n 
23 275  ASP n 
23 276  TRP n 
23 277  HIS n 
23 278  ASP n 
23 279  PHE n 
23 280  VAL n 
23 281  VAL n 
23 282  VAL n 
23 283  GLU n 
23 284  THR n 
23 285  VAL n 
23 286  ASP n 
23 287  PHE n 
23 288  GLN n 
23 289  PRO n 
23 290  ASN n 
23 291  GLU n 
23 292  GLN n 
23 293  GLY n 
23 294  ASN n 
23 295  PHE n 
23 296  PRO n 
23 297  PRO n 
23 298  PRO n 
23 299  THR n 
23 300  THR n 
23 301  PRO n 
23 302  GLU n 
23 303  GLU n 
23 304  LEU n 
23 305  GLY n 
23 306  ALA n 
23 307  ARG n 
23 308  ILE n 
23 309  LEU n 
23 310  ILE n 
23 311  GLN n 
23 312  GLU n 
23 313  ARG n 
23 314  TYR n 
23 315  GLU n 
23 316  LYS n 
23 317  PHE n 
23 318  GLY n 
23 319  GLU n 
23 320  SER n 
23 321  GLU n 
23 322  GLU n 
23 323  VAL n 
23 324  GLU n 
23 325  MET n 
23 326  GLU n 
23 327  VAL n 
23 328  GLU n 
23 329  SER n 
23 330  ASP n 
23 331  GLU n 
23 332  GLU n 
23 333  ASP n 
23 334  ASP n 
23 335  LYS n 
23 336  GLN n 
23 337  GLU n 
23 338  LYS n 
23 339  ALA n 
23 340  GLU n 
23 341  GLU n 
23 342  PRO n 
23 343  PRO n 
23 344  SER n 
23 345  GLN n 
23 346  LEU n 
23 347  ASP n 
23 348  GLN n 
23 349  ASP n 
23 350  THR n 
23 351  GLN n 
23 352  VAL n 
23 353  GLN n 
23 354  ASP n 
23 355  MET n 
23 356  ASP n 
23 357  GLU n 
23 358  GLY n 
23 359  SER n 
23 360  ASP n 
23 361  ASP n 
23 362  GLU n 
23 363  GLU n 
23 364  GLU n 
23 365  GLY n 
23 366  GLN n 
23 367  LYS n 
23 368  VAL n 
23 369  PRO n 
23 370  PRO n 
23 371  PRO n 
23 372  PRO n 
23 373  GLU n 
23 374  THR n 
23 375  PRO n 
23 376  MET n 
23 377  PRO n 
23 378  PRO n 
23 379  PRO n 
23 380  LEU n 
23 381  PRO n 
23 382  PRO n 
23 383  THR n 
23 384  PRO n 
23 385  ASP n 
23 386  GLN n 
23 387  VAL n 
23 388  ILE n 
23 389  VAL n 
23 390  ARG n 
23 391  LYS n 
23 392  ASP n 
23 393  TYR n 
23 394  ASP n 
23 395  PRO n 
23 396  LYS n 
23 397  ALA n 
23 398  SER n 
23 399  LYS n 
23 400  PRO n 
23 401  LEU n 
23 402  PRO n 
23 403  PRO n 
23 404  ALA n 
23 405  PRO n 
23 406  ALA n 
23 407  PRO n 
23 408  ASP n 
23 409  GLU n 
23 410  TYR n 
23 411  LEU n 
23 412  VAL n 
23 413  SER n 
23 414  PRO n 
23 415  ILE n 
23 416  THR n 
23 417  GLY n 
23 418  GLU n 
23 419  LYS n 
23 420  ILE n 
23 421  PRO n 
23 422  ALA n 
23 423  SER n 
23 424  LYS n 
23 425  MET n 
23 426  GLN n 
23 427  GLU n 
23 428  HIS n 
23 429  MET n 
23 430  ARG n 
23 431  ILE n 
23 432  GLY n 
23 433  LEU n 
23 434  LEU n 
23 435  ASP n 
23 436  PRO n 
23 437  ARG n 
23 438  TRP n 
23 439  LEU n 
23 440  GLU n 
23 441  GLN n 
23 442  ARG n 
23 443  ASP n 
23 444  ARG n 
23 445  SER n 
23 446  ILE n 
23 447  ARG n 
23 448  GLU n 
23 449  LYS n 
23 450  GLN n 
23 451  SER n 
23 452  ASP n 
23 453  ASP n 
23 454  GLU n 
23 455  VAL n 
23 456  TYR n 
23 457  ALA n 
23 458  PRO n 
23 459  GLY n 
23 460  LEU n 
23 461  ASP n 
23 462  ILE n 
23 463  GLU n 
23 464  SER n 
23 465  SER n 
23 466  LEU n 
23 467  LYS n 
23 468  GLN n 
23 469  LEU n 
23 470  ALA n 
23 471  GLU n 
23 472  ARG n 
23 473  ARG n 
23 474  THR n 
23 475  ASP n 
23 476  ILE n 
23 477  PHE n 
23 478  GLY n 
23 479  VAL n 
23 480  GLU n 
23 481  GLU n 
23 482  THR n 
23 483  ALA n 
23 484  ILE n 
23 485  GLY n 
23 486  LYS n 
23 487  LYS n 
23 488  ILE n 
23 489  GLY n 
23 490  GLU n 
23 491  GLU n 
23 492  GLU n 
23 493  ILE n 
23 494  GLN n 
23 495  LYS n 
23 496  PRO n 
23 497  GLU n 
23 498  GLU n 
23 499  LYS n 
23 500  VAL n 
23 501  THR n 
23 502  TRP n 
23 503  ASP n 
23 504  GLY n 
23 505  HIS n 
23 506  SER n 
23 507  GLY n 
23 508  SER n 
23 509  MET n 
23 510  ALA n 
23 511  ARG n 
23 512  THR n 
23 513  GLN n 
23 514  GLN n 
23 515  ALA n 
23 516  ALA n 
23 517  GLN n 
23 518  ALA n 
23 519  ASN n 
23 520  ILE n 
23 521  THR n 
23 522  LEU n 
23 523  GLN n 
23 524  GLU n 
23 525  GLN n 
23 526  ILE n 
23 527  GLU n 
23 528  ALA n 
23 529  ILE n 
23 530  HIS n 
23 531  LYS n 
23 532  ALA n 
23 533  LYS n 
23 534  GLY n 
23 535  LEU n 
23 536  VAL n 
23 537  PRO n 
23 538  GLU n 
23 539  ASP n 
23 540  ASP n 
23 541  THR n 
23 542  LYS n 
23 543  GLU n 
23 544  LYS n 
23 545  ILE n 
23 546  GLY n 
23 547  PRO n 
23 548  SER n 
23 549  LYS n 
23 550  PRO n 
23 551  ASN n 
23 552  GLU n 
23 553  ILE n 
23 554  PRO n 
23 555  GLN n 
23 556  GLN n 
23 557  PRO n 
23 558  PRO n 
23 559  PRO n 
23 560  PRO n 
23 561  SER n 
23 562  SER n 
23 563  ALA n 
23 564  THR n 
23 565  ASN n 
23 566  ILE n 
23 567  PRO n 
23 568  SER n 
23 569  SER n 
23 570  ALA n 
23 571  PRO n 
23 572  PRO n 
23 573  ILE n 
23 574  THR n 
23 575  SER n 
23 576  VAL n 
23 577  PRO n 
23 578  ARG n 
23 579  PRO n 
23 580  PRO n 
23 581  THR n 
23 582  MET n 
23 583  PRO n 
23 584  PRO n 
23 585  PRO n 
23 586  VAL n 
23 587  ARG n 
23 588  THR n 
23 589  THR n 
23 590  VAL n 
23 591  VAL n 
23 592  SER n 
23 593  ALA n 
23 594  VAL n 
23 595  PRO n 
23 596  VAL n 
23 597  MET n 
23 598  PRO n 
23 599  ARG n 
23 600  PRO n 
23 601  PRO n 
23 602  MET n 
23 603  ALA n 
23 604  SER n 
23 605  VAL n 
23 606  VAL n 
23 607  ARG n 
23 608  LEU n 
23 609  PRO n 
23 610  PRO n 
23 611  GLY n 
23 612  SER n 
23 613  VAL n 
23 614  ILE n 
23 615  ALA n 
23 616  PRO n 
23 617  MET n 
23 618  PRO n 
23 619  PRO n 
23 620  ILE n 
23 621  ILE n 
23 622  HIS n 
23 623  ALA n 
23 624  PRO n 
23 625  ARG n 
23 626  ILE n 
23 627  ASN n 
23 628  VAL n 
23 629  VAL n 
23 630  PRO n 
23 631  MET n 
23 632  PRO n 
23 633  PRO n 
23 634  SER n 
23 635  ALA n 
23 636  PRO n 
23 637  PRO n 
23 638  ILE n 
23 639  MET n 
23 640  ALA n 
23 641  PRO n 
23 642  ARG n 
23 643  PRO n 
23 644  PRO n 
23 645  PRO n 
23 646  MET n 
23 647  ILE n 
23 648  VAL n 
23 649  PRO n 
23 650  THR n 
23 651  ALA n 
23 652  PHE n 
23 653  VAL n 
23 654  PRO n 
23 655  ALA n 
23 656  PRO n 
23 657  PRO n 
23 658  VAL n 
23 659  ALA n 
23 660  PRO n 
23 661  VAL n 
23 662  PRO n 
23 663  ALA n 
23 664  PRO n 
23 665  ALA n 
23 666  PRO n 
23 667  MET n 
23 668  PRO n 
23 669  PRO n 
23 670  VAL n 
23 671  HIS n 
23 672  PRO n 
23 673  PRO n 
23 674  PRO n 
23 675  PRO n 
23 676  MET n 
23 677  GLU n 
23 678  ASP n 
23 679  GLU n 
23 680  PRO n 
23 681  THR n 
23 682  SER n 
23 683  LYS n 
23 684  LYS n 
23 685  LEU n 
23 686  LYS n 
23 687  THR n 
23 688  GLU n 
23 689  ASP n 
23 690  SER n 
23 691  LEU n 
23 692  MET n 
23 693  PRO n 
23 694  GLU n 
23 695  GLU n 
23 696  GLU n 
23 697  PHE n 
23 698  LEU n 
23 699  ARG n 
23 700  ARG n 
23 701  ASN n 
23 702  LYS n 
23 703  GLY n 
23 704  PRO n 
23 705  VAL n 
23 706  SER n 
23 707  ILE n 
23 708  LYS n 
23 709  VAL n 
23 710  GLN n 
23 711  VAL n 
23 712  PRO n 
23 713  ASN n 
23 714  MET n 
23 715  GLN n 
23 716  ASP n 
23 717  LYS n 
23 718  THR n 
23 719  GLU n 
23 720  TRP n 
23 721  LYS n 
23 722  LEU n 
23 723  ASN n 
23 724  GLY n 
23 725  GLN n 
23 726  VAL n 
23 727  LEU n 
23 728  VAL n 
23 729  PHE n 
23 730  THR n 
23 731  LEU n 
23 732  PRO n 
23 733  LEU n 
23 734  THR n 
23 735  ASP n 
23 736  GLN n 
23 737  VAL n 
23 738  SER n 
23 739  VAL n 
23 740  ILE n 
23 741  LYS n 
23 742  VAL n 
23 743  LYS n 
23 744  ILE n 
23 745  HIS n 
23 746  GLU n 
23 747  ALA n 
23 748  THR n 
23 749  GLY n 
23 750  MET n 
23 751  PRO n 
23 752  ALA n 
23 753  GLY n 
23 754  LYS n 
23 755  GLN n 
23 756  LYS n 
23 757  LEU n 
23 758  GLN n 
23 759  TYR n 
23 760  GLU n 
23 761  GLY n 
23 762  ILE n 
23 763  PHE n 
23 764  ILE n 
23 765  LYS n 
23 766  ASP n 
23 767  SER n 
23 768  ASN n 
23 769  SER n 
23 770  LEU n 
23 771  ALA n 
23 772  TYR n 
23 773  TYR n 
23 774  ASN n 
23 775  MET n 
23 776  ALA n 
23 777  ASN n 
23 778  GLY n 
23 779  ALA n 
23 780  VAL n 
23 781  ILE n 
23 782  HIS n 
23 783  LEU n 
23 784  ALA n 
23 785  LEU n 
23 786  LYS n 
23 787  GLU n 
23 788  ARG n 
23 789  GLY n 
23 790  GLY n 
23 791  ARG n 
23 792  LYS n 
23 793  LYS n 
24 1    MET n 
24 2    ASP n 
24 3    PHE n 
24 4    GLN n 
24 5    HIS n 
24 6    ARG n 
24 7    PRO n 
24 8    GLY n 
24 9    GLY n 
24 10   LYS n 
24 11   THR n 
24 12   GLY n 
24 13   SER n 
24 14   GLY n 
24 15   GLY n 
24 16   VAL n 
24 17   ALA n 
24 18   SER n 
24 19   SER n 
24 20   SER n 
24 21   GLU n 
24 22   SER n 
24 23   ASN n 
24 24   ARG n 
24 25   ASP n 
24 26   ARG n 
24 27   ARG n 
24 28   GLU n 
24 29   ARG n 
24 30   LEU n 
24 31   ARG n 
24 32   GLN n 
24 33   LEU n 
24 34   ALA n 
24 35   LEU n 
24 36   GLU n 
24 37   THR n 
24 38   ILE n 
24 39   ASP n 
24 40   ILE n 
24 41   ASN n 
24 42   LYS n 
24 43   ASP n 
24 44   PRO n 
24 45   TYR n 
24 46   PHE n 
24 47   MET n 
24 48   LYS n 
24 49   ASN n 
24 50   HIS n 
24 51   LEU n 
24 52   GLY n 
24 53   SER n 
24 54   TYR n 
24 55   GLU n 
24 56   CYS n 
24 57   LYS n 
24 58   LEU n 
24 59   CYS n 
24 60   LEU n 
24 61   THR n 
24 62   LEU n 
24 63   HIS n 
24 64   ASN n 
24 65   ASN n 
24 66   GLU n 
24 67   GLY n 
24 68   SER n 
24 69   TYR n 
24 70   LEU n 
24 71   ALA n 
24 72   HIS n 
24 73   THR n 
24 74   GLN n 
24 75   GLY n 
24 76   LYS n 
24 77   LYS n 
24 78   HIS n 
24 79   GLN n 
24 80   THR n 
24 81   ASN n 
24 82   LEU n 
24 83   ALA n 
24 84   ARG n 
24 85   ARG n 
24 86   ALA n 
24 87   ALA n 
24 88   LYS n 
24 89   GLU n 
24 90   ALA n 
24 91   LYS n 
24 92   GLU n 
24 93   ALA n 
24 94   PRO n 
24 95   ALA n 
24 96   GLN n 
24 97   PRO n 
24 98   ALA n 
24 99   PRO n 
24 100  GLU n 
24 101  LYS n 
24 102  VAL n 
24 103  LYS n 
24 104  VAL n 
24 105  GLU n 
24 106  VAL n 
24 107  LYS n 
24 108  LYS n 
24 109  PHE n 
24 110  VAL n 
24 111  LYS n 
24 112  ILE n 
24 113  GLY n 
24 114  ARG n 
24 115  PRO n 
24 116  GLY n 
24 117  TYR n 
24 118  LYS n 
24 119  VAL n 
24 120  THR n 
24 121  LYS n 
24 122  GLN n 
24 123  ARG n 
24 124  ASP n 
24 125  SER n 
24 126  GLU n 
24 127  MET n 
24 128  GLY n 
24 129  GLN n 
24 130  GLN n 
24 131  SER n 
24 132  LEU n 
24 133  LEU n 
24 134  PHE n 
24 135  GLN n 
24 136  ILE n 
24 137  ASP n 
24 138  TYR n 
24 139  PRO n 
24 140  GLU n 
24 141  ILE n 
24 142  ALA n 
24 143  GLU n 
24 144  GLY n 
24 145  ILE n 
24 146  MET n 
24 147  PRO n 
24 148  ARG n 
24 149  HIS n 
24 150  ARG n 
24 151  PHE n 
24 152  MET n 
24 153  SER n 
24 154  ALA n 
24 155  TYR n 
24 156  GLU n 
24 157  GLN n 
24 158  ARG n 
24 159  ILE n 
24 160  GLU n 
24 161  PRO n 
24 162  PRO n 
24 163  ASP n 
24 164  ARG n 
24 165  ARG n 
24 166  TRP n 
24 167  GLN n 
24 168  TYR n 
24 169  LEU n 
24 170  LEU n 
24 171  MET n 
24 172  ALA n 
24 173  ALA n 
24 174  GLU n 
24 175  PRO n 
24 176  TYR n 
24 177  GLU n 
24 178  THR n 
24 179  ILE n 
24 180  ALA n 
24 181  PHE n 
24 182  LYS n 
24 183  VAL n 
24 184  PRO n 
24 185  SER n 
24 186  ARG n 
24 187  GLU n 
24 188  ILE n 
24 189  ASP n 
24 190  LYS n 
24 191  ALA n 
24 192  GLU n 
24 193  GLY n 
24 194  LYS n 
24 195  PHE n 
24 196  TRP n 
24 197  THR n 
24 198  HIS n 
24 199  TRP n 
24 200  ASN n 
24 201  ARG n 
24 202  GLU n 
24 203  THR n 
24 204  LYS n 
24 205  GLN n 
24 206  PHE n 
24 207  PHE n 
24 208  LEU n 
24 209  GLN n 
24 210  PHE n 
24 211  HIS n 
24 212  PHE n 
24 213  LYS n 
24 214  MET n 
24 215  GLU n 
24 216  LYS n 
24 217  PRO n 
24 218  PRO n 
24 219  ALA n 
24 220  PRO n 
24 221  PRO n 
24 222  SER n 
24 223  LEU n 
24 224  PRO n 
24 225  ALA n 
24 226  GLY n 
24 227  PRO n 
24 228  PRO n 
24 229  GLY n 
24 230  VAL n 
24 231  LYS n 
24 232  ARG n 
24 233  PRO n 
24 234  PRO n 
24 235  PRO n 
24 236  PRO n 
24 237  LEU n 
24 238  MET n 
24 239  ASN n 
24 240  GLY n 
24 241  LEU n 
24 242  PRO n 
24 243  PRO n 
24 244  ARG n 
24 245  PRO n 
24 246  PRO n 
24 247  LEU n 
24 248  PRO n 
24 249  GLU n 
24 250  SER n 
24 251  LEU n 
24 252  PRO n 
24 253  PRO n 
24 254  PRO n 
24 255  PRO n 
24 256  PRO n 
24 257  GLY n 
24 258  GLY n 
24 259  LEU n 
24 260  PRO n 
24 261  LEU n 
24 262  PRO n 
24 263  PRO n 
24 264  MET n 
24 265  PRO n 
24 266  PRO n 
24 267  THR n 
24 268  GLY n 
24 269  PRO n 
24 270  ALA n 
24 271  PRO n 
24 272  SER n 
24 273  GLY n 
24 274  PRO n 
24 275  PRO n 
24 276  GLY n 
24 277  PRO n 
24 278  PRO n 
24 279  GLN n 
24 280  LEU n 
24 281  PRO n 
24 282  PRO n 
24 283  PRO n 
24 284  ALA n 
24 285  PRO n 
24 286  GLY n 
24 287  VAL n 
24 288  HIS n 
24 289  PRO n 
24 290  PRO n 
24 291  ALA n 
24 292  PRO n 
24 293  VAL n 
24 294  VAL n 
24 295  HIS n 
24 296  PRO n 
24 297  PRO n 
24 298  ALA n 
24 299  SER n 
24 300  GLY n 
24 301  VAL n 
24 302  HIS n 
24 303  PRO n 
24 304  PRO n 
24 305  ALA n 
24 306  PRO n 
24 307  GLY n 
24 308  VAL n 
24 309  HIS n 
24 310  PRO n 
24 311  PRO n 
24 312  ALA n 
24 313  PRO n 
24 314  GLY n 
24 315  VAL n 
24 316  HIS n 
24 317  PRO n 
24 318  PRO n 
24 319  ALA n 
24 320  PRO n 
24 321  GLY n 
24 322  VAL n 
24 323  HIS n 
24 324  PRO n 
24 325  PRO n 
24 326  THR n 
24 327  SER n 
24 328  GLY n 
24 329  VAL n 
24 330  HIS n 
24 331  PRO n 
24 332  PRO n 
24 333  ALA n 
24 334  PRO n 
24 335  GLY n 
24 336  VAL n 
24 337  HIS n 
24 338  PRO n 
24 339  PRO n 
24 340  ALA n 
24 341  PRO n 
24 342  GLY n 
24 343  VAL n 
24 344  HIS n 
24 345  PRO n 
24 346  PRO n 
24 347  ALA n 
24 348  PRO n 
24 349  GLY n 
24 350  VAL n 
24 351  HIS n 
24 352  PRO n 
24 353  PRO n 
24 354  ALA n 
24 355  PRO n 
24 356  GLY n 
24 357  VAL n 
24 358  HIS n 
24 359  PRO n 
24 360  PRO n 
24 361  ALA n 
24 362  PRO n 
24 363  GLY n 
24 364  VAL n 
24 365  HIS n 
24 366  PRO n 
24 367  PRO n 
24 368  PRO n 
24 369  SER n 
24 370  ALA n 
24 371  GLY n 
24 372  VAL n 
24 373  HIS n 
24 374  PRO n 
24 375  GLN n 
24 376  ALA n 
24 377  PRO n 
24 378  GLY n 
24 379  VAL n 
24 380  HIS n 
24 381  PRO n 
24 382  ALA n 
24 383  ALA n 
24 384  PRO n 
24 385  ALA n 
24 386  VAL n 
24 387  HIS n 
24 388  PRO n 
24 389  GLN n 
24 390  ALA n 
24 391  PRO n 
24 392  GLY n 
24 393  VAL n 
24 394  HIS n 
24 395  PRO n 
24 396  PRO n 
24 397  ALA n 
24 398  PRO n 
24 399  GLY n 
24 400  MET n 
24 401  HIS n 
24 402  PRO n 
24 403  GLN n 
24 404  ALA n 
24 405  PRO n 
24 406  GLY n 
24 407  VAL n 
24 408  HIS n 
24 409  PRO n 
24 410  GLN n 
24 411  PRO n 
24 412  PRO n 
24 413  GLY n 
24 414  VAL n 
24 415  HIS n 
24 416  PRO n 
24 417  SER n 
24 418  ALA n 
24 419  PRO n 
24 420  GLY n 
24 421  VAL n 
24 422  HIS n 
24 423  PRO n 
24 424  GLN n 
24 425  PRO n 
24 426  PRO n 
24 427  GLY n 
24 428  VAL n 
24 429  HIS n 
24 430  PRO n 
24 431  SER n 
24 432  ASN n 
24 433  PRO n 
24 434  GLY n 
24 435  VAL n 
24 436  HIS n 
24 437  PRO n 
24 438  PRO n 
24 439  THR n 
24 440  PRO n 
24 441  MET n 
24 442  PRO n 
24 443  PRO n 
24 444  MET n 
24 445  LEU n 
24 446  ARG n 
24 447  PRO n 
24 448  PRO n 
24 449  LEU n 
24 450  PRO n 
24 451  SER n 
24 452  GLU n 
24 453  GLY n 
24 454  PRO n 
24 455  GLY n 
24 456  ASN n 
24 457  ILE n 
24 458  PRO n 
24 459  PRO n 
24 460  PRO n 
24 461  PRO n 
24 462  PRO n 
24 463  THR n 
24 464  ASN n 
25 1    MET n 
25 2    GLU n 
25 3    THR n 
25 4    ILE n 
25 5    LEU n 
25 6    GLU n 
25 7    GLN n 
25 8    GLN n 
25 9    ARG n 
25 10   ARG n 
25 11   TYR n 
25 12   HIS n 
25 13   GLU n 
25 14   GLU n 
25 15   LYS n 
25 16   GLU n 
25 17   ARG n 
25 18   LEU n 
25 19   MET n 
25 20   ASP n 
25 21   VAL n 
25 22   MET n 
25 23   ALA n 
25 24   LYS n 
25 25   GLU n 
25 26   MET n 
25 27   LEU n 
25 28   THR n 
25 29   LYS n 
25 30   LYS n 
25 31   SER n 
25 32   THR n 
25 33   LEU n 
25 34   ARG n 
25 35   ASP n 
25 36   GLN n 
25 37   ILE n 
25 38   ASN n 
25 39   SER n 
25 40   ASP n 
25 41   HIS n 
25 42   ARG n 
25 43   THR n 
25 44   ARG n 
25 45   ALA n 
25 46   MET n 
25 47   GLN n 
25 48   ASP n 
25 49   ARG n 
25 50   TYR n 
25 51   MET n 
25 52   GLU n 
25 53   VAL n 
25 54   SER n 
25 55   GLY n 
25 56   ASN n 
25 57   LEU n 
25 58   ARG n 
25 59   ASP n 
25 60   LEU n 
25 61   TYR n 
25 62   ASP n 
25 63   ASP n 
25 64   LYS n 
25 65   ASP n 
25 66   GLY n 
25 67   LEU n 
25 68   ARG n 
25 69   LYS n 
25 70   GLU n 
25 71   GLU n 
25 72   LEU n 
25 73   ASN n 
25 74   ALA n 
25 75   ILE n 
25 76   SER n 
25 77   GLY n 
25 78   PRO n 
25 79   ASN n 
25 80   GLU n 
25 81   PHE n 
25 82   ALA n 
25 83   GLU n 
25 84   PHE n 
25 85   TYR n 
25 86   ASN n 
25 87   ARG n 
25 88   LEU n 
25 89   LYS n 
25 90   GLN n 
25 91   ILE n 
25 92   LYS n 
25 93   GLU n 
25 94   PHE n 
25 95   HIS n 
25 96   ARG n 
25 97   LYS n 
25 98   HIS n 
25 99   PRO n 
25 100  ASN n 
25 101  GLU n 
25 102  ILE n 
25 103  CYS n 
25 104  VAL n 
25 105  PRO n 
25 106  MET n 
25 107  SER n 
25 108  VAL n 
25 109  GLU n 
25 110  PHE n 
25 111  GLU n 
25 112  GLU n 
25 113  LEU n 
25 114  LEU n 
25 115  LYS n 
25 116  ALA n 
25 117  ARG n 
25 118  GLU n 
25 119  ASN n 
25 120  PRO n 
25 121  SER n 
25 122  GLU n 
25 123  GLU n 
25 124  ALA n 
25 125  GLN n 
25 126  ASN n 
25 127  LEU n 
25 128  VAL n 
25 129  GLU n 
25 130  PHE n 
25 131  THR n 
25 132  ASP n 
25 133  GLU n 
25 134  GLU n 
25 135  GLY n 
25 136  TYR n 
25 137  GLY n 
25 138  ARG n 
25 139  TYR n 
25 140  LEU n 
25 141  ASP n 
25 142  LEU n 
25 143  HIS n 
25 144  ASP n 
25 145  CYS n 
25 146  TYR n 
25 147  LEU n 
25 148  LYS n 
25 149  TYR n 
25 150  ILE n 
25 151  ASN n 
25 152  LEU n 
25 153  LYS n 
25 154  ALA n 
25 155  SER n 
25 156  GLU n 
25 157  LYS n 
25 158  LEU n 
25 159  ASP n 
25 160  TYR n 
25 161  ILE n 
25 162  THR n 
25 163  TYR n 
25 164  LEU n 
25 165  SER n 
25 166  ILE n 
25 167  PHE n 
25 168  ASP n 
25 169  GLN n 
25 170  LEU n 
25 171  PHE n 
25 172  ASP n 
25 173  ILE n 
25 174  PRO n 
25 175  LYS n 
25 176  GLU n 
25 177  ARG n 
25 178  LYS n 
25 179  ASN n 
25 180  ALA n 
25 181  GLU n 
25 182  TYR n 
25 183  LYS n 
25 184  ARG n 
25 185  TYR n 
25 186  LEU n 
25 187  GLU n 
25 188  MET n 
25 189  LEU n 
25 190  LEU n 
25 191  GLU n 
25 192  TYR n 
25 193  LEU n 
25 194  GLN n 
25 195  ASP n 
25 196  TYR n 
25 197  THR n 
25 198  ASP n 
25 199  ARG n 
25 200  VAL n 
25 201  LYS n 
25 202  PRO n 
25 203  LEU n 
25 204  GLN n 
25 205  ASP n 
25 206  GLN n 
25 207  ASN n 
25 208  GLU n 
25 209  LEU n 
25 210  PHE n 
25 211  GLY n 
25 212  LYS n 
25 213  ILE n 
25 214  GLN n 
25 215  ALA n 
25 216  GLU n 
25 217  PHE n 
25 218  GLU n 
25 219  LYS n 
25 220  LYS n 
25 221  TRP n 
25 222  GLU n 
25 223  ASN n 
25 224  GLY n 
25 225  THR n 
25 226  PHE n 
25 227  PRO n 
25 228  GLY n 
25 229  TRP n 
25 230  PRO n 
25 231  LYS n 
25 232  GLU n 
25 233  THR n 
25 234  SER n 
25 235  SER n 
25 236  ALA n 
25 237  LEU n 
25 238  THR n 
25 239  HIS n 
25 240  ALA n 
25 241  GLY n 
25 242  ALA n 
25 243  HIS n 
25 244  LEU n 
25 245  ASP n 
25 246  LEU n 
25 247  SER n 
25 248  ALA n 
25 249  PHE n 
25 250  SER n 
25 251  SER n 
25 252  TRP n 
25 253  GLU n 
25 254  GLU n 
25 255  LEU n 
25 256  ALA n 
25 257  SER n 
25 258  LEU n 
25 259  GLY n 
25 260  LEU n 
25 261  ASP n 
25 262  ARG n 
25 263  LEU n 
25 264  LYS n 
25 265  SER n 
25 266  ALA n 
25 267  LEU n 
25 268  LEU n 
25 269  ALA n 
25 270  LEU n 
25 271  GLY n 
25 272  LEU n 
25 273  LYS n 
25 274  CYS n 
25 275  GLY n 
25 276  GLY n 
25 277  THR n 
25 278  LEU n 
25 279  GLU n 
25 280  GLU n 
25 281  ARG n 
25 282  ALA n 
25 283  GLN n 
25 284  ARG n 
25 285  LEU n 
25 286  PHE n 
25 287  SER n 
25 288  THR n 
25 289  LYS n 
25 290  GLY n 
25 291  LYS n 
25 292  SER n 
25 293  LEU n 
25 294  GLU n 
25 295  SER n 
25 296  LEU n 
25 297  ASP n 
25 298  THR n 
25 299  SER n 
25 300  LEU n 
25 301  PHE n 
25 302  ALA n 
25 303  LYS n 
25 304  ASN n 
25 305  PRO n 
25 306  LYS n 
25 307  SER n 
25 308  LYS n 
25 309  GLY n 
25 310  THR n 
25 311  LYS n 
25 312  ARG n 
25 313  ASP n 
25 314  THR n 
25 315  GLU n 
25 316  ARG n 
25 317  ASN n 
25 318  LYS n 
25 319  ASP n 
25 320  ILE n 
25 321  ALA n 
25 322  PHE n 
25 323  LEU n 
25 324  GLU n 
25 325  ALA n 
25 326  GLN n 
25 327  ILE n 
25 328  TYR n 
25 329  GLU n 
25 330  TYR n 
25 331  VAL n 
25 332  GLU n 
25 333  ILE n 
25 334  LEU n 
25 335  GLY n 
25 336  GLU n 
25 337  GLN n 
25 338  ARG n 
25 339  HIS n 
25 340  LEU n 
25 341  THR n 
25 342  HIS n 
25 343  GLU n 
25 344  ASN n 
25 345  VAL n 
25 346  GLN n 
25 347  ARG n 
25 348  LYS n 
25 349  GLN n 
25 350  ALA n 
25 351  ARG n 
25 352  THR n 
25 353  GLY n 
25 354  GLU n 
25 355  GLU n 
25 356  ARG n 
25 357  GLU n 
25 358  GLU n 
25 359  GLU n 
25 360  GLU n 
25 361  GLU n 
25 362  GLU n 
25 363  GLN n 
25 364  ILE n 
25 365  SER n 
25 366  GLU n 
25 367  SER n 
25 368  GLU n 
25 369  SER n 
25 370  GLU n 
25 371  ASP n 
25 372  GLU n 
25 373  GLU n 
25 374  ASN n 
25 375  GLU n 
25 376  ILE n 
25 377  ILE n 
25 378  TYR n 
25 379  ASN n 
25 380  PRO n 
25 381  LYS n 
25 382  ASN n 
25 383  LEU n 
25 384  PRO n 
25 385  LEU n 
25 386  GLY n 
25 387  TRP n 
25 388  ASP n 
25 389  GLY n 
25 390  LYS n 
25 391  PRO n 
25 392  ILE n 
25 393  PRO n 
25 394  TYR n 
25 395  TRP n 
25 396  LEU n 
25 397  TYR n 
25 398  LYS n 
25 399  LEU n 
25 400  HIS n 
25 401  GLY n 
25 402  LEU n 
25 403  ASN n 
25 404  ILE n 
25 405  ASN n 
25 406  TYR n 
25 407  ASN n 
25 408  CYS n 
25 409  GLU n 
25 410  ILE n 
25 411  CYS n 
25 412  GLY n 
25 413  ASN n 
25 414  TYR n 
25 415  THR n 
25 416  TYR n 
25 417  ARG n 
25 418  GLY n 
25 419  PRO n 
25 420  LYS n 
25 421  ALA n 
25 422  PHE n 
25 423  GLN n 
25 424  ARG n 
25 425  HIS n 
25 426  PHE n 
25 427  ALA n 
25 428  GLU n 
25 429  TRP n 
25 430  ARG n 
25 431  HIS n 
25 432  ALA n 
25 433  HIS n 
25 434  GLY n 
25 435  MET n 
25 436  ARG n 
25 437  CYS n 
25 438  LEU n 
25 439  GLY n 
25 440  ILE n 
25 441  PRO n 
25 442  ASN n 
25 443  THR n 
25 444  ALA n 
25 445  HIS n 
25 446  PHE n 
25 447  ALA n 
25 448  ASN n 
25 449  VAL n 
25 450  THR n 
25 451  GLN n 
25 452  ILE n 
25 453  GLU n 
25 454  ASP n 
25 455  ALA n 
25 456  VAL n 
25 457  SER n 
25 458  LEU n 
25 459  TRP n 
25 460  ALA n 
25 461  LYS n 
25 462  LEU n 
25 463  LYS n 
25 464  LEU n 
25 465  GLN n 
25 466  LYS n 
25 467  ALA n 
25 468  SER n 
25 469  GLU n 
25 470  ARG n 
25 471  TRP n 
25 472  GLN n 
25 473  PRO n 
25 474  ASP n 
25 475  THR n 
25 476  GLU n 
25 477  GLU n 
25 478  GLU n 
25 479  TYR n 
25 480  GLU n 
25 481  ASP n 
25 482  SER n 
25 483  SER n 
25 484  GLY n 
25 485  ASN n 
25 486  VAL n 
25 487  VAL n 
25 488  ASN n 
25 489  LYS n 
25 490  LYS n 
25 491  THR n 
25 492  TYR n 
25 493  GLU n 
25 494  ASP n 
25 495  LEU n 
25 496  LYS n 
25 497  ARG n 
25 498  GLN n 
25 499  GLY n 
25 500  LEU n 
25 501  LEU n 
26 1    MET n 
26 2    ALA n 
26 3    LYS n 
26 4    ILE n 
26 5    ALA n 
26 6    LYS n 
26 7    THR n 
26 8    HIS n 
26 9    GLU n 
26 10   ASP n 
26 11   ILE n 
26 12   GLU n 
26 13   ALA n 
26 14   GLN n 
26 15   ILE n 
26 16   ARG n 
26 17   GLU n 
26 18   ILE n 
26 19   GLN n 
26 20   GLY n 
26 21   LYS n 
26 22   LYS n 
26 23   ALA n 
26 24   ALA n 
26 25   LEU n 
26 26   ASP n 
26 27   GLU n 
26 28   ALA n 
26 29   GLN n 
26 30   GLY n 
26 31   VAL n 
26 32   GLY n 
26 33   LEU n 
26 34   ASP n 
26 35   SER n 
26 36   THR n 
26 37   GLY n 
26 38   TYR n 
26 39   TYR n 
26 40   ASP n 
26 41   GLN n 
26 42   GLU n 
26 43   ILE n 
26 44   TYR n 
26 45   GLY n 
26 46   GLY n 
26 47   SER n 
26 48   ASP n 
26 49   SER n 
26 50   ARG n 
26 51   PHE n 
26 52   ALA n 
26 53   GLY n 
26 54   TYR n 
26 55   VAL n 
26 56   THR n 
26 57   SER n 
26 58   ILE n 
26 59   ALA n 
26 60   ALA n 
26 61   THR n 
26 62   GLU n 
26 63   LEU n 
26 64   GLU n 
26 65   ASP n 
26 66   ASP n 
26 67   ASP n 
26 68   ASP n 
26 69   ASP n 
26 70   TYR n 
26 71   SER n 
26 72   SER n 
26 73   SER n 
26 74   THR n 
26 75   SER n 
26 76   LEU n 
26 77   LEU n 
26 78   GLY n 
26 79   GLN n 
26 80   LYS n 
26 81   LYS n 
26 82   PRO n 
26 83   GLY n 
26 84   TYR n 
26 85   HIS n 
26 86   ALA n 
26 87   PRO n 
26 88   VAL n 
26 89   ALA n 
26 90   LEU n 
26 91   LEU n 
26 92   ASN n 
26 93   ASP n 
26 94   ILE n 
26 95   PRO n 
26 96   GLN n 
26 97   SER n 
26 98   THR n 
26 99   GLU n 
26 100  GLN n 
26 101  TYR n 
26 102  ASP n 
26 103  PRO n 
26 104  PHE n 
26 105  ALA n 
26 106  GLU n 
26 107  HIS n 
26 108  ARG n 
26 109  PRO n 
26 110  PRO n 
26 111  LYS n 
26 112  ILE n 
26 113  ALA n 
26 114  ASP n 
26 115  ARG n 
26 116  GLU n 
26 117  ASP n 
26 118  GLU n 
26 119  TYR n 
26 120  LYS n 
26 121  LYS n 
26 122  HIS n 
26 123  ARG n 
26 124  ARG n 
26 125  THR n 
26 126  MET n 
26 127  ILE n 
26 128  ILE n 
26 129  SER n 
26 130  PRO n 
26 131  GLU n 
26 132  ARG n 
26 133  LEU n 
26 134  ASP n 
26 135  PRO n 
26 136  PHE n 
26 137  ALA n 
26 138  ASP n 
26 139  GLY n 
26 140  GLY n 
26 141  LYS n 
26 142  THR n 
26 143  PRO n 
26 144  ASP n 
26 145  PRO n 
26 146  LYS n 
26 147  MET n 
26 148  ASN n 
26 149  ALA n 
26 150  ARG n 
26 151  THR n 
26 152  TYR n 
26 153  MET n 
26 154  ASP n 
26 155  VAL n 
26 156  MET n 
26 157  ARG n 
26 158  GLU n 
26 159  GLN n 
26 160  HIS n 
26 161  LEU n 
26 162  THR n 
26 163  LYS n 
26 164  GLU n 
26 165  GLU n 
26 166  ARG n 
26 167  GLU n 
26 168  ILE n 
26 169  ARG n 
26 170  GLN n 
26 171  GLN n 
26 172  LEU n 
26 173  ALA n 
26 174  GLU n 
26 175  LYS n 
26 176  ALA n 
26 177  LYS n 
26 178  ALA n 
26 179  GLY n 
26 180  GLU n 
26 181  LEU n 
26 182  LYS n 
26 183  VAL n 
26 184  VAL n 
26 185  ASN n 
26 186  GLY n 
26 187  ALA n 
26 188  ALA n 
26 189  ALA n 
26 190  SER n 
26 191  GLN n 
26 192  PRO n 
26 193  PRO n 
26 194  SER n 
26 195  LYS n 
26 196  ARG n 
26 197  LYS n 
26 198  ARG n 
26 199  ARG n 
26 200  TRP n 
26 201  ASP n 
26 202  GLN n 
26 203  THR n 
26 204  ALA n 
26 205  ASP n 
26 206  GLN n 
26 207  THR n 
26 208  PRO n 
26 209  GLY n 
26 210  ALA n 
26 211  THR n 
26 212  PRO n 
26 213  LYS n 
26 214  LYS n 
26 215  LEU n 
26 216  SER n 
26 217  SER n 
26 218  TRP n 
26 219  ASP n 
26 220  GLN n 
26 221  ALA n 
26 222  GLU n 
26 223  THR n 
26 224  PRO n 
26 225  GLY n 
26 226  HIS n 
26 227  THR n 
26 228  PRO n 
26 229  SER n 
26 230  LEU n 
26 231  ARG n 
26 232  TRP n 
26 233  ASP n 
26 234  GLU n 
26 235  THR n 
26 236  PRO n 
26 237  GLY n 
26 238  ARG n 
26 239  ALA n 
26 240  LYS n 
26 241  GLY n 
26 242  SER n 
26 243  GLU n 
26 244  THR n 
26 245  PRO n 
26 246  GLY n 
26 247  ALA n 
26 248  THR n 
26 249  PRO n 
26 250  GLY n 
26 251  SER n 
26 252  LYS n 
26 253  ILE n 
26 254  TRP n 
26 255  ASP n 
26 256  PRO n 
26 257  THR n 
26 258  PRO n 
26 259  SER n 
26 260  HIS n 
26 261  THR n 
26 262  PRO n 
26 263  ALA n 
26 264  GLY n 
26 265  ALA n 
26 266  ALA n 
26 267  THR n 
26 268  PRO n 
26 269  GLY n 
26 270  ARG n 
26 271  GLY n 
26 272  ASP n 
26 273  THR n 
26 274  PRO n 
26 275  GLY n 
26 276  HIS n 
26 277  ALA n 
26 278  THR n 
26 279  PRO n 
26 280  GLY n 
26 281  HIS n 
26 282  GLY n 
26 283  GLY n 
26 284  ALA n 
26 285  THR n 
26 286  SER n 
26 287  SER n 
26 288  ALA n 
26 289  ARG n 
26 290  LYS n 
26 291  ASN n 
26 292  ARG n 
26 293  TRP n 
26 294  ASP n 
26 295  GLU n 
26 296  THR n 
26 297  PRO n 
26 298  LYS n 
26 299  THR n 
26 300  GLU n 
26 301  ARG n 
26 302  ASP n 
26 303  THR n 
26 304  PRO n 
26 305  GLY n 
26 306  HIS n 
26 307  GLY n 
26 308  SER n 
26 309  GLY n 
26 310  TRP n 
26 311  ALA n 
26 312  GLU n 
26 313  THR n 
26 314  PRO n 
26 315  ARG n 
26 316  THR n 
26 317  ASP n 
26 318  ARG n 
26 319  GLY n 
26 320  GLY n 
26 321  ASP n 
26 322  SER n 
26 323  ILE n 
26 324  GLY n 
26 325  GLU n 
26 326  THR n 
26 327  PRO n 
26 328  THR n 
26 329  PRO n 
26 330  GLY n 
26 331  ALA n 
26 332  SER n 
26 333  LYS n 
26 334  ARG n 
26 335  LYS n 
26 336  SER n 
26 337  ARG n 
26 338  TRP n 
26 339  ASP n 
26 340  GLU n 
26 341  THR n 
26 342  PRO n 
26 343  ALA n 
26 344  SER n 
26 345  GLN n 
26 346  MET n 
26 347  GLY n 
26 348  GLY n 
26 349  SER n 
26 350  THR n 
26 351  PRO n 
26 352  VAL n 
26 353  LEU n 
26 354  THR n 
26 355  PRO n 
26 356  GLY n 
26 357  LYS n 
26 358  THR n 
26 359  PRO n 
26 360  ILE n 
26 361  GLY n 
26 362  THR n 
26 363  PRO n 
26 364  ALA n 
26 365  MET n 
26 366  ASN n 
26 367  MET n 
26 368  ALA n 
26 369  THR n 
26 370  PRO n 
26 371  THR n 
26 372  PRO n 
26 373  GLY n 
26 374  HIS n 
26 375  ILE n 
26 376  MET n 
26 377  SER n 
26 378  MET n 
26 379  THR n 
26 380  PRO n 
26 381  GLU n 
26 382  GLN n 
26 383  LEU n 
26 384  GLN n 
26 385  ALA n 
26 386  TRP n 
26 387  ARG n 
26 388  TRP n 
26 389  GLU n 
26 390  ARG n 
26 391  GLU n 
26 392  ILE n 
26 393  ASP n 
26 394  GLU n 
26 395  ARG n 
26 396  ASN n 
26 397  ARG n 
26 398  PRO n 
26 399  LEU n 
26 400  SER n 
26 401  ASP n 
26 402  GLU n 
26 403  GLU n 
26 404  LEU n 
26 405  ASP n 
26 406  ALA n 
26 407  MET n 
26 408  PHE n 
26 409  PRO n 
26 410  GLU n 
26 411  GLY n 
26 412  TYR n 
26 413  LYS n 
26 414  VAL n 
26 415  LEU n 
26 416  PRO n 
26 417  PRO n 
26 418  PRO n 
26 419  ALA n 
26 420  GLY n 
26 421  TYR n 
26 422  VAL n 
26 423  PRO n 
26 424  ILE n 
26 425  ARG n 
26 426  THR n 
26 427  PRO n 
26 428  ALA n 
26 429  ARG n 
26 430  LYS n 
26 431  LEU n 
26 432  THR n 
26 433  ALA n 
26 434  THR n 
26 435  PRO n 
26 436  THR n 
26 437  PRO n 
26 438  LEU n 
26 439  GLY n 
26 440  GLY n 
26 441  MET n 
26 442  THR n 
26 443  GLY n 
26 444  PHE n 
26 445  HIS n 
26 446  MET n 
26 447  GLN n 
26 448  THR n 
26 449  GLU n 
26 450  ASP n 
26 451  ARG n 
26 452  THR n 
26 453  MET n 
26 454  LYS n 
26 455  SER n 
26 456  VAL n 
26 457  ASN n 
26 458  ASP n 
26 459  GLN n 
26 460  PRO n 
26 461  SER n 
26 462  GLY n 
26 463  ASN n 
26 464  LEU n 
26 465  PRO n 
26 466  PHE n 
26 467  LEU n 
26 468  LYS n 
26 469  PRO n 
26 470  ASP n 
26 471  ASP n 
26 472  ILE n 
26 473  GLN n 
26 474  TYR n 
26 475  PHE n 
26 476  ASP n 
26 477  LYS n 
26 478  LEU n 
26 479  LEU n 
26 480  VAL n 
26 481  ASP n 
26 482  VAL n 
26 483  ASP n 
26 484  GLU n 
26 485  SER n 
26 486  THR n 
26 487  LEU n 
26 488  SER n 
26 489  PRO n 
26 490  GLU n 
26 491  GLU n 
26 492  GLN n 
26 493  LYS n 
26 494  GLU n 
26 495  ARG n 
26 496  LYS n 
26 497  ILE n 
26 498  MET n 
26 499  LYS n 
26 500  LEU n 
26 501  LEU n 
26 502  LEU n 
26 503  LYS n 
26 504  ILE n 
26 505  LYS n 
26 506  ASN n 
26 507  GLY n 
26 508  THR n 
26 509  PRO n 
26 510  PRO n 
26 511  MET n 
26 512  ARG n 
26 513  LYS n 
26 514  ALA n 
26 515  ALA n 
26 516  LEU n 
26 517  ARG n 
26 518  GLN n 
26 519  ILE n 
26 520  THR n 
26 521  ASP n 
26 522  LYS n 
26 523  ALA n 
26 524  ARG n 
26 525  GLU n 
26 526  PHE n 
26 527  GLY n 
26 528  ALA n 
26 529  GLY n 
26 530  PRO n 
26 531  LEU n 
26 532  PHE n 
26 533  ASN n 
26 534  GLN n 
26 535  ILE n 
26 536  LEU n 
26 537  PRO n 
26 538  LEU n 
26 539  LEU n 
26 540  MET n 
26 541  SER n 
26 542  PRO n 
26 543  THR n 
26 544  LEU n 
26 545  GLU n 
26 546  ASP n 
26 547  GLN n 
26 548  GLU n 
26 549  ARG n 
26 550  HIS n 
26 551  LEU n 
26 552  LEU n 
26 553  VAL n 
26 554  LYS n 
26 555  VAL n 
26 556  ILE n 
26 557  ASP n 
26 558  ARG n 
26 559  ILE n 
26 560  LEU n 
26 561  TYR n 
26 562  LYS n 
26 563  LEU n 
26 564  ASP n 
26 565  ASP n 
26 566  LEU n 
26 567  VAL n 
26 568  ARG n 
26 569  PRO n 
26 570  TYR n 
26 571  VAL n 
26 572  HIS n 
26 573  LYS n 
26 574  ILE n 
26 575  LEU n 
26 576  VAL n 
26 577  VAL n 
26 578  ILE n 
26 579  GLU n 
26 580  PRO n 
26 581  LEU n 
26 582  LEU n 
26 583  ILE n 
26 584  ASP n 
26 585  GLU n 
26 586  ASP n 
26 587  TYR n 
26 588  TYR n 
26 589  ALA n 
26 590  ARG n 
26 591  VAL n 
26 592  GLU n 
26 593  GLY n 
26 594  ARG n 
26 595  GLU n 
26 596  ILE n 
26 597  ILE n 
26 598  SER n 
26 599  ASN n 
26 600  LEU n 
26 601  ALA n 
26 602  LYS n 
26 603  ALA n 
26 604  ALA n 
26 605  GLY n 
26 606  LEU n 
26 607  ALA n 
26 608  THR n 
26 609  MET n 
26 610  ILE n 
26 611  SER n 
26 612  THR n 
26 613  MET n 
26 614  ARG n 
26 615  PRO n 
26 616  ASP n 
26 617  ILE n 
26 618  ASP n 
26 619  ASN n 
26 620  MET n 
26 621  ASP n 
26 622  GLU n 
26 623  TYR n 
26 624  VAL n 
26 625  ARG n 
26 626  ASN n 
26 627  THR n 
26 628  THR n 
26 629  ALA n 
26 630  ARG n 
26 631  ALA n 
26 632  PHE n 
26 633  ALA n 
26 634  VAL n 
26 635  VAL n 
26 636  ALA n 
26 637  SER n 
26 638  ALA n 
26 639  LEU n 
26 640  GLY n 
26 641  ILE n 
26 642  PRO n 
26 643  SER n 
26 644  LEU n 
26 645  LEU n 
26 646  PRO n 
26 647  PHE n 
26 648  LEU n 
26 649  LYS n 
26 650  ALA n 
26 651  VAL n 
26 652  CYS n 
26 653  LYS n 
26 654  SER n 
26 655  LYS n 
26 656  LYS n 
26 657  SER n 
26 658  TRP n 
26 659  GLN n 
26 660  ALA n 
26 661  ARG n 
26 662  HIS n 
26 663  THR n 
26 664  GLY n 
26 665  ILE n 
26 666  LYS n 
26 667  ILE n 
26 668  VAL n 
26 669  GLN n 
26 670  GLN n 
26 671  ILE n 
26 672  ALA n 
26 673  ILE n 
26 674  LEU n 
26 675  MET n 
26 676  GLY n 
26 677  CYS n 
26 678  ALA n 
26 679  ILE n 
26 680  LEU n 
26 681  PRO n 
26 682  HIS n 
26 683  LEU n 
26 684  ARG n 
26 685  SER n 
26 686  LEU n 
26 687  VAL n 
26 688  GLU n 
26 689  ILE n 
26 690  ILE n 
26 691  GLU n 
26 692  HIS n 
26 693  GLY n 
26 694  LEU n 
26 695  VAL n 
26 696  ASP n 
26 697  GLU n 
26 698  GLN n 
26 699  GLN n 
26 700  LYS n 
26 701  VAL n 
26 702  ARG n 
26 703  THR n 
26 704  ILE n 
26 705  SER n 
26 706  ALA n 
26 707  LEU n 
26 708  ALA n 
26 709  ILE n 
26 710  ALA n 
26 711  ALA n 
26 712  LEU n 
26 713  ALA n 
26 714  GLU n 
26 715  ALA n 
26 716  ALA n 
26 717  THR n 
26 718  PRO n 
26 719  TYR n 
26 720  GLY n 
26 721  ILE n 
26 722  GLU n 
26 723  SER n 
26 724  PHE n 
26 725  ASP n 
26 726  SER n 
26 727  VAL n 
26 728  LEU n 
26 729  LYS n 
26 730  PRO n 
26 731  LEU n 
26 732  TRP n 
26 733  LYS n 
26 734  GLY n 
26 735  ILE n 
26 736  ARG n 
26 737  GLN n 
26 738  HIS n 
26 739  ARG n 
26 740  GLY n 
26 741  LYS n 
26 742  GLY n 
26 743  LEU n 
26 744  ALA n 
26 745  ALA n 
26 746  PHE n 
26 747  LEU n 
26 748  LYS n 
26 749  ALA n 
26 750  ILE n 
26 751  GLY n 
26 752  TYR n 
26 753  LEU n 
26 754  ILE n 
26 755  PRO n 
26 756  LEU n 
26 757  MET n 
26 758  ASP n 
26 759  ALA n 
26 760  GLU n 
26 761  TYR n 
26 762  ALA n 
26 763  ASN n 
26 764  TYR n 
26 765  TYR n 
26 766  THR n 
26 767  ARG n 
26 768  GLU n 
26 769  VAL n 
26 770  MET n 
26 771  LEU n 
26 772  ILE n 
26 773  LEU n 
26 774  ILE n 
26 775  ARG n 
26 776  GLU n 
26 777  PHE n 
26 778  GLN n 
26 779  SER n 
26 780  PRO n 
26 781  ASP n 
26 782  GLU n 
26 783  GLU n 
26 784  MET n 
26 785  LYS n 
26 786  LYS n 
26 787  ILE n 
26 788  VAL n 
26 789  LEU n 
26 790  LYS n 
26 791  VAL n 
26 792  VAL n 
26 793  LYS n 
26 794  GLN n 
26 795  CYS n 
26 796  CYS n 
26 797  GLY n 
26 798  THR n 
26 799  ASP n 
26 800  GLY n 
26 801  VAL n 
26 802  GLU n 
26 803  ALA n 
26 804  ASN n 
26 805  TYR n 
26 806  ILE n 
26 807  LYS n 
26 808  THR n 
26 809  GLU n 
26 810  ILE n 
26 811  LEU n 
26 812  PRO n 
26 813  PRO n 
26 814  PHE n 
26 815  PHE n 
26 816  LYS n 
26 817  HIS n 
26 818  PHE n 
26 819  TRP n 
26 820  GLN n 
26 821  HIS n 
26 822  ARG n 
26 823  MET n 
26 824  ALA n 
26 825  LEU n 
26 826  ASP n 
26 827  ARG n 
26 828  ARG n 
26 829  ASN n 
26 830  TYR n 
26 831  ARG n 
26 832  GLN n 
26 833  LEU n 
26 834  VAL n 
26 835  ASP n 
26 836  THR n 
26 837  THR n 
26 838  VAL n 
26 839  GLU n 
26 840  LEU n 
26 841  ALA n 
26 842  ASN n 
26 843  LYS n 
26 844  VAL n 
26 845  GLY n 
26 846  ALA n 
26 847  ALA n 
26 848  GLU n 
26 849  ILE n 
26 850  ILE n 
26 851  SER n 
26 852  ARG n 
26 853  ILE n 
26 854  VAL n 
26 855  ASP n 
26 856  ASP n 
26 857  LEU n 
26 858  LYS n 
26 859  ASP n 
26 860  GLU n 
26 861  ALA n 
26 862  GLU n 
26 863  GLN n 
26 864  TYR n 
26 865  ARG n 
26 866  LYS n 
26 867  MET n 
26 868  VAL n 
26 869  MET n 
26 870  GLU n 
26 871  THR n 
26 872  ILE n 
26 873  GLU n 
26 874  LYS n 
26 875  ILE n 
26 876  MET n 
26 877  GLY n 
26 878  ASN n 
26 879  LEU n 
26 880  GLY n 
26 881  ALA n 
26 882  ALA n 
26 883  ASP n 
26 884  ILE n 
26 885  ASP n 
26 886  HIS n 
26 887  LYS n 
26 888  LEU n 
26 889  GLU n 
26 890  GLU n 
26 891  GLN n 
26 892  LEU n 
26 893  ILE n 
26 894  ASP n 
26 895  GLY n 
26 896  ILE n 
26 897  LEU n 
26 898  TYR n 
26 899  ALA n 
26 900  PHE n 
26 901  GLN n 
26 902  GLU n 
26 903  GLN n 
26 904  THR n 
26 905  THR n 
26 906  GLU n 
26 907  ASP n 
26 908  SER n 
26 909  VAL n 
26 910  MET n 
26 911  LEU n 
26 912  ASN n 
26 913  GLY n 
26 914  PHE n 
26 915  GLY n 
26 916  THR n 
26 917  VAL n 
26 918  VAL n 
26 919  ASN n 
26 920  ALA n 
26 921  LEU n 
26 922  GLY n 
26 923  LYS n 
26 924  ARG n 
26 925  VAL n 
26 926  LYS n 
26 927  PRO n 
26 928  TYR n 
26 929  LEU n 
26 930  PRO n 
26 931  GLN n 
26 932  ILE n 
26 933  CYS n 
26 934  GLY n 
26 935  THR n 
26 936  VAL n 
26 937  LEU n 
26 938  TRP n 
26 939  ARG n 
26 940  LEU n 
26 941  ASN n 
26 942  ASN n 
26 943  LYS n 
26 944  SER n 
26 945  ALA n 
26 946  LYS n 
26 947  VAL n 
26 948  ARG n 
26 949  GLN n 
26 950  GLN n 
26 951  ALA n 
26 952  ALA n 
26 953  ASP n 
26 954  LEU n 
26 955  ILE n 
26 956  SER n 
26 957  ARG n 
26 958  THR n 
26 959  ALA n 
26 960  VAL n 
26 961  VAL n 
26 962  MET n 
26 963  LYS n 
26 964  THR n 
26 965  CYS n 
26 966  GLN n 
26 967  GLU n 
26 968  GLU n 
26 969  LYS n 
26 970  LEU n 
26 971  MET n 
26 972  GLY n 
26 973  HIS n 
26 974  LEU n 
26 975  GLY n 
26 976  VAL n 
26 977  VAL n 
26 978  LEU n 
26 979  TYR n 
26 980  GLU n 
26 981  TYR n 
26 982  LEU n 
26 983  GLY n 
26 984  GLU n 
26 985  GLU n 
26 986  TYR n 
26 987  PRO n 
26 988  GLU n 
26 989  VAL n 
26 990  LEU n 
26 991  GLY n 
26 992  SER n 
26 993  ILE n 
26 994  LEU n 
26 995  GLY n 
26 996  ALA n 
26 997  LEU n 
26 998  LYS n 
26 999  ALA n 
26 1000 ILE n 
26 1001 VAL n 
26 1002 ASN n 
26 1003 VAL n 
26 1004 ILE n 
26 1005 GLY n 
26 1006 MET n 
26 1007 HIS n 
26 1008 LYS n 
26 1009 MET n 
26 1010 THR n 
26 1011 PRO n 
26 1012 PRO n 
26 1013 ILE n 
26 1014 LYS n 
26 1015 ASP n 
26 1016 LEU n 
26 1017 LEU n 
26 1018 PRO n 
26 1019 ARG n 
26 1020 LEU n 
26 1021 THR n 
26 1022 PRO n 
26 1023 ILE n 
26 1024 LEU n 
26 1025 LYS n 
26 1026 ASN n 
26 1027 ARG n 
26 1028 HIS n 
26 1029 GLU n 
26 1030 LYS n 
26 1031 VAL n 
26 1032 GLN n 
26 1033 GLU n 
26 1034 ASN n 
26 1035 CYS n 
26 1036 ILE n 
26 1037 ASP n 
26 1038 LEU n 
26 1039 VAL n 
26 1040 GLY n 
26 1041 ARG n 
26 1042 ILE n 
26 1043 ALA n 
26 1044 ASP n 
26 1045 ARG n 
26 1046 GLY n 
26 1047 ALA n 
26 1048 GLU n 
26 1049 TYR n 
26 1050 VAL n 
26 1051 SER n 
26 1052 ALA n 
26 1053 ARG n 
26 1054 GLU n 
26 1055 TRP n 
26 1056 MET n 
26 1057 ARG n 
26 1058 ILE n 
26 1059 CYS n 
26 1060 PHE n 
26 1061 GLU n 
26 1062 LEU n 
26 1063 LEU n 
26 1064 GLU n 
26 1065 LEU n 
26 1066 LEU n 
26 1067 LYS n 
26 1068 ALA n 
26 1069 HIS n 
26 1070 LYS n 
26 1071 LYS n 
26 1072 ALA n 
26 1073 ILE n 
26 1074 ARG n 
26 1075 ARG n 
26 1076 ALA n 
26 1077 THR n 
26 1078 VAL n 
26 1079 ASN n 
26 1080 THR n 
26 1081 PHE n 
26 1082 GLY n 
26 1083 TYR n 
26 1084 ILE n 
26 1085 ALA n 
26 1086 LYS n 
26 1087 ALA n 
26 1088 ILE n 
26 1089 GLY n 
26 1090 PRO n 
26 1091 HIS n 
26 1092 ASP n 
26 1093 VAL n 
26 1094 LEU n 
26 1095 ALA n 
26 1096 THR n 
26 1097 LEU n 
26 1098 LEU n 
26 1099 ASN n 
26 1100 ASN n 
26 1101 LEU n 
26 1102 LYS n 
26 1103 VAL n 
26 1104 GLN n 
26 1105 GLU n 
26 1106 ARG n 
26 1107 GLN n 
26 1108 ASN n 
26 1109 ARG n 
26 1110 VAL n 
26 1111 CYS n 
26 1112 THR n 
26 1113 THR n 
26 1114 VAL n 
26 1115 ALA n 
26 1116 ILE n 
26 1117 ALA n 
26 1118 ILE n 
26 1119 VAL n 
26 1120 ALA n 
26 1121 GLU n 
26 1122 THR n 
26 1123 CYS n 
26 1124 SER n 
26 1125 PRO n 
26 1126 PHE n 
26 1127 THR n 
26 1128 VAL n 
26 1129 LEU n 
26 1130 PRO n 
26 1131 ALA n 
26 1132 LEU n 
26 1133 MET n 
26 1134 ASN n 
26 1135 GLU n 
26 1136 TYR n 
26 1137 ARG n 
26 1138 VAL n 
26 1139 PRO n 
26 1140 GLU n 
26 1141 LEU n 
26 1142 ASN n 
26 1143 VAL n 
26 1144 GLN n 
26 1145 ASN n 
26 1146 GLY n 
26 1147 VAL n 
26 1148 LEU n 
26 1149 LYS n 
26 1150 SER n 
26 1151 LEU n 
26 1152 SER n 
26 1153 PHE n 
26 1154 LEU n 
26 1155 PHE n 
26 1156 GLU n 
26 1157 TYR n 
26 1158 ILE n 
26 1159 GLY n 
26 1160 GLU n 
26 1161 MET n 
26 1162 GLY n 
26 1163 LYS n 
26 1164 ASP n 
26 1165 TYR n 
26 1166 ILE n 
26 1167 TYR n 
26 1168 ALA n 
26 1169 VAL n 
26 1170 THR n 
26 1171 PRO n 
26 1172 LEU n 
26 1173 LEU n 
26 1174 GLU n 
26 1175 ASP n 
26 1176 ALA n 
26 1177 LEU n 
26 1178 MET n 
26 1179 ASP n 
26 1180 ARG n 
26 1181 ASP n 
26 1182 LEU n 
26 1183 VAL n 
26 1184 HIS n 
26 1185 ARG n 
26 1186 GLN n 
26 1187 THR n 
26 1188 ALA n 
26 1189 SER n 
26 1190 ALA n 
26 1191 VAL n 
26 1192 VAL n 
26 1193 GLN n 
26 1194 HIS n 
26 1195 MET n 
26 1196 SER n 
26 1197 LEU n 
26 1198 GLY n 
26 1199 VAL n 
26 1200 TYR n 
26 1201 GLY n 
26 1202 PHE n 
26 1203 GLY n 
26 1204 CYS n 
26 1205 GLU n 
26 1206 ASP n 
26 1207 SER n 
26 1208 LEU n 
26 1209 ASN n 
26 1210 HIS n 
26 1211 LEU n 
26 1212 LEU n 
26 1213 ASN n 
26 1214 TYR n 
26 1215 VAL n 
26 1216 TRP n 
26 1217 PRO n 
26 1218 ASN n 
26 1219 VAL n 
26 1220 PHE n 
26 1221 GLU n 
26 1222 THR n 
26 1223 SER n 
26 1224 PRO n 
26 1225 HIS n 
26 1226 VAL n 
26 1227 ILE n 
26 1228 GLN n 
26 1229 ALA n 
26 1230 VAL n 
26 1231 MET n 
26 1232 GLY n 
26 1233 ALA n 
26 1234 LEU n 
26 1235 GLU n 
26 1236 GLY n 
26 1237 LEU n 
26 1238 ARG n 
26 1239 VAL n 
26 1240 ALA n 
26 1241 ILE n 
26 1242 GLY n 
26 1243 PRO n 
26 1244 CYS n 
26 1245 ARG n 
26 1246 MET n 
26 1247 LEU n 
26 1248 GLN n 
26 1249 TYR n 
26 1250 CYS n 
26 1251 LEU n 
26 1252 GLN n 
26 1253 GLY n 
26 1254 LEU n 
26 1255 PHE n 
26 1256 HIS n 
26 1257 PRO n 
26 1258 ALA n 
26 1259 ARG n 
26 1260 LYS n 
26 1261 VAL n 
26 1262 ARG n 
26 1263 ASP n 
26 1264 VAL n 
26 1265 TYR n 
26 1266 TRP n 
26 1267 LYS n 
26 1268 ILE n 
26 1269 TYR n 
26 1270 ASN n 
26 1271 SER n 
26 1272 ILE n 
26 1273 TYR n 
26 1274 ILE n 
26 1275 GLY n 
26 1276 SER n 
26 1277 GLN n 
26 1278 ASP n 
26 1279 ALA n 
26 1280 LEU n 
26 1281 ILE n 
26 1282 ALA n 
26 1283 HIS n 
26 1284 TYR n 
26 1285 PRO n 
26 1286 ARG n 
26 1287 ILE n 
26 1288 TYR n 
26 1289 ASN n 
26 1290 ASP n 
26 1291 ASP n 
26 1292 LYS n 
26 1293 ASN n 
26 1294 THR n 
26 1295 TYR n 
26 1296 ILE n 
26 1297 ARG n 
26 1298 TYR n 
26 1299 GLU n 
26 1300 LEU n 
26 1301 ASP n 
26 1302 TYR n 
26 1303 ILE n 
26 1304 LEU n 
27 1    MET n 
27 2    ALA n 
27 3    THR n 
27 4    GLU n 
27 5    HIS n 
27 6    PRO n 
27 7    GLU n 
27 8    PRO n 
27 9    PRO n 
27 10   LYS n 
27 11   ALA n 
27 12   GLU n 
27 13   LEU n 
27 14   GLN n 
27 15   LEU n 
27 16   PRO n 
27 17   PRO n 
27 18   PRO n 
27 19   PRO n 
27 20   PRO n 
27 21   PRO n 
27 22   GLY n 
27 23   HIS n 
27 24   TYR n 
27 25   GLY n 
27 26   ALA n 
27 27   TRP n 
27 28   ALA n 
27 29   ALA n 
27 30   GLN n 
27 31   GLU n 
27 32   LEU n 
27 33   GLN n 
27 34   ALA n 
27 35   LYS n 
27 36   LEU n 
27 37   ALA n 
27 38   GLU n 
27 39   ILE n 
27 40   GLY n 
27 41   ALA n 
27 42   PRO n 
27 43   ILE n 
27 44   GLN n 
27 45   GLY n 
27 46   ASN n 
27 47   ARG n 
27 48   GLU n 
27 49   GLU n 
27 50   LEU n 
27 51   VAL n 
27 52   GLU n 
27 53   ARG n 
27 54   LEU n 
27 55   GLN n 
27 56   SER n 
27 57   TYR n 
27 58   THR n 
27 59   ARG n 
27 60   GLN n 
27 61   THR n 
27 62   GLY n 
27 63   ILE n 
27 64   VAL n 
27 65   LEU n 
27 66   ASN n 
27 67   ARG n 
27 68   PRO n 
27 69   VAL n 
27 70   LEU n 
27 71   ARG n 
27 72   GLY n 
27 73   GLU n 
27 74   ASP n 
27 75   GLY n 
27 76   ASP n 
27 77   LYS n 
27 78   ALA n 
27 79   ALA n 
27 80   PRO n 
27 81   PRO n 
27 82   PRO n 
27 83   MET n 
27 84   SER n 
27 85   ALA n 
27 86   GLN n 
27 87   LEU n 
27 88   PRO n 
27 89   GLY n 
27 90   ILE n 
27 91   PRO n 
27 92   MET n 
27 93   PRO n 
27 94   PRO n 
27 95   PRO n 
27 96   PRO n 
27 97   LEU n 
27 98   GLY n 
27 99   LEU n 
27 100  PRO n 
27 101  PRO n 
27 102  LEU n 
27 103  GLN n 
27 104  PRO n 
27 105  PRO n 
27 106  PRO n 
27 107  PRO n 
27 108  PRO n 
27 109  PRO n 
27 110  PRO n 
27 111  PRO n 
27 112  PRO n 
27 113  PRO n 
27 114  GLY n 
27 115  LEU n 
27 116  GLY n 
27 117  LEU n 
27 118  GLY n 
27 119  PHE n 
27 120  PRO n 
27 121  MET n 
27 122  ALA n 
27 123  HIS n 
27 124  PRO n 
27 125  PRO n 
27 126  ASN n 
27 127  LEU n 
27 128  GLY n 
27 129  PRO n 
27 130  PRO n 
27 131  PRO n 
27 132  PRO n 
27 133  LEU n 
27 134  ARG n 
27 135  VAL n 
27 136  GLY n 
27 137  GLU n 
27 138  PRO n 
27 139  VAL n 
27 140  ALA n 
27 141  LEU n 
27 142  SER n 
27 143  GLU n 
27 144  GLU n 
27 145  GLU n 
27 146  ARG n 
27 147  LEU n 
27 148  LYS n 
27 149  LEU n 
27 150  ALA n 
27 151  GLN n 
27 152  GLN n 
27 153  GLN n 
27 154  ALA n 
27 155  ALA n 
27 156  LEU n 
27 157  LEU n 
27 158  MET n 
27 159  GLN n 
27 160  GLN n 
27 161  GLU n 
27 162  GLU n 
27 163  ARG n 
27 164  ALA n 
27 165  LYS n 
27 166  GLN n 
27 167  GLN n 
27 168  GLY n 
27 169  ASP n 
27 170  HIS n 
27 171  SER n 
27 172  LEU n 
27 173  LYS n 
27 174  GLU n 
27 175  HIS n 
27 176  GLU n 
27 177  LEU n 
27 178  LEU n 
27 179  GLU n 
27 180  GLN n 
27 181  GLN n 
27 182  LYS n 
27 183  ARG n 
27 184  ALA n 
27 185  ALA n 
27 186  VAL n 
27 187  LEU n 
27 188  LEU n 
27 189  GLU n 
27 190  GLN n 
27 191  GLU n 
27 192  ARG n 
27 193  GLN n 
27 194  GLN n 
27 195  GLU n 
27 196  ILE n 
27 197  ALA n 
27 198  LYS n 
27 199  MET n 
27 200  GLY n 
27 201  THR n 
27 202  PRO n 
27 203  VAL n 
27 204  PRO n 
27 205  ARG n 
27 206  PRO n 
27 207  PRO n 
27 208  GLN n 
27 209  ASP n 
27 210  MET n 
27 211  GLY n 
27 212  GLN n 
27 213  ILE n 
27 214  GLY n 
27 215  VAL n 
27 216  ARG n 
27 217  THR n 
27 218  PRO n 
27 219  LEU n 
27 220  GLY n 
27 221  PRO n 
27 222  ARG n 
27 223  VAL n 
27 224  ALA n 
27 225  ALA n 
27 226  PRO n 
27 227  VAL n 
27 228  GLY n 
27 229  PRO n 
27 230  VAL n 
27 231  GLY n 
27 232  PRO n 
27 233  THR n 
27 234  PRO n 
27 235  THR n 
27 236  VAL n 
27 237  LEU n 
27 238  PRO n 
27 239  MET n 
27 240  GLY n 
27 241  ALA n 
27 242  PRO n 
27 243  VAL n 
27 244  PRO n 
27 245  ARG n 
27 246  PRO n 
27 247  ARG n 
27 248  GLY n 
27 249  PRO n 
27 250  PRO n 
27 251  PRO n 
27 252  PRO n 
27 253  PRO n 
27 254  GLY n 
27 255  ASP n 
27 256  GLU n 
27 257  ASN n 
27 258  ARG n 
27 259  GLU n 
27 260  MET n 
27 261  ASP n 
27 262  ASP n 
27 263  PRO n 
27 264  SER n 
27 265  VAL n 
27 266  GLY n 
27 267  PRO n 
27 268  LYS n 
27 269  ILE n 
27 270  PRO n 
27 271  GLN n 
27 272  ALA n 
27 273  LEU n 
27 274  GLU n 
27 275  LYS n 
27 276  ILE n 
27 277  LEU n 
27 278  GLN n 
27 279  LEU n 
27 280  LYS n 
27 281  GLU n 
27 282  SER n 
27 283  ARG n 
27 284  GLN n 
27 285  GLU n 
27 286  GLU n 
27 287  MET n 
27 288  ASN n 
27 289  SER n 
27 290  GLN n 
27 291  GLN n 
27 292  GLU n 
27 293  GLU n 
27 294  GLU n 
27 295  GLU n 
27 296  MET n 
27 297  GLU n 
27 298  THR n 
27 299  ASP n 
27 300  ALA n 
27 301  ARG n 
27 302  SER n 
27 303  SER n 
27 304  LEU n 
27 305  GLY n 
27 306  GLN n 
27 307  SER n 
27 308  ALA n 
27 309  SER n 
27 310  GLU n 
27 311  THR n 
27 312  GLU n 
27 313  GLU n 
27 314  ASP n 
27 315  THR n 
27 316  VAL n 
27 317  SER n 
27 318  VAL n 
27 319  SER n 
27 320  LYS n 
27 321  LYS n 
27 322  GLU n 
27 323  LYS n 
27 324  ASN n 
27 325  ARG n 
27 326  LYS n 
27 327  ARG n 
27 328  ARG n 
27 329  ASN n 
27 330  ARG n 
27 331  LYS n 
27 332  LYS n 
27 333  LYS n 
27 334  LYS n 
27 335  LYS n 
27 336  PRO n 
27 337  GLN n 
27 338  ARG n 
27 339  VAL n 
27 340  ARG n 
27 341  GLY n 
27 342  VAL n 
27 343  SER n 
27 344  SER n 
27 345  GLU n 
27 346  SER n 
27 347  SER n 
27 348  GLY n 
27 349  ASP n 
27 350  ARG n 
27 351  GLU n 
27 352  LYS n 
27 353  ASP n 
27 354  SER n 
27 355  THR n 
27 356  ARG n 
27 357  SER n 
27 358  ARG n 
27 359  GLY n 
27 360  SER n 
27 361  ASP n 
27 362  SER n 
27 363  PRO n 
27 364  ALA n 
27 365  ALA n 
27 366  ASP n 
27 367  VAL n 
27 368  GLU n 
27 369  ILE n 
27 370  GLU n 
27 371  TYR n 
27 372  VAL n 
27 373  THR n 
27 374  GLU n 
27 375  GLU n 
27 376  PRO n 
27 377  GLU n 
27 378  ILE n 
27 379  TYR n 
27 380  GLU n 
27 381  PRO n 
27 382  ASN n 
27 383  PHE n 
27 384  ILE n 
27 385  PHE n 
27 386  PHE n 
27 387  LYS n 
27 388  ARG n 
27 389  ILE n 
27 390  PHE n 
27 391  GLU n 
27 392  ALA n 
27 393  PHE n 
27 394  LYS n 
27 395  LEU n 
27 396  THR n 
27 397  ASP n 
27 398  ASP n 
27 399  VAL n 
27 400  LYS n 
27 401  LYS n 
27 402  GLU n 
27 403  LYS n 
27 404  GLU n 
27 405  LYS n 
27 406  GLU n 
27 407  PRO n 
27 408  GLU n 
27 409  LYS n 
27 410  LEU n 
27 411  ASP n 
27 412  LYS n 
27 413  LEU n 
27 414  GLU n 
27 415  ASN n 
27 416  SER n 
27 417  ALA n 
27 418  ALA n 
27 419  PRO n 
27 420  LYS n 
27 421  LYS n 
27 422  LYS n 
27 423  GLY n 
27 424  PHE n 
27 425  GLU n 
27 426  GLU n 
27 427  GLU n 
27 428  HIS n 
27 429  LYS n 
27 430  ASP n 
27 431  SER n 
27 432  ASP n 
27 433  ASP n 
27 434  ASP n 
27 435  SER n 
27 436  SER n 
27 437  ASP n 
27 438  ASP n 
27 439  GLU n 
27 440  GLN n 
27 441  GLU n 
27 442  LYS n 
27 443  LYS n 
27 444  PRO n 
27 445  GLU n 
27 446  ALA n 
27 447  PRO n 
27 448  LYS n 
27 449  LEU n 
27 450  SER n 
27 451  LYS n 
27 452  LYS n 
27 453  LYS n 
27 454  LEU n 
27 455  ARG n 
27 456  ARG n 
27 457  MET n 
27 458  ASN n 
27 459  ARG n 
27 460  PHE n 
27 461  THR n 
27 462  VAL n 
27 463  ALA n 
27 464  GLU n 
27 465  LEU n 
27 466  LYS n 
27 467  GLN n 
27 468  LEU n 
27 469  VAL n 
27 470  ALA n 
27 471  ARG n 
27 472  PRO n 
27 473  ASP n 
27 474  VAL n 
27 475  VAL n 
27 476  GLU n 
27 477  MET n 
27 478  HIS n 
27 479  ASP n 
27 480  VAL n 
27 481  THR n 
27 482  ALA n 
27 483  GLN n 
27 484  ASP n 
27 485  PRO n 
27 486  LYS n 
27 487  LEU n 
27 488  LEU n 
27 489  VAL n 
27 490  HIS n 
27 491  LEU n 
27 492  LYS n 
27 493  ALA n 
27 494  THR n 
27 495  ARG n 
27 496  ASN n 
27 497  SER n 
27 498  VAL n 
27 499  PRO n 
27 500  VAL n 
27 501  PRO n 
27 502  ARG n 
27 503  HIS n 
27 504  TRP n 
27 505  CYS n 
27 506  PHE n 
27 507  LYS n 
27 508  ARG n 
27 509  LYS n 
27 510  TYR n 
27 511  LEU n 
27 512  GLN n 
27 513  GLY n 
27 514  LYS n 
27 515  ARG n 
27 516  GLY n 
27 517  ILE n 
27 518  GLU n 
27 519  LYS n 
27 520  PRO n 
27 521  PRO n 
27 522  PHE n 
27 523  GLU n 
27 524  LEU n 
27 525  PRO n 
27 526  ASP n 
27 527  PHE n 
27 528  ILE n 
27 529  LYS n 
27 530  ARG n 
27 531  THR n 
27 532  GLY n 
27 533  ILE n 
27 534  GLN n 
27 535  GLU n 
27 536  MET n 
27 537  ARG n 
27 538  GLU n 
27 539  ALA n 
27 540  LEU n 
27 541  GLN n 
27 542  GLU n 
27 543  LYS n 
27 544  GLU n 
27 545  GLU n 
27 546  GLN n 
27 547  LYS n 
27 548  THR n 
27 549  MET n 
27 550  LYS n 
27 551  SER n 
27 552  LYS n 
27 553  MET n 
27 554  ARG n 
27 555  GLU n 
27 556  LYS n 
27 557  VAL n 
27 558  ARG n 
27 559  PRO n 
27 560  LYS n 
27 561  MET n 
27 562  GLY n 
27 563  LYS n 
27 564  ILE n 
27 565  ASP n 
27 566  ILE n 
27 567  ASP n 
27 568  TYR n 
27 569  GLN n 
27 570  LYS n 
27 571  LEU n 
27 572  HIS n 
27 573  ASP n 
27 574  ALA n 
27 575  PHE n 
27 576  PHE n 
27 577  LYS n 
27 578  TRP n 
27 579  GLN n 
27 580  THR n 
27 581  LYS n 
27 582  PRO n 
27 583  LYS n 
27 584  LEU n 
27 585  THR n 
27 586  ILE n 
27 587  HIS n 
27 588  GLY n 
27 589  ASP n 
27 590  LEU n 
27 591  TYR n 
27 592  TYR n 
27 593  GLU n 
27 594  GLY n 
27 595  LYS n 
27 596  GLU n 
27 597  PHE n 
27 598  GLU n 
27 599  THR n 
27 600  ARG n 
27 601  LEU n 
27 602  LYS n 
27 603  GLU n 
27 604  LYS n 
27 605  LYS n 
27 606  PRO n 
27 607  GLY n 
27 608  ASP n 
27 609  LEU n 
27 610  SER n 
27 611  ASP n 
27 612  GLU n 
27 613  LEU n 
27 614  ARG n 
27 615  ILE n 
27 616  SER n 
27 617  LEU n 
27 618  GLY n 
27 619  MET n 
27 620  PRO n 
27 621  VAL n 
27 622  GLY n 
27 623  PRO n 
27 624  ASN n 
27 625  ALA n 
27 626  HIS n 
27 627  LYS n 
27 628  VAL n 
27 629  PRO n 
27 630  PRO n 
27 631  PRO n 
27 632  TRP n 
27 633  LEU n 
27 634  ILE n 
27 635  ALA n 
27 636  MET n 
27 637  GLN n 
27 638  ARG n 
27 639  TYR n 
27 640  GLY n 
27 641  PRO n 
27 642  PRO n 
27 643  PRO n 
27 644  SER n 
27 645  TYR n 
27 646  PRO n 
27 647  ASN n 
27 648  LEU n 
27 649  LYS n 
27 650  ILE n 
27 651  PRO n 
27 652  GLY n 
27 653  LEU n 
27 654  ASN n 
27 655  SER n 
27 656  PRO n 
27 657  ILE n 
27 658  PRO n 
27 659  GLU n 
27 660  SER n 
27 661  CYS n 
27 662  SER n 
27 663  PHE n 
27 664  GLY n 
27 665  TYR n 
27 666  HIS n 
27 667  ALA n 
27 668  GLY n 
27 669  GLY n 
27 670  TRP n 
27 671  GLY n 
27 672  LYS n 
27 673  PRO n 
27 674  PRO n 
27 675  VAL n 
27 676  ASP n 
27 677  GLU n 
27 678  THR n 
27 679  GLY n 
27 680  LYS n 
27 681  PRO n 
27 682  LEU n 
27 683  TYR n 
27 684  GLY n 
27 685  ASP n 
27 686  VAL n 
27 687  PHE n 
27 688  GLY n 
27 689  THR n 
27 690  ASN n 
27 691  ALA n 
27 692  ALA n 
27 693  GLU n 
27 694  PHE n 
27 695  GLN n 
27 696  THR n 
27 697  LYS n 
27 698  THR n 
27 699  GLU n 
27 700  GLU n 
27 701  GLU n 
27 702  GLU n 
27 703  ILE n 
27 704  ASP n 
27 705  ARG n 
27 706  THR n 
27 707  PRO n 
27 708  TRP n 
27 709  GLY n 
27 710  GLU n 
27 711  LEU n 
27 712  GLU n 
27 713  PRO n 
27 714  SER n 
27 715  ASP n 
27 716  GLU n 
27 717  GLU n 
27 718  SER n 
27 719  SER n 
27 720  GLU n 
27 721  GLU n 
27 722  GLU n 
27 723  GLU n 
27 724  GLU n 
27 725  GLU n 
27 726  GLU n 
27 727  SER n 
27 728  ASP n 
27 729  GLU n 
27 730  ASP n 
27 731  LYS n 
27 732  PRO n 
27 733  ASP n 
27 734  GLU n 
27 735  THR n 
27 736  GLY n 
27 737  PHE n 
27 738  ILE n 
27 739  THR n 
27 740  PRO n 
27 741  ALA n 
27 742  ASP n 
27 743  SER n 
27 744  GLY n 
27 745  LEU n 
27 746  ILE n 
27 747  THR n 
27 748  PRO n 
27 749  GLY n 
27 750  GLY n 
27 751  PHE n 
27 752  SER n 
27 753  SER n 
27 754  VAL n 
27 755  PRO n 
27 756  ALA n 
27 757  GLY n 
27 758  MET n 
27 759  GLU n 
27 760  THR n 
27 761  PRO n 
27 762  GLU n 
27 763  LEU n 
27 764  ILE n 
27 765  GLU n 
27 766  LEU n 
27 767  ARG n 
27 768  LYS n 
27 769  LYS n 
27 770  LYS n 
27 771  ILE n 
27 772  GLU n 
27 773  GLU n 
27 774  ALA n 
27 775  MET n 
27 776  ASP n 
27 777  GLY n 
27 778  SER n 
27 779  GLU n 
27 780  THR n 
27 781  PRO n 
27 782  GLN n 
27 783  LEU n 
27 784  PHE n 
27 785  THR n 
27 786  VAL n 
27 787  LEU n 
27 788  PRO n 
27 789  GLU n 
27 790  LYS n 
27 791  ARG n 
27 792  THR n 
27 793  ALA n 
27 794  THR n 
27 795  VAL n 
27 796  GLY n 
27 797  GLY n 
27 798  ALA n 
27 799  MET n 
27 800  MET n 
27 801  GLY n 
27 802  SER n 
27 803  THR n 
27 804  HIS n 
27 805  ILE n 
27 806  TYR n 
27 807  ASP n 
27 808  MET n 
27 809  SER n 
27 810  THR n 
27 811  VAL n 
27 812  MET n 
27 813  SER n 
27 814  ARG n 
27 815  LYS n 
27 816  GLY n 
27 817  PRO n 
27 818  ALA n 
27 819  PRO n 
27 820  GLU n 
27 821  LEU n 
27 822  GLN n 
27 823  GLY n 
27 824  VAL n 
27 825  GLU n 
27 826  VAL n 
27 827  ALA n 
27 828  LEU n 
27 829  ALA n 
27 830  PRO n 
27 831  GLU n 
27 832  GLU n 
27 833  LEU n 
27 834  GLU n 
27 835  LEU n 
27 836  ASP n 
27 837  PRO n 
27 838  MET n 
27 839  ALA n 
27 840  MET n 
27 841  THR n 
27 842  GLN n 
27 843  LYS n 
27 844  TYR n 
27 845  GLU n 
27 846  GLU n 
27 847  HIS n 
27 848  VAL n 
27 849  ARG n 
27 850  GLU n 
27 851  GLN n 
27 852  GLN n 
27 853  ALA n 
27 854  GLN n 
27 855  VAL n 
27 856  GLU n 
27 857  LYS n 
27 858  GLU n 
27 859  ASP n 
27 860  PHE n 
27 861  SER n 
27 862  ASP n 
27 863  MET n 
27 864  VAL n 
27 865  ALA n 
27 866  GLU n 
27 867  HIS n 
27 868  ALA n 
27 869  ALA n 
27 870  LYS n 
27 871  GLN n 
27 872  LYS n 
27 873  GLN n 
27 874  LYS n 
27 875  LYS n 
27 876  ARG n 
27 877  LYS n 
27 878  ALA n 
27 879  GLN n 
27 880  PRO n 
27 881  GLN n 
27 882  ASP n 
27 883  SER n 
27 884  ARG n 
27 885  GLY n 
27 886  GLY n 
27 887  SER n 
27 888  LYS n 
27 889  LYS n 
27 890  TYR n 
27 891  LYS n 
27 892  GLU n 
27 893  PHE n 
27 894  LYS n 
27 895  PHE n 
28 1    MET n 
28 2    PHE n 
28 3    LEU n 
28 4    TYR n 
28 5    ASN n 
28 6    LEU n 
28 7    THR n 
28 8    LEU n 
28 9    GLN n 
28 10   ARG n 
28 11   ALA n 
28 12   THR n 
28 13   GLY n 
28 14   ILE n 
28 15   SER n 
28 16   PHE n 
28 17   ALA n 
28 18   ILE n 
28 19   HIS n 
28 20   GLY n 
28 21   ASN n 
28 22   PHE n 
28 23   SER n 
28 24   GLY n 
28 25   THR n 
28 26   LYS n 
28 27   GLN n 
28 28   GLN n 
28 29   GLU n 
28 30   ILE n 
28 31   VAL n 
28 32   VAL n 
28 33   SER n 
28 34   ARG n 
28 35   GLY n 
28 36   LYS n 
28 37   ILE n 
28 38   LEU n 
28 39   GLU n 
28 40   LEU n 
28 41   LEU n 
28 42   ARG n 
28 43   PRO n 
28 44   ASP n 
28 45   PRO n 
28 46   ASN n 
28 47   THR n 
28 48   GLY n 
28 49   LYS n 
28 50   VAL n 
28 51   HIS n 
28 52   THR n 
28 53   LEU n 
28 54   LEU n 
28 55   THR n 
28 56   VAL n 
28 57   GLU n 
28 58   VAL n 
28 59   PHE n 
28 60   GLY n 
28 61   VAL n 
28 62   ILE n 
28 63   ARG n 
28 64   SER n 
28 65   LEU n 
28 66   MET n 
28 67   ALA n 
28 68   PHE n 
28 69   ARG n 
28 70   LEU n 
28 71   THR n 
28 72   GLY n 
28 73   GLY n 
28 74   THR n 
28 75   LYS n 
28 76   ASP n 
28 77   TYR n 
28 78   ILE n 
28 79   VAL n 
28 80   VAL n 
28 81   GLY n 
28 82   SER n 
28 83   ASP n 
28 84   SER n 
28 85   GLY n 
28 86   ARG n 
28 87   ILE n 
28 88   VAL n 
28 89   ILE n 
28 90   LEU n 
28 91   GLU n 
28 92   TYR n 
28 93   GLN n 
28 94   PRO n 
28 95   SER n 
28 96   LYS n 
28 97   ASN n 
28 98   MET n 
28 99   PHE n 
28 100  GLU n 
28 101  LYS n 
28 102  ILE n 
28 103  HIS n 
28 104  GLN n 
28 105  GLU n 
28 106  THR n 
28 107  PHE n 
28 108  GLY n 
28 109  LYS n 
28 110  SER n 
28 111  GLY n 
28 112  CYS n 
28 113  ARG n 
28 114  ARG n 
28 115  ILE n 
28 116  VAL n 
28 117  PRO n 
28 118  GLY n 
28 119  GLN n 
28 120  PHE n 
28 121  LEU n 
28 122  ALA n 
28 123  VAL n 
28 124  ASP n 
28 125  PRO n 
28 126  LYS n 
28 127  GLY n 
28 128  ARG n 
28 129  ALA n 
28 130  VAL n 
28 131  MET n 
28 132  ILE n 
28 133  SER n 
28 134  ALA n 
28 135  ILE n 
28 136  GLU n 
28 137  LYS n 
28 138  GLN n 
28 139  LYS n 
28 140  LEU n 
28 141  VAL n 
28 142  TYR n 
28 143  ILE n 
28 144  LEU n 
28 145  ASN n 
28 146  ARG n 
28 147  ASP n 
28 148  ALA n 
28 149  ALA n 
28 150  ALA n 
28 151  ARG n 
28 152  LEU n 
28 153  THR n 
28 154  ILE n 
28 155  SER n 
28 156  SER n 
28 157  PRO n 
28 158  LEU n 
28 159  GLU n 
28 160  ALA n 
28 161  HIS n 
28 162  LYS n 
28 163  ALA n 
28 164  ASN n 
28 165  THR n 
28 166  LEU n 
28 167  VAL n 
28 168  TYR n 
28 169  HIS n 
28 170  VAL n 
28 171  VAL n 
28 172  GLY n 
28 173  VAL n 
28 174  ASP n 
28 175  VAL n 
28 176  GLY n 
28 177  PHE n 
28 178  GLU n 
28 179  ASN n 
28 180  PRO n 
28 181  MET n 
28 182  PHE n 
28 183  ALA n 
28 184  CYS n 
28 185  LEU n 
28 186  GLU n 
28 187  MET n 
28 188  ASP n 
28 189  TYR n 
28 190  GLU n 
28 191  GLU n 
28 192  ALA n 
28 193  ASP n 
28 194  ASN n 
28 195  ASP n 
28 196  PRO n 
28 197  THR n 
28 198  GLY n 
28 199  GLU n 
28 200  ALA n 
28 201  ALA n 
28 202  ALA n 
28 203  ASN n 
28 204  THR n 
28 205  GLN n 
28 206  GLN n 
28 207  THR n 
28 208  LEU n 
28 209  THR n 
28 210  PHE n 
28 211  TYR n 
28 212  GLU n 
28 213  LEU n 
28 214  ASP n 
28 215  LEU n 
28 216  GLY n 
28 217  LEU n 
28 218  ASN n 
28 219  HIS n 
28 220  VAL n 
28 221  VAL n 
28 222  ARG n 
28 223  LYS n 
28 224  TYR n 
28 225  SER n 
28 226  GLU n 
28 227  PRO n 
28 228  LEU n 
28 229  GLU n 
28 230  GLU n 
28 231  HIS n 
28 232  GLY n 
28 233  ASN n 
28 234  PHE n 
28 235  LEU n 
28 236  ILE n 
28 237  THR n 
28 238  VAL n 
28 239  PRO n 
28 240  GLY n 
28 241  GLY n 
28 242  SER n 
28 243  ASP n 
28 244  GLY n 
28 245  PRO n 
28 246  SER n 
28 247  GLY n 
28 248  VAL n 
28 249  LEU n 
28 250  ILE n 
28 251  CYS n 
28 252  SER n 
28 253  GLU n 
28 254  ASN n 
28 255  TYR n 
28 256  ILE n 
28 257  THR n 
28 258  TYR n 
28 259  LYS n 
28 260  ASN n 
28 261  PHE n 
28 262  GLY n 
28 263  ASP n 
28 264  GLN n 
28 265  PRO n 
28 266  ASP n 
28 267  ILE n 
28 268  ARG n 
28 269  CYS n 
28 270  PRO n 
28 271  ILE n 
28 272  PRO n 
28 273  ARG n 
28 274  ARG n 
28 275  ARG n 
28 276  ASN n 
28 277  ASP n 
28 278  LEU n 
28 279  ASP n 
28 280  ASP n 
28 281  PRO n 
28 282  GLU n 
28 283  ARG n 
28 284  GLY n 
28 285  MET n 
28 286  ILE n 
28 287  PHE n 
28 288  VAL n 
28 289  CYS n 
28 290  SER n 
28 291  ALA n 
28 292  THR n 
28 293  HIS n 
28 294  LYS n 
28 295  THR n 
28 296  LYS n 
28 297  SER n 
28 298  MET n 
28 299  PHE n 
28 300  PHE n 
28 301  PHE n 
28 302  LEU n 
28 303  ALA n 
28 304  GLN n 
28 305  THR n 
28 306  GLU n 
28 307  GLN n 
28 308  GLY n 
28 309  ASP n 
28 310  ILE n 
28 311  PHE n 
28 312  LYS n 
28 313  ILE n 
28 314  THR n 
28 315  LEU n 
28 316  GLU n 
28 317  THR n 
28 318  ASP n 
28 319  GLU n 
28 320  ASP n 
28 321  MET n 
28 322  VAL n 
28 323  THR n 
28 324  GLU n 
28 325  ILE n 
28 326  ARG n 
28 327  LEU n 
28 328  LYS n 
28 329  TYR n 
28 330  PHE n 
28 331  ASP n 
28 332  THR n 
28 333  VAL n 
28 334  PRO n 
28 335  VAL n 
28 336  ALA n 
28 337  ALA n 
28 338  ALA n 
28 339  MET n 
28 340  CYS n 
28 341  VAL n 
28 342  LEU n 
28 343  LYS n 
28 344  THR n 
28 345  GLY n 
28 346  PHE n 
28 347  LEU n 
28 348  PHE n 
28 349  VAL n 
28 350  ALA n 
28 351  SER n 
28 352  GLU n 
28 353  PHE n 
28 354  GLY n 
28 355  ASN n 
28 356  HIS n 
28 357  TYR n 
28 358  LEU n 
28 359  TYR n 
28 360  GLN n 
28 361  ILE n 
28 362  ALA n 
28 363  HIS n 
28 364  LEU n 
28 365  GLY n 
28 366  ASP n 
28 367  ASP n 
28 368  ASP n 
28 369  GLU n 
28 370  GLU n 
28 371  PRO n 
28 372  GLU n 
28 373  PHE n 
28 374  SER n 
28 375  SER n 
28 376  ALA n 
28 377  MET n 
28 378  PRO n 
28 379  LEU n 
28 380  GLU n 
28 381  GLU n 
28 382  GLY n 
28 383  ASP n 
28 384  THR n 
28 385  PHE n 
28 386  PHE n 
28 387  PHE n 
28 388  GLN n 
28 389  PRO n 
28 390  ARG n 
28 391  PRO n 
28 392  LEU n 
28 393  LYS n 
28 394  ASN n 
28 395  LEU n 
28 396  VAL n 
28 397  LEU n 
28 398  VAL n 
28 399  ASP n 
28 400  GLU n 
28 401  LEU n 
28 402  ASP n 
28 403  SER n 
28 404  LEU n 
28 405  SER n 
28 406  PRO n 
28 407  ILE n 
28 408  LEU n 
28 409  PHE n 
28 410  CYS n 
28 411  GLN n 
28 412  ILE n 
28 413  ALA n 
28 414  ASP n 
28 415  LEU n 
28 416  ALA n 
28 417  ASN n 
28 418  GLU n 
28 419  ASP n 
28 420  THR n 
28 421  PRO n 
28 422  GLN n 
28 423  LEU n 
28 424  TYR n 
28 425  VAL n 
28 426  ALA n 
28 427  CYS n 
28 428  GLY n 
28 429  ARG n 
28 430  GLY n 
28 431  PRO n 
28 432  ARG n 
28 433  SER n 
28 434  SER n 
28 435  LEU n 
28 436  ARG n 
28 437  VAL n 
28 438  LEU n 
28 439  ARG n 
28 440  HIS n 
28 441  GLY n 
28 442  LEU n 
28 443  GLU n 
28 444  VAL n 
28 445  SER n 
28 446  GLU n 
28 447  MET n 
28 448  ALA n 
28 449  VAL n 
28 450  SER n 
28 451  GLU n 
28 452  LEU n 
28 453  PRO n 
28 454  GLY n 
28 455  ASN n 
28 456  PRO n 
28 457  ASN n 
28 458  ALA n 
28 459  VAL n 
28 460  TRP n 
28 461  THR n 
28 462  VAL n 
28 463  ARG n 
28 464  ARG n 
28 465  HIS n 
28 466  ILE n 
28 467  GLU n 
28 468  ASP n 
28 469  GLU n 
28 470  PHE n 
28 471  ASP n 
28 472  ALA n 
28 473  TYR n 
28 474  ILE n 
28 475  ILE n 
28 476  VAL n 
28 477  SER n 
28 478  PHE n 
28 479  VAL n 
28 480  ASN n 
28 481  ALA n 
28 482  THR n 
28 483  LEU n 
28 484  VAL n 
28 485  LEU n 
28 486  SER n 
28 487  ILE n 
28 488  GLY n 
28 489  GLU n 
28 490  THR n 
28 491  VAL n 
28 492  GLU n 
28 493  GLU n 
28 494  VAL n 
28 495  THR n 
28 496  ASP n 
28 497  SER n 
28 498  GLY n 
28 499  PHE n 
28 500  LEU n 
28 501  GLY n 
28 502  THR n 
28 503  THR n 
28 504  PRO n 
28 505  THR n 
28 506  LEU n 
28 507  SER n 
28 508  CYS n 
28 509  SER n 
28 510  LEU n 
28 511  LEU n 
28 512  GLY n 
28 513  ASP n 
28 514  ASP n 
28 515  ALA n 
28 516  LEU n 
28 517  VAL n 
28 518  GLN n 
28 519  VAL n 
28 520  TYR n 
28 521  PRO n 
28 522  ASP n 
28 523  GLY n 
28 524  ILE n 
28 525  ARG n 
28 526  HIS n 
28 527  ILE n 
28 528  ARG n 
28 529  ALA n 
28 530  ASP n 
28 531  LYS n 
28 532  ARG n 
28 533  VAL n 
28 534  ASN n 
28 535  GLU n 
28 536  TRP n 
28 537  LYS n 
28 538  THR n 
28 539  PRO n 
28 540  GLY n 
28 541  LYS n 
28 542  LYS n 
28 543  THR n 
28 544  ILE n 
28 545  VAL n 
28 546  LYS n 
28 547  CYS n 
28 548  ALA n 
28 549  VAL n 
28 550  ASN n 
28 551  GLN n 
28 552  ARG n 
28 553  GLN n 
28 554  VAL n 
28 555  VAL n 
28 556  ILE n 
28 557  ALA n 
28 558  LEU n 
28 559  THR n 
28 560  GLY n 
28 561  GLY n 
28 562  GLU n 
28 563  LEU n 
28 564  VAL n 
28 565  TYR n 
28 566  PHE n 
28 567  GLU n 
28 568  MET n 
28 569  ASP n 
28 570  PRO n 
28 571  SER n 
28 572  GLY n 
28 573  GLN n 
28 574  LEU n 
28 575  ASN n 
28 576  GLU n 
28 577  TYR n 
28 578  THR n 
28 579  GLU n 
28 580  ARG n 
28 581  LYS n 
28 582  GLU n 
28 583  MET n 
28 584  SER n 
28 585  ALA n 
28 586  ASP n 
28 587  VAL n 
28 588  VAL n 
28 589  CYS n 
28 590  MET n 
28 591  SER n 
28 592  LEU n 
28 593  ALA n 
28 594  ASN n 
28 595  VAL n 
28 596  PRO n 
28 597  PRO n 
28 598  GLY n 
28 599  GLU n 
28 600  GLN n 
28 601  ARG n 
28 602  SER n 
28 603  ARG n 
28 604  PHE n 
28 605  LEU n 
28 606  ALA n 
28 607  VAL n 
28 608  GLY n 
28 609  LEU n 
28 610  VAL n 
28 611  ASP n 
28 612  ASN n 
28 613  THR n 
28 614  VAL n 
28 615  ARG n 
28 616  ILE n 
28 617  ILE n 
28 618  SER n 
28 619  LEU n 
28 620  ASP n 
28 621  PRO n 
28 622  SER n 
28 623  ASP n 
28 624  CYS n 
28 625  LEU n 
28 626  GLN n 
28 627  PRO n 
28 628  LEU n 
28 629  SER n 
28 630  MET n 
28 631  GLN n 
28 632  ALA n 
28 633  LEU n 
28 634  PRO n 
28 635  ALA n 
28 636  GLN n 
28 637  PRO n 
28 638  GLU n 
28 639  SER n 
28 640  LEU n 
28 641  CYS n 
28 642  ILE n 
28 643  VAL n 
28 644  GLU n 
28 645  MET n 
28 646  GLY n 
28 647  GLY n 
28 648  THR n 
28 649  GLU n 
28 650  LYS n 
28 651  GLN n 
28 652  ASP n 
28 653  GLU n 
28 654  LEU n 
28 655  GLY n 
28 656  GLU n 
28 657  ARG n 
28 658  GLY n 
28 659  SER n 
28 660  ILE n 
28 661  GLY n 
28 662  PHE n 
28 663  LEU n 
28 664  TYR n 
28 665  LEU n 
28 666  ASN n 
28 667  ILE n 
28 668  GLY n 
28 669  LEU n 
28 670  GLN n 
28 671  ASN n 
28 672  GLY n 
28 673  VAL n 
28 674  LEU n 
28 675  LEU n 
28 676  ARG n 
28 677  THR n 
28 678  VAL n 
28 679  LEU n 
28 680  ASP n 
28 681  PRO n 
28 682  VAL n 
28 683  THR n 
28 684  GLY n 
28 685  ASP n 
28 686  LEU n 
28 687  SER n 
28 688  ASP n 
28 689  THR n 
28 690  ARG n 
28 691  THR n 
28 692  ARG n 
28 693  TYR n 
28 694  LEU n 
28 695  GLY n 
28 696  SER n 
28 697  ARG n 
28 698  PRO n 
28 699  VAL n 
28 700  LYS n 
28 701  LEU n 
28 702  PHE n 
28 703  ARG n 
28 704  VAL n 
28 705  ARG n 
28 706  MET n 
28 707  GLN n 
28 708  GLY n 
28 709  GLN n 
28 710  GLU n 
28 711  ALA n 
28 712  VAL n 
28 713  LEU n 
28 714  ALA n 
28 715  MET n 
28 716  SER n 
28 717  SER n 
28 718  ARG n 
28 719  SER n 
28 720  TRP n 
28 721  LEU n 
28 722  SER n 
28 723  TYR n 
28 724  SER n 
28 725  TYR n 
28 726  GLN n 
28 727  SER n 
28 728  ARG n 
28 729  PHE n 
28 730  HIS n 
28 731  LEU n 
28 732  THR n 
28 733  PRO n 
28 734  LEU n 
28 735  SER n 
28 736  TYR n 
28 737  GLU n 
28 738  THR n 
28 739  LEU n 
28 740  GLU n 
28 741  PHE n 
28 742  ALA n 
28 743  SER n 
28 744  GLY n 
28 745  PHE n 
28 746  ALA n 
28 747  SER n 
28 748  GLU n 
28 749  GLN n 
28 750  CYS n 
28 751  PRO n 
28 752  GLU n 
28 753  GLY n 
28 754  ILE n 
28 755  VAL n 
28 756  ALA n 
28 757  ILE n 
28 758  SER n 
28 759  THR n 
28 760  ASN n 
28 761  THR n 
28 762  LEU n 
28 763  ARG n 
28 764  ILE n 
28 765  LEU n 
28 766  ALA n 
28 767  LEU n 
28 768  GLU n 
28 769  LYS n 
28 770  LEU n 
28 771  GLY n 
28 772  ALA n 
28 773  VAL n 
28 774  PHE n 
28 775  ASN n 
28 776  GLN n 
28 777  VAL n 
28 778  ALA n 
28 779  PHE n 
28 780  PRO n 
28 781  LEU n 
28 782  GLN n 
28 783  TYR n 
28 784  THR n 
28 785  PRO n 
28 786  ARG n 
28 787  LYS n 
28 788  PHE n 
28 789  VAL n 
28 790  ILE n 
28 791  HIS n 
28 792  PRO n 
28 793  GLU n 
28 794  SER n 
28 795  ASN n 
28 796  ASN n 
28 797  LEU n 
28 798  ILE n 
28 799  ILE n 
28 800  ILE n 
28 801  GLU n 
28 802  THR n 
28 803  ASP n 
28 804  HIS n 
28 805  ASN n 
28 806  ALA n 
28 807  TYR n 
28 808  THR n 
28 809  GLU n 
28 810  ALA n 
28 811  THR n 
28 812  LYS n 
28 813  ALA n 
28 814  GLN n 
28 815  ARG n 
28 816  LYS n 
28 817  GLN n 
28 818  GLN n 
28 819  MET n 
28 820  ALA n 
28 821  GLU n 
28 822  GLU n 
28 823  MET n 
28 824  VAL n 
28 825  GLU n 
28 826  ALA n 
28 827  ALA n 
28 828  GLY n 
28 829  GLU n 
28 830  ASP n 
28 831  GLU n 
28 832  ARG n 
28 833  GLU n 
28 834  LEU n 
28 835  ALA n 
28 836  ALA n 
28 837  GLU n 
28 838  MET n 
28 839  ALA n 
28 840  ALA n 
28 841  ALA n 
28 842  PHE n 
28 843  LEU n 
28 844  ASN n 
28 845  GLU n 
28 846  ASN n 
28 847  LEU n 
28 848  PRO n 
28 849  GLU n 
28 850  SER n 
28 851  ILE n 
28 852  PHE n 
28 853  GLY n 
28 854  ALA n 
28 855  PRO n 
28 856  LYS n 
28 857  ALA n 
28 858  GLY n 
28 859  ASN n 
28 860  GLY n 
28 861  GLN n 
28 862  TRP n 
28 863  ALA n 
28 864  SER n 
28 865  VAL n 
28 866  ILE n 
28 867  ARG n 
28 868  VAL n 
28 869  MET n 
28 870  ASN n 
28 871  PRO n 
28 872  ILE n 
28 873  GLN n 
28 874  GLY n 
28 875  ASN n 
28 876  THR n 
28 877  LEU n 
28 878  ASP n 
28 879  LEU n 
28 880  VAL n 
28 881  GLN n 
28 882  LEU n 
28 883  GLU n 
28 884  GLN n 
28 885  ASN n 
28 886  GLU n 
28 887  ALA n 
28 888  ALA n 
28 889  PHE n 
28 890  SER n 
28 891  VAL n 
28 892  ALA n 
28 893  VAL n 
28 894  CYS n 
28 895  ARG n 
28 896  PHE n 
28 897  SER n 
28 898  ASN n 
28 899  THR n 
28 900  GLY n 
28 901  GLU n 
28 902  ASP n 
28 903  TRP n 
28 904  TYR n 
28 905  VAL n 
28 906  LEU n 
28 907  VAL n 
28 908  GLY n 
28 909  VAL n 
28 910  ALA n 
28 911  LYS n 
28 912  ASP n 
28 913  LEU n 
28 914  ILE n 
28 915  LEU n 
28 916  ASN n 
28 917  PRO n 
28 918  ARG n 
28 919  SER n 
28 920  VAL n 
28 921  ALA n 
28 922  GLY n 
28 923  GLY n 
28 924  PHE n 
28 925  VAL n 
28 926  TYR n 
28 927  THR n 
28 928  TYR n 
28 929  LYS n 
28 930  LEU n 
28 931  VAL n 
28 932  ASN n 
28 933  ASN n 
28 934  GLY n 
28 935  GLU n 
28 936  LYS n 
28 937  LEU n 
28 938  GLU n 
28 939  PHE n 
28 940  LEU n 
28 941  HIS n 
28 942  LYS n 
28 943  THR n 
28 944  PRO n 
28 945  VAL n 
28 946  GLU n 
28 947  GLU n 
28 948  VAL n 
28 949  PRO n 
28 950  ALA n 
28 951  ALA n 
28 952  ILE n 
28 953  ALA n 
28 954  PRO n 
28 955  PHE n 
28 956  GLN n 
28 957  GLY n 
28 958  ARG n 
28 959  VAL n 
28 960  LEU n 
28 961  ILE n 
28 962  GLY n 
28 963  VAL n 
28 964  GLY n 
28 965  LYS n 
28 966  LEU n 
28 967  LEU n 
28 968  ARG n 
28 969  VAL n 
28 970  TYR n 
28 971  ASP n 
28 972  LEU n 
28 973  GLY n 
28 974  LYS n 
28 975  LYS n 
28 976  LYS n 
28 977  LEU n 
28 978  LEU n 
28 979  ARG n 
28 980  LYS n 
28 981  CYS n 
28 982  GLU n 
28 983  ASN n 
28 984  LYS n 
28 985  HIS n 
28 986  ILE n 
28 987  ALA n 
28 988  ASN n 
28 989  TYR n 
28 990  ILE n 
28 991  SER n 
28 992  GLY n 
28 993  ILE n 
28 994  GLN n 
28 995  THR n 
28 996  ILE n 
28 997  GLY n 
28 998  HIS n 
28 999  ARG n 
28 1000 VAL n 
28 1001 ILE n 
28 1002 VAL n 
28 1003 SER n 
28 1004 ASP n 
28 1005 VAL n 
28 1006 GLN n 
28 1007 GLU n 
28 1008 SER n 
28 1009 PHE n 
28 1010 ILE n 
28 1011 TRP n 
28 1012 VAL n 
28 1013 ARG n 
28 1014 TYR n 
28 1015 LYS n 
28 1016 ARG n 
28 1017 ASN n 
28 1018 GLU n 
28 1019 ASN n 
28 1020 GLN n 
28 1021 LEU n 
28 1022 ILE n 
28 1023 ILE n 
28 1024 PHE n 
28 1025 ALA n 
28 1026 ASP n 
28 1027 ASP n 
28 1028 THR n 
28 1029 TYR n 
28 1030 PRO n 
28 1031 ARG n 
28 1032 TRP n 
28 1033 VAL n 
28 1034 THR n 
28 1035 THR n 
28 1036 ALA n 
28 1037 SER n 
28 1038 LEU n 
28 1039 LEU n 
28 1040 ASP n 
28 1041 TYR n 
28 1042 ASP n 
28 1043 THR n 
28 1044 VAL n 
28 1045 ALA n 
28 1046 GLY n 
28 1047 ALA n 
28 1048 ASP n 
28 1049 LYS n 
28 1050 PHE n 
28 1051 GLY n 
28 1052 ASN n 
28 1053 ILE n 
28 1054 CYS n 
28 1055 VAL n 
28 1056 VAL n 
28 1057 ARG n 
28 1058 LEU n 
28 1059 PRO n 
28 1060 PRO n 
28 1061 ASN n 
28 1062 THR n 
28 1063 ASN n 
28 1064 ASP n 
28 1065 GLU n 
28 1066 VAL n 
28 1067 ASP n 
28 1068 GLU n 
28 1069 ASP n 
28 1070 PRO n 
28 1071 THR n 
28 1072 GLY n 
28 1073 ASN n 
28 1074 LYS n 
28 1075 ALA n 
28 1076 LEU n 
28 1077 TRP n 
28 1078 ASP n 
28 1079 ARG n 
28 1080 GLY n 
28 1081 LEU n 
28 1082 LEU n 
28 1083 ASN n 
28 1084 GLY n 
28 1085 ALA n 
28 1086 SER n 
28 1087 GLN n 
28 1088 LYS n 
28 1089 ALA n 
28 1090 GLU n 
28 1091 VAL n 
28 1092 ILE n 
28 1093 MET n 
28 1094 ASN n 
28 1095 TYR n 
28 1096 HIS n 
28 1097 VAL n 
28 1098 GLY n 
28 1099 GLU n 
28 1100 THR n 
28 1101 VAL n 
28 1102 LEU n 
28 1103 SER n 
28 1104 LEU n 
28 1105 GLN n 
28 1106 LYS n 
28 1107 THR n 
28 1108 THR n 
28 1109 LEU n 
28 1110 ILE n 
28 1111 PRO n 
28 1112 GLY n 
28 1113 GLY n 
28 1114 SER n 
28 1115 GLU n 
28 1116 SER n 
28 1117 LEU n 
28 1118 VAL n 
28 1119 TYR n 
28 1120 THR n 
28 1121 THR n 
28 1122 LEU n 
28 1123 SER n 
28 1124 GLY n 
28 1125 GLY n 
28 1126 ILE n 
28 1127 GLY n 
28 1128 ILE n 
28 1129 LEU n 
28 1130 VAL n 
28 1131 PRO n 
28 1132 PHE n 
28 1133 THR n 
28 1134 SER n 
28 1135 HIS n 
28 1136 GLU n 
28 1137 ASP n 
28 1138 HIS n 
28 1139 ASP n 
28 1140 PHE n 
28 1141 PHE n 
28 1142 GLN n 
28 1143 HIS n 
28 1144 VAL n 
28 1145 GLU n 
28 1146 MET n 
28 1147 HIS n 
28 1148 LEU n 
28 1149 ARG n 
28 1150 SER n 
28 1151 GLU n 
28 1152 HIS n 
28 1153 PRO n 
28 1154 PRO n 
28 1155 LEU n 
28 1156 CYS n 
28 1157 GLY n 
28 1158 ARG n 
28 1159 ASP n 
28 1160 HIS n 
28 1161 LEU n 
28 1162 SER n 
28 1163 PHE n 
28 1164 ARG n 
28 1165 SER n 
28 1166 TYR n 
28 1167 TYR n 
28 1168 PHE n 
28 1169 PRO n 
28 1170 VAL n 
28 1171 LYS n 
28 1172 ASN n 
28 1173 VAL n 
28 1174 ILE n 
28 1175 ASP n 
28 1176 GLY n 
28 1177 ASP n 
28 1178 LEU n 
28 1179 CYS n 
28 1180 GLU n 
28 1181 GLN n 
28 1182 PHE n 
28 1183 ASN n 
28 1184 SER n 
28 1185 MET n 
28 1186 GLU n 
28 1187 PRO n 
28 1188 ASN n 
28 1189 LYS n 
28 1190 GLN n 
28 1191 LYS n 
28 1192 ASN n 
28 1193 VAL n 
28 1194 SER n 
28 1195 GLU n 
28 1196 GLU n 
28 1197 LEU n 
28 1198 ASP n 
28 1199 ARG n 
28 1200 THR n 
28 1201 PRO n 
28 1202 PRO n 
28 1203 GLU n 
28 1204 VAL n 
28 1205 SER n 
28 1206 LYS n 
28 1207 LYS n 
28 1208 LEU n 
28 1209 GLU n 
28 1210 ASP n 
28 1211 ILE n 
28 1212 ARG n 
28 1213 THR n 
28 1214 ARG n 
28 1215 TYR n 
28 1216 ALA n 
28 1217 PHE n 
29 1    MET n 
29 2    ALA n 
29 3    ALA n 
29 4    GLY n 
29 5    PRO n 
29 6    ILE n 
29 7    SER n 
29 8    GLU n 
29 9    ARG n 
29 10   ASN n 
29 11   GLN n 
29 12   ASP n 
29 13   ALA n 
29 14   THR n 
29 15   VAL n 
29 16   TYR n 
29 17   VAL n 
29 18   GLY n 
29 19   GLY n 
29 20   LEU n 
29 21   ASP n 
29 22   GLU n 
29 23   LYS n 
29 24   VAL n 
29 25   SER n 
29 26   GLU n 
29 27   PRO n 
29 28   LEU n 
29 29   LEU n 
29 30   TRP n 
29 31   GLU n 
29 32   LEU n 
29 33   PHE n 
29 34   LEU n 
29 35   GLN n 
29 36   ALA n 
29 37   GLY n 
29 38   PRO n 
29 39   VAL n 
29 40   VAL n 
29 41   ASN n 
29 42   THR n 
29 43   HIS n 
29 44   MET n 
29 45   PRO n 
29 46   LYS n 
29 47   ASP n 
29 48   ARG n 
29 49   VAL n 
29 50   THR n 
29 51   GLY n 
29 52   GLN n 
29 53   HIS n 
29 54   GLN n 
29 55   GLY n 
29 56   TYR n 
29 57   GLY n 
29 58   PHE n 
29 59   VAL n 
29 60   GLU n 
29 61   PHE n 
29 62   LEU n 
29 63   SER n 
29 64   GLU n 
29 65   GLU n 
29 66   ASP n 
29 67   ALA n 
29 68   ASP n 
29 69   TYR n 
29 70   ALA n 
29 71   ILE n 
29 72   LYS n 
29 73   ILE n 
29 74   MET n 
29 75   ASN n 
29 76   MET n 
29 77   ILE n 
29 78   LYS n 
29 79   LEU n 
29 80   TYR n 
29 81   GLY n 
29 82   LYS n 
29 83   PRO n 
29 84   ILE n 
29 85   ARG n 
29 86   VAL n 
29 87   ASN n 
29 88   LYS n 
29 89   ALA n 
29 90   SER n 
29 91   ALA n 
29 92   HIS n 
29 93   ASN n 
29 94   LYS n 
29 95   ASN n 
29 96   LEU n 
29 97   ASP n 
29 98   VAL n 
29 99   GLY n 
29 100  ALA n 
29 101  ASN n 
29 102  ILE n 
29 103  PHE n 
29 104  ILE n 
29 105  GLY n 
29 106  ASN n 
29 107  LEU n 
29 108  ASP n 
29 109  PRO n 
29 110  GLU n 
29 111  ILE n 
29 112  ASP n 
29 113  GLU n 
29 114  LYS n 
29 115  LEU n 
29 116  LEU n 
29 117  TYR n 
29 118  ASP n 
29 119  THR n 
29 120  PHE n 
29 121  SER n 
29 122  ALA n 
29 123  PHE n 
29 124  GLY n 
29 125  VAL n 
29 126  ILE n 
29 127  LEU n 
29 128  GLN n 
29 129  THR n 
29 130  PRO n 
29 131  LYS n 
29 132  ILE n 
29 133  MET n 
29 134  ARG n 
29 135  ASP n 
29 136  PRO n 
29 137  ASP n 
29 138  THR n 
29 139  GLY n 
29 140  ASN n 
29 141  SER n 
29 142  LYS n 
29 143  GLY n 
29 144  TYR n 
29 145  ALA n 
29 146  PHE n 
29 147  ILE n 
29 148  ASN n 
29 149  PHE n 
29 150  ALA n 
29 151  SER n 
29 152  PHE n 
29 153  ASP n 
29 154  ALA n 
29 155  SER n 
29 156  ASP n 
29 157  ALA n 
29 158  ALA n 
29 159  ILE n 
29 160  GLU n 
29 161  ALA n 
29 162  MET n 
29 163  ASN n 
29 164  GLY n 
29 165  GLN n 
29 166  TYR n 
29 167  LEU n 
29 168  CYS n 
29 169  ASN n 
29 170  ARG n 
29 171  PRO n 
29 172  ILE n 
29 173  THR n 
29 174  VAL n 
29 175  SER n 
29 176  TYR n 
29 177  ALA n 
29 178  PHE n 
29 179  LYS n 
29 180  LYS n 
29 181  ASP n 
29 182  SER n 
29 183  LYS n 
29 184  GLY n 
29 185  GLU n 
29 186  ARG n 
29 187  HIS n 
29 188  GLY n 
29 189  SER n 
29 190  ALA n 
29 191  ALA n 
29 192  GLU n 
29 193  ARG n 
29 194  LEU n 
29 195  LEU n 
29 196  ALA n 
29 197  ALA n 
29 198  GLN n 
29 199  ASN n 
29 200  PRO n 
29 201  LEU n 
29 202  SER n 
29 203  GLN n 
29 204  ALA n 
29 205  ASP n 
29 206  ARG n 
29 207  PRO n 
29 208  HIS n 
29 209  GLN n 
29 210  LEU n 
29 211  PHE n 
29 212  ALA n 
29 213  ASP n 
29 214  ALA n 
29 215  PRO n 
29 216  PRO n 
29 217  PRO n 
29 218  PRO n 
29 219  SER n 
29 220  ALA n 
29 221  PRO n 
29 222  ASN n 
29 223  PRO n 
29 224  VAL n 
29 225  VAL n 
29 226  SER n 
29 227  SER n 
29 228  LEU n 
29 229  GLY n 
29 230  SER n 
29 231  GLY n 
29 232  LEU n 
29 233  PRO n 
29 234  PRO n 
29 235  PRO n 
29 236  GLY n 
29 237  MET n 
29 238  PRO n 
29 239  PRO n 
29 240  PRO n 
29 241  GLY n 
29 242  SER n 
29 243  PHE n 
29 244  PRO n 
29 245  PRO n 
29 246  PRO n 
29 247  VAL n 
29 248  PRO n 
29 249  PRO n 
29 250  PRO n 
29 251  GLY n 
29 252  ALA n 
29 253  LEU n 
29 254  PRO n 
29 255  PRO n 
29 256  GLY n 
29 257  ILE n 
29 258  PRO n 
29 259  PRO n 
29 260  ALA n 
29 261  MET n 
29 262  PRO n 
29 263  PRO n 
29 264  PRO n 
29 265  PRO n 
29 266  MET n 
29 267  PRO n 
29 268  PRO n 
29 269  GLY n 
29 270  ALA n 
29 271  ALA n 
29 272  GLY n 
29 273  HIS n 
29 274  GLY n 
29 275  PRO n 
29 276  PRO n 
29 277  SER n 
29 278  ALA n 
29 279  GLY n 
29 280  THR n 
29 281  PRO n 
29 282  GLY n 
29 283  ALA n 
29 284  GLY n 
29 285  HIS n 
29 286  PRO n 
29 287  GLY n 
29 288  HIS n 
29 289  GLY n 
29 290  HIS n 
29 291  SER n 
29 292  HIS n 
29 293  PRO n 
29 294  HIS n 
29 295  PRO n 
29 296  PHE n 
29 297  PRO n 
29 298  PRO n 
29 299  GLY n 
29 300  GLY n 
29 301  MET n 
29 302  PRO n 
29 303  HIS n 
29 304  PRO n 
29 305  GLY n 
29 306  MET n 
29 307  SER n 
29 308  GLN n 
29 309  MET n 
29 310  GLN n 
29 311  LEU n 
29 312  ALA n 
29 313  HIS n 
29 314  HIS n 
29 315  GLY n 
29 316  PRO n 
29 317  HIS n 
29 318  GLY n 
29 319  LEU n 
29 320  GLY n 
29 321  HIS n 
29 322  PRO n 
29 323  HIS n 
29 324  ALA n 
29 325  GLY n 
29 326  PRO n 
29 327  PRO n 
29 328  GLY n 
29 329  SER n 
29 330  GLY n 
29 331  GLY n 
29 332  GLN n 
29 333  PRO n 
29 334  PRO n 
29 335  PRO n 
29 336  ARG n 
29 337  PRO n 
29 338  PRO n 
29 339  PRO n 
29 340  GLY n 
29 341  MET n 
29 342  PRO n 
29 343  HIS n 
29 344  PRO n 
29 345  GLY n 
29 346  PRO n 
29 347  PRO n 
29 348  PRO n 
29 349  MET n 
29 350  GLY n 
29 351  MET n 
29 352  PRO n 
29 353  PRO n 
29 354  ARG n 
29 355  GLY n 
29 356  PRO n 
29 357  PRO n 
29 358  PHE n 
29 359  GLY n 
29 360  SER n 
29 361  PRO n 
29 362  MET n 
29 363  GLY n 
29 364  HIS n 
29 365  PRO n 
29 366  GLY n 
29 367  PRO n 
29 368  MET n 
29 369  PRO n 
29 370  PRO n 
29 371  HIS n 
29 372  GLY n 
29 373  MET n 
29 374  ARG n 
29 375  GLY n 
29 376  PRO n 
29 377  PRO n 
29 378  PRO n 
29 379  LEU n 
29 380  MET n 
29 381  PRO n 
29 382  PRO n 
29 383  HIS n 
29 384  GLY n 
29 385  TYR n 
29 386  THR n 
29 387  GLY n 
29 388  PRO n 
29 389  PRO n 
29 390  ARG n 
29 391  PRO n 
29 392  PRO n 
29 393  PRO n 
29 394  TYR n 
29 395  GLY n 
29 396  TYR n 
29 397  GLN n 
29 398  ARG n 
29 399  GLY n 
29 400  PRO n 
29 401  LEU n 
29 402  PRO n 
29 403  PRO n 
29 404  PRO n 
29 405  ARG n 
29 406  PRO n 
29 407  THR n 
29 408  PRO n 
29 409  ARG n 
29 410  PRO n 
29 411  PRO n 
29 412  VAL n 
29 413  PRO n 
29 414  PRO n 
29 415  ARG n 
29 416  GLY n 
29 417  PRO n 
29 418  LEU n 
29 419  ARG n 
29 420  GLY n 
29 421  PRO n 
29 422  LEU n 
29 423  PRO n 
29 424  GLN n 
30 1    MET n 
30 2    ALA n 
30 3    MET n 
30 4    GLN n 
30 5    ALA n 
30 6    ALA n 
30 7    LYS n 
30 8    ARG n 
30 9    ALA n 
30 10   ASN n 
30 11   ILE n 
30 12   ARG n 
30 13   LEU n 
30 14   PRO n 
30 15   PRO n 
30 16   GLU n 
30 17   VAL n 
30 18   ASN n 
30 19   ARG n 
30 20   ILE n 
30 21   LEU n 
30 22   TYR n 
30 23   ILE n 
30 24   ARG n 
30 25   ASN n 
30 26   LEU n 
30 27   PRO n 
30 28   TYR n 
30 29   LYS n 
30 30   ILE n 
30 31   THR n 
30 32   ALA n 
30 33   GLU n 
30 34   GLU n 
30 35   MET n 
30 36   TYR n 
30 37   ASP n 
30 38   ILE n 
30 39   PHE n 
30 40   GLY n 
30 41   LYS n 
30 42   TYR n 
30 43   GLY n 
30 44   PRO n 
30 45   ILE n 
30 46   ARG n 
30 47   GLN n 
30 48   ILE n 
30 49   ARG n 
30 50   VAL n 
30 51   GLY n 
30 52   ASN n 
30 53   THR n 
30 54   PRO n 
30 55   GLU n 
30 56   THR n 
30 57   ARG n 
30 58   GLY n 
30 59   THR n 
30 60   ALA n 
30 61   TYR n 
30 62   VAL n 
30 63   VAL n 
30 64   TYR n 
30 65   GLU n 
30 66   ASP n 
30 67   ILE n 
30 68   PHE n 
30 69   ASP n 
30 70   ALA n 
30 71   LYS n 
30 72   ASN n 
30 73   ALA n 
30 74   CYS n 
30 75   ASP n 
30 76   HIS n 
30 77   LEU n 
30 78   SER n 
30 79   GLY n 
30 80   PHE n 
30 81   ASN n 
30 82   VAL n 
30 83   CYS n 
30 84   ASN n 
30 85   ARG n 
30 86   TYR n 
30 87   LEU n 
30 88   VAL n 
30 89   VAL n 
30 90   LEU n 
30 91   TYR n 
30 92   TYR n 
30 93   ASN n 
30 94   ALA n 
30 95   ASN n 
30 96   ARG n 
30 97   ALA n 
30 98   PHE n 
30 99   GLN n 
30 100  LYS n 
30 101  MET n 
30 102  ASP n 
30 103  THR n 
30 104  LYS n 
30 105  LYS n 
30 106  LYS n 
30 107  GLU n 
30 108  GLU n 
30 109  GLN n 
30 110  LEU n 
30 111  LYS n 
30 112  LEU n 
30 113  LEU n 
30 114  LYS n 
30 115  GLU n 
30 116  LYS n 
30 117  TYR n 
30 118  GLY n 
30 119  ILE n 
30 120  ASN n 
30 121  THR n 
30 122  ASP n 
30 123  PRO n 
30 124  PRO n 
30 125  LYS n 
31 1    MET n 
31 2    ALA n 
31 3    LYS n 
31 4    HIS n 
31 5    HIS n 
31 6    PRO n 
31 7    ASP n 
31 8    LEU n 
31 9    ILE n 
31 10   PHE n 
31 11   CYS n 
31 12   ARG n 
31 13   LYS n 
31 14   GLN n 
31 15   ALA n 
31 16   GLY n 
31 17   VAL n 
31 18   ALA n 
31 19   ILE n 
31 20   GLY n 
31 21   ARG n 
31 22   LEU n 
31 23   CYS n 
31 24   GLU n 
31 25   LYS n 
31 26   CYS n 
31 27   ASP n 
31 28   GLY n 
31 29   LYS n 
31 30   CYS n 
31 31   VAL n 
31 32   ILE n 
31 33   CYS n 
31 34   ASP n 
31 35   SER n 
31 36   TYR n 
31 37   VAL n 
31 38   ARG n 
31 39   PRO n 
31 40   CYS n 
31 41   THR n 
31 42   LEU n 
31 43   VAL n 
31 44   ARG n 
31 45   ILE n 
31 46   CYS n 
31 47   ASP n 
31 48   GLU n 
31 49   CYS n 
31 50   ASN n 
31 51   TYR n 
31 52   GLY n 
31 53   SER n 
31 54   TYR n 
31 55   GLN n 
31 56   GLY n 
31 57   ARG n 
31 58   CYS n 
31 59   VAL n 
31 60   ILE n 
31 61   CYS n 
31 62   GLY n 
31 63   GLY n 
31 64   PRO n 
31 65   GLY n 
31 66   VAL n 
31 67   SER n 
31 68   ASP n 
31 69   ALA n 
31 70   TYR n 
31 71   TYR n 
31 72   CYS n 
31 73   LYS n 
31 74   GLU n 
31 75   CYS n 
31 76   THR n 
31 77   ILE n 
31 78   GLN n 
31 79   GLU n 
31 80   LYS n 
31 81   ASP n 
31 82   ARG n 
31 83   ASP n 
31 84   GLY n 
31 85   CYS n 
31 86   PRO n 
31 87   LYS n 
31 88   ILE n 
31 89   VAL n 
31 90   ASN n 
31 91   LEU n 
31 92   GLY n 
31 93   SER n 
31 94   SER n 
31 95   LYS n 
31 96   THR n 
31 97   ASP n 
31 98   LEU n 
31 99   PHE n 
31 100  TYR n 
31 101  GLU n 
31 102  ARG n 
31 103  LYS n 
31 104  LYS n 
31 105  TYR n 
31 106  GLY n 
31 107  PHE n 
31 108  LYS n 
31 109  LYS n 
31 110  ARG n 
32 1    MET n 
32 2    THR n 
32 3    ASP n 
32 4    ARG n 
32 5    TYR n 
32 6    THR n 
32 7    ILE n 
32 8    HIS n 
32 9    SER n 
32 10   GLN n 
32 11   LEU n 
32 12   GLU n 
32 13   HIS n 
32 14   LEU n 
32 15   GLN n 
32 16   SER n 
32 17   LYS n 
32 18   TYR n 
32 19   ILE n 
32 20   GLY n 
32 21   THR n 
32 22   GLY n 
32 23   HIS n 
32 24   ALA n 
32 25   ASP n 
32 26   THR n 
32 27   THR n 
32 28   LYS n 
32 29   TRP n 
32 30   GLU n 
32 31   TRP n 
32 32   LEU n 
32 33   VAL n 
32 34   ASN n 
32 35   GLN n 
32 36   HIS n 
32 37   ARG n 
32 38   ASP n 
32 39   SER n 
32 40   TYR n 
32 41   CYS n 
32 42   SER n 
32 43   TYR n 
32 44   MET n 
32 45   GLY n 
32 46   HIS n 
32 47   PHE n 
32 48   ASP n 
32 49   LEU n 
32 50   LEU n 
32 51   ASN n 
32 52   TYR n 
32 53   PHE n 
32 54   ALA n 
32 55   ILE n 
32 56   ALA n 
32 57   GLU n 
32 58   ASN n 
32 59   GLU n 
32 60   SER n 
32 61   LYS n 
32 62   ALA n 
32 63   ARG n 
32 64   VAL n 
32 65   ARG n 
32 66   PHE n 
32 67   ASN n 
32 68   LEU n 
32 69   MET n 
32 70   GLU n 
32 71   LYS n 
32 72   MET n 
32 73   LEU n 
32 74   GLN n 
32 75   PRO n 
32 76   CYS n 
32 77   GLY n 
32 78   PRO n 
32 79   PRO n 
32 80   ALA n 
32 81   ASP n 
32 82   LYS n 
32 83   PRO n 
32 84   GLU n 
32 85   GLU n 
32 86   ASN n 
33 1    MET n 
33 2    ALA n 
33 3    LEU n 
33 4    SER n 
33 5    LYS n 
33 6    ARG n 
33 7    GLU n 
33 8    LEU n 
33 9    ASP n 
33 10   GLU n 
33 11   LEU n 
33 12   LYS n 
33 13   PRO n 
33 14   TRP n 
33 15   ILE n 
33 16   GLU n 
33 17   LYS n 
33 18   THR n 
33 19   VAL n 
33 20   LYS n 
33 21   ARG n 
33 22   VAL n 
33 23   LEU n 
33 24   GLY n 
33 25   PHE n 
33 26   SER n 
33 27   GLU n 
33 28   PRO n 
33 29   THR n 
33 30   VAL n 
33 31   VAL n 
33 32   THR n 
33 33   ALA n 
33 34   ALA n 
33 35   LEU n 
33 36   ASN n 
33 37   CYS n 
33 38   VAL n 
33 39   GLY n 
33 40   LYS n 
33 41   GLY n 
33 42   MET n 
33 43   ASP n 
33 44   LYS n 
33 45   LYS n 
33 46   LYS n 
33 47   ALA n 
33 48   ALA n 
33 49   ASP n 
33 50   HIS n 
33 51   LEU n 
33 52   LYS n 
33 53   PRO n 
33 54   PHE n 
33 55   LEU n 
33 56   ASP n 
33 57   ASP n 
33 58   SER n 
33 59   THR n 
33 60   LEU n 
33 61   ARG n 
33 62   PHE n 
33 63   VAL n 
33 64   ASP n 
33 65   LYS n 
33 66   LEU n 
33 67   PHE n 
33 68   GLU n 
33 69   ALA n 
33 70   VAL n 
33 71   GLU n 
33 72   GLU n 
33 73   GLY n 
33 74   ARG n 
33 75   SER n 
33 76   SER n 
33 77   ARG n 
33 78   HIS n 
33 79   SER n 
33 80   LYS n 
33 81   SER n 
33 82   SER n 
33 83   SER n 
33 84   ASP n 
33 85   ARG n 
33 86   SER n 
33 87   ARG n 
33 88   LYS n 
33 89   ARG n 
33 90   GLU n 
33 91   LEU n 
33 92   LYS n 
33 93   GLU n 
33 94   VAL n 
33 95   PHE n 
33 96   GLY n 
33 97   ASP n 
33 98   ASP n 
33 99   SER n 
33 100  GLU n 
33 101  ILE n 
33 102  SER n 
33 103  LYS n 
33 104  GLU n 
33 105  SER n 
33 106  SER n 
33 107  GLY n 
33 108  VAL n 
33 109  LYS n 
33 110  LYS n 
33 111  ARG n 
33 112  ARG n 
33 113  ILE n 
33 114  PRO n 
33 115  ARG n 
33 116  PHE n 
33 117  GLU n 
33 118  GLU n 
33 119  VAL n 
33 120  GLU n 
33 121  GLU n 
33 122  GLU n 
33 123  PRO n 
33 124  GLU n 
33 125  VAL n 
33 126  ILE n 
33 127  PRO n 
33 128  GLY n 
33 129  PRO n 
33 130  PRO n 
33 131  SER n 
33 132  GLU n 
33 133  SER n 
33 134  PRO n 
33 135  GLY n 
33 136  MET n 
33 137  LEU n 
33 138  THR n 
33 139  LYS n 
33 140  LEU n 
33 141  GLN n 
33 142  ILE n 
33 143  LYS n 
33 144  GLN n 
33 145  MET n 
33 146  MET n 
33 147  GLU n 
33 148  ALA n 
33 149  ALA n 
33 150  THR n 
33 151  ARG n 
33 152  GLN n 
33 153  ILE n 
33 154  GLU n 
33 155  GLU n 
33 156  ARG n 
33 157  LYS n 
33 158  LYS n 
33 159  GLN n 
33 160  LEU n 
33 161  SER n 
33 162  PHE n 
33 163  ILE n 
33 164  SER n 
33 165  PRO n 
33 166  PRO n 
33 167  THR n 
33 168  PRO n 
33 169  GLN n 
33 170  PRO n 
33 171  LYS n 
33 172  THR n 
33 173  PRO n 
33 174  SER n 
33 175  SER n 
33 176  SER n 
33 177  GLN n 
33 178  PRO n 
33 179  GLU n 
33 180  ARG n 
33 181  LEU n 
33 182  PRO n 
33 183  ILE n 
33 184  GLY n 
33 185  ASN n 
33 186  THR n 
33 187  ILE n 
33 188  GLN n 
33 189  PRO n 
33 190  SER n 
33 191  GLN n 
33 192  ALA n 
33 193  ALA n 
33 194  THR n 
33 195  PHE n 
33 196  MET n 
33 197  ASN n 
33 198  ASP n 
33 199  ALA n 
33 200  ILE n 
33 201  GLU n 
33 202  LYS n 
33 203  ALA n 
33 204  ARG n 
33 205  LYS n 
33 206  ALA n 
33 207  ALA n 
33 208  GLU n 
33 209  LEU n 
33 210  GLN n 
33 211  ALA n 
33 212  ARG n 
33 213  ILE n 
33 214  GLN n 
33 215  ALA n 
33 216  GLN n 
33 217  LEU n 
33 218  ALA n 
33 219  LEU n 
33 220  LYS n 
33 221  PRO n 
33 222  GLY n 
33 223  LEU n 
33 224  ILE n 
33 225  GLY n 
33 226  ASN n 
33 227  ALA n 
33 228  ASN n 
33 229  MET n 
33 230  VAL n 
33 231  GLY n 
33 232  LEU n 
33 233  ALA n 
33 234  ASN n 
33 235  LEU n 
33 236  HIS n 
33 237  ALA n 
33 238  MET n 
33 239  GLY n 
33 240  ILE n 
33 241  ALA n 
33 242  PRO n 
33 243  PRO n 
33 244  LYS n 
33 245  VAL n 
33 246  GLU n 
33 247  LEU n 
33 248  LYS n 
33 249  ASP n 
33 250  GLN n 
33 251  THR n 
33 252  LYS n 
33 253  PRO n 
33 254  THR n 
33 255  PRO n 
33 256  LEU n 
33 257  ILE n 
33 258  LEU n 
33 259  ASP n 
33 260  GLU n 
33 261  GLN n 
33 262  GLY n 
33 263  ARG n 
33 264  THR n 
33 265  VAL n 
33 266  ASP n 
33 267  ALA n 
33 268  THR n 
33 269  GLY n 
33 270  LYS n 
33 271  GLU n 
33 272  ILE n 
33 273  GLU n 
33 274  LEU n 
33 275  THR n 
33 276  HIS n 
33 277  ARG n 
33 278  MET n 
33 279  PRO n 
33 280  THR n 
33 281  LEU n 
33 282  LYS n 
33 283  ALA n 
33 284  ASN n 
33 285  ILE n 
33 286  ARG n 
33 287  ALA n 
33 288  VAL n 
33 289  LYS n 
33 290  ARG n 
33 291  GLU n 
33 292  GLN n 
33 293  PHE n 
33 294  LYS n 
33 295  GLN n 
33 296  GLN n 
33 297  LEU n 
33 298  LYS n 
33 299  GLU n 
33 300  LYS n 
33 301  PRO n 
33 302  SER n 
33 303  GLU n 
33 304  ASP n 
33 305  MET n 
33 306  GLU n 
33 307  SER n 
33 308  ASN n 
33 309  THR n 
33 310  PHE n 
33 311  PHE n 
33 312  ASP n 
33 313  PRO n 
33 314  ARG n 
33 315  VAL n 
33 316  SER n 
33 317  ILE n 
33 318  ALA n 
33 319  PRO n 
33 320  SER n 
33 321  GLN n 
33 322  ARG n 
33 323  GLN n 
33 324  ARG n 
33 325  ARG n 
33 326  THR n 
33 327  PHE n 
33 328  LYS n 
33 329  PHE n 
33 330  HIS n 
33 331  ASP n 
33 332  LYS n 
33 333  GLY n 
33 334  LYS n 
33 335  PHE n 
33 336  GLU n 
33 337  LYS n 
33 338  ILE n 
33 339  ALA n 
33 340  GLN n 
33 341  ARG n 
33 342  LEU n 
33 343  ARG n 
33 344  THR n 
33 345  LYS n 
33 346  ALA n 
33 347  GLN n 
33 348  LEU n 
33 349  GLU n 
33 350  LYS n 
33 351  LEU n 
33 352  GLN n 
33 353  ALA n 
33 354  GLU n 
33 355  ILE n 
33 356  SER n 
33 357  GLN n 
33 358  ALA n 
33 359  ALA n 
33 360  ARG n 
33 361  LYS n 
33 362  THR n 
33 363  GLY n 
33 364  ILE n 
33 365  HIS n 
33 366  THR n 
33 367  SER n 
33 368  THR n 
33 369  ARG n 
33 370  LEU n 
33 371  ALA n 
33 372  LEU n 
33 373  ILE n 
33 374  ALA n 
33 375  PRO n 
33 376  LYS n 
33 377  LYS n 
33 378  GLU n 
33 379  LEU n 
33 380  LYS n 
33 381  GLU n 
33 382  GLY n 
33 383  ASP n 
33 384  ILE n 
33 385  PRO n 
33 386  GLU n 
33 387  ILE n 
33 388  GLU n 
33 389  TRP n 
33 390  TRP n 
33 391  ASP n 
33 392  SER n 
33 393  TYR n 
33 394  ILE n 
33 395  ILE n 
33 396  PRO n 
33 397  ASN n 
33 398  GLY n 
33 399  PHE n 
33 400  ASP n 
33 401  LEU n 
33 402  THR n 
33 403  GLU n 
33 404  GLU n 
33 405  ASN n 
33 406  PRO n 
33 407  LYS n 
33 408  ARG n 
33 409  GLU n 
33 410  ASP n 
33 411  TYR n 
33 412  PHE n 
33 413  GLY n 
33 414  ILE n 
33 415  THR n 
33 416  ASN n 
33 417  LEU n 
33 418  VAL n 
33 419  GLU n 
33 420  HIS n 
33 421  PRO n 
33 422  ALA n 
33 423  GLN n 
33 424  LEU n 
33 425  ASN n 
33 426  PRO n 
33 427  PRO n 
33 428  VAL n 
33 429  ASP n 
33 430  ASN n 
33 431  ASP n 
33 432  THR n 
33 433  PRO n 
33 434  VAL n 
33 435  THR n 
33 436  LEU n 
33 437  GLY n 
33 438  VAL n 
33 439  TYR n 
33 440  LEU n 
33 441  THR n 
33 442  LYS n 
33 443  LYS n 
33 444  GLU n 
33 445  GLN n 
33 446  LYS n 
33 447  LYS n 
33 448  LEU n 
33 449  ARG n 
33 450  ARG n 
33 451  GLN n 
33 452  THR n 
33 453  ARG n 
33 454  ARG n 
33 455  GLU n 
33 456  ALA n 
33 457  GLN n 
33 458  LYS n 
33 459  GLU n 
33 460  LEU n 
33 461  GLN n 
33 462  GLU n 
33 463  LYS n 
33 464  VAL n 
33 465  ARG n 
33 466  LEU n 
33 467  GLY n 
33 468  LEU n 
33 469  MET n 
33 470  PRO n 
33 471  PRO n 
33 472  PRO n 
33 473  GLU n 
33 474  PRO n 
33 475  LYS n 
33 476  VAL n 
33 477  ARG n 
33 478  ILE n 
33 479  SER n 
33 480  ASN n 
33 481  LEU n 
33 482  MET n 
33 483  ARG n 
33 484  VAL n 
33 485  LEU n 
33 486  GLY n 
33 487  THR n 
33 488  GLU n 
33 489  ALA n 
33 490  VAL n 
33 491  GLN n 
33 492  ASP n 
33 493  PRO n 
33 494  THR n 
33 495  LYS n 
33 496  VAL n 
33 497  GLU n 
33 498  ALA n 
33 499  HIS n 
33 500  VAL n 
33 501  ARG n 
33 502  ALA n 
33 503  GLN n 
33 504  MET n 
33 505  ALA n 
33 506  LYS n 
33 507  ARG n 
33 508  GLN n 
33 509  LYS n 
33 510  ALA n 
33 511  HIS n 
33 512  GLU n 
33 513  GLU n 
33 514  ALA n 
33 515  ASN n 
33 516  ALA n 
33 517  ALA n 
33 518  ARG n 
33 519  LYS n 
33 520  LEU n 
33 521  THR n 
33 522  ALA n 
33 523  GLU n 
33 524  GLN n 
33 525  ARG n 
33 526  LYS n 
33 527  VAL n 
33 528  LYS n 
33 529  LYS n 
33 530  ILE n 
33 531  LYS n 
33 532  LYS n 
33 533  LEU n 
33 534  LYS n 
33 535  GLU n 
33 536  ASP n 
33 537  ILE n 
33 538  SER n 
33 539  GLN n 
33 540  GLY n 
33 541  VAL n 
33 542  HIS n 
33 543  ILE n 
33 544  SER n 
33 545  VAL n 
33 546  TYR n 
33 547  ARG n 
33 548  VAL n 
33 549  ARG n 
33 550  ASN n 
33 551  LEU n 
33 552  SER n 
33 553  ASN n 
33 554  PRO n 
33 555  ALA n 
33 556  LYS n 
33 557  LYS n 
33 558  PHE n 
33 559  LYS n 
33 560  ILE n 
33 561  GLU n 
33 562  ALA n 
33 563  ASN n 
33 564  ALA n 
33 565  GLY n 
33 566  GLN n 
33 567  LEU n 
33 568  TYR n 
33 569  LEU n 
33 570  THR n 
33 571  GLY n 
33 572  VAL n 
33 573  VAL n 
33 574  VAL n 
33 575  LEU n 
33 576  HIS n 
33 577  LYS n 
33 578  ASP n 
33 579  VAL n 
33 580  ASN n 
33 581  VAL n 
33 582  VAL n 
33 583  VAL n 
33 584  VAL n 
33 585  GLU n 
33 586  GLY n 
33 587  GLY n 
33 588  PRO n 
33 589  LYS n 
33 590  ALA n 
33 591  GLN n 
33 592  LYS n 
33 593  LYS n 
33 594  PHE n 
33 595  LYS n 
33 596  ARG n 
33 597  LEU n 
33 598  MET n 
33 599  LEU n 
33 600  HIS n 
33 601  ARG n 
33 602  ILE n 
33 603  LYS n 
33 604  TRP n 
33 605  ASP n 
33 606  GLU n 
33 607  GLN n 
33 608  THR n 
33 609  SER n 
33 610  ASN n 
33 611  THR n 
33 612  LYS n 
33 613  GLY n 
33 614  ASP n 
33 615  ASP n 
33 616  ASP n 
33 617  GLU n 
33 618  GLU n 
33 619  SER n 
33 620  ASP n 
33 621  GLU n 
33 622  GLU n 
33 623  ALA n 
33 624  VAL n 
33 625  LYS n 
33 626  LYS n 
33 627  THR n 
33 628  ASN n 
33 629  LYS n 
33 630  CYS n 
33 631  VAL n 
33 632  LEU n 
33 633  VAL n 
33 634  TRP n 
33 635  GLU n 
33 636  GLY n 
33 637  THR n 
33 638  ALA n 
33 639  LYS n 
33 640  ASP n 
33 641  ARG n 
33 642  SER n 
33 643  PHE n 
33 644  GLY n 
33 645  GLU n 
33 646  MET n 
33 647  LYS n 
33 648  PHE n 
33 649  LYS n 
33 650  GLN n 
33 651  CYS n 
33 652  PRO n 
33 653  THR n 
33 654  GLU n 
33 655  ASN n 
33 656  MET n 
33 657  ALA n 
33 658  ARG n 
33 659  GLU n 
33 660  HIS n 
33 661  PHE n 
33 662  LYS n 
33 663  LYS n 
33 664  HIS n 
33 665  GLY n 
33 666  ALA n 
33 667  GLU n 
33 668  HIS n 
33 669  TYR n 
33 670  TRP n 
33 671  ASP n 
33 672  LEU n 
33 673  ALA n 
33 674  LEU n 
33 675  SER n 
33 676  GLU n 
33 677  SER n 
33 678  VAL n 
33 679  LEU n 
33 680  GLU n 
33 681  SER n 
33 682  THR n 
33 683  ASP n 
34 1    MET n 
34 2    ALA n 
34 3    SER n 
34 4    SER n 
34 5    ARG n 
34 6    ALA n 
34 7    SER n 
34 8    SER n 
34 9    THR n 
34 10   GLN n 
34 11   ALA n 
34 12   THR n 
34 13   LYS n 
34 14   THR n 
34 15   LYS n 
34 16   ALA n 
34 17   PRO n 
34 18   ASP n 
34 19   ASP n 
34 20   LEU n 
34 21   VAL n 
34 22   ALA n 
34 23   PRO n 
34 24   VAL n 
34 25   VAL n 
34 26   LYS n 
34 27   LYS n 
34 28   PRO n 
34 29   HIS n 
34 30   ILE n 
34 31   TYR n 
34 32   TYR n 
34 33   GLY n 
34 34   SER n 
34 35   LEU n 
34 36   GLU n 
34 37   GLU n 
34 38   LYS n 
34 39   GLU n 
34 40   ARG n 
34 41   GLU n 
34 42   ARG n 
34 43   LEU n 
34 44   ALA n 
34 45   LYS n 
34 46   GLY n 
34 47   GLU n 
34 48   SER n 
34 49   GLY n 
34 50   ILE n 
34 51   LEU n 
34 52   GLY n 
34 53   LYS n 
34 54   ASP n 
34 55   GLY n 
34 56   LEU n 
34 57   LYS n 
34 58   ALA n 
34 59   GLY n 
34 60   ILE n 
34 61   GLU n 
34 62   ALA n 
34 63   GLY n 
34 64   ASN n 
34 65   ILE n 
34 66   ASN n 
34 67   ILE n 
34 68   THR n 
34 69   SER n 
34 70   GLY n 
34 71   GLU n 
34 72   VAL n 
34 73   PHE n 
34 74   GLU n 
34 75   ILE n 
34 76   GLU n 
34 77   GLU n 
34 78   HIS n 
34 79   ILE n 
34 80   SER n 
34 81   GLU n 
34 82   ARG n 
34 83   GLN n 
34 84   ALA n 
34 85   GLU n 
34 86   VAL n 
34 87   LEU n 
34 88   ALA n 
34 89   GLU n 
34 90   PHE n 
34 91   GLU n 
34 92   ARG n 
34 93   ARG n 
34 94   LYS n 
34 95   ARG n 
34 96   ALA n 
34 97   ARG n 
34 98   GLN n 
34 99   ILE n 
34 100  ASN n 
34 101  VAL n 
34 102  SER n 
34 103  THR n 
34 104  ASP n 
34 105  ASP n 
34 106  SER n 
34 107  GLU n 
34 108  VAL n 
34 109  LYS n 
34 110  ALA n 
34 111  CYS n 
34 112  LEU n 
34 113  ARG n 
34 114  ALA n 
34 115  LEU n 
34 116  GLY n 
34 117  GLU n 
34 118  PRO n 
34 119  ILE n 
34 120  THR n 
34 121  LEU n 
34 122  PHE n 
34 123  GLY n 
34 124  GLU n 
34 125  GLY n 
34 126  PRO n 
34 127  ALA n 
34 128  GLU n 
34 129  ARG n 
34 130  ARG n 
34 131  GLU n 
34 132  ARG n 
34 133  LEU n 
34 134  ARG n 
34 135  ASN n 
34 136  ILE n 
34 137  LEU n 
34 138  SER n 
34 139  VAL n 
34 140  VAL n 
34 141  GLY n 
34 142  THR n 
34 143  ASP n 
34 144  ALA n 
34 145  LEU n 
34 146  LYS n 
34 147  LYS n 
34 148  THR n 
34 149  LYS n 
34 150  LYS n 
34 151  ASP n 
34 152  ASP n 
34 153  GLU n 
34 154  LYS n 
34 155  SER n 
34 156  LYS n 
34 157  LYS n 
34 158  SER n 
34 159  LYS n 
34 160  GLU n 
34 161  GLU n 
34 162  TYR n 
34 163  GLN n 
34 164  GLN n 
34 165  THR n 
34 166  TRP n 
34 167  TYR n 
34 168  HIS n 
34 169  GLU n 
34 170  GLY n 
34 171  PRO n 
34 172  ASN n 
34 173  SER n 
34 174  LEU n 
34 175  LYS n 
34 176  VAL n 
34 177  ALA n 
34 178  ARG n 
34 179  LEU n 
34 180  TRP n 
34 181  ILE n 
34 182  ALA n 
34 183  ASN n 
34 184  TYR n 
34 185  SER n 
34 186  LEU n 
34 187  PRO n 
34 188  ARG n 
34 189  ALA n 
34 190  MET n 
34 191  LYS n 
34 192  ARG n 
34 193  LEU n 
34 194  GLU n 
34 195  GLU n 
34 196  ALA n 
34 197  ARG n 
34 198  LEU n 
34 199  HIS n 
34 200  LYS n 
34 201  GLU n 
34 202  ILE n 
34 203  PRO n 
34 204  GLU n 
34 205  THR n 
34 206  THR n 
34 207  ARG n 
34 208  THR n 
34 209  SER n 
34 210  GLN n 
34 211  MET n 
34 212  GLN n 
34 213  GLU n 
34 214  LEU n 
34 215  HIS n 
34 216  LYS n 
34 217  SER n 
34 218  LEU n 
34 219  ARG n 
34 220  SER n 
34 221  LEU n 
34 222  ASN n 
34 223  ASN n 
34 224  PHE n 
34 225  CYS n 
34 226  SER n 
34 227  GLN n 
34 228  ILE n 
34 229  GLY n 
34 230  ASP n 
34 231  ASP n 
34 232  ARG n 
34 233  PRO n 
34 234  ILE n 
34 235  SER n 
34 236  TYR n 
34 237  CYS n 
34 238  HIS n 
34 239  PHE n 
34 240  SER n 
34 241  PRO n 
34 242  ASN n 
34 243  SER n 
34 244  LYS n 
34 245  MET n 
34 246  LEU n 
34 247  ALA n 
34 248  THR n 
34 249  ALA n 
34 250  CYS n 
34 251  TRP n 
34 252  SER n 
34 253  GLY n 
34 254  LEU n 
34 255  CYS n 
34 256  LYS n 
34 257  LEU n 
34 258  TRP n 
34 259  SER n 
34 260  VAL n 
34 261  PRO n 
34 262  ASP n 
34 263  CYS n 
34 264  ASN n 
34 265  LEU n 
34 266  LEU n 
34 267  HIS n 
34 268  THR n 
34 269  LEU n 
34 270  ARG n 
34 271  GLY n 
34 272  HIS n 
34 273  ASN n 
34 274  THR n 
34 275  ASN n 
34 276  VAL n 
34 277  GLY n 
34 278  ALA n 
34 279  ILE n 
34 280  VAL n 
34 281  PHE n 
34 282  HIS n 
34 283  PRO n 
34 284  LYS n 
34 285  SER n 
34 286  THR n 
34 287  VAL n 
34 288  SER n 
34 289  LEU n 
34 290  ASP n 
34 291  PRO n 
34 292  LYS n 
34 293  ASP n 
34 294  VAL n 
34 295  ASN n 
34 296  LEU n 
34 297  ALA n 
34 298  SER n 
34 299  CYS n 
34 300  ALA n 
34 301  ALA n 
34 302  ASP n 
34 303  GLY n 
34 304  SER n 
34 305  VAL n 
34 306  LYS n 
34 307  LEU n 
34 308  TRP n 
34 309  SER n 
34 310  LEU n 
34 311  ASP n 
34 312  SER n 
34 313  ASP n 
34 314  GLU n 
34 315  PRO n 
34 316  VAL n 
34 317  ALA n 
34 318  ASP n 
34 319  ILE n 
34 320  GLU n 
34 321  GLY n 
34 322  HIS n 
34 323  THR n 
34 324  VAL n 
34 325  ARG n 
34 326  VAL n 
34 327  ALA n 
34 328  ARG n 
34 329  VAL n 
34 330  MET n 
34 331  TRP n 
34 332  HIS n 
34 333  PRO n 
34 334  SER n 
34 335  GLY n 
34 336  ARG n 
34 337  PHE n 
34 338  LEU n 
34 339  GLY n 
34 340  THR n 
34 341  THR n 
34 342  CYS n 
34 343  TYR n 
34 344  ASP n 
34 345  ARG n 
34 346  SER n 
34 347  TRP n 
34 348  ARG n 
34 349  LEU n 
34 350  TRP n 
34 351  ASP n 
34 352  LEU n 
34 353  GLU n 
34 354  ALA n 
34 355  GLN n 
34 356  GLU n 
34 357  GLU n 
34 358  ILE n 
34 359  LEU n 
34 360  HIS n 
34 361  GLN n 
34 362  GLU n 
34 363  GLY n 
34 364  HIS n 
34 365  SER n 
34 366  MET n 
34 367  GLY n 
34 368  VAL n 
34 369  TYR n 
34 370  ASP n 
34 371  ILE n 
34 372  ALA n 
34 373  PHE n 
34 374  HIS n 
34 375  GLN n 
34 376  ASP n 
34 377  GLY n 
34 378  SER n 
34 379  LEU n 
34 380  ALA n 
34 381  GLY n 
34 382  THR n 
34 383  GLY n 
34 384  GLY n 
34 385  LEU n 
34 386  ASP n 
34 387  ALA n 
34 388  PHE n 
34 389  GLY n 
34 390  ARG n 
34 391  VAL n 
34 392  TRP n 
34 393  ASP n 
34 394  LEU n 
34 395  ARG n 
34 396  THR n 
34 397  GLY n 
34 398  ARG n 
34 399  CYS n 
34 400  ILE n 
34 401  MET n 
34 402  PHE n 
34 403  LEU n 
34 404  GLU n 
34 405  GLY n 
34 406  HIS n 
34 407  LEU n 
34 408  LYS n 
34 409  GLU n 
34 410  ILE n 
34 411  TYR n 
34 412  GLY n 
34 413  ILE n 
34 414  ASN n 
34 415  PHE n 
34 416  SER n 
34 417  PRO n 
34 418  ASN n 
34 419  GLY n 
34 420  TYR n 
34 421  HIS n 
34 422  ILE n 
34 423  ALA n 
34 424  THR n 
34 425  GLY n 
34 426  SER n 
34 427  GLY n 
34 428  ASP n 
34 429  ASN n 
34 430  THR n 
34 431  CYS n 
34 432  LYS n 
34 433  VAL n 
34 434  TRP n 
34 435  ASP n 
34 436  LEU n 
34 437  ARG n 
34 438  GLN n 
34 439  ARG n 
34 440  ARG n 
34 441  CYS n 
34 442  VAL n 
34 443  TYR n 
34 444  THR n 
34 445  ILE n 
34 446  PRO n 
34 447  ALA n 
34 448  HIS n 
34 449  GLN n 
34 450  ASN n 
34 451  LEU n 
34 452  VAL n 
34 453  THR n 
34 454  GLY n 
34 455  VAL n 
34 456  LYS n 
34 457  PHE n 
34 458  GLU n 
34 459  PRO n 
34 460  ILE n 
34 461  HIS n 
34 462  GLY n 
34 463  ASN n 
34 464  PHE n 
34 465  LEU n 
34 466  LEU n 
34 467  THR n 
34 468  GLY n 
34 469  ALA n 
34 470  TYR n 
34 471  ASP n 
34 472  ASN n 
34 473  THR n 
34 474  ALA n 
34 475  LYS n 
34 476  ILE n 
34 477  TRP n 
34 478  THR n 
34 479  HIS n 
34 480  PRO n 
34 481  GLY n 
34 482  TRP n 
34 483  SER n 
34 484  PRO n 
34 485  LEU n 
34 486  LYS n 
34 487  THR n 
34 488  LEU n 
34 489  ALA n 
34 490  GLY n 
34 491  HIS n 
34 492  GLU n 
34 493  GLY n 
34 494  LYS n 
34 495  VAL n 
34 496  MET n 
34 497  GLY n 
34 498  LEU n 
34 499  ASP n 
34 500  ILE n 
34 501  SER n 
34 502  SER n 
34 503  ASP n 
34 504  GLY n 
34 505  GLN n 
34 506  LEU n 
34 507  ILE n 
34 508  ALA n 
34 509  THR n 
34 510  CYS n 
34 511  SER n 
34 512  TYR n 
34 513  ASP n 
34 514  ARG n 
34 515  THR n 
34 516  PHE n 
34 517  LYS n 
34 518  LEU n 
34 519  TRP n 
34 520  MET n 
34 521  ALA n 
34 522  GLU n 
35 1    MET n 
35 2    ASN n 
35 3    LYS n 
35 4    LYS n 
35 5    LYS n 
35 6    LYS n 
35 7    PRO n 
35 8    PHE n 
35 9    LEU n 
35 10   GLY n 
35 11   MET n 
35 12   PRO n 
35 13   ALA n 
35 14   PRO n 
35 15   LEU n 
35 16   GLY n 
35 17   TYR n 
35 18   VAL n 
35 19   PRO n 
35 20   GLY n 
35 21   LEU n 
35 22   GLY n 
35 23   ARG n 
35 24   GLY n 
35 25   ALA n 
35 26   THR n 
35 27   GLY n 
35 28   PHE n 
35 29   THR n 
35 30   THR n 
35 31   ARG n 
35 32   SER n 
35 33   ASP n 
35 34   ILE n 
35 35   GLY n 
35 36   PRO n 
35 37   ALA n 
35 38   ARG n 
35 39   ASP n 
35 40   ALA n 
35 41   ASN n 
35 42   ASP n 
35 43   PRO n 
35 44   VAL n 
35 45   ASP n 
35 46   ASP n 
35 47   ARG n 
35 48   HIS n 
35 49   ALA n 
35 50   PRO n 
35 51   PRO n 
35 52   GLY n 
35 53   LYS n 
35 54   ARG n 
35 55   THR n 
35 56   VAL n 
35 57   GLY n 
35 58   ASP n 
35 59   GLN n 
35 60   MET n 
35 61   LYS n 
35 62   LYS n 
35 63   ASN n 
35 64   GLN n 
35 65   ALA n 
35 66   ALA n 
35 67   ASP n 
35 68   ASP n 
35 69   ASP n 
35 70   ASP n 
35 71   GLU n 
35 72   ASP n 
35 73   LEU n 
35 74   ASN n 
35 75   ASP n 
35 76   THR n 
35 77   ASN n 
35 78   TYR n 
35 79   ASP n 
35 80   GLU n 
35 81   PHE n 
35 82   ASN n 
35 83   GLY n 
35 84   TYR n 
35 85   ALA n 
35 86   GLY n 
35 87   SER n 
35 88   LEU n 
35 89   PHE n 
35 90   SER n 
35 91   SER n 
35 92   GLY n 
35 93   PRO n 
35 94   TYR n 
35 95   GLU n 
35 96   LYS n 
35 97   ASP n 
35 98   ASP n 
35 99   GLU n 
35 100  GLU n 
35 101  ALA n 
35 102  ASP n 
35 103  ALA n 
35 104  ILE n 
35 105  TYR n 
35 106  ALA n 
35 107  ALA n 
35 108  LEU n 
35 109  ASP n 
35 110  LYS n 
35 111  ARG n 
35 112  MET n 
35 113  ASP n 
35 114  GLU n 
35 115  ARG n 
35 116  ARG n 
35 117  LYS n 
35 118  GLU n 
35 119  ARG n 
35 120  ARG n 
35 121  GLU n 
35 122  GLN n 
35 123  ARG n 
35 124  GLU n 
35 125  LYS n 
35 126  GLU n 
35 127  GLU n 
35 128  ILE n 
35 129  GLU n 
35 130  LYS n 
35 131  TYR n 
35 132  ARG n 
35 133  MET n 
35 134  GLU n 
35 135  ARG n 
35 136  PRO n 
35 137  LYS n 
35 138  ILE n 
35 139  GLN n 
35 140  GLN n 
35 141  GLN n 
35 142  PHE n 
35 143  SER n 
35 144  ASP n 
35 145  LEU n 
35 146  LYS n 
35 147  ARG n 
35 148  LYS n 
35 149  LEU n 
35 150  ALA n 
35 151  GLU n 
35 152  VAL n 
35 153  THR n 
35 154  GLU n 
35 155  GLU n 
35 156  GLU n 
35 157  TRP n 
35 158  LEU n 
35 159  SER n 
35 160  ILE n 
35 161  PRO n 
35 162  GLU n 
35 163  VAL n 
35 164  GLY n 
35 165  ASP n 
35 166  ALA n 
35 167  ARG n 
35 168  ASN n 
35 169  LYS n 
35 170  ARG n 
35 171  GLN n 
35 172  ARG n 
35 173  ASN n 
35 174  PRO n 
35 175  ARG n 
35 176  TYR n 
35 177  GLU n 
35 178  LYS n 
35 179  LEU n 
35 180  THR n 
35 181  PRO n 
35 182  VAL n 
35 183  PRO n 
35 184  ASP n 
35 185  SER n 
35 186  PHE n 
35 187  PHE n 
35 188  ALA n 
35 189  LYS n 
35 190  HIS n 
35 191  LEU n 
35 192  GLN n 
35 193  THR n 
35 194  GLY n 
35 195  GLU n 
35 196  ASN n 
35 197  HIS n 
35 198  THR n 
35 199  SER n 
35 200  VAL n 
35 201  ASP n 
35 202  PRO n 
35 203  ARG n 
35 204  GLN n 
35 205  THR n 
35 206  GLN n 
35 207  PHE n 
35 208  GLY n 
35 209  GLY n 
35 210  LEU n 
35 211  ASN n 
35 212  THR n 
35 213  PRO n 
35 214  TYR n 
35 215  PRO n 
35 216  GLY n 
35 217  GLY n 
35 218  LEU n 
35 219  ASN n 
35 220  THR n 
35 221  PRO n 
35 222  TYR n 
35 223  PRO n 
35 224  GLY n 
35 225  GLY n 
35 226  MET n 
35 227  THR n 
35 228  PRO n 
35 229  GLY n 
35 230  LEU n 
35 231  MET n 
35 232  THR n 
35 233  PRO n 
35 234  GLY n 
35 235  THR n 
35 236  GLY n 
35 237  GLU n 
35 238  LEU n 
35 239  ASP n 
35 240  MET n 
35 241  ARG n 
35 242  LYS n 
35 243  ILE n 
35 244  GLY n 
35 245  GLN n 
35 246  ALA n 
35 247  ARG n 
35 248  ASN n 
35 249  THR n 
35 250  LEU n 
35 251  MET n 
35 252  ASP n 
35 253  MET n 
35 254  ARG n 
35 255  LEU n 
35 256  SER n 
35 257  GLN n 
35 258  VAL n 
35 259  SER n 
35 260  ASP n 
35 261  SER n 
35 262  VAL n 
35 263  SER n 
35 264  GLY n 
35 265  GLN n 
35 266  THR n 
35 267  VAL n 
35 268  VAL n 
35 269  ASP n 
35 270  PRO n 
35 271  LYS n 
35 272  GLY n 
35 273  TYR n 
35 274  LEU n 
35 275  THR n 
35 276  ASP n 
35 277  LEU n 
35 278  ASN n 
35 279  SER n 
35 280  MET n 
35 281  ILE n 
35 282  PRO n 
35 283  THR n 
35 284  HIS n 
35 285  GLY n 
35 286  GLY n 
35 287  ASP n 
35 288  ILE n 
35 289  ASN n 
35 290  ASP n 
35 291  ILE n 
35 292  LYS n 
35 293  LYS n 
35 294  ALA n 
35 295  ARG n 
35 296  LEU n 
35 297  LEU n 
35 298  LEU n 
35 299  LYS n 
35 300  SER n 
35 301  VAL n 
35 302  ARG n 
35 303  GLU n 
35 304  THR n 
35 305  ASN n 
35 306  PRO n 
35 307  HIS n 
35 308  HIS n 
35 309  PRO n 
35 310  PRO n 
35 311  ALA n 
35 312  TRP n 
35 313  ILE n 
35 314  ALA n 
35 315  SER n 
35 316  ALA n 
35 317  ARG n 
35 318  LEU n 
35 319  GLU n 
35 320  GLU n 
35 321  VAL n 
35 322  THR n 
35 323  GLY n 
35 324  LYS n 
35 325  LEU n 
35 326  GLN n 
35 327  VAL n 
35 328  ALA n 
35 329  ARG n 
35 330  ASN n 
35 331  LEU n 
35 332  ILE n 
35 333  MET n 
35 334  LYS n 
35 335  GLY n 
35 336  THR n 
35 337  GLU n 
35 338  MET n 
35 339  CYS n 
35 340  PRO n 
35 341  LYS n 
35 342  SER n 
35 343  GLU n 
35 344  ASP n 
35 345  VAL n 
35 346  TRP n 
35 347  LEU n 
35 348  GLU n 
35 349  ALA n 
35 350  ALA n 
35 351  ARG n 
35 352  LEU n 
35 353  GLN n 
35 354  PRO n 
35 355  GLY n 
35 356  ASP n 
35 357  THR n 
35 358  ALA n 
35 359  LYS n 
35 360  ALA n 
35 361  VAL n 
35 362  VAL n 
35 363  ALA n 
35 364  GLN n 
35 365  ALA n 
35 366  VAL n 
35 367  ARG n 
35 368  HIS n 
35 369  LEU n 
35 370  PRO n 
35 371  GLN n 
35 372  SER n 
35 373  VAL n 
35 374  ARG n 
35 375  ILE n 
35 376  TYR n 
35 377  ILE n 
35 378  ARG n 
35 379  ALA n 
35 380  ALA n 
35 381  GLU n 
35 382  LEU n 
35 383  GLU n 
35 384  THR n 
35 385  ASP n 
35 386  ILE n 
35 387  ARG n 
35 388  ALA n 
35 389  LYS n 
35 390  LYS n 
35 391  ARG n 
35 392  VAL n 
35 393  LEU n 
35 394  ARG n 
35 395  LYS n 
35 396  ALA n 
35 397  LEU n 
35 398  GLU n 
35 399  HIS n 
35 400  VAL n 
35 401  PRO n 
35 402  ASN n 
35 403  SER n 
35 404  VAL n 
35 405  ARG n 
35 406  LEU n 
35 407  TRP n 
35 408  LYS n 
35 409  ALA n 
35 410  ALA n 
35 411  VAL n 
35 412  GLU n 
35 413  LEU n 
35 414  GLU n 
35 415  GLU n 
35 416  PRO n 
35 417  GLU n 
35 418  ASP n 
35 419  ALA n 
35 420  ARG n 
35 421  ILE n 
35 422  MET n 
35 423  LEU n 
35 424  SER n 
35 425  ARG n 
35 426  ALA n 
35 427  VAL n 
35 428  GLU n 
35 429  CYS n 
35 430  CYS n 
35 431  PRO n 
35 432  THR n 
35 433  SER n 
35 434  VAL n 
35 435  GLU n 
35 436  LEU n 
35 437  TRP n 
35 438  LEU n 
35 439  ALA n 
35 440  LEU n 
35 441  ALA n 
35 442  ARG n 
35 443  LEU n 
35 444  GLU n 
35 445  THR n 
35 446  TYR n 
35 447  GLU n 
35 448  ASN n 
35 449  ALA n 
35 450  ARG n 
35 451  LYS n 
35 452  VAL n 
35 453  LEU n 
35 454  ASN n 
35 455  LYS n 
35 456  ALA n 
35 457  ARG n 
35 458  GLU n 
35 459  ASN n 
35 460  ILE n 
35 461  PRO n 
35 462  THR n 
35 463  ASP n 
35 464  ARG n 
35 465  HIS n 
35 466  ILE n 
35 467  TRP n 
35 468  ILE n 
35 469  THR n 
35 470  ALA n 
35 471  ALA n 
35 472  LYS n 
35 473  LEU n 
35 474  GLU n 
35 475  GLU n 
35 476  ALA n 
35 477  ASN n 
35 478  GLY n 
35 479  ASN n 
35 480  THR n 
35 481  GLN n 
35 482  MET n 
35 483  VAL n 
35 484  GLU n 
35 485  LYS n 
35 486  ILE n 
35 487  ILE n 
35 488  ASP n 
35 489  ARG n 
35 490  ALA n 
35 491  ILE n 
35 492  THR n 
35 493  SER n 
35 494  LEU n 
35 495  ARG n 
35 496  ALA n 
35 497  ASN n 
35 498  GLY n 
35 499  VAL n 
35 500  GLU n 
35 501  ILE n 
35 502  ASN n 
35 503  ARG n 
35 504  GLU n 
35 505  GLN n 
35 506  TRP n 
35 507  ILE n 
35 508  GLN n 
35 509  ASP n 
35 510  ALA n 
35 511  GLU n 
35 512  GLU n 
35 513  CYS n 
35 514  ASP n 
35 515  ARG n 
35 516  ALA n 
35 517  GLY n 
35 518  SER n 
35 519  VAL n 
35 520  ALA n 
35 521  THR n 
35 522  CYS n 
35 523  GLN n 
35 524  ALA n 
35 525  VAL n 
35 526  MET n 
35 527  ARG n 
35 528  ALA n 
35 529  VAL n 
35 530  ILE n 
35 531  GLY n 
35 532  ILE n 
35 533  GLY n 
35 534  ILE n 
35 535  GLU n 
35 536  GLU n 
35 537  GLU n 
35 538  ASP n 
35 539  ARG n 
35 540  LYS n 
35 541  HIS n 
35 542  THR n 
35 543  TRP n 
35 544  MET n 
35 545  GLU n 
35 546  ASP n 
35 547  ALA n 
35 548  ASP n 
35 549  SER n 
35 550  CYS n 
35 551  VAL n 
35 552  ALA n 
35 553  HIS n 
35 554  ASN n 
35 555  ALA n 
35 556  LEU n 
35 557  GLU n 
35 558  CYS n 
35 559  ALA n 
35 560  ARG n 
35 561  ALA n 
35 562  ILE n 
35 563  TYR n 
35 564  ALA n 
35 565  TYR n 
35 566  ALA n 
35 567  LEU n 
35 568  GLN n 
35 569  VAL n 
35 570  PHE n 
35 571  PRO n 
35 572  SER n 
35 573  LYS n 
35 574  LYS n 
35 575  SER n 
35 576  VAL n 
35 577  TRP n 
35 578  LEU n 
35 579  ARG n 
35 580  ALA n 
35 581  ALA n 
35 582  TYR n 
35 583  PHE n 
35 584  GLU n 
35 585  LYS n 
35 586  ASN n 
35 587  HIS n 
35 588  GLY n 
35 589  THR n 
35 590  ARG n 
35 591  GLU n 
35 592  SER n 
35 593  LEU n 
35 594  GLU n 
35 595  ALA n 
35 596  LEU n 
35 597  LEU n 
35 598  GLN n 
35 599  ARG n 
35 600  ALA n 
35 601  VAL n 
35 602  ALA n 
35 603  HIS n 
35 604  CYS n 
35 605  PRO n 
35 606  LYS n 
35 607  ALA n 
35 608  GLU n 
35 609  VAL n 
35 610  LEU n 
35 611  TRP n 
35 612  LEU n 
35 613  MET n 
35 614  GLY n 
35 615  ALA n 
35 616  LYS n 
35 617  SER n 
35 618  LYS n 
35 619  TRP n 
35 620  LEU n 
35 621  ALA n 
35 622  GLY n 
35 623  ASP n 
35 624  VAL n 
35 625  PRO n 
35 626  ALA n 
35 627  ALA n 
35 628  ARG n 
35 629  SER n 
35 630  ILE n 
35 631  LEU n 
35 632  ALA n 
35 633  LEU n 
35 634  ALA n 
35 635  PHE n 
35 636  GLN n 
35 637  ALA n 
35 638  ASN n 
35 639  PRO n 
35 640  ASN n 
35 641  SER n 
35 642  GLU n 
35 643  GLU n 
35 644  ILE n 
35 645  TRP n 
35 646  LEU n 
35 647  ALA n 
35 648  ALA n 
35 649  VAL n 
35 650  LYS n 
35 651  LEU n 
35 652  GLU n 
35 653  SER n 
35 654  GLU n 
35 655  ASN n 
35 656  ASP n 
35 657  GLU n 
35 658  TYR n 
35 659  GLU n 
35 660  ARG n 
35 661  ALA n 
35 662  ARG n 
35 663  ARG n 
35 664  LEU n 
35 665  LEU n 
35 666  ALA n 
35 667  LYS n 
35 668  ALA n 
35 669  ARG n 
35 670  SER n 
35 671  SER n 
35 672  ALA n 
35 673  PRO n 
35 674  THR n 
35 675  ALA n 
35 676  ARG n 
35 677  VAL n 
35 678  PHE n 
35 679  MET n 
35 680  LYS n 
35 681  SER n 
35 682  VAL n 
35 683  LYS n 
35 684  LEU n 
35 685  GLU n 
35 686  TRP n 
35 687  VAL n 
35 688  GLN n 
35 689  ASP n 
35 690  ASN n 
35 691  ILE n 
35 692  ARG n 
35 693  ALA n 
35 694  ALA n 
35 695  GLN n 
35 696  ASP n 
35 697  LEU n 
35 698  CYS n 
35 699  GLU n 
35 700  GLU n 
35 701  ALA n 
35 702  LEU n 
35 703  ARG n 
35 704  HIS n 
35 705  TYR n 
35 706  GLU n 
35 707  ASP n 
35 708  PHE n 
35 709  PRO n 
35 710  LYS n 
35 711  LEU n 
35 712  TRP n 
35 713  MET n 
35 714  MET n 
35 715  LYS n 
35 716  GLY n 
35 717  GLN n 
35 718  ILE n 
35 719  GLU n 
35 720  GLU n 
35 721  GLN n 
35 722  LYS n 
35 723  GLU n 
35 724  MET n 
35 725  MET n 
35 726  GLU n 
35 727  LYS n 
35 728  ALA n 
35 729  ARG n 
35 730  GLU n 
35 731  ALA n 
35 732  TYR n 
35 733  ASN n 
35 734  GLN n 
35 735  GLY n 
35 736  LEU n 
35 737  LYS n 
35 738  LYS n 
35 739  CYS n 
35 740  PRO n 
35 741  HIS n 
35 742  SER n 
35 743  THR n 
35 744  PRO n 
35 745  LEU n 
35 746  TRP n 
35 747  LEU n 
35 748  LEU n 
35 749  LEU n 
35 750  SER n 
35 751  ARG n 
35 752  LEU n 
35 753  GLU n 
35 754  GLU n 
35 755  LYS n 
35 756  ILE n 
35 757  GLY n 
35 758  GLN n 
35 759  LEU n 
35 760  THR n 
35 761  ARG n 
35 762  ALA n 
35 763  ARG n 
35 764  ALA n 
35 765  ILE n 
35 766  LEU n 
35 767  GLU n 
35 768  LYS n 
35 769  SER n 
35 770  ARG n 
35 771  LEU n 
35 772  LYS n 
35 773  ASN n 
35 774  PRO n 
35 775  LYS n 
35 776  ASN n 
35 777  PRO n 
35 778  GLY n 
35 779  LEU n 
35 780  TRP n 
35 781  LEU n 
35 782  GLU n 
35 783  SER n 
35 784  VAL n 
35 785  ARG n 
35 786  LEU n 
35 787  GLU n 
35 788  TYR n 
35 789  ARG n 
35 790  ALA n 
35 791  GLY n 
35 792  LEU n 
35 793  LYS n 
35 794  ASN n 
35 795  ILE n 
35 796  ALA n 
35 797  ASN n 
35 798  THR n 
35 799  LEU n 
35 800  MET n 
35 801  ALA n 
35 802  LYS n 
35 803  ALA n 
35 804  LEU n 
35 805  GLN n 
35 806  GLU n 
35 807  CYS n 
35 808  PRO n 
35 809  ASN n 
35 810  SER n 
35 811  GLY n 
35 812  ILE n 
35 813  LEU n 
35 814  TRP n 
35 815  SER n 
35 816  GLU n 
35 817  ALA n 
35 818  ILE n 
35 819  PHE n 
35 820  LEU n 
35 821  GLU n 
35 822  ALA n 
35 823  ARG n 
35 824  PRO n 
35 825  GLN n 
35 826  ARG n 
35 827  ARG n 
35 828  THR n 
35 829  LYS n 
35 830  SER n 
35 831  VAL n 
35 832  ASP n 
35 833  ALA n 
35 834  LEU n 
35 835  LYS n 
35 836  LYS n 
35 837  CYS n 
35 838  GLU n 
35 839  HIS n 
35 840  ASP n 
35 841  PRO n 
35 842  HIS n 
35 843  VAL n 
35 844  LEU n 
35 845  LEU n 
35 846  ALA n 
35 847  VAL n 
35 848  ALA n 
35 849  LYS n 
35 850  LEU n 
35 851  PHE n 
35 852  TRP n 
35 853  SER n 
35 854  GLN n 
35 855  ARG n 
35 856  LYS n 
35 857  ILE n 
35 858  THR n 
35 859  LYS n 
35 860  ALA n 
35 861  ARG n 
35 862  GLU n 
35 863  TRP n 
35 864  PHE n 
35 865  HIS n 
35 866  ARG n 
35 867  THR n 
35 868  VAL n 
35 869  LYS n 
35 870  ILE n 
35 871  ASP n 
35 872  SER n 
35 873  ASP n 
35 874  LEU n 
35 875  GLY n 
35 876  ASP n 
35 877  ALA n 
35 878  TRP n 
35 879  ALA n 
35 880  PHE n 
35 881  PHE n 
35 882  TYR n 
35 883  LYS n 
35 884  PHE n 
35 885  GLU n 
35 886  LEU n 
35 887  GLN n 
35 888  HIS n 
35 889  GLY n 
35 890  THR n 
35 891  GLU n 
35 892  GLU n 
35 893  GLN n 
35 894  GLN n 
35 895  GLU n 
35 896  GLU n 
35 897  VAL n 
35 898  ARG n 
35 899  LYS n 
35 900  ARG n 
35 901  CYS n 
35 902  GLU n 
35 903  SER n 
35 904  ALA n 
35 905  GLU n 
35 906  PRO n 
35 907  ARG n 
35 908  HIS n 
35 909  GLY n 
35 910  GLU n 
35 911  LEU n 
35 912  TRP n 
35 913  CYS n 
35 914  ALA n 
35 915  VAL n 
35 916  SER n 
35 917  LYS n 
35 918  ASP n 
35 919  ILE n 
35 920  ALA n 
35 921  ASN n 
35 922  TRP n 
35 923  GLN n 
35 924  LYS n 
35 925  LYS n 
35 926  ILE n 
35 927  GLY n 
35 928  ASP n 
35 929  ILE n 
35 930  LEU n 
35 931  ARG n 
35 932  LEU n 
35 933  VAL n 
35 934  ALA n 
35 935  GLY n 
35 936  ARG n 
35 937  ILE n 
35 938  LYS n 
35 939  ASN n 
35 940  THR n 
35 941  PHE n 
36 1    MET n 
36 2    SER n 
36 3    LEU n 
36 4    ALA n 
36 5    ASP n 
36 6    GLU n 
36 7    LEU n 
36 8    LEU n 
36 9    ALA n 
36 10   ASP n 
36 11   LEU n 
36 12   GLU n 
36 13   GLU n 
36 14   ALA n 
36 15   ALA n 
36 16   GLU n 
36 17   GLU n 
36 18   GLU n 
36 19   GLU n 
36 20   GLY n 
36 21   GLY n 
36 22   SER n 
36 23   TYR n 
36 24   GLY n 
36 25   GLU n 
36 26   GLU n 
36 27   GLU n 
36 28   GLU n 
36 29   GLU n 
36 30   PRO n 
36 31   ALA n 
36 32   ILE n 
36 33   GLU n 
36 34   ASP n 
36 35   VAL n 
36 36   GLN n 
36 37   GLU n 
36 38   GLU n 
36 39   THR n 
36 40   GLN n 
36 41   LEU n 
36 42   ASP n 
36 43   LEU n 
36 44   SER n 
36 45   GLY n 
36 46   ASP n 
36 47   SER n 
36 48   VAL n 
36 49   LYS n 
36 50   THR n 
36 51   ILE n 
36 52   ALA n 
36 53   LYS n 
36 54   LEU n 
36 55   TRP n 
36 56   ASP n 
36 57   SER n 
36 58   LYS n 
36 59   MET n 
36 60   PHE n 
36 61   ALA n 
36 62   GLU n 
36 63   ILE n 
36 64   MET n 
36 65   MET n 
36 66   LYS n 
36 67   ILE n 
36 68   GLU n 
36 69   GLU n 
36 70   TYR n 
36 71   ILE n 
36 72   SER n 
36 73   LYS n 
36 74   GLN n 
36 75   ALA n 
36 76   LYS n 
36 77   ALA n 
36 78   SER n 
36 79   GLU n 
36 80   VAL n 
36 81   MET n 
36 82   GLY n 
36 83   PRO n 
36 84   VAL n 
36 85   GLU n 
36 86   ALA n 
36 87   ALA n 
36 88   PRO n 
36 89   GLU n 
36 90   TYR n 
36 91   ARG n 
36 92   VAL n 
36 93   ILE n 
36 94   VAL n 
36 95   ASP n 
36 96   ALA n 
36 97   ASN n 
36 98   ASN n 
36 99   LEU n 
36 100  THR n 
36 101  VAL n 
36 102  GLU n 
36 103  ILE n 
36 104  GLU n 
36 105  ASN n 
36 106  GLU n 
36 107  LEU n 
36 108  ASN n 
36 109  ILE n 
36 110  ILE n 
36 111  HIS n 
36 112  LYS n 
36 113  PHE n 
36 114  ILE n 
36 115  ARG n 
36 116  ASP n 
36 117  LYS n 
36 118  TYR n 
36 119  SER n 
36 120  LYS n 
36 121  ARG n 
36 122  PHE n 
36 123  PRO n 
36 124  GLU n 
36 125  LEU n 
36 126  GLU n 
36 127  SER n 
36 128  LEU n 
36 129  VAL n 
36 130  PRO n 
36 131  ASN n 
36 132  ALA n 
36 133  LEU n 
36 134  ASP n 
36 135  TYR n 
36 136  ILE n 
36 137  ARG n 
36 138  THR n 
36 139  VAL n 
36 140  LYS n 
36 141  GLU n 
36 142  LEU n 
36 143  GLY n 
36 144  ASN n 
36 145  SER n 
36 146  LEU n 
36 147  ASP n 
36 148  LYS n 
36 149  CYS n 
36 150  LYS n 
36 151  ASN n 
36 152  ASN n 
36 153  GLU n 
36 154  ASN n 
36 155  LEU n 
36 156  GLN n 
36 157  GLN n 
36 158  ILE n 
36 159  LEU n 
36 160  THR n 
36 161  ASN n 
36 162  ALA n 
36 163  THR n 
36 164  ILE n 
36 165  MET n 
36 166  VAL n 
36 167  VAL n 
36 168  SER n 
36 169  VAL n 
36 170  THR n 
36 171  ALA n 
36 172  SER n 
36 173  THR n 
36 174  THR n 
36 175  GLN n 
36 176  GLY n 
36 177  GLN n 
36 178  GLN n 
36 179  LEU n 
36 180  SER n 
36 181  GLU n 
36 182  GLU n 
36 183  GLU n 
36 184  LEU n 
36 185  GLU n 
36 186  ARG n 
36 187  LEU n 
36 188  GLU n 
36 189  GLU n 
36 190  ALA n 
36 191  CYS n 
36 192  ASP n 
36 193  MET n 
36 194  ALA n 
36 195  LEU n 
36 196  GLU n 
36 197  LEU n 
36 198  ASN n 
36 199  ALA n 
36 200  SER n 
36 201  LYS n 
36 202  HIS n 
36 203  ARG n 
36 204  ILE n 
36 205  TYR n 
36 206  GLU n 
36 207  TYR n 
36 208  VAL n 
36 209  GLU n 
36 210  SER n 
36 211  ARG n 
36 212  MET n 
36 213  SER n 
36 214  PHE n 
36 215  ILE n 
36 216  ALA n 
36 217  PRO n 
36 218  ASN n 
36 219  LEU n 
36 220  SER n 
36 221  ILE n 
36 222  ILE n 
36 223  ILE n 
36 224  GLY n 
36 225  ALA n 
36 226  SER n 
36 227  THR n 
36 228  ALA n 
36 229  ALA n 
36 230  LYS n 
36 231  ILE n 
36 232  MET n 
36 233  GLY n 
36 234  VAL n 
36 235  ALA n 
36 236  GLY n 
36 237  GLY n 
36 238  LEU n 
36 239  THR n 
36 240  ASN n 
36 241  LEU n 
36 242  SER n 
36 243  LYS n 
36 244  MET n 
36 245  PRO n 
36 246  ALA n 
36 247  CYS n 
36 248  ASN n 
36 249  ILE n 
36 250  MET n 
36 251  LEU n 
36 252  LEU n 
36 253  GLY n 
36 254  ALA n 
36 255  GLN n 
36 256  ARG n 
36 257  LYS n 
36 258  THR n 
36 259  LEU n 
36 260  SER n 
36 261  GLY n 
36 262  PHE n 
36 263  SER n 
36 264  SER n 
36 265  THR n 
36 266  SER n 
36 267  VAL n 
36 268  LEU n 
36 269  PRO n 
36 270  HIS n 
36 271  THR n 
36 272  GLY n 
36 273  TYR n 
36 274  ILE n 
36 275  TYR n 
36 276  HIS n 
36 277  SER n 
36 278  ASP n 
36 279  ILE n 
36 280  VAL n 
36 281  GLN n 
36 282  SER n 
36 283  LEU n 
36 284  PRO n 
36 285  PRO n 
36 286  ASP n 
36 287  LEU n 
36 288  ARG n 
36 289  ARG n 
36 290  LYS n 
36 291  ALA n 
36 292  ALA n 
36 293  ARG n 
36 294  LEU n 
36 295  VAL n 
36 296  ALA n 
36 297  ALA n 
36 298  LYS n 
36 299  CYS n 
36 300  THR n 
36 301  LEU n 
36 302  ALA n 
36 303  ALA n 
36 304  ARG n 
36 305  VAL n 
36 306  ASP n 
36 307  SER n 
36 308  PHE n 
36 309  HIS n 
36 310  GLU n 
36 311  SER n 
36 312  THR n 
36 313  GLU n 
36 314  GLY n 
36 315  LYS n 
36 316  VAL n 
36 317  GLY n 
36 318  TYR n 
36 319  GLU n 
36 320  LEU n 
36 321  LYS n 
36 322  ASP n 
36 323  GLU n 
36 324  ILE n 
36 325  GLU n 
36 326  ARG n 
36 327  LYS n 
36 328  PHE n 
36 329  ASP n 
36 330  LYS n 
36 331  TRP n 
36 332  GLN n 
36 333  GLU n 
36 334  PRO n 
36 335  PRO n 
36 336  PRO n 
36 337  VAL n 
36 338  LYS n 
36 339  GLN n 
36 340  VAL n 
36 341  LYS n 
36 342  PRO n 
36 343  LEU n 
36 344  PRO n 
36 345  ALA n 
36 346  PRO n 
36 347  LEU n 
36 348  ASP n 
36 349  GLY n 
36 350  GLN n 
36 351  ARG n 
36 352  LYS n 
36 353  LYS n 
36 354  ARG n 
36 355  GLY n 
36 356  GLY n 
36 357  ARG n 
36 358  ARG n 
36 359  TYR n 
36 360  ARG n 
36 361  LYS n 
36 362  MET n 
36 363  LYS n 
36 364  GLU n 
36 365  ARG n 
36 366  LEU n 
36 367  GLY n 
36 368  LEU n 
36 369  THR n 
36 370  GLU n 
36 371  ILE n 
36 372  ARG n 
36 373  LYS n 
36 374  GLN n 
36 375  ALA n 
36 376  ASN n 
36 377  ARG n 
36 378  MET n 
36 379  SER n 
36 380  PHE n 
36 381  GLY n 
36 382  GLU n 
36 383  ILE n 
36 384  GLU n 
36 385  GLU n 
36 386  ASP n 
36 387  ALA n 
36 388  TYR n 
36 389  GLN n 
36 390  GLU n 
36 391  ASP n 
36 392  LEU n 
36 393  GLY n 
36 394  PHE n 
36 395  SER n 
36 396  LEU n 
36 397  GLY n 
36 398  HIS n 
36 399  LEU n 
36 400  GLY n 
36 401  LYS n 
36 402  SER n 
36 403  GLY n 
36 404  SER n 
36 405  GLY n 
36 406  ARG n 
36 407  VAL n 
36 408  ARG n 
36 409  GLN n 
36 410  THR n 
36 411  GLN n 
36 412  VAL n 
36 413  ASN n 
36 414  GLU n 
36 415  ALA n 
36 416  THR n 
36 417  LYS n 
36 418  ALA n 
36 419  ARG n 
36 420  ILE n 
36 421  SER n 
36 422  LYS n 
36 423  THR n 
36 424  LEU n 
36 425  GLN n 
36 426  ARG n 
36 427  THR n 
36 428  LEU n 
36 429  GLN n 
36 430  LYS n 
36 431  GLN n 
36 432  SER n 
36 433  VAL n 
36 434  VAL n 
36 435  TYR n 
36 436  GLY n 
36 437  GLY n 
36 438  LYS n 
36 439  SER n 
36 440  THR n 
36 441  ILE n 
36 442  ARG n 
36 443  ASP n 
36 444  ARG n 
36 445  SER n 
36 446  SER n 
36 447  GLY n 
36 448  THR n 
36 449  ALA n 
36 450  SER n 
36 451  SER n 
36 452  VAL n 
36 453  ALA n 
36 454  PHE n 
36 455  THR n 
36 456  PRO n 
36 457  LEU n 
36 458  GLN n 
36 459  GLY n 
36 460  LEU n 
36 461  GLU n 
36 462  ILE n 
36 463  VAL n 
36 464  ASN n 
36 465  PRO n 
36 466  GLN n 
36 467  ALA n 
36 468  ALA n 
36 469  GLU n 
36 470  LYS n 
36 471  LYS n 
36 472  VAL n 
36 473  ALA n 
36 474  GLU n 
36 475  ALA n 
36 476  ASN n 
36 477  GLN n 
36 478  LYS n 
36 479  TYR n 
36 480  PHE n 
36 481  SER n 
36 482  SER n 
36 483  MET n 
36 484  ALA n 
36 485  GLU n 
36 486  PHE n 
36 487  LEU n 
36 488  LYS n 
36 489  VAL n 
36 490  LYS n 
36 491  GLY n 
36 492  GLU n 
36 493  LYS n 
36 494  SER n 
36 495  GLY n 
36 496  LEU n 
36 497  MET n 
36 498  SER n 
36 499  THR n 
37 1    MET n 
37 2    THR n 
37 3    GLU n 
37 4    ALA n 
37 5    ASP n 
37 6    VAL n 
37 7    ASN n 
37 8    PRO n 
37 9    LYS n 
37 10   ALA n 
37 11   TYR n 
37 12   PRO n 
37 13   LEU n 
37 14   ALA n 
37 15   ASP n 
37 16   ALA n 
37 17   HIS n 
37 18   LEU n 
37 19   THR n 
37 20   LYS n 
37 21   LYS n 
37 22   LEU n 
37 23   LEU n 
37 24   ASP n 
37 25   LEU n 
37 26   VAL n 
37 27   GLN n 
37 28   GLN n 
37 29   SER n 
37 30   CYS n 
37 31   ASN n 
37 32   TYR n 
37 33   LYS n 
37 34   GLN n 
37 35   LEU n 
37 36   ARG n 
37 37   LYS n 
37 38   GLY n 
37 39   ALA n 
37 40   ASN n 
37 41   GLU n 
37 42   ALA n 
37 43   THR n 
37 44   LYS n 
37 45   THR n 
37 46   LEU n 
37 47   ASN n 
37 48   ARG n 
37 49   GLY n 
37 50   ILE n 
37 51   SER n 
37 52   GLU n 
37 53   PHE n 
37 54   ILE n 
37 55   VAL n 
37 56   MET n 
37 57   ALA n 
37 58   ALA n 
37 59   ASP n 
37 60   ALA n 
37 61   GLU n 
37 62   PRO n 
37 63   LEU n 
37 64   GLU n 
37 65   ILE n 
37 66   ILE n 
37 67   LEU n 
37 68   HIS n 
37 69   LEU n 
37 70   PRO n 
37 71   LEU n 
37 72   LEU n 
37 73   CYS n 
37 74   GLU n 
37 75   ASP n 
37 76   LYS n 
37 77   ASN n 
37 78   VAL n 
37 79   PRO n 
37 80   TYR n 
37 81   VAL n 
37 82   PHE n 
37 83   VAL n 
37 84   ARG n 
37 85   SER n 
37 86   LYS n 
37 87   GLN n 
37 88   ALA n 
37 89   LEU n 
37 90   GLY n 
37 91   ARG n 
37 92   ALA n 
37 93   CYS n 
37 94   GLY n 
37 95   VAL n 
37 96   SER n 
37 97   ARG n 
37 98   PRO n 
37 99   VAL n 
37 100  ILE n 
37 101  ALA n 
37 102  CYS n 
37 103  SER n 
37 104  VAL n 
37 105  THR n 
37 106  ILE n 
37 107  LYS n 
37 108  GLU n 
37 109  GLY n 
37 110  SER n 
37 111  GLN n 
37 112  LEU n 
37 113  LYS n 
37 114  GLN n 
37 115  GLN n 
37 116  ILE n 
37 117  GLN n 
37 118  SER n 
37 119  ILE n 
37 120  GLN n 
37 121  GLN n 
37 122  SER n 
37 123  ILE n 
37 124  GLU n 
37 125  ARG n 
37 126  LEU n 
37 127  LEU n 
37 128  VAL n 
38 1    MET n 
38 2    SER n 
38 3    TYR n 
38 4    MET n 
38 5    LEU n 
38 6    PRO n 
38 7    HIS n 
38 8    LEU n 
38 9    HIS n 
38 10   ASN n 
38 11   GLY n 
38 12   TRP n 
38 13   GLN n 
38 14   VAL n 
38 15   ASP n 
38 16   GLN n 
38 17   ALA n 
38 18   ILE n 
38 19   LEU n 
38 20   SER n 
38 21   GLU n 
38 22   GLU n 
38 23   ASP n 
38 24   ARG n 
38 25   VAL n 
38 26   VAL n 
38 27   VAL n 
38 28   ILE n 
38 29   ARG n 
38 30   PHE n 
38 31   GLY n 
38 32   HIS n 
38 33   ASP n 
38 34   TRP n 
38 35   ASP n 
38 36   PRO n 
38 37   THR n 
38 38   CYS n 
38 39   MET n 
38 40   LYS n 
38 41   MET n 
38 42   ASP n 
38 43   GLU n 
38 44   VAL n 
38 45   LEU n 
38 46   TYR n 
38 47   SER n 
38 48   ILE n 
38 49   ALA n 
38 50   GLU n 
38 51   LYS n 
38 52   VAL n 
38 53   LYS n 
38 54   ASN n 
38 55   PHE n 
38 56   ALA n 
38 57   VAL n 
38 58   ILE n 
38 59   TYR n 
38 60   LEU n 
38 61   VAL n 
38 62   ASP n 
38 63   ILE n 
38 64   THR n 
38 65   GLU n 
38 66   VAL n 
38 67   PRO n 
38 68   ASP n 
38 69   PHE n 
38 70   ASN n 
38 71   LYS n 
38 72   MET n 
38 73   TYR n 
38 74   GLU n 
38 75   LEU n 
38 76   TYR n 
38 77   ASP n 
38 78   PRO n 
38 79   CYS n 
38 80   THR n 
38 81   VAL n 
38 82   MET n 
38 83   PHE n 
38 84   PHE n 
38 85   PHE n 
38 86   ARG n 
38 87   ASN n 
38 88   LYS n 
38 89   HIS n 
38 90   ILE n 
38 91   MET n 
38 92   ILE n 
38 93   ASP n 
38 94   LEU n 
38 95   GLY n 
38 96   THR n 
38 97   GLY n 
38 98   ASN n 
38 99   ASN n 
38 100  ASN n 
38 101  LYS n 
38 102  ILE n 
38 103  ASN n 
38 104  TRP n 
38 105  ALA n 
38 106  MET n 
38 107  GLU n 
38 108  ASP n 
38 109  LYS n 
38 110  GLN n 
38 111  GLU n 
38 112  MET n 
38 113  VAL n 
38 114  ASP n 
38 115  ILE n 
38 116  ILE n 
38 117  GLU n 
38 118  THR n 
38 119  VAL n 
38 120  TYR n 
38 121  ARG n 
38 122  GLY n 
38 123  ALA n 
38 124  ARG n 
38 125  LYS n 
38 126  GLY n 
38 127  ARG n 
38 128  GLY n 
38 129  LEU n 
38 130  VAL n 
38 131  VAL n 
38 132  SER n 
38 133  PRO n 
38 134  LYS n 
38 135  ASP n 
38 136  TYR n 
38 137  SER n 
38 138  THR n 
38 139  LYS n 
38 140  TYR n 
38 141  ARG n 
38 142  TYR n 
39 1    MET n 
39 2    SER n 
39 3    GLY n 
39 4    ARG n 
39 5    SER n 
39 6    LYS n 
39 7    ARG n 
39 8    GLU n 
39 9    SER n 
39 10   ARG n 
39 11   GLY n 
39 12   SER n 
39 13   THR n 
39 14   ARG n 
39 15   GLY n 
39 16   LYS n 
39 17   ARG n 
39 18   GLU n 
39 19   SER n 
39 20   GLU n 
39 21   SER n 
39 22   ARG n 
39 23   GLY n 
39 24   SER n 
39 25   SER n 
39 26   GLY n 
39 27   ARG n 
39 28   VAL n 
39 29   LYS n 
39 30   ARG n 
39 31   GLU n 
39 32   ARG n 
39 33   ASP n 
39 34   ARG n 
39 35   GLU n 
39 36   ARG n 
39 37   GLU n 
39 38   PRO n 
39 39   GLU n 
39 40   ALA n 
39 41   ALA n 
39 42   SER n 
39 43   SER n 
39 44   ARG n 
39 45   GLY n 
39 46   SER n 
39 47   PRO n 
39 48   VAL n 
39 49   ARG n 
39 50   VAL n 
39 51   LYS n 
39 52   ARG n 
39 53   GLU n 
39 54   PHE n 
39 55   GLU n 
39 56   PRO n 
39 57   ALA n 
39 58   SER n 
39 59   ALA n 
39 60   ARG n 
39 61   GLU n 
39 62   ALA n 
39 63   PRO n 
39 64   ALA n 
39 65   SER n 
39 66   VAL n 
39 67   VAL n 
39 68   PRO n 
39 69   PHE n 
39 70   VAL n 
39 71   ARG n 
39 72   VAL n 
39 73   LYS n 
39 74   ARG n 
39 75   GLU n 
39 76   ARG n 
39 77   GLU n 
39 78   VAL n 
39 79   ASP n 
39 80   GLU n 
39 81   ASP n 
39 82   SER n 
39 83   GLU n 
39 84   PRO n 
39 85   GLU n 
39 86   ARG n 
39 87   GLU n 
39 88   VAL n 
39 89   ARG n 
39 90   ALA n 
39 91   LYS n 
39 92   ASN n 
39 93   GLY n 
39 94   ARG n 
39 95   VAL n 
39 96   ASP n 
39 97   SER n 
39 98   GLU n 
39 99   ASP n 
39 100  ARG n 
39 101  ARG n 
39 102  SER n 
39 103  ARG n 
39 104  HIS n 
39 105  CYS n 
39 106  PRO n 
39 107  TYR n 
39 108  LEU n 
39 109  ASP n 
39 110  THR n 
39 111  ILE n 
39 112  ASN n 
39 113  ARG n 
39 114  SER n 
39 115  VAL n 
39 116  LEU n 
39 117  ASP n 
39 118  PHE n 
39 119  ASP n 
39 120  PHE n 
39 121  GLU n 
39 122  LYS n 
39 123  LEU n 
39 124  CYS n 
39 125  SER n 
39 126  ILE n 
39 127  SER n 
39 128  LEU n 
39 129  SER n 
39 130  HIS n 
39 131  ILE n 
39 132  ASN n 
39 133  ALA n 
39 134  TYR n 
39 135  ALA n 
39 136  CYS n 
39 137  LEU n 
39 138  VAL n 
39 139  CYS n 
39 140  GLY n 
39 141  LYS n 
39 142  TYR n 
39 143  PHE n 
39 144  GLN n 
39 145  GLY n 
39 146  ARG n 
39 147  GLY n 
39 148  LEU n 
39 149  LYS n 
39 150  SER n 
39 151  HIS n 
39 152  ALA n 
39 153  TYR n 
39 154  ILE n 
39 155  HIS n 
39 156  SER n 
39 157  VAL n 
39 158  GLN n 
39 159  PHE n 
39 160  SER n 
39 161  HIS n 
39 162  HIS n 
39 163  VAL n 
39 164  PHE n 
39 165  LEU n 
39 166  ASN n 
39 167  LEU n 
39 168  HIS n 
39 169  THR n 
39 170  LEU n 
39 171  LYS n 
39 172  PHE n 
39 173  TYR n 
39 174  CYS n 
39 175  LEU n 
39 176  PRO n 
39 177  ASP n 
39 178  ASN n 
39 179  TYR n 
39 180  GLU n 
39 181  ILE n 
39 182  ILE n 
39 183  ASP n 
39 184  SER n 
39 185  SER n 
39 186  LEU n 
39 187  GLU n 
39 188  ASP n 
39 189  ILE n 
39 190  THR n 
39 191  TYR n 
39 192  VAL n 
39 193  LEU n 
39 194  LYS n 
39 195  PRO n 
39 196  THR n 
39 197  PHE n 
39 198  THR n 
39 199  LYS n 
39 200  GLN n 
39 201  GLN n 
39 202  ILE n 
39 203  ALA n 
39 204  ASN n 
39 205  LEU n 
39 206  ASP n 
39 207  LYS n 
39 208  GLN n 
39 209  ALA n 
39 210  LYS n 
39 211  LEU n 
39 212  SER n 
39 213  ARG n 
39 214  ALA n 
39 215  TYR n 
39 216  ASP n 
39 217  GLY n 
39 218  THR n 
39 219  THR n 
39 220  TYR n 
39 221  LEU n 
39 222  PRO n 
39 223  GLY n 
39 224  ILE n 
39 225  VAL n 
39 226  GLY n 
39 227  LEU n 
39 228  ASN n 
39 229  ASN n 
39 230  ILE n 
39 231  LYS n 
39 232  ALA n 
39 233  ASN n 
39 234  ASP n 
39 235  TYR n 
39 236  ALA n 
39 237  ASN n 
39 238  ALA n 
39 239  VAL n 
39 240  LEU n 
39 241  GLN n 
39 242  ALA n 
39 243  LEU n 
39 244  SER n 
39 245  ASN n 
39 246  VAL n 
39 247  PRO n 
39 248  PRO n 
39 249  LEU n 
39 250  ARG n 
39 251  ASN n 
39 252  TYR n 
39 253  PHE n 
39 254  LEU n 
39 255  GLU n 
39 256  GLU n 
39 257  ASP n 
39 258  ASN n 
39 259  TYR n 
39 260  LYS n 
39 261  ASN n 
39 262  ILE n 
39 263  LYS n 
39 264  ARG n 
39 265  PRO n 
39 266  PRO n 
39 267  GLY n 
39 268  ASP n 
39 269  ILE n 
39 270  MET n 
39 271  PHE n 
39 272  LEU n 
39 273  LEU n 
39 274  VAL n 
39 275  GLN n 
39 276  ARG n 
39 277  PHE n 
39 278  GLY n 
39 279  GLU n 
39 280  LEU n 
39 281  MET n 
39 282  ARG n 
39 283  LYS n 
39 284  LEU n 
39 285  TRP n 
39 286  ASN n 
39 287  PRO n 
39 288  ARG n 
39 289  ASN n 
39 290  PHE n 
39 291  LYS n 
39 292  ALA n 
39 293  HIS n 
39 294  VAL n 
39 295  SER n 
39 296  PRO n 
39 297  HIS n 
39 298  GLU n 
39 299  MET n 
39 300  LEU n 
39 301  GLN n 
39 302  ALA n 
39 303  VAL n 
39 304  VAL n 
39 305  LEU n 
39 306  CYS n 
39 307  SER n 
39 308  LYS n 
39 309  LYS n 
39 310  THR n 
39 311  PHE n 
39 312  GLN n 
39 313  ILE n 
39 314  THR n 
39 315  LYS n 
39 316  GLN n 
39 317  GLY n 
39 318  ASP n 
39 319  GLY n 
39 320  VAL n 
39 321  ASP n 
39 322  PHE n 
39 323  LEU n 
39 324  SER n 
39 325  TRP n 
39 326  PHE n 
39 327  LEU n 
39 328  ASN n 
39 329  ALA n 
39 330  LEU n 
39 331  HIS n 
39 332  SER n 
39 333  ALA n 
39 334  LEU n 
39 335  GLY n 
39 336  GLY n 
39 337  THR n 
39 338  LYS n 
39 339  LYS n 
39 340  LYS n 
39 341  LYS n 
39 342  LYS n 
39 343  THR n 
39 344  ILE n 
39 345  VAL n 
39 346  THR n 
39 347  ASP n 
39 348  VAL n 
39 349  PHE n 
39 350  GLN n 
39 351  GLY n 
39 352  SER n 
39 353  MET n 
39 354  ARG n 
39 355  ILE n 
39 356  PHE n 
39 357  THR n 
39 358  LYS n 
39 359  LYS n 
39 360  LEU n 
39 361  PRO n 
39 362  HIS n 
39 363  PRO n 
39 364  ASP n 
39 365  LEU n 
39 366  PRO n 
39 367  ALA n 
39 368  GLU n 
39 369  GLU n 
39 370  LYS n 
39 371  GLU n 
39 372  GLN n 
39 373  LEU n 
39 374  LEU n 
39 375  HIS n 
39 376  ASN n 
39 377  ASP n 
39 378  GLU n 
39 379  TYR n 
39 380  GLN n 
39 381  GLU n 
39 382  THR n 
39 383  MET n 
39 384  VAL n 
39 385  GLU n 
39 386  SER n 
39 387  THR n 
39 388  PHE n 
39 389  MET n 
39 390  TYR n 
39 391  LEU n 
39 392  THR n 
39 393  LEU n 
39 394  ASP n 
39 395  LEU n 
39 396  PRO n 
39 397  THR n 
39 398  ALA n 
39 399  PRO n 
39 400  LEU n 
39 401  TYR n 
39 402  LYS n 
39 403  ASP n 
39 404  GLU n 
39 405  LYS n 
39 406  GLU n 
39 407  GLN n 
39 408  LEU n 
39 409  ILE n 
39 410  ILE n 
39 411  PRO n 
39 412  GLN n 
39 413  VAL n 
39 414  PRO n 
39 415  LEU n 
39 416  PHE n 
39 417  ASN n 
39 418  ILE n 
39 419  LEU n 
39 420  ALA n 
39 421  LYS n 
39 422  PHE n 
39 423  ASN n 
39 424  GLY n 
39 425  ILE n 
39 426  THR n 
39 427  GLU n 
39 428  LYS n 
39 429  GLU n 
39 430  TYR n 
39 431  LYS n 
39 432  THR n 
39 433  TYR n 
39 434  LYS n 
39 435  GLU n 
39 436  ASN n 
39 437  PHE n 
39 438  LEU n 
39 439  LYS n 
39 440  ARG n 
39 441  PHE n 
39 442  GLN n 
39 443  LEU n 
39 444  THR n 
39 445  LYS n 
39 446  LEU n 
39 447  PRO n 
39 448  PRO n 
39 449  TYR n 
39 450  LEU n 
39 451  ILE n 
39 452  PHE n 
39 453  CYS n 
39 454  ILE n 
39 455  LYS n 
39 456  ARG n 
39 457  PHE n 
39 458  THR n 
39 459  LYS n 
39 460  ASN n 
39 461  ASN n 
39 462  PHE n 
39 463  PHE n 
39 464  VAL n 
39 465  GLU n 
39 466  LYS n 
39 467  ASN n 
39 468  PRO n 
39 469  THR n 
39 470  ILE n 
39 471  VAL n 
39 472  ASN n 
39 473  PHE n 
39 474  PRO n 
39 475  ILE n 
39 476  THR n 
39 477  ASN n 
39 478  VAL n 
39 479  ASP n 
39 480  LEU n 
39 481  ARG n 
39 482  GLU n 
39 483  TYR n 
39 484  LEU n 
39 485  SER n 
39 486  GLU n 
39 487  GLU n 
39 488  VAL n 
39 489  GLN n 
39 490  ALA n 
39 491  VAL n 
39 492  HIS n 
39 493  LYS n 
39 494  ASN n 
39 495  THR n 
39 496  THR n 
39 497  TYR n 
39 498  ASP n 
39 499  LEU n 
39 500  ILE n 
39 501  ALA n 
39 502  ASN n 
39 503  ILE n 
39 504  VAL n 
39 505  HIS n 
39 506  ASP n 
39 507  GLY n 
39 508  LYS n 
39 509  PRO n 
39 510  SER n 
39 511  GLU n 
39 512  GLY n 
39 513  SER n 
39 514  TYR n 
39 515  ARG n 
39 516  ILE n 
39 517  HIS n 
39 518  VAL n 
39 519  LEU n 
39 520  HIS n 
39 521  HIS n 
39 522  GLY n 
39 523  THR n 
39 524  GLY n 
39 525  LYS n 
39 526  TRP n 
39 527  TYR n 
39 528  GLU n 
39 529  LEU n 
39 530  GLN n 
39 531  ASP n 
39 532  LEU n 
39 533  GLN n 
39 534  VAL n 
39 535  THR n 
39 536  ASP n 
39 537  ILE n 
39 538  LEU n 
39 539  PRO n 
39 540  GLN n 
39 541  MET n 
39 542  ILE n 
39 543  THR n 
39 544  LEU n 
39 545  SER n 
39 546  GLU n 
39 547  ALA n 
39 548  TYR n 
39 549  ILE n 
39 550  GLN n 
39 551  ILE n 
39 552  TRP n 
39 553  LYS n 
39 554  ARG n 
39 555  ARG n 
39 556  ASP n 
39 557  ASN n 
39 558  ASP n 
39 559  GLU n 
39 560  THR n 
39 561  ASN n 
39 562  GLN n 
39 563  GLN n 
39 564  GLY n 
39 565  ALA n 
40 1    A   n 
40 2    G   n 
40 3    C   n 
40 4    U   n 
40 5    U   n 
40 6    U   n 
40 7    G   n 
40 8    C   n 
40 9    G   n 
40 10   C   n 
40 11   A   n 
40 12   G   n 
40 13   U   n 
40 14   G   n 
40 15   G   n 
40 16   C   n 
40 17   A   n 
40 18   G   n 
40 19   U   n 
40 20   A   n 
40 21   U   n 
40 22   C   n 
40 23   G   n 
40 24   U   n 
40 25   A   n 
40 26   G   n 
40 27   C   n 
40 28   C   n 
40 29   A   n 
40 30   A   n 
40 31   U   n 
40 32   G   n 
40 33   A   n 
40 34   G   n 
40 35   G   n 
40 36   U   n 
40 37   C   n 
40 38   U   n 
40 39   A   n 
40 40   U   n 
40 41   C   n 
40 42   C   n 
40 43   G   n 
40 44   A   n 
40 45   G   n 
40 46   G   n 
40 47   C   n 
40 48   G   n 
40 49   C   n 
40 50   G   n 
40 51   A   n 
40 52   U   n 
40 53   U   n 
40 54   A   n 
40 55   U   n 
40 56   U   n 
40 57   G   n 
40 58   C   n 
40 59   U   n 
40 60   A   n 
40 61   A   n 
40 62   U   n 
40 63   U   n 
40 64   G   n 
40 65   A   n 
40 66   A   n 
40 67   A   n 
40 68   A   n 
40 69   C   n 
40 70   U   n 
40 71   U   n 
40 72   U   n 
40 73   U   n 
40 74   C   n 
40 75   C   n 
40 76   C   n 
40 77   A   n 
40 78   A   n 
40 79   U   n 
40 80   A   n 
40 81   C   n 
40 82   C   n 
40 83   C   n 
40 84   C   n 
40 85   G   n 
40 86   C   n 
40 87   C   n 
40 88   G   n 
40 89   U   n 
40 90   G   n 
40 91   A   n 
40 92   C   n 
40 93   G   n 
40 94   A   n 
40 95   C   n 
40 96   U   n 
40 97   U   n 
40 98   G   n 
40 99   C   n 
40 100  A   n 
40 101  A   n 
40 102  U   n 
40 103  A   n 
40 104  U   n 
40 105  A   n 
40 106  G   n 
40 107  U   n 
40 108  C   n 
40 109  G   n 
40 110  G   n 
40 111  C   n 
40 112  A   n 
40 113  C   n 
40 114  U   n 
40 115  G   n 
40 116  G   n 
40 117  C   n 
40 118  A   n 
40 119  A   n 
40 120  U   n 
40 121  U   n 
40 122  U   n 
40 123  U   n 
40 124  U   n 
40 125  G   n 
40 126  A   n 
40 127  C   n 
40 128  A   n 
40 129  G   n 
40 130  U   n 
40 131  C   n 
40 132  U   n 
40 133  C   n 
40 134  U   n 
40 135  A   n 
40 136  C   n 
40 137  G   n 
40 138  G   n 
40 139  A   n 
40 140  G   n 
40 141  A   n 
40 142  C   n 
40 143  U   n 
40 144  G   n 
41 1    MET n 
41 2    ALA n 
41 3    GLY n 
41 4    GLU n 
41 5    LEU n 
41 6    ALA n 
41 7    ASP n 
41 8    LYS n 
41 9    LYS n 
41 10   ASP n 
41 11   ARG n 
41 12   ASP n 
41 13   ALA n 
41 14   SER n 
41 15   PRO n 
41 16   SER n 
41 17   LYS n 
41 18   GLU n 
41 19   GLU n 
41 20   ARG n 
41 21   LYS n 
41 22   ARG n 
41 23   SER n 
41 24   ARG n 
41 25   THR n 
41 26   PRO n 
41 27   ASP n 
41 28   ARG n 
41 29   GLU n 
41 30   ARG n 
41 31   ASP n 
41 32   ARG n 
41 33   ASP n 
41 34   ARG n 
41 35   ASP n 
41 36   ARG n 
41 37   LYS n 
41 38   SER n 
41 39   SER n 
41 40   PRO n 
41 41   SER n 
41 42   LYS n 
41 43   ASP n 
41 44   ARG n 
41 45   LYS n 
41 46   ARG n 
41 47   HIS n 
41 48   ARG n 
41 49   SER n 
41 50   ARG n 
41 51   ASP n 
41 52   ARG n 
41 53   ARG n 
41 54   ARG n 
41 55   GLY n 
41 56   GLY n 
41 57   SER n 
41 58   ARG n 
41 59   SER n 
41 60   ARG n 
41 61   SER n 
41 62   ARG n 
41 63   SER n 
41 64   ARG n 
41 65   SER n 
41 66   LYS n 
41 67   SER n 
41 68   ALA n 
41 69   GLU n 
41 70   ARG n 
41 71   GLU n 
41 72   ARG n 
41 73   ARG n 
41 74   HIS n 
41 75   LYS n 
41 76   GLU n 
41 77   ARG n 
41 78   GLU n 
41 79   ARG n 
41 80   ASP n 
41 81   LYS n 
41 82   GLU n 
41 83   ARG n 
41 84   ASP n 
41 85   ARG n 
41 86   ASN n 
41 87   LYS n 
41 88   LYS n 
41 89   ASP n 
41 90   ARG n 
41 91   ASP n 
41 92   ARG n 
41 93   ASP n 
41 94   LYS n 
41 95   ASP n 
41 96   GLY n 
41 97   HIS n 
41 98   ARG n 
41 99   ARG n 
41 100  ASP n 
41 101  LYS n 
41 102  ASP n 
41 103  ARG n 
41 104  LYS n 
41 105  ARG n 
41 106  SER n 
41 107  SER n 
41 108  LEU n 
41 109  SER n 
41 110  PRO n 
41 111  GLY n 
41 112  ARG n 
41 113  GLY n 
41 114  LYS n 
41 115  ASP n 
41 116  PHE n 
41 117  LYS n 
41 118  SER n 
41 119  ARG n 
41 120  LYS n 
41 121  ASP n 
41 122  ARG n 
41 123  ASP n 
41 124  SER n 
41 125  LYS n 
41 126  LYS n 
41 127  ASP n 
41 128  GLU n 
41 129  GLU n 
41 130  ASP n 
41 131  GLU n 
41 132  HIS n 
41 133  GLY n 
41 134  ASP n 
41 135  LYS n 
41 136  LYS n 
41 137  PRO n 
41 138  LYS n 
41 139  ALA n 
41 140  GLN n 
41 141  PRO n 
41 142  LEU n 
41 143  SER n 
41 144  LEU n 
41 145  GLU n 
41 146  GLU n 
41 147  LEU n 
41 148  LEU n 
41 149  ALA n 
41 150  LYS n 
41 151  LYS n 
41 152  LYS n 
41 153  ALA n 
41 154  GLU n 
41 155  GLU n 
41 156  GLU n 
41 157  ALA n 
41 158  GLU n 
41 159  ALA n 
41 160  LYS n 
41 161  PRO n 
41 162  LYS n 
41 163  PHE n 
41 164  LEU n 
41 165  SER n 
41 166  LYS n 
41 167  ALA n 
41 168  GLU n 
41 169  ARG n 
41 170  GLU n 
41 171  ALA n 
41 172  GLU n 
41 173  ALA n 
41 174  LEU n 
41 175  LYS n 
41 176  ARG n 
41 177  ARG n 
41 178  GLN n 
41 179  GLN n 
41 180  GLU n 
41 181  VAL n 
41 182  GLU n 
41 183  GLU n 
41 184  ARG n 
41 185  GLN n 
41 186  ARG n 
41 187  MET n 
41 188  LEU n 
41 189  GLU n 
41 190  GLU n 
41 191  GLU n 
41 192  ARG n 
41 193  LYS n 
41 194  LYS n 
41 195  ARG n 
41 196  LYS n 
41 197  GLN n 
41 198  PHE n 
41 199  GLN n 
41 200  ASP n 
41 201  LEU n 
41 202  GLY n 
41 203  ARG n 
41 204  LYS n 
41 205  MET n 
41 206  LEU n 
41 207  GLU n 
41 208  ASP n 
41 209  PRO n 
41 210  GLN n 
41 211  GLU n 
41 212  ARG n 
41 213  GLU n 
41 214  ARG n 
41 215  ARG n 
41 216  GLU n 
41 217  ARG n 
41 218  ARG n 
41 219  GLU n 
41 220  ARG n 
41 221  MET n 
41 222  GLU n 
41 223  ARG n 
41 224  GLU n 
41 225  THR n 
41 226  ASN n 
41 227  GLY n 
41 228  ASN n 
41 229  GLU n 
41 230  ASP n 
41 231  GLU n 
41 232  GLU n 
41 233  GLY n 
41 234  ARG n 
41 235  GLN n 
41 236  LYS n 
41 237  ILE n 
41 238  ARG n 
41 239  GLU n 
41 240  GLU n 
41 241  LYS n 
41 242  ASP n 
41 243  LYS n 
41 244  SER n 
41 245  LYS n 
41 246  GLU n 
41 247  LEU n 
41 248  HIS n 
41 249  ALA n 
41 250  ILE n 
41 251  LYS n 
41 252  GLU n 
41 253  ARG n 
41 254  TYR n 
41 255  LEU n 
41 256  GLY n 
41 257  GLY n 
41 258  ILE n 
41 259  LYS n 
41 260  LYS n 
41 261  ARG n 
41 262  ARG n 
41 263  ARG n 
41 264  THR n 
41 265  ARG n 
41 266  HIS n 
41 267  LEU n 
41 268  ASN n 
41 269  ASP n 
41 270  ARG n 
41 271  LYS n 
41 272  PHE n 
41 273  VAL n 
41 274  PHE n 
41 275  GLU n 
41 276  TRP n 
41 277  ASP n 
41 278  ALA n 
41 279  SER n 
41 280  GLU n 
41 281  ASP n 
41 282  THR n 
41 283  SER n 
41 284  ILE n 
41 285  ASP n 
41 286  TYR n 
41 287  ASN n 
41 288  PRO n 
41 289  LEU n 
41 290  TYR n 
41 291  LYS n 
41 292  GLU n 
41 293  ARG n 
41 294  HIS n 
41 295  GLN n 
41 296  VAL n 
41 297  GLN n 
41 298  LEU n 
41 299  LEU n 
41 300  GLY n 
41 301  ARG n 
41 302  GLY n 
41 303  PHE n 
41 304  ILE n 
41 305  ALA n 
41 306  GLY n 
41 307  ILE n 
41 308  ASP n 
41 309  LEU n 
41 310  LYS n 
41 311  GLN n 
41 312  GLN n 
41 313  LYS n 
41 314  ARG n 
41 315  GLU n 
41 316  GLN n 
41 317  SER n 
41 318  ARG n 
41 319  PHE n 
41 320  TYR n 
41 321  GLY n 
41 322  ASP n 
41 323  LEU n 
41 324  MET n 
41 325  GLU n 
41 326  LYS n 
41 327  ARG n 
41 328  ARG n 
41 329  THR n 
41 330  LEU n 
41 331  GLU n 
41 332  GLU n 
41 333  LYS n 
41 334  GLU n 
41 335  GLN n 
41 336  GLU n 
41 337  GLU n 
41 338  ALA n 
41 339  ARG n 
41 340  LEU n 
41 341  ARG n 
41 342  LYS n 
41 343  LEU n 
41 344  ARG n 
41 345  LYS n 
41 346  LYS n 
41 347  GLU n 
41 348  ALA n 
41 349  LYS n 
41 350  GLN n 
41 351  ARG n 
41 352  TRP n 
41 353  ASP n 
41 354  ASP n 
41 355  ARG n 
41 356  HIS n 
41 357  TRP n 
41 358  SER n 
41 359  GLN n 
41 360  LYS n 
41 361  LYS n 
41 362  LEU n 
41 363  ASP n 
41 364  GLU n 
41 365  MET n 
41 366  THR n 
41 367  ASP n 
41 368  ARG n 
41 369  ASP n 
41 370  TRP n 
41 371  ARG n 
41 372  ILE n 
41 373  PHE n 
41 374  ARG n 
41 375  GLU n 
41 376  ASP n 
41 377  TYR n 
41 378  SER n 
41 379  ILE n 
41 380  THR n 
41 381  THR n 
41 382  LYS n 
41 383  GLY n 
41 384  GLY n 
41 385  LYS n 
41 386  ILE n 
41 387  PRO n 
41 388  ASN n 
41 389  PRO n 
41 390  ILE n 
41 391  ARG n 
41 392  SER n 
41 393  TRP n 
41 394  LYS n 
41 395  ASP n 
41 396  SER n 
41 397  SER n 
41 398  LEU n 
41 399  PRO n 
41 400  PRO n 
41 401  HIS n 
41 402  ILE n 
41 403  LEU n 
41 404  GLU n 
41 405  VAL n 
41 406  ILE n 
41 407  ASP n 
41 408  LYS n 
41 409  CYS n 
41 410  GLY n 
41 411  TYR n 
41 412  LYS n 
41 413  GLU n 
41 414  PRO n 
41 415  THR n 
41 416  PRO n 
41 417  ILE n 
41 418  GLN n 
41 419  ARG n 
41 420  GLN n 
41 421  ALA n 
41 422  ILE n 
41 423  PRO n 
41 424  ILE n 
41 425  GLY n 
41 426  LEU n 
41 427  GLN n 
41 428  ASN n 
41 429  ARG n 
41 430  ASP n 
41 431  ILE n 
41 432  ILE n 
41 433  GLY n 
41 434  VAL n 
41 435  ALA n 
41 436  GLU n 
41 437  THR n 
41 438  GLY n 
41 439  SER n 
41 440  GLY n 
41 441  LYS n 
41 442  THR n 
41 443  ALA n 
41 444  ALA n 
41 445  PHE n 
41 446  LEU n 
41 447  ILE n 
41 448  PRO n 
41 449  LEU n 
41 450  LEU n 
41 451  VAL n 
41 452  TRP n 
41 453  ILE n 
41 454  THR n 
41 455  THR n 
41 456  LEU n 
41 457  PRO n 
41 458  LYS n 
41 459  ILE n 
41 460  ASP n 
41 461  ARG n 
41 462  ILE n 
41 463  GLU n 
41 464  GLU n 
41 465  SER n 
41 466  ASP n 
41 467  GLN n 
41 468  GLY n 
41 469  PRO n 
41 470  TYR n 
41 471  ALA n 
41 472  ILE n 
41 473  ILE n 
41 474  LEU n 
41 475  ALA n 
41 476  PRO n 
41 477  THR n 
41 478  ARG n 
41 479  GLU n 
41 480  LEU n 
41 481  ALA n 
41 482  GLN n 
41 483  GLN n 
41 484  ILE n 
41 485  GLU n 
41 486  GLU n 
41 487  GLU n 
41 488  THR n 
41 489  ILE n 
41 490  LYS n 
41 491  PHE n 
41 492  GLY n 
41 493  LYS n 
41 494  PRO n 
41 495  LEU n 
41 496  GLY n 
41 497  ILE n 
41 498  ARG n 
41 499  THR n 
41 500  VAL n 
41 501  ALA n 
41 502  VAL n 
41 503  ILE n 
41 504  GLY n 
41 505  GLY n 
41 506  ILE n 
41 507  SER n 
41 508  ARG n 
41 509  GLU n 
41 510  ASP n 
41 511  GLN n 
41 512  GLY n 
41 513  PHE n 
41 514  ARG n 
41 515  LEU n 
41 516  ARG n 
41 517  MET n 
41 518  GLY n 
41 519  CYS n 
41 520  GLU n 
41 521  ILE n 
41 522  VAL n 
41 523  ILE n 
41 524  ALA n 
41 525  THR n 
41 526  PRO n 
41 527  GLY n 
41 528  ARG n 
41 529  LEU n 
41 530  ILE n 
41 531  ASP n 
41 532  VAL n 
41 533  LEU n 
41 534  GLU n 
41 535  ASN n 
41 536  ARG n 
41 537  TYR n 
41 538  LEU n 
41 539  VAL n 
41 540  LEU n 
41 541  SER n 
41 542  ARG n 
41 543  CYS n 
41 544  THR n 
41 545  TYR n 
41 546  VAL n 
41 547  VAL n 
41 548  LEU n 
41 549  ASP n 
41 550  GLU n 
41 551  ALA n 
41 552  ASP n 
41 553  ARG n 
41 554  MET n 
41 555  ILE n 
41 556  ASP n 
41 557  MET n 
41 558  GLY n 
41 559  PHE n 
41 560  GLU n 
41 561  PRO n 
41 562  ASP n 
41 563  VAL n 
41 564  GLN n 
41 565  LYS n 
41 566  ILE n 
41 567  LEU n 
41 568  GLU n 
41 569  HIS n 
41 570  MET n 
41 571  PRO n 
41 572  VAL n 
41 573  SER n 
41 574  ASN n 
41 575  GLN n 
41 576  LYS n 
41 577  PRO n 
41 578  ASP n 
41 579  THR n 
41 580  ASP n 
41 581  GLU n 
41 582  ALA n 
41 583  GLU n 
41 584  ASP n 
41 585  PRO n 
41 586  GLU n 
41 587  LYS n 
41 588  MET n 
41 589  LEU n 
41 590  ALA n 
41 591  ASN n 
41 592  PHE n 
41 593  GLU n 
41 594  SER n 
41 595  GLY n 
41 596  LYS n 
41 597  HIS n 
41 598  LYS n 
41 599  TYR n 
41 600  ARG n 
41 601  GLN n 
41 602  THR n 
41 603  VAL n 
41 604  MET n 
41 605  PHE n 
41 606  THR n 
41 607  ALA n 
41 608  THR n 
41 609  MET n 
41 610  PRO n 
41 611  PRO n 
41 612  ALA n 
41 613  VAL n 
41 614  GLU n 
41 615  ARG n 
41 616  LEU n 
41 617  ALA n 
41 618  ARG n 
41 619  SER n 
41 620  TYR n 
41 621  LEU n 
41 622  ARG n 
41 623  ARG n 
41 624  PRO n 
41 625  ALA n 
41 626  VAL n 
41 627  VAL n 
41 628  TYR n 
41 629  ILE n 
41 630  GLY n 
41 631  SER n 
41 632  ALA n 
41 633  GLY n 
41 634  LYS n 
41 635  PRO n 
41 636  HIS n 
41 637  GLU n 
41 638  ARG n 
41 639  VAL n 
41 640  GLU n 
41 641  GLN n 
41 642  LYS n 
41 643  VAL n 
41 644  PHE n 
41 645  LEU n 
41 646  MET n 
41 647  SER n 
41 648  GLU n 
41 649  SER n 
41 650  GLU n 
41 651  LYS n 
41 652  ARG n 
41 653  LYS n 
41 654  LYS n 
41 655  LEU n 
41 656  LEU n 
41 657  ALA n 
41 658  ILE n 
41 659  LEU n 
41 660  GLU n 
41 661  GLN n 
41 662  GLY n 
41 663  PHE n 
41 664  ASP n 
41 665  PRO n 
41 666  PRO n 
41 667  ILE n 
41 668  ILE n 
41 669  ILE n 
41 670  PHE n 
41 671  VAL n 
41 672  ASN n 
41 673  GLN n 
41 674  LYS n 
41 675  LYS n 
41 676  GLY n 
41 677  CYS n 
41 678  ASP n 
41 679  VAL n 
41 680  LEU n 
41 681  ALA n 
41 682  LYS n 
41 683  SER n 
41 684  LEU n 
41 685  GLU n 
41 686  LYS n 
41 687  MET n 
41 688  GLY n 
41 689  TYR n 
41 690  ASN n 
41 691  ALA n 
41 692  CYS n 
41 693  THR n 
41 694  LEU n 
41 695  HIS n 
41 696  GLY n 
41 697  GLY n 
41 698  LYS n 
41 699  GLY n 
41 700  GLN n 
41 701  GLU n 
41 702  GLN n 
41 703  ARG n 
41 704  GLU n 
41 705  PHE n 
41 706  ALA n 
41 707  LEU n 
41 708  SER n 
41 709  ASN n 
41 710  LEU n 
41 711  LYS n 
41 712  ALA n 
41 713  GLY n 
41 714  ALA n 
41 715  LYS n 
41 716  ASP n 
41 717  ILE n 
41 718  LEU n 
41 719  VAL n 
41 720  ALA n 
41 721  THR n 
41 722  ASP n 
41 723  VAL n 
41 724  ALA n 
41 725  GLY n 
41 726  ARG n 
41 727  GLY n 
41 728  ILE n 
41 729  ASP n 
41 730  ILE n 
41 731  GLN n 
41 732  ASP n 
41 733  VAL n 
41 734  SER n 
41 735  MET n 
41 736  VAL n 
41 737  VAL n 
41 738  ASN n 
41 739  TYR n 
41 740  ASP n 
41 741  MET n 
41 742  ALA n 
41 743  LYS n 
41 744  ASN n 
41 745  ILE n 
41 746  GLU n 
41 747  ASP n 
41 748  TYR n 
41 749  ILE n 
41 750  HIS n 
41 751  ARG n 
41 752  ILE n 
41 753  GLY n 
41 754  ARG n 
41 755  THR n 
41 756  GLY n 
41 757  ARG n 
41 758  ALA n 
41 759  GLY n 
41 760  LYS n 
41 761  SER n 
41 762  GLY n 
41 763  VAL n 
41 764  ALA n 
41 765  ILE n 
41 766  THR n 
41 767  PHE n 
41 768  LEU n 
41 769  THR n 
41 770  LYS n 
41 771  GLU n 
41 772  ASP n 
41 773  SER n 
41 774  ALA n 
41 775  VAL n 
41 776  PHE n 
41 777  TYR n 
41 778  GLU n 
41 779  LEU n 
41 780  LYS n 
41 781  GLN n 
41 782  ALA n 
41 783  ILE n 
41 784  LEU n 
41 785  GLU n 
41 786  SER n 
41 787  PRO n 
41 788  VAL n 
41 789  SER n 
41 790  SER n 
41 791  CYS n 
41 792  PRO n 
41 793  PRO n 
41 794  GLU n 
41 795  LEU n 
41 796  ALA n 
41 797  ASN n 
41 798  HIS n 
41 799  PRO n 
41 800  ASP n 
41 801  ALA n 
41 802  GLN n 
41 803  HIS n 
41 804  LYS n 
41 805  PRO n 
41 806  GLY n 
41 807  THR n 
41 808  ILE n 
41 809  LEU n 
41 810  THR n 
41 811  LYS n 
41 812  LYS n 
41 813  ARG n 
41 814  ARG n 
41 815  GLU n 
41 816  GLU n 
41 817  THR n 
41 818  ILE n 
41 819  PHE n 
41 820  ALA n 
42 1    MET n 
42 2    ALA n 
42 3    GLY n 
42 4    VAL n 
42 5    PHE n 
42 6    PRO n 
42 7    TYR n 
42 8    ARG n 
42 9    GLY n 
42 10   PRO n 
42 11   GLY n 
42 12   ASN n 
42 13   PRO n 
42 14   VAL n 
42 15   PRO n 
42 16   GLY n 
42 17   PRO n 
42 18   LEU n 
42 19   ALA n 
42 20   PRO n 
42 21   LEU n 
42 22   PRO n 
42 23   ASP n 
42 24   TYR n 
42 25   MET n 
42 26   SER n 
42 27   GLU n 
42 28   GLU n 
42 29   LYS n 
42 30   LEU n 
42 31   GLN n 
42 32   GLU n 
42 33   LYS n 
42 34   ALA n 
42 35   ARG n 
42 36   LYS n 
42 37   TRP n 
42 38   GLN n 
42 39   GLN n 
42 40   LEU n 
42 41   GLN n 
42 42   ALA n 
42 43   LYS n 
42 44   ARG n 
42 45   TYR n 
42 46   ALA n 
42 47   GLU n 
42 48   LYS n 
42 49   ARG n 
42 50   LYS n 
42 51   PHE n 
42 52   GLY n 
42 53   PHE n 
42 54   VAL n 
42 55   ASP n 
42 56   ALA n 
42 57   GLN n 
42 58   LYS n 
42 59   GLU n 
42 60   ASP n 
42 61   MET n 
42 62   PRO n 
42 63   PRO n 
42 64   GLU n 
42 65   HIS n 
42 66   VAL n 
42 67   ARG n 
42 68   LYS n 
42 69   ILE n 
42 70   ILE n 
42 71   ARG n 
42 72   ASP n 
42 73   HIS n 
42 74   GLY n 
42 75   ASP n 
42 76   MET n 
42 77   THR n 
42 78   ASN n 
42 79   ARG n 
42 80   LYS n 
42 81   PHE n 
42 82   ARG n 
42 83   HIS n 
42 84   ASP n 
42 85   LYS n 
42 86   ARG n 
42 87   VAL n 
42 88   TYR n 
42 89   LEU n 
42 90   GLY n 
42 91   ALA n 
42 92   LEU n 
42 93   LYS n 
42 94   TYR n 
42 95   MET n 
42 96   PRO n 
42 97   HIS n 
42 98   ALA n 
42 99   VAL n 
42 100  LEU n 
42 101  LYS n 
42 102  LEU n 
42 103  LEU n 
42 104  GLU n 
42 105  ASN n 
42 106  MET n 
42 107  PRO n 
42 108  MET n 
42 109  PRO n 
42 110  TRP n 
42 111  GLU n 
42 112  GLN n 
42 113  ILE n 
42 114  ARG n 
42 115  ASP n 
42 116  VAL n 
42 117  PRO n 
42 118  VAL n 
42 119  LEU n 
42 120  TYR n 
42 121  HIS n 
42 122  ILE n 
42 123  THR n 
42 124  GLY n 
42 125  ALA n 
42 126  ILE n 
42 127  SER n 
42 128  PHE n 
42 129  VAL n 
42 130  ASN n 
42 131  GLU n 
42 132  ILE n 
42 133  PRO n 
42 134  TRP n 
42 135  VAL n 
42 136  ILE n 
42 137  GLU n 
42 138  PRO n 
42 139  VAL n 
42 140  TYR n 
42 141  ILE n 
42 142  SER n 
42 143  GLN n 
42 144  TRP n 
42 145  GLY n 
42 146  SER n 
42 147  MET n 
42 148  TRP n 
42 149  ILE n 
42 150  MET n 
42 151  MET n 
42 152  ARG n 
42 153  ARG n 
42 154  GLU n 
42 155  LYS n 
42 156  ARG n 
42 157  ASP n 
42 158  ARG n 
42 159  ARG n 
42 160  HIS n 
42 161  PHE n 
42 162  LYS n 
42 163  ARG n 
42 164  MET n 
42 165  ARG n 
42 166  PHE n 
42 167  PRO n 
42 168  PRO n 
42 169  PHE n 
42 170  ASP n 
42 171  ASP n 
42 172  GLU n 
42 173  GLU n 
42 174  PRO n 
42 175  PRO n 
42 176  LEU n 
42 177  ASP n 
42 178  TYR n 
42 179  ALA n 
42 180  ASP n 
42 181  ASN n 
42 182  ILE n 
42 183  LEU n 
42 184  ASP n 
42 185  VAL n 
42 186  GLU n 
42 187  PRO n 
42 188  LEU n 
42 189  GLU n 
42 190  ALA n 
42 191  ILE n 
42 192  GLN n 
42 193  LEU n 
42 194  GLU n 
42 195  LEU n 
42 196  ASP n 
42 197  PRO n 
42 198  GLU n 
42 199  GLU n 
42 200  ASP n 
42 201  ALA n 
42 202  PRO n 
42 203  VAL n 
42 204  LEU n 
42 205  ASP n 
42 206  TRP n 
42 207  PHE n 
42 208  TYR n 
42 209  ASP n 
42 210  HIS n 
42 211  GLN n 
42 212  PRO n 
42 213  LEU n 
42 214  ARG n 
42 215  ASP n 
42 216  SER n 
42 217  ARG n 
42 218  LYS n 
42 219  TYR n 
42 220  VAL n 
42 221  ASN n 
42 222  GLY n 
42 223  SER n 
42 224  THR n 
42 225  TYR n 
42 226  GLN n 
42 227  ARG n 
42 228  TRP n 
42 229  GLN n 
42 230  PHE n 
42 231  THR n 
42 232  LEU n 
42 233  PRO n 
42 234  MET n 
42 235  MET n 
42 236  SER n 
42 237  THR n 
42 238  LEU n 
42 239  TYR n 
42 240  ARG n 
42 241  LEU n 
42 242  ALA n 
42 243  ASN n 
42 244  GLN n 
42 245  LEU n 
42 246  LEU n 
42 247  THR n 
42 248  ASP n 
42 249  LEU n 
42 250  VAL n 
42 251  ASP n 
42 252  ASP n 
42 253  ASN n 
42 254  TYR n 
42 255  PHE n 
42 256  TYR n 
42 257  LEU n 
42 258  PHE n 
42 259  ASP n 
42 260  LEU n 
42 261  LYS n 
42 262  ALA n 
42 263  PHE n 
42 264  PHE n 
42 265  THR n 
42 266  SER n 
42 267  LYS n 
42 268  ALA n 
42 269  LEU n 
42 270  ASN n 
42 271  MET n 
42 272  ALA n 
42 273  ILE n 
42 274  PRO n 
42 275  GLY n 
42 276  GLY n 
42 277  PRO n 
42 278  LYS n 
42 279  PHE n 
42 280  GLU n 
42 281  PRO n 
42 282  LEU n 
42 283  VAL n 
42 284  ARG n 
42 285  ASP n 
42 286  ILE n 
42 287  ASN n 
42 288  LEU n 
42 289  GLN n 
42 290  ASP n 
42 291  GLU n 
42 292  ASP n 
42 293  TRP n 
42 294  ASN n 
42 295  GLU n 
42 296  PHE n 
42 297  ASN n 
42 298  ASP n 
42 299  ILE n 
42 300  ASN n 
42 301  LYS n 
42 302  ILE n 
42 303  ILE n 
42 304  ILE n 
42 305  ARG n 
42 306  GLN n 
42 307  PRO n 
42 308  ILE n 
42 309  ARG n 
42 310  THR n 
42 311  GLU n 
42 312  TYR n 
42 313  LYS n 
42 314  ILE n 
42 315  ALA n 
42 316  PHE n 
42 317  PRO n 
42 318  TYR n 
42 319  LEU n 
42 320  TYR n 
42 321  ASN n 
42 322  ASN n 
42 323  LEU n 
42 324  PRO n 
42 325  HIS n 
42 326  HIS n 
42 327  VAL n 
42 328  HIS n 
42 329  LEU n 
42 330  THR n 
42 331  TRP n 
42 332  TYR n 
42 333  HIS n 
42 334  THR n 
42 335  PRO n 
42 336  ASN n 
42 337  VAL n 
42 338  VAL n 
42 339  PHE n 
42 340  ILE n 
42 341  LYS n 
42 342  THR n 
42 343  GLU n 
42 344  ASP n 
42 345  PRO n 
42 346  ASP n 
42 347  LEU n 
42 348  PRO n 
42 349  ALA n 
42 350  PHE n 
42 351  TYR n 
42 352  PHE n 
42 353  ASP n 
42 354  PRO n 
42 355  LEU n 
42 356  ILE n 
42 357  ASN n 
42 358  PRO n 
42 359  ILE n 
42 360  SER n 
42 361  HIS n 
42 362  ARG n 
42 363  HIS n 
42 364  SER n 
42 365  VAL n 
42 366  LYS n 
42 367  SER n 
42 368  GLN n 
42 369  GLU n 
42 370  PRO n 
42 371  LEU n 
42 372  PRO n 
42 373  ASP n 
42 374  ASP n 
42 375  ASP n 
42 376  GLU n 
42 377  GLU n 
42 378  PHE n 
42 379  GLU n 
42 380  LEU n 
42 381  PRO n 
42 382  GLU n 
42 383  PHE n 
42 384  VAL n 
42 385  GLU n 
42 386  PRO n 
42 387  PHE n 
42 388  LEU n 
42 389  LYS n 
42 390  ASP n 
42 391  THR n 
42 392  PRO n 
42 393  LEU n 
42 394  TYR n 
42 395  THR n 
42 396  ASP n 
42 397  ASN n 
42 398  THR n 
42 399  ALA n 
42 400  ASN n 
42 401  GLY n 
42 402  ILE n 
42 403  ALA n 
42 404  LEU n 
42 405  LEU n 
42 406  TRP n 
42 407  ALA n 
42 408  PRO n 
42 409  ARG n 
42 410  PRO n 
42 411  PHE n 
42 412  ASN n 
42 413  LEU n 
42 414  ARG n 
42 415  SER n 
42 416  GLY n 
42 417  ARG n 
42 418  THR n 
42 419  ARG n 
42 420  ARG n 
42 421  ALA n 
42 422  LEU n 
42 423  ASP n 
42 424  ILE n 
42 425  PRO n 
42 426  LEU n 
42 427  VAL n 
42 428  LYS n 
42 429  ASN n 
42 430  TRP n 
42 431  TYR n 
42 432  ARG n 
42 433  GLU n 
42 434  HIS n 
42 435  CYS n 
42 436  PRO n 
42 437  ALA n 
42 438  GLY n 
42 439  GLN n 
42 440  PRO n 
42 441  VAL n 
42 442  LYS n 
42 443  VAL n 
42 444  ARG n 
42 445  VAL n 
42 446  SER n 
42 447  TYR n 
42 448  GLN n 
42 449  LYS n 
42 450  LEU n 
42 451  LEU n 
42 452  LYS n 
42 453  TYR n 
42 454  TYR n 
42 455  VAL n 
42 456  LEU n 
42 457  ASN n 
42 458  ALA n 
42 459  LEU n 
42 460  LYS n 
42 461  HIS n 
42 462  ARG n 
42 463  PRO n 
42 464  PRO n 
42 465  LYS n 
42 466  ALA n 
42 467  GLN n 
42 468  LYS n 
42 469  LYS n 
42 470  ARG n 
42 471  TYR n 
42 472  LEU n 
42 473  PHE n 
42 474  ARG n 
42 475  SER n 
42 476  PHE n 
42 477  LYS n 
42 478  ALA n 
42 479  THR n 
42 480  LYS n 
42 481  PHE n 
42 482  PHE n 
42 483  GLN n 
42 484  SER n 
42 485  THR n 
42 486  LYS n 
42 487  LEU n 
42 488  ASP n 
42 489  TRP n 
42 490  VAL n 
42 491  GLU n 
42 492  VAL n 
42 493  GLY n 
42 494  LEU n 
42 495  GLN n 
42 496  VAL n 
42 497  CYS n 
42 498  ARG n 
42 499  GLN n 
42 500  GLY n 
42 501  TYR n 
42 502  ASN n 
42 503  MET n 
42 504  LEU n 
42 505  ASN n 
42 506  LEU n 
42 507  LEU n 
42 508  ILE n 
42 509  HIS n 
42 510  ARG n 
42 511  LYS n 
42 512  ASN n 
42 513  LEU n 
42 514  ASN n 
42 515  TYR n 
42 516  LEU n 
42 517  HIS n 
42 518  LEU n 
42 519  ASP n 
42 520  TYR n 
42 521  ASN n 
42 522  PHE n 
42 523  ASN n 
42 524  LEU n 
42 525  LYS n 
42 526  PRO n 
42 527  VAL n 
42 528  LYS n 
42 529  THR n 
42 530  LEU n 
42 531  THR n 
42 532  THR n 
42 533  LYS n 
42 534  GLU n 
42 535  ARG n 
42 536  LYS n 
42 537  LYS n 
42 538  SER n 
42 539  ARG n 
42 540  PHE n 
42 541  GLY n 
42 542  ASN n 
42 543  ALA n 
42 544  PHE n 
42 545  HIS n 
42 546  LEU n 
42 547  CYS n 
42 548  ARG n 
42 549  GLU n 
42 550  VAL n 
42 551  LEU n 
42 552  ARG n 
42 553  LEU n 
42 554  THR n 
42 555  LYS n 
42 556  LEU n 
42 557  VAL n 
42 558  VAL n 
42 559  ASP n 
42 560  SER n 
42 561  HIS n 
42 562  VAL n 
42 563  GLN n 
42 564  TYR n 
42 565  ARG n 
42 566  LEU n 
42 567  GLY n 
42 568  ASN n 
42 569  VAL n 
42 570  ASP n 
42 571  ALA n 
42 572  PHE n 
42 573  GLN n 
42 574  LEU n 
42 575  ALA n 
42 576  ASP n 
42 577  GLY n 
42 578  LEU n 
42 579  GLN n 
42 580  TYR n 
42 581  ILE n 
42 582  PHE n 
42 583  ALA n 
42 584  HIS n 
42 585  VAL n 
42 586  GLY n 
42 587  GLN n 
42 588  LEU n 
42 589  THR n 
42 590  GLY n 
42 591  MET n 
42 592  TYR n 
42 593  ARG n 
42 594  TYR n 
42 595  LYS n 
42 596  TYR n 
42 597  LYS n 
42 598  LEU n 
42 599  MET n 
42 600  ARG n 
42 601  GLN n 
42 602  ILE n 
42 603  ARG n 
42 604  MET n 
42 605  CYS n 
42 606  LYS n 
42 607  ASP n 
42 608  LEU n 
42 609  LYS n 
42 610  HIS n 
42 611  LEU n 
42 612  ILE n 
42 613  TYR n 
42 614  TYR n 
42 615  ARG n 
42 616  PHE n 
42 617  ASN n 
42 618  THR n 
42 619  GLY n 
42 620  PRO n 
42 621  VAL n 
42 622  GLY n 
42 623  LYS n 
42 624  GLY n 
42 625  PRO n 
42 626  GLY n 
42 627  CYS n 
42 628  GLY n 
42 629  PHE n 
42 630  TRP n 
42 631  ALA n 
42 632  ALA n 
42 633  GLY n 
42 634  TRP n 
42 635  ARG n 
42 636  VAL n 
42 637  TRP n 
42 638  LEU n 
42 639  PHE n 
42 640  PHE n 
42 641  MET n 
42 642  ARG n 
42 643  GLY n 
42 644  ILE n 
42 645  THR n 
42 646  PRO n 
42 647  LEU n 
42 648  LEU n 
42 649  GLU n 
42 650  ARG n 
42 651  TRP n 
42 652  LEU n 
42 653  GLY n 
42 654  ASN n 
42 655  LEU n 
42 656  LEU n 
42 657  ALA n 
42 658  ARG n 
42 659  GLN n 
42 660  PHE n 
42 661  GLU n 
42 662  GLY n 
42 663  ARG n 
42 664  HIS n 
42 665  SER n 
42 666  LYS n 
42 667  GLY n 
42 668  VAL n 
42 669  ALA n 
42 670  LYS n 
42 671  THR n 
42 672  VAL n 
42 673  THR n 
42 674  LYS n 
42 675  GLN n 
42 676  ARG n 
42 677  VAL n 
42 678  GLU n 
42 679  SER n 
42 680  HIS n 
42 681  PHE n 
42 682  ASP n 
42 683  LEU n 
42 684  GLU n 
42 685  LEU n 
42 686  ARG n 
42 687  ALA n 
42 688  ALA n 
42 689  VAL n 
42 690  MET n 
42 691  HIS n 
42 692  ASP n 
42 693  ILE n 
42 694  LEU n 
42 695  ASP n 
42 696  MET n 
42 697  MET n 
42 698  PRO n 
42 699  GLU n 
42 700  GLY n 
42 701  ILE n 
42 702  LYS n 
42 703  GLN n 
42 704  ASN n 
42 705  LYS n 
42 706  ALA n 
42 707  ARG n 
42 708  THR n 
42 709  ILE n 
42 710  LEU n 
42 711  GLN n 
42 712  HIS n 
42 713  LEU n 
42 714  SER n 
42 715  GLU n 
42 716  ALA n 
42 717  TRP n 
42 718  ARG n 
42 719  CYS n 
42 720  TRP n 
42 721  LYS n 
42 722  ALA n 
42 723  ASN n 
42 724  ILE n 
42 725  PRO n 
42 726  TRP n 
42 727  LYS n 
42 728  VAL n 
42 729  PRO n 
42 730  GLY n 
42 731  LEU n 
42 732  PRO n 
42 733  THR n 
42 734  PRO n 
42 735  ILE n 
42 736  GLU n 
42 737  ASN n 
42 738  MET n 
42 739  ILE n 
42 740  LEU n 
42 741  ARG n 
42 742  TYR n 
42 743  VAL n 
42 744  LYS n 
42 745  ALA n 
42 746  LYS n 
42 747  ALA n 
42 748  ASP n 
42 749  TRP n 
42 750  TRP n 
42 751  THR n 
42 752  ASN n 
42 753  THR n 
42 754  ALA n 
42 755  HIS n 
42 756  TYR n 
42 757  ASN n 
42 758  ARG n 
42 759  GLU n 
42 760  ARG n 
42 761  ILE n 
42 762  ARG n 
42 763  ARG n 
42 764  GLY n 
42 765  ALA n 
42 766  THR n 
42 767  VAL n 
42 768  ASP n 
42 769  LYS n 
42 770  THR n 
42 771  VAL n 
42 772  CYS n 
42 773  LYS n 
42 774  LYS n 
42 775  ASN n 
42 776  LEU n 
42 777  GLY n 
42 778  ARG n 
42 779  LEU n 
42 780  THR n 
42 781  ARG n 
42 782  LEU n 
42 783  TYR n 
42 784  LEU n 
42 785  LYS n 
42 786  ALA n 
42 787  GLU n 
42 788  GLN n 
42 789  GLU n 
42 790  ARG n 
42 791  GLN n 
42 792  HIS n 
42 793  ASN n 
42 794  TYR n 
42 795  LEU n 
42 796  LYS n 
42 797  ASP n 
42 798  GLY n 
42 799  PRO n 
42 800  TYR n 
42 801  ILE n 
42 802  THR n 
42 803  ALA n 
42 804  GLU n 
42 805  GLU n 
42 806  ALA n 
42 807  VAL n 
42 808  ALA n 
42 809  VAL n 
42 810  TYR n 
42 811  THR n 
42 812  THR n 
42 813  THR n 
42 814  VAL n 
42 815  HIS n 
42 816  TRP n 
42 817  LEU n 
42 818  GLU n 
42 819  SER n 
42 820  ARG n 
42 821  ARG n 
42 822  PHE n 
42 823  SER n 
42 824  PRO n 
42 825  ILE n 
42 826  PRO n 
42 827  PHE n 
42 828  PRO n 
42 829  PRO n 
42 830  LEU n 
42 831  SER n 
42 832  TYR n 
42 833  LYS n 
42 834  HIS n 
42 835  ASP n 
42 836  THR n 
42 837  LYS n 
42 838  LEU n 
42 839  LEU n 
42 840  ILE n 
42 841  LEU n 
42 842  ALA n 
42 843  LEU n 
42 844  GLU n 
42 845  ARG n 
42 846  LEU n 
42 847  LYS n 
42 848  GLU n 
42 849  ALA n 
42 850  TYR n 
42 851  SER n 
42 852  VAL n 
42 853  LYS n 
42 854  SER n 
42 855  ARG n 
42 856  LEU n 
42 857  ASN n 
42 858  GLN n 
42 859  SER n 
42 860  GLN n 
42 861  ARG n 
42 862  GLU n 
42 863  GLU n 
42 864  LEU n 
42 865  GLY n 
42 866  LEU n 
42 867  ILE n 
42 868  GLU n 
42 869  GLN n 
42 870  ALA n 
42 871  TYR n 
42 872  ASP n 
42 873  ASN n 
42 874  PRO n 
42 875  HIS n 
42 876  GLU n 
42 877  ALA n 
42 878  LEU n 
42 879  SER n 
42 880  ARG n 
42 881  ILE n 
42 882  LYS n 
42 883  ARG n 
42 884  HIS n 
42 885  LEU n 
42 886  LEU n 
42 887  THR n 
42 888  GLN n 
42 889  ARG n 
42 890  ALA n 
42 891  PHE n 
42 892  LYS n 
42 893  GLU n 
42 894  VAL n 
42 895  GLY n 
42 896  ILE n 
42 897  GLU n 
42 898  PHE n 
42 899  MET n 
42 900  ASP n 
42 901  LEU n 
42 902  TYR n 
42 903  SER n 
42 904  HIS n 
42 905  LEU n 
42 906  VAL n 
42 907  PRO n 
42 908  VAL n 
42 909  TYR n 
42 910  ASP n 
42 911  VAL n 
42 912  GLU n 
42 913  PRO n 
42 914  LEU n 
42 915  GLU n 
42 916  LYS n 
42 917  ILE n 
42 918  THR n 
42 919  ASP n 
42 920  ALA n 
42 921  TYR n 
42 922  LEU n 
42 923  ASP n 
42 924  GLN n 
42 925  TYR n 
42 926  LEU n 
42 927  TRP n 
42 928  TYR n 
42 929  GLU n 
42 930  ALA n 
42 931  ASP n 
42 932  LYS n 
42 933  ARG n 
42 934  ARG n 
42 935  LEU n 
42 936  PHE n 
42 937  PRO n 
42 938  PRO n 
42 939  TRP n 
42 940  ILE n 
42 941  LYS n 
42 942  PRO n 
42 943  ALA n 
42 944  ASP n 
42 945  THR n 
42 946  GLU n 
42 947  PRO n 
42 948  PRO n 
42 949  PRO n 
42 950  LEU n 
42 951  LEU n 
42 952  VAL n 
42 953  TYR n 
42 954  LYS n 
42 955  TRP n 
42 956  CYS n 
42 957  GLN n 
42 958  GLY n 
42 959  ILE n 
42 960  ASN n 
42 961  ASN n 
42 962  LEU n 
42 963  GLN n 
42 964  ASP n 
42 965  VAL n 
42 966  TRP n 
42 967  GLU n 
42 968  THR n 
42 969  SER n 
42 970  GLU n 
42 971  GLY n 
42 972  GLU n 
42 973  CYS n 
42 974  ASN n 
42 975  VAL n 
42 976  MET n 
42 977  LEU n 
42 978  GLU n 
42 979  SER n 
42 980  ARG n 
42 981  PHE n 
42 982  GLU n 
42 983  LYS n 
42 984  MET n 
42 985  TYR n 
42 986  GLU n 
42 987  LYS n 
42 988  ILE n 
42 989  ASP n 
42 990  LEU n 
42 991  THR n 
42 992  LEU n 
42 993  LEU n 
42 994  ASN n 
42 995  ARG n 
42 996  LEU n 
42 997  LEU n 
42 998  ARG n 
42 999  LEU n 
42 1000 ILE n 
42 1001 VAL n 
42 1002 ASP n 
42 1003 HIS n 
42 1004 ASN n 
42 1005 ILE n 
42 1006 ALA n 
42 1007 ASP n 
42 1008 TYR n 
42 1009 MET n 
42 1010 THR n 
42 1011 ALA n 
42 1012 LYS n 
42 1013 ASN n 
42 1014 ASN n 
42 1015 VAL n 
42 1016 VAL n 
42 1017 ILE n 
42 1018 ASN n 
42 1019 TYR n 
42 1020 LYS n 
42 1021 ASP n 
42 1022 MET n 
42 1023 ASN n 
42 1024 HIS n 
42 1025 THR n 
42 1026 ASN n 
42 1027 SER n 
42 1028 TYR n 
42 1029 GLY n 
42 1030 ILE n 
42 1031 ILE n 
42 1032 ARG n 
42 1033 GLY n 
42 1034 LEU n 
42 1035 GLN n 
42 1036 PHE n 
42 1037 ALA n 
42 1038 SER n 
42 1039 PHE n 
42 1040 ILE n 
42 1041 VAL n 
42 1042 GLN n 
42 1043 TYR n 
42 1044 TYR n 
42 1045 GLY n 
42 1046 LEU n 
42 1047 VAL n 
42 1048 MET n 
42 1049 ASP n 
42 1050 LEU n 
42 1051 LEU n 
42 1052 VAL n 
42 1053 LEU n 
42 1054 GLY n 
42 1055 LEU n 
42 1056 HIS n 
42 1057 ARG n 
42 1058 ALA n 
42 1059 SER n 
42 1060 GLU n 
42 1061 MET n 
42 1062 ALA n 
42 1063 GLY n 
42 1064 PRO n 
42 1065 PRO n 
42 1066 GLN n 
42 1067 MET n 
42 1068 PRO n 
42 1069 ASN n 
42 1070 ASP n 
42 1071 PHE n 
42 1072 LEU n 
42 1073 SER n 
42 1074 PHE n 
42 1075 GLN n 
42 1076 ASP n 
42 1077 ILE n 
42 1078 ALA n 
42 1079 THR n 
42 1080 GLU n 
42 1081 ALA n 
42 1082 ALA n 
42 1083 HIS n 
42 1084 PRO n 
42 1085 ILE n 
42 1086 ARG n 
42 1087 LEU n 
42 1088 PHE n 
42 1089 CYS n 
42 1090 ARG n 
42 1091 TYR n 
42 1092 ILE n 
42 1093 ASP n 
42 1094 ARG n 
42 1095 ILE n 
42 1096 HIS n 
42 1097 ILE n 
42 1098 PHE n 
42 1099 PHE n 
42 1100 ARG n 
42 1101 PHE n 
42 1102 THR n 
42 1103 ALA n 
42 1104 ASP n 
42 1105 GLU n 
42 1106 ALA n 
42 1107 ARG n 
42 1108 ASP n 
42 1109 LEU n 
42 1110 ILE n 
42 1111 GLN n 
42 1112 ARG n 
42 1113 TYR n 
42 1114 LEU n 
42 1115 THR n 
42 1116 GLU n 
42 1117 HIS n 
42 1118 PRO n 
42 1119 ASP n 
42 1120 PRO n 
42 1121 ASN n 
42 1122 ASN n 
42 1123 GLU n 
42 1124 ASN n 
42 1125 ILE n 
42 1126 VAL n 
42 1127 GLY n 
42 1128 TYR n 
42 1129 ASN n 
42 1130 ASN n 
42 1131 LYS n 
42 1132 LYS n 
42 1133 CYS n 
42 1134 TRP n 
42 1135 PRO n 
42 1136 ARG n 
42 1137 ASP n 
42 1138 ALA n 
42 1139 ARG n 
42 1140 MET n 
42 1141 ARG n 
42 1142 LEU n 
42 1143 MET n 
42 1144 LYS n 
42 1145 HIS n 
42 1146 ASP n 
42 1147 VAL n 
42 1148 ASN n 
42 1149 LEU n 
42 1150 GLY n 
42 1151 ARG n 
42 1152 ALA n 
42 1153 VAL n 
42 1154 PHE n 
42 1155 TRP n 
42 1156 ASP n 
42 1157 ILE n 
42 1158 LYS n 
42 1159 ASN n 
42 1160 ARG n 
42 1161 LEU n 
42 1162 PRO n 
42 1163 ARG n 
42 1164 SER n 
42 1165 VAL n 
42 1166 THR n 
42 1167 THR n 
42 1168 VAL n 
42 1169 GLN n 
42 1170 TRP n 
42 1171 GLU n 
42 1172 ASN n 
42 1173 SER n 
42 1174 PHE n 
42 1175 VAL n 
42 1176 SER n 
42 1177 VAL n 
42 1178 TYR n 
42 1179 SER n 
42 1180 LYS n 
42 1181 ASP n 
42 1182 ASN n 
42 1183 PRO n 
42 1184 ASN n 
42 1185 LEU n 
42 1186 LEU n 
42 1187 PHE n 
42 1188 ASN n 
42 1189 MET n 
42 1190 CYS n 
42 1191 GLY n 
42 1192 PHE n 
42 1193 GLU n 
42 1194 CYS n 
42 1195 ARG n 
42 1196 ILE n 
42 1197 LEU n 
42 1198 PRO n 
42 1199 LYS n 
42 1200 CYS n 
42 1201 ARG n 
42 1202 THR n 
42 1203 SER n 
42 1204 TYR n 
42 1205 GLU n 
42 1206 GLU n 
42 1207 PHE n 
42 1208 THR n 
42 1209 HIS n 
42 1210 LYS n 
42 1211 ASP n 
42 1212 GLY n 
42 1213 VAL n 
42 1214 TRP n 
42 1215 ASN n 
42 1216 LEU n 
42 1217 GLN n 
42 1218 ASN n 
42 1219 GLU n 
42 1220 VAL n 
42 1221 THR n 
42 1222 LYS n 
42 1223 GLU n 
42 1224 ARG n 
42 1225 THR n 
42 1226 ALA n 
42 1227 GLN n 
42 1228 CYS n 
42 1229 PHE n 
42 1230 LEU n 
42 1231 ARG n 
42 1232 VAL n 
42 1233 ASP n 
42 1234 ASP n 
42 1235 GLU n 
42 1236 SER n 
42 1237 MET n 
42 1238 GLN n 
42 1239 ARG n 
42 1240 PHE n 
42 1241 HIS n 
42 1242 ASN n 
42 1243 ARG n 
42 1244 VAL n 
42 1245 ARG n 
42 1246 GLN n 
42 1247 ILE n 
42 1248 LEU n 
42 1249 MET n 
42 1250 ALA n 
42 1251 SER n 
42 1252 GLY n 
42 1253 SER n 
42 1254 THR n 
42 1255 THR n 
42 1256 PHE n 
42 1257 THR n 
42 1258 LYS n 
42 1259 ILE n 
42 1260 VAL n 
42 1261 ASN n 
42 1262 LYS n 
42 1263 TRP n 
42 1264 ASN n 
42 1265 THR n 
42 1266 ALA n 
42 1267 LEU n 
42 1268 ILE n 
42 1269 GLY n 
42 1270 LEU n 
42 1271 MET n 
42 1272 THR n 
42 1273 TYR n 
42 1274 PHE n 
42 1275 ARG n 
42 1276 GLU n 
42 1277 ALA n 
42 1278 VAL n 
42 1279 VAL n 
42 1280 ASN n 
42 1281 THR n 
42 1282 GLN n 
42 1283 GLU n 
42 1284 LEU n 
42 1285 LEU n 
42 1286 ASP n 
42 1287 LEU n 
42 1288 LEU n 
42 1289 VAL n 
42 1290 LYS n 
42 1291 CYS n 
42 1292 GLU n 
42 1293 ASN n 
42 1294 LYS n 
42 1295 ILE n 
42 1296 GLN n 
42 1297 THR n 
42 1298 ARG n 
42 1299 ILE n 
42 1300 LYS n 
42 1301 ILE n 
42 1302 GLY n 
42 1303 LEU n 
42 1304 ASN n 
42 1305 SER n 
42 1306 LYS n 
42 1307 MET n 
42 1308 PRO n 
42 1309 SER n 
42 1310 ARG n 
42 1311 PHE n 
42 1312 PRO n 
42 1313 PRO n 
42 1314 VAL n 
42 1315 VAL n 
42 1316 PHE n 
42 1317 TYR n 
42 1318 THR n 
42 1319 PRO n 
42 1320 LYS n 
42 1321 GLU n 
42 1322 LEU n 
42 1323 GLY n 
42 1324 GLY n 
42 1325 LEU n 
42 1326 GLY n 
42 1327 MET n 
42 1328 LEU n 
42 1329 SER n 
42 1330 MET n 
42 1331 GLY n 
42 1332 HIS n 
42 1333 VAL n 
42 1334 LEU n 
42 1335 ILE n 
42 1336 PRO n 
42 1337 GLN n 
42 1338 SER n 
42 1339 ASP n 
42 1340 LEU n 
42 1341 ARG n 
42 1342 TRP n 
42 1343 SER n 
42 1344 LYS n 
42 1345 GLN n 
42 1346 THR n 
42 1347 ASP n 
42 1348 VAL n 
42 1349 GLY n 
42 1350 ILE n 
42 1351 THR n 
42 1352 HIS n 
42 1353 PHE n 
42 1354 ARG n 
42 1355 SER n 
42 1356 GLY n 
42 1357 MET n 
42 1358 SER n 
42 1359 HIS n 
42 1360 GLU n 
42 1361 GLU n 
42 1362 ASP n 
42 1363 GLN n 
42 1364 LEU n 
42 1365 ILE n 
42 1366 PRO n 
42 1367 ASN n 
42 1368 LEU n 
42 1369 TYR n 
42 1370 ARG n 
42 1371 TYR n 
42 1372 ILE n 
42 1373 GLN n 
42 1374 PRO n 
42 1375 TRP n 
42 1376 GLU n 
42 1377 SER n 
42 1378 GLU n 
42 1379 PHE n 
42 1380 ILE n 
42 1381 ASP n 
42 1382 SER n 
42 1383 GLN n 
42 1384 ARG n 
42 1385 VAL n 
42 1386 TRP n 
42 1387 ALA n 
42 1388 GLU n 
42 1389 TYR n 
42 1390 ALA n 
42 1391 LEU n 
42 1392 LYS n 
42 1393 ARG n 
42 1394 GLN n 
42 1395 GLU n 
42 1396 ALA n 
42 1397 ILE n 
42 1398 ALA n 
42 1399 GLN n 
42 1400 ASN n 
42 1401 ARG n 
42 1402 ARG n 
42 1403 LEU n 
42 1404 THR n 
42 1405 LEU n 
42 1406 GLU n 
42 1407 ASP n 
42 1408 LEU n 
42 1409 GLU n 
42 1410 ASP n 
42 1411 SER n 
42 1412 TRP n 
42 1413 ASP n 
42 1414 ARG n 
42 1415 GLY n 
42 1416 ILE n 
42 1417 PRO n 
42 1418 ARG n 
42 1419 ILE n 
42 1420 ASN n 
42 1421 THR n 
42 1422 LEU n 
42 1423 PHE n 
42 1424 GLN n 
42 1425 LYS n 
42 1426 ASP n 
42 1427 ARG n 
42 1428 HIS n 
42 1429 THR n 
42 1430 LEU n 
42 1431 ALA n 
42 1432 TYR n 
42 1433 ASP n 
42 1434 LYS n 
42 1435 GLY n 
42 1436 TRP n 
42 1437 ARG n 
42 1438 VAL n 
42 1439 ARG n 
42 1440 THR n 
42 1441 ASP n 
42 1442 PHE n 
42 1443 LYS n 
42 1444 GLN n 
42 1445 TYR n 
42 1446 GLN n 
42 1447 VAL n 
42 1448 LEU n 
42 1449 LYS n 
42 1450 GLN n 
42 1451 ASN n 
42 1452 PRO n 
42 1453 PHE n 
42 1454 TRP n 
42 1455 TRP n 
42 1456 THR n 
42 1457 HIS n 
42 1458 GLN n 
42 1459 ARG n 
42 1460 HIS n 
42 1461 ASP n 
42 1462 GLY n 
42 1463 LYS n 
42 1464 LEU n 
42 1465 TRP n 
42 1466 ASN n 
42 1467 LEU n 
42 1468 ASN n 
42 1469 ASN n 
42 1470 TYR n 
42 1471 ARG n 
42 1472 THR n 
42 1473 ASP n 
42 1474 MET n 
42 1475 ILE n 
42 1476 GLN n 
42 1477 ALA n 
42 1478 LEU n 
42 1479 GLY n 
42 1480 GLY n 
42 1481 VAL n 
42 1482 GLU n 
42 1483 GLY n 
42 1484 ILE n 
42 1485 LEU n 
42 1486 GLU n 
42 1487 HIS n 
42 1488 THR n 
42 1489 LEU n 
42 1490 PHE n 
42 1491 LYS n 
42 1492 GLY n 
42 1493 THR n 
42 1494 TYR n 
42 1495 PHE n 
42 1496 PRO n 
42 1497 THR n 
42 1498 TRP n 
42 1499 GLU n 
42 1500 GLY n 
42 1501 LEU n 
42 1502 PHE n 
42 1503 TRP n 
42 1504 GLU n 
42 1505 LYS n 
42 1506 ALA n 
42 1507 SER n 
42 1508 GLY n 
42 1509 PHE n 
42 1510 GLU n 
42 1511 GLU n 
42 1512 SER n 
42 1513 MET n 
42 1514 LYS n 
42 1515 TRP n 
42 1516 LYS n 
42 1517 LYS n 
42 1518 LEU n 
42 1519 THR n 
42 1520 ASN n 
42 1521 ALA n 
42 1522 GLN n 
42 1523 ARG n 
42 1524 SER n 
42 1525 GLY n 
42 1526 LEU n 
42 1527 ASN n 
42 1528 GLN n 
42 1529 ILE n 
42 1530 PRO n 
42 1531 ASN n 
42 1532 ARG n 
42 1533 ARG n 
42 1534 PHE n 
42 1535 THR n 
42 1536 LEU n 
42 1537 TRP n 
42 1538 TRP n 
42 1539 SER n 
42 1540 PRO n 
42 1541 THR n 
42 1542 ILE n 
42 1543 ASN n 
42 1544 ARG n 
42 1545 ALA n 
42 1546 ASN n 
42 1547 VAL n 
42 1548 TYR n 
42 1549 VAL n 
42 1550 GLY n 
42 1551 PHE n 
42 1552 GLN n 
42 1553 VAL n 
42 1554 GLN n 
42 1555 LEU n 
42 1556 ASP n 
42 1557 LEU n 
42 1558 THR n 
42 1559 GLY n 
42 1560 ILE n 
42 1561 PHE n 
42 1562 MET n 
42 1563 HIS n 
42 1564 GLY n 
42 1565 LYS n 
42 1566 ILE n 
42 1567 PRO n 
42 1568 THR n 
42 1569 LEU n 
42 1570 LYS n 
42 1571 ILE n 
42 1572 SER n 
42 1573 LEU n 
42 1574 ILE n 
42 1575 GLN n 
42 1576 ILE n 
42 1577 PHE n 
42 1578 ARG n 
42 1579 ALA n 
42 1580 HIS n 
42 1581 LEU n 
42 1582 TRP n 
42 1583 GLN n 
42 1584 LYS n 
42 1585 ILE n 
42 1586 HIS n 
42 1587 GLU n 
42 1588 SER n 
42 1589 ILE n 
42 1590 VAL n 
42 1591 MET n 
42 1592 ASP n 
42 1593 LEU n 
42 1594 CYS n 
42 1595 GLN n 
42 1596 VAL n 
42 1597 PHE n 
42 1598 ASP n 
42 1599 GLN n 
42 1600 GLU n 
42 1601 LEU n 
42 1602 ASP n 
42 1603 ALA n 
42 1604 LEU n 
42 1605 GLU n 
42 1606 ILE n 
42 1607 GLU n 
42 1608 THR n 
42 1609 VAL n 
42 1610 GLN n 
42 1611 LYS n 
42 1612 GLU n 
42 1613 THR n 
42 1614 ILE n 
42 1615 HIS n 
42 1616 PRO n 
42 1617 ARG n 
42 1618 LYS n 
42 1619 SER n 
42 1620 TYR n 
42 1621 LYS n 
42 1622 MET n 
42 1623 ASN n 
42 1624 SER n 
42 1625 SER n 
42 1626 CYS n 
42 1627 ALA n 
42 1628 ASP n 
42 1629 ILE n 
42 1630 LEU n 
42 1631 LEU n 
42 1632 PHE n 
42 1633 ALA n 
42 1634 SER n 
42 1635 TYR n 
42 1636 LYS n 
42 1637 TRP n 
42 1638 ASN n 
42 1639 VAL n 
42 1640 SER n 
42 1641 ARG n 
42 1642 PRO n 
42 1643 SER n 
42 1644 LEU n 
42 1645 LEU n 
42 1646 ALA n 
42 1647 ASP n 
42 1648 SER n 
42 1649 LYS n 
42 1650 ASP n 
42 1651 VAL n 
42 1652 MET n 
42 1653 ASP n 
42 1654 SER n 
42 1655 THR n 
42 1656 THR n 
42 1657 THR n 
42 1658 GLN n 
42 1659 LYS n 
42 1660 TYR n 
42 1661 TRP n 
42 1662 ILE n 
42 1663 ASP n 
42 1664 ILE n 
42 1665 GLN n 
42 1666 LEU n 
42 1667 ARG n 
42 1668 TRP n 
42 1669 GLY n 
42 1670 ASP n 
42 1671 TYR n 
42 1672 ASP n 
42 1673 SER n 
42 1674 HIS n 
42 1675 ASP n 
42 1676 ILE n 
42 1677 GLU n 
42 1678 ARG n 
42 1679 TYR n 
42 1680 ALA n 
42 1681 ARG n 
42 1682 ALA n 
42 1683 LYS n 
42 1684 PHE n 
42 1685 LEU n 
42 1686 ASP n 
42 1687 TYR n 
42 1688 THR n 
42 1689 THR n 
42 1690 ASP n 
42 1691 ASN n 
42 1692 MET n 
42 1693 SER n 
42 1694 ILE n 
42 1695 TYR n 
42 1696 PRO n 
42 1697 SER n 
42 1698 PRO n 
42 1699 THR n 
42 1700 GLY n 
42 1701 VAL n 
42 1702 LEU n 
42 1703 ILE n 
42 1704 ALA n 
42 1705 ILE n 
42 1706 ASP n 
42 1707 LEU n 
42 1708 ALA n 
42 1709 TYR n 
42 1710 ASN n 
42 1711 LEU n 
42 1712 HIS n 
42 1713 SER n 
42 1714 ALA n 
42 1715 TYR n 
42 1716 GLY n 
42 1717 ASN n 
42 1718 TRP n 
42 1719 PHE n 
42 1720 PRO n 
42 1721 GLY n 
42 1722 SER n 
42 1723 LYS n 
42 1724 PRO n 
42 1725 LEU n 
42 1726 ILE n 
42 1727 GLN n 
42 1728 GLN n 
42 1729 ALA n 
42 1730 MET n 
42 1731 ALA n 
42 1732 LYS n 
42 1733 ILE n 
42 1734 MET n 
42 1735 LYS n 
42 1736 ALA n 
42 1737 ASN n 
42 1738 PRO n 
42 1739 ALA n 
42 1740 LEU n 
42 1741 TYR n 
42 1742 VAL n 
42 1743 LEU n 
42 1744 ARG n 
42 1745 GLU n 
42 1746 ARG n 
42 1747 ILE n 
42 1748 ARG n 
42 1749 LYS n 
42 1750 GLY n 
42 1751 LEU n 
42 1752 GLN n 
42 1753 LEU n 
42 1754 TYR n 
42 1755 SER n 
42 1756 SER n 
42 1757 GLU n 
42 1758 PRO n 
42 1759 THR n 
42 1760 GLU n 
42 1761 PRO n 
42 1762 TYR n 
42 1763 LEU n 
42 1764 SER n 
42 1765 SER n 
42 1766 GLN n 
42 1767 ASN n 
42 1768 TYR n 
42 1769 GLY n 
42 1770 GLU n 
42 1771 LEU n 
42 1772 PHE n 
42 1773 SER n 
42 1774 ASN n 
42 1775 GLN n 
42 1776 ILE n 
42 1777 ILE n 
42 1778 TRP n 
42 1779 PHE n 
42 1780 VAL n 
42 1781 ASP n 
42 1782 ASP n 
42 1783 THR n 
42 1784 ASN n 
42 1785 VAL n 
42 1786 TYR n 
42 1787 ARG n 
42 1788 VAL n 
42 1789 THR n 
42 1790 ILE n 
42 1791 HIS n 
42 1792 LYS n 
42 1793 THR n 
42 1794 PHE n 
42 1795 GLU n 
42 1796 GLY n 
42 1797 ASN n 
42 1798 LEU n 
42 1799 THR n 
42 1800 THR n 
42 1801 LYS n 
42 1802 PRO n 
42 1803 ILE n 
42 1804 ASN n 
42 1805 GLY n 
42 1806 ALA n 
42 1807 ILE n 
42 1808 PHE n 
42 1809 ILE n 
42 1810 PHE n 
42 1811 ASN n 
42 1812 PRO n 
42 1813 ARG n 
42 1814 THR n 
42 1815 GLY n 
42 1816 GLN n 
42 1817 LEU n 
42 1818 PHE n 
42 1819 LEU n 
42 1820 LYS n 
42 1821 ILE n 
42 1822 ILE n 
42 1823 HIS n 
42 1824 THR n 
42 1825 SER n 
42 1826 VAL n 
42 1827 TRP n 
42 1828 ALA n 
42 1829 GLY n 
42 1830 GLN n 
42 1831 LYS n 
42 1832 ARG n 
42 1833 LEU n 
42 1834 GLY n 
42 1835 GLN n 
42 1836 LEU n 
42 1837 ALA n 
42 1838 LYS n 
42 1839 TRP n 
42 1840 LYS n 
42 1841 THR n 
42 1842 ALA n 
42 1843 GLU n 
42 1844 GLU n 
42 1845 VAL n 
42 1846 ALA n 
42 1847 ALA n 
42 1848 LEU n 
42 1849 ILE n 
42 1850 ARG n 
42 1851 SER n 
42 1852 LEU n 
42 1853 PRO n 
42 1854 VAL n 
42 1855 GLU n 
42 1856 GLU n 
42 1857 GLN n 
42 1858 PRO n 
42 1859 LYS n 
42 1860 GLN n 
42 1861 ILE n 
42 1862 ILE n 
42 1863 VAL n 
42 1864 THR n 
42 1865 ARG n 
42 1866 LYS n 
42 1867 GLY n 
42 1868 MET n 
42 1869 LEU n 
42 1870 ASP n 
42 1871 PRO n 
42 1872 LEU n 
42 1873 GLU n 
42 1874 VAL n 
42 1875 HIS n 
42 1876 LEU n 
42 1877 LEU n 
42 1878 ASP n 
42 1879 PHE n 
42 1880 PRO n 
42 1881 ASN n 
42 1882 ILE n 
42 1883 VAL n 
42 1884 ILE n 
42 1885 LYS n 
42 1886 GLY n 
42 1887 SER n 
42 1888 GLU n 
42 1889 LEU n 
42 1890 GLN n 
42 1891 LEU n 
42 1892 PRO n 
42 1893 PHE n 
42 1894 GLN n 
42 1895 ALA n 
42 1896 CYS n 
42 1897 LEU n 
42 1898 LYS n 
42 1899 VAL n 
42 1900 GLU n 
42 1901 LYS n 
42 1902 PHE n 
42 1903 GLY n 
42 1904 ASP n 
42 1905 LEU n 
42 1906 ILE n 
42 1907 LEU n 
42 1908 LYS n 
42 1909 ALA n 
42 1910 THR n 
42 1911 GLU n 
42 1912 PRO n 
42 1913 GLN n 
42 1914 MET n 
42 1915 VAL n 
42 1916 LEU n 
42 1917 PHE n 
42 1918 ASN n 
42 1919 LEU n 
42 1920 TYR n 
42 1921 ASP n 
42 1922 ASP n 
42 1923 TRP n 
42 1924 LEU n 
42 1925 LYS n 
42 1926 THR n 
42 1927 ILE n 
42 1928 SER n 
42 1929 SER n 
42 1930 TYR n 
42 1931 THR n 
42 1932 ALA n 
42 1933 PHE n 
42 1934 SER n 
42 1935 ARG n 
42 1936 LEU n 
42 1937 ILE n 
42 1938 LEU n 
42 1939 ILE n 
42 1940 LEU n 
42 1941 ARG n 
42 1942 ALA n 
42 1943 LEU n 
42 1944 HIS n 
42 1945 VAL n 
42 1946 ASN n 
42 1947 ASN n 
42 1948 ASP n 
42 1949 ARG n 
42 1950 ALA n 
42 1951 LYS n 
42 1952 VAL n 
42 1953 ILE n 
42 1954 LEU n 
42 1955 LYS n 
42 1956 PRO n 
42 1957 ASP n 
42 1958 LYS n 
42 1959 THR n 
42 1960 THR n 
42 1961 ILE n 
42 1962 THR n 
42 1963 GLU n 
42 1964 PRO n 
42 1965 HIS n 
42 1966 HIS n 
42 1967 ILE n 
42 1968 TRP n 
42 1969 PRO n 
42 1970 THR n 
42 1971 LEU n 
42 1972 THR n 
42 1973 ASP n 
42 1974 GLU n 
42 1975 GLU n 
42 1976 TRP n 
42 1977 ILE n 
42 1978 LYS n 
42 1979 VAL n 
42 1980 GLU n 
42 1981 VAL n 
42 1982 GLN n 
42 1983 LEU n 
42 1984 LYS n 
42 1985 ASP n 
42 1986 LEU n 
42 1987 ILE n 
42 1988 LEU n 
42 1989 ALA n 
42 1990 ASP n 
42 1991 TYR n 
42 1992 GLY n 
42 1993 LYS n 
42 1994 LYS n 
42 1995 ASN n 
42 1996 ASN n 
42 1997 VAL n 
42 1998 ASN n 
42 1999 VAL n 
42 2000 ALA n 
42 2001 SER n 
42 2002 LEU n 
42 2003 THR n 
42 2004 GLN n 
42 2005 SER n 
42 2006 GLU n 
42 2007 ILE n 
42 2008 ARG n 
42 2009 ASP n 
42 2010 ILE n 
42 2011 ILE n 
42 2012 LEU n 
42 2013 GLY n 
42 2014 MET n 
42 2015 GLU n 
42 2016 ILE n 
42 2017 SER n 
42 2018 ALA n 
42 2019 PRO n 
42 2020 SER n 
42 2021 GLN n 
42 2022 GLN n 
42 2023 ARG n 
42 2024 GLN n 
42 2025 GLN n 
42 2026 ILE n 
42 2027 ALA n 
42 2028 GLU n 
42 2029 ILE n 
42 2030 GLU n 
42 2031 LYS n 
42 2032 GLN n 
42 2033 THR n 
42 2034 LYS n 
42 2035 GLU n 
42 2036 GLN n 
42 2037 SER n 
42 2038 GLN n 
42 2039 LEU n 
42 2040 THR n 
42 2041 ALA n 
42 2042 THR n 
42 2043 GLN n 
42 2044 THR n 
42 2045 ARG n 
42 2046 THR n 
42 2047 VAL n 
42 2048 ASN n 
42 2049 LYS n 
42 2050 HIS n 
42 2051 GLY n 
42 2052 ASP n 
42 2053 GLU n 
42 2054 ILE n 
42 2055 ILE n 
42 2056 THR n 
42 2057 SER n 
42 2058 THR n 
42 2059 THR n 
42 2060 SER n 
42 2061 ASN n 
42 2062 TYR n 
42 2063 GLU n 
42 2064 THR n 
42 2065 GLN n 
42 2066 THR n 
42 2067 PHE n 
42 2068 SER n 
42 2069 SER n 
42 2070 LYS n 
42 2071 THR n 
42 2072 GLU n 
42 2073 TRP n 
42 2074 ARG n 
42 2075 VAL n 
42 2076 ARG n 
42 2077 ALA n 
42 2078 ILE n 
42 2079 SER n 
42 2080 ALA n 
42 2081 ALA n 
42 2082 ASN n 
42 2083 LEU n 
42 2084 HIS n 
42 2085 LEU n 
42 2086 ARG n 
42 2087 THR n 
42 2088 ASN n 
42 2089 HIS n 
42 2090 ILE n 
42 2091 TYR n 
42 2092 VAL n 
42 2093 SER n 
42 2094 SER n 
42 2095 ASP n 
42 2096 ASP n 
42 2097 ILE n 
42 2098 LYS n 
42 2099 GLU n 
42 2100 THR n 
42 2101 GLY n 
42 2102 TYR n 
42 2103 THR n 
42 2104 TYR n 
42 2105 ILE n 
42 2106 LEU n 
42 2107 PRO n 
42 2108 LYS n 
42 2109 ASN n 
42 2110 VAL n 
42 2111 LEU n 
42 2112 LYS n 
42 2113 LYS n 
42 2114 PHE n 
42 2115 ILE n 
42 2116 CYS n 
42 2117 ILE n 
42 2118 SER n 
42 2119 ASP n 
42 2120 LEU n 
42 2121 ARG n 
42 2122 ALA n 
42 2123 GLN n 
42 2124 ILE n 
42 2125 ALA n 
42 2126 GLY n 
42 2127 TYR n 
42 2128 LEU n 
42 2129 TYR n 
42 2130 GLY n 
42 2131 VAL n 
42 2132 SER n 
42 2133 PRO n 
42 2134 PRO n 
42 2135 ASP n 
42 2136 ASN n 
42 2137 PRO n 
42 2138 GLN n 
42 2139 VAL n 
42 2140 LYS n 
42 2141 GLU n 
42 2142 ILE n 
42 2143 ARG n 
42 2144 CYS n 
42 2145 ILE n 
42 2146 VAL n 
42 2147 MET n 
42 2148 VAL n 
42 2149 PRO n 
42 2150 GLN n 
42 2151 TRP n 
42 2152 GLY n 
42 2153 THR n 
42 2154 HIS n 
42 2155 GLN n 
42 2156 THR n 
42 2157 VAL n 
42 2158 HIS n 
42 2159 LEU n 
42 2160 PRO n 
42 2161 GLY n 
42 2162 GLN n 
42 2163 LEU n 
42 2164 PRO n 
42 2165 GLN n 
42 2166 HIS n 
42 2167 GLU n 
42 2168 TYR n 
42 2169 LEU n 
42 2170 LYS n 
42 2171 GLU n 
42 2172 MET n 
42 2173 GLU n 
42 2174 PRO n 
42 2175 LEU n 
42 2176 GLY n 
42 2177 TRP n 
42 2178 ILE n 
42 2179 HIS n 
42 2180 THR n 
42 2181 GLN n 
42 2182 PRO n 
42 2183 ASN n 
42 2184 GLU n 
42 2185 SER n 
42 2186 PRO n 
42 2187 GLN n 
42 2188 LEU n 
42 2189 SER n 
42 2190 PRO n 
42 2191 GLN n 
42 2192 ASP n 
42 2193 VAL n 
42 2194 THR n 
42 2195 THR n 
42 2196 HIS n 
42 2197 ALA n 
42 2198 LYS n 
42 2199 ILE n 
42 2200 MET n 
42 2201 ALA n 
42 2202 ASP n 
42 2203 ASN n 
42 2204 PRO n 
42 2205 SER n 
42 2206 TRP n 
42 2207 ASP n 
42 2208 GLY n 
42 2209 GLU n 
42 2210 LYS n 
42 2211 THR n 
42 2212 ILE n 
42 2213 ILE n 
42 2214 ILE n 
42 2215 THR n 
42 2216 CYS n 
42 2217 SER n 
42 2218 PHE n 
42 2219 THR n 
42 2220 PRO n 
42 2221 GLY n 
42 2222 SER n 
42 2223 CYS n 
42 2224 THR n 
42 2225 LEU n 
42 2226 THR n 
42 2227 ALA n 
42 2228 TYR n 
42 2229 LYS n 
42 2230 LEU n 
42 2231 THR n 
42 2232 PRO n 
42 2233 SER n 
42 2234 GLY n 
42 2235 TYR n 
42 2236 GLU n 
42 2237 TRP n 
42 2238 GLY n 
42 2239 ARG n 
42 2240 GLN n 
42 2241 ASN n 
42 2242 THR n 
42 2243 ASP n 
42 2244 LYS n 
42 2245 GLY n 
42 2246 ASN n 
42 2247 ASN n 
42 2248 PRO n 
42 2249 LYS n 
42 2250 GLY n 
42 2251 TYR n 
42 2252 LEU n 
42 2253 PRO n 
42 2254 SER n 
42 2255 HIS n 
42 2256 TYR n 
42 2257 GLU n 
42 2258 ARG n 
42 2259 VAL n 
42 2260 GLN n 
42 2261 MET n 
42 2262 LEU n 
42 2263 LEU n 
42 2264 SER n 
42 2265 ASP n 
42 2266 ARG n 
42 2267 PHE n 
42 2268 LEU n 
42 2269 GLY n 
42 2270 PHE n 
42 2271 PHE n 
42 2272 MET n 
42 2273 VAL n 
42 2274 PRO n 
42 2275 ALA n 
42 2276 GLN n 
42 2277 SER n 
42 2278 SER n 
42 2279 TRP n 
42 2280 ASN n 
42 2281 TYR n 
42 2282 ASN n 
42 2283 PHE n 
42 2284 MET n 
42 2285 GLY n 
42 2286 VAL n 
42 2287 ARG n 
42 2288 HIS n 
42 2289 ASP n 
42 2290 PRO n 
42 2291 ASN n 
42 2292 MET n 
42 2293 LYS n 
42 2294 TYR n 
42 2295 GLU n 
42 2296 LEU n 
42 2297 GLN n 
42 2298 LEU n 
42 2299 ALA n 
42 2300 ASN n 
42 2301 PRO n 
42 2302 LYS n 
42 2303 GLU n 
42 2304 PHE n 
42 2305 TYR n 
42 2306 HIS n 
42 2307 GLU n 
42 2308 VAL n 
42 2309 HIS n 
42 2310 ARG n 
42 2311 PRO n 
42 2312 SER n 
42 2313 HIS n 
42 2314 PHE n 
42 2315 LEU n 
42 2316 ASN n 
42 2317 PHE n 
42 2318 ALA n 
42 2319 LEU n 
42 2320 LEU n 
42 2321 GLN n 
42 2322 GLU n 
42 2323 GLY n 
42 2324 GLU n 
42 2325 VAL n 
42 2326 TYR n 
42 2327 SER n 
42 2328 ALA n 
42 2329 ASP n 
42 2330 ARG n 
42 2331 GLU n 
42 2332 ASP n 
42 2333 LEU n 
42 2334 TYR n 
42 2335 ALA n 
43 1    MET n 
43 2    ASP n 
43 3    THR n 
43 4    ASP n 
43 5    LEU n 
43 6    TYR n 
43 7    ASP n 
43 8    GLU n 
43 9    PHE n 
43 10   GLY n 
43 11   ASN n 
43 12   TYR n 
43 13   ILE n 
43 14   GLY n 
43 15   PRO n 
43 16   GLU n 
43 17   LEU n 
43 18   ASP n 
43 19   SER n 
43 20   ASP n 
43 21   GLU n 
43 22   ASP n 
43 23   ASP n 
43 24   ASP n 
43 25   GLU n 
43 26   LEU n 
43 27   GLY n 
43 28   ARG n 
43 29   GLU n 
43 30   THR n 
43 31   LYS n 
43 32   ASP n 
43 33   LEU n 
43 34   ASP n 
43 35   GLU n 
43 36   MET n 
43 37   ASP n 
43 38   ASP n 
43 39   ASP n 
43 40   ASP n 
43 41   ASP n 
43 42   ASP n 
43 43   ASP n 
43 44   ASP n 
43 45   VAL n 
43 46   GLY n 
43 47   ASP n 
43 48   HIS n 
43 49   ASP n 
43 50   ASP n 
43 51   ASP n 
43 52   HIS n 
43 53   PRO n 
43 54   GLY n 
43 55   MET n 
43 56   GLU n 
43 57   VAL n 
43 58   VAL n 
43 59   LEU n 
43 60   HIS n 
43 61   GLU n 
43 62   ASP n 
43 63   LYS n 
43 64   LYS n 
43 65   TYR n 
43 66   TYR n 
43 67   PRO n 
43 68   THR n 
43 69   ALA n 
43 70   GLU n 
43 71   GLU n 
43 72   VAL n 
43 73   TYR n 
43 74   GLY n 
43 75   PRO n 
43 76   GLU n 
43 77   VAL n 
43 78   GLU n 
43 79   THR n 
43 80   ILE n 
43 81   VAL n 
43 82   GLN n 
43 83   GLU n 
43 84   GLU n 
43 85   ASP n 
43 86   THR n 
43 87   GLN n 
43 88   PRO n 
43 89   LEU n 
43 90   THR n 
43 91   GLU n 
43 92   PRO n 
43 93   ILE n 
43 94   ILE n 
43 95   LYS n 
43 96   PRO n 
43 97   VAL n 
43 98   LYS n 
43 99   THR n 
43 100  LYS n 
43 101  LYS n 
43 102  PHE n 
43 103  THR n 
43 104  LEU n 
43 105  MET n 
43 106  GLU n 
43 107  GLN n 
43 108  THR n 
43 109  LEU n 
43 110  PRO n 
43 111  VAL n 
43 112  THR n 
43 113  VAL n 
43 114  TYR n 
43 115  GLU n 
43 116  MET n 
43 117  ASP n 
43 118  PHE n 
43 119  LEU n 
43 120  ALA n 
43 121  ASP n 
43 122  LEU n 
43 123  MET n 
43 124  ASP n 
43 125  ASN n 
43 126  SER n 
43 127  GLU n 
43 128  LEU n 
43 129  ILE n 
43 130  ARG n 
43 131  ASN n 
43 132  VAL n 
43 133  THR n 
43 134  LEU n 
43 135  CYS n 
43 136  GLY n 
43 137  HIS n 
43 138  LEU n 
43 139  HIS n 
43 140  HIS n 
43 141  GLY n 
43 142  LYS n 
43 143  THR n 
43 144  CYS n 
43 145  PHE n 
43 146  VAL n 
43 147  ASP n 
43 148  CYS n 
43 149  LEU n 
43 150  ILE n 
43 151  GLU n 
43 152  GLN n 
43 153  THR n 
43 154  HIS n 
43 155  PRO n 
43 156  GLU n 
43 157  ILE n 
43 158  ARG n 
43 159  LYS n 
43 160  ARG n 
43 161  TYR n 
43 162  ASP n 
43 163  GLN n 
43 164  ASP n 
43 165  LEU n 
43 166  CYS n 
43 167  TYR n 
43 168  THR n 
43 169  ASP n 
43 170  ILE n 
43 171  LEU n 
43 172  PHE n 
43 173  THR n 
43 174  GLU n 
43 175  GLN n 
43 176  GLU n 
43 177  ARG n 
43 178  GLY n 
43 179  VAL n 
43 180  GLY n 
43 181  ILE n 
43 182  LYS n 
43 183  SER n 
43 184  THR n 
43 185  PRO n 
43 186  VAL n 
43 187  THR n 
43 188  VAL n 
43 189  VAL n 
43 190  LEU n 
43 191  PRO n 
43 192  ASP n 
43 193  THR n 
43 194  LYS n 
43 195  GLY n 
43 196  LYS n 
43 197  SER n 
43 198  TYR n 
43 199  LEU n 
43 200  PHE n 
43 201  ASN n 
43 202  ILE n 
43 203  MET n 
43 204  ASP n 
43 205  THR n 
43 206  PRO n 
43 207  GLY n 
43 208  HIS n 
43 209  VAL n 
43 210  ASN n 
43 211  PHE n 
43 212  SER n 
43 213  ASP n 
43 214  GLU n 
43 215  VAL n 
43 216  THR n 
43 217  ALA n 
43 218  GLY n 
43 219  LEU n 
43 220  ARG n 
43 221  ILE n 
43 222  SER n 
43 223  ASP n 
43 224  GLY n 
43 225  VAL n 
43 226  VAL n 
43 227  LEU n 
43 228  PHE n 
43 229  ILE n 
43 230  ASP n 
43 231  ALA n 
43 232  ALA n 
43 233  GLU n 
43 234  GLY n 
43 235  VAL n 
43 236  MET n 
43 237  LEU n 
43 238  ASN n 
43 239  THR n 
43 240  GLU n 
43 241  ARG n 
43 242  LEU n 
43 243  ILE n 
43 244  LYS n 
43 245  HIS n 
43 246  ALA n 
43 247  VAL n 
43 248  GLN n 
43 249  GLU n 
43 250  ARG n 
43 251  LEU n 
43 252  ALA n 
43 253  VAL n 
43 254  THR n 
43 255  VAL n 
43 256  CYS n 
43 257  ILE n 
43 258  ASN n 
43 259  LYS n 
43 260  ILE n 
43 261  ASP n 
43 262  ARG n 
43 263  LEU n 
43 264  ILE n 
43 265  LEU n 
43 266  GLU n 
43 267  LEU n 
43 268  LYS n 
43 269  LEU n 
43 270  PRO n 
43 271  PRO n 
43 272  THR n 
43 273  ASP n 
43 274  ALA n 
43 275  TYR n 
43 276  TYR n 
43 277  LYS n 
43 278  LEU n 
43 279  ARG n 
43 280  HIS n 
43 281  ILE n 
43 282  VAL n 
43 283  ASP n 
43 284  GLU n 
43 285  VAL n 
43 286  ASN n 
43 287  GLY n 
43 288  LEU n 
43 289  ILE n 
43 290  SER n 
43 291  MET n 
43 292  TYR n 
43 293  SER n 
43 294  THR n 
43 295  ASP n 
43 296  GLU n 
43 297  ASN n 
43 298  LEU n 
43 299  ILE n 
43 300  LEU n 
43 301  SER n 
43 302  PRO n 
43 303  LEU n 
43 304  LEU n 
43 305  GLY n 
43 306  ASN n 
43 307  VAL n 
43 308  CYS n 
43 309  PHE n 
43 310  SER n 
43 311  SER n 
43 312  SER n 
43 313  GLN n 
43 314  TYR n 
43 315  SER n 
43 316  ILE n 
43 317  CYS n 
43 318  PHE n 
43 319  THR n 
43 320  LEU n 
43 321  GLY n 
43 322  SER n 
43 323  PHE n 
43 324  ALA n 
43 325  LYS n 
43 326  ILE n 
43 327  TYR n 
43 328  ALA n 
43 329  ASP n 
43 330  THR n 
43 331  PHE n 
43 332  GLY n 
43 333  ASP n 
43 334  ILE n 
43 335  ASN n 
43 336  TYR n 
43 337  GLN n 
43 338  GLU n 
43 339  PHE n 
43 340  ALA n 
43 341  LYS n 
43 342  ARG n 
43 343  LEU n 
43 344  TRP n 
43 345  GLY n 
43 346  ASP n 
43 347  ILE n 
43 348  TYR n 
43 349  PHE n 
43 350  ASN n 
43 351  PRO n 
43 352  LYS n 
43 353  THR n 
43 354  ARG n 
43 355  LYS n 
43 356  PHE n 
43 357  THR n 
43 358  LYS n 
43 359  LYS n 
43 360  ALA n 
43 361  PRO n 
43 362  THR n 
43 363  SER n 
43 364  SER n 
43 365  SER n 
43 366  GLN n 
43 367  ARG n 
43 368  SER n 
43 369  PHE n 
43 370  VAL n 
43 371  GLU n 
43 372  PHE n 
43 373  ILE n 
43 374  LEU n 
43 375  GLU n 
43 376  PRO n 
43 377  LEU n 
43 378  TYR n 
43 379  LYS n 
43 380  ILE n 
43 381  LEU n 
43 382  ALA n 
43 383  GLN n 
43 384  VAL n 
43 385  VAL n 
43 386  GLY n 
43 387  ASP n 
43 388  VAL n 
43 389  ASP n 
43 390  THR n 
43 391  SER n 
43 392  LEU n 
43 393  PRO n 
43 394  ARG n 
43 395  THR n 
43 396  LEU n 
43 397  ASP n 
43 398  GLU n 
43 399  LEU n 
43 400  GLY n 
43 401  ILE n 
43 402  HIS n 
43 403  LEU n 
43 404  THR n 
43 405  LYS n 
43 406  GLU n 
43 407  GLU n 
43 408  LEU n 
43 409  LYS n 
43 410  LEU n 
43 411  ASN n 
43 412  ILE n 
43 413  ARG n 
43 414  PRO n 
43 415  LEU n 
43 416  LEU n 
43 417  ARG n 
43 418  LEU n 
43 419  VAL n 
43 420  CYS n 
43 421  LYS n 
43 422  LYS n 
43 423  PHE n 
43 424  PHE n 
43 425  GLY n 
43 426  GLU n 
43 427  PHE n 
43 428  THR n 
43 429  GLY n 
43 430  PHE n 
43 431  VAL n 
43 432  ASP n 
43 433  MET n 
43 434  CYS n 
43 435  VAL n 
43 436  GLN n 
43 437  HIS n 
43 438  ILE n 
43 439  PRO n 
43 440  SER n 
43 441  PRO n 
43 442  LYS n 
43 443  VAL n 
43 444  GLY n 
43 445  ALA n 
43 446  LYS n 
43 447  PRO n 
43 448  LYS n 
43 449  ILE n 
43 450  GLU n 
43 451  HIS n 
43 452  THR n 
43 453  TYR n 
43 454  THR n 
43 455  GLY n 
43 456  GLY n 
43 457  VAL n 
43 458  ASP n 
43 459  SER n 
43 460  ASP n 
43 461  LEU n 
43 462  GLY n 
43 463  GLU n 
43 464  ALA n 
43 465  MET n 
43 466  SER n 
43 467  ASP n 
43 468  CYS n 
43 469  ASP n 
43 470  PRO n 
43 471  ASP n 
43 472  GLY n 
43 473  PRO n 
43 474  LEU n 
43 475  MET n 
43 476  CYS n 
43 477  HIS n 
43 478  THR n 
43 479  THR n 
43 480  LYS n 
43 481  MET n 
43 482  TYR n 
43 483  SER n 
43 484  THR n 
43 485  ASP n 
43 486  ASP n 
43 487  GLY n 
43 488  VAL n 
43 489  GLN n 
43 490  PHE n 
43 491  HIS n 
43 492  ALA n 
43 493  PHE n 
43 494  GLY n 
43 495  ARG n 
43 496  VAL n 
43 497  LEU n 
43 498  SER n 
43 499  GLY n 
43 500  THR n 
43 501  ILE n 
43 502  HIS n 
43 503  ALA n 
43 504  GLY n 
43 505  GLN n 
43 506  PRO n 
43 507  VAL n 
43 508  LYS n 
43 509  VAL n 
43 510  LEU n 
43 511  GLY n 
43 512  GLU n 
43 513  ASN n 
43 514  TYR n 
43 515  THR n 
43 516  LEU n 
43 517  GLU n 
43 518  ASP n 
43 519  GLU n 
43 520  GLU n 
43 521  ASP n 
43 522  SER n 
43 523  GLN n 
43 524  ILE n 
43 525  CYS n 
43 526  THR n 
43 527  VAL n 
43 528  GLY n 
43 529  ARG n 
43 530  LEU n 
43 531  TRP n 
43 532  ILE n 
43 533  SER n 
43 534  VAL n 
43 535  ALA n 
43 536  ARG n 
43 537  TYR n 
43 538  HIS n 
43 539  ILE n 
43 540  GLU n 
43 541  VAL n 
43 542  ASN n 
43 543  ARG n 
43 544  VAL n 
43 545  PRO n 
43 546  ALA n 
43 547  GLY n 
43 548  ASN n 
43 549  TRP n 
43 550  VAL n 
43 551  LEU n 
43 552  ILE n 
43 553  GLU n 
43 554  GLY n 
43 555  VAL n 
43 556  ASP n 
43 557  GLN n 
43 558  PRO n 
43 559  ILE n 
43 560  VAL n 
43 561  LYS n 
43 562  THR n 
43 563  ALA n 
43 564  THR n 
43 565  ILE n 
43 566  THR n 
43 567  GLU n 
43 568  PRO n 
43 569  ARG n 
43 570  GLY n 
43 571  ASN n 
43 572  GLU n 
43 573  GLU n 
43 574  ALA n 
43 575  GLN n 
43 576  ILE n 
43 577  PHE n 
43 578  ARG n 
43 579  PRO n 
43 580  LEU n 
43 581  LYS n 
43 582  PHE n 
43 583  ASN n 
43 584  THR n 
43 585  THR n 
43 586  SER n 
43 587  VAL n 
43 588  ILE n 
43 589  LYS n 
43 590  ILE n 
43 591  ALA n 
43 592  VAL n 
43 593  GLU n 
43 594  PRO n 
43 595  VAL n 
43 596  ASN n 
43 597  PRO n 
43 598  SER n 
43 599  GLU n 
43 600  LEU n 
43 601  PRO n 
43 602  LYS n 
43 603  MET n 
43 604  LEU n 
43 605  ASP n 
43 606  GLY n 
43 607  LEU n 
43 608  ARG n 
43 609  LYS n 
43 610  VAL n 
43 611  ASN n 
43 612  LYS n 
43 613  SER n 
43 614  TYR n 
43 615  PRO n 
43 616  SER n 
43 617  LEU n 
43 618  THR n 
43 619  THR n 
43 620  LYS n 
43 621  VAL n 
43 622  GLU n 
43 623  GLU n 
43 624  SER n 
43 625  GLY n 
43 626  GLU n 
43 627  HIS n 
43 628  VAL n 
43 629  ILE n 
43 630  LEU n 
43 631  GLY n 
43 632  THR n 
43 633  GLY n 
43 634  GLU n 
43 635  LEU n 
43 636  TYR n 
43 637  LEU n 
43 638  ASP n 
43 639  CYS n 
43 640  VAL n 
43 641  MET n 
43 642  HIS n 
43 643  ASP n 
43 644  LEU n 
43 645  ARG n 
43 646  LYS n 
43 647  MET n 
43 648  TYR n 
43 649  SER n 
43 650  GLU n 
43 651  ILE n 
43 652  ASP n 
43 653  ILE n 
43 654  LYS n 
43 655  VAL n 
43 656  ALA n 
43 657  ASP n 
43 658  PRO n 
43 659  VAL n 
43 660  VAL n 
43 661  THR n 
43 662  PHE n 
43 663  CYS n 
43 664  GLU n 
43 665  THR n 
43 666  VAL n 
43 667  VAL n 
43 668  GLU n 
43 669  THR n 
43 670  SER n 
43 671  SER n 
43 672  LEU n 
43 673  LYS n 
43 674  CYS n 
43 675  PHE n 
43 676  ALA n 
43 677  GLU n 
43 678  THR n 
43 679  PRO n 
43 680  ASN n 
43 681  LYS n 
43 682  LYS n 
43 683  ASN n 
43 684  LYS n 
43 685  ILE n 
43 686  THR n 
43 687  MET n 
43 688  ILE n 
43 689  ALA n 
43 690  GLU n 
43 691  PRO n 
43 692  LEU n 
43 693  GLU n 
43 694  LYS n 
43 695  GLY n 
43 696  LEU n 
43 697  ALA n 
43 698  GLU n 
43 699  ASP n 
43 700  ILE n 
43 701  GLU n 
43 702  ASN n 
43 703  GLU n 
43 704  VAL n 
43 705  VAL n 
43 706  GLN n 
43 707  ILE n 
43 708  THR n 
43 709  TRP n 
43 710  ASN n 
43 711  ARG n 
43 712  LYS n 
43 713  LYS n 
43 714  LEU n 
43 715  GLY n 
43 716  GLU n 
43 717  PHE n 
43 718  PHE n 
43 719  GLN n 
43 720  THR n 
43 721  LYS n 
43 722  TYR n 
43 723  ASP n 
43 724  TRP n 
43 725  ASP n 
43 726  LEU n 
43 727  LEU n 
43 728  ALA n 
43 729  ALA n 
43 730  ARG n 
43 731  SER n 
43 732  ILE n 
43 733  TRP n 
43 734  ALA n 
43 735  PHE n 
43 736  GLY n 
43 737  PRO n 
43 738  ASP n 
43 739  ALA n 
43 740  THR n 
43 741  GLY n 
43 742  PRO n 
43 743  ASN n 
43 744  ILE n 
43 745  LEU n 
43 746  VAL n 
43 747  ASP n 
43 748  ASP n 
43 749  THR n 
43 750  LEU n 
43 751  PRO n 
43 752  SER n 
43 753  GLU n 
43 754  VAL n 
43 755  ASP n 
43 756  LYS n 
43 757  ALA n 
43 758  LEU n 
43 759  LEU n 
43 760  GLY n 
43 761  SER n 
43 762  VAL n 
43 763  LYS n 
43 764  ASP n 
43 765  SER n 
43 766  ILE n 
43 767  VAL n 
43 768  GLN n 
43 769  GLY n 
43 770  PHE n 
43 771  GLN n 
43 772  TRP n 
43 773  GLY n 
43 774  THR n 
43 775  ARG n 
43 776  GLU n 
43 777  GLY n 
43 778  PRO n 
43 779  LEU n 
43 780  CYS n 
43 781  ASP n 
43 782  GLU n 
43 783  LEU n 
43 784  ILE n 
43 785  ARG n 
43 786  ASN n 
43 787  VAL n 
43 788  LYS n 
43 789  PHE n 
43 790  LYS n 
43 791  ILE n 
43 792  LEU n 
43 793  ASP n 
43 794  ALA n 
43 795  VAL n 
43 796  VAL n 
43 797  ALA n 
43 798  GLN n 
43 799  GLU n 
43 800  PRO n 
43 801  LEU n 
43 802  HIS n 
43 803  ARG n 
43 804  GLY n 
43 805  GLY n 
43 806  GLY n 
43 807  GLN n 
43 808  ILE n 
43 809  ILE n 
43 810  PRO n 
43 811  THR n 
43 812  ALA n 
43 813  ARG n 
43 814  ARG n 
43 815  VAL n 
43 816  VAL n 
43 817  TYR n 
43 818  SER n 
43 819  ALA n 
43 820  PHE n 
43 821  LEU n 
43 822  MET n 
43 823  ALA n 
43 824  THR n 
43 825  PRO n 
43 826  ARG n 
43 827  LEU n 
43 828  MET n 
43 829  GLU n 
43 830  PRO n 
43 831  TYR n 
43 832  TYR n 
43 833  PHE n 
43 834  VAL n 
43 835  GLU n 
43 836  VAL n 
43 837  GLN n 
43 838  ALA n 
43 839  PRO n 
43 840  ALA n 
43 841  ASP n 
43 842  CYS n 
43 843  VAL n 
43 844  SER n 
43 845  ALA n 
43 846  VAL n 
43 847  TYR n 
43 848  THR n 
43 849  VAL n 
43 850  LEU n 
43 851  ALA n 
43 852  ARG n 
43 853  ARG n 
43 854  ARG n 
43 855  GLY n 
43 856  HIS n 
43 857  VAL n 
43 858  THR n 
43 859  GLN n 
43 860  ASP n 
43 861  ALA n 
43 862  PRO n 
43 863  ILE n 
43 864  PRO n 
43 865  GLY n 
43 866  SER n 
43 867  PRO n 
43 868  LEU n 
43 869  TYR n 
43 870  THR n 
43 871  ILE n 
43 872  LYS n 
43 873  ALA n 
43 874  PHE n 
43 875  ILE n 
43 876  PRO n 
43 877  ALA n 
43 878  ILE n 
43 879  ASP n 
43 880  SER n 
43 881  PHE n 
43 882  GLY n 
43 883  PHE n 
43 884  GLU n 
43 885  THR n 
43 886  ASP n 
43 887  LEU n 
43 888  ARG n 
43 889  THR n 
43 890  HIS n 
43 891  THR n 
43 892  GLN n 
43 893  GLY n 
43 894  GLN n 
43 895  ALA n 
43 896  PHE n 
43 897  SER n 
43 898  LEU n 
43 899  SER n 
43 900  VAL n 
43 901  PHE n 
43 902  HIS n 
43 903  HIS n 
43 904  TRP n 
43 905  GLN n 
43 906  ILE n 
43 907  VAL n 
43 908  PRO n 
43 909  GLY n 
43 910  ASP n 
43 911  PRO n 
43 912  LEU n 
43 913  ASP n 
43 914  LYS n 
43 915  SER n 
43 916  ILE n 
43 917  VAL n 
43 918  ILE n 
43 919  ARG n 
43 920  PRO n 
43 921  LEU n 
43 922  GLU n 
43 923  PRO n 
43 924  GLN n 
43 925  PRO n 
43 926  ALA n 
43 927  PRO n 
43 928  HIS n 
43 929  LEU n 
43 930  ALA n 
43 931  ARG n 
43 932  GLU n 
43 933  PHE n 
43 934  MET n 
43 935  ILE n 
43 936  LYS n 
43 937  THR n 
43 938  ARG n 
43 939  ARG n 
43 940  ARG n 
43 941  LYS n 
43 942  GLY n 
43 943  LEU n 
43 944  SER n 
43 945  GLU n 
43 946  ASP n 
43 947  VAL n 
43 948  SER n 
43 949  ILE n 
43 950  SER n 
43 951  LYS n 
43 952  PHE n 
43 953  PHE n 
43 954  ASP n 
43 955  ASP n 
43 956  PRO n 
43 957  MET n 
43 958  LEU n 
43 959  LEU n 
43 960  GLU n 
43 961  LEU n 
43 962  ALA n 
43 963  LYS n 
43 964  GLN n 
43 965  ASP n 
43 966  VAL n 
43 967  VAL n 
43 968  LEU n 
43 969  ASN n 
43 970  TYR n 
43 971  PRO n 
43 972  MET n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample 1 117  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample 1 2136 Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample 1 357  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample 1 118  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample 1 86   Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample 1 92   Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample 1 76   Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample 1 126  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample 1 231  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample 1 119  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample 1 107  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample 1 95   Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
13 1 sample 1 102  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
14 1 sample 1 139  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
15 1 sample 1 91   Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
16 1 sample 1 80   Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
17 1 sample 1 103  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
18 1 sample 1 96   Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
20 1 sample 1 188  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
21 1 sample 1 255  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
22 1 sample 1 225  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
23 1 sample 1 793  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
24 1 sample 1 464  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
25 1 sample 1 501  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
26 1 sample 1 1304 Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
27 1 sample 1 895  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
28 1 sample 1 1217 Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
29 1 sample 1 424  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
30 1 sample 1 125  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
31 1 sample 1 110  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
32 1 sample 1 86   Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
33 1 sample 1 683  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
34 1 sample 1 522  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
35 1 sample 1 941  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
36 1 sample 1 499  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
37 1 sample 1 128  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
38 1 sample 1 142  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
39 1 sample 1 565  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
40 1 sample 1 144  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
41 1 sample 1 820  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
42 1 sample 1 2335 Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
43 1 sample 1 972  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
_pdbx_entity_src_syn.entity_id              19 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       274 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   Human 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1  GB  AC105129.4  20330981 ?        1  
;AUACUCUGGUUUCUCUUCAGAUCGCAUAAAUCUUUCGCCUUUUACUAAAGAUUUCCGUGGAGAGGAACAACUCUGAGUCU
UAACCCAAUUUUUUGAGGCCUUGCUUUGGCAAGGCUA
;
189711 
2  UNP U520_HUMAN  O75643   ?        2  
;MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTKPQMQEERRAKRRKRDEDRHD
INKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFIQAALGDQPRDILCGAADEVLAVLKNEKLRDKERRKEIDLL
LGQTDDTRYHVLVNLGKKITDYGGDKEIQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASDDDMEGDEAVVRCTL
SANLVASGELMSSKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDRECENQLVLLLGFNTFDFIKV
LRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFLYQLHETEKEDLIREERSRRERVRQSRMDTDLETMDLDQGG
EALAPRQVLDLEDLVFTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLLPVEKLPKYAQAGFEGFKT
LNRIQSKLYRAALETDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDDFKIIYIAPMRSLVQEMVGSFGKRLA
TYGITVAELTGDHQLCKEEISATQIIVCTPEKWDIITRKGGERTYTQLVRLIILDEIHLLHDDRGPVLEALVARAIRNIE
MTQEDVRLIGLSATLPNYEDVATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQ
VLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELKDLLPYGFAIHHAGMTRVDRTLVEDL
FADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYL
SLLNQQLPIESQMVSKLPDMLNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLDLVHTA
ALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELFRVFSLSSEFKNITVREEEKLELQKL
LERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDK
RMWQSMCPLRQFRKLPEEVVKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITRSTLKV
ELTITPDFQWDEKVHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLITFFVPVFEPLPPQYFIRVVSDRWLSCET
QLPVSFRHLILPEKYPPPTELLDLQPLPVSALRNSAFESLYQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICA
EFAILRMLLQSSEGRCVYITPMEALAEQVYMDWYEKFQDRLNKKVVLLTGETSTDLKLLGKGNIIISTPEKWDILSRRWK
QRKNVQNINLFVVDEVHLIGGENGPVLEVICSRMRYISSQIERPIRIVALSSSLSNAKDVAHWLGCSATSTFNFHPNVRP
VPLELHIQGFNISHTQTRLLSMAKPVYHAITKHSPKKPVIVFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKDLIPY
LEKLSDSTLKETLLNGVGYLHEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVIIMDTQYYNGKIHAYVDYP
IYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCMHDHFNAEIVTKTIENKQDAVDYLTWTFL
YRRMTQNPNYYNLQGISHRHLSDHLSELVEQTLSDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKT
KVRGLIEIISNAAEYENIPIRHHEDNLLRQLAQKVPHKLNNPKFNDPHVKTNLLLQAHLSRMQLSAELQSDTEEILSKAI
RLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPHFTSEHIKRCTDKGVESVFDIMEMEDEERNALLQLT
DSQIADVARFCNRYPNIELSYEVVDKDSIRSGGPVVVLVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDAKSNSLISIK
RLTLQQKAKVKLDFVAPATGAHNYTLYFMSDAYMGCDQEYKFSVDVKEAETDSDSD
;
1      
3  UNP SNR40_HUMAN Q96DI7   ?        3  
;MIEQQKRKGPELPLVPVKRQRHELLLGAGSGPGAGQQQATPGALLQAGPPRCSSLQAPIMLLSGHEGEVYCCKFHPNGST
LASAGFDRLILLWNVYGDCDNYATLKGHSGAVMELHYNTDGSMLFSASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPA
RRGPQLVCTGSDDGTVKLWDIRKKAAIQTFQNTYQVLAVTFNDTSDQIISGGIDNDIKVWDLRQNKLTYTMRGHADSVTG
LSLSSEGSYLLSNAMDNTVRVWDVRPFAPKERCVKIFQGNVHNFEKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRIL
YKLPGHAGSINEVAFHPDEPIIISASSDKRLYMGEIQ
;
1      
4  UNP SMD2_HUMAN  P62316   ?        4  
;MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKS
GKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK
;
1      
5  UNP RUXF_HUMAN  P62306   ?        5  
;MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEE
DGEMRE
;
1      
6  UNP RUXE_HUMAN  P62304   ?        6  
;MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLK
GDNITLLQSVSN
;
1      
7  UNP RUXG_HUMAN  P62308   ?        7  MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV 1      
8  UNP SMD3_HUMAN  P62318   ?        8  
;MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNA
PMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR
;
1      
9  UNP RSMB_HUMAN  P14678   P14678-2 9  
;MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSM
TVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATAS
IAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGLL
;
1      
10 UNP SMD1_HUMAN  P62314   ?        10 
;MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLL
VDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR
;
1      
11 PDB 6AH0        6AH0     ?        11 ? 1      
12 UNP LSM2_HUMAN  Q9Y333   ?        12 
;MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQ
LLQDAARKEALQQKQ
;
1      
13 UNP LSM3_HUMAN  P62310   ?        13 
;MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKR
NIPMLFVRGDGVVLVAPPLRVG
;
1      
14 UNP LSM4_HUMAN  Q9Y4Z0   ?        14 
;MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVK
EEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ
;
1      
15 UNP LSM5_HUMAN  Q9Y4Y9   ?        15 
;MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNIT
MLVPGGEGPEV
;
1      
16 UNP LSM6_HUMAN  P62312   ?        16 
;MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRM

;
1      
17 UNP LSM7_HUMAN  Q9UK45   ?        17 
;MADKEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQLGLVVCRGTS
VVLICPQDGMEAIPNPFIQQQDA
;
1      
18 UNP LSM8_HUMAN  O95777   ?        18 
;MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNVAVIGEIDEETDSA
LDLGNIRAEPLNSVAH
;
1      
19 PDB 6AH0        6AH0     ?        19 ? 1      
20 GB  K02227.1    340097   ?        20 
;AUCGCUUCUCGGCCUUUUGGCUAAGAUCAAGUGUAGUAUCUGUUCUUAUCAGUUUAAUAUCUGAUACGUCCUCUAUCCGA
GGACAAUAUAUUAAAUGGAUUUUUGGAGCAGGGAGAUGGAAUAGGAGCUUGCUCCGUCCACUCCACGCAUCGACCUGGUA
UUGCAGUACCUCCAGGAACGGUGCACCC
;
192    
21 UNP RU2A_HUMAN  P09661   ?        21 
;MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIG
EGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEK
MFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTD
DGEEEMEEDTVTNGS
;
1      
22 UNP RU2B_HUMAN  P08579   ?        22 
;MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMR
IQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPE
ETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK
;
1      
23 UNP SF3A1_HUMAN Q15459   ?        23 
;MPAGPVQAVPPPPPVPTEPKQPTEEEASSKEDSAPSKPVVGIIYPPPEVRNIVDKTASFVARNGPEFEARIRQNEINNPK
FNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQQQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSIS
AFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKILIPPKGLFSKLKKEAENPREVL
DQVCYRVEWAKFQERERKKEEEEKEKERVAYAQIDWHDFVVVETVDFQPNEQGNFPPPTTPEELGARILIQERYEKFGES
EEVEMEVESDEEDDKQEKAEEPPSQLDQDTQVQDMDEGSDDEEEGQKVPPPPETPMPPPLPPTPDQVIVRKDYDPKASKP
LPPAPAPDEYLVSPITGEKIPASKMQEHMRIGLLDPRWLEQRDRSIREKQSDDEVYAPGLDIESSLKQLAERRTDIFGVE
ETAIGKKIGEEEIQKPEEKVTWDGHSGSMARTQQAAQANITLQEQIEAIHKAKGLVPEDDTKEKIGPSKPNEIPQQPPPP
SSATNIPSSAPPITSVPRPPTMPPPVRTTVVSAVPVMPRPPMASVVRLPPGSVIAPMPPIIHAPRINVVPMPPSAPPIMA
PRPPPMIVPTAFVPAPPVAPVPAPAPMPPVHPPPPMEDEPTSKKLKTEDSLMPEEEFLRRNKGPVSIKVQVPNMQDKTEW
KLNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHLALKERGGRKK
;
1      
24 UNP SF3A2_HUMAN Q15428   ?        24 
;MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQT
NLARRAAKEAKEAPAQPAPEKVKVEVKKFVKIGRPGYKVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIE
PPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKPPAPPSLPAGPPGVKRPPPPLMNG
LPPRPPLPESLPPPPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAPVVHPPASGVHPPAPGVHPPAPGVHPPAP
GVHPPTSGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPPSAGVHPQAPGVHPAAPAVHPQAPGVHPPAPGM
HPQAPGVHPQPPGVHPSAPGVHPQPPGVHPSNPGVHPPTPMPPMLRPPLPSEGPGNIPPPPPTN
;
1      
25 UNP SF3A3_HUMAN Q12874   ?        25 
;METILEQQRRYHEEKERLMDVMAKEMLTKKSTLRDQINSDHRTRAMQDRYMEVSGNLRDLYDDKDGLRKEELNAISGPNE
FAEFYNRLKQIKEFHRKHPNEICVPMSVEFEELLKARENPSEEAQNLVEFTDEEGYGRYLDLHDCYLKYINLKASEKLDY
ITYLSIFDQLFDIPKERKNAEYKRYLEMLLEYLQDYTDRVKPLQDQNELFGKIQAEFEKKWENGTFPGWPKETSSALTHA
GAHLDLSAFSSWEELASLGLDRLKSALLALGLKCGGTLEERAQRLFSTKGKSLESLDTSLFAKNPKSKGTKRDTERNKDI
AFLEAQIYEYVEILGEQRHLTHENVQRKQARTGEEREEEEEEQISESESEDEENEIIYNPKNLPLGWDGKPIPYWLYKLH
GLNINYNCEICGNYTYRGPKAFQRHFAEWRHAHGMRCLGIPNTAHFANVTQIEDAVSLWAKLKLQKASERWQPDTEEEYE
DSSGNVVNKKTYEDLKRQGLL
;
1      
26 UNP SF3B1_HUMAN O75533   ?        26 
;MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSRFAGYVTSIAATELEDDDDDYSSSTSLLGQK
KPGYHAPVALLNDIPQSTEQYDPFAEHRPPKIADREDEYKKHRRTMIISPERLDPFADGGKTPDPKMNARTYMDVMREQH
LTKEEREIRQQLAEKAKAGELKVVNGAAASQPPSKRKRRWDQTADQTPGATPKKLSSWDQAETPGHTPSLRWDETPGRAK
GSETPGATPGSKIWDPTPSHTPAGAATPGRGDTPGHATPGHGGATSSARKNRWDETPKTERDTPGHGSGWAETPRTDRGG
DSIGETPTPGASKRKSRWDETPASQMGGSTPVLTPGKTPIGTPAMNMATPTPGHIMSMTPEQLQAWRWEREIDERNRPLS
DEELDAMFPEGYKVLPPPAGYVPIRTPARKLTATPTPLGGMTGFHMQTEDRTMKSVNDQPSGNLPFLKPDDIQYFDKLLV
DVDESTLSPEEQKERKIMKLLLKIKNGTPPMRKAALRQITDKAREFGAGPLFNQILPLLMSPTLEDQERHLLVKVIDRIL
YKLDDLVRPYVHKILVVIEPLLIDEDYYARVEGREIISNLAKAAGLATMISTMRPDIDNMDEYVRNTTARAFAVVASALG
IPSLLPFLKAVCKSKKSWQARHTGIKIVQQIAILMGCAILPHLRSLVEIIEHGLVDEQQKVRTISALAIAALAEAATPYG
IESFDSVLKPLWKGIRQHRGKGLAAFLKAIGYLIPLMDAEYANYYTREVMLILIREFQSPDEEMKKIVLKVVKQCCGTDG
VEANYIKTEILPPFFKHFWQHRMALDRRNYRQLVDTTVELANKVGAAEIISRIVDDLKDEAEQYRKMVMETIEKIMGNLG
AADIDHKLEEQLIDGILYAFQEQTTEDSVMLNGFGTVVNALGKRVKPYLPQICGTVLWRLNNKSAKVRQQAADLISRTAV
VMKTCQEEKLMGHLGVVLYEYLGEEYPEVLGSILGALKAIVNVIGMHKMTPPIKDLLPRLTPILKNRHEKVQENCIDLVG
RIADRGAEYVSAREWMRICFELLELLKAHKKAIRRATVNTFGYIAKAIGPHDVLATLLNNLKVQERQNRVCTTVAIAIVA
ETCSPFTVLPALMNEYRVPELNVQNGVLKSLSFLFEYIGEMGKDYIYAVTPLLEDALMDRDLVHRQTASAVVQHMSLGVY
GFGCEDSLNHLLNYVWPNVFETSPHVIQAVMGALEGLRVAIGPCRMLQYCLQGLFHPARKVRDVYWKIYNSIYIGSQDAL
IAHYPRIYNDDKNTYIRYELDYIL
;
1      
27 UNP SF3B2_HUMAN Q13435   ?        27 
;MATEHPEPPKAELQLPPPPPPGHYGAWAAQELQAKLAEIGAPIQGNREELVERLQSYTRQTGIVLNRPVLRGEDGDKAAP
PPMSAQLPGIPMPPPPLGLPPLQPPPPPPPPPPGLGLGFPMAHPPNLGPPPPLRVGEPVALSEEERLKLAQQQAALLMQQ
EERAKQQGDHSLKEHELLEQQKRAAVLLEQERQQEIAKMGTPVPRPPQDMGQIGVRTPLGPRVAAPVGPVGPTPTVLPMG
APVPRPRGPPPPPGDENREMDDPSVGPKIPQALEKILQLKESRQEEMNSQQEEEEMETDARSSLGQSASETEEDTVSVSK
KEKNRKRRNRKKKKKPQRVRGVSSESSGDREKDSTRSRGSDSPAADVEIEYVTEEPEIYEPNFIFFKRIFEAFKLTDDVK
KEKEKEPEKLDKLENSAAPKKKGFEEEHKDSDDDSSDDEQEKKPEAPKLSKKKLRRMNRFTVAELKQLVARPDVVEMHDV
TAQDPKLLVHLKATRNSVPVPRHWCFKRKYLQGKRGIEKPPFELPDFIKRTGIQEMREALQEKEEQKTMKSKMREKVRPK
MGKIDIDYQKLHDAFFKWQTKPKLTIHGDLYYEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYG
PPPSYPNLKIPGLNSPIPESCSFGYHAGGWGKPPVDETGKPLYGDVFGTNAAEFQTKTEEEEIDRTPWGELEPSDEESSE
EEEEEESDEDKPDETGFITPADSGLITPGGFSSVPAGMETPELIELRKKKIEEAMDGSETPQLFTVLPEKRTATVGGAMM
GSTHIYDMSTVMSRKGPAPELQGVEVALAPEELELDPMAMTQKYEEHVREQQAQVEKEDFSDMVAEHAAKQKQKKRKAQP
QDSRGGSKKYKEFKF
;
1      
28 UNP SF3B3_HUMAN Q15393   ?        28 
;MFLYNLTLQRATGISFAIHGNFSGTKQQEIVVSRGKILELLRPDPNTGKVHTLLTVEVFGVIRSLMAFRLTGGTKDYIVV
GSDSGRIVILEYQPSKNMFEKIHQETFGKSGCRRIVPGQFLAVDPKGRAVMISAIEKQKLVYILNRDAAARLTISSPLEA
HKANTLVYHVVGVDVGFENPMFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEPLEEHGNFLITVPG
GSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKSMFFFLAQTEQGDIFKITLETDED
MVTEIRLKYFDTVPVAAAMCVLKTGFLFVASEFGNHYLYQIAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDE
LDSLSPILFCQIADLANEDTPQLYVACGRGPRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHIEDEFDAYIIVSFVN
ATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGDDALVQVYPDGIRHIRADKRVNEWKTPGKKTIVKCAVNQRQVVIALTG
GELVYFEMDPSGQLNEYTERKEMSADVVCMSLANVPPGEQRSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPESL
CIVEMGGTEKQDELGERGSIGFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSW
LSYSYQSRFHLTPLSYETLEFASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFPLQYTPRKFVIHPESNNLIII
ETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLV
QLEQNEAAFSVAVCRFSNTGEDWYVLVGVAKDLILNPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVL
IGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRYKRNENQLIIFADDTYPRWVTTASLLD
YDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYT
TLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRT
PPEVSKKLEDIRTRYAF
;
1      
29 UNP SF3B4_HUMAN Q15427   ?        29 
;MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLY
GKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIE
AMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFADAPPPPSAPNPVVSSLGSGLPPPGMPPP
GSFPPPVPPPGALPPGIPPAMPPPPMPPGAAGHGPPSAGTPGAGHPGHGHSHPHPFPPGGMPHPGMSQMQLAHHGPHGLG
HPHAGPPGSGGQPPPRPPPGMPHPGPPPMGMPPRGPPFGSPMGHPGPMPPHGMRGPPPLMPPHGYTGPPRPPPYGYQRGP
LPPPRPTPRPPVPPRGPLRGPLPQ
;
1      
30 UNP SF3B6_HUMAN Q9Y3B4   ?        30 
;MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGF
NVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK
;
1      
31 UNP PHF5A_HUMAN Q7RTV0   ?        31 
;MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEK
DRDGCPKIVNLGSSKTDLFYERKKYGFKKR
;
1      
32 UNP SF3B5_HUMAN Q9BWJ5   ?        32 
;MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPA
DKPEEN
;
1      
33 UNP PRPF3_HUMAN O43395   ?        33 
;MALSKRELDELKPWIEKTVKRVLGFSEPTVVTAALNCVGKGMDKKKAADHLKPFLDDSTLRFVDKLFEAVEEGRSSRHSK
SSSDRSRKRELKEVFGDDSEISKESSGVKKRRIPRFEEVEEEPEVIPGPPSESPGMLTKLQIKQMMEAATRQIEERKKQL
SFISPPTPQPKTPSSSQPERLPIGNTIQPSQAATFMNDAIEKARKAAELQARIQAQLALKPGLIGNANMVGLANLHAMGI
APPKVELKDQTKPTPLILDEQGRTVDATGKEIELTHRMPTLKANIRAVKREQFKQQLKEKPSEDMESNTFFDPRVSIAPS
QRQRRTFKFHDKGKFEKIAQRLRTKAQLEKLQAEISQAARKTGIHTSTRLALIAPKKELKEGDIPEIEWWDSYIIPNGFD
LTEENPKREDYFGITNLVEHPAQLNPPVDNDTPVTLGVYLTKKEQKKLRRQTRREAQKELQEKVRLGLMPPPEPKVRISN
LMRVLGTEAVQDPTKVEAHVRAQMAKRQKAHEEANAARKLTAEQRKVKKIKKLKEDISQGVHISVYRVRNLSNPAKKFKI
EANAGQLYLTGVVVLHKDVNVVVVEGGPKAQKKFKRLMLHRIKWDEQTSNTKGDDDEESDEEAVKKTNKCVLVWEGTAKD
RSFGEMKFKQCPTENMAREHFKKHGAEHYWDLALSESVLESTD
;
1      
34 UNP PRP4_HUMAN  O43172   ?        34 
;MASSRASSTQATKTKAPDDLVAPVVKKPHIYYGSLEEKERERLAKGESGILGKDGLKAGIEAGNINITSGEVFEIEEHIS
ERQAEVLAEFERRKRARQINVSTDDSEVKACLRALGEPITLFGEGPAERRERLRNILSVVGTDALKKTKKDDEKSKKSKE
EYQQTWYHEGPNSLKVARLWIANYSLPRAMKRLEEARLHKEIPETTRTSQMQELHKSLRSLNNFCSQIGDDRPISYCHFS
PNSKMLATACWSGLCKLWSVPDCNLLHTLRGHNTNVGAIVFHPKSTVSLDPKDVNLASCAADGSVKLWSLDSDEPVADIE
GHTVRVARVMWHPSGRFLGTTCYDRSWRLWDLEAQEEILHQEGHSMGVYDIAFHQDGSLAGTGGLDAFGRVWDLRTGRCI
MFLEGHLKEIYGINFSPNGYHIATGSGDNTCKVWDLRQRRCVYTIPAHQNLVTGVKFEPIHGNFLLTGAYDNTAKIWTHP
GWSPLKTLAGHEGKVMGLDISSDGQLIATCSYDRTFKLWMAE
;
1      
35 UNP PRP6_HUMAN  O94906   ?        35 
;MNKKKKPFLGMPAPLGYVPGLGRGATGFTTRSDIGPARDANDPVDDRHAPPGKRTVGDQMKKNQAADDDDEDLNDTNYDE
FNGYAGSLFSSGPYEKDDEEADAIYAALDKRMDERRKERREQREKEEIEKYRMERPKIQQQFSDLKRKLAEVTEEEWLSI
PEVGDARNKRQRNPRYEKLTPVPDSFFAKHLQTGENHTSVDPRQTQFGGLNTPYPGGLNTPYPGGMTPGLMTPGTGELDM
RKIGQARNTLMDMRLSQVSDSVSGQTVVDPKGYLTDLNSMIPTHGGDINDIKKARLLLKSVRETNPHHPPAWIASARLEE
VTGKLQVARNLIMKGTEMCPKSEDVWLEAARLQPGDTAKAVVAQAVRHLPQSVRIYIRAAELETDIRAKKRVLRKALEHV
PNSVRLWKAAVELEEPEDARIMLSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDRHIWITAAKLEEANGNT
QMVEKIIDRAITSLRANGVEINREQWIQDAEECDRAGSVATCQAVMRAVIGIGIEEEDRKHTWMEDADSCVAHNALECAR
AIYAYALQVFPSKKSVWLRAAYFEKNHGTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPN
SEEIWLAAVKLESENDEYERARRLLAKARSSAPTARVFMKSVKLEWVQDNIRAAQDLCEEALRHYEDFPKLWMMKGQIEE
QKEMMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESVRLEYRAGLKNIANTLM
AKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHDPHVLLAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAF
FYKFELQHGTEEQQEEVRKRCESAEPRHGELWCAVSKDIANWQKKIGDILRLVAGRIKNTF
;
1      
36 UNP PRP31_HUMAN Q8WWY3   ?        36 
;MSLADELLADLEEAAEEEEGGSYGEEEEEPAIEDVQEETQLDLSGDSVKTIAKLWDSKMFAEIMMKIEEYISKQAKASEV
MGPVEAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGNSLDKCKNNENLQQILT
NATIMVVSVTASTTQGQQLSEEELERLEEACDMALELNASKHRIYEYVESRMSFIAPNLSIIIGASTAAKIMGVAGGLTN
LSKMPACNIMLLGAQRKTLSGFSSTSVLPHTGYIYHSDIVQSLPPDLRRKAARLVAAKCTLAARVDSFHESTEGKVGYEL
KDEIERKFDKWQEPPPVKQVKPLPAPLDGQRKKRGGRRYRKMKERLGLTEIRKQANRMSFGEIEEDAYQEDLGFSLGHLG
KSGSGRVRQTQVNEATKARISKTLQRTLQKQSVVYGGKSTIRDRSSGTASSVAFTPLQGLEIVNPQAAEKKVAEANQKYF
SSMAEFLKVKGEKSGLMST
;
1      
37 UNP NH2L1_HUMAN P55769   ?        37 
;MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPY
VFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
;
1      
38 UNP TXN4A_HUMAN P83876   ?        38 
;MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCT
VMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY
;
1      
39 UNP SNUT2_HUMAN Q53GS9   ?        39 
;MSGRSKRESRGSTRGKRESESRGSSGRVKRERDREREPEAASSRGSPVRVKREFEPASAREAPASVVPFVRVKREREVDE
DSEPEREVRAKNGRVDSEDRRSRHCPYLDTINRSVLDFDFEKLCSISLSHINAYACLVCGKYFQGRGLKSHAYIHSVQFS
HHVFLNLHTLKFYCLPDNYEIIDSSLEDITYVLKPTFTKQQIANLDKQAKLSRAYDGTTYLPGIVGLNNIKANDYANAVL
QALSNVPPLRNYFLEEDNYKNIKRPPGDIMFLLVQRFGELMRKLWNPRNFKAHVSPHEMLQAVVLCSKKTFQITKQGDGV
DFLSWFLNALHSALGGTKKKKKTIVTDVFQGSMRIFTKKLPHPDLPAEEKEQLLHNDEYQETMVESTFMYLTLDLPTAPL
YKDEKEQLIIPQVPLFNILAKFNGITEKEYKTYKENFLKRFQLTKLPPYLIFCIKRFTKNNFFVEKNPTIVNFPITNVDL
REYLSEEVQAVHKNTTYDLIANIVHDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRRDNDET
NQQGA
;
1      
40 GB  M15956.1    340142   ?        40 
;AGCUUUGCGCAGUGGCAGUAUCGUAGCCAAUGAGGUCUAUCCGAGGCGCGAUUAUUGCUAAUUGAAAACUUUUCCCAAUA
CCCCGCCGUGACGACUUGCAAUAUAGUCGGCACUGGCAAUUUUUGACAGUCUCUACGGAGACUG
;
271    
41 UNP DDX23_HUMAN Q9BUQ8   ?        41 
;MAGELADKKDRDASPSKEERKRSRTPDRERDRDRDRKSSPSKDRKRHRSRDRRRGGSRSRSRSRSKSAERERRHKERERD
KERDRNKKDRDRDKDGHRRDKDRKRSSLSPGRGKDFKSRKDRDSKKDEEDEHGDKKPKAQPLSLEELLAKKKAEEEAEAK
PKFLSKAEREAEALKRRQQEVEERQRMLEEERKKRKQFQDLGRKMLEDPQERERRERRERMERETNGNEDEEGRQKIREE
KDKSKELHAIKERYLGGIKKRRRTRHLNDRKFVFEWDASEDTSIDYNPLYKERHQVQLLGRGFIAGIDLKQQKREQSRFY
GDLMEKRRTLEEKEQEEARLRKLRKKEAKQRWDDRHWSQKKLDEMTDRDWRIFREDYSITTKGGKIPNPIRSWKDSSLPP
HILEVIDKCGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLVWITTLPKIDRIEESDQGPYAIILAPTREL
AQQIEEETIKFGKPLGIRTVAVIGGISREDQGFRLRMGCEIVIATPGRLIDVLENRYLVLSRCTYVVLDEADRMIDMGFE
PDVQKILEHMPVSNQKPDTDEAEDPEKMLANFESGKHKYRQTVMFTATMPPAVERLARSYLRRPAVVYIGSAGKPHERVE
QKVFLMSESEKRKKLLAILEQGFDPPIIIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQEQREFALSNLKAGAKDILVA
TDVAGRGIDIQDVSMVVNYDMAKNIEDYIHRIGRTGRAGKSGVAITFLTKEDSAVFYELKQAILESPVSSCPPELANHPD
AQHKPGTILTKKRREETIFA
;
1      
42 UNP PRP8_HUMAN  Q6P2Q9   ?        42 
;MAGVFPYRGPGNPVPGPLAPLPDYMSEEKLQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRK
FRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYISQWGSMWIMMRREKRDRRH
FKRMRFPPFDDEEPPLDYADNILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSTLYR
LANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLY
NNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTAN
GIALLWAPRPFNLRSGRTRRALDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATK
FFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLTKLVVDS
HVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFF
MRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCW
KANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPY
ITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSR
IKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGIN
NLQDVWETSEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFI
VQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDIATEAAHPIRLFCRYIDRIHIFFRFTADEARDLIQRYLTEHPDP
NNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKC
RTSYEEFTHKDGVWNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVN
TQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHE
EDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRT
DFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTN
AQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQE
LDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYA
RAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTE
PYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWK
TAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLY
DDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVA
SLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISA
ANLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFICISDLRAQIAGYLYGVSPPDNPQVKEIRCIVMVPQWGTHQTVHLP
GQLPQHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKIMADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQ
NTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQSSWNYNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALL
QEGEVYSADREDLYA
;
1      
43 UNP U5S1_HUMAN  Q15029   ?        43 
;MDTDLYDEFGNYIGPELDSDEDDDELGRETKDLDEMDDDDDDDDVGDHDDDHPGMEVVLHEDKKYYPTAEEVYGPEVETI
VQEEDTQPLTEPIIKPVKTKKFTLMEQTLPVTVYEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKR
YDQDLCYTDILFTEQERGVGIKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTE
RLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTDENLILSPLLGNVCFSSSQYSICFTL
GSFAKIYADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKAPTSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDELG
IHLTKEELKLNIRPLLRLVCKKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTK
MYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIEVNRVPAGNWVLIEGVDQPIV
KTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSELPKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCV
MHDLRKMYSEIDIKVADPVVTFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQT
KYDWDLLAARSIWAFGPDATGPNILVDDTLPSEVDKALLGSVKDSIVQGFQWGTREGPLCDELIRNVKFKILDAVVAQEP
LHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDS
FGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPMLLE
LAKQDVVLNYPM
;
1      
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  6AH0 B 1 ? 117  ? 20330981 189711 ? 189595 ? 1   117  
2  2  6AH0 D 1 ? 2136 ? O75643   1      ? 2136   ? 1   2136 
3  3  6AH0 E 1 ? 357  ? Q96DI7   1      ? 357    ? 1   357  
4  4  6AH0 a 1 ? 118  ? P62316   1      ? 118    ? 1   118  
5  5  6AH0 b 1 ? 86   ? P62306   1      ? 86     ? 1   86   
6  6  6AH0 c 1 ? 92   ? P62304   1      ? 92     ? 1   92   
7  7  6AH0 d 1 ? 76   ? P62308   1      ? 76     ? 1   76   
8  8  6AH0 e 1 ? 126  ? P62318   1      ? 126    ? 1   126  
9  9  6AH0 f 1 ? 231  ? P14678   1      ? 231    ? 1   231  
10 10 6AH0 g 1 ? 119  ? P62314   1      ? 119    ? 1   119  
11 11 6AH0 F 1 ? 107  ? 6AH0     1      ? 107    ? 1   107  
12 12 6AH0 q 1 ? 95   ? Q9Y333   1      ? 95     ? 1   95   
13 13 6AH0 r 1 ? 102  ? P62310   1      ? 102    ? 1   102  
14 14 6AH0 s 1 ? 139  ? Q9Y4Z0   1      ? 139    ? 1   139  
15 15 6AH0 t 1 ? 91   ? Q9Y4Y9   1      ? 91     ? 1   91   
16 16 6AH0 x 1 ? 80   ? P62312   1      ? 80     ? 1   80   
17 17 6AH0 y 1 ? 103  ? Q9UK45   1      ? 103    ? 1   103  
18 18 6AH0 z 1 ? 96   ? O95777   1      ? 96     ? 1   96   
19 19 6AH0 G 1 ? 274  ? 6AH0     -60    ? 213    ? -60 213  
20 20 6AH0 H 1 ? 188  ? 340097   192    ? 379    ? 1   188  
21 21 6AH0 o 1 ? 255  ? P09661   1      ? 255    ? 1   255  
22 22 6AH0 p 1 ? 225  ? P08579   1      ? 225    ? 1   225  
23 8  6AH0 h 1 ? 126  ? P62318   1      ? 126    ? 1   126  
24 9  6AH0 i 1 ? 231  ? P14678   1      ? 231    ? 1   231  
25 10 6AH0 j 1 ? 119  ? P62314   1      ? 119    ? 1   119  
26 4  6AH0 k 1 ? 118  ? P62316   1      ? 118    ? 1   118  
27 5  6AH0 m 1 ? 86   ? P62306   1      ? 86     ? 1   86   
28 6  6AH0 l 1 ? 92   ? P62304   1      ? 92     ? 1   92   
29 7  6AH0 n 1 ? 76   ? P62308   1      ? 76     ? 1   76   
30 23 6AH0 u 1 ? 793  ? Q15459   1      ? 793    ? 1   793  
31 24 6AH0 v 1 ? 464  ? Q15428   1      ? 464    ? 1   464  
32 25 6AH0 w 1 ? 501  ? Q12874   1      ? 501    ? 1   501  
33 26 6AH0 1 1 ? 1304 ? O75533   1      ? 1304   ? 1   1304 
34 27 6AH0 2 1 ? 895  ? Q13435   1      ? 895    ? 1   895  
35 28 6AH0 3 1 ? 1217 ? Q15393   1      ? 1217   ? 1   1217 
36 29 6AH0 4 1 ? 424  ? Q15427   1      ? 424    ? 1   424  
37 30 6AH0 5 1 ? 125  ? Q9Y3B4   1      ? 125    ? 1   125  
38 31 6AH0 6 1 ? 110  ? Q7RTV0   1      ? 110    ? 1   110  
39 32 6AH0 7 1 ? 86   ? Q9BWJ5   1      ? 86     ? 1   86   
40 33 6AH0 J 1 ? 683  ? O43395   1      ? 683    ? 1   683  
41 34 6AH0 K 1 ? 522  ? O43172   1      ? 522    ? 1   522  
42 35 6AH0 N 1 ? 941  ? O94906   1      ? 941    ? 1   941  
43 36 6AH0 L 1 ? 499  ? Q8WWY3   1      ? 499    ? 1   499  
44 37 6AH0 M 1 ? 128  ? P55769   1      ? 128    ? 1   128  
45 38 6AH0 O 1 ? 142  ? P83876   1      ? 142    ? 1   142  
46 39 6AH0 W 1 ? 565  ? Q53GS9   1      ? 565    ? 1   565  
47 40 6AH0 I 1 ? 144  ? 340142   271    ? 414    ? 1   144  
48 4  6AH0 P 1 ? 118  ? P62316   1      ? 118    ? 1   118  
49 5  6AH0 Q 1 ? 86   ? P62306   1      ? 86     ? 1   86   
50 6  6AH0 R 1 ? 92   ? P62304   1      ? 92     ? 1   92   
51 7  6AH0 S 1 ? 76   ? P62308   1      ? 76     ? 1   76   
52 8  6AH0 T 1 ? 126  ? P62318   1      ? 126    ? 1   126  
53 9  6AH0 U 1 ? 231  ? P14678   1      ? 231    ? 1   231  
54 10 6AH0 V 1 ? 119  ? P62314   1      ? 119    ? 1   119  
55 41 6AH0 X 1 ? 820  ? Q9BUQ8   1      ? 820    ? 1   820  
56 42 6AH0 A 1 ? 2335 ? Q6P2Q9   1      ? 2335   ? 1   2335 
57 43 6AH0 C 1 ? 972  ? Q15029   1      ? 972    ? 1   972  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'   347.221 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'        133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O8 P'    323.197 
CYS 'L-peptide linking' y CYSTEINE                     ? 'C3 H7 N O2 S'      121.158 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P'   363.221 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'        75.067  
GTP non-polymer         n "GUANOSINE-5'-TRIPHOSPHATE"  ? 'C10 H16 N5 O14 P3' 523.180 
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1'    156.162 
IHP non-polymer         . 'INOSITOL HEXAKISPHOSPHATE'  ? 'C6 H18 O24 P6'     660.035 
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'              ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'       181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"   ? 'C9 H13 N2 O9 P'    324.181 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6AH0 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6AH0 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            5.70 
_refine.ls_d_res_low                             ? 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_struct.entry_id                     6AH0 
_struct.title                        'The Cryo-EM Structure of the Precusor of Human Pre-catalytic Spliceosome (pre-B complex)' 
_struct.pdbx_descriptor              
;U5 small nuclear ribonucleoprotein 200 kDa helicase, U5 small nuclear ribonucleoprotein 40 kDa protein, Small nuclear ribonucleoprotein Sm D2, Small nuclear ribonucleoprotein F, Small nuclear ribonucleoprotein E, Small nuclear ribonucleoprotein G, Small nuclear ribonucleoprotein Sm D3, Small nuclear ribonucleoprotein-associated proteins B and B', Small nuclear ribonucleoprotein Sm D1, U6 snRNA-associated Sm-like protein LSm2, U6 snRNA-associated Sm-like protein LSm3, U6 snRNA-associated Sm-like protein LSm4, U6 snRNA-associated Sm-like protein LSm5, U6 snRNA-associated Sm-like protein LSm6, U6 snRNA-associated Sm-like protein LSm7, U6 snRNA-associated Sm-like protein LSm8, U2 small nuclear ribonucleoprotein A', U2 small nuclear ribonucleoprotein B'', Splicing factor 3A subunit 1, Splicing factor 3A subunit 2, Splicing factor 3A subunit 3, Splicing factor 3B subunit 1, Splicing factor 3B subunit 2, Splicing factor 3B subunit 3, Splicing factor 3B subunit 4, Splicing factor 3B subunit 6, PHD finger-like domain-containing protein 5A, Splicing factor 3B subunit 5, U4/U6 small nuclear ribonucleoprotein Prp3, U4/U6 small nuclear ribonucleoprotein Prp4, Pre-mRNA-processing factor 6, U4/U6 small nuclear ribonucleoprotein Prp31, NHP2-like protein 1, Thioredoxin-like protein 4A, U4/U6.U5 tri-snRNP-associated protein 2, Probable ATP-dependent RNA helicase DDX23, Pre-mRNA-processing-splicing factor 8, 116 kDa U5 small nuclear ribonucleoprotein component/RNA Complex
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6AH0 
_struct_keywords.text            'Spliceosome, SPLICING' 
_struct_keywords.pdbx_keywords   SPLICING 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 11 ? 
L  N N 12 ? 
M  N N 13 ? 
N  N N 14 ? 
O  N N 15 ? 
P  N N 16 ? 
Q  N N 17 ? 
R  N N 18 ? 
S  N N 19 ? 
T  N N 20 ? 
U  N N 21 ? 
V  N N 22 ? 
W  N N 8  ? 
X  N N 9  ? 
Y  N N 10 ? 
Z  N N 4  ? 
AA N N 5  ? 
BA N N 6  ? 
CA N N 7  ? 
DA N N 23 ? 
EA N N 24 ? 
FA N N 25 ? 
GA N N 26 ? 
HA N N 27 ? 
IA N N 28 ? 
JA N N 29 ? 
KA N N 30 ? 
LA N N 31 ? 
MA N N 32 ? 
NA N N 33 ? 
OA N N 34 ? 
PA N N 35 ? 
QA N N 36 ? 
RA N N 37 ? 
SA N N 38 ? 
TA N N 39 ? 
UA N N 40 ? 
VA N N 4  ? 
WA N N 5  ? 
XA N N 6  ? 
YA N N 7  ? 
ZA N N 8  ? 
AB N N 9  ? 
BB N N 10 ? 
CB N N 41 ? 
DB N N 42 ? 
EB N N 43 ? 
FB N N 44 ? 
GB N N 45 ? 
HB N N 46 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 LYS B  107  ? GLY B  125  ? LYS D 107  GLY D 125  1 ? 19 
HELX_P HELX_P2   AA2 PRO B  128  ? ASN B  145  ? PRO D 128  ASN D 145  1 ? 18 
HELX_P HELX_P3   AA3 LYS B  151  ? LEU B  160  ? LYS D 151  LEU D 160  1 ? 10 
HELX_P HELX_P4   AA4 ASP B  166  ? LYS B  178  ? ASP D 166  LYS D 178  1 ? 13 
HELX_P HELX_P5   AA5 PHE B  266  ? ARG B  274  ? PHE D 266  ARG D 274  1 ? 9  
HELX_P HELX_P6   AA6 ASP B  278  ? ALA B  296  ? ASP D 278  ALA D 296  1 ? 19 
HELX_P HELX_P7   AA7 ASP B  298  ? LEU B  310  ? ASP D 298  LEU D 310  1 ? 13 
HELX_P HELX_P8   AA8 THR B  314  ? HIS B  324  ? THR D 314  HIS D 324  1 ? 11 
HELX_P HELX_P9   AA9 HIS B  324  ? SER B  336  ? HIS D 324  SER D 336  1 ? 13 
HELX_P HELX_P10  AB1 SER B  339  ? ASP B  353  ? SER D 339  ASP D 353  1 ? 15 
HELX_P HELX_P11  AB2 PRO B  354  ? GLU B  365  ? PRO D 354  GLU D 365  1 ? 12 
HELX_P HELX_P12  AB3 ASN B  482  ? THR B  495  ? ASN D 482  THR D 495  1 ? 14 
HELX_P HELX_P13  AB4 LYS B  509  ? HIS B  524  ? LYS D 509  HIS D 524  1 ? 16 
HELX_P HELX_P14  AB5 MET B  544  ? ALA B  560  ? MET D 544  ALA D 560  1 ? 17 
HELX_P HELX_P15  AB6 GLU B  579  ? THR B  583  ? GLU D 579  THR D 583  5 ? 5  
HELX_P HELX_P16  AB7 THR B  589  ? GLY B  600  ? THR D 589  GLY D 600  1 ? 12 
HELX_P HELX_P17  AB8 GLU B  616  ? ASP B  622  ? GLU D 616  ASP D 622  5 ? 7  
HELX_P HELX_P18  AB9 ARG B  624  ? GLN B  643  ? ARG D 624  GLN D 643  1 ? 20 
HELX_P HELX_P19  AC1 ASN B  657  ? LEU B  665  ? ASN D 657  LEU D 665  1 ? 9  
HELX_P HELX_P20  AC2 ASP B  668  ? GLY B  672  ? ASP D 668  GLY D 672  1 ? 5  
HELX_P HELX_P21  AC3 ASP B  677  ? ARG B  681  ? ASP D 677  ARG D 681  5 ? 5  
HELX_P HELX_P22  AC4 LYS B  696  ? HIS B  715  ? LYS D 696  HIS D 715  1 ? 20 
HELX_P HELX_P23  AC5 LYS B  729  ? ALA B  735  ? LYS D 729  ALA D 735  1 ? 7  
HELX_P HELX_P24  AC6 ARG B  736  ? LYS B  745  ? ARG D 736  LYS D 745  1 ? 10 
HELX_P HELX_P25  AC7 GLU B  760  ? GLU B  767  ? GLU D 760  GLU D 767  1 ? 8  
HELX_P HELX_P26  AC8 GLU B  773  ? LEU B  778  ? GLU D 773  LEU D 778  1 ? 6  
HELX_P HELX_P27  AC9 ARG B  791  ? ASP B  803  ? ARG D 791  ASP D 803  1 ? 13 
HELX_P HELX_P28  AD1 THR B  812  ? GLY B  818  ? THR D 812  GLY D 818  1 ? 7  
HELX_P HELX_P29  AD2 GLY B  845  ? GLY B  854  ? GLY D 845  GLY D 854  1 ? 10 
HELX_P HELX_P30  AD3 GLU B  875  ? ASN B  884  ? GLU D 875  ASN D 884  1 ? 10 
HELX_P HELX_P31  AD4 GLN B  892  ? LEU B  907  ? GLN D 892  LEU D 907  1 ? 16 
HELX_P HELX_P32  AD5 ASN B  912  ? GLY B  921  ? ASN D 912  GLY D 921  1 ? 10 
HELX_P HELX_P33  AD6 ALA B  923  ? SER B  932  ? ALA D 923  SER D 932  1 ? 10 
HELX_P HELX_P34  AD7 SER B  932  ? GLY B  937  ? SER D 932  GLY D 937  1 ? 6  
HELX_P HELX_P35  AD8 SER B  939  ? ASP B  946  ? SER D 939  ASP D 946  1 ? 8  
HELX_P HELX_P36  AD9 LEU B  949  ? LEU B  956  ? LEU D 949  LEU D 956  1 ? 8  
HELX_P HELX_P37  AE1 VAL B  957  ? ASN B  967  ? VAL D 957  ASN D 967  1 ? 11 
HELX_P HELX_P38  AE2 THR B  982  ? TYR B  992  ? THR D 982  TYR D 992  1 ? 11 
HELX_P HELX_P39  AE3 THR B  994  ? LEU B  1005 ? THR D 994  LEU D 1005 1 ? 12 
HELX_P HELX_P40  AE4 SER B  1010 ? LEU B  1020 ? SER D 1010 LEU D 1020 1 ? 11 
HELX_P HELX_P41  AE5 SER B  1021 ? LYS B  1025 ? SER D 1021 LYS D 1025 5 ? 5  
HELX_P HELX_P42  AE6 ARG B  1030 ? GLU B  1032 ? ARG D 1030 GLU D 1032 5 ? 3  
HELX_P HELX_P43  AE7 GLU B  1033 ? ARG B  1043 ? GLU D 1033 ARG D 1043 1 ? 11 
HELX_P HELX_P44  AE8 GLU B  1054 ? SER B  1068 ? GLU D 1054 SER D 1068 1 ? 15 
HELX_P HELX_P45  AE9 GLY B  1074 ? GLY B  1103 ? GLY D 1074 GLY D 1103 1 ? 30 
HELX_P HELX_P46  AF1 TRP B  1104 ? ARG B  1121 ? TRP D 1104 ARG D 1121 1 ? 18 
HELX_P HELX_P47  AF2 CYS B  1127 ? PHE B  1132 ? CYS D 1127 PHE D 1132 5 ? 6  
HELX_P HELX_P48  AF3 PRO B  1136 ? LYS B  1146 ? PRO D 1136 LYS D 1146 1 ? 11 
HELX_P HELX_P49  AF4 PRO B  1149 ? LEU B  1153 ? PRO D 1149 LEU D 1153 5 ? 5  
HELX_P HELX_P50  AF5 ASN B  1157 ? GLU B  1163 ? ASN D 1157 GLU D 1163 1 ? 7  
HELX_P HELX_P51  AF6 MET B  1167 ? LYS B  1169 ? MET D 1167 LYS D 1169 5 ? 3  
HELX_P HELX_P52  AF7 MET B  1170 ? PHE B  1181 ? MET D 1170 PHE D 1181 1 ? 12 
HELX_P HELX_P53  AF8 ASN B  1314 ? ASP B  1323 ? ASN D 1314 ASP D 1323 1 ? 10 
HELX_P HELX_P54  AF9 ASN B  1329 ? TYR B  1340 ? ASN D 1329 TYR D 1340 1 ? 12 
HELX_P HELX_P55  AG1 GLY B  1355 ? SER B  1371 ? GLY D 1355 SER D 1371 1 ? 17 
HELX_P HELX_P56  AG2 MET B  1382 ? PHE B  1397 ? MET D 1382 PHE D 1397 1 ? 16 
HELX_P HELX_P57  AG3 PHE B  1397 ? ASN B  1402 ? PHE D 1397 ASN D 1402 1 ? 6  
HELX_P HELX_P58  AG4 GLU B  1411 ? LEU B  1419 ? GLU D 1411 LEU D 1419 1 ? 9  
HELX_P HELX_P59  AG5 GLU B  1430 ? ARG B  1438 ? GLU D 1430 ARG D 1438 1 ? 9  
HELX_P HELX_P60  AG6 ARG B  1442 ? ASN B  1447 ? ARG D 1442 ASN D 1447 1 ? 6  
HELX_P HELX_P61  AG7 VAL B  1456 ? GLY B  1461 ? VAL D 1456 GLY D 1461 5 ? 6  
HELX_P HELX_P62  AG8 GLY B  1464 ? ILE B  1481 ? GLY D 1464 ILE D 1481 1 ? 18 
HELX_P HELX_P63  AG9 ASN B  1496 ? GLY B  1505 ? ASN D 1496 GLY D 1505 1 ? 10 
HELX_P HELX_P64  AH1 SER B  1507 ? THR B  1509 ? SER D 1507 THR D 1509 5 ? 3  
HELX_P HELX_P65  AH2 HIS B  1534 ? MET B  1542 ? HIS D 1534 MET D 1542 1 ? 9  
HELX_P HELX_P66  AH3 MET B  1542 ? SER B  1554 ? MET D 1542 SER D 1554 1 ? 13 
HELX_P HELX_P67  AH4 LYS B  1567 ? ASP B  1583 ? LYS D 1567 ASP D 1583 1 ? 17 
HELX_P HELX_P68  AH5 THR B  1593 ? GLU B  1602 ? THR D 1593 GLU D 1602 1 ? 10 
HELX_P HELX_P69  AH6 ASP B  1606 ? ASN B  1615 ? ASP D 1606 ASN D 1615 1 ? 10 
HELX_P HELX_P70  AH7 SER B  1625 ? SER B  1638 ? SER D 1625 SER D 1638 1 ? 14 
HELX_P HELX_P71  AH8 SER B  1649 ? TRP B  1652 ? SER D 1649 TRP D 1652 5 ? 4  
HELX_P HELX_P72  AH9 PRO B  1680 ? HIS B  1690 ? PRO D 1680 HIS D 1690 1 ? 11 
HELX_P HELX_P73  AI1 LYS B  1710 ? LEU B  1718 ? LYS D 1710 LEU D 1718 1 ? 9  
HELX_P HELX_P74  AI2 MET B  1732 ? THR B  1742 ? MET D 1732 THR D 1742 1 ? 11 
HELX_P HELX_P75  AI3 ASN B  1747 ? THR B  1756 ? ASN D 1747 THR D 1756 1 ? 10 
HELX_P HELX_P76  AI4 THR B  1758 ? THR B  1765 ? THR D 1758 THR D 1765 1 ? 8  
HELX_P HELX_P77  AI5 GLN B  1766 ? TYR B  1771 ? GLN D 1766 TYR D 1771 5 ? 6  
HELX_P HELX_P78  AI6 SER B  1777 ? SER B  1799 ? SER D 1777 SER D 1799 1 ? 23 
HELX_P HELX_P79  AI7 LEU B  1813 ? TYR B  1823 ? LEU D 1813 TYR D 1823 1 ? 11 
HELX_P HELX_P80  AI8 ASN B  1825 ? LEU B  1836 ? ASN D 1825 LEU D 1836 1 ? 12 
HELX_P HELX_P81  AI9 LYS B  1841 ? ASN B  1851 ? LYS D 1841 ASN D 1851 1 ? 11 
HELX_P HELX_P82  AJ1 ALA B  1852 ? GLU B  1856 ? ALA D 1852 GLU D 1856 5 ? 5  
HELX_P HELX_P83  AJ2 ASN B  1866 ? LYS B  1874 ? ASN D 1866 LYS D 1874 1 ? 9  
HELX_P HELX_P84  AJ3 ASP B  1886 ? SER B  1900 ? ASP D 1886 SER D 1900 1 ? 15 
HELX_P HELX_P85  AJ4 SER B  1905 ? GLY B  1934 ? SER D 1905 GLY D 1934 1 ? 30 
HELX_P HELX_P86  AJ5 TRP B  1935 ? ALA B  1952 ? TRP D 1935 ALA D 1952 1 ? 18 
HELX_P HELX_P87  AJ6 TYR B  1959 ? LEU B  1963 ? TYR D 1959 LEU D 1963 5 ? 5  
HELX_P HELX_P88  AJ7 THR B  1967 ? GLY B  1978 ? THR D 1967 GLY D 1978 1 ? 12 
HELX_P HELX_P89  AJ8 THR B  2000 ? TYR B  2014 ? THR D 2000 TYR D 2014 1 ? 15 
HELX_P HELX_P90  AJ9 ALA B  2071 ? ASN B  2074 ? ALA D 2071 ASN D 2074 5 ? 4  
HELX_P HELX_P91  AK1 GLY D  27   ? ASN D  38   ? GLY a 27   ASN a 38   1 ? 12 
HELX_P HELX_P92  AK2 ASN E  6    ? LEU E  14   ? ASN b 6    LEU b 14   1 ? 9  
HELX_P HELX_P93  AK3 ILE F  21   ? ARG F  28   ? ILE c 21   ARG c 28   1 ? 8  
HELX_P HELX_P94  AK4 HIS G  5    ? MET G  13   ? HIS d 5    MET d 13   1 ? 9  
HELX_P HELX_P95  AK5 VAL H  5    ? ALA H  13   ? VAL e 5    ALA e 13   1 ? 9  
HELX_P HELX_P96  AK6 LEU J  3    ? LEU J  10   ? LEU g 3    LEU g 10   1 ? 8  
HELX_P HELX_P97  AK7 VAL J  83   ? VAL J  95   ? VAL g 83   VAL g 95   1 ? 13 
HELX_P HELX_P98  AK8 LEU L  2    ? SER L  9    ? LEU q 2    SER q 9    1 ? 8  
HELX_P HELX_P99  AK9 PRO L  73   ? VAL L  77   ? PRO q 73   VAL q 77   5 ? 5  
HELX_P HELX_P100 AL1 ASP L  78   ? GLU L  89   ? ASP q 78   GLU q 89   1 ? 12 
HELX_P HELX_P101 AL2 ILE M  21   ? LEU M  25   ? ILE r 21   LEU r 25   5 ? 5  
HELX_P HELX_P102 AL3 ARG M  88   ? ASP M  90   ? ARG r 88   ASP r 90   5 ? 3  
HELX_P HELX_P103 AL4 LEU N  2    ? ALA N  10   ? LEU s 2    ALA s 10   1 ? 9  
HELX_P HELX_P104 AL5 GLU N  74   ? LYS N  80   ? GLU s 74   LYS s 80   1 ? 7  
HELX_P HELX_P105 AL6 LEU O  13   ? CYS O  21   ? LEU t 13   CYS t 21   1 ? 9  
HELX_P HELX_P106 AL7 PRO P  8    ? ILE P  15   ? PRO x 8    ILE x 15   1 ? 8  
HELX_P HELX_P107 AL8 LEU R  5    ? ILE R  9    ? LEU z 5    ILE z 9    5 ? 5  
HELX_P HELX_P108 AL9 THR U  5    ? GLN U  11   ? THR o 5    GLN o 11   1 ? 7  
HELX_P HELX_P109 AM1 ASN U  36   ? LEU U  41   ? ASN o 36   LEU o 41   5 ? 6  
HELX_P HELX_P110 AM2 GLY U  82   ? LEU U  87   ? GLY o 82   LEU o 87   1 ? 6  
HELX_P HELX_P111 AM3 GLU U  102  ? LEU U  112  ? GLU o 102  LEU o 112  5 ? 11 
HELX_P HELX_P112 AM4 ASN U  123  ? LYS U  128  ? ASN o 123  LYS o 128  5 ? 6  
HELX_P HELX_P113 AM5 HIS U  130  ? VAL U  139  ? HIS o 130  VAL o 139  1 ? 10 
HELX_P HELX_P114 AM6 LYS U  151  ? MET U  161  ? LYS o 151  MET o 161  1 ? 11 
HELX_P HELX_P115 AM7 LYS V  19   ? GLN V  33   ? LYS p 19   GLN p 33   1 ? 15 
HELX_P HELX_P116 AM8 GLU V  58   ? LEU V  69   ? GLU p 58   LEU p 69   1 ? 12 
HELX_P HELX_P117 AM9 SER V  88   ? GLY V  96   ? SER p 88   GLY p 96   1 ? 9  
HELX_P HELX_P118 AN1 VAL W  5    ? ALA W  13   ? VAL h 5    ALA h 13   1 ? 9  
HELX_P HELX_P119 AN2 SER X  6    ? GLN X  11   ? SER i 6    GLN i 11   1 ? 6  
HELX_P HELX_P120 AN3 LYS Y  2    ? LYS Y  9    ? LYS j 2    LYS j 9    1 ? 8  
HELX_P HELX_P121 AN4 PRO Y  75   ? LEU Y  80   ? PRO j 75   LEU j 80   1 ? 6  
HELX_P HELX_P122 AN5 GLU Z  21   ? GLY Z  27   ? GLU k 21   GLY k 27   1 ? 7  
HELX_P HELX_P123 AN6 LEU Z  29   ? ASN Z  39   ? LEU k 29   ASN k 39   1 ? 11 
HELX_P HELX_P124 AN7 ASN AA 6    ? THR AA 15   ? ASN m 6    THR m 15   1 ? 10 
HELX_P HELX_P125 AN8 GLN BA 16   ? ARG BA 28   ? GLN l 16   ARG l 28   1 ? 13 
HELX_P HELX_P126 AN9 LEU CA 9    ? MET CA 13   ? LEU n 9    MET n 13   5 ? 5  
HELX_P HELX_P127 AO1 ALA DA 161  ? ALA DA 175  ? ALA u 161  ALA u 175  1 ? 15 
HELX_P HELX_P128 AO2 GLY DA 178  ? GLN DA 190  ? GLY u 178  GLN u 190  1 ? 13 
HELX_P HELX_P129 AO3 ARG DA 191  ? ARG DA 199  ? ARG u 191  ARG u 199  1 ? 9  
HELX_P HELX_P130 AO4 LEU DA 204  ? LEU DA 219  ? LEU u 204  LEU u 219  1 ? 16 
HELX_P HELX_P131 AO5 ASP DA 241  ? GLN DA 273  ? ASP u 241  GLN u 273  1 ? 33 
HELX_P HELX_P132 AO6 LYS EA 204  ? PHE EA 210  ? LYS v 204  PHE v 210  1 ? 7  
HELX_P HELX_P133 AO7 THR FA 3    ? LYS FA 29   ? THR w 3    LYS w 29   1 ? 27 
HELX_P HELX_P134 AO8 LYS FA 30   ? ARG FA 42   ? LYS w 30   ARG w 42   1 ? 13 
HELX_P HELX_P135 AO9 MET FA 51   ? ARG FA 58   ? MET w 51   ARG w 58   1 ? 8  
HELX_P HELX_P136 AP1 LYS FA 69   ? HIS FA 98   ? LYS w 69   HIS w 98   1 ? 30 
HELX_P HELX_P137 AP2 GLU FA 111  ? ASN FA 119  ? GLU w 111  ASN w 119  1 ? 9  
HELX_P HELX_P138 AP3 PRO FA 120  ? GLU FA 123  ? PRO w 120  GLU w 123  5 ? 4  
HELX_P HELX_P139 AP4 GLU FA 134  ? LEU FA 142  ? GLU w 134  LEU w 142  1 ? 9  
HELX_P HELX_P140 AP5 LEU FA 158  ? THR FA 162  ? LEU w 158  THR w 162  5 ? 5  
HELX_P HELX_P141 AP6 SER FA 165  ? GLN FA 169  ? SER w 165  GLN w 169  5 ? 5  
HELX_P HELX_P142 AP7 TYR FA 182  ? GLN FA 194  ? TYR w 182  GLN w 194  1 ? 13 
HELX_P HELX_P143 AP8 ARG FA 199  ? LEU FA 209  ? ARG w 199  LEU w 209  1 ? 11 
HELX_P HELX_P144 AP9 LYS FA 219  ? ASN FA 223  ? LYS w 219  ASN w 223  1 ? 5  
HELX_P HELX_P145 AQ1 PRO FA 230  ? TRP FA 252  ? PRO w 230  TRP w 252  1 ? 23 
HELX_P HELX_P146 AQ2 ALA FA 256  ? GLY FA 276  ? ALA w 256  GLY w 276  1 ? 21 
HELX_P HELX_P147 AQ3 ASP FA 297  ? LYS FA 303  ? ASP w 297  LYS w 303  1 ? 7  
HELX_P HELX_P148 AQ4 SER FA 307  ? ASN FA 317  ? SER w 307  ASN w 317  1 ? 11 
HELX_P HELX_P149 AQ5 ASN FA 317  ? LEU FA 334  ? ASN w 317  LEU w 334  1 ? 18 
HELX_P HELX_P150 AQ6 LEU FA 334  ? ALA FA 350  ? LEU w 334  ALA w 350  1 ? 17 
HELX_P HELX_P151 AQ7 THR FA 352  ? GLU FA 368  ? THR w 352  GLU w 368  1 ? 17 
HELX_P HELX_P152 AQ8 PRO FA 393  ? GLY FA 401  ? PRO w 393  GLY w 401  1 ? 9  
HELX_P HELX_P153 AQ9 GLY FA 418  ? PHE FA 426  ? GLY w 418  PHE w 426  1 ? 9  
HELX_P HELX_P154 AR1 GLU FA 428  ? GLY FA 439  ? GLU w 428  GLY w 439  1 ? 12 
HELX_P HELX_P155 AR2 GLU FA 453  ? LYS FA 463  ? GLU w 453  LYS w 463  1 ? 11 
HELX_P HELX_P156 AR3 SER FA 483  ? VAL FA 487  ? SER w 483  VAL w 487  5 ? 5  
HELX_P HELX_P157 AR4 ASN FA 488  ? GLY FA 499  ? ASN w 488  GLY w 499  1 ? 12 
HELX_P HELX_P158 AR5 PRO GA 103  ? ARG GA 108  ? PRO 1 103  ARG 1 108  1 ? 6  
HELX_P HELX_P159 AR6 GLU GA 118  ? MET GA 126  ? GLU 1 118  MET 1 126  5 ? 9  
HELX_P HELX_P160 AR7 GLU GA 174  ? SER GA 190  ? GLU 1 174  SER 1 190  1 ? 17 
HELX_P HELX_P161 AR8 GLY GA 209  ? SER GA 216  ? GLY 1 209  SER 1 216  1 ? 8  
HELX_P HELX_P162 AR9 HIS GA 226  ? THR GA 235  ? HIS 1 226  THR 1 235  1 ? 10 
HELX_P HELX_P163 AS1 GLY GA 237  ? ASP GA 255  ? GLY 1 237  ASP 1 255  1 ? 19 
HELX_P HELX_P164 AS2 ARG GA 301  ? GLU GA 325  ? ARG 1 301  GLU 1 325  1 ? 25 
HELX_P HELX_P165 AS3 SER GA 400  ? PHE GA 408  ? SER 1 400  PHE 1 408  1 ? 9  
HELX_P HELX_P166 AS4 GLY GA 420  ? ARG GA 429  ? GLY 1 420  ARG 1 429  1 ? 10 
HELX_P HELX_P167 AS5 ARG GA 429  ? THR GA 434  ? ARG 1 429  THR 1 434  1 ? 6  
HELX_P HELX_P168 AS6 ASP GA 471  ? ASP GA 476  ? ASP 1 471  ASP 1 476  1 ? 6  
HELX_P HELX_P169 AS7 LYS GA 477  ? LEU GA 479  ? LYS 1 477  LEU 1 479  5 ? 3  
HELX_P HELX_P170 AS8 GLU GA 491  ? LYS GA 499  ? GLU 1 491  LYS 1 499  1 ? 9  
HELX_P HELX_P171 AS9 LYS GA 499  ? ASN GA 506  ? LYS 1 499  ASN 1 506  1 ? 8  
HELX_P HELX_P172 AT1 THR GA 508  ? ASP GA 521  ? THR 1 508  ASP 1 521  1 ? 14 
HELX_P HELX_P173 AT2 LYS GA 522  ? GLY GA 527  ? LYS 1 522  GLY 1 527  1 ? 6  
HELX_P HELX_P174 AT3 GLY GA 527  ? MET GA 540  ? GLY 1 527  MET 1 540  1 ? 14 
HELX_P HELX_P175 AT4 ASP GA 546  ? LEU GA 563  ? ASP 1 546  LEU 1 563  1 ? 18 
HELX_P HELX_P176 AT5 ASP GA 564  ? PRO GA 569  ? ASP 1 564  PRO 1 569  5 ? 6  
HELX_P HELX_P177 AT6 TYR GA 570  ? ILE GA 583  ? TYR 1 570  ILE 1 583  1 ? 14 
HELX_P HELX_P178 AT7 ASP GA 586  ? ALA GA 604  ? ASP 1 586  ALA 1 604  1 ? 19 
HELX_P HELX_P179 AT8 GLY GA 605  ? ARG GA 614  ? GLY 1 605  ARG 1 614  1 ? 10 
HELX_P HELX_P180 AT9 PRO GA 615  ? ASP GA 618  ? PRO 1 615  ASP 1 618  5 ? 4  
HELX_P HELX_P181 AU1 ASP GA 621  ? GLY GA 640  ? ASP 1 621  GLY 1 640  1 ? 20 
HELX_P HELX_P182 AU2 GLY GA 640  ? CYS GA 652  ? GLY 1 640  CYS 1 652  1 ? 13 
HELX_P HELX_P183 AU3 SER GA 657  ? GLY GA 676  ? SER 1 657  GLY 1 676  1 ? 20 
HELX_P HELX_P184 AU4 CYS GA 677  ? PRO GA 681  ? CYS 1 677  PRO 1 681  5 ? 5  
HELX_P HELX_P185 AU5 HIS GA 682  ? VAL GA 695  ? HIS 1 682  VAL 1 695  1 ? 14 
HELX_P HELX_P186 AU6 GLN GA 698  ? ALA GA 716  ? GLN 1 698  ALA 1 716  1 ? 19 
HELX_P HELX_P187 AU7 GLY GA 720  ? SER GA 726  ? GLY 1 720  SER 1 726  5 ? 7  
HELX_P HELX_P188 AU8 VAL GA 727  ? GLN GA 737  ? VAL 1 727  GLN 1 737  1 ? 11 
HELX_P HELX_P189 AU9 GLY GA 740  ? ILE GA 754  ? GLY 1 740  ILE 1 754  1 ? 15 
HELX_P HELX_P190 AV1 PRO GA 755  ? MET GA 757  ? PRO 1 755  MET 1 757  5 ? 3  
HELX_P HELX_P191 AV2 GLU GA 760  ? GLU GA 776  ? GLU 1 760  GLU 1 776  1 ? 17 
HELX_P HELX_P192 AV3 ASP GA 781  ? CYS GA 796  ? ASP 1 781  CYS 1 796  1 ? 16 
HELX_P HELX_P193 AV4 GLU GA 802  ? ILE GA 810  ? GLU 1 802  ILE 1 810  1 ? 9  
HELX_P HELX_P194 AV5 ILE GA 810  ? PHE GA 818  ? ILE 1 810  PHE 1 818  1 ? 9  
HELX_P HELX_P195 AV6 GLN GA 820  ? ASP GA 826  ? GLN 1 820  ASP 1 826  1 ? 7  
HELX_P HELX_P196 AV7 ASP GA 826  ? GLY GA 845  ? ASP 1 826  GLY 1 845  1 ? 20 
HELX_P HELX_P197 AV8 ALA GA 846  ? ASP GA 855  ? ALA 1 846  ASP 1 855  1 ? 10 
HELX_P HELX_P198 AV9 ALA GA 861  ? LEU GA 879  ? ALA 1 861  LEU 1 879  1 ? 19 
HELX_P HELX_P199 AW1 GLY GA 880  ? ILE GA 884  ? GLY 1 880  ILE 1 884  5 ? 5  
HELX_P HELX_P200 AW2 HIS GA 886  ? GLU GA 902  ? HIS 1 886  GLU 1 902  1 ? 17 
HELX_P HELX_P201 AW3 ASP GA 907  ? GLY GA 922  ? ASP 1 907  GLY 1 922  1 ? 16 
HELX_P HELX_P202 AW4 LYS GA 923  ? PRO GA 927  ? LYS 1 923  PRO 1 927  5 ? 5  
HELX_P HELX_P203 AW5 TYR GA 928  ? ASN GA 942  ? TYR 1 928  ASN 1 942  1 ? 15 
HELX_P HELX_P204 AW6 VAL GA 947  ? CYS GA 965  ? VAL 1 947  CYS 1 965  1 ? 19 
HELX_P HELX_P205 AW7 GLU GA 967  ? LEU GA 982  ? GLU 1 967  LEU 1 982  1 ? 16 
HELX_P HELX_P206 AW8 TYR GA 986  ? ASN GA 1002 ? TYR 1 986  ASN 1 1002 1 ? 17 
HELX_P HELX_P207 AW9 GLY GA 1005 ? MET GA 1009 ? GLY 1 1005 MET 1 1009 5 ? 5  
HELX_P HELX_P208 AX1 PRO GA 1012 ? THR GA 1021 ? PRO 1 1012 THR 1 1021 1 ? 10 
HELX_P HELX_P209 AX2 PRO GA 1022 ? ASN GA 1026 ? PRO 1 1022 ASN 1 1026 5 ? 5  
HELX_P HELX_P210 AX3 HIS GA 1028 ? GLY GA 1046 ? HIS 1 1028 GLY 1 1046 1 ? 19 
HELX_P HELX_P211 AX4 SER GA 1051 ? LEU GA 1063 ? SER 1 1051 LEU 1 1063 1 ? 13 
HELX_P HELX_P212 AX5 GLU GA 1064 ? ALA GA 1068 ? GLU 1 1064 ALA 1 1068 5 ? 5  
HELX_P HELX_P213 AX6 LYS GA 1070 ? GLY GA 1089 ? LYS 1 1070 GLY 1 1089 1 ? 20 
HELX_P HELX_P214 AX7 GLY GA 1089 ? LEU GA 1098 ? GLY 1 1089 LEU 1 1098 1 ? 10 
HELX_P HELX_P215 AX8 VAL GA 1110 ? CYS GA 1123 ? VAL 1 1110 CYS 1 1123 1 ? 14 
HELX_P HELX_P216 AX9 SER GA 1124 ? TYR GA 1136 ? SER 1 1124 TYR 1 1136 1 ? 13 
HELX_P HELX_P217 AY1 GLU GA 1140 ? GLY GA 1159 ? GLU 1 1140 GLY 1 1159 1 ? 20 
HELX_P HELX_P218 AY2 GLU GA 1160 ? ASP GA 1164 ? GLU 1 1160 ASP 1 1164 5 ? 5  
HELX_P HELX_P219 AY3 TYR GA 1165 ? MET GA 1178 ? TYR 1 1165 MET 1 1178 1 ? 14 
HELX_P HELX_P220 AY4 ASP GA 1181 ? VAL GA 1199 ? ASP 1 1181 VAL 1 1199 1 ? 19 
HELX_P HELX_P221 AY5 CYS GA 1204 ? TRP GA 1216 ? CYS 1 1204 TRP 1 1216 1 ? 13 
HELX_P HELX_P222 AY6 PRO GA 1217 ? PHE GA 1220 ? PRO 1 1217 PHE 1 1220 5 ? 4  
HELX_P HELX_P223 AY7 SER GA 1223 ? GLY GA 1242 ? SER 1 1223 GLY 1 1242 1 ? 20 
HELX_P HELX_P224 AY8 GLY GA 1242 ? LEU GA 1251 ? GLY 1 1242 LEU 1 1251 1 ? 10 
HELX_P HELX_P225 AY9 ALA GA 1258 ? GLY GA 1275 ? ALA 1 1258 GLY 1 1275 1 ? 18 
HELX_P HELX_P226 AZ1 SER GA 1276 ? ILE GA 1281 ? SER 1 1276 ILE 1 1281 1 ? 6  
HELX_P HELX_P227 AZ2 ALA GA 1282 ? TYR GA 1284 ? ALA 1 1282 TYR 1 1284 5 ? 3  
HELX_P HELX_P228 AZ3 TYR GA 1298 ? TYR GA 1302 ? TYR 1 1298 TYR 1 1302 5 ? 5  
HELX_P HELX_P229 AZ4 ALA HA 463  ? LEU HA 468  ? ALA 2 463  LEU 2 468  5 ? 6  
HELX_P HELX_P230 AZ5 ARG HA 471  ? VAL HA 475  ? ARG 2 471  VAL 2 475  5 ? 5  
HELX_P HELX_P231 AZ6 GLU HA 476  ? ALA HA 482  ? GLU 2 476  ALA 2 482  5 ? 7  
HELX_P HELX_P232 AZ7 ASP HA 484  ? ALA HA 493  ? ASP 2 484  ALA 2 493  1 ? 10 
HELX_P HELX_P233 AZ8 PRO HA 525  ? ARG HA 530  ? PRO 2 525  ARG 2 530  1 ? 6  
HELX_P HELX_P234 AZ9 GLY HA 532  ? ARG HA 537  ? GLY 2 532  ARG 2 537  1 ? 6  
HELX_P HELX_P235 BA1 SER HA 551  ? LYS HA 556  ? SER 2 551  LYS 2 556  1 ? 6  
HELX_P HELX_P236 BA2 ASP HA 567  ? THR HA 580  ? ASP 2 567  THR 2 580  1 ? 14 
HELX_P HELX_P237 BA3 SER HA 610  ? GLY HA 618  ? SER 2 610  GLY 2 618  1 ? 9  
HELX_P HELX_P238 BA4 TRP HA 632  ? GLY HA 640  ? TRP 2 632  GLY 2 640  1 ? 9  
HELX_P HELX_P239 BA5 TYR IA 189  ? ASN IA 194  ? TYR 3 189  ASN 3 194  1 ? 6  
HELX_P HELX_P240 BA6 ARG IA 429  ? ARG IA 432  ? ARG 3 429  ARG 3 432  5 ? 4  
HELX_P HELX_P241 BA7 THR IA 808  ? GLU IA 825  ? THR 3 808  GLU 3 825  1 ? 18 
HELX_P HELX_P242 BA8 MET IA 838  ? GLU IA 845  ? MET 3 838  GLU 3 845  1 ? 8  
HELX_P HELX_P243 BA9 SER IA 1134 ? HIS IA 1152 ? SER 3 1134 HIS 3 1152 1 ? 19 
HELX_P HELX_P244 BB1 ASP IA 1159 ? SER IA 1165 ? ASP 3 1159 SER 3 1165 1 ? 7  
HELX_P HELX_P245 BB2 ASP IA 1175 ? GLU IA 1180 ? ASP 3 1175 GLU 3 1180 1 ? 6  
HELX_P HELX_P246 BB3 GLN IA 1181 ? ASN IA 1183 ? GLN 3 1181 ASN 3 1183 5 ? 3  
HELX_P HELX_P247 BB4 GLU IA 1186 ? ASP IA 1198 ? GLU 3 1186 ASP 3 1198 1 ? 13 
HELX_P HELX_P248 BB5 THR IA 1200 ? ALA IA 1216 ? THR 3 1200 ALA 3 1216 1 ? 17 
HELX_P HELX_P249 BB6 SER JA 25   ? LEU JA 34   ? SER 4 25   LEU 4 34   1 ? 10 
HELX_P HELX_P250 BB7 SER JA 63   ? ASN JA 75   ? SER 4 63   ASN 4 75   1 ? 13 
HELX_P HELX_P251 BB8 THR KA 31   ? GLY KA 40   ? THR 5 31   GLY 5 40   1 ? 10 
HELX_P HELX_P252 BB9 ASP KA 66   ? LEU KA 77   ? ASP 5 66   LEU 5 77   1 ? 12 
HELX_P HELX_P253 BC1 LYS KA 105  ? LYS KA 116  ? LYS 5 105  LYS 5 116  1 ? 12 
HELX_P HELX_P254 BC2 TYR LA 51   ? GLN LA 55   ? TYR 6 51   GLN 6 55   5 ? 5  
HELX_P HELX_P255 BC3 LYS LA 73   ? GLN LA 78   ? LYS 6 73   GLN 6 78   1 ? 6  
HELX_P HELX_P256 BC4 GLU LA 79   ? ASP LA 83   ? GLU 6 79   ASP 6 83   5 ? 5  
HELX_P HELX_P257 BC5 THR MA 27   ? HIS MA 46   ? THR 7 27   HIS 7 46   1 ? 20 
HELX_P HELX_P258 BC6 HIS MA 46   ? GLU MA 57   ? HIS 7 46   GLU 7 57   1 ? 12 
HELX_P HELX_P259 BC7 SER MA 60   ? MET MA 72   ? SER 7 60   MET 7 72   1 ? 13 
HELX_P HELX_P260 BC8 LYS NA 442  ? LEU NA 466  ? LYS J 442  LEU J 466  1 ? 25 
HELX_P HELX_P261 BC9 ASN NA 553  ? LEU NA 567  ? ASN J 553  LEU J 567  1 ? 15 
HELX_P HELX_P262 BD1 GLY NA 587  ? HIS NA 600  ? GLY J 587  HIS J 600  1 ? 14 
HELX_P HELX_P263 BD2 ASN NA 655  ? HIS NA 664  ? ASN J 655  HIS J 664  1 ? 10 
HELX_P HELX_P264 BD3 GLY NA 665  ? TRP NA 670  ? GLY J 665  TRP J 670  5 ? 6  
HELX_P HELX_P265 BD4 PRO OA 171  ? ARG OA 197  ? PRO K 171  ARG K 197  1 ? 27 
HELX_P HELX_P266 BD5 ILE OA 202  ? SER OA 220  ? ILE K 202  SER K 220  1 ? 19 
HELX_P HELX_P267 BD6 PRO PA 7    ? MET PA 11   ? PRO N 7    MET N 11   1 ? 5  
HELX_P HELX_P268 BD7 VAL PA 18   ? GLY PA 24   ? VAL N 18   GLY N 24   1 ? 7  
HELX_P HELX_P269 BD8 ASP PA 109  ? GLU PA 121  ? ASP N 109  GLU N 121  1 ? 13 
HELX_P HELX_P270 BD9 LYS PA 137  ? ALA PA 150  ? LYS N 137  ALA N 150  1 ? 14 
HELX_P HELX_P271 BE1 THR PA 153  ? SER PA 159  ? THR N 153  SER N 159  1 ? 7  
HELX_P HELX_P272 BE2 ASP PA 290  ? ASN PA 305  ? ASP N 290  ASN N 305  1 ? 16 
HELX_P HELX_P273 BE3 PRO PA 309  ? GLY PA 323  ? PRO N 309  GLY N 323  1 ? 15 
HELX_P HELX_P274 BE4 LEU PA 325  ? GLY PA 335  ? LEU N 325  GLY N 335  1 ? 11 
HELX_P HELX_P275 BE5 SER PA 342  ? GLN PA 353  ? SER N 342  GLN N 353  1 ? 12 
HELX_P HELX_P276 BE6 ASP PA 356  ? LEU PA 369  ? ASP N 356  LEU N 369  1 ? 14 
HELX_P HELX_P277 BE7 TYR PA 376  ? THR PA 384  ? TYR N 376  THR N 384  1 ? 9  
HELX_P HELX_P278 BE8 LYS PA 390  ? GLU PA 398  ? LYS N 390  GLU N 398  1 ? 9  
HELX_P HELX_P279 BE9 PRO PA 401  ? ARG PA 405  ? PRO N 401  ARG N 405  5 ? 5  
HELX_P HELX_P280 BF1 TRP PA 407  ? ASP PA 418  ? TRP N 407  ASP N 418  1 ? 12 
HELX_P HELX_P281 BF2 MET PA 422  ? LEU PA 438  ? MET N 422  LEU N 438  1 ? 17 
HELX_P HELX_P282 BF3 ALA PA 439  ? LYS PA 451  ? ALA N 439  LYS N 451  1 ? 13 
HELX_P HELX_P283 BF4 ASN PA 459  ? ALA PA 470  ? ASN N 459  ALA N 470  1 ? 12 
HELX_P HELX_P284 BF5 ASN PA 477  ? ILE PA 486  ? ASN N 477  ILE N 486  1 ? 10 
HELX_P HELX_P285 BF6 ILE PA 491  ? ILE PA 501  ? ILE N 491  ILE N 501  1 ? 11 
HELX_P HELX_P286 BF7 ALA PA 510  ? VAL PA 519  ? ALA N 510  VAL N 519  1 ? 10 
HELX_P HELX_P287 BF8 ALA PA 524  ? ILE PA 534  ? ALA N 524  ILE N 534  1 ? 11 
HELX_P HELX_P288 BF9 SER PA 549  ? TYR PA 563  ? SER N 549  TYR N 563  1 ? 15 
HELX_P HELX_P289 BG1 ALA PA 564  ? LEU PA 578  ? ALA N 564  LEU N 578  1 ? 15 
HELX_P HELX_P290 BG2 SER PA 641  ? SER PA 653  ? SER N 641  SER N 653  1 ? 13 
HELX_P HELX_P291 BG3 ASP PA 656  ? LYS PA 667  ? ASP N 656  LYS N 667  1 ? 12 
HELX_P HELX_P292 BG4 THR PA 674  ? VAL PA 682  ? THR N 674  VAL N 682  1 ? 9  
HELX_P HELX_P293 BG5 ASP PA 689  ? CYS PA 698  ? ASP N 689  CYS N 698  1 ? 10 
HELX_P HELX_P294 BG6 LEU PA 711  ? GLN PA 721  ? LEU N 711  GLN N 721  1 ? 11 
HELX_P HELX_P295 BG7 LYS PA 727  ? CYS PA 739  ? LYS N 727  CYS N 739  1 ? 13 
HELX_P HELX_P296 BG8 SER PA 742  ? GLU PA 754  ? SER N 742  GLU N 754  1 ? 13 
HELX_P HELX_P297 BG9 ARG PA 761  ? LEU PA 771  ? ARG N 761  LEU N 771  1 ? 11 
HELX_P HELX_P298 BH1 PRO PA 777  ? GLY PA 791  ? PRO N 777  GLY N 791  1 ? 15 
HELX_P HELX_P299 BH2 LEU PA 792  ? CYS PA 807  ? LEU N 792  CYS N 807  1 ? 16 
HELX_P HELX_P300 BH3 SER PA 810  ? GLU PA 821  ? SER N 810  GLU N 821  1 ? 12 
HELX_P HELX_P301 BH4 ARG PA 827  ? CYS PA 837  ? ARG N 827  CYS N 837  1 ? 11 
HELX_P HELX_P302 BH5 PRO PA 841  ? ARG PA 855  ? PRO N 841  ARG N 855  1 ? 15 
HELX_P HELX_P303 BH6 THR PA 858  ? ARG PA 866  ? THR N 858  ARG N 866  1 ? 9  
HELX_P HELX_P304 BH7 LEU PA 874  ? HIS PA 888  ? LEU N 874  HIS N 888  1 ? 15 
HELX_P HELX_P305 BH8 GLN PA 893  ? ALA PA 904  ? GLN N 893  ALA N 904  1 ? 12 
HELX_P HELX_P306 BH9 HIS PA 908  ? ASP PA 918  ? HIS N 908  ASP N 918  1 ? 11 
HELX_P HELX_P307 BI1 PRO QA 88   ? SER QA 119  ? PRO L 88   SER L 119  1 ? 32 
HELX_P HELX_P308 BI2 GLU QA 124  ? VAL QA 129  ? GLU L 124  VAL L 129  1 ? 6  
HELX_P HELX_P309 BI3 ASN QA 131  ? GLY QA 143  ? ASN L 131  GLY L 143  1 ? 13 
HELX_P HELX_P310 BI4 LYS QA 148  ? ASN QA 152  ? LYS L 148  ASN L 152  5 ? 5  
HELX_P HELX_P311 BI5 THR QA 160  ? SER QA 172  ? THR L 160  SER L 172  1 ? 13 
HELX_P HELX_P312 BI6 SER QA 180  ? ALA QA 216  ? SER L 180  ALA L 216  1 ? 37 
HELX_P HELX_P313 BI7 ALA QA 216  ? GLY QA 236  ? ALA L 216  GLY L 236  1 ? 21 
HELX_P HELX_P314 BI8 GLY QA 237  ? LYS QA 243  ? GLY L 237  LYS L 243  1 ? 7  
HELX_P HELX_P315 BI9 PRO QA 245  ? MET QA 250  ? PRO L 245  MET L 250  1 ? 6  
HELX_P HELX_P316 BJ1 SER QA 277  ? SER QA 282  ? SER L 277  SER L 282  1 ? 6  
HELX_P HELX_P317 BJ2 PRO QA 284  ? ASP QA 286  ? PRO L 284  ASP L 286  5 ? 3  
HELX_P HELX_P318 BJ3 LEU QA 287  ? PHE QA 308  ? LEU L 287  PHE L 308  1 ? 22 
HELX_P HELX_P319 BJ4 GLY QA 314  ? GLN QA 332  ? GLY L 314  GLN L 332  1 ? 19 
HELX_P HELX_P320 BJ5 ASP RA 15   ? TYR RA 32   ? ASP M 15   TYR M 32   1 ? 18 
HELX_P HELX_P321 BJ6 GLY RA 38   ? GLY RA 49   ? GLY M 38   GLY M 49   1 ? 12 
HELX_P HELX_P322 BJ7 PRO RA 62   ? ILE RA 66   ? PRO M 62   ILE M 66   5 ? 5  
HELX_P HELX_P323 BJ8 LEU RA 67   ? ASN RA 77   ? LEU M 67   ASN M 77   1 ? 11 
HELX_P HELX_P324 BJ9 SER RA 85   ? CYS RA 93   ? SER M 85   CYS M 93   1 ? 9  
HELX_P HELX_P325 BK1 LEU RA 112  ? LEU RA 127  ? LEU M 112  LEU M 127  1 ? 16 
HELX_P HELX_P326 BK2 ASN SA 10   ? SER SA 20   ? ASN O 10   SER O 20   1 ? 11 
HELX_P HELX_P327 BK3 ASP SA 35   ? ALA SA 49   ? ASP O 35   ALA O 49   1 ? 15 
HELX_P HELX_P328 BK4 PHE SA 69   ? GLU SA 74   ? PHE O 69   GLU O 74   1 ? 6  
HELX_P HELX_P329 BK5 ASP SA 108  ? LYS SA 125  ? ASP O 108  LYS O 125  1 ? 18 
HELX_P HELX_P330 BK6 CYS TA 105  ? ILE TA 111  ? CYS W 105  ILE W 111  5 ? 7  
HELX_P HELX_P331 BK7 ASN TA 112  ? LEU TA 116  ? ASN W 112  LEU W 116  5 ? 5  
HELX_P HELX_P332 BK8 SER TA 150  ? PHE TA 159  ? SER W 150  PHE W 159  1 ? 10 
HELX_P HELX_P333 BK9 LEU TA 186  ? LYS TA 194  ? LEU W 186  LYS W 194  1 ? 9  
HELX_P HELX_P334 BL1 THR TA 198  ? ASN TA 204  ? THR W 198  ASN W 204  1 ? 7  
HELX_P HELX_P335 BL2 ASN TA 229  ? VAL TA 246  ? ASN W 229  VAL W 246  1 ? 18 
HELX_P HELX_P336 BL3 VAL TA 246  ? GLU TA 256  ? VAL W 246  GLU W 256  1 ? 11 
HELX_P HELX_P337 BL4 PHE TA 271  ? TRP TA 285  ? PHE W 271  TRP W 285  1 ? 15 
HELX_P HELX_P338 BL5 PRO TA 296  ? CYS TA 306  ? PRO W 296  CYS W 306  1 ? 11 
HELX_P HELX_P339 BL6 ASP TA 318  ? LEU TA 334  ? ASP W 318  LEU W 334  1 ? 17 
HELX_P HELX_P340 BL7 GLU TA 406  ? ILE TA 410  ? GLU W 406  ILE W 410  5 ? 5  
HELX_P HELX_P341 BL8 LEU TA 538  ? SER TA 545  ? LEU W 538  SER W 545  5 ? 8  
HELX_P HELX_P342 BL9 ASP TA 556  ? GLY TA 564  ? ASP W 556  GLY W 564  1 ? 9  
HELX_P HELX_P343 BM1 GLY VA 27   ? ASN VA 38   ? GLY P 27   ASN P 38   1 ? 12 
HELX_P HELX_P344 BM2 ASN WA 6    ? LEU WA 14   ? ASN Q 6    LEU Q 14   1 ? 9  
HELX_P HELX_P345 BM3 ILE XA 21   ? ASN XA 27   ? ILE R 21   ASN R 27   1 ? 7  
HELX_P HELX_P346 BM4 HIS YA 5    ? MET YA 13   ? HIS S 5    MET S 13   1 ? 9  
HELX_P HELX_P347 BM5 VAL ZA 5    ? ALA ZA 13   ? VAL T 5    ALA T 13   1 ? 9  
HELX_P HELX_P348 BM6 LEU BB 3    ? LEU BB 10   ? LEU V 3    LEU V 10   1 ? 8  
HELX_P HELX_P349 BM7 HIS CB 356  ? LYS CB 360  ? HIS X 356  LYS X 360  5 ? 5  
HELX_P HELX_P350 BM8 LYS CB 361  ? MET CB 365  ? LYS X 361  MET X 365  5 ? 5  
HELX_P HELX_P351 BM9 THR CB 366  ? SER CB 378  ? THR X 366  SER X 378  1 ? 13 
HELX_P HELX_P352 BN1 PRO CB 399  ? GLY CB 410  ? PRO X 399  GLY X 410  1 ? 12 
HELX_P HELX_P353 BN2 THR CB 415  ? LEU CB 426  ? THR X 415  LEU X 426  1 ? 12 
HELX_P HELX_P354 BN3 GLY CB 440  ? LEU CB 456  ? GLY X 440  LEU X 456  1 ? 17 
HELX_P HELX_P355 BN4 PRO CB 457  ? ILE CB 462  ? PRO X 457  ILE X 462  1 ? 6  
HELX_P HELX_P356 BN5 THR CB 477  ? LYS CB 493  ? THR X 477  LYS X 493  1 ? 17 
HELX_P HELX_P357 BN6 PRO CB 494  ? GLY CB 496  ? PRO X 494  GLY X 496  5 ? 3  
HELX_P HELX_P358 BN7 SER CB 507  ? MET CB 517  ? SER X 507  MET X 517  1 ? 11 
HELX_P HELX_P359 BN8 THR CB 525  ? ASN CB 535  ? THR X 525  ASN X 535  1 ? 11 
HELX_P HELX_P360 BN9 GLU CB 550  ? MET CB 557  ? GLU X 550  MET X 557  1 ? 8  
HELX_P HELX_P361 BO1 PHE CB 559  ? GLU CB 568  ? PHE X 559  GLU X 568  1 ? 10 
HELX_P HELX_P362 BO2 HIS CB 569  ? MET CB 570  ? HIS X 569  MET X 570  5 ? 2  
HELX_P HELX_P363 BO3 PRO CB 571  ? GLN CB 575  ? PRO X 571  GLN X 575  5 ? 5  
HELX_P HELX_P364 BO4 THR CB 579  ? GLU CB 583  ? THR X 579  GLU X 583  5 ? 5  
HELX_P HELX_P365 BO5 ASP CB 584  ? GLY CB 595  ? ASP X 584  GLY X 595  1 ? 12 
HELX_P HELX_P366 BO6 PRO CB 610  ? LEU CB 621  ? PRO X 610  LEU X 621  1 ? 12 
HELX_P HELX_P367 BO7 SER CB 647  ? SER CB 649  ? SER X 647  SER X 649  5 ? 3  
HELX_P HELX_P368 BO8 GLU CB 650  ? GLN CB 661  ? GLU X 650  GLN X 661  1 ? 12 
HELX_P HELX_P369 BO9 GLN CB 673  ? MET CB 687  ? GLN X 673  MET X 687  1 ? 15 
HELX_P HELX_P370 BP1 GLU CB 704  ? GLY CB 713  ? GLU X 704  GLY X 713  1 ? 10 
HELX_P HELX_P371 BP2 ASN CB 744  ? GLY CB 753  ? ASN X 744  GLY X 753  1 ? 10 
HELX_P HELX_P372 BP3 ARG CB 754  ? GLY CB 756  ? ARG X 754  GLY X 756  5 ? 3  
HELX_P HELX_P373 BP4 THR CB 769  ? ALA CB 774  ? THR X 769  ALA X 774  5 ? 6  
HELX_P HELX_P374 BP5 VAL CB 775  ? GLU CB 785  ? VAL X 775  GLU X 785  1 ? 11 
HELX_P HELX_P375 BP6 PRO DB 63   ? HIS DB 73   ? PRO A 63   HIS A 73   1 ? 11 
HELX_P HELX_P376 BP7 PHE DB 81   ? ALA DB 91   ? PHE A 81   ALA A 91   1 ? 11 
HELX_P HELX_P377 BP8 TYR DB 94   ? GLU DB 104  ? TYR A 94   GLU A 104  1 ? 11 
HELX_P HELX_P378 BP9 ILE DB 136  ? ARG DB 158  ? ILE A 136  ARG A 158  1 ? 23 
HELX_P HELX_P379 BQ1 ASP DB 200  ? ASP DB 205  ? ASP A 200  ASP A 205  1 ? 6  
HELX_P HELX_P380 BQ2 THR DB 231  ? ALA DB 242  ? THR A 231  ALA A 242  1 ? 12 
HELX_P HELX_P381 BQ3 ASP DB 259  ? ASN DB 270  ? ASP A 259  ASN A 270  1 ? 12 
HELX_P HELX_P382 BQ4 ARG DB 309  ? PHE DB 316  ? ARG A 309  PHE A 316  1 ? 8  
HELX_P HELX_P383 BQ5 ASN DB 397  ? LEU DB 404  ? ASN A 397  LEU A 404  1 ? 8  
HELX_P HELX_P384 BQ6 PRO DB 408  ? ASN DB 412  ? PRO A 408  ASN A 412  5 ? 5  
HELX_P HELX_P385 BQ7 VAL DB 427  ? ARG DB 432  ? VAL A 427  ARG A 432  1 ? 6  
HELX_P HELX_P386 BQ8 VAL DB 441  ? LYS DB 460  ? VAL A 441  LYS A 460  1 ? 20 
HELX_P HELX_P387 BQ9 TYR DB 471  ? ALA DB 478  ? TYR A 471  ALA A 478  1 ? 8  
HELX_P HELX_P388 BR1 TRP DB 489  ? ASN DB 512  ? TRP A 489  ASN A 512  1 ? 24 
HELX_P HELX_P389 BR2 THR DB 531  ? SER DB 538  ? THR A 531  SER A 538  1 ? 8  
HELX_P HELX_P390 BR3 GLY DB 541  ? GLY DB 567  ? GLY A 541  GLY A 567  1 ? 27 
HELX_P HELX_P391 BR4 PHE DB 572  ? HIS DB 584  ? PHE A 572  HIS A 584  1 ? 13 
HELX_P HELX_P392 BR5 HIS DB 584  ? THR DB 589  ? HIS A 584  THR A 589  1 ? 6  
HELX_P HELX_P393 BR6 GLY DB 590  ? TYR DB 594  ? GLY A 590  TYR A 594  5 ? 5  
HELX_P HELX_P394 BR7 LYS DB 595  ? LYS DB 597  ? LYS A 595  LYS A 597  5 ? 3  
HELX_P HELX_P395 BR8 LEU DB 598  ? ASN DB 617  ? LEU A 598  ASN A 617  1 ? 20 
HELX_P HELX_P396 BR9 TRP DB 630  ? GLY DB 662  ? TRP A 630  GLY A 662  1 ? 33 
HELX_P HELX_P397 BS1 ARG DB 676  ? MET DB 697  ? ARG A 676  MET A 697  1 ? 22 
HELX_P HELX_P398 BS2 LYS DB 702  ? LYS DB 721  ? LYS A 702  LYS A 721  1 ? 20 
HELX_P HELX_P399 BS3 PRO DB 732  ? GLY DB 764  ? PRO A 732  GLY A 764  1 ? 33 
HELX_P HELX_P400 BS4 ASP DB 768  ? GLY DB 798  ? ASP A 768  GLY A 798  1 ? 31 
HELX_P HELX_P401 BS5 THR DB 802  ? ARG DB 821  ? THR A 802  ARG A 821  1 ? 20 
HELX_P HELX_P402 BS6 TYR DB 832  ? ALA DB 849  ? TYR A 832  ALA A 849  1 ? 18 
HELX_P HELX_P403 BS7 ASN DB 857  ? ASN DB 873  ? ASN A 857  ASN A 873  1 ? 17 
HELX_P HELX_P404 BS8 ASN DB 873  ? THR DB 887  ? ASN A 873  THR A 887  1 ? 15 
HELX_P HELX_P405 BS9 GLU DB 912  ? ARG DB 933  ? GLU A 912  ARG A 933  1 ? 22 
HELX_P HELX_P406 BT1 PRO DB 947  ? LEU DB 962  ? PRO A 947  LEU A 962  1 ? 16 
HELX_P HELX_P407 BT2 ASP DB 989  ? LEU DB 999  ? ASP A 989  LEU A 999  1 ? 11 
HELX_P HELX_P408 BT3 ASP DB 1002 ? ASN DB 1013 ? ASP A 1002 ASN A 1013 1 ? 12 
HELX_P HELX_P409 BT4 PHE DB 1036 ? GLY DB 1054 ? PHE A 1036 GLY A 1054 1 ? 19 
HELX_P HELX_P410 BT5 GLY DB 1054 ? GLY DB 1063 ? GLY A 1054 GLY A 1063 1 ? 10 
HELX_P HELX_P411 BT6 ASP DB 1076 ? ALA DB 1082 ? ASP A 1076 ALA A 1082 1 ? 7  
HELX_P HELX_P412 BT7 THR DB 1102 ? HIS DB 1117 ? THR A 1102 HIS A 1117 1 ? 16 
HELX_P HELX_P413 BT8 GLU DB 1123 ? TYR DB 1128 ? GLU A 1123 TYR A 1128 5 ? 6  
HELX_P HELX_P414 BT9 MET DB 1143 ? ASN DB 1159 ? MET A 1143 ASN A 1159 1 ? 17 
HELX_P HELX_P415 BU1 HIS DB 1209 ? VAL DB 1213 ? HIS A 1209 VAL A 1213 5 ? 5  
HELX_P HELX_P416 BU2 ASP DB 1233 ? SER DB 1251 ? ASP A 1233 SER A 1251 1 ? 19 
HELX_P HELX_P417 BU3 THR DB 1255 ? ARG DB 1275 ? THR A 1255 ARG A 1275 1 ? 21 
HELX_P HELX_P418 BU4 GLU DB 1276 ? ASN DB 1280 ? GLU A 1276 ASN A 1280 5 ? 5  
HELX_P HELX_P419 BU5 THR DB 1281 ? GLY DB 1302 ? THR A 1281 GLY A 1302 1 ? 22 
HELX_P HELX_P420 BU6 PRO DB 1313 ? THR DB 1318 ? PRO A 1313 THR A 1318 1 ? 6  
HELX_P HELX_P421 BU7 PRO DB 1319 ? GLY DB 1323 ? PRO A 1319 GLY A 1323 5 ? 5  
HELX_P HELX_P422 BU8 PRO DB 1336 ? ARG DB 1341 ? PRO A 1336 ARG A 1341 5 ? 6  
HELX_P HELX_P423 BU9 ASN DB 1367 ? ILE DB 1372 ? ASN A 1367 ILE A 1372 1 ? 6  
HELX_P HELX_P424 BV1 PRO DB 1374 ? GLN DB 1399 ? PRO A 1374 GLN A 1399 1 ? 26 
HELX_P HELX_P425 BV2 LEU DB 1408 ? TRP DB 1412 ? LEU A 1408 TRP A 1412 5 ? 5  
HELX_P HELX_P426 BV3 ARG DB 1418 ? GLN DB 1424 ? ARG A 1418 GLN A 1424 5 ? 7  
HELX_P HELX_P427 BV4 ASP DB 1426 ? ALA DB 1431 ? ASP A 1426 ALA A 1431 1 ? 6  
HELX_P HELX_P428 BV5 GLY DB 1435 ? VAL DB 1447 ? GLY A 1435 VAL A 1447 1 ? 13 
HELX_P HELX_P429 BV6 HIS DB 1457 ? GLY DB 1462 ? HIS A 1457 GLY A 1462 1 ? 6  
HELX_P HELX_P430 BV7 ASN DB 1466 ? GLY DB 1479 ? ASN A 1466 GLY A 1479 1 ? 14 
HELX_P HELX_P431 BV8 GLY DB 1479 ? THR DB 1488 ? GLY A 1479 THR A 1488 1 ? 10 
HELX_P HELX_P432 BV9 LEU DB 1489 ? TYR DB 1494 ? LEU A 1489 TYR A 1494 5 ? 6  
HELX_P HELX_P433 BW1 LYS DB 1505 ? GLU DB 1511 ? LYS A 1505 GLU A 1511 1 ? 7  
HELX_P HELX_P434 BW2 THR DB 1519 ? GLN DB 1522 ? THR A 1519 GLN A 1522 5 ? 4  
HELX_P HELX_P435 BW3 ARG DB 1523 ? ASN DB 1543 ? ARG A 1523 ASN A 1543 1 ? 21 
HELX_P HELX_P436 BW4 ILE DB 1566 ? PHE DB 1577 ? ILE A 1566 PHE A 1577 1 ? 12 
HELX_P HELX_P437 BW5 HIS DB 1580 ? ALA DB 1603 ? HIS A 1580 ALA A 1603 1 ? 24 
HELX_P HELX_P438 BW6 VAL DB 1651 ? SER DB 1654 ? VAL A 1651 SER A 1654 5 ? 4  
HELX_P HELX_P439 BW7 ILE DB 1676 ? ASP DB 1690 ? ILE A 1676 ASP A 1690 1 ? 15 
HELX_P HELX_P440 BW8 GLY DB 1721 ? LYS DB 1735 ? GLY A 1721 LYS A 1735 1 ? 15 
HELX_P HELX_P441 BW9 ASN DB 1737 ? LEU DB 1751 ? ASN A 1737 LEU A 1751 1 ? 15 
HELX_P HELX_P442 BX1 TYR DB 1768 ? PHE DB 1772 ? TYR A 1768 PHE A 1772 5 ? 5  
HELX_P HELX_P443 BX2 HIS DB 1823 ? ALA DB 1828 ? HIS A 1823 ALA A 1828 5 ? 6  
HELX_P HELX_P444 BX3 ARG DB 1832 ? LEU DB 1852 ? ARG A 1832 LEU A 1852 1 ? 21 
HELX_P HELX_P445 BX4 ARG DB 1865 ? LEU DB 1876 ? ARG A 1865 LEU A 1876 1 ? 12 
HELX_P HELX_P446 BX5 GLN DB 1894 ? VAL DB 1899 ? GLN A 1894 VAL A 1899 1 ? 6  
HELX_P HELX_P447 BX6 VAL DB 1899 ? ALA DB 1909 ? VAL A 1899 ALA A 1909 1 ? 11 
HELX_P HELX_P448 BX7 ASP DB 1922 ? ILE DB 1927 ? ASP A 1922 ILE A 1927 1 ? 6  
HELX_P HELX_P449 BX8 SER DB 1928 ? ASN DB 1947 ? SER A 1928 ASN A 1947 1 ? 20 
HELX_P HELX_P450 BX9 ASN DB 1947 ? LYS DB 1955 ? ASN A 1947 LYS A 1955 1 ? 9  
HELX_P HELX_P451 BY1 THR DB 1972 ? ASN DB 1996 ? THR A 1972 ASN A 1996 1 ? 25 
HELX_P HELX_P452 BY2 THR DB 2003 ? GLY DB 2013 ? THR A 2003 GLY A 2013 1 ? 11 
HELX_P HELX_P453 BY3 LYS DB 2070 ? ALA DB 2081 ? LYS A 2070 ALA A 2081 1 ? 12 
HELX_P HELX_P454 BY4 ASN DB 2082 ? THR DB 2087 ? ASN A 2082 THR A 2087 1 ? 6  
HELX_P HELX_P455 BY5 LYS DB 2108 ? SER DB 2118 ? LYS A 2108 SER A 2118 1 ? 11 
HELX_P HELX_P456 BY6 HIS DB 2166 ? LYS DB 2170 ? HIS A 2166 LYS A 2170 5 ? 5  
HELX_P HELX_P457 BY7 SER DB 2189 ? ASN DB 2203 ? SER A 2189 ASN A 2203 1 ? 15 
HELX_P HELX_P458 BY8 THR DB 2231 ? ASN DB 2241 ? THR A 2231 ASN A 2241 1 ? 11 
HELX_P HELX_P459 BY9 LEU DB 2252 ? SER DB 2254 ? LEU A 2252 SER A 2254 5 ? 3  
HELX_P HELX_P460 BZ1 HIS DB 2306 ? HIS DB 2309 ? HIS A 2306 HIS A 2309 5 ? 4  
HELX_P HELX_P461 BZ2 ARG DB 2310 ? LEU DB 2315 ? ARG A 2310 LEU A 2315 1 ? 6  
HELX_P HELX_P462 BZ3 LEU DB 2320 ? TYR DB 2326 ? LEU A 2320 TYR A 2326 5 ? 7  
HELX_P HELX_P463 BZ4 VAL EB 113  ? SER EB 126  ? VAL C 113  SER C 126  1 ? 14 
HELX_P HELX_P464 BZ5 GLY EB 141  ? HIS EB 154  ? GLY C 141  HIS C 154  1 ? 14 
HELX_P HELX_P465 BZ6 GLU EB 174  ? GLY EB 178  ? GLU C 174  GLY C 178  1 ? 5  
HELX_P HELX_P466 BZ7 PHE EB 211  ? SER EB 222  ? PHE C 211  SER C 222  1 ? 12 
HELX_P HELX_P467 BZ8 MET EB 236  ? GLU EB 249  ? MET C 236  GLU C 249  1 ? 14 
HELX_P HELX_P468 BZ9 ILE EB 260  ? GLU EB 266  ? ILE C 260  GLU C 266  1 ? 7  
HELX_P HELX_P469 CA1 PRO EB 270  ? SER EB 293  ? PRO C 270  SER C 293  1 ? 24 
HELX_P HELX_P470 CA2 THR EB 319  ? PHE EB 331  ? THR C 319  PHE C 331  1 ? 13 
HELX_P HELX_P471 CA3 ASN EB 335  ? TRP EB 344  ? ASN C 335  TRP C 344  1 ? 10 
HELX_P HELX_P472 CA4 ARG EB 367  ? ILE EB 373  ? ARG C 367  ILE C 373  1 ? 7  
HELX_P HELX_P473 CA5 ILE EB 373  ? ASP EB 387  ? ILE C 373  ASP C 387  1 ? 15 
HELX_P HELX_P474 CA6 SER EB 391  ? GLY EB 400  ? SER C 391  GLY C 400  1 ? 10 
HELX_P HELX_P475 CA7 THR EB 404  ? LYS EB 409  ? THR C 404  LYS C 409  1 ? 6  
HELX_P HELX_P476 CA8 ASN EB 411  ? GLY EB 425  ? ASN C 411  GLY C 425  1 ? 15 
HELX_P HELX_P477 CA9 PHE EB 427  ? ILE EB 438  ? PHE C 427  ILE C 438  1 ? 12 
HELX_P HELX_P478 CB1 PRO EB 439  ? TYR EB 453  ? PRO C 439  TYR C 453  1 ? 15 
HELX_P HELX_P479 CB2 ASP EB 460  ? CYS EB 468  ? ASP C 460  CYS C 468  1 ? 9  
HELX_P HELX_P480 CB3 ASN EB 596  ? SER EB 598  ? ASN C 596  SER C 598  5 ? 3  
HELX_P HELX_P481 CB4 GLU EB 599  ? TYR EB 614  ? GLU C 599  TYR C 614  1 ? 16 
HELX_P HELX_P482 CB5 GLY EB 633  ? TYR EB 648  ? GLY C 633  TYR C 648  1 ? 16 
HELX_P HELX_P483 CB6 LEU EB 696  ? ASN EB 702  ? LEU C 696  ASN C 702  1 ? 7  
HELX_P HELX_P484 CB7 ASN EB 710  ? ASP EB 723  ? ASN C 710  ASP C 723  1 ? 14 
HELX_P HELX_P485 CB8 ASP EB 725  ? SER EB 731  ? ASP C 725  SER C 731  1 ? 7  
HELX_P HELX_P486 CB9 THR EB 749  ? ASP EB 755  ? THR C 749  ASP C 755  1 ? 7  
HELX_P HELX_P487 CC1 ASP EB 755  ? GLY EB 777  ? ASP C 755  GLY C 777  1 ? 23 
HELX_P HELX_P488 CC2 LEU EB 801  ? ALA EB 823  ? LEU C 801  ALA C 823  1 ? 23 
HELX_P HELX_P489 CC3 PRO EB 839  ? ASP EB 841  ? PRO C 839  ASP C 841  5 ? 3  
HELX_P HELX_P490 CC4 CYS EB 842  ? ARG EB 853  ? CYS C 842  ARG C 853  1 ? 12 
HELX_P HELX_P491 CC5 GLY EB 882  ? THR EB 891  ? GLY C 882  THR C 891  1 ? 10 
HELX_P HELX_P492 CC6 PRO EB 925  ? PRO EB 927  ? PRO C 925  PRO C 927  5 ? 3  
HELX_P HELX_P493 CC7 HIS EB 928  ? LYS EB 941  ? HIS C 928  LYS C 941  1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? GB GTP .   O3B ? ? ? 1_555 HB MG .   MG ? ? C GTP 1500 C MG 1501 1_555 ? ? ? ? ? ? ?                       
2.538 ? 
metalc2   metalc ? ? GB GTP .   O1B ? ? ? 1_555 HB MG .   MG ? ? C GTP 1500 C MG 1501 1_555 ? ? ? ? ? ? ?                       
2.810 ? 
hydrog1   hydrog ? ? A  C   4   N3  ? ? ? 1_555 A  G  77  N1 ? ? B C   4    B G  77   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog2   hydrog ? ? A  C   4   N4  ? ? ? 1_555 A  G  77  O6 ? ? B C   4    B G  77   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog3   hydrog ? ? A  C   4   O2  ? ? ? 1_555 A  G  77  N2 ? ? B C   4    B G  77   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog4   hydrog ? ? A  U   5   N3  ? ? ? 1_555 A  A  76  N1 ? ? B U   5    B A  76   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog5   hydrog ? ? A  U   5   O4  ? ? ? 1_555 A  A  76  N6 ? ? B U   5    B A  76   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog6   hydrog ? ? A  C   6   N3  ? ? ? 1_555 A  G  75  N1 ? ? B C   6    B G  75   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog7   hydrog ? ? A  C   6   N4  ? ? ? 1_555 A  G  75  O6 ? ? B C   6    B G  75   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog8   hydrog ? ? A  C   6   O2  ? ? ? 1_555 A  G  75  N2 ? ? B C   6    B G  75   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog9   hydrog ? ? A  U   7   N3  ? ? ? 1_555 A  U  74  O4 ? ? B U   7    B U  74   1_555 ? ? ? ? ? ? TYPE_16_PAIR            ? 
? 
hydrog10  hydrog ? ? A  U   7   O2  ? ? ? 1_555 A  U  74  N3 ? ? B U   7    B U  74   1_555 ? ? ? ? ? ? TYPE_16_PAIR            ? 
? 
hydrog11  hydrog ? ? A  G   8   N2  ? ? ? 1_555 A  U  72  O4 ? ? B G   8    B U  72   1_555 ? ? ? ? ? ? 'G-U MISPAIR'           ? 
? 
hydrog12  hydrog ? ? A  G   8   N3  ? ? ? 1_555 A  C  73  N4 ? ? B G   8    B C  73   1_555 ? ? ? ? ? ? 'G-C PAIR'              ? 
? 
hydrog13  hydrog ? ? A  U   10  N3  ? ? ? 1_555 A  A  67  N1 ? ? B U   10   B A  67   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog14  hydrog ? ? A  U   10  O4  ? ? ? 1_555 A  A  67  N6 ? ? B U   10   B A  67   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog15  hydrog ? ? A  U   11  N3  ? ? ? 1_555 A  A  66  N1 ? ? B U   11   B A  66   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog16  hydrog ? ? A  U   11  O4  ? ? ? 1_555 A  A  66  N6 ? ? B U   11   B A  66   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog17  hydrog ? ? A  U   12  N3  ? ? ? 1_555 A  G  65  O6 ? ? B U   12   B G  65   1_555 ? ? ? ? ? ? TYPE_27_PAIR            ? 
? 
hydrog18  hydrog ? ? A  U   12  O4  ? ? ? 1_555 A  G  65  N1 ? ? B U   12   B G  65   1_555 ? ? ? ? ? ? TYPE_27_PAIR            ? 
? 
hydrog19  hydrog ? ? A  C   13  N3  ? ? ? 1_555 A  G  64  N1 ? ? B C   13   B G  64   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog20  hydrog ? ? A  C   13  N4  ? ? ? 1_555 A  G  64  O6 ? ? B C   13   B G  64   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog21  hydrog ? ? A  C   13  O2  ? ? ? 1_555 A  G  64  N2 ? ? B C   13   B G  64   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog22  hydrog ? ? A  U   14  N3  ? ? ? 1_555 A  A  63  N1 ? ? B U   14   B A  63   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog23  hydrog ? ? A  U   14  O4  ? ? ? 1_555 A  A  63  N6 ? ? B U   14   B A  63   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog24  hydrog ? ? A  C   15  N3  ? ? ? 1_555 A  G  62  N1 ? ? B C   15   B G  62   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog25  hydrog ? ? A  C   15  N4  ? ? ? 1_555 A  G  62  O6 ? ? B C   15   B G  62   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog26  hydrog ? ? A  C   15  O2  ? ? ? 1_555 A  G  62  N2 ? ? B C   15   B G  62   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog27  hydrog ? ? A  U   16  N3  ? ? ? 1_555 A  A  61  N1 ? ? B U   16   B A  61   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog28  hydrog ? ? A  U   16  O4  ? ? ? 1_555 A  A  61  N6 ? ? B U   16   B A  61   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog29  hydrog ? ? A  U   17  N3  ? ? ? 1_555 A  G  60  O6 ? ? B U   17   B G  60   1_555 ? ? ? ? ? ? TYPE_27_PAIR            ? 
? 
hydrog30  hydrog ? ? A  U   17  O4  ? ? ? 1_555 A  G  60  N1 ? ? B U   17   B G  60   1_555 ? ? ? ? ? ? TYPE_27_PAIR            ? 
? 
hydrog31  hydrog ? ? A  C   18  N3  ? ? ? 1_555 A  G  59  N1 ? ? B C   18   B G  59   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog32  hydrog ? ? A  C   18  N4  ? ? ? 1_555 A  G  59  O6 ? ? B C   18   B G  59   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog33  hydrog ? ? A  C   18  O2  ? ? ? 1_555 A  G  59  N2 ? ? B C   18   B G  59   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog34  hydrog ? ? A  A   19  N1  ? ? ? 1_555 A  U  58  N3 ? ? B A   19   B U  58   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog35  hydrog ? ? A  A   19  N6  ? ? ? 1_555 A  U  58  O4 ? ? B A   19   B U  58   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog36  hydrog ? ? A  A   28  N1  ? ? ? 1_555 A  U  54  N3 ? ? B A   28   B U  54   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog37  hydrog ? ? A  A   28  N6  ? ? ? 1_555 A  U  54  O4 ? ? B A   28   B U  54   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog38  hydrog ? ? A  A   29  N1  ? ? ? 1_555 A  U  53  N3 ? ? B A   29   B U  53   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog39  hydrog ? ? A  A   29  N6  ? ? ? 1_555 A  U  53  O4 ? ? B A   29   B U  53   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog40  hydrog ? ? A  A   30  N1  ? ? ? 1_555 A  U  52  N3 ? ? B A   30   B U  52   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog41  hydrog ? ? A  A   30  N6  ? ? ? 1_555 A  U  52  O4 ? ? B A   30   B U  52   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog42  hydrog ? ? A  U   31  N3  ? ? ? 1_555 A  A  51  N1 ? ? B U   31   B A  51   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog43  hydrog ? ? A  U   31  O4  ? ? ? 1_555 A  A  51  N6 ? ? B U   31   B A  51   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog44  hydrog ? ? A  C   32  N3  ? ? ? 1_555 A  G  50  N1 ? ? B C   32   B G  50   1_555 ? ? ? ? ? ? 'C-G PAIR'              ? 
? 
hydrog45  hydrog ? ? A  U   33  N3  ? ? ? 1_555 A  A  49  N1 ? ? B U   33   B A  49   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog46  hydrog ? ? A  U   33  O4  ? ? ? 1_555 A  A  49  N6 ? ? B U   33   B A  49   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog47  hydrog ? ? A  U   34  N3  ? ? ? 1_555 A  A  48  N1 ? ? B U   34   B A  48   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog48  hydrog ? ? A  U   34  O4  ? ? ? 1_555 A  A  48  N6 ? ? B U   34   B A  48   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog49  hydrog ? ? A  U   35  N3  ? ? ? 1_555 A  A  47  N1 ? ? B U   35   B A  47   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog50  hydrog ? ? A  U   35  O4  ? ? ? 1_555 A  A  47  N6 ? ? B U   35   B A  47   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog51  hydrog ? ? A  C   36  N3  ? ? ? 1_555 A  U  46  N3 ? ? B C   36   B U  46   1_555 ? ? ? ? ? ? TYPE_18_PAIR            ? 
? 
hydrog52  hydrog ? ? A  C   36  N4  ? ? ? 1_555 A  U  46  O4 ? ? B C   36   B U  46   1_555 ? ? ? ? ? ? TYPE_18_PAIR            ? 
? 
hydrog53  hydrog ? ? A  G   97  N1  ? ? ? 1_555 A  U  116 O4 ? ? B G   97   B U  116  1_555 ? ? ? ? ? ? TYPE_27_PAIR            ? 
? 
hydrog54  hydrog ? ? A  G   97  O6  ? ? ? 1_555 A  U  116 N3 ? ? B G   97   B U  116  1_555 ? ? ? ? ? ? TYPE_27_PAIR            ? 
? 
hydrog55  hydrog ? ? A  G   98  N1  ? ? ? 1_555 A  C  115 N3 ? ? B G   98   B C  115  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog56  hydrog ? ? A  G   98  N2  ? ? ? 1_555 A  C  115 O2 ? ? B G   98   B C  115  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog57  hydrog ? ? A  G   98  O6  ? ? ? 1_555 A  C  115 N4 ? ? B G   98   B C  115  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog58  hydrog ? ? A  C   99  N3  ? ? ? 1_555 A  G  114 N1 ? ? B C   99   B G  114  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog59  hydrog ? ? A  C   99  N4  ? ? ? 1_555 A  G  114 O6 ? ? B C   99   B G  114  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog60  hydrog ? ? A  C   99  O2  ? ? ? 1_555 A  G  114 N2 ? ? B C   99   B G  114  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog61  hydrog ? ? A  C   100 N3  ? ? ? 1_555 A  G  113 N1 ? ? B C   100  B G  113  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog62  hydrog ? ? A  C   100 N4  ? ? ? 1_555 A  G  113 O6 ? ? B C   100  B G  113  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog63  hydrog ? ? A  C   100 O2  ? ? ? 1_555 A  G  113 N2 ? ? B C   100  B G  113  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog64  hydrog ? ? A  U   101 N3  ? ? ? 1_555 A  A  112 N1 ? ? B U   101  B A  112  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog65  hydrog ? ? A  U   101 O4  ? ? ? 1_555 A  A  112 N6 ? ? B U   101  B A  112  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog66  hydrog ? ? A  U   102 N3  ? ? ? 1_555 A  A  111 N1 ? ? B U   102  B A  111  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog67  hydrog ? ? A  U   102 O4  ? ? ? 1_555 A  A  111 N6 ? ? B U   102  B A  111  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog68  hydrog ? ? A  G   103 N1  ? ? ? 1_555 A  C  110 N3 ? ? B G   103  B C  110  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog69  hydrog ? ? A  G   103 N2  ? ? ? 1_555 A  C  110 O2 ? ? B G   103  B C  110  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog70  hydrog ? ? A  G   103 O6  ? ? ? 1_555 A  C  110 N4 ? ? B G   103  B C  110  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog71  hydrog ? ? A  C   104 N3  ? ? ? 1_555 A  G  109 N1 ? ? B C   104  B G  109  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog72  hydrog ? ? A  C   104 N4  ? ? ? 1_555 A  G  109 O6 ? ? B C   104  B G  109  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog73  hydrog ? ? A  C   104 O2  ? ? ? 1_555 A  G  109 N2 ? ? B C   104  B G  109  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog74  hydrog ? ? A  U   105 N3  ? ? ? 1_555 A  G  109 O6 ? ? B U   105  B G  109  1_555 ? ? ? ? ? ? TYPE_28_PAIR            ? 
? 
hydrog75  hydrog ? ? A  U   105 O2  ? ? ? 1_555 A  G  109 N1 ? ? B U   105  B G  109  1_555 ? ? ? ? ? ? TYPE_28_PAIR            ? 
? 
hydrog76  hydrog ? ? K  G   1   N1  ? ? ? 1_555 K  C  19  N3 ? ? F G   1    F C  19   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog77  hydrog ? ? K  G   1   N2  ? ? ? 1_555 K  C  19  O2 ? ? F G   1    F C  19   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog78  hydrog ? ? K  G   1   O6  ? ? ? 1_555 K  C  19  N4 ? ? F G   1    F C  19   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog79  hydrog ? ? K  U   2   N3  ? ? ? 1_555 K  A  18  N1 ? ? F U   2    F A  18   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog80  hydrog ? ? K  U   2   O4  ? ? ? 1_555 K  A  18  N6 ? ? F U   2    F A  18   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog81  hydrog ? ? K  G   3   N1  ? ? ? 1_555 K  C  17  N3 ? ? F G   3    F C  17   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog82  hydrog ? ? K  G   3   N2  ? ? ? 1_555 K  C  17  O2 ? ? F G   3    F C  17   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog83  hydrog ? ? K  G   3   O6  ? ? ? 1_555 K  C  17  N4 ? ? F G   3    F C  17   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog84  hydrog ? ? K  C   4   N3  ? ? ? 1_555 K  G  16  N1 ? ? F C   4    F G  16   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog85  hydrog ? ? K  C   4   N4  ? ? ? 1_555 K  G  16  O6 ? ? F C   4    F G  16   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog86  hydrog ? ? K  C   4   O2  ? ? ? 1_555 K  G  16  N2 ? ? F C   4    F G  16   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog87  hydrog ? ? K  U   5   N3  ? ? ? 1_555 K  A  15  N1 ? ? F U   5    F A  15   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog88  hydrog ? ? K  U   5   O4  ? ? ? 1_555 K  A  15  N6 ? ? F U   5    F A  15   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog89  hydrog ? ? K  G   7   N1  ? ? ? 1_555 K  C  14  N3 ? ? F G   7    F C  14   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog90  hydrog ? ? K  G   7   N2  ? ? ? 1_555 K  C  14  O2 ? ? F G   7    F C  14   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog91  hydrog ? ? K  G   7   O6  ? ? ? 1_555 K  C  14  N4 ? ? F G   7    F C  14   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog92  hydrog ? ? K  C   8   N3  ? ? ? 1_555 K  G  13  N1 ? ? F C   8    F G  13   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog93  hydrog ? ? K  C   8   N4  ? ? ? 1_555 K  G  13  O6 ? ? F C   8    F G  13   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog94  hydrog ? ? K  C   8   O2  ? ? ? 1_555 K  G  13  N2 ? ? F C   8    F G  13   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog95  hydrog ? ? K  A   48  N1  ? ? ? 1_555 UA G  64  N1 ? ? F A   48   I G  64   1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? 
? 
hydrog96  hydrog ? ? K  A   48  N6  ? ? ? 1_555 UA G  64  O6 ? ? F A   48   I G  64   1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? 
? 
hydrog97  hydrog ? ? K  G   49  N1  ? ? ? 1_555 UA U  63  O2 ? ? F G   49   I U  63   1_555 ? ? ? ? ? ? TYPE_28_PAIR            ? 
? 
hydrog98  hydrog ? ? K  G   49  O6  ? ? ? 1_555 UA U  63  N3 ? ? F G   49   I U  63   1_555 ? ? ? ? ? ? TYPE_28_PAIR            ? 
? 
hydrog99  hydrog ? ? K  A   50  N1  ? ? ? 1_555 UA U  62  N3 ? ? F A   50   I U  62   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog100 hydrog ? ? K  A   50  N6  ? ? ? 1_555 UA U  62  O4 ? ? F A   50   I U  62   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog101 hydrog ? ? K  U   51  N3  ? ? ? 1_555 UA A  61  N1 ? ? F U   51   I A  61   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog102 hydrog ? ? K  U   51  O4  ? ? ? 1_555 UA A  61  N6 ? ? F U   51   I A  61   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog103 hydrog ? ? K  U   52  N3  ? ? ? 1_555 UA A  60  N1 ? ? F U   52   I A  60   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog104 hydrog ? ? K  U   52  O4  ? ? ? 1_555 UA A  60  N6 ? ? F U   52   I A  60   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog105 hydrog ? ? K  A   53  N1  ? ? ? 1_555 UA U  59  N3 ? ? F A   53   I U  59   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog106 hydrog ? ? K  A   53  N6  ? ? ? 1_555 UA U  59  O4 ? ? F A   53   I U  59   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog107 hydrog ? ? K  G   54  N1  ? ? ? 1_555 UA C  58  N3 ? ? F G   54   I C  58   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog108 hydrog ? ? K  G   54  N2  ? ? ? 1_555 UA C  58  O2 ? ? F G   54   I C  58   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog109 hydrog ? ? K  G   54  O6  ? ? ? 1_555 UA C  58  N4 ? ? F G   54   I C  58   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog110 hydrog ? ? K  C   55  N3  ? ? ? 1_555 UA G  57  N1 ? ? F C   55   I G  57   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog111 hydrog ? ? K  C   55  N4  ? ? ? 1_555 UA G  57  O6 ? ? F C   55   I G  57   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog112 hydrog ? ? K  C   55  O2  ? ? ? 1_555 UA G  57  N2 ? ? F C   55   I G  57   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog113 hydrog ? ? K  A   56  N1  ? ? ? 1_555 UA U  56  N3 ? ? F A   56   I U  56   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog114 hydrog ? ? K  A   56  N6  ? ? ? 1_555 UA U  56  O4 ? ? F A   56   I U  56   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog115 hydrog ? ? K  U   57  N3  ? ? ? 1_555 UA U  55  O4 ? ? F U   57   I U  55   1_555 ? ? ? ? ? ? 'U-U MISPAIR'           ? 
? 
hydrog116 hydrog ? ? K  G   58  N1  ? ? ? 1_555 UA A  17  N1 ? ? F G   58   I A  17   1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? 
? 
hydrog117 hydrog ? ? K  G   58  O6  ? ? ? 1_555 UA A  17  N6 ? ? F G   58   I A  17   1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? 
? 
hydrog118 hydrog ? ? K  G   59  N1  ? ? ? 1_555 UA C  16  N3 ? ? F G   59   I C  16   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog119 hydrog ? ? K  G   59  N2  ? ? ? 1_555 UA C  16  O2 ? ? F G   59   I C  16   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog120 hydrog ? ? K  G   59  O6  ? ? ? 1_555 UA C  16  N4 ? ? F G   59   I C  16   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog121 hydrog ? ? K  C   60  N3  ? ? ? 1_555 UA G  15  N1 ? ? F C   60   I G  15   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog122 hydrog ? ? K  C   60  N4  ? ? ? 1_555 UA G  15  O6 ? ? F C   60   I G  15   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog123 hydrog ? ? K  C   60  O2  ? ? ? 1_555 UA G  15  N2 ? ? F C   60   I G  15   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog124 hydrog ? ? K  C   61  N3  ? ? ? 1_555 UA G  14  N1 ? ? F C   61   I G  14   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog125 hydrog ? ? K  C   61  N4  ? ? ? 1_555 UA G  14  O6 ? ? F C   61   I G  14   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog126 hydrog ? ? K  C   61  O2  ? ? ? 1_555 UA G  14  N2 ? ? F C   61   I G  14   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog127 hydrog ? ? K  C   63  N3  ? ? ? 1_555 UA G  12  N1 ? ? F C   63   I G  12   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog128 hydrog ? ? K  C   63  N4  ? ? ? 1_555 UA G  12  O6 ? ? F C   63   I G  12   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog129 hydrog ? ? K  C   63  O2  ? ? ? 1_555 UA G  12  N2 ? ? F C   63   I G  12   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog130 hydrog ? ? K  U   64  N3  ? ? ? 1_555 UA A  11  N1 ? ? F U   64   I A  11   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog131 hydrog ? ? K  U   64  O4  ? ? ? 1_555 UA A  11  N6 ? ? F U   64   I A  11   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog132 hydrog ? ? K  G   65  N1  ? ? ? 1_555 UA C  10  N3 ? ? F G   65   I C  10   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog133 hydrog ? ? K  G   65  N2  ? ? ? 1_555 UA C  10  O2 ? ? F G   65   I C  10   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog134 hydrog ? ? K  G   65  O6  ? ? ? 1_555 UA C  10  N4 ? ? F G   65   I C  10   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog135 hydrog ? ? K  C   66  N3  ? ? ? 1_555 UA G  9   N1 ? ? F C   66   I G  9    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog136 hydrog ? ? K  C   66  N4  ? ? ? 1_555 UA G  9   O6 ? ? F C   66   I G  9    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog137 hydrog ? ? K  C   66  O2  ? ? ? 1_555 UA G  9   N2 ? ? F C   66   I G  9    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog138 hydrog ? ? K  G   67  N1  ? ? ? 1_555 UA C  8   N3 ? ? F G   67   I C  8    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog139 hydrog ? ? K  G   67  N2  ? ? ? 1_555 UA C  8   O2 ? ? F G   67   I C  8    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog140 hydrog ? ? K  G   67  O6  ? ? ? 1_555 UA C  8   N4 ? ? F G   67   I C  8    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog141 hydrog ? ? K  C   68  N3  ? ? ? 1_555 UA G  7   N1 ? ? F C   68   I G  7    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog142 hydrog ? ? K  C   68  N4  ? ? ? 1_555 UA G  7   O6 ? ? F C   68   I G  7    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog143 hydrog ? ? K  C   68  O2  ? ? ? 1_555 UA G  7   N2 ? ? F C   68   I G  7    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog144 hydrog ? ? K  A   69  N1  ? ? ? 1_555 UA U  6   N3 ? ? F A   69   I U  6    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog145 hydrog ? ? K  A   69  N6  ? ? ? 1_555 UA U  6   O4 ? ? F A   69   I U  6    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog146 hydrog ? ? K  A   70  N1  ? ? ? 1_555 UA U  5   N3 ? ? F A   70   I U  5    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog147 hydrog ? ? K  A   70  N6  ? ? ? 1_555 UA U  5   O4 ? ? F A   70   I U  5    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog148 hydrog ? ? K  G   71  N1  ? ? ? 1_555 UA U  4   O2 ? ? F G   71   I U  4    1_555 ? ? ? ? ? ? TYPE_28_PAIR            ? 
? 
hydrog149 hydrog ? ? K  G   71  O6  ? ? ? 1_555 UA U  4   N3 ? ? F G   71   I U  4    1_555 ? ? ? ? ? ? TYPE_28_PAIR            ? 
? 
hydrog150 hydrog ? ? K  G   72  N1  ? ? ? 1_555 UA C  3   N3 ? ? F G   72   I C  3    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog151 hydrog ? ? K  G   72  N2  ? ? ? 1_555 UA C  3   O2 ? ? F G   72   I C  3    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog152 hydrog ? ? K  G   72  O6  ? ? ? 1_555 UA C  3   N4 ? ? F G   72   I C  3    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog153 hydrog ? ? K  A   73  N1  ? ? ? 1_555 UA G  2   N1 ? ? F A   73   I G  2    1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? 
? 
hydrog154 hydrog ? ? K  A   73  N6  ? ? ? 1_555 UA G  2   O6 ? ? F A   73   I G  2    1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? 
? 
hydrog155 hydrog ? ? K  U   74  N3  ? ? ? 1_555 UA A  1   N1 ? ? F U   74   I A  1    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog156 hydrog ? ? K  U   74  O4  ? ? ? 1_555 UA A  1   N6 ? ? F U   74   I A  1    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog157 hydrog ? ? K  U   85  O4  ? ? ? 1_555 T  C  13  N4 ? ? F U   85   H C  13   1_555 ? ? ? ? ? ? 'U-C MISPAIR'           ? 
? 
hydrog158 hydrog ? ? K  U   86  N3  ? ? ? 1_555 T  G  12  O6 ? ? F U   86   H G  12   1_555 ? ? ? ? ? ? TYPE_28_PAIR            ? 
? 
hydrog159 hydrog ? ? K  U   86  O2  ? ? ? 1_555 T  G  12  N1 ? ? F U   86   H G  12   1_555 ? ? ? ? ? ? TYPE_28_PAIR            ? 
? 
hydrog160 hydrog ? ? K  C   87  N3  ? ? ? 1_555 T  G  11  N1 ? ? F C   87   H G  11   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog161 hydrog ? ? K  C   87  N4  ? ? ? 1_555 T  G  11  O6 ? ? F C   87   H G  11   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog162 hydrog ? ? K  C   87  O2  ? ? ? 1_555 T  G  11  N2 ? ? F C   87   H G  11   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog163 hydrog ? ? K  G   88  N1  ? ? ? 1_555 T  C  10  N3 ? ? F G   88   H C  10   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog164 hydrog ? ? K  G   88  N2  ? ? ? 1_555 T  C  10  O2 ? ? F G   88   H C  10   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog165 hydrog ? ? K  G   88  O6  ? ? ? 1_555 T  C  10  N4 ? ? F G   88   H C  10   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog166 hydrog ? ? K  G   90  N1  ? ? ? 1_555 T  C  8   N3 ? ? F G   90   H C  8    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog167 hydrog ? ? K  G   90  N2  ? ? ? 1_555 T  C  8   O2 ? ? F G   90   H C  8    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog168 hydrog ? ? K  G   90  O6  ? ? ? 1_555 T  C  8   N4 ? ? F G   90   H C  8    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog169 hydrog ? ? K  A   91  N1  ? ? ? 1_555 T  U  7   N3 ? ? F A   91   H U  7    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog170 hydrog ? ? K  A   91  N6  ? ? ? 1_555 T  U  7   O4 ? ? F A   91   H U  7    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog171 hydrog ? ? K  A   92  N1  ? ? ? 1_555 T  U  6   N3 ? ? F A   92   H U  6    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog172 hydrog ? ? K  A   92  N6  ? ? ? 1_555 T  U  6   O4 ? ? F A   92   H U  6    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog173 hydrog ? ? K  G   93  N1  ? ? ? 1_555 T  C  5   N3 ? ? F G   93   H C  5    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog174 hydrog ? ? K  G   93  N2  ? ? ? 1_555 T  C  5   O2 ? ? F G   93   H C  5    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog175 hydrog ? ? K  G   93  O6  ? ? ? 1_555 T  C  5   N4 ? ? F G   93   H C  5    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog176 hydrog ? ? K  C   94  N3  ? ? ? 1_555 T  G  4   N1 ? ? F C   94   H G  4    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog177 hydrog ? ? K  C   94  N4  ? ? ? 1_555 T  G  4   O6 ? ? F C   94   H G  4    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog178 hydrog ? ? K  C   94  O2  ? ? ? 1_555 T  G  4   N2 ? ? F C   94   H G  4    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog179 hydrog ? ? K  G   95  N1  ? ? ? 1_555 T  C  3   N3 ? ? F G   95   H C  3    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog180 hydrog ? ? K  G   95  N2  ? ? ? 1_555 T  C  3   O2 ? ? F G   95   H C  3    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog181 hydrog ? ? K  G   95  O6  ? ? ? 1_555 T  C  3   N4 ? ? F G   95   H C  3    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog182 hydrog ? ? S  U   192 N3  ? ? ? 1_555 T  U  46  O4 ? ? G U   131  H U  46   1_555 ? ? ? ? ? ? 'U-U MISPAIR'           ? 
? 
hydrog183 hydrog ? ? S  G   193 N1  ? ? ? 1_555 T  U  44  O4 ? ? G G   132  H U  44   1_555 ? ? ? ? ? ? TYPE_27_PAIR            ? 
? 
hydrog184 hydrog ? ? S  G   193 O6  ? ? ? 1_555 T  U  44  N3 ? ? G G   132  H U  44   1_555 ? ? ? ? ? ? TYPE_27_PAIR            ? 
? 
hydrog185 hydrog ? ? S  A   194 N1  ? ? ? 1_555 T  U  43  N3 ? ? G A   133  H U  43   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog186 hydrog ? ? S  A   194 N6  ? ? ? 1_555 T  U  43  O4 ? ? G A   133  H U  43   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog187 hydrog ? ? S  U   195 N3  ? ? ? 1_555 T  G  42  O6 ? ? G U   134  H G  42   1_555 ? ? ? ? ? ? TYPE_27_PAIR            ? 
? 
hydrog188 hydrog ? ? S  U   195 O4  ? ? ? 1_555 T  G  42  N1 ? ? G U   134  H G  42   1_555 ? ? ? ? ? ? TYPE_27_PAIR            ? 
? 
hydrog189 hydrog ? ? S  G   196 N1  ? ? ? 1_555 T  U  41  O4 ? ? G G   135  H U  41   1_555 ? ? ? ? ? ? TYPE_27_PAIR            ? 
? 
hydrog190 hydrog ? ? S  G   196 O6  ? ? ? 1_555 T  U  41  N3 ? ? G G   135  H U  41   1_555 ? ? ? ? ? ? TYPE_27_PAIR            ? 
? 
hydrog191 hydrog ? ? S  A   199 N1  ? ? ? 1_555 T  U  39  N3 ? ? G A   138  H U  39   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog192 hydrog ? ? S  A   199 N6  ? ? ? 1_555 T  U  39  O4 ? ? G A   138  H U  39   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog193 hydrog ? ? S  U   200 N3  ? ? ? 1_555 T  A  38  N1 ? ? G U   139  H A  38   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog194 hydrog ? ? S  U   200 O4  ? ? ? 1_555 T  A  38  N6 ? ? G U   139  H A  38   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog195 hydrog ? ? S  A   201 N1  ? ? ? 1_555 T  U  37  N3 ? ? G A   140  H U  37   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog196 hydrog ? ? S  A   201 N6  ? ? ? 1_555 T  U  37  O4 ? ? G A   140  H U  37   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog197 hydrog ? ? S  C   202 N3  ? ? ? 1_555 T  G  36  N1 ? ? G C   141  H G  36   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog198 hydrog ? ? S  C   202 N4  ? ? ? 1_555 T  G  36  O6 ? ? G C   141  H G  36   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog199 hydrog ? ? S  C   202 O2  ? ? ? 1_555 T  G  36  N2 ? ? G C   141  H G  36   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog200 hydrog ? ? S  U   203 N3  ? ? ? 1_555 T  A  35  N1 ? ? G U   142  H A  35   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog201 hydrog ? ? S  U   203 O4  ? ? ? 1_555 T  A  35  N6 ? ? G U   142  H A  35   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog202 hydrog ? ? S  U   206 O2  ? ? ? 1_555 T  G  33  N2 ? ? G U   145  H G  33   1_555 ? ? ? ? ? ? 'U-G MISPAIR'           ? 
? 
hydrog203 hydrog ? ? S  C   208 N3  ? ? ? 1_555 T  G  31  N1 ? ? G C   147  H G  31   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog204 hydrog ? ? S  C   208 N4  ? ? ? 1_555 T  G  31  O6 ? ? G C   147  H G  31   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog205 hydrog ? ? S  C   208 O2  ? ? ? 1_555 T  G  31  N2 ? ? G C   147  H G  31   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog206 hydrog ? ? S  C   208 N3  ? ? ? 1_555 T  U  32  N3 ? ? G C   147  H U  32   1_555 ? ? ? ? ? ? TYPE_18_PAIR            ? 
? 
hydrog207 hydrog ? ? S  C   208 N4  ? ? ? 1_555 T  U  32  O4 ? ? G C   147  H U  32   1_555 ? ? ? ? ? ? TYPE_18_PAIR            ? 
? 
hydrog208 hydrog ? ? T  A   48  N1  ? ? ? 1_555 T  U  65  N3 ? ? H A   48   H U  65   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog209 hydrog ? ? T  A   48  N6  ? ? ? 1_555 T  U  65  O4 ? ? H A   48   H U  65   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog210 hydrog ? ? T  U   49  N3  ? ? ? 1_555 T  A  64  N1 ? ? H U   49   H A  64   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog211 hydrog ? ? T  U   49  O4  ? ? ? 1_555 T  A  64  N6 ? ? H U   49   H A  64   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog212 hydrog ? ? T  C   50  N3  ? ? ? 1_555 T  G  63  N1 ? ? H C   50   H G  63   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog213 hydrog ? ? T  C   50  N4  ? ? ? 1_555 T  G  63  O6 ? ? H C   50   H G  63   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog214 hydrog ? ? T  C   50  O2  ? ? ? 1_555 T  G  63  N2 ? ? H C   50   H G  63   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog215 hydrog ? ? T  A   51  N1  ? ? ? 1_555 T  U  62  N3 ? ? H A   51   H U  62   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog216 hydrog ? ? T  A   51  N6  ? ? ? 1_555 T  U  62  O4 ? ? H A   51   H U  62   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog217 hydrog ? ? T  G   52  N1  ? ? ? 1_555 T  C  61  N3 ? ? H G   52   H C  61   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog218 hydrog ? ? T  G   52  N2  ? ? ? 1_555 T  C  61  O2 ? ? H G   52   H C  61   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog219 hydrog ? ? T  G   52  O6  ? ? ? 1_555 T  C  61  N4 ? ? H G   52   H C  61   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog220 hydrog ? ? T  U   54  O2  ? ? ? 1_555 T  A  59  N6 ? ? H U   54   H A  59   1_555 ? ? ? ? ? ? 'U-A PAIR'              ? 
? 
hydrog221 hydrog ? ? T  G   112 N1  ? ? ? 1_555 T  C  146 N3 ? ? H G   112  H C  144  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog222 hydrog ? ? T  G   112 N2  ? ? ? 1_555 T  C  146 O2 ? ? H G   112  H C  144  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog223 hydrog ? ? T  G   112 O6  ? ? ? 1_555 T  C  146 N4 ? ? H G   112  H C  144  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog224 hydrog ? ? T  G   113 N1  ? ? ? 1_555 T  A  145 N7 ? ? H G   113  H A  143  1_555 ? ? ? ? ? ? TYPE_9_PAIR             ? 
? 
hydrog225 hydrog ? ? T  G   113 O6  ? ? ? 1_555 T  A  145 N6 ? ? H G   113  H A  143  1_555 ? ? ? ? ? ? TYPE_9_PAIR             ? 
? 
hydrog226 hydrog ? ? T  A   114 N6  ? ? ? 1_555 T  C  144 N3 ? ? H A   114  H C  142  1_555 ? ? ? ? ? ? 'A-C MISPAIR'           ? 
? 
hydrog227 hydrog ? ? T  G   115 N1  ? ? ? 1_555 T  C  143 N3 ? ? H G   115  H C  141  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog228 hydrog ? ? T  G   115 N2  ? ? ? 1_555 T  C  143 O2 ? ? H G   115  H C  141  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog229 hydrog ? ? T  G   115 O6  ? ? ? 1_555 T  C  143 N4 ? ? H G   115  H C  141  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog230 hydrog ? ? T  G   147 N1  ? ? ? 1_555 T  C  184 N3 ? ? H G   147  H C  184  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog231 hydrog ? ? T  G   147 N2  ? ? ? 1_555 T  C  184 O2 ? ? H G   147  H C  184  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog232 hydrog ? ? T  G   147 O6  ? ? ? 1_555 T  C  184 N4 ? ? H G   147  H C  184  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog233 hydrog ? ? T  C   148 N3  ? ? ? 1_555 T  G  183 N1 ? ? H C   148  H G  183  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog234 hydrog ? ? T  C   148 N4  ? ? ? 1_555 T  G  183 O6 ? ? H C   148  H G  183  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog235 hydrog ? ? T  C   148 O2  ? ? ? 1_555 T  G  183 N2 ? ? H C   148  H G  183  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog236 hydrog ? ? T  A   149 N1  ? ? ? 1_555 T  U  182 N3 ? ? H A   149  H U  182  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog237 hydrog ? ? T  A   149 N6  ? ? ? 1_555 T  U  182 O4 ? ? H A   149  H U  182  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog238 hydrog ? ? T  U   150 N3  ? ? ? 1_555 T  G  181 O6 ? ? H U   150  H G  181  1_555 ? ? ? ? ? ? TYPE_28_PAIR            ? 
? 
hydrog239 hydrog ? ? T  U   150 O2  ? ? ? 1_555 T  G  181 N1 ? ? H U   150  H G  181  1_555 ? ? ? ? ? ? TYPE_28_PAIR            ? 
? 
hydrog240 hydrog ? ? T  C   151 N3  ? ? ? 1_555 T  G  180 N1 ? ? H C   151  H G  180  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog241 hydrog ? ? T  C   151 N4  ? ? ? 1_555 T  G  180 O6 ? ? H C   151  H G  180  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog242 hydrog ? ? T  C   151 O2  ? ? ? 1_555 T  G  180 N2 ? ? H C   151  H G  180  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog243 hydrog ? ? T  G   152 N1  ? ? ? 1_555 T  C  179 N3 ? ? H G   152  H C  179  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog244 hydrog ? ? T  G   152 N2  ? ? ? 1_555 T  C  179 O2 ? ? H G   152  H C  179  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog245 hydrog ? ? T  G   152 O6  ? ? ? 1_555 T  C  179 N4 ? ? H G   152  H C  179  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog246 hydrog ? ? T  A   153 N6  ? ? ? 1_555 T  A  177 N1 ? ? H A   153  H A  177  1_555 ? ? ? ? ? ? 'A-A MISPAIR'           ? 
? 
hydrog247 hydrog ? ? T  C   154 N3  ? ? ? 1_555 T  G  176 N2 ? ? H C   154  H G  176  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? 
? 
hydrog248 hydrog ? ? T  C   154 O2  ? ? ? 1_555 T  G  176 N1 ? ? H C   154  H G  176  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? 
? 
hydrog249 hydrog ? ? T  C   155 N3  ? ? ? 1_555 T  G  175 N1 ? ? H C   155  H G  175  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog250 hydrog ? ? T  C   155 N4  ? ? ? 1_555 T  G  175 O6 ? ? H C   155  H G  175  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog251 hydrog ? ? T  C   155 O2  ? ? ? 1_555 T  G  175 N2 ? ? H C   155  H G  175  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog252 hydrog ? ? T  U   156 N3  ? ? ? 1_555 T  A  174 N1 ? ? H U   156  H A  174  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog253 hydrog ? ? T  U   156 O4  ? ? ? 1_555 T  A  174 N6 ? ? H U   156  H A  174  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog254 hydrog ? ? T  G   157 N1  ? ? ? 1_555 T  C  173 N3 ? ? H G   157  H C  173  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog255 hydrog ? ? T  G   157 N2  ? ? ? 1_555 T  C  173 O2 ? ? H G   157  H C  173  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog256 hydrog ? ? T  G   157 O6  ? ? ? 1_555 T  C  173 N4 ? ? H G   157  H C  173  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog257 hydrog ? ? T  G   158 N1  ? ? ? 1_555 T  C  172 N3 ? ? H G   158  H C  172  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog258 hydrog ? ? T  G   158 N2  ? ? ? 1_555 T  C  172 O2 ? ? H G   158  H C  172  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog259 hydrog ? ? T  G   158 O6  ? ? ? 1_555 T  C  172 N4 ? ? H G   158  H C  172  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog260 hydrog ? ? T  U   159 N3  ? ? ? 1_555 T  U  171 O4 ? ? H U   159  H U  171  1_555 ? ? ? ? ? ? TYPE_16_PAIR            ? 
? 
hydrog261 hydrog ? ? T  U   159 O2  ? ? ? 1_555 T  U  171 N3 ? ? H U   159  H U  171  1_555 ? ? ? ? ? ? TYPE_16_PAIR            ? 
? 
hydrog262 hydrog ? ? UA U   21  N3  ? ? ? 1_555 UA A  51  N1 ? ? I U   21   I A  51   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog263 hydrog ? ? UA U   21  O4  ? ? ? 1_555 UA A  51  N6 ? ? I U   21   I A  51   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog264 hydrog ? ? UA C   22  N3  ? ? ? 1_555 UA G  50  N1 ? ? I C   22   I G  50   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog265 hydrog ? ? UA C   22  N4  ? ? ? 1_555 UA G  50  O6 ? ? I C   22   I G  50   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog266 hydrog ? ? UA C   22  O2  ? ? ? 1_555 UA G  50  N2 ? ? I C   22   I G  50   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog267 hydrog ? ? UA G   23  N1  ? ? ? 1_555 UA C  49  N3 ? ? I G   23   I C  49   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog268 hydrog ? ? UA G   23  N2  ? ? ? 1_555 UA C  49  O2 ? ? I G   23   I C  49   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog269 hydrog ? ? UA G   23  O6  ? ? ? 1_555 UA C  49  N4 ? ? I G   23   I C  49   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog270 hydrog ? ? UA U   24  N3  ? ? ? 1_555 UA G  48  O6 ? ? I U   24   I G  48   1_555 ? ? ? ? ? ? TYPE_28_PAIR            ? 
? 
hydrog271 hydrog ? ? UA U   24  O2  ? ? ? 1_555 UA G  48  N1 ? ? I U   24   I G  48   1_555 ? ? ? ? ? ? TYPE_28_PAIR            ? 
? 
hydrog272 hydrog ? ? UA G   26  N1  ? ? ? 1_555 UA C  47  N3 ? ? I G   26   I C  47   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog273 hydrog ? ? UA G   26  N2  ? ? ? 1_555 UA C  47  O2 ? ? I G   26   I C  47   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog274 hydrog ? ? UA G   26  O6  ? ? ? 1_555 UA C  47  N4 ? ? I G   26   I C  47   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog275 hydrog ? ? UA C   27  N3  ? ? ? 1_555 UA G  46  N1 ? ? I C   27   I G  46   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog276 hydrog ? ? UA C   27  N4  ? ? ? 1_555 UA G  46  O6 ? ? I C   27   I G  46   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog277 hydrog ? ? UA C   27  O2  ? ? ? 1_555 UA G  46  N2 ? ? I C   27   I G  46   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog278 hydrog ? ? UA C   28  N3  ? ? ? 1_555 UA G  45  N1 ? ? I C   28   I G  45   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog279 hydrog ? ? UA C   28  N4  ? ? ? 1_555 UA G  45  O6 ? ? I C   28   I G  45   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog280 hydrog ? ? UA C   28  O2  ? ? ? 1_555 UA G  45  N2 ? ? I C   28   I G  45   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog281 hydrog ? ? UA G   32  N2  ? ? ? 1_555 UA A  44  N7 ? ? I G   32   I A  44   1_555 ? ? ? ? ? ? TYPE_11_PAIR            ? 
? 
hydrog282 hydrog ? ? UA G   32  N3  ? ? ? 1_555 UA A  44  N6 ? ? I G   32   I A  44   1_555 ? ? ? ? ? ? TYPE_11_PAIR            ? 
? 
hydrog283 hydrog ? ? UA A   33  N6  ? ? ? 1_555 UA G  43  N3 ? ? I A   33   I G  43   1_555 ? ? ? ? ? ? TYPE_11_PAIR            ? 
? 
hydrog284 hydrog ? ? UA A   33  N7  ? ? ? 1_555 UA G  43  N2 ? ? I A   33   I G  43   1_555 ? ? ? ? ? ? TYPE_11_PAIR            ? 
? 
hydrog285 hydrog ? ? UA G   34  N1  ? ? ? 1_555 UA C  42  N3 ? ? I G   34   I C  42   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog286 hydrog ? ? UA G   34  N2  ? ? ? 1_555 UA C  42  O2 ? ? I G   34   I C  42   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog287 hydrog ? ? UA G   34  O6  ? ? ? 1_555 UA C  42  N4 ? ? I G   34   I C  42   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog288 hydrog ? ? UA G   35  N1  ? ? ? 1_555 UA C  41  N3 ? ? I G   35   I C  41   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog289 hydrog ? ? UA G   35  N2  ? ? ? 1_555 UA C  41  O2 ? ? I G   35   I C  41   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog290 hydrog ? ? UA G   35  O6  ? ? ? 1_555 UA C  41  N4 ? ? I G   35   I C  41   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog291 hydrog ? ? UA G   85  N2  ? ? ? 1_555 UA C  117 O2 ? ? I G   85   I C  117  1_555 ? ? ? ? ? ? 'G-C PAIR'              ? 
? 
hydrog292 hydrog ? ? UA C   86  N3  ? ? ? 1_555 UA G  116 N1 ? ? I C   86   I G  116  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog293 hydrog ? ? UA C   86  N4  ? ? ? 1_555 UA G  116 O6 ? ? I C   86   I G  116  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog294 hydrog ? ? UA C   86  O2  ? ? ? 1_555 UA G  116 N2 ? ? I C   86   I G  116  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog295 hydrog ? ? UA C   87  N3  ? ? ? 1_555 UA G  115 N1 ? ? I C   87   I G  115  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog296 hydrog ? ? UA C   87  N4  ? ? ? 1_555 UA G  115 O6 ? ? I C   87   I G  115  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog297 hydrog ? ? UA C   87  O2  ? ? ? 1_555 UA G  115 N2 ? ? I C   87   I G  115  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog298 hydrog ? ? UA G   88  N2  ? ? ? 1_555 UA C  113 O2 ? ? I G   88   I C  113  1_555 ? ? ? ? ? ? 'G-C PAIR'              ? 
? 
hydrog299 hydrog ? ? UA U   89  N3  ? ? ? 1_555 UA A  112 N1 ? ? I U   89   I A  112  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog300 hydrog ? ? UA U   89  O4  ? ? ? 1_555 UA A  112 N6 ? ? I U   89   I A  112  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog301 hydrog ? ? UA G   90  N1  ? ? ? 1_555 UA C  111 N3 ? ? I G   90   I C  111  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog302 hydrog ? ? UA G   90  N2  ? ? ? 1_555 UA C  111 O2 ? ? I G   90   I C  111  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog303 hydrog ? ? UA G   90  O6  ? ? ? 1_555 UA C  111 N4 ? ? I G   90   I C  111  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog304 hydrog ? ? UA A   91  N1  ? ? ? 1_555 UA G  110 N1 ? ? I A   91   I G  110  1_555 ? ? ? ? ? ? 'A-G MISPAIR'           ? 
? 
hydrog305 hydrog ? ? UA C   92  N3  ? ? ? 1_555 UA G  109 N1 ? ? I C   92   I G  109  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog306 hydrog ? ? UA C   92  N4  ? ? ? 1_555 UA G  109 O6 ? ? I C   92   I G  109  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog307 hydrog ? ? UA C   92  O2  ? ? ? 1_555 UA G  109 N2 ? ? I C   92   I G  109  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog308 hydrog ? ? UA G   93  N1  ? ? ? 1_555 UA C  108 N3 ? ? I G   93   I C  108  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog309 hydrog ? ? UA G   93  N2  ? ? ? 1_555 UA C  108 O2 ? ? I G   93   I C  108  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog310 hydrog ? ? UA G   93  O6  ? ? ? 1_555 UA C  108 N4 ? ? I G   93   I C  108  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog311 hydrog ? ? UA A   94  N1  ? ? ? 1_555 UA U  107 N3 ? ? I A   94   I U  107  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog312 hydrog ? ? UA A   94  N6  ? ? ? 1_555 UA U  107 O4 ? ? I A   94   I U  107  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog313 hydrog ? ? UA C   95  N3  ? ? ? 1_555 UA G  106 N1 ? ? I C   95   I G  106  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog314 hydrog ? ? UA C   95  N4  ? ? ? 1_555 UA G  106 O6 ? ? I C   95   I G  106  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog315 hydrog ? ? UA C   95  O2  ? ? ? 1_555 UA G  106 N2 ? ? I C   95   I G  106  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog316 hydrog ? ? UA U   96  N3  ? ? ? 1_555 UA A  105 N1 ? ? I U   96   I A  105  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog317 hydrog ? ? UA U   96  O4  ? ? ? 1_555 UA A  105 N6 ? ? I U   96   I A  105  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog318 hydrog ? ? UA C   127 N4  ? ? ? 1_555 UA G  144 O6 ? ? I C   127  I G  144  1_555 ? ? ? ? ? ? 'C-G PAIR'              ? 
? 
hydrog319 hydrog ? ? UA A   128 N1  ? ? ? 1_555 UA U  143 N3 ? ? I A   128  I U  143  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog320 hydrog ? ? UA A   128 N6  ? ? ? 1_555 UA U  143 O4 ? ? I A   128  I U  143  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog321 hydrog ? ? UA G   129 N1  ? ? ? 1_555 UA C  142 N3 ? ? I G   129  I C  142  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog322 hydrog ? ? UA G   129 N2  ? ? ? 1_555 UA C  142 O2 ? ? I G   129  I C  142  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog323 hydrog ? ? UA G   129 O6  ? ? ? 1_555 UA C  142 N4 ? ? I G   129  I C  142  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog324 hydrog ? ? UA U   130 N3  ? ? ? 1_555 UA A  141 N1 ? ? I U   130  I A  141  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog325 hydrog ? ? UA U   130 O4  ? ? ? 1_555 UA A  141 N6 ? ? I U   130  I A  141  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog326 hydrog ? ? UA C   131 N3  ? ? ? 1_555 UA G  140 N1 ? ? I C   131  I G  140  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog327 hydrog ? ? UA C   131 N4  ? ? ? 1_555 UA G  140 O6 ? ? I C   131  I G  140  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog328 hydrog ? ? UA C   131 O2  ? ? ? 1_555 UA G  140 N2 ? ? I C   131  I G  140  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog329 hydrog ? ? UA U   132 N3  ? ? ? 1_555 UA A  139 N1 ? ? I U   132  I A  139  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog330 hydrog ? ? UA U   132 O4  ? ? ? 1_555 UA A  139 N6 ? ? I U   132  I A  139  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog331 hydrog ? ? UA C   133 N3  ? ? ? 1_555 UA G  138 N1 ? ? I C   133  I G  138  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog332 hydrog ? ? UA C   133 N4  ? ? ? 1_555 UA G  138 O6 ? ? I C   133  I G  138  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog333 hydrog ? ? UA C   133 O2  ? ? ? 1_555 UA G  138 N2 ? ? I C   133  I G  138  1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 8  ? 
AA2 ? 6  ? 
AA3 ? 2  ? 
AA4 ? 2  ? 
AA5 ? 3  ? 
AA6 ? 4  ? 
AA7 ? 7  ? 
AA8 ? 6  ? 
AA9 ? 2  ? 
AB1 ? 2  ? 
AB2 ? 3  ? 
AB3 ? 4  ? 
AB4 ? 4  ? 
AB5 ? 4  ? 
AB6 ? 4  ? 
AB7 ? 4  ? 
AB8 ? 4  ? 
AB9 ? 4  ? 
AC1 ? 4  ? 
AC2 ? 37 ? 
AC3 ? 20 ? 
AC4 ? 8  ? 
AC5 ? 8  ? 
AC6 ? 3  ? 
AC7 ? 3  ? 
AC8 ? 5  ? 
AC9 ? 8  ? 
AD1 ? 2  ? 
AD2 ? 4  ? 
AD3 ? 2  ? 
AD4 ? 36 ? 
AD5 ? 2  ? 
AD6 ? 3  ? 
AD7 ? 2  ? 
AD8 ? 2  ? 
AD9 ? 5  ? 
AE1 ? 2  ? 
AE2 ? 5  ? 
AE3 ? 4  ? 
AE4 ? 4  ? 
AE5 ? 4  ? 
AE6 ? 4  ? 
AE7 ? 4  ? 
AE8 ? 5  ? 
AE9 ? 4  ? 
AF1 ? 4  ? 
AF2 ? 8  ? 
AF3 ? 4  ? 
AF4 ? 4  ? 
AF5 ? 3  ? 
AF6 ? 3  ? 
AF7 ? 4  ? 
AF8 ? 4  ? 
AF9 ? 4  ? 
AG1 ? 4  ? 
AG2 ? 4  ? 
AG3 ? 4  ? 
AG4 ? 5  ? 
AG5 ? 2  ? 
AG6 ? 2  ? 
AG7 ? 2  ? 
AG8 ? 2  ? 
AG9 ? 3  ? 
AH1 ? 5  ? 
AH2 ? 2  ? 
AH3 ? 4  ? 
AH4 ? 4  ? 
AH5 ? 4  ? 
AH6 ? 4  ? 
AH7 ? 4  ? 
AH8 ? 4  ? 
AH9 ? 3  ? 
AI1 ? 4  ? 
AI2 ? 4  ? 
AI3 ? 2  ? 
AI4 ? 5  ? 
AI5 ? 2  ? 
AI6 ? 3  ? 
AI7 ? 5  ? 
AI8 ? 7  ? 
AI9 ? 8  ? 
AJ1 ? 35 ? 
AJ2 ? 8  ? 
AJ3 ? 6  ? 
AJ4 ? 3  ? 
AJ5 ? 2  ? 
AJ6 ? 2  ? 
AJ7 ? 2  ? 
AJ8 ? 4  ? 
AJ9 ? 2  ? 
AK1 ? 2  ? 
AK2 ? 3  ? 
AK3 ? 2  ? 
AK4 ? 6  ? 
AK5 ? 5  ? 
AK6 ? 6  ? 
AK7 ? 8  ? 
AK8 ? 8  ? 
AK9 ? 2  ? 
AL1 ? 7  ? 
AL2 ? 8  ? 
AL3 ? 2  ? 
AL4 ? 4  ? 
AL5 ? 4  ? 
AL6 ? 4  ? 
AL7 ? 4  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? anti-parallel 
AA1 3  4  ? parallel      
AA1 4  5  ? parallel      
AA1 5  6  ? parallel      
AA1 6  7  ? parallel      
AA1 7  8  ? parallel      
AA2 1  2  ? parallel      
AA2 2  3  ? parallel      
AA2 3  4  ? parallel      
AA2 4  5  ? parallel      
AA2 5  6  ? parallel      
AA3 1  2  ? anti-parallel 
AA4 1  2  ? anti-parallel 
AA5 1  2  ? anti-parallel 
AA5 2  3  ? anti-parallel 
AA6 1  2  ? anti-parallel 
AA6 2  3  ? anti-parallel 
AA6 3  4  ? anti-parallel 
AA7 1  2  ? parallel      
AA7 2  3  ? parallel      
AA7 3  4  ? parallel      
AA7 4  5  ? parallel      
AA7 5  6  ? parallel      
AA7 6  7  ? parallel      
AA8 1  2  ? parallel      
AA8 2  3  ? parallel      
AA8 3  4  ? parallel      
AA8 4  5  ? parallel      
AA8 5  6  ? parallel      
AA9 1  2  ? anti-parallel 
AB1 1  2  ? anti-parallel 
AB2 1  2  ? anti-parallel 
AB2 2  3  ? anti-parallel 
AB3 1  2  ? anti-parallel 
AB3 2  3  ? anti-parallel 
AB3 3  4  ? anti-parallel 
AB4 1  2  ? anti-parallel 
AB4 2  3  ? anti-parallel 
AB4 3  4  ? anti-parallel 
AB5 1  2  ? anti-parallel 
AB5 2  3  ? anti-parallel 
AB5 3  4  ? anti-parallel 
AB6 1  2  ? anti-parallel 
AB6 2  3  ? anti-parallel 
AB6 3  4  ? anti-parallel 
AB7 1  2  ? anti-parallel 
AB7 2  3  ? anti-parallel 
AB7 3  4  ? anti-parallel 
AB8 1  2  ? anti-parallel 
AB8 2  3  ? anti-parallel 
AB8 3  4  ? anti-parallel 
AB9 1  2  ? anti-parallel 
AB9 2  3  ? anti-parallel 
AB9 3  4  ? anti-parallel 
AC1 1  2  ? anti-parallel 
AC1 2  3  ? anti-parallel 
AC1 3  4  ? anti-parallel 
AC2 1  2  ? anti-parallel 
AC2 2  3  ? anti-parallel 
AC2 3  4  ? anti-parallel 
AC2 4  5  ? anti-parallel 
AC2 5  6  ? anti-parallel 
AC2 6  7  ? anti-parallel 
AC2 7  8  ? anti-parallel 
AC2 8  9  ? anti-parallel 
AC2 9  10 ? anti-parallel 
AC2 10 11 ? anti-parallel 
AC2 11 12 ? anti-parallel 
AC2 12 13 ? anti-parallel 
AC2 13 14 ? anti-parallel 
AC2 14 15 ? anti-parallel 
AC2 15 16 ? anti-parallel 
AC2 16 17 ? anti-parallel 
AC2 17 18 ? anti-parallel 
AC2 18 19 ? anti-parallel 
AC2 19 20 ? anti-parallel 
AC2 20 21 ? anti-parallel 
AC2 21 22 ? anti-parallel 
AC2 22 23 ? anti-parallel 
AC2 23 24 ? anti-parallel 
AC2 24 25 ? anti-parallel 
AC2 25 26 ? anti-parallel 
AC2 26 27 ? anti-parallel 
AC2 27 28 ? anti-parallel 
AC2 28 29 ? anti-parallel 
AC2 29 30 ? anti-parallel 
AC2 30 31 ? anti-parallel 
AC2 31 32 ? anti-parallel 
AC2 32 33 ? anti-parallel 
AC2 33 34 ? anti-parallel 
AC2 34 35 ? anti-parallel 
AC2 35 36 ? anti-parallel 
AC2 36 37 ? anti-parallel 
AC3 1  2  ? anti-parallel 
AC3 2  3  ? anti-parallel 
AC3 3  4  ? anti-parallel 
AC3 4  5  ? anti-parallel 
AC3 5  6  ? anti-parallel 
AC3 6  7  ? anti-parallel 
AC3 7  8  ? anti-parallel 
AC3 8  9  ? anti-parallel 
AC3 9  10 ? anti-parallel 
AC3 10 11 ? anti-parallel 
AC3 11 12 ? anti-parallel 
AC3 12 13 ? anti-parallel 
AC3 13 14 ? anti-parallel 
AC3 14 15 ? anti-parallel 
AC3 15 16 ? anti-parallel 
AC3 16 17 ? anti-parallel 
AC3 17 18 ? anti-parallel 
AC3 18 19 ? anti-parallel 
AC3 19 20 ? anti-parallel 
AC4 1  2  ? anti-parallel 
AC4 2  3  ? anti-parallel 
AC4 3  4  ? anti-parallel 
AC4 4  5  ? anti-parallel 
AC4 5  6  ? anti-parallel 
AC4 6  7  ? anti-parallel 
AC4 7  8  ? anti-parallel 
AC5 1  2  ? anti-parallel 
AC5 2  3  ? anti-parallel 
AC5 3  4  ? anti-parallel 
AC5 4  5  ? anti-parallel 
AC5 5  6  ? anti-parallel 
AC5 6  7  ? anti-parallel 
AC5 7  8  ? anti-parallel 
AC6 1  2  ? anti-parallel 
AC6 2  3  ? anti-parallel 
AC7 1  2  ? anti-parallel 
AC7 2  3  ? anti-parallel 
AC8 1  2  ? anti-parallel 
AC8 2  3  ? anti-parallel 
AC8 3  4  ? anti-parallel 
AC8 4  5  ? anti-parallel 
AC9 1  2  ? anti-parallel 
AC9 2  3  ? parallel      
AC9 3  4  ? parallel      
AC9 4  5  ? parallel      
AC9 5  6  ? parallel      
AC9 6  7  ? parallel      
AC9 7  8  ? anti-parallel 
AD1 1  2  ? parallel      
AD2 1  2  ? anti-parallel 
AD2 2  3  ? anti-parallel 
AD2 3  4  ? anti-parallel 
AD3 1  2  ? anti-parallel 
AD4 1  2  ? anti-parallel 
AD4 2  3  ? anti-parallel 
AD4 3  4  ? anti-parallel 
AD4 4  5  ? anti-parallel 
AD4 5  6  ? anti-parallel 
AD4 6  7  ? anti-parallel 
AD4 7  8  ? anti-parallel 
AD4 8  9  ? anti-parallel 
AD4 9  10 ? anti-parallel 
AD4 10 11 ? anti-parallel 
AD4 11 12 ? anti-parallel 
AD4 12 13 ? anti-parallel 
AD4 13 14 ? anti-parallel 
AD4 14 15 ? anti-parallel 
AD4 15 16 ? anti-parallel 
AD4 16 17 ? anti-parallel 
AD4 17 18 ? anti-parallel 
AD4 18 19 ? anti-parallel 
AD4 19 20 ? anti-parallel 
AD4 20 21 ? anti-parallel 
AD4 21 22 ? anti-parallel 
AD4 22 23 ? anti-parallel 
AD4 23 24 ? anti-parallel 
AD4 24 25 ? anti-parallel 
AD4 25 26 ? anti-parallel 
AD4 26 27 ? anti-parallel 
AD4 27 28 ? anti-parallel 
AD4 28 29 ? anti-parallel 
AD4 29 30 ? anti-parallel 
AD4 30 31 ? anti-parallel 
AD4 31 32 ? anti-parallel 
AD4 32 33 ? anti-parallel 
AD4 33 34 ? anti-parallel 
AD4 34 35 ? anti-parallel 
AD4 35 36 ? anti-parallel 
AD5 1  2  ? anti-parallel 
AD6 1  2  ? anti-parallel 
AD6 2  3  ? anti-parallel 
AD7 1  2  ? anti-parallel 
AD8 1  2  ? anti-parallel 
AD9 1  2  ? anti-parallel 
AD9 2  3  ? anti-parallel 
AD9 3  4  ? anti-parallel 
AD9 4  5  ? anti-parallel 
AE1 1  2  ? anti-parallel 
AE2 1  2  ? anti-parallel 
AE2 2  3  ? anti-parallel 
AE2 3  4  ? anti-parallel 
AE2 4  5  ? parallel      
AE3 1  2  ? anti-parallel 
AE3 2  3  ? anti-parallel 
AE3 3  4  ? anti-parallel 
AE4 1  2  ? anti-parallel 
AE4 2  3  ? anti-parallel 
AE4 3  4  ? anti-parallel 
AE5 1  2  ? anti-parallel 
AE5 2  3  ? anti-parallel 
AE5 3  4  ? anti-parallel 
AE6 1  2  ? anti-parallel 
AE6 2  3  ? anti-parallel 
AE6 3  4  ? anti-parallel 
AE7 1  2  ? anti-parallel 
AE7 2  3  ? anti-parallel 
AE7 3  4  ? anti-parallel 
AE8 1  2  ? anti-parallel 
AE8 2  3  ? anti-parallel 
AE8 3  4  ? anti-parallel 
AE8 4  5  ? anti-parallel 
AE9 1  2  ? anti-parallel 
AE9 2  3  ? anti-parallel 
AE9 3  4  ? anti-parallel 
AF1 1  2  ? anti-parallel 
AF1 2  3  ? anti-parallel 
AF1 3  4  ? anti-parallel 
AF2 1  2  ? anti-parallel 
AF2 2  3  ? anti-parallel 
AF2 3  4  ? anti-parallel 
AF2 4  5  ? parallel      
AF2 5  6  ? anti-parallel 
AF2 6  7  ? anti-parallel 
AF2 7  8  ? anti-parallel 
AF3 1  2  ? anti-parallel 
AF3 2  3  ? anti-parallel 
AF3 3  4  ? anti-parallel 
AF4 1  2  ? anti-parallel 
AF4 2  3  ? anti-parallel 
AF4 3  4  ? anti-parallel 
AF5 1  2  ? anti-parallel 
AF5 2  3  ? anti-parallel 
AF6 1  2  ? anti-parallel 
AF6 2  3  ? anti-parallel 
AF7 1  2  ? anti-parallel 
AF7 2  3  ? anti-parallel 
AF7 3  4  ? anti-parallel 
AF8 1  2  ? anti-parallel 
AF8 2  3  ? anti-parallel 
AF8 3  4  ? anti-parallel 
AF9 1  2  ? anti-parallel 
AF9 2  3  ? anti-parallel 
AF9 3  4  ? anti-parallel 
AG1 1  2  ? anti-parallel 
AG1 2  3  ? anti-parallel 
AG1 3  4  ? anti-parallel 
AG2 1  2  ? anti-parallel 
AG2 2  3  ? anti-parallel 
AG2 3  4  ? anti-parallel 
AG3 1  2  ? anti-parallel 
AG3 2  3  ? anti-parallel 
AG3 3  4  ? anti-parallel 
AG4 1  2  ? anti-parallel 
AG4 2  3  ? anti-parallel 
AG4 3  4  ? anti-parallel 
AG4 4  5  ? anti-parallel 
AG5 1  2  ? anti-parallel 
AG6 1  2  ? anti-parallel 
AG7 1  2  ? anti-parallel 
AG8 1  2  ? anti-parallel 
AG9 1  2  ? anti-parallel 
AG9 2  3  ? anti-parallel 
AH1 1  2  ? anti-parallel 
AH1 2  3  ? anti-parallel 
AH1 3  4  ? anti-parallel 
AH1 4  5  ? parallel      
AH2 1  2  ? anti-parallel 
AH3 1  2  ? anti-parallel 
AH3 2  3  ? anti-parallel 
AH3 3  4  ? anti-parallel 
AH4 1  2  ? anti-parallel 
AH4 2  3  ? anti-parallel 
AH4 3  4  ? anti-parallel 
AH5 1  2  ? anti-parallel 
AH5 2  3  ? anti-parallel 
AH5 3  4  ? anti-parallel 
AH6 1  2  ? anti-parallel 
AH6 2  3  ? anti-parallel 
AH6 3  4  ? anti-parallel 
AH7 1  2  ? anti-parallel 
AH7 2  3  ? anti-parallel 
AH7 3  4  ? anti-parallel 
AH8 1  2  ? anti-parallel 
AH8 2  3  ? anti-parallel 
AH8 3  4  ? anti-parallel 
AH9 1  2  ? anti-parallel 
AH9 2  3  ? anti-parallel 
AI1 1  2  ? anti-parallel 
AI1 2  3  ? anti-parallel 
AI1 3  4  ? parallel      
AI2 1  2  ? parallel      
AI2 2  3  ? anti-parallel 
AI2 3  4  ? anti-parallel 
AI3 1  2  ? parallel      
AI4 1  2  ? anti-parallel 
AI4 2  3  ? anti-parallel 
AI4 3  4  ? anti-parallel 
AI4 4  5  ? anti-parallel 
AI5 1  2  ? anti-parallel 
AI6 1  2  ? anti-parallel 
AI6 2  3  ? anti-parallel 
AI7 1  2  ? parallel      
AI7 2  3  ? anti-parallel 
AI7 3  4  ? anti-parallel 
AI7 4  5  ? anti-parallel 
AI8 1  2  ? parallel      
AI8 2  3  ? anti-parallel 
AI8 3  4  ? anti-parallel 
AI8 4  5  ? anti-parallel 
AI8 5  6  ? anti-parallel 
AI8 6  7  ? anti-parallel 
AI9 1  2  ? anti-parallel 
AI9 2  3  ? anti-parallel 
AI9 3  4  ? anti-parallel 
AI9 4  5  ? anti-parallel 
AI9 5  6  ? anti-parallel 
AI9 6  7  ? anti-parallel 
AI9 7  8  ? anti-parallel 
AJ1 1  2  ? anti-parallel 
AJ1 2  3  ? anti-parallel 
AJ1 3  4  ? anti-parallel 
AJ1 4  5  ? anti-parallel 
AJ1 5  6  ? anti-parallel 
AJ1 6  7  ? anti-parallel 
AJ1 7  8  ? anti-parallel 
AJ1 8  9  ? anti-parallel 
AJ1 9  10 ? anti-parallel 
AJ1 10 11 ? anti-parallel 
AJ1 11 12 ? anti-parallel 
AJ1 12 13 ? anti-parallel 
AJ1 13 14 ? anti-parallel 
AJ1 14 15 ? anti-parallel 
AJ1 15 16 ? anti-parallel 
AJ1 16 17 ? anti-parallel 
AJ1 17 18 ? anti-parallel 
AJ1 18 19 ? anti-parallel 
AJ1 19 20 ? anti-parallel 
AJ1 20 21 ? anti-parallel 
AJ1 21 22 ? anti-parallel 
AJ1 22 23 ? anti-parallel 
AJ1 23 24 ? anti-parallel 
AJ1 24 25 ? anti-parallel 
AJ1 25 26 ? anti-parallel 
AJ1 26 27 ? anti-parallel 
AJ1 27 28 ? anti-parallel 
AJ1 28 29 ? anti-parallel 
AJ1 29 30 ? anti-parallel 
AJ1 30 31 ? anti-parallel 
AJ1 31 32 ? anti-parallel 
AJ1 32 33 ? anti-parallel 
AJ1 33 34 ? anti-parallel 
AJ1 34 35 ? anti-parallel 
AJ2 1  2  ? anti-parallel 
AJ2 2  3  ? parallel      
AJ2 3  4  ? parallel      
AJ2 4  5  ? parallel      
AJ2 5  6  ? parallel      
AJ2 6  7  ? parallel      
AJ2 7  8  ? parallel      
AJ3 1  2  ? parallel      
AJ3 2  3  ? parallel      
AJ3 3  4  ? parallel      
AJ3 4  5  ? parallel      
AJ3 5  6  ? parallel      
AJ4 1  2  ? anti-parallel 
AJ4 2  3  ? anti-parallel 
AJ5 1  2  ? anti-parallel 
AJ6 1  2  ? anti-parallel 
AJ7 1  2  ? anti-parallel 
AJ8 1  2  ? anti-parallel 
AJ8 2  3  ? anti-parallel 
AJ8 3  4  ? anti-parallel 
AJ9 1  2  ? anti-parallel 
AK1 1  2  ? anti-parallel 
AK2 1  2  ? anti-parallel 
AK2 2  3  ? anti-parallel 
AK3 1  2  ? anti-parallel 
AK4 1  2  ? anti-parallel 
AK4 2  3  ? anti-parallel 
AK4 3  4  ? parallel      
AK4 4  5  ? anti-parallel 
AK4 5  6  ? anti-parallel 
AK5 1  2  ? anti-parallel 
AK5 2  3  ? anti-parallel 
AK5 3  4  ? parallel      
AK5 4  5  ? parallel      
AK6 1  2  ? parallel      
AK6 2  3  ? parallel      
AK6 3  4  ? anti-parallel 
AK6 4  5  ? anti-parallel 
AK6 5  6  ? anti-parallel 
AK7 1  2  ? parallel      
AK7 2  3  ? anti-parallel 
AK7 3  4  ? parallel      
AK7 4  5  ? anti-parallel 
AK7 5  6  ? anti-parallel 
AK7 6  7  ? parallel      
AK7 7  8  ? parallel      
AK8 1  2  ? anti-parallel 
AK8 2  3  ? anti-parallel 
AK8 3  4  ? parallel      
AK8 4  5  ? anti-parallel 
AK8 5  6  ? anti-parallel 
AK8 6  7  ? parallel      
AK8 7  8  ? anti-parallel 
AK9 1  2  ? anti-parallel 
AL1 1  2  ? anti-parallel 
AL1 2  3  ? parallel      
AL1 3  4  ? parallel      
AL1 4  5  ? parallel      
AL1 5  6  ? parallel      
AL1 6  7  ? anti-parallel 
AL2 1  2  ? anti-parallel 
AL2 2  3  ? anti-parallel 
AL2 3  4  ? anti-parallel 
AL2 4  5  ? anti-parallel 
AL2 5  6  ? anti-parallel 
AL2 6  7  ? anti-parallel 
AL2 7  8  ? anti-parallel 
AL3 1  2  ? anti-parallel 
AL4 1  2  ? anti-parallel 
AL4 2  3  ? anti-parallel 
AL4 3  4  ? anti-parallel 
AL5 1  2  ? anti-parallel 
AL5 2  3  ? anti-parallel 
AL5 3  4  ? anti-parallel 
AL6 1  2  ? anti-parallel 
AL6 2  3  ? parallel      
AL6 3  4  ? anti-parallel 
AL7 1  2  ? anti-parallel 
AL7 2  3  ? anti-parallel 
AL7 3  4  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  PHE B  435  ? GLN B  438  ? PHE D 435  GLN D 438  
AA1 2  TYR B  442  ? VAL B  447  ? TYR D 442  VAL D 447  
AA1 3  LEU B  685  ? ILE B  692  ? LEU D 685  ILE D 692  
AA1 4  GLY B  865  ? SER B  872  ? GLY D 865  SER D 872  
AA1 5  THR B  825  ? LYS B  829  ? THR D 825  LYS D 829  
AA1 6  VAL B  721  ? PHE B  724  ? VAL D 721  PHE D 724  
AA1 7  VAL B  808  ? SER B  811  ? VAL D 808  SER D 811  
AA1 8  PHE B  782  ? ILE B  784  ? PHE D 782  ILE D 784  
AA2 1  ILE B  586  ? CYS B  588  ? ILE D 586  CYS D 588  
AA2 2  LYS B  537  ? ILE B  541  ? LYS D 537  ILE D 541  
AA2 3  VAL B  609  ? LEU B  614  ? VAL D 609  LEU D 614  
AA2 4  ARG B  647  ? SER B  652  ? ARG D 647  SER D 652  
AA2 5  LEU B  499  ? CYS B  502  ? LEU D 499  CYS D 502  
AA2 6  LEU B  673  ? TYR B  675  ? LEU D 673  TYR D 675  
AA3 1  GLN B  832  ? SER B  835  ? GLN D 832  SER D 835  
AA3 2  ARG B  840  ? GLU B  843  ? ARG D 840  GLU D 843  
AA4 1  VAL B  970  ? TYR B  972  ? VAL D 970  TYR D 972  
AA4 2  PHE B  979  ? VAL B  981  ? PHE D 979  VAL D 981  
AA5 1  LEU B  1184 ? THR B  1194 ? LEU D 1184 THR D 1194 
AA5 2  THR B  1197 ? PRO B  1206 ? THR D 1197 PRO D 1206 
AA5 3  HIS B  1250 ? PRO B  1257 ? HIS D 1250 PRO D 1257 
AA6 1  ILE B  1233 ? LYS B  1242 ? ILE D 1233 LYS D 1242 
AA6 2  SER B  1218 ? GLU B  1226 ? SER D 1218 GLU D 1226 
AA6 3  GLN B  1265 ? SER B  1272 ? GLN D 1265 SER D 1272 
AA6 4  GLU B  1279 ? SER B  1285 ? GLU D 1279 SER D 1285 
AA7 1  VAL B  1405 ? LEU B  1407 ? VAL D 1405 LEU D 1407 
AA7 2  ILE B  1424 ? SER B  1427 ? ILE D 1424 SER D 1427 
AA7 3  CYS B  1376 ? ILE B  1379 ? CYS D 1376 ILE D 1379 
AA7 4  LEU B  1450 ? ASP B  1454 ? LEU D 1450 ASP D 1454 
AA7 5  ARG B  1486 ? SER B  1491 ? ARG D 1486 SER D 1491 
AA7 6  VAL B  1346 ? GLY B  1349 ? VAL D 1346 GLY D 1349 
AA7 7  THR B  1511 ? ASN B  1513 ? THR D 1511 ASN D 1513 
AA8 1  LEU B  1523 ? PHE B  1530 ? LEU D 1523 PHE D 1530 
AA8 2  GLY B  1700 ? GLN B  1707 ? GLY D 1700 GLN D 1707 
AA8 3  LEU B  1660 ? MET B  1664 ? LEU D 1660 MET D 1664 
AA8 4  VAL B  1559 ? VAL B  1563 ? VAL D 1559 VAL D 1563 
AA8 5  VAL B  1643 ? SER B  1647 ? VAL D 1643 SER D 1647 
AA8 6  TYR B  1619 ? LEU B  1620 ? TYR D 1619 LEU D 1620 
AA9 1  GLN B  1667 ? ASN B  1670 ? GLN D 1667 ASN D 1670 
AA9 2  ALA B  1675 ? ASP B  1678 ? ALA D 1675 ASP D 1678 
AB1 1  ILE B  1802 ? GLU B  1805 ? ILE D 1802 GLU D 1805 
AB1 2  ASP B  1809 ? PRO B  1812 ? ASP D 1809 PRO D 1812 
AB2 1  ILE B  2017 ? VAL B  2023 ? ILE D 2017 VAL D 2023 
AB2 2  PRO B  2034 ? ARG B  2043 ? PRO D 2034 ARG D 2043 
AB2 3  LYS B  2087 ? VAL B  2095 ? LYS D 2087 VAL D 2095 
AB3 1  SER B  2075 ? LEU B  2082 ? SER D 2075 LEU D 2082 
AB3 2  TRP B  2064 ? ASP B  2070 ? TRP D 2064 ASP D 2070 
AB3 3  HIS B  2102 ? SER B  2110 ? HIS D 2102 SER D 2110 
AB3 4  GLN B  2118 ? VAL B  2124 ? GLN D 2118 VAL D 2124 
AB4 1  LEU C  61   ? SER C  63   ? LEU E 61   SER E 63   
AB4 2  ARG C  350  ? GLU C  355  ? ARG E 350  GLU E 355  
AB4 3  ILE C  341  ? SER C  346  ? ILE E 341  SER E 346  
AB4 4  ILE C  330  ? PHE C  335  ? ILE E 330  PHE E 335  
AB5 1  VAL C  69   ? PHE C  74   ? VAL E 69   PHE E 74   
AB5 2  THR C  80   ? GLY C  85   ? THR E 80   GLY E 85   
AB5 3  ILE C  90   ? ASN C  94   ? ILE E 90   ASN E 94   
AB5 4  ASN C  101  ? LEU C  105  ? ASN E 101  LEU E 105  
AB6 1  VAL C  112  ? TYR C  117  ? VAL E 112  TYR E 117  
AB6 2  MET C  123  ? SER C  128  ? MET E 123  SER E 128  
AB6 3  THR C  132  ? ASP C  137  ? THR E 132  ASP E 137  
AB6 4  ARG C  143  ? LYS C  148  ? ARG E 143  LYS E 148  
AB7 1  VAL C  154  ? PRO C  159  ? VAL E 154  PRO E 159  
AB7 2  VAL C  167  ? SER C  171  ? VAL E 167  SER E 171  
AB7 3  THR C  175  ? TRP C  179  ? THR E 175  TRP E 179  
AB7 4  ALA C  186  ? GLN C  191  ? ALA E 186  GLN E 191  
AB8 1  VAL C  196  ? PHE C  201  ? VAL E 196  PHE E 201  
AB8 2  GLN C  207  ? GLY C  212  ? GLN E 207  GLY E 212  
AB8 3  ILE C  217  ? ASP C  221  ? ILE E 217  ASP E 221  
AB8 4  LEU C  227  ? MET C  231  ? LEU E 227  MET E 231  
AB9 1  VAL C  238  ? LEU C  243  ? VAL E 238  LEU E 243  
AB9 2  TYR C  249  ? ALA C  254  ? TYR E 249  ALA E 254  
AB9 3  VAL C  259  ? ASP C  263  ? VAL E 259  ASP E 263  
AB9 4  LYS C  275  ? PHE C  277  ? LYS E 275  PHE E 277  
AC1 1  CYS C  291  ? TRP C  293  ? CYS E 291  TRP E 293  
AC1 2  LYS C  299  ? ALA C  302  ? LYS E 299  ALA E 302  
AC1 3  VAL C  309  ? ASP C  313  ? VAL E 309  ASP E 313  
AC1 4  ILE C  319  ? LEU C  323  ? ILE E 319  LEU E 323  
AC2 1  ALA E  54   ? HIS E  58   ? ALA b 54   HIS b 58   
AC2 2  GLN E  43   ? ILE E  51   ? GLN b 43   ILE b 51   
AC2 3  GLU E  61   ? ILE E  64   ? GLU b 61   ILE b 64   
AC2 4  VAL D  106  ? LEU D  110  ? VAL a 106  LEU a 110  
AC2 5  VAL D  42   ? CYS D  46   ? VAL a 42   CYS a 46   
AC2 6  LYS D  51   ? PHE D  59   ? LYS a 51   PHE a 59   
AC2 7  MET D  65   ? MET D  73   ? MET a 65   MET a 73   
AC2 8  ASP D  93   ? LEU D  101  ? ASP a 93   LEU a 101  
AC2 9  ILE J  65   ? ILE J  69   ? ILE g 65   ILE g 69   
AC2 10 VAL J  15   ? LEU J  19   ? VAL g 15   LEU g 19   
AC2 11 GLN J  24   ? VAL J  32   ? GLN g 24   VAL g 32   
AC2 12 THR J  38   ? THR J  46   ? THR g 38   THR g 46   
AC2 13 PRO J  52   ? ILE J  60   ? PRO g 52   ILE g 60   
AC2 14 LEU I  77   ? VAL I  82   ? LEU f 77   VAL f 82   
AC2 15 TYR I  15   ? LEU I  21   ? TYR f 15   LEU f 21   
AC2 16 ILE I  26   ? ALA I  33   ? ILE f 26   ALA f 33   
AC2 17 LEU I  40   ? GLU I  47   ? LEU f 40   GLU f 47   
AC2 18 VAL I  66   ? LEU I  72   ? VAL f 66   LEU f 72   
AC2 19 ILE H  68   ? ILE H  72   ? ILE e 68   ILE e 72   
AC2 20 ILE H  17   ? THR H  22   ? ILE e 17   THR e 22   
AC2 21 VAL H  27   ? ALA H  35   ? VAL e 27   ALA e 35   
AC2 22 CYS H  41   ? THR H  49   ? CYS e 41   THR e 49   
AC2 23 VAL H  55   ? ILE H  63   ? VAL e 55   ILE e 63   
AC2 24 ILE G  67   ? GLU G  71   ? ILE d 67   GLU d 71   
AC2 25 LYS G  16   ? LEU G  21   ? LYS d 16   LEU d 21   
AC2 26 HIS G  26   ? LEU G  31   ? HIS d 26   LEU d 31   
AC2 27 VAL G  41   ? GLU G  47   ? VAL d 41   GLU d 47   
AC2 28 ASN G  55   ? ILE G  62   ? ASN d 55   ILE d 62   
AC2 29 LEU F  86   ? SER F  89   ? LEU c 86   SER c 89   
AC2 30 GLN F  32   ? TYR F  36   ? GLN c 32   TYR c 36   
AC2 31 ARG F  42   ? PHE F  50   ? ARG c 42   PHE c 50   
AC2 32 LEU F  56   ? ILE F  64   ? LEU c 56   ILE c 64   
AC2 33 GLN F  73   ? LEU F  79   ? GLN c 73   LEU c 79   
AC2 34 VAL E  69   ? ARG E  73   ? VAL b 69   ARG b 73   
AC2 35 LYS E  17   ? LEU E  23   ? LYS b 17   LEU b 23   
AC2 36 GLU E  28   ? SER E  35   ? GLU b 28   SER b 35   
AC2 37 GLN E  43   ? ILE E  51   ? GLN b 43   ILE b 51   
AC3 1  VAL L  67   ? GLN L  71   ? VAL q 67   GLN q 71   
AC3 2  ASP L  14   ? LEU L  19   ? ASP q 14   LEU q 19   
AC3 3  LEU L  23   ? VAL L  32   ? LEU q 23   VAL q 32   
AC3 4  ILE L  38   ? SER L  44   ? ILE q 38   SER q 44   
AC3 5  ASN L  59   ? ILE L  62   ? ASN q 59   ILE q 62   
AC3 6  VAL R  67   ? GLU R  72   ? VAL z 67   GLU z 72   
AC3 7  THR R  12   ? THR R  17   ? THR z 12   THR z 17   
AC3 8  MET R  22   ? PHE R  30   ? MET z 22   PHE z 30   
AC3 9  LEU R  36   ? GLU R  43   ? LEU z 36   GLU z 43   
AC3 10 VAL R  55   ? VAL R  62   ? VAL z 55   VAL z 62   
AC3 11 ILE N  66   ? ARG N  70   ? ILE s 66   ARG s 70   
AC3 12 PRO N  14   ? LEU N  19   ? PRO s 14   LEU s 19   
AC3 13 THR N  24   ? CYS N  32   ? THR s 24   CYS s 32   
AC3 14 ILE N  38   ? THR N  46   ? ILE s 38   THR s 46   
AC3 15 ARG N  55   ? ILE N  61   ? ARG s 55   ILE s 61   
AC3 16 VAL Q  81   ? PRO Q  86   ? VAL y 81   PRO y 86   
AC3 17 THR Q  22   ? PHE Q  27   ? THR y 22   PHE y 27   
AC3 18 ARG Q  31   ? PHE Q  40   ? ARG y 31   PHE y 40   
AC3 19 LEU Q  46   ? TYR Q  54   ? LEU y 46   TYR y 54   
AC3 20 ARG Q  69   ? GLN Q  70   ? ARG y 69   GLN y 70   
AC4 1  ARG Q  69   ? GLN Q  70   ? ARG y 69   GLN y 70   
AC4 2  LEU Q  46   ? TYR Q  54   ? LEU y 46   TYR y 54   
AC4 3  VAL Q  74   ? CYS Q  76   ? VAL y 74   CYS y 76   
AC4 4  ILE O  79   ? PRO O  84   ? ILE t 79   PRO t 84   
AC4 5  ARG O  25   ? MET O  30   ? ARG t 25   MET t 30   
AC4 6  GLU O  35   ? PHE O  43   ? GLU t 35   PHE t 43   
AC4 7  MET O  49   ? PHE O  57   ? MET t 49   PHE t 57   
AC4 8  ILE O  66   ? THR O  67   ? ILE t 66   THR t 67   
AC5 1  ILE O  66   ? THR O  67   ? ILE t 66   THR t 67   
AC5 2  MET O  49   ? PHE O  57   ? MET t 49   PHE t 57   
AC5 3  GLN O  71   ? LEU O  74   ? GLN t 71   LEU t 74   
AC5 4  VAL P  70   ? THR P  75   ? VAL x 70   THR x 75   
AC5 5  PRO P  19   ? LEU P  24   ? PRO x 19   LEU x 24   
AC5 6  ASP P  29   ? LEU P  37   ? ASP x 29   LEU x 37   
AC5 7  ILE P  43   ? GLU P  50   ? ILE x 43   GLU x 50   
AC5 8  PHE P  64   ? ILE P  65   ? PHE x 64   ILE x 65   
AC6 1  PHE P  64   ? ILE P  65   ? PHE x 64   ILE x 65   
AC6 2  ILE P  43   ? GLU P  50   ? ILE x 43   GLU x 50   
AC6 3  LEU P  56   ? LYS P  59   ? LEU x 56   LYS x 59   
AC7 1  TYR M  75   ? ARG M  80   ? TYR r 75   ARG r 80   
AC7 2  MET M  52   ? THR M  63   ? MET r 52   THR r 63   
AC7 3  MET M  84   ? VAL M  87   ? MET r 84   VAL r 87   
AC8 1  TYR M  75   ? ARG M  80   ? TYR r 75   ARG r 80   
AC8 2  MET M  52   ? THR M  63   ? MET r 52   THR r 63   
AC8 3  ARG M  37   ? TYR M  46   ? ARG r 37   TYR r 46   
AC8 4  ARG M  28   ? MET M  33   ? ARG r 28   MET r 33   
AC8 5  VAL M  92   ? ALA M  96   ? VAL r 92   ALA r 96   
AC9 1  GLN U  14   ? THR U  16   ? GLN o 14   THR o 16   
AC9 2  ARG U  22   ? ASP U  25   ? ARG o 22   ASP o 25   
AC9 3  ALA U  46   ? ASP U  48   ? ALA o 46   ASP o 48   
AC9 4  THR U  68   ? LEU U  70   ? THR o 68   LEU o 70   
AC9 5  GLU U  92   ? ILE U  94   ? GLU o 92   ILE o 94   
AC9 6  TYR U  117  ? SER U  119  ? TYR o 117  SER o 119  
AC9 7  VAL U  144  ? LEU U  145  ? VAL o 144  LEU o 145  
AC9 8  GLN U  148  ? LYS U  149  ? GLN o 148  LYS o 149  
AD1 1  LYS U  56   ? LEU U  57   ? LYS o 56   LEU o 57   
AD1 2  ARG U  78   ? ILE U  79   ? ARG o 78   ILE o 79   
AD2 1  VAL V  37   ? VAL V  41   ? VAL p 37   VAL p 41   
AD2 2  ALA V  52   ? PHE V  56   ? ALA p 52   PHE p 56   
AD2 3  THR V  8    ? ASN V  12   ? THR p 8    ASN p 12   
AD2 4  ARG V  80   ? TYR V  83   ? ARG p 80   TYR p 83   
AD3 1  PRO V  73   ? PHE V  74   ? PRO p 73   PHE p 74   
AD3 2  LYS V  77   ? PRO V  78   ? LYS p 77   PRO p 78   
AD4 1  ILE W  17   ? THR W  22   ? ILE h 17   THR h 22   
AD4 2  VAL W  27   ? ALA W  35   ? VAL h 27   ALA h 35   
AD4 3  CYS W  41   ? THR W  49   ? CYS h 41   THR h 49   
AD4 4  VAL W  55   ? ILE W  63   ? VAL h 55   ILE h 63   
AD4 5  ILE CA 67   ? ALA CA 72   ? ILE n 67   ALA n 72   
AD4 6  LYS CA 16   ? LEU CA 21   ? LYS n 16   LEU n 21   
AD4 7  ARG CA 25   ? PHE CA 34   ? ARG n 25   PHE n 34   
AD4 8  LEU CA 40   ? GLU CA 47   ? LEU n 40   GLU n 47   
AD4 9  ASN CA 55   ? ILE CA 62   ? ASN n 55   ILE n 62   
AD4 10 ILE BA 84   ? VAL BA 90   ? ILE l 84   VAL l 90   
AD4 11 ARG BA 30   ? LEU BA 35   ? ARG l 30   LEU l 35   
AD4 12 GLN BA 38   ? PHE BA 50   ? GLN l 38   PHE l 50   
AD4 13 LEU BA 56   ? HIS BA 65   ? LEU l 56   HIS l 65   
AD4 14 SER BA 70   ? LEU BA 79   ? SER l 70   LEU l 79   
AD4 15 VAL AA 69   ? GLY AA 74   ? VAL m 69   GLY m 74   
AD4 16 PRO AA 18   ? LEU AA 23   ? PRO m 18   LEU m 23   
AD4 17 GLU AA 28   ? VAL AA 36   ? GLU m 28   VAL m 36   
AD4 18 MET AA 42   ? ILE AA 51   ? MET m 42   ILE m 51   
AD4 19 ALA AA 54   ? ILE AA 64   ? ALA m 54   ILE m 64   
AD4 20 VAL Z  106  ? ARG Z  111  ? VAL k 106  ARG k 111  
AD4 21 GLN Z  41   ? CYS Z  46   ? GLN k 41   CYS k 46   
AD4 22 LYS Z  51   ? PHE Z  59   ? LYS k 51   PHE k 59   
AD4 23 MET Z  65   ? THR Z  75   ? MET k 65   THR k 75   
AD4 24 ASN Z  91   ? LEU Z  101  ? ASN k 91   LEU k 101  
AD4 25 ILE Y  65   ? ILE Y  69   ? ILE j 65   ILE j 69   
AD4 26 THR Y  14   ? LEU Y  19   ? THR j 14   LEU j 19   
AD4 27 GLN Y  24   ? VAL Y  32   ? GLN j 24   VAL j 32   
AD4 28 THR Y  38   ? THR Y  46   ? THR j 38   THR j 46   
AD4 29 VAL Y  53   ? ILE Y  60   ? VAL j 53   ILE j 60   
AD4 30 LEU X  77   ? GLY X  84   ? LEU i 77   GLY i 84   
AD4 31 ARG X  16   ? LEU X  21   ? ARG i 16   LEU i 21   
AD4 32 ILE X  26   ? ALA X  33   ? ILE i 26   ALA i 33   
AD4 33 LEU X  40   ? PHE X  48   ? LEU i 40   PHE i 48   
AD4 34 ARG X  65   ? LEU X  72   ? ARG i 65   LEU i 72   
AD4 35 ILE W  68   ? LEU W  73   ? ILE h 68   LEU h 73   
AD4 36 ILE W  17   ? THR W  22   ? ILE h 17   THR h 22   
AD5 1  VAL EA 119  ? THR EA 120  ? VAL v 119  THR v 120  
AD5 2  PRO EA 221  ? SER EA 222  ? PRO v 221  SER v 222  
AD6 1  ARG EA 148  ? SER EA 153  ? ARG v 148  SER v 153  
AD6 2  GLN EA 167  ? ALA EA 172  ? GLN v 167  ALA v 172  
AD6 3  LYS EA 182  ? VAL EA 183  ? LYS v 182  VAL v 183  
AD7 1  GLU FA 279  ? GLU FA 280  ? GLU w 279  GLU w 280  
AD7 2  ARG FA 284  ? LEU FA 285  ? ARG w 284  LEU w 285  
AD8 1  TYR FA 406  ? CYS FA 408  ? TYR w 406  CYS w 408  
AD8 2  TYR FA 414  ? TYR FA 416  ? TYR w 414  TYR w 416  
AD9 1  LYS GA 413  ? VAL GA 414  ? LYS 1 413  VAL 1 414  
AD9 2  ILE KA 45   ? VAL KA 50   ? ILE 5 45   VAL 5 50   
AD9 3  ALA KA 60   ? TYR KA 64   ? ALA 5 60   TYR 5 64   
AD9 4  ILE KA 20   ? ARG KA 24   ? ILE 5 20   ARG 5 24   
AD9 5  VAL KA 88   ? TYR KA 91   ? VAL 5 88   TYR 5 91   
AE1 1  LEU HA 648  ? LYS HA 649  ? LEU 2 648  LYS 2 649  
AE1 2  THR HA 689  ? ASN HA 690  ? THR 2 689  ASN 2 690  
AE2 1  LEU IA 1104 ? THR IA 1107 ? LEU 3 1104 THR 3 1107 
AE2 2  SER IA 1116 ? TYR IA 1119 ? SER 3 1116 TYR 3 1119 
AE2 3  ILE IA 1126 ? PRO IA 1131 ? ILE 3 1126 PRO 3 1131 
AE2 4  LEU IA 3    ? GLN IA 9    ? LEU 3 3    GLN 3 9    
AE2 5  VAL IA 1173 ? ILE IA 1174 ? VAL 3 1173 ILE 3 1174 
AE3 1  ILE IA 14   ? GLY IA 20   ? ILE 3 14   GLY 3 20   
AE3 2  GLU IA 29   ? ARG IA 34   ? GLU 3 29   ARG 3 34   
AE3 3  ILE IA 37   ? ARG IA 42   ? ILE 3 37   ARG 3 42   
AE3 4  HIS IA 51   ? GLU IA 57   ? HIS 3 51   GLU 3 57   
AE4 1  ILE IA 62   ? ALA IA 67   ? ILE 3 62   ALA 3 67   
AE4 2  ILE IA 78   ? SER IA 82   ? ILE 3 78   SER 3 82   
AE4 3  ARG IA 86   ? GLN IA 93   ? ARG 3 86   GLN 3 93   
AE4 4  MET IA 98   ? THR IA 106  ? MET 3 98   THR 3 106  
AE5 1  PHE IA 120  ? VAL IA 123  ? PHE 3 120  VAL 3 123  
AE5 2  ALA IA 129  ? SER IA 133  ? ALA 3 129  SER 3 133  
AE5 3  LYS IA 139  ? ARG IA 146  ? LYS 3 139  ARG 3 146  
AE5 4  LEU IA 152  ? ILE IA 154  ? LEU 3 152  ILE 3 154  
AE6 1  THR IA 165  ? GLY IA 172  ? THR 3 165  GLY 3 172  
AE6 2  MET IA 181  ? ASP IA 188  ? MET 3 181  ASP 3 188  
AE6 3  THR IA 207  ? ASP IA 214  ? THR 3 207  ASP 3 214  
AE6 4  HIS IA 219  ? PRO IA 227  ? HIS 3 219  PRO 3 227  
AE7 1  GLY IA 232  ? VAL IA 238  ? GLY 3 232  VAL 3 238  
AE7 2  GLY IA 247  ? SER IA 252  ? GLY 3 247  SER 3 252  
AE7 3  TYR IA 255  ? LYS IA 259  ? TYR 3 255  LYS 3 259  
AE7 4  ILE IA 267  ? PRO IA 270  ? ILE 3 267  PRO 3 270  
AE8 1  HIS IA 293  ? LYS IA 294  ? HIS 3 293  LYS 3 294  
AE8 2  PHE IA 299  ? GLN IA 304  ? PHE 3 299  GLN 3 304  
AE8 3  ASP IA 309  ? ASP IA 318  ? ASP 3 309  ASP 3 318  
AE8 4  MET IA 321  ? THR IA 332  ? MET 3 321  THR 3 332  
AE8 5  GLU IA 372  ? SER IA 374  ? GLU 3 372  SER 3 374  
AE9 1  ALA IA 336  ? ALA IA 338  ? ALA 3 336  ALA 3 338  
AE9 2  PHE IA 346  ? SER IA 351  ? PHE 3 346  SER 3 351  
AE9 3  HIS IA 356  ? GLN IA 360  ? HIS 3 356  GLN 3 360  
AE9 4  VAL IA 396  ? LEU IA 401  ? VAL 3 396  LEU 3 401  
AF1 1  ILE IA 407  ? ALA IA 413  ? ILE 3 407  ALA 3 413  
AF1 2  GLN IA 422  ? CYS IA 427  ? GLN 3 422  CYS 3 427  
AF1 3  SER IA 434  ? ARG IA 439  ? SER 3 434  ARG 3 439  
AF1 4  ASN IA 775  ? PRO IA 780  ? ASN 3 775  PRO 3 780  
AF2 1  LYS IA 700  ? MET IA 706  ? LYS 3 700  MET 3 706  
AF2 2  GLN IA 709  ? MET IA 715  ? GLN 3 709  MET 3 715  
AF2 3  SER IA 719  ? SER IA 724  ? SER 3 719  SER 3 724  
AF2 4  PHE IA 729  ? SER IA 735  ? PHE 3 729  SER 3 735  
AF2 5  LEU IA 442  ? SER IA 450  ? LEU 3 442  SER 3 450  
AF2 6  THR IA 761  ? LEU IA 767  ? THR 3 761  LEU 3 767  
AF2 7  GLY IA 753  ? SER IA 758  ? GLY 3 753  SER 3 758  
AF2 8  PHE IA 741  ? PHE IA 745  ? PHE 3 741  PHE 3 745  
AF3 1  ALA IA 458  ? VAL IA 462  ? ALA 3 458  VAL 3 462  
AF3 2  TYR IA 473  ? SER IA 477  ? TYR 3 473  SER 3 477  
AF3 3  THR IA 482  ? SER IA 486  ? THR 3 482  SER 3 486  
AF3 4  GLU IA 492  ? GLU IA 493  ? GLU 3 492  GLU 3 493  
AF4 1  SER IA 507  ? LEU IA 510  ? SER 3 507  LEU 3 510  
AF4 2  LEU IA 516  ? TYR IA 520  ? LEU 3 516  TYR 3 520  
AF4 3  GLY IA 523  ? ARG IA 528  ? GLY 3 523  ARG 3 528  
AF4 4  ARG IA 532  ? ASN IA 534  ? ARG 3 532  ASN 3 534  
AF5 1  ILE IA 544  ? VAL IA 549  ? ILE 3 544  VAL 3 549  
AF5 2  GLN IA 553  ? LEU IA 558  ? GLN 3 553  LEU 3 558  
AF5 3  GLU IA 562  ? GLU IA 567  ? GLU 3 562  GLU 3 567  
AF6 1  LEU IA 605  ? GLY IA 608  ? LEU 3 605  GLY 3 608  
AF6 2  THR IA 613  ? ILE IA 617  ? THR 3 613  ILE 3 617  
AF6 3  PRO IA 627  ? ALA IA 632  ? PRO 3 627  ALA 3 632  
AF7 1  PRO IA 637  ? CYS IA 641  ? PRO 3 637  CYS 3 641  
AF7 2  ASN IA 666  ? LEU IA 669  ? ASN 3 666  LEU 3 669  
AF7 3  LEU IA 674  ? ARG IA 676  ? LEU 3 674  ARG 3 676  
AF7 4  ASP IA 688  ? THR IA 689  ? ASP 3 688  THR 3 689  
AF8 1  PRO IA 785  ? HIS IA 791  ? PRO 3 785  HIS 3 791  
AF8 2  ASN IA 796  ? HIS IA 804  ? ASN 3 796  HIS 3 804  
AF8 3  TRP IA 862  ? MET IA 869  ? TRP 3 862  MET 3 869  
AF8 4  THR IA 876  ? GLN IA 881  ? THR 3 876  GLN 3 881  
AF9 1  ALA IA 887  ? ALA IA 892  ? ALA 3 887  ALA 3 892  
AF9 2  VAL IA 905  ? LYS IA 911  ? VAL 3 905  LYS 3 911  
AF9 3  GLY IA 922  ? TYR IA 928  ? GLY 3 922  TYR 3 928  
AF9 4  PHE IA 939  ? VAL IA 945  ? PHE 3 939  VAL 3 945  
AG1 1  ALA IA 951  ? PHE IA 955  ? ALA 3 951  PHE 3 955  
AG1 2  ARG IA 958  ? VAL IA 963  ? ARG 3 958  VAL 3 963  
AG1 3  LEU IA 966  ? ASP IA 971  ? LEU 3 966  ASP 3 971  
AG1 4  LEU IA 978  ? ASN IA 983  ? LEU 3 978  ASN 3 983  
AG2 1  ILE IA 990  ? THR IA 995  ? ILE 3 990  THR 3 995  
AG2 2  ARG IA 999  ? ASP IA 1004 ? ARG 3 999  ASP 3 1004 
AG2 3  PHE IA 1009 ? TYR IA 1014 ? PHE 3 1009 TYR 3 1014 
AG2 4  LEU IA 1021 ? ASP IA 1026 ? LEU 3 1021 ASP 3 1026 
AG3 1  VAL IA 1033 ? ASP IA 1040 ? VAL 3 1033 ASP 3 1040 
AG3 2  THR IA 1043 ? ASP IA 1048 ? THR 3 1043 ASP 3 1048 
AG3 3  ASN IA 1052 ? ARG IA 1057 ? ASN 3 1052 ARG 3 1057 
AG3 4  GLU IA 1090 ? HIS IA 1096 ? GLU 3 1090 HIS 3 1096 
AG4 1  VAL JA 39   ? HIS JA 43   ? VAL 4 39   HIS 4 43   
AG4 2  TYR JA 56   ? PHE JA 61   ? TYR 4 56   PHE 4 61   
AG4 3  THR JA 14   ? GLY JA 18   ? THR 4 14   GLY 4 18   
AG4 4  LYS JA 82   ? LYS JA 88   ? LYS 4 82   LYS 4 88   
AG4 5  ILE JA 77   ? LEU JA 79   ? ILE 4 77   LEU 4 79   
AG5 1  LYS JA 46   ? ASP JA 47   ? LYS 4 46   ASP 4 47   
AG5 2  GLN JA 52   ? HIS JA 53   ? GLN 4 52   HIS 4 53   
AG6 1  ASN KA 81   ? VAL KA 82   ? ASN 5 81   VAL 5 82   
AG6 2  ARG KA 85   ? TYR KA 86   ? ARG 5 85   TYR 5 86   
AG7 1  LEU LA 8    ? PHE LA 10   ? LEU 6 8    PHE 6 10   
AG7 2  ILE LA 88   ? ASN LA 90   ? ILE 6 88   ASN 6 90   
AG8 1  ALA LA 18   ? ILE LA 19   ? ALA 6 18   ILE 6 19   
AG8 2  ARG LA 44   ? ILE LA 45   ? ARG 6 44   ILE 6 45   
AG9 1  CYS NA 630  ? LEU NA 632  ? CYS J 630  LEU J 632  
AG9 2  HIS NA 542  ? VAL NA 548  ? HIS J 542  VAL J 548  
AG9 3  GLY NA 636  ? THR NA 637  ? GLY J 636  THR J 637  
AH1 1  CYS NA 630  ? LEU NA 632  ? CYS J 630  LEU J 632  
AH1 2  HIS NA 542  ? VAL NA 548  ? HIS J 542  VAL J 548  
AH1 3  VAL NA 582  ? GLY NA 586  ? VAL J 582  GLY J 586  
AH1 4  THR NA 570  ? VAL NA 573  ? THR J 570  VAL J 573  
AH1 5  LYS NA 647  ? PHE NA 648  ? LYS J 647  PHE J 648  
AH2 1  THR NA 608  ? THR NA 611  ? THR J 608  THR J 611  
AH2 2  ASP NA 616  ? SER NA 619  ? ASP J 616  SER J 619  
AH3 1  ILE OA 234  ? PHE OA 239  ? ILE K 234  PHE K 239  
AH3 2  MET OA 245  ? CYS OA 250  ? MET K 245  CYS K 250  
AH3 3  LEU OA 254  ? TRP OA 258  ? LEU K 254  TRP K 258  
AH3 4  THR OA 268  ? LEU OA 269  ? THR K 268  LEU K 269  
AH4 1  VAL OA 276  ? PHE OA 281  ? VAL K 276  PHE K 281  
AH4 2  ASN OA 295  ? ALA OA 300  ? ASN K 295  ALA K 300  
AH4 3  VAL OA 305  ? SER OA 309  ? VAL K 305  SER K 309  
AH4 4  ALA OA 317  ? ILE OA 319  ? ALA K 317  ILE K 319  
AH5 1  ARG OA 328  ? TRP OA 331  ? ARG K 328  TRP K 331  
AH5 2  PHE OA 337  ? THR OA 341  ? PHE K 337  THR K 341  
AH5 3  TRP OA 347  ? ASP OA 351  ? TRP K 347  ASP K 351  
AH5 4  GLU OA 357  ? GLN OA 361  ? GLU K 357  GLN K 361  
AH6 1  ASP OA 370  ? PHE OA 373  ? ASP K 370  PHE K 373  
AH6 2  LEU OA 379  ? GLY OA 383  ? LEU K 379  GLY K 383  
AH6 3  PHE OA 388  ? ASP OA 393  ? PHE K 388  ASP K 393  
AH6 4  ARG OA 398  ? GLU OA 404  ? ARG K 398  GLU K 404  
AH7 1  ILE OA 410  ? PHE OA 415  ? ILE K 410  PHE K 415  
AH7 2  HIS OA 421  ? SER OA 426  ? HIS K 421  SER K 426  
AH7 3  THR OA 430  ? ASP OA 435  ? THR K 430  ASP K 435  
AH7 4  CYS OA 441  ? PRO OA 446  ? CYS K 441  PRO K 446  
AH8 1  GLY OA 454  ? PHE OA 457  ? GLY K 454  PHE K 457  
AH8 2  PHE OA 464  ? GLY OA 468  ? PHE K 464  GLY K 468  
AH8 3  ALA OA 474  ? THR OA 478  ? ALA K 474  THR K 478  
AH8 4  PRO OA 484  ? THR OA 487  ? PRO K 484  THR K 487  
AH9 1  VAL OA 495  ? ILE OA 500  ? VAL K 495  ILE K 500  
AH9 2  ILE OA 507  ? SER OA 511  ? ILE K 507  SER K 511  
AH9 3  PHE OA 516  ? TRP OA 519  ? PHE K 516  TRP K 519  
AI1 1  LEU RA 35   ? LYS RA 37   ? LEU M 35   LYS M 37   
AI1 2  ALA RA 101  ? THR RA 105  ? ALA M 101  THR M 105  
AI1 3  SER RA 51   ? ALA RA 57   ? SER M 51   ALA M 57   
AI1 4  TYR RA 80   ? VAL RA 83   ? TYR M 80   VAL M 83   
AI2 1  ALA SA 56   ? VAL SA 61   ? ALA O 56   VAL O 61   
AI2 2  VAL SA 25   ? GLY SA 31   ? VAL O 25   GLY O 31   
AI2 3  CYS SA 79   ? PHE SA 85   ? CYS O 79   PHE O 85   
AI2 4  LYS SA 88   ? HIS SA 89   ? LYS O 88   HIS O 89   
AI3 1  ILE SA 92   ? ASP SA 93   ? ILE O 92   ASP O 93   
AI3 2  VAL SA 130  ? VAL SA 131  ? VAL O 130  VAL O 131  
AI4 1  TYR TA 142  ? GLN TA 144  ? TYR W 142  GLN W 144  
AI4 2  ALA TA 133  ? CYS TA 136  ? ALA W 133  CYS W 136  
AI4 3  VAL TA 163  ? ASN TA 166  ? VAL W 163  ASN W 166  
AI4 4  LYS TA 171  ? CYS TA 174  ? LYS W 171  CYS W 174  
AI4 5  TYR TA 179  ? GLU TA 180  ? TYR W 179  GLU W 180  
AI5 1  SER TA 212  ? ARG TA 213  ? SER W 212  ARG W 213  
AI5 2  THR TA 219  ? TYR TA 220  ? THR W 219  TYR W 220  
AI6 1  MET TA 383  ? PHE TA 388  ? MET W 383  PHE W 388  
AI6 2  ALA TA 367  ? LEU TA 374  ? ALA W 367  LEU W 374  
AI6 3  LEU TA 438  ? LYS TA 445  ? LEU W 438  LYS W 445  
AI7 1  LEU TA 391  ? LEU TA 393  ? LEU W 391  LEU W 393  
AI7 2  ILE TA 451  ? ILE TA 454  ? ILE W 451  ILE W 454  
AI7 3  GLU TA 546  ? ARG TA 555  ? GLU W 546  ARG W 555  
AI7 4  THR TA 496  ? ASP TA 506  ? THR W 496  ASP W 506  
AI7 5  VAL TA 488  ? GLN TA 489  ? VAL W 488  GLN W 489  
AI8 1  LEU TA 391  ? LEU TA 393  ? LEU W 391  LEU W 393  
AI8 2  ILE TA 451  ? ILE TA 454  ? ILE W 451  ILE W 454  
AI8 3  GLU TA 546  ? ARG TA 555  ? GLU W 546  ARG W 555  
AI8 4  THR TA 496  ? ASP TA 506  ? THR W 496  ASP W 506  
AI8 5  SER TA 513  ? VAL TA 518  ? SER W 513  VAL W 518  
AI8 6  TRP TA 526  ? GLN TA 530  ? TRP W 526  GLN W 530  
AI8 7  GLN TA 533  ? ILE TA 537  ? GLN W 533  ILE W 537  
AI9 1  ASP VA 93   ? PHE VA 100  ? ASP P 93   PHE P 100  
AI9 2  VAL VA 66   ? MET VA 73   ? VAL P 66   MET P 73   
AI9 3  LYS VA 51   ? ALA VA 58   ? LYS P 51   ALA P 58   
AI9 4  VAL VA 42   ? CYS VA 46   ? VAL P 42   CYS P 46   
AI9 5  VAL VA 106  ? LEU VA 110  ? VAL P 106  LEU P 110  
AI9 6  GLU WA 61   ? ILE WA 64   ? GLU Q 61   ILE Q 64   
AI9 7  GLN WA 43   ? ILE WA 51   ? GLN Q 43   ILE Q 51   
AI9 8  ALA WA 54   ? HIS WA 58   ? ALA Q 54   HIS Q 58   
AJ1 1  ASP VA 93   ? PHE VA 100  ? ASP P 93   PHE P 100  
AJ1 2  VAL VA 66   ? MET VA 73   ? VAL P 66   MET P 73   
AJ1 3  LYS VA 51   ? ALA VA 58   ? LYS P 51   ALA P 58   
AJ1 4  VAL VA 42   ? CYS VA 46   ? VAL P 42   CYS P 46   
AJ1 5  VAL VA 106  ? LEU VA 110  ? VAL P 106  LEU P 110  
AJ1 6  GLU WA 61   ? ILE WA 64   ? GLU Q 61   ILE Q 64   
AJ1 7  GLN WA 43   ? ILE WA 51   ? GLN Q 43   ILE Q 51   
AJ1 8  GLU WA 28   ? LEU WA 33   ? GLU Q 28   LEU Q 33   
AJ1 9  LYS WA 17   ? LEU WA 23   ? LYS Q 17   LEU Q 23   
AJ1 10 VAL WA 69   ? ARG WA 73   ? VAL Q 69   ARG Q 73   
AJ1 11 GLN XA 73   ? LEU XA 79   ? GLN R 73   LEU R 79   
AJ1 12 LEU XA 56   ? GLU XA 63   ? LEU R 56   GLU R 63   
AJ1 13 ILE XA 43   ? PHE XA 50   ? ILE R 43   PHE R 50   
AJ1 14 GLN XA 32   ? TYR XA 36   ? GLN R 32   TYR R 36   
AJ1 15 LEU XA 86   ? SER XA 89   ? LEU R 86   SER R 89   
AJ1 16 ASN YA 55   ? ILE YA 62   ? ASN S 55   ILE S 62   
AJ1 17 VAL YA 41   ? GLU YA 47   ? VAL S 41   GLU S 47   
AJ1 18 HIS YA 26   ? LEU YA 31   ? HIS S 26   LEU S 31   
AJ1 19 LYS YA 16   ? LEU YA 21   ? LYS S 16   LEU S 21   
AJ1 20 ILE YA 67   ? ALA YA 72   ? ILE S 67   ALA S 72   
AJ1 21 VAL ZA 55   ? ILE ZA 63   ? VAL T 55   ILE T 63   
AJ1 22 CYS ZA 41   ? THR ZA 49   ? CYS T 41   THR T 49   
AJ1 23 VAL ZA 27   ? ALA ZA 35   ? VAL T 27   ALA T 35   
AJ1 24 ILE ZA 17   ? THR ZA 22   ? ILE T 17   THR T 22   
AJ1 25 ILE ZA 68   ? ILE ZA 72   ? ILE T 68   ILE T 72   
AJ1 26 VAL AB 66   ? LEU AB 72   ? VAL U 66   LEU U 72   
AJ1 27 ILE AB 41   ? GLU AB 47   ? ILE U 41   GLU U 47   
AJ1 28 ILE AB 26   ? ALA AB 33   ? ILE U 26   ALA U 33   
AJ1 29 TYR AB 15   ? LEU AB 21   ? TYR U 15   LEU U 21   
AJ1 30 LEU AB 77   ? VAL AB 82   ? LEU U 77   VAL U 82   
AJ1 31 PRO BB 52   ? ILE BB 60   ? PRO V 52   ILE V 60   
AJ1 32 THR BB 38   ? THR BB 46   ? THR V 38   THR V 46   
AJ1 33 GLN BB 24   ? ILE BB 29   ? GLN V 24   ILE V 29   
AJ1 34 VAL BB 15   ? LEU BB 19   ? VAL V 15   LEU V 19   
AJ1 35 ILE BB 65   ? PHE BB 68   ? ILE V 65   PHE V 68   
AJ2 1  THR CB 380  ? LYS CB 382  ? THR X 380  LYS X 382  
AJ2 2  ALA CB 625  ? TYR CB 628  ? ALA X 625  TYR X 628  
AJ2 3  ILE CB 431  ? VAL CB 434  ? ILE X 431  VAL X 434  
AJ2 4  GLN CB 601  ? THR CB 606  ? GLN X 601  THR X 606  
AJ2 5  TYR CB 545  ? LEU CB 548  ? TYR X 545  LEU X 548  
AJ2 6  ALA CB 471  ? LEU CB 474  ? ALA X 471  LEU X 474  
AJ2 7  ILE CB 521  ? ALA CB 524  ? ILE X 521  ALA X 524  
AJ2 8  THR CB 499  ? VAL CB 502  ? THR X 499  VAL X 502  
AJ3 1  GLN CB 641  ? LEU CB 645  ? GLN X 641  LEU X 645  
AJ3 2  VAL CB 763  ? LEU CB 768  ? VAL X 763  LEU X 768  
AJ3 3  MET CB 735  ? ASN CB 738  ? MET X 735  ASN X 738  
AJ3 4  ILE CB 667  ? PHE CB 670  ? ILE X 667  PHE X 670  
AJ3 5  ILE CB 717  ? ALA CB 720  ? ILE X 717  ALA X 720  
AJ3 6  ALA CB 691  ? THR CB 693  ? ALA X 691  THR X 693  
AJ4 1  SER DB 127  ? VAL DB 129  ? SER A 127  VAL A 129  
AJ4 2  ASP DB 115  ? HIS DB 121  ? ASP A 115  HIS A 121  
AJ4 3  PHE DB 482  ? ASP DB 488  ? PHE A 482  ASP A 488  
AJ5 1  TRP DB 228  ? GLN DB 229  ? TRP A 228  GLN A 229  
AJ5 2  SER DB 415  ? GLY DB 416  ? SER A 415  GLY A 416  
AJ6 1  LEU DB 516  ? LEU DB 518  ? LEU A 516  LEU A 518  
AJ6 2  LEU DB 524  ? PRO DB 526  ? LEU A 524  PRO A 526  
AJ7 1  GLY DB 895  ? ASP DB 900  ? GLY A 895  ASP A 900  
AJ7 2  LEU DB 905  ? ASP DB 910  ? LEU A 905  ASP A 910  
AJ8 1  LEU DB 1087 ? TYR DB 1091 ? LEU A 1087 TYR A 1091 
AJ8 2  ARG DB 1094 ? PHE DB 1101 ? ARG A 1094 PHE A 1101 
AJ8 3  CYS DB 973  ? ARG DB 980  ? CYS A 973  ARG A 980  
AJ8 4  VAL DB 1175 ? SER DB 1176 ? VAL A 1175 SER A 1176 
AJ9 1  ILE DB 1017 ? TYR DB 1019 ? ILE A 1017 TYR A 1019 
AJ9 2  MET DB 1022 ? HIS DB 1024 ? MET A 1022 HIS A 1024 
AK1 1  PHE DB 1192 ? GLU DB 1193 ? PHE A 1192 GLU A 1193 
AK1 2  ARG DB 1231 ? VAL DB 1232 ? ARG A 1231 VAL A 1232 
AK2 1  ILE DB 1196 ? PRO DB 1198 ? ILE A 1196 PRO A 1198 
AK2 2  ARG DB 1224 ? CYS DB 1228 ? ARG A 1224 CYS A 1228 
AK2 3  TRP DB 1214 ? GLN DB 1217 ? TRP A 1214 GLN A 1217 
AK3 1  TRP DB 1342 ? THR DB 1346 ? TRP A 1342 THR A 1346 
AK3 2  GLY DB 1349 ? PHE DB 1353 ? GLY A 1349 PHE A 1353 
AK4 1  ILE DB 1606 ? LYS DB 1611 ? ILE A 1606 LYS A 1611 
AK4 2  ILE DB 1629 ? VAL DB 1639 ? ILE A 1629 VAL A 1639 
AK4 3  THR DB 1655 ? ASP DB 1663 ? THR A 1655 ASP A 1663 
AK4 4  GLY DB 1700 ? ASP DB 1706 ? GLY A 1700 ASP A 1706 
AK4 5  LEU DB 1711 ? GLY DB 1716 ? LEU A 1711 GLY A 1716 
AK4 6  SER DB 1643 ? LEU DB 1644 ? SER A 1643 LEU A 1644 
AK5 1  ILE DB 1606 ? LYS DB 1611 ? ILE A 1606 LYS A 1611 
AK5 2  ILE DB 1629 ? VAL DB 1639 ? ILE A 1629 VAL A 1639 
AK5 3  THR DB 1655 ? ASP DB 1663 ? THR A 1655 ASP A 1663 
AK5 4  GLY DB 1700 ? ASP DB 1706 ? GLY A 1700 ASP A 1706 
AK5 5  LEU DB 1666 ? ARG DB 1667 ? LEU A 1666 ARG A 1667 
AK6 1  VAL DB 1883 ? GLY DB 1886 ? VAL A 1883 GLY A 1886 
AK6 2  GLN DB 1860 ? VAL DB 1863 ? GLN A 1860 VAL A 1863 
AK6 3  ILE DB 1777 ? ASP DB 1781 ? ILE A 1777 ASP A 1781 
AK6 4  GLY DB 1805 ? PHE DB 1810 ? GLY A 1805 PHE A 1810 
AK6 5  GLN DB 1816 ? ILE DB 1822 ? GLN A 1816 ILE A 1822 
AK6 6  GLN DB 1913 ? ASN DB 1918 ? GLN A 1913 ASN A 1918 
AK7 1  ILE DB 2090 ? VAL DB 2092 ? ILE A 2090 VAL A 2092 
AK7 2  SER DB 2222 ? LEU DB 2230 ? SER A 2222 LEU A 2230 
AK7 3  ILE DB 2212 ? THR DB 2219 ? ILE A 2212 THR A 2219 
AK7 4  GLU DB 2173 ? GLN DB 2181 ? GLU A 2173 GLN A 2181 
AK7 5  ALA DB 2125 ? VAL DB 2131 ? ALA A 2125 VAL A 2131 
AK7 6  VAL DB 2139 ? VAL DB 2146 ? VAL A 2139 VAL A 2146 
AK7 7  THR DB 2103 ? PRO DB 2107 ? THR A 2103 PRO A 2107 
AK7 8  GLN DB 2260 ? SER DB 2264 ? GLN A 2260 SER A 2264 
AK8 1  TYR DB 2256 ? ARG DB 2258 ? TYR A 2256 ARG A 2258 
AK8 2  SER DB 2222 ? LEU DB 2230 ? SER A 2222 LEU A 2230 
AK8 3  ILE DB 2212 ? THR DB 2219 ? ILE A 2212 THR A 2219 
AK8 4  GLU DB 2173 ? GLN DB 2181 ? GLU A 2173 GLN A 2181 
AK8 5  ALA DB 2125 ? VAL DB 2131 ? ALA A 2125 VAL A 2131 
AK8 6  VAL DB 2139 ? VAL DB 2146 ? VAL A 2139 VAL A 2146 
AK8 7  PHE DB 2270 ? PRO DB 2274 ? PHE A 2270 PRO A 2274 
AK8 8  LEU DB 2296 ? LEU DB 2298 ? LEU A 2296 LEU A 2298 
AK9 1  TRP DB 2151 ? GLY DB 2152 ? TRP A 2151 GLY A 2152 
AK9 2  VAL DB 2157 ? HIS DB 2158 ? VAL A 2157 HIS A 2158 
AL1 1  THR EB 184  ? VAL EB 189  ? THR C 184  VAL C 189  
AL1 2  LEU EB 199  ? ASP EB 204  ? LEU C 199  ASP C 204  
AL1 3  ILE EB 129  ? GLY EB 136  ? ILE C 129  GLY C 136  
AL1 4  GLY EB 224  ? ASP EB 230  ? GLY C 224  ASP C 230  
AL1 5  ALA EB 252  ? ASN EB 258  ? ALA C 252  ASN C 258  
AL1 6  VAL EB 307  ? SER EB 311  ? VAL C 307  SER C 311  
AL1 7  ILE EB 316  ? PHE EB 318  ? ILE C 316  PHE C 318  
AL2 1  GLN EB 523  ? THR EB 526  ? GLN C 523  THR C 526  
AL2 2  PRO EB 506  ? LEU EB 510  ? PRO C 506  LEU C 510  
AL2 3  ALA EB 563  ? THR EB 566  ? ALA C 563  THR C 566  
AL2 4  CYS EB 476  ? TYR EB 482  ? CYS C 476  TYR C 482  
AL2 5  HIS EB 491  ? ARG EB 495  ? HIS C 491  ARG C 495  
AL2 6  TRP EB 549  ? ILE EB 552  ? TRP C 549  ILE C 552  
AL2 7  LEU EB 530  ? VAL EB 534  ? LEU C 530  VAL C 534  
AL2 8  TYR EB 537  ? VAL EB 541  ? TYR C 537  VAL C 541  
AL3 1  THR EB 500  ? HIS EB 502  ? THR C 500  HIS C 502  
AL3 2  ARG EB 543  ? PRO EB 545  ? ARG C 543  PRO C 545  
AL4 1  THR EB 618  ? VAL EB 621  ? THR C 618  VAL C 621  
AL4 2  HIS EB 627  ? GLY EB 631  ? HIS C 627  GLY C 631  
AL4 3  ILE EB 588  ? PRO EB 594  ? ILE C 588  PRO C 594  
AL4 4  ILE EB 653  ? VAL EB 655  ? ILE C 653  VAL C 655  
AL5 1  THR EB 618  ? VAL EB 621  ? THR C 618  VAL C 621  
AL5 2  HIS EB 627  ? GLY EB 631  ? HIS C 627  GLY C 631  
AL5 3  ILE EB 588  ? PRO EB 594  ? ILE C 588  PRO C 594  
AL5 4  VAL EB 659  ? VAL EB 660  ? VAL C 659  VAL C 660  
AL6 1  ASN EB 683  ? PRO EB 691  ? ASN C 683  PRO C 691  
AL6 2  VAL EB 787  ? VAL EB 796  ? VAL C 787  VAL C 796  
AL6 3  ILE EB 744  ? ASP EB 747  ? ILE C 744  ASP C 747  
AL6 4  ILE EB 732  ? ALA EB 734  ? ILE C 732  ALA C 734  
AL7 1  VAL EB 857  ? PRO EB 862  ? VAL C 857  PRO C 862  
AL7 2  TYR EB 869  ? PRO EB 876  ? TYR C 869  PRO C 876  
AL7 3  GLU EB 829  ? ALA EB 838  ? GLU C 829  ALA C 838  
AL7 4  PHE EB 896  ? GLN EB 905  ? PHE C 896  GLN C 905  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N ARG B  437  ? N ARG D 437  O GLU B  444  ? O GLU D 444  
AA1 2  3  N VAL B  445  ? N VAL D 445  O TYR B  689  ? O TYR D 689  
AA1 3  4  N THR B  688  ? N THR D 688  O LEU B  869  ? O LEU D 869  
AA1 4  5  O ILE B  868  ? O ILE D 868  N ILE B  828  ? N ILE D 828  
AA1 5  6  O ILE B  827  ? O ILE D 827  N LEU B  722  ? N LEU D 722  
AA1 6  7  N VAL B  723  ? N VAL D 723  O SER B  811  ? O SER D 811  
AA1 7  8  O VAL B  808  ? O VAL D 808  N ALA B  783  ? N ALA D 783  
AA2 1  2  O ILE B  586  ? O ILE D 586  N TYR B  540  ? N TYR D 540  
AA2 2  3  N ILE B  541  ? N ILE D 541  O ILE B  613  ? O ILE D 613  
AA2 3  4  N ARG B  610  ? N ARG D 610  O ARG B  647  ? O ARG D 647  
AA2 4  5  O LEU B  648  ? O LEU D 648  N LEU B  499  ? N LEU D 499  
AA2 5  6  N CYS B  502  ? N CYS D 502  O PHE B  674  ? O PHE D 674  
AA3 1  2  N SER B  835  ? N SER D 835  O ARG B  840  ? O ARG D 840  
AA4 1  2  N LYS B  971  ? N LYS D 971  O GLN B  980  ? O GLN D 980  
AA5 1  2  N SER B  1187 ? N SER D 1187 O THR B  1203 ? O THR D 1203 
AA5 2  3  N LEU B  1198 ? N LEU D 1198 O VAL B  1256 ? O VAL D 1256 
AA6 1  2  O GLU B  1237 ? O GLU D 1237 N ILE B  1223 ? N ILE D 1223 
AA6 2  3  N TRP B  1222 ? N TRP D 1222 O VAL B  1271 ? O VAL D 1271 
AA6 3  4  N TYR B  1266 ? N TYR D 1266 O VAL B  1284 ? O VAL D 1284 
AA7 1  2  N VAL B  1406 ? N VAL D 1406 O ILE B  1424 ? O ILE D 1424 
AA7 2  3  O ILE B  1425 ? O ILE D 1425 N TYR B  1378 ? N TYR D 1378 
AA7 3  4  N ILE B  1379 ? N ILE D 1379 O VAL B  1452 ? O VAL D 1452 
AA7 4  5  N VAL B  1453 ? N VAL D 1453 O LEU B  1490 ? O LEU D 1490 
AA7 5  6  O ALA B  1489 ? O ALA D 1489 N VAL B  1348 ? N VAL D 1348 
AA7 6  7  N PHE B  1347 ? N PHE D 1347 O PHE B  1512 ? O PHE D 1512 
AA8 1  2  N GLN B  1528 ? N GLN D 1528 O ILE B  1704 ? O ILE D 1704 
AA8 2  3  O MET B  1705 ? O MET D 1705 N ILE B  1663 ? N ILE D 1663 
AA8 3  4  O ILE B  1662 ? O ILE D 1662 N ILE B  1560 ? N ILE D 1560 
AA8 4  5  N VAL B  1561 ? N VAL D 1561 O ALA B  1646 ? O ALA D 1646 
AA8 5  6  O SER B  1647 ? O SER D 1647 N LEU B  1620 ? N LEU D 1620 
AA9 1  2  N TYR B  1668 ? N TYR D 1668 O VAL B  1677 ? O VAL D 1677 
AB1 1  2  N SER B  1803 ? N SER D 1803 O ALA B  1811 ? O ALA D 1811 
AB2 1  2  N GLU B  2022 ? N GLU D 2022 O LEU B  2038 ? O LEU D 2038 
AB2 2  3  N VAL B  2039 ? N VAL D 2039 O VAL B  2090 ? O VAL D 2090 
AB3 1  2  O SER B  2078 ? O SER D 2078 N ILE B  2068 ? N ILE D 2068 
AB3 2  3  N VAL B  2067 ? N VAL D 2067 O TYR B  2107 ? O TYR D 2107 
AB3 3  4  N LEU B  2106 ? N LEU D 2106 O TYR B  2120 ? O TYR D 2120 
AB4 1  2  N LEU C  62   ? N LEU E 62   O LEU C  351  ? O LEU E 351  
AB4 2  3  O GLY C  354  ? O GLY E 354  N ILE C  342  ? N ILE E 342  
AB4 3  4  O ALA C  345  ? O ALA E 345  N GLU C  332  ? N GLU E 332  
AB5 1  2  N LYS C  73   ? N LYS E 73   O ALA C  82   ? O ALA E 82   
AB5 2  3  N SER C  83   ? N SER E 83   O LEU C  91   ? O LEU E 91   
AB5 3  4  N ILE C  90   ? N ILE E 90   O LEU C  105  ? O LEU E 105  
AB6 1  2  N HIS C  116  ? N HIS E 116  O PHE C  125  ? O PHE E 125  
AB6 2  3  N LEU C  124  ? N LEU E 124  O TRP C  136  ? O TRP E 136  
AB6 3  4  N VAL C  135  ? N VAL E 135  O VAL C  144  ? O VAL E 144  
AB7 1  2  N TYR C  158  ? N TYR E 158  O CYS C  168  ? O CYS E 168  
AB7 2  3  N VAL C  167  ? N VAL E 167  O TRP C  179  ? O TRP E 179  
AB7 3  4  N LEU C  178  ? N LEU E 178  O ILE C  187  ? O ILE E 187  
AB8 1  2  N THR C  200  ? N THR E 200  O ILE C  209  ? O ILE E 209  
AB8 2  3  N SER C  210  ? N SER E 210  O LYS C  218  ? O LYS E 218  
AB8 3  4  N ILE C  217  ? N ILE E 217  O MET C  231  ? O MET E 231  
AB9 1  2  N SER C  242  ? N SER E 242  O LEU C  251  ? O LEU E 251  
AB9 2  3  N LEU C  250  ? N LEU E 250  O TRP C  262  ? O TRP E 262  
AB9 3  4  N VAL C  259  ? N VAL E 259  O PHE C  277  ? O PHE E 277  
AC1 1  2  N SER C  292  ? N SER E 292  O ALA C  301  ? O ALA E 301  
AC1 2  3  N ILE C  300  ? N ILE E 300  O TRP C  312  ? O TRP E 312  
AC1 3  4  N VAL C  311  ? N VAL E 311  O LEU C  320  ? O LEU E 320  
AC2 1  2  O ALA E  54   ? O ALA b 54   N ILE E  51   ? N ILE b 51   
AC2 2  3  N LEU E  44   ? N LEU b 44   O VAL E  62   ? O VAL b 62   
AC2 3  4  O LEU E  63   ? O LEU b 63   N VAL D  109  ? N VAL a 109  
AC2 4  5  O LEU D  110  ? O LEU a 110  N LEU D  43   ? N LEU a 43   
AC2 5  6  N ILE D  44   ? N ILE a 44   O LEU D  52   ? O LEU a 52   
AC2 6  7  N LYS D  51   ? N LYS a 51   O MET D  73   ? O MET a 73   
AC2 7  8  N GLU D  72   ? N GLU a 72   O ARG D  94   ? O ARG a 94   
AC2 8  9  N PHE D  100  ? N PHE a 100  O PHE J  68   ? O PHE g 68   
AC2 9  10 O ILE J  69   ? O ILE g 69   N THR J  16   ? N THR g 16   
AC2 10 11 N ILE J  17   ? N ILE g 17   O VAL J  25   ? O VAL g 25   
AC2 11 12 N HIS J  26   ? N HIS g 26   O LYS J  44   ? O LYS g 44   
AC2 12 13 N ALA J  42   ? N ALA g 42   O GLU J  56   ? O GLU g 56   
AC2 13 14 O THR J  57   ? O THR g 57   N VAL I  82   ? N VAL f 82   
AC2 14 15 O THR I  81   ? O THR f 81   N ARG I  18   ? N ARG f 18   
AC2 15 16 N TYR I  15   ? N TYR f 15   O PHE I  31   ? O PHE f 31   
AC2 16 17 N THR I  30   ? N THR f 30   O CYS I  43   ? O CYS f 43   
AC2 17 18 N LEU I  40   ? N LEU f 40   O LEU I  72   ? O LEU f 72   
AC2 18 19 O LEU I  71   ? O LEU f 71   N LEU H  71   ? N LEU e 71   
AC2 19 20 O ILE H  72   ? O ILE e 72   N THR H  19   ? N THR e 19   
AC2 20 21 N CYS H  20   ? N CYS e 20   O TYR H  28   ? O TYR e 28   
AC2 21 22 N ILE H  33   ? N ILE e 33   O GLN H  42   ? O GLN e 42   
AC2 22 23 N VAL H  48   ? N VAL e 48   O ALA H  56   ? O ALA e 56   
AC2 23 24 O TYR H  62   ? O TYR e 62   N LEU G  70   ? N LEU d 70   
AC2 24 25 O GLU G  71   ? O GLU d 71   N SER G  18   ? N SER d 18   
AC2 25 26 N LEU G  19   ? N LEU d 19   O VAL G  27   ? O VAL d 27   
AC2 26 27 N ILE G  30   ? N ILE d 30   O ASP G  43   ? O ASP d 43   
AC2 27 28 N GLU G  44   ? N GLU d 44   O GLY G  58   ? O GLY d 58   
AC2 28 29 O VAL G  61   ? O VAL d 61   N LEU F  87   ? N LEU c 87   
AC2 29 30 O GLN F  88   ? O GLN c 88   N TRP F  34   ? N TRP c 34   
AC2 30 31 N LEU F  35   ? N LEU c 35   O ILE F  43   ? O ILE c 43   
AC2 31 32 N ARG F  42   ? N ARG c 42   O ILE F  64   ? O ILE c 64   
AC2 32 33 N ALA F  61   ? N ALA c 61   O LEU F  74   ? O LEU c 74   
AC2 33 34 O MET F  78   ? O MET c 78   N ILE E  72   ? N ILE b 72   
AC2 34 35 O ARG E  73   ? O ARG b 73   N MET E  20   ? N MET b 20   
AC2 35 36 N VAL E  21   ? N VAL b 21   O TYR E  29   ? O TYR b 29   
AC2 36 37 N TYR E  32   ? N TYR b 32   O ALA E  45   ? O ALA b 45   
AC3 1  2  O GLN L  71   ? O GLN q 71   N VAL L  16   ? N VAL q 16   
AC3 2  3  N VAL L  15   ? N VAL q 15   O GLY L  27   ? O GLY q 27   
AC3 3  4  N HIS L  30   ? N HIS q 30   O LYS L  39   ? O LYS q 39   
AC3 4  5  N ILE L  38   ? N ILE q 38   O ILE L  62   ? O ILE q 62   
AC3 5  6  N PHE L  61   ? N PHE q 61   O ILE R  70   ? O ILE z 70   
AC3 6  7  O ALA R  68   ? O ALA z 68   N ILE R  16   ? N ILE z 16   
AC3 7  8  N VAL R  13   ? N VAL z 13   O GLY R  25   ? O GLY z 25   
AC3 8  9  N GLY R  29   ? N GLY z 29   O ILE R  37   ? O ILE z 37   
AC3 9  10 N LEU R  38   ? N LEU z 38   O TYR R  60   ? O TYR z 60   
AC3 10 11 O ILE R  61   ? O ILE z 61   N LEU N  69   ? N LEU s 69   
AC3 11 12 O TYR N  68   ? O TYR s 68   N GLU N  18   ? N GLU s 18   
AC3 12 13 N MET N  15   ? N MET s 15   O GLY N  27   ? O GLY s 27   
AC3 13 14 N VAL N  30   ? N VAL s 30   O ASN N  39   ? O ASN s 39   
AC3 14 15 N VAL N  43   ? N VAL s 43   O MET N  56   ? O MET s 56   
AC3 15 16 N TYR N  60   ? N TYR s 60   O ILE Q  84   ? O ILE y 84   
AC3 16 17 O CYS Q  85   ? O CYS y 85   N ARG Q  24   ? N ARG y 24   
AC3 17 18 N VAL Q  25   ? N VAL y 25   O ALA Q  33   ? O ALA y 33   
AC3 18 19 N GLY Q  39   ? N GLY y 39   O VAL Q  47   ? O VAL y 47   
AC3 19 20 N GLU Q  53   ? N GLU y 53   O ARG Q  69   ? O ARG y 69   
AC4 1  2  O ARG Q  69   ? O ARG y 69   N GLU Q  53   ? N GLU y 53   
AC4 2  3  N LEU Q  46   ? N LEU y 46   O CYS Q  76   ? O CYS y 76   
AC4 3  4  O VAL Q  75   ? O VAL y 75   N LEU O  82   ? N LEU t 82   
AC4 4  5  O MET O  81   ? O MET t 81   N VAL O  29   ? N VAL t 29   
AC4 5  6  N ILE O  28   ? N ILE t 28   O ILE O  36   ? O ILE t 36   
AC4 6  7  N GLU O  35   ? N GLU t 35   O PHE O  57   ? O PHE t 57   
AC4 7  8  N GLU O  56   ? N GLU t 56   O ILE O  66   ? O ILE t 66   
AC5 1  2  O ILE O  66   ? O ILE t 66   N GLU O  56   ? N GLU t 56   
AC5 2  3  N MET O  49   ? N MET t 49   O LEU O  74   ? O LEU t 74   
AC5 3  4  N LEU O  73   ? N LEU t 73   O ILE P  73   ? O ILE x 73   
AC5 4  5  O LEU P  71   ? O LEU x 71   N LYS P  23   ? N LYS x 23   
AC5 5  6  N VAL P  20   ? N VAL x 20   O GLY P  32   ? O GLY x 32   
AC5 6  7  N ASP P  29   ? N ASP x 29   O GLU P  50   ? O GLU x 50   
AC5 7  8  N ILE P  43   ? N ILE x 43   O ILE P  65   ? O ILE x 65   
AC6 1  2  O ILE P  65   ? O ILE x 65   N ILE P  43   ? N ILE x 43   
AC6 2  3  N GLU P  49   ? N GLU x 49   O ASN P  58   ? O ASN x 58   
AC7 1  2  O LYS M  79   ? O LYS r 79   N GLU M  59   ? N GLU r 59   
AC7 2  3  N MET M  52   ? N MET r 52   O VAL M  87   ? O VAL r 87   
AC8 1  2  O LYS M  79   ? O LYS r 79   N GLU M  59   ? N GLU r 59   
AC8 2  3  O ILE M  53   ? O ILE r 53   N HIS M  44   ? N HIS r 44   
AC8 3  4  O LEU M  39   ? O LEU r 39   N VAL M  31   ? N VAL r 31   
AC8 4  5  N LYS M  32   ? N LYS r 32   O VAL M  93   ? O VAL r 93   
AC9 1  2  N TYR U  15   ? N TYR o 15   O GLU U  23   ? O GLU o 23   
AC9 2  3  N LEU U  24   ? N LEU o 24   O ASP U  48   ? O ASP o 48   
AC9 3  4  N ILE U  47   ? N ILE o 47   O THR U  68   ? O THR o 68   
AC9 4  5  N LEU U  69   ? N LEU o 69   O ILE U  94   ? O ILE o 94   
AC9 5  6  N LEU U  93   ? N LEU o 93   O TYR U  117  ? O TYR o 117  
AC9 6  7  N LEU U  118  ? N LEU o 118  O VAL U  144  ? O VAL o 144  
AC9 7  8  N LEU U  145  ? N LEU o 145  O GLN U  148  ? O GLN o 148  
AD1 1  2  N LEU U  57   ? N LEU o 57   O ARG U  78   ? O ARG o 78   
AD2 1  2  N ASP V  39   ? N ASP p 39   O ILE V  55   ? O ILE p 55   
AD2 2  3  O ALA V  52   ? O ALA p 52   N ILE V  11   ? N ILE p 11   
AD2 3  4  N TYR V  10   ? N TYR p 10   O GLN V  82   ? O GLN p 82   
AD3 1  2  N PHE V  74   ? N PHE p 74   O LYS V  77   ? O LYS p 77   
AD4 1  2  N CYS W  20   ? N CYS h 20   O TYR W  28   ? O TYR h 28   
AD4 2  3  N GLU W  34   ? N GLU h 34   O GLN W  42   ? O GLN h 42   
AD4 3  4  N ASN W  45   ? N ASN h 45   O GLU W  59   ? O GLU h 59   
AD4 4  5  N TYR W  62   ? N TYR h 62   O LEU CA 70   ? O LEU n 70   
AD4 5  6  O GLU CA 71   ? O GLU n 71   N SER CA 18   ? N SER n 18   
AD4 6  7  N LEU CA 21   ? N LEU n 21   O ARG CA 25   ? O ARG n 25   
AD4 7  8  N ARG CA 32   ? N ARG n 32   O VAL CA 41   ? O VAL n 41   
AD4 8  9  N LEU CA 40   ? N LEU n 40   O ILE CA 62   ? O ILE n 62   
AD4 9  10 O VAL CA 61   ? O VAL n 61   N LEU BA 87   ? N LEU l 87   
AD4 10 11 O THR BA 85   ? O THR l 85   N TRP BA 34   ? N TRP l 34   
AD4 11 12 N VAL BA 33   ? N VAL l 33   O ILE BA 43   ? O ILE l 43   
AD4 12 13 N ARG BA 42   ? N ARG l 42   O ILE BA 64   ? O ILE l 64   
AD4 13 14 N HIS BA 65   ? N HIS l 65   O SER BA 70   ? O SER l 70   
AD4 14 15 O MET BA 78   ? O MET l 78   N ILE AA 72   ? N ILE m 72   
AD4 15 16 O ARG AA 73   ? O ARG m 73   N MET AA 20   ? N MET m 20   
AD4 16 17 N VAL AA 19   ? N VAL m 19   O GLY AA 31   ? O GLY m 31   
AD4 17 18 N GLU AA 28   ? N GLU m 28   O TYR AA 50   ? O TYR m 50   
AD4 18 19 N GLU AA 49   ? N GLU m 49   O SER AA 56   ? O SER m 56   
AD4 19 20 O LEU AA 63   ? O LEU m 63   N VAL Z  109  ? N VAL k 109  
AD4 20 21 O LEU Z  110  ? O LEU k 110  N LEU Z  43   ? N LEU k 43   
AD4 21 22 N ILE Z  44   ? N ILE k 44   O LEU Z  52   ? O LEU k 52   
AD4 22 23 N LEU Z  53   ? N LEU k 53   O LYS Z  71   ? O LYS k 71   
AD4 23 24 N LEU Z  67   ? N LEU k 67   O MET Z  99   ? O MET k 99   
AD4 24 25 O PHE Z  100  ? O PHE k 100  N PHE Y  68   ? N PHE j 68   
AD4 25 26 O ILE Y  69   ? O ILE j 69   N THR Y  16   ? N THR j 16   
AD4 26 27 N ILE Y  17   ? N ILE j 17   O VAL Y  25   ? O VAL j 25   
AD4 27 28 N GLN Y  24   ? N GLN j 24   O THR Y  46   ? O THR j 46   
AD4 28 29 N THR Y  38   ? N THR j 38   O ILE Y  60   ? O ILE j 60   
AD4 29 30 O SER Y  59   ? O SER j 59   N MET X  80   ? N MET i 80   
AD4 30 31 O THR X  81   ? O THR i 81   N ARG X  18   ? N ARG i 18   
AD4 31 32 N CYS X  19   ? N CYS i 19   O PHE X  27   ? O PHE i 27   
AD4 32 33 N THR X  30   ? N THR i 30   O CYS X  43   ? O CYS i 43   
AD4 33 34 N LEU X  42   ? N LEU i 42   O VAL X  70   ? O VAL i 70   
AD4 34 35 O LEU X  71   ? O LEU i 71   N LEU W  71   ? N LEU h 71   
AD4 35 36 O ILE W  72   ? O ILE h 72   N THR W  19   ? N THR h 19   
AD5 1  2  N VAL EA 119  ? N VAL v 119  O SER EA 222  ? O SER v 222  
AD6 1  2  N ARG EA 148  ? N ARG v 148  O ALA EA 172  ? O ALA v 172  
AD6 2  3  N GLN EA 167  ? N GLN v 167  O VAL EA 183  ? O VAL v 183  
AD7 1  2  N GLU FA 280  ? N GLU w 280  O ARG FA 284  ? O ARG w 284  
AD8 1  2  N TYR FA 406  ? N TYR w 406  O TYR FA 416  ? O TYR w 416  
AD9 1  2  N LYS GA 413  ? N LYS 1 413  O VAL KA 50   ? O VAL 5 50   
AD9 2  3  N ARG KA 46   ? N ARG 5 46   O VAL KA 63   ? O VAL 5 63   
AD9 3  4  O ALA KA 60   ? O ALA 5 60   N ILE KA 23   ? N ILE 5 23   
AD9 4  5  N TYR KA 22   ? N TYR 5 22   O LEU KA 90   ? O LEU 5 90   
AE1 1  2  N LYS HA 649  ? N LYS 2 649  O THR HA 689  ? O THR 2 689  
AE2 1  2  N THR IA 1107 ? N THR 3 1107 O SER IA 1116 ? O SER 3 1116 
AE2 2  3  N TYR IA 1119 ? N TYR 3 1119 O GLY IA 1127 ? O GLY 3 1127 
AE2 3  4  O ILE IA 1128 ? O ILE 3 1128 N LEU IA 6    ? N LEU 3 6    
AE2 4  5  N ASN IA 5    ? N ASN 3 5    O ILE IA 1174 ? O ILE 3 1174 
AE3 1  2  N SER IA 15   ? N SER 3 15   O SER IA 33   ? O SER 3 33   
AE3 2  3  N ILE IA 30   ? N ILE 3 30   O LEU IA 41   ? O LEU 3 41   
AE3 3  4  N ARG IA 42   ? N ARG 3 42   O HIS IA 51   ? O HIS 3 51   
AE4 1  2  N MET IA 66   ? N MET 3 66   O VAL IA 79   ? O VAL 3 79   
AE4 2  3  N ILE IA 78   ? N ILE 3 78   O LEU IA 90   ? O LEU 3 90   
AE4 3  4  N ILE IA 87   ? N ILE 3 87   O GLU IA 105  ? O GLU 3 105  
AE5 1  2  N ALA IA 122  ? N ALA 3 122  O MET IA 131  ? O MET 3 131  
AE5 2  3  N VAL IA 130  ? N VAL 3 130  O TYR IA 142  ? O TYR 3 142  
AE5 3  4  N ASN IA 145  ? N ASN 3 145  O THR IA 153  ? O THR 3 153  
AE6 1  2  N LEU IA 166  ? N LEU 3 166  O MET IA 187  ? O MET 3 187  
AE6 2  3  N CYS IA 184  ? N CYS 3 184  O THR IA 209  ? O THR 3 209  
AE6 3  4  N LEU IA 208  ? N LEU 3 208  O GLU IA 226  ? O GLU 3 226  
AE7 1  2  N PHE IA 234  ? N PHE 3 234  O CYS IA 251  ? O CYS 3 251  
AE7 2  3  N ILE IA 250  ? N ILE 3 250  O THR IA 257  ? O THR 3 257  
AE7 3  4  N TYR IA 258  ? N TYR 3 258  O ILE IA 267  ? O ILE 3 267  
AE8 1  2  N HIS IA 293  ? N HIS 3 293  O PHE IA 300  ? O PHE 3 300  
AE8 2  3  N PHE IA 301  ? N PHE 3 301  O ILE IA 313  ? O ILE 3 313  
AE8 3  4  N ASP IA 318  ? N ASP 3 318  O MET IA 321  ? O MET 3 321  
AE8 4  5  N LEU IA 327  ? N LEU 3 327  O PHE IA 373  ? O PHE 3 373  
AE9 1  2  N ALA IA 338  ? N ALA 3 338  O ALA IA 350  ? O ALA 3 350  
AE9 2  3  N LEU IA 347  ? N LEU 3 347  O TYR IA 359  ? O TYR 3 359  
AE9 3  4  N GLN IA 360  ? N GLN 3 360  O VAL IA 396  ? O VAL 3 396  
AF1 1  2  N ALA IA 413  ? N ALA 3 413  O GLN IA 422  ? O GLN 3 422  
AF1 2  3  N VAL IA 425  ? N VAL 3 425  O ARG IA 436  ? O ARG 3 436  
AF1 3  4  N LEU IA 435  ? N LEU 3 435  O PHE IA 779  ? O PHE 3 779  
AF2 1  2  N VAL IA 704  ? N VAL 3 704  O ALA IA 711  ? O ALA 3 711  
AF2 2  3  N ALA IA 714  ? N ALA 3 714  O TRP IA 720  ? O TRP 3 720  
AF2 3  4  N LEU IA 721  ? N LEU 3 721  O THR IA 732  ? O THR 3 732  
AF2 4  5  O SER IA 735  ? O SER 3 735  N LEU IA 442  ? N LEU 3 442  
AF2 5  6  N ALA IA 448  ? N ALA 3 448  O ILE IA 764  ? O ILE 3 764  
AF2 6  7  O ARG IA 763  ? O ARG 3 763  N ALA IA 756  ? N ALA 3 756  
AF2 7  8  O ILE IA 757  ? O ILE 3 757  N PHE IA 741  ? N PHE 3 741  
AF3 1  2  N VAL IA 462  ? N VAL 3 462  O TYR IA 473  ? O TYR 3 473  
AF3 2  3  N ILE IA 474  ? N ILE 3 474  O LEU IA 485  ? O LEU 3 485  
AF3 3  4  N SER IA 486  ? N SER 3 486  O GLU IA 492  ? O GLU 3 492  
AF4 1  2  N SER IA 507  ? N SER 3 507  O VAL IA 519  ? O VAL 3 519  
AF4 2  3  N LEU IA 516  ? N LEU 3 516  O ILE IA 527  ? O ILE 3 527  
AF4 3  4  N HIS IA 526  ? N HIS 3 526  O ASN IA 534  ? O ASN 3 534  
AF5 1  2  N VAL IA 545  ? N VAL 3 545  O ALA IA 557  ? O ALA 3 557  
AF5 2  3  N ILE IA 556  ? N ILE 3 556  O VAL IA 564  ? O VAL 3 564  
AF6 1  2  N VAL IA 607  ? N VAL 3 607  O ARG IA 615  ? O ARG 3 615  
AF6 2  3  N VAL IA 614  ? N VAL 3 614  O GLN IA 631  ? O GLN 3 631  
AF7 1  2  N GLU IA 638  ? N GLU 3 638  O GLY IA 668  ? O GLY 3 668  
AF7 2  3  N ILE IA 667  ? N ILE 3 667  O LEU IA 675  ? O LEU 3 675  
AF7 3  4  N LEU IA 674  ? N LEU 3 674  O THR IA 689  ? O THR 3 689  
AF8 1  2  N LYS IA 787  ? N LYS 3 787  O ILE IA 800  ? O ILE 3 800  
AF8 2  3  N LEU IA 797  ? N LEU 3 797  O MET IA 869  ? O MET 3 869  
AF8 3  4  N VAL IA 868  ? N VAL 3 868  O LEU IA 877  ? O LEU 3 877  
AF9 1  2  N SER IA 890  ? N SER 3 890  O GLY IA 908  ? O GLY 3 908  
AF9 2  3  N VAL IA 909  ? N VAL 3 909  O PHE IA 924  ? O PHE 3 924  
AF9 3  4  N THR IA 927  ? N THR 3 927  O LEU IA 940  ? O LEU 3 940  
AG1 1  2  N PHE IA 955  ? N PHE 3 955  O ARG IA 958  ? O ARG 3 958  
AG1 2  3  N ILE IA 961  ? N ILE 3 961  O ARG IA 968  ? O ARG 3 968  
AG1 3  4  N VAL IA 969  ? N VAL 3 969  O LYS IA 980  ? O LYS 3 980  
AG2 1  2  N GLN IA 994  ? N GLN 3 994  O ILE IA 1001 ? O ILE 3 1001 
AG2 2  3  N VAL IA 1002 ? N VAL 3 1002 O ILE IA 1010 ? O ILE 3 1010 
AG2 3  4  N TRP IA 1011 ? N TRP 3 1011 O ALA IA 1025 ? O ALA 3 1025 
AG3 1  2  N THR IA 1034 ? N THR 3 1034 O ALA IA 1047 ? O ALA 3 1047 
AG3 2  3  N GLY IA 1046 ? N GLY 3 1046 O CYS IA 1054 ? O CYS 3 1054 
AG3 3  4  N ILE IA 1053 ? N ILE 3 1053 O TYR IA 1095 ? O TYR 3 1095 
AG4 1  2  N ASN JA 41   ? N ASN 4 41   O GLU JA 60   ? O GLU 4 60   
AG4 2  3  O GLY JA 57   ? O GLY 4 57   N VAL JA 17   ? N VAL 4 17   
AG4 3  4  N TYR JA 16   ? N TYR 4 16   O ASN JA 87   ? O ASN 4 87   
AG4 4  5  O ILE JA 84   ? O ILE 4 84   N ILE JA 77   ? N ILE 4 77   
AG5 1  2  N ASP JA 47   ? N ASP 4 47   O GLN JA 52   ? O GLN 4 52   
AG6 1  2  N VAL KA 82   ? N VAL 5 82   O ARG KA 85   ? O ARG 5 85   
AG7 1  2  N ILE LA 9    ? N ILE 6 9    O VAL LA 89   ? O VAL 6 89   
AG8 1  2  N ALA LA 18   ? N ALA 6 18   O ILE LA 45   ? O ILE 6 45   
AG9 1  2  O VAL NA 631  ? O VAL J 631  N ARG NA 547  ? N ARG J 547  
AG9 2  3  N ILE NA 543  ? N ILE J 543  O GLY NA 636  ? O GLY J 636  
AH1 1  2  O VAL NA 631  ? O VAL J 631  N ARG NA 547  ? N ARG J 547  
AH1 2  3  N TYR NA 546  ? N TYR J 546  O VAL NA 582  ? O VAL J 582  
AH1 3  4  O GLU NA 585  ? O GLU J 585  N THR NA 570  ? N THR J 570  
AH1 4  5  N VAL NA 573  ? N VAL J 573  O LYS NA 647  ? O LYS J 647  
AH2 1  2  N ASN NA 610  ? N ASN J 610  O GLU NA 617  ? O GLU J 617  
AH3 1  2  N TYR OA 236  ? N TYR K 236  O ALA OA 249  ? O ALA K 249  
AH3 2  3  N LEU OA 246  ? N LEU K 246  O LEU OA 257  ? O LEU K 257  
AH3 3  4  N LEU OA 254  ? N LEU K 254  O LEU OA 269  ? O LEU K 269  
AH4 1  2  N GLY OA 277  ? N GLY K 277  O CYS OA 299  ? O CYS K 299  
AH4 2  3  N SER OA 298  ? N SER K 298  O LYS OA 306  ? O LYS K 306  
AH4 3  4  N LEU OA 307  ? N LEU K 307  O ALA OA 317  ? O ALA K 317  
AH5 1  2  N MET OA 330  ? N MET K 330  O GLY OA 339  ? O GLY K 339  
AH5 2  3  N LEU OA 338  ? N LEU K 338  O TRP OA 350  ? O TRP K 350  
AH5 3  4  N LEU OA 349  ? N LEU K 349  O ILE OA 358  ? O ILE K 358  
AH6 1  2  N ASP OA 370  ? N ASP K 370  O GLY OA 383  ? O GLY K 383  
AH6 2  3  N THR OA 382  ? N THR K 382  O ARG OA 390  ? O ARG K 390  
AH6 3  4  N GLY OA 389  ? N GLY K 389  O LEU OA 403  ? O LEU K 403  
AH7 1  2  N ASN OA 414  ? N ASN K 414  O ALA OA 423  ? O ALA K 423  
AH7 2  3  N THR OA 424  ? N THR K 424  O LYS OA 432  ? O LYS K 432  
AH7 3  4  N CYS OA 431  ? N CYS K 431  O ILE OA 445  ? O ILE K 445  
AH8 1  2  N LYS OA 456  ? N LYS K 456  O LEU OA 466  ? O LEU K 466  
AH8 2  3  N LEU OA 465  ? N LEU K 465  O TRP OA 477  ? O TRP K 477  
AH8 3  4  N ILE OA 476  ? N ILE K 476  O LEU OA 485  ? O LEU K 485  
AH9 1  2  N ASP OA 499  ? N ASP K 499  O ALA OA 508  ? O ALA K 508  
AH9 2  3  N ILE OA 507  ? N ILE K 507  O TRP OA 519  ? O TRP K 519  
AI1 1  2  N ARG RA 36   ? N ARG M 36   O SER RA 103  ? O SER M 103  
AI1 2  3  O VAL RA 104  ? O VAL M 104  N GLU RA 52   ? N GLU M 52   
AI1 3  4  N MET RA 56   ? N MET M 56   O VAL RA 83   ? O VAL M 83   
AI2 1  2  O VAL SA 57   ? O VAL O 57   N VAL SA 27   ? N VAL O 27   
AI2 2  3  N PHE SA 30   ? N PHE O 30   O THR SA 80   ? O THR O 80   
AI2 3  4  N PHE SA 85   ? N PHE O 85   O LYS SA 88   ? O LYS O 88   
AI3 1  2  N ASP SA 93   ? N ASP O 93   O VAL SA 130  ? O VAL O 130  
AI4 1  2  O PHE TA 143  ? O PHE W 143  N TYR TA 134  ? N TYR W 134  
AI4 2  3  N ALA TA 135  ? N ALA W 135  O LEU TA 165  ? O LEU W 165  
AI4 3  4  N ASN TA 166  ? N ASN W 166  O LYS TA 171  ? O LYS W 171  
AI4 4  5  N CYS TA 174  ? N CYS W 174  O TYR TA 179  ? O TYR W 179  
AI5 1  2  N SER TA 212  ? N SER W 212  O TYR TA 220  ? O TYR W 220  
AI6 1  2  O PHE TA 388  ? O PHE W 388  N ALA TA 367  ? N ALA W 367  
AI6 2  3  N GLU TA 368  ? N GLU W 368  O LYS TA 445  ? O LYS W 445  
AI7 1  2  N LEU TA 391  ? N LEU W 391  O ILE TA 451  ? O ILE W 451  
AI7 2  3  N PHE TA 452  ? N PHE W 452  O GLN TA 550  ? O GLN W 550  
AI7 3  4  O ILE TA 549  ? O ILE W 549  N ILE TA 503  ? N ILE W 503  
AI7 4  5  O TYR TA 497  ? O TYR W 497  N VAL TA 488  ? N VAL W 488  
AI8 1  2  N LEU TA 391  ? N LEU W 391  O ILE TA 451  ? O ILE W 451  
AI8 2  3  N PHE TA 452  ? N PHE W 452  O GLN TA 550  ? O GLN W 550  
AI8 3  4  O ILE TA 549  ? O ILE W 549  N ILE TA 503  ? N ILE W 503  
AI8 4  5  N VAL TA 504  ? N VAL W 504  O ARG TA 515  ? O ARG W 515  
AI8 5  6  N VAL TA 518  ? N VAL W 518  O TYR TA 527  ? O TYR W 527  
AI8 6  7  N GLU TA 528  ? N GLU W 528  O THR TA 535  ? O THR W 535  
AI9 1  2  O ARG VA 94   ? O ARG P 94   N GLU VA 72   ? N GLU P 72   
AI9 2  3  O MET VA 73   ? O MET P 73   N LYS VA 51   ? N LYS P 51   
AI9 3  4  O LEU VA 52   ? O LEU P 52   N ILE VA 44   ? N ILE P 44   
AI9 4  5  N LEU VA 43   ? N LEU P 43   O LEU VA 110  ? O LEU P 110  
AI9 5  6  N VAL VA 109  ? N VAL P 109  O LEU WA 63   ? O LEU Q 63   
AI9 6  7  O VAL WA 62   ? O VAL Q 62   N LEU WA 44   ? N LEU Q 44   
AI9 7  8  N ILE WA 51   ? N ILE Q 51   O ALA WA 54   ? O ALA Q 54   
AJ1 1  2  O ARG VA 94   ? O ARG P 94   N GLU VA 72   ? N GLU P 72   
AJ1 2  3  O MET VA 73   ? O MET P 73   N LYS VA 51   ? N LYS P 51   
AJ1 3  4  O LEU VA 52   ? O LEU P 52   N ILE VA 44   ? N ILE P 44   
AJ1 4  5  N LEU VA 43   ? N LEU P 43   O LEU VA 110  ? O LEU P 110  
AJ1 5  6  N VAL VA 109  ? N VAL P 109  O LEU WA 63   ? O LEU Q 63   
AJ1 6  7  O VAL WA 62   ? O VAL Q 62   N LEU WA 44   ? N LEU Q 44   
AJ1 7  8  O TYR WA 50   ? O TYR Q 50   N GLU WA 28   ? N GLU Q 28   
AJ1 8  9  O TYR WA 29   ? O TYR Q 29   N VAL WA 21   ? N VAL Q 21   
AJ1 9  10 N MET WA 20   ? N MET Q 20   O ARG WA 73   ? O ARG Q 73   
AJ1 10 11 N ILE WA 72   ? N ILE Q 72   O MET XA 78   ? O MET R 78   
AJ1 11 12 O LEU XA 74   ? O LEU R 74   N ALA XA 61   ? N ALA R 61   
AJ1 12 13 O ASP XA 59   ? O ASP R 59   N CYS XA 46   ? N CYS R 46   
AJ1 13 14 O ILE XA 43   ? O ILE R 43   N LEU XA 35   ? N LEU R 35   
AJ1 14 15 N TRP XA 34   ? N TRP R 34   O GLN XA 88   ? O GLN R 88   
AJ1 15 16 N LEU XA 87   ? N LEU R 87   O VAL YA 61   ? O VAL S 61   
AJ1 16 17 O GLY YA 58   ? O GLY S 58   N GLU YA 44   ? N GLU S 44   
AJ1 17 18 O ASP YA 43   ? O ASP S 43   N ILE YA 30   ? N ILE S 30   
AJ1 18 19 O VAL YA 27   ? O VAL S 27   N LEU YA 19   ? N LEU S 19   
AJ1 19 20 N SER YA 18   ? N SER S 18   O GLU YA 71   ? O GLU S 71   
AJ1 20 21 N LEU YA 70   ? N LEU S 70   O TYR ZA 62   ? O TYR T 62   
AJ1 21 22 O ALA ZA 56   ? O ALA T 56   N VAL ZA 48   ? N VAL T 48   
AJ1 22 23 O GLN ZA 42   ? O GLN T 42   N ILE ZA 33   ? N ILE T 33   
AJ1 23 24 O TYR ZA 28   ? O TYR T 28   N CYS ZA 20   ? N CYS T 20   
AJ1 24 25 N THR ZA 19   ? N THR T 19   O ILE ZA 72   ? O ILE T 72   
AJ1 25 26 N LEU ZA 71   ? N LEU T 71   O LEU AB 71   ? O LEU U 71   
AJ1 26 27 O GLY AB 68   ? O GLY U 68   N CYS AB 45   ? N CYS U 45   
AJ1 27 28 O CYS AB 43   ? O CYS U 43   N THR AB 30   ? N THR U 30   
AJ1 28 29 O PHE AB 27   ? O PHE U 27   N CYS AB 19   ? N CYS U 19   
AJ1 29 30 N ARG AB 18   ? N ARG U 18   O THR AB 81   ? O THR U 81   
AJ1 30 31 N MET AB 80   ? N MET U 80   O SER BB 59   ? O SER V 59   
AJ1 31 32 O GLU BB 56   ? O GLU V 56   N ALA BB 42   ? N ALA V 42   
AJ1 32 33 O LYS BB 44   ? O LYS V 44   N HIS BB 26   ? N HIS V 26   
AJ1 33 34 O VAL BB 25   ? O VAL V 25   N ILE BB 17   ? N ILE V 17   
AJ1 34 35 N GLU BB 18   ? N GLU V 18   O TYR BB 67   ? O TYR V 67   
AJ2 1  2  N THR CB 380  ? N THR X 380  O TYR CB 628  ? O TYR X 628  
AJ2 2  3  O VAL CB 627  ? O VAL X 627  N VAL CB 434  ? N VAL X 434  
AJ2 3  4  N ILE CB 431  ? N ILE X 431  O MET CB 604  ? O MET X 604  
AJ2 4  5  O PHE CB 605  ? O PHE X 605  N LEU CB 548  ? N LEU X 548  
AJ2 5  6  O VAL CB 547  ? O VAL X 547  N LEU CB 474  ? N LEU X 474  
AJ2 6  7  N ILE CB 473  ? N ILE X 473  O VAL CB 522  ? O VAL X 522  
AJ2 7  8  O ILE CB 523  ? O ILE X 523  N VAL CB 502  ? N VAL X 502  
AJ3 1  2  N LYS CB 642  ? N LYS X 642  O ALA CB 764  ? O ALA X 764  
AJ3 2  3  O ILE CB 765  ? O ILE X 765  N ASN CB 738  ? N ASN X 738  
AJ3 3  4  O VAL CB 737  ? O VAL X 737  N PHE CB 670  ? N PHE X 670  
AJ3 4  5  N ILE CB 669  ? N ILE X 669  O LEU CB 718  ? O LEU X 718  
AJ3 5  6  O VAL CB 719  ? O VAL X 719  N CYS CB 692  ? N CYS X 692  
AJ4 1  2  O PHE DB 128  ? O PHE A 128  N LEU DB 119  ? N LEU A 119  
AJ4 2  3  N TYR DB 120  ? N TYR A 120  O GLN DB 483  ? O GLN A 483  
AJ5 1  2  N TRP DB 228  ? N TRP A 228  O GLY DB 416  ? O GLY A 416  
AJ6 1  2  N HIS DB 517  ? N HIS A 517  O LYS DB 525  ? O LYS A 525  
AJ7 1  2  N GLU DB 897  ? N GLU A 897  O VAL DB 908  ? O VAL A 908  
AJ8 1  2  N CYS DB 1089 ? N CYS A 1089 O HIS DB 1096 ? O HIS A 1096 
AJ8 2  3  O PHE DB 1101 ? O PHE A 1101 N CYS DB 973  ? N CYS A 973  
AJ8 3  4  N MET DB 976  ? N MET A 976  O SER DB 1176 ? O SER A 1176 
AJ9 1  2  N ILE DB 1017 ? N ILE A 1017 O HIS DB 1024 ? O HIS A 1024 
AK1 1  2  N GLU DB 1193 ? N GLU A 1193 O ARG DB 1231 ? O ARG A 1231 
AK2 1  2  N LEU DB 1197 ? N LEU A 1197 O GLN DB 1227 ? O GLN A 1227 
AK2 2  3  O ALA DB 1226 ? O ALA A 1226 N LEU DB 1216 ? N LEU A 1216 
AK3 1  2  N THR DB 1346 ? N THR A 1346 O GLY DB 1349 ? O GLY A 1349 
AK4 1  2  N GLN DB 1610 ? N GLN A 1610 O LEU DB 1630 ? O LEU A 1630 
AK4 2  3  N LEU DB 1631 ? N LEU A 1631 O TYR DB 1660 ? O TYR A 1660 
AK4 3  4  N ASP DB 1663 ? N ASP A 1663 O VAL DB 1701 ? O VAL A 1701 
AK4 4  5  N ASP DB 1706 ? N ASP A 1706 O LEU DB 1711 ? O LEU A 1711 
AK4 5  6  O GLY DB 1716 ? O GLY A 1716 N SER DB 1643 ? N SER A 1643 
AK5 1  2  N GLN DB 1610 ? N GLN A 1610 O LEU DB 1630 ? O LEU A 1630 
AK5 2  3  N LEU DB 1631 ? N LEU A 1631 O TYR DB 1660 ? O TYR A 1660 
AK5 3  4  N ASP DB 1663 ? N ASP A 1663 O VAL DB 1701 ? O VAL A 1701 
AK5 4  5  O ILE DB 1705 ? O ILE A 1705 N ARG DB 1667 ? N ARG A 1667 
AK6 1  2  O VAL DB 1883 ? O VAL A 1883 N ILE DB 1861 ? N ILE A 1861 
AK6 2  3  O ILE DB 1862 ? O ILE A 1862 N TRP DB 1778 ? N TRP A 1778 
AK6 3  4  N PHE DB 1779 ? N PHE A 1779 O PHE DB 1810 ? O PHE A 1810 
AK6 4  5  N GLY DB 1805 ? N GLY A 1805 O ILE DB 1822 ? O ILE A 1822 
AK6 5  6  N LEU DB 1817 ? N LEU A 1817 O PHE DB 1917 ? O PHE A 1917 
AK7 1  2  N TYR DB 2091 ? N TYR A 2091 O LEU DB 2225 ? O LEU A 2225 
AK7 2  3  O THR DB 2224 ? O THR A 2224 N SER DB 2217 ? N SER A 2217 
AK7 3  4  O ILE DB 2212 ? O ILE A 2212 N LEU DB 2175 ? N LEU A 2175 
AK7 4  5  O ILE DB 2178 ? O ILE A 2178 N GLY DB 2126 ? N GLY A 2126 
AK7 5  6  N TYR DB 2127 ? N TYR A 2127 O VAL DB 2146 ? O VAL A 2146 
AK7 6  7  O ILE DB 2142 ? O ILE A 2142 N ILE DB 2105 ? N ILE A 2105 
AK7 7  8  N LEU DB 2106 ? N LEU A 2106 O LEU DB 2262 ? O LEU A 2262 
AK8 1  2  O GLU DB 2257 ? O GLU A 2257 N LYS DB 2229 ? N LYS A 2229 
AK8 2  3  O THR DB 2224 ? O THR A 2224 N SER DB 2217 ? N SER A 2217 
AK8 3  4  O ILE DB 2212 ? O ILE A 2212 N LEU DB 2175 ? N LEU A 2175 
AK8 4  5  O ILE DB 2178 ? O ILE A 2178 N GLY DB 2126 ? N GLY A 2126 
AK8 5  6  N TYR DB 2127 ? N TYR A 2127 O VAL DB 2146 ? O VAL A 2146 
AK8 6  7  N ILE DB 2145 ? N ILE A 2145 O PHE DB 2270 ? O PHE A 2270 
AK8 7  8  N VAL DB 2273 ? N VAL A 2273 O GLN DB 2297 ? O GLN A 2297 
AK9 1  2  N TRP DB 2151 ? N TRP A 2151 O HIS DB 2158 ? O HIS A 2158 
AL1 1  2  N VAL EB 186  ? N VAL C 186  O ILE EB 202  ? O ILE C 202  
AL1 2  3  O ASN EB 201  ? O ASN C 201  N VAL EB 132  ? N VAL C 132  
AL1 3  4  N THR EB 133  ? N THR C 133  O VAL EB 226  ? O VAL C 226  
AL1 4  5  N LEU EB 227  ? N LEU C 227  O THR EB 254  ? O THR C 254  
AL1 5  6  N ILE EB 257  ? N ILE C 257  O CYS EB 308  ? O CYS C 308  
AL1 6  7  N SER EB 311  ? N SER C 311  O ILE EB 316  ? O ILE C 316  
AL2 1  2  O GLN EB 523  ? O GLN C 523  N VAL EB 509  ? N VAL C 509  
AL2 2  3  N LYS EB 508  ? N LYS C 508  O THR EB 566  ? O THR C 566  
AL2 3  4  O ALA EB 563  ? O ALA C 563  N THR EB 478  ? N THR C 478  
AL2 4  5  N TYR EB 482  ? N TYR C 482  O HIS EB 491  ? O HIS C 491  
AL2 5  6  N ALA EB 492  ? N ALA C 492  O ILE EB 552  ? O ILE C 552  
AL2 6  7  O LEU EB 551  ? O LEU C 551  N TRP EB 531  ? N TRP C 531  
AL2 7  8  N ILE EB 532  ? N ILE C 532  O ILE EB 539  ? O ILE C 539  
AL3 1  2  N ILE EB 501  ? N ILE C 501  O VAL EB 544  ? O VAL C 544  
AL4 1  2  N LYS EB 620  ? N LYS C 620  O VAL EB 628  ? O VAL C 628  
AL4 2  3  O HIS EB 627  ? O HIS C 627  N VAL EB 592  ? N VAL C 592  
AL4 3  4  N GLU EB 593  ? N GLU C 593  O LYS EB 654  ? O LYS C 654  
AL5 1  2  N LYS EB 620  ? N LYS C 620  O VAL EB 628  ? O VAL C 628  
AL5 2  3  O HIS EB 627  ? O HIS C 627  N VAL EB 592  ? N VAL C 592  
AL5 3  4  N LYS EB 589  ? N LYS C 589  O VAL EB 659  ? O VAL C 659  
AL6 1  2  N LYS EB 684  ? N LYS C 684  O VAL EB 795  ? O VAL C 795  
AL6 2  3  O PHE EB 789  ? O PHE C 789  N ILE EB 744  ? N ILE C 744  
AL6 3  4  O LEU EB 745  ? O LEU C 745  N ALA EB 734  ? N ALA C 734  
AL7 1  2  N ALA EB 861  ? N ALA C 861  O THR EB 870  ? O THR C 870  
AL7 2  3  O ALA EB 873  ? O ALA C 873  N VAL EB 834  ? N VAL C 834  
AL7 3  4  N TYR EB 831  ? N TYR C 831  O HIS EB 903  ? O HIS C 903  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software C GTP 1500 ? 12 'binding site for residue GTP C 1500' 
AC2 Software C MG  1501 ? 1  'binding site for residue MG C 1501'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 HIS EB 139 ? HIS C 139  . ? 1_555 ? 
2  AC1 12 GLY EB 141 ? GLY C 141  . ? 1_555 ? 
3  AC1 12 LYS EB 142 ? LYS C 142  . ? 1_555 ? 
4  AC1 12 THR EB 143 ? THR C 143  . ? 1_555 ? 
5  AC1 12 CYS EB 144 ? CYS C 144  . ? 1_555 ? 
6  AC1 12 GLY EB 180 ? GLY C 180  . ? 1_555 ? 
7  AC1 12 GLY EB 207 ? GLY C 207  . ? 1_555 ? 
8  AC1 12 LYS EB 259 ? LYS C 259  . ? 1_555 ? 
9  AC1 12 SER EB 311 ? SER C 311  . ? 1_555 ? 
10 AC1 12 SER EB 312 ? SER C 312  . ? 1_555 ? 
11 AC1 12 GLN EB 313 ? GLN C 313  . ? 1_555 ? 
12 AC1 12 MG  HB .   ? MG  C 1501 . ? 1_555 ? 
13 AC2 1  GTP GB .   ? GTP C 1500 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6AH0 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     P  P     . A   A  1  3    ? 244.708 253.132 153.719 1.00 50.00  ? 3    A   B P     1 
ATOM   2     O  OP1   . A   A  1  3    ? 246.141 253.494 153.558 1.00 50.00  ? 3    A   B OP1   1 
ATOM   3     O  OP2   . A   A  1  3    ? 244.099 253.137 155.072 1.00 50.00  ? 3    A   B OP2   1 
ATOM   4     O  "O5'" . A   A  1  3    ? 243.851 254.104 152.791 1.00 50.00  ? 3    A   B "O5'" 1 
ATOM   5     C  "C5'" . A   A  1  3    ? 242.545 254.511 153.172 1.00 50.00  ? 3    A   B "C5'" 1 
ATOM   6     C  "C4'" . A   A  1  3    ? 242.369 256.000 153.026 1.00 50.00  ? 3    A   B "C4'" 1 
ATOM   7     O  "O4'" . A   A  1  3    ? 241.029 256.378 153.433 1.00 50.00  ? 3    A   B "O4'" 1 
ATOM   8     C  "C3'" . A   A  1  3    ? 243.277 256.863 153.887 1.00 50.00  ? 3    A   B "C3'" 1 
ATOM   9     O  "O3'" . A   A  1  3    ? 244.565 257.034 153.322 1.00 50.00  ? 3    A   B "O3'" 1 
ATOM   10    C  "C2'" . A   A  1  3    ? 242.489 258.161 154.013 1.00 50.00  ? 3    A   B "C2'" 1 
ATOM   11    O  "O2'" . A   A  1  3    ? 242.640 258.954 152.845 1.00 50.00  ? 3    A   B "O2'" 1 
ATOM   12    C  "C1'" . A   A  1  3    ? 241.053 257.641 154.064 1.00 50.00  ? 3    A   B "C1'" 1 
ATOM   13    N  N9    . A   A  1  3    ? 240.554 257.486 155.444 1.00 50.00  ? 3    A   B N9    1 
ATOM   14    C  C8    . A   A  1  3    ? 240.204 256.320 156.077 1.00 50.00  ? 3    A   B C8    1 
ATOM   15    N  N7    . A   A  1  3    ? 239.783 256.490 157.307 1.00 50.00  ? 3    A   B N7    1 
ATOM   16    C  C5    . A   A  1  3    ? 239.857 257.864 157.495 1.00 50.00  ? 3    A   B C5    1 
ATOM   17    C  C6    . A   A  1  3    ? 239.549 258.684 158.594 1.00 50.00  ? 3    A   B C6    1 
ATOM   18    N  N6    . A   A  1  3    ? 239.089 258.222 159.758 1.00 50.00  ? 3    A   B N6    1 
ATOM   19    N  N1    . A   A  1  3    ? 239.736 260.016 158.455 1.00 50.00  ? 3    A   B N1    1 
ATOM   20    C  C2    . A   A  1  3    ? 240.199 260.480 157.288 1.00 50.00  ? 3    A   B C2    1 
ATOM   21    N  N3    . A   A  1  3    ? 240.523 259.809 156.185 1.00 50.00  ? 3    A   B N3    1 
ATOM   22    C  C4    . A   A  1  3    ? 240.327 258.490 156.354 1.00 50.00  ? 3    A   B C4    1 
ATOM   23    P  P     . C   A  1  4    ? 245.815 257.431 154.250 1.00 50.00  ? 4    C   B P     1 
ATOM   24    O  OP1   . C   A  1  4    ? 247.014 256.720 153.738 1.00 50.00  ? 4    C   B OP1   1 
ATOM   25    O  OP2   . C   A  1  4    ? 245.408 257.257 155.668 1.00 50.00  ? 4    C   B OP2   1 
ATOM   26    O  "O5'" . C   A  1  4    ? 246.014 258.990 153.983 1.00 50.00  ? 4    C   B "O5'" 1 
ATOM   27    C  "C5'" . C   A  1  4    ? 246.246 259.484 152.671 1.00 50.00  ? 4    C   B "C5'" 1 
ATOM   28    C  "C4'" . C   A  1  4    ? 246.215 260.990 152.640 1.00 50.00  ? 4    C   B "C4'" 1 
ATOM   29    O  "O4'" . C   A  1  4    ? 244.907 261.457 153.063 1.00 50.00  ? 4    C   B "O4'" 1 
ATOM   30    C  "C3'" . C   A  1  4    ? 247.187 261.690 153.581 1.00 50.00  ? 4    C   B "C3'" 1 
ATOM   31    O  "O3'" . C   A  1  4    ? 248.489 261.804 153.033 1.00 50.00  ? 4    C   B "O3'" 1 
ATOM   32    C  "C2'" . C   A  1  4    ? 246.512 263.034 153.828 1.00 50.00  ? 4    C   B "C2'" 1 
ATOM   33    O  "O2'" . C   A  1  4    ? 246.746 263.919 152.742 1.00 50.00  ? 4    C   B "O2'" 1 
ATOM   34    C  "C1'" . C   A  1  4    ? 245.035 262.641 153.822 1.00 50.00  ? 4    C   B "C1'" 1 
ATOM   35    N  N1    . C   A  1  4    ? 244.505 262.383 155.181 1.00 50.00  ? 4    C   B N1    1 
ATOM   36    C  C2    . C   A  1  4    ? 244.281 263.445 156.064 1.00 50.00  ? 4    C   B C2    1 
ATOM   37    O  O2    . C   A  1  4    ? 244.544 264.601 155.699 1.00 50.00  ? 4    C   B O2    1 
ATOM   38    N  N3    . C   A  1  4    ? 243.789 263.184 157.298 1.00 50.00  ? 4    C   B N3    1 
ATOM   39    C  C4    . C   A  1  4    ? 243.516 261.929 157.659 1.00 50.00  ? 4    C   B C4    1 
ATOM   40    N  N4    . C   A  1  4    ? 243.032 261.714 158.884 1.00 50.00  ? 4    C   B N4    1 
ATOM   41    C  C5    . C   A  1  4    ? 243.726 260.829 156.779 1.00 50.00  ? 4    C   B C5    1 
ATOM   42    C  C6    . C   A  1  4    ? 244.213 261.102 155.564 1.00 50.00  ? 4    C   B C6    1 
ATOM   43    P  P     . U   A  1  5    ? 249.782 261.742 153.987 1.00 50.00  ? 5    U   B P     1 
ATOM   44    O  OP1   . U   A  1  5    ? 250.976 261.536 153.126 1.00 50.00  ? 5    U   B OP1   1 
ATOM   45    O  OP2   . U   A  1  5    ? 249.496 260.787 155.087 1.00 50.00  ? 5    U   B OP2   1 
ATOM   46    O  "O5'" . U   A  1  5    ? 249.874 263.204 154.614 1.00 50.00  ? 5    U   B "O5'" 1 
ATOM   47    C  "C5'" . U   A  1  5    ? 250.091 264.345 153.793 1.00 50.00  ? 5    U   B "C5'" 1 
ATOM   48    C  "C4'" . U   A  1  5    ? 249.918 265.621 154.575 1.00 50.00  ? 5    U   B "C4'" 1 
ATOM   49    O  "O4'" . U   A  1  5    ? 248.562 265.699 155.083 1.00 50.00  ? 5    U   B "O4'" 1 
ATOM   50    C  "C3'" . U   A  1  5    ? 250.792 265.761 155.814 1.00 50.00  ? 5    U   B "C3'" 1 
ATOM   51    O  "O3'" . U   A  1  5    ? 252.094 266.239 155.512 1.00 50.00  ? 5    U   B "O3'" 1 
ATOM   52    C  "C2'" . U   A  1  5    ? 249.986 266.706 156.695 1.00 50.00  ? 5    U   B "C2'" 1 
ATOM   53    O  "O2'" . U   A  1  5    ? 250.165 268.052 156.281 1.00 50.00  ? 5    U   B "O2'" 1 
ATOM   54    C  "C1'" . U   A  1  5    ? 248.554 266.286 156.367 1.00 50.00  ? 5    U   B "C1'" 1 
ATOM   55    N  N1    . U   A  1  5    ? 248.011 265.297 157.327 1.00 50.00  ? 5    U   B N1    1 
ATOM   56    C  C2    . U   A  1  5    ? 247.534 265.743 158.546 1.00 50.00  ? 5    U   B C2    1 
ATOM   57    O  O2    . U   A  1  5    ? 247.551 266.917 158.877 1.00 50.00  ? 5    U   B O2    1 
ATOM   58    N  N3    . U   A  1  5    ? 247.037 264.759 159.369 1.00 50.00  ? 5    U   B N3    1 
ATOM   59    C  C4    . U   A  1  5    ? 246.966 263.406 159.098 1.00 50.00  ? 5    U   B C4    1 
ATOM   60    O  O4    . U   A  1  5    ? 246.493 262.631 159.930 1.00 50.00  ? 5    U   B O4    1 
ATOM   61    C  C5    . U   A  1  5    ? 247.474 263.029 157.817 1.00 50.00  ? 5    U   B C5    1 
ATOM   62    C  C6    . U   A  1  5    ? 247.961 263.962 156.998 1.00 50.00  ? 5    U   B C6    1 
ATOM   63    P  P     . C   A  1  6    ? 253.350 265.802 156.413 1.00 50.00  ? 6    C   B P     1 
ATOM   64    O  OP1   . C   A  1  6    ? 254.589 266.131 155.662 1.00 50.00  ? 6    C   B OP1   1 
ATOM   65    O  OP2   . C   A  1  6    ? 253.120 264.411 156.879 1.00 50.00  ? 6    C   B OP2   1 
ATOM   66    O  "O5'" . C   A  1  6    ? 253.273 266.764 157.681 1.00 50.00  ? 6    C   B "O5'" 1 
ATOM   67    C  "C5'" . C   A  1  6    ? 253.313 268.177 157.537 1.00 50.00  ? 6    C   B "C5'" 1 
ATOM   68    C  "C4'" . C   A  1  6    ? 252.888 268.868 158.806 1.00 50.00  ? 6    C   B "C4'" 1 
ATOM   69    O  "O4'" . C   A  1  6    ? 251.511 268.521 159.107 1.00 50.00  ? 6    C   B "O4'" 1 
ATOM   70    C  "C3'" . C   A  1  6    ? 253.657 268.475 160.059 1.00 50.00  ? 6    C   B "C3'" 1 
ATOM   71    O  "O3'" . C   A  1  6    ? 254.879 269.180 160.197 1.00 50.00  ? 6    C   B "O3'" 1 
ATOM   72    C  "C2'" . C   A  1  6    ? 252.658 268.756 161.176 1.00 50.00  ? 6    C   B "C2'" 1 
ATOM   73    O  "O2'" . C   A  1  6    ? 252.630 270.140 161.489 1.00 50.00  ? 6    C   B "O2'" 1 
ATOM   74    C  "C1'" . C   A  1  6    ? 251.336 268.387 160.501 1.00 50.00  ? 6    C   B "C1'" 1 
ATOM   75    N  N1    . C   A  1  6    ? 250.918 266.992 160.784 1.00 50.00  ? 6    C   B N1    1 
ATOM   76    C  C2    . C   A  1  6    ? 250.201 266.704 161.951 1.00 50.00  ? 6    C   B C2    1 
ATOM   77    O  O2    . C   A  1  6    ? 249.932 267.612 162.749 1.00 50.00  ? 6    C   B O2    1 
ATOM   78    N  N3    . C   A  1  6    ? 249.820 265.429 162.192 1.00 50.00  ? 6    C   B N3    1 
ATOM   79    C  C4    . C   A  1  6    ? 250.120 264.464 161.321 1.00 50.00  ? 6    C   B C4    1 
ATOM   80    N  N4    . C   A  1  6    ? 249.723 263.220 161.597 1.00 50.00  ? 6    C   B N4    1 
ATOM   81    C  C5    . C   A  1  6    ? 250.842 264.727 160.124 1.00 50.00  ? 6    C   B C5    1 
ATOM   82    C  C6    . C   A  1  6    ? 251.213 265.992 159.902 1.00 50.00  ? 6    C   B C6    1 
ATOM   83    P  P     . U   A  1  7    ? 255.999 268.670 161.229 1.00 50.00  ? 7    U   B P     1 
ATOM   84    O  OP1   . U   A  1  7    ? 257.278 269.343 160.892 1.00 50.00  ? 7    U   B OP1   1 
ATOM   85    O  OP2   . U   A  1  7    ? 255.940 267.186 161.276 1.00 50.00  ? 7    U   B OP2   1 
ATOM   86    O  "O5'" . U   A  1  7    ? 255.504 269.227 162.637 1.00 50.00  ? 7    U   B "O5'" 1 
ATOM   87    C  "C5'" . U   A  1  7    ? 256.045 268.722 163.848 1.00 50.00  ? 7    U   B "C5'" 1 
ATOM   88    C  "C4'" . U   A  1  7    ? 254.960 268.415 164.848 1.00 50.00  ? 7    U   B "C4'" 1 
ATOM   89    O  "O4'" . U   A  1  7    ? 253.835 267.790 164.175 1.00 50.00  ? 7    U   B "O4'" 1 
ATOM   90    C  "C3'" . U   A  1  7    ? 255.332 267.429 165.943 1.00 50.00  ? 7    U   B "C3'" 1 
ATOM   91    O  "O3'" . U   A  1  7    ? 256.046 268.025 167.009 1.00 50.00  ? 7    U   B "O3'" 1 
ATOM   92    C  "C2'" . U   A  1  7    ? 253.981 266.857 166.354 1.00 50.00  ? 7    U   B "C2'" 1 
ATOM   93    O  "O2'" . U   A  1  7    ? 253.292 267.761 167.205 1.00 50.00  ? 7    U   B "O2'" 1 
ATOM   94    C  "C1'" . U   A  1  7    ? 253.254 266.810 165.011 1.00 50.00  ? 7    U   B "C1'" 1 
ATOM   95    N  N1    . U   A  1  7    ? 253.386 265.494 164.343 1.00 50.00  ? 7    U   B N1    1 
ATOM   96    C  C2    . U   A  1  7    ? 252.673 264.423 164.852 1.00 50.00  ? 7    U   B C2    1 
ATOM   97    O  O2    . U   A  1  7    ? 251.949 264.505 165.829 1.00 50.00  ? 7    U   B O2    1 
ATOM   98    N  N3    . U   A  1  7    ? 252.847 263.240 164.176 1.00 50.00  ? 7    U   B N3    1 
ATOM   99    C  C4    . U   A  1  7    ? 253.635 263.021 163.066 1.00 50.00  ? 7    U   B C4    1 
ATOM   100   O  O4    . U   A  1  7    ? 253.685 261.893 162.571 1.00 50.00  ? 7    U   B O4    1 
ATOM   101   C  C5    . U   A  1  7    ? 254.335 264.176 162.598 1.00 50.00  ? 7    U   B C5    1 
ATOM   102   C  C6    . U   A  1  7    ? 254.187 265.341 163.236 1.00 50.00  ? 7    U   B C6    1 
ATOM   103   P  P     . G   A  1  8    ? 257.202 267.200 167.759 1.00 50.00  ? 8    G   B P     1 
ATOM   104   O  OP1   . G   A  1  8    ? 256.662 266.730 169.062 1.00 50.00  ? 8    G   B OP1   1 
ATOM   105   O  OP2   . G   A  1  8    ? 258.445 268.013 167.728 1.00 50.00  ? 8    G   B OP2   1 
ATOM   106   O  "O5'" . G   A  1  8    ? 257.425 265.924 166.832 1.00 50.00  ? 8    G   B "O5'" 1 
ATOM   107   C  "C5'" . G   A  1  8    ? 257.181 264.611 167.326 1.00 50.00  ? 8    G   B "C5'" 1 
ATOM   108   C  "C4'" . G   A  1  8    ? 258.330 263.681 167.030 1.00 50.00  ? 8    G   B "C4'" 1 
ATOM   109   O  "O4'" . G   A  1  8    ? 258.124 263.053 165.735 1.00 50.00  ? 8    G   B "O4'" 1 
ATOM   110   C  "C3'" . G   A  1  8    ? 259.708 264.341 166.977 1.00 50.00  ? 8    G   B "C3'" 1 
ATOM   111   O  "O3'" . G   A  1  8    ? 260.681 263.466 167.545 1.00 50.00  ? 8    G   B "O3'" 1 
ATOM   112   C  "C2'" . G   A  1  8    ? 259.956 264.495 165.479 1.00 50.00  ? 8    G   B "C2'" 1 
ATOM   113   O  "O2'" . G   A  1  8    ? 261.321 264.537 165.110 1.00 50.00  ? 8    G   B "O2'" 1 
ATOM   114   C  "C1'" . G   A  1  8    ? 259.257 263.260 164.917 1.00 50.00  ? 8    G   B "C1'" 1 
ATOM   115   N  N9    . G   A  1  8    ? 258.802 263.414 163.533 1.00 50.00  ? 8    G   B N9    1 
ATOM   116   C  C8    . G   A  1  8    ? 258.978 264.512 162.726 1.00 50.00  ? 8    G   B C8    1 
ATOM   117   N  N7    . G   A  1  8    ? 258.466 264.361 161.534 1.00 50.00  ? 8    G   B N7    1 
ATOM   118   C  C5    . G   A  1  8    ? 257.921 263.085 161.552 1.00 50.00  ? 8    G   B C5    1 
ATOM   119   C  C6    . G   A  1  8    ? 257.233 262.364 160.541 1.00 50.00  ? 8    G   B C6    1 
ATOM   120   O  O6    . G   A  1  8    ? 256.957 262.722 159.389 1.00 50.00  ? 8    G   B O6    1 
ATOM   121   N  N1    . G   A  1  8    ? 256.853 261.101 160.982 1.00 50.00  ? 8    G   B N1    1 
ATOM   122   C  C2    . G   A  1  8    ? 257.101 260.595 162.233 1.00 50.00  ? 8    G   B C2    1 
ATOM   123   N  N2    . G   A  1  8    ? 256.653 259.353 162.470 1.00 50.00  ? 8    G   B N2    1 
ATOM   124   N  N3    . G   A  1  8    ? 257.741 261.257 163.185 1.00 50.00  ? 8    G   B N3    1 
ATOM   125   C  C4    . G   A  1  8    ? 258.123 262.486 162.777 1.00 50.00  ? 8    G   B C4    1 
ATOM   126   P  P     . G   A  1  9    ? 261.430 263.883 168.905 1.00 50.00  ? 9    G   B P     1 
ATOM   127   O  OP1   . G   A  1  9    ? 260.786 265.117 169.422 1.00 50.00  ? 9    G   B OP1   1 
ATOM   128   O  OP2   . G   A  1  9    ? 262.891 263.878 168.642 1.00 50.00  ? 9    G   B OP2   1 
ATOM   129   O  "O5'" . G   A  1  9    ? 261.098 262.694 169.912 1.00 50.00  ? 9    G   B "O5'" 1 
ATOM   130   C  "C5'" . G   A  1  9    ? 259.768 262.473 170.371 1.00 50.00  ? 9    G   B "C5'" 1 
ATOM   131   C  "C4'" . G   A  1  9    ? 259.400 261.010 170.329 1.00 50.00  ? 9    G   B "C4'" 1 
ATOM   132   O  "O4'" . G   A  1  9    ? 260.136 260.373 169.250 1.00 50.00  ? 9    G   B "O4'" 1 
ATOM   133   C  "C3'" . G   A  1  9    ? 259.721 260.215 171.598 1.00 50.00  ? 9    G   B "C3'" 1 
ATOM   134   O  "O3'" . G   A  1  9    ? 258.706 259.240 171.842 1.00 50.00  ? 9    G   B "O3'" 1 
ATOM   135   C  "C2'" . G   A  1  9    ? 261.024 259.505 171.244 1.00 50.00  ? 9    G   B "C2'" 1 
ATOM   136   O  "O2'" . G   A  1  9    ? 261.224 258.291 171.932 1.00 50.00  ? 9    G   B "O2'" 1 
ATOM   137   C  "C1'" . G   A  1  9    ? 260.861 259.268 169.748 1.00 50.00  ? 9    G   B "C1'" 1 
ATOM   138   N  N9    . G   A  1  9    ? 262.131 259.169 169.015 1.00 50.00  ? 9    G   B N9    1 
ATOM   139   C  C8    . G   A  1  9    ? 262.441 258.209 168.084 1.00 50.00  ? 9    G   B C8    1 
ATOM   140   N  N7    . G   A  1  9    ? 263.637 258.340 167.581 1.00 50.00  ? 9    G   B N7    1 
ATOM   141   C  C5    . G   A  1  9    ? 264.157 259.454 168.218 1.00 50.00  ? 9    G   B C5    1 
ATOM   142   C  C6    . G   A  1  9    ? 265.426 260.077 168.077 1.00 50.00  ? 9    G   B C6    1 
ATOM   143   O  O6    . G   A  1  9    ? 266.363 259.754 167.336 1.00 50.00  ? 9    G   B O6    1 
ATOM   144   N  N1    . G   A  1  9    ? 265.554 261.182 168.907 1.00 50.00  ? 9    G   B N1    1 
ATOM   145   C  C2    . G   A  1  9    ? 264.585 261.633 169.767 1.00 50.00  ? 9    G   B C2    1 
ATOM   146   N  N2    . G   A  1  9    ? 264.893 262.720 170.490 1.00 50.00  ? 9    G   B N2    1 
ATOM   147   N  N3    . G   A  1  9    ? 263.401 261.064 169.907 1.00 50.00  ? 9    G   B N3    1 
ATOM   148   C  C4    . G   A  1  9    ? 263.244 259.983 169.110 1.00 50.00  ? 9    G   B C4    1 
ATOM   149   P  P     . U   A  1  10   ? 258.439 258.722 173.343 1.00 50.00  ? 10   U   B P     1 
ATOM   150   O  OP1   . U   A  1  10   ? 257.200 257.904 173.325 1.00 50.00  ? 10   U   B OP1   1 
ATOM   151   O  OP2   . U   A  1  10   ? 258.538 259.887 174.255 1.00 50.00  ? 10   U   B OP2   1 
ATOM   152   O  "O5'" . U   A  1  10   ? 259.668 257.750 173.643 1.00 50.00  ? 10   U   B "O5'" 1 
ATOM   153   C  "C5'" . U   A  1  10   ? 260.299 257.732 174.919 1.00 50.00  ? 10   U   B "C5'" 1 
ATOM   154   C  "C4'" . U   A  1  10   ? 261.312 256.617 175.024 1.00 50.00  ? 10   U   B "C4'" 1 
ATOM   155   O  "O4'" . U   A  1  10   ? 262.104 256.552 173.809 1.00 50.00  ? 10   U   B "O4'" 1 
ATOM   156   C  "C3'" . U   A  1  10   ? 262.346 256.746 176.135 1.00 50.00  ? 10   U   B "C3'" 1 
ATOM   157   O  "O3'" . U   A  1  10   ? 261.856 256.316 177.395 1.00 50.00  ? 10   U   B "O3'" 1 
ATOM   158   C  "C2'" . U   A  1  10   ? 263.504 255.899 175.622 1.00 50.00  ? 10   U   B "C2'" 1 
ATOM   159   O  "O2'" . U   A  1  10   ? 263.273 254.523 175.884 1.00 50.00  ? 10   U   B "O2'" 1 
ATOM   160   C  "C1'" . U   A  1  10   ? 263.415 256.124 174.109 1.00 50.00  ? 10   U   B "C1'" 1 
ATOM   161   N  N1    . U   A  1  10   ? 264.382 257.130 173.602 1.00 50.00  ? 10   U   B N1    1 
ATOM   162   C  C2    . U   A  1  10   ? 265.741 256.885 173.701 1.00 50.00  ? 10   U   B C2    1 
ATOM   163   O  O2    . U   A  1  10   ? 266.217 255.889 174.220 1.00 50.00  ? 10   U   B O2    1 
ATOM   164   N  N3    . U   A  1  10   ? 266.550 257.868 173.188 1.00 50.00  ? 10   U   B N3    1 
ATOM   165   C  C4    . U   A  1  10   ? 266.158 259.043 172.578 1.00 50.00  ? 10   U   B C4    1 
ATOM   166   O  O4    . U   A  1  10   ? 267.006 259.834 172.160 1.00 50.00  ? 10   U   B O4    1 
ATOM   167   C  C5    . U   A  1  10   ? 264.744 259.217 172.496 1.00 50.00  ? 10   U   B C5    1 
ATOM   168   C  C6    . U   A  1  10   ? 263.936 258.278 172.994 1.00 50.00  ? 10   U   B C6    1 
ATOM   169   P  P     . U   A  1  11   ? 262.455 256.924 178.759 1.00 50.00  ? 11   U   B P     1 
ATOM   170   O  OP1   . U   A  1  11   ? 261.600 256.448 179.876 1.00 50.00  ? 11   U   B OP1   1 
ATOM   171   O  OP2   . U   A  1  11   ? 262.654 258.382 178.564 1.00 50.00  ? 11   U   B OP2   1 
ATOM   172   O  "O5'" . U   A  1  11   ? 263.879 256.220 178.919 1.00 50.00  ? 11   U   B "O5'" 1 
ATOM   173   C  "C5'" . U   A  1  11   ? 263.980 254.869 179.353 1.00 50.00  ? 11   U   B "C5'" 1 
ATOM   174   C  "C4'" . U   A  1  11   ? 265.417 254.420 179.479 1.00 50.00  ? 11   U   B "C4'" 1 
ATOM   175   O  "O4'" . U   A  1  11   ? 266.064 254.475 178.181 1.00 50.00  ? 11   U   B "O4'" 1 
ATOM   176   C  "C3'" . U   A  1  11   ? 266.309 255.268 180.378 1.00 50.00  ? 11   U   B "C3'" 1 
ATOM   177   O  "O3'" . U   A  1  11   ? 266.189 254.933 181.752 1.00 50.00  ? 11   U   B "O3'" 1 
ATOM   178   C  "C2'" . U   A  1  11   ? 267.698 255.008 179.814 1.00 50.00  ? 11   U   B "C2'" 1 
ATOM   179   O  "O2'" . U   A  1  11   ? 268.199 253.759 180.266 1.00 50.00  ? 11   U   B "O2'" 1 
ATOM   180   C  "C1'" . U   A  1  11   ? 267.402 254.900 178.321 1.00 50.00  ? 11   U   B "C1'" 1 
ATOM   181   N  N1    . U   A  1  11   ? 267.542 256.201 177.629 1.00 50.00  ? 11   U   B N1    1 
ATOM   182   C  C2    . U   A  1  11   ? 268.806 256.694 177.359 1.00 50.00  ? 11   U   B C2    1 
ATOM   183   O  O2    . U   A  1  11   ? 269.830 256.111 177.669 1.00 50.00  ? 11   U   B O2    1 
ATOM   184   N  N3    . U   A  1  11   ? 268.819 257.907 176.711 1.00 50.00  ? 11   U   B N3    1 
ATOM   185   C  C4    . U   A  1  11   ? 267.728 258.654 176.313 1.00 50.00  ? 11   U   B C4    1 
ATOM   186   O  O4    . U   A  1  11   ? 267.884 259.730 175.737 1.00 50.00  ? 11   U   B O4    1 
ATOM   187   C  C5    . U   A  1  11   ? 266.462 258.073 176.629 1.00 50.00  ? 11   U   B C5    1 
ATOM   188   C  C6    . U   A  1  11   ? 266.420 256.898 177.255 1.00 50.00  ? 11   U   B C6    1 
ATOM   189   P  P     . U   A  1  12   ? 266.583 255.999 182.889 1.00 50.00  ? 12   U   B P     1 
ATOM   190   O  OP1   . U   A  1  12   ? 266.236 255.409 184.206 1.00 50.00  ? 12   U   B OP1   1 
ATOM   191   O  OP2   . U   A  1  12   ? 266.020 257.315 182.501 1.00 50.00  ? 12   U   B OP2   1 
ATOM   192   O  "O5'" . U   A  1  12   ? 268.173 256.100 182.806 1.00 50.00  ? 12   U   B "O5'" 1 
ATOM   193   C  "C5'" . U   A  1  12   ? 269.001 255.020 183.212 1.00 50.00  ? 12   U   B "C5'" 1 
ATOM   194   C  "C4'" . U   A  1  12   ? 270.452 255.296 182.906 1.00 50.00  ? 12   U   B "C4'" 1 
ATOM   195   O  "O4'" . U   A  1  12   ? 270.597 255.617 181.498 1.00 50.00  ? 12   U   B "O4'" 1 
ATOM   196   C  "C3'" . U   A  1  12   ? 271.067 256.487 183.629 1.00 50.00  ? 12   U   B "C3'" 1 
ATOM   197   O  "O3'" . U   A  1  12   ? 271.512 256.160 184.935 1.00 50.00  ? 12   U   B "O3'" 1 
ATOM   198   C  "C2'" . U   A  1  12   ? 272.193 256.911 182.694 1.00 50.00  ? 12   U   B "C2'" 1 
ATOM   199   O  "O2'" . U   A  1  12   ? 273.328 256.076 182.867 1.00 50.00  ? 12   U   B "O2'" 1 
ATOM   200   C  "C1'" . U   A  1  12   ? 271.582 256.613 181.325 1.00 50.00  ? 12   U   B "C1'" 1 
ATOM   201   N  N1    . U   A  1  12   ? 270.939 257.801 180.716 1.00 50.00  ? 12   U   B N1    1 
ATOM   202   C  C2    . U   A  1  12   ? 271.739 258.815 180.221 1.00 50.00  ? 12   U   B C2    1 
ATOM   203   O  O2    . U   A  1  12   ? 272.957 258.800 180.266 1.00 50.00  ? 12   U   B O2    1 
ATOM   204   N  N3    . U   A  1  12   ? 271.053 259.867 179.666 1.00 50.00  ? 12   U   B N3    1 
ATOM   205   C  C4    . U   A  1  12   ? 269.683 260.006 179.551 1.00 50.00  ? 12   U   B C4    1 
ATOM   206   O  O4    . U   A  1  12   ? 269.217 261.016 179.025 1.00 50.00  ? 12   U   B O4    1 
ATOM   207   C  C5    . U   A  1  12   ? 268.929 258.915 180.080 1.00 50.00  ? 12   U   B C5    1 
ATOM   208   C  C6    . U   A  1  12   ? 269.570 257.879 180.627 1.00 50.00  ? 12   U   B C6    1 
ATOM   209   P  P     . C   A  1  13   ? 271.608 257.292 186.071 1.00 50.00  ? 13   C   B P     1 
ATOM   210   O  OP1   . C   A  1  13   ? 271.878 256.620 187.366 1.00 50.00  ? 13   C   B OP1   1 
ATOM   211   O  OP2   . C   A  1  13   ? 270.425 258.181 185.936 1.00 50.00  ? 13   C   B OP2   1 
ATOM   212   O  "O5'" . C   A  1  13   ? 272.902 258.134 185.676 1.00 50.00  ? 13   C   B "O5'" 1 
ATOM   213   C  "C5'" . C   A  1  13   ? 274.192 257.540 185.662 1.00 50.00  ? 13   C   B "C5'" 1 
ATOM   214   C  "C4'" . C   A  1  13   ? 275.237 258.522 185.197 1.00 50.00  ? 13   C   B "C4'" 1 
ATOM   215   O  "O4'" . C   A  1  13   ? 274.961 258.912 183.826 1.00 50.00  ? 13   C   B "O4'" 1 
ATOM   216   C  "C3'" . C   A  1  13   ? 275.282 259.835 185.960 1.00 50.00  ? 13   C   B "C3'" 1 
ATOM   217   O  "O3'" . C   A  1  13   ? 276.036 259.744 187.155 1.00 50.00  ? 13   C   B "O3'" 1 
ATOM   218   C  "C2'" . C   A  1  13   ? 275.864 260.806 184.940 1.00 50.00  ? 13   C   B "C2'" 1 
ATOM   219   O  "O2'" . C   A  1  13   ? 277.276 260.672 184.869 1.00 50.00  ? 13   C   B "O2'" 1 
ATOM   220   C  "C1'" . C   A  1  13   ? 275.264 260.277 183.638 1.00 50.00  ? 13   C   B "C1'" 1 
ATOM   221   N  N1    . C   A  1  13   ? 274.017 260.979 183.251 1.00 50.00  ? 13   C   B N1    1 
ATOM   222   C  C2    . C   A  1  13   ? 274.068 262.250 182.668 1.00 50.00  ? 13   C   B C2    1 
ATOM   223   O  O2    . C   A  1  13   ? 275.168 262.798 182.487 1.00 50.00  ? 13   C   B O2    1 
ATOM   224   N  N3    . C   A  1  13   ? 272.909 262.857 182.312 1.00 50.00  ? 13   C   B N3    1 
ATOM   225   C  C4    . C   A  1  13   ? 271.742 262.243 182.515 1.00 50.00  ? 13   C   B C4    1 
ATOM   226   N  N4    . C   A  1  13   ? 270.622 262.874 182.153 1.00 50.00  ? 13   C   B N4    1 
ATOM   227   C  C5    . C   A  1  13   ? 271.661 260.950 183.102 1.00 50.00  ? 13   C   B C5    1 
ATOM   228   C  C6    . C   A  1  13   ? 272.811 260.363 183.445 1.00 50.00  ? 13   C   B C6    1 
ATOM   229   P  P     . U   A  1  14   ? 275.817 260.814 188.334 1.00 50.00  ? 14   U   B P     1 
ATOM   230   O  OP1   . U   A  1  14   ? 276.513 260.311 189.545 1.00 50.00  ? 14   U   B OP1   1 
ATOM   231   O  OP2   . U   A  1  14   ? 274.369 261.135 188.398 1.00 50.00  ? 14   U   B OP2   1 
ATOM   232   O  "O5'" . U   A  1  14   ? 276.588 262.109 187.821 1.00 50.00  ? 14   U   B "O5'" 1 
ATOM   233   C  "C5'" . U   A  1  14   ? 276.446 263.349 188.495 1.00 50.00  ? 14   U   B "C5'" 1 
ATOM   234   C  "C4'" . U   A  1  14   ? 276.793 264.511 187.600 1.00 50.00  ? 14   U   B "C4'" 1 
ATOM   235   O  "O4'" . U   A  1  14   ? 276.199 264.323 186.288 1.00 50.00  ? 14   U   B "O4'" 1 
ATOM   236   C  "C3'" . U   A  1  14   ? 276.271 265.864 188.056 1.00 50.00  ? 14   U   B "C3'" 1 
ATOM   237   O  "O3'" . U   A  1  14   ? 277.092 266.465 189.042 1.00 50.00  ? 14   U   B "O3'" 1 
ATOM   238   C  "C2'" . U   A  1  14   ? 276.196 266.650 186.755 1.00 50.00  ? 14   U   B "C2'" 1 
ATOM   239   O  "O2'" . U   A  1  14   ? 277.483 267.115 186.374 1.00 50.00  ? 14   U   B "O2'" 1 
ATOM   240   C  "C1'" . U   A  1  14   ? 275.763 265.562 185.771 1.00 50.00  ? 14   U   B "C1'" 1 
ATOM   241   N  N1    . U   A  1  14   ? 274.291 265.499 185.609 1.00 50.00  ? 14   U   B N1    1 
ATOM   242   C  C2    . U   A  1  14   ? 273.605 266.570 185.061 1.00 50.00  ? 14   U   B C2    1 
ATOM   243   O  O2    . U   A  1  14   ? 274.136 267.606 184.696 1.00 50.00  ? 14   U   B O2    1 
ATOM   244   N  N3    . U   A  1  14   ? 272.248 266.395 184.959 1.00 50.00  ? 14   U   B N3    1 
ATOM   245   C  C4    . U   A  1  14   ? 271.518 265.282 185.331 1.00 50.00  ? 14   U   B C4    1 
ATOM   246   O  O4    . U   A  1  14   ? 270.296 265.266 185.177 1.00 50.00  ? 14   U   B O4    1 
ATOM   247   C  C5    . U   A  1  14   ? 272.299 264.218 185.879 1.00 50.00  ? 14   U   B C5    1 
ATOM   248   C  C6    . U   A  1  14   ? 273.621 264.361 185.993 1.00 50.00  ? 14   U   B C6    1 
ATOM   249   P  P     . C   A  1  15   ? 276.431 267.146 190.337 1.00 50.00  ? 15   C   B P     1 
ATOM   250   O  OP1   . C   A  1  15   ? 277.488 267.295 191.372 1.00 50.00  ? 15   C   B OP1   1 
ATOM   251   O  OP2   . C   A  1  15   ? 275.187 266.403 190.662 1.00 50.00  ? 15   C   B OP2   1 
ATOM   252   O  "O5'" . C   A  1  15   ? 276.020 268.601 189.835 1.00 50.00  ? 15   C   B "O5'" 1 
ATOM   253   C  "C5'" . C   A  1  15   ? 276.982 269.467 189.255 1.00 50.00  ? 15   C   B "C5'" 1 
ATOM   254   C  "C4'" . C   A  1  15   ? 276.325 270.651 188.592 1.00 50.00  ? 15   C   B "C4'" 1 
ATOM   255   O  "O4'" . C   A  1  15   ? 275.601 270.217 187.411 1.00 50.00  ? 15   C   B "O4'" 1 
ATOM   256   C  "C3'" . C   A  1  15   ? 275.278 271.375 189.423 1.00 50.00  ? 15   C   B "C3'" 1 
ATOM   257   O  "O3'" . C   A  1  15   ? 275.839 272.282 190.355 1.00 50.00  ? 15   C   B "O3'" 1 
ATOM   258   C  "C2'" . C   A  1  15   ? 274.419 272.045 188.359 1.00 50.00  ? 15   C   B "C2'" 1 
ATOM   259   O  "O2'" . C   A  1  15   ? 275.051 273.217 187.869 1.00 50.00  ? 15   C   B "O2'" 1 
ATOM   260   C  "C1'" . C   A  1  15   ? 274.431 270.989 187.252 1.00 50.00  ? 15   C   B "C1'" 1 
ATOM   261   N  N1    . C   A  1  15   ? 273.256 270.089 187.322 1.00 50.00  ? 15   C   B N1    1 
ATOM   262   C  C2    . C   A  1  15   ? 271.998 270.571 186.947 1.00 50.00  ? 15   C   B C2    1 
ATOM   263   O  O2    . C   A  1  15   ? 271.893 271.747 186.568 1.00 50.00  ? 15   C   B O2    1 
ATOM   264   N  N3    . C   A  1  15   ? 270.929 269.745 187.010 1.00 50.00  ? 15   C   B N3    1 
ATOM   265   C  C4    . C   A  1  15   ? 271.079 268.485 187.424 1.00 50.00  ? 15   C   B C4    1 
ATOM   266   N  N4    . C   A  1  15   ? 269.995 267.705 187.469 1.00 50.00  ? 15   C   B N4    1 
ATOM   267   C  C5    . C   A  1  15   ? 272.349 267.967 187.808 1.00 50.00  ? 15   C   B C5    1 
ATOM   268   C  C6    . C   A  1  15   ? 273.398 268.794 187.741 1.00 50.00  ? 15   C   B C6    1 
ATOM   269   P  P     . U   A  1  16   ? 275.101 272.559 191.755 1.00 50.00  ? 16   U   B P     1 
ATOM   270   O  OP1   . U   A  1  16   ? 275.992 273.408 192.585 1.00 50.00  ? 16   U   B OP1   1 
ATOM   271   O  OP2   . U   A  1  16   ? 274.618 271.259 192.287 1.00 50.00  ? 16   U   B OP2   1 
ATOM   272   O  "O5'" . U   A  1  16   ? 273.830 273.429 191.351 1.00 50.00  ? 16   U   B "O5'" 1 
ATOM   273   C  "C5'" . U   A  1  16   ? 273.982 274.700 190.735 1.00 50.00  ? 16   U   B "C5'" 1 
ATOM   274   C  "C4'" . U   A  1  16   ? 272.652 275.285 190.336 1.00 50.00  ? 16   U   B "C4'" 1 
ATOM   275   O  "O4'" . U   A  1  16   ? 272.057 274.494 189.275 1.00 50.00  ? 16   U   B "O4'" 1 
ATOM   276   C  "C3'" . U   A  1  16   ? 271.584 275.309 191.417 1.00 50.00  ? 16   U   B "C3'" 1 
ATOM   277   O  "O3'" . U   A  1  16   ? 271.744 276.385 192.325 1.00 50.00  ? 16   U   B "O3'" 1 
ATOM   278   C  "C2'" . U   A  1  16   ? 270.295 275.371 190.610 1.00 50.00  ? 16   U   B "C2'" 1 
ATOM   279   O  "O2'" . U   A  1  16   ? 270.049 276.693 190.156 1.00 50.00  ? 16   U   B "O2'" 1 
ATOM   280   C  "C1'" . U   A  1  16   ? 270.649 274.503 189.401 1.00 50.00  ? 16   U   B "C1'" 1 
ATOM   281   N  N1    . U   A  1  16   ? 270.172 273.108 189.551 1.00 50.00  ? 16   U   B N1    1 
ATOM   282   C  C2    . U   A  1  16   ? 268.835 272.860 189.307 1.00 50.00  ? 16   U   B C2    1 
ATOM   283   O  O2    . U   A  1  16   ? 268.046 273.732 188.983 1.00 50.00  ? 16   U   B O2    1 
ATOM   284   N  N3    . U   A  1  16   ? 268.445 271.552 189.458 1.00 50.00  ? 16   U   B N3    1 
ATOM   285   C  C4    . U   A  1  16   ? 269.248 270.486 189.819 1.00 50.00  ? 16   U   B C4    1 
ATOM   286   O  O4    . U   A  1  16   ? 268.756 269.360 189.914 1.00 50.00  ? 16   U   B O4    1 
ATOM   287   C  C5    . U   A  1  16   ? 270.618 270.825 190.053 1.00 50.00  ? 16   U   B C5    1 
ATOM   288   C  C6    . U   A  1  16   ? 271.025 272.090 189.912 1.00 50.00  ? 16   U   B C6    1 
ATOM   289   P  P     . U   A  1  17   ? 271.068 276.313 193.781 1.00 50.00  ? 17   U   B P     1 
ATOM   290   O  OP1   . U   A  1  17   ? 271.526 277.490 194.562 1.00 50.00  ? 17   U   B OP1   1 
ATOM   291   O  OP2   . U   A  1  17   ? 271.277 274.945 194.320 1.00 50.00  ? 17   U   B OP2   1 
ATOM   292   O  "O5'" . U   A  1  17   ? 269.513 276.492 193.482 1.00 50.00  ? 17   U   B "O5'" 1 
ATOM   293   C  "C5'" . U   A  1  17   ? 268.538 276.034 194.405 1.00 50.00  ? 17   U   B "C5'" 1 
ATOM   294   C  "C4'" . U   A  1  17   ? 267.158 276.061 193.799 1.00 50.00  ? 17   U   B "C4'" 1 
ATOM   295   O  "O4'" . U   A  1  17   ? 267.114 275.195 192.632 1.00 50.00  ? 17   U   B "O4'" 1 
ATOM   296   C  "C3'" . U   A  1  17   ? 266.039 275.538 194.685 1.00 50.00  ? 17   U   B "C3'" 1 
ATOM   297   O  "O3'" . U   A  1  17   ? 265.589 276.496 195.626 1.00 50.00  ? 17   U   B "O3'" 1 
ATOM   298   C  "C2'" . U   A  1  17   ? 264.983 275.123 193.672 1.00 50.00  ? 17   U   B "C2'" 1 
ATOM   299   O  "O2'" . U   A  1  17   ? 264.286 276.258 193.180 1.00 50.00  ? 17   U   B "O2'" 1 
ATOM   300   C  "C1'" . U   A  1  17   ? 265.853 274.564 192.547 1.00 50.00  ? 17   U   B "C1'" 1 
ATOM   301   N  N1    . U   A  1  17   ? 266.057 273.101 192.672 1.00 50.00  ? 17   U   B N1    1 
ATOM   302   C  C2    . U   A  1  17   ? 264.980 272.251 192.481 1.00 50.00  ? 17   U   B C2    1 
ATOM   303   O  O2    . U   A  1  17   ? 263.854 272.635 192.216 1.00 50.00  ? 17   U   B O2    1 
ATOM   304   N  N3    . U   A  1  17   ? 265.265 270.914 192.619 1.00 50.00  ? 17   U   B N3    1 
ATOM   305   C  C4    . U   A  1  17   ? 266.489 270.348 192.915 1.00 50.00  ? 17   U   B C4    1 
ATOM   306   O  O4    . U   A  1  17   ? 266.584 269.124 193.002 1.00 50.00  ? 17   U   B O4    1 
ATOM   307   C  C5    . U   A  1  17   ? 267.551 271.290 193.093 1.00 50.00  ? 17   U   B C5    1 
ATOM   308   C  C6    . U   A  1  17   ? 267.303 272.596 192.966 1.00 50.00  ? 17   U   B C6    1 
ATOM   309   P  P     . C   A  1  18   ? 265.289 276.057 197.142 1.00 50.00  ? 18   C   B P     1 
ATOM   310   O  OP1   . C   A  1  18   ? 265.247 277.282 197.979 1.00 50.00  ? 18   C   B OP1   1 
ATOM   311   O  OP2   . C   A  1  18   ? 266.219 274.955 197.496 1.00 50.00  ? 18   C   B OP2   1 
ATOM   312   O  "O5'" . C   A  1  18   ? 263.817 275.453 197.080 1.00 50.00  ? 18   C   B "O5'" 1 
ATOM   313   C  "C5'" . C   A  1  18   ? 262.741 276.216 196.556 1.00 50.00  ? 18   C   B "C5'" 1 
ATOM   314   C  "C4'" . C   A  1  18   ? 261.592 275.335 196.134 1.00 50.00  ? 18   C   B "C4'" 1 
ATOM   315   O  "O4'" . C   A  1  18   ? 262.012 274.465 195.049 1.00 50.00  ? 18   C   B "O4'" 1 
ATOM   316   C  "C3'" . C   A  1  18   ? 261.069 274.376 197.191 1.00 50.00  ? 18   C   B "C3'" 1 
ATOM   317   O  "O3'" . C   A  1  18   ? 260.192 274.991 198.120 1.00 50.00  ? 18   C   B "O3'" 1 
ATOM   318   C  "C2'" . C   A  1  18   ? 260.410 273.292 196.353 1.00 50.00  ? 18   C   B "C2'" 1 
ATOM   319   O  "O2'" . C   A  1  18   ? 259.141 273.724 195.882 1.00 50.00  ? 18   C   B "O2'" 1 
ATOM   320   C  "C1'" . C   A  1  18   ? 261.366 273.213 195.162 1.00 50.00  ? 18   C   B "C1'" 1 
ATOM   321   N  N1    . C   A  1  18   ? 262.393 272.163 195.345 1.00 50.00  ? 18   C   B N1    1 
ATOM   322   C  C2    . C   A  1  18   ? 262.012 270.819 195.273 1.00 50.00  ? 18   C   B C2    1 
ATOM   323   O  O2    . C   A  1  18   ? 260.821 270.553 195.055 1.00 50.00  ? 18   C   B O2    1 
ATOM   324   N  N3    . C   A  1  18   ? 262.948 269.856 195.436 1.00 50.00  ? 18   C   B N3    1 
ATOM   325   C  C4    . C   A  1  18   ? 264.218 270.190 195.664 1.00 50.00  ? 18   C   B C4    1 
ATOM   326   N  N4    . C   A  1  18   ? 265.111 269.211 195.820 1.00 50.00  ? 18   C   B N4    1 
ATOM   327   C  C5    . C   A  1  18   ? 264.635 271.550 195.744 1.00 50.00  ? 18   C   B C5    1 
ATOM   328   C  C6    . C   A  1  18   ? 263.699 272.492 195.579 1.00 50.00  ? 18   C   B C6    1 
ATOM   329   P  P     . A   A  1  19   ? 260.161 274.493 199.647 1.00 50.00  ? 19   A   B P     1 
ATOM   330   O  OP1   . A   A  1  19   ? 259.195 275.344 200.388 1.00 50.00  ? 19   A   B OP1   1 
ATOM   331   O  OP2   . A   A  1  19   ? 261.563 274.386 200.123 1.00 50.00  ? 19   A   B OP2   1 
ATOM   332   O  "O5'" . A   A  1  19   ? 259.555 273.022 199.565 1.00 50.00  ? 19   A   B "O5'" 1 
ATOM   333   C  "C5'" . A   A  1  19   ? 258.251 272.798 199.050 1.00 50.00  ? 19   A   B "C5'" 1 
ATOM   334   C  "C4'" . A   A  1  19   ? 257.934 271.328 198.961 1.00 50.00  ? 19   A   B "C4'" 1 
ATOM   335   O  "O4'" . A   A  1  19   ? 258.862 270.668 198.063 1.00 50.00  ? 19   A   B "O4'" 1 
ATOM   336   C  "C3'" . A   A  1  19   ? 258.053 270.535 200.252 1.00 50.00  ? 19   A   B "C3'" 1 
ATOM   337   O  "O3'" . A   A  1  19   ? 256.926 270.695 201.093 1.00 50.00  ? 19   A   B "O3'" 1 
ATOM   338   C  "C2'" . A   A  1  19   ? 258.239 269.109 199.751 1.00 50.00  ? 19   A   B "C2'" 1 
ATOM   339   O  "O2'" . A   A  1  19   ? 256.992 268.537 199.385 1.00 50.00  ? 19   A   B "O2'" 1 
ATOM   340   C  "C1'" . A   A  1  19   ? 259.061 269.333 198.478 1.00 50.00  ? 19   A   B "C1'" 1 
ATOM   341   N  N9    . A   A  1  19   ? 260.503 269.092 198.685 1.00 50.00  ? 19   A   B N9    1 
ATOM   342   C  C8    . A   A  1  19   ? 261.528 269.994 198.829 1.00 50.00  ? 19   A   B C8    1 
ATOM   343   N  N7    . A   A  1  19   ? 262.704 269.432 198.992 1.00 50.00  ? 19   A   B N7    1 
ATOM   344   C  C5    . A   A  1  19   ? 262.437 268.069 198.953 1.00 50.00  ? 19   A   B C5    1 
ATOM   345   C  C6    . A   A  1  19   ? 263.253 266.926 199.066 1.00 50.00  ? 19   A   B C6    1 
ATOM   346   N  N6    . A   A  1  19   ? 264.575 266.957 199.251 1.00 50.00  ? 19   A   B N6    1 
ATOM   347   N  N1    . A   A  1  19   ? 262.657 265.717 198.980 1.00 50.00  ? 19   A   B N1    1 
ATOM   348   C  C2    . A   A  1  19   ? 261.331 265.670 198.797 1.00 50.00  ? 19   A   B C2    1 
ATOM   349   N  N3    . A   A  1  19   ? 260.460 266.667 198.674 1.00 50.00  ? 19   A   B N3    1 
ATOM   350   C  C4    . A   A  1  19   ? 261.084 267.851 198.763 1.00 50.00  ? 19   A   B C4    1 
ATOM   351   P  P     . G   A  1  20   ? 257.015 271.611 202.410 1.00 50.00  ? 20   G   B P     1 
ATOM   352   O  OP1   . G   A  1  20   ? 255.629 271.932 202.831 1.00 50.00  ? 20   G   B OP1   1 
ATOM   353   O  OP2   . G   A  1  20   ? 257.980 272.713 202.164 1.00 50.00  ? 20   G   B OP2   1 
ATOM   354   O  "O5'" . G   A  1  20   ? 257.660 270.650 203.502 1.00 50.00  ? 20   G   B "O5'" 1 
ATOM   355   C  "C5'" . G   A  1  20   ? 258.145 271.173 204.734 1.00 50.00  ? 20   G   B "C5'" 1 
ATOM   356   C  "C4'" . G   A  1  20   ? 257.328 270.686 205.903 1.00 50.00  ? 20   G   B "C4'" 1 
ATOM   357   O  "O4'" . G   A  1  20   ? 258.005 271.042 207.138 1.00 50.00  ? 20   G   B "O4'" 1 
ATOM   358   C  "C3'" . G   A  1  20   ? 255.921 271.268 206.005 1.00 50.00  ? 20   G   B "C3'" 1 
ATOM   359   O  "O3'" . G   A  1  20   ? 255.039 270.289 206.557 1.00 50.00  ? 20   G   B "O3'" 1 
ATOM   360   C  "C2'" . G   A  1  20   ? 256.104 272.414 206.994 1.00 50.00  ? 20   G   B "C2'" 1 
ATOM   361   O  "O2'" . G   A  1  20   ? 254.929 272.788 207.684 1.00 50.00  ? 20   G   B "O2'" 1 
ATOM   362   C  "C1'" . G   A  1  20   ? 257.161 271.845 207.938 1.00 50.00  ? 20   G   B "C1'" 1 
ATOM   363   N  N9    . G   A  1  20   ? 258.000 272.863 208.575 1.00 50.00  ? 20   G   B N9    1 
ATOM   364   C  C8    . G   A  1  20   ? 258.018 274.210 208.312 1.00 50.00  ? 20   G   B C8    1 
ATOM   365   N  N7    . G   A  1  20   ? 258.884 274.859 209.043 1.00 50.00  ? 20   G   B N7    1 
ATOM   366   C  C5    . G   A  1  20   ? 259.473 273.881 209.833 1.00 50.00  ? 20   G   B C5    1 
ATOM   367   C  C6    . G   A  1  20   ? 260.485 273.980 210.822 1.00 50.00  ? 20   G   B C6    1 
ATOM   368   O  O6    . G   A  1  20   ? 261.084 274.989 211.215 1.00 50.00  ? 20   G   B O6    1 
ATOM   369   N  N1    . G   A  1  20   ? 260.781 272.738 211.375 1.00 50.00  ? 20   G   B N1    1 
ATOM   370   C  C2    . G   A  1  20   ? 260.185 271.553 211.024 1.00 50.00  ? 20   G   B C2    1 
ATOM   371   N  N2    . G   A  1  20   ? 260.610 270.459 211.673 1.00 50.00  ? 20   G   B N2    1 
ATOM   372   N  N3    . G   A  1  20   ? 259.242 271.446 210.103 1.00 50.00  ? 20   G   B N3    1 
ATOM   373   C  C4    . G   A  1  20   ? 258.937 272.642 209.553 1.00 50.00  ? 20   G   B C4    1 
ATOM   374   P  P     . A   A  1  21   ? 254.315 269.214 205.602 1.00 50.00  ? 21   A   B P     1 
ATOM   375   O  OP1   . A   A  1  21   ? 254.003 268.017 206.424 1.00 50.00  ? 21   A   B OP1   1 
ATOM   376   O  OP2   . A   A  1  21   ? 255.111 269.058 204.359 1.00 50.00  ? 21   A   B OP2   1 
ATOM   377   O  "O5'" . A   A  1  21   ? 252.937 269.910 205.209 1.00 50.00  ? 21   A   B "O5'" 1 
ATOM   378   C  "C5'" . A   A  1  21   ? 252.721 270.413 203.895 1.00 50.00  ? 21   A   B "C5'" 1 
ATOM   379   C  "C4'" . A   A  1  21   ? 251.292 270.212 203.449 1.00 50.00  ? 21   A   B "C4'" 1 
ATOM   380   O  "O4'" . A   A  1  21   ? 251.021 271.067 202.303 1.00 50.00  ? 21   A   B "O4'" 1 
ATOM   381   C  "C3'" . A   A  1  21   ? 250.936 268.789 203.015 1.00 50.00  ? 21   A   B "C3'" 1 
ATOM   382   O  "O3'" . A   A  1  21   ? 249.589 268.498 203.388 1.00 50.00  ? 21   A   B "O3'" 1 
ATOM   383   C  "C2'" . A   A  1  21   ? 251.034 268.868 201.494 1.00 50.00  ? 21   A   B "C2'" 1 
ATOM   384   O  "O2'" . A   A  1  21   ? 250.266 267.905 200.803 1.00 50.00  ? 21   A   B "O2'" 1 
ATOM   385   C  "C1'" . A   A  1  21   ? 250.534 270.285 201.232 1.00 50.00  ? 21   A   B "C1'" 1 
ATOM   386   N  N9    . A   A  1  21   ? 251.000 270.873 199.971 1.00 50.00  ? 21   A   B N9    1 
ATOM   387   C  C8    . A   A  1  21   ? 250.225 271.528 199.047 1.00 50.00  ? 21   A   B C8    1 
ATOM   388   N  N7    . A   A  1  21   ? 250.887 271.959 198.001 1.00 50.00  ? 21   A   B N7    1 
ATOM   389   C  C5    . A   A  1  21   ? 252.192 271.560 198.251 1.00 50.00  ? 21   A   B C5    1 
ATOM   390   C  C6    . A   A  1  21   ? 253.381 271.716 197.516 1.00 50.00  ? 21   A   B C6    1 
ATOM   391   N  N6    . A   A  1  21   ? 253.444 272.340 196.337 1.00 50.00  ? 21   A   B N6    1 
ATOM   392   N  N1    . A   A  1  21   ? 254.516 271.205 198.037 1.00 50.00  ? 21   A   B N1    1 
ATOM   393   C  C2    . A   A  1  21   ? 254.450 270.580 199.218 1.00 50.00  ? 21   A   B C2    1 
ATOM   394   N  N3    . A   A  1  21   ? 253.396 270.371 200.003 1.00 50.00  ? 21   A   B N3    1 
ATOM   395   C  C4    . A   A  1  21   ? 252.280 270.889 199.461 1.00 50.00  ? 21   A   B C4    1 
ATOM   396   P  P     . U   A  1  22   ? 249.280 267.384 204.506 1.00 50.00  ? 22   U   B P     1 
ATOM   397   O  OP1   . U   A  1  22   ? 248.127 267.852 205.315 1.00 50.00  ? 22   U   B OP1   1 
ATOM   398   O  OP2   . U   A  1  22   ? 250.558 267.042 205.178 1.00 50.00  ? 22   U   B OP2   1 
ATOM   399   O  "O5'" . U   A  1  22   ? 248.808 266.111 203.670 1.00 50.00  ? 22   U   B "O5'" 1 
ATOM   400   C  "C5'" . U   A  1  22   ? 249.693 265.452 202.776 1.00 50.00  ? 22   U   B "C5'" 1 
ATOM   401   C  "C4'" . U   A  1  22   ? 249.104 264.165 202.257 1.00 50.00  ? 22   U   B "C4'" 1 
ATOM   402   O  "O4'" . U   A  1  22   ? 247.857 264.439 201.563 1.00 50.00  ? 22   U   B "O4'" 1 
ATOM   403   C  "C3'" . U   A  1  22   ? 249.938 263.415 201.231 1.00 50.00  ? 22   U   B "C3'" 1 
ATOM   404   O  "O3'" . U   A  1  22   ? 250.976 262.647 201.813 1.00 50.00  ? 22   U   B "O3'" 1 
ATOM   405   C  "C2'" . U   A  1  22   ? 248.893 262.584 200.499 1.00 50.00  ? 22   U   B "C2'" 1 
ATOM   406   O  "O2'" . U   A  1  22   ? 248.531 261.444 201.265 1.00 50.00  ? 22   U   B "O2'" 1 
ATOM   407   C  "C1'" . U   A  1  22   ? 247.705 263.547 200.478 1.00 50.00  ? 22   U   B "C1'" 1 
ATOM   408   N  N1    . U   A  1  22   ? 247.648 264.333 199.224 1.00 50.00  ? 22   U   B N1    1 
ATOM   409   C  C2    . U   A  1  22   ? 247.098 263.723 198.110 1.00 50.00  ? 22   U   B C2    1 
ATOM   410   O  O2    . U   A  1  22   ? 246.668 262.583 198.120 1.00 50.00  ? 22   U   B O2    1 
ATOM   411   N  N3    . U   A  1  22   ? 247.074 264.501 196.978 1.00 50.00  ? 22   U   B N3    1 
ATOM   412   C  C4    . U   A  1  22   ? 247.529 265.796 196.848 1.00 50.00  ? 22   U   B C4    1 
ATOM   413   O  O4    . U   A  1  22   ? 247.438 266.364 195.759 1.00 50.00  ? 22   U   B O4    1 
ATOM   414   C  C5    . U   A  1  22   ? 248.082 266.356 198.042 1.00 50.00  ? 22   U   B C5    1 
ATOM   415   C  C6    . U   A  1  22   ? 248.121 265.623 199.160 1.00 50.00  ? 22   U   B C6    1 
ATOM   416   P  P     . C   A  1  23   ? 252.118 262.000 200.886 1.00 50.00  ? 23   C   B P     1 
ATOM   417   O  OP1   . C   A  1  23   ? 253.427 262.200 201.561 1.00 50.00  ? 23   C   B OP1   1 
ATOM   418   O  OP2   . C   A  1  23   ? 251.937 262.503 199.502 1.00 50.00  ? 23   C   B OP2   1 
ATOM   419   O  "O5'" . C   A  1  23   ? 251.778 260.442 200.895 1.00 50.00  ? 23   C   B "O5'" 1 
ATOM   420   C  "C5'" . C   A  1  23   ? 252.435 259.553 201.792 1.00 50.00  ? 23   C   B "C5'" 1 
ATOM   421   C  "C4'" . C   A  1  23   ? 252.072 259.832 203.229 1.00 50.00  ? 23   C   B "C4'" 1 
ATOM   422   O  "O4'" . C   A  1  23   ? 250.654 259.583 203.424 1.00 50.00  ? 23   C   B "O4'" 1 
ATOM   423   C  "C3'" . C   A  1  23   ? 252.804 258.976 204.260 1.00 50.00  ? 23   C   B "C3'" 1 
ATOM   424   O  "O3'" . C   A  1  23   ? 253.055 259.750 205.433 1.00 50.00  ? 23   C   B "O3'" 1 
ATOM   425   C  "C2'" . C   A  1  23   ? 251.792 257.881 204.571 1.00 50.00  ? 23   C   B "C2'" 1 
ATOM   426   O  "O2'" . C   A  1  23   ? 251.947 257.279 205.839 1.00 50.00  ? 23   C   B "O2'" 1 
ATOM   427   C  "C1'" . C   A  1  23   ? 250.473 258.639 204.463 1.00 50.00  ? 23   C   B "C1'" 1 
ATOM   428   N  N1    . C   A  1  23   ? 249.328 257.786 204.112 1.00 50.00  ? 23   C   B N1    1 
ATOM   429   C  C2    . C   A  1  23   ? 248.311 257.607 205.052 1.00 50.00  ? 23   C   B C2    1 
ATOM   430   O  O2    . C   A  1  23   ? 248.404 258.172 206.153 1.00 50.00  ? 23   C   B O2    1 
ATOM   431   N  N3    . C   A  1  23   ? 247.254 256.823 204.736 1.00 50.00  ? 23   C   B N3    1 
ATOM   432   C  C4    . C   A  1  23   ? 247.193 256.234 203.541 1.00 50.00  ? 23   C   B C4    1 
ATOM   433   N  N4    . C   A  1  23   ? 246.133 255.469 203.273 1.00 50.00  ? 23   C   B N4    1 
ATOM   434   C  C5    . C   A  1  23   ? 248.218 256.400 202.565 1.00 50.00  ? 23   C   B C5    1 
ATOM   435   C  C6    . C   A  1  23   ? 249.258 257.180 202.891 1.00 50.00  ? 23   C   B C6    1 
ATOM   436   P  P     . G   A  1  24   ? 254.513 260.376 205.701 1.00 50.00  ? 24   G   B P     1 
ATOM   437   O  OP1   . G   A  1  24   ? 255.155 259.602 206.795 1.00 50.00  ? 24   G   B OP1   1 
ATOM   438   O  OP2   . G   A  1  24   ? 254.355 261.846 205.822 1.00 50.00  ? 24   G   B OP2   1 
ATOM   439   O  "O5'" . G   A  1  24   ? 255.327 260.095 204.360 1.00 50.00  ? 24   G   B "O5'" 1 
ATOM   440   C  "C5'" . G   A  1  24   ? 256.238 259.003 204.262 1.00 50.00  ? 24   G   B "C5'" 1 
ATOM   441   C  "C4'" . G   A  1  24   ? 256.111 258.309 202.929 1.00 50.00  ? 24   G   B "C4'" 1 
ATOM   442   O  "O4'" . G   A  1  24   ? 256.456 259.243 201.873 1.00 50.00  ? 24   G   B "O4'" 1 
ATOM   443   C  "C3'" . G   A  1  24   ? 257.006 257.089 202.732 1.00 50.00  ? 24   G   B "C3'" 1 
ATOM   444   O  "O3'" . G   A  1  24   ? 256.337 256.149 201.891 1.00 50.00  ? 24   G   B "O3'" 1 
ATOM   445   C  "C2'" . G   A  1  24   ? 258.204 257.674 201.993 1.00 50.00  ? 24   G   B "C2'" 1 
ATOM   446   O  "O2'" . G   A  1  24   ? 258.933 256.743 201.224 1.00 50.00  ? 24   G   B "O2'" 1 
ATOM   447   C  "C1'" . G   A  1  24   ? 257.541 258.737 201.118 1.00 50.00  ? 24   G   B "C1'" 1 
ATOM   448   N  N9    . G   A  1  24   ? 258.409 259.867 200.784 1.00 50.00  ? 24   G   B N9    1 
ATOM   449   C  C8    . G   A  1  24   ? 258.727 260.318 199.528 1.00 50.00  ? 24   G   B C8    1 
ATOM   450   N  N7    . G   A  1  24   ? 259.520 261.352 199.545 1.00 50.00  ? 24   G   B N7    1 
ATOM   451   C  C5    . G   A  1  24   ? 259.739 261.603 200.892 1.00 50.00  ? 24   G   B C5    1 
ATOM   452   C  C6    . G   A  1  24   ? 260.520 262.605 201.530 1.00 50.00  ? 24   G   B C6    1 
ATOM   453   O  O6    . G   A  1  24   ? 261.199 263.501 201.017 1.00 50.00  ? 24   G   B O6    1 
ATOM   454   N  N1    . G   A  1  24   ? 260.461 262.496 202.914 1.00 50.00  ? 24   G   B N1    1 
ATOM   455   C  C2    . G   A  1  24   ? 259.747 261.548 203.602 1.00 50.00  ? 24   G   B C2    1 
ATOM   456   N  N2    . G   A  1  24   ? 259.818 261.606 204.940 1.00 50.00  ? 24   G   B N2    1 
ATOM   457   N  N3    . G   A  1  24   ? 259.018 260.612 203.021 1.00 50.00  ? 24   G   B N3    1 
ATOM   458   C  C4    . G   A  1  24   ? 259.058 260.695 201.673 1.00 50.00  ? 24   G   B C4    1 
ATOM   459   P  P     . C   A  1  25   ? 254.848 255.658 202.253 1.00 50.00  ? 25   C   B P     1 
ATOM   460   O  OP1   . C   A  1  25   ? 253.878 256.523 201.534 1.00 50.00  ? 25   C   B OP1   1 
ATOM   461   O  OP2   . C   A  1  25   ? 254.754 255.507 203.727 1.00 50.00  ? 25   C   B OP2   1 
ATOM   462   O  "O5'" . C   A  1  25   ? 254.754 254.203 201.612 1.00 50.00  ? 25   C   B "O5'" 1 
ATOM   463   C  "C5'" . C   A  1  25   ? 253.666 253.343 201.910 1.00 50.00  ? 25   C   B "C5'" 1 
ATOM   464   C  "C4'" . C   A  1  25   ? 254.097 251.900 201.906 1.00 50.00  ? 25   C   B "C4'" 1 
ATOM   465   O  "O4'" . C   A  1  25   ? 254.647 251.567 200.603 1.00 50.00  ? 25   C   B "O4'" 1 
ATOM   466   C  "C3'" . C   A  1  25   ? 255.210 251.545 202.881 1.00 50.00  ? 25   C   B "C3'" 1 
ATOM   467   O  "O3'" . C   A  1  25   ? 254.737 251.307 204.196 1.00 50.00  ? 25   C   B "O3'" 1 
ATOM   468   C  "C2'" . C   A  1  25   ? 255.849 250.325 202.232 1.00 50.00  ? 25   C   B "C2'" 1 
ATOM   469   O  "O2'" . C   A  1  25   ? 255.077 249.160 202.485 1.00 50.00  ? 25   C   B "O2'" 1 
ATOM   470   C  "C1'" . C   A  1  25   ? 255.729 250.672 200.748 1.00 50.00  ? 25   C   B "C1'" 1 
ATOM   471   N  N1    . C   A  1  25   ? 256.951 251.322 200.220 1.00 50.00  ? 25   C   B N1    1 
ATOM   472   C  C2    . C   A  1  25   ? 258.035 250.525 199.837 1.00 50.00  ? 25   C   B C2    1 
ATOM   473   O  O2    . C   A  1  25   ? 257.947 249.293 199.953 1.00 50.00  ? 25   C   B O2    1 
ATOM   474   N  N3    . C   A  1  25   ? 259.151 251.115 199.350 1.00 50.00  ? 25   C   B N3    1 
ATOM   475   C  C4    . C   A  1  25   ? 259.212 252.442 199.239 1.00 50.00  ? 25   C   B C4    1 
ATOM   476   N  N4    . C   A  1  25   ? 260.334 252.981 198.756 1.00 50.00  ? 25   C   B N4    1 
ATOM   477   C  C5    . C   A  1  25   ? 258.125 253.280 199.620 1.00 50.00  ? 25   C   B C5    1 
ATOM   478   C  C6    . C   A  1  25   ? 257.028 252.683 200.097 1.00 50.00  ? 25   C   B C6    1 
ATOM   479   P  P     . A   A  1  26   ? 254.652 252.519 205.231 1.00 50.00  ? 26   A   B P     1 
ATOM   480   O  OP1   . A   A  1  26   ? 253.281 253.085 205.161 1.00 50.00  ? 26   A   B OP1   1 
ATOM   481   O  OP2   . A   A  1  26   ? 255.823 253.402 205.000 1.00 50.00  ? 26   A   B OP2   1 
ATOM   482   O  "O5'" . A   A  1  26   ? 254.836 251.800 206.640 1.00 50.00  ? 26   A   B "O5'" 1 
ATOM   483   C  "C5'" . A   A  1  26   ? 256.149 251.570 207.183 1.00 50.00  ? 26   A   B "C5'" 1 
ATOM   484   C  "C4'" . A   A  1  26   ? 256.434 250.089 207.246 1.00 50.00  ? 26   A   B "C4'" 1 
ATOM   485   O  "O4'" . A   A  1  26   ? 256.302 249.520 205.914 1.00 50.00  ? 26   A   B "O4'" 1 
ATOM   486   C  "C3'" . A   A  1  26   ? 257.839 249.713 207.711 1.00 50.00  ? 26   A   B "C3'" 1 
ATOM   487   O  "O3'" . A   A  1  26   ? 257.925 249.576 209.124 1.00 50.00  ? 26   A   B "O3'" 1 
ATOM   488   C  "C2'" . A   A  1  26   ? 258.079 248.394 206.987 1.00 50.00  ? 26   A   B "C2'" 1 
ATOM   489   O  "O2'" . A   A  1  26   ? 257.485 247.284 207.628 1.00 50.00  ? 26   A   B "O2'" 1 
ATOM   490   C  "C1'" . A   A  1  26   ? 257.399 248.665 205.646 1.00 50.00  ? 26   A   B "C1'" 1 
ATOM   491   N  N9    . A   A  1  26   ? 258.275 249.332 204.685 1.00 50.00  ? 26   A   B N9    1 
ATOM   492   C  C8    . A   A  1  26   ? 258.769 248.827 203.508 1.00 50.00  ? 26   A   B C8    1 
ATOM   493   N  N7    . A   A  1  26   ? 259.538 249.663 202.855 1.00 50.00  ? 26   A   B N7    1 
ATOM   494   C  C5    . A   A  1  26   ? 259.554 250.796 203.657 1.00 50.00  ? 26   A   B C5    1 
ATOM   495   C  C6    . A   A  1  26   ? 260.191 252.042 203.521 1.00 50.00  ? 26   A   B C6    1 
ATOM   496   N  N6    . A   A  1  26   ? 260.966 252.369 202.485 1.00 50.00  ? 26   A   B N6    1 
ATOM   497   N  N1    . A   A  1  26   ? 260.002 252.954 204.500 1.00 50.00  ? 26   A   B N1    1 
ATOM   498   C  C2    . A   A  1  26   ? 259.225 252.625 205.539 1.00 50.00  ? 26   A   B C2    1 
ATOM   499   N  N3    . A   A  1  26   ? 258.573 251.490 205.778 1.00 50.00  ? 26   A   B N3    1 
ATOM   500   C  C4    . A   A  1  26   ? 258.782 250.605 204.788 1.00 50.00  ? 26   A   B C4    1 
ATOM   501   P  P     . U   A  1  27   ? 259.361 249.526 209.817 1.00 50.00  ? 27   U   B P     1 
ATOM   502   O  OP1   . U   A  1  27   ? 259.954 248.190 209.561 1.00 50.00  ? 27   U   B OP1   1 
ATOM   503   O  OP2   . U   A  1  27   ? 259.242 250.011 211.214 1.00 50.00  ? 27   U   B OP2   1 
ATOM   504   O  "O5'" . U   A  1  27   ? 260.195 250.604 208.991 1.00 50.00  ? 27   U   B "O5'" 1 
ATOM   505   C  "C5'" . U   A  1  27   ? 261.553 250.357 208.646 1.00 50.00  ? 27   U   B "C5'" 1 
ATOM   506   C  "C4'" . U   A  1  27   ? 262.487 251.389 209.233 1.00 50.00  ? 27   U   B "C4'" 1 
ATOM   507   O  "O4'" . U   A  1  27   ? 262.518 252.564 208.377 1.00 50.00  ? 27   U   B "O4'" 1 
ATOM   508   C  "C3'" . U   A  1  27   ? 262.126 251.889 210.633 1.00 50.00  ? 27   U   B "C3'" 1 
ATOM   509   O  "O3'" . U   A  1  27   ? 263.323 252.125 211.376 1.00 50.00  ? 27   U   B "O3'" 1 
ATOM   510   C  "C2'" . U   A  1  27   ? 261.438 253.220 210.349 1.00 50.00  ? 27   U   B "C2'" 1 
ATOM   511   O  "O2'" . U   A  1  27   ? 261.480 254.143 211.417 1.00 50.00  ? 27   U   B "O2'" 1 
ATOM   512   C  "C1'" . U   A  1  27   ? 262.225 253.716 209.141 1.00 50.00  ? 27   U   B "C1'" 1 
ATOM   513   N  N1    . U   A  1  27   ? 261.493 254.664 208.291 1.00 50.00  ? 27   U   B N1    1 
ATOM   514   C  C2    . U   A  1  27   ? 262.163 255.802 207.885 1.00 50.00  ? 27   U   B C2    1 
ATOM   515   O  O2    . U   A  1  27   ? 263.318 256.032 208.198 1.00 50.00  ? 27   U   B O2    1 
ATOM   516   N  N3    . U   A  1  27   ? 261.435 256.654 207.096 1.00 50.00  ? 27   U   B N3    1 
ATOM   517   C  C4    . U   A  1  27   ? 260.128 256.490 206.684 1.00 50.00  ? 27   U   B C4    1 
ATOM   518   O  O4    . U   A  1  27   ? 259.607 257.348 205.973 1.00 50.00  ? 27   U   B O4    1 
ATOM   519   C  C5    . U   A  1  27   ? 259.503 255.290 207.151 1.00 50.00  ? 27   U   B C5    1 
ATOM   520   C  C6    . U   A  1  27   ? 260.190 254.438 207.920 1.00 50.00  ? 27   U   B C6    1 
ATOM   521   P  P     . A   A  1  28   ? 263.917 250.984 212.337 1.00 50.00  ? 28   A   B P     1 
ATOM   522   O  OP1   . A   A  1  28   ? 263.915 249.697 211.597 1.00 50.00  ? 28   A   B OP1   1 
ATOM   523   O  OP2   . A   A  1  28   ? 263.220 251.075 213.646 1.00 50.00  ? 28   A   B OP2   1 
ATOM   524   O  "O5'" . A   A  1  28   ? 265.432 251.421 212.557 1.00 50.00  ? 28   A   B "O5'" 1 
ATOM   525   C  "C5'" . A   A  1  28   ? 265.756 252.576 213.319 1.00 50.00  ? 28   A   B "C5'" 1 
ATOM   526   C  "C4'" . A   A  1  28   ? 267.142 253.076 212.999 1.00 50.00  ? 28   A   B "C4'" 1 
ATOM   527   O  "O4'" . A   A  1  28   ? 267.132 253.773 211.723 1.00 50.00  ? 28   A   B "O4'" 1 
ATOM   528   C  "C3'" . A   A  1  28   ? 267.719 254.096 213.968 1.00 50.00  ? 28   A   B "C3'" 1 
ATOM   529   O  "O3'" . A   A  1  28   ? 268.264 253.508 215.136 1.00 50.00  ? 28   A   B "O3'" 1 
ATOM   530   C  "C2'" . A   A  1  28   ? 268.747 254.818 213.108 1.00 50.00  ? 28   A   B "C2'" 1 
ATOM   531   O  "O2'" . A   A  1  28   ? 269.913 254.025 212.950 1.00 50.00  ? 28   A   B "O2'" 1 
ATOM   532   C  "C1'" . A   A  1  28   ? 268.017 254.872 211.767 1.00 50.00  ? 28   A   B "C1'" 1 
ATOM   533   N  N9    . A   A  1  28   ? 267.221 256.108 211.643 1.00 50.00  ? 28   A   B N9    1 
ATOM   534   C  C8    . A   A  1  28   ? 265.855 256.220 211.604 1.00 50.00  ? 28   A   B C8    1 
ATOM   535   N  N7    . A   A  1  28   ? 265.430 257.456 211.498 1.00 50.00  ? 28   A   B N7    1 
ATOM   536   C  C5    . A   A  1  28   ? 266.596 258.206 211.470 1.00 50.00  ? 28   A   B C5    1 
ATOM   537   C  C6    . A   A  1  28   ? 266.828 259.589 211.370 1.00 50.00  ? 28   A   B C6    1 
ATOM   538   N  N6    . A   A  1  28   ? 265.853 260.493 211.276 1.00 50.00  ? 28   A   B N6    1 
ATOM   539   N  N1    . A   A  1  28   ? 268.108 260.015 211.371 1.00 50.00  ? 28   A   B N1    1 
ATOM   540   C  C2    . A   A  1  28   ? 269.086 259.105 211.463 1.00 50.00  ? 28   A   B C2    1 
ATOM   541   N  N3    . A   A  1  28   ? 268.995 257.780 211.562 1.00 50.00  ? 28   A   B N3    1 
ATOM   542   C  C4    . A   A  1  28   ? 267.709 257.391 211.559 1.00 50.00  ? 28   A   B C4    1 
ATOM   543   P  P     . A   A  1  29   ? 268.059 254.216 216.565 1.00 50.00  ? 29   A   B P     1 
ATOM   544   O  OP1   . A   A  1  29   ? 268.430 253.241 217.621 1.00 50.00  ? 29   A   B OP1   1 
ATOM   545   O  OP2   . A   A  1  29   ? 266.708 254.834 216.579 1.00 50.00  ? 29   A   B OP2   1 
ATOM   546   O  "O5'" . A   A  1  29   ? 269.136 255.389 216.573 1.00 50.00  ? 29   A   B "O5'" 1 
ATOM   547   C  "C5'" . A   A  1  29   ? 270.523 255.100 216.471 1.00 50.00  ? 29   A   B "C5'" 1 
ATOM   548   C  "C4'" . A   A  1  29   ? 271.317 256.318 216.069 1.00 50.00  ? 29   A   B "C4'" 1 
ATOM   549   O  "O4'" . A   A  1  29   ? 270.816 256.839 214.810 1.00 50.00  ? 29   A   B "O4'" 1 
ATOM   550   C  "C3'" . A   A  1  29   ? 271.244 257.509 217.012 1.00 50.00  ? 29   A   B "C3'" 1 
ATOM   551   O  "O3'" . A   A  1  29   ? 272.098 257.382 218.136 1.00 50.00  ? 29   A   B "O3'" 1 
ATOM   552   C  "C2'" . A   A  1  29   ? 271.601 258.672 216.099 1.00 50.00  ? 29   A   B "C2'" 1 
ATOM   553   O  "O2'" . A   A  1  29   ? 273.002 258.721 215.874 1.00 50.00  ? 29   A   B "O2'" 1 
ATOM   554   C  "C1'" . A   A  1  29   ? 270.920 258.248 214.797 1.00 50.00  ? 29   A   B "C1'" 1 
ATOM   555   N  N9    . A   A  1  29   ? 269.564 258.817 214.686 1.00 50.00  ? 29   A   B N9    1 
ATOM   556   C  C8    . A   A  1  29   ? 268.366 258.148 214.680 1.00 50.00  ? 29   A   B C8    1 
ATOM   557   N  N7    . A   A  1  29   ? 267.324 258.936 214.573 1.00 50.00  ? 29   A   B N7    1 
ATOM   558   C  C5    . A   A  1  29   ? 267.875 260.208 214.509 1.00 50.00  ? 29   A   B C5    1 
ATOM   559   C  C6    . A   A  1  29   ? 267.302 261.486 214.391 1.00 50.00  ? 29   A   B C6    1 
ATOM   560   N  N6    . A   A  1  29   ? 265.987 261.702 214.313 1.00 50.00  ? 29   A   B N6    1 
ATOM   561   N  N1    . A   A  1  29   ? 268.133 262.551 214.355 1.00 50.00  ? 29   A   B N1    1 
ATOM   562   C  C2    . A   A  1  29   ? 269.451 262.335 214.429 1.00 50.00  ? 29   A   B C2    1 
ATOM   563   N  N3    . A   A  1  29   ? 270.109 261.185 214.544 1.00 50.00  ? 29   A   B N3    1 
ATOM   564   C  C4    . A   A  1  29   ? 269.255 260.150 214.579 1.00 50.00  ? 29   A   B C4    1 
ATOM   565   P  P     . A   A  1  30   ? 271.710 258.085 219.528 1.00 50.00  ? 30   A   B P     1 
ATOM   566   O  OP1   . A   A  1  30   ? 272.485 257.425 220.609 1.00 50.00  ? 30   A   B OP1   1 
ATOM   567   O  OP2   . A   A  1  30   ? 270.229 258.142 219.614 1.00 50.00  ? 30   A   B OP2   1 
ATOM   568   O  "O5'" . A   A  1  30   ? 272.251 259.575 219.371 1.00 50.00  ? 30   A   B "O5'" 1 
ATOM   569   C  "C5'" . A   A  1  30   ? 273.635 259.830 219.181 1.00 50.00  ? 30   A   B "C5'" 1 
ATOM   570   C  "C4'" . A   A  1  30   ? 273.896 261.275 218.838 1.00 50.00  ? 30   A   B "C4'" 1 
ATOM   571   O  "O4'" . A   A  1  30   ? 273.188 261.627 217.620 1.00 50.00  ? 30   A   B "O4'" 1 
ATOM   572   C  "C3'" . A   A  1  30   ? 273.417 262.303 219.851 1.00 50.00  ? 30   A   B "C3'" 1 
ATOM   573   O  "O3'" . A   A  1  30   ? 274.304 262.460 220.944 1.00 50.00  ? 30   A   B "O3'" 1 
ATOM   574   C  "C2'" . A   A  1  30   ? 273.270 263.559 219.002 1.00 50.00  ? 30   A   B "C2'" 1 
ATOM   575   O  "O2'" . A   A  1  30   ? 274.537 264.158 218.766 1.00 50.00  ? 30   A   B "O2'" 1 
ATOM   576   C  "C1'" . A   A  1  30   ? 272.759 262.973 217.686 1.00 50.00  ? 30   A   B "C1'" 1 
ATOM   577   N  N9    . A   A  1  30   ? 271.287 263.003 217.606 1.00 50.00  ? 30   A   B N9    1 
ATOM   578   C  C8    . A   A  1  30   ? 270.423 261.938 217.573 1.00 50.00  ? 30   A   B C8    1 
ATOM   579   N  N7    . A   A  1  30   ? 269.160 262.286 217.503 1.00 50.00  ? 30   A   B N7    1 
ATOM   580   C  C5    . A   A  1  30   ? 269.201 263.675 217.485 1.00 50.00  ? 30   A   B C5    1 
ATOM   581   C  C6    . A   A  1  30   ? 268.190 264.650 217.418 1.00 50.00  ? 30   A   B C6    1 
ATOM   582   N  N6    . A   A  1  30   ? 266.889 264.360 217.353 1.00 50.00  ? 30   A   B N6    1 
ATOM   583   N  N1    . A   A  1  30   ? 268.563 265.948 217.424 1.00 50.00  ? 30   A   B N1    1 
ATOM   584   C  C2    . A   A  1  30   ? 269.868 266.238 217.489 1.00 50.00  ? 30   A   B C2    1 
ATOM   585   N  N3    . A   A  1  30   ? 270.909 265.411 217.556 1.00 50.00  ? 30   A   B N3    1 
ATOM   586   C  C4    . A   A  1  30   ? 270.502 264.129 217.547 1.00 50.00  ? 30   A   B C4    1 
ATOM   587   P  P     . U   A  1  31   ? 273.737 262.855 222.396 1.00 50.00  ? 31   U   B P     1 
ATOM   588   O  OP1   . U   A  1  31   ? 274.867 262.811 223.358 1.00 50.00  ? 31   U   B OP1   1 
ATOM   589   O  OP2   . U   A  1  31   ? 272.522 262.040 222.653 1.00 50.00  ? 31   U   B OP2   1 
ATOM   590   O  "O5'" . U   A  1  31   ? 273.289 264.376 222.238 1.00 50.00  ? 31   U   B "O5'" 1 
ATOM   591   C  "C5'" . U   A  1  31   ? 274.242 265.396 221.982 1.00 50.00  ? 31   U   B "C5'" 1 
ATOM   592   C  "C4'" . U   A  1  31   ? 273.581 266.741 221.808 1.00 50.00  ? 31   U   B "C4'" 1 
ATOM   593   O  "O4'" . U   A  1  31   ? 272.707 266.714 220.649 1.00 50.00  ? 31   U   B "O4'" 1 
ATOM   594   C  "C3'" . U   A  1  31   ? 272.675 267.190 222.943 1.00 50.00  ? 31   U   B "C3'" 1 
ATOM   595   O  "O3'" . U   A  1  31   ? 273.387 267.751 224.031 1.00 50.00  ? 31   U   B "O3'" 1 
ATOM   596   C  "C2'" . U   A  1  31   ? 271.742 268.176 222.255 1.00 50.00  ? 31   U   B "C2'" 1 
ATOM   597   O  "O2'" . U   A  1  31   ? 272.379 269.434 222.083 1.00 50.00  ? 31   U   B "O2'" 1 
ATOM   598   C  "C1'" . U   A  1  31   ? 271.575 267.528 220.879 1.00 50.00  ? 31   U   B "C1'" 1 
ATOM   599   N  N1    . U   A  1  31   ? 270.361 266.683 220.794 1.00 50.00  ? 31   U   B N1    1 
ATOM   600   C  C2    . U   A  1  31   ? 269.126 267.307 220.725 1.00 50.00  ? 31   U   B C2    1 
ATOM   601   O  O2    . U   A  1  31   ? 268.985 268.518 220.748 1.00 50.00  ? 31   U   B O2    1 
ATOM   602   N  N3    . U   A  1  31   ? 268.048 266.457 220.643 1.00 50.00  ? 31   U   B N3    1 
ATOM   603   C  C4    . U   A  1  31   ? 268.078 265.077 220.614 1.00 50.00  ? 31   U   B C4    1 
ATOM   604   O  O4    . U   A  1  31   ? 267.026 264.439 220.532 1.00 50.00  ? 31   U   B O4    1 
ATOM   605   C  C5    . U   A  1  31   ? 269.390 264.512 220.680 1.00 50.00  ? 31   U   B C5    1 
ATOM   606   C  C6    . U   A  1  31   ? 270.457 265.314 220.763 1.00 50.00  ? 31   U   B C6    1 
ATOM   607   P  P     . C   A  1  32   ? 272.781 267.682 225.517 1.00 50.00  ? 32   C   B P     1 
ATOM   608   O  OP1   . C   A  1  32   ? 273.837 268.125 226.465 1.00 50.00  ? 32   C   B OP1   1 
ATOM   609   O  OP2   . C   A  1  32   ? 272.149 266.352 225.694 1.00 50.00  ? 32   C   B OP2   1 
ATOM   610   O  "O5'" . C   A  1  32   ? 271.627 268.782 225.517 1.00 50.00  ? 32   C   B "O5'" 1 
ATOM   611   C  "C5'" . C   A  1  32   ? 271.931 270.161 225.366 1.00 50.00  ? 32   C   B "C5'" 1 
ATOM   612   C  "C4'" . C   A  1  32   ? 270.679 270.995 225.258 1.00 50.00  ? 32   C   B "C4'" 1 
ATOM   613   O  "O4'" . C   A  1  32   ? 269.939 270.617 224.068 1.00 50.00  ? 32   C   B "O4'" 1 
ATOM   614   C  "C3'" . C   A  1  32   ? 269.672 270.833 226.388 1.00 50.00  ? 32   C   B "C3'" 1 
ATOM   615   O  "O3'" . C   A  1  32   ? 269.998 271.602 227.533 1.00 50.00  ? 32   C   B "O3'" 1 
ATOM   616   C  "C2'" . C   A  1  32   ? 268.363 271.249 225.731 1.00 50.00  ? 32   C   B "C2'" 1 
ATOM   617   O  "O2'" . C   A  1  32   ? 268.261 272.664 225.669 1.00 50.00  ? 32   C   B "O2'" 1 
ATOM   618   C  "C1'" . C   A  1  32   ? 268.551 270.718 224.310 1.00 50.00  ? 32   C   B "C1'" 1 
ATOM   619   N  N1    . C   A  1  32   ? 267.939 269.382 224.115 1.00 50.00  ? 32   C   B N1    1 
ATOM   620   C  C2    . C   A  1  32   ? 266.548 269.267 224.006 1.00 50.00  ? 32   C   B C2    1 
ATOM   621   O  O2    . C   A  1  32   ? 265.855 270.291 224.093 1.00 50.00  ? 32   C   B O2    1 
ATOM   622   N  N3    . C   A  1  32   ? 266.000 268.043 223.820 1.00 50.00  ? 32   C   B N3    1 
ATOM   623   C  C4    . C   A  1  32   ? 266.781 266.963 223.735 1.00 50.00  ? 32   C   B C4    1 
ATOM   624   N  N4    . C   A  1  32   ? 266.202 265.774 223.550 1.00 50.00  ? 32   C   B N4    1 
ATOM   625   C  C5    . C   A  1  32   ? 268.198 267.053 223.837 1.00 50.00  ? 32   C   B C5    1 
ATOM   626   C  C6    . C   A  1  32   ? 268.725 268.270 224.019 1.00 50.00  ? 32   C   B C6    1 
ATOM   627   P  P     . U   A  1  33   ? 269.479 271.152 228.985 1.00 50.00  ? 33   U   B P     1 
ATOM   628   O  OP1   . U   A  1  33   ? 270.134 272.019 229.997 1.00 50.00  ? 33   U   B OP1   1 
ATOM   629   O  OP2   . U   A  1  33   ? 269.617 269.676 229.085 1.00 50.00  ? 33   U   B OP2   1 
ATOM   630   O  "O5'" . U   A  1  33   ? 267.924 271.500 228.969 1.00 50.00  ? 33   U   B "O5'" 1 
ATOM   631   C  "C5'" . U   A  1  33   ? 267.473 272.845 228.883 1.00 50.00  ? 33   U   B "C5'" 1 
ATOM   632   C  "C4'" . U   A  1  33   ? 265.968 272.912 228.817 1.00 50.00  ? 33   U   B "C4'" 1 
ATOM   633   O  "O4'" . U   A  1  33   ? 265.503 272.283 227.597 1.00 50.00  ? 33   U   B "O4'" 1 
ATOM   634   C  "C3'" . U   A  1  33   ? 265.226 272.179 229.925 1.00 50.00  ? 33   U   B "C3'" 1 
ATOM   635   O  "O3'" . U   A  1  33   ? 265.113 272.957 231.104 1.00 50.00  ? 33   U   B "O3'" 1 
ATOM   636   C  "C2'" . U   A  1  33   ? 263.882 271.855 229.284 1.00 50.00  ? 33   U   B "C2'" 1 
ATOM   637   O  "O2'" . U   A  1  33   ? 263.016 272.979 229.339 1.00 50.00  ? 33   U   B "O2'" 1 
ATOM   638   C  "C1'" . U   A  1  33   ? 264.278 271.621 227.826 1.00 50.00  ? 33   U   B "C1'" 1 
ATOM   639   N  N1    . U   A  1  33   ? 264.448 270.189 227.487 1.00 50.00  ? 33   U   B N1    1 
ATOM   640   C  C2    . U   A  1  33   ? 263.321 269.436 227.216 1.00 50.00  ? 33   U   B C2    1 
ATOM   641   O  O2    . U   A  1  33   ? 262.192 269.891 227.267 1.00 50.00  ? 33   U   B O2    1 
ATOM   642   N  N3    . U   A  1  33   ? 263.566 268.122 226.891 1.00 50.00  ? 33   U   B N3    1 
ATOM   643   C  C4    . U   A  1  33   ? 264.796 267.502 226.804 1.00 50.00  ? 33   U   B C4    1 
ATOM   644   O  O4    . U   A  1  33   ? 264.866 266.312 226.499 1.00 50.00  ? 33   U   B O4    1 
ATOM   645   C  C5    . U   A  1  33   ? 265.910 268.351 227.091 1.00 50.00  ? 33   U   B C5    1 
ATOM   646   C  C6    . U   A  1  33   ? 265.703 269.632 227.408 1.00 50.00  ? 33   U   B C6    1 
ATOM   647   P  P     . U   A  1  34   ? 265.966 272.584 232.413 1.00 50.00  ? 34   U   B P     1 
ATOM   648   O  OP1   . U   A  1  34   ? 266.270 273.843 233.140 1.00 50.00  ? 34   U   B OP1   1 
ATOM   649   O  OP2   . U   A  1  34   ? 267.076 271.690 231.998 1.00 50.00  ? 34   U   B OP2   1 
ATOM   650   O  "O5'" . U   A  1  34   ? 264.954 271.732 233.300 1.00 50.00  ? 34   U   B "O5'" 1 
ATOM   651   C  "C5'" . U   A  1  34   ? 264.728 270.360 233.023 1.00 50.00  ? 34   U   B "C5'" 1 
ATOM   652   C  "C4'" . U   A  1  34   ? 263.268 270.069 232.795 1.00 50.00  ? 34   U   B "C4'" 1 
ATOM   653   O  "O4'" . U   A  1  34   ? 263.067 269.644 231.423 1.00 50.00  ? 34   U   B "O4'" 1 
ATOM   654   C  "C3'" . U   A  1  34   ? 262.692 268.936 233.630 1.00 50.00  ? 34   U   B "C3'" 1 
ATOM   655   O  "O3'" . U   A  1  34   ? 262.300 269.367 234.921 1.00 50.00  ? 34   U   B "O3'" 1 
ATOM   656   C  "C2'" . U   A  1  34   ? 261.541 268.427 232.774 1.00 50.00  ? 34   U   B "C2'" 1 
ATOM   657   O  "O2'" . U   A  1  34   ? 260.399 269.258 232.923 1.00 50.00  ? 34   U   B "O2'" 1 
ATOM   658   C  "C1'" . U   A  1  34   ? 262.099 268.621 231.364 1.00 50.00  ? 34   U   B "C1'" 1 
ATOM   659   N  N1    . U   A  1  34   ? 262.753 267.403 230.831 1.00 50.00  ? 34   U   B N1    1 
ATOM   660   C  C2    . U   A  1  34   ? 261.978 266.381 230.316 1.00 50.00  ? 34   U   B C2    1 
ATOM   661   O  O2    . U   A  1  34   ? 260.760 266.418 230.286 1.00 50.00  ? 34   U   B O2    1 
ATOM   662   N  N3    . U   A  1  34   ? 262.691 265.302 229.840 1.00 50.00  ? 34   U   B N3    1 
ATOM   663   C  C4    . U   A  1  34   ? 264.064 265.153 229.823 1.00 50.00  ? 34   U   B C4    1 
ATOM   664   O  O4    . U   A  1  34   ? 264.573 264.132 229.361 1.00 50.00  ? 34   U   B O4    1 
ATOM   665   C  C5    . U   A  1  34   ? 264.790 266.256 230.365 1.00 50.00  ? 34   U   B C5    1 
ATOM   666   C  C6    . U   A  1  34   ? 264.125 267.314 230.833 1.00 50.00  ? 34   U   B C6    1 
ATOM   667   P  P     . U   A  1  35   ? 262.268 268.333 236.150 1.00 50.00  ? 35   U   B P     1 
ATOM   668   O  OP1   . U   A  1  35   ? 262.170 269.116 237.408 1.00 50.00  ? 35   U   B OP1   1 
ATOM   669   O  OP2   . U   A  1  35   ? 263.380 267.366 235.970 1.00 50.00  ? 35   U   B OP2   1 
ATOM   670   O  "O5'" . U   A  1  35   ? 260.895 267.555 235.949 1.00 50.00  ? 35   U   B "O5'" 1 
ATOM   671   C  "C5'" . U   A  1  35   ? 260.654 266.324 236.611 1.00 50.00  ? 35   U   B "C5'" 1 
ATOM   672   C  "C4'" . U   A  1  35   ? 259.824 265.402 235.758 1.00 50.00  ? 35   U   B "C4'" 1 
ATOM   673   O  "O4'" . U   A  1  35   ? 260.368 265.357 234.414 1.00 50.00  ? 35   U   B "O4'" 1 
ATOM   674   C  "C3'" . U   A  1  35   ? 259.792 263.947 236.195 1.00 50.00  ? 35   U   B "C3'" 1 
ATOM   675   O  "O3'" . U   A  1  35   ? 258.872 263.704 237.244 1.00 50.00  ? 35   U   B "O3'" 1 
ATOM   676   C  "C2'" . U   A  1  35   ? 259.453 263.220 234.903 1.00 50.00  ? 35   U   B "C2'" 1 
ATOM   677   O  "O2'" . U   A  1  35   ? 258.065 263.315 234.622 1.00 50.00  ? 35   U   B "O2'" 1 
ATOM   678   C  "C1'" . U   A  1  35   ? 260.212 264.062 233.875 1.00 50.00  ? 35   U   B "C1'" 1 
ATOM   679   N  N1    . U   A  1  35   ? 261.554 263.508 233.578 1.00 50.00  ? 35   U   B N1    1 
ATOM   680   C  C2    . U   A  1  35   ? 261.613 262.344 232.840 1.00 50.00  ? 35   U   B C2    1 
ATOM   681   O  O2    . U   A  1  35   ? 260.627 261.754 232.435 1.00 50.00  ? 35   U   B O2    1 
ATOM   682   N  N3    . U   A  1  35   ? 262.873 261.870 232.593 1.00 50.00  ? 35   U   B N3    1 
ATOM   683   C  C4    . U   A  1  35   ? 264.066 262.437 232.990 1.00 50.00  ? 35   U   B C4    1 
ATOM   684   O  O4    . U   A  1  35   ? 265.124 261.888 232.683 1.00 50.00  ? 35   U   B O4    1 
ATOM   685   C  C5    . U   A  1  35   ? 263.926 263.645 233.746 1.00 50.00  ? 35   U   B C5    1 
ATOM   686   C  C6    . U   A  1  35   ? 262.705 264.128 234.005 1.00 50.00  ? 35   U   B C6    1 
ATOM   687   P  P     . C   A  1  36   ? 259.403 263.499 238.745 1.00 50.00  ? 36   C   B P     1 
ATOM   688   O  OP1   . C   A  1  36   ? 258.459 262.592 239.449 1.00 50.00  ? 36   C   B OP1   1 
ATOM   689   O  OP2   . C   A  1  36   ? 259.698 264.837 239.319 1.00 50.00  ? 36   C   B OP2   1 
ATOM   690   O  "O5'" . C   A  1  36   ? 260.783 262.725 238.557 1.00 50.00  ? 36   C   B "O5'" 1 
ATOM   691   C  "C5'" . C   A  1  36   ? 260.910 261.363 238.930 1.00 50.00  ? 36   C   B "C5'" 1 
ATOM   692   C  "C4'" . C   A  1  36   ? 260.475 260.439 237.820 1.00 50.00  ? 36   C   B "C4'" 1 
ATOM   693   O  "O4'" . C   A  1  36   ? 261.174 260.774 236.593 1.00 50.00  ? 36   C   B "O4'" 1 
ATOM   694   C  "C3'" . C   A  1  36   ? 260.783 258.965 238.029 1.00 50.00  ? 36   C   B "C3'" 1 
ATOM   695   O  "O3'" . C   A  1  36   ? 259.843 258.311 238.863 1.00 50.00  ? 36   C   B "O3'" 1 
ATOM   696   C  "C2'" . C   A  1  36   ? 260.813 258.428 236.608 1.00 50.00  ? 36   C   B "C2'" 1 
ATOM   697   O  "O2'" . C   A  1  36   ? 259.496 258.245 236.111 1.00 50.00  ? 36   C   B "O2'" 1 
ATOM   698   C  "C1'" . C   A  1  36   ? 261.450 259.600 235.859 1.00 50.00  ? 36   C   B "C1'" 1 
ATOM   699   N  N1    . C   A  1  36   ? 262.921 259.457 235.742 1.00 50.00  ? 36   C   B N1    1 
ATOM   700   C  C2    . C   A  1  36   ? 263.472 258.448 234.941 1.00 50.00  ? 36   C   B C2    1 
ATOM   701   O  O2    . C   A  1  36   ? 262.727 257.663 234.335 1.00 50.00  ? 36   C   B O2    1 
ATOM   702   N  N3    . C   A  1  36   ? 264.817 258.341 234.845 1.00 50.00  ? 36   C   B N3    1 
ATOM   703   C  C4    . C   A  1  36   ? 265.607 259.192 235.502 1.00 50.00  ? 36   C   B C4    1 
ATOM   704   N  N4    . C   A  1  36   ? 266.929 259.044 235.374 1.00 50.00  ? 36   C   B N4    1 
ATOM   705   C  C5    . C   A  1  36   ? 265.077 260.230 236.320 1.00 50.00  ? 36   C   B C5    1 
ATOM   706   C  C6    . C   A  1  36   ? 263.744 260.324 236.405 1.00 50.00  ? 36   C   B C6    1 
ATOM   707   P  P     . G   A  1  37   ? 260.342 257.193 239.903 1.00 50.00  ? 37   G   B P     1 
ATOM   708   O  OP1   . G   A  1  37   ? 259.208 256.272 240.171 1.00 50.00  ? 37   G   B OP1   1 
ATOM   709   O  OP2   . G   A  1  37   ? 261.012 257.883 241.031 1.00 50.00  ? 37   G   B OP2   1 
ATOM   710   O  "O5'" . G   A  1  37   ? 261.448 256.386 239.090 1.00 50.00  ? 37   G   B "O5'" 1 
ATOM   711   C  "C5'" . G   A  1  37   ? 262.504 255.718 239.765 1.00 50.00  ? 37   G   B "C5'" 1 
ATOM   712   C  "C4'" . G   A  1  37   ? 262.988 254.521 238.991 1.00 50.00  ? 37   G   B "C4'" 1 
ATOM   713   O  "O4'" . G   A  1  37   ? 263.480 254.939 237.690 1.00 50.00  ? 37   G   B "O4'" 1 
ATOM   714   C  "C3'" . G   A  1  37   ? 264.159 253.771 239.602 1.00 50.00  ? 37   G   B "C3'" 1 
ATOM   715   O  "O3'" . G   A  1  37   ? 263.773 252.882 240.635 1.00 50.00  ? 37   G   B "O3'" 1 
ATOM   716   C  "C2'" . G   A  1  37   ? 264.775 253.077 238.396 1.00 50.00  ? 37   G   B "C2'" 1 
ATOM   717   O  "O2'" . G   A  1  37   ? 264.024 251.926 238.040 1.00 50.00  ? 37   G   B "O2'" 1 
ATOM   718   C  "C1'" . G   A  1  37   ? 264.580 254.136 237.311 1.00 50.00  ? 37   G   B "C1'" 1 
ATOM   719   N  N9    . G   A  1  37   ? 265.764 255.004 237.163 1.00 50.00  ? 37   G   B N9    1 
ATOM   720   C  C8    . G   A  1  37   ? 265.821 256.359 237.379 1.00 50.00  ? 37   G   B C8    1 
ATOM   721   N  N7    . G   A  1  37   ? 267.006 256.863 237.166 1.00 50.00  ? 37   G   B N7    1 
ATOM   722   C  C5    . G   A  1  37   ? 267.778 255.777 236.784 1.00 50.00  ? 37   G   B C5    1 
ATOM   723   C  C6    . G   A  1  37   ? 269.149 255.709 236.425 1.00 50.00  ? 37   G   B C6    1 
ATOM   724   O  O6    . G   A  1  37   ? 269.977 256.626 236.371 1.00 50.00  ? 37   G   B O6    1 
ATOM   725   N  N1    . G   A  1  37   ? 269.530 254.409 236.105 1.00 50.00  ? 37   G   B N1    1 
ATOM   726   C  C2    . G   A  1  37   ? 268.700 253.316 236.128 1.00 50.00  ? 37   G   B C2    1 
ATOM   727   N  N2    . G   A  1  37   ? 269.257 252.144 235.785 1.00 50.00  ? 37   G   B N2    1 
ATOM   728   N  N3    . G   A  1  37   ? 267.421 253.367 236.461 1.00 50.00  ? 37   G   B N3    1 
ATOM   729   C  C4    . G   A  1  37   ? 267.028 254.621 236.774 1.00 50.00  ? 37   G   B C4    1 
ATOM   730   P  P     . C   A  1  38   ? 264.254 253.139 242.147 1.00 50.00  ? 38   C   B P     1 
ATOM   731   O  OP1   . C   A  1  38   ? 263.367 252.363 243.049 1.00 50.00  ? 38   C   B OP1   1 
ATOM   732   O  OP2   . C   A  1  38   ? 264.394 254.605 242.337 1.00 50.00  ? 38   C   B OP2   1 
ATOM   733   O  "O5'" . C   A  1  38   ? 265.710 252.495 242.213 1.00 50.00  ? 38   C   B "O5'" 1 
ATOM   734   C  "C5'" . C   A  1  38   ? 266.844 253.197 241.726 1.00 50.00  ? 38   C   B "C5'" 1 
ATOM   735   C  "C4'" . C   A  1  38   ? 267.807 252.274 241.024 1.00 50.00  ? 38   C   B "C4'" 1 
ATOM   736   O  "O4'" . C   A  1  38   ? 268.129 252.804 239.711 1.00 50.00  ? 38   C   B "O4'" 1 
ATOM   737   C  "C3'" . C   A  1  38   ? 269.161 252.096 241.692 1.00 50.00  ? 38   C   B "C3'" 1 
ATOM   738   O  "O3'" . C   A  1  38   ? 269.137 251.176 242.767 1.00 50.00  ? 38   C   B "O3'" 1 
ATOM   739   C  "C2'" . C   A  1  38   ? 270.048 251.673 240.531 1.00 50.00  ? 38   C   B "C2'" 1 
ATOM   740   O  "O2'" . C   A  1  38   ? 269.843 250.304 240.217 1.00 50.00  ? 38   C   B "O2'" 1 
ATOM   741   C  "C1'" . C   A  1  38   ? 269.476 252.519 239.395 1.00 50.00  ? 38   C   B "C1'" 1 
ATOM   742   N  N1    . C   A  1  38   ? 270.200 253.801 239.235 1.00 50.00  ? 38   C   B N1    1 
ATOM   743   C  C2    . C   A  1  38   ? 271.425 253.813 238.561 1.00 50.00  ? 38   C   B C2    1 
ATOM   744   O  O2    . C   A  1  38   ? 271.878 252.748 238.112 1.00 50.00  ? 38   C   B O2    1 
ATOM   745   N  N3    . C   A  1  38   ? 272.088 254.982 238.414 1.00 50.00  ? 38   C   B N3    1 
ATOM   746   C  C4    . C   A  1  38   ? 271.574 256.109 238.911 1.00 50.00  ? 38   C   B C4    1 
ATOM   747   N  N4    . C   A  1  38   ? 272.263 257.241 238.741 1.00 50.00  ? 38   C   B N4    1 
ATOM   748   C  C5    . C   A  1  38   ? 270.328 256.126 239.600 1.00 50.00  ? 38   C   B C5    1 
ATOM   749   C  C6    . C   A  1  38   ? 269.683 254.963 239.738 1.00 50.00  ? 38   C   B C6    1 
ATOM   750   P  P     . C   A  1  39   ? 269.614 251.647 244.225 1.00 50.00  ? 39   C   B P     1 
ATOM   751   O  OP1   . C   A  1  39   ? 271.005 251.167 244.431 1.00 50.00  ? 39   C   B OP1   1 
ATOM   752   O  OP2   . C   A  1  39   ? 268.558 251.275 245.201 1.00 50.00  ? 39   C   B OP2   1 
ATOM   753   O  "O5'" . C   A  1  39   ? 269.647 253.235 244.112 1.00 50.00  ? 39   C   B "O5'" 1 
ATOM   754   C  "C5'" . C   A  1  39   ? 270.187 254.035 245.158 1.00 50.00  ? 39   C   B "C5'" 1 
ATOM   755   C  "C4'" . C   A  1  39   ? 271.645 254.343 244.923 1.00 50.00  ? 39   C   B "C4'" 1 
ATOM   756   O  "O4'" . C   A  1  39   ? 271.794 255.013 243.640 1.00 50.00  ? 39   C   B "O4'" 1 
ATOM   757   C  "C3'" . C   A  1  39   ? 272.297 255.256 245.962 1.00 50.00  ? 39   C   B "C3'" 1 
ATOM   758   O  "O3'" . C   A  1  39   ? 273.654 254.863 246.147 1.00 50.00  ? 39   C   B "O3'" 1 
ATOM   759   C  "C2'" . C   A  1  39   ? 272.253 256.621 245.284 1.00 50.00  ? 39   C   B "C2'" 1 
ATOM   760   O  "O2'" . C   A  1  39   ? 273.230 257.532 245.739 1.00 50.00  ? 39   C   B "O2'" 1 
ATOM   761   C  "C1'" . C   A  1  39   ? 272.471 256.241 243.822 1.00 50.00  ? 39   C   B "C1'" 1 
ATOM   762   N  N1    . C   A  1  39   ? 271.928 257.219 242.867 1.00 50.00  ? 39   C   B N1    1 
ATOM   763   C  C2    . C   A  1  39   ? 272.783 257.751 241.899 1.00 50.00  ? 39   C   B C2    1 
ATOM   764   O  O2    . C   A  1  39   ? 273.965 257.374 241.871 1.00 50.00  ? 39   C   B O2    1 
ATOM   765   N  N3    . C   A  1  39   ? 272.300 258.654 241.017 1.00 50.00  ? 39   C   B N3    1 
ATOM   766   C  C4    . C   A  1  39   ? 271.024 259.033 241.082 1.00 50.00  ? 39   C   B C4    1 
ATOM   767   N  N4    . C   A  1  39   ? 270.590 259.927 240.192 1.00 50.00  ? 39   C   B N4    1 
ATOM   768   C  C5    . C   A  1  39   ? 270.132 258.509 242.062 1.00 50.00  ? 39   C   B C5    1 
ATOM   769   C  C6    . C   A  1  39   ? 270.622 257.614 242.930 1.00 50.00  ? 39   C   B C6    1 
ATOM   770   P  P     . U   A  1  40   ? 274.342 255.003 247.592 1.00 50.00  ? 40   U   B P     1 
ATOM   771   O  OP1   . U   A  1  40   ? 274.265 253.679 248.258 1.00 50.00  ? 40   U   B OP1   1 
ATOM   772   O  OP2   . U   A  1  40   ? 273.770 256.197 248.264 1.00 50.00  ? 40   U   B OP2   1 
ATOM   773   O  "O5'" . U   A  1  40   ? 275.869 255.307 247.257 1.00 50.00  ? 40   U   B "O5'" 1 
ATOM   774   C  "C5'" . U   A  1  40   ? 276.218 256.140 246.162 1.00 50.00  ? 40   U   B "C5'" 1 
ATOM   775   C  "C4'" . U   A  1  40   ? 277.706 256.155 245.924 1.00 50.00  ? 40   U   B "C4'" 1 
ATOM   776   O  "O4'" . U   A  1  40   ? 278.183 254.803 245.707 1.00 50.00  ? 40   U   B "O4'" 1 
ATOM   777   C  "C3'" . U   A  1  40   ? 278.172 256.914 244.694 1.00 50.00  ? 40   U   B "C3'" 1 
ATOM   778   O  "O3'" . U   A  1  40   ? 278.247 258.312 244.901 1.00 50.00  ? 40   U   B "O3'" 1 
ATOM   779   C  "C2'" . U   A  1  40   ? 279.516 256.264 244.391 1.00 50.00  ? 40   U   B "C2'" 1 
ATOM   780   O  "O2'" . U   A  1  40   ? 280.523 256.770 245.256 1.00 50.00  ? 40   U   B "O2'" 1 
ATOM   781   C  "C1'" . U   A  1  40   ? 279.240 254.808 244.769 1.00 50.00  ? 40   U   B "C1'" 1 
ATOM   782   N  N1    . U   A  1  40   ? 278.840 253.994 243.600 1.00 50.00  ? 40   U   B N1    1 
ATOM   783   C  C2    . U   A  1  40   ? 279.837 253.550 242.751 1.00 50.00  ? 40   U   B C2    1 
ATOM   784   O  O2    . U   A  1  40   ? 281.018 253.802 242.925 1.00 50.00  ? 40   U   B O2    1 
ATOM   785   N  N3    . U   A  1  40   ? 279.403 252.799 241.688 1.00 50.00  ? 40   U   B N3    1 
ATOM   786   C  C4    . U   A  1  40   ? 278.100 252.453 241.394 1.00 50.00  ? 40   U   B C4    1 
ATOM   787   O  O4    . U   A  1  40   ? 277.866 251.769 240.396 1.00 50.00  ? 40   U   B O4    1 
ATOM   788   C  C5    . U   A  1  40   ? 277.127 252.949 242.317 1.00 50.00  ? 40   U   B C5    1 
ATOM   789   C  C6    . U   A  1  40   ? 277.523 253.682 243.363 1.00 50.00  ? 40   U   B C6    1 
ATOM   790   P  P     . U   A  1  41   ? 277.456 259.315 243.926 1.00 50.00  ? 41   U   B P     1 
ATOM   791   O  OP1   . U   A  1  41   ? 276.636 260.223 244.766 1.00 50.00  ? 41   U   B OP1   1 
ATOM   792   O  OP2   . U   A  1  41   ? 276.805 258.504 242.868 1.00 50.00  ? 41   U   B OP2   1 
ATOM   793   O  "O5'" . U   A  1  41   ? 278.607 260.177 243.243 1.00 50.00  ? 41   U   B "O5'" 1 
ATOM   794   C  "C5'" . U   A  1  41   ? 278.397 260.805 241.989 1.00 50.00  ? 41   U   B "C5'" 1 
ATOM   795   C  "C4'" . U   A  1  41   ? 279.703 261.177 241.335 1.00 50.00  ? 41   U   B "C4'" 1 
ATOM   796   O  "O4'" . U   A  1  41   ? 280.754 260.300 241.810 1.00 50.00  ? 41   U   B "O4'" 1 
ATOM   797   C  "C3'" . U   A  1  41   ? 279.748 261.034 239.823 1.00 50.00  ? 41   U   B "C3'" 1 
ATOM   798   O  "O3'" . U   A  1  41   ? 279.187 262.150 239.153 1.00 50.00  ? 41   U   B "O3'" 1 
ATOM   799   C  "C2'" . U   A  1  41   ? 281.234 260.840 239.545 1.00 50.00  ? 41   U   B "C2'" 1 
ATOM   800   O  "O2'" . U   A  1  41   ? 281.913 262.089 239.554 1.00 50.00  ? 41   U   B "O2'" 1 
ATOM   801   C  "C1'" . U   A  1  41   ? 281.676 260.042 240.773 1.00 50.00  ? 41   U   B "C1'" 1 
ATOM   802   N  N1    . U   A  1  41   ? 281.711 258.581 240.530 1.00 50.00  ? 41   U   B N1    1 
ATOM   803   C  C2    . U   A  1  41   ? 282.748 258.063 239.778 1.00 50.00  ? 41   U   B C2    1 
ATOM   804   O  O2    . U   A  1  41   ? 283.627 258.755 239.292 1.00 50.00  ? 41   U   B O2    1 
ATOM   805   N  N3    . U   A  1  41   ? 282.715 256.700 239.605 1.00 50.00  ? 41   U   B N3    1 
ATOM   806   C  C4    . U   A  1  41   ? 281.777 255.821 240.103 1.00 50.00  ? 41   U   B C4    1 
ATOM   807   O  O4    . U   A  1  41   ? 281.885 254.618 239.861 1.00 50.00  ? 41   U   B O4    1 
ATOM   808   C  C5    . U   A  1  41   ? 280.741 256.432 240.878 1.00 50.00  ? 41   U   B C5    1 
ATOM   809   C  C6    . U   A  1  41   ? 280.746 257.756 241.061 1.00 50.00  ? 41   U   B C6    1 
ATOM   810   P  P     . U   A  1  42   ? 278.665 262.018 237.639 1.00 50.00  ? 42   U   B P     1 
ATOM   811   O  OP1   . U   A  1  42   ? 277.205 262.292 237.637 1.00 50.00  ? 42   U   B OP1   1 
ATOM   812   O  OP2   . U   A  1  42   ? 279.170 260.741 237.075 1.00 50.00  ? 42   U   B OP2   1 
ATOM   813   O  "O5'" . U   A  1  42   ? 279.390 263.216 236.880 1.00 50.00  ? 42   U   B "O5'" 1 
ATOM   814   C  "C5'" . U   A  1  42   ? 279.400 263.281 235.462 1.00 50.00  ? 42   U   B "C5'" 1 
ATOM   815   C  "C4'" . U   A  1  42   ? 280.772 263.624 234.938 1.00 50.00  ? 42   U   B "C4'" 1 
ATOM   816   O  "O4'" . U   A  1  42   ? 281.776 262.936 235.725 1.00 50.00  ? 42   U   B "O4'" 1 
ATOM   817   C  "C3'" . U   A  1  42   ? 281.059 263.196 233.506 1.00 50.00  ? 42   U   B "C3'" 1 
ATOM   818   O  "O3'" . U   A  1  42   ? 280.564 264.114 232.546 1.00 50.00  ? 42   U   B "O3'" 1 
ATOM   819   C  "C2'" . U   A  1  42   ? 282.577 263.067 233.492 1.00 50.00  ? 42   U   B "C2'" 1 
ATOM   820   O  "O2'" . U   A  1  42   ? 283.188 264.343 233.367 1.00 50.00  ? 42   U   B "O2'" 1 
ATOM   821   C  "C1'" . U   A  1  42   ? 282.851 262.537 234.901 1.00 50.00  ? 42   U   B "C1'" 1 
ATOM   822   N  N1    . U   A  1  42   ? 282.943 261.059 234.940 1.00 50.00  ? 42   U   B N1    1 
ATOM   823   C  C2    . U   A  1  42   ? 284.110 260.469 234.491 1.00 50.00  ? 42   U   B C2    1 
ATOM   824   O  O2    . U   A  1  42   ? 285.056 261.105 234.061 1.00 50.00  ? 42   U   B O2    1 
ATOM   825   N  N3    . U   A  1  42   ? 284.125 259.097 234.563 1.00 50.00  ? 42   U   B N3    1 
ATOM   826   C  C4    . U   A  1  42   ? 283.118 258.276 235.029 1.00 50.00  ? 42   U   B C4    1 
ATOM   827   O  O4    . U   A  1  42   ? 283.283 257.057 235.029 1.00 50.00  ? 42   U   B O4    1 
ATOM   828   C  C5    . U   A  1  42   ? 281.948 258.964 235.479 1.00 50.00  ? 42   U   B C5    1 
ATOM   829   C  C6    . U   A  1  42   ? 281.904 260.299 235.421 1.00 50.00  ? 42   U   B C6    1 
ATOM   830   P  P     . U   A  1  43   ? 279.339 263.704 231.590 1.00 50.00  ? 43   U   B P     1 
ATOM   831   O  OP1   . U   A  1  43   ? 278.876 264.929 230.889 1.00 50.00  ? 43   U   B OP1   1 
ATOM   832   O  OP2   . U   A  1  43   ? 278.374 262.910 232.393 1.00 50.00  ? 43   U   B OP2   1 
ATOM   833   O  "O5'" . U   A  1  43   ? 279.991 262.732 230.510 1.00 50.00  ? 43   U   B "O5'" 1 
ATOM   834   C  "C5'" . U   A  1  43   ? 279.171 262.016 229.599 1.00 50.00  ? 43   U   B "C5'" 1 
ATOM   835   C  "C4'" . U   A  1  43   ? 279.961 261.018 228.789 1.00 50.00  ? 43   U   B "C4'" 1 
ATOM   836   O  "O4'" . U   A  1  43   ? 280.975 260.396 229.621 1.00 50.00  ? 43   U   B "O4'" 1 
ATOM   837   C  "C3'" . U   A  1  43   ? 279.162 259.847 228.236 1.00 50.00  ? 43   U   B "C3'" 1 
ATOM   838   O  "O3'" . U   A  1  43   ? 278.479 260.165 227.035 1.00 50.00  ? 43   U   B "O3'" 1 
ATOM   839   C  "C2'" . U   A  1  43   ? 280.222 258.766 228.062 1.00 50.00  ? 43   U   B "C2'" 1 
ATOM   840   O  "O2'" . U   A  1  43   ? 280.960 258.977 226.869 1.00 50.00  ? 43   U   B "O2'" 1 
ATOM   841   C  "C1'" . U   A  1  43   ? 281.139 259.041 229.256 1.00 50.00  ? 43   U   B "C1'" 1 
ATOM   842   N  N1    . U   A  1  43   ? 280.825 258.200 230.434 1.00 50.00  ? 43   U   B N1    1 
ATOM   843   C  C2    . U   A  1  43   ? 281.014 256.827 230.372 1.00 50.00  ? 43   U   B C2    1 
ATOM   844   O  O2    . U   A  1  43   ? 281.414 256.241 229.381 1.00 50.00  ? 43   U   B O2    1 
ATOM   845   N  N3    . U   A  1  43   ? 280.702 256.145 231.525 1.00 50.00  ? 43   U   B N3    1 
ATOM   846   C  C4    . U   A  1  43   ? 280.244 256.683 232.711 1.00 50.00  ? 43   U   B C4    1 
ATOM   847   O  O4    . U   A  1  43   ? 280.003 255.949 233.671 1.00 50.00  ? 43   U   B O4    1 
ATOM   848   C  C5    . U   A  1  43   ? 280.086 258.105 232.697 1.00 50.00  ? 43   U   B C5    1 
ATOM   849   C  C6    . U   A  1  43   ? 280.378 258.792 231.592 1.00 50.00  ? 43   U   B C6    1 
ATOM   850   P  P     . A   A  1  44   ? 276.879 260.315 227.028 1.00 50.00  ? 44   A   B P     1 
ATOM   851   O  OP1   . A   A  1  44   ? 276.426 260.290 225.614 1.00 50.00  ? 44   A   B OP1   1 
ATOM   852   O  OP2   . A   A  1  44   ? 276.512 261.466 227.891 1.00 50.00  ? 44   A   B OP2   1 
ATOM   853   O  "O5'" . A   A  1  44   ? 276.363 258.986 227.732 1.00 50.00  ? 44   A   B "O5'" 1 
ATOM   854   C  "C5'" . A   A  1  44   ? 275.866 257.898 226.967 1.00 50.00  ? 44   A   B "C5'" 1 
ATOM   855   C  "C4'" . A   A  1  44   ? 276.940 256.874 226.704 1.00 50.00  ? 44   A   B "C4'" 1 
ATOM   856   O  "O4'" . A   A  1  44   ? 277.710 256.649 227.911 1.00 50.00  ? 44   A   B "O4'" 1 
ATOM   857   C  "C3'" . A   A  1  44   ? 276.457 255.486 226.317 1.00 50.00  ? 44   A   B "C3'" 1 
ATOM   858   O  "O3'" . A   A  1  44   ? 276.071 255.383 224.958 1.00 50.00  ? 44   A   B "O3'" 1 
ATOM   859   C  "C2'" . A   A  1  44   ? 277.641 254.612 226.700 1.00 50.00  ? 44   A   B "C2'" 1 
ATOM   860   O  "O2'" . A   A  1  44   ? 278.677 254.724 225.738 1.00 50.00  ? 44   A   B "O2'" 1 
ATOM   861   C  "C1'" . A   A  1  44   ? 278.101 255.294 227.989 1.00 50.00  ? 44   A   B "C1'" 1 
ATOM   862   N  N9    . A   A  1  44   ? 277.462 254.691 229.173 1.00 50.00  ? 44   A   B N9    1 
ATOM   863   C  C8    . A   A  1  44   ? 277.025 253.395 229.301 1.00 50.00  ? 44   A   B C8    1 
ATOM   864   N  N7    . A   A  1  44   ? 276.499 253.123 230.468 1.00 50.00  ? 44   A   B N7    1 
ATOM   865   C  C5    . A   A  1  44   ? 276.597 254.320 231.160 1.00 50.00  ? 44   A   B C5    1 
ATOM   866   C  C6    . A   A  1  44   ? 276.212 254.687 232.462 1.00 50.00  ? 44   A   B C6    1 
ATOM   867   N  N6    . A   A  1  44   ? 275.630 253.853 233.327 1.00 50.00  ? 44   A   B N6    1 
ATOM   868   N  N1    . A   A  1  44   ? 276.448 255.958 232.850 1.00 50.00  ? 44   A   B N1    1 
ATOM   869   C  C2    . A   A  1  44   ? 277.031 256.795 231.982 1.00 50.00  ? 44   A   B C2    1 
ATOM   870   N  N3    . A   A  1  44   ? 277.440 256.568 230.736 1.00 50.00  ? 44   A   B N3    1 
ATOM   871   C  C4    . A   A  1  44   ? 277.193 255.294 230.380 1.00 50.00  ? 44   A   B C4    1 
ATOM   872   P  P     . C   A  1  45   ? 274.513 255.249 224.585 1.00 50.00  ? 45   C   B P     1 
ATOM   873   O  OP1   . C   A  1  45   ? 274.391 254.437 223.349 1.00 50.00  ? 45   C   B OP1   1 
ATOM   874   O  OP2   . C   A  1  45   ? 273.909 256.603 224.637 1.00 50.00  ? 45   C   B OP2   1 
ATOM   875   O  "O5'" . C   A  1  45   ? 273.915 254.403 225.795 1.00 50.00  ? 45   C   B "O5'" 1 
ATOM   876   C  "C5'" . C   A  1  45   ? 272.814 254.883 226.551 1.00 50.00  ? 45   C   B "C5'" 1 
ATOM   877   C  "C4'" . C   A  1  45   ? 272.703 254.163 227.871 1.00 50.00  ? 45   C   B "C4'" 1 
ATOM   878   O  "O4'" . C   A  1  45   ? 273.539 254.818 228.861 1.00 50.00  ? 45   C   B "O4'" 1 
ATOM   879   C  "C3'" . C   A  1  45   ? 271.326 254.151 228.510 1.00 50.00  ? 45   C   B "C3'" 1 
ATOM   880   O  "O3'" . C   A  1  45   ? 270.468 253.171 227.955 1.00 50.00  ? 45   C   B "O3'" 1 
ATOM   881   C  "C2'" . C   A  1  45   ? 271.646 253.919 229.982 1.00 50.00  ? 45   C   B "C2'" 1 
ATOM   882   O  "O2'" . C   A  1  45   ? 271.940 252.552 230.223 1.00 50.00  ? 45   C   B "O2'" 1 
ATOM   883   C  "C1'" . C   A  1  45   ? 272.937 254.724 230.136 1.00 50.00  ? 45   C   B "C1'" 1 
ATOM   884   N  N1    . C   A  1  45   ? 272.682 256.090 230.646 1.00 50.00  ? 45   C   B N1    1 
ATOM   885   C  C2    . C   A  1  45   ? 272.439 256.267 232.012 1.00 50.00  ? 45   C   B C2    1 
ATOM   886   O  O2    . C   A  1  45   ? 272.441 255.277 232.759 1.00 50.00  ? 45   C   B O2    1 
ATOM   887   N  N3    . C   A  1  45   ? 272.203 257.510 232.489 1.00 50.00  ? 45   C   B N3    1 
ATOM   888   C  C4    . C   A  1  45   ? 272.207 258.555 231.659 1.00 50.00  ? 45   C   B C4    1 
ATOM   889   N  N4    . C   A  1  45   ? 271.971 259.763 232.173 1.00 50.00  ? 45   C   B N4    1 
ATOM   890   C  C5    . C   A  1  45   ? 272.454 258.406 230.264 1.00 50.00  ? 45   C   B C5    1 
ATOM   891   C  C6    . C   A  1  45   ? 272.684 257.169 229.806 1.00 50.00  ? 45   C   B C6    1 
ATOM   892   P  P     . U   A  1  46   ? 268.884 253.263 228.193 1.00 50.00  ? 46   U   B P     1 
ATOM   893   O  OP1   . U   A  1  46   ? 268.224 252.387 227.194 1.00 50.00  ? 46   U   B OP1   1 
ATOM   894   O  OP2   . U   A  1  46   ? 268.506 254.696 228.277 1.00 50.00  ? 46   U   B OP2   1 
ATOM   895   O  "O5'" . U   A  1  46   ? 268.677 252.609 229.631 1.00 50.00  ? 46   U   B "O5'" 1 
ATOM   896   C  "C5'" . U   A  1  46   ? 268.564 251.203 229.782 1.00 50.00  ? 46   U   B "C5'" 1 
ATOM   897   C  "C4'" . U   A  1  46   ? 267.255 250.837 230.428 1.00 50.00  ? 46   U   B "C4'" 1 
ATOM   898   O  "O4'" . U   A  1  46   ? 267.299 251.181 231.837 1.00 50.00  ? 46   U   B "O4'" 1 
ATOM   899   C  "C3'" . U   A  1  46   ? 266.041 251.582 229.888 1.00 50.00  ? 46   U   B "C3'" 1 
ATOM   900   O  "O3'" . U   A  1  46   ? 265.497 250.958 228.735 1.00 50.00  ? 46   U   B "O3'" 1 
ATOM   901   C  "C2'" . U   A  1  46   ? 265.090 251.598 231.073 1.00 50.00  ? 46   U   B "C2'" 1 
ATOM   902   O  "O2'" . U   A  1  46   ? 264.401 250.361 231.181 1.00 50.00  ? 46   U   B "O2'" 1 
ATOM   903   C  "C1'" . U   A  1  46   ? 266.061 251.715 232.249 1.00 50.00  ? 46   U   B "C1'" 1 
ATOM   904   N  N1    . U   A  1  46   ? 266.294 253.110 232.697 1.00 50.00  ? 46   U   B N1    1 
ATOM   905   C  C2    . U   A  1  46   ? 265.253 253.975 233.014 1.00 50.00  ? 46   U   B C2    1 
ATOM   906   O  O2    . U   A  1  46   ? 264.068 253.705 232.927 1.00 50.00  ? 46   U   B O2    1 
ATOM   907   N  N3    . U   A  1  46   ? 265.654 255.222 233.435 1.00 50.00  ? 46   U   B N3    1 
ATOM   908   C  C4    . U   A  1  46   ? 266.944 255.687 233.585 1.00 50.00  ? 46   U   B C4    1 
ATOM   909   O  O4    . U   A  1  46   ? 267.137 256.837 233.978 1.00 50.00  ? 46   U   B O4    1 
ATOM   910   C  C5    . U   A  1  46   ? 267.956 254.736 233.257 1.00 50.00  ? 46   U   B C5    1 
ATOM   911   C  C6    . U   A  1  46   ? 267.599 253.517 232.846 1.00 50.00  ? 46   U   B C6    1 
ATOM   912   P  P     . A   A  1  47   ? 264.671 251.806 227.650 1.00 50.00  ? 47   A   B P     1 
ATOM   913   O  OP1   . A   A  1  47   ? 264.129 250.851 226.651 1.00 50.00  ? 47   A   B OP1   1 
ATOM   914   O  OP2   . A   A  1  47   ? 265.511 252.942 227.194 1.00 50.00  ? 47   A   B OP2   1 
ATOM   915   O  "O5'" . A   A  1  47   ? 263.451 252.413 228.473 1.00 50.00  ? 47   A   B "O5'" 1 
ATOM   916   C  "C5'" . A   A  1  47   ? 262.333 251.613 228.846 1.00 50.00  ? 47   A   B "C5'" 1 
ATOM   917   C  "C4'" . A   A  1  47   ? 261.158 252.471 229.242 1.00 50.00  ? 47   A   B "C4'" 1 
ATOM   918   O  "O4'" . A   A  1  47   ? 261.585 253.386 230.291 1.00 50.00  ? 47   A   B "O4'" 1 
ATOM   919   C  "C3'" . A   A  1  47   ? 260.601 253.342 228.115 1.00 50.00  ? 47   A   B "C3'" 1 
ATOM   920   O  "O3'" . A   A  1  47   ? 259.186 253.481 228.231 1.00 50.00  ? 47   A   B "O3'" 1 
ATOM   921   C  "C2'" . A   A  1  47   ? 261.277 254.686 228.355 1.00 50.00  ? 47   A   B "C2'" 1 
ATOM   922   O  "O2'" . A   A  1  47   ? 260.570 255.797 227.851 1.00 50.00  ? 47   A   B "O2'" 1 
ATOM   923   C  "C1'" . A   A  1  47   ? 261.386 254.724 229.877 1.00 50.00  ? 47   A   B "C1'" 1 
ATOM   924   N  N9    . A   A  1  47   ? 262.521 255.530 230.328 1.00 50.00  ? 47   A   B N9    1 
ATOM   925   C  C8    . A   A  1  47   ? 263.856 255.209 230.285 1.00 50.00  ? 47   A   B C8    1 
ATOM   926   N  N7    . A   A  1  47   ? 264.644 256.155 230.737 1.00 50.00  ? 47   A   B N7    1 
ATOM   927   C  C5    . A   A  1  47   ? 263.770 257.174 231.089 1.00 50.00  ? 47   A   B C5    1 
ATOM   928   C  C6    . A   A  1  47   ? 263.976 258.455 231.633 1.00 50.00  ? 47   A   B C6    1 
ATOM   929   N  N6    . A   A  1  47   ? 265.176 258.958 231.934 1.00 50.00  ? 47   A   B N6    1 
ATOM   930   N  N1    . A   A  1  47   ? 262.887 259.216 231.865 1.00 50.00  ? 47   A   B N1    1 
ATOM   931   C  C2    . A   A  1  47   ? 261.681 258.719 231.573 1.00 50.00  ? 47   A   B C2    1 
ATOM   932   N  N3    . A   A  1  47   ? 261.357 257.536 231.056 1.00 50.00  ? 47   A   B N3    1 
ATOM   933   C  C4    . A   A  1  47   ? 262.460 256.802 230.841 1.00 50.00  ? 47   A   B C4    1 
ATOM   934   P  P     . A   A  1  48   ? 258.326 253.857 226.924 1.00 50.00  ? 48   A   B P     1 
ATOM   935   O  OP1   . A   A  1  48   ? 257.355 252.770 226.648 1.00 50.00  ? 48   A   B OP1   1 
ATOM   936   O  OP2   . A   A  1  48   ? 259.292 254.227 225.860 1.00 50.00  ? 48   A   B OP2   1 
ATOM   937   O  "O5'" . A   A  1  48   ? 257.561 255.197 227.319 1.00 50.00  ? 48   A   B "O5'" 1 
ATOM   938   C  "C5'" . A   A  1  48   ? 257.510 256.280 226.401 1.00 50.00  ? 48   A   B "C5'" 1 
ATOM   939   C  "C4'" . A   A  1  48   ? 256.922 257.533 227.002 1.00 50.00  ? 48   A   B "C4'" 1 
ATOM   940   O  "O4'" . A   A  1  48   ? 257.549 257.826 228.277 1.00 50.00  ? 48   A   B "O4'" 1 
ATOM   941   C  "C3'" . A   A  1  48   ? 257.132 258.798 226.187 1.00 50.00  ? 48   A   B "C3'" 1 
ATOM   942   O  "O3'" . A   A  1  48   ? 256.203 258.928 225.124 1.00 50.00  ? 48   A   B "O3'" 1 
ATOM   943   C  "C2'" . A   A  1  48   ? 257.029 259.900 227.234 1.00 50.00  ? 48   A   B "C2'" 1 
ATOM   944   O  "O2'" . A   A  1  48   ? 255.669 260.184 227.533 1.00 50.00  ? 48   A   B "O2'" 1 
ATOM   945   C  "C1'" . A   A  1  48   ? 257.663 259.225 228.451 1.00 50.00  ? 48   A   B "C1'" 1 
ATOM   946   N  N9    . A   A  1  48   ? 259.092 259.561 228.600 1.00 50.00  ? 48   A   B N9    1 
ATOM   947   C  C8    . A   A  1  48   ? 260.144 258.693 228.458 1.00 50.00  ? 48   A   B C8    1 
ATOM   948   N  N7    . A   A  1  48   ? 261.317 259.239 228.640 1.00 50.00  ? 48   A   B N7    1 
ATOM   949   C  C5    . A   A  1  48   ? 261.023 260.561 228.936 1.00 50.00  ? 48   A   B C5    1 
ATOM   950   C  C6    . A   A  1  48   ? 261.851 261.655 229.233 1.00 50.00  ? 48   A   B C6    1 
ATOM   951   N  N6    . A   A  1  48   ? 263.180 261.568 229.284 1.00 50.00  ? 48   A   B N6    1 
ATOM   952   N  N1    . A   A  1  48   ? 261.261 262.845 229.482 1.00 50.00  ? 48   A   B N1    1 
ATOM   953   C  C2    . A   A  1  48   ? 259.925 262.913 229.430 1.00 50.00  ? 48   A   B C2    1 
ATOM   954   N  N3    . A   A  1  48   ? 259.040 261.953 229.156 1.00 50.00  ? 48   A   B N3    1 
ATOM   955   C  C4    . A   A  1  48   ? 259.657 260.781 228.916 1.00 50.00  ? 48   A   B C4    1 
ATOM   956   P  P     . A   A  1  49   ? 256.574 259.806 223.832 1.00 50.00  ? 49   A   B P     1 
ATOM   957   O  OP1   . A   A  1  49   ? 255.588 259.499 222.764 1.00 50.00  ? 49   A   B OP1   1 
ATOM   958   O  OP2   . A   A  1  49   ? 258.025 259.636 223.563 1.00 50.00  ? 49   A   B OP2   1 
ATOM   959   O  "O5'" . A   A  1  49   ? 256.324 261.304 224.305 1.00 50.00  ? 49   A   B "O5'" 1 
ATOM   960   C  "C5'" . A   A  1  49   ? 255.030 261.733 224.702 1.00 50.00  ? 49   A   B "C5'" 1 
ATOM   961   C  "C4'" . A   A  1  49   ? 255.033 263.182 225.118 1.00 50.00  ? 49   A   B "C4'" 1 
ATOM   962   O  "O4'" . A   A  1  49   ? 255.783 263.337 226.351 1.00 50.00  ? 49   A   B "O4'" 1 
ATOM   963   C  "C3'" . A   A  1  49   ? 255.706 264.143 224.152 1.00 50.00  ? 49   A   B "C3'" 1 
ATOM   964   O  "O3'" . A   A  1  49   ? 254.865 264.522 223.077 1.00 50.00  ? 49   A   B "O3'" 1 
ATOM   965   C  "C2'" . A   A  1  49   ? 256.105 265.299 225.058 1.00 50.00  ? 49   A   B "C2'" 1 
ATOM   966   O  "O2'" . A   A  1  49   ? 254.986 266.125 225.340 1.00 50.00  ? 49   A   B "O2'" 1 
ATOM   967   C  "C1'" . A   A  1  49   ? 256.491 264.557 226.336 1.00 50.00  ? 49   A   B "C1'" 1 
ATOM   968   N  N9    . A   A  1  49   ? 257.935 264.254 226.386 1.00 50.00  ? 49   A   B N9    1 
ATOM   969   C  C8    . A   A  1  49   ? 258.522 263.015 226.320 1.00 50.00  ? 49   A   B C8    1 
ATOM   970   N  N7    . A   A  1  49   ? 259.830 263.044 226.392 1.00 50.00  ? 49   A   B N7    1 
ATOM   971   C  C5    . A   A  1  49   ? 260.124 264.394 226.518 1.00 50.00  ? 49   A   B C5    1 
ATOM   972   C  C6    . A   A  1  49   ? 261.341 265.085 226.641 1.00 50.00  ? 49   A   B C6    1 
ATOM   973   N  N6    . A   A  1  49   ? 262.530 264.483 226.659 1.00 50.00  ? 49   A   B N6    1 
ATOM   974   N  N1    . A   A  1  49   ? 261.293 266.432 226.748 1.00 50.00  ? 49   A   B N1    1 
ATOM   975   C  C2    . A   A  1  49   ? 260.096 267.032 226.728 1.00 50.00  ? 49   A   B C2    1 
ATOM   976   N  N3    . A   A  1  49   ? 258.884 266.490 226.619 1.00 50.00  ? 49   A   B N3    1 
ATOM   977   C  C4    . A   A  1  49   ? 258.966 265.152 226.518 1.00 50.00  ? 49   A   B C4    1 
ATOM   978   P  P     . G   A  1  50   ? 255.456 264.619 221.586 1.00 50.00  ? 50   G   B P     1 
ATOM   979   O  OP1   . G   A  1  50   ? 254.318 264.544 220.634 1.00 50.00  ? 50   G   B OP1   1 
ATOM   980   O  OP2   . G   A  1  50   ? 256.575 263.651 221.470 1.00 50.00  ? 50   G   B OP2   1 
ATOM   981   O  "O5'" . G   A  1  50   ? 256.064 266.088 221.511 1.00 50.00  ? 50   G   B "O5'" 1 
ATOM   982   C  "C5'" . G   A  1  50   ? 255.263 267.220 221.816 1.00 50.00  ? 50   G   B "C5'" 1 
ATOM   983   C  "C4'" . G   A  1  50   ? 256.103 268.381 222.284 1.00 50.00  ? 50   G   B "C4'" 1 
ATOM   984   O  "O4'" . G   A  1  50   ? 256.860 267.998 223.460 1.00 50.00  ? 50   G   B "O4'" 1 
ATOM   985   C  "C3'" . G   A  1  50   ? 257.158 268.876 221.309 1.00 50.00  ? 50   G   B "C3'" 1 
ATOM   986   O  "O3'" . G   A  1  50   ? 256.625 269.740 220.320 1.00 50.00  ? 50   G   B "O3'" 1 
ATOM   987   C  "C2'" . G   A  1  50   ? 258.169 269.554 222.227 1.00 50.00  ? 50   G   B "C2'" 1 
ATOM   988   O  "O2'" . G   A  1  50   ? 257.726 270.854 222.586 1.00 50.00  ? 50   G   B "O2'" 1 
ATOM   989   C  "C1'" . G   A  1  50   ? 258.104 268.666 223.469 1.00 50.00  ? 50   G   B "C1'" 1 
ATOM   990   N  N9    . G   A  1  50   ? 259.188 267.665 223.513 1.00 50.00  ? 50   G   B N9    1 
ATOM   991   C  C8    . G   A  1  50   ? 259.058 266.298 223.522 1.00 50.00  ? 50   G   B C8    1 
ATOM   992   N  N7    . G   A  1  50   ? 260.202 265.673 223.584 1.00 50.00  ? 50   G   B N7    1 
ATOM   993   C  C5    . G   A  1  50   ? 261.146 266.688 223.620 1.00 50.00  ? 50   G   B C5    1 
ATOM   994   C  C6    . G   A  1  50   ? 262.561 266.627 223.691 1.00 50.00  ? 50   G   B C6    1 
ATOM   995   O  O6    . G   A  1  50   ? 263.287 265.627 223.734 1.00 50.00  ? 50   G   B O6    1 
ATOM   996   N  N1    . G   A  1  50   ? 263.128 267.897 223.708 1.00 50.00  ? 50   G   B N1    1 
ATOM   997   C  C2    . G   A  1  50   ? 262.429 269.078 223.666 1.00 50.00  ? 50   G   B C2    1 
ATOM   998   N  N3    . G   A  1  50   ? 261.110 269.145 223.600 1.00 50.00  ? 50   G   B N3    1 
ATOM   999   C  C4    . G   A  1  50   ? 260.538 267.924 223.581 1.00 50.00  ? 50   G   B C4    1 
ATOM   1000  P  P     . A   A  1  51   ? 257.281 269.802 218.855 1.00 50.00  ? 51   A   B P     1 
ATOM   1001  O  OP1   . A   A  1  51   ? 256.338 270.515 217.957 1.00 50.00  ? 51   A   B OP1   1 
ATOM   1002  O  OP2   . A   A  1  51   ? 257.742 268.436 218.502 1.00 50.00  ? 51   A   B OP2   1 
ATOM   1003  O  "O5'" . A   A  1  51   ? 258.569 270.721 219.047 1.00 50.00  ? 51   A   B "O5'" 1 
ATOM   1004  C  "C5'" . A   A  1  51   ? 258.479 271.989 219.692 1.00 50.00  ? 51   A   B "C5'" 1 
ATOM   1005  C  "C4'" . A   A  1  51   ? 259.837 272.499 220.106 1.00 50.00  ? 51   A   B "C4'" 1 
ATOM   1006  O  "O4'" . A   A  1  51   ? 260.532 271.458 220.851 1.00 50.00  ? 51   A   B "O4'" 1 
ATOM   1007  C  "C3'" . A   A  1  51   ? 260.759 272.879 218.947 1.00 50.00  ? 51   A   B "C3'" 1 
ATOM   1008  O  "O3'" . A   A  1  51   ? 261.599 273.969 219.331 1.00 50.00  ? 51   A   B "O3'" 1 
ATOM   1009  C  "C2'" . A   A  1  51   ? 261.604 271.626 218.776 1.00 50.00  ? 51   A   B "C2'" 1 
ATOM   1010  O  "O2'" . A   A  1  51   ? 262.850 271.840 218.154 1.00 50.00  ? 51   A   B "O2'" 1 
ATOM   1011  C  "C1'" . A   A  1  51   ? 261.764 271.171 220.220 1.00 50.00  ? 51   A   B "C1'" 1 
ATOM   1012  N  N9    . A   A  1  51   ? 262.059 269.740 220.351 1.00 50.00  ? 51   A   B N9    1 
ATOM   1013  C  C8    . A   A  1  51   ? 261.194 268.674 220.356 1.00 50.00  ? 51   A   B C8    1 
ATOM   1014  N  N7    . A   A  1  51   ? 261.794 267.514 220.477 1.00 50.00  ? 51   A   B N7    1 
ATOM   1015  C  C5    . A   A  1  51   ? 263.144 267.836 220.552 1.00 50.00  ? 51   A   B C5    1 
ATOM   1016  C  C6    . A   A  1  51   ? 264.308 267.057 220.687 1.00 50.00  ? 51   A   B C6    1 
ATOM   1017  N  N6    . A   A  1  51   ? 264.305 265.725 220.776 1.00 50.00  ? 51   A   B N6    1 
ATOM   1018  N  N1    . A   A  1  51   ? 265.497 267.697 220.730 1.00 50.00  ? 51   A   B N1    1 
ATOM   1019  C  C2    . A   A  1  51   ? 265.505 269.033 220.643 1.00 50.00  ? 51   A   B C2    1 
ATOM   1020  N  N3    . A   A  1  51   ? 264.482 269.872 220.513 1.00 50.00  ? 51   A   B N3    1 
ATOM   1021  C  C4    . A   A  1  51   ? 263.317 269.204 220.476 1.00 50.00  ? 51   A   B C4    1 
ATOM   1022  P  P     . U   A  1  52   ? 262.301 274.881 218.207 1.00 50.00  ? 52   U   B P     1 
ATOM   1023  O  OP1   . U   A  1  52   ? 262.520 276.233 218.781 1.00 50.00  ? 52   U   B OP1   1 
ATOM   1024  O  OP2   . U   A  1  52   ? 261.528 274.732 216.947 1.00 50.00  ? 52   U   B OP2   1 
ATOM   1025  O  "O5'" . U   A  1  52   ? 263.728 274.200 217.989 1.00 50.00  ? 52   U   B "O5'" 1 
ATOM   1026  C  "C5'" . U   A  1  52   ? 264.312 274.124 216.695 1.00 50.00  ? 52   U   B "C5'" 1 
ATOM   1027  C  "C4'" . U   A  1  52   ? 265.767 273.730 216.757 1.00 50.00  ? 52   U   B "C4'" 1 
ATOM   1028  O  "O4'" . U   A  1  52   ? 265.974 272.730 217.789 1.00 50.00  ? 52   U   B "O4'" 1 
ATOM   1029  C  "C3'" . U   A  1  52   ? 266.338 273.087 215.504 1.00 50.00  ? 52   U   B "C3'" 1 
ATOM   1030  O  "O3'" . U   A  1  52   ? 266.682 274.030 214.504 1.00 50.00  ? 52   U   B "O3'" 1 
ATOM   1031  C  "C2'" . U   A  1  52   ? 267.531 272.307 216.041 1.00 50.00  ? 52   U   B "C2'" 1 
ATOM   1032  O  "O2'" . U   A  1  52   ? 268.640 273.168 216.249 1.00 50.00  ? 52   U   B "O2'" 1 
ATOM   1033  C  "C1'" . U   A  1  52   ? 267.012 271.850 217.405 1.00 50.00  ? 52   U   B "C1'" 1 
ATOM   1034  N  N1    . U   A  1  52   ? 266.483 270.465 217.388 1.00 50.00  ? 52   U   B N1    1 
ATOM   1035  C  C2    . U   A  1  52   ? 267.372 269.405 217.430 1.00 50.00  ? 52   U   B C2    1 
ATOM   1036  O  O2    . U   A  1  52   ? 268.583 269.556 217.464 1.00 50.00  ? 52   U   B O2    1 
ATOM   1037  N  N3    . U   A  1  52   ? 266.791 268.159 217.424 1.00 50.00  ? 52   U   B N3    1 
ATOM   1038  C  C4    . U   A  1  52   ? 265.439 267.868 217.386 1.00 50.00  ? 52   U   B C4    1 
ATOM   1039  O  O4    . U   A  1  52   ? 265.054 266.699 217.384 1.00 50.00  ? 52   U   B O4    1 
ATOM   1040  C  C5    . U   A  1  52   ? 264.592 269.014 217.348 1.00 50.00  ? 52   U   B C5    1 
ATOM   1041  C  C6    . U   A  1  52   ? 265.132 270.235 217.353 1.00 50.00  ? 52   U   B C6    1 
ATOM   1042  P  P     . U   A  1  53   ? 266.398 273.712 212.954 1.00 50.00  ? 53   U   B P     1 
ATOM   1043  O  OP1   . U   A  1  53   ? 266.603 274.964 212.181 1.00 50.00  ? 53   U   B OP1   1 
ATOM   1044  O  OP2   . U   A  1  53   ? 265.100 272.997 212.865 1.00 50.00  ? 53   U   B OP2   1 
ATOM   1045  O  "O5'" . U   A  1  53   ? 267.551 272.689 212.550 1.00 50.00  ? 53   U   B "O5'" 1 
ATOM   1046  C  "C5'" . U   A  1  53   ? 267.327 271.286 212.586 1.00 50.00  ? 53   U   B "C5'" 1 
ATOM   1047  C  "C4'" . U   A  1  53   ? 268.574 270.535 212.979 1.00 50.00  ? 53   U   B "C4'" 1 
ATOM   1048  O  "O4'" . U   A  1  53   ? 268.329 269.782 214.196 1.00 50.00  ? 53   U   B "O4'" 1 
ATOM   1049  C  "C3'" . U   A  1  53   ? 269.056 269.494 211.982 1.00 50.00  ? 53   U   B "C3'" 1 
ATOM   1050  O  "O3'" . U   A  1  53   ? 269.828 270.056 210.937 1.00 50.00  ? 53   U   B "O3'" 1 
ATOM   1051  C  "C2'" . U   A  1  53   ? 269.829 268.520 212.858 1.00 50.00  ? 53   U   B "C2'" 1 
ATOM   1052  O  "O2'" . U   A  1  53   ? 271.123 269.025 213.151 1.00 50.00  ? 53   U   B "O2'" 1 
ATOM   1053  C  "C1'" . U   A  1  53   ? 269.000 268.542 214.143 1.00 50.00  ? 53   U   B "C1'" 1 
ATOM   1054  N  N1    . U   A  1  53   ? 267.980 267.468 214.179 1.00 50.00  ? 53   U   B N1    1 
ATOM   1055  C  C2    . U   A  1  53   ? 268.378 266.144 214.247 1.00 50.00  ? 53   U   B C2    1 
ATOM   1056  O  O2    . U   A  1  53   ? 269.543 265.785 214.264 1.00 50.00  ? 53   U   B O2    1 
ATOM   1057  N  N3    . U   A  1  53   ? 267.349 265.235 214.280 1.00 50.00  ? 53   U   B N3    1 
ATOM   1058  C  C4    . U   A  1  53   ? 265.995 265.505 214.265 1.00 50.00  ? 53   U   B C4    1 
ATOM   1059  O  O4    . U   A  1  53   ? 265.180 264.581 214.303 1.00 50.00  ? 53   U   B O4    1 
ATOM   1060  C  C5    . U   A  1  53   ? 265.668 266.895 214.204 1.00 50.00  ? 53   U   B C5    1 
ATOM   1061  C  C6    . U   A  1  53   ? 266.647 267.801 214.169 1.00 50.00  ? 53   U   B C6    1 
ATOM   1062  P  P     . U   A  1  54   ? 270.176 269.191 209.629 1.00 50.00  ? 54   U   B P     1 
ATOM   1063  O  OP1   . U   A  1  54   ? 270.544 270.131 208.540 1.00 50.00  ? 54   U   B OP1   1 
ATOM   1064  O  OP2   . U   A  1  54   ? 269.074 268.217 209.417 1.00 50.00  ? 54   U   B OP2   1 
ATOM   1065  O  "O5'" . U   A  1  54   ? 271.480 268.376 210.040 1.00 50.00  ? 54   U   B "O5'" 1 
ATOM   1066  C  "C5'" . U   A  1  54   ? 272.181 267.603 209.078 1.00 50.00  ? 54   U   B "C5'" 1 
ATOM   1067  C  "C4'" . U   A  1  54   ? 272.815 266.382 209.694 1.00 50.00  ? 54   U   B "C4'" 1 
ATOM   1068  O  "O4'" . U   A  1  54   ? 272.154 266.050 210.946 1.00 50.00  ? 54   U   B "O4'" 1 
ATOM   1069  C  "C3'" . U   A  1  54   ? 272.713 265.108 208.871 1.00 50.00  ? 54   U   B "C3'" 1 
ATOM   1070  O  "O3'" . U   A  1  54   ? 273.691 265.026 207.848 1.00 50.00  ? 54   U   B "O3'" 1 
ATOM   1071  C  "C2'" . U   A  1  54   ? 272.835 264.019 209.923 1.00 50.00  ? 54   U   B "C2'" 1 
ATOM   1072  O  "O2'" . U   A  1  54   ? 274.191 263.841 210.306 1.00 50.00  ? 54   U   B "O2'" 1 
ATOM   1073  C  "C1'" . U   A  1  54   ? 272.081 264.647 211.096 1.00 50.00  ? 54   U   B "C1'" 1 
ATOM   1074  N  N1    . U   A  1  54   ? 270.647 264.265 211.125 1.00 50.00  ? 54   U   B N1    1 
ATOM   1075  C  C2    . U   A  1  54   ? 270.262 262.931 211.156 1.00 50.00  ? 54   U   B C2    1 
ATOM   1076  O  O2    . U   A  1  54   ? 271.031 261.984 211.150 1.00 50.00  ? 54   U   B O2    1 
ATOM   1077  N  N3    . U   A  1  54   ? 268.903 262.722 211.186 1.00 50.00  ? 54   U   B N3    1 
ATOM   1078  C  C4    . U   A  1  54   ? 267.911 263.680 211.200 1.00 50.00  ? 54   U   B C4    1 
ATOM   1079  O  O4    . U   A  1  54   ? 266.726 263.342 211.230 1.00 50.00  ? 54   U   B O4    1 
ATOM   1080  C  C5    . U   A  1  54   ? 268.387 265.025 211.176 1.00 50.00  ? 54   U   B C5    1 
ATOM   1081  C  C6    . U   A  1  54   ? 269.702 265.262 211.145 1.00 50.00  ? 54   U   B C6    1 
ATOM   1082  P  P     . C   A  1  55   ? 273.333 264.330 206.446 1.00 50.00  ? 55   C   B P     1 
ATOM   1083  O  OP1   . C   A  1  55   ? 274.477 264.540 205.524 1.00 50.00  ? 55   C   B OP1   1 
ATOM   1084  O  OP2   . C   A  1  55   ? 271.974 264.774 206.042 1.00 50.00  ? 55   C   B OP2   1 
ATOM   1085  O  "O5'" . C   A  1  55   ? 273.261 262.777 206.795 1.00 50.00  ? 55   C   B "O5'" 1 
ATOM   1086  C  "C5'" . C   A  1  55   ? 274.413 262.079 207.242 1.00 50.00  ? 55   C   B "C5'" 1 
ATOM   1087  C  "C4'" . C   A  1  55   ? 274.162 260.595 207.329 1.00 50.00  ? 55   C   B "C4'" 1 
ATOM   1088  O  "O4'" . C   A  1  55   ? 273.286 260.302 208.448 1.00 50.00  ? 55   C   B "O4'" 1 
ATOM   1089  C  "C3'" . C   A  1  55   ? 273.458 259.967 206.139 1.00 50.00  ? 55   C   B "C3'" 1 
ATOM   1090  O  "O3'" . C   A  1  55   ? 274.323 259.716 205.046 1.00 50.00  ? 55   C   B "O3'" 1 
ATOM   1091  C  "C2'" . C   A  1  55   ? 272.855 258.706 206.742 1.00 50.00  ? 55   C   B "C2'" 1 
ATOM   1092  O  "O2'" . C   A  1  55   ? 273.843 257.697 206.886 1.00 50.00  ? 55   C   B "O2'" 1 
ATOM   1093  C  "C1'" . C   A  1  55   ? 272.462 259.196 208.136 1.00 50.00  ? 55   C   B "C1'" 1 
ATOM   1094  N  N1    . C   A  1  55   ? 271.046 259.626 208.201 1.00 50.00  ? 55   C   B N1    1 
ATOM   1095  C  C2    . C   A  1  55   ? 270.030 258.662 208.170 1.00 50.00  ? 55   C   B C2    1 
ATOM   1096  O  O2    . C   A  1  55   ? 270.328 257.460 208.075 1.00 50.00  ? 55   C   B O2    1 
ATOM   1097  N  N3    . C   A  1  55   ? 268.739 259.060 208.229 1.00 50.00  ? 55   C   B N3    1 
ATOM   1098  C  C4    . C   A  1  55   ? 268.441 260.358 208.324 1.00 50.00  ? 55   C   B C4    1 
ATOM   1099  N  N4    . C   A  1  55   ? 267.154 260.703 208.386 1.00 50.00  ? 55   C   B N4    1 
ATOM   1100  C  C5    . C   A  1  55   ? 269.455 261.357 208.365 1.00 50.00  ? 55   C   B C5    1 
ATOM   1101  C  C6    . C   A  1  55   ? 270.727 260.951 208.302 1.00 50.00  ? 55   C   B C6    1 
ATOM   1102  P  P     . C   A  1  56   ? 273.743 259.696 203.548 1.00 50.00  ? 56   C   B P     1 
ATOM   1103  O  OP1   . C   A  1  56   ? 274.889 259.570 202.611 1.00 50.00  ? 56   C   B OP1   1 
ATOM   1104  O  OP2   . C   A  1  56   ? 272.800 260.833 203.405 1.00 50.00  ? 56   C   B OP2   1 
ATOM   1105  O  "O5'" . C   A  1  56   ? 272.901 258.345 203.478 1.00 50.00  ? 56   C   B "O5'" 1 
ATOM   1106  C  "C5'" . C   A  1  56   ? 273.528 257.085 203.666 1.00 50.00  ? 56   C   B "C5'" 1 
ATOM   1107  C  "C4'" . C   A  1  56   ? 272.521 255.963 203.694 1.00 50.00  ? 56   C   B "C4'" 1 
ATOM   1108  O  "O4'" . C   A  1  56   ? 271.687 256.067 204.881 1.00 50.00  ? 56   C   B "O4'" 1 
ATOM   1109  C  "C3'" . C   A  1  56   ? 271.519 255.942 202.553 1.00 50.00  ? 56   C   B "C3'" 1 
ATOM   1110  O  "O3'" . C   A  1  56   ? 272.047 255.421 201.347 1.00 50.00  ? 56   C   B "O3'" 1 
ATOM   1111  C  "C2'" . C   A  1  56   ? 270.377 255.127 203.139 1.00 50.00  ? 56   C   B "C2'" 1 
ATOM   1112  O  "O2'" . C   A  1  56   ? 270.699 253.743 203.140 1.00 50.00  ? 56   C   B "O2'" 1 
ATOM   1113  C  "C1'" . C   A  1  56   ? 270.377 255.622 204.586 1.00 50.00  ? 56   C   B "C1'" 1 
ATOM   1114  N  N1    . C   A  1  56   ? 269.439 256.755 204.771 1.00 50.00  ? 56   C   B N1    1 
ATOM   1115  C  C2    . C   A  1  56   ? 268.063 256.505 204.802 1.00 50.00  ? 56   C   B C2    1 
ATOM   1116  O  O2    . C   A  1  56   ? 267.651 255.340 204.679 1.00 50.00  ? 56   C   B O2    1 
ATOM   1117  N  N3    . C   A  1  56   ? 267.206 257.540 204.963 1.00 50.00  ? 56   C   B N3    1 
ATOM   1118  C  C4    . C   A  1  56   ? 267.672 258.783 205.088 1.00 50.00  ? 56   C   B C4    1 
ATOM   1119  N  N4    . C   A  1  56   ? 266.788 259.771 205.245 1.00 50.00  ? 56   C   B N4    1 
ATOM   1120  C  C5    . C   A  1  56   ? 269.067 259.068 205.059 1.00 50.00  ? 56   C   B C5    1 
ATOM   1121  C  C6    . C   A  1  56   ? 269.903 258.036 204.899 1.00 50.00  ? 56   C   B C6    1 
ATOM   1122  P  P     . G   A  1  57   ? 272.102 256.354 200.042 1.00 50.00  ? 57   G   B P     1 
ATOM   1123  O  OP1   . G   A  1  57   ? 271.386 255.658 198.944 1.00 50.00  ? 57   G   B OP1   1 
ATOM   1124  O  OP2   . G   A  1  57   ? 273.510 256.782 199.840 1.00 50.00  ? 57   G   B OP2   1 
ATOM   1125  O  "O5'" . G   A  1  57   ? 271.256 257.639 200.464 1.00 50.00  ? 57   G   B "O5'" 1 
ATOM   1126  C  "C5'" . G   A  1  57   ? 270.064 257.987 199.777 1.00 50.00  ? 57   G   B "C5'" 1 
ATOM   1127  C  "C4'" . G   A  1  57   ? 268.879 257.209 200.292 1.00 50.00  ? 57   G   B "C4'" 1 
ATOM   1128  O  "O4'" . G   A  1  57   ? 268.494 257.693 201.608 1.00 50.00  ? 57   G   B "O4'" 1 
ATOM   1129  C  "C3'" . G   A  1  57   ? 267.603 257.327 199.476 1.00 50.00  ? 57   G   B "C3'" 1 
ATOM   1130  O  "O3'" . G   A  1  57   ? 267.598 256.508 198.321 1.00 50.00  ? 57   G   B "O3'" 1 
ATOM   1131  C  "C2'" . G   A  1  57   ? 266.533 256.965 200.493 1.00 50.00  ? 57   G   B "C2'" 1 
ATOM   1132  O  "O2'" . G   A  1  57   ? 266.496 255.562 200.705 1.00 50.00  ? 57   G   B "O2'" 1 
ATOM   1133  C  "C1'" . G   A  1  57   ? 267.089 257.627 201.752 1.00 50.00  ? 57   G   B "C1'" 1 
ATOM   1134  N  N9    . G   A  1  57   ? 266.575 259.001 201.916 1.00 50.00  ? 57   G   B N9    1 
ATOM   1135  C  C8    . G   A  1  57   ? 267.326 260.141 202.065 1.00 50.00  ? 57   G   B C8    1 
ATOM   1136  N  N7    . G   A  1  57   ? 266.607 261.221 202.180 1.00 50.00  ? 57   G   B N7    1 
ATOM   1137  C  C5    . G   A  1  57   ? 265.296 260.772 202.104 1.00 50.00  ? 57   G   B C5    1 
ATOM   1138  C  C6    . G   A  1  57   ? 264.076 261.493 202.162 1.00 50.00  ? 57   G   B C6    1 
ATOM   1139  O  O6    . G   A  1  57   ? 263.905 262.710 202.303 1.00 50.00  ? 57   G   B O6    1 
ATOM   1140  N  N1    . G   A  1  57   ? 262.975 260.652 202.042 1.00 50.00  ? 57   G   B N1    1 
ATOM   1141  C  C2    . G   A  1  57   ? 263.038 259.291 201.883 1.00 50.00  ? 57   G   B C2    1 
ATOM   1142  N  N2    . G   A  1  57   ? 261.864 258.652 201.783 1.00 50.00  ? 57   G   B N2    1 
ATOM   1143  N  N3    . G   A  1  57   ? 264.168 258.608 201.824 1.00 50.00  ? 57   G   B N3    1 
ATOM   1144  C  C4    . G   A  1  57   ? 265.255 259.402 201.939 1.00 50.00  ? 57   G   B C4    1 
ATOM   1145  P  P     . U   A  1  58   ? 267.258 257.148 196.887 1.00 50.00  ? 58   U   B P     1 
ATOM   1146  O  OP1   . U   A  1  58   ? 267.167 256.043 195.899 1.00 50.00  ? 58   U   B OP1   1 
ATOM   1147  O  OP2   . U   A  1  58   ? 268.203 258.269 196.649 1.00 50.00  ? 58   U   B OP2   1 
ATOM   1148  O  "O5'" . U   A  1  58   ? 265.801 257.762 197.073 1.00 50.00  ? 58   U   B "O5'" 1 
ATOM   1149  C  "C5'" . U   A  1  58   ? 264.695 256.927 197.381 1.00 50.00  ? 58   U   B "C5'" 1 
ATOM   1150  C  "C4'" . U   A  1  58   ? 263.423 257.722 197.547 1.00 50.00  ? 58   U   B "C4'" 1 
ATOM   1151  O  "O4'" . U   A  1  58   ? 263.502 258.558 198.730 1.00 50.00  ? 58   U   B "O4'" 1 
ATOM   1152  C  "C3'" . U   A  1  58   ? 263.092 258.699 196.433 1.00 50.00  ? 58   U   B "C3'" 1 
ATOM   1153  O  "O3'" . U   A  1  58   ? 262.529 258.075 195.292 1.00 50.00  ? 58   U   B "O3'" 1 
ATOM   1154  C  "C2'" . U   A  1  58   ? 262.148 259.672 197.123 1.00 50.00  ? 58   U   B "C2'" 1 
ATOM   1155  O  "O2'" . U   A  1  58   ? 260.847 259.116 197.233 1.00 50.00  ? 58   U   B "O2'" 1 
ATOM   1156  C  "C1'" . U   A  1  58   ? 262.761 259.744 198.526 1.00 50.00  ? 58   U   B "C1'" 1 
ATOM   1157  N  N1    . U   A  1  58   ? 263.657 260.915 198.689 1.00 50.00  ? 58   U   B N1    1 
ATOM   1158  C  C2    . U   A  1  58   ? 263.083 262.173 198.683 1.00 50.00  ? 58   U   B C2    1 
ATOM   1159  O  O2    . U   A  1  58   ? 261.890 262.367 198.547 1.00 50.00  ? 58   U   B O2    1 
ATOM   1160  N  N3    . U   A  1  58   ? 263.944 263.226 198.833 1.00 50.00  ? 58   U   B N3    1 
ATOM   1161  C  C4    . U   A  1  58   ? 265.309 263.158 198.998 1.00 50.00  ? 58   U   B C4    1 
ATOM   1162  O  O4    . U   A  1  58   ? 265.954 264.202 199.125 1.00 50.00  ? 58   U   B O4    1 
ATOM   1163  C  C5    . U   A  1  58   ? 265.837 261.826 199.002 1.00 50.00  ? 58   U   B C5    1 
ATOM   1164  C  C6    . U   A  1  58   ? 265.016 260.777 198.850 1.00 50.00  ? 58   U   B C6    1 
ATOM   1165  P  P     . G   A  1  59   ? 262.642 258.780 193.852 1.00 50.00  ? 59   G   B P     1 
ATOM   1166  O  OP1   . G   A  1  59   ? 262.279 257.776 192.819 1.00 50.00  ? 59   G   B OP1   1 
ATOM   1167  O  OP2   . G   A  1  59   ? 263.956 259.466 193.778 1.00 50.00  ? 59   G   B OP2   1 
ATOM   1168  O  "O5'" . G   A  1  59   ? 261.505 259.895 193.877 1.00 50.00  ? 59   G   B "O5'" 1 
ATOM   1169  C  "C5'" . G   A  1  59   ? 260.136 259.534 193.991 1.00 50.00  ? 59   G   B "C5'" 1 
ATOM   1170  C  "C4'" . G   A  1  59   ? 259.255 260.742 194.177 1.00 50.00  ? 59   G   B "C4'" 1 
ATOM   1171  O  "O4'" . G   A  1  59   ? 259.564 261.392 195.439 1.00 50.00  ? 59   G   B "O4'" 1 
ATOM   1172  C  "C3'" . G   A  1  59   ? 259.411 261.853 193.148 1.00 50.00  ? 59   G   B "C3'" 1 
ATOM   1173  O  "O3'" . G   A  1  59   ? 258.725 261.596 191.936 1.00 50.00  ? 59   G   B "O3'" 1 
ATOM   1174  C  "C2'" . G   A  1  59   ? 258.893 263.070 193.898 1.00 50.00  ? 59   G   B "C2'" 1 
ATOM   1175  O  "O2'" . G   A  1  59   ? 257.474 263.068 193.939 1.00 50.00  ? 59   G   B "O2'" 1 
ATOM   1176  C  "C1'" . G   A  1  59   ? 259.416 262.792 195.309 1.00 50.00  ? 59   G   B "C1'" 1 
ATOM   1177  N  N9    . G   A  1  59   ? 260.727 263.425 195.532 1.00 50.00  ? 59   G   B N9    1 
ATOM   1178  C  C8    . G   A  1  59   ? 261.929 262.797 195.748 1.00 50.00  ? 59   G   B C8    1 
ATOM   1179  N  N7    . G   A  1  59   ? 262.923 263.626 195.913 1.00 50.00  ? 59   G   B N7    1 
ATOM   1180  C  C5    . G   A  1  59   ? 262.345 264.881 195.788 1.00 50.00  ? 59   G   B C5    1 
ATOM   1181  C  C6    . G   A  1  59   ? 262.923 266.174 195.866 1.00 50.00  ? 59   G   B C6    1 
ATOM   1182  O  O6    . G   A  1  59   ? 264.105 266.476 196.069 1.00 50.00  ? 59   G   B O6    1 
ATOM   1183  N  N1    . G   A  1  59   ? 261.973 267.171 195.681 1.00 50.00  ? 59   G   B N1    1 
ATOM   1184  C  C2    . G   A  1  59   ? 260.634 266.955 195.455 1.00 50.00  ? 59   G   B C2    1 
ATOM   1185  N  N2    . G   A  1  59   ? 259.855 268.032 195.290 1.00 50.00  ? 59   G   B N2    1 
ATOM   1186  N  N3    . G   A  1  59   ? 260.086 265.756 195.378 1.00 50.00  ? 59   G   B N3    1 
ATOM   1187  C  C4    . G   A  1  59   ? 260.992 264.773 195.552 1.00 50.00  ? 59   G   B C4    1 
ATOM   1188  P  P     . G   A  1  60   ? 259.297 262.180 190.552 1.00 50.00  ? 60   G   B P     1 
ATOM   1189  O  OP1   . G   A  1  60   ? 258.517 261.578 189.440 1.00 50.00  ? 60   G   B OP1   1 
ATOM   1190  O  OP2   . G   A  1  60   ? 260.774 262.042 190.570 1.00 50.00  ? 60   G   B OP2   1 
ATOM   1191  O  "O5'" . G   A  1  60   ? 258.947 263.733 190.614 1.00 50.00  ? 60   G   B "O5'" 1 
ATOM   1192  C  "C5'" . G   A  1  60   ? 257.599 264.178 190.630 1.00 50.00  ? 60   G   B "C5'" 1 
ATOM   1193  C  "C4'" . G   A  1  60   ? 257.508 265.681 190.688 1.00 50.00  ? 60   G   B "C4'" 1 
ATOM   1194  O  "O4'" . G   A  1  60   ? 258.035 266.162 191.954 1.00 50.00  ? 60   G   B "O4'" 1 
ATOM   1195  C  "C3'" . G   A  1  60   ? 258.310 266.444 189.645 1.00 50.00  ? 60   G   B "C3'" 1 
ATOM   1196  O  "O3'" . G   A  1  60   ? 257.669 266.501 188.385 1.00 50.00  ? 60   G   B "O3'" 1 
ATOM   1197  C  "C2'" . G   A  1  60   ? 258.496 267.804 190.299 1.00 50.00  ? 60   G   B "C2'" 1 
ATOM   1198  O  "O2'" . G   A  1  60   ? 257.313 268.582 190.182 1.00 50.00  ? 60   G   B "O2'" 1 
ATOM   1199  C  "C1'" . G   A  1  60   ? 258.671 267.409 191.768 1.00 50.00  ? 60   G   B "C1'" 1 
ATOM   1200  N  N9    . G   A  1  60   ? 260.093 267.274 192.133 1.00 50.00  ? 60   G   B N9    1 
ATOM   1201  C  C8    . G   A  1  60   ? 260.747 266.121 192.494 1.00 50.00  ? 60   G   B C8    1 
ATOM   1202  N  N7    . G   A  1  60   ? 262.009 266.315 192.766 1.00 50.00  ? 60   G   B N7    1 
ATOM   1203  C  C5    . G   A  1  60   ? 262.203 267.673 192.560 1.00 50.00  ? 60   G   B C5    1 
ATOM   1204  C  C6    . G   A  1  60   ? 263.372 268.466 192.689 1.00 50.00  ? 60   G   B C6    1 
ATOM   1205  O  O6    . G   A  1  60   ? 264.508 268.116 193.025 1.00 50.00  ? 60   G   B O6    1 
ATOM   1206  N  N1    . G   A  1  60   ? 263.122 269.800 192.383 1.00 50.00  ? 60   G   B N1    1 
ATOM   1207  C  C2    . G   A  1  60   ? 261.905 270.310 192.005 1.00 50.00  ? 60   G   B C2    1 
ATOM   1208  N  N2    . G   A  1  60   ? 261.864 271.623 191.745 1.00 50.00  ? 60   G   B N2    1 
ATOM   1209  N  N3    . G   A  1  60   ? 260.809 269.579 191.879 1.00 50.00  ? 60   G   B N3    1 
ATOM   1210  C  C4    . G   A  1  60   ? 261.028 268.280 192.170 1.00 50.00  ? 60   G   B C4    1 
ATOM   1211  P  P     . A   A  1  61   ? 258.543 266.586 187.039 1.00 50.00  ? 61   A   B P     1 
ATOM   1212  O  OP1   . A   A  1  61   ? 257.634 266.377 185.884 1.00 50.00  ? 61   A   B OP1   1 
ATOM   1213  O  OP2   . A   A  1  61   ? 259.728 265.707 187.205 1.00 50.00  ? 61   A   B OP2   1 
ATOM   1214  O  "O5'" . A   A  1  61   ? 259.051 268.095 187.001 1.00 50.00  ? 61   A   B "O5'" 1 
ATOM   1215  C  "C5'" . A   A  1  61   ? 258.131 269.171 186.884 1.00 50.00  ? 61   A   B "C5'" 1 
ATOM   1216  C  "C4'" . A   A  1  61   ? 258.832 270.505 186.915 1.00 50.00  ? 61   A   B "C4'" 1 
ATOM   1217  O  "O4'" . A   A  1  61   ? 259.422 270.722 188.224 1.00 50.00  ? 61   A   B "O4'" 1 
ATOM   1218  C  "C3'" . A   A  1  61   ? 259.997 270.667 185.951 1.00 50.00  ? 61   A   B "C3'" 1 
ATOM   1219  O  "O3'" . A   A  1  61   ? 259.582 270.987 184.635 1.00 50.00  ? 61   A   B "O3'" 1 
ATOM   1220  C  "C2'" . A   A  1  61   ? 260.827 271.762 186.612 1.00 50.00  ? 61   A   B "C2'" 1 
ATOM   1221  O  "O2'" . A   A  1  61   ? 260.261 273.039 186.361 1.00 50.00  ? 61   A   B "O2'" 1 
ATOM   1222  C  "C1'" . A   A  1  61   ? 260.638 271.431 188.094 1.00 50.00  ? 61   A   B "C1'" 1 
ATOM   1223  N  N9    . A   A  1  61   ? 261.727 270.586 188.617 1.00 50.00  ? 61   A   B N9    1 
ATOM   1224  C  C8    . A   A  1  61   ? 261.631 269.291 189.062 1.00 50.00  ? 61   A   B C8    1 
ATOM   1225  N  N7    . A   A  1  61   ? 262.766 268.789 189.482 1.00 50.00  ? 61   A   B N7    1 
ATOM   1226  C  C5    . A   A  1  61   ? 263.676 269.821 189.290 1.00 50.00  ? 61   A   B C5    1 
ATOM   1227  C  C6    . A   A  1  61   ? 265.057 269.920 189.534 1.00 50.00  ? 61   A   B C6    1 
ATOM   1228  N  N6    . A   A  1  61   ? 265.792 268.930 190.043 1.00 50.00  ? 61   A   B N6    1 
ATOM   1229  N  N1    . A   A  1  61   ? 265.666 271.086 189.235 1.00 50.00  ? 61   A   B N1    1 
ATOM   1230  C  C2    . A   A  1  61   ? 264.929 272.084 188.727 1.00 50.00  ? 61   A   B C2    1 
ATOM   1231  N  N3    . A   A  1  61   ? 263.627 272.110 188.453 1.00 50.00  ? 61   A   B N3    1 
ATOM   1232  C  C4    . A   A  1  61   ? 263.050 270.935 188.760 1.00 50.00  ? 61   A   B C4    1 
ATOM   1233  P  P     . G   A  1  62   ? 260.390 270.418 183.368 1.00 50.00  ? 62   G   B P     1 
ATOM   1234  O  OP1   . G   A  1  62   ? 259.517 270.542 182.173 1.00 50.00  ? 62   G   B OP1   1 
ATOM   1235  O  OP2   . G   A  1  62   ? 260.945 269.091 183.736 1.00 50.00  ? 62   G   B OP2   1 
ATOM   1236  O  "O5'" . G   A  1  62   ? 261.606 271.434 183.198 1.00 50.00  ? 62   G   B "O5'" 1 
ATOM   1237  C  "C5'" . G   A  1  62   ? 261.377 272.800 182.884 1.00 50.00  ? 62   G   B "C5'" 1 
ATOM   1238  C  "C4'" . G   A  1  62   ? 262.628 273.623 183.055 1.00 50.00  ? 62   G   B "C4'" 1 
ATOM   1239  O  "O4'" . G   A  1  62   ? 263.050 273.592 184.444 1.00 50.00  ? 62   G   B "O4'" 1 
ATOM   1240  C  "C3'" . G   A  1  62   ? 263.851 273.147 182.286 1.00 50.00  ? 62   G   B "C3'" 1 
ATOM   1241  O  "O3'" . G   A  1  62   ? 263.850 273.559 180.929 1.00 50.00  ? 62   G   B "O3'" 1 
ATOM   1242  C  "C2'" . G   A  1  62   ? 265.001 273.726 183.096 1.00 50.00  ? 62   G   B "C2'" 1 
ATOM   1243  O  "O2'" . G   A  1  62   ? 265.172 275.106 182.807 1.00 50.00  ? 62   G   B "O2'" 1 
ATOM   1244  C  "C1'" . G   A  1  62   ? 264.460 273.595 184.520 1.00 50.00  ? 62   G   B "C1'" 1 
ATOM   1245  N  N9    . G   A  1  62   ? 264.894 272.341 185.163 1.00 50.00  ? 62   G   B N9    1 
ATOM   1246  C  C8    . G   A  1  62   ? 264.092 271.314 185.593 1.00 50.00  ? 62   G   B C8    1 
ATOM   1247  N  N7    . G   A  1  62   ? 264.759 270.329 186.133 1.00 50.00  ? 62   G   B N7    1 
ATOM   1248  C  C5    . G   A  1  62   ? 266.085 270.731 186.050 1.00 50.00  ? 62   G   B C5    1 
ATOM   1249  C  C6    . G   A  1  62   ? 267.271 270.077 186.474 1.00 50.00  ? 62   G   B C6    1 
ATOM   1250  O  O6    . G   A  1  62   ? 267.391 268.975 187.022 1.00 50.00  ? 62   G   B O6    1 
ATOM   1251  N  N1    . G   A  1  62   ? 268.398 270.841 186.200 1.00 50.00  ? 62   G   B N1    1 
ATOM   1252  C  C2    . G   A  1  62   ? 268.395 272.078 185.601 1.00 50.00  ? 62   G   B C2    1 
ATOM   1253  N  N2    . G   A  1  62   ? 269.584 272.665 185.413 1.00 50.00  ? 62   G   B N2    1 
ATOM   1254  N  N3    . G   A  1  62   ? 267.297 272.696 185.203 1.00 50.00  ? 62   G   B N3    1 
ATOM   1255  C  C4    . G   A  1  62   ? 266.185 271.972 185.457 1.00 50.00  ? 62   G   B C4    1 
ATOM   1256  P  P     . A   A  1  63   ? 264.471 272.606 179.793 1.00 50.00  ? 63   A   B P     1 
ATOM   1257  O  OP1   . A   A  1  63   ? 264.073 273.147 178.471 1.00 50.00  ? 63   A   B OP1   1 
ATOM   1258  O  OP2   . A   A  1  63   ? 264.138 271.200 180.143 1.00 50.00  ? 63   A   B OP2   1 
ATOM   1259  O  "O5'" . A   A  1  63   ? 266.046 272.790 179.950 1.00 50.00  ? 63   A   B "O5'" 1 
ATOM   1260  C  "C5'" . A   A  1  63   ? 266.678 274.015 179.608 1.00 50.00  ? 63   A   B "C5'" 1 
ATOM   1261  C  "C4'" . A   A  1  63   ? 268.151 273.986 179.934 1.00 50.00  ? 63   A   B "C4'" 1 
ATOM   1262  O  "O4'" . A   A  1  63   ? 268.328 273.788 181.361 1.00 50.00  ? 63   A   B "O4'" 1 
ATOM   1263  C  "C3'" . A   A  1  63   ? 268.951 272.861 179.297 1.00 50.00  ? 63   A   B "C3'" 1 
ATOM   1264  O  "O3'" . A   A  1  63   ? 269.342 273.150 177.965 1.00 50.00  ? 63   A   B "O3'" 1 
ATOM   1265  C  "C2'" . A   A  1  63   ? 270.122 272.694 180.254 1.00 50.00  ? 63   A   B "C2'" 1 
ATOM   1266  O  "O2'" . A   A  1  63   ? 271.104 273.693 180.025 1.00 50.00  ? 63   A   B "O2'" 1 
ATOM   1267  C  "C1'" . A   A  1  63   ? 269.456 272.973 181.600 1.00 50.00  ? 63   A   B "C1'" 1 
ATOM   1268  N  N9    . A   A  1  63   ? 268.999 271.739 182.265 1.00 50.00  ? 63   A   B N9    1 
ATOM   1269  C  C8    . A   A  1  63   ? 267.701 271.339 182.469 1.00 50.00  ? 63   A   B C8    1 
ATOM   1270  N  N7    . A   A  1  63   ? 267.593 270.194 183.097 1.00 50.00  ? 63   A   B N7    1 
ATOM   1271  C  C5    . A   A  1  63   ? 268.909 269.816 183.320 1.00 50.00  ? 63   A   B C5    1 
ATOM   1272  C  C6    . A   A  1  63   ? 269.472 268.691 183.947 1.00 50.00  ? 63   A   B C6    1 
ATOM   1273  N  N6    . A   A  1  63   ? 268.750 267.705 184.479 1.00 50.00  ? 63   A   B N6    1 
ATOM   1274  N  N1    . A   A  1  63   ? 270.818 268.614 184.005 1.00 50.00  ? 63   A   B N1    1 
ATOM   1275  C  C2    . A   A  1  63   ? 271.543 269.605 183.472 1.00 50.00  ? 63   A   B C2    1 
ATOM   1276  N  N3    . A   A  1  63   ? 271.130 270.713 182.856 1.00 50.00  ? 63   A   B N3    1 
ATOM   1277  C  C4    . A   A  1  63   ? 269.787 270.758 182.815 1.00 50.00  ? 63   A   B C4    1 
ATOM   1278  P  P     . G   A  1  64   ? 269.685 271.960 176.942 1.00 50.00  ? 64   G   B P     1 
ATOM   1279  O  OP1   . G   A  1  64   ? 269.800 272.544 175.582 1.00 50.00  ? 64   G   B OP1   1 
ATOM   1280  O  OP2   . G   A  1  64   ? 268.732 270.848 177.189 1.00 50.00  ? 64   G   B OP2   1 
ATOM   1281  O  "O5'" . G   A  1  64   ? 271.135 271.473 177.386 1.00 50.00  ? 64   G   B "O5'" 1 
ATOM   1282  C  "C5'" . G   A  1  64   ? 272.260 272.334 177.286 1.00 50.00  ? 64   G   B "C5'" 1 
ATOM   1283  C  "C4'" . G   A  1  64   ? 273.527 271.628 177.698 1.00 50.00  ? 64   G   B "C4'" 1 
ATOM   1284  O  "O4'" . G   A  1  64   ? 273.473 271.312 179.113 1.00 50.00  ? 64   G   B "O4'" 1 
ATOM   1285  C  "C3'" . G   A  1  64   ? 273.780 270.287 177.025 1.00 50.00  ? 64   G   B "C3'" 1 
ATOM   1286  O  "O3'" . G   A  1  64   ? 274.369 270.419 175.742 1.00 50.00  ? 64   G   B "O3'" 1 
ATOM   1287  C  "C2'" . G   A  1  64   ? 274.661 269.564 178.034 1.00 50.00  ? 64   G   B "C2'" 1 
ATOM   1288  O  "O2'" . G   A  1  64   ? 276.004 270.017 177.940 1.00 50.00  ? 64   G   B "O2'" 1 
ATOM   1289  C  "C1'" . G   A  1  64   ? 274.076 270.058 179.355 1.00 50.00  ? 64   G   B "C1'" 1 
ATOM   1290  N  N9    . G   A  1  64   ? 273.043 269.148 179.887 1.00 50.00  ? 64   G   B N9    1 
ATOM   1291  C  C8    . G   A  1  64   ? 271.687 269.329 179.794 1.00 50.00  ? 64   G   B C8    1 
ATOM   1292  N  N7    . G   A  1  64   ? 270.997 268.374 180.353 1.00 50.00  ? 64   G   B N7    1 
ATOM   1293  C  C5    . G   A  1  64   ? 271.957 267.505 180.850 1.00 50.00  ? 64   G   B C5    1 
ATOM   1294  C  C6    . G   A  1  64   ? 271.804 266.287 181.560 1.00 50.00  ? 64   G   B C6    1 
ATOM   1295  O  O6    . G   A  1  64   ? 270.762 265.715 181.899 1.00 50.00  ? 64   G   B O6    1 
ATOM   1296  N  N1    . G   A  1  64   ? 273.031 265.723 181.881 1.00 50.00  ? 64   G   B N1    1 
ATOM   1297  C  C2    . G   A  1  64   ? 274.252 266.259 181.557 1.00 50.00  ? 64   G   B C2    1 
ATOM   1298  N  N2    . G   A  1  64   ? 275.322 265.555 181.959 1.00 50.00  ? 64   G   B N2    1 
ATOM   1299  N  N3    . G   A  1  64   ? 274.412 267.397 180.896 1.00 50.00  ? 64   G   B N3    1 
ATOM   1300  C  C4    . G   A  1  64   ? 273.229 267.966 180.574 1.00 50.00  ? 64   G   B C4    1 
ATOM   1301  P  P     . G   A  1  65   ? 274.348 269.186 174.713 1.00 50.00  ? 65   G   B P     1 
ATOM   1302  O  OP1   . G   A  1  65   ? 274.504 269.715 173.334 1.00 50.00  ? 65   G   B OP1   1 
ATOM   1303  O  OP2   . G   A  1  65   ? 273.168 268.350 175.045 1.00 50.00  ? 65   G   B OP2   1 
ATOM   1304  O  "O5'" . G   A  1  65   ? 275.658 268.359 175.079 1.00 50.00  ? 65   G   B "O5'" 1 
ATOM   1305  C  "C5'" . G   A  1  65   ? 275.922 267.107 174.462 1.00 50.00  ? 65   G   B "C5'" 1 
ATOM   1306  C  "C4'" . G   A  1  65   ? 276.637 266.165 175.398 1.00 50.00  ? 65   G   B "C4'" 1 
ATOM   1307  O  "O4'" . G   A  1  65   ? 276.046 266.247 176.721 1.00 50.00  ? 65   G   B "O4'" 1 
ATOM   1308  C  "C3'" . G   A  1  65   ? 276.552 264.689 175.038 1.00 50.00  ? 65   G   B "C3'" 1 
ATOM   1309  O  "O3'" . G   A  1  65   ? 277.508 264.310 174.063 1.00 50.00  ? 65   G   B "O3'" 1 
ATOM   1310  C  "C2'" . G   A  1  65   ? 276.741 264.000 176.382 1.00 50.00  ? 65   G   B "C2'" 1 
ATOM   1311  O  "O2'" . G   A  1  65   ? 278.117 263.956 176.732 1.00 50.00  ? 65   G   B "O2'" 1 
ATOM   1312  C  "C1'" . G   A  1  65   ? 276.033 264.970 177.325 1.00 50.00  ? 65   G   B "C1'" 1 
ATOM   1313  N  N9    . G   A  1  65   ? 274.627 264.597 177.571 1.00 50.00  ? 65   G   B N9    1 
ATOM   1314  C  C8    . G   A  1  65   ? 273.522 265.291 177.144 1.00 50.00  ? 65   G   B C8    1 
ATOM   1315  N  N7    . G   A  1  65   ? 272.398 264.743 177.505 1.00 50.00  ? 65   G   B N7    1 
ATOM   1316  C  C5    . G   A  1  65   ? 272.783 263.618 178.219 1.00 50.00  ? 65   G   B C5    1 
ATOM   1317  C  C6    . G   A  1  65   ? 271.991 262.632 178.857 1.00 50.00  ? 65   G   B C6    1 
ATOM   1318  O  O6    . G   A  1  65   ? 270.757 262.565 178.914 1.00 50.00  ? 65   G   B O6    1 
ATOM   1319  N  N1    . G   A  1  65   ? 272.776 261.660 179.470 1.00 50.00  ? 65   G   B N1    1 
ATOM   1320  C  C2    . G   A  1  65   ? 274.149 261.643 179.466 1.00 50.00  ? 65   G   B C2    1 
ATOM   1321  N  N2    . G   A  1  65   ? 274.730 260.621 180.112 1.00 50.00  ? 65   G   B N2    1 
ATOM   1322  N  N3    . G   A  1  65   ? 274.901 262.559 178.874 1.00 50.00  ? 65   G   B N3    1 
ATOM   1323  C  C4    . G   A  1  65   ? 274.156 263.513 178.274 1.00 50.00  ? 65   G   B C4    1 
ATOM   1324  P  P     . A   A  1  66   ? 277.047 263.555 172.722 1.00 50.00  ? 66   A   B P     1 
ATOM   1325  O  OP1   . A   A  1  66   ? 278.024 263.881 171.651 1.00 50.00  ? 66   A   B OP1   1 
ATOM   1326  O  OP2   . A   A  1  66   ? 275.604 263.832 172.508 1.00 50.00  ? 66   A   B OP2   1 
ATOM   1327  O  "O5'" . A   A  1  66   ? 277.206 262.010 173.078 1.00 50.00  ? 66   A   B "O5'" 1 
ATOM   1328  C  "C5'" . A   A  1  66   ? 278.419 261.505 173.614 1.00 50.00  ? 66   A   B "C5'" 1 
ATOM   1329  C  "C4'" . A   A  1  66   ? 278.161 260.373 174.575 1.00 50.00  ? 66   A   B "C4'" 1 
ATOM   1330  O  "O4'" . A   A  1  66   ? 277.335 260.848 175.670 1.00 50.00  ? 66   A   B "O4'" 1 
ATOM   1331  C  "C3'" . A   A  1  66   ? 277.386 259.192 174.008 1.00 50.00  ? 66   A   B "C3'" 1 
ATOM   1332  O  "O3'" . A   A  1  66   ? 278.210 258.280 173.301 1.00 50.00  ? 66   A   B "O3'" 1 
ATOM   1333  C  "C2'" . A   A  1  66   ? 276.731 258.596 175.245 1.00 50.00  ? 66   A   B "C2'" 1 
ATOM   1334  O  "O2'" . A   A  1  66   ? 277.667 257.828 175.988 1.00 50.00  ? 66   A   B "O2'" 1 
ATOM   1335  C  "C1'" . A   A  1  66   ? 276.403 259.857 176.043 1.00 50.00  ? 66   A   B "C1'" 1 
ATOM   1336  N  N9    . A   A  1  66   ? 275.053 260.362 175.732 1.00 50.00  ? 66   A   B N9    1 
ATOM   1337  C  C8    . A   A  1  66   ? 274.737 261.489 175.014 1.00 50.00  ? 66   A   B C8    1 
ATOM   1338  N  N7    . A   A  1  66   ? 273.449 261.694 174.892 1.00 50.00  ? 66   A   B N7    1 
ATOM   1339  C  C5    . A   A  1  66   ? 272.882 260.629 175.575 1.00 50.00  ? 66   A   B C5    1 
ATOM   1340  C  C6    . A   A  1  66   ? 271.546 260.271 175.812 1.00 50.00  ? 66   A   B C6    1 
ATOM   1341  N  N6    . A   A  1  66   ? 270.508 260.979 175.368 1.00 50.00  ? 66   A   B N6    1 
ATOM   1342  N  N1    . A   A  1  66   ? 271.314 259.151 176.530 1.00 50.00  ? 66   A   B N1    1 
ATOM   1343  C  C2    . A   A  1  66   ? 272.362 258.444 176.970 1.00 50.00  ? 66   A   B C2    1 
ATOM   1344  N  N3    . A   A  1  66   ? 273.663 258.680 176.814 1.00 50.00  ? 66   A   B N3    1 
ATOM   1345  C  C4    . A   A  1  66   ? 273.857 259.801 176.098 1.00 50.00  ? 66   A   B C4    1 
ATOM   1346  P  P     . A   A  1  67   ? 277.733 257.683 171.887 1.00 50.00  ? 67   A   B P     1 
ATOM   1347  O  OP1   . A   A  1  67   ? 278.921 257.111 171.204 1.00 50.00  ? 67   A   B OP1   1 
ATOM   1348  O  OP2   . A   A  1  67   ? 276.919 258.721 171.202 1.00 50.00  ? 67   A   B OP2   1 
ATOM   1349  O  "O5'" . A   A  1  67   ? 276.765 256.482 172.281 1.00 50.00  ? 67   A   B "O5'" 1 
ATOM   1350  C  "C5'" . A   A  1  67   ? 277.200 255.453 173.158 1.00 50.00  ? 67   A   B "C5'" 1 
ATOM   1351  C  "C4'" . A   A  1  67   ? 276.034 254.707 173.753 1.00 50.00  ? 67   A   B "C4'" 1 
ATOM   1352  O  "O4'" . A   A  1  67   ? 275.180 255.635 174.471 1.00 50.00  ? 67   A   B "O4'" 1 
ATOM   1353  C  "C3'" . A   A  1  67   ? 275.098 254.035 172.760 1.00 50.00  ? 67   A   B "C3'" 1 
ATOM   1354  O  "O3'" . A   A  1  67   ? 275.576 252.778 172.311 1.00 50.00  ? 67   A   B "O3'" 1 
ATOM   1355  C  "C2'" . A   A  1  67   ? 273.794 253.947 173.541 1.00 50.00  ? 67   A   B "C2'" 1 
ATOM   1356  O  "O2'" . A   A  1  67   ? 273.834 252.868 174.465 1.00 50.00  ? 67   A   B "O2'" 1 
ATOM   1357  C  "C1'" . A   A  1  67   ? 273.826 255.258 174.326 1.00 50.00  ? 67   A   B "C1'" 1 
ATOM   1358  N  N9    . A   A  1  67   ? 273.115 256.337 173.618 1.00 50.00  ? 67   A   B N9    1 
ATOM   1359  C  C8    . A   A  1  67   ? 273.655 257.407 172.946 1.00 50.00  ? 67   A   B C8    1 
ATOM   1360  N  N7    . A   A  1  67   ? 272.758 258.200 172.414 1.00 50.00  ? 67   A   B N7    1 
ATOM   1361  C  C5    . A   A  1  67   ? 271.546 257.612 172.755 1.00 50.00  ? 67   A   B C5    1 
ATOM   1362  C  C6    . A   A  1  67   ? 270.213 257.966 172.491 1.00 50.00  ? 67   A   B C6    1 
ATOM   1363  N  N6    . A   A  1  67   ? 269.856 259.044 171.791 1.00 50.00  ? 67   A   B N6    1 
ATOM   1364  N  N1    . A   A  1  67   ? 269.243 257.163 172.978 1.00 50.00  ? 67   A   B N1    1 
ATOM   1365  C  C2    . A   A  1  67   ? 269.598 256.080 173.681 1.00 50.00  ? 67   A   B C2    1 
ATOM   1366  N  N3    . A   A  1  67   ? 270.814 255.643 173.995 1.00 50.00  ? 67   A   B N3    1 
ATOM   1367  C  C4    . A   A  1  67   ? 271.754 256.464 173.496 1.00 50.00  ? 67   A   B C4    1 
ATOM   1368  P  P     . C   A  1  68   ? 276.070 252.594 170.793 1.00 50.00  ? 68   C   B P     1 
ATOM   1369  O  OP1   . C   A  1  68   ? 276.260 251.141 170.547 1.00 50.00  ? 68   C   B OP1   1 
ATOM   1370  O  OP2   . C   A  1  68   ? 277.195 253.530 170.551 1.00 50.00  ? 68   C   B OP2   1 
ATOM   1371  O  "O5'" . C   A  1  68   ? 274.829 253.078 169.918 1.00 50.00  ? 68   C   B "O5'" 1 
ATOM   1372  C  "C5'" . C   A  1  68   ? 273.686 252.252 169.749 1.00 50.00  ? 68   C   B "C5'" 1 
ATOM   1373  C  "C4'" . C   A  1  68   ? 273.110 252.396 168.363 1.00 50.00  ? 68   C   B "C4'" 1 
ATOM   1374  O  "O4'" . C   A  1  68   ? 272.045 251.431 168.168 1.00 50.00  ? 68   C   B "O4'" 1 
ATOM   1375  C  "C3'" . C   A  1  68   ? 272.458 253.732 168.045 1.00 50.00  ? 68   C   B "C3'" 1 
ATOM   1376  O  "O3'" . C   A  1  68   ? 273.394 254.743 167.716 1.00 50.00  ? 68   C   B "O3'" 1 
ATOM   1377  C  "C2'" . C   A  1  68   ? 271.508 253.380 166.903 1.00 50.00  ? 68   C   B "C2'" 1 
ATOM   1378  O  "O2'" . C   A  1  68   ? 272.205 253.332 165.667 1.00 50.00  ? 68   C   B "O2'" 1 
ATOM   1379  C  "C1'" . C   A  1  68   ? 271.085 251.955 167.276 1.00 50.00  ? 68   C   B "C1'" 1 
ATOM   1380  N  N1    . C   A  1  68   ? 269.729 251.880 167.878 1.00 50.00  ? 68   C   B N1    1 
ATOM   1381  C  C2    . C   A  1  68   ? 269.449 252.255 169.204 1.00 50.00  ? 68   C   B C2    1 
ATOM   1382  O  O2    . C   A  1  68   ? 270.346 252.660 169.957 1.00 50.00  ? 68   C   B O2    1 
ATOM   1383  N  N3    . C   A  1  68   ? 268.180 252.157 169.664 1.00 50.00  ? 68   C   B N3    1 
ATOM   1384  C  C4    . C   A  1  68   ? 267.202 251.719 168.872 1.00 50.00  ? 68   C   B C4    1 
ATOM   1385  N  N4    . C   A  1  68   ? 265.970 251.645 169.376 1.00 50.00  ? 68   C   B N4    1 
ATOM   1386  C  C5    . C   A  1  68   ? 267.449 251.340 167.523 1.00 50.00  ? 68   C   B C5    1 
ATOM   1387  C  C6    . C   A  1  68   ? 268.707 251.439 167.081 1.00 50.00  ? 68   C   B C6    1 
ATOM   1388  P  P     . A   A  1  69   ? 273.506 256.064 168.628 1.00 50.00  ? 69   A   B P     1 
ATOM   1389  O  OP1   . A   A  1  69   ? 274.584 256.919 168.068 1.00 50.00  ? 69   A   B OP1   1 
ATOM   1390  O  OP2   . A   A  1  69   ? 273.569 255.641 170.050 1.00 50.00  ? 69   A   B OP2   1 
ATOM   1391  O  "O5'" . A   A  1  69   ? 272.118 256.812 168.399 1.00 50.00  ? 69   A   B "O5'" 1 
ATOM   1392  C  "C5'" . A   A  1  69   ? 271.889 257.594 167.233 1.00 50.00  ? 69   A   B "C5'" 1 
ATOM   1393  C  "C4'" . A   A  1  69   ? 270.966 256.893 166.266 1.00 50.00  ? 69   A   B "C4'" 1 
ATOM   1394  O  "O4'" . A   A  1  69   ? 269.901 256.240 167.011 1.00 50.00  ? 69   A   B "O4'" 1 
ATOM   1395  C  "C3'" . A   A  1  69   ? 270.277 257.800 165.247 1.00 50.00  ? 69   A   B "C3'" 1 
ATOM   1396  O  "O3'" . A   A  1  69   ? 270.082 257.078 164.032 1.00 50.00  ? 69   A   B "O3'" 1 
ATOM   1397  C  "C2'" . A   A  1  69   ? 268.923 258.061 165.901 1.00 50.00  ? 69   A   B "C2'" 1 
ATOM   1398  O  "O2'" . A   A  1  69   ? 267.897 258.422 165.002 1.00 50.00  ? 69   A   B "O2'" 1 
ATOM   1399  C  "C1'" . A   A  1  69   ? 268.646 256.715 166.565 1.00 50.00  ? 69   A   B "C1'" 1 
ATOM   1400  N  N9    . A   A  1  69   ? 267.746 256.786 167.718 1.00 50.00  ? 69   A   B N9    1 
ATOM   1401  C  C8    . A   A  1  69   ? 267.847 257.591 168.828 1.00 50.00  ? 69   A   B C8    1 
ATOM   1402  N  N7    . A   A  1  69   ? 266.881 257.415 169.696 1.00 50.00  ? 69   A   B N7    1 
ATOM   1403  C  C5    . A   A  1  69   ? 266.092 256.427 169.123 1.00 50.00  ? 69   A   B C5    1 
ATOM   1404  C  C6    . A   A  1  69   ? 264.912 255.790 169.545 1.00 50.00  ? 69   A   B C6    1 
ATOM   1405  N  N6    . A   A  1  69   ? 264.289 256.066 170.693 1.00 50.00  ? 69   A   B N6    1 
ATOM   1406  N  N1    . A   A  1  69   ? 264.382 254.845 168.737 1.00 50.00  ? 69   A   B N1    1 
ATOM   1407  C  C2    . A   A  1  69   ? 265.003 254.566 167.584 1.00 50.00  ? 69   A   B C2    1 
ATOM   1408  N  N3    . A   A  1  69   ? 266.115 255.094 167.079 1.00 50.00  ? 69   A   B N3    1 
ATOM   1409  C  C4    . A   A  1  69   ? 266.615 256.028 167.906 1.00 50.00  ? 69   A   B C4    1 
ATOM   1410  P  P     . A   A  1  70   ? 271.028 257.349 162.759 1.00 50.00  ? 70   A   B P     1 
ATOM   1411  O  OP1   . A   A  1  70   ? 272.439 257.253 163.210 1.00 50.00  ? 70   A   B OP1   1 
ATOM   1412  O  OP2   . A   A  1  70   ? 270.555 258.588 162.090 1.00 50.00  ? 70   A   B OP2   1 
ATOM   1413  O  "O5'" . A   A  1  70   ? 270.734 256.118 161.791 1.00 50.00  ? 70   A   B "O5'" 1 
ATOM   1414  C  "C5'" . A   A  1  70   ? 269.675 256.161 160.843 1.00 50.00  ? 70   A   B "C5'" 1 
ATOM   1415  C  "C4'" . A   A  1  70   ? 268.352 255.803 161.470 1.00 50.00  ? 70   A   B "C4'" 1 
ATOM   1416  O  "O4'" . A   A  1  70   ? 267.927 256.879 162.347 1.00 50.00  ? 70   A   B "O4'" 1 
ATOM   1417  C  "C3'" . A   A  1  70   ? 267.177 255.620 160.518 1.00 50.00  ? 70   A   B "C3'" 1 
ATOM   1418  O  "O3'" . A   A  1  70   ? 267.147 254.341 159.905 1.00 50.00  ? 70   A   B "O3'" 1 
ATOM   1419  C  "C2'" . A   A  1  70   ? 265.979 255.899 161.414 1.00 50.00  ? 70   A   B "C2'" 1 
ATOM   1420  O  "O2'" . A   A  1  70   ? 265.687 254.769 162.224 1.00 50.00  ? 70   A   B "O2'" 1 
ATOM   1421  C  "C1'" . A   A  1  70   ? 266.522 257.008 162.312 1.00 50.00  ? 70   A   B "C1'" 1 
ATOM   1422  N  N9    . A   A  1  70   ? 266.182 258.354 161.808 1.00 50.00  ? 70   A   B N9    1 
ATOM   1423  C  C8    . A   A  1  70   ? 265.966 258.750 160.512 1.00 50.00  ? 70   A   B C8    1 
ATOM   1424  N  N7    . A   A  1  70   ? 265.680 260.022 160.383 1.00 50.00  ? 70   A   B N7    1 
ATOM   1425  C  C5    . A   A  1  70   ? 265.707 260.499 161.685 1.00 50.00  ? 70   A   B C5    1 
ATOM   1426  C  C6    . A   A  1  70   ? 265.488 261.778 162.228 1.00 50.00  ? 70   A   B C6    1 
ATOM   1427  N  N6    . A   A  1  70   ? 265.183 262.849 161.495 1.00 50.00  ? 70   A   B N6    1 
ATOM   1428  N  N1    . A   A  1  70   ? 265.592 261.916 163.568 1.00 50.00  ? 70   A   B N1    1 
ATOM   1429  C  C2    . A   A  1  70   ? 265.897 260.839 164.302 1.00 50.00  ? 70   A   B C2    1 
ATOM   1430  N  N3    . A   A  1  70   ? 266.126 259.589 163.908 1.00 50.00  ? 70   A   B N3    1 
ATOM   1431  C  C4    . A   A  1  70   ? 266.015 259.484 162.572 1.00 50.00  ? 70   A   B C4    1 
ATOM   1432  P  P     . C   A  1  71   ? 265.847 253.848 159.091 1.00 50.00  ? 71   C   B P     1 
ATOM   1433  O  OP1   . C   A  1  71   ? 266.291 252.788 158.152 1.00 50.00  ? 71   C   B OP1   1 
ATOM   1434  O  OP2   . C   A  1  71   ? 265.126 255.030 158.552 1.00 50.00  ? 71   C   B OP2   1 
ATOM   1435  O  "O5'" . C   A  1  71   ? 264.937 253.152 160.202 1.00 50.00  ? 71   C   B "O5'" 1 
ATOM   1436  C  "C5'" . C   A  1  71   ? 263.523 253.304 160.210 1.00 50.00  ? 71   C   B "C5'" 1 
ATOM   1437  C  "C4'" . C   A  1  71   ? 262.953 252.955 161.563 1.00 50.00  ? 71   C   B "C4'" 1 
ATOM   1438  O  "O4'" . C   A  1  71   ? 263.669 253.692 162.589 1.00 50.00  ? 71   C   B "O4'" 1 
ATOM   1439  C  "C3'" . C   A  1  71   ? 261.495 253.318 161.808 1.00 50.00  ? 71   C   B "C3'" 1 
ATOM   1440  O  "O3'" . C   A  1  71   ? 260.565 252.403 161.254 1.00 50.00  ? 71   C   B "O3'" 1 
ATOM   1441  C  "C2'" . C   A  1  71   ? 261.433 253.405 163.326 1.00 50.00  ? 71   C   B "C2'" 1 
ATOM   1442  O  "O2'" . C   A  1  71   ? 261.401 252.107 163.901 1.00 50.00  ? 71   C   B "O2'" 1 
ATOM   1443  C  "C1'" . C   A  1  71   ? 262.787 254.036 163.639 1.00 50.00  ? 71   C   B "C1'" 1 
ATOM   1444  N  N1    . C   A  1  71   ? 262.695 255.514 163.721 1.00 50.00  ? 71   C   B N1    1 
ATOM   1445  C  C2    . C   A  1  71   ? 262.435 256.092 164.965 1.00 50.00  ? 71   C   B C2    1 
ATOM   1446  O  O2    . C   A  1  71   ? 262.305 255.353 165.953 1.00 50.00  ? 71   C   B O2    1 
ATOM   1447  N  N3    . C   A  1  71   ? 262.340 257.439 165.062 1.00 50.00  ? 71   C   B N3    1 
ATOM   1448  C  C4    . C   A  1  71   ? 262.488 258.202 163.979 1.00 50.00  ? 71   C   B C4    1 
ATOM   1449  N  N4    . C   A  1  71   ? 262.382 259.524 164.125 1.00 50.00  ? 71   C   B N4    1 
ATOM   1450  C  C5    . C   A  1  71   ? 262.745 257.643 162.696 1.00 50.00  ? 71   C   B C5    1 
ATOM   1451  C  C6    . C   A  1  71   ? 262.836 256.311 162.618 1.00 50.00  ? 71   C   B C6    1 
ATOM   1452  P  P     . U   A  1  72   ? 259.069 252.891 160.916 1.00 50.00  ? 72   U   B P     1 
ATOM   1453  O  OP1   . U   A  1  72   ? 258.348 251.763 160.274 1.00 50.00  ? 72   U   B OP1   1 
ATOM   1454  O  OP2   . U   A  1  72   ? 259.169 254.195 160.211 1.00 50.00  ? 72   U   B OP2   1 
ATOM   1455  O  "O5'" . U   A  1  72   ? 258.404 253.157 162.342 1.00 50.00  ? 72   U   B "O5'" 1 
ATOM   1456  C  "C5'" . U   A  1  72   ? 257.959 252.077 163.153 1.00 50.00  ? 72   U   B "C5'" 1 
ATOM   1457  C  "C4'" . U   A  1  72   ? 257.680 252.511 164.573 1.00 50.00  ? 72   U   B "C4'" 1 
ATOM   1458  O  "O4'" . U   A  1  72   ? 258.792 253.294 165.080 1.00 50.00  ? 72   U   B "O4'" 1 
ATOM   1459  C  "C3'" . U   A  1  72   ? 256.473 253.412 164.789 1.00 50.00  ? 72   U   B "C3'" 1 
ATOM   1460  O  "O3'" . U   A  1  72   ? 255.242 252.712 164.809 1.00 50.00  ? 72   U   B "O3'" 1 
ATOM   1461  C  "C2'" . U   A  1  72   ? 256.807 254.088 166.111 1.00 50.00  ? 72   U   B "C2'" 1 
ATOM   1462  O  "O2'" . U   A  1  72   ? 256.564 253.206 167.199 1.00 50.00  ? 72   U   B "O2'" 1 
ATOM   1463  C  "C1'" . U   A  1  72   ? 258.316 254.279 165.976 1.00 50.00  ? 72   U   B "C1'" 1 
ATOM   1464  N  N1    . U   A  1  72   ? 258.654 255.618 165.443 1.00 50.00  ? 72   U   B N1    1 
ATOM   1465  C  C2    . U   A  1  72   ? 258.573 256.694 166.308 1.00 50.00  ? 72   U   B C2    1 
ATOM   1466  O  O2    . U   A  1  72   ? 258.240 256.587 167.477 1.00 50.00  ? 72   U   B O2    1 
ATOM   1467  N  N3    . U   A  1  72   ? 258.894 257.908 165.756 1.00 50.00  ? 72   U   B N3    1 
ATOM   1468  C  C4    . U   A  1  72   ? 259.279 258.151 164.454 1.00 50.00  ? 72   U   B C4    1 
ATOM   1469  O  O4    . U   A  1  72   ? 259.541 259.301 164.107 1.00 50.00  ? 72   U   B O4    1 
ATOM   1470  C  C5    . U   A  1  72   ? 259.340 256.990 163.622 1.00 50.00  ? 72   U   B C5    1 
ATOM   1471  C  C6    . U   A  1  72   ? 259.031 255.795 164.132 1.00 50.00  ? 72   U   B C6    1 
ATOM   1472  P  P     . C   A  1  73   ? 253.858 253.507 164.595 1.00 50.00  ? 73   C   B P     1 
ATOM   1473  O  OP1   . C   A  1  73   ? 252.778 252.506 164.405 1.00 50.00  ? 73   C   B OP1   1 
ATOM   1474  O  OP2   . C   A  1  73   ? 254.084 254.548 163.560 1.00 50.00  ? 73   C   B OP2   1 
ATOM   1475  O  "O5'" . C   A  1  73   ? 253.606 254.244 165.987 1.00 50.00  ? 73   C   B "O5'" 1 
ATOM   1476  C  "C5'" . C   A  1  73   ? 253.371 253.501 167.175 1.00 50.00  ? 73   C   B "C5'" 1 
ATOM   1477  C  "C4'" . C   A  1  73   ? 253.387 254.383 168.400 1.00 50.00  ? 73   C   B "C4'" 1 
ATOM   1478  O  "O4'" . C   A  1  73   ? 254.639 255.116 168.467 1.00 50.00  ? 73   C   B "O4'" 1 
ATOM   1479  C  "C3'" . C   A  1  73   ? 252.324 255.467 168.463 1.00 50.00  ? 73   C   B "C3'" 1 
ATOM   1480  O  "O3'" . C   A  1  73   ? 251.065 254.979 168.896 1.00 50.00  ? 73   C   B "O3'" 1 
ATOM   1481  C  "C2'" . C   A  1  73   ? 252.939 256.483 169.414 1.00 50.00  ? 73   C   B "C2'" 1 
ATOM   1482  O  "O2'" . C   A  1  73   ? 252.787 256.064 170.763 1.00 50.00  ? 73   C   B "O2'" 1 
ATOM   1483  C  "C1'" . C   A  1  73   ? 254.421 256.389 169.044 1.00 50.00  ? 73   C   B "C1'" 1 
ATOM   1484  N  N1    . C   A  1  73   ? 254.827 257.430 168.071 1.00 50.00  ? 73   C   B N1    1 
ATOM   1485  C  C2    . C   A  1  73   ? 254.898 258.771 168.475 1.00 50.00  ? 73   C   B C2    1 
ATOM   1486  O  O2    . C   A  1  73   ? 254.609 259.080 169.642 1.00 50.00  ? 73   C   B O2    1 
ATOM   1487  N  N3    . C   A  1  73   ? 255.272 259.712 167.578 1.00 50.00  ? 73   C   B N3    1 
ATOM   1488  C  C4    . C   A  1  73   ? 255.580 259.364 166.328 1.00 50.00  ? 73   C   B C4    1 
ATOM   1489  N  N4    . C   A  1  73   ? 255.946 260.329 165.481 1.00 50.00  ? 73   C   B N4    1 
ATOM   1490  C  C5    . C   A  1  73   ? 255.524 258.010 165.892 1.00 50.00  ? 73   C   B C5    1 
ATOM   1491  C  C6    . C   A  1  73   ? 255.148 257.089 166.788 1.00 50.00  ? 73   C   B C6    1 
ATOM   1492  P  P     . U   A  1  74   ? 249.710 255.716 168.441 1.00 50.00  ? 74   U   B P     1 
ATOM   1493  O  OP1   . U   A  1  74   ? 248.564 254.887 168.892 1.00 50.00  ? 74   U   B OP1   1 
ATOM   1494  O  OP2   . U   A  1  74   ? 249.841 256.068 167.003 1.00 50.00  ? 74   U   B OP2   1 
ATOM   1495  O  "O5'" . U   A  1  74   ? 249.698 257.069 169.281 1.00 50.00  ? 74   U   B "O5'" 1 
ATOM   1496  C  "C5'" . U   A  1  74   ? 249.563 257.055 170.695 1.00 50.00  ? 74   U   B "C5'" 1 
ATOM   1497  C  "C4'" . U   A  1  74   ? 249.717 258.436 171.279 1.00 50.00  ? 74   U   B "C4'" 1 
ATOM   1498  O  "O4'" . U   A  1  74   ? 251.031 258.959 170.952 1.00 50.00  ? 74   U   B "O4'" 1 
ATOM   1499  C  "C3'" . U   A  1  74   ? 248.754 259.491 170.754 1.00 50.00  ? 74   U   B "C3'" 1 
ATOM   1500  O  "O3'" . U   A  1  74   ? 247.494 259.453 171.401 1.00 50.00  ? 74   U   B "O3'" 1 
ATOM   1501  C  "C2'" . U   A  1  74   ? 249.517 260.789 170.986 1.00 50.00  ? 74   U   B "C2'" 1 
ATOM   1502  O  "O2'" . U   A  1  74   ? 249.410 261.198 172.341 1.00 50.00  ? 74   U   B "O2'" 1 
ATOM   1503  C  "C1'" . U   A  1  74   ? 250.958 260.350 170.725 1.00 50.00  ? 74   U   B "C1'" 1 
ATOM   1504  N  N1    . U   A  1  74   ? 251.398 260.623 169.337 1.00 50.00  ? 74   U   B N1    1 
ATOM   1505  C  C2    . U   A  1  74   ? 251.661 261.931 168.965 1.00 50.00  ? 74   U   B C2    1 
ATOM   1506  O  O2    . U   A  1  74   ? 251.533 262.881 169.718 1.00 50.00  ? 74   U   B O2    1 
ATOM   1507  N  N3    . U   A  1  74   ? 252.073 262.090 167.665 1.00 50.00  ? 74   U   B N3    1 
ATOM   1508  C  C4    . U   A  1  74   ? 252.257 261.100 166.721 1.00 50.00  ? 74   U   B C4    1 
ATOM   1509  O  O4    . U   A  1  74   ? 252.634 261.402 165.588 1.00 50.00  ? 74   U   B O4    1 
ATOM   1510  C  C5    . U   A  1  74   ? 251.971 259.776 167.183 1.00 50.00  ? 74   U   B C5    1 
ATOM   1511  C  C6    . U   A  1  74   ? 251.567 259.592 168.444 1.00 50.00  ? 74   U   B C6    1 
ATOM   1512  P  P     . G   A  1  75   ? 246.139 259.654 170.560 1.00 50.00  ? 75   G   B P     1 
ATOM   1513  O  OP1   . G   A  1  75   ? 245.013 259.140 171.378 1.00 50.00  ? 75   G   B OP1   1 
ATOM   1514  O  OP2   . G   A  1  75   ? 246.365 259.116 169.195 1.00 50.00  ? 75   G   B OP2   1 
ATOM   1515  O  "O5'" . G   A  1  75   ? 245.986 261.236 170.444 1.00 50.00  ? 75   G   B "O5'" 1 
ATOM   1516  C  "C5'" . G   A  1  75   ? 245.870 262.050 171.603 1.00 50.00  ? 75   G   B "C5'" 1 
ATOM   1517  C  "C4'" . G   A  1  75   ? 246.249 263.480 171.305 1.00 50.00  ? 75   G   B "C4'" 1 
ATOM   1518  O  "O4'" . G   A  1  75   ? 247.623 263.525 170.836 1.00 50.00  ? 75   G   B "O4'" 1 
ATOM   1519  C  "C3'" . G   A  1  75   ? 245.450 264.157 170.200 1.00 50.00  ? 75   G   B "C3'" 1 
ATOM   1520  O  "O3'" . G   A  1  75   ? 244.220 264.692 170.656 1.00 50.00  ? 75   G   B "O3'" 1 
ATOM   1521  C  "C2'" . G   A  1  75   ? 246.420 265.210 169.681 1.00 50.00  ? 75   G   B "C2'" 1 
ATOM   1522  O  "O2'" . G   A  1  75   ? 246.449 266.335 170.548 1.00 50.00  ? 75   G   B "O2'" 1 
ATOM   1523  C  "C1'" . G   A  1  75   ? 247.751 264.476 169.801 1.00 50.00  ? 75   G   B "C1'" 1 
ATOM   1524  N  N9    . G   A  1  75   ? 248.096 263.753 168.563 1.00 50.00  ? 75   G   B N9    1 
ATOM   1525  C  C8    . G   A  1  75   ? 248.024 262.392 168.384 1.00 50.00  ? 75   G   B C8    1 
ATOM   1526  N  N7    . G   A  1  75   ? 248.388 262.010 167.195 1.00 50.00  ? 75   G   B N7    1 
ATOM   1527  C  C5    . G   A  1  75   ? 248.723 263.189 166.548 1.00 50.00  ? 75   G   B C5    1 
ATOM   1528  C  C6    . G   A  1  75   ? 249.189 263.397 165.229 1.00 50.00  ? 75   G   B C6    1 
ATOM   1529  O  O6    . G   A  1  75   ? 249.401 262.550 164.356 1.00 50.00  ? 75   G   B O6    1 
ATOM   1530  N  N1    . G   A  1  75   ? 249.410 264.746 164.972 1.00 50.00  ? 75   G   B N1    1 
ATOM   1531  C  C2    . G   A  1  75   ? 249.205 265.770 165.868 1.00 50.00  ? 75   G   B C2    1 
ATOM   1532  N  N2    . G   A  1  75   ? 249.473 267.013 165.439 1.00 50.00  ? 75   G   B N2    1 
ATOM   1533  N  N3    . G   A  1  75   ? 248.770 265.584 167.105 1.00 50.00  ? 75   G   B N3    1 
ATOM   1534  C  C4    . G   A  1  75   ? 248.551 264.279 167.376 1.00 50.00  ? 75   G   B C4    1 
ATOM   1535  P  P     . A   A  1  76   ? 242.963 264.802 169.661 1.00 50.00  ? 76   A   B P     1 
ATOM   1536  O  OP1   . A   A  1  76   ? 241.770 265.170 170.467 1.00 50.00  ? 76   A   B OP1   1 
ATOM   1537  O  OP2   . A   A  1  76   ? 242.934 263.576 168.824 1.00 50.00  ? 76   A   B OP2   1 
ATOM   1538  O  "O5'" . A   A  1  76   ? 243.320 266.036 168.719 1.00 50.00  ? 76   A   B "O5'" 1 
ATOM   1539  C  "C5'" . A   A  1  76   ? 243.492 267.342 169.252 1.00 50.00  ? 76   A   B "C5'" 1 
ATOM   1540  C  "C4'" . A   A  1  76   ? 244.129 268.266 168.245 1.00 50.00  ? 76   A   B "C4'" 1 
ATOM   1541  O  "O4'" . A   A  1  76   ? 245.429 267.745 167.861 1.00 50.00  ? 76   A   B "O4'" 1 
ATOM   1542  C  "C3'" . A   A  1  76   ? 243.385 268.425 166.928 1.00 50.00  ? 76   A   B "C3'" 1 
ATOM   1543  O  "O3'" . A   A  1  76   ? 242.332 269.370 167.001 1.00 50.00  ? 76   A   B "O3'" 1 
ATOM   1544  C  "C2'" . A   A  1  76   ? 244.494 268.816 165.961 1.00 50.00  ? 76   A   B "C2'" 1 
ATOM   1545  O  "O2'" . A   A  1  76   ? 244.823 270.190 166.105 1.00 50.00  ? 76   A   B "O2'" 1 
ATOM   1546  C  "C1'" . A   A  1  76   ? 245.659 267.982 166.489 1.00 50.00  ? 76   A   B "C1'" 1 
ATOM   1547  N  N9    . A   A  1  76   ? 245.760 266.676 165.808 1.00 50.00  ? 76   A   B N9    1 
ATOM   1548  C  C8    . A   A  1  76   ? 245.486 265.444 166.347 1.00 50.00  ? 76   A   B C8    1 
ATOM   1549  N  N7    . A   A  1  76   ? 245.663 264.450 165.514 1.00 50.00  ? 76   A   B N7    1 
ATOM   1550  C  C5    . A   A  1  76   ? 246.084 265.070 164.347 1.00 50.00  ? 76   A   B C5    1 
ATOM   1551  C  C6    . A   A  1  76   ? 246.435 264.558 163.087 1.00 50.00  ? 76   A   B C6    1 
ATOM   1552  N  N6    . A   A  1  76   ? 246.416 263.258 162.795 1.00 50.00  ? 76   A   B N6    1 
ATOM   1553  N  N1    . A   A  1  76   ? 246.812 265.436 162.132 1.00 50.00  ? 76   A   B N1    1 
ATOM   1554  C  C2    . A   A  1  76   ? 246.825 266.742 162.435 1.00 50.00  ? 76   A   B C2    1 
ATOM   1555  N  N3    . A   A  1  76   ? 246.517 267.344 163.583 1.00 50.00  ? 76   A   B N3    1 
ATOM   1556  C  C4    . A   A  1  76   ? 246.150 266.441 164.511 1.00 50.00  ? 76   A   B C4    1 
ATOM   1557  P  P     . G   A  1  77   ? 240.993 269.165 166.134 1.00 50.00  ? 77   G   B P     1 
ATOM   1558  O  OP1   . G   A  1  77   ? 239.954 270.079 166.669 1.00 50.00  ? 77   G   B OP1   1 
ATOM   1559  O  OP2   . G   A  1  77   ? 240.720 267.707 166.053 1.00 50.00  ? 77   G   B OP2   1 
ATOM   1560  O  "O5'" . G   A  1  77   ? 241.395 269.671 164.678 1.00 50.00  ? 77   G   B "O5'" 1 
ATOM   1561  C  "C5'" . G   A  1  77   ? 241.858 270.997 164.467 1.00 50.00  ? 77   G   B "C5'" 1 
ATOM   1562  C  "C4'" . G   A  1  77   ? 242.509 271.141 163.115 1.00 50.00  ? 77   G   B "C4'" 1 
ATOM   1563  O  "O4'" . G   A  1  77   ? 243.658 270.256 163.034 1.00 50.00  ? 77   G   B "O4'" 1 
ATOM   1564  C  "C3'" . G   A  1  77   ? 241.651 270.746 161.923 1.00 50.00  ? 77   G   B "C3'" 1 
ATOM   1565  O  "O3'" . G   A  1  77   ? 240.770 271.777 161.513 1.00 50.00  ? 77   G   B "O3'" 1 
ATOM   1566  C  "C2'" . G   A  1  77   ? 242.689 270.378 160.871 1.00 50.00  ? 77   G   B "C2'" 1 
ATOM   1567  O  "O2'" . G   A  1  77   ? 243.235 271.543 160.274 1.00 50.00  ? 77   G   B "O2'" 1 
ATOM   1568  C  "C1'" . G   A  1  77   ? 243.770 269.724 161.733 1.00 50.00  ? 77   G   B "C1'" 1 
ATOM   1569  N  N9    . G   A  1  77   ? 243.605 268.261 161.815 1.00 50.00  ? 77   G   B N9    1 
ATOM   1570  C  C8    . G   A  1  77   ? 243.210 267.535 162.913 1.00 50.00  ? 77   G   B C8    1 
ATOM   1571  N  N7    . G   A  1  77   ? 243.157 266.253 162.688 1.00 50.00  ? 77   G   B N7    1 
ATOM   1572  C  C5    . G   A  1  77   ? 243.539 266.121 161.360 1.00 50.00  ? 77   G   B C5    1 
ATOM   1573  C  C6    . G   A  1  77   ? 243.671 264.963 160.555 1.00 50.00  ? 77   G   B C6    1 
ATOM   1574  O  O6    . G   A  1  77   ? 243.467 263.784 160.863 1.00 50.00  ? 77   G   B O6    1 
ATOM   1575  N  N1    . G   A  1  77   ? 244.084 265.280 159.264 1.00 50.00  ? 77   G   B N1    1 
ATOM   1576  C  C2    . G   A  1  77   ? 244.341 266.550 158.806 1.00 50.00  ? 77   G   B C2    1 
ATOM   1577  N  N2    . G   A  1  77   ? 244.731 266.667 157.529 1.00 50.00  ? 77   G   B N2    1 
ATOM   1578  N  N3    . G   A  1  77   ? 244.223 267.637 159.550 1.00 50.00  ? 77   G   B N3    1 
ATOM   1579  C  C4    . G   A  1  77   ? 243.820 267.351 160.806 1.00 50.00  ? 77   G   B C4    1 
ATOM   1580  P  P     . U   A  1  78   ? 239.187 271.505 161.420 1.00 50.00  ? 78   U   B P     1 
ATOM   1581  O  OP1   . U   A  1  78   ? 238.495 272.820 161.435 1.00 50.00  ? 78   U   B OP1   1 
ATOM   1582  O  OP2   . U   A  1  78   ? 238.838 270.481 162.435 1.00 50.00  ? 78   U   B OP2   1 
ATOM   1583  O  "O5'" . U   A  1  78   ? 238.985 270.859 159.976 1.00 50.00  ? 78   U   B "O5'" 1 
ATOM   1584  C  "C5'" . U   A  1  78   ? 239.117 269.458 159.779 1.00 50.00  ? 78   U   B "C5'" 1 
ATOM   1585  C  "C4'" . U   A  1  78   ? 238.688 269.049 158.393 1.00 50.00  ? 78   U   B "C4'" 1 
ATOM   1586  O  "O4'" . U   A  1  78   ? 237.309 269.447 158.176 1.00 50.00  ? 78   U   B "O4'" 1 
ATOM   1587  C  "C3'" . U   A  1  78   ? 239.446 269.695 157.241 1.00 50.00  ? 78   U   B "C3'" 1 
ATOM   1588  O  "O3'" . U   A  1  78   ? 240.707 269.098 156.948 1.00 50.00  ? 78   U   B "O3'" 1 
ATOM   1589  C  "C2'" . U   A  1  78   ? 238.446 269.624 156.094 1.00 50.00  ? 78   U   B "C2'" 1 
ATOM   1590  O  "O2'" . U   A  1  78   ? 238.441 268.331 155.511 1.00 50.00  ? 78   U   B "O2'" 1 
ATOM   1591  C  "C1'" . U   A  1  78   ? 237.121 269.829 156.829 1.00 50.00  ? 78   U   B "C1'" 1 
ATOM   1592  N  N1    . U   A  1  78   ? 236.672 271.240 156.791 1.00 50.00  ? 78   U   B N1    1 
ATOM   1593  C  C2    . U   A  1  78   ? 235.990 271.663 155.665 1.00 50.00  ? 78   U   B C2    1 
ATOM   1594  O  O2    . U   A  1  78   ? 235.752 270.929 154.721 1.00 50.00  ? 78   U   B O2    1 
ATOM   1595  N  N3    . U   A  1  78   ? 235.597 272.978 155.685 1.00 50.00  ? 78   U   B N3    1 
ATOM   1596  C  C4    . U   A  1  78   ? 235.811 273.895 156.692 1.00 50.00  ? 78   U   B C4    1 
ATOM   1597  O  O4    . U   A  1  78   ? 235.395 275.048 156.562 1.00 50.00  ? 78   U   B O4    1 
ATOM   1598  C  C5    . U   A  1  78   ? 236.523 273.381 157.823 1.00 50.00  ? 78   U   B C5    1 
ATOM   1599  C  C6    . U   A  1  78   ? 236.918 272.104 157.833 1.00 50.00  ? 78   U   B C6    1 
ATOM   1600  P  P     . C   A  1  79   ? 241.034 267.544 157.240 1.00 50.00  ? 79   C   B P     1 
ATOM   1601  O  OP1   . C   A  1  79   ? 241.218 267.332 158.698 1.00 50.00  ? 79   C   B OP1   1 
ATOM   1602  O  OP2   . C   A  1  79   ? 242.152 267.180 156.332 1.00 50.00  ? 79   C   B OP2   1 
ATOM   1603  O  "O5'" . C   A  1  79   ? 239.757 266.737 156.731 1.00 50.00  ? 79   C   B "O5'" 1 
ATOM   1604  C  "C5'" . C   A  1  79   ? 239.909 265.558 155.948 1.00 50.00  ? 79   C   B "C5'" 1 
ATOM   1605  C  "C4'" . C   A  1  79   ? 239.087 264.411 156.483 1.00 50.00  ? 79   C   B "C4'" 1 
ATOM   1606  O  "O4'" . C   A  1  79   ? 239.600 263.984 157.769 1.00 50.00  ? 79   C   B "O4'" 1 
ATOM   1607  C  "C3'" . C   A  1  79   ? 237.615 264.693 156.748 1.00 50.00  ? 79   C   B "C3'" 1 
ATOM   1608  O  "O3'" . C   A  1  79   ? 236.829 264.644 155.571 1.00 50.00  ? 79   C   B "O3'" 1 
ATOM   1609  C  "C2'" . C   A  1  79   ? 237.247 263.617 157.763 1.00 50.00  ? 79   C   B "C2'" 1 
ATOM   1610  O  "O2'" . C   A  1  79   ? 236.999 262.378 157.115 1.00 50.00  ? 79   C   B "O2'" 1 
ATOM   1611  C  "C1'" . C   A  1  79   ? 238.544 263.492 158.568 1.00 50.00  ? 79   C   B "C1'" 1 
ATOM   1612  N  N1    . C   A  1  79   ? 238.500 264.254 159.837 1.00 50.00  ? 79   C   B N1    1 
ATOM   1613  C  C2    . C   A  1  79   ? 237.901 263.660 160.952 1.00 50.00  ? 79   C   B C2    1 
ATOM   1614  O  O2    . C   A  1  79   ? 237.426 262.518 160.842 1.00 50.00  ? 79   C   B O2    1 
ATOM   1615  N  N3    . C   A  1  79   ? 237.855 264.339 162.120 1.00 50.00  ? 79   C   B N3    1 
ATOM   1616  C  C4    . C   A  1  79   ? 238.376 265.564 162.200 1.00 50.00  ? 79   C   B C4    1 
ATOM   1617  N  N4    . C   A  1  79   ? 238.308 266.199 163.372 1.00 50.00  ? 79   C   B N4    1 
ATOM   1618  C  C5    . C   A  1  79   ? 238.993 266.193 161.081 1.00 50.00  ? 79   C   B C5    1 
ATOM   1619  C  C6    . C   A  1  79   ? 239.032 265.509 159.931 1.00 50.00  ? 79   C   B C6    1 
ATOM   1620  P  P     . U   A  1  80   ? 236.036 265.946 155.064 1.00 50.00  ? 80   U   B P     1 
ATOM   1621  O  OP1   . U   A  1  80   ? 237.036 266.966 154.662 1.00 50.00  ? 80   U   B OP1   1 
ATOM   1622  O  OP2   . U   A  1  80   ? 235.000 266.283 156.071 1.00 50.00  ? 80   U   B OP2   1 
ATOM   1623  O  "O5'" . U   A  1  80   ? 235.304 265.455 153.739 1.00 50.00  ? 80   U   B "O5'" 1 
ATOM   1624  C  "C5'" . U   A  1  80   ? 236.006 264.699 152.759 1.00 50.00  ? 80   U   B "C5'" 1 
ATOM   1625  C  "C4'" . U   A  1  80   ? 235.127 264.349 151.586 1.00 50.00  ? 80   U   B "C4'" 1 
ATOM   1626  O  "O4'" . U   A  1  80   ? 234.838 265.557 150.829 1.00 50.00  ? 80   U   B "O4'" 1 
ATOM   1627  C  "C3'" . U   A  1  80   ? 235.731 263.359 150.593 1.00 50.00  ? 80   U   B "C3'" 1 
ATOM   1628  O  "O3'" . U   A  1  80   ? 234.692 262.552 150.046 1.00 50.00  ? 80   U   B "O3'" 1 
ATOM   1629  C  "C2'" . U   A  1  80   ? 236.292 264.271 149.510 1.00 50.00  ? 80   U   B "C2'" 1 
ATOM   1630  O  "O2'" . U   A  1  80   ? 236.432 263.664 148.244 1.00 50.00  ? 80   U   B "O2'" 1 
ATOM   1631  C  "C1'" . U   A  1  80   ? 235.257 265.392 149.487 1.00 50.00  ? 80   U   B "C1'" 1 
ATOM   1632  N  N1    . U   A  1  80   ? 235.780 266.678 149.008 1.00 50.00  ? 80   U   B N1    1 
ATOM   1633  C  C2    . U   A  1  80   ? 235.249 267.199 147.843 1.00 50.00  ? 80   U   B C2    1 
ATOM   1634  O  O2    . U   A  1  80   ? 234.371 266.639 147.210 1.00 50.00  ? 80   U   B O2    1 
ATOM   1635  N  N3    . U   A  1  80   ? 235.780 268.401 147.451 1.00 50.00  ? 80   U   B N3    1 
ATOM   1636  C  C4    . U   A  1  80   ? 236.772 269.119 148.090 1.00 50.00  ? 80   U   B C4    1 
ATOM   1637  O  O4    . U   A  1  80   ? 237.148 270.190 147.611 1.00 50.00  ? 80   U   B O4    1 
ATOM   1638  C  C5    . U   A  1  80   ? 237.270 268.512 149.285 1.00 50.00  ? 80   U   B C5    1 
ATOM   1639  C  C6    . U   A  1  80   ? 236.770 267.343 149.694 1.00 50.00  ? 80   U   B C6    1 
ATOM   1640  P  P     . U   A  1  81   ? 234.411 261.087 150.643 1.00 50.00  ? 81   U   B P     1 
ATOM   1641  O  OP1   . U   A  1  81   ? 233.386 261.213 151.709 1.00 50.00  ? 81   U   B OP1   1 
ATOM   1642  O  OP2   . U   A  1  81   ? 235.718 260.454 150.953 1.00 50.00  ? 81   U   B OP2   1 
ATOM   1643  O  "O5'" . U   A  1  81   ? 233.760 260.299 149.422 1.00 50.00  ? 81   U   B "O5'" 1 
ATOM   1644  C  "C5'" . U   A  1  81   ? 234.215 260.513 148.095 1.00 50.00  ? 81   U   B "C5'" 1 
ATOM   1645  C  "C4'" . U   A  1  81   ? 234.043 259.277 147.250 1.00 50.00  ? 81   U   B "C4'" 1 
ATOM   1646  O  "O4'" . U   A  1  81   ? 234.893 258.217 147.759 1.00 50.00  ? 81   U   B "O4'" 1 
ATOM   1647  C  "C3'" . U   A  1  81   ? 232.648 258.668 147.249 1.00 50.00  ? 81   U   B "C3'" 1 
ATOM   1648  O  "O3'" . U   A  1  81   ? 231.765 259.323 146.355 1.00 50.00  ? 81   U   B "O3'" 1 
ATOM   1649  C  "C2'" . U   A  1  81   ? 232.922 257.212 146.894 1.00 50.00  ? 81   U   B "C2'" 1 
ATOM   1650  O  "O2'" . U   A  1  81   ? 233.138 257.068 145.497 1.00 50.00  ? 81   U   B "O2'" 1 
ATOM   1651  C  "C1'" . U   A  1  81   ? 234.249 256.969 147.615 1.00 50.00  ? 81   U   B "C1'" 1 
ATOM   1652  N  N1    . U   A  1  81   ? 234.059 256.380 148.961 1.00 50.00  ? 81   U   B N1    1 
ATOM   1653  C  C2    . U   A  1  81   ? 233.796 255.025 149.049 1.00 50.00  ? 81   U   B C2    1 
ATOM   1654  O  O2    . U   A  1  81   ? 233.705 254.302 148.072 1.00 50.00  ? 81   U   B O2    1 
ATOM   1655  N  N3    . U   A  1  81   ? 233.635 254.547 150.326 1.00 50.00  ? 81   U   B N3    1 
ATOM   1656  C  C4    . U   A  1  81   ? 233.715 255.266 151.501 1.00 50.00  ? 81   U   B C4    1 
ATOM   1657  O  O4    . U   A  1  81   ? 233.547 254.689 152.577 1.00 50.00  ? 81   U   B O4    1 
ATOM   1658  C  C5    . U   A  1  81   ? 233.995 256.658 151.329 1.00 50.00  ? 81   U   B C5    1 
ATOM   1659  C  C6    . U   A  1  81   ? 234.155 257.152 150.095 1.00 50.00  ? 81   U   B C6    1 
ATOM   1660  P  P     . A   A  1  82   ? 230.255 258.803 146.174 1.00 50.00  ? 82   A   B P     1 
ATOM   1661  O  OP1   . A   A  1  82   ? 229.430 259.953 145.720 1.00 50.00  ? 82   A   B OP1   1 
ATOM   1662  O  OP2   . A   A  1  82   ? 229.859 258.060 147.396 1.00 50.00  ? 82   A   B OP2   1 
ATOM   1663  O  "O5'" . A   A  1  82   ? 230.355 257.768 144.969 1.00 50.00  ? 82   A   B "O5'" 1 
ATOM   1664  C  "C5'" . A   A  1  82   ? 229.352 256.778 144.763 1.00 50.00  ? 82   A   B "C5'" 1 
ATOM   1665  C  "C4'" . A   A  1  82   ? 229.585 256.016 143.484 1.00 50.00  ? 82   A   B "C4'" 1 
ATOM   1666  O  "O4'" . A   A  1  82   ? 230.987 255.632 143.406 1.00 50.00  ? 82   A   B "O4'" 1 
ATOM   1667  C  "C3'" . A   A  1  82   ? 228.782 254.727 143.333 1.00 50.00  ? 82   A   B "C3'" 1 
ATOM   1668  O  "O3'" . A   A  1  82   ? 228.464 254.525 141.959 1.00 50.00  ? 82   A   B "O3'" 1 
ATOM   1669  C  "C2'" . A   A  1  82   ? 229.775 253.661 143.789 1.00 50.00  ? 82   A   B "C2'" 1 
ATOM   1670  O  "O2'" . A   A  1  82   ? 229.522 252.368 143.283 1.00 50.00  ? 82   A   B "O2'" 1 
ATOM   1671  C  "C1'" . A   A  1  82   ? 231.090 254.230 143.267 1.00 50.00  ? 82   A   B "C1'" 1 
ATOM   1672  N  N9    . A   A  1  82   ? 232.269 253.782 144.013 1.00 50.00  ? 82   A   B N9    1 
ATOM   1673  C  C8    . A   A  1  82   ? 232.311 252.966 145.117 1.00 50.00  ? 82   A   B C8    1 
ATOM   1674  N  N7    . A   A  1  82   ? 233.524 252.742 145.562 1.00 50.00  ? 82   A   B N7    1 
ATOM   1675  C  C5    . A   A  1  82   ? 234.336 253.455 144.691 1.00 50.00  ? 82   A   B C5    1 
ATOM   1676  C  C6    . A   A  1  82   ? 235.730 253.627 144.620 1.00 50.00  ? 82   A   B C6    1 
ATOM   1677  N  N6    . A   A  1  82   ? 236.589 253.069 145.476 1.00 50.00  ? 82   A   B N6    1 
ATOM   1678  N  N1    . A   A  1  82   ? 236.219 254.403 143.630 1.00 50.00  ? 82   A   B N1    1 
ATOM   1679  C  C2    . A   A  1  82   ? 235.358 254.964 142.771 1.00 50.00  ? 82   A   B C2    1 
ATOM   1680  N  N3    . A   A  1  82   ? 234.030 254.878 142.734 1.00 50.00  ? 82   A   B N3    1 
ATOM   1681  C  C4    . A   A  1  82   ? 233.577 254.099 143.732 1.00 50.00  ? 82   A   B C4    1 
ATOM   1682  P  P     . A   A  1  83   ? 227.000 254.018 141.533 1.00 50.00  ? 83   A   B P     1 
ATOM   1683  O  OP1   . A   A  1  83   ? 226.596 254.749 140.304 1.00 50.00  ? 83   A   B OP1   1 
ATOM   1684  O  OP2   . A   A  1  83   ? 226.129 254.067 142.735 1.00 50.00  ? 83   A   B OP2   1 
ATOM   1685  O  "O5'" . A   A  1  83   ? 227.221 252.488 141.151 1.00 50.00  ? 83   A   B "O5'" 1 
ATOM   1686  C  "C5'" . A   A  1  83   ? 226.133 251.578 141.111 1.00 50.00  ? 83   A   B "C5'" 1 
ATOM   1687  C  "C4'" . A   A  1  83   ? 226.590 250.163 141.350 1.00 50.00  ? 83   A   B "C4'" 1 
ATOM   1688  O  "O4'" . A   A  1  83   ? 227.270 250.078 142.630 1.00 50.00  ? 83   A   B "O4'" 1 
ATOM   1689  C  "C3'" . A   A  1  83   ? 225.491 249.116 141.448 1.00 50.00  ? 83   A   B "C3'" 1 
ATOM   1690  O  "O3'" . A   A  1  83   ? 225.029 248.684 140.179 1.00 50.00  ? 83   A   B "O3'" 1 
ATOM   1691  C  "C2'" . A   A  1  83   ? 226.146 248.015 142.268 1.00 50.00  ? 83   A   B "C2'" 1 
ATOM   1692  O  "O2'" . A   A  1  83   ? 227.005 247.226 141.456 1.00 50.00  ? 83   A   B "O2'" 1 
ATOM   1693  C  "C1'" . A   A  1  83   ? 227.011 248.828 143.234 1.00 50.00  ? 83   A   B "C1'" 1 
ATOM   1694  N  N9    . A   A  1  83   ? 226.338 249.059 144.529 1.00 50.00  ? 83   A   B N9    1 
ATOM   1695  C  C8    . A   A  1  83   ? 224.999 248.975 144.820 1.00 50.00  ? 83   A   B C8    1 
ATOM   1696  N  N7    . A   A  1  83   ? 224.712 249.238 146.072 1.00 50.00  ? 83   A   B N7    1 
ATOM   1697  C  C5    . A   A  1  83   ? 225.944 249.514 146.645 1.00 50.00  ? 83   A   B C5    1 
ATOM   1698  C  C6    . A   A  1  83   ? 226.324 249.866 147.953 1.00 50.00  ? 83   A   B C6    1 
ATOM   1699  N  N6    . A   A  1  83   ? 225.461 250.007 148.963 1.00 50.00  ? 83   A   B N6    1 
ATOM   1700  N  N1    . A   A  1  83   ? 227.637 250.073 148.193 1.00 50.00  ? 83   A   B N1    1 
ATOM   1701  C  C2    . A   A  1  83   ? 228.503 249.931 147.181 1.00 50.00  ? 83   A   B C2    1 
ATOM   1702  N  N3    . A   A  1  83   ? 228.268 249.605 145.912 1.00 50.00  ? 83   A   B N3    1 
ATOM   1703  C  C4    . A   A  1  83   ? 226.956 249.406 145.708 1.00 50.00  ? 83   A   B C4    1 
ATOM   1704  P  P     . C   A  1  84   ? 223.525 249.007 139.716 1.00 50.00  ? 84   C   B P     1 
ATOM   1705  O  OP1   . C   A  1  84   ? 223.226 248.187 138.514 1.00 50.00  ? 84   C   B OP1   1 
ATOM   1706  O  OP2   . C   A  1  84   ? 223.368 250.482 139.655 1.00 50.00  ? 84   C   B OP2   1 
ATOM   1707  O  "O5'" . C   A  1  84   ? 222.631 248.467 140.916 1.00 50.00  ? 84   C   B "O5'" 1 
ATOM   1708  C  "C5'" . C   A  1  84   ? 221.267 248.841 141.037 1.00 50.00  ? 84   C   B "C5'" 1 
ATOM   1709  C  "C4'" . C   A  1  84   ? 220.691 248.398 142.358 1.00 50.00  ? 84   C   B "C4'" 1 
ATOM   1710  O  "O4'" . C   A  1  84   ? 221.567 248.809 143.438 1.00 50.00  ? 84   C   B "O4'" 1 
ATOM   1711  C  "C3'" . C   A  1  84   ? 219.343 248.997 142.728 1.00 50.00  ? 84   C   B "C3'" 1 
ATOM   1712  O  "O3'" . C   A  1  84   ? 218.255 248.338 142.103 1.00 50.00  ? 84   C   B "O3'" 1 
ATOM   1713  C  "C2'" . C   A  1  84   ? 219.334 248.887 144.248 1.00 50.00  ? 84   C   B "C2'" 1 
ATOM   1714  O  "O2'" . C   A  1  84   ? 219.006 247.567 144.656 1.00 50.00  ? 84   C   B "O2'" 1 
ATOM   1715  C  "C1'" . C   A  1  84   ? 220.807 249.143 144.579 1.00 50.00  ? 84   C   B "C1'" 1 
ATOM   1716  N  N1    . C   A  1  84   ? 221.070 250.558 144.928 1.00 50.00  ? 84   C   B N1    1 
ATOM   1717  C  C2    . C   A  1  84   ? 220.797 250.999 146.227 1.00 50.00  ? 84   C   B C2    1 
ATOM   1718  O  O2    . C   A  1  84   ? 220.337 250.194 147.051 1.00 50.00  ? 84   C   B O2    1 
ATOM   1719  N  N3    . C   A  1  84   ? 221.039 252.289 146.553 1.00 50.00  ? 84   C   B N3    1 
ATOM   1720  C  C4    . C   A  1  84   ? 221.534 253.128 145.643 1.00 50.00  ? 84   C   B C4    1 
ATOM   1721  N  N4    . C   A  1  84   ? 221.757 254.392 146.010 1.00 50.00  ? 84   C   B N4    1 
ATOM   1722  C  C5    . C   A  1  84   ? 221.825 252.707 144.313 1.00 50.00  ? 84   C   B C5    1 
ATOM   1723  C  C6    . C   A  1  84   ? 221.581 251.427 144.003 1.00 50.00  ? 84   C   B C6    1 
ATOM   1724  P  P     . C   A  1  85   ? 216.870 249.116 141.861 1.00 50.00  ? 85   C   B P     1 
ATOM   1725  O  OP1   . C   A  1  85   ? 216.024 248.285 140.969 1.00 50.00  ? 85   C   B OP1   1 
ATOM   1726  O  OP2   . C   A  1  85   ? 217.188 250.515 141.479 1.00 50.00  ? 85   C   B OP2   1 
ATOM   1727  O  "O5'" . C   A  1  85   ? 216.192 249.142 143.303 1.00 50.00  ? 85   C   B "O5'" 1 
ATOM   1728  C  "C5'" . C   A  1  85   ? 215.193 250.097 143.622 1.00 50.00  ? 85   C   B "C5'" 1 
ATOM   1729  C  "C4'" . C   A  1  85   ? 215.207 250.436 145.091 1.00 50.00  ? 85   C   B "C4'" 1 
ATOM   1730  O  "O4'" . C   A  1  85   ? 216.565 250.735 145.509 1.00 50.00  ? 85   C   B "O4'" 1 
ATOM   1731  C  "C3'" . C   A  1  85   ? 214.415 251.669 145.500 1.00 50.00  ? 85   C   B "C3'" 1 
ATOM   1732  O  "O3'" . C   A  1  85   ? 213.028 251.415 145.639 1.00 50.00  ? 85   C   B "O3'" 1 
ATOM   1733  C  "C2'" . C   A  1  85   ? 215.096 252.090 146.796 1.00 50.00  ? 85   C   B "C2'" 1 
ATOM   1734  O  "O2'" . C   A  1  85   ? 214.656 251.284 147.879 1.00 50.00  ? 85   C   B "O2'" 1 
ATOM   1735  C  "C1'" . C   A  1  85   ? 216.556 251.744 146.497 1.00 50.00  ? 85   C   B "C1'" 1 
ATOM   1736  N  N1    . C   A  1  85   ? 217.316 252.911 145.991 1.00 50.00  ? 85   C   B N1    1 
ATOM   1737  C  C2    . C   A  1  85   ? 217.842 253.824 146.908 1.00 50.00  ? 85   C   B C2    1 
ATOM   1738  O  O2    . C   A  1  85   ? 217.655 253.634 148.120 1.00 50.00  ? 85   C   B O2    1 
ATOM   1739  N  N3    . C   A  1  85   ? 218.541 254.891 146.457 1.00 50.00  ? 85   C   B N3    1 
ATOM   1740  C  C4    . C   A  1  85   ? 218.721 255.063 145.145 1.00 50.00  ? 85   C   B C4    1 
ATOM   1741  N  N4    . C   A  1  85   ? 219.417 256.130 144.744 1.00 50.00  ? 85   C   B N4    1 
ATOM   1742  C  C5    . C   A  1  85   ? 218.199 254.149 144.186 1.00 50.00  ? 85   C   B C5    1 
ATOM   1743  C  C6    . C   A  1  85   ? 217.511 253.097 144.649 1.00 50.00  ? 85   C   B C6    1 
ATOM   1744  P  P     . C   A  1  86   ? 211.961 252.576 145.333 1.00 50.00  ? 86   C   B P     1 
ATOM   1745  O  OP1   . C   A  1  86   ? 210.602 252.028 145.570 1.00 50.00  ? 86   C   B OP1   1 
ATOM   1746  O  OP2   . C   A  1  86   ? 212.293 253.172 144.014 1.00 50.00  ? 86   C   B OP2   1 
ATOM   1747  O  "O5'" . C   A  1  86   ? 212.253 253.667 146.456 1.00 50.00  ? 86   C   B "O5'" 1 
ATOM   1748  C  "C5'" . C   A  1  86   ? 211.813 255.007 146.308 1.00 50.00  ? 86   C   B "C5'" 1 
ATOM   1749  C  "C4'" . C   A  1  86   ? 211.930 255.769 147.603 1.00 50.00  ? 86   C   B "C4'" 1 
ATOM   1750  O  "O4'" . C   A  1  86   ? 213.247 255.563 148.175 1.00 50.00  ? 86   C   B "O4'" 1 
ATOM   1751  C  "C3'" . C   A  1  86   ? 211.803 257.281 147.504 1.00 50.00  ? 86   C   B "C3'" 1 
ATOM   1752  O  "O3'" . C   A  1  86   ? 210.459 257.721 147.425 1.00 50.00  ? 86   C   B "O3'" 1 
ATOM   1753  C  "C2'" . C   A  1  86   ? 212.535 257.755 148.752 1.00 50.00  ? 86   C   B "C2'" 1 
ATOM   1754  O  "O2'" . C   A  1  86   ? 211.712 257.612 149.902 1.00 50.00  ? 86   C   B "O2'" 1 
ATOM   1755  C  "C1'" . C   A  1  86   ? 213.670 256.736 148.842 1.00 50.00  ? 86   C   B "C1'" 1 
ATOM   1756  N  N1    . C   A  1  86   ? 214.914 257.225 148.204 1.00 50.00  ? 86   C   B N1    1 
ATOM   1757  C  C2    . C   A  1  86   ? 215.760 258.063 148.937 1.00 50.00  ? 86   C   B C2    1 
ATOM   1758  O  O2    . C   A  1  86   ? 215.443 258.372 150.096 1.00 50.00  ? 86   C   B O2    1 
ATOM   1759  N  N3    . C   A  1  86   ? 216.899 258.518 148.367 1.00 50.00  ? 86   C   B N3    1 
ATOM   1760  C  C4    . C   A  1  86   ? 217.207 258.164 147.118 1.00 50.00  ? 86   C   B C4    1 
ATOM   1761  N  N4    . C   A  1  86   ? 218.341 258.637 146.596 1.00 50.00  ? 86   C   B N4    1 
ATOM   1762  C  C5    . C   A  1  86   ? 216.366 257.311 146.347 1.00 50.00  ? 86   C   B C5    1 
ATOM   1763  C  C6    . C   A  1  86   ? 215.241 256.868 146.925 1.00 50.00  ? 86   C   B C6    1 
ATOM   1764  P  P     . A   A  1  87   ? 210.044 258.857 146.364 1.00 50.00  ? 87   A   B P     1 
ATOM   1765  O  OP1   . A   A  1  87   ? 208.566 258.838 146.227 1.00 50.00  ? 87   A   B OP1   1 
ATOM   1766  O  OP2   . A   A  1  87   ? 210.897 258.692 145.159 1.00 50.00  ? 87   A   B OP2   1 
ATOM   1767  O  "O5'" . A   A  1  87   ? 210.457 260.220 147.077 1.00 50.00  ? 87   A   B "O5'" 1 
ATOM   1768  C  "C5'" . A   A  1  87   ? 209.611 260.819 148.048 1.00 50.00  ? 87   A   B "C5'" 1 
ATOM   1769  C  "C4'" . A   A  1  87   ? 209.901 260.297 149.433 1.00 50.00  ? 87   A   B "C4'" 1 
ATOM   1770  O  "O4'" . A   A  1  87   ? 211.262 260.626 149.807 1.00 50.00  ? 87   A   B "O4'" 1 
ATOM   1771  C  "C3'" . A   A  1  87   ? 209.058 260.882 150.557 1.00 50.00  ? 87   A   B "C3'" 1 
ATOM   1772  O  "O3'" . A   A  1  87   ? 207.780 260.278 150.658 1.00 50.00  ? 87   A   B "O3'" 1 
ATOM   1773  C  "C2'" . A   A  1  87   ? 209.936 260.658 151.782 1.00 50.00  ? 87   A   B "C2'" 1 
ATOM   1774  O  "O2'" . A   A  1  87   ? 209.823 259.319 152.244 1.00 50.00  ? 87   A   B "O2'" 1 
ATOM   1775  C  "C1'" . A   A  1  87   ? 211.337 260.850 151.198 1.00 50.00  ? 87   A   B "C1'" 1 
ATOM   1776  N  N9    . A   A  1  87   ? 211.877 262.203 151.445 1.00 50.00  ? 87   A   B N9    1 
ATOM   1777  C  C8    . A   A  1  87   ? 212.804 262.547 152.400 1.00 50.00  ? 87   A   B C8    1 
ATOM   1778  N  N7    . A   A  1  87   ? 213.110 263.821 152.410 1.00 50.00  ? 87   A   B N7    1 
ATOM   1779  C  C5    . A   A  1  87   ? 212.331 264.357 151.396 1.00 50.00  ? 87   A   B C5    1 
ATOM   1780  C  C6    . A   A  1  87   ? 212.198 265.667 150.905 1.00 50.00  ? 87   A   B C6    1 
ATOM   1781  N  N6    . A   A  1  87   ? 212.874 266.711 151.390 1.00 50.00  ? 87   A   B N6    1 
ATOM   1782  N  N1    . A   A  1  87   ? 211.337 265.874 149.885 1.00 50.00  ? 87   A   B N1    1 
ATOM   1783  C  C2    . A   A  1  87   ? 210.662 264.826 149.398 1.00 50.00  ? 87   A   B C2    1 
ATOM   1784  N  N3    . A   A  1  87   ? 210.702 263.550 149.776 1.00 50.00  ? 87   A   B N3    1 
ATOM   1785  C  C4    . A   A  1  87   ? 211.563 263.376 150.793 1.00 50.00  ? 87   A   B C4    1 
ATOM   1786  P  P     . A   A  1  88   ? 206.457 261.108 150.277 1.00 50.00  ? 88   A   B P     1 
ATOM   1787  O  OP1   . A   A  1  88   ? 205.279 260.275 150.634 1.00 50.00  ? 88   A   B OP1   1 
ATOM   1788  O  OP2   . A   A  1  88   ? 206.605 261.612 148.890 1.00 50.00  ? 88   A   B OP2   1 
ATOM   1789  O  "O5'" . A   A  1  88   ? 206.484 262.359 151.262 1.00 50.00  ? 88   A   B "O5'" 1 
ATOM   1790  C  "C5'" . A   A  1  88   ? 206.380 262.188 152.668 1.00 50.00  ? 88   A   B "C5'" 1 
ATOM   1791  C  "C4'" . A   A  1  88   ? 205.456 263.208 153.281 1.00 50.00  ? 88   A   B "C4'" 1 
ATOM   1792  O  "O4'" . A   A  1  88   ? 204.101 262.988 152.808 1.00 50.00  ? 88   A   B "O4'" 1 
ATOM   1793  C  "C3'" . A   A  1  88   ? 205.328 263.168 154.795 1.00 50.00  ? 88   A   B "C3'" 1 
ATOM   1794  O  "O3'" . A   A  1  88   ? 206.394 263.828 155.457 1.00 50.00  ? 88   A   B "O3'" 1 
ATOM   1795  C  "C2'" . A   A  1  88   ? 203.968 263.810 155.030 1.00 50.00  ? 88   A   B "C2'" 1 
ATOM   1796  O  "O2'" . A   A  1  88   ? 204.052 265.222 154.909 1.00 50.00  ? 88   A   B "O2'" 1 
ATOM   1797  C  "C1'" . A   A  1  88   ? 203.177 263.271 153.838 1.00 50.00  ? 88   A   B "C1'" 1 
ATOM   1798  N  N9    . A   A  1  88   ? 202.462 262.025 154.174 1.00 50.00  ? 88   A   B N9    1 
ATOM   1799  C  C8    . A   A  1  88   ? 202.760 260.749 153.762 1.00 50.00  ? 88   A   B C8    1 
ATOM   1800  N  N7    . A   A  1  88   ? 201.940 259.840 154.226 1.00 50.00  ? 88   A   B N7    1 
ATOM   1801  C  C5    . A   A  1  88   ? 201.040 260.564 154.997 1.00 50.00  ? 88   A   B C5    1 
ATOM   1802  C  C6    . A   A  1  88   ? 199.924 260.180 155.760 1.00 50.00  ? 88   A   B C6    1 
ATOM   1803  N  N6    . A   A  1  88   ? 199.506 258.917 155.875 1.00 50.00  ? 88   A   B N6    1 
ATOM   1804  N  N1    . A   A  1  88   ? 199.242 261.148 156.408 1.00 50.00  ? 88   A   B N1    1 
ATOM   1805  C  C2    . A   A  1  88   ? 199.661 262.416 156.291 1.00 50.00  ? 88   A   B C2    1 
ATOM   1806  N  N3    . A   A  1  88   ? 200.694 262.901 155.606 1.00 50.00  ? 88   A   B N3    1 
ATOM   1807  C  C4    . A   A  1  88   ? 201.350 261.913 154.975 1.00 50.00  ? 88   A   B C4    1 
ATOM   1808  P  P     . U   A  1  89   ? 206.608 263.639 157.038 1.00 50.00  ? 89   U   B P     1 
ATOM   1809  O  OP1   . U   A  1  89   ? 208.067 263.554 157.296 1.00 50.00  ? 89   U   B OP1   1 
ATOM   1810  O  OP2   . U   A  1  89   ? 205.717 262.543 157.498 1.00 50.00  ? 89   U   B OP2   1 
ATOM   1811  O  "O5'" . U   A  1  89   ? 206.074 265.004 157.660 1.00 50.00  ? 89   U   B "O5'" 1 
ATOM   1812  C  "C5'" . U   A  1  89   ? 206.355 266.245 157.032 1.00 50.00  ? 89   U   B "C5'" 1 
ATOM   1813  C  "C4'" . U   A  1  89   ? 207.037 267.202 157.975 1.00 50.00  ? 89   U   B "C4'" 1 
ATOM   1814  O  "O4'" . U   A  1  89   ? 206.118 267.599 159.026 1.00 50.00  ? 89   U   B "O4'" 1 
ATOM   1815  C  "C3'" . U   A  1  89   ? 208.239 266.653 158.726 1.00 50.00  ? 89   U   B "C3'" 1 
ATOM   1816  O  "O3'" . U   A  1  89   ? 209.424 266.662 157.948 1.00 50.00  ? 89   U   B "O3'" 1 
ATOM   1817  C  "C2'" . U   A  1  89   ? 208.306 267.551 159.954 1.00 50.00  ? 89   U   B "C2'" 1 
ATOM   1818  O  "O2'" . U   A  1  89   ? 208.909 268.796 159.634 1.00 50.00  ? 89   U   B "O2'" 1 
ATOM   1819  C  "C1'" . U   A  1  89   ? 206.821 267.793 160.235 1.00 50.00  ? 89   U   B "C1'" 1 
ATOM   1820  N  N1    . U   A  1  89   ? 206.282 266.864 161.254 1.00 50.00  ? 89   U   B N1    1 
ATOM   1821  C  C2    . U   A  1  89   ? 206.496 267.177 162.582 1.00 50.00  ? 89   U   B C2    1 
ATOM   1822  O  O2    . U   A  1  89   ? 207.103 268.172 162.938 1.00 50.00  ? 89   U   B O2    1 
ATOM   1823  N  N3    . U   A  1  89   ? 205.971 266.282 163.480 1.00 50.00  ? 89   U   B N3    1 
ATOM   1824  C  C4    . U   A  1  89   ? 205.268 265.130 163.191 1.00 50.00  ? 89   U   B C4    1 
ATOM   1825  O  O4    . U   A  1  89   ? 204.858 264.423 164.113 1.00 50.00  ? 89   U   B O4    1 
ATOM   1826  C  C5    . U   A  1  89   ? 205.086 264.877 161.795 1.00 50.00  ? 89   U   B C5    1 
ATOM   1827  C  C6    . U   A  1  89   ? 205.587 265.731 160.897 1.00 50.00  ? 89   U   B C6    1 
ATOM   1828  P  P     . U   A  1  90   ? 210.514 265.492 158.116 1.00 50.00  ? 90   U   B P     1 
ATOM   1829  O  OP1   . U   A  1  90   ? 210.691 264.835 156.796 1.00 50.00  ? 90   U   B OP1   1 
ATOM   1830  O  OP2   . U   A  1  90   ? 210.136 264.676 159.297 1.00 50.00  ? 90   U   B OP2   1 
ATOM   1831  O  "O5'" . U   A  1  90   ? 211.858 266.271 158.462 1.00 50.00  ? 90   U   B "O5'" 1 
ATOM   1832  C  "C5'" . U   A  1  90   ? 211.891 267.231 159.507 1.00 50.00  ? 90   U   B "C5'" 1 
ATOM   1833  C  "C4'" . U   A  1  90   ? 212.148 268.617 158.972 1.00 50.00  ? 90   U   B "C4'" 1 
ATOM   1834  O  "O4'" . U   A  1  90   ? 211.843 269.602 159.993 1.00 50.00  ? 90   U   B "O4'" 1 
ATOM   1835  C  "C3'" . U   A  1  90   ? 213.584 268.921 158.580 1.00 50.00  ? 90   U   B "C3'" 1 
ATOM   1836  O  "O3'" . U   A  1  90   ? 213.920 268.428 157.294 1.00 50.00  ? 90   U   B "O3'" 1 
ATOM   1837  C  "C2'" . U   A  1  90   ? 213.643 270.441 158.688 1.00 50.00  ? 90   U   B "C2'" 1 
ATOM   1838  O  "O2'" . U   A  1  90   ? 213.059 271.049 157.545 1.00 50.00  ? 90   U   B "O2'" 1 
ATOM   1839  C  "C1'" . U   A  1  90   ? 212.730 270.695 159.889 1.00 50.00  ? 90   U   B "C1'" 1 
ATOM   1840  N  N1    . U   A  1  90   ? 213.488 270.808 161.156 1.00 50.00  ? 90   U   B N1    1 
ATOM   1841  C  C2    . U   A  1  90   ? 214.041 272.034 161.463 1.00 50.00  ? 90   U   B C2    1 
ATOM   1842  O  O2    . U   A  1  90   ? 213.933 273.007 160.739 1.00 50.00  ? 90   U   B O2    1 
ATOM   1843  N  N3    . U   A  1  90   ? 214.731 272.078 162.649 1.00 50.00  ? 90   U   B N3    1 
ATOM   1844  C  C4    . U   A  1  90   ? 214.917 271.042 163.542 1.00 50.00  ? 90   U   B C4    1 
ATOM   1845  O  O4    . U   A  1  90   ? 215.563 271.238 164.574 1.00 50.00  ? 90   U   B O4    1 
ATOM   1846  C  C5    . U   A  1  90   ? 214.310 269.806 163.154 1.00 50.00  ? 90   U   B C5    1 
ATOM   1847  C  C6    . U   A  1  90   ? 213.634 269.734 162.005 1.00 50.00  ? 90   U   B C6    1 
ATOM   1848  P  P     . U   A  1  91   ? 215.222 267.506 157.100 1.00 50.00  ? 91   U   B P     1 
ATOM   1849  O  OP1   . U   A  1  91   ? 214.887 266.435 156.128 1.00 50.00  ? 91   U   B OP1   1 
ATOM   1850  O  OP2   . U   A  1  91   ? 215.733 267.143 158.447 1.00 50.00  ? 91   U   B OP2   1 
ATOM   1851  O  "O5'" . U   A  1  91   ? 216.281 268.477 156.414 1.00 50.00  ? 91   U   B "O5'" 1 
ATOM   1852  C  "C5'" . U   A  1  91   ? 216.138 268.868 155.057 1.00 50.00  ? 91   U   B "C5'" 1 
ATOM   1853  C  "C4'" . U   A  1  91   ? 215.596 270.270 154.940 1.00 50.00  ? 91   U   B "C4'" 1 
ATOM   1854  O  "O4'" . U   A  1  91   ? 216.282 271.139 155.875 1.00 50.00  ? 91   U   B "O4'" 1 
ATOM   1855  C  "C3'" . U   A  1  91   ? 215.785 270.945 153.589 1.00 50.00  ? 91   U   B "C3'" 1 
ATOM   1856  O  "O3'" . U   A  1  91   ? 214.790 270.569 152.654 1.00 50.00  ? 91   U   B "O3'" 1 
ATOM   1857  C  "C2'" . U   A  1  91   ? 215.755 272.426 153.946 1.00 50.00  ? 91   U   B "C2'" 1 
ATOM   1858  O  "O2'" . U   A  1  91   ? 214.418 272.877 154.106 1.00 50.00  ? 91   U   B "O2'" 1 
ATOM   1859  C  "C1'" . U   A  1  91   ? 216.433 272.427 155.319 1.00 50.00  ? 91   U   B "C1'" 1 
ATOM   1860  N  N1    . U   A  1  91   ? 217.879 272.735 155.238 1.00 50.00  ? 91   U   B N1    1 
ATOM   1861  C  C2    . U   A  1  91   ? 218.258 274.062 155.166 1.00 50.00  ? 91   U   B C2    1 
ATOM   1862  O  O2    . U   A  1  91   ? 217.457 274.980 155.154 1.00 50.00  ? 91   U   B O2    1 
ATOM   1863  N  N3    . U   A  1  91   ? 219.613 274.271 155.104 1.00 50.00  ? 91   U   B N3    1 
ATOM   1864  C  C4    . U   A  1  91   ? 220.606 273.311 155.110 1.00 50.00  ? 91   U   B C4    1 
ATOM   1865  O  O4    . U   A  1  91   ? 221.785 273.657 155.046 1.00 50.00  ? 91   U   B O4    1 
ATOM   1866  C  C5    . U   A  1  91   ? 220.131 271.965 155.190 1.00 50.00  ? 91   U   B C5    1 
ATOM   1867  C  C6    . U   A  1  91   ? 218.818 271.730 155.254 1.00 50.00  ? 91   U   B C6    1 
ATOM   1868  P  P     . U   A  1  92   ? 215.161 270.329 151.108 1.00 50.00  ? 92   U   B P     1 
ATOM   1869  O  OP1   . U   A  1  92   ? 215.604 271.623 150.533 1.00 50.00  ? 92   U   B OP1   1 
ATOM   1870  O  OP2   . U   A  1  92   ? 214.020 269.603 150.491 1.00 50.00  ? 92   U   B OP2   1 
ATOM   1871  O  "O5'" . U   A  1  92   ? 216.428 269.360 151.150 1.00 50.00  ? 92   U   B "O5'" 1 
ATOM   1872  C  "C5'" . U   A  1  92   ? 216.666 268.420 150.112 1.00 50.00  ? 92   U   B "C5'" 1 
ATOM   1873  C  "C4'" . U   A  1  92   ? 216.566 269.053 148.746 1.00 50.00  ? 92   U   B "C4'" 1 
ATOM   1874  O  "O4'" . U   A  1  92   ? 217.772 269.809 148.456 1.00 50.00  ? 92   U   B "O4'" 1 
ATOM   1875  C  "C3'" . U   A  1  92   ? 216.448 268.093 147.572 1.00 50.00  ? 92   U   B "C3'" 1 
ATOM   1876  O  "O3'" . U   A  1  92   ? 215.138 267.581 147.400 1.00 50.00  ? 92   U   B "O3'" 1 
ATOM   1877  C  "C2'" . U   A  1  92   ? 216.938 268.940 146.406 1.00 50.00  ? 92   U   B "C2'" 1 
ATOM   1878  O  "O2'" . U   A  1  92   ? 215.930 269.850 145.989 1.00 50.00  ? 92   U   B "O2'" 1 
ATOM   1879  C  "C1'" . U   A  1  92   ? 218.060 269.738 147.072 1.00 50.00  ? 92   U   B "C1'" 1 
ATOM   1880  N  N1    . U   A  1  92   ? 219.377 269.085 146.893 1.00 50.00  ? 92   U   B N1    1 
ATOM   1881  C  C2    . U   A  1  92   ? 220.020 269.266 145.683 1.00 50.00  ? 92   U   B C2    1 
ATOM   1882  O  O2    . U   A  1  92   ? 219.555 269.937 144.778 1.00 50.00  ? 92   U   B O2    1 
ATOM   1883  N  N3    . U   A  1  92   ? 221.234 268.634 145.571 1.00 50.00  ? 92   U   B N3    1 
ATOM   1884  C  C4    . U   A  1  92   ? 221.857 267.854 146.525 1.00 50.00  ? 92   U   B C4    1 
ATOM   1885  O  O4    . U   A  1  92   ? 222.952 267.352 146.274 1.00 50.00  ? 92   U   B O4    1 
ATOM   1886  C  C5    . U   A  1  92   ? 221.127 267.713 147.746 1.00 50.00  ? 92   U   B C5    1 
ATOM   1887  C  C6    . U   A  1  92   ? 219.943 268.317 147.885 1.00 50.00  ? 92   U   B C6    1 
ATOM   1888  P  P     . U   A  1  93   ? 214.817 266.054 147.788 1.00 50.00  ? 93   U   B P     1 
ATOM   1889  O  OP1   . U   A  1  93   ? 214.751 265.956 149.269 1.00 50.00  ? 93   U   B OP1   1 
ATOM   1890  O  OP2   . U   A  1  93   ? 215.761 265.186 147.039 1.00 50.00  ? 93   U   B OP2   1 
ATOM   1891  O  "O5'" . U   A  1  93   ? 213.355 265.806 147.206 1.00 50.00  ? 93   U   B "O5'" 1 
ATOM   1892  C  "C5'" . U   A  1  93   ? 213.177 265.344 145.870 1.00 50.00  ? 93   U   B "C5'" 1 
ATOM   1893  C  "C4'" . U   A  1  93   ? 212.693 266.445 144.960 1.00 50.00  ? 93   U   B "C4'" 1 
ATOM   1894  O  "O4'" . U   A  1  93   ? 212.779 265.989 143.581 1.00 50.00  ? 93   U   B "O4'" 1 
ATOM   1895  C  "C3'" . U   A  1  93   ? 211.245 266.880 145.174 1.00 50.00  ? 93   U   B "C3'" 1 
ATOM   1896  O  "O3'" . U   A  1  93   ? 211.124 268.273 144.890 1.00 50.00  ? 93   U   B "O3'" 1 
ATOM   1897  C  "C2'" . U   A  1  93   ? 210.494 266.074 144.119 1.00 50.00  ? 93   U   B "C2'" 1 
ATOM   1898  O  "O2'" . U   A  1  93   ? 209.262 266.634 143.720 1.00 50.00  ? 93   U   B "O2'" 1 
ATOM   1899  C  "C1'" . U   A  1  93   ? 211.503 266.051 142.973 1.00 50.00  ? 93   U   B "C1'" 1 
ATOM   1900  N  N1    . U   A  1  93   ? 211.368 264.890 142.083 1.00 50.00  ? 93   U   B N1    1 
ATOM   1901  C  C2    . U   A  1  93   ? 210.982 265.117 140.777 1.00 50.00  ? 93   U   B C2    1 
ATOM   1902  O  O2    . U   A  1  93   ? 210.750 266.231 140.339 1.00 50.00  ? 93   U   B O2    1 
ATOM   1903  N  N3    . U   A  1  93   ? 210.877 263.989 140.001 1.00 50.00  ? 93   U   B N3    1 
ATOM   1904  C  C4    . U   A  1  93   ? 211.115 262.687 140.391 1.00 50.00  ? 93   U   B C4    1 
ATOM   1905  O  O4    . U   A  1  93   ? 210.977 261.774 139.575 1.00 50.00  ? 93   U   B O4    1 
ATOM   1906  C  C5    . U   A  1  93   ? 211.510 262.536 141.758 1.00 50.00  ? 93   U   B C5    1 
ATOM   1907  C  C6    . U   A  1  93   ? 211.621 263.616 142.537 1.00 50.00  ? 93   U   B C6    1 
ATOM   1908  P  P     . U   A  1  94   ? 210.659 269.297 146.038 1.00 50.00  ? 94   U   B P     1 
ATOM   1909  O  OP1   . U   A  1  94   ? 211.710 270.334 146.189 1.00 50.00  ? 94   U   B OP1   1 
ATOM   1910  O  OP2   . U   A  1  94   ? 210.249 268.495 147.221 1.00 50.00  ? 94   U   B OP2   1 
ATOM   1911  O  "O5'" . U   A  1  94   ? 209.357 269.987 145.435 1.00 50.00  ? 94   U   B "O5'" 1 
ATOM   1912  C  "C5'" . U   A  1  94   ? 208.563 270.871 146.220 1.00 50.00  ? 94   U   B "C5'" 1 
ATOM   1913  C  "C4'" . U   A  1  94   ? 207.089 270.604 146.040 1.00 50.00  ? 94   U   B "C4'" 1 
ATOM   1914  O  "O4'" . U   A  1  94   ? 206.826 269.223 146.405 1.00 50.00  ? 94   U   B "O4'" 1 
ATOM   1915  C  "C3'" . U   A  1  94   ? 206.166 271.466 146.902 1.00 50.00  ? 94   U   B "C3'" 1 
ATOM   1916  O  "O3'" . U   A  1  94   ? 204.995 271.913 146.187 1.00 50.00  ? 94   U   B "O3'" 1 
ATOM   1917  C  "C2'" . U   A  1  94   ? 205.816 270.549 148.077 1.00 50.00  ? 94   U   B "C2'" 1 
ATOM   1918  O  "O2'" . U   A  1  94   ? 204.560 270.807 148.669 1.00 50.00  ? 94   U   B "O2'" 1 
ATOM   1919  C  "C1'" . U   A  1  94   ? 205.867 269.159 147.441 1.00 50.00  ? 94   U   B "C1'" 1 
ATOM   1920  N  N1    . U   A  1  94   ? 206.277 268.096 148.370 1.00 50.00  ? 94   U   B N1    1 
ATOM   1921  C  C2    . U   A  1  94   ? 205.345 267.132 148.710 1.00 50.00  ? 94   U   B C2    1 
ATOM   1922  O  O2    . U   A  1  94   ? 204.207 267.131 148.274 1.00 50.00  ? 94   U   B O2    1 
ATOM   1923  N  N3    . U   A  1  94   ? 205.801 266.173 149.580 1.00 50.00  ? 94   U   B N3    1 
ATOM   1924  C  C4    . U   A  1  94   ? 207.063 266.083 150.130 1.00 50.00  ? 94   U   B C4    1 
ATOM   1925  O  O4    . U   A  1  94   ? 207.323 265.157 150.901 1.00 50.00  ? 94   U   B O4    1 
ATOM   1926  C  C5    . U   A  1  94   ? 207.966 267.116 149.729 1.00 50.00  ? 94   U   B C5    1 
ATOM   1927  C  C6    . U   A  1  94   ? 207.552 268.064 148.883 1.00 50.00  ? 94   U   B C6    1 
ATOM   1928  P  P     . G   A  1  95   ? 204.179 270.895 145.258 1.00 50.00  ? 95   G   B P     1 
ATOM   1929  O  OP1   . G   A  1  95   ? 203.887 269.677 146.055 1.00 50.00  ? 95   G   B OP1   1 
ATOM   1930  O  OP2   . G   A  1  95   ? 204.903 270.771 143.967 1.00 50.00  ? 95   G   B OP2   1 
ATOM   1931  O  "O5'" . G   A  1  95   ? 202.810 271.667 144.994 1.00 50.00  ? 95   G   B "O5'" 1 
ATOM   1932  C  "C5'" . G   A  1  95   ? 201.782 271.730 146.005 1.00 50.00  ? 95   G   B "C5'" 1 
ATOM   1933  C  "C4'" . G   A  1  95   ? 200.875 272.912 145.757 1.00 50.00  ? 95   G   B "C4'" 1 
ATOM   1934  O  "O4'" . G   A  1  95   ? 199.604 272.442 145.230 1.00 50.00  ? 95   G   B "O4'" 1 
ATOM   1935  C  "C3'" . G   A  1  95   ? 200.518 273.738 146.985 1.00 50.00  ? 95   G   B "C3'" 1 
ATOM   1936  O  "O3'" . G   A  1  95   ? 201.479 274.765 147.199 1.00 50.00  ? 95   G   B "O3'" 1 
ATOM   1937  C  "C2'" . G   A  1  95   ? 199.162 274.320 146.606 1.00 50.00  ? 95   G   B "C2'" 1 
ATOM   1938  O  "O2'" . G   A  1  95   ? 199.256 275.474 145.795 1.00 50.00  ? 95   G   B "O2'" 1 
ATOM   1939  C  "C1'" . G   A  1  95   ? 198.540 273.159 145.830 1.00 50.00  ? 95   G   B "C1'" 1 
ATOM   1940  N  N9    . G   A  1  95   ? 197.784 272.235 146.669 1.00 50.00  ? 95   G   B N9    1 
ATOM   1941  C  C8    . G   A  1  95   ? 196.879 271.290 146.248 1.00 50.00  ? 95   G   B C8    1 
ATOM   1942  N  N7    . G   A  1  95   ? 196.358 270.606 147.231 1.00 50.00  ? 95   G   B N7    1 
ATOM   1943  C  C5    . G   A  1  95   ? 196.954 271.131 148.369 1.00 50.00  ? 95   G   B C5    1 
ATOM   1944  C  C6    . G   A  1  95   ? 196.785 270.789 149.736 1.00 50.00  ? 95   G   B C6    1 
ATOM   1945  O  O6    . G   A  1  95   ? 196.050 269.926 150.230 1.00 50.00  ? 95   G   B O6    1 
ATOM   1946  N  N1    . G   A  1  95   ? 197.585 271.573 150.561 1.00 50.00  ? 95   G   B N1    1 
ATOM   1947  C  C2    . G   A  1  95   ? 198.438 272.558 150.129 1.00 50.00  ? 95   G   B C2    1 
ATOM   1948  N  N2    . G   A  1  95   ? 199.126 273.204 151.082 1.00 50.00  ? 95   G   B N2    1 
ATOM   1949  N  N3    . G   A  1  95   ? 198.605 272.886 148.859 1.00 50.00  ? 95   G   B N3    1 
ATOM   1950  C  C4    . G   A  1  95   ? 197.837 272.137 148.039 1.00 50.00  ? 95   G   B C4    1 
ATOM   1951  P  P     . A   A  1  96   ? 202.786 274.465 148.070 1.00 76.88  ? 96   A   B P     1 
ATOM   1952  O  OP1   . A   A  1  96   ? 203.859 275.390 147.626 1.00 78.59  ? 96   A   B OP1   1 
ATOM   1953  O  OP2   . A   A  1  96   ? 203.026 273.000 148.046 1.00 75.20  ? 96   A   B OP2   1 
ATOM   1954  O  "O5'" . A   A  1  96   ? 202.335 274.867 149.543 1.00 78.76  ? 96   A   B "O5'" 1 
ATOM   1955  C  "C5'" . A   A  1  96   ? 203.168 275.704 150.365 1.00 77.93  ? 96   A   B "C5'" 1 
ATOM   1956  C  "C4'" . A   A  1  96   ? 202.809 277.154 150.155 1.00 78.66  ? 96   A   B "C4'" 1 
ATOM   1957  O  "O4'" . A   A  1  96   ? 203.807 277.991 150.800 1.00 79.49  ? 96   A   B "O4'" 1 
ATOM   1958  C  "C3'" . A   A  1  96   ? 202.745 277.608 148.697 1.00 78.23  ? 96   A   B "C3'" 1 
ATOM   1959  O  "O3'" . A   A  1  96   ? 201.673 278.521 148.496 1.00 77.17  ? 96   A   B "O3'" 1 
ATOM   1960  C  "C2'" . A   A  1  96   ? 204.114 278.243 148.474 1.00 79.34  ? 96   A   B "C2'" 1 
ATOM   1961  O  "O2'" . A   A  1  96   ? 204.106 279.247 147.480 1.00 79.34  ? 96   A   B "O2'" 1 
ATOM   1962  C  "C1'" . A   A  1  96   ? 204.404 278.847 149.847 1.00 78.22  ? 96   A   B "C1'" 1 
ATOM   1963  N  N9    . A   A  1  96   ? 205.833 278.936 150.147 1.00 20.00  ? 96   A   B N9    1 
ATOM   1964  C  C8    . A   A  1  96   ? 206.885 278.695 149.299 1.00 20.00  ? 96   A   B C8    1 
ATOM   1965  N  N7    . A   A  1  96   ? 208.061 278.855 149.856 1.00 20.00  ? 96   A   B N7    1 
ATOM   1966  C  C5    . A   A  1  96   ? 207.763 279.226 151.160 1.00 20.00  ? 96   A   B C5    1 
ATOM   1967  C  C6    . A   A  1  96   ? 208.576 279.542 152.264 1.00 20.00  ? 96   A   B C6    1 
ATOM   1968  N  N6    . A   A  1  96   ? 209.911 279.534 152.227 1.00 20.00  ? 96   A   B N6    1 
ATOM   1969  N  N1    . A   A  1  96   ? 207.963 279.870 153.422 1.00 20.00  ? 96   A   B N1    1 
ATOM   1970  C  C2    . A   A  1  96   ? 206.624 279.878 153.457 1.00 20.00  ? 96   A   B C2    1 
ATOM   1971  N  N3    . A   A  1  96   ? 205.753 279.601 152.490 1.00 20.00  ? 96   A   B N3    1 
ATOM   1972  C  C4    . A   A  1  96   ? 206.394 279.279 151.353 1.00 20.00  ? 96   A   B C4    1 
ATOM   1973  P  P     . G   A  1  97   ? 200.164 277.993 148.543 1.00 50.00  ? 97   G   B P     1 
ATOM   1974  O  OP1   . G   A  1  97   ? 199.380 278.923 149.394 1.00 50.00  ? 97   G   B OP1   1 
ATOM   1975  O  OP2   . G   A  1  97   ? 200.195 276.546 148.874 1.00 50.00  ? 97   G   B OP2   1 
ATOM   1976  O  "O5'" . G   A  1  97   ? 199.677 278.152 147.034 1.00 50.00  ? 97   G   B "O5'" 1 
ATOM   1977  C  "C5'" . G   A  1  97   ? 200.227 279.175 146.182 1.00 50.00  ? 97   G   B "C5'" 1 
ATOM   1978  C  "C4'" . G   A  1  97   ? 199.424 279.296 144.906 1.00 50.00  ? 97   G   B "C4'" 1 
ATOM   1979  O  "O4'" . G   A  1  97   ? 198.649 278.083 144.698 1.00 50.00  ? 97   G   B "O4'" 1 
ATOM   1980  C  "C3'" . G   A  1  97   ? 198.411 280.433 144.869 1.00 50.00  ? 97   G   B "C3'" 1 
ATOM   1981  O  "O3'" . G   A  1  97   ? 199.011 281.621 144.367 1.00 50.00  ? 97   G   B "O3'" 1 
ATOM   1982  C  "C2'" . G   A  1  97   ? 197.359 279.901 143.905 1.00 50.00  ? 97   G   B "C2'" 1 
ATOM   1983  O  "O2'" . G   A  1  97   ? 197.710 280.078 142.548 1.00 50.00  ? 97   G   B "O2'" 1 
ATOM   1984  C  "C1'" . G   A  1  97   ? 197.342 278.416 144.265 1.00 50.00  ? 97   G   B "C1'" 1 
ATOM   1985  N  N9    . G   A  1  97   ? 196.411 278.096 145.341 1.00 20.00  ? 97   G   B N9    1 
ATOM   1986  C  C8    . G   A  1  97   ? 196.691 277.415 146.501 1.00 20.00  ? 97   G   B C8    1 
ATOM   1987  N  N7    . G   A  1  97   ? 195.652 277.280 147.280 1.00 20.00  ? 97   G   B N7    1 
ATOM   1988  C  C5    . G   A  1  97   ? 194.624 277.911 146.593 1.00 20.00  ? 97   G   B C5    1 
ATOM   1989  C  C6    . G   A  1  97   ? 193.260 278.088 146.940 1.00 20.00  ? 97   G   B C6    1 
ATOM   1990  O  O6    . G   A  1  97   ? 192.669 277.711 147.959 1.00 20.00  ? 97   G   B O6    1 
ATOM   1991  N  N1    . G   A  1  97   ? 192.568 278.786 145.955 1.00 20.00  ? 97   G   B N1    1 
ATOM   1992  C  C2    . G   A  1  97   ? 193.116 279.254 144.787 1.00 20.00  ? 97   G   B C2    1 
ATOM   1993  N  N2    . G   A  1  97   ? 192.283 279.905 143.962 1.00 20.00  ? 97   G   B N2    1 
ATOM   1994  N  N3    . G   A  1  97   ? 194.386 279.095 144.451 1.00 20.00  ? 97   G   B N3    1 
ATOM   1995  C  C4    . G   A  1  97   ? 195.076 278.420 145.394 1.00 20.00  ? 97   G   B C4    1 
ATOM   1996  P  P     . G   A  1  98   ? 198.824 283.001 145.153 1.00 50.00  ? 98   G   B P     1 
ATOM   1997  O  OP1   . G   A  1  98   ? 200.155 283.428 145.654 1.00 50.00  ? 98   G   B OP1   1 
ATOM   1998  O  OP2   . G   A  1  98   ? 197.698 282.838 146.106 1.00 50.00  ? 98   G   B OP2   1 
ATOM   1999  O  "O5'" . G   A  1  98   ? 198.381 284.010 144.004 1.00 50.00  ? 98   G   B "O5'" 1 
ATOM   2000  C  "C5'" . G   A  1  98   ? 198.390 283.600 142.626 1.00 50.00  ? 98   G   B "C5'" 1 
ATOM   2001  C  "C4'" . G   A  1  98   ? 197.033 283.829 142.009 1.00 50.00  ? 98   G   B "C4'" 1 
ATOM   2002  O  "O4'" . G   A  1  98   ? 196.148 282.735 142.371 1.00 50.00  ? 98   G   B "O4'" 1 
ATOM   2003  C  "C3'" . G   A  1  98   ? 196.303 285.080 142.471 1.00 50.00  ? 98   G   B "C3'" 1 
ATOM   2004  O  "O3'" . G   A  1  98   ? 196.718 286.215 141.717 1.00 50.00  ? 98   G   B "O3'" 1 
ATOM   2005  C  "C2'" . G   A  1  98   ? 194.848 284.715 142.201 1.00 50.00  ? 98   G   B "C2'" 1 
ATOM   2006  O  "O2'" . G   A  1  98   ? 194.464 284.905 140.854 1.00 50.00  ? 98   G   B "O2'" 1 
ATOM   2007  C  "C1'" . G   A  1  98   ? 194.832 283.228 142.561 1.00 50.00  ? 98   G   B "C1'" 1 
ATOM   2008  N  N9    . G   A  1  98   ? 194.449 282.987 143.948 1.00 50.00  ? 98   G   B N9    1 
ATOM   2009  C  C8    . G   A  1  98   ? 195.260 282.557 144.970 1.00 50.00  ? 98   G   B C8    1 
ATOM   2010  N  N7    . G   A  1  98   ? 194.632 282.444 146.110 1.00 50.00  ? 98   G   B N7    1 
ATOM   2011  C  C5    . G   A  1  98   ? 193.329 282.825 145.823 1.00 50.00  ? 98   G   B C5    1 
ATOM   2012  C  C6    . G   A  1  98   ? 192.186 282.911 146.668 1.00 50.00  ? 98   G   B C6    1 
ATOM   2013  O  O6    . G   A  1  98   ? 192.097 282.646 147.873 1.00 50.00  ? 98   G   B O6    1 
ATOM   2014  N  N1    . G   A  1  98   ? 191.063 283.339 145.968 1.00 50.00  ? 98   G   B N1    1 
ATOM   2015  C  C2    . G   A  1  98   ? 191.036 283.654 144.633 1.00 50.00  ? 98   G   B C2    1 
ATOM   2016  N  N2    . G   A  1  98   ? 189.854 284.056 144.143 1.00 50.00  ? 98   G   B N2    1 
ATOM   2017  N  N3    . G   A  1  98   ? 192.095 283.586 143.835 1.00 50.00  ? 98   G   B N3    1 
ATOM   2018  C  C4    . G   A  1  98   ? 193.199 283.161 144.492 1.00 50.00  ? 98   G   B C4    1 
ATOM   2019  P  P     . C   A  1  99   ? 196.589 287.687 142.338 1.00 50.00  ? 99   C   B P     1 
ATOM   2020  O  OP1   . C   A  1  99   ? 197.342 288.626 141.471 1.00 50.00  ? 99   C   B OP1   1 
ATOM   2021  O  OP2   . C   A  1  99   ? 196.902 287.614 143.788 1.00 50.00  ? 99   C   B OP2   1 
ATOM   2022  O  "O5'" . C   A  1  99   ? 195.036 288.011 142.186 1.00 50.00  ? 99   C   B "O5'" 1 
ATOM   2023  C  "C5'" . C   A  1  99   ? 194.411 288.040 140.909 1.00 50.00  ? 99   C   B "C5'" 1 
ATOM   2024  C  "C4'" . C   A  1  99   ? 192.911 288.115 141.041 1.00 50.00  ? 99   C   B "C4'" 1 
ATOM   2025  O  "O4'" . C   A  1  99   ? 192.429 286.939 141.744 1.00 50.00  ? 99   C   B "O4'" 1 
ATOM   2026  C  "C3'" . C   A  1  99   ? 192.381 289.286 141.856 1.00 50.00  ? 99   C   B "C3'" 1 
ATOM   2027  O  "O3'" . C   A  1  99   ? 192.262 290.471 141.087 1.00 50.00  ? 99   C   B "O3'" 1 
ATOM   2028  C  "C2'" . C   A  1  99   ? 191.050 288.765 142.381 1.00 50.00  ? 99   C   B "C2'" 1 
ATOM   2029  O  "O2'" . C   A  1  99   ? 190.045 288.864 141.382 1.00 50.00  ? 99   C   B "O2'" 1 
ATOM   2030  C  "C1'" . C   A  1  99   ? 191.363 287.286 142.600 1.00 50.00  ? 99   C   B "C1'" 1 
ATOM   2031  N  N1    . C   A  1  99   ? 191.769 286.970 143.994 1.00 50.00  ? 99   C   B N1    1 
ATOM   2032  C  C2    . C   A  1  99   ? 190.849 286.997 145.051 1.00 50.00  ? 99   C   B C2    1 
ATOM   2033  O  O2    . C   A  1  99   ? 189.673 287.321 144.833 1.00 50.00  ? 99   C   B O2    1 
ATOM   2034  N  N3    . C   A  1  99   ? 191.282 286.679 146.298 1.00 50.00  ? 99   C   B N3    1 
ATOM   2035  C  C4    . C   A  1  99   ? 192.554 286.333 146.509 1.00 50.00  ? 99   C   B C4    1 
ATOM   2036  N  N4    . C   A  1  99   ? 192.944 286.025 147.748 1.00 50.00  ? 99   C   B N4    1 
ATOM   2037  C  C5    . C   A  1  99   ? 193.500 286.289 145.451 1.00 50.00  ? 99   C   B C5    1 
ATOM   2038  C  C6    . C   A  1  99   ? 193.063 286.607 144.230 1.00 50.00  ? 99   C   B C6    1 
ATOM   2039  P  P     . C   A  1  100  ? 192.340 291.912 141.795 1.00 50.00  ? 100  C   B P     1 
ATOM   2040  O  OP1   . C   A  1  100  ? 192.427 292.942 140.729 1.00 50.00  ? 100  C   B OP1   1 
ATOM   2041  O  OP2   . C   A  1  100  ? 193.391 291.852 142.843 1.00 50.00  ? 100  C   B OP2   1 
ATOM   2042  O  "O5'" . C   A  1  100  ? 190.929 292.070 142.519 1.00 50.00  ? 100  C   B "O5'" 1 
ATOM   2043  C  "C5'" . C   A  1  100  ? 189.719 292.113 141.775 1.00 50.00  ? 100  C   B "C5'" 1 
ATOM   2044  C  "C4'" . C   A  1  100  ? 188.521 292.165 142.689 1.00 50.00  ? 100  C   B "C4'" 1 
ATOM   2045  O  "O4'" . C   A  1  100  ? 188.439 290.932 143.452 1.00 50.00  ? 100  C   B "O4'" 1 
ATOM   2046  C  "C3'" . C   A  1  100  ? 188.552 293.262 143.742 1.00 50.00  ? 100  C   B "C3'" 1 
ATOM   2047  O  "O3'" . C   A  1  100  ? 188.095 294.507 143.245 1.00 50.00  ? 100  C   B "O3'" 1 
ATOM   2048  C  "C2'" . C   A  1  100  ? 187.681 292.692 144.854 1.00 50.00  ? 100  C   B "C2'" 1 
ATOM   2049  O  "O2'" . C   A  1  100  ? 186.303 292.866 144.552 1.00 50.00  ? 100  C   B "O2'" 1 
ATOM   2050  C  "C1'" . C   A  1  100  ? 188.008 291.203 144.769 1.00 50.00  ? 100  C   B "C1'" 1 
ATOM   2051  N  N1    . C   A  1  100  ? 189.086 290.787 145.698 1.00 50.00  ? 100  C   B N1    1 
ATOM   2052  C  C2    . C   A  1  100  ? 188.851 290.620 147.071 1.00 50.00  ? 100  C   B C2    1 
ATOM   2053  O  O2    . C   A  1  100  ? 187.724 290.850 147.534 1.00 50.00  ? 100  C   B O2    1 
ATOM   2054  N  N3    . C   A  1  100  ? 189.876 290.219 147.864 1.00 50.00  ? 100  C   B N3    1 
ATOM   2055  C  C4    . C   A  1  100  ? 191.082 289.978 147.346 1.00 50.00  ? 100  C   B C4    1 
ATOM   2056  N  N4    . C   A  1  100  ? 192.071 289.584 148.150 1.00 50.00  ? 100  C   B N4    1 
ATOM   2057  C  C5    . C   A  1  100  ? 191.343 290.129 145.957 1.00 50.00  ? 100  C   B C5    1 
ATOM   2058  C  C6    . C   A  1  100  ? 190.326 290.525 145.190 1.00 50.00  ? 100  C   B C6    1 
ATOM   2059  P  P     . U   A  1  101  ? 188.685 295.883 143.828 1.00 50.00  ? 101  U   B P     1 
ATOM   2060  O  OP1   . U   A  1  101  ? 188.296 296.978 142.904 1.00 50.00  ? 101  U   B OP1   1 
ATOM   2061  O  OP2   . U   A  1  101  ? 190.119 295.666 144.148 1.00 50.00  ? 101  U   B OP2   1 
ATOM   2062  O  "O5'" . U   A  1  101  ? 187.900 296.086 145.199 1.00 50.00  ? 101  U   B "O5'" 1 
ATOM   2063  C  "C5'" . U   A  1  101  ? 186.481 296.128 145.231 1.00 50.00  ? 101  U   B "C5'" 1 
ATOM   2064  C  "C4'" . U   A  1  101  ? 185.965 296.032 146.644 1.00 50.00  ? 101  U   B "C4'" 1 
ATOM   2065  O  "O4'" . U   A  1  101  ? 186.289 294.725 147.191 1.00 50.00  ? 101  U   B "O4'" 1 
ATOM   2066  C  "C3'" . U   A  1  101  ? 186.576 297.013 147.632 1.00 50.00  ? 101  U   B "C3'" 1 
ATOM   2067  O  "O3'" . U   A  1  101  ? 185.960 298.289 147.587 1.00 50.00  ? 101  U   B "O3'" 1 
ATOM   2068  C  "C2'" . U   A  1  101  ? 186.406 296.299 148.966 1.00 50.00  ? 101  U   B "C2'" 1 
ATOM   2069  O  "O2'" . U   A  1  101  ? 185.078 296.437 149.446 1.00 50.00  ? 101  U   B "O2'" 1 
ATOM   2070  C  "C1'" . U   A  1  101  ? 186.623 294.842 148.558 1.00 50.00  ? 101  U   B "C1'" 1 
ATOM   2071  N  N1    . U   A  1  101  ? 188.028 294.404 148.730 1.00 50.00  ? 101  U   B N1    1 
ATOM   2072  C  C2    . U   A  1  101  ? 188.498 294.109 149.996 1.00 50.00  ? 101  U   B C2    1 
ATOM   2073  O  O2    . U   A  1  101  ? 187.810 294.202 150.998 1.00 50.00  ? 101  U   B O2    1 
ATOM   2074  N  N3    . U   A  1  101  ? 189.810 293.700 150.047 1.00 50.00  ? 101  U   B N3    1 
ATOM   2075  C  C4    . U   A  1  101  ? 190.677 293.558 148.979 1.00 50.00  ? 101  U   B C4    1 
ATOM   2076  O  O4    . U   A  1  101  ? 191.834 293.180 149.161 1.00 50.00  ? 101  U   B O4    1 
ATOM   2077  C  C5    . U   A  1  101  ? 190.113 293.876 147.706 1.00 50.00  ? 101  U   B C5    1 
ATOM   2078  C  C6    . U   A  1  101  ? 188.845 294.275 147.633 1.00 50.00  ? 101  U   B C6    1 
ATOM   2079  P  P     . U   A  1  102  ? 186.831 299.616 147.835 1.00 50.00  ? 102  U   B P     1 
ATOM   2080  O  OP1   . U   A  1  102  ? 186.021 300.785 147.407 1.00 50.00  ? 102  U   B OP1   1 
ATOM   2081  O  OP2   . U   A  1  102  ? 188.177 299.399 147.246 1.00 50.00  ? 102  U   B OP2   1 
ATOM   2082  O  "O5'" . U   A  1  102  ? 186.991 299.678 149.418 1.00 50.00  ? 102  U   B "O5'" 1 
ATOM   2083  C  "C5'" . U   A  1  102  ? 185.853 299.660 150.267 1.00 50.00  ? 102  U   B "C5'" 1 
ATOM   2084  C  "C4'" . U   A  1  102  ? 186.241 299.372 151.695 1.00 50.00  ? 102  U   B "C4'" 1 
ATOM   2085  O  "O4'" . U   A  1  102  ? 186.771 298.024 151.797 1.00 50.00  ? 102  U   B "O4'" 1 
ATOM   2086  C  "C3'" . U   A  1  102  ? 187.347 300.247 152.266 1.00 50.00  ? 102  U   B "C3'" 1 
ATOM   2087  O  "O3'" . U   A  1  102  ? 186.882 301.509 152.710 1.00 50.00  ? 102  U   B "O3'" 1 
ATOM   2088  C  "C2'" . U   A  1  102  ? 187.921 299.375 153.373 1.00 50.00  ? 102  U   B "C2'" 1 
ATOM   2089  O  "O2'" . U   A  1  102  ? 187.086 299.410 154.522 1.00 50.00  ? 102  U   B "O2'" 1 
ATOM   2090  C  "C1'" . U   A  1  102  ? 187.819 297.986 152.744 1.00 50.00  ? 102  U   B "C1'" 1 
ATOM   2091  N  N1    . U   A  1  102  ? 189.066 297.601 152.045 1.00 50.00  ? 102  U   B N1    1 
ATOM   2092  C  C2    . U   A  1  102  ? 190.158 297.212 152.800 1.00 50.00  ? 102  U   B C2    1 
ATOM   2093  O  O2    . U   A  1  102  ? 190.146 297.172 154.018 1.00 50.00  ? 102  U   B O2    1 
ATOM   2094  N  N3    . U   A  1  102  ? 191.274 296.870 152.073 1.00 50.00  ? 102  U   B N3    1 
ATOM   2095  C  C4    . U   A  1  102  ? 191.400 296.877 150.696 1.00 50.00  ? 102  U   B C4    1 
ATOM   2096  O  O4    . U   A  1  102  ? 192.462 296.544 150.170 1.00 50.00  ? 102  U   B O4    1 
ATOM   2097  C  C5    . U   A  1  102  ? 190.229 297.288 149.990 1.00 50.00  ? 102  U   B C5    1 
ATOM   2098  C  C6    . U   A  1  102  ? 189.133 297.626 150.672 1.00 50.00  ? 102  U   B C6    1 
ATOM   2099  P  P     . G   A  1  103  ? 187.804 302.813 152.537 1.00 50.00  ? 103  G   B P     1 
ATOM   2100  O  OP1   . G   A  1  103  ? 186.968 304.008 152.808 1.00 50.00  ? 103  G   B OP1   1 
ATOM   2101  O  OP2   . G   A  1  103  ? 188.527 302.697 151.245 1.00 50.00  ? 103  G   B OP2   1 
ATOM   2102  O  "O5'" . G   A  1  103  ? 188.873 302.683 153.711 1.00 50.00  ? 103  G   B "O5'" 1 
ATOM   2103  C  "C5'" . G   A  1  103  ? 188.456 302.592 155.065 1.00 50.00  ? 103  G   B "C5'" 1 
ATOM   2104  C  "C4'" . G   A  1  103  ? 189.555 302.066 155.952 1.00 50.00  ? 103  G   B "C4'" 1 
ATOM   2105  O  "O4'" . G   A  1  103  ? 189.903 300.710 155.559 1.00 50.00  ? 103  G   B "O4'" 1 
ATOM   2106  C  "C3'" . G   A  1  103  ? 190.878 302.812 155.891 1.00 50.00  ? 103  G   B "C3'" 1 
ATOM   2107  O  "O3'" . G   A  1  103  ? 190.884 304.005 156.653 1.00 50.00  ? 103  G   B "O3'" 1 
ATOM   2108  C  "C2'" . G   A  1  103  ? 191.865 301.762 156.376 1.00 50.00  ? 103  G   B "C2'" 1 
ATOM   2109  O  "O2'" . G   A  1  103  ? 191.797 301.624 157.788 1.00 50.00  ? 103  G   B "O2'" 1 
ATOM   2110  C  "C1'" . G   A  1  103  ? 191.290 300.499 155.739 1.00 50.00  ? 103  G   B "C1'" 1 
ATOM   2111  N  N9    . G   A  1  103  ? 191.898 300.236 154.423 1.00 50.00  ? 103  G   B N9    1 
ATOM   2112  C  C8    . G   A  1  103  ? 191.317 300.383 153.187 1.00 50.00  ? 103  G   B C8    1 
ATOM   2113  N  N7    . G   A  1  103  ? 192.121 300.078 152.204 1.00 50.00  ? 103  G   B N7    1 
ATOM   2114  C  C5    . G   A  1  103  ? 193.305 299.712 152.830 1.00 50.00  ? 103  G   B C5    1 
ATOM   2115  C  C6    . G   A  1  103  ? 194.540 299.281 152.283 1.00 50.00  ? 103  G   B C6    1 
ATOM   2116  O  O6    . G   A  1  103  ? 194.846 299.131 151.095 1.00 50.00  ? 103  G   B O6    1 
ATOM   2117  N  N1    . G   A  1  103  ? 195.476 299.014 153.279 1.00 50.00  ? 103  G   B N1    1 
ATOM   2118  C  C2    . G   A  1  103  ? 195.253 299.138 154.628 1.00 50.00  ? 103  G   B C2    1 
ATOM   2119  N  N2    . G   A  1  103  ? 196.271 298.837 155.448 1.00 50.00  ? 103  G   B N2    1 
ATOM   2120  N  N3    . G   A  1  103  ? 194.106 299.541 155.147 1.00 50.00  ? 103  G   B N3    1 
ATOM   2121  C  C4    . G   A  1  103  ? 193.185 299.807 154.198 1.00 50.00  ? 103  G   B C4    1 
ATOM   2122  P  P     . C   A  1  104  ? 191.655 305.303 156.105 1.00 50.00  ? 104  C   B P     1 
ATOM   2123  O  OP1   . C   A  1  104  ? 191.288 306.457 156.963 1.00 50.00  ? 104  C   B OP1   1 
ATOM   2124  O  OP2   . C   A  1  104  ? 191.440 305.381 154.638 1.00 50.00  ? 104  C   B OP2   1 
ATOM   2125  O  "O5'" . C   A  1  104  ? 193.192 304.968 156.359 1.00 50.00  ? 104  C   B "O5'" 1 
ATOM   2126  C  "C5'" . C   A  1  104  ? 193.668 304.704 157.670 1.00 50.00  ? 104  C   B "C5'" 1 
ATOM   2127  C  "C4'" . C   A  1  104  ? 195.046 304.092 157.655 1.00 50.00  ? 104  C   B "C4'" 1 
ATOM   2128  O  "O4'" . C   A  1  104  ? 195.022 302.820 156.950 1.00 50.00  ? 104  C   B "O4'" 1 
ATOM   2129  C  "C3'" . C   A  1  104  ? 196.126 304.882 156.933 1.00 50.00  ? 104  C   B "C3'" 1 
ATOM   2130  O  "O3'" . C   A  1  104  ? 196.637 305.965 157.690 1.00 50.00  ? 104  C   B "O3'" 1 
ATOM   2131  C  "C2'" . C   A  1  104  ? 197.156 303.809 156.621 1.00 50.00  ? 104  C   B "C2'" 1 
ATOM   2132  O  "O2'" . C   A  1  104  ? 197.907 303.483 157.782 1.00 50.00  ? 104  C   B "O2'" 1 
ATOM   2133  C  "C1'" . C   A  1  104  ? 196.252 302.621 156.282 1.00 50.00  ? 104  C   B "C1'" 1 
ATOM   2134  N  N1    . C   A  1  104  ? 195.998 302.537 154.824 1.00 50.00  ? 104  C   B N1    1 
ATOM   2135  C  C2    . C   A  1  104  ? 197.028 302.081 153.994 1.00 50.00  ? 104  C   B C2    1 
ATOM   2136  O  O2    . C   A  1  104  ? 198.105 301.752 154.514 1.00 50.00  ? 104  C   B O2    1 
ATOM   2137  N  N3    . C   A  1  104  ? 196.819 302.009 152.660 1.00 50.00  ? 104  C   B N3    1 
ATOM   2138  C  C4    . C   A  1  104  ? 195.640 302.373 152.150 1.00 50.00  ? 104  C   B C4    1 
ATOM   2139  N  N4    . C   A  1  104  ? 195.475 302.286 150.826 1.00 50.00  ? 104  C   B N4    1 
ATOM   2140  C  C5    . C   A  1  104  ? 194.576 302.845 152.972 1.00 50.00  ? 104  C   B C5    1 
ATOM   2141  C  C6    . C   A  1  104  ? 194.796 302.911 154.290 1.00 50.00  ? 104  C   B C6    1 
ATOM   2142  P  P     . U   A  1  105  ? 196.896 307.387 156.984 1.00 50.00  ? 105  U   B P     1 
ATOM   2143  O  OP1   . U   A  1  105  ? 197.350 308.342 158.026 1.00 50.00  ? 105  U   B OP1   1 
ATOM   2144  O  OP2   . U   A  1  105  ? 195.707 307.711 156.156 1.00 50.00  ? 105  U   B OP2   1 
ATOM   2145  O  "O5'" . U   A  1  105  ? 198.120 307.115 155.999 1.00 50.00  ? 105  U   B "O5'" 1 
ATOM   2146  C  "C5'" . U   A  1  105  ? 199.415 306.840 156.508 1.00 50.00  ? 105  U   B "C5'" 1 
ATOM   2147  C  "C4'" . U   A  1  105  ? 200.330 306.282 155.446 1.00 50.00  ? 105  U   B "C4'" 1 
ATOM   2148  O  "O4'" . U   A  1  105  ? 199.723 305.114 154.836 1.00 50.00  ? 105  U   B "O4'" 1 
ATOM   2149  C  "C3'" . U   A  1  105  ? 200.630 307.192 154.264 1.00 50.00  ? 105  U   B "C3'" 1 
ATOM   2150  O  "O3'" . U   A  1  105  ? 201.613 308.173 154.542 1.00 50.00  ? 105  U   B "O3'" 1 
ATOM   2151  C  "C2'" . U   A  1  105  ? 201.044 306.199 153.187 1.00 50.00  ? 105  U   B "C2'" 1 
ATOM   2152  O  "O2'" . U   A  1  105  ? 202.376 305.755 153.398 1.00 50.00  ? 105  U   B "O2'" 1 
ATOM   2153  C  "C1'" . U   A  1  105  ? 200.096 305.033 153.474 1.00 50.00  ? 105  U   B "C1'" 1 
ATOM   2154  N  N1    . U   A  1  105  ? 198.889 305.092 152.626 1.00 20.00  ? 105  U   B N1    1 
ATOM   2155  C  C2    . U   A  1  105  ? 198.978 304.531 151.368 1.00 20.00  ? 105  U   B C2    1 
ATOM   2156  O  O2    . U   A  1  105  ? 199.993 304.000 150.954 1.00 20.00  ? 105  U   B O2    1 
ATOM   2157  N  N3    . U   A  1  105  ? 197.830 304.611 150.605 1.00 20.00  ? 105  U   B N3    1 
ATOM   2158  C  C4    . U   A  1  105  ? 196.637 305.188 150.974 1.00 20.00  ? 105  U   B C4    1 
ATOM   2159  O  O4    . U   A  1  105  ? 195.673 305.201 150.199 1.00 20.00  ? 105  U   B O4    1 
ATOM   2160  C  C5    . U   A  1  105  ? 196.639 305.752 152.302 1.00 20.00  ? 105  U   B C5    1 
ATOM   2161  C  C6    . U   A  1  105  ? 197.738 305.687 153.079 1.00 20.00  ? 105  U   B C6    1 
ATOM   2162  P  P     . U   A  1  106  ? 201.354 309.705 154.137 1.00 50.00  ? 106  U   B P     1 
ATOM   2163  O  OP1   . U   A  1  106  ? 202.638 310.440 154.271 1.00 50.00  ? 106  U   B OP1   1 
ATOM   2164  O  OP2   . U   A  1  106  ? 200.157 310.181 154.876 1.00 50.00  ? 106  U   B OP2   1 
ATOM   2165  O  "O5'" . U   A  1  106  ? 200.982 309.643 152.588 1.00 50.00  ? 106  U   B "O5'" 1 
ATOM   2166  C  "C5'" . U   A  1  106  ? 200.100 310.595 152.011 1.00 50.00  ? 106  U   B "C5'" 1 
ATOM   2167  C  "C4'" . U   A  1  106  ? 200.492 310.940 150.595 1.00 50.00  ? 106  U   B "C4'" 1 
ATOM   2168  O  "O4'" . U   A  1  106  ? 201.805 311.560 150.584 1.00 50.00  ? 106  U   B "O4'" 1 
ATOM   2169  C  "C3'" . U   A  1  106  ? 200.631 309.770 149.633 1.00 50.00  ? 106  U   B "C3'" 1 
ATOM   2170  O  "O3'" . U   A  1  106  ? 199.387 309.327 149.117 1.00 50.00  ? 106  U   B "O3'" 1 
ATOM   2171  C  "C2'" . U   A  1  106  ? 201.570 310.324 148.569 1.00 50.00  ? 106  U   B "C2'" 1 
ATOM   2172  O  "O2'" . U   A  1  106  ? 200.866 311.162 147.664 1.00 50.00  ? 106  U   B "O2'" 1 
ATOM   2173  C  "C1'" . U   A  1  106  ? 202.501 311.196 149.410 1.00 50.00  ? 106  U   B "C1'" 1 
ATOM   2174  N  N1    . U   A  1  106  ? 203.742 310.485 149.796 1.00 50.00  ? 106  U   B N1    1 
ATOM   2175  C  C2    . U   A  1  106  ? 204.747 310.388 148.854 1.00 50.00  ? 106  U   B C2    1 
ATOM   2176  O  O2    . U   A  1  106  ? 204.655 310.857 147.733 1.00 50.00  ? 106  U   B O2    1 
ATOM   2177  N  N3    . U   A  1  106  ? 205.871 309.719 149.273 1.00 50.00  ? 106  U   B N3    1 
ATOM   2178  C  C4    . U   A  1  106  ? 206.088 309.152 150.512 1.00 50.00  ? 106  U   B C4    1 
ATOM   2179  O  O4    . U   A  1  106  ? 207.156 308.581 150.738 1.00 50.00  ? 106  U   B O4    1 
ATOM   2180  C  C5    . U   A  1  106  ? 205.001 309.295 151.431 1.00 50.00  ? 106  U   B C5    1 
ATOM   2181  C  C6    . U   A  1  106  ? 203.894 309.941 151.051 1.00 50.00  ? 106  U   B C6    1 
ATOM   2182  P  P     . U   A  1  107  ? 198.933 307.798 149.312 1.00 50.00  ? 107  U   B P     1 
ATOM   2183  O  OP1   . U   A  1  107  ? 197.448 307.750 149.324 1.00 50.00  ? 107  U   B OP1   1 
ATOM   2184  O  OP2   . U   A  1  107  ? 199.697 307.259 150.464 1.00 50.00  ? 107  U   B OP2   1 
ATOM   2185  O  "O5'" . U   A  1  107  ? 199.445 307.063 147.994 1.00 50.00  ? 107  U   B "O5'" 1 
ATOM   2186  C  "C5'" . U   A  1  107  ? 198.823 307.301 146.740 1.00 50.00  ? 107  U   B "C5'" 1 
ATOM   2187  C  "C4'" . U   A  1  107  ? 199.800 307.157 145.600 1.00 50.00  ? 107  U   B "C4'" 1 
ATOM   2188  O  "O4'" . U   A  1  107  ? 200.968 307.980 145.851 1.00 50.00  ? 107  U   B "O4'" 1 
ATOM   2189  C  "C3'" . U   A  1  107  ? 200.374 305.765 145.376 1.00 50.00  ? 107  U   B "C3'" 1 
ATOM   2190  O  "O3'" . U   A  1  107  ? 199.501 304.908 144.660 1.00 50.00  ? 107  U   B "O3'" 1 
ATOM   2191  C  "C2'" . U   A  1  107  ? 201.675 306.061 144.643 1.00 50.00  ? 107  U   B "C2'" 1 
ATOM   2192  O  "O2'" . U   A  1  107  ? 201.425 306.348 143.275 1.00 50.00  ? 107  U   B "O2'" 1 
ATOM   2193  C  "C1'" . U   A  1  107  ? 202.122 307.349 145.333 1.00 50.00  ? 107  U   B "C1'" 1 
ATOM   2194  N  N1    . U   A  1  107  ? 203.062 307.081 146.448 1.00 50.00  ? 107  U   B N1    1 
ATOM   2195  C  C2    . U   A  1  107  ? 204.388 306.870 146.125 1.00 50.00  ? 107  U   B C2    1 
ATOM   2196  O  O2    . U   A  1  107  ? 204.805 306.897 144.980 1.00 50.00  ? 107  U   B O2    1 
ATOM   2197  N  N3    . U   A  1  107  ? 205.214 306.624 147.195 1.00 50.00  ? 107  U   B N3    1 
ATOM   2198  C  C4    . U   A  1  107  ? 204.857 306.571 148.526 1.00 50.00  ? 107  U   B C4    1 
ATOM   2199  O  O4    . U   A  1  107  ? 205.717 306.338 149.375 1.00 50.00  ? 107  U   B O4    1 
ATOM   2200  C  C5    . U   A  1  107  ? 203.467 306.799 148.777 1.00 50.00  ? 107  U   B C5    1 
ATOM   2201  C  C6    . U   A  1  107  ? 202.640 307.041 147.757 1.00 50.00  ? 107  U   B C6    1 
ATOM   2202  P  P     . G   A  1  108  ? 199.319 303.376 145.114 1.00 50.00  ? 108  G   B P     1 
ATOM   2203  O  OP1   . G   A  1  108  ? 198.403 302.717 144.147 1.00 50.00  ? 108  G   B OP1   1 
ATOM   2204  O  OP2   . G   A  1  108  ? 198.987 303.366 146.560 1.00 50.00  ? 108  G   B OP2   1 
ATOM   2205  O  "O5'" . G   A  1  108  ? 200.768 302.738 144.932 1.00 50.00  ? 108  G   B "O5'" 1 
ATOM   2206  C  "C5'" . G   A  1  108  ? 201.329 302.544 143.642 1.00 50.00  ? 108  G   B "C5'" 1 
ATOM   2207  C  "C4'" . G   A  1  108  ? 202.822 302.336 143.710 1.00 50.00  ? 108  G   B "C4'" 1 
ATOM   2208  O  "O4'" . G   A  1  108  ? 203.433 303.426 144.450 1.00 50.00  ? 108  G   B "O4'" 1 
ATOM   2209  C  "C3'" . G   A  1  108  ? 203.290 301.086 144.442 1.00 50.00  ? 108  G   B "C3'" 1 
ATOM   2210  O  "O3'" . G   A  1  108  ? 203.248 299.921 143.634 1.00 50.00  ? 108  G   B "O3'" 1 
ATOM   2211  C  "C2'" . G   A  1  108  ? 204.696 301.467 144.886 1.00 50.00  ? 108  G   B "C2'" 1 
ATOM   2212  O  "O2'" . G   A  1  108  ? 205.610 301.364 143.803 1.00 50.00  ? 108  G   B "O2'" 1 
ATOM   2213  C  "C1'" . G   A  1  108  ? 204.511 302.945 145.222 1.00 50.00  ? 108  G   B "C1'" 1 
ATOM   2214  N  N9    . G   A  1  108  ? 204.190 303.150 146.647 1.00 50.00  ? 108  G   B N9    1 
ATOM   2215  C  C8    . G   A  1  108  ? 202.973 303.508 147.173 1.00 50.00  ? 108  G   B C8    1 
ATOM   2216  N  N7    . G   A  1  108  ? 202.989 303.612 148.473 1.00 50.00  ? 108  G   B N7    1 
ATOM   2217  C  C5    . G   A  1  108  ? 204.295 303.305 148.828 1.00 50.00  ? 108  G   B C5    1 
ATOM   2218  C  C6    . G   A  1  108  ? 204.913 303.254 150.105 1.00 50.00  ? 108  G   B C6    1 
ATOM   2219  O  O6    . G   A  1  108  ? 204.411 303.477 151.213 1.00 50.00  ? 108  G   B O6    1 
ATOM   2220  N  N1    . G   A  1  108  ? 206.254 302.901 150.006 1.00 50.00  ? 108  G   B N1    1 
ATOM   2221  C  C2    . G   A  1  108  ? 206.918 302.631 148.837 1.00 50.00  ? 108  G   B C2    1 
ATOM   2222  N  N2    . G   A  1  108  ? 208.215 302.306 148.952 1.00 50.00  ? 108  G   B N2    1 
ATOM   2223  N  N3    . G   A  1  108  ? 206.354 302.676 147.641 1.00 50.00  ? 108  G   B N3    1 
ATOM   2224  C  C4    . G   A  1  108  ? 205.050 303.018 147.710 1.00 50.00  ? 108  G   B C4    1 
ATOM   2225  P  P     . G   A  1  109  ? 202.988 298.483 144.304 1.00 50.00  ? 109  G   B P     1 
ATOM   2226  O  OP1   . G   A  1  109  ? 203.181 297.447 143.257 1.00 50.00  ? 109  G   B OP1   1 
ATOM   2227  O  OP2   . G   A  1  109  ? 201.702 298.546 145.043 1.00 50.00  ? 109  G   B OP2   1 
ATOM   2228  O  "O5'" . G   A  1  109  ? 204.165 298.333 145.367 1.00 50.00  ? 109  G   B "O5'" 1 
ATOM   2229  C  "C5'" . G   A  1  109  ? 204.075 297.387 146.422 1.00 50.00  ? 109  G   B "C5'" 1 
ATOM   2230  C  "C4'" . G   A  1  109  ? 204.397 298.014 147.754 1.00 50.00  ? 109  G   B "C4'" 1 
ATOM   2231  O  "O4'" . G   A  1  109  ? 204.078 299.431 147.720 1.00 50.00  ? 109  G   B "O4'" 1 
ATOM   2232  C  "C3'" . G   A  1  109  ? 203.609 297.479 148.941 1.00 50.00  ? 109  G   B "C3'" 1 
ATOM   2233  O  "O3'" . G   A  1  109  ? 204.157 296.284 149.472 1.00 50.00  ? 109  G   B "O3'" 1 
ATOM   2234  C  "C2'" . G   A  1  109  ? 203.636 298.647 149.920 1.00 50.00  ? 109  G   B "C2'" 1 
ATOM   2235  O  "O2'" . G   A  1  109  ? 204.877 298.698 150.606 1.00 50.00  ? 109  G   B "O2'" 1 
ATOM   2236  C  "C1'" . G   A  1  109  ? 203.561 299.843 148.968 1.00 50.00  ? 109  G   B "C1'" 1 
ATOM   2237  N  N9    . G   A  1  109  ? 202.178 300.318 148.754 1.00 50.00  ? 109  G   B N9    1 
ATOM   2238  C  C8    . G   A  1  109  ? 201.601 300.556 147.530 1.00 50.00  ? 109  G   B C8    1 
ATOM   2239  N  N7    . G   A  1  109  ? 200.371 300.977 147.609 1.00 50.00  ? 109  G   B N7    1 
ATOM   2240  C  C5    . G   A  1  109  ? 200.116 301.027 148.970 1.00 50.00  ? 109  G   B C5    1 
ATOM   2241  C  C6    . G   A  1  109  ? 198.936 301.411 149.661 1.00 50.00  ? 109  G   B C6    1 
ATOM   2242  O  O6    . G   A  1  109  ? 197.859 301.797 149.189 1.00 50.00  ? 109  G   B O6    1 
ATOM   2243  N  N1    . G   A  1  109  ? 199.098 301.317 151.039 1.00 50.00  ? 109  G   B N1    1 
ATOM   2244  C  C2    . G   A  1  109  ? 200.245 300.908 151.673 1.00 50.00  ? 109  G   B C2    1 
ATOM   2245  N  N2    . G   A  1  109  ? 200.223 300.873 153.012 1.00 50.00  ? 109  G   B N2    1 
ATOM   2246  N  N3    . G   A  1  109  ? 201.347 300.545 151.037 1.00 50.00  ? 109  G   B N3    1 
ATOM   2247  C  C4    . G   A  1  109  ? 201.219 300.629 149.696 1.00 50.00  ? 109  G   B C4    1 
ATOM   2248  P  P     . C   A  1  110  ? 203.239 294.975 149.639 1.00 50.00  ? 110  C   B P     1 
ATOM   2249  O  OP1   . C   A  1  110  ? 204.117 293.782 149.528 1.00 50.00  ? 110  C   B OP1   1 
ATOM   2250  O  OP2   . C   A  1  110  ? 202.072 295.111 148.732 1.00 50.00  ? 110  C   B OP2   1 
ATOM   2251  O  "O5'" . C   A  1  110  ? 202.710 295.056 151.141 1.00 50.00  ? 110  C   B "O5'" 1 
ATOM   2252  C  "C5'" . C   A  1  110  ? 203.605 294.988 152.239 1.00 50.00  ? 110  C   B "C5'" 1 
ATOM   2253  C  "C4'" . C   A  1  110  ? 202.942 295.441 153.516 1.00 50.00  ? 110  C   B "C4'" 1 
ATOM   2254  O  "O4'" . C   A  1  110  ? 202.511 296.820 153.372 1.00 50.00  ? 110  C   B "O4'" 1 
ATOM   2255  C  "C3'" . C   A  1  110  ? 201.677 294.689 153.905 1.00 50.00  ? 110  C   B "C3'" 1 
ATOM   2256  O  "O3'" . C   A  1  110  ? 201.941 293.481 154.596 1.00 50.00  ? 110  C   B "O3'" 1 
ATOM   2257  C  "C2'" . C   A  1  110  ? 200.921 295.710 154.743 1.00 50.00  ? 110  C   B "C2'" 1 
ATOM   2258  O  "O2'" . C   A  1  110  ? 201.445 295.768 156.060 1.00 50.00  ? 110  C   B "O2'" 1 
ATOM   2259  C  "C1'" . C   A  1  110  ? 201.275 297.015 154.025 1.00 50.00  ? 110  C   B "C1'" 1 
ATOM   2260  N  N1    . C   A  1  110  ? 200.269 297.401 153.005 1.00 50.00  ? 110  C   B N1    1 
ATOM   2261  C  C2    . C   A  1  110  ? 198.970 297.780 153.378 1.00 50.00  ? 110  C   B C2    1 
ATOM   2262  O  O2    . C   A  1  110  ? 198.657 297.768 154.578 1.00 50.00  ? 110  C   B O2    1 
ATOM   2263  N  N3    . C   A  1  110  ? 198.088 298.135 152.412 1.00 50.00  ? 110  C   B N3    1 
ATOM   2264  C  C4    . C   A  1  110  ? 198.455 298.138 151.131 1.00 50.00  ? 110  C   B C4    1 
ATOM   2265  N  N4    . C   A  1  110  ? 197.558 298.497 150.208 1.00 50.00  ? 110  C   B N4    1 
ATOM   2266  C  C5    . C   A  1  110  ? 199.769 297.767 150.727 1.00 50.00  ? 110  C   B C5    1 
ATOM   2267  C  C6    . C   A  1  110  ? 200.631 297.418 151.688 1.00 50.00  ? 110  C   B C6    1 
ATOM   2268  P  P     . A   A  1  111  ? 200.873 292.280 154.579 1.00 50.00  ? 111  A   B P     1 
ATOM   2269  O  OP1   . A   A  1  111  ? 201.521 291.079 155.160 1.00 50.00  ? 111  A   B OP1   1 
ATOM   2270  O  OP2   . A   A  1  111  ? 200.286 292.210 153.216 1.00 50.00  ? 111  A   B OP2   1 
ATOM   2271  O  "O5'" . A   A  1  111  ? 199.727 292.755 155.583 1.00 50.00  ? 111  A   B "O5'" 1 
ATOM   2272  C  "C5'" . A   A  1  111  ? 199.924 292.732 156.991 1.00 50.00  ? 111  A   B "C5'" 1 
ATOM   2273  C  "C4'" . A   A  1  111  ? 198.698 293.219 157.722 1.00 50.00  ? 111  A   B "C4'" 1 
ATOM   2274  O  "O4'" . A   A  1  111  ? 198.409 294.585 157.321 1.00 50.00  ? 111  A   B "O4'" 1 
ATOM   2275  C  "C3'" . A   A  1  111  ? 197.412 292.455 157.433 1.00 50.00  ? 111  A   B "C3'" 1 
ATOM   2276  O  "O3'" . A   A  1  111  ? 197.273 291.294 158.233 1.00 50.00  ? 111  A   B "O3'" 1 
ATOM   2277  C  "C2'" . A   A  1  111  ? 196.331 293.498 157.685 1.00 50.00  ? 111  A   B "C2'" 1 
ATOM   2278  O  "O2'" . A   A  1  111  ? 196.081 293.635 159.076 1.00 50.00  ? 111  A   B "O2'" 1 
ATOM   2279  C  "C1'" . A   A  1  111  ? 197.016 294.771 157.193 1.00 50.00  ? 111  A   B "C1'" 1 
ATOM   2280  N  N9    . A   A  1  111  ? 196.733 295.053 155.773 1.00 50.00  ? 111  A   B N9    1 
ATOM   2281  C  C8    . A   A  1  111  ? 197.631 294.939 154.743 1.00 50.00  ? 111  A   B C8    1 
ATOM   2282  N  N7    . A   A  1  111  ? 197.146 295.260 153.571 1.00 50.00  ? 111  A   B N7    1 
ATOM   2283  C  C5    . A   A  1  111  ? 195.837 295.614 153.849 1.00 50.00  ? 111  A   B C5    1 
ATOM   2284  C  C6    . A   A  1  111  ? 194.798 296.048 153.017 1.00 50.00  ? 111  A   B C6    1 
ATOM   2285  N  N6    . A   A  1  111  ? 194.937 296.204 151.699 1.00 50.00  ? 111  A   B N6    1 
ATOM   2286  N  N1    . A   A  1  111  ? 193.608 296.324 153.589 1.00 50.00  ? 111  A   B N1    1 
ATOM   2287  C  C2    . A   A  1  111  ? 193.480 296.166 154.913 1.00 50.00  ? 111  A   B C2    1 
ATOM   2288  N  N3    . A   A  1  111  ? 194.387 295.759 155.803 1.00 50.00  ? 111  A   B N3    1 
ATOM   2289  C  C4    . A   A  1  111  ? 195.561 295.495 155.202 1.00 50.00  ? 111  A   B C4    1 
ATOM   2290  P  P     . A   A  1  112  ? 196.482 290.009 157.678 1.00 50.00  ? 112  A   B P     1 
ATOM   2291  O  OP1   . A   A  1  112  ? 196.769 288.867 158.584 1.00 50.00  ? 112  A   B OP1   1 
ATOM   2292  O  OP2   . A   A  1  112  ? 196.769 289.886 156.226 1.00 50.00  ? 112  A   B OP2   1 
ATOM   2293  O  "O5'" . A   A  1  112  ? 194.945 290.394 157.845 1.00 50.00  ? 112  A   B "O5'" 1 
ATOM   2294  C  "C5'" . A   A  1  112  ? 194.357 290.541 159.132 1.00 50.00  ? 112  A   B "C5'" 1 
ATOM   2295  C  "C4'" . A   A  1  112  ? 192.949 291.070 159.028 1.00 50.00  ? 112  A   B "C4'" 1 
ATOM   2296  O  "O4'" . A   A  1  112  ? 192.975 292.382 158.409 1.00 50.00  ? 112  A   B "O4'" 1 
ATOM   2297  C  "C3'" . A   A  1  112  ? 192.004 290.255 158.155 1.00 50.00  ? 112  A   B "C3'" 1 
ATOM   2298  O  "O3'" . A   A  1  112  ? 191.412 289.176 158.858 1.00 50.00  ? 112  A   B "O3'" 1 
ATOM   2299  C  "C2'" . A   A  1  112  ? 191.000 291.293 157.674 1.00 50.00  ? 112  A   B "C2'" 1 
ATOM   2300  O  "O2'" . A   A  1  112  ? 190.032 291.557 158.679 1.00 50.00  ? 112  A   B "O2'" 1 
ATOM   2301  C  "C1'" . A   A  1  112  ? 191.886 292.527 157.524 1.00 50.00  ? 112  A   B "C1'" 1 
ATOM   2302  N  N9    . A   A  1  112  ? 192.433 292.666 156.161 1.00 50.00  ? 112  A   B N9    1 
ATOM   2303  C  C8    . A   A  1  112  ? 193.715 292.372 155.769 1.00 50.00  ? 112  A   B C8    1 
ATOM   2304  N  N7    . A   A  1  112  ? 193.951 292.594 154.503 1.00 50.00  ? 112  A   B N7    1 
ATOM   2305  C  C5    . A   A  1  112  ? 192.738 293.068 154.027 1.00 50.00  ? 112  A   B C5    1 
ATOM   2306  C  C6    . A   A  1  112  ? 192.338 293.485 152.750 1.00 50.00  ? 112  A   B C6    1 
ATOM   2307  N  N6    . A   A  1  112  ? 193.156 293.482 151.698 1.00 50.00  ? 112  A   B N6    1 
ATOM   2308  N  N1    . A   A  1  112  ? 191.063 293.905 152.591 1.00 50.00  ? 112  A   B N1    1 
ATOM   2309  C  C2    . A   A  1  112  ? 190.255 293.902 153.661 1.00 50.00  ? 112  A   B C2    1 
ATOM   2310  N  N3    . A   A  1  112  ? 190.517 293.533 154.916 1.00 50.00  ? 112  A   B N3    1 
ATOM   2311  C  C4    . A   A  1  112  ? 191.793 293.123 155.034 1.00 50.00  ? 112  A   B C4    1 
ATOM   2312  P  P     . G   A  1  113  ? 191.339 287.712 158.196 1.00 50.00  ? 113  G   B P     1 
ATOM   2313  O  OP1   . G   A  1  113  ? 191.388 286.711 159.291 1.00 50.00  ? 113  G   B OP1   1 
ATOM   2314  O  OP2   . G   A  1  113  ? 192.338 287.654 157.100 1.00 50.00  ? 113  G   B OP2   1 
ATOM   2315  O  "O5'" . G   A  1  113  ? 189.887 287.655 157.541 1.00 50.00  ? 113  G   B "O5'" 1 
ATOM   2316  C  "C5'" . G   A  1  113  ? 188.726 287.958 158.302 1.00 50.00  ? 113  G   B "C5'" 1 
ATOM   2317  C  "C4'" . G   A  1  113  ? 187.623 288.490 157.421 1.00 50.00  ? 113  G   B "C4'" 1 
ATOM   2318  O  "O4'" . G   A  1  113  ? 188.083 289.691 156.749 1.00 50.00  ? 113  G   B "O4'" 1 
ATOM   2319  C  "C3'" . G   A  1  113  ? 187.180 287.570 156.291 1.00 50.00  ? 113  G   B "C3'" 1 
ATOM   2320  O  "O3'" . G   A  1  113  ? 186.234 286.602 156.708 1.00 50.00  ? 113  G   B "O3'" 1 
ATOM   2321  C  "C2'" . G   A  1  113  ? 186.640 288.546 155.255 1.00 50.00  ? 113  G   B "C2'" 1 
ATOM   2322  O  "O2'" . G   A  1  113  ? 185.337 288.982 155.607 1.00 50.00  ? 113  G   B "O2'" 1 
ATOM   2323  C  "C1'" . G   A  1  113  ? 187.602 289.720 155.421 1.00 50.00  ? 113  G   B "C1'" 1 
ATOM   2324  N  N9    . G   A  1  113  ? 188.763 289.612 154.520 1.00 50.00  ? 113  G   B N9    1 
ATOM   2325  C  C8    . G   A  1  113  ? 190.008 289.145 154.869 1.00 50.00  ? 113  G   B C8    1 
ATOM   2326  N  N7    . G   A  1  113  ? 190.859 289.157 153.884 1.00 50.00  ? 113  G   B N7    1 
ATOM   2327  C  C5    . G   A  1  113  ? 190.132 289.667 152.819 1.00 50.00  ? 113  G   B C5    1 
ATOM   2328  C  C6    . G   A  1  113  ? 190.534 289.911 151.484 1.00 50.00  ? 113  G   B C6    1 
ATOM   2329  O  O6    . G   A  1  113  ? 191.644 289.715 150.978 1.00 50.00  ? 113  G   B O6    1 
ATOM   2330  N  N1    . G   A  1  113  ? 189.495 290.432 150.722 1.00 50.00  ? 113  G   B N1    1 
ATOM   2331  C  C2    . G   A  1  113  ? 188.225 290.687 151.184 1.00 50.00  ? 113  G   B C2    1 
ATOM   2332  N  N2    . G   A  1  113  ? 187.364 291.192 150.288 1.00 50.00  ? 113  G   B N2    1 
ATOM   2333  N  N3    . G   A  1  113  ? 187.837 290.464 152.431 1.00 50.00  ? 113  G   B N3    1 
ATOM   2334  C  C4    . G   A  1  113  ? 188.835 289.956 153.189 1.00 50.00  ? 113  G   B C4    1 
ATOM   2335  P  P     . G   A  1  114  ? 186.339 285.086 156.184 1.00 50.00  ? 114  G   B P     1 
ATOM   2336  O  OP1   . G   A  1  114  ? 185.538 284.227 157.096 1.00 50.00  ? 114  G   B OP1   1 
ATOM   2337  O  OP2   . G   A  1  114  ? 187.773 284.776 155.956 1.00 50.00  ? 114  G   B OP2   1 
ATOM   2338  O  "O5'" . G   A  1  114  ? 185.609 285.114 154.768 1.00 50.00  ? 114  G   B "O5'" 1 
ATOM   2339  C  "C5'" . G   A  1  114  ? 184.268 285.566 154.645 1.00 50.00  ? 114  G   B "C5'" 1 
ATOM   2340  C  "C4'" . G   A  1  114  ? 183.983 286.073 153.255 1.00 50.00  ? 114  G   B "C4'" 1 
ATOM   2341  O  "O4'" . G   A  1  114  ? 184.994 287.043 152.876 1.00 50.00  ? 114  G   B "O4'" 1 
ATOM   2342  C  "C3'" . G   A  1  114  ? 184.029 285.035 152.144 1.00 50.00  ? 114  G   B "C3'" 1 
ATOM   2343  O  "O3'" . G   A  1  114  ? 182.827 284.292 152.029 1.00 50.00  ? 114  G   B "O3'" 1 
ATOM   2344  C  "C2'" . G   A  1  114  ? 184.344 285.878 150.915 1.00 50.00  ? 114  G   B "C2'" 1 
ATOM   2345  O  "O2'" . G   A  1  114  ? 183.178 286.543 150.452 1.00 50.00  ? 114  G   B "O2'" 1 
ATOM   2346  C  "C1'" . G   A  1  114  ? 185.291 286.920 151.501 1.00 50.00  ? 114  G   B "C1'" 1 
ATOM   2347  N  N9    . G   A  1  114  ? 186.703 286.519 151.366 1.00 50.00  ? 114  G   B N9    1 
ATOM   2348  C  C8    . G   A  1  114  ? 187.497 285.958 152.336 1.00 50.00  ? 114  G   B C8    1 
ATOM   2349  N  N7    . G   A  1  114  ? 188.710 285.710 151.925 1.00 50.00  ? 114  G   B N7    1 
ATOM   2350  C  C5    . G   A  1  114  ? 188.716 286.133 150.602 1.00 50.00  ? 114  G   B C5    1 
ATOM   2351  C  C6    . G   A  1  114  ? 189.755 286.115 149.640 1.00 50.00  ? 114  G   B C6    1 
ATOM   2352  O  O6    . G   A  1  114  ? 190.913 285.708 149.777 1.00 50.00  ? 114  G   B O6    1 
ATOM   2353  N  N1    . G   A  1  114  ? 189.336 286.637 148.422 1.00 50.00  ? 114  G   B N1    1 
ATOM   2354  C  C2    . G   A  1  114  ? 188.075 287.116 148.156 1.00 50.00  ? 114  G   B C2    1 
ATOM   2355  N  N2    . G   A  1  114  ? 187.850 287.586 146.920 1.00 50.00  ? 114  G   B N2    1 
ATOM   2356  N  N3    . G   A  1  114  ? 187.097 287.138 149.048 1.00 50.00  ? 114  G   B N3    1 
ATOM   2357  C  C4    . G   A  1  114  ? 187.484 286.635 150.241 1.00 50.00  ? 114  G   B C4    1 
ATOM   2358  P  P     . C   A  1  115  ? 182.855 282.788 151.464 1.00 50.00  ? 115  C   B P     1 
ATOM   2359  O  OP1   . C   A  1  115  ? 181.489 282.222 151.602 1.00 50.00  ? 115  C   B OP1   1 
ATOM   2360  O  OP2   . C   A  1  115  ? 184.006 282.086 152.084 1.00 50.00  ? 115  C   B OP2   1 
ATOM   2361  O  "O5'" . C   A  1  115  ? 183.161 282.962 149.909 1.00 50.00  ? 115  C   B "O5'" 1 
ATOM   2362  C  "C5'" . C   A  1  115  ? 182.279 283.687 149.065 1.00 50.00  ? 115  C   B "C5'" 1 
ATOM   2363  C  "C4'" . C   A  1  115  ? 182.886 283.932 147.706 1.00 50.00  ? 115  C   B "C4'" 1 
ATOM   2364  O  "O4'" . C   A  1  115  ? 184.133 284.663 147.847 1.00 50.00  ? 115  C   B "O4'" 1 
ATOM   2365  C  "C3'" . C   A  1  115  ? 183.276 282.690 146.919 1.00 50.00  ? 115  C   B "C3'" 1 
ATOM   2366  O  "O3'" . C   A  1  115  ? 182.174 282.084 146.261 1.00 50.00  ? 115  C   B "O3'" 1 
ATOM   2367  C  "C2'" . C   A  1  115  ? 184.341 283.222 145.967 1.00 50.00  ? 115  C   B "C2'" 1 
ATOM   2368  O  "O2'" . C   A  1  115  ? 183.743 283.904 144.874 1.00 50.00  ? 115  C   B "O2'" 1 
ATOM   2369  C  "C1'" . C   A  1  115  ? 185.048 284.251 146.851 1.00 50.00  ? 115  C   B "C1'" 1 
ATOM   2370  N  N1    . C   A  1  115  ? 186.251 283.691 147.511 1.00 50.00  ? 115  C   B N1    1 
ATOM   2371  C  C2    . C   A  1  115  ? 187.452 283.619 146.795 1.00 50.00  ? 115  C   B C2    1 
ATOM   2372  O  O2    . C   A  1  115  ? 187.476 284.028 145.624 1.00 50.00  ? 115  C   B O2    1 
ATOM   2373  N  N3    . C   A  1  115  ? 188.551 283.104 147.399 1.00 50.00  ? 115  C   B N3    1 
ATOM   2374  C  C4    . C   A  1  115  ? 188.478 282.677 148.662 1.00 50.00  ? 115  C   B C4    1 
ATOM   2375  N  N4    . C   A  1  115  ? 189.580 282.176 149.223 1.00 50.00  ? 115  C   B N4    1 
ATOM   2376  C  C5    . C   A  1  115  ? 187.270 282.739 149.412 1.00 50.00  ? 115  C   B C5    1 
ATOM   2377  C  C6    . C   A  1  115  ? 186.194 283.248 148.804 1.00 50.00  ? 115  C   B C6    1 
ATOM   2378  P  P     . U   A  1  116  ? 181.600 280.678 146.782 1.00 50.00  ? 116  U   B P     1 
ATOM   2379  O  OP1   . U   A  1  116  ? 180.724 280.123 145.720 1.00 50.00  ? 116  U   B OP1   1 
ATOM   2380  O  OP2   . U   A  1  116  ? 181.059 280.866 148.152 1.00 50.00  ? 116  U   B OP2   1 
ATOM   2381  O  "O5'" . U   A  1  116  ? 182.890 279.750 146.886 1.00 50.00  ? 116  U   B "O5'" 1 
ATOM   2382  C  "C5'" . U   A  1  116  ? 183.304 278.955 145.786 1.00 50.00  ? 116  U   B "C5'" 1 
ATOM   2383  C  "C4'" . U   A  1  116  ? 184.302 279.680 144.919 1.00 50.00  ? 116  U   B "C4'" 1 
ATOM   2384  O  "O4'" . U   A  1  116  ? 185.457 280.059 145.710 1.00 50.00  ? 116  U   B "O4'" 1 
ATOM   2385  C  "C3'" . U   A  1  116  ? 184.887 278.876 143.769 1.00 50.00  ? 116  U   B "C3'" 1 
ATOM   2386  O  "O3'" . U   A  1  116  ? 184.032 278.836 142.639 1.00 50.00  ? 116  U   B "O3'" 1 
ATOM   2387  C  "C2'" . U   A  1  116  ? 186.212 279.582 143.506 1.00 50.00  ? 116  U   B "C2'" 1 
ATOM   2388  O  "O2'" . U   A  1  116  ? 186.011 280.760 142.740 1.00 50.00  ? 116  U   B "O2'" 1 
ATOM   2389  C  "C1'" . U   A  1  116  ? 186.627 279.990 144.920 1.00 50.00  ? 116  U   B "C1'" 1 
ATOM   2390  N  N1    . U   A  1  116  ? 187.559 279.019 145.541 1.00 50.00  ? 116  U   B N1    1 
ATOM   2391  C  C2    . U   A  1  116  ? 188.904 279.120 145.234 1.00 50.00  ? 116  U   B C2    1 
ATOM   2392  O  O2    . U   A  1  116  ? 189.350 279.963 144.475 1.00 50.00  ? 116  U   B O2    1 
ATOM   2393  N  N3    . U   A  1  116  ? 189.705 278.189 145.850 1.00 50.00  ? 116  U   B N3    1 
ATOM   2394  C  C4    . U   A  1  116  ? 189.306 277.194 146.720 1.00 50.00  ? 116  U   B C4    1 
ATOM   2395  O  O4    . U   A  1  116  ? 190.158 276.442 147.191 1.00 50.00  ? 116  U   B O4    1 
ATOM   2396  C  C5    . U   A  1  116  ? 187.903 277.161 146.991 1.00 50.00  ? 116  U   B C5    1 
ATOM   2397  C  C6    . U   A  1  116  ? 187.099 278.054 146.406 1.00 50.00  ? 116  U   B C6    1 
ATOM   2398  P  P     . A   A  1  117  ? 183.038 277.590 142.419 1.00 50.00  ? 117  A   B P     1 
ATOM   2399  O  OP1   . A   A  1  117  ? 181.667 278.126 142.218 1.00 50.00  ? 117  A   B OP1   1 
ATOM   2400  O  OP2   . A   A  1  117  ? 183.286 276.606 143.502 1.00 50.00  ? 117  A   B OP2   1 
ATOM   2401  O  "O5'" . A   A  1  117  ? 183.522 276.948 141.045 1.00 50.00  ? 117  A   B "O5'" 1 
ATOM   2402  C  "C5'" . A   A  1  117  ? 184.907 276.806 140.757 1.00 50.00  ? 117  A   B "C5'" 1 
ATOM   2403  C  "C4'" . A   A  1  117  ? 185.292 275.363 140.531 1.00 50.00  ? 117  A   B "C4'" 1 
ATOM   2404  O  "O4'" . A   A  1  117  ? 186.739 275.275 140.445 1.00 50.00  ? 117  A   B "O4'" 1 
ATOM   2405  C  "C3'" . A   A  1  117  ? 184.874 274.402 141.641 1.00 50.00  ? 117  A   B "C3'" 1 
ATOM   2406  O  "O3'" . A   A  1  117  ? 184.601 273.118 141.078 1.00 50.00  ? 117  A   B "O3'" 1 
ATOM   2407  C  "C2'" . A   A  1  117  ? 186.127 274.327 142.505 1.00 50.00  ? 117  A   B "C2'" 1 
ATOM   2408  O  "O2'" . A   A  1  117  ? 186.234 273.154 143.283 1.00 50.00  ? 117  A   B "O2'" 1 
ATOM   2409  C  "C1'" . A   A  1  117  ? 187.231 274.413 141.455 1.00 50.00  ? 117  A   B "C1'" 1 
ATOM   2410  N  N9    . A   A  1  117  ? 188.483 274.977 141.961 1.00 50.00  ? 117  A   B N9    1 
ATOM   2411  C  C8    . A   A  1  117  ? 188.697 275.593 143.169 1.00 50.00  ? 117  A   B C8    1 
ATOM   2412  N  N7    . A   A  1  117  ? 189.930 276.001 143.344 1.00 50.00  ? 117  A   B N7    1 
ATOM   2413  C  C5    . A   A  1  117  ? 190.572 275.629 142.170 1.00 50.00  ? 117  A   B C5    1 
ATOM   2414  C  C6    . A   A  1  117  ? 191.898 275.778 141.728 1.00 50.00  ? 117  A   B C6    1 
ATOM   2415  N  N6    . A   A  1  117  ? 192.858 276.364 142.450 1.00 50.00  ? 117  A   B N6    1 
ATOM   2416  N  N1    . A   A  1  117  ? 192.212 275.295 140.506 1.00 50.00  ? 117  A   B N1    1 
ATOM   2417  C  C2    . A   A  1  117  ? 191.251 274.707 139.783 1.00 50.00  ? 117  A   B C2    1 
ATOM   2418  N  N3    . A   A  1  117  ? 189.970 274.509 140.088 1.00 50.00  ? 117  A   B N3    1 
ATOM   2419  C  C4    . A   A  1  117  ? 189.693 274.998 141.309 1.00 50.00  ? 117  A   B C4    1 
ATOM   2420  N  N     . LYS B  2  107  ? 266.499 250.369 325.450 1.00 169.78 ? 107  LYS D N     1 
ATOM   2421  C  CA    . LYS B  2  107  ? 265.309 249.656 324.970 1.00 174.42 ? 107  LYS D CA    1 
ATOM   2422  C  C     . LYS B  2  107  ? 265.149 248.282 325.579 1.00 177.30 ? 107  LYS D C     1 
ATOM   2423  O  O     . LYS B  2  107  ? 264.052 247.977 326.046 1.00 180.01 ? 107  LYS D O     1 
ATOM   2424  N  N     . GLU B  2  108  ? 266.204 247.473 325.644 1.00 172.71 ? 108  GLU D N     1 
ATOM   2425  C  CA    . GLU B  2  108  ? 266.099 246.139 326.226 1.00 164.75 ? 108  GLU D CA    1 
ATOM   2426  C  C     . GLU B  2  108  ? 265.937 246.163 327.740 1.00 166.74 ? 108  GLU D C     1 
ATOM   2427  O  O     . GLU B  2  108  ? 265.121 245.403 328.290 1.00 167.83 ? 108  GLU D O     1 
ATOM   2428  N  N     . THR B  2  109  ? 266.696 247.016 328.420 1.00 168.22 ? 109  THR D N     1 
ATOM   2429  C  CA    . THR B  2  109  ? 266.483 247.222 329.840 1.00 168.09 ? 109  THR D CA    1 
ATOM   2430  C  C     . THR B  2  109  ? 265.022 247.475 330.150 1.00 171.80 ? 109  THR D C     1 
ATOM   2431  O  O     . THR B  2  109  ? 264.481 246.840 331.055 1.00 171.09 ? 109  THR D O     1 
ATOM   2432  N  N     . ARG B  2  110  ? 264.363 248.353 329.404 1.00 176.04 ? 110  ARG D N     1 
ATOM   2433  C  CA    . ARG B  2  110  ? 262.968 248.626 329.704 1.00 175.85 ? 110  ARG D CA    1 
ATOM   2434  C  C     . ARG B  2  110  ? 262.057 247.515 329.195 1.00 175.38 ? 110  ARG D C     1 
ATOM   2435  O  O     . ARG B  2  110  ? 261.022 247.234 329.817 1.00 177.87 ? 110  ARG D O     1 
ATOM   2436  N  N     . GLU B  2  111  ? 262.447 246.849 328.103 1.00 174.37 ? 111  GLU D N     1 
ATOM   2437  C  CA    . GLU B  2  111  ? 261.759 245.641 327.671 1.00 174.34 ? 111  GLU D CA    1 
ATOM   2438  C  C     . GLU B  2  111  ? 261.529 244.718 328.835 1.00 171.40 ? 111  GLU D C     1 
ATOM   2439  O  O     . GLU B  2  111  ? 260.440 244.160 328.972 1.00 171.95 ? 111  GLU D O     1 
ATOM   2440  N  N     . THR B  2  112  ? 262.547 244.515 329.674 1.00 165.84 ? 112  THR D N     1 
ATOM   2441  C  CA    . THR B  2  112  ? 262.304 243.662 330.827 1.00 163.28 ? 112  THR D CA    1 
ATOM   2442  C  C     . THR B  2  112  ? 261.913 244.439 332.078 1.00 156.55 ? 112  THR D C     1 
ATOM   2443  O  O     . THR B  2  112  ? 261.450 243.831 333.049 1.00 152.13 ? 112  THR D O     1 
ATOM   2444  N  N     . TYR B  2  113  ? 262.048 245.760 332.091 1.00 151.12 ? 113  TYR D N     1 
ATOM   2445  C  CA    . TYR B  2  113  ? 261.648 246.485 333.286 1.00 145.95 ? 113  TYR D CA    1 
ATOM   2446  C  C     . TYR B  2  113  ? 260.140 246.486 333.434 1.00 147.61 ? 113  TYR D C     1 
ATOM   2447  O  O     . TYR B  2  113  ? 259.612 246.297 334.540 1.00 144.66 ? 113  TYR D O     1 
ATOM   2448  N  N     . GLU B  2  114  ? 259.425 246.694 332.331 1.00 148.39 ? 114  GLU D N     1 
ATOM   2449  C  CA    . GLU B  2  114  ? 257.982 246.522 332.400 1.00 147.82 ? 114  GLU D CA    1 
ATOM   2450  C  C     . GLU B  2  114  ? 257.633 245.199 333.053 1.00 150.42 ? 114  GLU D C     1 
ATOM   2451  O  O     . GLU B  2  114  ? 257.037 245.174 334.135 1.00 155.30 ? 114  GLU D O     1 
ATOM   2452  N  N     . VAL B  2  115  ? 258.046 244.086 332.457 1.00 148.26 ? 115  VAL D N     1 
ATOM   2453  C  CA    . VAL B  2  115  ? 257.647 242.799 333.006 1.00 141.61 ? 115  VAL D CA    1 
ATOM   2454  C  C     . VAL B  2  115  ? 258.055 242.615 334.459 1.00 140.35 ? 115  VAL D C     1 
ATOM   2455  O  O     . VAL B  2  115  ? 257.350 241.916 335.200 1.00 139.71 ? 115  VAL D O     1 
ATOM   2456  N  N     . LEU B  2  116  ? 259.140 243.245 334.900 1.00 140.60 ? 116  LEU D N     1 
ATOM   2457  C  CA    . LEU B  2  116  ? 259.359 243.319 336.338 1.00 141.88 ? 116  LEU D CA    1 
ATOM   2458  C  C     . LEU B  2  116  ? 258.155 243.944 337.022 1.00 141.14 ? 116  LEU D C     1 
ATOM   2459  O  O     . LEU B  2  116  ? 257.646 243.407 338.018 1.00 141.47 ? 116  LEU D O     1 
ATOM   2460  N  N     . LEU B  2  117  ? 257.651 245.061 336.491 1.00 135.05 ? 117  LEU D N     1 
ATOM   2461  C  CA    . LEU B  2  117  ? 256.466 245.651 337.110 1.00 128.29 ? 117  LEU D CA    1 
ATOM   2462  C  C     . LEU B  2  117  ? 255.273 244.717 337.065 1.00 125.61 ? 117  LEU D C     1 
ATOM   2463  O  O     . LEU B  2  117  ? 254.451 244.713 337.993 1.00 125.43 ? 117  LEU D O     1 
ATOM   2464  N  N     . SER B  2  118  ? 255.143 243.930 336.005 1.00 126.95 ? 118  SER D N     1 
ATOM   2465  C  CA    . SER B  2  118  ? 254.082 242.940 336.007 1.00 130.79 ? 118  SER D CA    1 
ATOM   2466  C  C     . SER B  2  118  ? 254.204 242.038 337.208 1.00 130.26 ? 118  SER D C     1 
ATOM   2467  O  O     . SER B  2  118  ? 253.244 241.869 337.960 1.00 128.07 ? 118  SER D O     1 
ATOM   2468  N  N     . PHE B  2  119  ? 255.376 241.448 337.407 1.00 130.93 ? 119  PHE D N     1 
ATOM   2469  C  CA    . PHE B  2  119  ? 255.536 240.568 338.553 1.00 134.48 ? 119  PHE D CA    1 
ATOM   2470  C  C     . PHE B  2  119  ? 255.100 241.260 339.824 1.00 134.46 ? 119  PHE D C     1 
ATOM   2471  O  O     . PHE B  2  119  ? 254.357 240.693 340.632 1.00 128.52 ? 119  PHE D O     1 
ATOM   2472  N  N     . ILE B  2  120  ? 255.528 242.505 340.003 1.00 132.44 ? 120  ILE D N     1 
ATOM   2473  C  CA    . ILE B  2  120  ? 255.082 243.257 341.165 1.00 128.41 ? 120  ILE D CA    1 
ATOM   2474  C  C     . ILE B  2  120  ? 253.575 243.169 341.312 1.00 129.22 ? 120  ILE D C     1 
ATOM   2475  O  O     . ILE B  2  120  ? 253.076 242.602 342.292 1.00 127.86 ? 120  ILE D O     1 
ATOM   2476  N  N     . GLN B  2  121  ? 252.826 243.695 340.345 1.00 130.10 ? 121  GLN D N     1 
ATOM   2477  C  CA    . GLN B  2  121  ? 251.374 243.708 340.504 1.00 131.28 ? 121  GLN D CA    1 
ATOM   2478  C  C     . GLN B  2  121  ? 250.851 242.322 340.816 1.00 132.75 ? 121  GLN D C     1 
ATOM   2479  O  O     . GLN B  2  121  ? 250.101 242.138 341.778 1.00 134.31 ? 121  GLN D O     1 
ATOM   2480  N  N     . ALA B  2  122  ? 251.259 241.329 340.026 1.00 135.18 ? 122  ALA D N     1 
ATOM   2481  C  CA    . ALA B  2  122  ? 250.837 239.955 340.266 1.00 138.25 ? 122  ALA D CA    1 
ATOM   2482  C  C     . ALA B  2  122  ? 250.956 239.587 341.731 1.00 140.17 ? 122  ALA D C     1 
ATOM   2483  O  O     . ALA B  2  122  ? 250.083 238.903 342.268 1.00 136.05 ? 122  ALA D O     1 
ATOM   2484  N  N     . ALA B  2  123  ? 252.015 240.044 342.390 1.00 142.11 ? 123  ALA D N     1 
ATOM   2485  C  CA    . ALA B  2  123  ? 252.186 239.739 343.805 1.00 142.96 ? 123  ALA D CA    1 
ATOM   2486  C  C     . ALA B  2  123  ? 251.241 240.571 344.652 1.00 144.16 ? 123  ALA D C     1 
ATOM   2487  O  O     . ALA B  2  123  ? 250.391 240.036 345.368 1.00 139.27 ? 123  ALA D O     1 
ATOM   2488  N  N     . LEU B  2  124  ? 251.525 241.870 344.667 1.00 148.03 ? 124  LEU D N     1 
ATOM   2489  C  CA    . LEU B  2  124  ? 250.784 242.874 345.422 1.00 151.15 ? 124  LEU D CA    1 
ATOM   2490  C  C     . LEU B  2  124  ? 249.340 243.129 345.016 1.00 148.04 ? 124  LEU D C     1 
ATOM   2491  O  O     . LEU B  2  124  ? 248.478 243.338 345.869 1.00 146.57 ? 124  LEU D O     1 
ATOM   2492  N  N     . GLY B  2  125  ? 249.076 243.113 343.715 1.00 146.32 ? 125  GLY D N     1 
ATOM   2493  C  CA    . GLY B  2  125  ? 247.746 243.417 343.225 1.00 143.73 ? 125  GLY D CA    1 
ATOM   2494  C  C     . GLY B  2  125  ? 247.739 244.844 342.710 1.00 141.60 ? 125  GLY D C     1 
ATOM   2495  O  O     . GLY B  2  125  ? 248.800 245.420 342.465 1.00 148.21 ? 125  GLY D O     1 
ATOM   2496  N  N     . ASP B  2  126  ? 246.556 245.426 342.541 1.00 121.75 ? 126  ASP D N     1 
ATOM   2497  C  CA    . ASP B  2  126  ? 246.466 246.784 342.014 1.00 116.53 ? 126  ASP D CA    1 
ATOM   2498  C  C     . ASP B  2  126  ? 246.673 247.870 343.067 1.00 112.20 ? 126  ASP D C     1 
ATOM   2499  O  O     . ASP B  2  126  ? 245.734 248.560 343.464 1.00 106.93 ? 126  ASP D O     1 
ATOM   2500  N  N     . GLN B  2  127  ? 247.919 248.007 343.510 1.00 110.52 ? 127  GLN D N     1 
ATOM   2501  C  CA    . GLN B  2  127  ? 248.306 249.018 344.488 1.00 112.61 ? 127  GLN D CA    1 
ATOM   2502  C  C     . GLN B  2  127  ? 248.380 250.387 343.818 1.00 111.70 ? 127  GLN D C     1 
ATOM   2503  O  O     . GLN B  2  127  ? 248.507 250.474 342.597 1.00 117.18 ? 127  GLN D O     1 
ATOM   2504  N  N     . PRO B  2  128  ? 248.303 251.466 344.613 1.00 109.97 ? 128  PRO D N     1 
ATOM   2505  C  CA    . PRO B  2  128  ? 248.382 252.784 343.972 1.00 108.44 ? 128  PRO D CA    1 
ATOM   2506  C  C     . PRO B  2  128  ? 249.731 252.957 343.279 1.00 107.03 ? 128  PRO D C     1 
ATOM   2507  O  O     . PRO B  2  128  ? 250.760 252.553 343.824 1.00 105.33 ? 128  PRO D O     1 
ATOM   2508  N  N     . ARG B  2  129  ? 249.727 253.563 342.095 1.00 108.53 ? 129  ARG D N     1 
ATOM   2509  C  CA    . ARG B  2  129  ? 250.954 253.737 341.336 1.00 113.23 ? 129  ARG D CA    1 
ATOM   2510  C  C     . ARG B  2  129  ? 252.155 253.804 342.253 1.00 118.25 ? 129  ARG D C     1 
ATOM   2511  O  O     . ARG B  2  129  ? 253.018 252.917 342.228 1.00 121.17 ? 129  ARG D O     1 
ATOM   2512  N  N     . ASP B  2  130  ? 252.203 254.838 343.097 1.00 125.36 ? 130  ASP D N     1 
ATOM   2513  C  CA    . ASP B  2  130  ? 253.372 255.123 343.922 1.00 131.05 ? 130  ASP D CA    1 
ATOM   2514  C  C     . ASP B  2  130  ? 253.900 253.870 344.580 1.00 130.00 ? 130  ASP D C     1 
ATOM   2515  O  O     . ASP B  2  130  ? 255.111 253.634 344.607 1.00 127.74 ? 130  ASP D O     1 
ATOM   2516  N  N     . ILE B  2  131  ? 252.996 253.055 345.089 1.00 129.77 ? 131  ILE D N     1 
ATOM   2517  C  CA    . ILE B  2  131  ? 253.383 251.865 345.811 1.00 132.40 ? 131  ILE D CA    1 
ATOM   2518  C  C     . ILE B  2  131  ? 253.906 250.809 344.850 1.00 134.69 ? 131  ILE D C     1 
ATOM   2519  O  O     . ILE B  2  131  ? 254.875 250.107 345.168 1.00 144.48 ? 131  ILE D O     1 
ATOM   2520  N  N     . LEU B  2  132  ? 253.315 250.711 343.652 1.00 133.73 ? 132  LEU D N     1 
ATOM   2521  C  CA    . LEU B  2  132  ? 253.856 249.762 342.684 1.00 132.22 ? 132  LEU D CA    1 
ATOM   2522  C  C     . LEU B  2  132  ? 255.278 250.125 342.291 1.00 135.96 ? 132  LEU D C     1 
ATOM   2523  O  O     . LEU B  2  132  ? 256.201 249.317 342.451 1.00 137.05 ? 132  LEU D O     1 
ATOM   2524  N  N     . CYS B  2  133  ? 255.499 251.331 341.773 1.00 140.66 ? 133  CYS D N     1 
ATOM   2525  C  CA    . CYS B  2  133  ? 256.826 251.626 341.237 1.00 141.78 ? 133  CYS D CA    1 
ATOM   2526  C  C     . CYS B  2  133  ? 257.848 251.785 342.355 1.00 139.59 ? 133  CYS D C     1 
ATOM   2527  O  O     . CYS B  2  133  ? 258.994 251.333 342.237 1.00 139.61 ? 133  CYS D O     1 
ATOM   2528  N  N     . GLY B  2  134  ? 257.453 252.408 343.458 1.00 137.67 ? 134  GLY D N     1 
ATOM   2529  C  CA    . GLY B  2  134  ? 258.321 252.408 344.616 1.00 134.83 ? 134  GLY D CA    1 
ATOM   2530  C  C     . GLY B  2  134  ? 258.807 251.017 344.951 1.00 131.05 ? 134  GLY D C     1 
ATOM   2531  O  O     . GLY B  2  134  ? 260.010 250.783 345.091 1.00 126.30 ? 134  GLY D O     1 
ATOM   2532  N  N     . ALA B  2  135  ? 257.882 250.063 345.052 1.00 131.14 ? 135  ALA D N     1 
ATOM   2533  C  CA    . ALA B  2  135  ? 258.282 248.685 345.309 1.00 133.81 ? 135  ALA D CA    1 
ATOM   2534  C  C     . ALA B  2  135  ? 259.284 248.203 344.276 1.00 139.66 ? 135  ALA D C     1 
ATOM   2535  O  O     . ALA B  2  135  ? 260.304 247.595 344.621 1.00 146.85 ? 135  ALA D O     1 
ATOM   2536  N  N     . ALA B  2  136  ? 259.016 248.470 343.001 1.00 139.65 ? 136  ALA D N     1 
ATOM   2537  C  CA    . ALA B  2  136  ? 259.960 248.062 341.969 1.00 141.03 ? 136  ALA D CA    1 
ATOM   2538  C  C     . ALA B  2  136  ? 261.365 248.527 342.292 1.00 140.45 ? 136  ALA D C     1 
ATOM   2539  O  O     . ALA B  2  136  ? 262.298 247.717 342.325 1.00 138.78 ? 136  ALA D O     1 
ATOM   2540  N  N     . ASP B  2  137  ? 261.520 249.822 342.549 1.00 143.85 ? 137  ASP D N     1 
ATOM   2541  C  CA    . ASP B  2  137  ? 262.787 250.360 343.008 1.00 144.12 ? 137  ASP D CA    1 
ATOM   2542  C  C     . ASP B  2  137  ? 263.360 249.540 344.147 1.00 140.76 ? 137  ASP D C     1 
ATOM   2543  O  O     . ASP B  2  137  ? 264.547 249.209 344.126 1.00 140.46 ? 137  ASP D O     1 
ATOM   2544  N  N     . GLU B  2  138  ? 262.542 249.193 345.141 1.00 137.08 ? 138  GLU D N     1 
ATOM   2545  C  CA    . GLU B  2  138  ? 263.054 248.398 346.250 1.00 138.53 ? 138  GLU D CA    1 
ATOM   2546  C  C     . GLU B  2  138  ? 263.654 247.094 345.757 1.00 140.45 ? 138  GLU D C     1 
ATOM   2547  O  O     . GLU B  2  138  ? 264.876 246.927 345.781 1.00 140.28 ? 138  GLU D O     1 
ATOM   2548  N  N     . VAL B  2  139  ? 262.824 246.159 345.285 1.00 143.44 ? 139  VAL D N     1 
ATOM   2549  C  CA    . VAL B  2  139  ? 263.358 244.848 344.922 1.00 141.77 ? 139  VAL D CA    1 
ATOM   2550  C  C     . VAL B  2  139  ? 264.544 244.967 343.981 1.00 142.42 ? 139  VAL D C     1 
ATOM   2551  O  O     . VAL B  2  139  ? 265.618 244.432 344.269 1.00 144.88 ? 139  VAL D O     1 
ATOM   2552  N  N     . LEU B  2  140  ? 264.387 245.693 342.874 1.00 144.03 ? 140  LEU D N     1 
ATOM   2553  C  CA    . LEU B  2  140  ? 265.501 245.884 341.953 1.00 143.95 ? 140  LEU D CA    1 
ATOM   2554  C  C     . LEU B  2  140  ? 266.742 246.313 342.704 1.00 148.80 ? 140  LEU D C     1 
ATOM   2555  O  O     . LEU B  2  140  ? 267.852 245.851 342.412 1.00 154.76 ? 140  LEU D O     1 
ATOM   2556  N  N     . ALA B  2  141  ? 266.587 247.174 343.702 1.00 152.05 ? 141  ALA D N     1 
ATOM   2557  C  CA    . ALA B  2  141  ? 267.765 247.626 344.424 1.00 153.12 ? 141  ALA D CA    1 
ATOM   2558  C  C     . ALA B  2  141  ? 268.351 246.504 345.260 1.00 155.68 ? 141  ALA D C     1 
ATOM   2559  O  O     . ALA B  2  141  ? 269.571 246.392 345.379 1.00 157.65 ? 141  ALA D O     1 
ATOM   2560  N  N     . VAL B  2  142  ? 267.508 245.641 345.820 1.00 157.14 ? 142  VAL D N     1 
ATOM   2561  C  CA    . VAL B  2  142  ? 268.026 244.590 346.684 1.00 161.77 ? 142  VAL D CA    1 
ATOM   2562  C  C     . VAL B  2  142  ? 268.766 243.527 345.893 1.00 167.69 ? 142  VAL D C     1 
ATOM   2563  O  O     . VAL B  2  142  ? 269.912 243.185 346.198 1.00 158.25 ? 142  VAL D O     1 
ATOM   2564  N  N     . LEU B  2  143  ? 268.120 242.980 344.876 1.00 183.32 ? 143  LEU D N     1 
ATOM   2565  C  CA    . LEU B  2  143  ? 268.717 241.853 344.184 1.00 190.86 ? 143  LEU D CA    1 
ATOM   2566  C  C     . LEU B  2  143  ? 269.989 242.256 343.453 1.00 201.17 ? 143  LEU D C     1 
ATOM   2567  O  O     . LEU B  2  143  ? 271.017 241.591 343.589 1.00 210.77 ? 143  LEU D O     1 
ATOM   2568  N  N     . LYS B  2  144  ? 269.954 243.446 342.865 1.00 205.78 ? 144  LYS D N     1 
ATOM   2569  C  CA    . LYS B  2  144  ? 270.822 243.861 341.777 1.00 205.12 ? 144  LYS D CA    1 
ATOM   2570  C  C     . LYS B  2  144  ? 272.291 243.751 342.152 1.00 212.42 ? 144  LYS D C     1 
ATOM   2571  O  O     . LYS B  2  144  ? 273.130 243.488 341.292 1.00 213.47 ? 144  LYS D O     1 
ATOM   2572  N  N     . ASN B  2  145  ? 272.612 243.941 343.426 1.00 213.28 ? 145  ASN D N     1 
ATOM   2573  C  CA    . ASN B  2  145  ? 273.999 243.813 343.841 1.00 211.97 ? 145  ASN D CA    1 
ATOM   2574  C  C     . ASN B  2  145  ? 274.335 242.335 344.012 1.00 208.77 ? 145  ASN D C     1 
ATOM   2575  O  O     . ASN B  2  145  ? 274.536 241.839 345.122 1.00 205.10 ? 145  ASN D O     1 
ATOM   2576  N  N     . GLU B  2  146  ? 274.392 241.652 342.874 1.00 206.18 ? 146  GLU D N     1 
ATOM   2577  C  CA    . GLU B  2  146  ? 274.819 240.263 342.769 1.00 203.86 ? 146  GLU D CA    1 
ATOM   2578  C  C     . GLU B  2  146  ? 276.274 240.157 343.198 1.00 206.18 ? 146  GLU D C     1 
ATOM   2579  O  O     . GLU B  2  146  ? 276.690 239.174 343.810 1.00 203.55 ? 146  GLU D O     1 
ATOM   2580  N  N     . LYS B  2  147  ? 277.040 241.193 342.871 1.00 205.18 ? 147  LYS D N     1 
ATOM   2581  C  CA    . LYS B  2  147  ? 278.446 241.262 343.229 1.00 202.68 ? 147  LYS D CA    1 
ATOM   2582  C  C     . LYS B  2  147  ? 278.499 241.175 344.745 1.00 200.23 ? 147  LYS D C     1 
ATOM   2583  O  O     . LYS B  2  147  ? 279.410 240.575 345.312 1.00 202.76 ? 147  LYS D O     1 
ATOM   2584  N  N     . LEU B  2  148  ? 277.503 241.766 345.394 1.00 195.92 ? 148  LEU D N     1 
ATOM   2585  C  CA    . LEU B  2  148  ? 277.342 241.613 346.830 1.00 189.94 ? 148  LEU D CA    1 
ATOM   2586  C  C     . LEU B  2  148  ? 277.150 240.126 347.085 1.00 189.29 ? 148  LEU D C     1 
ATOM   2587  O  O     . LEU B  2  148  ? 277.640 239.588 348.080 1.00 186.08 ? 148  LEU D O     1 
ATOM   2588  N  N     . ARG B  2  149  ? 276.436 239.459 346.182 1.00 188.43 ? 149  ARG D N     1 
ATOM   2589  C  CA    . ARG B  2  149  ? 276.279 238.011 346.261 1.00 187.67 ? 149  ARG D CA    1 
ATOM   2590  C  C     . ARG B  2  149  ? 275.575 237.588 347.554 1.00 193.49 ? 149  ARG D C     1 
ATOM   2591  O  O     . ARG B  2  149  ? 274.469 238.047 347.836 1.00 196.74 ? 149  ARG D O     1 
ATOM   2592  N  N     . ASP B  2  150  ? 276.206 236.716 348.336 1.00 194.52 ? 150  ASP D N     1 
ATOM   2593  C  CA    . ASP B  2  150  ? 275.566 236.178 349.527 1.00 188.00 ? 150  ASP D CA    1 
ATOM   2594  C  C     . ASP B  2  150  ? 274.365 235.291 349.163 1.00 184.43 ? 150  ASP D C     1 
ATOM   2595  O  O     . ASP B  2  150  ? 274.512 234.332 348.405 1.00 184.87 ? 150  ASP D O     1 
ATOM   2596  N  N     . LYS B  2  151  ? 273.191 235.730 349.577 1.00 210.83 ? 151  LYS D N     1 
ATOM   2597  C  CA    . LYS B  2  151  ? 271.950 234.992 349.411 1.00 207.79 ? 151  LYS D CA    1 
ATOM   2598  C  C     . LYS B  2  151  ? 271.554 234.565 350.824 1.00 209.34 ? 151  LYS D C     1 
ATOM   2599  O  O     . LYS B  2  151  ? 270.373 234.388 351.104 1.00 213.38 ? 151  LYS D O     1 
ATOM   2600  N  N     . GLU B  2  152  ? 272.535 234.340 351.704 1.00 205.74 ? 152  GLU D N     1 
ATOM   2601  C  CA    . GLU B  2  152  ? 272.217 234.136 353.111 1.00 202.31 ? 152  GLU D CA    1 
ATOM   2602  C  C     . GLU B  2  152  ? 271.802 235.551 353.550 1.00 206.45 ? 152  GLU D C     1 
ATOM   2603  O  O     . GLU B  2  152  ? 270.775 235.752 354.198 1.00 207.54 ? 152  GLU D O     1 
ATOM   2604  N  N     . ARG B  2  153  ? 272.643 236.521 353.167 1.00 207.08 ? 153  ARG D N     1 
ATOM   2605  C  CA    . ARG B  2  153  ? 272.428 237.947 353.380 1.00 200.03 ? 153  ARG D CA    1 
ATOM   2606  C  C     . ARG B  2  153  ? 271.263 238.371 352.499 1.00 194.10 ? 153  ARG D C     1 
ATOM   2607  O  O     . ARG B  2  153  ? 270.428 239.181 352.892 1.00 186.00 ? 153  ARG D O     1 
ATOM   2608  N  N     . ARG B  2  154  ? 271.233 237.811 351.287 1.00 193.60 ? 154  ARG D N     1 
ATOM   2609  C  CA    . ARG B  2  154  ? 270.180 238.077 350.306 1.00 196.03 ? 154  ARG D CA    1 
ATOM   2610  C  C     . ARG B  2  154  ? 268.846 237.592 350.858 1.00 204.87 ? 154  ARG D C     1 
ATOM   2611  O  O     . ARG B  2  154  ? 267.819 238.247 350.694 1.00 214.41 ? 154  ARG D O     1 
ATOM   2612  N  N     . LYS B  2  155  ? 268.873 236.427 351.504 1.00 209.09 ? 155  LYS D N     1 
ATOM   2613  C  CA    . LYS B  2  155  ? 267.706 235.850 352.156 1.00 207.74 ? 155  LYS D CA    1 
ATOM   2614  C  C     . LYS B  2  155  ? 267.291 236.782 353.291 1.00 210.08 ? 155  LYS D C     1 
ATOM   2615  O  O     . LYS B  2  155  ? 266.108 236.985 353.520 1.00 203.24 ? 155  LYS D O     1 
ATOM   2616  N  N     . GLU B  2  156  ? 268.272 237.303 354.029 1.00 209.62 ? 156  GLU D N     1 
ATOM   2617  C  CA    . GLU B  2  156  ? 268.015 238.266 355.093 1.00 202.99 ? 156  GLU D CA    1 
ATOM   2618  C  C     . GLU B  2  156  ? 267.445 239.542 354.468 1.00 208.76 ? 156  GLU D C     1 
ATOM   2619  O  O     . GLU B  2  156  ? 266.512 240.144 355.001 1.00 207.05 ? 156  GLU D O     1 
ATOM   2620  N  N     . ILE B  2  157  ? 268.017 239.946 353.331 1.00 215.18 ? 157  ILE D N     1 
ATOM   2621  C  CA    . ILE B  2  157  ? 267.566 241.130 352.595 1.00 211.25 ? 157  ILE D CA    1 
ATOM   2622  C  C     . ILE B  2  157  ? 266.140 240.890 352.116 1.00 207.22 ? 157  ILE D C     1 
ATOM   2623  O  O     . ILE B  2  157  ? 265.285 241.772 352.190 1.00 209.26 ? 157  ILE D O     1 
ATOM   2624  N  N     . ASP B  2  158  ? 265.897 239.674 351.623 1.00 195.27 ? 158  ASP D N     1 
ATOM   2625  C  CA    . ASP B  2  158  ? 264.575 239.229 351.190 1.00 184.60 ? 158  ASP D CA    1 
ATOM   2626  C  C     . ASP B  2  158  ? 263.658 239.173 352.413 1.00 180.21 ? 158  ASP D C     1 
ATOM   2627  O  O     . ASP B  2  158  ? 262.483 239.536 352.346 1.00 172.29 ? 158  ASP D O     1 
ATOM   2628  N  N     . LEU B  2  159  ? 264.218 238.711 353.530 1.00 179.75 ? 159  LEU D N     1 
ATOM   2629  C  CA    . LEU B  2  159  ? 263.503 238.614 354.783 1.00 176.70 ? 159  LEU D CA    1 
ATOM   2630  C  C     . LEU B  2  159  ? 263.097 240.035 355.114 1.00 182.38 ? 159  LEU D C     1 
ATOM   2631  O  O     . LEU B  2  159  ? 261.971 240.262 355.556 1.00 180.92 ? 159  LEU D O     1 
ATOM   2632  N  N     . LEU B  2  160  ? 263.986 241.008 354.906 1.00 190.93 ? 160  LEU D N     1 
ATOM   2633  C  CA    . LEU B  2  160  ? 263.513 242.362 355.159 1.00 193.61 ? 160  LEU D CA    1 
ATOM   2634  C  C     . LEU B  2  160  ? 262.211 242.622 354.433 1.00 197.01 ? 160  LEU D C     1 
ATOM   2635  O  O     . LEU B  2  160  ? 261.543 243.629 354.675 1.00 193.13 ? 160  LEU D O     1 
ATOM   2636  N  N     . LEU B  2  161  ? 261.870 241.772 353.480 1.00 203.74 ? 161  LEU D N     1 
ATOM   2637  C  CA    . LEU B  2  161  ? 260.554 241.896 352.880 1.00 206.97 ? 161  LEU D CA    1 
ATOM   2638  C  C     . LEU B  2  161  ? 259.593 240.857 353.450 1.00 212.05 ? 161  LEU D C     1 
ATOM   2639  O  O     . LEU B  2  161  ? 258.399 240.866 353.142 1.00 219.04 ? 161  LEU D O     1 
ATOM   2640  N  N     . GLY B  2  162  ? 260.096 240.021 354.352 1.00 208.90 ? 162  GLY D N     1 
ATOM   2641  C  CA    . GLY B  2  162  ? 259.302 238.967 354.955 1.00 200.93 ? 162  GLY D CA    1 
ATOM   2642  C  C     . GLY B  2  162  ? 258.793 237.913 353.989 1.00 197.90 ? 162  GLY D C     1 
ATOM   2643  O  O     . GLY B  2  162  ? 259.570 237.362 353.209 1.00 194.85 ? 162  GLY D O     1 
ATOM   2644  N  N     . GLN B  2  163  ? 257.496 237.615 354.043 1.00 190.51 ? 163  GLN D N     1 
ATOM   2645  C  CA    . GLN B  2  163  ? 256.965 236.464 353.317 1.00 187.10 ? 163  GLN D CA    1 
ATOM   2646  C  C     . GLN B  2  163  ? 256.395 236.797 351.943 1.00 192.09 ? 163  GLN D C     1 
ATOM   2647  O  O     . GLN B  2  163  ? 255.412 237.526 351.814 1.00 195.23 ? 163  GLN D O     1 
ATOM   2648  N  N     . THR B  2  164  ? 257.035 236.238 350.921 1.00 197.30 ? 164  THR D N     1 
ATOM   2649  C  CA    . THR B  2  164  ? 256.590 236.352 349.537 1.00 199.78 ? 164  THR D CA    1 
ATOM   2650  C  C     . THR B  2  164  ? 256.323 234.981 348.910 1.00 200.11 ? 164  THR D C     1 
ATOM   2651  O  O     . THR B  2  164  ? 256.333 234.843 347.687 1.00 201.52 ? 164  THR D O     1 
ATOM   2652  N  N     . ASP B  2  165  ? 256.101 233.971 349.745 1.00 195.73 ? 165  ASP D N     1 
ATOM   2653  C  CA    . ASP B  2  165  ? 256.051 232.585 349.287 1.00 188.54 ? 165  ASP D CA    1 
ATOM   2654  C  C     . ASP B  2  165  ? 257.405 232.205 348.694 1.00 186.68 ? 165  ASP D C     1 
ATOM   2655  O  O     . ASP B  2  165  ? 258.435 232.480 349.308 1.00 193.04 ? 165  ASP D O     1 
ATOM   2656  N  N     . ASP B  2  166  ? 257.434 231.588 347.514 1.00 176.00 ? 166  ASP D N     1 
ATOM   2657  C  CA    . ASP B  2  166  ? 258.734 231.290 346.925 1.00 167.94 ? 166  ASP D CA    1 
ATOM   2658  C  C     . ASP B  2  166  ? 258.697 231.347 345.413 1.00 170.94 ? 166  ASP D C     1 
ATOM   2659  O  O     . ASP B  2  166  ? 259.395 232.158 344.796 1.00 165.97 ? 166  ASP D O     1 
ATOM   2660  N  N     . THR B  2  167  ? 257.902 230.479 344.803 1.00 178.86 ? 167  THR D N     1 
ATOM   2661  C  CA    . THR B  2  167  ? 258.110 230.142 343.403 1.00 184.34 ? 167  THR D CA    1 
ATOM   2662  C  C     . THR B  2  167  ? 257.981 231.362 342.503 1.00 187.05 ? 167  THR D C     1 
ATOM   2663  O  O     . THR B  2  167  ? 258.460 231.360 341.363 1.00 191.10 ? 167  THR D O     1 
ATOM   2664  N  N     . ARG B  2  168  ? 257.342 232.417 343.000 1.00 189.70 ? 168  ARG D N     1 
ATOM   2665  C  CA    . ARG B  2  168  ? 257.508 233.722 342.384 1.00 189.42 ? 168  ARG D CA    1 
ATOM   2666  C  C     . ARG B  2  168  ? 258.933 234.215 342.514 1.00 190.46 ? 168  ARG D C     1 
ATOM   2667  O  O     . ARG B  2  168  ? 259.545 234.657 341.531 1.00 190.41 ? 168  ARG D O     1 
ATOM   2668  N  N     . TYR B  2  169  ? 259.482 234.146 343.721 1.00 193.15 ? 169  TYR D N     1 
ATOM   2669  C  CA    . TYR B  2  169  ? 260.707 234.871 343.996 1.00 191.67 ? 169  TYR D CA    1 
ATOM   2670  C  C     . TYR B  2  169  ? 261.815 234.380 343.088 1.00 183.46 ? 169  TYR D C     1 
ATOM   2671  O  O     . TYR B  2  169  ? 262.800 235.084 342.861 1.00 179.80 ? 169  TYR D O     1 
ATOM   2672  N  N     . HIS B  2  170  ? 261.645 233.189 342.523 1.00 178.73 ? 170  HIS D N     1 
ATOM   2673  C  CA    . HIS B  2  170  ? 262.575 232.728 341.507 1.00 176.89 ? 170  HIS D CA    1 
ATOM   2674  C  C     . HIS B  2  170  ? 262.353 233.445 340.187 1.00 175.36 ? 170  HIS D C     1 
ATOM   2675  O  O     . HIS B  2  170  ? 263.309 233.884 339.548 1.00 169.52 ? 170  HIS D O     1 
ATOM   2676  N  N     . VAL B  2  171  ? 261.100 233.559 339.749 1.00 177.57 ? 171  VAL D N     1 
ATOM   2677  C  CA    . VAL B  2  171  ? 260.862 234.329 338.541 1.00 182.29 ? 171  VAL D CA    1 
ATOM   2678  C  C     . VAL B  2  171  ? 261.409 235.727 338.673 1.00 181.16 ? 171  VAL D C     1 
ATOM   2679  O  O     . VAL B  2  171  ? 261.852 236.303 337.682 1.00 175.37 ? 171  VAL D O     1 
ATOM   2680  N  N     . LEU B  2  172  ? 261.434 236.276 339.873 1.00 179.61 ? 172  LEU D N     1 
ATOM   2681  C  CA    . LEU B  2  172  ? 262.137 237.535 340.015 1.00 175.60 ? 172  LEU D CA    1 
ATOM   2682  C  C     . LEU B  2  172  ? 263.637 237.348 340.110 1.00 174.22 ? 172  LEU D C     1 
ATOM   2683  O  O     . LEU B  2  172  ? 264.380 238.285 339.831 1.00 184.75 ? 172  LEU D O     1 
ATOM   2684  N  N     . VAL B  2  173  ? 264.116 236.164 340.470 1.00 167.32 ? 173  VAL D N     1 
ATOM   2685  C  CA    . VAL B  2  173  ? 265.536 235.883 340.296 1.00 166.82 ? 173  VAL D CA    1 
ATOM   2686  C  C     . VAL B  2  173  ? 265.930 235.980 338.828 1.00 167.09 ? 173  VAL D C     1 
ATOM   2687  O  O     . VAL B  2  173  ? 266.593 236.937 338.415 1.00 171.33 ? 173  VAL D O     1 
ATOM   2688  N  N     . ASN B  2  174  ? 265.497 235.006 338.011 1.00 164.66 ? 174  ASN D N     1 
ATOM   2689  C  CA    . ASN B  2  174  ? 266.059 234.856 336.666 1.00 160.36 ? 174  ASN D CA    1 
ATOM   2690  C  C     . ASN B  2  174  ? 265.806 236.112 335.846 1.00 155.94 ? 174  ASN D C     1 
ATOM   2691  O  O     . ASN B  2  174  ? 266.658 236.532 335.058 1.00 156.92 ? 174  ASN D O     1 
ATOM   2692  N  N     . LEU B  2  175  ? 264.658 236.747 336.056 1.00 151.89 ? 175  LEU D N     1 
ATOM   2693  C  CA    . LEU B  2  175  ? 264.440 238.080 335.516 1.00 148.55 ? 175  LEU D CA    1 
ATOM   2694  C  C     . LEU B  2  175  ? 265.550 239.031 335.915 1.00 145.18 ? 175  LEU D C     1 
ATOM   2695  O  O     . LEU B  2  175  ? 266.229 239.601 335.060 1.00 136.57 ? 175  LEU D O     1 
ATOM   2696  N  N     . GLY B  2  176  ? 265.774 239.190 337.212 1.00 150.02 ? 176  GLY D N     1 
ATOM   2697  C  CA    . GLY B  2  176  ? 266.618 240.286 337.649 1.00 155.72 ? 176  GLY D CA    1 
ATOM   2698  C  C     . GLY B  2  176  ? 268.064 240.014 337.292 1.00 155.83 ? 176  GLY D C     1 
ATOM   2699  O  O     . GLY B  2  176  ? 268.945 240.855 337.503 1.00 151.04 ? 176  GLY D O     1 
ATOM   2700  N  N     . LYS B  2  177  ? 268.330 238.823 336.768 1.00 158.06 ? 177  LYS D N     1 
ATOM   2701  C  CA    . LYS B  2  177  ? 269.621 238.551 336.154 1.00 155.06 ? 177  LYS D CA    1 
ATOM   2702  C  C     . LYS B  2  177  ? 269.691 239.190 334.774 1.00 156.29 ? 177  LYS D C     1 
ATOM   2703  O  O     . LYS B  2  177  ? 270.773 239.521 334.283 1.00 151.79 ? 177  LYS D O     1 
ATOM   2704  N  N     . LYS B  2  178  ? 268.529 239.412 334.153 1.00 160.02 ? 178  LYS D N     1 
ATOM   2705  C  CA    . LYS B  2  178  ? 268.490 239.709 332.726 1.00 158.61 ? 178  LYS D CA    1 
ATOM   2706  C  C     . LYS B  2  178  ? 268.442 241.209 332.472 1.00 157.37 ? 178  LYS D C     1 
ATOM   2707  O  O     . LYS B  2  178  ? 268.213 241.644 331.342 1.00 156.49 ? 178  LYS D O     1 
ATOM   2708  N  N     . ILE B  2  179  ? 268.593 242.020 333.503 1.00 157.33 ? 179  ILE D N     1 
ATOM   2709  C  CA    . ILE B  2  179  ? 268.808 243.421 333.213 1.00 161.23 ? 179  ILE D CA    1 
ATOM   2710  C  C     . ILE B  2  179  ? 270.285 243.718 333.397 1.00 152.91 ? 179  ILE D C     1 
ATOM   2711  O  O     . ILE B  2  179  ? 271.058 243.670 332.440 1.00 140.96 ? 179  ILE D O     1 
ATOM   2712  N  N     . ASP B  2  264  ? 206.778 296.077 260.805 1.00 7.03   ? 264  ASP D N     1 
ATOM   2713  C  CA    . ASP B  2  264  ? 206.421 296.573 259.499 1.00 6.94   ? 264  ASP D CA    1 
ATOM   2714  C  C     . ASP B  2  264  ? 204.903 296.724 259.420 1.00 6.63   ? 264  ASP D C     1 
ATOM   2715  O  O     . ASP B  2  264  ? 204.137 296.395 260.354 1.00 6.38   ? 264  ASP D O     1 
ATOM   2716  N  N     . ALA B  2  265  ? 204.420 297.222 258.272 1.00 6.95   ? 265  ALA D N     1 
ATOM   2717  C  CA    . ALA B  2  265  ? 203.009 297.482 258.049 1.00 6.21   ? 265  ALA D CA    1 
ATOM   2718  C  C     . ALA B  2  265  ? 202.116 296.256 258.224 1.00 5.79   ? 265  ALA D C     1 
ATOM   2719  O  O     . ALA B  2  265  ? 200.916 296.433 258.486 1.00 6.73   ? 265  ALA D O     1 
ATOM   2720  N  N     . PHE B  2  266  ? 202.669 295.048 258.075 1.00 5.71   ? 266  PHE D N     1 
ATOM   2721  C  CA    . PHE B  2  266  ? 201.901 293.814 258.140 1.00 5.45   ? 266  PHE D CA    1 
ATOM   2722  C  C     . PHE B  2  266  ? 202.311 292.927 259.324 1.00 5.18   ? 266  PHE D C     1 
ATOM   2723  O  O     . PHE B  2  266  ? 201.851 291.795 259.391 1.00 6.14   ? 266  PHE D O     1 
ATOM   2724  N  N     . TRP B  2  267  ? 203.132 293.412 260.253 1.00 5.29   ? 267  TRP D N     1 
ATOM   2725  C  CA    . TRP B  2  267  ? 203.590 292.563 261.344 1.00 5.67   ? 267  TRP D CA    1 
ATOM   2726  C  C     . TRP B  2  267  ? 202.427 291.991 262.135 1.00 5.30   ? 267  TRP D C     1 
ATOM   2727  O  O     . TRP B  2  267  ? 202.383 290.797 262.417 1.00 6.01   ? 267  TRP D O     1 
ATOM   2728  N  N     . LEU B  2  268  ? 201.479 292.850 262.510 1.00 5.91   ? 268  LEU D N     1 
ATOM   2729  C  CA    . LEU B  2  268  ? 200.358 292.392 263.325 1.00 5.88   ? 268  LEU D CA    1 
ATOM   2730  C  C     . LEU B  2  268  ? 199.539 291.357 262.567 1.00 5.93   ? 268  LEU D C     1 
ATOM   2731  O  O     . LEU B  2  268  ? 199.161 290.300 263.100 1.00 6.13   ? 268  LEU D O     1 
ATOM   2732  N  N     . GLN B  2  269  ? 199.209 291.666 261.299 1.00 6.12   ? 269  GLN D N     1 
ATOM   2733  C  CA    . GLN B  2  269  ? 198.445 290.757 260.473 1.00 6.43   ? 269  GLN D CA    1 
ATOM   2734  C  C     . GLN B  2  269  ? 199.135 289.410 260.368 1.00 6.72   ? 269  GLN D C     1 
ATOM   2735  O  O     . GLN B  2  269  ? 198.476 288.359 260.373 1.00 6.99   ? 269  GLN D O     1 
ATOM   2736  N  N     . ARG B  2  270  ? 200.468 289.394 260.249 1.00 7.07   ? 270  ARG D N     1 
ATOM   2737  C  CA    . ARG B  2  270  ? 201.197 288.122 260.187 1.00 8.36   ? 270  ARG D CA    1 
ATOM   2738  C  C     . ARG B  2  270  ? 201.125 287.366 261.481 1.00 7.94   ? 270  ARG D C     1 
ATOM   2739  O  O     . ARG B  2  270  ? 201.004 286.142 261.461 1.00 10.22  ? 270  ARG D O     1 
ATOM   2740  N  N     . GLN B  2  271  ? 201.164 288.058 262.619 1.00 7.77   ? 271  GLN D N     1 
ATOM   2741  C  CA    . GLN B  2  271  ? 201.038 287.311 263.871 1.00 8.27   ? 271  GLN D CA    1 
ATOM   2742  C  C     . GLN B  2  271  ? 199.659 286.683 263.962 1.00 9.62   ? 271  GLN D C     1 
ATOM   2743  O  O     . GLN B  2  271  ? 199.519 285.536 264.383 1.00 11.65  ? 271  GLN D O     1 
ATOM   2744  N  N     . LEU B  2  272  ? 198.624 287.428 263.602 1.00 8.45   ? 272  LEU D N     1 
ATOM   2745  C  CA    . LEU B  2  272  ? 197.264 286.928 263.652 1.00 8.30   ? 272  LEU D CA    1 
ATOM   2746  C  C     . LEU B  2  272  ? 197.059 285.830 262.614 1.00 8.60   ? 272  LEU D C     1 
ATOM   2747  O  O     . LEU B  2  272  ? 196.384 284.826 262.882 1.00 9.57   ? 272  LEU D O     1 
ATOM   2748  N  N     . SER B  2  273  ? 197.681 285.985 261.450 1.00 9.19   ? 273  SER D N     1 
ATOM   2749  C  CA    . SER B  2  273  ? 197.520 285.035 260.365 1.00 10.55  ? 273  SER D CA    1 
ATOM   2750  C  C     . SER B  2  273  ? 198.067 283.648 260.664 1.00 11.11  ? 273  SER D C     1 
ATOM   2751  O  O     . SER B  2  273  ? 197.694 282.649 260.027 1.00 13.33  ? 273  SER D O     1 
ATOM   2752  N  N     . ARG B  2  274  ? 198.994 283.538 261.606 1.00 11.84  ? 274  ARG D N     1 
ATOM   2753  C  CA    . ARG B  2  274  ? 199.473 282.224 261.998 1.00 13.84  ? 274  ARG D CA    1 
ATOM   2754  C  C     . ARG B  2  274  ? 198.398 281.411 262.673 1.00 14.77  ? 274  ARG D C     1 
ATOM   2755  O  O     . ARG B  2  274  ? 198.447 280.190 262.621 1.00 18.45  ? 274  ARG D O     1 
ATOM   2756  N  N     . PHE B  2  275  ? 197.421 282.086 263.289 1.00 13.80  ? 275  PHE D N     1 
ATOM   2757  C  CA    . PHE B  2  275  ? 196.287 281.454 263.950 1.00 14.05  ? 275  PHE D CA    1 
ATOM   2758  C  C     . PHE B  2  275  ? 195.045 281.431 263.039 1.00 13.05  ? 275  PHE D C     1 
ATOM   2759  O  O     . PHE B  2  275  ? 194.248 280.499 263.121 1.00 14.77  ? 275  PHE D O     1 
ATOM   2760  N  N     . TYR B  2  276  ? 194.875 282.454 262.211 1.00 11.06  ? 276  TYR D N     1 
ATOM   2761  C  CA    . TYR B  2  276  ? 193.728 282.616 261.331 1.00 11.07  ? 276  TYR D CA    1 
ATOM   2762  C  C     . TYR B  2  276  ? 194.244 282.754 259.902 1.00 11.47  ? 276  TYR D C     1 
ATOM   2763  O  O     . TYR B  2  276  ? 194.501 283.859 259.428 1.00 11.26  ? 276  TYR D O     1 
ATOM   2764  N  N     . ASP B  2  277  ? 194.429 281.636 259.203 1.00 11.82  ? 277  ASP D N     1 
ATOM   2765  C  CA    . ASP B  2  277  ? 195.035 281.715 257.862 1.00 13.13  ? 277  ASP D CA    1 
ATOM   2766  C  C     . ASP B  2  277  ? 194.140 282.339 256.793 1.00 12.93  ? 277  ASP D C     1 
ATOM   2767  O  O     . ASP B  2  277  ? 194.649 282.736 255.751 1.00 13.14  ? 277  ASP D O     1 
ATOM   2768  N  N     . ASP B  2  278  ? 192.850 282.456 257.037 1.00 11.65  ? 278  ASP D N     1 
ATOM   2769  C  CA    . ASP B  2  278  ? 191.972 283.053 256.040 1.00 11.72  ? 278  ASP D CA    1 
ATOM   2770  C  C     . ASP B  2  278  ? 192.282 284.512 255.874 1.00 10.21  ? 278  ASP D C     1 
ATOM   2771  O  O     . ASP B  2  278  ? 192.396 285.249 256.852 1.00 10.17  ? 278  ASP D O     1 
ATOM   2772  N  N     . ALA B  2  279  ? 192.420 284.966 254.625 1.00 10.87  ? 279  ALA D N     1 
ATOM   2773  C  CA    . ALA B  2  279  ? 192.827 286.345 254.371 1.00 10.29  ? 279  ALA D CA    1 
ATOM   2774  C  C     . ALA B  2  279  ? 191.825 287.353 254.906 1.00 9.78   ? 279  ALA D C     1 
ATOM   2775  O  O     . ALA B  2  279  ? 192.207 288.364 255.485 1.00 10.25  ? 279  ALA D O     1 
ATOM   2776  N  N     . ILE B  2  280  ? 190.537 287.130 254.664 1.00 9.22   ? 280  ILE D N     1 
ATOM   2777  C  CA    . ILE B  2  280  ? 189.511 288.066 255.093 1.00 9.26   ? 280  ILE D CA    1 
ATOM   2778  C  C     . ILE B  2  280  ? 189.438 288.128 256.619 1.00 9.04   ? 280  ILE D C     1 
ATOM   2779  O  O     . ILE B  2  280  ? 189.492 289.206 257.200 1.00 8.93   ? 280  ILE D O     1 
ATOM   2780  N  N     . VAL B  2  281  ? 189.339 286.971 257.266 1.00 9.25   ? 281  VAL D N     1 
ATOM   2781  C  CA    . VAL B  2  281  ? 189.219 286.950 258.723 1.00 8.57   ? 281  VAL D CA    1 
ATOM   2782  C  C     . VAL B  2  281  ? 190.464 287.544 259.382 1.00 8.01   ? 281  VAL D C     1 
ATOM   2783  O  O     . VAL B  2  281  ? 190.340 288.322 260.326 1.00 8.33   ? 281  VAL D O     1 
ATOM   2784  N  N     . SER B  2  282  ? 191.667 287.192 258.924 1.00 8.46   ? 282  SER D N     1 
ATOM   2785  C  CA    . SER B  2  282  ? 192.837 287.753 259.596 1.00 8.82   ? 282  SER D CA    1 
ATOM   2786  C  C     . SER B  2  282  ? 192.898 289.255 259.452 1.00 7.87   ? 282  SER D C     1 
ATOM   2787  O  O     . SER B  2  282  ? 193.367 289.935 260.365 1.00 7.96   ? 282  SER D O     1 
ATOM   2788  N  N     . GLN B  2  283  ? 192.424 289.782 258.320 1.00 8.05   ? 283  GLN D N     1 
ATOM   2789  C  CA    . GLN B  2  283  ? 192.432 291.215 258.135 1.00 8.34   ? 283  GLN D CA    1 
ATOM   2790  C  C     . GLN B  2  283  ? 191.395 291.884 259.064 1.00 7.46   ? 283  GLN D C     1 
ATOM   2791  O  O     . GLN B  2  283  ? 191.687 292.915 259.677 1.00 7.99   ? 283  GLN D O     1 
ATOM   2792  N  N     . LYS B  2  284  ? 190.183 291.333 259.023 1.00 7.73   ? 284  LYS D N     1 
ATOM   2793  C  CA    . LYS B  2  284  ? 189.086 291.783 259.854 1.00 8.73   ? 284  LYS D CA    1 
ATOM   2794  C  C     . LYS B  2  284  ? 189.527 291.483 261.270 1.00 8.16   ? 284  LYS D C     1 
ATOM   2795  O  O     . LYS B  2  284  ? 189.257 292.250 262.181 1.00 8.72   ? 284  LYS D O     1 
ATOM   2796  N  N     . LYS B  2  285  ? 190.132 290.314 261.460 1.00 7.18   ? 285  LYS D N     1 
ATOM   2797  C  CA    . LYS B  2  285  ? 190.662 289.955 262.766 1.00 7.37   ? 285  LYS D CA    1 
ATOM   2798  C  C     . LYS B  2  285  ? 191.839 290.873 263.091 1.00 7.04   ? 285  LYS D C     1 
ATOM   2799  O  O     . LYS B  2  285  ? 191.938 291.411 264.192 1.00 7.71   ? 285  LYS D O     1 
ATOM   2800  N  N     . ALA B  2  286  ? 192.710 291.069 262.103 1.00 7.22   ? 286  ALA D N     1 
ATOM   2801  C  CA    . ALA B  2  286  ? 193.886 291.924 262.254 1.00 7.42   ? 286  ALA D CA    1 
ATOM   2802  C  C     . ALA B  2  286  ? 193.445 293.360 262.481 1.00 7.40   ? 286  ALA D C     1 
ATOM   2803  O  O     . ALA B  2  286  ? 193.989 294.078 263.327 1.00 7.54   ? 286  ALA D O     1 
ATOM   2804  N  N     . ASP B  2  287  ? 192.427 293.761 261.723 1.00 7.97   ? 287  ASP D N     1 
ATOM   2805  C  CA    . ASP B  2  287  ? 191.864 295.100 261.823 1.00 9.04   ? 287  ASP D CA    1 
ATOM   2806  C  C     . ASP B  2  287  ? 191.264 295.297 263.208 1.00 7.99   ? 287  ASP D C     1 
ATOM   2807  O  O     . ASP B  2  287  ? 191.410 296.353 263.806 1.00 8.33   ? 287  ASP D O     1 
ATOM   2808  N  N     . GLU B  2  288  ? 190.587 294.266 263.706 1.00 7.97   ? 288  GLU D N     1 
ATOM   2809  C  CA    . GLU B  2  288  ? 189.970 294.287 265.020 1.00 8.33   ? 288  GLU D CA    1 
ATOM   2810  C  C     . GLU B  2  288  ? 191.045 294.436 266.083 1.00 7.25   ? 288  GLU D C     1 
ATOM   2811  O  O     . GLU B  2  288  ? 190.865 295.167 267.042 1.00 8.65   ? 288  GLU D O     1 
ATOM   2812  N  N     . VAL B  2  289  ? 192.164 293.737 265.908 1.00 7.00   ? 289  VAL D N     1 
ATOM   2813  C  CA    . VAL B  2  289  ? 193.274 293.817 266.853 1.00 7.28   ? 289  VAL D CA    1 
ATOM   2814  C  C     . VAL B  2  289  ? 193.829 295.238 266.867 1.00 7.38   ? 289  VAL D C     1 
ATOM   2815  O  O     . VAL B  2  289  ? 194.118 295.797 267.930 1.00 8.10   ? 289  VAL D O     1 
ATOM   2816  N  N     . LEU B  2  290  ? 193.947 295.833 265.680 1.00 7.61   ? 290  LEU D N     1 
ATOM   2817  C  CA    . LEU B  2  290  ? 194.443 297.202 265.561 1.00 7.66   ? 290  LEU D CA    1 
ATOM   2818  C  C     . LEU B  2  290  ? 193.484 298.164 266.261 1.00 9.49   ? 290  LEU D C     1 
ATOM   2819  O  O     . LEU B  2  290  ? 193.905 299.093 266.953 1.00 11.15  ? 290  LEU D O     1 
ATOM   2820  N  N     . GLU B  2  291  ? 192.188 297.918 266.080 1.00 9.06   ? 291  GLU D N     1 
ATOM   2821  C  CA    . GLU B  2  291  ? 191.142 298.721 266.683 1.00 10.88  ? 291  GLU D CA    1 
ATOM   2822  C  C     . GLU B  2  291  ? 191.223 298.611 268.196 1.00 10.49  ? 291  GLU D C     1 
ATOM   2823  O  O     . GLU B  2  291  ? 191.045 299.593 268.886 1.00 12.51  ? 291  GLU D O     1 
ATOM   2824  N  N     . ILE B  2  292  ? 191.481 297.408 268.700 1.00 10.09  ? 292  ILE D N     1 
ATOM   2825  C  CA    . ILE B  2  292  ? 191.606 297.160 270.130 1.00 10.31  ? 292  ILE D CA    1 
ATOM   2826  C  C     . ILE B  2  292  ? 192.798 297.929 270.678 1.00 10.39  ? 292  ILE D C     1 
ATOM   2827  O  O     . ILE B  2  292  ? 192.729 298.509 271.763 1.00 12.01  ? 292  ILE D O     1 
ATOM   2828  N  N     . LEU B  2  293  ? 193.892 297.938 269.918 1.00 10.21  ? 293  LEU D N     1 
ATOM   2829  C  CA    . LEU B  2  293  ? 195.090 298.666 270.325 1.00 11.30  ? 293  LEU D CA    1 
ATOM   2830  C  C     . LEU B  2  293  ? 194.776 300.158 270.404 1.00 12.64  ? 293  LEU D C     1 
ATOM   2831  O  O     . LEU B  2  293  ? 195.200 300.845 271.334 1.00 15.11  ? 293  LEU D O     1 
ATOM   2832  N  N     . LYS B  2  294  ? 194.027 300.650 269.419 1.00 13.15  ? 294  LYS D N     1 
ATOM   2833  C  CA    . LYS B  2  294  ? 193.610 302.048 269.369 1.00 15.73  ? 294  LYS D CA    1 
ATOM   2834  C  C     . LYS B  2  294  ? 192.681 302.390 270.534 1.00 18.15  ? 294  LYS D C     1 
ATOM   2835  O  O     . LYS B  2  294  ? 192.737 303.484 271.097 1.00 20.18  ? 294  LYS D O     1 
ATOM   2836  N  N     . THR B  2  295  ? 191.829 301.432 270.880 1.00 17.76  ? 295  THR D N     1 
ATOM   2837  C  CA    . THR B  2  295  ? 190.829 301.578 271.920 1.00 19.70  ? 295  THR D CA    1 
ATOM   2838  C  C     . THR B  2  295  ? 191.459 301.863 273.261 1.00 23.21  ? 295  THR D C     1 
ATOM   2839  O  O     . THR B  2  295  ? 190.956 302.710 274.000 1.00 25.50  ? 295  THR D O     1 
ATOM   2840  N  N     . ALA B  2  296  ? 192.548 301.185 273.611 1.00 25.91  ? 296  ALA D N     1 
ATOM   2841  C  CA    . ALA B  2  296  ? 193.120 301.566 274.895 1.00 31.62  ? 296  ALA D CA    1 
ATOM   2842  C  C     . ALA B  2  296  ? 192.202 301.405 276.096 1.00 36.11  ? 296  ALA D C     1 
ATOM   2843  O  O     . ALA B  2  296  ? 191.706 300.314 276.377 1.00 35.90  ? 296  ALA D O     1 
ATOM   2844  N  N     . SER B  2  297  ? 191.982 302.510 276.801 1.00 39.27  ? 297  SER D N     1 
ATOM   2845  C  CA    . SER B  2  297  ? 191.175 302.498 278.011 1.00 41.96  ? 297  SER D CA    1 
ATOM   2846  C  C     . SER B  2  297  ? 191.912 301.653 279.040 1.00 43.81  ? 297  SER D C     1 
ATOM   2847  O  O     . SER B  2  297  ? 193.092 301.888 279.301 1.00 44.66  ? 297  SER D O     1 
ATOM   2848  N  N     . ASP B  2  298  ? 191.237 300.673 279.627 1.00 39.65  ? 298  ASP D N     1 
ATOM   2849  C  CA    . ASP B  2  298  ? 191.890 299.845 280.630 1.00 39.85  ? 298  ASP D CA    1 
ATOM   2850  C  C     . ASP B  2  298  ? 192.278 298.471 280.101 1.00 36.12  ? 298  ASP D C     1 
ATOM   2851  O  O     . ASP B  2  298  ? 191.437 297.719 279.608 1.00 36.94  ? 298  ASP D O     1 
ATOM   2852  N  N     . ASP B  2  299  ? 193.564 298.152 280.212 1.00 32.56  ? 299  ASP D N     1 
ATOM   2853  C  CA    . ASP B  2  299  ? 194.075 296.863 279.777 1.00 31.31  ? 299  ASP D CA    1 
ATOM   2854  C  C     . ASP B  2  299  ? 193.043 295.776 280.027 1.00 28.96  ? 299  ASP D C     1 
ATOM   2855  O  O     . ASP B  2  299  ? 192.859 294.882 279.202 1.00 29.53  ? 299  ASP D O     1 
ATOM   2856  N  N     . ARG B  2  300  ? 192.370 295.856 281.168 1.00 18.36  ? 300  ARG D N     1 
ATOM   2857  C  CA    . ARG B  2  300  ? 191.405 294.833 281.531 1.00 17.54  ? 300  ARG D CA    1 
ATOM   2858  C  C     . ARG B  2  300  ? 190.335 294.753 280.449 1.00 17.05  ? 300  ARG D C     1 
ATOM   2859  O  O     . ARG B  2  300  ? 189.937 293.664 280.037 1.00 17.53  ? 300  ARG D O     1 
ATOM   2860  N  N     . GLU B  2  301  ? 189.882 295.911 279.983 1.00 15.99  ? 301  GLU D N     1 
ATOM   2861  C  CA    . GLU B  2  301  ? 188.888 295.963 278.919 1.00 16.24  ? 301  GLU D CA    1 
ATOM   2862  C  C     . GLU B  2  301  ? 189.438 295.379 277.625 1.00 14.49  ? 301  GLU D C     1 
ATOM   2863  O  O     . GLU B  2  301  ? 188.754 294.634 276.925 1.00 13.95  ? 301  GLU D O     1 
ATOM   2864  N  N     . CYS B  2  302  ? 190.684 295.722 277.318 1.00 12.96  ? 302  CYS D N     1 
ATOM   2865  C  CA    . CYS B  2  302  ? 191.333 295.228 276.113 1.00 12.77  ? 302  CYS D CA    1 
ATOM   2866  C  C     . CYS B  2  302  ? 191.479 293.716 276.180 1.00 11.54  ? 302  CYS D C     1 
ATOM   2867  O  O     . CYS B  2  302  ? 191.246 293.014 275.196 1.00 11.50  ? 302  CYS D O     1 
ATOM   2868  N  N     . GLU B  2  303  ? 191.848 293.220 277.356 1.00 11.67  ? 303  GLU D N     1 
ATOM   2869  C  CA    . GLU B  2  303  ? 191.958 291.787 277.571 1.00 11.60  ? 303  GLU D CA    1 
ATOM   2870  C  C     . GLU B  2  303  ? 190.576 291.186 277.384 1.00 10.78  ? 303  GLU D C     1 
ATOM   2871  O  O     . GLU B  2  303  ? 190.422 290.114 276.800 1.00 11.53  ? 303  GLU D O     1 
ATOM   2872  N  N     . ASN B  2  304  ? 189.569 291.899 277.873 1.00 11.98  ? 304  ASN D N     1 
ATOM   2873  C  CA    . ASN B  2  304  ? 188.189 291.467 277.730 1.00 13.91  ? 304  ASN D CA    1 
ATOM   2874  C  C     . ASN B  2  304  ? 187.805 291.397 276.263 1.00 12.06  ? 304  ASN D C     1 
ATOM   2875  O  O     . ASN B  2  304  ? 187.107 290.479 275.836 1.00 12.85  ? 304  ASN D O     1 
ATOM   2876  N  N     . GLN B  2  305  ? 188.260 292.376 275.491 1.00 11.83  ? 305  GLN D N     1 
ATOM   2877  C  CA    . GLN B  2  305  ? 187.895 292.451 274.103 1.00 11.89  ? 305  GLN D CA    1 
ATOM   2878  C  C     . GLN B  2  305  ? 188.865 291.664 273.235 1.00 11.38  ? 305  GLN D C     1 
ATOM   2879  O  O     . GLN B  2  305  ? 188.467 290.986 272.294 1.00 10.86  ? 305  GLN D O     1 
ATOM   2880  N  N     . LEU B  2  306  ? 190.157 291.732 273.533 1.00 9.98   ? 306  LEU D N     1 
ATOM   2881  C  CA    . LEU B  2  306  ? 191.138 290.992 272.750 1.00 10.12  ? 306  LEU D CA    1 
ATOM   2882  C  C     . LEU B  2  306  ? 190.973 289.469 272.948 1.00 10.60  ? 306  LEU D C     1 
ATOM   2883  O  O     . LEU B  2  306  ? 191.145 288.679 272.008 1.00 10.58  ? 306  LEU D O     1 
ATOM   2884  N  N     . VAL B  2  307  ? 190.673 289.055 274.187 1.00 10.39  ? 307  VAL D N     1 
ATOM   2885  C  CA    . VAL B  2  307  ? 190.527 287.626 274.410 1.00 10.42  ? 307  VAL D CA    1 
ATOM   2886  C  C     . VAL B  2  307  ? 189.350 287.088 273.580 1.00 10.29  ? 307  VAL D C     1 
ATOM   2887  O  O     . VAL B  2  307  ? 189.432 285.992 273.030 1.00 10.92  ? 307  VAL D O     1 
ATOM   2888  N  N     . LEU B  2  308  ? 188.236 287.822 273.534 1.00 11.18  ? 308  LEU D N     1 
ATOM   2889  C  CA    . LEU B  2  308  ? 187.108 287.419 272.722 1.00 11.65  ? 308  LEU D CA    1 
ATOM   2890  C  C     . LEU B  2  308  ? 187.462 287.414 271.222 1.00 11.28  ? 308  LEU D C     1 
ATOM   2891  O  O     . LEU B  2  308  ? 187.052 286.512 270.501 1.00 12.04  ? 308  LEU D O     1 
ATOM   2892  N  N     . LEU B  2  309  ? 188.254 288.391 270.784 1.00 11.62  ? 309  LEU D N     1 
ATOM   2893  C  CA    . LEU B  2  309  ? 188.636 288.474 269.387 1.00 9.95   ? 309  LEU D CA    1 
ATOM   2894  C  C     . LEU B  2  309  ? 189.389 287.222 268.962 1.00 10.17  ? 309  LEU D C     1 
ATOM   2895  O  O     . LEU B  2  309  ? 189.285 286.772 267.808 1.00 10.92  ? 309  LEU D O     1 
ATOM   2896  N  N     . LEU B  2  310  ? 190.152 286.654 269.888 1.00 9.82   ? 310  LEU D N     1 
ATOM   2897  C  CA    . LEU B  2  310  ? 190.967 285.471 269.658 1.00 9.71   ? 310  LEU D CA    1 
ATOM   2898  C  C     . LEU B  2  310  ? 190.252 284.196 270.154 1.00 9.47   ? 310  LEU D C     1 
ATOM   2899  O  O     . LEU B  2  310  ? 190.908 283.184 270.412 1.00 9.94   ? 310  LEU D O     1 
ATOM   2900  N  N     . GLY B  2  311  ? 188.921 284.248 270.269 1.00 9.63   ? 311  GLY D N     1 
ATOM   2901  C  CA    . GLY B  2  311  ? 188.144 283.026 270.531 1.00 10.33  ? 311  GLY D CA    1 
ATOM   2902  C  C     . GLY B  2  311  ? 188.543 282.308 271.826 1.00 10.11  ? 311  GLY D C     1 
ATOM   2903  O  O     . GLY B  2  311  ? 188.395 281.074 271.952 1.00 11.78  ? 311  GLY D O     1 
ATOM   2904  N  N     . PHE B  2  312  ? 188.988 283.097 272.798 1.00 9.98   ? 312  PHE D N     1 
ATOM   2905  C  CA    . PHE B  2  312  ? 189.296 282.604 274.156 1.00 10.13  ? 312  PHE D CA    1 
ATOM   2906  C  C     . PHE B  2  312  ? 190.422 281.590 274.122 1.00 10.55  ? 312  PHE D C     1 
ATOM   2907  O  O     . PHE B  2  312  ? 190.590 280.806 275.075 1.00 12.79  ? 312  PHE D O     1 
ATOM   2908  N  N     . ASN B  2  313  ? 191.249 281.682 273.087 1.00 9.39   ? 313  ASN D N     1 
ATOM   2909  C  CA    . ASN B  2  313  ? 192.432 280.891 273.003 1.00 10.01  ? 313  ASN D CA    1 
ATOM   2910  C  C     . ASN B  2  313  ? 193.607 281.808 272.633 1.00 9.03   ? 313  ASN D C     1 
ATOM   2911  O  O     . ASN B  2  313  ? 193.484 283.007 272.529 1.00 9.26   ? 313  ASN D O     1 
ATOM   2912  N  N     . THR B  2  314  ? 194.779 281.219 272.496 1.00 13.69  ? 314  THR D N     1 
ATOM   2913  C  CA    . THR B  2  314  ? 196.017 281.930 272.191 1.00 14.30  ? 314  THR D CA    1 
ATOM   2914  C  C     . THR B  2  314  ? 196.221 283.122 273.097 1.00 13.54  ? 314  THR D C     1 
ATOM   2915  O  O     . THR B  2  314  ? 196.578 284.234 272.708 1.00 12.32  ? 314  THR D O     1 
ATOM   2916  N  N     . PHE B  2  315  ? 196.089 282.839 274.393 1.00 14.62  ? 315  PHE D N     1 
ATOM   2917  C  CA    . PHE B  2  315  ? 196.314 283.877 275.401 1.00 13.76  ? 315  PHE D CA    1 
ATOM   2918  C  C     . PHE B  2  315  ? 197.728 284.462 275.357 1.00 11.79  ? 315  PHE D C     1 
ATOM   2919  O  O     . PHE B  2  315  ? 197.938 285.642 275.633 1.00 11.28  ? 315  PHE D O     1 
ATOM   2920  N  N     . ASP B  2  316  ? 198.706 283.645 275.024 1.00 13.03  ? 316  ASP D N     1 
ATOM   2921  C  CA    . ASP B  2  316  ? 200.074 284.163 274.933 1.00 11.98  ? 316  ASP D CA    1 
ATOM   2922  C  C     . ASP B  2  316  ? 200.177 285.269 273.870 1.00 10.82  ? 316  ASP D C     1 
ATOM   2923  O  O     . ASP B  2  316  ? 200.862 286.279 274.065 1.00 10.71  ? 316  ASP D O     1 
ATOM   2924  N  N     . PHE B  2  317  ? 199.495 285.095 272.740 1.00 11.46  ? 317  PHE D N     1 
ATOM   2925  C  CA    . PHE B  2  317  ? 199.502 286.122 271.696 1.00 11.89  ? 317  PHE D CA    1 
ATOM   2926  C  C     . PHE B  2  317  ? 198.772 287.347 272.217 1.00 10.49  ? 317  PHE D C     1 
ATOM   2927  O  O     . PHE B  2  317  ? 199.237 288.483 272.056 1.00 10.60  ? 317  PHE D O     1 
ATOM   2928  N  N     . ILE B  2  318  ? 197.615 287.135 272.846 1.00 11.16  ? 318  ILE D N     1 
ATOM   2929  C  CA    . ILE B  2  318  ? 196.876 288.238 273.434 1.00 11.57  ? 318  ILE D CA    1 
ATOM   2930  C  C     . ILE B  2  318  ? 197.779 289.080 274.363 1.00 10.25  ? 318  ILE D C     1 
ATOM   2931  O  O     . ILE B  2  318  ? 197.856 290.308 274.245 1.00 10.06  ? 318  ILE D O     1 
ATOM   2932  N  N     . LYS B  2  319  ? 198.476 288.423 275.292 1.00 9.73   ? 319  LYS D N     1 
ATOM   2933  C  CA    . LYS B  2  319  ? 199.336 289.161 276.267 1.00 10.22  ? 319  LYS D CA    1 
ATOM   2934  C  C     . LYS B  2  319  ? 200.483 289.826 275.553 1.00 8.28   ? 319  LYS D C     1 
ATOM   2935  O  O     . LYS B  2  319  ? 200.848 290.921 275.912 1.00 8.02   ? 319  LYS D O     1 
ATOM   2936  N  N     . VAL B  2  320  ? 201.078 289.165 274.564 1.00 7.72   ? 320  VAL D N     1 
ATOM   2937  C  CA    . VAL B  2  320  ? 202.167 289.799 273.822 1.00 7.28   ? 320  VAL D CA    1 
ATOM   2938  C  C     . VAL B  2  320  ? 201.715 291.125 273.195 1.00 6.72   ? 320  VAL D C     1 
ATOM   2939  O  O     . VAL B  2  320  ? 202.435 292.123 273.208 1.00 7.19   ? 320  VAL D O     1 
ATOM   2940  N  N     . LEU B  2  321  ? 200.515 291.118 272.619 1.00 7.29   ? 321  LEU D N     1 
ATOM   2941  C  CA    . LEU B  2  321  ? 200.010 292.323 271.996 1.00 8.10   ? 321  LEU D CA    1 
ATOM   2942  C  C     . LEU B  2  321  ? 199.746 293.425 273.027 1.00 7.59   ? 321  LEU D C     1 
ATOM   2943  O  O     . LEU B  2  321  ? 200.083 294.580 272.854 1.00 8.68   ? 321  LEU D O     1 
ATOM   2944  N  N     . ARG B  2  322  ? 199.146 293.031 274.156 1.00 7.50   ? 322  ARG D N     1 
ATOM   2945  C  CA    . ARG B  2  322  ? 198.862 294.007 275.203 1.00 7.84   ? 322  ARG D CA    1 
ATOM   2946  C  C     . ARG B  2  322  ? 200.147 294.596 275.807 1.00 6.62   ? 322  ARG D C     1 
ATOM   2947  O  O     . ARG B  2  322  ? 200.263 295.804 275.992 1.00 7.60   ? 322  ARG D O     1 
ATOM   2948  N  N     . GLN B  2  323  ? 201.138 293.756 276.078 1.00 6.70   ? 323  GLN D N     1 
ATOM   2949  C  CA    . GLN B  2  323  ? 202.415 294.230 276.615 1.00 6.92   ? 323  GLN D CA    1 
ATOM   2950  C  C     . GLN B  2  323  ? 203.070 295.242 275.677 1.00 6.96   ? 323  GLN D C     1 
ATOM   2951  O  O     . GLN B  2  323  ? 203.787 296.125 276.120 1.00 9.79   ? 323  GLN D O     1 
ATOM   2952  N  N     . HIS B  2  324  ? 202.842 295.068 274.380 1.00 6.02   ? 324  HIS D N     1 
ATOM   2953  C  CA    . HIS B  2  324  ? 203.396 295.922 273.332 1.00 6.35   ? 324  HIS D CA    1 
ATOM   2954  C  C     . HIS B  2  324  ? 202.369 296.850 272.716 1.00 6.11   ? 324  HIS D C     1 
ATOM   2955  O  O     . HIS B  2  324  ? 202.561 297.272 271.574 1.00 7.00   ? 324  HIS D O     1 
ATOM   2956  N  N     . ARG B  2  325  ? 201.316 297.207 273.433 1.00 6.51   ? 325  ARG D N     1 
ATOM   2957  C  CA    . ARG B  2  325  ? 200.228 297.923 272.787 1.00 7.20   ? 325  ARG D CA    1 
ATOM   2958  C  C     . ARG B  2  325  ? 200.688 299.226 272.149 1.00 6.67   ? 325  ARG D C     1 
ATOM   2959  O  O     . ARG B  2  325  ? 200.246 299.532 271.037 1.00 7.55   ? 325  ARG D O     1 
ATOM   2960  N  N     . MET B  2  326  ? 201.536 300.010 272.795 1.00 6.89   ? 326  MET D N     1 
ATOM   2961  C  CA    . MET B  2  326  ? 201.959 301.264 272.198 1.00 7.07   ? 326  MET D CA    1 
ATOM   2962  C  C     . MET B  2  326  ? 202.790 301.020 270.927 1.00 6.43   ? 326  MET D C     1 
ATOM   2963  O  O     . MET B  2  326  ? 202.546 301.659 269.890 1.00 7.16   ? 326  MET D O     1 
ATOM   2964  N  N     . MET B  2  327  ? 203.741 300.097 270.980 1.00 5.87   ? 327  MET D N     1 
ATOM   2965  C  CA    . MET B  2  327  ? 204.517 299.779 269.808 1.00 6.16   ? 327  MET D CA    1 
ATOM   2966  C  C     . MET B  2  327  ? 203.637 299.290 268.672 1.00 5.65   ? 327  MET D C     1 
ATOM   2967  O  O     . MET B  2  327  ? 203.813 299.713 267.514 1.00 6.79   ? 327  MET D O     1 
ATOM   2968  N  N     . ILE B  2  328  ? 202.754 298.343 268.959 1.00 6.27   ? 328  ILE D N     1 
ATOM   2969  C  CA    . ILE B  2  328  ? 201.965 297.756 267.892 1.00 7.07   ? 328  ILE D CA    1 
ATOM   2970  C  C     . ILE B  2  328  ? 201.080 298.816 267.230 1.00 5.95   ? 328  ILE D C     1 
ATOM   2971  O  O     . ILE B  2  328  ? 201.023 298.912 265.999 1.00 6.89   ? 328  ILE D O     1 
ATOM   2972  N  N     . LEU B  2  329  ? 200.379 299.613 268.005 1.00 6.01   ? 329  LEU D N     1 
ATOM   2973  C  CA    . LEU B  2  329  ? 199.448 300.579 267.457 1.00 6.06   ? 329  LEU D CA    1 
ATOM   2974  C  C     . LEU B  2  329  ? 200.215 301.646 266.670 1.00 6.24   ? 329  LEU D C     1 
ATOM   2975  O  O     . LEU B  2  329  ? 199.885 301.957 265.515 1.00 6.94   ? 329  LEU D O     1 
ATOM   2976  N  N     . TYR B  2  330  ? 201.196 302.278 267.309 1.00 5.88   ? 330  TYR D N     1 
ATOM   2977  C  CA    . TYR B  2  330  ? 201.858 303.401 266.703 1.00 5.60   ? 330  TYR D CA    1 
ATOM   2978  C  C     . TYR B  2  330  ? 202.768 303.022 265.565 1.00 5.90   ? 330  TYR D C     1 
ATOM   2979  O  O     . TYR B  2  330  ? 202.836 303.734 264.552 1.00 6.79   ? 330  TYR D O     1 
ATOM   2980  N  N     . CYS B  2  331  ? 203.556 301.967 265.705 1.00 5.79   ? 331  CYS D N     1 
ATOM   2981  C  CA    . CYS B  2  331  ? 204.456 301.583 264.651 1.00 5.81   ? 331  CYS D CA    1 
ATOM   2982  C  C     . CYS B  2  331  ? 203.745 301.007 263.435 1.00 5.84   ? 331  CYS D C     1 
ATOM   2983  O  O     . CYS B  2  331  ? 204.238 301.160 262.315 1.00 6.35   ? 331  CYS D O     1 
ATOM   2984  N  N     . THR B  2  332  ? 202.602 300.345 263.628 1.00 6.31   ? 332  THR D N     1 
ATOM   2985  C  CA    . THR B  2  332  ? 201.810 299.910 262.485 1.00 5.56   ? 332  THR D CA    1 
ATOM   2986  C  C     . THR B  2  332  ? 201.343 301.146 261.699 1.00 6.46   ? 332  THR D C     1 
ATOM   2987  O  O     . THR B  2  332  ? 201.424 301.208 260.469 1.00 7.42   ? 332  THR D O     1 
ATOM   2988  N  N     . LEU B  2  333  ? 200.797 302.134 262.409 1.00 6.39   ? 333  LEU D N     1 
ATOM   2989  C  CA    . LEU B  2  333  ? 200.350 303.346 261.781 1.00 7.11   ? 333  LEU D CA    1 
ATOM   2990  C  C     . LEU B  2  333  ? 201.509 304.047 261.066 1.00 6.49   ? 333  LEU D C     1 
ATOM   2991  O  O     . LEU B  2  333  ? 201.382 304.484 259.911 1.00 7.44   ? 333  LEU D O     1 
ATOM   2992  N  N     . LEU B  2  334  ? 202.623 304.192 261.744 1.00 6.60   ? 334  LEU D N     1 
ATOM   2993  C  CA    . LEU B  2  334  ? 203.778 304.873 261.154 1.00 6.93   ? 334  LEU D CA    1 
ATOM   2994  C  C     . LEU B  2  334  ? 204.283 304.137 259.923 1.00 6.90   ? 334  LEU D C     1 
ATOM   2995  O  O     . LEU B  2  334  ? 204.608 304.764 258.893 1.00 8.01   ? 334  LEU D O     1 
ATOM   2996  N  N     . ALA B  2  335  ? 204.365 302.816 259.997 1.00 6.98   ? 335  ALA D N     1 
ATOM   2997  C  CA    . ALA B  2  335  ? 204.867 302.039 258.855 1.00 7.70   ? 335  ALA D CA    1 
ATOM   2998  C  C     . ALA B  2  335  ? 203.998 302.222 257.631 1.00 7.55   ? 335  ALA D C     1 
ATOM   2999  O  O     . ALA B  2  335  ? 204.467 302.042 256.505 1.00 9.66   ? 335  ALA D O     1 
ATOM   3000  N  N     . SER B  2  336  ? 202.723 302.499 257.832 1.00 7.17   ? 336  SER D N     1 
ATOM   3001  C  CA    . SER B  2  336  ? 201.752 302.682 256.763 1.00 7.91   ? 336  SER D CA    1 
ATOM   3002  C  C     . SER B  2  336  ? 201.681 304.124 256.246 1.00 8.34   ? 336  SER D C     1 
ATOM   3003  O  O     . SER B  2  336  ? 200.973 304.339 255.243 1.00 11.28  ? 336  SER D O     1 
ATOM   3004  N  N     . ALA B  2  337  ? 202.407 305.061 256.827 1.00 7.49   ? 337  ALA D N     1 
ATOM   3005  C  CA    . ALA B  2  337  ? 202.384 306.461 256.445 1.00 7.69   ? 337  ALA D CA    1 
ATOM   3006  C  C     . ALA B  2  337  ? 203.514 306.723 255.448 1.00 8.23   ? 337  ALA D C     1 
ATOM   3007  O  O     . ALA B  2  337  ? 204.680 306.500 255.728 1.00 8.99   ? 337  ALA D O     1 
ATOM   3008  N  N     . GLN B  2  338  ? 203.123 307.160 254.235 1.00 9.23   ? 338  GLN D N     1 
ATOM   3009  C  CA    . GLN B  2  338  ? 204.056 307.385 253.146 1.00 10.11  ? 338  GLN D CA    1 
ATOM   3010  C  C     . GLN B  2  338  ? 204.491 308.840 252.977 1.00 9.32   ? 338  GLN D C     1 
ATOM   3011  O  O     . GLN B  2  338  ? 205.594 309.112 252.526 1.00 12.28  ? 338  GLN D O     1 
ATOM   3012  N  N     . SER B  2  339  ? 203.593 309.783 253.260 1.00 8.86   ? 339  SER D N     1 
ATOM   3013  C  CA    . SER B  2  339  ? 203.869 311.190 253.023 1.00 8.81   ? 339  SER D CA    1 
ATOM   3014  C  C     . SER B  2  339  ? 204.681 311.795 254.159 1.00 8.99   ? 339  SER D C     1 
ATOM   3015  O  O     . SER B  2  339  ? 204.615 311.337 255.323 1.00 8.41   ? 339  SER D O     1 
ATOM   3016  N  N     . GLU B  2  340  ? 205.409 312.861 253.858 1.00 9.68   ? 340  GLU D N     1 
ATOM   3017  C  CA    . GLU B  2  340  ? 206.155 313.588 254.878 1.00 10.76  ? 340  GLU D CA    1 
ATOM   3018  C  C     . GLU B  2  340  ? 205.185 314.087 255.945 1.00 9.58   ? 340  GLU D C     1 
ATOM   3019  O  O     . GLU B  2  340  ? 205.462 313.937 257.168 1.00 9.98   ? 340  GLU D O     1 
ATOM   3020  N  N     . ALA B  2  341  ? 204.078 314.700 255.569 1.00 10.55  ? 341  ALA D N     1 
ATOM   3021  C  CA    . ALA B  2  341  ? 203.203 315.293 256.548 1.00 11.83  ? 341  ALA D CA    1 
ATOM   3022  C  C     . ALA B  2  341  ? 202.633 314.253 257.464 1.00 10.01  ? 341  ALA D C     1 
ATOM   3023  O  O     . ALA B  2  341  ? 202.542 314.476 258.680 1.00 10.41  ? 341  ALA D O     1 
ATOM   3024  N  N     . GLU B  2  342  ? 202.226 313.107 256.935 1.00 9.12   ? 342  GLU D N     1 
ATOM   3025  C  CA    . GLU B  2  342  ? 201.604 312.113 257.792 1.00 9.38   ? 342  GLU D CA    1 
ATOM   3026  C  C     . GLU B  2  342  ? 202.644 311.502 258.742 1.00 8.46   ? 342  GLU D C     1 
ATOM   3027  O  O     . GLU B  2  342  ? 202.375 311.312 259.954 1.00 8.57   ? 342  GLU D O     1 
ATOM   3028  N  N     . LYS B  2  343  ? 203.834 311.179 258.244 1.00 7.47   ? 343  LYS D N     1 
ATOM   3029  C  CA    . LYS B  2  343  ? 204.867 310.641 259.119 1.00 7.26   ? 343  LYS D CA    1 
ATOM   3030  C  C     . LYS B  2  343  ? 205.224 311.621 260.209 1.00 6.80   ? 343  LYS D C     1 
ATOM   3031  O  O     . LYS B  2  343  ? 205.381 311.260 261.358 1.00 7.68   ? 343  LYS D O     1 
ATOM   3032  N  N     . GLU B  2  344  ? 205.371 312.892 259.851 1.00 7.34   ? 344  GLU D N     1 
ATOM   3033  C  CA    . GLU B  2  344  ? 205.708 313.934 260.803 1.00 7.14   ? 344  GLU D CA    1 
ATOM   3034  C  C     . GLU B  2  344  ? 204.633 314.037 261.894 1.00 7.81   ? 344  GLU D C     1 
ATOM   3035  O  O     . GLU B  2  344  ? 204.939 314.140 263.085 1.00 7.95   ? 344  GLU D O     1 
ATOM   3036  N  N     . ARG B  2  345  ? 203.358 314.066 261.484 1.00 7.78   ? 345  ARG D N     1 
ATOM   3037  C  CA    . ARG B  2  345  ? 202.261 314.138 262.414 1.00 7.96   ? 345  ARG D CA    1 
ATOM   3038  C  C     . ARG B  2  345  ? 202.323 312.985 263.426 1.00 7.24   ? 345  ARG D C     1 
ATOM   3039  O  O     . ARG B  2  345  ? 202.172 313.184 264.641 1.00 8.12   ? 345  ARG D O     1 
ATOM   3040  N  N     . ILE B  2  346  ? 202.534 311.778 262.917 1.00 6.89   ? 346  ILE D N     1 
ATOM   3041  C  CA    . ILE B  2  346  ? 202.599 310.594 263.773 1.00 7.20   ? 346  ILE D CA    1 
ATOM   3042  C  C     . ILE B  2  346  ? 203.782 310.669 264.736 1.00 6.51   ? 346  ILE D C     1 
ATOM   3043  O  O     . ILE B  2  346  ? 203.652 310.369 265.927 1.00 7.26   ? 346  ILE D O     1 
ATOM   3044  N  N     . MET B  2  347  ? 204.933 311.077 264.234 1.00 7.11   ? 347  MET D N     1 
ATOM   3045  C  CA    . MET B  2  347  ? 206.114 311.191 265.076 1.00 7.49   ? 347  MET D CA    1 
ATOM   3046  C  C     . MET B  2  347  ? 205.908 312.222 266.177 1.00 7.22   ? 347  MET D C     1 
ATOM   3047  O  O     . MET B  2  347  ? 206.335 311.989 267.339 1.00 8.01   ? 347  MET D O     1 
ATOM   3048  N  N     . GLY B  2  348  ? 205.300 313.359 265.863 1.00 7.09   ? 348  GLY D N     1 
ATOM   3049  C  CA    . GLY B  2  348  ? 205.014 314.354 266.883 1.00 7.11   ? 348  GLY D CA    1 
ATOM   3050  C  C     . GLY B  2  348  ? 204.023 313.803 267.900 1.00 7.07   ? 348  GLY D C     1 
ATOM   3051  O  O     . GLY B  2  348  ? 204.211 314.005 269.121 1.00 8.12   ? 348  GLY D O     1 
ATOM   3052  N  N     . LYS B  2  349  ? 202.984 313.110 267.433 1.00 7.76   ? 349  LYS D N     1 
ATOM   3053  C  CA    . LYS B  2  349  ? 202.009 312.547 268.361 1.00 7.90   ? 349  LYS D CA    1 
ATOM   3054  C  C     . LYS B  2  349  ? 202.639 311.514 269.277 1.00 6.89   ? 349  LYS D C     1 
ATOM   3055  O  O     . LYS B  2  349  ? 202.349 311.503 270.487 1.00 8.11   ? 349  LYS D O     1 
ATOM   3056  N  N     . MET B  2  350  ? 203.502 310.674 268.744 1.00 6.76   ? 350  MET D N     1 
ATOM   3057  C  CA    . MET B  2  350  ? 204.199 309.718 269.578 1.00 7.00   ? 350  MET D CA    1 
ATOM   3058  C  C     . MET B  2  350  ? 205.007 310.418 270.649 1.00 6.92   ? 350  MET D C     1 
ATOM   3059  O  O     . MET B  2  350  ? 204.979 310.012 271.808 1.00 7.39   ? 350  MET D O     1 
ATOM   3060  N  N     . GLU B  2  351  ? 205.762 311.459 270.298 1.00 7.08   ? 351  GLU D N     1 
ATOM   3061  C  CA    . GLU B  2  351  ? 206.548 312.193 271.290 1.00 7.37   ? 351  GLU D CA    1 
ATOM   3062  C  C     . GLU B  2  351  ? 205.597 312.752 272.360 1.00 7.56   ? 351  GLU D C     1 
ATOM   3063  O  O     . GLU B  2  351  ? 205.919 312.727 273.551 1.00 8.22   ? 351  GLU D O     1 
ATOM   3064  N  N     . ALA B  2  352  ? 204.438 313.249 271.941 1.00 7.20   ? 352  ALA D N     1 
ATOM   3065  C  CA    . ALA B  2  352  ? 203.464 313.775 272.892 1.00 8.07   ? 352  ALA D CA    1 
ATOM   3066  C  C     . ALA B  2  352  ? 203.022 312.624 273.791 1.00 8.52   ? 352  ALA D C     1 
ATOM   3067  O  O     . ALA B  2  352  ? 202.866 312.783 275.002 1.00 10.61  ? 352  ALA D O     1 
ATOM   3068  N  N     . ASP B  2  353  ? 202.825 311.465 273.173 1.00 8.10   ? 353  ASP D N     1 
ATOM   3069  C  CA    . ASP B  2  353  ? 202.424 310.245 273.866 1.00 10.15  ? 353  ASP D CA    1 
ATOM   3070  C  C     . ASP B  2  353  ? 203.500 309.790 274.847 1.00 8.56   ? 353  ASP D C     1 
ATOM   3071  O  O     . ASP B  2  353  ? 203.194 309.290 275.930 1.00 11.45  ? 353  ASP D O     1 
ATOM   3072  N  N     . PRO B  2  354  ? 204.771 309.969 274.459 1.00 8.41   ? 354  PRO D N     1 
ATOM   3073  C  CA    . PRO B  2  354  ? 206.044 309.629 275.101 1.00 8.90   ? 354  PRO D CA    1 
ATOM   3074  C  C     . PRO B  2  354  ? 206.565 308.294 274.578 1.00 8.23   ? 354  PRO D C     1 
ATOM   3075  O  O     . PRO B  2  354  ? 207.693 307.906 274.883 1.00 9.77   ? 354  PRO D O     1 
ATOM   3076  N  N     . GLU B  2  355  ? 205.739 307.605 273.795 1.00 30.00  ? 355  GLU D N     1 
ATOM   3077  C  CA    . GLU B  2  355  ? 206.121 306.342 273.168 1.00 30.00  ? 355  GLU D CA    1 
ATOM   3078  C  C     . GLU B  2  355  ? 207.242 306.588 272.157 1.00 30.00  ? 355  GLU D C     1 
ATOM   3079  O  O     . GLU B  2  355  ? 208.180 305.801 272.036 1.00 30.00  ? 355  GLU D O     1 
ATOM   3080  N  N     . LEU B  2  356  ? 207.118 307.701 271.439 1.00 7.72   ? 356  LEU D N     1 
ATOM   3081  C  CA    . LEU B  2  356  ? 208.095 308.150 270.455 1.00 7.59   ? 356  LEU D CA    1 
ATOM   3082  C  C     . LEU B  2  356  ? 209.457 308.437 271.078 1.00 6.24   ? 356  LEU D C     1 
ATOM   3083  O  O     . LEU B  2  356  ? 210.492 308.187 270.460 1.00 7.34   ? 356  LEU D O     1 
ATOM   3084  N  N     . SER B  2  357  ? 209.457 308.962 272.299 1.00 7.13   ? 357  SER D N     1 
ATOM   3085  C  CA    . SER B  2  357  ? 210.705 309.306 272.969 1.00 7.87   ? 357  SER D CA    1 
ATOM   3086  C  C     . SER B  2  357  ? 211.582 308.068 273.117 1.00 7.64   ? 357  SER D C     1 
ATOM   3087  O  O     . SER B  2  357  ? 212.795 308.141 272.920 1.00 8.50   ? 357  SER D O     1 
ATOM   3088  N  N     . LYS B  2  358  ? 210.982 306.933 273.462 1.00 6.86   ? 358  LYS D N     1 
ATOM   3089  C  CA    . LYS B  2  358  ? 211.753 305.709 273.564 1.00 7.07   ? 358  LYS D CA    1 
ATOM   3090  C  C     . LYS B  2  358  ? 211.550 304.785 272.365 1.00 6.90   ? 358  LYS D C     1 
ATOM   3091  O  O     . LYS B  2  358  ? 212.466 304.114 271.934 1.00 8.09   ? 358  LYS D O     1 
ATOM   3092  N  N     . PHE B  2  359  ? 210.331 304.769 271.825 1.00 6.36   ? 359  PHE D N     1 
ATOM   3093  C  CA    . PHE B  2  359  ? 210.036 303.932 270.666 1.00 6.56   ? 359  PHE D CA    1 
ATOM   3094  C  C     . PHE B  2  359  ? 210.687 304.493 269.407 1.00 6.59   ? 359  PHE D C     1 
ATOM   3095  O  O     . PHE B  2  359  ? 211.274 303.742 268.624 1.00 7.27   ? 359  PHE D O     1 
ATOM   3096  N  N     . LEU B  2  360  ? 210.614 305.790 269.226 1.00 6.75   ? 360  LEU D N     1 
ATOM   3097  C  CA    . LEU B  2  360  ? 211.275 306.433 268.110 1.00 8.32   ? 360  LEU D CA    1 
ATOM   3098  C  C     . LEU B  2  360  ? 212.789 306.270 268.173 1.00 7.78   ? 360  LEU D C     1 
ATOM   3099  O  O     . LEU B  2  360  ? 213.435 306.078 267.150 1.00 8.19   ? 360  LEU D O     1 
ATOM   3100  N  N     . TYR B  2  361  ? 213.370 306.342 269.387 1.00 8.98   ? 361  TYR D N     1 
ATOM   3101  C  CA    . TYR B  2  361  ? 214.793 306.100 269.531 1.00 9.07   ? 361  TYR D CA    1 
ATOM   3102  C  C     . TYR B  2  361  ? 215.144 304.691 269.122 1.00 8.39   ? 361  TYR D C     1 
ATOM   3103  O  O     . TYR B  2  361  ? 216.166 304.447 268.468 1.00 10.86  ? 361  TYR D O     1 
ATOM   3104  N  N     . GLN B  2  362  ? 214.309 303.731 269.479 1.00 9.74   ? 362  GLN D N     1 
ATOM   3105  C  CA    . GLN B  2  362  ? 214.549 302.355 269.073 1.00 10.51  ? 362  GLN D CA    1 
ATOM   3106  C  C     . GLN B  2  362  ? 214.484 302.241 267.542 1.00 10.03  ? 362  GLN D C     1 
ATOM   3107  O  O     . GLN B  2  362  ? 215.317 301.587 266.902 1.00 11.50  ? 362  GLN D O     1 
ATOM   3108  N  N     . LEU B  2  363  ? 213.462 302.852 266.945 1.00 8.20   ? 363  LEU D N     1 
ATOM   3109  C  CA    . LEU B  2  363  ? 213.237 302.700 265.506 1.00 9.21   ? 363  LEU D CA    1 
ATOM   3110  C  C     . LEU B  2  363  ? 214.360 303.337 264.693 1.00 9.07   ? 363  LEU D C     1 
ATOM   3111  O  O     . LEU B  2  363  ? 214.879 302.725 263.769 1.00 12.05  ? 363  LEU D O     1 
ATOM   3112  N  N     . HIS B  2  364  ? 214.708 304.568 265.036 1.00 7.55   ? 364  HIS D N     1 
ATOM   3113  C  CA    . HIS B  2  364  ? 215.598 305.377 264.235 1.00 9.93   ? 364  HIS D CA    1 
ATOM   3114  C  C     . HIS B  2  364  ? 217.037 305.417 264.733 1.00 12.34  ? 364  HIS D C     1 
ATOM   3115  O  O     . HIS B  2  364  ? 217.947 305.837 264.007 1.00 15.53  ? 364  HIS D O     1 
ATOM   3116  N  N     . GLU B  2  365  ? 217.267 304.986 265.956 1.00 14.04  ? 365  GLU D N     1 
ATOM   3117  C  CA    . GLU B  2  365  ? 218.570 305.053 266.603 1.00 16.41  ? 365  GLU D CA    1 
ATOM   3118  C  C     . GLU B  2  365  ? 218.772 306.365 267.325 1.00 22.62  ? 365  GLU D C     1 
ATOM   3119  O  O     . GLU B  2  365  ? 218.062 307.335 267.103 1.00 27.32  ? 365  GLU D O     1 
ATOM   3120  N  N     . ARG B  2  427  ? 244.198 278.646 354.722 1.00 198.72 ? 427  ARG D N     1 
ATOM   3121  C  CA    . ARG B  2  427  ? 244.426 278.670 356.170 1.00 199.53 ? 427  ARG D CA    1 
ATOM   3122  C  C     . ARG B  2  427  ? 243.318 277.951 356.957 1.00 198.45 ? 427  ARG D C     1 
ATOM   3123  O  O     . ARG B  2  427  ? 242.135 278.036 356.605 1.00 197.52 ? 427  ARG D O     1 
ATOM   3124  N  N     . CYS B  2  428  ? 243.715 277.246 358.019 1.00 185.11 ? 428  CYS D N     1 
ATOM   3125  C  CA    . CYS B  2  428  ? 242.775 276.485 358.846 1.00 184.28 ? 428  CYS D CA    1 
ATOM   3126  C  C     . CYS B  2  428  ? 242.860 276.887 360.315 1.00 185.69 ? 428  CYS D C     1 
ATOM   3127  O  O     . CYS B  2  428  ? 243.633 277.774 360.676 1.00 187.21 ? 428  CYS D O     1 
ATOM   3128  N  N     . GLN B  2  429  ? 242.077 276.219 361.158 1.00 167.24 ? 429  GLN D N     1 
ATOM   3129  C  CA    . GLN B  2  429  ? 241.954 276.598 362.562 1.00 169.40 ? 429  GLN D CA    1 
ATOM   3130  C  C     . GLN B  2  429  ? 242.044 275.399 363.519 1.00 169.76 ? 429  GLN D C     1 
ATOM   3131  O  O     . GLN B  2  429  ? 241.722 274.273 363.173 1.00 167.95 ? 429  GLN D O     1 
ATOM   3132  N  N     . LEU B  2  430  ? 242.512 275.654 364.729 1.00 180.19 ? 430  LEU D N     1 
ATOM   3133  C  CA    . LEU B  2  430  ? 242.456 274.661 365.784 1.00 180.31 ? 430  LEU D CA    1 
ATOM   3134  C  C     . LEU B  2  430  ? 240.994 274.567 366.203 1.00 179.85 ? 430  LEU D C     1 
ATOM   3135  O  O     . LEU B  2  430  ? 240.209 275.470 365.916 1.00 179.84 ? 430  LEU D O     1 
ATOM   3136  N  N     . PRO B  2  431  ? 240.596 273.446 366.816 1.00 184.66 ? 431  PRO D N     1 
ATOM   3137  C  CA    . PRO B  2  431  ? 239.533 273.572 367.823 1.00 185.28 ? 431  PRO D CA    1 
ATOM   3138  C  C     . PRO B  2  431  ? 240.164 273.952 369.182 1.00 187.34 ? 431  PRO D C     1 
ATOM   3139  O  O     . PRO B  2  431  ? 241.367 274.224 369.235 1.00 188.17 ? 431  PRO D O     1 
ATOM   3140  N  N     . ASP B  2  432  ? 239.372 273.982 370.252 1.00 214.47 ? 432  ASP D N     1 
ATOM   3141  C  CA    . ASP B  2  432  ? 239.853 274.448 371.559 1.00 217.08 ? 432  ASP D CA    1 
ATOM   3142  C  C     . ASP B  2  432  ? 241.063 273.707 372.133 1.00 218.62 ? 432  ASP D C     1 
ATOM   3143  O  O     . ASP B  2  432  ? 242.163 274.254 372.184 1.00 220.22 ? 432  ASP D O     1 
ATOM   3144  N  N     . GLY B  2  433  ? 240.848 272.465 372.557 1.00 194.50 ? 433  GLY D N     1 
ATOM   3145  C  CA    . GLY B  2  433  ? 241.858 271.711 373.286 1.00 196.14 ? 433  GLY D CA    1 
ATOM   3146  C  C     . GLY B  2  433  ? 242.783 270.892 372.407 1.00 194.78 ? 433  GLY D C     1 
ATOM   3147  O  O     . GLY B  2  433  ? 243.374 269.913 372.861 1.00 195.49 ? 433  GLY D O     1 
ATOM   3148  N  N     . SER B  2  434  ? 242.906 271.299 371.148 1.00 179.43 ? 434  SER D N     1 
ATOM   3149  C  CA    . SER B  2  434  ? 243.618 270.513 370.145 1.00 177.82 ? 434  SER D CA    1 
ATOM   3150  C  C     . SER B  2  434  ? 245.131 270.699 370.134 1.00 179.45 ? 434  SER D C     1 
ATOM   3151  O  O     . SER B  2  434  ? 245.643 271.801 370.353 1.00 181.17 ? 434  SER D O     1 
ATOM   3152  N  N     . PHE B  2  435  ? 245.842 269.612 369.844 1.00 178.89 ? 435  PHE D N     1 
ATOM   3153  C  CA    . PHE B  2  435  ? 247.298 269.652 369.793 1.00 180.31 ? 435  PHE D CA    1 
ATOM   3154  C  C     . PHE B  2  435  ? 247.917 268.870 368.630 1.00 178.46 ? 435  PHE D C     1 
ATOM   3155  O  O     . PHE B  2  435  ? 247.391 267.834 368.193 1.00 176.50 ? 435  PHE D O     1 
ATOM   3156  N  N     . ARG B  2  436  ? 249.042 269.390 368.146 1.00 210.34 ? 436  ARG D N     1 
ATOM   3157  C  CA    . ARG B  2  436  ? 249.871 268.724 367.149 1.00 209.07 ? 436  ARG D CA    1 
ATOM   3158  C  C     . ARG B  2  436  ? 251.015 267.959 367.808 1.00 210.72 ? 436  ARG D C     1 
ATOM   3159  O  O     . ARG B  2  436  ? 251.841 268.549 368.509 1.00 213.12 ? 436  ARG D O     1 
ATOM   3160  N  N     . ARG B  2  437  ? 251.067 266.647 367.588 1.00 178.57 ? 437  ARG D N     1 
ATOM   3161  C  CA    . ARG B  2  437  ? 252.210 265.872 368.043 1.00 180.02 ? 437  ARG D CA    1 
ATOM   3162  C  C     . ARG B  2  437  ? 252.756 265.037 366.897 1.00 178.28 ? 437  ARG D C     1 
ATOM   3163  O  O     . ARG B  2  437  ? 252.112 264.109 366.426 1.00 176.31 ? 437  ARG D O     1 
ATOM   3164  N  N     . GLN B  2  438  ? 253.956 265.378 366.456 1.00 179.10 ? 438  GLN D N     1 
ATOM   3165  C  CA    . GLN B  2  438  ? 254.556 264.737 365.299 1.00 177.61 ? 438  GLN D CA    1 
ATOM   3166  C  C     . GLN B  2  438  ? 255.489 263.601 365.710 1.00 178.57 ? 438  GLN D C     1 
ATOM   3167  O  O     . GLN B  2  438  ? 256.324 263.767 366.586 1.00 180.92 ? 438  GLN D O     1 
ATOM   3168  N  N     . ARG B  2  439  ? 255.344 262.452 365.063 1.00 176.80 ? 439  ARG D N     1 
ATOM   3169  C  CA    . ARG B  2  439  ? 256.176 261.283 365.326 1.00 177.49 ? 439  ARG D CA    1 
ATOM   3170  C  C     . ARG B  2  439  ? 257.044 261.089 364.083 1.00 176.52 ? 439  ARG D C     1 
ATOM   3171  O  O     . ARG B  2  439  ? 257.018 261.921 363.175 1.00 175.64 ? 439  ARG D O     1 
ATOM   3172  N  N     . LYS B  2  440  ? 257.834 260.023 364.038 1.00 189.41 ? 440  LYS D N     1 
ATOM   3173  C  CA    . LYS B  2  440  ? 258.693 259.789 362.888 1.00 188.64 ? 440  LYS D CA    1 
ATOM   3174  C  C     . LYS B  2  440  ? 257.879 259.300 361.709 1.00 185.88 ? 440  LYS D C     1 
ATOM   3175  O  O     . LYS B  2  440  ? 257.184 258.288 361.792 1.00 184.76 ? 440  LYS D O     1 
ATOM   3176  N  N     . GLY B  2  441  ? 257.954 260.042 360.613 1.00 204.21 ? 441  GLY D N     1 
ATOM   3177  C  CA    . GLY B  2  441  ? 257.259 259.670 359.397 1.00 201.69 ? 441  GLY D CA    1 
ATOM   3178  C  C     . GLY B  2  441  ? 255.796 260.071 359.352 1.00 200.20 ? 441  GLY D C     1 
ATOM   3179  O  O     . GLY B  2  441  ? 255.196 260.072 358.278 1.00 198.18 ? 441  GLY D O     1 
ATOM   3180  N  N     . TYR B  2  442  ? 255.204 260.383 360.506 1.00 169.21 ? 442  TYR D N     1 
ATOM   3181  C  CA    . TYR B  2  442  ? 253.817 260.847 360.532 1.00 167.95 ? 442  TYR D CA    1 
ATOM   3182  C  C     . TYR B  2  442  ? 253.486 261.910 361.575 1.00 169.53 ? 442  TYR D C     1 
ATOM   3183  O  O     . TYR B  2  442  ? 253.770 261.735 362.748 1.00 171.37 ? 442  TYR D O     1 
ATOM   3184  N  N     . GLU B  2  443  ? 252.847 262.995 361.153 1.00 168.86 ? 443  GLU D N     1 
ATOM   3185  C  CA    . GLU B  2  443  ? 252.322 263.969 362.100 1.00 170.13 ? 443  GLU D CA    1 
ATOM   3186  C  C     . GLU B  2  443  ? 250.982 263.455 362.587 1.00 169.08 ? 443  GLU D C     1 
ATOM   3187  O  O     . GLU B  2  443  ? 250.207 262.926 361.801 1.00 166.88 ? 443  GLU D O     1 
ATOM   3188  N  N     . GLU B  2  444  ? 250.712 263.573 363.878 1.00 170.70 ? 444  GLU D N     1 
ATOM   3189  C  CA    . GLU B  2  444  ? 249.418 263.158 364.400 1.00 169.89 ? 444  GLU D CA    1 
ATOM   3190  C  C     . GLU B  2  444  ? 248.733 264.311 365.118 1.00 170.89 ? 444  GLU D C     1 
ATOM   3191  O  O     . GLU B  2  444  ? 249.287 264.894 366.048 1.00 173.22 ? 444  GLU D O     1 
ATOM   3192  N  N     . VAL B  2  445  ? 247.525 264.642 364.683 1.00 169.19 ? 445  VAL D N     1 
ATOM   3193  C  CA    . VAL B  2  445  ? 246.786 265.740 365.281 1.00 169.98 ? 445  VAL D CA    1 
ATOM   3194  C  C     . VAL B  2  445  ? 245.613 265.217 366.096 1.00 169.75 ? 445  VAL D C     1 
ATOM   3195  O  O     . VAL B  2  445  ? 244.933 264.269 365.690 1.00 167.90 ? 445  VAL D O     1 
ATOM   3196  N  N     . HIS B  2  446  ? 245.399 265.834 367.258 1.00 182.87 ? 446  HIS D N     1 
ATOM   3197  C  CA    . HIS B  2  446  ? 244.321 265.433 368.159 1.00 183.04 ? 446  HIS D CA    1 
ATOM   3198  C  C     . HIS B  2  446  ? 243.409 266.599 368.506 1.00 183.41 ? 446  HIS D C     1 
ATOM   3199  O  O     . HIS B  2  446  ? 243.875 267.657 368.923 1.00 185.21 ? 446  HIS D O     1 
ATOM   3200  N  N     . VAL B  2  447  ? 242.107 266.405 368.334 1.00 197.48 ? 447  VAL D N     1 
ATOM   3201  C  CA    . VAL B  2  447  ? 241.139 267.354 368.873 1.00 198.34 ? 447  VAL D CA    1 
ATOM   3202  C  C     . VAL B  2  447  ? 240.110 266.620 369.728 1.00 198.60 ? 447  VAL D C     1 
ATOM   3203  O  O     . VAL B  2  447  ? 239.688 265.509 369.391 1.00 197.40 ? 447  VAL D O     1 
ATOM   3204  N  N     . PRO B  2  448  ? 239.722 267.233 370.860 1.00 225.04 ? 448  PRO D N     1 
ATOM   3205  C  CA    . PRO B  2  448  ? 238.764 266.620 371.784 1.00 225.59 ? 448  PRO D CA    1 
ATOM   3206  C  C     . PRO B  2  448  ? 237.325 266.768 371.299 1.00 224.55 ? 448  PRO D C     1 
ATOM   3207  O  O     . PRO B  2  448  ? 237.089 267.326 370.226 1.00 223.37 ? 448  PRO D O     1 
ATOM   3208  N  N     . ALA B  2  449  ? 236.380 266.261 372.086 1.00 185.38 ? 449  ALA D N     1 
ATOM   3209  C  CA    . ALA B  2  449  ? 234.967 266.368 371.751 1.00 184.56 ? 449  ALA D CA    1 
ATOM   3210  C  C     . ALA B  2  449  ? 234.463 267.783 372.013 1.00 185.49 ? 449  ALA D C     1 
ATOM   3211  O  O     . ALA B  2  449  ? 235.004 268.500 372.855 1.00 187.20 ? 449  ALA D O     1 
ATOM   3212  N  N     . LEU B  2  450  ? 233.439 268.185 371.271 1.00 200.89 ? 450  LEU D N     1 
ATOM   3213  C  CA    . LEU B  2  450  ? 232.823 269.495 371.455 1.00 201.69 ? 450  LEU D CA    1 
ATOM   3214  C  C     . LEU B  2  450  ? 231.918 269.555 372.691 1.00 203.13 ? 450  LEU D C     1 
ATOM   3215  O  O     . LEU B  2  450  ? 231.477 268.526 373.212 1.00 203.22 ? 450  LEU D O     1 
ATOM   3216  N  N     . LYS B  2  451  ? 231.660 270.772 373.163 1.00 196.22 ? 451  LYS D N     1 
ATOM   3217  C  CA    . LYS B  2  451  ? 230.803 270.997 374.321 1.00 197.74 ? 451  LYS D CA    1 
ATOM   3218  C  C     . LYS B  2  451  ? 229.447 271.566 373.892 1.00 197.04 ? 451  LYS D C     1 
ATOM   3219  O  O     . LYS B  2  451  ? 229.373 272.695 373.397 1.00 196.94 ? 451  LYS D O     1 
ATOM   3220  N  N     . PRO B  2  452  ? 228.370 270.772 374.069 1.00 182.34 ? 452  PRO D N     1 
ATOM   3221  C  CA    . PRO B  2  452  ? 226.999 271.125 373.672 1.00 181.60 ? 452  PRO D CA    1 
ATOM   3222  C  C     . PRO B  2  452  ? 226.551 272.481 374.224 1.00 183.00 ? 452  PRO D C     1 
ATOM   3223  O  O     . PRO B  2  452  ? 226.758 272.736 375.411 1.00 184.91 ? 452  PRO D O     1 
ATOM   3224  N  N     . LYS B  2  453  ? 225.952 273.328 373.388 1.00 208.93 ? 453  LYS D N     1 
ATOM   3225  C  CA    . LYS B  2  453  ? 225.433 274.622 373.851 1.00 210.20 ? 453  LYS D CA    1 
ATOM   3226  C  C     . LYS B  2  453  ? 224.363 274.430 374.924 1.00 211.36 ? 453  LYS D C     1 
ATOM   3227  O  O     . LYS B  2  453  ? 223.417 273.667 374.726 1.00 210.44 ? 453  LYS D O     1 
ATOM   3228  N  N     . PRO B  2  454  ? 224.507 275.132 376.061 1.00 187.96 ? 454  PRO D N     1 
ATOM   3229  C  CA    . PRO B  2  454  ? 223.564 274.998 377.177 1.00 189.34 ? 454  PRO D CA    1 
ATOM   3230  C  C     . PRO B  2  454  ? 222.154 275.410 376.773 1.00 188.61 ? 454  PRO D C     1 
ATOM   3231  O  O     . PRO B  2  454  ? 221.994 276.400 376.058 1.00 188.01 ? 454  PRO D O     1 
ATOM   3232  N  N     . PHE B  2  455  ? 221.154 274.651 377.218 1.00 203.02 ? 455  PHE D N     1 
ATOM   3233  C  CA    . PHE B  2  455  ? 219.761 274.919 376.868 1.00 202.57 ? 455  PHE D CA    1 
ATOM   3234  C  C     . PHE B  2  455  ? 219.364 276.359 377.220 1.00 203.75 ? 455  PHE D C     1 
ATOM   3235  O  O     . PHE B  2  455  ? 219.582 276.819 378.346 1.00 205.62 ? 455  PHE D O     1 
ATOM   3236  N  N     . GLY B  2  456  ? 218.799 277.065 376.240 1.00 252.14 ? 456  GLY D N     1 
ATOM   3237  C  CA    . GLY B  2  456  ? 218.396 278.450 376.417 1.00 253.11 ? 456  GLY D CA    1 
ATOM   3238  C  C     . GLY B  2  456  ? 217.241 278.591 377.387 1.00 254.55 ? 456  GLY D C     1 
ATOM   3239  O  O     . GLY B  2  456  ? 216.561 277.606 377.692 1.00 254.47 ? 456  GLY D O     1 
ATOM   3240  N  N     . SER B  2  457  ? 217.019 279.811 377.872 1.00 212.98 ? 457  SER D N     1 
ATOM   3241  C  CA    . SER B  2  457  ? 215.996 280.049 378.886 1.00 214.59 ? 457  SER D CA    1 
ATOM   3242  C  C     . SER B  2  457  ? 214.617 279.626 378.387 1.00 213.72 ? 457  SER D C     1 
ATOM   3243  O  O     . SER B  2  457  ? 214.138 280.112 377.361 1.00 212.79 ? 457  SER D O     1 
ATOM   3244  N  N     . GLU B  2  458  ? 213.990 278.730 379.141 1.00 253.25 ? 458  GLU D N     1 
ATOM   3245  C  CA    . GLU B  2  458  ? 212.701 278.144 378.776 1.00 253.12 ? 458  GLU D CA    1 
ATOM   3246  C  C     . GLU B  2  458  ? 212.660 277.565 377.351 1.00 251.22 ? 458  GLU D C     1 
ATOM   3247  O  O     . GLU B  2  458  ? 211.764 277.886 376.571 1.00 250.66 ? 458  GLU D O     1 
ATOM   3248  N  N     . GLU B  2  459  ? 213.633 276.713 377.025 1.00 227.28 ? 459  GLU D N     1 
ATOM   3249  C  CA    . GLU B  2  459  ? 213.638 275.987 375.751 1.00 225.53 ? 459  GLU D CA    1 
ATOM   3250  C  C     . GLU B  2  459  ? 213.525 274.482 375.983 1.00 225.45 ? 459  GLU D C     1 
ATOM   3251  O  O     . GLU B  2  459  ? 214.425 273.865 376.554 1.00 225.68 ? 459  GLU D O     1 
ATOM   3252  N  N     . GLN B  2  460  ? 212.432 273.885 375.523 1.00 223.57 ? 460  GLN D N     1 
ATOM   3253  C  CA    . GLN B  2  460  ? 212.196 272.469 375.773 1.00 223.72 ? 460  GLN D CA    1 
ATOM   3254  C  C     . GLN B  2  460  ? 212.076 271.685 374.464 1.00 221.92 ? 460  GLN D C     1 
ATOM   3255  O  O     . GLN B  2  460  ? 211.851 272.263 373.393 1.00 220.78 ? 460  GLN D O     1 
ATOM   3256  N  N     . LEU B  2  461  ? 212.251 270.369 374.551 1.00 202.96 ? 461  LEU D N     1 
ATOM   3257  C  CA    . LEU B  2  461  ? 212.015 269.490 373.413 1.00 201.42 ? 461  LEU D CA    1 
ATOM   3258  C  C     . LEU B  2  461  ? 210.517 269.438 373.146 1.00 201.77 ? 461  LEU D C     1 
ATOM   3259  O  O     . LEU B  2  461  ? 209.711 269.666 374.047 1.00 203.44 ? 461  LEU D O     1 
ATOM   3260  N  N     . LEU B  2  462  ? 210.142 269.128 371.912 1.00 175.08 ? 462  LEU D N     1 
ATOM   3261  C  CA    . LEU B  2  462  ? 208.735 268.955 371.590 1.00 175.32 ? 462  LEU D CA    1 
ATOM   3262  C  C     . LEU B  2  462  ? 208.402 267.474 371.473 1.00 175.17 ? 462  LEU D C     1 
ATOM   3263  O  O     . LEU B  2  462  ? 209.026 266.753 370.700 1.00 173.72 ? 462  LEU D O     1 
ATOM   3264  N  N     . PRO B  2  463  ? 207.417 267.009 372.250 1.00 202.61 ? 463  PRO D N     1 
ATOM   3265  C  CA    . PRO B  2  463  ? 206.965 265.628 372.067 1.00 202.59 ? 463  PRO D CA    1 
ATOM   3266  C  C     . PRO B  2  463  ? 206.177 265.505 370.768 1.00 201.22 ? 463  PRO D C     1 
ATOM   3267  O  O     . PRO B  2  463  ? 205.948 266.512 370.095 1.00 200.43 ? 463  PRO D O     1 
ATOM   3268  N  N     . VAL B  2  464  ? 205.741 264.297 370.433 1.00 214.96 ? 464  VAL D N     1 
ATOM   3269  C  CA    . VAL B  2  464  ? 205.011 264.079 369.187 1.00 213.63 ? 464  VAL D CA    1 
ATOM   3270  C  C     . VAL B  2  464  ? 203.526 264.374 369.396 1.00 214.88 ? 464  VAL D C     1 
ATOM   3271  O  O     . VAL B  2  464  ? 202.694 264.183 368.508 1.00 214.14 ? 464  VAL D O     1 
ATOM   3272  N  N     . GLU B  2  465  ? 203.217 264.841 370.597 1.00 224.50 ? 465  GLU D N     1 
ATOM   3273  C  CA    . GLU B  2  465  ? 201.877 265.264 370.986 1.00 225.98 ? 465  GLU D CA    1 
ATOM   3274  C  C     . GLU B  2  465  ? 201.547 266.678 370.496 1.00 225.34 ? 465  GLU D C     1 
ATOM   3275  O  O     . GLU B  2  465  ? 200.565 266.889 369.783 1.00 224.93 ? 465  GLU D O     1 
ATOM   3276  N  N     . LYS B  2  466  ? 202.378 267.637 370.890 1.00 183.07 ? 466  LYS D N     1 
ATOM   3277  C  CA    . LYS B  2  466  ? 202.057 269.061 370.830 1.00 183.11 ? 466  LYS D CA    1 
ATOM   3278  C  C     . LYS B  2  466  ? 202.235 269.698 369.446 1.00 181.07 ? 466  LYS D C     1 
ATOM   3279  O  O     . LYS B  2  466  ? 202.139 270.918 369.301 1.00 181.00 ? 466  LYS D O     1 
ATOM   3280  N  N     . LEU B  2  467  ? 202.512 268.879 368.439 1.00 187.95 ? 467  LEU D N     1 
ATOM   3281  C  CA    . LEU B  2  467  ? 202.583 269.369 367.063 1.00 186.03 ? 467  LEU D CA    1 
ATOM   3282  C  C     . LEU B  2  467  ? 201.376 268.821 366.277 1.00 185.55 ? 467  LEU D C     1 
ATOM   3283  O  O     . LEU B  2  467  ? 200.864 267.753 366.620 1.00 186.27 ? 467  LEU D O     1 
ATOM   3284  N  N     . PRO B  2  468  ? 200.932 269.539 365.219 1.00 162.14 ? 468  PRO D N     1 
ATOM   3285  C  CA    . PRO B  2  468  ? 199.580 269.387 364.653 1.00 162.05 ? 468  PRO D CA    1 
ATOM   3286  C  C     . PRO B  2  468  ? 199.080 267.955 364.439 1.00 161.98 ? 468  PRO D C     1 
ATOM   3287  O  O     . PRO B  2  468  ? 199.853 267.045 364.141 1.00 161.14 ? 468  PRO D O     1 
ATOM   3288  N  N     . LYS B  2  469  ? 197.770 267.794 364.625 1.00 193.53 ? 469  LYS D N     1 
ATOM   3289  C  CA    . LYS B  2  469  ? 197.094 266.496 364.731 1.00 194.17 ? 469  LYS D CA    1 
ATOM   3290  C  C     . LYS B  2  469  ? 197.431 265.466 363.647 1.00 192.46 ? 469  LYS D C     1 
ATOM   3291  O  O     . LYS B  2  469  ? 197.742 264.312 363.956 1.00 192.83 ? 469  LYS D O     1 
ATOM   3292  N  N     . TYR B  2  470  ? 197.355 265.888 362.388 1.00 183.07 ? 470  TYR D N     1 
ATOM   3293  C  CA    . TYR B  2  470  ? 197.508 264.987 361.244 1.00 181.38 ? 470  TYR D CA    1 
ATOM   3294  C  C     . TYR B  2  470  ? 198.925 264.444 361.089 1.00 180.38 ? 470  TYR D C     1 
ATOM   3295  O  O     . TYR B  2  470  ? 199.118 263.247 360.865 1.00 179.94 ? 470  TYR D O     1 
ATOM   3296  N  N     . ALA B  2  471  ? 199.905 265.333 361.219 1.00 148.95 ? 471  ALA D N     1 
ATOM   3297  C  CA    . ALA B  2  471  ? 201.297 265.010 360.946 1.00 147.88 ? 471  ALA D CA    1 
ATOM   3298  C  C     . ALA B  2  471  ? 201.823 263.965 361.916 1.00 148.86 ? 471  ALA D C     1 
ATOM   3299  O  O     . ALA B  2  471  ? 202.739 263.207 361.591 1.00 147.87 ? 471  ALA D O     1 
ATOM   3300  N  N     . GLN B  2  472  ? 201.222 263.928 363.103 1.00 200.86 ? 472  GLN D N     1 
ATOM   3301  C  CA    . GLN B  2  472  ? 201.658 263.043 364.178 1.00 202.19 ? 472  GLN D CA    1 
ATOM   3302  C  C     . GLN B  2  472  ? 201.682 261.582 363.748 1.00 201.61 ? 472  GLN D C     1 
ATOM   3303  O  O     . GLN B  2  472  ? 202.524 260.803 364.203 1.00 201.75 ? 472  GLN D O     1 
ATOM   3304  N  N     . ALA B  2  473  ? 200.750 261.220 362.872 1.00 186.40 ? 473  ALA D N     1 
ATOM   3305  C  CA    . ALA B  2  473  ? 200.696 259.866 362.345 1.00 185.76 ? 473  ALA D CA    1 
ATOM   3306  C  C     . ALA B  2  473  ? 202.020 259.525 361.670 1.00 184.00 ? 473  ALA D C     1 
ATOM   3307  O  O     . ALA B  2  473  ? 202.678 260.399 361.094 1.00 182.84 ? 473  ALA D O     1 
ATOM   3308  N  N     . GLY B  2  474  ? 202.421 258.262 361.769 1.00 221.98 ? 474  GLY D N     1 
ATOM   3309  C  CA    . GLY B  2  474  ? 203.644 257.803 361.138 1.00 220.37 ? 474  GLY D CA    1 
ATOM   3310  C  C     . GLY B  2  474  ? 204.926 258.160 361.869 1.00 220.69 ? 474  GLY D C     1 
ATOM   3311  O  O     . GLY B  2  474  ? 206.019 257.879 361.384 1.00 219.37 ? 474  GLY D O     1 
ATOM   3312  N  N     . PHE B  2  475  ? 204.814 258.795 363.031 1.00 188.52 ? 475  PHE D N     1 
ATOM   3313  C  CA    . PHE B  2  475  ? 206.006 259.055 363.830 1.00 188.99 ? 475  PHE D CA    1 
ATOM   3314  C  C     . PHE B  2  475  ? 206.227 257.989 364.902 1.00 190.45 ? 475  PHE D C     1 
ATOM   3315  O  O     . PHE B  2  475  ? 207.153 258.098 365.713 1.00 191.06 ? 475  PHE D O     1 
ATOM   3316  N  N     . GLU B  2  476  ? 205.385 256.955 364.875 1.00 214.11 ? 476  GLU D N     1 
ATOM   3317  C  CA    . GLU B  2  476  ? 205.335 255.933 365.925 1.00 215.87 ? 476  GLU D CA    1 
ATOM   3318  C  C     . GLU B  2  476  ? 206.689 255.277 366.229 1.00 215.50 ? 476  GLU D C     1 
ATOM   3319  O  O     . GLU B  2  476  ? 207.523 255.097 365.340 1.00 213.62 ? 476  GLU D O     1 
ATOM   3320  N  N     . GLY B  2  477  ? 206.898 254.949 367.502 1.00 254.23 ? 477  GLY D N     1 
ATOM   3321  C  CA    . GLY B  2  477  ? 208.149 254.374 367.957 1.00 254.18 ? 477  GLY D CA    1 
ATOM   3322  C  C     . GLY B  2  477  ? 209.030 255.469 368.514 1.00 254.25 ? 477  GLY D C     1 
ATOM   3323  O  O     . GLY B  2  477  ? 209.964 255.210 369.277 1.00 254.86 ? 477  GLY D O     1 
ATOM   3324  N  N     . PHE B  2  478  ? 208.715 256.705 368.135 1.00 209.87 ? 478  PHE D N     1 
ATOM   3325  C  CA    . PHE B  2  478  ? 209.497 257.865 368.542 1.00 209.84 ? 478  PHE D CA    1 
ATOM   3326  C  C     . PHE B  2  478  ? 208.674 258.798 369.429 1.00 211.62 ? 478  PHE D C     1 
ATOM   3327  O  O     . PHE B  2  478  ? 207.661 259.349 368.990 1.00 211.53 ? 478  PHE D O     1 
ATOM   3328  N  N     . LYS B  2  479  ? 209.101 258.927 370.688 1.00 192.15 ? 479  LYS D N     1 
ATOM   3329  C  CA    . LYS B  2  479  ? 208.389 259.717 371.698 1.00 194.11 ? 479  LYS D CA    1 
ATOM   3330  C  C     . LYS B  2  479  ? 208.692 261.223 371.667 1.00 193.71 ? 479  LYS D C     1 
ATOM   3331  O  O     . LYS B  2  479  ? 207.814 262.044 371.942 1.00 194.60 ? 479  LYS D O     1 
ATOM   3332  N  N     . THR B  2  480  ? 209.928 261.577 371.325 1.00 211.99 ? 480  THR D N     1 
ATOM   3333  C  CA    . THR B  2  480  ? 210.378 262.969 371.399 1.00 211.83 ? 480  THR D CA    1 
ATOM   3334  C  C     . THR B  2  480  ? 211.107 263.437 370.128 1.00 209.63 ? 480  THR D C     1 
ATOM   3335  O  O     . THR B  2  480  ? 211.694 262.630 369.408 1.00 208.25 ? 480  THR D O     1 
ATOM   3336  N  N     . LEU B  2  481  ? 211.060 264.744 369.871 1.00 179.76 ? 481  LEU D N     1 
ATOM   3337  C  CA    . LEU B  2  481  ? 211.747 265.366 368.734 1.00 178.01 ? 481  LEU D CA    1 
ATOM   3338  C  C     . LEU B  2  481  ? 213.190 265.732 369.104 1.00 177.91 ? 481  LEU D C     1 
ATOM   3339  O  O     . LEU B  2  481  ? 213.454 266.144 370.233 1.00 179.31 ? 481  LEU D O     1 
ATOM   3340  N  N     . ASN B  2  482  ? 214.121 265.586 368.162 1.00 189.63 ? 482  ASN D N     1 
ATOM   3341  C  CA    . ASN B  2  482  ? 215.505 266.009 368.396 1.00 189.49 ? 482  ASN D CA    1 
ATOM   3342  C  C     . ASN B  2  482  ? 215.590 267.527 368.578 1.00 190.01 ? 482  ASN D C     1 
ATOM   3343  O  O     . ASN B  2  482  ? 214.749 268.264 368.063 1.00 189.88 ? 482  ASN D O     1 
ATOM   3344  N  N     . ARG B  2  483  ? 216.600 267.966 369.329 1.00 180.42 ? 483  ARG D N     1 
ATOM   3345  C  CA    . ARG B  2  483  ? 216.802 269.368 369.693 1.00 181.16 ? 483  ARG D CA    1 
ATOM   3346  C  C     . ARG B  2  483  ? 216.678 270.337 368.511 1.00 180.15 ? 483  ARG D C     1 
ATOM   3347  O  O     . ARG B  2  483  ? 216.015 271.370 368.614 1.00 180.84 ? 483  ARG D O     1 
ATOM   3348  N  N     . ILE B  2  484  ? 217.308 269.987 367.391 1.00 188.80 ? 484  ILE D N     1 
ATOM   3349  C  CA    . ILE B  2  484  ? 217.291 270.823 366.190 1.00 187.84 ? 484  ILE D CA    1 
ATOM   3350  C  C     . ILE B  2  484  ? 215.965 270.713 365.440 1.00 187.32 ? 484  ILE D C     1 
ATOM   3351  O  O     . ILE B  2  484  ? 215.396 271.721 364.990 1.00 187.39 ? 484  ILE D O     1 
ATOM   3352  N  N     . GLN B  2  485  ? 215.491 269.475 365.303 1.00 177.91 ? 485  GLN D N     1 
ATOM   3353  C  CA    . GLN B  2  485  ? 214.168 269.197 364.763 1.00 177.59 ? 485  GLN D CA    1 
ATOM   3354  C  C     . GLN B  2  485  ? 213.173 270.078 365.507 1.00 179.02 ? 485  GLN D C     1 
ATOM   3355  O  O     . GLN B  2  485  ? 212.367 270.798 364.901 1.00 178.88 ? 485  GLN D O     1 
ATOM   3356  N  N     . SER B  2  486  ? 213.275 270.032 366.832 1.00 184.20 ? 486  SER D N     1 
ATOM   3357  C  CA    . SER B  2  486  ? 212.432 270.817 367.724 1.00 185.78 ? 486  SER D CA    1 
ATOM   3358  C  C     . SER B  2  486  ? 212.680 272.319 367.577 1.00 186.04 ? 486  SER D C     1 
ATOM   3359  O  O     . SER B  2  486  ? 211.801 273.133 367.856 1.00 186.89 ? 486  SER D O     1 
ATOM   3360  N  N     . LYS B  2  487  ? 213.884 272.685 367.154 1.00 197.04 ? 487  LYS D N     1 
ATOM   3361  C  CA    . LYS B  2  487  ? 214.196 274.089 366.939 1.00 198.17 ? 487  LYS D CA    1 
ATOM   3362  C  C     . LYS B  2  487  ? 213.396 274.633 365.755 1.00 196.97 ? 487  LYS D C     1 
ATOM   3363  O  O     . LYS B  2  487  ? 212.686 275.629 365.881 1.00 199.60 ? 487  LYS D O     1 
ATOM   3364  N  N     . LEU B  2  488  ? 213.508 273.981 364.603 1.00 240.79 ? 488  LEU D N     1 
ATOM   3365  C  CA    . LEU B  2  488  ? 212.866 274.518 363.398 1.00 239.71 ? 488  LEU D CA    1 
ATOM   3366  C  C     . LEU B  2  488  ? 211.492 273.965 362.949 1.00 241.05 ? 488  LEU D C     1 
ATOM   3367  O  O     . LEU B  2  488  ? 211.004 274.352 361.877 1.00 241.40 ? 488  LEU D O     1 
ATOM   3368  N  N     . TYR B  2  489  ? 210.879 273.067 363.724 1.00 193.20 ? 489  TYR D N     1 
ATOM   3369  C  CA    . TYR B  2  489  ? 209.572 272.515 363.329 1.00 193.52 ? 489  TYR D CA    1 
ATOM   3370  C  C     . TYR B  2  489  ? 208.543 273.605 362.989 1.00 195.80 ? 489  TYR D C     1 
ATOM   3371  O  O     . TYR B  2  489  ? 207.742 273.445 362.067 1.00 194.92 ? 489  TYR D O     1 
ATOM   3372  N  N     . ARG B  2  490  ? 208.586 274.708 363.733 1.00 222.17 ? 490  ARG D N     1 
ATOM   3373  C  CA    . ARG B  2  490  ? 207.673 275.832 363.530 1.00 225.28 ? 490  ARG D CA    1 
ATOM   3374  C  C     . ARG B  2  490  ? 207.734 276.389 362.112 1.00 224.29 ? 490  ARG D C     1 
ATOM   3375  O  O     . ARG B  2  490  ? 206.717 276.493 361.435 1.00 226.39 ? 490  ARG D O     1 
ATOM   3376  N  N     . ALA B  2  491  ? 208.928 276.757 361.667 1.00 208.48 ? 491  ALA D N     1 
ATOM   3377  C  CA    . ALA B  2  491  ? 209.097 277.264 360.314 1.00 207.26 ? 491  ALA D CA    1 
ATOM   3378  C  C     . ALA B  2  491  ? 208.862 276.152 359.294 1.00 205.78 ? 491  ALA D C     1 
ATOM   3379  O  O     . ALA B  2  491  ? 208.495 276.417 358.146 1.00 206.07 ? 491  ALA D O     1 
ATOM   3380  N  N     . ALA B  2  492  ? 209.074 274.905 359.714 1.00 189.72 ? 492  ALA D N     1 
ATOM   3381  C  CA    . ALA B  2  492  ? 208.831 273.764 358.831 1.00 186.79 ? 492  ALA D CA    1 
ATOM   3382  C  C     . ALA B  2  492  ? 207.365 273.657 358.424 1.00 188.30 ? 492  ALA D C     1 
ATOM   3383  O  O     . ALA B  2  492  ? 207.049 273.669 357.237 1.00 186.58 ? 492  ALA D O     1 
ATOM   3384  N  N     . LEU B  2  493  ? 206.474 273.544 359.411 1.00 191.74 ? 493  LEU D N     1 
ATOM   3385  C  CA    . LEU B  2  493  ? 205.047 273.375 359.125 1.00 193.73 ? 493  LEU D CA    1 
ATOM   3386  C  C     . LEU B  2  493  ? 204.207 274.652 358.995 1.00 196.83 ? 493  LEU D C     1 
ATOM   3387  O  O     . LEU B  2  493  ? 203.085 274.599 358.499 1.00 198.20 ? 493  LEU D O     1 
ATOM   3388  N  N     . GLU B  2  494  ? 204.721 275.792 359.451 1.00 207.63 ? 494  GLU D N     1 
ATOM   3389  C  CA    . GLU B  2  494  ? 203.944 277.037 359.387 1.00 210.74 ? 494  GLU D CA    1 
ATOM   3390  C  C     . GLU B  2  494  ? 204.261 278.021 358.249 1.00 210.19 ? 494  GLU D C     1 
ATOM   3391  O  O     . GLU B  2  494  ? 203.607 279.059 358.142 1.00 212.99 ? 494  GLU D O     1 
ATOM   3392  N  N     . THR B  2  495  ? 205.255 277.724 357.415 1.00 211.99 ? 495  THR D N     1 
ATOM   3393  C  CA    . THR B  2  495  ? 205.640 278.676 356.371 1.00 211.26 ? 495  THR D CA    1 
ATOM   3394  C  C     . THR B  2  495  ? 206.080 278.014 355.082 1.00 208.70 ? 495  THR D C     1 
ATOM   3395  O  O     . THR B  2  495  ? 206.706 276.958 355.092 1.00 205.95 ? 495  THR D O     1 
ATOM   3396  N  N     . ASP B  2  496  ? 205.761 278.669 353.968 1.00 217.81 ? 496  ASP D N     1 
ATOM   3397  C  CA    . ASP B  2  496  ? 206.206 278.226 352.657 1.00 215.48 ? 496  ASP D CA    1 
ATOM   3398  C  C     . ASP B  2  496  ? 207.559 278.847 352.326 1.00 211.64 ? 496  ASP D C     1 
ATOM   3399  O  O     . ASP B  2  496  ? 208.103 278.637 351.240 1.00 209.08 ? 496  ASP D O     1 
ATOM   3400  N  N     . GLU B  2  497  ? 208.092 279.621 353.270 1.00 214.57 ? 497  GLU D N     1 
ATOM   3401  C  CA    . GLU B  2  497  ? 209.408 280.215 353.117 1.00 211.42 ? 497  GLU D CA    1 
ATOM   3402  C  C     . GLU B  2  497  ? 210.436 279.106 352.920 1.00 206.88 ? 497  GLU D C     1 
ATOM   3403  O  O     . GLU B  2  497  ? 210.363 278.066 353.572 1.00 206.17 ? 497  GLU D O     1 
ATOM   3404  N  N     . ASN B  2  498  ? 211.378 279.327 352.009 1.00 201.62 ? 498  ASN D N     1 
ATOM   3405  C  CA    . ASN B  2  498  ? 212.405 278.332 351.731 1.00 197.10 ? 498  ASN D CA    1 
ATOM   3406  C  C     . ASN B  2  498  ? 213.327 278.096 352.917 1.00 195.31 ? 498  ASN D C     1 
ATOM   3407  O  O     . ASN B  2  498  ? 213.561 278.992 353.731 1.00 196.82 ? 498  ASN D O     1 
ATOM   3408  N  N     . LEU B  2  499  ? 213.856 276.881 352.995 1.00 179.79 ? 499  LEU D N     1 
ATOM   3409  C  CA    . LEU B  2  499  ? 214.693 276.487 354.111 1.00 178.17 ? 499  LEU D CA    1 
ATOM   3410  C  C     . LEU B  2  499  ? 216.129 276.165 353.713 1.00 174.37 ? 499  LEU D C     1 
ATOM   3411  O  O     . LEU B  2  499  ? 216.399 275.676 352.615 1.00 171.87 ? 499  LEU D O     1 
ATOM   3412  N  N     . LEU B  2  500  ? 217.045 276.461 354.622 1.00 173.74 ? 500  LEU D N     1 
ATOM   3413  C  CA    . LEU B  2  500  ? 218.407 275.978 354.549 1.00 172.16 ? 500  LEU D CA    1 
ATOM   3414  C  C     . LEU B  2  500  ? 218.741 275.591 355.979 1.00 173.95 ? 500  LEU D C     1 
ATOM   3415  O  O     . LEU B  2  500  ? 218.570 276.399 356.891 1.00 176.92 ? 500  LEU D O     1 
ATOM   3416  N  N     . LEU B  2  501  ? 219.169 274.351 356.195 1.00 190.32 ? 501  LEU D N     1 
ATOM   3417  C  CA    . LEU B  2  501  ? 219.783 274.014 357.477 1.00 191.97 ? 501  LEU D CA    1 
ATOM   3418  C  C     . LEU B  2  501  ? 221.207 273.494 357.295 1.00 190.60 ? 501  LEU D C     1 
ATOM   3419  O  O     . LEU B  2  501  ? 221.488 272.697 356.389 1.00 187.89 ? 501  LEU D O     1 
ATOM   3420  N  N     . CYS B  2  502  ? 222.109 273.988 358.135 1.00 191.32 ? 502  CYS D N     1 
ATOM   3421  C  CA    . CYS B  2  502  ? 223.440 273.422 358.223 1.00 190.71 ? 502  CYS D CA    1 
ATOM   3422  C  C     . CYS B  2  502  ? 223.597 272.818 359.610 1.00 192.56 ? 502  CYS D C     1 
ATOM   3423  O  O     . CYS B  2  502  ? 223.635 273.534 360.611 1.00 195.52 ? 502  CYS D O     1 
ATOM   3424  N  N     . ALA B  2  503  ? 223.663 271.496 359.665 1.00 174.41 ? 503  ALA D N     1 
ATOM   3425  C  CA    . ALA B  2  503  ? 223.821 270.800 360.931 1.00 176.06 ? 503  ALA D CA    1 
ATOM   3426  C  C     . ALA B  2  503  ? 224.715 269.598 360.715 1.00 174.39 ? 503  ALA D C     1 
ATOM   3427  O  O     . ALA B  2  503  ? 224.679 268.977 359.657 1.00 171.69 ? 503  ALA D O     1 
ATOM   3428  N  N     . PRO B  2  504  ? 225.527 269.273 361.720 1.00 176.21 ? 504  PRO D N     1 
ATOM   3429  C  CA    . PRO B  2  504  ? 226.491 268.174 361.636 1.00 175.20 ? 504  PRO D CA    1 
ATOM   3430  C  C     . PRO B  2  504  ? 225.842 266.823 361.404 1.00 173.26 ? 504  PRO D C     1 
ATOM   3431  O  O     . PRO B  2  504  ? 224.676 266.610 361.729 1.00 173.46 ? 504  PRO D O     1 
ATOM   3432  N  N     . THR B  2  505  ? 226.628 265.920 360.835 1.00 187.07 ? 505  THR D N     1 
ATOM   3433  C  CA    . THR B  2  505  ? 226.211 264.552 360.600 1.00 185.50 ? 505  THR D CA    1 
ATOM   3434  C  C     . THR B  2  505  ? 225.813 263.882 361.910 1.00 187.43 ? 505  THR D C     1 
ATOM   3435  O  O     . THR B  2  505  ? 226.555 263.913 362.890 1.00 189.58 ? 505  THR D O     1 
ATOM   3436  N  N     . GLY B  2  506  ? 224.627 263.288 361.919 1.00 171.69 ? 506  GLY D N     1 
ATOM   3437  C  CA    . GLY B  2  506  ? 224.108 262.640 363.105 1.00 173.63 ? 506  GLY D CA    1 
ATOM   3438  C  C     . GLY B  2  506  ? 222.985 263.423 363.757 1.00 175.41 ? 506  GLY D C     1 
ATOM   3439  O  O     . GLY B  2  506  ? 222.259 262.882 364.586 1.00 176.91 ? 506  GLY D O     1 
ATOM   3440  N  N     . ALA B  2  507  ? 222.819 264.689 363.378 1.00 176.88 ? 507  ALA D N     1 
ATOM   3441  C  CA    . ALA B  2  507  ? 221.773 265.533 363.960 1.00 178.85 ? 507  ALA D CA    1 
ATOM   3442  C  C     . ALA B  2  507  ? 220.358 265.069 363.587 1.00 178.14 ? 507  ALA D C     1 
ATOM   3443  O  O     . ALA B  2  507  ? 219.376 265.526 364.181 1.00 180.13 ? 507  ALA D O     1 
ATOM   3444  N  N     . GLY B  2  508  ? 220.265 264.153 362.618 1.00 211.18 ? 508  GLY D N     1 
ATOM   3445  C  CA    . GLY B  2  508  ? 218.993 263.622 362.148 1.00 210.50 ? 508  GLY D CA    1 
ATOM   3446  C  C     . GLY B  2  508  ? 218.217 264.544 361.225 1.00 209.67 ? 508  GLY D C     1 
ATOM   3447  O  O     . GLY B  2  508  ? 217.024 264.778 361.434 1.00 211.04 ? 508  GLY D O     1 
ATOM   3448  N  N     . LYS B  2  509  ? 218.883 265.070 360.203 1.00 170.43 ? 509  LYS D N     1 
ATOM   3449  C  CA    . LYS B  2  509  ? 218.288 266.115 359.371 1.00 169.91 ? 509  LYS D CA    1 
ATOM   3450  C  C     . LYS B  2  509  ? 217.013 265.696 358.618 1.00 169.06 ? 509  LYS D C     1 
ATOM   3451  O  O     . LYS B  2  509  ? 216.128 266.525 358.384 1.00 169.89 ? 509  LYS D O     1 
ATOM   3452  N  N     . THR B  2  510  ? 216.927 264.421 358.237 1.00 170.38 ? 510  THR D N     1 
ATOM   3453  C  CA    . THR B  2  510  ? 215.821 263.926 357.414 1.00 169.57 ? 510  THR D CA    1 
ATOM   3454  C  C     . THR B  2  510  ? 214.479 264.299 357.992 1.00 173.35 ? 510  THR D C     1 
ATOM   3455  O  O     . THR B  2  510  ? 213.614 264.818 357.292 1.00 174.36 ? 510  THR D O     1 
ATOM   3456  N  N     . ASN B  2  511  ? 214.315 264.027 359.282 1.00 171.67 ? 511  ASN D N     1 
ATOM   3457  C  CA    . ASN B  2  511  ? 213.030 264.208 359.930 1.00 174.41 ? 511  ASN D CA    1 
ATOM   3458  C  C     . ASN B  2  511  ? 212.587 265.661 359.974 1.00 175.89 ? 511  ASN D C     1 
ATOM   3459  O  O     . ASN B  2  511  ? 211.428 265.948 360.260 1.00 178.14 ? 511  ASN D O     1 
ATOM   3460  N  N     . VAL B  2  512  ? 213.509 266.577 359.696 1.00 174.90 ? 512  VAL D N     1 
ATOM   3461  C  CA    . VAL B  2  512  ? 213.124 267.961 359.484 1.00 176.03 ? 512  VAL D CA    1 
ATOM   3462  C  C     . VAL B  2  512  ? 212.425 268.076 358.147 1.00 174.43 ? 512  VAL D C     1 
ATOM   3463  O  O     . VAL B  2  512  ? 211.283 268.525 358.068 1.00 176.13 ? 512  VAL D O     1 
ATOM   3464  N  N     . ALA B  2  513  ? 213.117 267.638 357.098 1.00 186.21 ? 513  ALA D N     1 
ATOM   3465  C  CA    . ALA B  2  513  ? 212.580 267.671 355.739 1.00 185.56 ? 513  ALA D CA    1 
ATOM   3466  C  C     . ALA B  2  513  ? 211.271 266.893 355.636 1.00 188.55 ? 513  ALA D C     1 
ATOM   3467  O  O     . ALA B  2  513  ? 210.348 267.315 354.939 1.00 191.00 ? 513  ALA D O     1 
ATOM   3468  N  N     . LEU B  2  514  ? 211.200 265.764 356.340 1.00 171.16 ? 514  LEU D N     1 
ATOM   3469  C  CA    . LEU B  2  514  ? 209.977 264.970 356.428 1.00 172.64 ? 514  LEU D CA    1 
ATOM   3470  C  C     . LEU B  2  514  ? 208.791 265.846 356.799 1.00 175.65 ? 514  LEU D C     1 
ATOM   3471  O  O     . LEU B  2  514  ? 207.735 265.764 356.183 1.00 176.33 ? 514  LEU D O     1 
ATOM   3472  N  N     . MET B  2  515  ? 208.983 266.709 357.791 1.00 207.47 ? 515  MET D N     1 
ATOM   3473  C  CA    . MET B  2  515  ? 207.922 267.606 358.217 1.00 212.84 ? 515  MET D CA    1 
ATOM   3474  C  C     . MET B  2  515  ? 207.552 268.566 357.097 1.00 213.59 ? 515  MET D C     1 
ATOM   3475  O  O     . MET B  2  515  ? 206.371 268.820 356.855 1.00 218.09 ? 515  MET D O     1 
ATOM   3476  N  N     . CYS B  2  516  ? 208.562 269.079 356.400 1.00 188.51 ? 516  CYS D N     1 
ATOM   3477  C  CA    . CYS B  2  516  ? 208.331 269.964 355.268 1.00 188.79 ? 516  CYS D CA    1 
ATOM   3478  C  C     . CYS B  2  516  ? 207.489 269.256 354.220 1.00 189.59 ? 516  CYS D C     1 
ATOM   3479  O  O     . CYS B  2  516  ? 206.793 269.899 353.437 1.00 192.14 ? 516  CYS D O     1 
ATOM   3480  N  N     . MET B  2  517  ? 207.564 267.928 354.202 1.00 189.21 ? 517  MET D N     1 
ATOM   3481  C  CA    . MET B  2  517  ? 206.712 267.142 353.322 1.00 188.57 ? 517  MET D CA    1 
ATOM   3482  C  C     . MET B  2  517  ? 205.314 266.957 353.921 1.00 194.37 ? 517  MET D C     1 
ATOM   3483  O  O     . MET B  2  517  ? 204.306 267.101 353.220 1.00 195.87 ? 517  MET D O     1 
ATOM   3484  N  N     . LEU B  2  518  ? 205.255 266.675 355.221 1.00 185.28 ? 518  LEU D N     1 
ATOM   3485  C  CA    . LEU B  2  518  ? 203.977 266.447 355.891 1.00 190.25 ? 518  LEU D CA    1 
ATOM   3486  C  C     . LEU B  2  518  ? 203.109 267.691 355.887 1.00 194.43 ? 518  LEU D C     1 
ATOM   3487  O  O     . LEU B  2  518  ? 201.901 267.612 356.076 1.00 196.28 ? 518  LEU D O     1 
ATOM   3488  N  N     . ARG B  2  519  ? 203.726 268.846 355.678 1.00 197.34 ? 519  ARG D N     1 
ATOM   3489  C  CA    . ARG B  2  519  ? 202.961 270.066 355.493 1.00 199.69 ? 519  ARG D CA    1 
ATOM   3490  C  C     . ARG B  2  519  ? 202.241 270.015 354.156 1.00 199.97 ? 519  ARG D C     1 
ATOM   3491  O  O     . ARG B  2  519  ? 201.033 270.242 354.082 1.00 202.20 ? 519  ARG D O     1 
ATOM   3492  N  N     . GLU B  2  520  ? 202.980 269.706 353.095 1.00 183.45 ? 520  GLU D N     1 
ATOM   3493  C  CA    . GLU B  2  520  ? 202.398 269.682 351.764 1.00 182.66 ? 520  GLU D CA    1 
ATOM   3494  C  C     . GLU B  2  520  ? 201.377 268.566 351.668 1.00 184.13 ? 520  GLU D C     1 
ATOM   3495  O  O     . GLU B  2  520  ? 200.292 268.760 351.132 1.00 186.17 ? 520  GLU D O     1 
ATOM   3496  N  N     . ILE B  2  521  ? 201.723 267.400 352.206 1.00 183.37 ? 521  ILE D N     1 
ATOM   3497  C  CA    . ILE B  2  521  ? 200.792 266.280 352.295 1.00 185.21 ? 521  ILE D CA    1 
ATOM   3498  C  C     . ILE B  2  521  ? 199.515 266.707 353.008 1.00 189.88 ? 521  ILE D C     1 
ATOM   3499  O  O     . ILE B  2  521  ? 198.435 266.185 352.740 1.00 192.16 ? 521  ILE D O     1 
ATOM   3500  N  N     . GLY B  2  522  ? 199.637 267.685 353.898 1.00 209.18 ? 522  GLY D N     1 
ATOM   3501  C  CA    . GLY B  2  522  ? 198.489 268.196 354.626 1.00 213.48 ? 522  GLY D CA    1 
ATOM   3502  C  C     . GLY B  2  522  ? 197.748 269.294 353.887 1.00 215.84 ? 522  GLY D C     1 
ATOM   3503  O  O     . GLY B  2  522  ? 196.557 269.509 354.123 1.00 218.12 ? 522  GLY D O     1 
ATOM   3504  N  N     . LYS B  2  523  ? 198.453 269.992 352.999 1.00 194.94 ? 523  LYS D N     1 
ATOM   3505  C  CA    . LYS B  2  523  ? 197.859 271.080 352.222 1.00 196.24 ? 523  LYS D CA    1 
ATOM   3506  C  C     . LYS B  2  523  ? 196.672 270.587 351.407 1.00 197.98 ? 523  LYS D C     1 
ATOM   3507  O  O     . LYS B  2  523  ? 195.711 271.323 351.173 1.00 201.12 ? 523  LYS D O     1 
ATOM   3508  N  N     . HIS B  2  524  ? 196.747 269.332 350.981 1.00 215.13 ? 524  HIS D N     1 
ATOM   3509  C  CA    . HIS B  2  524  ? 195.638 268.705 350.288 1.00 213.89 ? 524  HIS D CA    1 
ATOM   3510  C  C     . HIS B  2  524  ? 195.078 267.590 351.152 1.00 213.15 ? 524  HIS D C     1 
ATOM   3511  O  O     . HIS B  2  524  ? 195.661 266.512 351.262 1.00 209.73 ? 524  HIS D O     1 
ATOM   3512  N  N     . ILE B  2  525  ? 193.921 267.858 351.740 1.00 219.65 ? 525  ILE D N     1 
ATOM   3513  C  CA    . ILE B  2  525  ? 193.263 266.922 352.640 1.00 219.86 ? 525  ILE D CA    1 
ATOM   3514  C  C     . ILE B  2  525  ? 191.775 267.166 352.519 1.00 222.35 ? 525  ILE D C     1 
ATOM   3515  O  O     . ILE B  2  525  ? 191.360 268.272 352.185 1.00 224.85 ? 525  ILE D O     1 
ATOM   3516  N  N     . ASN B  2  526  ? 190.971 266.138 352.773 1.00 255.04 ? 526  ASN D N     1 
ATOM   3517  C  CA    . ASN B  2  526  ? 189.513 266.292 352.807 1.00 260.53 ? 526  ASN D CA    1 
ATOM   3518  C  C     . ASN B  2  526  ? 188.949 265.721 354.110 1.00 264.68 ? 526  ASN D C     1 
ATOM   3519  O  O     . ASN B  2  526  ? 189.653 265.013 354.837 1.00 262.95 ? 526  ASN D O     1 
ATOM   3520  N  N     . MET B  2  527  ? 187.699 266.047 354.430 1.00 233.15 ? 527  MET D N     1 
ATOM   3521  C  CA    . MET B  2  527  ? 187.091 265.435 355.598 1.00 237.51 ? 527  MET D CA    1 
ATOM   3522  C  C     . MET B  2  527  ? 186.869 263.950 355.340 1.00 237.56 ? 527  MET D C     1 
ATOM   3523  O  O     . MET B  2  527  ? 187.441 263.106 356.031 1.00 236.25 ? 527  MET D O     1 
ATOM   3524  N  N     . ASP B  2  528  ? 186.098 263.635 354.303 1.00 287.48 ? 528  ASP D N     1 
ATOM   3525  C  CA    . ASP B  2  528  ? 185.653 262.259 354.072 1.00 288.88 ? 528  ASP D CA    1 
ATOM   3526  C  C     . ASP B  2  528  ? 186.659 261.428 353.276 1.00 283.31 ? 528  ASP D C     1 
ATOM   3527  O  O     . ASP B  2  528  ? 186.424 260.258 352.973 1.00 283.90 ? 528  ASP D O     1 
ATOM   3528  N  N     . GLY B  2  529  ? 187.789 262.029 352.946 1.00 315.98 ? 529  GLY D N     1 
ATOM   3529  C  CA    . GLY B  2  529  ? 188.894 261.261 352.415 1.00 310.74 ? 529  GLY D CA    1 
ATOM   3530  C  C     . GLY B  2  529  ? 190.155 261.972 352.817 1.00 306.51 ? 529  GLY D C     1 
ATOM   3531  O  O     . GLY B  2  529  ? 190.160 263.186 352.985 1.00 306.87 ? 529  GLY D O     1 
ATOM   3532  N  N     . THR B  2  530  ? 191.238 261.232 352.964 1.00 306.41 ? 530  THR D N     1 
ATOM   3533  C  CA    . THR B  2  530  ? 192.455 261.867 353.421 1.00 302.79 ? 530  THR D CA    1 
ATOM   3534  C  C     . THR B  2  530  ? 193.488 261.885 352.308 1.00 297.48 ? 530  THR D C     1 
ATOM   3535  O  O     . THR B  2  530  ? 193.514 260.999 351.443 1.00 296.10 ? 530  THR D O     1 
ATOM   3536  N  N     . ILE B  2  531  ? 194.293 262.945 352.311 1.00 292.89 ? 531  ILE D N     1 
ATOM   3537  C  CA    . ILE B  2  531  ? 195.458 263.087 351.440 1.00 288.95 ? 531  ILE D CA    1 
ATOM   3538  C  C     . ILE B  2  531  ? 195.238 262.704 349.965 1.00 286.85 ? 531  ILE D C     1 
ATOM   3539  O  O     . ILE B  2  531  ? 196.066 262.021 349.369 1.00 283.22 ? 531  ILE D O     1 
ATOM   3540  N  N     . ASN B  2  532  ? 194.129 263.162 349.376 1.00 234.18 ? 532  ASN D N     1 
ATOM   3541  C  CA    . ASN B  2  532  ? 193.828 262.818 347.982 1.00 232.80 ? 532  ASN D CA    1 
ATOM   3542  C  C     . ASN B  2  532  ? 194.994 263.211 347.058 1.00 229.11 ? 532  ASN D C     1 
ATOM   3543  O  O     . ASN B  2  532  ? 195.385 264.377 346.984 1.00 229.50 ? 532  ASN D O     1 
ATOM   3544  N  N     . VAL B  2  533  ? 195.517 262.220 346.342 1.00 191.10 ? 533  VAL D N     1 
ATOM   3545  C  CA    . VAL B  2  533  ? 196.897 262.247 345.878 1.00 186.34 ? 533  VAL D CA    1 
ATOM   3546  C  C     . VAL B  2  533  ? 197.190 262.746 344.470 1.00 183.95 ? 533  VAL D C     1 
ATOM   3547  O  O     . VAL B  2  533  ? 198.323 262.670 344.013 1.00 180.22 ? 533  VAL D O     1 
ATOM   3548  N  N     . ASP B  2  534  ? 196.185 263.236 343.768 1.00 186.26 ? 534  ASP D N     1 
ATOM   3549  C  CA    . ASP B  2  534  ? 196.434 263.664 342.401 1.00 184.20 ? 534  ASP D CA    1 
ATOM   3550  C  C     . ASP B  2  534  ? 196.692 265.163 342.301 1.00 183.57 ? 534  ASP D C     1 
ATOM   3551  O  O     . ASP B  2  534  ? 196.903 265.694 341.211 1.00 182.06 ? 534  ASP D O     1 
ATOM   3552  N  N     . ASP B  2  535  ? 196.657 265.845 343.440 1.00 186.56 ? 535  ASP D N     1 
ATOM   3553  C  CA    . ASP B  2  535  ? 196.939 267.282 343.501 1.00 189.64 ? 535  ASP D CA    1 
ATOM   3554  C  C     . ASP B  2  535  ? 198.437 267.632 343.556 1.00 187.38 ? 535  ASP D C     1 
ATOM   3555  O  O     . ASP B  2  535  ? 198.860 268.676 343.049 1.00 188.80 ? 535  ASP D O     1 
ATOM   3556  N  N     . PHE B  2  536  ? 199.226 266.771 344.193 1.00 193.53 ? 536  PHE D N     1 
ATOM   3557  C  CA    . PHE B  2  536  ? 200.615 267.094 344.507 1.00 191.69 ? 536  PHE D CA    1 
ATOM   3558  C  C     . PHE B  2  536  ? 201.562 265.920 344.288 1.00 186.15 ? 536  PHE D C     1 
ATOM   3559  O  O     . PHE B  2  536  ? 201.167 264.755 344.407 1.00 184.59 ? 536  PHE D O     1 
ATOM   3560  N  N     . LYS B  2  537  ? 202.819 266.248 344.001 1.00 169.60 ? 537  LYS D N     1 
ATOM   3561  C  CA    . LYS B  2  537  ? 203.922 265.289 343.972 1.00 166.80 ? 537  LYS D CA    1 
ATOM   3562  C  C     . LYS B  2  537  ? 205.138 265.973 344.593 1.00 165.17 ? 537  LYS D C     1 
ATOM   3563  O  O     . LYS B  2  537  ? 205.337 267.172 344.409 1.00 165.12 ? 537  LYS D O     1 
ATOM   3564  N  N     . ILE B  2  538  ? 205.947 265.224 345.339 1.00 171.43 ? 538  ILE D N     1 
ATOM   3565  C  CA    . ILE B  2  538  ? 207.149 265.784 345.971 1.00 170.59 ? 538  ILE D CA    1 
ATOM   3566  C  C     . ILE B  2  538  ? 208.429 265.147 345.411 1.00 165.70 ? 538  ILE D C     1 
ATOM   3567  O  O     . ILE B  2  538  ? 208.451 263.959 345.114 1.00 163.94 ? 538  ILE D O     1 
ATOM   3568  N  N     . ILE B  2  539  ? 209.489 265.928 345.231 1.00 158.20 ? 539  ILE D N     1 
ATOM   3569  C  CA    . ILE B  2  539  ? 210.726 265.360 344.704 1.00 155.62 ? 539  ILE D CA    1 
ATOM   3570  C  C     . ILE B  2  539  ? 211.862 265.444 345.712 1.00 155.24 ? 539  ILE D C     1 
ATOM   3571  O  O     . ILE B  2  539  ? 212.290 266.531 346.101 1.00 155.67 ? 539  ILE D O     1 
ATOM   3572  N  N     . TYR B  2  540  ? 212.348 264.283 346.129 1.00 169.05 ? 540  TYR D N     1 
ATOM   3573  C  CA    . TYR B  2  540  ? 213.423 264.205 347.100 1.00 168.30 ? 540  TYR D CA    1 
ATOM   3574  C  C     . TYR B  2  540  ? 214.716 263.843 346.395 1.00 165.36 ? 540  TYR D C     1 
ATOM   3575  O  O     . TYR B  2  540  ? 214.856 262.733 345.880 1.00 163.97 ? 540  TYR D O     1 
ATOM   3576  N  N     . ILE B  2  541  ? 215.661 264.779 346.364 1.00 162.82 ? 541  ILE D N     1 
ATOM   3577  C  CA    . ILE B  2  541  ? 216.944 264.532 345.717 1.00 160.54 ? 541  ILE D CA    1 
ATOM   3578  C  C     . ILE B  2  541  ? 218.016 264.171 346.745 1.00 160.43 ? 541  ILE D C     1 
ATOM   3579  O  O     . ILE B  2  541  ? 218.393 264.992 347.585 1.00 161.54 ? 541  ILE D O     1 
ATOM   3580  N  N     . ALA B  2  542  ? 218.502 262.939 346.670 1.00 166.51 ? 542  ALA D N     1 
ATOM   3581  C  CA    . ALA B  2  542  ? 219.544 262.469 347.573 1.00 166.88 ? 542  ALA D CA    1 
ATOM   3582  C  C     . ALA B  2  542  ? 220.798 262.162 346.758 1.00 165.50 ? 542  ALA D C     1 
ATOM   3583  O  O     . ALA B  2  542  ? 220.703 261.742 345.609 1.00 164.29 ? 542  ALA D O     1 
ATOM   3584  N  N     . PRO B  2  543  ? 221.981 262.375 347.348 1.00 149.04 ? 543  PRO D N     1 
ATOM   3585  C  CA    . PRO B  2  543  ? 223.272 262.256 346.664 1.00 148.23 ? 543  PRO D CA    1 
ATOM   3586  C  C     . PRO B  2  543  ? 223.728 260.834 346.309 1.00 147.60 ? 543  PRO D C     1 
ATOM   3587  O  O     . PRO B  2  543  ? 224.473 260.672 345.349 1.00 146.74 ? 543  PRO D O     1 
ATOM   3588  N  N     . MET B  2  544  ? 223.305 259.827 347.067 1.00 162.52 ? 544  MET D N     1 
ATOM   3589  C  CA    . MET B  2  544  ? 223.801 258.466 346.848 1.00 162.30 ? 544  MET D CA    1 
ATOM   3590  C  C     . MET B  2  544  ? 222.709 257.436 346.573 1.00 162.15 ? 544  MET D C     1 
ATOM   3591  O  O     . MET B  2  544  ? 221.575 257.566 347.046 1.00 162.76 ? 544  MET D O     1 
ATOM   3592  N  N     . ARG B  2  545  ? 223.065 256.398 345.820 1.00 161.01 ? 545  ARG D N     1 
ATOM   3593  C  CA    . ARG B  2  545  ? 222.083 255.395 345.413 1.00 161.02 ? 545  ARG D CA    1 
ATOM   3594  C  C     . ARG B  2  545  ? 221.565 254.532 346.566 1.00 162.49 ? 545  ARG D C     1 
ATOM   3595  O  O     . ARG B  2  545  ? 220.357 254.435 346.753 1.00 163.05 ? 545  ARG D O     1 
ATOM   3596  N  N     . SER B  2  546  ? 222.475 253.926 347.329 1.00 163.70 ? 546  SER D N     1 
ATOM   3597  C  CA    . SER B  2  546  ? 222.108 253.099 348.480 1.00 165.29 ? 546  SER D CA    1 
ATOM   3598  C  C     . SER B  2  546  ? 221.152 253.867 349.373 1.00 166.10 ? 546  SER D C     1 
ATOM   3599  O  O     . SER B  2  546  ? 220.147 253.335 349.849 1.00 167.23 ? 546  SER D O     1 
ATOM   3600  N  N     . LEU B  2  547  ? 221.481 255.135 349.569 1.00 151.72 ? 547  LEU D N     1 
ATOM   3601  C  CA    . LEU B  2  547  ? 220.714 256.030 350.420 1.00 152.68 ? 547  LEU D CA    1 
ATOM   3602  C  C     . LEU B  2  547  ? 219.300 256.215 349.863 1.00 152.57 ? 547  LEU D C     1 
ATOM   3603  O  O     . LEU B  2  547  ? 218.328 256.170 350.608 1.00 154.00 ? 547  LEU D O     1 
ATOM   3604  N  N     . VAL B  2  548  ? 219.193 256.401 348.551 1.00 151.28 ? 548  VAL D N     1 
ATOM   3605  C  CA    . VAL B  2  548  ? 217.886 256.489 347.890 1.00 151.30 ? 548  VAL D CA    1 
ATOM   3606  C  C     . VAL B  2  548  ? 217.054 255.217 348.104 1.00 152.49 ? 548  VAL D C     1 
ATOM   3607  O  O     . VAL B  2  548  ? 215.893 255.290 348.515 1.00 153.85 ? 548  VAL D O     1 
ATOM   3608  N  N     . GLN B  2  549  ? 217.664 254.065 347.816 1.00 171.66 ? 549  GLN D N     1 
ATOM   3609  C  CA    . GLN B  2  549  ? 217.029 252.757 347.995 1.00 172.99 ? 549  GLN D CA    1 
ATOM   3610  C  C     . GLN B  2  549  ? 216.450 252.629 349.393 1.00 175.01 ? 549  GLN D C     1 
ATOM   3611  O  O     . GLN B  2  549  ? 215.229 252.516 349.576 1.00 176.41 ? 549  GLN D O     1 
ATOM   3612  N  N     . GLU B  2  550  ? 217.342 252.645 350.378 1.00 180.22 ? 550  GLU D N     1 
ATOM   3613  C  CA    . GLU B  2  550  ? 216.953 252.463 351.769 1.00 182.29 ? 550  GLU D CA    1 
ATOM   3614  C  C     . GLU B  2  550  ? 215.924 253.511 352.204 1.00 183.18 ? 550  GLU D C     1 
ATOM   3615  O  O     . GLU B  2  550  ? 215.005 253.205 352.969 1.00 185.22 ? 550  GLU D O     1 
ATOM   3616  N  N     . MET B  2  551  ? 216.057 254.733 351.689 1.00 168.60 ? 551  MET D N     1 
ATOM   3617  C  CA    . MET B  2  551  ? 215.119 255.798 352.030 1.00 169.56 ? 551  MET D CA    1 
ATOM   3618  C  C     . MET B  2  551  ? 213.712 255.526 351.538 1.00 170.50 ? 551  MET D C     1 
ATOM   3619  O  O     . MET B  2  551  ? 212.764 255.761 352.264 1.00 172.53 ? 551  MET D O     1 
ATOM   3620  N  N     . VAL B  2  552  ? 213.575 255.051 350.300 1.00 165.79 ? 552  VAL D N     1 
ATOM   3621  C  CA    . VAL B  2  552  ? 212.258 254.685 349.781 1.00 166.94 ? 552  VAL D CA    1 
ATOM   3622  C  C     . VAL B  2  552  ? 211.714 253.517 350.592 1.00 169.18 ? 552  VAL D C     1 
ATOM   3623  O  O     . VAL B  2  552  ? 210.506 253.443 350.885 1.00 171.59 ? 552  VAL D O     1 
ATOM   3624  N  N     . GLY B  2  553  ? 212.627 252.628 350.976 1.00 208.87 ? 553  GLY D N     1 
ATOM   3625  C  CA    . GLY B  2  553  ? 212.311 251.511 351.848 1.00 211.17 ? 553  GLY D CA    1 
ATOM   3626  C  C     . GLY B  2  553  ? 211.662 251.886 353.174 1.00 213.96 ? 553  GLY D C     1 
ATOM   3627  O  O     . GLY B  2  553  ? 210.612 251.342 353.530 1.00 216.80 ? 553  GLY D O     1 
ATOM   3628  N  N     . SER B  2  554  ? 212.281 252.799 353.918 1.00 187.61 ? 554  SER D N     1 
ATOM   3629  C  CA    . SER B  2  554  ? 211.715 253.220 355.200 1.00 190.59 ? 554  SER D CA    1 
ATOM   3630  C  C     . SER B  2  554  ? 210.593 254.261 355.083 1.00 192.14 ? 554  SER D C     1 
ATOM   3631  O  O     . SER B  2  554  ? 209.625 254.209 355.841 1.00 195.66 ? 554  SER D O     1 
ATOM   3632  N  N     . PHE B  2  555  ? 210.720 255.195 354.143 1.00 167.00 ? 555  PHE D N     1 
ATOM   3633  C  CA    . PHE B  2  555  ? 209.674 256.186 353.870 1.00 167.94 ? 555  PHE D CA    1 
ATOM   3634  C  C     . PHE B  2  555  ? 208.348 255.510 353.531 1.00 169.90 ? 555  PHE D C     1 
ATOM   3635  O  O     . PHE B  2  555  ? 207.278 255.979 353.932 1.00 172.29 ? 555  PHE D O     1 
ATOM   3636  N  N     . GLY B  2  556  ? 208.430 254.419 352.769 1.00 209.45 ? 556  GLY D N     1 
ATOM   3637  C  CA    . GLY B  2  556  ? 207.248 253.645 352.442 1.00 211.57 ? 556  GLY D CA    1 
ATOM   3638  C  C     . GLY B  2  556  ? 206.534 253.174 353.693 1.00 215.68 ? 556  GLY D C     1 
ATOM   3639  O  O     . GLY B  2  556  ? 205.343 253.449 353.878 1.00 218.55 ? 556  GLY D O     1 
ATOM   3640  N  N     . LYS B  2  557  ? 207.276 252.480 354.556 1.00 198.83 ? 557  LYS D N     1 
ATOM   3641  C  CA    . LYS B  2  557  ? 206.742 251.972 355.818 1.00 202.94 ? 557  LYS D CA    1 
ATOM   3642  C  C     . LYS B  2  557  ? 206.118 253.096 356.631 1.00 205.68 ? 557  LYS D C     1 
ATOM   3643  O  O     . LYS B  2  557  ? 204.975 252.993 357.082 1.00 210.14 ? 557  LYS D O     1 
ATOM   3644  N  N     . ARG B  2  558  ? 206.873 254.173 356.804 1.00 178.10 ? 558  ARG D N     1 
ATOM   3645  C  CA    . ARG B  2  558  ? 206.440 255.268 357.652 1.00 179.96 ? 558  ARG D CA    1 
ATOM   3646  C  C     . ARG B  2  558  ? 205.168 255.930 357.139 1.00 181.55 ? 558  ARG D C     1 
ATOM   3647  O  O     . ARG B  2  558  ? 204.147 255.955 357.820 1.00 184.95 ? 558  ARG D O     1 
ATOM   3648  N  N     . LEU B  2  559  ? 205.224 256.443 355.922 1.00 179.32 ? 559  LEU D N     1 
ATOM   3649  C  CA    . LEU B  2  559  ? 204.094 257.166 355.361 1.00 180.75 ? 559  LEU D CA    1 
ATOM   3650  C  C     . LEU B  2  559  ? 202.913 256.276 354.953 1.00 183.08 ? 559  LEU D C     1 
ATOM   3651  O  O     . LEU B  2  559  ? 201.860 256.788 354.560 1.00 184.91 ? 559  LEU D O     1 
ATOM   3652  N  N     . ALA B  2  560  ? 203.081 254.955 355.036 1.00 201.83 ? 560  ALA D N     1 
ATOM   3653  C  CA    . ALA B  2  560  ? 202.025 254.009 354.645 1.00 203.49 ? 560  ALA D CA    1 
ATOM   3654  C  C     . ALA B  2  560  ? 200.685 254.191 355.377 1.00 208.24 ? 560  ALA D C     1 
ATOM   3655  O  O     . ALA B  2  560  ? 199.626 253.814 354.862 1.00 209.35 ? 560  ALA D O     1 
ATOM   3656  N  N     . THR B  2  561  ? 200.741 254.761 356.579 1.00 235.00 ? 561  THR D N     1 
ATOM   3657  C  CA    . THR B  2  561  ? 199.547 255.033 357.373 1.00 239.72 ? 561  THR D CA    1 
ATOM   3658  C  C     . THR B  2  561  ? 198.628 255.974 356.603 1.00 239.13 ? 561  THR D C     1 
ATOM   3659  O  O     . THR B  2  561  ? 197.405 255.928 356.749 1.00 242.01 ? 561  THR D O     1 
ATOM   3660  N  N     . TYR B  2  562  ? 199.236 256.833 355.793 1.00 196.55 ? 562  TYR D N     1 
ATOM   3661  C  CA    . TYR B  2  562  ? 198.494 257.715 354.912 1.00 196.09 ? 562  TYR D CA    1 
ATOM   3662  C  C     . TYR B  2  562  ? 198.097 256.981 353.648 1.00 194.22 ? 562  TYR D C     1 
ATOM   3663  O  O     . TYR B  2  562  ? 197.136 257.359 352.990 1.00 195.48 ? 562  TYR D O     1 
ATOM   3664  N  N     . GLY B  2  563  ? 198.818 255.914 353.320 1.00 191.50 ? 563  GLY D N     1 
ATOM   3665  C  CA    . GLY B  2  563  ? 198.558 255.183 352.091 1.00 190.80 ? 563  GLY D CA    1 
ATOM   3666  C  C     . GLY B  2  563  ? 199.086 255.909 350.865 1.00 187.31 ? 563  GLY D C     1 
ATOM   3667  O  O     . GLY B  2  563  ? 198.650 255.662 349.734 1.00 187.21 ? 563  GLY D O     1 
ATOM   3668  N  N     . ILE B  2  564  ? 200.033 256.817 351.096 1.00 187.63 ? 564  ILE D N     1 
ATOM   3669  C  CA    . ILE B  2  564  ? 200.706 257.525 350.013 1.00 184.28 ? 564  ILE D CA    1 
ATOM   3670  C  C     . ILE B  2  564  ? 201.875 256.711 349.457 1.00 180.56 ? 564  ILE D C     1 
ATOM   3671  O  O     . ILE B  2  564  ? 202.689 256.146 350.199 1.00 179.97 ? 564  ILE D O     1 
ATOM   3672  N  N     . THR B  2  565  ? 201.931 256.661 348.133 1.00 182.64 ? 565  THR D N     1 
ATOM   3673  C  CA    . THR B  2  565  ? 202.831 255.776 347.419 1.00 179.98 ? 565  THR D CA    1 
ATOM   3674  C  C     . THR B  2  565  ? 204.116 256.499 347.046 1.00 176.34 ? 565  THR D C     1 
ATOM   3675  O  O     . THR B  2  565  ? 204.093 257.425 346.240 1.00 175.36 ? 565  THR D O     1 
ATOM   3676  N  N     . VAL B  2  566  ? 205.226 256.068 347.648 1.00 168.30 ? 566  VAL D N     1 
ATOM   3677  C  CA    . VAL B  2  566  ? 206.547 256.661 347.430 1.00 165.18 ? 566  VAL D CA    1 
ATOM   3678  C  C     . VAL B  2  566  ? 207.489 255.637 346.815 1.00 163.14 ? 566  VAL D C     1 
ATOM   3679  O  O     . VAL B  2  566  ? 207.605 254.519 347.320 1.00 163.98 ? 566  VAL D O     1 
ATOM   3680  N  N     . ALA B  2  567  ? 208.160 256.009 345.730 1.00 160.70 ? 567  ALA D N     1 
ATOM   3681  C  CA    . ALA B  2  567  ? 209.072 255.080 345.078 1.00 158.95 ? 567  ALA D CA    1 
ATOM   3682  C  C     . ALA B  2  567  ? 210.315 255.760 344.534 1.00 156.19 ? 567  ALA D C     1 
ATOM   3683  O  O     . ALA B  2  567  ? 210.335 256.976 344.333 1.00 155.53 ? 567  ALA D O     1 
ATOM   3684  N  N     . GLU B  2  568  ? 211.349 254.952 344.308 1.00 159.85 ? 568  GLU D N     1 
ATOM   3685  C  CA    . GLU B  2  568  ? 212.607 255.382 343.704 1.00 157.55 ? 568  GLU D CA    1 
ATOM   3686  C  C     . GLU B  2  568  ? 212.394 255.635 342.227 1.00 156.61 ? 568  GLU D C     1 
ATOM   3687  O  O     . GLU B  2  568  ? 211.651 254.894 341.589 1.00 157.49 ? 568  GLU D O     1 
ATOM   3688  N  N     . LEU B  2  569  ? 213.053 256.637 341.649 1.00 149.88 ? 569  LEU D N     1 
ATOM   3689  C  CA    . LEU B  2  569  ? 212.898 256.776 340.214 1.00 149.03 ? 569  LEU D CA    1 
ATOM   3690  C  C     . LEU B  2  569  ? 214.123 256.164 339.541 1.00 147.52 ? 569  LEU D C     1 
ATOM   3691  O  O     . LEU B  2  569  ? 215.098 256.844 339.251 1.00 146.14 ? 569  LEU D O     1 
ATOM   3692  N  N     . THR B  2  570  ? 214.016 254.874 339.223 1.00 169.36 ? 570  THR D N     1 
ATOM   3693  C  CA    . THR B  2  570  ? 215.024 254.147 338.450 1.00 168.97 ? 570  THR D CA    1 
ATOM   3694  C  C     . THR B  2  570  ? 214.529 253.940 337.033 1.00 169.34 ? 570  THR D C     1 
ATOM   3695  O  O     . THR B  2  570  ? 215.201 253.337 336.194 1.00 169.38 ? 570  THR D O     1 
ATOM   3696  N  N     . GLY B  2  571  ? 213.314 254.411 336.800 1.00 199.40 ? 571  GLY D N     1 
ATOM   3697  C  CA    . GLY B  2  571  ? 212.638 254.154 335.555 1.00 200.15 ? 571  GLY D CA    1 
ATOM   3698  C  C     . GLY B  2  571  ? 213.440 254.555 334.337 1.00 199.40 ? 571  GLY D C     1 
ATOM   3699  O  O     . GLY B  2  571  ? 214.021 255.637 334.280 1.00 198.42 ? 571  GLY D O     1 
ATOM   3700  N  N     . ASP B  2  572  ? 213.511 253.643 333.376 1.00 195.66 ? 572  ASP D N     1 
ATOM   3701  C  CA    . ASP B  2  572  ? 213.735 254.031 332.007 1.00 195.67 ? 572  ASP D CA    1 
ATOM   3702  C  C     . ASP B  2  572  ? 212.528 254.892 331.685 1.00 196.14 ? 572  ASP D C     1 
ATOM   3703  O  O     . ASP B  2  572  ? 211.414 254.618 332.148 1.00 197.11 ? 572  ASP D O     1 
ATOM   3704  N  N     . HIS B  2  573  ? 212.741 255.894 330.850 1.00 150.32 ? 573  HIS D N     1 
ATOM   3705  C  CA    . HIS B  2  573  ? 211.749 256.932 330.617 1.00 150.92 ? 573  HIS D CA    1 
ATOM   3706  C  C     . HIS B  2  573  ? 210.337 256.431 330.274 1.00 152.54 ? 573  HIS D C     1 
ATOM   3707  O  O     . HIS B  2  573  ? 209.372 256.748 330.965 1.00 153.36 ? 573  HIS D O     1 
ATOM   3708  N  N     . GLN B  2  574  ? 210.222 255.650 329.208 1.00 182.55 ? 574  GLN D N     1 
ATOM   3709  C  CA    . GLN B  2  574  ? 208.920 255.362 328.607 1.00 184.35 ? 574  GLN D CA    1 
ATOM   3710  C  C     . GLN B  2  574  ? 208.071 254.254 329.236 1.00 185.55 ? 574  GLN D C     1 
ATOM   3711  O  O     . GLN B  2  574  ? 206.843 254.371 329.295 1.00 187.05 ? 574  GLN D O     1 
ATOM   3712  N  N     . LEU B  2  575  ? 208.709 253.173 329.671 1.00 180.65 ? 575  LEU D N     1 
ATOM   3713  C  CA    . LEU B  2  575  ? 207.982 252.053 330.277 1.00 182.05 ? 575  LEU D CA    1 
ATOM   3714  C  C     . LEU B  2  575  ? 207.376 252.456 331.632 1.00 182.28 ? 575  LEU D C     1 
ATOM   3715  O  O     . LEU B  2  575  ? 206.206 252.159 331.929 1.00 184.72 ? 575  LEU D O     1 
ATOM   3716  N  N     . CYS B  2  576  ? 208.185 253.142 332.442 1.00 200.33 ? 576  CYS D N     1 
ATOM   3717  C  CA    . CYS B  2  576  ? 207.702 253.669 333.711 1.00 200.65 ? 576  CYS D CA    1 
ATOM   3718  C  C     . CYS B  2  576  ? 207.728 255.202 333.731 1.00 199.95 ? 576  CYS D C     1 
ATOM   3719  O  O     . CYS B  2  576  ? 208.718 255.844 334.127 1.00 198.44 ? 576  CYS D O     1 
ATOM   3720  N  N     . LYS B  2  577  ? 206.582 255.755 333.344 1.00 213.17 ? 577  LYS D N     1 
ATOM   3721  C  CA    . LYS B  2  577  ? 206.241 257.167 333.408 1.00 213.50 ? 577  LYS D CA    1 
ATOM   3722  C  C     . LYS B  2  577  ? 204.806 257.088 333.877 1.00 215.89 ? 577  LYS D C     1 
ATOM   3723  O  O     . LYS B  2  577  ? 204.441 257.597 334.935 1.00 216.71 ? 577  LYS D O     1 
ATOM   3724  N  N     . GLU B  2  578  ? 204.003 256.443 333.032 1.00 185.76 ? 578  GLU D N     1 
ATOM   3725  C  CA    . GLU B  2  578  ? 202.627 256.052 333.327 1.00 189.10 ? 578  GLU D CA    1 
ATOM   3726  C  C     . GLU B  2  578  ? 202.530 255.192 334.593 1.00 190.22 ? 578  GLU D C     1 
ATOM   3727  O  O     . GLU B  2  578  ? 201.445 255.026 335.163 1.00 193.13 ? 578  GLU D O     1 
ATOM   3728  N  N     . GLU B  2  579  ? 203.661 254.609 334.989 1.00 216.11 ? 579  GLU D N     1 
ATOM   3729  C  CA    . GLU B  2  579  ? 203.810 253.898 336.268 1.00 216.70 ? 579  GLU D CA    1 
ATOM   3730  C  C     . GLU B  2  579  ? 204.027 254.858 337.453 1.00 216.02 ? 579  GLU D C     1 
ATOM   3731  O  O     . GLU B  2  579  ? 203.382 254.752 338.501 1.00 218.06 ? 579  GLU D O     1 
ATOM   3732  N  N     . ILE B  2  580  ? 204.951 255.798 337.257 1.00 161.66 ? 580  ILE D N     1 
ATOM   3733  C  CA    . ILE B  2  580  ? 205.325 256.776 338.271 1.00 160.84 ? 580  ILE D CA    1 
ATOM   3734  C  C     . ILE B  2  580  ? 204.372 257.968 338.183 1.00 162.19 ? 580  ILE D C     1 
ATOM   3735  O  O     . ILE B  2  580  ? 204.482 258.930 338.938 1.00 162.42 ? 580  ILE D O     1 
ATOM   3736  N  N     . SER B  2  581  ? 203.434 257.894 337.245 1.00 162.94 ? 581  SER D N     1 
ATOM   3737  C  CA    . SER B  2  581  ? 202.377 258.887 337.136 1.00 164.94 ? 581  SER D CA    1 
ATOM   3738  C  C     . SER B  2  581  ? 201.606 258.892 338.432 1.00 167.53 ? 581  SER D C     1 
ATOM   3739  O  O     . SER B  2  581  ? 201.259 259.942 338.966 1.00 168.44 ? 581  SER D O     1 
ATOM   3740  N  N     . ALA B  2  582  ? 201.361 257.691 338.938 1.00 184.30 ? 582  ALA D N     1 
ATOM   3741  C  CA    . ALA B  2  582  ? 200.562 257.512 340.137 1.00 187.14 ? 582  ALA D CA    1 
ATOM   3742  C  C     . ALA B  2  582  ? 201.422 257.559 341.391 1.00 185.83 ? 582  ALA D C     1 
ATOM   3743  O  O     . ALA B  2  582  ? 200.934 257.285 342.488 1.00 188.05 ? 582  ALA D O     1 
ATOM   3744  N  N     . THR B  2  583  ? 202.703 257.880 341.224 1.00 167.19 ? 583  THR D N     1 
ATOM   3745  C  CA    . THR B  2  583  ? 203.635 257.911 342.351 1.00 165.96 ? 583  THR D CA    1 
ATOM   3746  C  C     . THR B  2  583  ? 203.896 259.337 342.865 1.00 165.44 ? 583  THR D C     1 
ATOM   3747  O  O     . THR B  2  583  ? 204.034 260.268 342.076 1.00 164.31 ? 583  THR D O     1 
ATOM   3748  N  N     . GLN B  2  584  ? 203.949 259.495 344.187 1.00 173.92 ? 584  GLN D N     1 
ATOM   3749  C  CA    . GLN B  2  584  ? 204.203 260.782 344.829 1.00 174.83 ? 584  GLN D CA    1 
ATOM   3750  C  C     . GLN B  2  584  ? 205.443 260.677 345.690 1.00 173.14 ? 584  GLN D C     1 
ATOM   3751  O  O     . GLN B  2  584  ? 205.883 259.589 346.045 1.00 172.06 ? 584  GLN D O     1 
ATOM   3752  N  N     . ILE B  2  585  ? 205.996 261.836 346.030 1.00 164.05 ? 585  ILE D N     1 
ATOM   3753  C  CA    . ILE B  2  585  ? 207.218 261.884 346.818 1.00 162.62 ? 585  ILE D CA    1 
ATOM   3754  C  C     . ILE B  2  585  ? 208.226 260.900 346.242 1.00 160.17 ? 585  ILE D C     1 
ATOM   3755  O  O     . ILE B  2  585  ? 208.421 259.816 346.793 1.00 160.45 ? 585  ILE D O     1 
ATOM   3756  N  N     . ILE B  2  586  ? 208.776 261.233 345.084 1.00 160.85 ? 586  ILE D N     1 
ATOM   3757  C  CA    . ILE B  2  586  ? 209.710 260.368 344.381 1.00 157.96 ? 586  ILE D CA    1 
ATOM   3758  C  C     . ILE B  2  586  ? 211.151 260.751 344.705 1.00 156.03 ? 586  ILE D C     1 
ATOM   3759  O  O     . ILE B  2  586  ? 211.516 261.928 344.712 1.00 156.04 ? 586  ILE D O     1 
ATOM   3760  N  N     . VAL B  2  587  ? 211.952 259.739 345.001 1.00 165.44 ? 587  VAL D N     1 
ATOM   3761  C  CA    . VAL B  2  587  ? 213.322 259.935 345.435 1.00 163.92 ? 587  VAL D CA    1 
ATOM   3762  C  C     . VAL B  2  587  ? 214.262 259.631 344.273 1.00 161.70 ? 587  VAL D C     1 
ATOM   3763  O  O     . VAL B  2  587  ? 214.063 258.651 343.551 1.00 161.41 ? 587  VAL D O     1 
ATOM   3764  N  N     . CYS B  2  588  ? 215.266 260.477 344.074 1.00 149.44 ? 588  CYS D N     1 
ATOM   3765  C  CA    . CYS B  2  588  ? 216.211 260.253 342.990 1.00 147.74 ? 588  CYS D CA    1 
ATOM   3766  C  C     . CYS B  2  588  ? 217.535 260.977 343.197 1.00 146.90 ? 588  CYS D C     1 
ATOM   3767  O  O     . CYS B  2  588  ? 217.643 261.897 344.007 1.00 147.56 ? 588  CYS D O     1 
ATOM   3768  N  N     . THR B  2  589  ? 218.540 260.543 342.445 1.00 145.24 ? 589  THR D N     1 
ATOM   3769  C  CA    . THR B  2  589  ? 219.834 261.201 342.393 1.00 144.68 ? 589  THR D CA    1 
ATOM   3770  C  C     . THR B  2  589  ? 219.728 262.397 341.452 1.00 144.15 ? 589  THR D C     1 
ATOM   3771  O  O     . THR B  2  589  ? 219.011 262.322 340.456 1.00 143.69 ? 589  THR D O     1 
ATOM   3772  N  N     . PRO B  2  590  ? 220.449 263.497 341.755 1.00 144.41 ? 590  PRO D N     1 
ATOM   3773  C  CA    . PRO B  2  590  ? 220.327 264.751 340.998 1.00 144.26 ? 590  PRO D CA    1 
ATOM   3774  C  C     . PRO B  2  590  ? 220.462 264.533 339.489 1.00 143.08 ? 590  PRO D C     1 
ATOM   3775  O  O     . PRO B  2  590  ? 219.750 265.130 338.674 1.00 142.95 ? 590  PRO D O     1 
ATOM   3776  N  N     . GLU B  2  591  ? 221.381 263.650 339.134 1.00 153.23 ? 591  GLU D N     1 
ATOM   3777  C  CA    . GLU B  2  591  ? 221.620 263.299 337.751 1.00 153.15 ? 591  GLU D CA    1 
ATOM   3778  C  C     . GLU B  2  591  ? 220.334 262.799 337.087 1.00 153.13 ? 591  GLU D C     1 
ATOM   3779  O  O     . GLU B  2  591  ? 219.887 263.379 336.093 1.00 153.49 ? 591  GLU D O     1 
ATOM   3780  N  N     . LYS B  2  592  ? 219.735 261.755 337.669 1.00 144.73 ? 592  LYS D N     1 
ATOM   3781  C  CA    . LYS B  2  592  ? 218.480 261.162 337.180 1.00 144.99 ? 592  LYS D CA    1 
ATOM   3782  C  C     . LYS B  2  592  ? 217.467 262.251 336.882 1.00 145.66 ? 592  LYS D C     1 
ATOM   3783  O  O     . LYS B  2  592  ? 216.883 262.293 335.796 1.00 146.01 ? 592  LYS D O     1 
ATOM   3784  N  N     . TRP B  2  593  ? 217.285 263.145 337.846 1.00 143.05 ? 593  TRP D N     1 
ATOM   3785  C  CA    . TRP B  2  593  ? 216.383 264.265 337.664 1.00 143.76 ? 593  TRP D CA    1 
ATOM   3786  C  C     . TRP B  2  593  ? 216.810 265.126 336.481 1.00 143.07 ? 593  TRP D C     1 
ATOM   3787  O  O     . TRP B  2  593  ? 215.964 265.611 335.732 1.00 143.42 ? 593  TRP D O     1 
ATOM   3788  N  N     . ASP B  2  594  ? 218.111 265.305 336.281 1.00 142.30 ? 594  ASP D N     1 
ATOM   3789  C  CA    . ASP B  2  594  ? 218.535 266.167 335.182 1.00 141.90 ? 594  ASP D CA    1 
ATOM   3790  C  C     . ASP B  2  594  ? 218.320 265.565 333.782 1.00 141.21 ? 594  ASP D C     1 
ATOM   3791  O  O     . ASP B  2  594  ? 217.811 266.252 332.887 1.00 141.38 ? 594  ASP D O     1 
ATOM   3792  N  N     . ILE B  2  595  ? 218.692 264.302 333.576 1.00 146.75 ? 595  ILE D N     1 
ATOM   3793  C  CA    . ILE B  2  595  ? 218.416 263.681 332.281 1.00 147.01 ? 595  ILE D CA    1 
ATOM   3794  C  C     . ILE B  2  595  ? 216.919 263.693 332.062 1.00 147.70 ? 595  ILE D C     1 
ATOM   3795  O  O     . ILE B  2  595  ? 216.431 264.194 331.047 1.00 148.55 ? 595  ILE D O     1 
ATOM   3796  N  N     . ILE B  2  596  ? 216.195 263.159 333.039 1.00 153.04 ? 596  ILE D N     1 
ATOM   3797  C  CA    . ILE B  2  596  ? 214.761 262.988 332.903 1.00 154.05 ? 596  ILE D CA    1 
ATOM   3798  C  C     . ILE B  2  596  ? 214.044 264.315 332.658 1.00 155.47 ? 596  ILE D C     1 
ATOM   3799  O  O     . ILE B  2  596  ? 213.015 264.353 331.991 1.00 156.71 ? 596  ILE D O     1 
ATOM   3800  N  N     . THR B  2  597  ? 214.617 265.412 333.135 1.00 143.36 ? 597  THR D N     1 
ATOM   3801  C  CA    . THR B  2  597  ? 214.069 266.721 332.795 1.00 144.15 ? 597  THR D CA    1 
ATOM   3802  C  C     . THR B  2  597  ? 214.469 267.167 331.388 1.00 143.54 ? 597  THR D C     1 
ATOM   3803  O  O     . THR B  2  597  ? 213.690 267.827 330.700 1.00 144.34 ? 597  THR D O     1 
ATOM   3804  N  N     . ARG B  2  598  ? 215.678 266.805 330.957 1.00 154.39 ? 598  ARG D N     1 
ATOM   3805  C  CA    . ARG B  2  598  ? 216.147 267.142 329.607 1.00 154.90 ? 598  ARG D CA    1 
ATOM   3806  C  C     . ARG B  2  598  ? 215.333 266.447 328.522 1.00 155.48 ? 598  ARG D C     1 
ATOM   3807  O  O     . ARG B  2  598  ? 215.200 266.951 327.402 1.00 156.54 ? 598  ARG D O     1 
ATOM   3808  N  N     . LYS B  2  599  ? 214.833 265.263 328.840 1.00 142.23 ? 599  LYS D N     1 
ATOM   3809  C  CA    . LYS B  2  599  ? 213.994 264.525 327.910 1.00 142.79 ? 599  LYS D CA    1 
ATOM   3810  C  C     . LYS B  2  599  ? 212.555 265.066 327.951 1.00 144.30 ? 599  LYS D C     1 
ATOM   3811  O  O     . LYS B  2  599  ? 211.846 265.099 326.937 1.00 145.08 ? 599  LYS D O     1 
ATOM   3812  N  N     . GLY B  2  600  ? 212.151 265.524 329.130 1.00 174.33 ? 600  GLY D N     1 
ATOM   3813  C  CA    . GLY B  2  600  ? 210.816 266.049 329.338 1.00 176.55 ? 600  GLY D CA    1 
ATOM   3814  C  C     . GLY B  2  600  ? 209.887 265.148 330.133 1.00 176.89 ? 600  GLY D C     1 
ATOM   3815  O  O     . GLY B  2  600  ? 208.703 265.459 330.287 1.00 178.91 ? 600  GLY D O     1 
ATOM   3816  N  N     . GLY B  2  601  ? 210.418 264.050 330.666 1.00 147.09 ? 601  GLY D N     1 
ATOM   3817  C  CA    . GLY B  2  601  ? 209.641 263.174 331.532 1.00 148.32 ? 601  GLY D CA    1 
ATOM   3818  C  C     . GLY B  2  601  ? 209.105 263.918 332.736 1.00 149.49 ? 601  GLY D C     1 
ATOM   3819  O  O     . GLY B  2  601  ? 208.111 263.531 333.340 1.00 151.22 ? 601  GLY D O     1 
ATOM   3820  N  N     . GLU B  2  602  ? 209.788 265.006 333.068 1.00 185.60 ? 602  GLU D N     1 
ATOM   3821  C  CA    . GLU B  2  602  ? 209.429 265.895 334.159 1.00 187.19 ? 602  GLU D CA    1 
ATOM   3822  C  C     . GLU B  2  602  ? 208.294 266.844 333.791 1.00 190.21 ? 602  GLU D C     1 
ATOM   3823  O  O     . GLU B  2  602  ? 207.511 267.228 334.655 1.00 192.62 ? 602  GLU D O     1 
ATOM   3824  N  N     . ARG B  2  603  ? 208.207 267.228 332.519 1.00 165.57 ? 603  ARG D N     1 
ATOM   3825  C  CA    . ARG B  2  603  ? 207.314 268.323 332.133 1.00 169.70 ? 603  ARG D CA    1 
ATOM   3826  C  C     . ARG B  2  603  ? 205.843 267.913 332.145 1.00 171.97 ? 603  ARG D C     1 
ATOM   3827  O  O     . ARG B  2  603  ? 204.948 268.754 332.047 1.00 175.94 ? 603  ARG D O     1 
ATOM   3828  N  N     . THR B  2  604  ? 205.610 266.609 332.242 1.00 157.41 ? 604  THR D N     1 
ATOM   3829  C  CA    . THR B  2  604  ? 204.286 266.064 332.532 1.00 159.19 ? 604  THR D CA    1 
ATOM   3830  C  C     . THR B  2  604  ? 203.993 266.064 334.057 1.00 159.99 ? 604  THR D C     1 
ATOM   3831  O  O     . THR B  2  604  ? 202.842 266.157 334.486 1.00 162.73 ? 604  THR D O     1 
ATOM   3832  N  N     . TYR B  2  605  ? 205.057 265.975 334.859 1.00 197.08 ? 605  TYR D N     1 
ATOM   3833  C  CA    . TYR B  2  605  ? 204.976 265.994 336.325 1.00 197.85 ? 605  TYR D CA    1 
ATOM   3834  C  C     . TYR B  2  605  ? 204.829 267.401 336.910 1.00 201.51 ? 605  TYR D C     1 
ATOM   3835  O  O     . TYR B  2  605  ? 204.076 267.605 337.857 1.00 204.43 ? 605  TYR D O     1 
ATOM   3836  N  N     . THR B  2  606  ? 205.578 268.354 336.361 1.00 200.22 ? 606  THR D N     1 
ATOM   3837  C  CA    . THR B  2  606  ? 205.706 269.688 336.955 1.00 203.64 ? 606  THR D CA    1 
ATOM   3838  C  C     . THR B  2  606  ? 204.421 270.497 336.937 1.00 209.18 ? 606  THR D C     1 
ATOM   3839  O  O     . THR B  2  606  ? 203.491 270.178 336.185 1.00 210.18 ? 606  THR D O     1 
ATOM   3840  N  N     . GLN B  2  607  ? 204.392 271.527 337.786 1.00 203.37 ? 607  GLN D N     1 
ATOM   3841  C  CA    . GLN B  2  607  ? 203.192 272.314 338.105 1.00 209.75 ? 607  GLN D CA    1 
ATOM   3842  C  C     . GLN B  2  607  ? 202.255 271.527 339.028 1.00 210.54 ? 607  GLN D C     1 
ATOM   3843  O  O     . GLN B  2  607  ? 201.282 272.070 339.553 1.00 216.11 ? 607  GLN D O     1 
ATOM   3844  N  N     . LEU B  2  608  ? 202.536 270.236 339.177 1.00 207.03 ? 608  LEU D N     1 
ATOM   3845  C  CA    . LEU B  2  608  ? 202.005 269.438 340.275 1.00 206.98 ? 608  LEU D CA    1 
ATOM   3846  C  C     . LEU B  2  608  ? 203.049 269.301 341.381 1.00 205.09 ? 608  LEU D C     1 
ATOM   3847  O  O     . LEU B  2  608  ? 202.820 268.604 342.369 1.00 204.83 ? 608  LEU D O     1 
ATOM   3848  N  N     . VAL B  2  609  ? 204.200 269.946 341.198 1.00 179.82 ? 609  VAL D N     1 
ATOM   3849  C  CA    . VAL B  2  609  ? 205.266 269.915 342.201 1.00 177.95 ? 609  VAL D CA    1 
ATOM   3850  C  C     . VAL B  2  609  ? 205.325 271.198 343.030 1.00 182.70 ? 609  VAL D C     1 
ATOM   3851  O  O     . VAL B  2  609  ? 205.677 272.262 342.522 1.00 184.24 ? 609  VAL D O     1 
ATOM   3852  N  N     . ARG B  2  610  ? 204.932 271.104 344.299 1.00 180.07 ? 610  ARG D N     1 
ATOM   3853  C  CA    . ARG B  2  610  ? 205.059 272.227 345.225 1.00 184.89 ? 610  ARG D CA    1 
ATOM   3854  C  C     . ARG B  2  610  ? 206.324 272.178 346.086 1.00 181.63 ? 610  ARG D C     1 
ATOM   3855  O  O     . ARG B  2  610  ? 206.680 273.164 346.729 1.00 183.97 ? 610  ARG D O     1 
ATOM   3856  N  N     . LEU B  2  611  ? 207.010 271.037 346.088 1.00 187.79 ? 611  LEU D N     1 
ATOM   3857  C  CA    . LEU B  2  611  ? 208.158 270.845 346.975 1.00 184.89 ? 611  LEU D CA    1 
ATOM   3858  C  C     . LEU B  2  611  ? 209.286 270.015 346.362 1.00 178.36 ? 611  LEU D C     1 
ATOM   3859  O  O     . LEU B  2  611  ? 209.041 268.935 345.820 1.00 175.77 ? 611  LEU D O     1 
ATOM   3860  N  N     . ILE B  2  612  ? 210.520 270.512 346.465 1.00 163.16 ? 612  ILE D N     1 
ATOM   3861  C  CA    . ILE B  2  612  ? 211.714 269.708 346.176 1.00 158.53 ? 612  ILE D CA    1 
ATOM   3862  C  C     . ILE B  2  612  ? 212.710 269.744 347.353 1.00 158.82 ? 612  ILE D C     1 
ATOM   3863  O  O     . ILE B  2  612  ? 213.019 270.809 347.904 1.00 160.09 ? 612  ILE D O     1 
ATOM   3864  N  N     . ILE B  2  613  ? 213.187 268.570 347.753 1.00 169.24 ? 613  ILE D N     1 
ATOM   3865  C  CA    . ILE B  2  613  ? 214.176 268.470 348.819 1.00 168.49 ? 613  ILE D CA    1 
ATOM   3866  C  C     . ILE B  2  613  ? 215.565 268.270 348.220 1.00 165.18 ? 613  ILE D C     1 
ATOM   3867  O  O     . ILE B  2  613  ? 215.785 267.345 347.434 1.00 162.96 ? 613  ILE D O     1 
ATOM   3868  N  N     . LEU B  2  614  ? 216.506 269.136 348.585 1.00 156.42 ? 614  LEU D N     1 
ATOM   3869  C  CA    . LEU B  2  614  ? 217.895 268.884 348.244 1.00 154.93 ? 614  LEU D CA    1 
ATOM   3870  C  C     . LEU B  2  614  ? 218.589 268.365 349.493 1.00 155.78 ? 614  LEU D C     1 
ATOM   3871  O  O     . LEU B  2  614  ? 218.886 269.128 350.416 1.00 157.51 ? 614  LEU D O     1 
ATOM   3872  N  N     . ASP B  2  615  ? 218.871 267.069 349.509 1.00 172.71 ? 615  ASP D N     1 
ATOM   3873  C  CA    . ASP B  2  615  ? 219.492 266.447 350.668 1.00 173.55 ? 615  ASP D CA    1 
ATOM   3874  C  C     . ASP B  2  615  ? 220.985 266.332 350.408 1.00 172.62 ? 615  ASP D C     1 
ATOM   3875  O  O     . ASP B  2  615  ? 221.396 265.970 349.302 1.00 170.91 ? 615  ASP D O     1 
ATOM   3876  N  N     . GLU B  2  616  ? 221.783 266.650 351.427 1.00 165.25 ? 616  GLU D N     1 
ATOM   3877  C  CA    . GLU B  2  616  ? 223.239 266.702 351.311 1.00 165.06 ? 616  GLU D CA    1 
ATOM   3878  C  C     . GLU B  2  616  ? 223.651 267.657 350.197 1.00 164.30 ? 616  GLU D C     1 
ATOM   3879  O  O     . GLU B  2  616  ? 224.466 267.314 349.344 1.00 163.06 ? 616  GLU D O     1 
ATOM   3880  N  N     . ILE B  2  617  ? 223.086 268.861 350.223 1.00 156.20 ? 617  ILE D N     1 
ATOM   3881  C  CA    . ILE B  2  617  ? 223.314 269.861 349.178 1.00 155.74 ? 617  ILE D CA    1 
ATOM   3882  C  C     . ILE B  2  617  ? 224.782 270.321 349.094 1.00 156.33 ? 617  ILE D C     1 
ATOM   3883  O  O     . ILE B  2  617  ? 225.191 270.965 348.117 1.00 155.87 ? 617  ILE D O     1 
ATOM   3884  N  N     . HIS B  2  618  ? 225.588 269.965 350.092 1.00 159.76 ? 618  HIS D N     1 
ATOM   3885  C  CA    . HIS B  2  618  ? 227.013 270.299 350.051 1.00 160.59 ? 618  HIS D CA    1 
ATOM   3886  C  C     . HIS B  2  618  ? 227.734 269.584 348.901 1.00 158.76 ? 618  HIS D C     1 
ATOM   3887  O  O     . HIS B  2  618  ? 228.892 269.875 348.596 1.00 159.43 ? 618  HIS D O     1 
ATOM   3888  N  N     . LEU B  2  619  ? 227.011 268.690 348.231 1.00 154.59 ? 619  LEU D N     1 
ATOM   3889  C  CA    . LEU B  2  619  ? 227.481 268.056 347.002 1.00 152.89 ? 619  LEU D CA    1 
ATOM   3890  C  C     . LEU B  2  619  ? 227.728 269.107 345.919 1.00 152.73 ? 619  LEU D C     1 
ATOM   3891  O  O     . LEU B  2  619  ? 228.292 268.806 344.867 1.00 151.74 ? 619  LEU D O     1 
ATOM   3892  N  N     . LEU B  2  620  ? 227.295 270.338 346.180 1.00 153.89 ? 620  LEU D N     1 
ATOM   3893  C  CA    . LEU B  2  620  ? 227.655 271.471 345.335 1.00 154.34 ? 620  LEU D CA    1 
ATOM   3894  C  C     . LEU B  2  620  ? 229.173 271.562 345.133 1.00 155.29 ? 620  LEU D C     1 
ATOM   3895  O  O     . LEU B  2  620  ? 229.641 271.995 344.073 1.00 155.06 ? 620  LEU D O     1 
ATOM   3896  N  N     . HIS B  2  621  ? 229.936 271.138 346.141 1.00 161.58 ? 621  HIS D N     1 
ATOM   3897  C  CA    . HIS B  2  621  ? 231.395 271.228 346.079 1.00 162.99 ? 621  HIS D CA    1 
ATOM   3898  C  C     . HIS B  2  621  ? 232.040 270.113 345.254 1.00 161.65 ? 621  HIS D C     1 
ATOM   3899  O  O     . HIS B  2  621  ? 233.186 270.238 344.827 1.00 162.71 ? 621  HIS D O     1 
ATOM   3900  N  N     . ASP B  2  622  ? 231.307 269.024 345.038 1.00 169.69 ? 622  ASP D N     1 
ATOM   3901  C  CA    . ASP B  2  622  ? 231.800 267.889 344.253 1.00 168.47 ? 622  ASP D CA    1 
ATOM   3902  C  C     . ASP B  2  622  ? 231.841 268.195 342.757 1.00 168.32 ? 622  ASP D C     1 
ATOM   3903  O  O     . ASP B  2  622  ? 231.252 269.182 342.311 1.00 168.28 ? 622  ASP D O     1 
ATOM   3904  N  N     . ASP B  2  623  ? 232.574 267.379 341.994 1.00 158.37 ? 623  ASP D N     1 
ATOM   3905  C  CA    . ASP B  2  623  ? 232.539 267.443 340.527 1.00 158.66 ? 623  ASP D CA    1 
ATOM   3906  C  C     . ASP B  2  623  ? 231.117 267.271 340.014 1.00 156.58 ? 623  ASP D C     1 
ATOM   3907  O  O     . ASP B  2  623  ? 230.761 267.765 338.947 1.00 156.69 ? 623  ASP D O     1 
ATOM   3908  N  N     . ARG B  2  624  ? 230.316 266.549 340.790 1.00 148.20 ? 624  ARG D N     1 
ATOM   3909  C  CA    . ARG B  2  624  ? 228.919 266.351 340.477 1.00 146.71 ? 624  ARG D CA    1 
ATOM   3910  C  C     . ARG B  2  624  ? 228.144 267.631 340.732 1.00 147.15 ? 624  ARG D C     1 
ATOM   3911  O  O     . ARG B  2  624  ? 226.985 267.749 340.357 1.00 146.26 ? 624  ARG D O     1 
ATOM   3912  N  N     . GLY B  2  625  ? 228.797 268.590 341.370 1.00 148.79 ? 625  GLY D N     1 
ATOM   3913  C  CA    . GLY B  2  625  ? 228.156 269.836 341.751 1.00 149.67 ? 625  GLY D CA    1 
ATOM   3914  C  C     . GLY B  2  625  ? 227.322 270.552 340.703 1.00 148.94 ? 625  GLY D C     1 
ATOM   3915  O  O     . GLY B  2  625  ? 226.203 270.961 341.000 1.00 148.96 ? 625  GLY D O     1 
ATOM   3916  N  N     . PRO B  2  626  ? 227.857 270.719 339.480 1.00 148.51 ? 626  PRO D N     1 
ATOM   3917  C  CA    . PRO B  2  626  ? 227.148 271.409 338.392 1.00 147.96 ? 626  PRO D CA    1 
ATOM   3918  C  C     . PRO B  2  626  ? 225.733 270.898 338.094 1.00 146.57 ? 626  PRO D C     1 
ATOM   3919  O  O     . PRO B  2  626  ? 224.892 271.664 337.611 1.00 146.64 ? 626  PRO D O     1 
ATOM   3920  N  N     . VAL B  2  627  ? 225.488 269.624 338.374 1.00 145.58 ? 627  VAL D N     1 
ATOM   3921  C  CA    . VAL B  2  627  ? 224.179 269.016 338.175 1.00 144.58 ? 627  VAL D CA    1 
ATOM   3922  C  C     . VAL B  2  627  ? 223.153 269.636 339.114 1.00 145.50 ? 627  VAL D C     1 
ATOM   3923  O  O     . VAL B  2  627  ? 222.137 270.170 338.670 1.00 145.55 ? 627  VAL D O     1 
ATOM   3924  N  N     . LEU B  2  628  ? 223.438 269.583 340.414 1.00 146.45 ? 628  LEU D N     1 
ATOM   3925  C  CA    . LEU B  2  628  ? 222.598 270.209 341.431 1.00 147.72 ? 628  LEU D CA    1 
ATOM   3926  C  C     . LEU B  2  628  ? 222.410 271.674 341.106 1.00 148.77 ? 628  LEU D C     1 
ATOM   3927  O  O     . LEU B  2  628  ? 221.354 272.258 341.353 1.00 149.59 ? 628  LEU D O     1 
ATOM   3928  N  N     . GLU B  2  629  ? 223.456 272.268 340.550 1.00 155.07 ? 629  GLU D N     1 
ATOM   3929  C  CA    . GLU B  2  629  ? 223.422 273.668 340.186 1.00 156.81 ? 629  GLU D CA    1 
ATOM   3930  C  C     . GLU B  2  629  ? 222.477 273.833 339.011 1.00 156.93 ? 629  GLU D C     1 
ATOM   3931  O  O     . GLU B  2  629  ? 221.717 274.796 338.957 1.00 158.45 ? 629  GLU D O     1 
ATOM   3932  N  N     . ALA B  2  630  ? 222.507 272.879 338.087 1.00 147.66 ? 630  ALA D N     1 
ATOM   3933  C  CA    . ALA B  2  630  ? 221.631 272.919 336.923 1.00 146.91 ? 630  ALA D CA    1 
ATOM   3934  C  C     . ALA B  2  630  ? 220.169 272.704 337.293 1.00 147.08 ? 630  ALA D C     1 
ATOM   3935  O  O     . ALA B  2  630  ? 219.293 273.368 336.748 1.00 147.60 ? 630  ALA D O     1 
ATOM   3936  N  N     . LEU B  2  631  ? 219.917 271.770 338.209 1.00 150.53 ? 631  LEU D N     1 
ATOM   3937  C  CA    . LEU B  2  631  ? 218.566 271.497 338.696 1.00 151.18 ? 631  LEU D CA    1 
ATOM   3938  C  C     . LEU B  2  631  ? 217.949 272.753 339.263 1.00 153.55 ? 631  LEU D C     1 
ATOM   3939  O  O     . LEU B  2  631  ? 216.980 273.287 338.723 1.00 155.13 ? 631  LEU D O     1 
ATOM   3940  N  N     . VAL B  2  632  ? 218.528 273.203 340.371 1.00 153.27 ? 632  VAL D N     1 
ATOM   3941  C  CA    . VAL B  2  632  ? 218.006 274.321 341.135 1.00 155.79 ? 632  VAL D CA    1 
ATOM   3942  C  C     . VAL B  2  632  ? 217.879 275.581 340.288 1.00 157.71 ? 632  VAL D C     1 
ATOM   3943  O  O     . VAL B  2  632  ? 216.861 276.269 340.354 1.00 160.85 ? 632  VAL D O     1 
ATOM   3944  N  N     . ALA B  2  633  ? 218.892 275.870 339.476 1.00 152.61 ? 633  ALA D N     1 
ATOM   3945  C  CA    . ALA B  2  633  ? 218.837 277.032 338.594 1.00 153.44 ? 633  ALA D CA    1 
ATOM   3946  C  C     . ALA B  2  633  ? 217.616 276.967 337.691 1.00 153.12 ? 633  ALA D C     1 
ATOM   3947  O  O     . ALA B  2  633  ? 216.885 277.949 337.557 1.00 154.71 ? 633  ALA D O     1 
ATOM   3948  N  N     . ARG B  2  634  ? 217.398 275.801 337.088 1.00 157.46 ? 634  ARG D N     1 
ATOM   3949  C  CA    . ARG B  2  634  ? 216.247 275.599 336.218 1.00 158.97 ? 634  ARG D CA    1 
ATOM   3950  C  C     . ARG B  2  634  ? 214.965 275.830 336.999 1.00 162.03 ? 634  ARG D C     1 
ATOM   3951  O  O     . ARG B  2  634  ? 214.094 276.566 336.548 1.00 165.36 ? 634  ARG D O     1 
ATOM   3952  N  N     . ALA B  2  635  ? 214.865 275.221 338.177 1.00 152.99 ? 635  ALA D N     1 
ATOM   3953  C  CA    . ALA B  2  635  ? 213.671 275.347 339.008 1.00 154.82 ? 635  ALA D CA    1 
ATOM   3954  C  C     . ALA B  2  635  ? 213.355 276.806 339.311 1.00 157.18 ? 635  ALA D C     1 
ATOM   3955  O  O     . ALA B  2  635  ? 212.220 277.245 339.149 1.00 159.90 ? 635  ALA D O     1 
ATOM   3956  N  N     . ILE B  2  636  ? 214.365 277.559 339.733 1.00 172.07 ? 636  ILE D N     1 
ATOM   3957  C  CA    . ILE B  2  636  ? 214.164 278.970 340.052 1.00 175.58 ? 636  ILE D CA    1 
ATOM   3958  C  C     . ILE B  2  636  ? 213.802 279.780 338.810 1.00 177.75 ? 636  ILE D C     1 
ATOM   3959  O  O     . ILE B  2  636  ? 212.762 280.436 338.782 1.00 181.74 ? 636  ILE D O     1 
ATOM   3960  N  N     . ARG B  2  637  ? 214.651 279.714 337.790 1.00 159.07 ? 637  ARG D N     1 
ATOM   3961  C  CA    . ARG B  2  637  ? 214.442 280.457 336.548 1.00 160.83 ? 637  ARG D CA    1 
ATOM   3962  C  C     . ARG B  2  637  ? 213.050 280.187 335.972 1.00 163.53 ? 637  ARG D C     1 
ATOM   3963  O  O     . ARG B  2  637  ? 212.426 281.071 335.385 1.00 166.89 ? 637  ARG D O     1 
ATOM   3964  N  N     . ASN B  2  638  ? 212.564 278.965 336.186 1.00 180.35 ? 638  ASN D N     1 
ATOM   3965  C  CA    . ASN B  2  638  ? 211.242 278.532 335.727 1.00 182.99 ? 638  ASN D CA    1 
ATOM   3966  C  C     . ASN B  2  638  ? 210.100 279.146 336.532 1.00 187.91 ? 638  ASN D C     1 
ATOM   3967  O  O     . ASN B  2  638  ? 209.078 279.550 335.974 1.00 191.91 ? 638  ASN D O     1 
ATOM   3968  N  N     . ILE B  2  639  ? 210.277 279.198 337.847 1.00 181.85 ? 639  ILE D N     1 
ATOM   3969  C  CA    . ILE B  2  639  ? 209.276 279.769 338.736 1.00 186.57 ? 639  ILE D CA    1 
ATOM   3970  C  C     . ILE B  2  639  ? 209.030 281.243 338.423 1.00 190.08 ? 639  ILE D C     1 
ATOM   3971  O  O     . ILE B  2  639  ? 207.908 281.732 338.531 1.00 195.11 ? 639  ILE D O     1 
ATOM   3972  N  N     . GLU B  2  640  ? 210.077 281.939 337.997 1.00 199.70 ? 640  GLU D N     1 
ATOM   3973  C  CA    . GLU B  2  640  ? 209.949 283.342 337.619 1.00 202.78 ? 640  GLU D CA    1 
ATOM   3974  C  C     . GLU B  2  640  ? 209.049 283.532 336.396 1.00 205.99 ? 640  GLU D C     1 
ATOM   3975  O  O     . GLU B  2  640  ? 208.396 284.567 336.265 1.00 210.23 ? 640  GLU D O     1 
ATOM   3976  N  N     . MET B  2  641  ? 209.021 282.551 335.496 1.00 194.87 ? 641  MET D N     1 
ATOM   3977  C  CA    . MET B  2  641  ? 208.128 282.615 334.336 1.00 198.32 ? 641  MET D CA    1 
ATOM   3978  C  C     . MET B  2  641  ? 206.690 282.245 334.676 1.00 203.17 ? 641  MET D C     1 
ATOM   3979  O  O     . MET B  2  641  ? 205.750 282.932 334.276 1.00 208.33 ? 641  MET D O     1 
ATOM   3980  N  N     . THR B  2  642  ? 206.529 281.145 335.407 1.00 208.91 ? 642  THR D N     1 
ATOM   3981  C  CA    . THR B  2  642  ? 205.211 280.589 335.704 1.00 213.44 ? 642  THR D CA    1 
ATOM   3982  C  C     . THR B  2  642  ? 204.469 281.347 336.799 1.00 218.64 ? 642  THR D C     1 
ATOM   3983  O  O     . THR B  2  642  ? 203.243 281.269 336.890 1.00 224.21 ? 642  THR D O     1 
ATOM   3984  N  N     . GLN B  2  643  ? 205.221 282.053 337.644 1.00 201.71 ? 643  GLN D N     1 
ATOM   3985  C  CA    . GLN B  2  643  ? 204.678 282.767 338.802 1.00 205.34 ? 643  GLN D CA    1 
ATOM   3986  C  C     . GLN B  2  643  ? 204.100 281.828 339.864 1.00 206.60 ? 643  GLN D C     1 
ATOM   3987  O  O     . GLN B  2  643  ? 203.686 282.273 340.933 1.00 208.89 ? 643  GLN D O     1 
ATOM   3988  N  N     . GLU B  2  644  ? 204.063 280.534 339.561 1.00 224.95 ? 644  GLU D N     1 
ATOM   3989  C  CA    . GLU B  2  644  ? 203.670 279.526 340.535 1.00 225.42 ? 644  GLU D CA    1 
ATOM   3990  C  C     . GLU B  2  644  ? 204.910 279.073 341.289 1.00 219.24 ? 644  GLU D C     1 
ATOM   3991  O  O     . GLU B  2  644  ? 205.894 278.659 340.672 1.00 213.78 ? 644  GLU D O     1 
ATOM   3992  N  N     . ASP B  2  645  ? 204.872 279.148 342.616 1.00 231.86 ? 645  ASP D N     1 
ATOM   3993  C  CA    . ASP B  2  645  ? 206.075 278.895 343.405 1.00 226.58 ? 645  ASP D CA    1 
ATOM   3994  C  C     . ASP B  2  645  ? 206.194 277.457 343.902 1.00 223.98 ? 645  ASP D C     1 
ATOM   3995  O  O     . ASP B  2  645  ? 205.295 276.630 343.712 1.00 226.26 ? 645  ASP D O     1 
ATOM   3996  N  N     . VAL B  2  646  ? 207.327 277.180 344.542 1.00 195.97 ? 646  VAL D N     1 
ATOM   3997  C  CA    . VAL B  2  646  ? 207.660 275.859 345.049 1.00 192.61 ? 646  VAL D CA    1 
ATOM   3998  C  C     . VAL B  2  646  ? 208.490 276.050 346.311 1.00 190.97 ? 646  VAL D C     1 
ATOM   3999  O  O     . VAL B  2  646  ? 209.309 276.966 346.380 1.00 189.64 ? 646  VAL D O     1 
ATOM   4000  N  N     . ARG B  2  647  ? 208.271 275.209 347.313 1.00 200.53 ? 647  ARG D N     1 
ATOM   4001  C  CA    . ARG B  2  647  ? 209.161 275.199 348.459 1.00 198.39 ? 647  ARG D CA    1 
ATOM   4002  C  C     . ARG B  2  647  ? 210.435 274.464 348.088 1.00 192.38 ? 647  ARG D C     1 
ATOM   4003  O  O     . ARG B  2  647  ? 210.408 273.476 347.357 1.00 189.81 ? 647  ARG D O     1 
ATOM   4004  N  N     . LEU B  2  648  ? 211.552 274.957 348.605 1.00 168.70 ? 648  LEU D N     1 
ATOM   4005  C  CA    . LEU B  2  648  ? 212.837 274.311 348.414 1.00 164.70 ? 648  LEU D CA    1 
ATOM   4006  C  C     . LEU B  2  648  ? 213.460 274.105 349.792 1.00 165.73 ? 648  LEU D C     1 
ATOM   4007  O  O     . LEU B  2  648  ? 213.638 275.066 350.546 1.00 167.88 ? 648  LEU D O     1 
ATOM   4008  N  N     . ILE B  2  649  ? 213.755 272.855 350.134 1.00 180.09 ? 649  ILE D N     1 
ATOM   4009  C  CA    . ILE B  2  649  ? 214.368 272.558 351.424 1.00 179.44 ? 649  ILE D CA    1 
ATOM   4010  C  C     . ILE B  2  649  ? 215.773 271.990 351.257 1.00 175.53 ? 649  ILE D C     1 
ATOM   4011  O  O     . ILE B  2  649  ? 215.930 270.840 350.832 1.00 173.22 ? 649  ILE D O     1 
ATOM   4012  N  N     . GLY B  2  650  ? 216.787 272.801 351.573 1.00 176.28 ? 650  GLY D N     1 
ATOM   4013  C  CA    . GLY B  2  650  ? 218.171 272.351 351.573 1.00 173.63 ? 650  GLY D CA    1 
ATOM   4014  C  C     . GLY B  2  650  ? 218.674 271.743 352.872 1.00 173.86 ? 650  GLY D C     1 
ATOM   4015  O  O     . GLY B  2  650  ? 218.438 272.272 353.960 1.00 176.29 ? 650  GLY D O     1 
ATOM   4016  N  N     . LEU B  2  651  ? 219.447 270.672 352.742 1.00 168.97 ? 651  LEU D N     1 
ATOM   4017  C  CA    . LEU B  2  651  ? 220.084 270.022 353.875 1.00 169.85 ? 651  LEU D CA    1 
ATOM   4018  C  C     . LEU B  2  651  ? 221.567 269.997 353.576 1.00 169.03 ? 651  LEU D C     1 
ATOM   4019  O  O     . LEU B  2  651  ? 221.969 269.571 352.489 1.00 166.92 ? 651  LEU D O     1 
ATOM   4020  N  N     . SER B  2  652  ? 222.389 270.441 354.521 1.00 203.81 ? 652  SER D N     1 
ATOM   4021  C  CA    . SER B  2  652  ? 223.832 270.391 354.312 1.00 203.45 ? 652  SER D CA    1 
ATOM   4022  C  C     . SER B  2  652  ? 224.596 270.040 355.577 1.00 205.25 ? 652  SER D C     1 
ATOM   4023  O  O     . SER B  2  652  ? 224.115 270.236 356.694 1.00 207.27 ? 652  SER D O     1 
ATOM   4024  N  N     . ALA B  2  653  ? 225.800 269.519 355.376 1.00 176.33 ? 653  ALA D N     1 
ATOM   4025  C  CA    . ALA B  2  653  ? 226.767 269.335 356.445 1.00 178.28 ? 653  ALA D CA    1 
ATOM   4026  C  C     . ALA B  2  653  ? 227.178 270.720 356.900 1.00 180.74 ? 653  ALA D C     1 
ATOM   4027  O  O     . ALA B  2  653  ? 226.924 271.702 356.201 1.00 180.58 ? 653  ALA D O     1 
ATOM   4028  N  N     . THR B  2  654  ? 227.797 270.820 358.071 1.00 171.96 ? 654  THR D N     1 
ATOM   4029  C  CA    . THR B  2  654  ? 228.089 272.140 358.598 1.00 174.73 ? 654  THR D CA    1 
ATOM   4030  C  C     . THR B  2  654  ? 229.379 272.689 357.994 1.00 175.23 ? 654  THR D C     1 
ATOM   4031  O  O     . THR B  2  654  ? 230.489 272.241 358.296 1.00 176.09 ? 654  THR D O     1 
ATOM   4032  N  N     . LEU B  2  655  ? 229.202 273.704 357.159 1.00 185.64 ? 655  LEU D N     1 
ATOM   4033  C  CA    . LEU B  2  655  ? 230.291 274.298 356.405 1.00 186.05 ? 655  LEU D CA    1 
ATOM   4034  C  C     . LEU B  2  655  ? 229.991 275.767 356.186 1.00 187.65 ? 655  LEU D C     1 
ATOM   4035  O  O     . LEU B  2  655  ? 228.820 276.144 356.044 1.00 187.07 ? 655  LEU D O     1 
ATOM   4036  N  N     . PRO B  2  656  ? 231.045 276.602 356.149 1.00 194.32 ? 656  PRO D N     1 
ATOM   4037  C  CA    . PRO B  2  656  ? 230.872 277.994 355.716 1.00 195.77 ? 656  PRO D CA    1 
ATOM   4038  C  C     . PRO B  2  656  ? 230.415 278.088 354.257 1.00 192.98 ? 656  PRO D C     1 
ATOM   4039  O  O     . PRO B  2  656  ? 230.293 277.060 353.583 1.00 189.98 ? 656  PRO D O     1 
ATOM   4040  N  N     . ASN B  2  657  ? 230.197 279.317 353.793 1.00 191.87 ? 657  ASN D N     1 
ATOM   4041  C  CA    . ASN B  2  657  ? 229.441 279.603 352.572 1.00 189.72 ? 657  ASN D CA    1 
ATOM   4042  C  C     . ASN B  2  657  ? 227.966 279.225 352.675 1.00 188.04 ? 657  ASN D C     1 
ATOM   4043  O  O     . ASN B  2  657  ? 227.317 278.942 351.667 1.00 185.54 ? 657  ASN D O     1 
ATOM   4044  N  N     . TYR B  2  658  ? 227.430 279.228 353.888 1.00 177.15 ? 658  TYR D N     1 
ATOM   4045  C  CA    . TYR B  2  658  ? 226.031 278.881 354.077 1.00 176.10 ? 658  TYR D CA    1 
ATOM   4046  C  C     . TYR B  2  658  ? 225.099 279.961 353.523 1.00 176.77 ? 658  TYR D C     1 
ATOM   4047  O  O     . TYR B  2  658  ? 224.035 279.656 352.981 1.00 175.00 ? 658  TYR D O     1 
ATOM   4048  N  N     . GLU B  2  659  ? 225.507 281.221 353.643 1.00 197.68 ? 659  GLU D N     1 
ATOM   4049  C  CA    . GLU B  2  659  ? 224.671 282.332 353.193 1.00 198.85 ? 659  GLU D CA    1 
ATOM   4050  C  C     . GLU B  2  659  ? 224.646 282.418 351.672 1.00 196.51 ? 659  GLU D C     1 
ATOM   4051  O  O     . GLU B  2  659  ? 223.717 282.971 351.079 1.00 196.43 ? 659  GLU D O     1 
ATOM   4052  N  N     . ASP B  2  660  ? 225.675 281.859 351.046 1.00 188.52 ? 660  ASP D N     1 
ATOM   4053  C  CA    . ASP B  2  660  ? 225.785 281.840 349.594 1.00 186.33 ? 660  ASP D CA    1 
ATOM   4054  C  C     . ASP B  2  660  ? 224.835 280.799 349.008 1.00 183.09 ? 660  ASP D C     1 
ATOM   4055  O  O     . ASP B  2  660  ? 224.144 281.038 348.005 1.00 181.91 ? 660  ASP D O     1 
ATOM   4056  N  N     . VAL B  2  661  ? 224.799 279.639 349.655 1.00 170.09 ? 661  VAL D N     1 
ATOM   4057  C  CA    . VAL B  2  661  ? 223.861 278.593 349.299 1.00 167.48 ? 661  VAL D CA    1 
ATOM   4058  C  C     . VAL B  2  661  ? 222.449 279.082 349.586 1.00 168.52 ? 661  VAL D C     1 
ATOM   4059  O  O     . VAL B  2  661  ? 221.514 278.756 348.860 1.00 167.28 ? 661  VAL D O     1 
ATOM   4060  N  N     . ALA B  2  662  ? 222.304 279.879 350.639 1.00 172.44 ? 662  ALA D N     1 
ATOM   4061  C  CA    . ALA B  2  662  ? 221.027 280.523 350.935 1.00 174.10 ? 662  ALA D CA    1 
ATOM   4062  C  C     . ALA B  2  662  ? 220.565 281.409 349.778 1.00 174.62 ? 662  ALA D C     1 
ATOM   4063  O  O     . ALA B  2  662  ? 219.423 281.297 349.320 1.00 174.96 ? 662  ALA D O     1 
ATOM   4064  N  N     . THR B  2  663  ? 221.455 282.283 349.308 1.00 185.22 ? 663  THR D N     1 
ATOM   4065  C  CA    . THR B  2  663  ? 221.147 283.167 348.181 1.00 186.10 ? 663  THR D CA    1 
ATOM   4066  C  C     . THR B  2  663  ? 220.736 282.342 346.975 1.00 183.69 ? 663  THR D C     1 
ATOM   4067  O  O     . THR B  2  663  ? 219.781 282.669 346.268 1.00 184.46 ? 663  THR D O     1 
ATOM   4068  N  N     . PHE B  2  664  ? 221.469 281.256 346.765 1.00 189.76 ? 664  PHE D N     1 
ATOM   4069  C  CA    . PHE B  2  664  ? 221.209 280.359 345.648 1.00 187.40 ? 664  PHE D CA    1 
ATOM   4070  C  C     . PHE B  2  664  ? 219.819 279.723 345.688 1.00 187.33 ? 664  PHE D C     1 
ATOM   4071  O  O     . PHE B  2  664  ? 219.147 279.631 344.662 1.00 187.05 ? 664  PHE D O     1 
ATOM   4072  N  N     . LEU B  2  665  ? 219.393 279.290 346.871 1.00 168.07 ? 665  LEU D N     1 
ATOM   4073  C  CA    . LEU B  2  665  ? 218.099 278.634 347.029 1.00 168.46 ? 665  LEU D CA    1 
ATOM   4074  C  C     . LEU B  2  665  ? 216.978 279.646 347.228 1.00 172.43 ? 665  LEU D C     1 
ATOM   4075  O  O     . LEU B  2  665  ? 215.833 279.266 347.471 1.00 174.31 ? 665  LEU D O     1 
ATOM   4076  N  N     . ARG B  2  666  ? 217.318 280.930 347.154 1.00 192.64 ? 666  ARG D N     1 
ATOM   4077  C  CA    . ARG B  2  666  ? 216.350 282.004 347.351 1.00 196.74 ? 666  ARG D CA    1 
ATOM   4078  C  C     . ARG B  2  666  ? 215.697 281.864 348.727 1.00 198.80 ? 666  ARG D C     1 
ATOM   4079  O  O     . ARG B  2  666  ? 214.490 282.056 348.888 1.00 201.92 ? 666  ARG D O     1 
ATOM   4080  N  N     . VAL B  2  667  ? 216.517 281.506 349.712 1.00 194.00 ? 667  VAL D N     1 
ATOM   4081  C  CA    . VAL B  2  667  ? 216.086 281.408 351.100 1.00 195.85 ? 667  VAL D CA    1 
ATOM   4082  C  C     . VAL B  2  667  ? 216.239 282.761 351.771 1.00 198.64 ? 667  VAL D C     1 
ATOM   4083  O  O     . VAL B  2  667  ? 217.348 283.284 351.841 1.00 197.94 ? 667  VAL D O     1 
ATOM   4084  N  N     . ASP B  2  668  ? 215.144 283.331 352.267 1.00 198.25 ? 668  ASP D N     1 
ATOM   4085  C  CA    . ASP B  2  668  ? 215.246 284.594 352.992 1.00 201.07 ? 668  ASP D CA    1 
ATOM   4086  C  C     . ASP B  2  668  ? 216.055 284.377 354.258 1.00 200.50 ? 668  ASP D C     1 
ATOM   4087  O  O     . ASP B  2  668  ? 215.614 283.665 355.160 1.00 200.88 ? 668  ASP D O     1 
ATOM   4088  N  N     . PRO B  2  669  ? 217.236 285.011 354.342 1.00 197.66 ? 669  PRO D N     1 
ATOM   4089  C  CA    . PRO B  2  669  ? 218.139 284.794 355.476 1.00 198.85 ? 669  PRO D CA    1 
ATOM   4090  C  C     . PRO B  2  669  ? 217.454 285.109 356.795 1.00 202.43 ? 669  PRO D C     1 
ATOM   4091  O  O     . PRO B  2  669  ? 217.739 284.462 357.801 1.00 202.85 ? 669  PRO D O     1 
ATOM   4092  N  N     . ALA B  2  670  ? 216.549 286.082 356.773 1.00 206.37 ? 670  ALA D N     1 
ATOM   4093  C  CA    . ALA B  2  670  ? 215.838 286.489 357.976 1.00 210.25 ? 670  ALA D CA    1 
ATOM   4094  C  C     . ALA B  2  670  ? 215.088 285.326 358.622 1.00 209.41 ? 670  ALA D C     1 
ATOM   4095  O  O     . ALA B  2  670  ? 215.494 284.827 359.671 1.00 210.19 ? 670  ALA D O     1 
ATOM   4096  N  N     . LYS B  2  671  ? 213.996 284.899 357.991 1.00 211.77 ? 671  LYS D N     1 
ATOM   4097  C  CA    . LYS B  2  671  ? 213.165 283.834 358.554 1.00 211.67 ? 671  LYS D CA    1 
ATOM   4098  C  C     . LYS B  2  671  ? 213.469 282.426 358.036 1.00 207.90 ? 671  LYS D C     1 
ATOM   4099  O  O     . LYS B  2  671  ? 212.989 281.438 358.592 1.00 207.89 ? 671  LYS D O     1 
ATOM   4100  N  N     . GLY B  2  672  ? 214.272 282.331 356.983 1.00 207.77 ? 672  GLY D N     1 
ATOM   4101  C  CA    . GLY B  2  672  ? 214.496 281.051 356.331 1.00 204.37 ? 672  GLY D CA    1 
ATOM   4102  C  C     . GLY B  2  672  ? 215.819 280.351 356.579 1.00 201.46 ? 672  GLY D C     1 
ATOM   4103  O  O     . GLY B  2  672  ? 215.973 279.180 356.222 1.00 198.82 ? 672  GLY D O     1 
ATOM   4104  N  N     . LEU B  2  673  ? 216.783 281.049 357.168 1.00 189.64 ? 673  LEU D N     1 
ATOM   4105  C  CA    . LEU B  2  673  ? 218.119 280.479 357.319 1.00 188.09 ? 673  LEU D CA    1 
ATOM   4106  C  C     . LEU B  2  673  ? 218.304 279.801 358.675 1.00 189.41 ? 673  LEU D C     1 
ATOM   4107  O  O     . LEU B  2  673  ? 217.836 280.304 359.701 1.00 192.69 ? 673  LEU D O     1 
ATOM   4108  N  N     . PHE B  2  674  ? 218.959 278.642 358.662 1.00 187.24 ? 674  PHE D N     1 
ATOM   4109  C  CA    . PHE B  2  674  ? 219.236 277.894 359.887 1.00 188.30 ? 674  PHE D CA    1 
ATOM   4110  C  C     . PHE B  2  674  ? 220.666 277.338 359.931 1.00 187.02 ? 674  PHE D C     1 
ATOM   4111  O  O     . PHE B  2  674  ? 221.075 276.555 359.067 1.00 183.91 ? 674  PHE D O     1 
ATOM   4112  N  N     . TYR B  2  675  ? 221.418 277.753 360.949 1.00 205.21 ? 675  TYR D N     1 
ATOM   4113  C  CA    . TYR B  2  675  ? 222.794 277.301 361.121 1.00 204.71 ? 675  TYR D CA    1 
ATOM   4114  C  C     . TYR B  2  675  ? 223.068 276.698 362.496 1.00 206.60 ? 675  TYR D C     1 
ATOM   4115  O  O     . TYR B  2  675  ? 222.683 277.262 363.522 1.00 209.82 ? 675  TYR D O     1 
ATOM   4116  N  N     . PHE B  2  676  ? 223.749 275.556 362.497 1.00 212.08 ? 676  PHE D N     1 
ATOM   4117  C  CA    . PHE B  2  676  ? 224.177 274.898 363.727 1.00 213.75 ? 676  PHE D CA    1 
ATOM   4118  C  C     . PHE B  2  676  ? 225.585 274.332 363.554 1.00 212.79 ? 676  PHE D C     1 
ATOM   4119  O  O     . PHE B  2  676  ? 225.867 273.644 362.571 1.00 209.75 ? 676  PHE D O     1 
ATOM   4120  N  N     . ASP B  2  677  ? 226.463 274.624 364.511 1.00 189.58 ? 677  ASP D N     1 
ATOM   4121  C  CA    . ASP B  2  677  ? 227.867 274.230 364.419 1.00 189.44 ? 677  ASP D CA    1 
ATOM   4122  C  C     . ASP B  2  677  ? 228.103 272.805 364.915 1.00 188.53 ? 677  ASP D C     1 
ATOM   4123  O  O     . ASP B  2  677  ? 227.168 272.118 365.332 1.00 188.00 ? 677  ASP D O     1 
ATOM   4124  N  N     . ASN B  2  678  ? 229.362 272.379 364.890 1.00 188.68 ? 678  ASN D N     1 
ATOM   4125  C  CA    . ASN B  2  678  ? 229.716 270.987 365.159 1.00 187.62 ? 678  ASN D CA    1 
ATOM   4126  C  C     . ASN B  2  678  ? 229.438 270.483 366.578 1.00 189.95 ? 678  ASN D C     1 
ATOM   4127  O  O     . ASN B  2  678  ? 229.616 269.298 366.862 1.00 189.25 ? 678  ASN D O     1 
ATOM   4128  N  N     . SER B  2  679  ? 229.011 271.377 367.463 1.00 192.90 ? 679  SER D N     1 
ATOM   4129  C  CA    . SER B  2  679  ? 228.694 271.012 368.846 1.00 195.51 ? 679  SER D CA    1 
ATOM   4130  C  C     . SER B  2  679  ? 227.357 270.288 368.984 1.00 194.18 ? 679  SER D C     1 
ATOM   4131  O  O     . SER B  2  679  ? 227.040 269.768 370.058 1.00 196.02 ? 679  SER D O     1 
ATOM   4132  N  N     . PHE B  2  680  ? 226.576 270.265 367.901 1.00 191.23 ? 680  PHE D N     1 
ATOM   4133  C  CA    . PHE B  2  680  ? 225.231 269.689 367.918 1.00 190.17 ? 680  PHE D CA    1 
ATOM   4134  C  C     . PHE B  2  680  ? 225.168 268.239 367.438 1.00 187.38 ? 680  PHE D C     1 
ATOM   4135  O  O     . PHE B  2  680  ? 224.085 267.662 367.333 1.00 186.40 ? 680  PHE D O     1 
ATOM   4136  N  N     . ARG B  2  681  ? 226.324 267.663 367.135 1.00 186.37 ? 681  ARG D N     1 
ATOM   4137  C  CA    . ARG B  2  681  ? 226.410 266.236 366.864 1.00 184.39 ? 681  ARG D CA    1 
ATOM   4138  C  C     . ARG B  2  681  ? 225.952 265.500 368.113 1.00 186.47 ? 681  ARG D C     1 
ATOM   4139  O  O     . ARG B  2  681  ? 226.490 265.730 369.196 1.00 189.37 ? 681  ARG D O     1 
ATOM   4140  N  N     . PRO B  2  682  ? 224.955 264.618 367.970 1.00 192.05 ? 682  PRO D N     1 
ATOM   4141  C  CA    . PRO B  2  682  ? 224.319 263.935 369.104 1.00 194.15 ? 682  PRO D CA    1 
ATOM   4142  C  C     . PRO B  2  682  ? 225.319 263.144 369.935 1.00 195.68 ? 682  PRO D C     1 
ATOM   4143  O  O     . PRO B  2  682  ? 225.225 263.129 371.159 1.00 198.64 ? 682  PRO D O     1 
ATOM   4144  N  N     . VAL B  2  683  ? 226.263 262.487 369.271 1.00 205.72 ? 683  VAL D N     1 
ATOM   4145  C  CA    . VAL B  2  683  ? 227.349 261.814 369.961 1.00 207.31 ? 683  VAL D CA    1 
ATOM   4146  C  C     . VAL B  2  683  ? 228.614 262.617 369.698 1.00 207.77 ? 683  VAL D C     1 
ATOM   4147  O  O     . VAL B  2  683  ? 229.108 262.623 368.570 1.00 205.45 ? 683  VAL D O     1 
ATOM   4148  N  N     . PRO B  2  684  ? 229.135 263.306 370.731 1.00 186.04 ? 684  PRO D N     1 
ATOM   4149  C  CA    . PRO B  2  684  ? 230.324 264.158 370.605 1.00 185.26 ? 684  PRO D CA    1 
ATOM   4150  C  C     . PRO B  2  684  ? 231.481 263.414 369.947 1.00 183.86 ? 684  PRO D C     1 
ATOM   4151  O  O     . PRO B  2  684  ? 231.645 262.217 370.180 1.00 184.64 ? 684  PRO D O     1 
ATOM   4152  N  N     . LEU B  2  685  ? 232.261 264.105 369.121 1.00 188.65 ? 685  LEU D N     1 
ATOM   4153  C  CA    . LEU B  2  685  ? 233.303 263.438 368.344 1.00 187.19 ? 685  LEU D CA    1 
ATOM   4154  C  C     . LEU B  2  685  ? 234.715 263.906 368.684 1.00 187.79 ? 685  LEU D C     1 
ATOM   4155  O  O     . LEU B  2  685  ? 235.050 265.083 368.523 1.00 187.28 ? 685  LEU D O     1 
ATOM   4156  N  N     . GLU B  2  686  ? 235.537 262.971 369.157 1.00 182.77 ? 686  GLU D N     1 
ATOM   4157  C  CA    . GLU B  2  686  ? 236.958 263.222 369.365 1.00 183.44 ? 686  GLU D CA    1 
ATOM   4158  C  C     . GLU B  2  686  ? 237.724 262.816 368.108 1.00 181.12 ? 686  GLU D C     1 
ATOM   4159  O  O     . GLU B  2  686  ? 237.753 261.638 367.722 1.00 180.71 ? 686  GLU D O     1 
ATOM   4160  N  N     . GLN B  2  687  ? 238.335 263.806 367.466 1.00 183.96 ? 687  GLN D N     1 
ATOM   4161  C  CA    . GLN B  2  687  ? 238.933 263.610 366.156 1.00 181.57 ? 687  GLN D CA    1 
ATOM   4162  C  C     . GLN B  2  687  ? 240.437 263.334 366.236 1.00 182.37 ? 687  GLN D C     1 
ATOM   4163  O  O     . GLN B  2  687  ? 241.186 264.072 366.883 1.00 183.88 ? 687  GLN D O     1 
ATOM   4164  N  N     . THR B  2  688  ? 240.858 262.255 365.582 1.00 194.14 ? 688  THR D N     1 
ATOM   4165  C  CA    . THR B  2  688  ? 242.266 261.892 365.455 1.00 194.72 ? 688  THR D CA    1 
ATOM   4166  C  C     . THR B  2  688  ? 242.625 261.900 363.969 1.00 192.00 ? 688  THR D C     1 
ATOM   4167  O  O     . THR B  2  688  ? 241.928 261.289 363.159 1.00 190.34 ? 688  THR D O     1 
ATOM   4168  N  N     . TYR B  2  689  ? 243.691 262.602 363.603 1.00 172.75 ? 689  TYR D N     1 
ATOM   4169  C  CA    . TYR B  2  689  ? 244.114 262.625 362.205 1.00 170.35 ? 689  TYR D CA    1 
ATOM   4170  C  C     . TYR B  2  689  ? 245.589 262.317 362.085 1.00 171.24 ? 689  TYR D C     1 
ATOM   4171  O  O     . TYR B  2  689  ? 246.406 263.107 362.525 1.00 172.50 ? 689  TYR D O     1 
ATOM   4172  N  N     . VAL B  2  690  ? 245.956 261.204 361.464 1.00 166.96 ? 690  VAL D N     1 
ATOM   4173  C  CA    . VAL B  2  690  ? 247.379 260.949 361.304 1.00 167.92 ? 690  VAL D CA    1 
ATOM   4174  C  C     . VAL B  2  690  ? 247.821 261.068 359.848 1.00 165.61 ? 690  VAL D C     1 
ATOM   4175  O  O     . VAL B  2  690  ? 247.521 260.205 359.022 1.00 164.27 ? 690  VAL D O     1 
ATOM   4176  N  N     . GLY B  2  691  ? 248.517 262.153 359.524 1.00 165.27 ? 691  GLY D N     1 
ATOM   4177  C  CA    . GLY B  2  691  ? 249.092 262.306 358.197 1.00 163.45 ? 691  GLY D CA    1 
ATOM   4178  C  C     . GLY B  2  691  ? 250.461 261.662 358.120 1.00 164.86 ? 691  GLY D C     1 
ATOM   4179  O  O     . GLY B  2  691  ? 251.246 261.793 359.048 1.00 167.29 ? 691  GLY D O     1 
ATOM   4180  N  N     . ILE B  2  692  ? 250.785 261.015 357.007 1.00 170.10 ? 692  ILE D N     1 
ATOM   4181  C  CA    . ILE B  2  692  ? 252.079 260.340 356.911 1.00 171.65 ? 692  ILE D CA    1 
ATOM   4182  C  C     . ILE B  2  692  ? 253.053 261.110 356.015 1.00 171.02 ? 692  ILE D C     1 
ATOM   4183  O  O     . ILE B  2  692  ? 252.709 261.475 354.891 1.00 168.71 ? 692  ILE D O     1 
ATOM   4184  N  N     . THR B  2  693  ? 254.266 261.338 356.514 1.00 184.66 ? 693  THR D N     1 
ATOM   4185  C  CA    . THR B  2  693  ? 255.270 262.130 355.805 1.00 184.54 ? 693  THR D CA    1 
ATOM   4186  C  C     . THR B  2  693  ? 256.085 261.315 354.813 1.00 184.31 ? 693  THR D C     1 
ATOM   4187  O  O     . THR B  2  693  ? 256.820 261.886 354.007 1.00 183.83 ? 693  THR D O     1 
ATOM   4188  N  N     . GLU B  2  694  ? 255.977 259.991 354.871 1.00 197.29 ? 694  GLU D N     1 
ATOM   4189  C  CA    . GLU B  2  694  ? 256.840 259.152 354.039 1.00 197.57 ? 694  GLU D CA    1 
ATOM   4190  C  C     . GLU B  2  694  ? 256.541 259.290 352.544 1.00 194.78 ? 694  GLU D C     1 
ATOM   4191  O  O     . GLU B  2  694  ? 255.403 259.113 352.094 1.00 192.73 ? 694  GLU D O     1 
ATOM   4192  N  N     . LYS B  2  695  ? 257.583 259.617 351.786 1.00 191.83 ? 695  LYS D N     1 
ATOM   4193  C  CA    . LYS B  2  695  ? 257.494 259.782 350.340 1.00 189.60 ? 695  LYS D CA    1 
ATOM   4194  C  C     . LYS B  2  695  ? 257.396 258.420 349.648 1.00 189.17 ? 695  LYS D C     1 
ATOM   4195  O  O     . LYS B  2  695  ? 256.531 258.203 348.792 1.00 187.05 ? 695  LYS D O     1 
ATOM   4196  N  N     . LYS B  2  696  ? 258.283 257.502 350.035 1.00 191.52 ? 696  LYS D N     1 
ATOM   4197  C  CA    . LYS B  2  696  ? 258.324 256.155 349.469 1.00 191.62 ? 696  LYS D CA    1 
ATOM   4198  C  C     . LYS B  2  696  ? 257.060 255.412 349.874 1.00 190.91 ? 696  LYS D C     1 
ATOM   4199  O  O     . LYS B  2  696  ? 256.744 255.333 351.057 1.00 192.17 ? 696  LYS D O     1 
ATOM   4200  N  N     . ALA B  2  697  ? 256.339 254.867 348.901 1.00 187.88 ? 697  ALA D N     1 
ATOM   4201  C  CA    . ALA B  2  697  ? 255.082 254.182 349.201 1.00 187.24 ? 697  ALA D CA    1 
ATOM   4202  C  C     . ALA B  2  697  ? 255.328 252.808 349.826 1.00 189.39 ? 697  ALA D C     1 
ATOM   4203  O  O     . ALA B  2  697  ? 254.502 252.292 350.596 1.00 189.85 ? 697  ALA D O     1 
ATOM   4204  N  N     . ILE B  2  698  ? 256.480 252.235 349.490 1.00 172.61 ? 698  ILE D N     1 
ATOM   4205  C  CA    . ILE B  2  698  ? 256.839 250.885 349.915 1.00 174.84 ? 698  ILE D CA    1 
ATOM   4206  C  C     . ILE B  2  698  ? 256.972 250.774 351.442 1.00 177.29 ? 698  ILE D C     1 
ATOM   4207  O  O     . ILE B  2  698  ? 256.557 249.779 352.041 1.00 178.54 ? 698  ILE D O     1 
ATOM   4208  N  N     . LYS B  2  699  ? 257.533 251.816 352.056 1.00 184.94 ? 699  LYS D N     1 
ATOM   4209  C  CA    . LYS B  2  699  ? 257.673 251.919 353.511 1.00 187.35 ? 699  LYS D CA    1 
ATOM   4210  C  C     . LYS B  2  699  ? 256.351 252.341 354.157 1.00 186.13 ? 699  LYS D C     1 
ATOM   4211  O  O     . LYS B  2  699  ? 256.025 251.946 355.284 1.00 187.87 ? 699  LYS D O     1 
ATOM   4212  N  N     . ARG B  2  700  ? 255.600 253.155 353.420 1.00 175.89 ? 700  ARG D N     1 
ATOM   4213  C  CA    . ARG B  2  700  ? 254.308 253.676 353.853 1.00 174.51 ? 700  ARG D CA    1 
ATOM   4214  C  C     . ARG B  2  700  ? 253.289 252.559 354.062 1.00 174.53 ? 700  ARG D C     1 
ATOM   4215  O  O     . ARG B  2  700  ? 252.487 252.599 355.009 1.00 175.05 ? 700  ARG D O     1 
ATOM   4216  N  N     . PHE B  2  701  ? 253.357 251.540 353.203 1.00 248.88 ? 701  PHE D N     1 
ATOM   4217  C  CA    . PHE B  2  701  ? 252.394 250.436 353.246 1.00 248.92 ? 701  PHE D CA    1 
ATOM   4218  C  C     . PHE B  2  701  ? 252.740 249.475 354.376 1.00 251.93 ? 701  PHE D C     1 
ATOM   4219  O  O     . PHE B  2  701  ? 252.078 248.456 354.569 1.00 252.55 ? 701  PHE D O     1 
ATOM   4220  N  N     . GLN B  2  702  ? 253.811 249.802 355.090 1.00 216.63 ? 702  GLN D N     1 
ATOM   4221  C  CA    . GLN B  2  702  ? 254.125 249.197 356.376 1.00 219.79 ? 702  GLN D CA    1 
ATOM   4222  C  C     . GLN B  2  702  ? 253.631 250.113 357.495 1.00 220.20 ? 702  GLN D C     1 
ATOM   4223  O  O     . GLN B  2  702  ? 252.839 249.694 358.354 1.00 221.18 ? 702  GLN D O     1 
ATOM   4224  N  N     . ILE B  2  703  ? 254.136 251.352 357.496 1.00 183.39 ? 703  ILE D N     1 
ATOM   4225  C  CA    . ILE B  2  703  ? 253.792 252.342 358.521 1.00 183.91 ? 703  ILE D CA    1 
ATOM   4226  C  C     . ILE B  2  703  ? 252.294 252.401 358.815 1.00 182.50 ? 703  ILE D C     1 
ATOM   4227  O  O     . ILE B  2  703  ? 251.890 252.356 359.981 1.00 184.24 ? 703  ILE D O     1 
ATOM   4228  N  N     . MET B  2  704  ? 251.469 252.477 357.767 1.00 179.31 ? 704  MET D N     1 
ATOM   4229  C  CA    . MET B  2  704  ? 250.022 252.558 357.976 1.00 178.05 ? 704  MET D CA    1 
ATOM   4230  C  C     . MET B  2  704  ? 249.436 251.284 358.585 1.00 179.61 ? 704  MET D C     1 
ATOM   4231  O  O     . MET B  2  704  ? 248.527 251.347 359.419 1.00 180.15 ? 704  MET D O     1 
ATOM   4232  N  N     . ASN B  2  705  ? 249.960 250.135 358.167 1.00 189.30 ? 705  ASN D N     1 
ATOM   4233  C  CA    . ASN B  2  705  ? 249.625 248.867 358.803 1.00 191.35 ? 705  ASN D CA    1 
ATOM   4234  C  C     . ASN B  2  705  ? 249.845 248.937 360.302 1.00 194.25 ? 705  ASN D C     1 
ATOM   4235  O  O     . ASN B  2  705  ? 248.962 248.581 361.087 1.00 195.20 ? 705  ASN D O     1 
ATOM   4236  N  N     . GLU B  2  706  ? 251.036 249.399 360.692 1.00 187.56 ? 706  GLU D N     1 
ATOM   4237  C  CA    . GLU B  2  706  ? 251.400 249.459 362.105 1.00 190.73 ? 706  GLU D CA    1 
ATOM   4238  C  C     . GLU B  2  706  ? 250.564 250.464 362.900 1.00 190.37 ? 706  GLU D C     1 
ATOM   4239  O  O     . GLU B  2  706  ? 250.219 250.207 364.061 1.00 192.66 ? 706  GLU D O     1 
ATOM   4240  N  N     . ILE B  2  707  ? 250.239 251.600 362.280 1.00 178.86 ? 707  ILE D N     1 
ATOM   4241  C  CA    . ILE B  2  707  ? 249.377 252.591 362.927 1.00 178.36 ? 707  ILE D CA    1 
ATOM   4242  C  C     . ILE B  2  707  ? 248.013 251.974 363.178 1.00 178.00 ? 707  ILE D C     1 
ATOM   4243  O  O     . ILE B  2  707  ? 247.426 252.145 364.251 1.00 179.49 ? 707  ILE D O     1 
ATOM   4244  N  N     . VAL B  2  708  ? 247.519 251.258 362.172 1.00 199.52 ? 708  VAL D N     1 
ATOM   4245  C  CA    . VAL B  2  708  ? 246.297 250.482 362.315 1.00 199.46 ? 708  VAL D CA    1 
ATOM   4246  C  C     . VAL B  2  708  ? 246.376 249.553 363.518 1.00 202.82 ? 708  VAL D C     1 
ATOM   4247  O  O     . VAL B  2  708  ? 245.490 249.562 364.369 1.00 203.81 ? 708  VAL D O     1 
ATOM   4248  N  N     . TYR B  2  709  ? 247.449 248.765 363.600 1.00 195.68 ? 709  TYR D N     1 
ATOM   4249  C  CA    . TYR B  2  709  ? 247.590 247.821 364.707 1.00 199.15 ? 709  TYR D CA    1 
ATOM   4250  C  C     . TYR B  2  709  ? 247.576 248.493 366.076 1.00 201.37 ? 709  TYR D C     1 
ATOM   4251  O  O     . TYR B  2  709  ? 246.839 248.064 366.963 1.00 203.07 ? 709  TYR D O     1 
ATOM   4252  N  N     . GLU B  2  710  ? 248.381 249.538 366.248 1.00 222.39 ? 710  GLU D N     1 
ATOM   4253  C  CA    . GLU B  2  710  ? 248.444 250.210 367.547 1.00 224.79 ? 710  GLU D CA    1 
ATOM   4254  C  C     . GLU B  2  710  ? 247.104 250.853 367.911 1.00 223.56 ? 710  GLU D C     1 
ATOM   4255  O  O     . GLU B  2  710  ? 246.647 250.757 369.059 1.00 225.91 ? 710  GLU D O     1 
ATOM   4256  N  N     . LYS B  2  711  ? 246.465 251.470 366.922 1.00 185.09 ? 711  LYS D N     1 
ATOM   4257  C  CA    . LYS B  2  711  ? 245.200 252.145 367.151 1.00 183.84 ? 711  LYS D CA    1 
ATOM   4258  C  C     . LYS B  2  711  ? 244.130 251.129 367.531 1.00 184.72 ? 711  LYS D C     1 
ATOM   4259  O  O     . LYS B  2  711  ? 243.268 251.405 368.367 1.00 185.68 ? 711  LYS D O     1 
ATOM   4260  N  N     . ILE B  2  712  ? 244.208 249.948 366.925 1.00 208.17 ? 712  ILE D N     1 
ATOM   4261  C  CA    . ILE B  2  712  ? 243.200 248.913 367.133 1.00 208.95 ? 712  ILE D CA    1 
ATOM   4262  C  C     . ILE B  2  712  ? 243.410 248.213 368.472 1.00 213.66 ? 712  ILE D C     1 
ATOM   4263  O  O     . ILE B  2  712  ? 242.448 247.841 369.144 1.00 216.46 ? 712  ILE D O     1 
ATOM   4264  N  N     . MET B  2  713  ? 244.671 248.062 368.871 1.00 223.13 ? 713  MET D N     1 
ATOM   4265  C  CA    . MET B  2  713  ? 244.987 247.457 370.153 1.00 228.15 ? 713  MET D CA    1 
ATOM   4266  C  C     . MET B  2  713  ? 244.622 248.415 371.278 1.00 228.32 ? 713  MET D C     1 
ATOM   4267  O  O     . MET B  2  713  ? 244.324 247.984 372.392 1.00 231.88 ? 713  MET D O     1 
ATOM   4268  N  N     . GLU B  2  714  ? 244.645 249.714 370.983 1.00 204.79 ? 714  GLU D N     1 
ATOM   4269  C  CA    . GLU B  2  714  ? 244.182 250.709 371.949 1.00 205.81 ? 714  GLU D CA    1 
ATOM   4270  C  C     . GLU B  2  714  ? 242.736 250.448 372.362 1.00 205.85 ? 714  GLU D C     1 
ATOM   4271  O  O     . GLU B  2  714  ? 242.376 250.599 373.525 1.00 208.40 ? 714  GLU D O     1 
ATOM   4272  N  N     . HIS B  2  715  ? 241.914 250.058 371.395 1.00 206.38 ? 715  HIS D N     1 
ATOM   4273  C  CA    . HIS B  2  715  ? 240.499 249.792 371.633 1.00 206.83 ? 715  HIS D CA    1 
ATOM   4274  C  C     . HIS B  2  715  ? 240.173 248.308 371.855 1.00 212.05 ? 715  HIS D C     1 
ATOM   4275  O  O     . HIS B  2  715  ? 239.003 247.934 371.979 1.00 214.07 ? 715  HIS D O     1 
ATOM   4276  N  N     . ALA B  2  716  ? 241.213 247.477 371.914 1.00 220.45 ? 716  ALA D N     1 
ATOM   4277  C  CA    . ALA B  2  716  ? 241.072 246.021 372.039 1.00 225.55 ? 716  ALA D CA    1 
ATOM   4278  C  C     . ALA B  2  716  ? 240.357 245.564 373.317 1.00 230.58 ? 716  ALA D C     1 
ATOM   4279  O  O     . ALA B  2  716  ? 239.989 244.393 373.458 1.00 234.95 ? 716  ALA D O     1 
ATOM   4280  N  N     . GLY B  2  717  ? 240.144 246.504 374.232 1.00 215.00 ? 717  GLY D N     1 
ATOM   4281  C  CA    . GLY B  2  717  ? 239.423 246.255 375.466 1.00 219.44 ? 717  GLY D CA    1 
ATOM   4282  C  C     . GLY B  2  717  ? 237.954 246.383 375.133 1.00 219.10 ? 717  GLY D C     1 
ATOM   4283  O  O     . GLY B  2  717  ? 237.552 246.041 374.022 1.00 217.53 ? 717  GLY D O     1 
ATOM   4284  N  N     . LYS B  2  718  ? 237.143 246.876 376.061 1.00 264.14 ? 718  LYS D N     1 
ATOM   4285  C  CA    . LYS B  2  718  ? 235.715 246.896 375.792 1.00 264.64 ? 718  LYS D CA    1 
ATOM   4286  C  C     . LYS B  2  718  ? 235.424 248.169 375.012 1.00 258.89 ? 718  LYS D C     1 
ATOM   4287  O  O     . LYS B  2  718  ? 235.497 249.279 375.542 1.00 257.03 ? 718  LYS D O     1 
ATOM   4288  N  N     . ASN B  2  719  ? 235.083 247.968 373.739 1.00 250.10 ? 719  ASN D N     1 
ATOM   4289  C  CA    . ASN B  2  719  ? 234.930 249.030 372.753 1.00 244.26 ? 719  ASN D CA    1 
ATOM   4290  C  C     . ASN B  2  719  ? 234.683 248.387 371.390 1.00 242.62 ? 719  ASN D C     1 
ATOM   4291  O  O     . ASN B  2  719  ? 234.763 247.166 371.259 1.00 246.00 ? 719  ASN D O     1 
ATOM   4292  N  N     . GLN B  2  720  ? 234.396 249.200 370.377 1.00 203.21 ? 720  GLN D N     1 
ATOM   4293  C  CA    . GLN B  2  720  ? 234.125 248.685 369.036 1.00 201.28 ? 720  GLN D CA    1 
ATOM   4294  C  C     . GLN B  2  720  ? 234.850 249.483 367.961 1.00 195.29 ? 720  GLN D C     1 
ATOM   4295  O  O     . GLN B  2  720  ? 234.780 250.710 367.949 1.00 191.63 ? 720  GLN D O     1 
ATOM   4296  N  N     . VAL B  2  721  ? 235.532 248.787 367.053 1.00 196.29 ? 721  VAL D N     1 
ATOM   4297  C  CA    . VAL B  2  721  ? 236.219 249.451 365.944 1.00 190.97 ? 721  VAL D CA    1 
ATOM   4298  C  C     . VAL B  2  721  ? 235.646 249.086 364.576 1.00 188.95 ? 721  VAL D C     1 
ATOM   4299  O  O     . VAL B  2  721  ? 235.181 247.967 364.355 1.00 192.17 ? 721  VAL D O     1 
ATOM   4300  N  N     . LEU B  2  722  ? 235.673 250.048 363.662 1.00 200.95 ? 722  LEU D N     1 
ATOM   4301  C  CA    . LEU B  2  722  ? 235.201 249.820 362.303 1.00 198.90 ? 722  LEU D CA    1 
ATOM   4302  C  C     . LEU B  2  722  ? 236.182 250.421 361.300 1.00 196.72 ? 722  LEU D C     1 
ATOM   4303  O  O     . LEU B  2  722  ? 236.519 251.602 361.374 1.00 195.78 ? 722  LEU D O     1 
ATOM   4304  N  N     . VAL B  2  723  ? 236.631 249.597 360.359 1.00 190.06 ? 723  VAL D N     1 
ATOM   4305  C  CA    . VAL B  2  723  ? 237.613 250.013 359.368 1.00 188.25 ? 723  VAL D CA    1 
ATOM   4306  C  C     . VAL B  2  723  ? 237.004 250.152 357.972 1.00 186.12 ? 723  VAL D C     1 
ATOM   4307  O  O     . VAL B  2  723  ? 236.441 249.198 357.429 1.00 186.31 ? 723  VAL D O     1 
ATOM   4308  N  N     . PHE B  2  724  ? 237.126 251.344 357.394 1.00 187.61 ? 724  PHE D N     1 
ATOM   4309  C  CA    . PHE B  2  724  ? 236.676 251.566 356.030 1.00 185.72 ? 724  PHE D CA    1 
ATOM   4310  C  C     . PHE B  2  724  ? 237.873 251.561 355.087 1.00 184.56 ? 724  PHE D C     1 
ATOM   4311  O  O     . PHE B  2  724  ? 238.650 252.503 355.069 1.00 183.77 ? 724  PHE D O     1 
ATOM   4312  N  N     . VAL B  2  725  ? 237.992 250.501 354.294 1.00 182.70 ? 725  VAL D N     1 
ATOM   4313  C  CA    . VAL B  2  725  ? 239.038 250.377 353.289 1.00 181.71 ? 725  VAL D CA    1 
ATOM   4314  C  C     . VAL B  2  725  ? 238.374 250.718 351.992 1.00 180.09 ? 725  VAL D C     1 
ATOM   4315  O  O     . VAL B  2  725  ? 237.198 250.399 351.830 1.00 180.35 ? 725  VAL D O     1 
ATOM   4316  N  N     . HIS B  2  726  ? 239.067 251.356 351.053 1.00 238.13 ? 726  HIS D N     1 
ATOM   4317  C  CA    . HIS B  2  726  ? 238.363 251.622 349.779 1.00 236.89 ? 726  HIS D CA    1 
ATOM   4318  C  C     . HIS B  2  726  ? 238.451 250.524 348.703 1.00 236.94 ? 726  HIS D C     1 
ATOM   4319  O  O     . HIS B  2  726  ? 237.907 250.677 347.600 1.00 236.08 ? 726  HIS D O     1 
ATOM   4320  N  N     . SER B  2  727  ? 239.078 249.408 349.053 1.00 179.11 ? 727  SER D N     1 
ATOM   4321  C  CA    . SER B  2  727  ? 239.168 248.253 348.158 1.00 179.50 ? 727  SER D CA    1 
ATOM   4322  C  C     . SER B  2  727  ? 238.040 247.212 348.369 1.00 180.90 ? 727  SER D C     1 
ATOM   4323  O  O     . SER B  2  727  ? 237.477 247.100 349.459 1.00 181.98 ? 727  SER D O     1 
ATOM   4324  N  N     . ARG B  2  728  ? 237.652 246.514 347.312 1.00 206.41 ? 728  ARG D N     1 
ATOM   4325  C  CA    . ARG B  2  728  ? 236.710 245.411 347.462 1.00 208.01 ? 728  ARG D CA    1 
ATOM   4326  C  C     . ARG B  2  728  ? 237.318 244.255 348.262 1.00 210.66 ? 728  ARG D C     1 
ATOM   4327  O  O     . ARG B  2  728  ? 236.781 243.850 349.296 1.00 213.61 ? 728  ARG D O     1 
ATOM   4328  N  N     . LYS B  2  729  ? 238.458 243.757 347.782 1.00 169.64 ? 729  LYS D N     1 
ATOM   4329  C  CA    . LYS B  2  729  ? 239.078 242.535 348.304 1.00 174.83 ? 729  LYS D CA    1 
ATOM   4330  C  C     . LYS B  2  729  ? 239.779 242.775 349.629 1.00 176.29 ? 729  LYS D C     1 
ATOM   4331  O  O     . LYS B  2  729  ? 239.902 241.876 350.458 1.00 180.95 ? 729  LYS D O     1 
ATOM   4332  N  N     . GLU B  2  730  ? 240.236 244.008 349.811 1.00 180.66 ? 730  GLU D N     1 
ATOM   4333  C  CA    . GLU B  2  730  ? 241.088 244.366 350.932 1.00 181.49 ? 730  GLU D CA    1 
ATOM   4334  C  C     . GLU B  2  730  ? 240.281 244.507 352.212 1.00 183.02 ? 730  GLU D C     1 
ATOM   4335  O  O     . GLU B  2  730  ? 240.831 244.699 353.294 1.00 184.94 ? 730  GLU D O     1 
ATOM   4336  N  N     . THR B  2  731  ? 238.962 244.410 352.081 1.00 218.27 ? 731  THR D N     1 
ATOM   4337  C  CA    . THR B  2  731  ? 238.095 244.275 353.241 1.00 220.69 ? 731  THR D CA    1 
ATOM   4338  C  C     . THR B  2  731  ? 238.556 243.069 354.057 1.00 226.69 ? 731  THR D C     1 
ATOM   4339  O  O     . THR B  2  731  ? 238.603 243.119 355.283 1.00 229.02 ? 731  THR D O     1 
ATOM   4340  N  N     . GLY B  2  732  ? 238.916 241.990 353.364 1.00 170.58 ? 732  GLY D N     1 
ATOM   4341  C  CA    . GLY B  2  732  ? 239.388 240.781 354.010 1.00 176.65 ? 732  GLY D CA    1 
ATOM   4342  C  C     . GLY B  2  732  ? 240.898 240.606 353.982 1.00 177.70 ? 732  GLY D C     1 
ATOM   4343  O  O     . GLY B  2  732  ? 241.420 239.661 354.567 1.00 182.74 ? 732  GLY D O     1 
ATOM   4344  N  N     . LYS B  2  733  ? 241.591 241.484 353.263 1.00 188.08 ? 733  LYS D N     1 
ATOM   4345  C  CA    . LYS B  2  733  ? 243.053 241.506 353.275 1.00 188.83 ? 733  LYS D CA    1 
ATOM   4346  C  C     . LYS B  2  733  ? 243.559 242.295 354.477 1.00 188.25 ? 733  LYS D C     1 
ATOM   4347  O  O     . LYS B  2  733  ? 244.644 242.034 354.998 1.00 191.03 ? 733  LYS D O     1 
ATOM   4348  N  N     . THR B  2  734  ? 242.770 243.280 354.896 1.00 194.44 ? 734  THR D N     1 
ATOM   4349  C  CA    . THR B  2  734  ? 243.048 244.042 356.111 1.00 193.94 ? 734  THR D CA    1 
ATOM   4350  C  C     . THR B  2  734  ? 242.819 243.158 357.334 1.00 199.36 ? 734  THR D C     1 
ATOM   4351  O  O     . THR B  2  734  ? 243.670 243.070 358.219 1.00 201.73 ? 734  THR D O     1 
ATOM   4352  N  N     . ALA B  2  735  ? 241.672 242.489 357.372 1.00 212.82 ? 735  ALA D N     1 
ATOM   4353  C  CA    . ALA B  2  735  ? 241.482 241.398 358.311 1.00 218.84 ? 735  ALA D CA    1 
ATOM   4354  C  C     . ALA B  2  735  ? 242.442 240.288 357.888 1.00 222.76 ? 735  ALA D C     1 
ATOM   4355  O  O     . ALA B  2  735  ? 242.952 240.309 356.765 1.00 220.82 ? 735  ALA D O     1 
ATOM   4356  N  N     . ARG B  2  736  ? 242.728 239.365 358.805 1.00 214.56 ? 736  ARG D N     1 
ATOM   4357  C  CA    . ARG B  2  736  ? 243.715 238.285 358.634 1.00 220.29 ? 736  ARG D CA    1 
ATOM   4358  C  C     . ARG B  2  736  ? 245.139 238.816 358.740 1.00 217.72 ? 736  ARG D C     1 
ATOM   4359  O  O     . ARG B  2  736  ? 246.074 238.054 358.963 1.00 223.01 ? 736  ARG D O     1 
ATOM   4360  N  N     . ALA B  2  737  ? 245.302 240.123 358.572 1.00 214.46 ? 737  ALA D N     1 
ATOM   4361  C  CA    . ALA B  2  737  ? 246.561 240.780 358.867 1.00 213.17 ? 737  ALA D CA    1 
ATOM   4362  C  C     . ALA B  2  737  ? 246.580 241.079 360.357 1.00 214.63 ? 737  ALA D C     1 
ATOM   4363  O  O     . ALA B  2  737  ? 247.585 240.873 361.050 1.00 217.40 ? 737  ALA D O     1 
ATOM   4364  N  N     . ILE B  2  738  ? 245.435 241.552 360.840 1.00 223.79 ? 738  ILE D N     1 
ATOM   4365  C  CA    . ILE B  2  738  ? 245.226 241.820 362.251 1.00 225.32 ? 738  ILE D CA    1 
ATOM   4366  C  C     . ILE B  2  738  ? 245.256 240.490 362.995 1.00 231.93 ? 738  ILE D C     1 
ATOM   4367  O  O     . ILE B  2  738  ? 245.838 240.378 364.080 1.00 234.71 ? 738  ILE D O     1 
ATOM   4368  N  N     . ARG B  2  739  ? 244.640 239.480 362.385 1.00 215.98 ? 739  ARG D N     1 
ATOM   4369  C  CA    . ARG B  2  739  ? 244.603 238.136 362.949 1.00 225.03 ? 739  ARG D CA    1 
ATOM   4370  C  C     . ARG B  2  739  ? 245.999 237.519 363.064 1.00 228.80 ? 739  ARG D C     1 
ATOM   4371  O  O     . ARG B  2  739  ? 246.435 237.144 364.157 1.00 233.13 ? 739  ARG D O     1 
ATOM   4372  N  N     . ASP B  2  740  ? 246.702 237.427 361.937 1.00 234.63 ? 740  ASP D N     1 
ATOM   4373  C  CA    . ASP B  2  740  ? 248.042 236.841 361.918 1.00 238.35 ? 740  ASP D CA    1 
ATOM   4374  C  C     . ASP B  2  740  ? 249.022 237.639 362.776 1.00 235.62 ? 740  ASP D C     1 
ATOM   4375  O  O     . ASP B  2  740  ? 250.008 237.091 363.271 1.00 240.06 ? 740  ASP D O     1 
ATOM   4376  N  N     . MET B  2  741  ? 248.749 238.932 362.951 1.00 249.95 ? 741  MET D N     1 
ATOM   4377  C  CA    . MET B  2  741  ? 249.544 239.753 363.860 1.00 248.91 ? 741  MET D CA    1 
ATOM   4378  C  C     . MET B  2  741  ? 249.284 239.387 365.324 1.00 252.80 ? 741  MET D C     1 
ATOM   4379  O  O     . MET B  2  741  ? 250.218 239.264 366.119 1.00 255.38 ? 741  MET D O     1 
ATOM   4380  N  N     . CYS B  2  742  ? 248.009 239.209 365.670 1.00 222.57 ? 742  CYS D N     1 
ATOM   4381  C  CA    . CYS B  2  742  ? 247.636 238.791 367.021 1.00 227.59 ? 742  CYS D CA    1 
ATOM   4382  C  C     . CYS B  2  742  ? 248.151 237.392 367.348 1.00 235.91 ? 742  CYS D C     1 
ATOM   4383  O  O     . CYS B  2  742  ? 248.371 237.061 368.515 1.00 239.78 ? 742  CYS D O     1 
ATOM   4384  N  N     . LEU B  2  743  ? 248.331 236.570 366.318 1.00 268.97 ? 743  LEU D N     1 
ATOM   4385  C  CA    . LEU B  2  743  ? 248.926 235.251 366.500 1.00 276.71 ? 743  LEU D CA    1 
ATOM   4386  C  C     . LEU B  2  743  ? 250.441 235.388 366.639 1.00 276.41 ? 743  LEU D C     1 
ATOM   4387  O  O     . LEU B  2  743  ? 251.072 234.672 367.417 1.00 281.69 ? 743  LEU D O     1 
ATOM   4388  N  N     . GLU B  2  744  ? 251.011 236.327 365.888 1.00 231.03 ? 744  GLU D N     1 
ATOM   4389  C  CA    . GLU B  2  744  ? 252.439 236.613 365.958 1.00 230.22 ? 744  GLU D CA    1 
ATOM   4390  C  C     . GLU B  2  744  ? 252.764 237.342 367.258 1.00 228.40 ? 744  GLU D C     1 
ATOM   4391  O  O     . GLU B  2  744  ? 253.928 237.534 367.604 1.00 228.70 ? 744  GLU D O     1 
ATOM   4392  N  N     . LYS B  2  745  ? 251.720 237.729 367.985 1.00 262.35 ? 745  LYS D N     1 
ATOM   4393  C  CA    . LYS B  2  745  ? 251.873 238.460 369.239 1.00 261.41 ? 745  LYS D CA    1 
ATOM   4394  C  C     . LYS B  2  745  ? 251.998 237.508 370.432 1.00 267.70 ? 745  LYS D C     1 
ATOM   4395  O  O     . LYS B  2  745  ? 251.984 237.948 371.583 1.00 267.93 ? 745  LYS D O     1 
ATOM   4396  N  N     . ASP B  2  746  ? 252.106 236.209 370.142 1.00 284.54 ? 746  ASP D N     1 
ATOM   4397  C  CA    . ASP B  2  746  ? 252.136 235.152 371.158 1.00 291.76 ? 746  ASP D CA    1 
ATOM   4398  C  C     . ASP B  2  746  ? 250.808 235.088 371.913 1.00 293.11 ? 746  ASP D C     1 
ATOM   4399  O  O     . ASP B  2  746  ? 250.776 235.023 373.148 1.00 295.41 ? 746  ASP D O     1 
ATOM   4400  N  N     . THR B  2  747  ? 249.719 235.111 371.149 1.00 337.34 ? 747  THR D N     1 
ATOM   4401  C  CA    . THR B  2  747  ? 248.357 235.092 371.682 1.00 338.52 ? 747  THR D CA    1 
ATOM   4402  C  C     . THR B  2  747  ? 248.068 236.303 372.567 1.00 333.88 ? 747  THR D C     1 
ATOM   4403  O  O     . THR B  2  747  ? 247.355 236.197 373.568 1.00 336.51 ? 747  THR D O     1 
ATOM   4404  N  N     . LEU B  2  748  ? 248.623 237.451 372.187 1.00 256.25 ? 748  LEU D N     1 
ATOM   4405  C  CA    . LEU B  2  748  ? 248.358 238.697 372.900 1.00 251.27 ? 748  LEU D CA    1 
ATOM   4406  C  C     . LEU B  2  748  ? 247.504 239.619 372.038 1.00 245.31 ? 748  LEU D C     1 
ATOM   4407  O  O     . LEU B  2  748  ? 247.756 239.794 370.846 1.00 242.25 ? 748  LEU D O     1 
ATOM   4408  N  N     . GLY B  2  749  ? 246.489 240.203 372.663 1.00 349.50 ? 749  GLY D N     1 
ATOM   4409  C  CA    . GLY B  2  749  ? 245.465 240.930 371.943 1.00 345.13 ? 749  GLY D CA    1 
ATOM   4410  C  C     . GLY B  2  749  ? 244.232 240.056 371.850 1.00 349.43 ? 749  GLY D C     1 
ATOM   4411  O  O     . GLY B  2  749  ? 243.120 240.542 371.642 1.00 347.26 ? 749  GLY D O     1 
ATOM   4412  N  N     . LEU B  2  750  ? 244.433 238.752 372.019 1.00 249.94 ? 750  LEU D N     1 
ATOM   4413  C  CA    . LEU B  2  750  ? 243.319 237.815 372.008 1.00 255.62 ? 750  LEU D CA    1 
ATOM   4414  C  C     . LEU B  2  750  ? 242.567 237.894 373.324 1.00 258.93 ? 750  LEU D C     1 
ATOM   4415  O  O     . LEU B  2  750  ? 242.861 238.750 374.164 1.00 255.85 ? 750  LEU D O     1 
ATOM   4416  N  N     . PHE B  2  751  ? 241.605 236.992 373.499 1.00 321.21 ? 751  PHE D N     1 
ATOM   4417  C  CA    . PHE B  2  751  ? 240.638 237.101 374.584 1.00 324.53 ? 751  PHE D CA    1 
ATOM   4418  C  C     . PHE B  2  751  ? 239.961 238.471 374.509 1.00 317.79 ? 751  PHE D C     1 
ATOM   4419  O  O     . PHE B  2  751  ? 240.209 239.357 375.327 1.00 314.25 ? 751  PHE D O     1 
ATOM   4420  N  N     . LEU B  2  752  ? 239.115 238.625 373.493 1.00 269.93 ? 752  LEU D N     1 
ATOM   4421  C  CA    . LEU B  2  752  ? 238.386 239.862 373.233 1.00 263.37 ? 752  LEU D CA    1 
ATOM   4422  C  C     . LEU B  2  752  ? 237.136 239.906 374.112 1.00 267.81 ? 752  LEU D C     1 
ATOM   4423  O  O     . LEU B  2  752  ? 236.297 240.801 373.984 1.00 263.96 ? 752  LEU D O     1 
ATOM   4424  N  N     . ARG B  2  753  ? 237.012 238.910 374.986 1.00 304.34 ? 753  ARG D N     1 
ATOM   4425  C  CA    . ARG B  2  753  ? 235.862 238.760 375.871 1.00 309.80 ? 753  ARG D CA    1 
ATOM   4426  C  C     . ARG B  2  753  ? 236.231 238.925 377.354 1.00 311.30 ? 753  ARG D C     1 
ATOM   4427  O  O     . ARG B  2  753  ? 237.383 239.199 377.694 1.00 307.93 ? 753  ARG D O     1 
ATOM   4428  N  N     . GLU B  2  754  ? 235.241 238.753 378.228 1.00 294.33 ? 754  GLU D N     1 
ATOM   4429  C  CA    . GLU B  2  754  ? 235.415 238.935 379.671 1.00 295.97 ? 754  GLU D CA    1 
ATOM   4430  C  C     . GLU B  2  754  ? 235.974 237.688 380.353 1.00 302.17 ? 754  GLU D C     1 
ATOM   4431  O  O     . GLU B  2  754  ? 236.187 237.676 381.567 1.00 304.01 ? 754  GLU D O     1 
ATOM   4432  N  N     . GLY B  2  755  ? 236.206 236.645 379.566 1.00 344.95 ? 755  GLY D N     1 
ATOM   4433  C  CA    . GLY B  2  755  ? 236.587 235.345 380.091 1.00 351.57 ? 755  GLY D CA    1 
ATOM   4434  C  C     . GLY B  2  755  ? 236.813 234.363 378.959 1.00 354.02 ? 755  GLY D C     1 
ATOM   4435  O  O     . GLY B  2  755  ? 237.137 234.761 377.844 1.00 349.37 ? 755  GLY D O     1 
ATOM   4436  N  N     . SER B  2  756  ? 236.690 233.072 379.253 1.00 327.91 ? 756  SER D N     1 
ATOM   4437  C  CA    . SER B  2  756  ? 236.713 232.057 378.205 1.00 331.23 ? 756  SER D CA    1 
ATOM   4438  C  C     . SER B  2  756  ? 235.327 231.925 377.562 1.00 333.54 ? 756  SER D C     1 
ATOM   4439  O  O     . SER B  2  756  ? 235.163 232.161 376.366 1.00 330.89 ? 756  SER D O     1 
ATOM   4440  N  N     . ALA B  2  757  ? 234.339 231.530 378.363 1.00 310.79 ? 757  ALA D N     1 
ATOM   4441  C  CA    . ALA B  2  757  ? 232.963 231.380 377.885 1.00 313.60 ? 757  ALA D CA    1 
ATOM   4442  C  C     . ALA B  2  757  ? 232.184 232.699 377.843 1.00 309.25 ? 757  ALA D C     1 
ATOM   4443  O  O     . ALA B  2  757  ? 231.169 232.805 377.149 1.00 310.16 ? 757  ALA D O     1 
ATOM   4444  N  N     . SER B  2  758  ? 232.665 233.699 378.579 1.00 319.04 ? 758  SER D N     1 
ATOM   4445  C  CA    . SER B  2  758  ? 231.952 234.970 378.721 1.00 315.13 ? 758  SER D CA    1 
ATOM   4446  C  C     . SER B  2  758  ? 231.869 235.762 377.416 1.00 309.29 ? 758  SER D C     1 
ATOM   4447  O  O     . SER B  2  758  ? 232.631 235.521 376.478 1.00 306.65 ? 758  SER D O     1 
ATOM   4448  N  N     . THR B  2  759  ? 230.912 236.690 377.370 1.00 312.58 ? 759  THR D N     1 
ATOM   4449  C  CA    . THR B  2  759  ? 230.692 237.574 376.224 1.00 306.42 ? 759  THR D CA    1 
ATOM   4450  C  C     . THR B  2  759  ? 230.364 236.806 374.945 1.00 308.62 ? 759  THR D C     1 
ATOM   4451  O  O     . THR B  2  759  ? 230.579 237.299 373.836 1.00 302.69 ? 759  THR D O     1 
ATOM   4452  N  N     . GLU B  2  760  ? 229.840 235.595 375.112 1.00 263.60 ? 760  GLU D N     1 
ATOM   4453  C  CA    . GLU B  2  760  ? 229.315 234.813 373.996 1.00 267.01 ? 760  GLU D CA    1 
ATOM   4454  C  C     . GLU B  2  760  ? 230.322 234.550 372.876 1.00 263.25 ? 760  GLU D C     1 
ATOM   4455  O  O     . GLU B  2  760  ? 230.214 235.105 371.781 1.00 258.17 ? 760  GLU D O     1 
ATOM   4456  N  N     . VAL B  2  761  ? 231.309 233.713 373.168 1.00 236.50 ? 761  VAL D N     1 
ATOM   4457  C  CA    . VAL B  2  761  ? 232.236 233.241 372.148 1.00 234.66 ? 761  VAL D CA    1 
ATOM   4458  C  C     . VAL B  2  761  ? 231.587 232.073 371.415 1.00 241.22 ? 761  VAL D C     1 
ATOM   4459  O  O     . VAL B  2  761  ? 232.013 231.688 370.327 1.00 240.28 ? 761  VAL D O     1 
ATOM   4460  N  N     . LEU B  2  762  ? 230.541 231.512 372.014 1.00 302.13 ? 762  LEU D N     1 
ATOM   4461  C  CA    . LEU B  2  762  ? 229.759 230.471 371.357 1.00 308.16 ? 762  LEU D CA    1 
ATOM   4462  C  C     . LEU B  2  762  ? 228.860 231.123 370.314 1.00 305.98 ? 762  LEU D C     1 
ATOM   4463  O  O     . LEU B  2  762  ? 228.366 230.461 369.412 1.00 309.21 ? 762  LEU D O     1 
ATOM   4464  N  N     . ARG B  2  763  ? 228.652 232.430 370.443 1.00 255.58 ? 763  ARG D N     1 
ATOM   4465  C  CA    . ARG B  2  763  ? 227.928 233.186 369.431 1.00 251.38 ? 763  ARG D CA    1 
ATOM   4466  C  C     . ARG B  2  763  ? 228.764 233.224 368.167 1.00 244.97 ? 763  ARG D C     1 
ATOM   4467  O  O     . ARG B  2  763  ? 228.261 232.983 367.074 1.00 244.22 ? 763  ARG D O     1 
ATOM   4468  N  N     . THR B  2  764  ? 230.049 233.518 368.331 1.00 289.00 ? 764  THR D N     1 
ATOM   4469  C  CA    . THR B  2  764  ? 230.949 233.632 367.191 1.00 282.46 ? 764  THR D CA    1 
ATOM   4470  C  C     . THR B  2  764  ? 231.364 232.260 366.658 1.00 288.81 ? 764  THR D C     1 
ATOM   4471  O  O     . THR B  2  764  ? 231.683 232.122 365.478 1.00 285.53 ? 764  THR D O     1 
ATOM   4472  N  N     . GLU B  2  765  ? 231.364 231.248 367.521 1.00 246.43 ? 765  GLU D N     1 
ATOM   4473  C  CA    . GLU B  2  765  ? 231.726 229.901 367.086 1.00 252.44 ? 765  GLU D CA    1 
ATOM   4474  C  C     . GLU B  2  765  ? 230.573 229.142 366.425 1.00 258.27 ? 765  GLU D C     1 
ATOM   4475  O  O     . GLU B  2  765  ? 230.768 228.477 365.407 1.00 259.45 ? 765  GLU D O     1 
ATOM   4476  N  N     . ALA B  2  766  ? 229.377 229.248 367.000 1.00 285.78 ? 766  ALA D N     1 
ATOM   4477  C  CA    . ALA B  2  766  ? 228.218 228.515 366.492 1.00 291.68 ? 766  ALA D CA    1 
ATOM   4478  C  C     . ALA B  2  766  ? 227.729 229.065 365.161 1.00 286.48 ? 766  ALA D C     1 
ATOM   4479  O  O     . ALA B  2  766  ? 227.067 228.361 364.403 1.00 288.68 ? 766  ALA D O     1 
ATOM   4480  N  N     . GLU B  2  767  ? 228.060 230.319 364.870 1.00 268.63 ? 767  GLU D N     1 
ATOM   4481  C  CA    . GLU B  2  767  ? 227.844 230.825 363.530 1.00 260.39 ? 767  GLU D CA    1 
ATOM   4482  C  C     . GLU B  2  767  ? 229.155 230.509 362.850 1.00 257.61 ? 767  GLU D C     1 
ATOM   4483  O  O     . GLU B  2  767  ? 230.172 231.150 363.103 1.00 252.20 ? 767  GLU D O     1 
ATOM   4484  N  N     . GLN B  2  768  ? 229.123 229.519 361.972 1.00 256.34 ? 768  GLN D N     1 
ATOM   4485  C  CA    . GLN B  2  768  ? 230.346 228.899 361.495 1.00 257.02 ? 768  GLN D CA    1 
ATOM   4486  C  C     . GLN B  2  768  ? 230.334 228.830 359.978 1.00 251.79 ? 768  GLN D C     1 
ATOM   4487  O  O     . GLN B  2  768  ? 231.172 229.434 359.311 1.00 243.69 ? 768  GLN D O     1 
ATOM   4488  N  N     . CYS B  2  769  ? 229.374 228.085 359.443 1.00 267.20 ? 769  CYS D N     1 
ATOM   4489  C  CA    . CYS B  2  769  ? 229.220 227.959 358.003 1.00 261.79 ? 769  CYS D CA    1 
ATOM   4490  C  C     . CYS B  2  769  ? 228.511 229.180 357.425 1.00 248.84 ? 769  CYS D C     1 
ATOM   4491  O  O     . CYS B  2  769  ? 227.358 229.455 357.759 1.00 247.85 ? 769  CYS D O     1 
ATOM   4492  N  N     . LYS B  2  770  ? 229.209 229.901 356.549 1.00 268.32 ? 770  LYS D N     1 
ATOM   4493  C  CA    . LYS B  2  770  ? 228.659 231.067 355.856 1.00 255.22 ? 770  LYS D CA    1 
ATOM   4494  C  C     . LYS B  2  770  ? 229.263 231.192 354.458 1.00 247.31 ? 770  LYS D C     1 
ATOM   4495  O  O     . LYS B  2  770  ? 230.285 230.575 354.159 1.00 251.08 ? 770  LYS D O     1 
ATOM   4496  N  N     . ASN B  2  771  ? 228.626 231.990 353.606 1.00 291.92 ? 771  ASN D N     1 
ATOM   4497  C  CA    . ASN B  2  771  ? 229.038 232.124 352.206 1.00 284.65 ? 771  ASN D CA    1 
ATOM   4498  C  C     . ASN B  2  771  ? 230.437 232.717 351.991 1.00 281.02 ? 771  ASN D C     1 
ATOM   4499  O  O     . ASN B  2  771  ? 231.166 232.296 351.092 1.00 280.77 ? 771  ASN D O     1 
ATOM   4500  N  N     . LEU B  2  772  ? 230.803 233.695 352.811 1.00 237.61 ? 772  LEU D N     1 
ATOM   4501  C  CA    . LEU B  2  772  ? 232.048 234.438 352.622 1.00 232.59 ? 772  LEU D CA    1 
ATOM   4502  C  C     . LEU B  2  772  ? 233.255 233.711 353.204 1.00 239.87 ? 772  LEU D C     1 
ATOM   4503  O  O     . LEU B  2  772  ? 233.203 232.520 353.509 1.00 248.93 ? 772  LEU D O     1 
ATOM   4504  N  N     . GLU B  2  773  ? 234.347 234.457 353.335 1.00 271.22 ? 773  GLU D N     1 
ATOM   4505  C  CA    . GLU B  2  773  ? 235.587 233.969 353.928 1.00 276.76 ? 773  GLU D CA    1 
ATOM   4506  C  C     . GLU B  2  773  ? 235.475 234.002 355.453 1.00 281.63 ? 773  GLU D C     1 
ATOM   4507  O  O     . GLU B  2  773  ? 236.401 233.608 356.168 1.00 286.72 ? 773  GLU D O     1 
ATOM   4508  N  N     . LEU B  2  774  ? 234.318 234.460 355.932 1.00 222.02 ? 774  LEU D N     1 
ATOM   4509  C  CA    . LEU B  2  774  ? 234.043 234.636 357.355 1.00 226.32 ? 774  LEU D CA    1 
ATOM   4510  C  C     . LEU B  2  774  ? 234.379 233.409 358.198 1.00 238.84 ? 774  LEU D C     1 
ATOM   4511  O  O     . LEU B  2  774  ? 234.749 233.540 359.366 1.00 242.13 ? 774  LEU D O     1 
ATOM   4512  N  N     . LYS B  2  775  ? 234.242 232.225 357.607 1.00 245.84 ? 775  LYS D N     1 
ATOM   4513  C  CA    . LYS B  2  775  ? 234.520 230.972 358.301 1.00 258.00 ? 775  LYS D CA    1 
ATOM   4514  C  C     . LYS B  2  775  ? 235.906 230.954 358.942 1.00 259.30 ? 775  LYS D C     1 
ATOM   4515  O  O     . LYS B  2  775  ? 236.125 230.267 359.940 1.00 267.35 ? 775  LYS D O     1 
ATOM   4516  N  N     . ASP B  2  776  ? 236.843 231.702 358.364 1.00 253.48 ? 776  ASP D N     1 
ATOM   4517  C  CA    . ASP B  2  776  ? 238.176 231.822 358.951 1.00 253.47 ? 776  ASP D CA    1 
ATOM   4518  C  C     . ASP B  2  776  ? 238.227 232.859 360.079 1.00 249.26 ? 776  ASP D C     1 
ATOM   4519  O  O     . ASP B  2  776  ? 238.831 232.621 361.125 1.00 253.52 ? 776  ASP D O     1 
ATOM   4520  N  N     . LEU B  2  777  ? 237.587 234.003 359.857 1.00 210.62 ? 777  LEU D N     1 
ATOM   4521  C  CA    . LEU B  2  777  ? 237.649 235.126 360.795 1.00 205.39 ? 777  LEU D CA    1 
ATOM   4522  C  C     . LEU B  2  777  ? 236.694 234.987 361.977 1.00 211.14 ? 777  LEU D C     1 
ATOM   4523  O  O     . LEU B  2  777  ? 237.024 235.373 363.095 1.00 211.58 ? 777  LEU D O     1 
ATOM   4524  N  N     . LEU B  2  778  ? 235.507 234.448 361.720 1.00 228.72 ? 778  LEU D N     1 
ATOM   4525  C  CA    . LEU B  2  778  ? 234.460 234.341 362.739 1.00 234.41 ? 778  LEU D CA    1 
ATOM   4526  C  C     . LEU B  2  778  ? 234.809 233.589 364.038 1.00 243.56 ? 778  LEU D C     1 
ATOM   4527  O  O     . LEU B  2  778  ? 234.365 233.997 365.109 1.00 244.83 ? 778  LEU D O     1 
ATOM   4528  N  N     . PRO B  2  779  ? 235.580 232.485 363.954 1.00 264.74 ? 779  PRO D N     1 
ATOM   4529  C  CA    . PRO B  2  779  ? 235.988 231.839 365.212 1.00 271.70 ? 779  PRO D CA    1 
ATOM   4530  C  C     . PRO B  2  779  ? 236.751 232.780 366.145 1.00 266.46 ? 779  PRO D C     1 
ATOM   4531  O  O     . PRO B  2  779  ? 236.692 232.627 367.365 1.00 270.39 ? 779  PRO D O     1 
ATOM   4532  N  N     . TYR B  2  780  ? 237.454 233.745 365.565 1.00 251.11 ? 780  TYR D N     1 
ATOM   4533  C  CA    . TYR B  2  780  ? 238.155 234.767 366.332 1.00 245.16 ? 780  TYR D CA    1 
ATOM   4534  C  C     . TYR B  2  780  ? 237.237 235.970 366.551 1.00 239.18 ? 780  TYR D C     1 
ATOM   4535  O  O     . TYR B  2  780  ? 236.029 235.880 366.342 1.00 241.11 ? 780  TYR D O     1 
ATOM   4536  N  N     . GLY B  2  781  ? 237.802 237.087 366.998 1.00 210.62 ? 781  GLY D N     1 
ATOM   4537  C  CA    . GLY B  2  781  ? 237.001 238.235 367.383 1.00 205.44 ? 781  GLY D CA    1 
ATOM   4538  C  C     . GLY B  2  781  ? 236.428 239.118 366.285 1.00 197.09 ? 781  GLY D C     1 
ATOM   4539  O  O     . GLY B  2  781  ? 235.548 239.938 366.558 1.00 194.03 ? 781  GLY D O     1 
ATOM   4540  N  N     . PHE B  2  782  ? 236.900 238.961 365.053 1.00 215.02 ? 782  PHE D N     1 
ATOM   4541  C  CA    . PHE B  2  782  ? 236.486 239.867 363.970 1.00 206.88 ? 782  PHE D CA    1 
ATOM   4542  C  C     . PHE B  2  782  ? 235.945 239.242 362.673 1.00 207.14 ? 782  PHE D C     1 
ATOM   4543  O  O     . PHE B  2  782  ? 236.058 238.039 362.439 1.00 213.68 ? 782  PHE D O     1 
ATOM   4544  N  N     . ALA B  2  783  ? 235.339 240.095 361.846 1.00 214.15 ? 783  ALA D N     1 
ATOM   4545  C  CA    . ALA B  2  783  ? 234.759 239.694 360.568 1.00 212.82 ? 783  ALA D CA    1 
ATOM   4546  C  C     . ALA B  2  783  ? 234.821 240.831 359.538 1.00 203.69 ? 783  ALA D C     1 
ATOM   4547  O  O     . ALA B  2  783  ? 235.356 241.903 359.819 1.00 199.93 ? 783  ALA D O     1 
ATOM   4548  N  N     . ILE B  2  784  ? 234.271 240.586 358.347 1.00 233.13 ? 784  ILE D N     1 
ATOM   4549  C  CA    . ILE B  2  784  ? 234.258 241.583 357.270 1.00 226.62 ? 784  ILE D CA    1 
ATOM   4550  C  C     . ILE B  2  784  ? 232.864 241.796 356.673 1.00 224.66 ? 784  ILE D C     1 
ATOM   4551  O  O     . ILE B  2  784  ? 232.003 240.917 356.754 1.00 228.47 ? 784  ILE D O     1 
ATOM   4552  N  N     . HIS B  2  785  ? 232.647 242.962 356.068 1.00 221.55 ? 785  HIS D N     1 
ATOM   4553  C  CA    . HIS B  2  785  ? 231.373 243.269 355.418 1.00 219.30 ? 785  HIS D CA    1 
ATOM   4554  C  C     . HIS B  2  785  ? 231.548 244.063 354.126 1.00 213.64 ? 785  HIS D C     1 
ATOM   4555  O  O     . HIS B  2  785  ? 232.356 244.996 354.066 1.00 210.15 ? 785  HIS D O     1 
ATOM   4556  N  N     . HIS B  2  786  ? 230.773 243.690 353.107 1.00 208.50 ? 786  HIS D N     1 
ATOM   4557  C  CA    . HIS B  2  786  ? 230.727 244.386 351.821 1.00 203.66 ? 786  HIS D CA    1 
ATOM   4558  C  C     . HIS B  2  786  ? 229.707 243.721 350.909 1.00 204.41 ? 786  HIS D C     1 
ATOM   4559  O  O     . HIS B  2  786  ? 229.275 242.591 351.158 1.00 208.79 ? 786  HIS D O     1 
ATOM   4560  N  N     . ALA B  2  787  ? 229.346 244.428 349.843 1.00 201.42 ? 787  ALA D N     1 
ATOM   4561  C  CA    . ALA B  2  787  ? 228.304 244.003 348.914 1.00 202.27 ? 787  ALA D CA    1 
ATOM   4562  C  C     . ALA B  2  787  ? 228.689 242.794 348.087 1.00 202.97 ? 787  ALA D C     1 
ATOM   4563  O  O     . ALA B  2  787  ? 227.812 242.054 347.627 1.00 204.54 ? 787  ALA D O     1 
ATOM   4564  N  N     . GLY B  2  788  ? 229.990 242.595 347.889 1.00 172.76 ? 788  GLY D N     1 
ATOM   4565  C  CA    . GLY B  2  788  ? 230.450 241.586 346.948 1.00 174.14 ? 788  GLY D CA    1 
ATOM   4566  C  C     . GLY B  2  788  ? 230.181 240.126 347.286 1.00 179.63 ? 788  GLY D C     1 
ATOM   4567  O  O     . GLY B  2  788  ? 229.451 239.448 346.559 1.00 180.72 ? 788  GLY D O     1 
ATOM   4568  N  N     . MET B  2  789  ? 230.692 239.653 348.418 1.00 243.26 ? 789  MET D N     1 
ATOM   4569  C  CA    . MET B  2  789  ? 230.745 238.207 348.660 1.00 249.08 ? 789  MET D CA    1 
ATOM   4570  C  C     . MET B  2  789  ? 229.386 237.534 348.919 1.00 252.06 ? 789  MET D C     1 
ATOM   4571  O  O     . MET B  2  789  ? 229.159 236.404 348.483 1.00 255.52 ? 789  MET D O     1 
ATOM   4572  N  N     . THR B  2  790  ? 228.486 238.224 349.617 1.00 218.02 ? 790  THR D N     1 
ATOM   4573  C  CA    . THR B  2  790  ? 227.177 237.651 349.928 1.00 220.91 ? 790  THR D CA    1 
ATOM   4574  C  C     . THR B  2  790  ? 226.053 238.671 349.821 1.00 217.12 ? 790  THR D C     1 
ATOM   4575  O  O     . THR B  2  790  ? 226.294 239.872 349.695 1.00 212.59 ? 790  THR D O     1 
ATOM   4576  N  N     . ARG B  2  791  ? 224.823 238.175 349.879 1.00 201.14 ? 791  ARG D N     1 
ATOM   4577  C  CA    . ARG B  2  791  ? 223.640 239.022 349.856 1.00 198.51 ? 791  ARG D CA    1 
ATOM   4578  C  C     . ARG B  2  791  ? 223.046 239.096 351.263 1.00 201.52 ? 791  ARG D C     1 
ATOM   4579  O  O     . ARG B  2  791  ? 222.985 240.161 351.880 1.00 199.25 ? 791  ARG D O     1 
ATOM   4580  N  N     . VAL B  2  792  ? 222.610 237.943 351.761 1.00 223.01 ? 792  VAL D N     1 
ATOM   4581  C  CA    . VAL B  2  792  ? 221.920 237.854 353.042 1.00 226.67 ? 792  VAL D CA    1 
ATOM   4582  C  C     . VAL B  2  792  ? 222.863 237.902 354.246 1.00 229.24 ? 792  VAL D C     1 
ATOM   4583  O  O     . VAL B  2  792  ? 222.515 238.468 355.289 1.00 230.02 ? 792  VAL D O     1 
ATOM   4584  N  N     . ASP B  2  793  ? 224.051 237.316 354.103 1.00 209.32 ? 793  ASP D N     1 
ATOM   4585  C  CA    . ASP B  2  793  ? 225.023 237.268 355.203 1.00 212.27 ? 793  ASP D CA    1 
ATOM   4586  C  C     . ASP B  2  793  ? 225.564 238.650 355.575 1.00 207.65 ? 793  ASP D C     1 
ATOM   4587  O  O     . ASP B  2  793  ? 226.220 238.797 356.602 1.00 209.70 ? 793  ASP D O     1 
ATOM   4588  N  N     . ARG B  2  794  ? 225.304 239.651 354.735 1.00 210.06 ? 794  ARG D N     1 
ATOM   4589  C  CA    . ARG B  2  794  ? 225.593 241.042 355.084 1.00 205.73 ? 794  ARG D CA    1 
ATOM   4590  C  C     . ARG B  2  794  ? 224.624 241.483 356.167 1.00 207.35 ? 794  ARG D C     1 
ATOM   4591  O  O     . ARG B  2  794  ? 225.019 242.092 357.156 1.00 207.58 ? 794  ARG D O     1 
ATOM   4592  N  N     . THR B  2  795  ? 223.347 241.177 355.966 1.00 232.89 ? 795  THR D N     1 
ATOM   4593  C  CA    . THR B  2  795  ? 222.329 241.459 356.968 1.00 235.13 ? 795  THR D CA    1 
ATOM   4594  C  C     . THR B  2  795  ? 222.589 240.617 358.224 1.00 241.49 ? 795  THR D C     1 
ATOM   4595  O  O     . THR B  2  795  ? 222.384 241.077 359.355 1.00 243.27 ? 795  THR D O     1 
ATOM   4596  N  N     . LEU B  2  796  ? 223.074 239.396 358.016 1.00 185.80 ? 796  LEU D N     1 
ATOM   4597  C  CA    . LEU B  2  796  ? 223.407 238.502 359.127 1.00 192.32 ? 796  LEU D CA    1 
ATOM   4598  C  C     . LEU B  2  796  ? 224.660 238.949 359.899 1.00 193.07 ? 796  LEU D C     1 
ATOM   4599  O  O     . LEU B  2  796  ? 224.839 238.587 361.060 1.00 200.51 ? 796  LEU D O     1 
ATOM   4600  N  N     . VAL B  2  797  ? 225.527 239.718 359.248 1.00 185.83 ? 797  VAL D N     1 
ATOM   4601  C  CA    . VAL B  2  797  ? 226.667 240.341 359.920 1.00 184.66 ? 797  VAL D CA    1 
ATOM   4602  C  C     . VAL B  2  797  ? 226.264 241.637 360.626 1.00 182.78 ? 797  VAL D C     1 
ATOM   4603  O  O     . VAL B  2  797  ? 226.732 241.920 361.723 1.00 183.54 ? 797  VAL D O     1 
ATOM   4604  N  N     . GLU B  2  798  ? 225.396 242.416 359.994 1.00 214.63 ? 798  GLU D N     1 
ATOM   4605  C  CA    . GLU B  2  798  ? 224.898 243.653 360.584 1.00 212.19 ? 798  GLU D CA    1 
ATOM   4606  C  C     . GLU B  2  798  ? 224.143 243.366 361.883 1.00 217.66 ? 798  GLU D C     1 
ATOM   4607  O  O     . GLU B  2  798  ? 224.299 244.086 362.882 1.00 218.06 ? 798  GLU D O     1 
ATOM   4608  N  N     . ASP B  2  799  ? 223.339 242.305 361.863 1.00 209.59 ? 799  ASP D N     1 
ATOM   4609  C  CA    . ASP B  2  799  ? 222.682 241.828 363.075 1.00 218.52 ? 799  ASP D CA    1 
ATOM   4610  C  C     . ASP B  2  799  ? 223.711 241.495 364.153 1.00 225.59 ? 799  ASP D C     1 
ATOM   4611  O  O     . ASP B  2  799  ? 223.501 241.781 365.332 1.00 230.52 ? 799  ASP D O     1 
ATOM   4612  N  N     . LEU B  2  800  ? 224.824 240.896 363.737 1.00 199.47 ? 800  LEU D N     1 
ATOM   4613  C  CA    . LEU B  2  800  ? 225.882 240.498 364.665 1.00 205.86 ? 800  LEU D CA    1 
ATOM   4614  C  C     . LEU B  2  800  ? 226.639 241.688 365.240 1.00 199.73 ? 800  LEU D C     1 
ATOM   4615  O  O     . LEU B  2  800  ? 227.131 241.628 366.364 1.00 205.01 ? 800  LEU D O     1 
ATOM   4616  N  N     . PHE B  2  801  ? 226.748 242.766 364.470 1.00 223.74 ? 801  PHE D N     1 
ATOM   4617  C  CA    . PHE B  2  801  ? 227.449 243.947 364.953 1.00 218.18 ? 801  PHE D CA    1 
ATOM   4618  C  C     . PHE B  2  801  ? 226.578 244.796 365.876 1.00 218.84 ? 801  PHE D C     1 
ATOM   4619  O  O     . PHE B  2  801  ? 227.069 245.349 366.860 1.00 219.53 ? 801  PHE D O     1 
ATOM   4620  N  N     . ALA B  2  802  ? 225.292 244.904 365.552 1.00 193.29 ? 802  ALA D N     1 
ATOM   4621  C  CA    . ALA B  2  802  ? 224.374 245.686 366.380 1.00 194.48 ? 802  ALA D CA    1 
ATOM   4622  C  C     . ALA B  2  802  ? 224.293 245.140 367.810 1.00 204.90 ? 802  ALA D C     1 
ATOM   4623  O  O     . ALA B  2  802  ? 224.255 245.903 368.779 1.00 205.86 ? 802  ALA D O     1 
ATOM   4624  N  N     . ASP B  2  803  ? 224.296 243.813 367.927 1.00 217.95 ? 803  ASP D N     1 
ATOM   4625  C  CA    . ASP B  2  803  ? 224.174 243.130 369.213 1.00 229.82 ? 803  ASP D CA    1 
ATOM   4626  C  C     . ASP B  2  803  ? 225.523 242.994 369.915 1.00 231.65 ? 803  ASP D C     1 
ATOM   4627  O  O     . ASP B  2  803  ? 225.624 242.358 370.965 1.00 240.91 ? 803  ASP D O     1 
ATOM   4628  N  N     . LYS B  2  804  ? 226.555 243.571 369.305 1.00 238.58 ? 804  LYS D N     1 
ATOM   4629  C  CA    . LYS B  2  804  ? 227.890 243.654 369.898 1.00 237.78 ? 804  LYS D CA    1 
ATOM   4630  C  C     . LYS B  2  804  ? 228.576 242.311 370.137 1.00 245.77 ? 804  LYS D C     1 
ATOM   4631  O  O     . LYS B  2  804  ? 229.221 242.118 371.165 1.00 249.77 ? 804  LYS D O     1 
ATOM   4632  N  N     . HIS B  2  805  ? 228.438 241.378 369.202 1.00 210.08 ? 805  HIS D N     1 
ATOM   4633  C  CA    . HIS B  2  805  ? 229.186 240.129 369.284 1.00 216.86 ? 805  HIS D CA    1 
ATOM   4634  C  C     . HIS B  2  805  ? 230.492 240.202 368.500 1.00 209.97 ? 805  HIS D C     1 
ATOM   4635  O  O     . HIS B  2  805  ? 231.320 239.298 368.568 1.00 214.30 ? 805  HIS D O     1 
ATOM   4636  N  N     . ILE B  2  806  ? 230.667 241.283 367.747 1.00 250.61 ? 806  ILE D N     1 
ATOM   4637  C  CA    . ILE B  2  806  ? 231.915 241.529 367.031 1.00 243.54 ? 806  ILE D CA    1 
ATOM   4638  C  C     . ILE B  2  806  ? 232.368 242.968 367.247 1.00 234.83 ? 806  ILE D C     1 
ATOM   4639  O  O     . ILE B  2  806  ? 231.685 243.912 366.846 1.00 229.13 ? 806  ILE D O     1 
ATOM   4640  N  N     . GLN B  2  807  ? 233.520 243.131 367.883 1.00 240.30 ? 807  GLN D N     1 
ATOM   4641  C  CA    . GLN B  2  807  ? 234.022 244.464 368.207 1.00 234.02 ? 807  GLN D CA    1 
ATOM   4642  C  C     . GLN B  2  807  ? 235.016 245.003 367.177 1.00 228.61 ? 807  GLN D C     1 
ATOM   4643  O  O     . GLN B  2  807  ? 235.515 246.124 367.313 1.00 224.70 ? 807  GLN D O     1 
ATOM   4644  N  N     . VAL B  2  808  ? 235.309 244.203 366.155 1.00 241.95 ? 808  VAL D N     1 
ATOM   4645  C  CA    . VAL B  2  808  ? 236.168 244.639 365.057 1.00 237.11 ? 808  VAL D CA    1 
ATOM   4646  C  C     . VAL B  2  808  ? 235.528 244.268 363.719 1.00 235.40 ? 808  VAL D C     1 
ATOM   4647  O  O     . VAL B  2  808  ? 235.311 243.090 363.436 1.00 239.20 ? 808  VAL D O     1 
ATOM   4648  N  N     . LEU B  2  809  ? 235.206 245.273 362.909 1.00 201.76 ? 809  LEU D N     1 
ATOM   4649  C  CA    . LEU B  2  809  ? 234.599 245.039 361.600 1.00 199.58 ? 809  LEU D CA    1 
ATOM   4650  C  C     . LEU B  2  809  ? 235.248 245.926 360.548 1.00 193.69 ? 809  LEU D C     1 
ATOM   4651  O  O     . LEU B  2  809  ? 235.197 247.149 360.648 1.00 189.83 ? 809  LEU D O     1 
ATOM   4652  N  N     . VAL B  2  810  ? 235.849 245.313 359.537 1.00 205.52 ? 810  VAL D N     1 
ATOM   4653  C  CA    . VAL B  2  810  ? 236.450 246.064 358.440 1.00 200.36 ? 810  VAL D CA    1 
ATOM   4654  C  C     . VAL B  2  810  ? 235.543 245.999 357.196 1.00 198.02 ? 810  VAL D C     1 
ATOM   4655  O  O     . VAL B  2  810  ? 235.034 244.932 356.855 1.00 201.01 ? 810  VAL D O     1 
ATOM   4656  N  N     . SER B  2  811  ? 235.324 247.142 356.540 1.00 195.24 ? 811  SER D N     1 
ATOM   4657  C  CA    . SER B  2  811  ? 234.294 247.253 355.496 1.00 193.46 ? 811  SER D CA    1 
ATOM   4658  C  C     . SER B  2  811  ? 234.556 248.333 354.434 1.00 191.06 ? 811  SER D C     1 
ATOM   4659  O  O     . SER B  2  811  ? 235.671 248.827 354.293 1.00 190.13 ? 811  SER D O     1 
ATOM   4660  N  N     . THR B  2  812  ? 233.517 248.664 353.669 1.00 165.22 ? 812  THR D N     1 
ATOM   4661  C  CA    . THR B  2  812  ? 233.583 249.674 352.607 1.00 163.18 ? 812  THR D CA    1 
ATOM   4662  C  C     . THR B  2  812  ? 232.584 250.810 352.836 1.00 162.82 ? 812  THR D C     1 
ATOM   4663  O  O     . THR B  2  812  ? 231.712 250.707 353.691 1.00 164.18 ? 812  THR D O     1 
ATOM   4664  N  N     . ALA B  2  813  ? 232.733 251.900 352.088 1.00 158.15 ? 813  ALA D N     1 
ATOM   4665  C  CA    . ALA B  2  813  ? 231.839 253.062 352.191 1.00 157.81 ? 813  ALA D CA    1 
ATOM   4666  C  C     . ALA B  2  813  ? 230.336 252.781 351.945 1.00 158.78 ? 813  ALA D C     1 
ATOM   4667  O  O     . ALA B  2  813  ? 229.453 253.510 352.436 1.00 159.28 ? 813  ALA D O     1 
ATOM   4668  N  N     . THR B  2  814  ? 230.036 251.727 351.190 1.00 185.71 ? 814  THR D N     1 
ATOM   4669  C  CA    . THR B  2  814  ? 228.644 251.377 350.925 1.00 186.93 ? 814  THR D CA    1 
ATOM   4670  C  C     . THR B  2  814  ? 227.939 250.892 352.186 1.00 188.84 ? 814  THR D C     1 
ATOM   4671  O  O     . THR B  2  814  ? 226.714 250.824 352.229 1.00 190.08 ? 814  THR D O     1 
ATOM   4672  N  N     . LEU B  2  815  ? 228.718 250.545 353.206 1.00 162.85 ? 815  LEU D N     1 
ATOM   4673  C  CA    . LEU B  2  815  ? 228.153 250.133 354.480 1.00 164.78 ? 815  LEU D CA    1 
ATOM   4674  C  C     . LEU B  2  815  ? 227.691 251.370 355.246 1.00 164.80 ? 815  LEU D C     1 
ATOM   4675  O  O     . LEU B  2  815  ? 226.684 251.337 355.950 1.00 166.37 ? 815  LEU D O     1 
ATOM   4676  N  N     . ALA B  2  816  ? 228.426 252.465 355.100 1.00 163.20 ? 816  ALA D N     1 
ATOM   4677  C  CA    . ALA B  2  816  ? 228.057 253.708 355.757 1.00 163.20 ? 816  ALA D CA    1 
ATOM   4678  C  C     . ALA B  2  816  ? 226.877 254.341 355.032 1.00 163.06 ? 816  ALA D C     1 
ATOM   4679  O  O     . ALA B  2  816  ? 225.979 254.897 355.660 1.00 164.10 ? 816  ALA D O     1 
ATOM   4680  N  N     . TRP B  2  817  ? 226.885 254.246 353.706 1.00 166.31 ? 817  TRP D N     1 
ATOM   4681  C  CA    . TRP B  2  817  ? 225.806 254.818 352.906 1.00 166.38 ? 817  TRP D CA    1 
ATOM   4682  C  C     . TRP B  2  817  ? 224.506 253.980 352.888 1.00 168.34 ? 817  TRP D C     1 
ATOM   4683  O  O     . TRP B  2  817  ? 223.418 254.498 352.601 1.00 169.10 ? 817  TRP D O     1 
ATOM   4684  N  N     . GLY B  2  818  ? 224.628 252.692 353.194 1.00 200.60 ? 818  GLY D N     1 
ATOM   4685  C  CA    . GLY B  2  818  ? 223.500 251.772 353.182 1.00 202.63 ? 818  GLY D CA    1 
ATOM   4686  C  C     . GLY B  2  818  ? 222.778 251.785 354.515 1.00 204.49 ? 818  GLY D C     1 
ATOM   4687  O  O     . GLY B  2  818  ? 222.678 252.836 355.155 1.00 204.31 ? 818  GLY D O     1 
ATOM   4688  N  N     . VAL B  2  819  ? 222.253 250.627 354.916 1.00 216.95 ? 819  VAL D N     1 
ATOM   4689  C  CA    . VAL B  2  819  ? 221.569 250.483 356.203 1.00 219.00 ? 819  VAL D CA    1 
ATOM   4690  C  C     . VAL B  2  819  ? 222.432 251.038 357.343 1.00 218.48 ? 819  VAL D C     1 
ATOM   4691  O  O     . VAL B  2  819  ? 223.655 250.874 357.350 1.00 217.23 ? 819  VAL D O     1 
ATOM   4692  N  N     . ASN B  2  820  ? 221.780 251.709 358.292 1.00 216.71 ? 820  ASN D N     1 
ATOM   4693  C  CA    . ASN B  2  820  ? 222.457 252.515 359.307 1.00 216.33 ? 820  ASN D CA    1 
ATOM   4694  C  C     . ASN B  2  820  ? 222.790 251.731 360.580 1.00 218.02 ? 820  ASN D C     1 
ATOM   4695  O  O     . ASN B  2  820  ? 221.897 251.338 361.338 1.00 220.23 ? 820  ASN D O     1 
ATOM   4696  N  N     . LEU B  2  821  ? 224.083 251.512 360.801 1.00 174.00 ? 821  LEU D N     1 
ATOM   4697  C  CA    . LEU B  2  821  ? 224.578 251.096 362.103 1.00 175.59 ? 821  LEU D CA    1 
ATOM   4698  C  C     . LEU B  2  821  ? 225.844 251.882 362.362 1.00 174.23 ? 821  LEU D C     1 
ATOM   4699  O  O     . LEU B  2  821  ? 226.655 252.060 361.448 1.00 172.21 ? 821  LEU D O     1 
ATOM   4700  N  N     . PRO B  2  822  ? 226.008 252.368 363.604 1.00 175.50 ? 822  PRO D N     1 
ATOM   4701  C  CA    . PRO B  2  822  ? 227.217 253.072 364.049 1.00 174.80 ? 822  PRO D CA    1 
ATOM   4702  C  C     . PRO B  2  822  ? 228.244 252.146 364.700 1.00 175.97 ? 822  PRO D C     1 
ATOM   4703  O  O     . PRO B  2  822  ? 228.003 250.945 364.847 1.00 178.68 ? 822  PRO D O     1 
ATOM   4704  N  N     . ALA B  2  823  ? 229.374 252.724 365.095 1.00 184.80 ? 823  ALA D N     1 
ATOM   4705  C  CA    . ALA B  2  823  ? 230.423 252.010 365.816 1.00 187.31 ? 823  ALA D CA    1 
ATOM   4706  C  C     . ALA B  2  823  ? 231.057 252.960 366.821 1.00 187.03 ? 823  ALA D C     1 
ATOM   4707  O  O     . ALA B  2  823  ? 231.206 254.149 366.534 1.00 185.55 ? 823  ALA D O     1 
ATOM   4708  N  N     . HIS B  2  824  ? 231.426 252.437 367.991 1.00 198.34 ? 824  HIS D N     1 
ATOM   4709  C  CA    . HIS B  2  824  ? 232.039 253.250 369.049 1.00 198.62 ? 824  HIS D CA    1 
ATOM   4710  C  C     . HIS B  2  824  ? 233.188 254.097 368.509 1.00 196.08 ? 824  HIS D C     1 
ATOM   4711  O  O     . HIS B  2  824  ? 233.256 255.301 368.758 1.00 195.72 ? 824  HIS D O     1 
ATOM   4712  N  N     . THR B  2  825  ? 234.090 253.457 367.776 1.00 193.97 ? 825  THR D N     1 
ATOM   4713  C  CA    . THR B  2  825  ? 235.151 254.192 367.109 1.00 192.12 ? 825  THR D CA    1 
ATOM   4714  C  C     . THR B  2  825  ? 235.433 253.641 365.713 1.00 189.84 ? 825  THR D C     1 
ATOM   4715  O  O     . THR B  2  825  ? 235.567 252.435 365.516 1.00 190.43 ? 825  THR D O     1 
ATOM   4716  N  N     . VAL B  2  826  ? 235.504 254.536 364.738 1.00 183.07 ? 826  VAL D N     1 
ATOM   4717  C  CA    . VAL B  2  826  ? 235.753 254.127 363.370 1.00 180.91 ? 826  VAL D CA    1 
ATOM   4718  C  C     . VAL B  2  826  ? 237.112 254.633 362.904 1.00 179.82 ? 826  VAL D C     1 
ATOM   4719  O  O     . VAL B  2  826  ? 237.606 255.656 363.388 1.00 180.02 ? 826  VAL D O     1 
ATOM   4720  N  N     . ILE B  2  827  ? 237.714 253.890 361.983 1.00 206.72 ? 827  ILE D N     1 
ATOM   4721  C  CA    . ILE B  2  827  ? 239.049 254.201 361.489 1.00 205.85 ? 827  ILE D CA    1 
ATOM   4722  C  C     . ILE B  2  827  ? 239.133 254.111 359.953 1.00 203.39 ? 827  ILE D C     1 
ATOM   4723  O  O     . ILE B  2  827  ? 238.932 253.050 359.361 1.00 203.24 ? 827  ILE D O     1 
ATOM   4724  N  N     . ILE B  2  828  ? 239.429 255.245 359.327 1.00 163.34 ? 828  ILE D N     1 
ATOM   4725  C  CA    . ILE B  2  828  ? 239.437 255.380 357.876 1.00 161.11 ? 828  ILE D CA    1 
ATOM   4726  C  C     . ILE B  2  828  ? 240.832 255.126 357.331 1.00 160.79 ? 828  ILE D C     1 
ATOM   4727  O  O     . ILE B  2  828  ? 241.727 255.942 357.513 1.00 160.79 ? 828  ILE D O     1 
ATOM   4728  N  N     . LYS B  2  829  ? 241.024 254.027 356.620 1.00 160.61 ? 829  LYS D N     1 
ATOM   4729  C  CA    . LYS B  2  829  ? 242.369 253.697 356.197 1.00 160.67 ? 829  LYS D CA    1 
ATOM   4730  C  C     . LYS B  2  829  ? 242.684 254.259 354.808 1.00 158.49 ? 829  LYS D C     1 
ATOM   4731  O  O     . LYS B  2  829  ? 242.188 253.791 353.789 1.00 157.39 ? 829  LYS D O     1 
ATOM   4732  N  N     . GLY B  2  830  ? 243.530 255.279 354.800 1.00 184.17 ? 830  GLY D N     1 
ATOM   4733  C  CA    . GLY B  2  830  ? 244.167 255.792 353.599 1.00 182.55 ? 830  GLY D CA    1 
ATOM   4734  C  C     . GLY B  2  830  ? 243.518 256.910 352.802 1.00 180.63 ? 830  GLY D C     1 
ATOM   4735  O  O     . GLY B  2  830  ? 244.231 257.682 352.153 1.00 179.72 ? 830  GLY D O     1 
ATOM   4736  N  N     . THR B  2  831  ? 242.194 257.023 352.849 1.00 154.17 ? 831  THR D N     1 
ATOM   4737  C  CA    . THR B  2  831  ? 241.474 258.120 352.180 1.00 152.69 ? 831  THR D CA    1 
ATOM   4738  C  C     . THR B  2  831  ? 241.611 258.196 350.645 1.00 151.08 ? 831  THR D C     1 
ATOM   4739  O  O     . THR B  2  831  ? 240.967 259.030 350.005 1.00 150.02 ? 831  THR D O     1 
ATOM   4740  N  N     . GLN B  2  832  ? 242.460 257.364 350.054 1.00 155.46 ? 832  GLN D N     1 
ATOM   4741  C  CA    . GLN B  2  832  ? 242.682 257.444 348.620 1.00 154.11 ? 832  GLN D CA    1 
ATOM   4742  C  C     . GLN B  2  832  ? 241.930 256.318 347.947 1.00 154.08 ? 832  GLN D C     1 
ATOM   4743  O  O     . GLN B  2  832  ? 241.853 255.222 348.492 1.00 155.22 ? 832  GLN D O     1 
ATOM   4744  N  N     . VAL B  2  833  ? 241.356 256.597 346.777 1.00 168.79 ? 833  VAL D N     1 
ATOM   4745  C  CA    . VAL B  2  833  ? 240.596 255.604 346.013 1.00 168.85 ? 833  VAL D CA    1 
ATOM   4746  C  C     . VAL B  2  833  ? 241.060 255.597 344.567 1.00 167.95 ? 833  VAL D C     1 
ATOM   4747  O  O     . VAL B  2  833  ? 241.882 256.428 344.179 1.00 167.22 ? 833  VAL D O     1 
ATOM   4748  N  N     . TYR B  2  834  ? 240.519 254.680 343.765 1.00 148.02 ? 834  TYR D N     1 
ATOM   4749  C  CA    . TYR B  2  834  ? 240.851 254.626 342.343 1.00 147.38 ? 834  TYR D CA    1 
ATOM   4750  C  C     . TYR B  2  834  ? 239.723 255.145 341.463 1.00 146.94 ? 834  TYR D C     1 
ATOM   4751  O  O     . TYR B  2  834  ? 238.632 254.596 341.467 1.00 147.60 ? 834  TYR D O     1 
ATOM   4752  N  N     . SER B  2  835  ? 239.994 256.194 340.699 1.00 146.04 ? 835  SER D N     1 
ATOM   4753  C  CA    . SER B  2  835  ? 238.957 256.812 339.885 1.00 145.82 ? 835  SER D CA    1 
ATOM   4754  C  C     . SER B  2  835  ? 239.141 256.501 338.400 1.00 145.73 ? 835  SER D C     1 
ATOM   4755  O  O     . SER B  2  835  ? 240.004 257.081 337.745 1.00 145.09 ? 835  SER D O     1 
ATOM   4756  N  N     . PRO B  2  836  ? 238.303 255.605 337.854 1.00 146.56 ? 836  PRO D N     1 
ATOM   4757  C  CA    . PRO B  2  836  ? 238.436 255.217 336.446 1.00 146.76 ? 836  PRO D CA    1 
ATOM   4758  C  C     . PRO B  2  836  ? 238.045 256.375 335.548 1.00 146.39 ? 836  PRO D C     1 
ATOM   4759  O  O     . PRO B  2  836  ? 238.440 256.435 334.388 1.00 146.36 ? 836  PRO D O     1 
ATOM   4760  N  N     . GLU B  2  837  ? 237.257 257.288 336.099 1.00 154.34 ? 837  GLU D N     1 
ATOM   4761  C  CA    . GLU B  2  837  ? 236.847 258.489 335.388 1.00 154.19 ? 837  GLU D CA    1 
ATOM   4762  C  C     . GLU B  2  837  ? 238.050 259.425 335.232 1.00 153.15 ? 837  GLU D C     1 
ATOM   4763  O  O     . GLU B  2  837  ? 238.225 260.074 334.200 1.00 153.04 ? 837  GLU D O     1 
ATOM   4764  N  N     . LYS B  2  838  ? 238.876 259.477 336.271 1.00 151.85 ? 838  LYS D N     1 
ATOM   4765  C  CA    . LYS B  2  838  ? 240.061 260.323 336.280 1.00 151.10 ? 838  LYS D CA    1 
ATOM   4766  C  C     . LYS B  2  838  ? 241.295 259.571 335.761 1.00 151.02 ? 838  LYS D C     1 
ATOM   4767  O  O     . LYS B  2  838  ? 242.351 260.175 335.529 1.00 150.55 ? 838  LYS D O     1 
ATOM   4768  N  N     . GLY B  2  839  ? 241.155 258.256 335.591 1.00 144.70 ? 839  GLY D N     1 
ATOM   4769  C  CA    . GLY B  2  839  ? 242.229 257.414 335.083 1.00 144.86 ? 839  GLY D CA    1 
ATOM   4770  C  C     . GLY B  2  839  ? 243.322 257.072 336.083 1.00 144.84 ? 839  GLY D C     1 
ATOM   4771  O  O     . GLY B  2  839  ? 244.226 256.295 335.783 1.00 145.18 ? 839  GLY D O     1 
ATOM   4772  N  N     . ARG B  2  840  ? 243.231 257.631 337.283 1.00 155.88 ? 840  ARG D N     1 
ATOM   4773  C  CA    . ARG B  2  840  ? 244.291 257.520 338.278 1.00 156.11 ? 840  ARG D CA    1 
ATOM   4774  C  C     . ARG B  2  840  ? 243.707 257.340 339.673 1.00 156.53 ? 840  ARG D C     1 
ATOM   4775  O  O     . ARG B  2  840  ? 242.505 257.158 339.824 1.00 156.72 ? 840  ARG D O     1 
ATOM   4776  N  N     . TRP B  2  841  ? 244.559 257.391 340.694 1.00 145.09 ? 841  TRP D N     1 
ATOM   4777  C  CA    . TRP B  2  841  ? 244.079 257.409 342.075 1.00 145.61 ? 841  TRP D CA    1 
ATOM   4778  C  C     . TRP B  2  841  ? 243.818 258.844 342.527 1.00 145.11 ? 841  TRP D C     1 
ATOM   4779  O  O     . TRP B  2  841  ? 244.517 259.762 342.093 1.00 144.61 ? 841  TRP D O     1 
ATOM   4780  N  N     . THR B  2  842  ? 242.794 259.037 343.357 1.00 157.36 ? 842  THR D N     1 
ATOM   4781  C  CA    . THR B  2  842  ? 242.549 260.323 344.014 1.00 157.22 ? 842  THR D CA    1 
ATOM   4782  C  C     . THR B  2  842  ? 241.879 260.152 345.367 1.00 158.07 ? 842  THR D C     1 
ATOM   4783  O  O     . THR B  2  842  ? 241.107 259.214 345.572 1.00 158.56 ? 842  THR D O     1 
ATOM   4784  N  N     . GLU B  2  843  ? 242.171 261.081 346.273 1.00 168.02 ? 843  GLU D N     1 
ATOM   4785  C  CA    . GLU B  2  843  ? 241.555 261.128 347.596 1.00 168.95 ? 843  GLU D CA    1 
ATOM   4786  C  C     . GLU B  2  843  ? 240.039 261.130 347.472 1.00 168.88 ? 843  GLU D C     1 
ATOM   4787  O  O     . GLU B  2  843  ? 239.486 261.827 346.621 1.00 168.17 ? 843  GLU D O     1 
ATOM   4788  N  N     . LEU B  2  844  ? 239.367 260.361 348.328 1.00 148.10 ? 844  LEU D N     1 
ATOM   4789  C  CA    . LEU B  2  844  ? 237.915 260.224 348.227 1.00 148.31 ? 844  LEU D CA    1 
ATOM   4790  C  C     . LEU B  2  844  ? 237.166 261.519 348.531 1.00 148.28 ? 844  LEU D C     1 
ATOM   4791  O  O     . LEU B  2  844  ? 237.722 262.454 349.119 1.00 148.32 ? 844  LEU D O     1 
ATOM   4792  N  N     . GLY B  2  845  ? 235.914 261.569 348.076 1.00 177.99 ? 845  GLY D N     1 
ATOM   4793  C  CA    . GLY B  2  845  ? 235.117 262.782 348.094 1.00 178.02 ? 845  GLY D CA    1 
ATOM   4794  C  C     . GLY B  2  845  ? 234.779 263.293 349.478 1.00 178.99 ? 845  GLY D C     1 
ATOM   4795  O  O     . GLY B  2  845  ? 235.012 262.614 350.478 1.00 179.80 ? 845  GLY D O     1 
ATOM   4796  N  N     . ALA B  2  846  ? 234.231 264.502 349.534 1.00 149.46 ? 846  ALA D N     1 
ATOM   4797  C  CA    . ALA B  2  846  ? 233.832 265.101 350.794 1.00 150.51 ? 846  ALA D CA    1 
ATOM   4798  C  C     . ALA B  2  846  ? 232.767 264.241 351.464 1.00 151.69 ? 846  ALA D C     1 
ATOM   4799  O  O     . ALA B  2  846  ? 232.897 263.850 352.631 1.00 152.66 ? 846  ALA D O     1 
ATOM   4800  N  N     . LEU B  2  847  ? 231.727 263.927 350.701 1.00 152.79 ? 847  LEU D N     1 
ATOM   4801  C  CA    . LEU B  2  847  ? 230.558 263.258 351.251 1.00 154.10 ? 847  LEU D CA    1 
ATOM   4802  C  C     . LEU B  2  847  ? 230.877 261.841 351.723 1.00 154.55 ? 847  LEU D C     1 
ATOM   4803  O  O     . LEU B  2  847  ? 230.207 261.322 352.612 1.00 155.87 ? 847  LEU D O     1 
ATOM   4804  N  N     . ASP B  2  848  ? 231.894 261.220 351.132 1.00 153.51 ? 848  ASP D N     1 
ATOM   4805  C  CA    . ASP B  2  848  ? 232.268 259.856 351.503 1.00 154.05 ? 848  ASP D CA    1 
ATOM   4806  C  C     . ASP B  2  848  ? 232.829 259.788 352.923 1.00 154.98 ? 848  ASP D C     1 
ATOM   4807  O  O     . ASP B  2  848  ? 232.370 258.984 353.747 1.00 156.31 ? 848  ASP D O     1 
ATOM   4808  N  N     . ILE B  2  849  ? 233.813 260.633 353.221 1.00 153.62 ? 849  ILE D N     1 
ATOM   4809  C  CA    . ILE B  2  849  ? 234.310 260.698 354.591 1.00 154.78 ? 849  ILE D CA    1 
ATOM   4810  C  C     . ILE B  2  849  ? 233.218 261.200 355.507 1.00 156.00 ? 849  ILE D C     1 
ATOM   4811  O  O     . ILE B  2  849  ? 232.920 260.557 356.495 1.00 157.45 ? 849  ILE D O     1 
ATOM   4812  N  N     . LEU B  2  850  ? 232.612 262.335 355.164 1.00 155.56 ? 850  LEU D N     1 
ATOM   4813  C  CA    . LEU B  2  850  ? 231.589 262.925 356.019 1.00 156.83 ? 850  LEU D CA    1 
ATOM   4814  C  C     . LEU B  2  850  ? 230.568 261.881 356.459 1.00 158.14 ? 850  LEU D C     1 
ATOM   4815  O  O     . LEU B  2  850  ? 230.204 261.813 357.630 1.00 159.68 ? 850  LEU D O     1 
ATOM   4816  N  N     . GLN B  2  851  ? 230.146 261.048 355.512 1.00 159.50 ? 851  GLN D N     1 
ATOM   4817  C  CA    . GLN B  2  851  ? 229.199 259.969 355.784 1.00 160.77 ? 851  GLN D CA    1 
ATOM   4818  C  C     . GLN B  2  851  ? 229.795 258.879 356.681 1.00 161.76 ? 851  GLN D C     1 
ATOM   4819  O  O     . GLN B  2  851  ? 229.155 258.451 357.646 1.00 163.46 ? 851  GLN D O     1 
ATOM   4820  N  N     . MET B  2  852  ? 231.010 258.430 356.367 1.00 159.27 ? 852  MET D N     1 
ATOM   4821  C  CA    . MET B  2  852  ? 231.564 257.266 357.067 1.00 160.34 ? 852  MET D CA    1 
ATOM   4822  C  C     . MET B  2  852  ? 232.117 257.584 358.457 1.00 161.65 ? 852  MET D C     1 
ATOM   4823  O  O     . MET B  2  852  ? 232.215 256.705 359.311 1.00 163.21 ? 852  MET D O     1 
ATOM   4824  N  N     . LEU B  2  853  ? 232.494 258.838 358.668 1.00 160.97 ? 853  LEU D N     1 
ATOM   4825  C  CA    . LEU B  2  853  ? 233.010 259.314 359.944 1.00 162.31 ? 853  LEU D CA    1 
ATOM   4826  C  C     . LEU B  2  853  ? 231.878 259.899 360.776 1.00 163.61 ? 853  LEU D C     1 
ATOM   4827  O  O     . LEU B  2  853  ? 232.019 260.140 361.971 1.00 165.22 ? 853  LEU D O     1 
ATOM   4828  N  N     . GLY B  2  854  ? 230.741 260.111 360.127 1.00 186.74 ? 854  GLY D N     1 
ATOM   4829  C  CA    . GLY B  2  854  ? 229.544 260.553 360.809 1.00 188.15 ? 854  GLY D CA    1 
ATOM   4830  C  C     . GLY B  2  854  ? 228.801 259.328 361.297 1.00 189.76 ? 854  GLY D C     1 
ATOM   4831  O  O     . GLY B  2  854  ? 227.673 259.408 361.781 1.00 191.10 ? 854  GLY D O     1 
ATOM   4832  N  N     . ARG B  2  855  ? 229.448 258.180 361.136 1.00 174.77 ? 855  ARG D N     1 
ATOM   4833  C  CA    . ARG B  2  855  ? 228.952 256.918 361.650 1.00 176.43 ? 855  ARG D CA    1 
ATOM   4834  C  C     . ARG B  2  855  ? 229.618 256.626 363.002 1.00 178.24 ? 855  ARG D C     1 
ATOM   4835  O  O     . ARG B  2  855  ? 229.358 255.596 363.626 1.00 179.97 ? 855  ARG D O     1 
ATOM   4836  N  N     . ALA B  2  856  ? 230.467 257.548 363.449 1.00 169.30 ? 856  ALA D N     1 
ATOM   4837  C  CA    . ALA B  2  856  ? 231.278 257.332 364.645 1.00 171.09 ? 856  ALA D CA    1 
ATOM   4838  C  C     . ALA B  2  856  ? 230.509 257.567 365.941 1.00 173.42 ? 856  ALA D C     1 
ATOM   4839  O  O     . ALA B  2  856  ? 230.057 258.680 366.217 1.00 173.50 ? 856  ALA D O     1 
ATOM   4840  N  N     . GLY B  2  857  ? 230.394 256.509 366.735 1.00 200.45 ? 857  GLY D N     1 
ATOM   4841  C  CA    . GLY B  2  857  ? 229.711 256.553 368.018 1.00 203.04 ? 857  GLY D CA    1 
ATOM   4842  C  C     . GLY B  2  857  ? 228.249 256.178 367.885 1.00 203.62 ? 857  GLY D C     1 
ATOM   4843  O  O     . GLY B  2  857  ? 227.603 256.515 366.897 1.00 201.98 ? 857  GLY D O     1 
ATOM   4844  N  N     . ARG B  2  858  ? 227.716 255.498 368.893 1.00 198.09 ? 858  ARG D N     1 
ATOM   4845  C  CA    . ARG B  2  858  ? 226.313 255.105 368.880 1.00 200.76 ? 858  ARG D CA    1 
ATOM   4846  C  C     . ARG B  2  858  ? 225.448 256.168 369.553 1.00 201.77 ? 858  ARG D C     1 
ATOM   4847  O  O     . ARG B  2  858  ? 225.909 256.853 370.459 1.00 202.69 ? 858  ARG D O     1 
ATOM   4848  N  N     . PRO B  2  859  ? 224.200 256.333 369.091 1.00 183.09 ? 859  PRO D N     1 
ATOM   4849  C  CA    . PRO B  2  859  ? 223.274 257.264 369.743 1.00 184.45 ? 859  PRO D CA    1 
ATOM   4850  C  C     . PRO B  2  859  ? 222.803 256.741 371.101 1.00 187.65 ? 859  PRO D C     1 
ATOM   4851  O  O     . PRO B  2  859  ? 222.460 257.524 371.990 1.00 189.21 ? 859  PRO D O     1 
ATOM   4852  N  N     . GLN B  2  860  ? 222.794 255.421 371.248 1.00 245.97 ? 860  GLN D N     1 
ATOM   4853  C  CA    . GLN B  2  860  ? 222.209 254.766 372.412 1.00 252.55 ? 860  GLN D CA    1 
ATOM   4854  C  C     . GLN B  2  860  ? 223.261 254.240 373.382 1.00 255.70 ? 860  GLN D C     1 
ATOM   4855  O  O     . GLN B  2  860  ? 223.359 254.703 374.519 1.00 258.63 ? 860  GLN D O     1 
ATOM   4856  N  N     . TYR B  2  861  ? 224.054 253.278 372.921 1.00 216.91 ? 861  TYR D N     1 
ATOM   4857  C  CA    . TYR B  2  861  ? 224.947 252.526 373.798 1.00 220.58 ? 861  TYR D CA    1 
ATOM   4858  C  C     . TYR B  2  861  ? 226.250 253.268 374.077 1.00 217.37 ? 861  TYR D C     1 
ATOM   4859  O  O     . TYR B  2  861  ? 227.135 252.747 374.757 1.00 219.60 ? 861  TYR D O     1 
ATOM   4860  N  N     . ASP B  2  862  ? 226.375 254.483 373.551 1.00 229.19 ? 862  ASP D N     1 
ATOM   4861  C  CA    . ASP B  2  862  ? 227.643 255.200 373.623 1.00 225.70 ? 862  ASP D CA    1 
ATOM   4862  C  C     . ASP B  2  862  ? 227.585 256.490 374.442 1.00 225.54 ? 862  ASP D C     1 
ATOM   4863  O  O     . ASP B  2  862  ? 226.526 257.106 374.581 1.00 226.39 ? 862  ASP D O     1 
ATOM   4864  N  N     . THR B  2  863  ? 228.740 256.877 374.979 1.00 218.31 ? 863  THR D N     1 
ATOM   4865  C  CA    . THR B  2  863  ? 228.911 258.145 375.688 1.00 217.74 ? 863  THR D CA    1 
ATOM   4866  C  C     . THR B  2  863  ? 229.384 259.226 374.722 1.00 212.46 ? 863  THR D C     1 
ATOM   4867  O  O     . THR B  2  863  ? 228.708 260.235 374.520 1.00 211.70 ? 863  THR D O     1 
ATOM   4868  N  N     . LYS B  2  864  ? 230.569 259.018 374.155 1.00 209.48 ? 864  LYS D N     1 
ATOM   4869  C  CA    . LYS B  2  864  ? 231.096 259.885 373.108 1.00 206.60 ? 864  LYS D CA    1 
ATOM   4870  C  C     . LYS B  2  864  ? 231.784 259.033 372.041 1.00 204.53 ? 864  LYS D C     1 
ATOM   4871  O  O     . LYS B  2  864  ? 232.360 257.990 372.354 1.00 205.73 ? 864  LYS D O     1 
ATOM   4872  N  N     . GLY B  2  865  ? 231.699 259.455 370.781 1.00 184.44 ? 865  GLY D N     1 
ATOM   4873  C  CA    . GLY B  2  865  ? 232.414 258.783 369.710 1.00 182.41 ? 865  GLY D CA    1 
ATOM   4874  C  C     . GLY B  2  865  ? 233.765 259.408 369.386 1.00 181.36 ? 865  GLY D C     1 
ATOM   4875  O  O     . GLY B  2  865  ? 233.982 260.594 369.604 1.00 181.29 ? 865  GLY D O     1 
ATOM   4876  N  N     . GLU B  2  866  ? 234.674 258.599 368.851 1.00 185.28 ? 866  GLU D N     1 
ATOM   4877  C  CA    . GLU B  2  866  ? 235.945 259.090 368.340 1.00 184.12 ? 866  GLU D CA    1 
ATOM   4878  C  C     . GLU B  2  866  ? 236.061 258.648 366.892 1.00 181.44 ? 866  GLU D C     1 
ATOM   4879  O  O     . GLU B  2  866  ? 235.355 257.744 366.466 1.00 181.02 ? 866  GLU D O     1 
ATOM   4880  N  N     . GLY B  2  867  ? 236.964 259.254 366.133 1.00 183.63 ? 867  GLY D N     1 
ATOM   4881  C  CA    . GLY B  2  867  ? 237.243 258.718 364.814 1.00 181.43 ? 867  GLY D CA    1 
ATOM   4882  C  C     . GLY B  2  867  ? 238.665 259.010 364.396 1.00 180.82 ? 867  GLY D C     1 
ATOM   4883  O  O     . GLY B  2  867  ? 239.240 260.015 364.803 1.00 181.30 ? 867  GLY D O     1 
ATOM   4884  N  N     . ILE B  2  868  ? 239.225 258.141 363.560 1.00 188.33 ? 868  ILE D N     1 
ATOM   4885  C  CA    . ILE B  2  868  ? 240.638 258.235 363.212 1.00 188.09 ? 868  ILE D CA    1 
ATOM   4886  C  C     . ILE B  2  868  ? 240.816 258.204 361.711 1.00 185.49 ? 868  ILE D C     1 
ATOM   4887  O  O     . ILE B  2  868  ? 240.527 257.199 361.065 1.00 184.85 ? 868  ILE D O     1 
ATOM   4888  N  N     . LEU B  2  869  ? 241.310 259.300 361.158 1.00 164.56 ? 869  LEU D N     1 
ATOM   4889  C  CA    . LEU B  2  869  ? 241.541 259.378 359.731 1.00 162.26 ? 869  LEU D CA    1 
ATOM   4890  C  C     . LEU B  2  869  ? 243.018 259.237 359.451 1.00 162.50 ? 869  LEU D C     1 
ATOM   4891  O  O     . LEU B  2  869  ? 243.794 260.115 359.798 1.00 163.07 ? 869  LEU D O     1 
ATOM   4892  N  N     . ILE B  2  870  ? 243.417 258.127 358.843 1.00 162.26 ? 870  ILE D N     1 
ATOM   4893  C  CA    . ILE B  2  870  ? 244.812 257.944 358.478 1.00 162.53 ? 870  ILE D CA    1 
ATOM   4894  C  C     . ILE B  2  870  ? 245.010 258.386 357.041 1.00 160.18 ? 870  ILE D C     1 
ATOM   4895  O  O     . ILE B  2  870  ? 244.528 257.738 356.129 1.00 158.91 ? 870  ILE D O     1 
ATOM   4896  N  N     . THR B  2  871  ? 245.724 259.477 356.825 1.00 159.75 ? 871  THR D N     1 
ATOM   4897  C  CA    . THR B  2  871  ? 245.889 259.978 355.469 1.00 157.65 ? 871  THR D CA    1 
ATOM   4898  C  C     . THR B  2  871  ? 247.331 260.332 355.140 1.00 157.96 ? 871  THR D C     1 
ATOM   4899  O  O     . THR B  2  871  ? 248.250 260.051 355.909 1.00 159.90 ? 871  THR D O     1 
ATOM   4900  N  N     . SER B  2  872  ? 247.523 260.927 353.968 1.00 182.35 ? 872  SER D N     1 
ATOM   4901  C  CA    . SER B  2  872  ? 248.813 261.495 353.600 1.00 182.63 ? 872  SER D CA    1 
ATOM   4902  C  C     . SER B  2  872  ? 248.921 262.884 354.217 1.00 183.17 ? 872  SER D C     1 
ATOM   4903  O  O     . SER B  2  872  ? 247.964 263.657 354.181 1.00 182.22 ? 872  SER D O     1 
ATOM   4904  N  N     . HIS B  2  873  ? 250.080 263.186 354.788 1.00 158.71 ? 873  HIS D N     1 
ATOM   4905  C  CA    . HIS B  2  873  ? 250.300 264.437 355.508 1.00 159.71 ? 873  HIS D CA    1 
ATOM   4906  C  C     . HIS B  2  873  ? 249.924 265.675 354.689 1.00 157.95 ? 873  HIS D C     1 
ATOM   4907  O  O     . HIS B  2  873  ? 249.421 266.660 355.227 1.00 158.21 ? 873  HIS D O     1 
ATOM   4908  N  N     . GLY B  2  874  ? 250.150 265.610 353.383 1.00 157.80 ? 874  GLY D N     1 
ATOM   4909  C  CA    . GLY B  2  874  ? 249.852 266.725 352.503 1.00 156.31 ? 874  GLY D CA    1 
ATOM   4910  C  C     . GLY B  2  874  ? 248.378 267.083 352.453 1.00 155.15 ? 874  GLY D C     1 
ATOM   4911  O  O     . GLY B  2  874  ? 248.008 268.244 352.276 1.00 154.67 ? 874  GLY D O     1 
ATOM   4912  N  N     . GLU B  2  875  ? 247.530 266.078 352.607 1.00 168.20 ? 875  GLU D N     1 
ATOM   4913  C  CA    . GLU B  2  875  ? 246.093 266.294 352.596 1.00 167.37 ? 875  GLU D CA    1 
ATOM   4914  C  C     . GLU B  2  875  ? 245.575 266.489 354.013 1.00 168.87 ? 875  GLU D C     1 
ATOM   4915  O  O     . GLU B  2  875  ? 244.381 266.709 354.215 1.00 168.56 ? 875  GLU D O     1 
ATOM   4916  N  N     . LEU B  2  876  ? 246.479 266.424 354.988 1.00 158.81 ? 876  LEU D N     1 
ATOM   4917  C  CA    . LEU B  2  876  ? 246.075 266.478 356.391 1.00 160.59 ? 876  LEU D CA    1 
ATOM   4918  C  C     . LEU B  2  876  ? 245.404 267.800 356.737 1.00 160.68 ? 876  LEU D C     1 
ATOM   4919  O  O     . LEU B  2  876  ? 244.502 267.842 357.567 1.00 161.43 ? 876  LEU D O     1 
ATOM   4920  N  N     . GLN B  2  877  ? 245.836 268.880 356.095 1.00 159.53 ? 877  GLN D N     1 
ATOM   4921  C  CA    . GLN B  2  877  ? 245.209 270.169 356.329 1.00 159.69 ? 877  GLN D CA    1 
ATOM   4922  C  C     . GLN B  2  877  ? 243.773 270.095 355.858 1.00 158.35 ? 877  GLN D C     1 
ATOM   4923  O  O     . GLN B  2  877  ? 242.846 270.514 356.563 1.00 159.01 ? 877  GLN D O     1 
ATOM   4924  N  N     . TYR B  2  878  ? 243.598 269.513 354.676 1.00 171.18 ? 878  TYR D N     1 
ATOM   4925  C  CA    . TYR B  2  878  ? 242.296 269.483 354.020 1.00 169.99 ? 878  TYR D CA    1 
ATOM   4926  C  C     . TYR B  2  878  ? 241.219 268.861 354.886 1.00 170.77 ? 878  TYR D C     1 
ATOM   4927  O  O     . TYR B  2  878  ? 240.180 269.470 355.134 1.00 170.99 ? 878  TYR D O     1 
ATOM   4928  N  N     . TYR B  2  879  ? 241.475 267.641 355.339 1.00 165.00 ? 879  TYR D N     1 
ATOM   4929  C  CA    . TYR B  2  879  ? 240.517 266.907 356.145 1.00 165.87 ? 879  TYR D CA    1 
ATOM   4930  C  C     . TYR B  2  879  ? 240.219 267.578 357.492 1.00 167.64 ? 879  TYR D C     1 
ATOM   4931  O  O     . TYR B  2  879  ? 239.261 267.207 358.169 1.00 168.44 ? 879  TYR D O     1 
ATOM   4932  N  N     . LEU B  2  880  ? 241.029 268.560 357.884 1.00 161.76 ? 880  LEU D N     1 
ATOM   4933  C  CA    . LEU B  2  880  ? 240.675 269.359 359.055 1.00 163.48 ? 880  LEU D CA    1 
ATOM   4934  C  C     . LEU B  2  880  ? 239.677 270.461 358.699 1.00 162.89 ? 880  LEU D C     1 
ATOM   4935  O  O     . LEU B  2  880  ? 238.745 270.722 359.462 1.00 163.94 ? 880  LEU D O     1 
ATOM   4936  N  N     . SER B  2  881  ? 239.855 271.081 357.533 1.00 156.96 ? 881  SER D N     1 
ATOM   4937  C  CA    . SER B  2  881  ? 238.953 272.144 357.083 1.00 156.49 ? 881  SER D CA    1 
ATOM   4938  C  C     . SER B  2  881  ? 237.518 271.665 356.856 1.00 156.08 ? 881  SER D C     1 
ATOM   4939  O  O     . SER B  2  881  ? 236.599 272.468 356.684 1.00 156.15 ? 881  SER D O     1 
ATOM   4940  N  N     . LEU B  2  882  ? 237.333 270.352 356.854 1.00 155.84 ? 882  LEU D N     1 
ATOM   4941  C  CA    . LEU B  2  882  ? 236.027 269.780 356.604 1.00 155.61 ? 882  LEU D CA    1 
ATOM   4942  C  C     . LEU B  2  882  ? 235.306 269.491 357.895 1.00 157.32 ? 882  LEU D C     1 
ATOM   4943  O  O     . LEU B  2  882  ? 234.265 270.073 358.184 1.00 158.01 ? 882  LEU D O     1 
ATOM   4944  N  N     . LEU B  2  883  ? 235.879 268.579 358.674 1.00 174.30 ? 883  LEU D N     1 
ATOM   4945  C  CA    . LEU B  2  883  ? 235.226 268.047 359.860 1.00 176.06 ? 883  LEU D CA    1 
ATOM   4946  C  C     . LEU B  2  883  ? 235.139 269.076 360.990 1.00 177.80 ? 883  LEU D C     1 
ATOM   4947  O  O     . LEU B  2  883  ? 234.528 268.829 362.032 1.00 179.47 ? 883  LEU D O     1 
ATOM   4948  N  N     . ASN B  2  884  ? 235.767 270.226 360.772 1.00 161.35 ? 884  ASN D N     1 
ATOM   4949  C  CA    . ASN B  2  884  ? 235.493 271.439 361.528 1.00 162.72 ? 884  ASN D CA    1 
ATOM   4950  C  C     . ASN B  2  884  ? 235.179 272.454 360.449 1.00 161.38 ? 884  ASN D C     1 
ATOM   4951  O  O     . ASN B  2  884  ? 235.718 272.335 359.350 1.00 159.72 ? 884  ASN D O     1 
ATOM   4952  N  N     . GLN B  2  885  ? 234.334 273.448 360.703 1.00 187.28 ? 885  GLN D N     1 
ATOM   4953  C  CA    . GLN B  2  885  ? 233.803 274.134 359.539 1.00 186.05 ? 885  GLN D CA    1 
ATOM   4954  C  C     . GLN B  2  885  ? 234.794 275.217 359.206 1.00 185.79 ? 885  GLN D C     1 
ATOM   4955  O  O     . GLN B  2  885  ? 234.749 276.320 359.746 1.00 187.05 ? 885  GLN D O     1 
ATOM   4956  N  N     . GLN B  2  886  ? 235.721 274.863 358.319 1.00 182.97 ? 886  GLN D N     1 
ATOM   4957  C  CA    . GLN B  2  886  ? 236.583 275.818 357.645 1.00 182.39 ? 886  GLN D CA    1 
ATOM   4958  C  C     . GLN B  2  886  ? 236.416 275.912 356.124 1.00 180.57 ? 886  GLN D C     1 
ATOM   4959  O  O     . GLN B  2  886  ? 236.911 276.848 355.505 1.00 180.24 ? 886  GLN D O     1 
ATOM   4960  N  N     . LEU B  2  887  ? 235.696 274.966 355.528 1.00 162.97 ? 887  LEU D N     1 
ATOM   4961  C  CA    . LEU B  2  887  ? 235.817 274.760 354.084 1.00 161.30 ? 887  LEU D CA    1 
ATOM   4962  C  C     . LEU B  2  887  ? 234.769 275.532 353.300 1.00 161.21 ? 887  LEU D C     1 
ATOM   4963  O  O     . LEU B  2  887  ? 233.586 275.496 353.634 1.00 162.01 ? 887  LEU D O     1 
ATOM   4964  N  N     . PRO B  2  888  ? 235.205 276.250 352.258 1.00 191.26 ? 888  PRO D N     1 
ATOM   4965  C  CA    . PRO B  2  888  ? 234.265 276.952 351.385 1.00 191.30 ? 888  PRO D CA    1 
ATOM   4966  C  C     . PRO B  2  888  ? 233.555 275.980 350.447 1.00 190.48 ? 888  PRO D C     1 
ATOM   4967  O  O     . PRO B  2  888  ? 234.150 275.000 350.000 1.00 189.44 ? 888  PRO D O     1 
ATOM   4968  N  N     . ILE B  2  889  ? 232.293 276.254 350.146 1.00 171.87 ? 889  ILE D N     1 
ATOM   4969  C  CA    . ILE B  2  889  ? 231.599 275.491 349.129 1.00 169.47 ? 889  ILE D CA    1 
ATOM   4970  C  C     . ILE B  2  889  ? 231.610 276.291 347.831 1.00 167.57 ? 889  ILE D C     1 
ATOM   4971  O  O     . ILE B  2  889  ? 230.981 277.345 347.729 1.00 168.10 ? 889  ILE D O     1 
ATOM   4972  N  N     . GLU B  2  890  ? 232.338 275.782 346.843 1.00 172.25 ? 890  GLU D N     1 
ATOM   4973  C  CA    . GLU B  2  890  ? 232.547 276.483 345.587 1.00 170.69 ? 890  GLU D CA    1 
ATOM   4974  C  C     . GLU B  2  890  ? 231.977 275.679 344.439 1.00 168.23 ? 890  GLU D C     1 
ATOM   4975  O  O     . GLU B  2  890  ? 231.782 274.471 344.564 1.00 167.70 ? 890  GLU D O     1 
ATOM   4976  N  N     . SER B  2  891  ? 231.707 276.338 343.315 1.00 163.29 ? 891  SER D N     1 
ATOM   4977  C  CA    . SER B  2  891  ? 231.061 275.663 342.186 1.00 161.03 ? 891  SER D CA    1 
ATOM   4978  C  C     . SER B  2  891  ? 232.033 275.219 341.095 1.00 159.42 ? 891  SER D C     1 
ATOM   4979  O  O     . SER B  2  891  ? 232.889 275.981 340.641 1.00 159.70 ? 891  SER D O     1 
ATOM   4980  N  N     . GLN B  2  892  ? 231.870 273.975 340.672 1.00 180.47 ? 892  GLN D N     1 
ATOM   4981  C  CA    . GLN B  2  892  ? 232.700 273.396 339.625 1.00 179.11 ? 892  GLN D CA    1 
ATOM   4982  C  C     . GLN B  2  892  ? 232.058 273.644 338.248 1.00 177.41 ? 892  GLN D C     1 
ATOM   4983  O  O     . GLN B  2  892  ? 232.531 273.143 337.220 1.00 176.21 ? 892  GLN D O     1 
ATOM   4984  N  N     . MET B  2  893  ? 230.993 274.446 338.268 1.00 159.52 ? 893  MET D N     1 
ATOM   4985  C  CA    . MET B  2  893  ? 230.142 274.780 337.120 1.00 158.49 ? 893  MET D CA    1 
ATOM   4986  C  C     . MET B  2  893  ? 230.878 275.145 335.811 1.00 157.81 ? 893  MET D C     1 
ATOM   4987  O  O     . MET B  2  893  ? 230.449 274.752 334.721 1.00 156.50 ? 893  MET D O     1 
ATOM   4988  N  N     . VAL B  2  894  ? 231.979 275.881 335.915 1.00 156.88 ? 894  VAL D N     1 
ATOM   4989  C  CA    . VAL B  2  894  ? 232.720 276.331 334.737 1.00 156.95 ? 894  VAL D CA    1 
ATOM   4990  C  C     . VAL B  2  894  ? 233.183 275.200 333.832 1.00 155.47 ? 894  VAL D C     1 
ATOM   4991  O  O     . VAL B  2  894  ? 233.198 275.343 332.611 1.00 155.16 ? 894  VAL D O     1 
ATOM   4992  N  N     . SER B  2  895  ? 233.580 274.084 334.435 1.00 157.06 ? 895  SER D N     1 
ATOM   4993  C  CA    . SER B  2  895  ? 234.057 272.937 333.676 1.00 156.00 ? 895  SER D CA    1 
ATOM   4994  C  C     . SER B  2  895  ? 232.971 272.445 332.736 1.00 154.39 ? 895  SER D C     1 
ATOM   4995  O  O     . SER B  2  895  ? 233.237 272.138 331.578 1.00 153.90 ? 895  SER D O     1 
ATOM   4996  N  N     . LYS B  2  896  ? 231.747 272.388 333.252 1.00 136.64 ? 896  LYS D N     1 
ATOM   4997  C  CA    . LYS B  2  896  ? 230.617 271.814 332.529 1.00 135.24 ? 896  LYS D CA    1 
ATOM   4998  C  C     . LYS B  2  896  ? 229.790 272.818 331.727 1.00 135.35 ? 896  LYS D C     1 
ATOM   4999  O  O     . LYS B  2  896  ? 228.926 272.427 330.945 1.00 134.40 ? 896  LYS D O     1 
ATOM   5000  N  N     . LEU B  2  897  ? 230.087 274.105 331.897 1.00 136.23 ? 897  LEU D N     1 
ATOM   5001  C  CA    . LEU B  2  897  ? 229.310 275.203 331.297 1.00 137.09 ? 897  LEU D CA    1 
ATOM   5002  C  C     . LEU B  2  897  ? 228.851 275.014 329.838 1.00 136.39 ? 897  LEU D C     1 
ATOM   5003  O  O     . LEU B  2  897  ? 227.732 275.386 329.508 1.00 136.66 ? 897  LEU D O     1 
ATOM   5004  N  N     . PRO B  2  898  ? 229.712 274.464 328.957 1.00 136.40 ? 898  PRO D N     1 
ATOM   5005  C  CA    . PRO B  2  898  ? 229.234 274.220 327.590 1.00 136.11 ? 898  PRO D CA    1 
ATOM   5006  C  C     . PRO B  2  898  ? 228.125 273.174 327.505 1.00 134.41 ? 898  PRO D C     1 
ATOM   5007  O  O     . PRO B  2  898  ? 227.205 273.323 326.695 1.00 134.50 ? 898  PRO D O     1 
ATOM   5008  N  N     . ASP B  2  899  ? 228.219 272.127 328.321 1.00 147.75 ? 899  ASP D N     1 
ATOM   5009  C  CA    . ASP B  2  899  ? 227.220 271.061 328.304 1.00 146.50 ? 899  ASP D CA    1 
ATOM   5010  C  C     . ASP B  2  899  ? 225.914 271.526 328.920 1.00 147.02 ? 899  ASP D C     1 
ATOM   5011  O  O     . ASP B  2  899  ? 224.836 271.173 328.448 1.00 146.71 ? 899  ASP D O     1 
ATOM   5012  N  N     . MET B  2  900  ? 226.020 272.329 329.972 1.00 152.92 ? 900  MET D N     1 
ATOM   5013  C  CA    . MET B  2  900  ? 224.844 272.867 330.641 1.00 154.11 ? 900  MET D CA    1 
ATOM   5014  C  C     . MET B  2  900  ? 224.062 273.799 329.713 1.00 155.15 ? 900  MET D C     1 
ATOM   5015  O  O     . MET B  2  900  ? 222.832 273.788 329.714 1.00 155.86 ? 900  MET D O     1 
ATOM   5016  N  N     . LEU B  2  901  ? 224.780 274.615 328.949 1.00 139.67 ? 901  LEU D N     1 
ATOM   5017  C  CA    . LEU B  2  901  ? 224.154 275.602 328.082 1.00 141.37 ? 901  LEU D CA    1 
ATOM   5018  C  C     . LEU B  2  901  ? 223.369 274.889 326.994 1.00 140.57 ? 901  LEU D C     1 
ATOM   5019  O  O     . LEU B  2  901  ? 222.210 275.222 326.751 1.00 141.85 ? 901  LEU D O     1 
ATOM   5020  N  N     . ASN B  2  902  ? 224.000 273.906 326.352 1.00 155.91 ? 902  ASN D N     1 
ATOM   5021  C  CA    . ASN B  2  902  ? 223.346 273.103 325.314 1.00 155.09 ? 902  ASN D CA    1 
ATOM   5022  C  C     . ASN B  2  902  ? 221.968 272.634 325.758 1.00 155.00 ? 902  ASN D C     1 
ATOM   5023  O  O     . ASN B  2  902  ? 220.954 273.030 325.181 1.00 156.30 ? 902  ASN D O     1 
ATOM   5024  N  N     . ALA B  2  903  ? 221.941 271.819 326.806 1.00 142.85 ? 903  ALA D N     1 
ATOM   5025  C  CA    . ALA B  2  903  ? 220.705 271.241 327.321 1.00 143.22 ? 903  ALA D CA    1 
ATOM   5026  C  C     . ALA B  2  903  ? 219.612 272.272 327.608 1.00 145.74 ? 903  ALA D C     1 
ATOM   5027  O  O     . ALA B  2  903  ? 218.425 271.949 327.547 1.00 146.76 ? 903  ALA D O     1 
ATOM   5028  N  N     . GLU B  2  904  ? 220.006 273.501 327.923 1.00 158.34 ? 904  GLU D N     1 
ATOM   5029  C  CA    . GLU B  2  904  ? 219.028 274.561 328.143 1.00 161.29 ? 904  GLU D CA    1 
ATOM   5030  C  C     . GLU B  2  904  ? 218.495 275.098 326.818 1.00 162.56 ? 904  GLU D C     1 
ATOM   5031  O  O     . GLU B  2  904  ? 217.347 275.533 326.738 1.00 165.09 ? 904  GLU D O     1 
ATOM   5032  N  N     . ILE B  2  905  ? 219.328 275.076 325.781 1.00 133.60 ? 905  ILE D N     1 
ATOM   5033  C  CA    . ILE B  2  905  ? 218.881 275.478 324.452 1.00 134.89 ? 905  ILE D CA    1 
ATOM   5034  C  C     . ILE B  2  905  ? 217.979 274.382 323.903 1.00 133.97 ? 905  ILE D C     1 
ATOM   5035  O  O     . ILE B  2  905  ? 216.987 274.644 323.225 1.00 135.78 ? 905  ILE D O     1 
ATOM   5036  N  N     . VAL B  2  906  ? 218.351 273.149 324.223 1.00 137.19 ? 906  VAL D N     1 
ATOM   5037  C  CA    . VAL B  2  906  ? 217.609 271.959 323.842 1.00 136.15 ? 906  VAL D CA    1 
ATOM   5038  C  C     . VAL B  2  906  ? 216.198 271.969 324.421 1.00 138.24 ? 906  VAL D C     1 
ATOM   5039  O  O     . VAL B  2  906  ? 215.254 271.519 323.775 1.00 138.95 ? 906  VAL D O     1 
ATOM   5040  N  N     . LEU B  2  907  ? 216.049 272.496 325.629 1.00 138.52 ? 907  LEU D N     1 
ATOM   5041  C  CA    . LEU B  2  907  ? 214.731 272.585 326.241 1.00 141.15 ? 907  LEU D CA    1 
ATOM   5042  C  C     . LEU B  2  907  ? 213.992 273.835 325.778 1.00 144.63 ? 907  LEU D C     1 
ATOM   5043  O  O     . LEU B  2  907  ? 212.793 273.991 326.023 1.00 147.77 ? 907  LEU D O     1 
ATOM   5044  N  N     . GLY B  2  908  ? 214.713 274.724 325.104 1.00 166.73 ? 908  GLY D N     1 
ATOM   5045  C  CA    . GLY B  2  908  ? 214.117 275.937 324.570 1.00 170.41 ? 908  GLY D CA    1 
ATOM   5046  C  C     . GLY B  2  908  ? 214.036 277.039 325.604 1.00 173.27 ? 908  GLY D C     1 
ATOM   5047  O  O     . GLY B  2  908  ? 213.381 278.062 325.399 1.00 177.16 ? 908  GLY D O     1 
ATOM   5048  N  N     . ASN B  2  909  ? 214.716 276.830 326.723 1.00 167.81 ? 909  ASN D N     1 
ATOM   5049  C  CA    . ASN B  2  909  ? 214.699 277.791 327.810 1.00 170.39 ? 909  ASN D CA    1 
ATOM   5050  C  C     . ASN B  2  909  ? 215.665 278.945 327.576 1.00 170.87 ? 909  ASN D C     1 
ATOM   5051  O  O     . ASN B  2  909  ? 215.612 279.963 328.271 1.00 173.57 ? 909  ASN D O     1 
ATOM   5052  N  N     . VAL B  2  910  ? 216.560 278.786 326.605 1.00 149.17 ? 910  VAL D N     1 
ATOM   5053  C  CA    . VAL B  2  910  ? 217.385 279.900 326.164 1.00 150.38 ? 910  VAL D CA    1 
ATOM   5054  C  C     . VAL B  2  910  ? 217.424 279.997 324.642 1.00 150.80 ? 910  VAL D C     1 
ATOM   5055  O  O     . VAL B  2  910  ? 217.935 279.111 323.962 1.00 148.16 ? 910  VAL D O     1 
ATOM   5056  N  N     . GLN B  2  911  ? 216.853 281.077 324.118 1.00 190.30 ? 911  GLN D N     1 
ATOM   5057  C  CA    . GLN B  2  911  ? 216.862 281.345 322.687 1.00 191.81 ? 911  GLN D CA    1 
ATOM   5058  C  C     . GLN B  2  911  ? 218.181 281.957 322.236 1.00 191.98 ? 911  GLN D C     1 
ATOM   5059  O  O     . GLN B  2  911  ? 218.774 281.521 321.253 1.00 190.86 ? 911  GLN D O     1 
ATOM   5060  N  N     . ASN B  2  912  ? 218.644 282.962 322.969 1.00 186.87 ? 912  ASN D N     1 
ATOM   5061  C  CA    . ASN B  2  912  ? 219.786 283.757 322.534 1.00 188.25 ? 912  ASN D CA    1 
ATOM   5062  C  C     . ASN B  2  912  ? 220.795 284.015 323.643 1.00 186.91 ? 912  ASN D C     1 
ATOM   5063  O  O     . ASN B  2  912  ? 220.667 283.481 324.742 1.00 184.60 ? 912  ASN D O     1 
ATOM   5064  N  N     . ALA B  2  913  ? 221.797 284.837 323.346 1.00 168.29 ? 913  ALA D N     1 
ATOM   5065  C  CA    . ALA B  2  913  ? 222.837 285.162 324.315 1.00 167.47 ? 913  ALA D CA    1 
ATOM   5066  C  C     . ALA B  2  913  ? 222.258 285.786 325.580 1.00 168.75 ? 913  ALA D C     1 
ATOM   5067  O  O     . ALA B  2  913  ? 222.688 285.465 326.689 1.00 166.65 ? 913  ALA D O     1 
ATOM   5068  N  N     . LYS B  2  914  ? 221.277 286.669 325.409 1.00 174.20 ? 914  LYS D N     1 
ATOM   5069  C  CA    . LYS B  2  914  ? 220.698 287.408 326.529 1.00 176.39 ? 914  LYS D CA    1 
ATOM   5070  C  C     . LYS B  2  914  ? 220.010 286.479 327.522 1.00 173.82 ? 914  LYS D C     1 
ATOM   5071  O  O     . LYS B  2  914  ? 220.215 286.577 328.736 1.00 173.36 ? 914  LYS D O     1 
ATOM   5072  N  N     . ASP B  2  915  ? 219.196 285.575 326.997 1.00 186.98 ? 915  ASP D N     1 
ATOM   5073  C  CA    . ASP B  2  915  ? 218.528 284.595 327.838 1.00 184.80 ? 915  ASP D CA    1 
ATOM   5074  C  C     . ASP B  2  915  ? 219.575 283.715 328.518 1.00 180.53 ? 915  ASP D C     1 
ATOM   5075  O  O     . ASP B  2  915  ? 219.367 283.239 329.630 1.00 179.49 ? 915  ASP D O     1 
ATOM   5076  N  N     . ALA B  2  916  ? 220.708 283.523 327.850 1.00 157.98 ? 916  ALA D N     1 
ATOM   5077  C  CA    . ALA B  2  916  ? 221.786 282.713 328.402 1.00 154.42 ? 916  ALA D CA    1 
ATOM   5078  C  C     . ALA B  2  916  ? 222.415 283.385 329.616 1.00 155.29 ? 916  ALA D C     1 
ATOM   5079  O  O     . ALA B  2  916  ? 222.628 282.738 330.642 1.00 153.41 ? 916  ALA D O     1 
ATOM   5080  N  N     . VAL B  2  917  ? 222.710 284.681 329.506 1.00 172.24 ? 917  VAL D N     1 
ATOM   5081  C  CA    . VAL B  2  917  ? 223.258 285.407 330.653 1.00 173.45 ? 917  VAL D CA    1 
ATOM   5082  C  C     . VAL B  2  917  ? 222.228 285.478 331.782 1.00 174.65 ? 917  VAL D C     1 
ATOM   5083  O  O     . VAL B  2  917  ? 222.586 285.428 332.966 1.00 174.21 ? 917  VAL D O     1 
ATOM   5084  N  N     . ASN B  2  918  ? 220.948 285.567 331.410 1.00 172.79 ? 918  ASN D N     1 
ATOM   5085  C  CA    . ASN B  2  918  ? 219.880 285.601 332.403 1.00 174.48 ? 918  ASN D CA    1 
ATOM   5086  C  C     . ASN B  2  918  ? 219.832 284.289 333.171 1.00 171.32 ? 918  ASN D C     1 
ATOM   5087  O  O     . ASN B  2  918  ? 219.657 284.273 334.391 1.00 172.03 ? 918  ASN D O     1 
ATOM   5088  N  N     . TRP B  2  919  ? 219.998 283.196 332.440 1.00 161.14 ? 919  TRP D N     1 
ATOM   5089  C  CA    . TRP B  2  919  ? 220.033 281.866 333.025 1.00 158.16 ? 919  TRP D CA    1 
ATOM   5090  C  C     . TRP B  2  919  ? 221.211 281.721 333.969 1.00 156.60 ? 919  TRP D C     1 
ATOM   5091  O  O     . TRP B  2  919  ? 221.045 281.288 335.109 1.00 156.60 ? 919  TRP D O     1 
ATOM   5092  N  N     . LEU B  2  920  ? 222.397 282.094 333.495 1.00 156.18 ? 920  LEU D N     1 
ATOM   5093  C  CA    . LEU B  2  920  ? 223.611 281.936 334.289 1.00 154.92 ? 920  LEU D CA    1 
ATOM   5094  C  C     . LEU B  2  920  ? 223.551 282.807 335.530 1.00 157.47 ? 920  LEU D C     1 
ATOM   5095  O  O     . LEU B  2  920  ? 224.195 282.514 336.535 1.00 156.85 ? 920  LEU D O     1 
ATOM   5096  N  N     . GLY B  2  921  ? 222.759 283.872 335.456 1.00 184.09 ? 921  GLY D N     1 
ATOM   5097  C  CA    . GLY B  2  921  ? 222.520 284.722 336.609 1.00 186.93 ? 921  GLY D CA    1 
ATOM   5098  C  C     . GLY B  2  921  ? 221.765 284.015 337.726 1.00 187.00 ? 921  GLY D C     1 
ATOM   5099  O  O     . GLY B  2  921  ? 221.634 284.555 338.828 1.00 189.15 ? 921  GLY D O     1 
ATOM   5100  N  N     . TYR B  2  922  ? 221.238 282.828 337.433 1.00 162.06 ? 922  TYR D N     1 
ATOM   5101  C  CA    . TYR B  2  922  ? 220.567 282.008 338.444 1.00 162.28 ? 922  TYR D CA    1 
ATOM   5102  C  C     . TYR B  2  922  ? 221.450 280.896 339.034 1.00 159.51 ? 922  TYR D C     1 
ATOM   5103  O  O     . TYR B  2  922  ? 220.997 280.126 339.880 1.00 159.75 ? 922  TYR D O     1 
ATOM   5104  N  N     . ALA B  2  923  ? 222.698 280.814 338.578 1.00 169.97 ? 923  ALA D N     1 
ATOM   5105  C  CA    . ALA B  2  923  ? 223.633 279.781 339.036 1.00 167.69 ? 923  ALA D CA    1 
ATOM   5106  C  C     . ALA B  2  923  ? 224.306 280.072 340.390 1.00 169.00 ? 923  ALA D C     1 
ATOM   5107  O  O     . ALA B  2  923  ? 224.419 281.229 340.813 1.00 171.26 ? 923  ALA D O     1 
ATOM   5108  N  N     . TYR B  2  924  ? 224.746 279.014 341.069 1.00 152.24 ? 924  TYR D N     1 
ATOM   5109  C  CA    . TYR B  2  924  ? 225.538 279.160 342.286 1.00 154.46 ? 924  TYR D CA    1 
ATOM   5110  C  C     . TYR B  2  924  ? 226.849 279.881 341.957 1.00 155.07 ? 924  TYR D C     1 
ATOM   5111  O  O     . TYR B  2  924  ? 227.295 280.779 342.685 1.00 158.14 ? 924  TYR D O     1 
ATOM   5112  N  N     . LEU B  2  925  ? 227.444 279.500 340.830 1.00 152.66 ? 925  LEU D N     1 
ATOM   5113  C  CA    . LEU B  2  925  ? 228.652 280.133 340.315 1.00 152.69 ? 925  LEU D CA    1 
ATOM   5114  C  C     . LEU B  2  925  ? 228.490 281.640 340.136 1.00 155.33 ? 925  LEU D C     1 
ATOM   5115  O  O     . LEU B  2  925  ? 229.469 282.379 340.155 1.00 157.02 ? 925  LEU D O     1 
ATOM   5116  N  N     . TYR B  2  926  ? 227.258 282.101 339.957 1.00 171.51 ? 926  TYR D N     1 
ATOM   5117  C  CA    . TYR B  2  926  ? 227.038 283.530 339.806 1.00 174.21 ? 926  TYR D CA    1 
ATOM   5118  C  C     . TYR B  2  926  ? 227.230 284.254 341.124 1.00 176.77 ? 926  TYR D C     1 
ATOM   5119  O  O     . TYR B  2  926  ? 227.950 285.247 341.190 1.00 178.50 ? 926  TYR D O     1 
ATOM   5120  N  N     . ILE B  2  927  ? 226.587 283.763 342.178 1.