data_6AHU
# 
_entry.id   6AHU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.315 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6AHU         
WWPDB D_1300008803 
EMDB  EMD-9627     
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
EMDB .                                                            EMD-9626 'other EM volume'      
EMDB 'cryo-EM structure of human Ribonuclease P with mature tRNA' EMD-9627 'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6AHU 
_pdbx_database_status.recvd_initial_deposition_date   2018-08-20 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Wu, J.'  1 ? 
'Niu, S.' 2 ? 
'Tan, M.' 3 ? 
'Lan, P.' 4 ? 
'Lei, M.' 5 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Cell 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1097-4172 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            175 
_citation.language                  ? 
_citation.page_first                1393 
_citation.page_last                 1404.e11 
_citation.title                     'Cryo-EM Structure of the Human Ribonuclease P Holoenzyme.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.cell.2018.10.003 
_citation.pdbx_database_id_PubMed   30454648 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Wu, J.'    1  ? 
primary 'Niu, S.'   2  ? 
primary 'Tan, M.'   3  ? 
primary 'Huang, C.' 4  ? 
primary 'Li, M.'    5  ? 
primary 'Song, Y.'  6  ? 
primary 'Wang, Q.'  7  ? 
primary 'Chen, J.'  8  ? 
primary 'Shi, S.'   9  ? 
primary 'Lan, P.'   10 ? 
primary 'Lei, M.'   11 ? 
# 
_cell.angle_alpha                  90 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6AHU 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1 
_cell.length_a_esd                 ? 
_cell.length_b                     1 
_cell.length_b_esd                 ? 
_cell.length_c                     1 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        1 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6AHU 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'H1 RNA'                                   110244.172 1 ?        ? ? ? 
2  polymer     nat 'Ribonucleases P/MRP protein subunit POP1' 114896.141 1 3.1.26.5 ? ? ? 
3  polymer     nat 'Ribonuclease P protein subunit p38'       31891.443  1 3.1.26.5 ? ? ? 
4  polymer     nat 'Ribonuclease P protein subunit p29'       25474.854  1 3.1.26.5 ? ? ? 
5  polymer     nat 'Ribonuclease P/MRP protein subunit POP5'  18844.672  1 3.1.26.5 ? ? ? 
6  polymer     nat 'Ribonuclease P protein subunit p25'       20659.406  1 3.1.26.5 ? ? ? 
7  polymer     nat 'Ribonuclease P protein subunit p20'       15672.866  1 3.1.26.5 ? ? ? 
8  polymer     nat 'Ribonuclease P protein subunit p14'       13707.014  1 3.1.26.5 ? ? ? 
9  polymer     nat 'Ribonuclease P protein subunit p30'       29364.277  2 3.1.26.5 ? ? ? 
10 polymer     nat 'Ribonuclease P protein subunit p21'       17596.068  1 3.1.26.5 ? ? ? 
11 polymer     nat 'Ribonuclease P protein subunit p40'       41884.844  1 3.1.26.5 ? ? ? 
12 polymer     man tRNA                                       23168.760  1 ?        ? ? ? 
13 non-polymer syn 'ZINC ION'                                 65.409     1 ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
2  hPOP1                                                                       
3  'RNaseP protein p38'                                                        
4  hPOP4                                                                       
5  hPop5                                                                       
6  'RNase P protein subunit p25'                                               
7  'RNaseP protein p20,Ribonucleases P/MRP protein subunit POP7 homolog,hPOP7' 
9  'RNaseP protein p30,RNase P subunit 2'                                      
10 'RNaseP protein p21,Ribonuclease P/MRP 21 kDa subunit,Ribonucleoprotein V'  
11 'RNaseP protein p40,RNase P subunit 1'                                      
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  polyribonucleotide no no 
;AUAGGGCGGAGGGAAGCUCAUCAGUGGGGCCACGAGCUGAGUGCGUCCUGUCACUCCACUCCCAUGUCCCUUGGGAAGGU
CUGAGACUAGGGCCAGAGGCGGCCCUAACAGGGCUCUCCCUGAGCUUCGGGGAGGUGAGUUCCCAGAGAACGGGGCUCCG
CGCGAGGUCAGACUGGGCAGGAGAUGCCGUGGACCCCGCCCUUCGGGGAGGGGCCCGGCGGAUGCCUCCUUUGCCGGAGC
UUGGAACAGACUCACGGCCAGCGAAGUGAGUUCAAUGGCUGAGGUGAGGUACCCCGCAGGGGACCUCAUAACCCAAUUCA
GACUACUCUCCUCCGCCCAUU
;
;AUAGGGCGGAGGGAAGCUCAUCAGUGGGGCCACGAGCUGAGUGCGUCCUGUCACUCCACUCCCAUGUCCCUUGGGAAGGU
CUGAGACUAGGGCCAGAGGCGGCCCUAACAGGGCUCUCCCUGAGCUUCGGGGAGGUGAGUUCCCAGAGAACGGGGCUCCG
CGCGAGGUCAGACUGGGCAGGAGAUGCCGUGGACCCCGCCCUUCGGGGAGGGGCCCGGCGGAUGCCUCCUUUGCCGGAGC
UUGGAACAGACUCACGGCCAGCGAAGUGAGUUCAAUGGCUGAGGUGAGGUACCCCGCAGGGGACCUCAUAACCCAAUUCA
GACUACUCUCCUCCGCCCAUU
;
A   ? 
2  'polypeptide(L)'   no no 
;MSNAKERKHAKKMRNQPTNVTLSSGFVADRGVKHHSGGEKPFQAQKQEPHPGTSRQRQTRVNPHSLPDPEVNEQSSSKGM
FRKKGGWKAGPEGTSQEIPKYITASTFAQARAAEISAMLKAVTQKSSNSLVFQTLPRHMRRRAMSHNVKRLPRRLQEIAQ
KEAEKAVHQKKEHSKNKCHKARRCHMNRTLEFNRRQKKNIWLETHIWHAKRFHMVKKWGYCLGERPTVKSHRACYRAMTN
RCLLQDLSYYCCLELKGKEEEILKALSGMCNIDTGLTFAAVHCLSGKRQGSLVLYRVNKYPREMLGPVTFIWKSQRTPGD
PSESRQLWIWLHPTLKQDILEEIKAACQCVEPIKSAVCIADPLPTPSQEKSQTELPDEKIGKKRKRKDDGENAKPIKKII
GDGTRDPCLPYSWISPTTGIIISDLTMEMNRFRLIGPLSHSILTEAIKAASVHTVGEDTEETPHRWWIETCKKPDSVSLH
CRQEAIFELLGGITSPAEIPAGTILGLTVGDPRINLPQKKSKALPNPEKCQDNEKVRQLLLEGVPVECTHSFIWNQDICK
SVTENKISDQDLNRMRSELLVPGSQLILGPHESKIPILLIQQPGKVTGEDRLGWGSGWDVLLPKGWGMAFWIPFIYRGVR
VGGLKESAVHSQYKRSPNVPGDFPDCPAGMLFAEEQAKNLLEKYKRRPPAKRPNYVKLGTLAPFCCPWEQLTQDWESRVQ
AYEEPSVASSPNGKESDLRRSEVPCAPMPKKTHQPSDEVGTSIEHPREAEEVMDAGCQESAGPERITDQEASENHVAATG
SHLCVLRSRKLLKQLSAWCGPSSEDSRGGRRAPGRGQQGLTREACLSILGHFPRALVWVSLSLLSKGSPEPHTMICVPAK
EDFLQLHEDWHYCGPQESKHSDPFRSKILKQKEKKKREKRQKPGRASSDGPAGEEPVAGQEALTLGLWSGPLPRVTLHCS
RTLLGFVTQGDFSMAVGCGEALGFVSLTGLLDMLSSQPAAQRGLVLLRPPASLQYRFARIAIEV
;
;MSNAKERKHAKKMRNQPTNVTLSSGFVADRGVKHHSGGEKPFQAQKQEPHPGTSRQRQTRVNPHSLPDPEVNEQSSSKGM
FRKKGGWKAGPEGTSQEIPKYITASTFAQARAAEISAMLKAVTQKSSNSLVFQTLPRHMRRRAMSHNVKRLPRRLQEIAQ
KEAEKAVHQKKEHSKNKCHKARRCHMNRTLEFNRRQKKNIWLETHIWHAKRFHMVKKWGYCLGERPTVKSHRACYRAMTN
RCLLQDLSYYCCLELKGKEEEILKALSGMCNIDTGLTFAAVHCLSGKRQGSLVLYRVNKYPREMLGPVTFIWKSQRTPGD
PSESRQLWIWLHPTLKQDILEEIKAACQCVEPIKSAVCIADPLPTPSQEKSQTELPDEKIGKKRKRKDDGENAKPIKKII
GDGTRDPCLPYSWISPTTGIIISDLTMEMNRFRLIGPLSHSILTEAIKAASVHTVGEDTEETPHRWWIETCKKPDSVSLH
CRQEAIFELLGGITSPAEIPAGTILGLTVGDPRINLPQKKSKALPNPEKCQDNEKVRQLLLEGVPVECTHSFIWNQDICK
SVTENKISDQDLNRMRSELLVPGSQLILGPHESKIPILLIQQPGKVTGEDRLGWGSGWDVLLPKGWGMAFWIPFIYRGVR
VGGLKESAVHSQYKRSPNVPGDFPDCPAGMLFAEEQAKNLLEKYKRRPPAKRPNYVKLGTLAPFCCPWEQLTQDWESRVQ
AYEEPSVASSPNGKESDLRRSEVPCAPMPKKTHQPSDEVGTSIEHPREAEEVMDAGCQESAGPERITDQEASENHVAATG
SHLCVLRSRKLLKQLSAWCGPSSEDSRGGRRAPGRGQQGLTREACLSILGHFPRALVWVSLSLLSKGSPEPHTMICVPAK
EDFLQLHEDWHYCGPQESKHSDPFRSKILKQKEKKKREKRQKPGRASSDGPAGEEPVAGQEALTLGLWSGPLPRVTLHCS
RTLLGFVTQGDFSMAVGCGEALGFVSLTGLLDMLSSQPAAQRGLVLLRPPASLQYRFARIAIEV
;
B   ? 
3  'polypeptide(L)'   no no 
;MAAAPQAPGRGSLRKTRPLVVKTSLNNPYIIRWSALESEDMHFILQTLEDRLKAIGLQKIEDKKKKNKTPFLKKESREKC
SIAVDISENLKEKKTDAKQQVSGWTPAHVRKQLAIGVNEVTRALERRELLLVLVCKSVKPAMITSHLIQLSLSRSVPACQ
VPRLSERIAPVIGLKCVLALAFKKNTTDFVDEVRAIIPRVPSLSVPWLQDRIEDSGENLETEPLESQDRELLDTSFEDLS
KPKRKLADGRQASVTLQPLKIKKLIPNPNKIRKPPKSKKATPK
;
;MAAAPQAPGRGSLRKTRPLVVKTSLNNPYIIRWSALESEDMHFILQTLEDRLKAIGLQKIEDKKKKNKTPFLKKESREKC
SIAVDISENLKEKKTDAKQQVSGWTPAHVRKQLAIGVNEVTRALERRELLLVLVCKSVKPAMITSHLIQLSLSRSVPACQ
VPRLSERIAPVIGLKCVLALAFKKNTTDFVDEVRAIIPRVPSLSVPWLQDRIEDSGENLETEPLESQDRELLDTSFEDLS
KPKRKLADGRQASVTLQPLKIKKLIPNPNKIRKPPKSKKATPK
;
C   ? 
4  'polypeptide(L)'   no no 
;MKSVIYHALSQKEANDSDVQPSGAQRAEAFVRAFLKRSTPRMSPQAREDQLQRKAVVLEYFTRHKRKEKKKKAKGLSARQ
RRELRLFDIKPEQQRYSLFLPLHELWKQYIRDLCSGLKPDTQPQMIQAKLLKADLHGAIISVTKSKCPSYVGITGILLQE
TKHIFKIITKEDRLKVIPKLNCVFTVETDGFISYIYGSKFQLRSSERSAKKFKAKGTIDL
;
;MKSVIYHALSQKEANDSDVQPSGAQRAEAFVRAFLKRSTPRMSPQAREDQLQRKAVVLEYFTRHKRKEKKKKAKGLSARQ
RRELRLFDIKPEQQRYSLFLPLHELWKQYIRDLCSGLKPDTQPQMIQAKLLKADLHGAIISVTKSKCPSYVGITGILLQE
TKHIFKIITKEDRLKVIPKLNCVFTVETDGFISYIYGSKFQLRSSERSAKKFKAKGTIDL
;
D   ? 
5  'polypeptide(L)'   no no 
;MVRFKHRYLLCELVSDDPRCRLSLDDRVLSSLVRDTIARVHGTFGAAACSIGFAVRYLNAYTGIVLLRCRKEFYQLVWSA
LPFITYLENKGHRYPCFFNTLHVGGTIRTCQKFLIQYNRRQLLILLQNCTDEGEREAIQKSVTRSCLLEEEEESGEEAAE
AME
;
;MVRFKHRYLLCELVSDDPRCRLSLDDRVLSSLVRDTIARVHGTFGAAACSIGFAVRYLNAYTGIVLLRCRKEFYQLVWSA
LPFITYLENKGHRYPCFFNTLHVGGTIRTCQKFLIQYNRRQLLILLQNCTDEGEREAIQKSVTRSCLLEEEEESGEEAAE
AME
;
E   ? 
6  'polypeptide(L)'   no no 
;MENFRKVRSEEAPAGCGAEGGGPGSGPFADLAPGAVHMRVKEGSKIRNLMAFATASMAQPATRAIVFSGCGRATTKTVTC
AEILKRRLAGLHQVTRLRYRSVREVWQSLPPGPTQGQTPGEPAASLSVLKNVPGLAILLSKDALDPRQPGYQPPNPHPGP
SSPPAAPASKRSLGEPAAGEGSAKRSQPEPGVADEDQTA
;
;MENFRKVRSEEAPAGCGAEGGGPGSGPFADLAPGAVHMRVKEGSKIRNLMAFATASMAQPATRAIVFSGCGRATTKTVTC
AEILKRRLAGLHQVTRLRYRSVREVWQSLPPGPTQGQTPGEPAASLSVLKNVPGLAILLSKDALDPRQPGYQPPNPHPGP
SSPPAAPASKRSLGEPAAGEGSAKRSQPEPGVADEDQTA
;
F   ? 
7  'polypeptide(L)'   no no 
;MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGARGQNACSEIYIHGLGLAINR
AINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK
;
;MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGARGQNACSEIYIHGLGLAINR
AINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK
;
G   ? 
8  'polypeptide(L)'   no no 
;MPAPAATYERVVYKNPSEYHYMKVCLEFQDCGVGLNAAQFKQLLISAVKDLFGEVDAALPLDILTYEEKTLSAILRICSS
GLVKLWSSLTLLGSYKGKKCAFRVIQVSPFLLALSGNSRELVLD
;
;MPAPAATYERVVYKNPSEYHYMKVCLEFQDCGVGLNAAQFKQLLISAVKDLFGEVDAALPLDILTYEEKTLSAILRICSS
GLVKLWSSLTLLGSYKGKKCAFRVIQVSPFLLALSGNSRELVLD
;
H   ? 
9  'polypeptide(L)'   no no 
;MAVFADLDLRAGSDLKALRGLVETAAHLGYSVVAINHIVDFKEKKQEIEKPVAVSELFTTLPIVQGKSRPIKILTRLTII
VSDPSHCNVLRATSSRARLYDVVAVFPKTEKLFHIACTHLDVDLVCITVTEKLPFYFKRPPINVAIDRGLAFELVYSPAI
KDSTMRRYTISSALNLMQICKGKNVIISSAAERPLEIRGPYDVANLGLLFGLSESDAKAAVSTNCRAALLHGETRKTAFG
IISTVKKPRPSEGDEDCLPASKKAKCEG
;
;MAVFADLDLRAGSDLKALRGLVETAAHLGYSVVAINHIVDFKEKKQEIEKPVAVSELFTTLPIVQGKSRPIKILTRLTII
VSDPSHCNVLRATSSRARLYDVVAVFPKTEKLFHIACTHLDVDLVCITVTEKLPFYFKRPPINVAIDRGLAFELVYSPAI
KDSTMRRYTISSALNLMQICKGKNVIISSAAERPLEIRGPYDVANLGLLFGLSESDAKAAVSTNCRAALLHGETRKTAFG
IISTVKKPRPSEGDEDCLPASKKAKCEG
;
I,J ? 
10 'polypeptide(L)'   no no 
;MAGPVKDREAFQRLNFLYQAAHCVLAQDPENQALARFYCYTERTIAKRLVLRRDPSVKRTLCRGCSSLLVPGLTCTQRQR
RCRGQRWTVQTCLTCQRSQRFLNDPGHLLWGDRPEAQLGSQADSKPLQPLPNTAHSISDRLPEEKMQTQGSSNQ
;
;MAGPVKDREAFQRLNFLYQAAHCVLAQDPENQALARFYCYTERTIAKRLVLRRDPSVKRTLCRGCSSLLVPGLTCTQRQR
RCRGQRWTVQTCLTCQRSQRFLNDPGHLLWGDRPEAQLGSQADSKPLQPLPNTAHSISDRLPEEKMQTQGSSNQ
;
K   ? 
11 'polypeptide(L)'   no no 
;MATLRRLREAPRHLLVCEKSNFGNHKSRHRHLVQTHYYNYRVSFLIPECGILSEELKNLVMNTGPYYFVKNLPLHELITP
EFISTFIKKGSCYALTYNTHIDEDNTVALLPNGKLILSLDKDTYEETGLQGHPSQFSGRKIMKFIVSIDLMELSLNLDSK
KYERISWSFKEKKPLKFDFLLAWHKTGSEESTMMSYFSKYQIQEHQPKVALSTLRDLQCPVLQSSELEGTPEVSCRALEL
FDWLGAVFSNVDLNNEPNNFISTYCCPEPSTVVAKAYLCTITGFILPEKICLLLEHLCHYFDEPKLAPWVTLSVQGFADS
PVSWEKNEHGFRKGGEHLYNFVIFNNQDYWLQMAVGANDHCPP
;
;MATLRRLREAPRHLLVCEKSNFGNHKSRHRHLVQTHYYNYRVSFLIPECGILSEELKNLVMNTGPYYFVKNLPLHELITP
EFISTFIKKGSCYALTYNTHIDEDNTVALLPNGKLILSLDKDTYEETGLQGHPSQFSGRKIMKFIVSIDLMELSLNLDSK
KYERISWSFKEKKPLKFDFLLAWHKTGSEESTMMSYFSKYQIQEHQPKVALSTLRDLQCPVLQSSELEGTPEVSCRALEL
FDWLGAVFSNVDLNNEPNNFISTYCCPEPSTVVAKAYLCTITGFILPEKICLLLEHLCHYFDEPKLAPWVTLSVQGFADS
PVSWEKNEHGFRKGGEHLYNFVIFNNQDYWLQMAVGANDHCPP
;
L   ? 
12 polyribonucleotide no no GUUUCCGUAGUGUAGUGGUUAUCACGUUCGCCUAACACGCGAAAGGUCCCCGGUUCGAAACCGGGCGGAAAC 
GUUUCCGUAGUGUAGUGGUUAUCACGUUCGCCUAACACGCGAAAGGUCCCCGGUUCGAAACCGGGCGGAAAC T   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    A   n 
1  2    U   n 
1  3    A   n 
1  4    G   n 
1  5    G   n 
1  6    G   n 
1  7    C   n 
1  8    G   n 
1  9    G   n 
1  10   A   n 
1  11   G   n 
1  12   G   n 
1  13   G   n 
1  14   A   n 
1  15   A   n 
1  16   G   n 
1  17   C   n 
1  18   U   n 
1  19   C   n 
1  20   A   n 
1  21   U   n 
1  22   C   n 
1  23   A   n 
1  24   G   n 
1  25   U   n 
1  26   G   n 
1  27   G   n 
1  28   G   n 
1  29   G   n 
1  30   C   n 
1  31   C   n 
1  32   A   n 
1  33   C   n 
1  34   G   n 
1  35   A   n 
1  36   G   n 
1  37   C   n 
1  38   U   n 
1  39   G   n 
1  40   A   n 
1  41   G   n 
1  42   U   n 
1  43   G   n 
1  44   C   n 
1  45   G   n 
1  46   U   n 
1  47   C   n 
1  48   C   n 
1  49   U   n 
1  50   G   n 
1  51   U   n 
1  52   C   n 
1  53   A   n 
1  54   C   n 
1  55   U   n 
1  56   C   n 
1  57   C   n 
1  58   A   n 
1  59   C   n 
1  60   U   n 
1  61   C   n 
1  62   C   n 
1  63   C   n 
1  64   A   n 
1  65   U   n 
1  66   G   n 
1  67   U   n 
1  68   C   n 
1  69   C   n 
1  70   C   n 
1  71   U   n 
1  72   U   n 
1  73   G   n 
1  74   G   n 
1  75   G   n 
1  76   A   n 
1  77   A   n 
1  78   G   n 
1  79   G   n 
1  80   U   n 
1  81   C   n 
1  82   U   n 
1  83   G   n 
1  84   A   n 
1  85   G   n 
1  86   A   n 
1  87   C   n 
1  88   U   n 
1  89   A   n 
1  90   G   n 
1  91   G   n 
1  92   G   n 
1  93   C   n 
1  94   C   n 
1  95   A   n 
1  96   G   n 
1  97   A   n 
1  98   G   n 
1  99   G   n 
1  100  C   n 
1  101  G   n 
1  102  G   n 
1  103  C   n 
1  104  C   n 
1  105  C   n 
1  106  U   n 
1  107  A   n 
1  108  A   n 
1  109  C   n 
1  110  A   n 
1  111  G   n 
1  112  G   n 
1  113  G   n 
1  114  C   n 
1  115  U   n 
1  116  C   n 
1  117  U   n 
1  118  C   n 
1  119  C   n 
1  120  C   n 
1  121  U   n 
1  122  G   n 
1  123  A   n 
1  124  G   n 
1  125  C   n 
1  126  U   n 
1  127  U   n 
1  128  C   n 
1  129  G   n 
1  130  G   n 
1  131  G   n 
1  132  G   n 
1  133  A   n 
1  134  G   n 
1  135  G   n 
1  136  U   n 
1  137  G   n 
1  138  A   n 
1  139  G   n 
1  140  U   n 
1  141  U   n 
1  142  C   n 
1  143  C   n 
1  144  C   n 
1  145  A   n 
1  146  G   n 
1  147  A   n 
1  148  G   n 
1  149  A   n 
1  150  A   n 
1  151  C   n 
1  152  G   n 
1  153  G   n 
1  154  G   n 
1  155  G   n 
1  156  C   n 
1  157  U   n 
1  158  C   n 
1  159  C   n 
1  160  G   n 
1  161  C   n 
1  162  G   n 
1  163  C   n 
1  164  G   n 
1  165  A   n 
1  166  G   n 
1  167  G   n 
1  168  U   n 
1  169  C   n 
1  170  A   n 
1  171  G   n 
1  172  A   n 
1  173  C   n 
1  174  U   n 
1  175  G   n 
1  176  G   n 
1  177  G   n 
1  178  C   n 
1  179  A   n 
1  180  G   n 
1  181  G   n 
1  182  A   n 
1  183  G   n 
1  184  A   n 
1  185  U   n 
1  186  G   n 
1  187  C   n 
1  188  C   n 
1  189  G   n 
1  190  U   n 
1  191  G   n 
1  192  G   n 
1  193  A   n 
1  194  C   n 
1  195  C   n 
1  196  C   n 
1  197  C   n 
1  198  G   n 
1  199  C   n 
1  200  C   n 
1  201  C   n 
1  202  U   n 
1  203  U   n 
1  204  C   n 
1  205  G   n 
1  206  G   n 
1  207  G   n 
1  208  G   n 
1  209  A   n 
1  210  G   n 
1  211  G   n 
1  212  G   n 
1  213  G   n 
1  214  C   n 
1  215  C   n 
1  216  C   n 
1  217  G   n 
1  218  G   n 
1  219  C   n 
1  220  G   n 
1  221  G   n 
1  222  A   n 
1  223  U   n 
1  224  G   n 
1  225  C   n 
1  226  C   n 
1  227  U   n 
1  228  C   n 
1  229  C   n 
1  230  U   n 
1  231  U   n 
1  232  U   n 
1  233  G   n 
1  234  C   n 
1  235  C   n 
1  236  G   n 
1  237  G   n 
1  238  A   n 
1  239  G   n 
1  240  C   n 
1  241  U   n 
1  242  U   n 
1  243  G   n 
1  244  G   n 
1  245  A   n 
1  246  A   n 
1  247  C   n 
1  248  A   n 
1  249  G   n 
1  250  A   n 
1  251  C   n 
1  252  U   n 
1  253  C   n 
1  254  A   n 
1  255  C   n 
1  256  G   n 
1  257  G   n 
1  258  C   n 
1  259  C   n 
1  260  A   n 
1  261  G   n 
1  262  C   n 
1  263  G   n 
1  264  A   n 
1  265  A   n 
1  266  G   n 
1  267  U   n 
1  268  G   n 
1  269  A   n 
1  270  G   n 
1  271  U   n 
1  272  U   n 
1  273  C   n 
1  274  A   n 
1  275  A   n 
1  276  U   n 
1  277  G   n 
1  278  G   n 
1  279  C   n 
1  280  U   n 
1  281  G   n 
1  282  A   n 
1  283  G   n 
1  284  G   n 
1  285  U   n 
1  286  G   n 
1  287  A   n 
1  288  G   n 
1  289  G   n 
1  290  U   n 
1  291  A   n 
1  292  C   n 
1  293  C   n 
1  294  C   n 
1  295  C   n 
1  296  G   n 
1  297  C   n 
1  298  A   n 
1  299  G   n 
1  300  G   n 
1  301  G   n 
1  302  G   n 
1  303  A   n 
1  304  C   n 
1  305  C   n 
1  306  U   n 
1  307  C   n 
1  308  A   n 
1  309  U   n 
1  310  A   n 
1  311  A   n 
1  312  C   n 
1  313  C   n 
1  314  C   n 
1  315  A   n 
1  316  A   n 
1  317  U   n 
1  318  U   n 
1  319  C   n 
1  320  A   n 
1  321  G   n 
1  322  A   n 
1  323  C   n 
1  324  U   n 
1  325  A   n 
1  326  C   n 
1  327  U   n 
1  328  C   n 
1  329  U   n 
1  330  C   n 
1  331  C   n 
1  332  U   n 
1  333  C   n 
1  334  C   n 
1  335  G   n 
1  336  C   n 
1  337  C   n 
1  338  C   n 
1  339  A   n 
1  340  U   n 
1  341  U   n 
2  1    MET n 
2  2    SER n 
2  3    ASN n 
2  4    ALA n 
2  5    LYS n 
2  6    GLU n 
2  7    ARG n 
2  8    LYS n 
2  9    HIS n 
2  10   ALA n 
2  11   LYS n 
2  12   LYS n 
2  13   MET n 
2  14   ARG n 
2  15   ASN n 
2  16   GLN n 
2  17   PRO n 
2  18   THR n 
2  19   ASN n 
2  20   VAL n 
2  21   THR n 
2  22   LEU n 
2  23   SER n 
2  24   SER n 
2  25   GLY n 
2  26   PHE n 
2  27   VAL n 
2  28   ALA n 
2  29   ASP n 
2  30   ARG n 
2  31   GLY n 
2  32   VAL n 
2  33   LYS n 
2  34   HIS n 
2  35   HIS n 
2  36   SER n 
2  37   GLY n 
2  38   GLY n 
2  39   GLU n 
2  40   LYS n 
2  41   PRO n 
2  42   PHE n 
2  43   GLN n 
2  44   ALA n 
2  45   GLN n 
2  46   LYS n 
2  47   GLN n 
2  48   GLU n 
2  49   PRO n 
2  50   HIS n 
2  51   PRO n 
2  52   GLY n 
2  53   THR n 
2  54   SER n 
2  55   ARG n 
2  56   GLN n 
2  57   ARG n 
2  58   GLN n 
2  59   THR n 
2  60   ARG n 
2  61   VAL n 
2  62   ASN n 
2  63   PRO n 
2  64   HIS n 
2  65   SER n 
2  66   LEU n 
2  67   PRO n 
2  68   ASP n 
2  69   PRO n 
2  70   GLU n 
2  71   VAL n 
2  72   ASN n 
2  73   GLU n 
2  74   GLN n 
2  75   SER n 
2  76   SER n 
2  77   SER n 
2  78   LYS n 
2  79   GLY n 
2  80   MET n 
2  81   PHE n 
2  82   ARG n 
2  83   LYS n 
2  84   LYS n 
2  85   GLY n 
2  86   GLY n 
2  87   TRP n 
2  88   LYS n 
2  89   ALA n 
2  90   GLY n 
2  91   PRO n 
2  92   GLU n 
2  93   GLY n 
2  94   THR n 
2  95   SER n 
2  96   GLN n 
2  97   GLU n 
2  98   ILE n 
2  99   PRO n 
2  100  LYS n 
2  101  TYR n 
2  102  ILE n 
2  103  THR n 
2  104  ALA n 
2  105  SER n 
2  106  THR n 
2  107  PHE n 
2  108  ALA n 
2  109  GLN n 
2  110  ALA n 
2  111  ARG n 
2  112  ALA n 
2  113  ALA n 
2  114  GLU n 
2  115  ILE n 
2  116  SER n 
2  117  ALA n 
2  118  MET n 
2  119  LEU n 
2  120  LYS n 
2  121  ALA n 
2  122  VAL n 
2  123  THR n 
2  124  GLN n 
2  125  LYS n 
2  126  SER n 
2  127  SER n 
2  128  ASN n 
2  129  SER n 
2  130  LEU n 
2  131  VAL n 
2  132  PHE n 
2  133  GLN n 
2  134  THR n 
2  135  LEU n 
2  136  PRO n 
2  137  ARG n 
2  138  HIS n 
2  139  MET n 
2  140  ARG n 
2  141  ARG n 
2  142  ARG n 
2  143  ALA n 
2  144  MET n 
2  145  SER n 
2  146  HIS n 
2  147  ASN n 
2  148  VAL n 
2  149  LYS n 
2  150  ARG n 
2  151  LEU n 
2  152  PRO n 
2  153  ARG n 
2  154  ARG n 
2  155  LEU n 
2  156  GLN n 
2  157  GLU n 
2  158  ILE n 
2  159  ALA n 
2  160  GLN n 
2  161  LYS n 
2  162  GLU n 
2  163  ALA n 
2  164  GLU n 
2  165  LYS n 
2  166  ALA n 
2  167  VAL n 
2  168  HIS n 
2  169  GLN n 
2  170  LYS n 
2  171  LYS n 
2  172  GLU n 
2  173  HIS n 
2  174  SER n 
2  175  LYS n 
2  176  ASN n 
2  177  LYS n 
2  178  CYS n 
2  179  HIS n 
2  180  LYS n 
2  181  ALA n 
2  182  ARG n 
2  183  ARG n 
2  184  CYS n 
2  185  HIS n 
2  186  MET n 
2  187  ASN n 
2  188  ARG n 
2  189  THR n 
2  190  LEU n 
2  191  GLU n 
2  192  PHE n 
2  193  ASN n 
2  194  ARG n 
2  195  ARG n 
2  196  GLN n 
2  197  LYS n 
2  198  LYS n 
2  199  ASN n 
2  200  ILE n 
2  201  TRP n 
2  202  LEU n 
2  203  GLU n 
2  204  THR n 
2  205  HIS n 
2  206  ILE n 
2  207  TRP n 
2  208  HIS n 
2  209  ALA n 
2  210  LYS n 
2  211  ARG n 
2  212  PHE n 
2  213  HIS n 
2  214  MET n 
2  215  VAL n 
2  216  LYS n 
2  217  LYS n 
2  218  TRP n 
2  219  GLY n 
2  220  TYR n 
2  221  CYS n 
2  222  LEU n 
2  223  GLY n 
2  224  GLU n 
2  225  ARG n 
2  226  PRO n 
2  227  THR n 
2  228  VAL n 
2  229  LYS n 
2  230  SER n 
2  231  HIS n 
2  232  ARG n 
2  233  ALA n 
2  234  CYS n 
2  235  TYR n 
2  236  ARG n 
2  237  ALA n 
2  238  MET n 
2  239  THR n 
2  240  ASN n 
2  241  ARG n 
2  242  CYS n 
2  243  LEU n 
2  244  LEU n 
2  245  GLN n 
2  246  ASP n 
2  247  LEU n 
2  248  SER n 
2  249  TYR n 
2  250  TYR n 
2  251  CYS n 
2  252  CYS n 
2  253  LEU n 
2  254  GLU n 
2  255  LEU n 
2  256  LYS n 
2  257  GLY n 
2  258  LYS n 
2  259  GLU n 
2  260  GLU n 
2  261  GLU n 
2  262  ILE n 
2  263  LEU n 
2  264  LYS n 
2  265  ALA n 
2  266  LEU n 
2  267  SER n 
2  268  GLY n 
2  269  MET n 
2  270  CYS n 
2  271  ASN n 
2  272  ILE n 
2  273  ASP n 
2  274  THR n 
2  275  GLY n 
2  276  LEU n 
2  277  THR n 
2  278  PHE n 
2  279  ALA n 
2  280  ALA n 
2  281  VAL n 
2  282  HIS n 
2  283  CYS n 
2  284  LEU n 
2  285  SER n 
2  286  GLY n 
2  287  LYS n 
2  288  ARG n 
2  289  GLN n 
2  290  GLY n 
2  291  SER n 
2  292  LEU n 
2  293  VAL n 
2  294  LEU n 
2  295  TYR n 
2  296  ARG n 
2  297  VAL n 
2  298  ASN n 
2  299  LYS n 
2  300  TYR n 
2  301  PRO n 
2  302  ARG n 
2  303  GLU n 
2  304  MET n 
2  305  LEU n 
2  306  GLY n 
2  307  PRO n 
2  308  VAL n 
2  309  THR n 
2  310  PHE n 
2  311  ILE n 
2  312  TRP n 
2  313  LYS n 
2  314  SER n 
2  315  GLN n 
2  316  ARG n 
2  317  THR n 
2  318  PRO n 
2  319  GLY n 
2  320  ASP n 
2  321  PRO n 
2  322  SER n 
2  323  GLU n 
2  324  SER n 
2  325  ARG n 
2  326  GLN n 
2  327  LEU n 
2  328  TRP n 
2  329  ILE n 
2  330  TRP n 
2  331  LEU n 
2  332  HIS n 
2  333  PRO n 
2  334  THR n 
2  335  LEU n 
2  336  LYS n 
2  337  GLN n 
2  338  ASP n 
2  339  ILE n 
2  340  LEU n 
2  341  GLU n 
2  342  GLU n 
2  343  ILE n 
2  344  LYS n 
2  345  ALA n 
2  346  ALA n 
2  347  CYS n 
2  348  GLN n 
2  349  CYS n 
2  350  VAL n 
2  351  GLU n 
2  352  PRO n 
2  353  ILE n 
2  354  LYS n 
2  355  SER n 
2  356  ALA n 
2  357  VAL n 
2  358  CYS n 
2  359  ILE n 
2  360  ALA n 
2  361  ASP n 
2  362  PRO n 
2  363  LEU n 
2  364  PRO n 
2  365  THR n 
2  366  PRO n 
2  367  SER n 
2  368  GLN n 
2  369  GLU n 
2  370  LYS n 
2  371  SER n 
2  372  GLN n 
2  373  THR n 
2  374  GLU n 
2  375  LEU n 
2  376  PRO n 
2  377  ASP n 
2  378  GLU n 
2  379  LYS n 
2  380  ILE n 
2  381  GLY n 
2  382  LYS n 
2  383  LYS n 
2  384  ARG n 
2  385  LYS n 
2  386  ARG n 
2  387  LYS n 
2  388  ASP n 
2  389  ASP n 
2  390  GLY n 
2  391  GLU n 
2  392  ASN n 
2  393  ALA n 
2  394  LYS n 
2  395  PRO n 
2  396  ILE n 
2  397  LYS n 
2  398  LYS n 
2  399  ILE n 
2  400  ILE n 
2  401  GLY n 
2  402  ASP n 
2  403  GLY n 
2  404  THR n 
2  405  ARG n 
2  406  ASP n 
2  407  PRO n 
2  408  CYS n 
2  409  LEU n 
2  410  PRO n 
2  411  TYR n 
2  412  SER n 
2  413  TRP n 
2  414  ILE n 
2  415  SER n 
2  416  PRO n 
2  417  THR n 
2  418  THR n 
2  419  GLY n 
2  420  ILE n 
2  421  ILE n 
2  422  ILE n 
2  423  SER n 
2  424  ASP n 
2  425  LEU n 
2  426  THR n 
2  427  MET n 
2  428  GLU n 
2  429  MET n 
2  430  ASN n 
2  431  ARG n 
2  432  PHE n 
2  433  ARG n 
2  434  LEU n 
2  435  ILE n 
2  436  GLY n 
2  437  PRO n 
2  438  LEU n 
2  439  SER n 
2  440  HIS n 
2  441  SER n 
2  442  ILE n 
2  443  LEU n 
2  444  THR n 
2  445  GLU n 
2  446  ALA n 
2  447  ILE n 
2  448  LYS n 
2  449  ALA n 
2  450  ALA n 
2  451  SER n 
2  452  VAL n 
2  453  HIS n 
2  454  THR n 
2  455  VAL n 
2  456  GLY n 
2  457  GLU n 
2  458  ASP n 
2  459  THR n 
2  460  GLU n 
2  461  GLU n 
2  462  THR n 
2  463  PRO n 
2  464  HIS n 
2  465  ARG n 
2  466  TRP n 
2  467  TRP n 
2  468  ILE n 
2  469  GLU n 
2  470  THR n 
2  471  CYS n 
2  472  LYS n 
2  473  LYS n 
2  474  PRO n 
2  475  ASP n 
2  476  SER n 
2  477  VAL n 
2  478  SER n 
2  479  LEU n 
2  480  HIS n 
2  481  CYS n 
2  482  ARG n 
2  483  GLN n 
2  484  GLU n 
2  485  ALA n 
2  486  ILE n 
2  487  PHE n 
2  488  GLU n 
2  489  LEU n 
2  490  LEU n 
2  491  GLY n 
2  492  GLY n 
2  493  ILE n 
2  494  THR n 
2  495  SER n 
2  496  PRO n 
2  497  ALA n 
2  498  GLU n 
2  499  ILE n 
2  500  PRO n 
2  501  ALA n 
2  502  GLY n 
2  503  THR n 
2  504  ILE n 
2  505  LEU n 
2  506  GLY n 
2  507  LEU n 
2  508  THR n 
2  509  VAL n 
2  510  GLY n 
2  511  ASP n 
2  512  PRO n 
2  513  ARG n 
2  514  ILE n 
2  515  ASN n 
2  516  LEU n 
2  517  PRO n 
2  518  GLN n 
2  519  LYS n 
2  520  LYS n 
2  521  SER n 
2  522  LYS n 
2  523  ALA n 
2  524  LEU n 
2  525  PRO n 
2  526  ASN n 
2  527  PRO n 
2  528  GLU n 
2  529  LYS n 
2  530  CYS n 
2  531  GLN n 
2  532  ASP n 
2  533  ASN n 
2  534  GLU n 
2  535  LYS n 
2  536  VAL n 
2  537  ARG n 
2  538  GLN n 
2  539  LEU n 
2  540  LEU n 
2  541  LEU n 
2  542  GLU n 
2  543  GLY n 
2  544  VAL n 
2  545  PRO n 
2  546  VAL n 
2  547  GLU n 
2  548  CYS n 
2  549  THR n 
2  550  HIS n 
2  551  SER n 
2  552  PHE n 
2  553  ILE n 
2  554  TRP n 
2  555  ASN n 
2  556  GLN n 
2  557  ASP n 
2  558  ILE n 
2  559  CYS n 
2  560  LYS n 
2  561  SER n 
2  562  VAL n 
2  563  THR n 
2  564  GLU n 
2  565  ASN n 
2  566  LYS n 
2  567  ILE n 
2  568  SER n 
2  569  ASP n 
2  570  GLN n 
2  571  ASP n 
2  572  LEU n 
2  573  ASN n 
2  574  ARG n 
2  575  MET n 
2  576  ARG n 
2  577  SER n 
2  578  GLU n 
2  579  LEU n 
2  580  LEU n 
2  581  VAL n 
2  582  PRO n 
2  583  GLY n 
2  584  SER n 
2  585  GLN n 
2  586  LEU n 
2  587  ILE n 
2  588  LEU n 
2  589  GLY n 
2  590  PRO n 
2  591  HIS n 
2  592  GLU n 
2  593  SER n 
2  594  LYS n 
2  595  ILE n 
2  596  PRO n 
2  597  ILE n 
2  598  LEU n 
2  599  LEU n 
2  600  ILE n 
2  601  GLN n 
2  602  GLN n 
2  603  PRO n 
2  604  GLY n 
2  605  LYS n 
2  606  VAL n 
2  607  THR n 
2  608  GLY n 
2  609  GLU n 
2  610  ASP n 
2  611  ARG n 
2  612  LEU n 
2  613  GLY n 
2  614  TRP n 
2  615  GLY n 
2  616  SER n 
2  617  GLY n 
2  618  TRP n 
2  619  ASP n 
2  620  VAL n 
2  621  LEU n 
2  622  LEU n 
2  623  PRO n 
2  624  LYS n 
2  625  GLY n 
2  626  TRP n 
2  627  GLY n 
2  628  MET n 
2  629  ALA n 
2  630  PHE n 
2  631  TRP n 
2  632  ILE n 
2  633  PRO n 
2  634  PHE n 
2  635  ILE n 
2  636  TYR n 
2  637  ARG n 
2  638  GLY n 
2  639  VAL n 
2  640  ARG n 
2  641  VAL n 
2  642  GLY n 
2  643  GLY n 
2  644  LEU n 
2  645  LYS n 
2  646  GLU n 
2  647  SER n 
2  648  ALA n 
2  649  VAL n 
2  650  HIS n 
2  651  SER n 
2  652  GLN n 
2  653  TYR n 
2  654  LYS n 
2  655  ARG n 
2  656  SER n 
2  657  PRO n 
2  658  ASN n 
2  659  VAL n 
2  660  PRO n 
2  661  GLY n 
2  662  ASP n 
2  663  PHE n 
2  664  PRO n 
2  665  ASP n 
2  666  CYS n 
2  667  PRO n 
2  668  ALA n 
2  669  GLY n 
2  670  MET n 
2  671  LEU n 
2  672  PHE n 
2  673  ALA n 
2  674  GLU n 
2  675  GLU n 
2  676  GLN n 
2  677  ALA n 
2  678  LYS n 
2  679  ASN n 
2  680  LEU n 
2  681  LEU n 
2  682  GLU n 
2  683  LYS n 
2  684  TYR n 
2  685  LYS n 
2  686  ARG n 
2  687  ARG n 
2  688  PRO n 
2  689  PRO n 
2  690  ALA n 
2  691  LYS n 
2  692  ARG n 
2  693  PRO n 
2  694  ASN n 
2  695  TYR n 
2  696  VAL n 
2  697  LYS n 
2  698  LEU n 
2  699  GLY n 
2  700  THR n 
2  701  LEU n 
2  702  ALA n 
2  703  PRO n 
2  704  PHE n 
2  705  CYS n 
2  706  CYS n 
2  707  PRO n 
2  708  TRP n 
2  709  GLU n 
2  710  GLN n 
2  711  LEU n 
2  712  THR n 
2  713  GLN n 
2  714  ASP n 
2  715  TRP n 
2  716  GLU n 
2  717  SER n 
2  718  ARG n 
2  719  VAL n 
2  720  GLN n 
2  721  ALA n 
2  722  TYR n 
2  723  GLU n 
2  724  GLU n 
2  725  PRO n 
2  726  SER n 
2  727  VAL n 
2  728  ALA n 
2  729  SER n 
2  730  SER n 
2  731  PRO n 
2  732  ASN n 
2  733  GLY n 
2  734  LYS n 
2  735  GLU n 
2  736  SER n 
2  737  ASP n 
2  738  LEU n 
2  739  ARG n 
2  740  ARG n 
2  741  SER n 
2  742  GLU n 
2  743  VAL n 
2  744  PRO n 
2  745  CYS n 
2  746  ALA n 
2  747  PRO n 
2  748  MET n 
2  749  PRO n 
2  750  LYS n 
2  751  LYS n 
2  752  THR n 
2  753  HIS n 
2  754  GLN n 
2  755  PRO n 
2  756  SER n 
2  757  ASP n 
2  758  GLU n 
2  759  VAL n 
2  760  GLY n 
2  761  THR n 
2  762  SER n 
2  763  ILE n 
2  764  GLU n 
2  765  HIS n 
2  766  PRO n 
2  767  ARG n 
2  768  GLU n 
2  769  ALA n 
2  770  GLU n 
2  771  GLU n 
2  772  VAL n 
2  773  MET n 
2  774  ASP n 
2  775  ALA n 
2  776  GLY n 
2  777  CYS n 
2  778  GLN n 
2  779  GLU n 
2  780  SER n 
2  781  ALA n 
2  782  GLY n 
2  783  PRO n 
2  784  GLU n 
2  785  ARG n 
2  786  ILE n 
2  787  THR n 
2  788  ASP n 
2  789  GLN n 
2  790  GLU n 
2  791  ALA n 
2  792  SER n 
2  793  GLU n 
2  794  ASN n 
2  795  HIS n 
2  796  VAL n 
2  797  ALA n 
2  798  ALA n 
2  799  THR n 
2  800  GLY n 
2  801  SER n 
2  802  HIS n 
2  803  LEU n 
2  804  CYS n 
2  805  VAL n 
2  806  LEU n 
2  807  ARG n 
2  808  SER n 
2  809  ARG n 
2  810  LYS n 
2  811  LEU n 
2  812  LEU n 
2  813  LYS n 
2  814  GLN n 
2  815  LEU n 
2  816  SER n 
2  817  ALA n 
2  818  TRP n 
2  819  CYS n 
2  820  GLY n 
2  821  PRO n 
2  822  SER n 
2  823  SER n 
2  824  GLU n 
2  825  ASP n 
2  826  SER n 
2  827  ARG n 
2  828  GLY n 
2  829  GLY n 
2  830  ARG n 
2  831  ARG n 
2  832  ALA n 
2  833  PRO n 
2  834  GLY n 
2  835  ARG n 
2  836  GLY n 
2  837  GLN n 
2  838  GLN n 
2  839  GLY n 
2  840  LEU n 
2  841  THR n 
2  842  ARG n 
2  843  GLU n 
2  844  ALA n 
2  845  CYS n 
2  846  LEU n 
2  847  SER n 
2  848  ILE n 
2  849  LEU n 
2  850  GLY n 
2  851  HIS n 
2  852  PHE n 
2  853  PRO n 
2  854  ARG n 
2  855  ALA n 
2  856  LEU n 
2  857  VAL n 
2  858  TRP n 
2  859  VAL n 
2  860  SER n 
2  861  LEU n 
2  862  SER n 
2  863  LEU n 
2  864  LEU n 
2  865  SER n 
2  866  LYS n 
2  867  GLY n 
2  868  SER n 
2  869  PRO n 
2  870  GLU n 
2  871  PRO n 
2  872  HIS n 
2  873  THR n 
2  874  MET n 
2  875  ILE n 
2  876  CYS n 
2  877  VAL n 
2  878  PRO n 
2  879  ALA n 
2  880  LYS n 
2  881  GLU n 
2  882  ASP n 
2  883  PHE n 
2  884  LEU n 
2  885  GLN n 
2  886  LEU n 
2  887  HIS n 
2  888  GLU n 
2  889  ASP n 
2  890  TRP n 
2  891  HIS n 
2  892  TYR n 
2  893  CYS n 
2  894  GLY n 
2  895  PRO n 
2  896  GLN n 
2  897  GLU n 
2  898  SER n 
2  899  LYS n 
2  900  HIS n 
2  901  SER n 
2  902  ASP n 
2  903  PRO n 
2  904  PHE n 
2  905  ARG n 
2  906  SER n 
2  907  LYS n 
2  908  ILE n 
2  909  LEU n 
2  910  LYS n 
2  911  GLN n 
2  912  LYS n 
2  913  GLU n 
2  914  LYS n 
2  915  LYS n 
2  916  LYS n 
2  917  ARG n 
2  918  GLU n 
2  919  LYS n 
2  920  ARG n 
2  921  GLN n 
2  922  LYS n 
2  923  PRO n 
2  924  GLY n 
2  925  ARG n 
2  926  ALA n 
2  927  SER n 
2  928  SER n 
2  929  ASP n 
2  930  GLY n 
2  931  PRO n 
2  932  ALA n 
2  933  GLY n 
2  934  GLU n 
2  935  GLU n 
2  936  PRO n 
2  937  VAL n 
2  938  ALA n 
2  939  GLY n 
2  940  GLN n 
2  941  GLU n 
2  942  ALA n 
2  943  LEU n 
2  944  THR n 
2  945  LEU n 
2  946  GLY n 
2  947  LEU n 
2  948  TRP n 
2  949  SER n 
2  950  GLY n 
2  951  PRO n 
2  952  LEU n 
2  953  PRO n 
2  954  ARG n 
2  955  VAL n 
2  956  THR n 
2  957  LEU n 
2  958  HIS n 
2  959  CYS n 
2  960  SER n 
2  961  ARG n 
2  962  THR n 
2  963  LEU n 
2  964  LEU n 
2  965  GLY n 
2  966  PHE n 
2  967  VAL n 
2  968  THR n 
2  969  GLN n 
2  970  GLY n 
2  971  ASP n 
2  972  PHE n 
2  973  SER n 
2  974  MET n 
2  975  ALA n 
2  976  VAL n 
2  977  GLY n 
2  978  CYS n 
2  979  GLY n 
2  980  GLU n 
2  981  ALA n 
2  982  LEU n 
2  983  GLY n 
2  984  PHE n 
2  985  VAL n 
2  986  SER n 
2  987  LEU n 
2  988  THR n 
2  989  GLY n 
2  990  LEU n 
2  991  LEU n 
2  992  ASP n 
2  993  MET n 
2  994  LEU n 
2  995  SER n 
2  996  SER n 
2  997  GLN n 
2  998  PRO n 
2  999  ALA n 
2  1000 ALA n 
2  1001 GLN n 
2  1002 ARG n 
2  1003 GLY n 
2  1004 LEU n 
2  1005 VAL n 
2  1006 LEU n 
2  1007 LEU n 
2  1008 ARG n 
2  1009 PRO n 
2  1010 PRO n 
2  1011 ALA n 
2  1012 SER n 
2  1013 LEU n 
2  1014 GLN n 
2  1015 TYR n 
2  1016 ARG n 
2  1017 PHE n 
2  1018 ALA n 
2  1019 ARG n 
2  1020 ILE n 
2  1021 ALA n 
2  1022 ILE n 
2  1023 GLU n 
2  1024 VAL n 
3  1    MET n 
3  2    ALA n 
3  3    ALA n 
3  4    ALA n 
3  5    PRO n 
3  6    GLN n 
3  7    ALA n 
3  8    PRO n 
3  9    GLY n 
3  10   ARG n 
3  11   GLY n 
3  12   SER n 
3  13   LEU n 
3  14   ARG n 
3  15   LYS n 
3  16   THR n 
3  17   ARG n 
3  18   PRO n 
3  19   LEU n 
3  20   VAL n 
3  21   VAL n 
3  22   LYS n 
3  23   THR n 
3  24   SER n 
3  25   LEU n 
3  26   ASN n 
3  27   ASN n 
3  28   PRO n 
3  29   TYR n 
3  30   ILE n 
3  31   ILE n 
3  32   ARG n 
3  33   TRP n 
3  34   SER n 
3  35   ALA n 
3  36   LEU n 
3  37   GLU n 
3  38   SER n 
3  39   GLU n 
3  40   ASP n 
3  41   MET n 
3  42   HIS n 
3  43   PHE n 
3  44   ILE n 
3  45   LEU n 
3  46   GLN n 
3  47   THR n 
3  48   LEU n 
3  49   GLU n 
3  50   ASP n 
3  51   ARG n 
3  52   LEU n 
3  53   LYS n 
3  54   ALA n 
3  55   ILE n 
3  56   GLY n 
3  57   LEU n 
3  58   GLN n 
3  59   LYS n 
3  60   ILE n 
3  61   GLU n 
3  62   ASP n 
3  63   LYS n 
3  64   LYS n 
3  65   LYS n 
3  66   LYS n 
3  67   ASN n 
3  68   LYS n 
3  69   THR n 
3  70   PRO n 
3  71   PHE n 
3  72   LEU n 
3  73   LYS n 
3  74   LYS n 
3  75   GLU n 
3  76   SER n 
3  77   ARG n 
3  78   GLU n 
3  79   LYS n 
3  80   CYS n 
3  81   SER n 
3  82   ILE n 
3  83   ALA n 
3  84   VAL n 
3  85   ASP n 
3  86   ILE n 
3  87   SER n 
3  88   GLU n 
3  89   ASN n 
3  90   LEU n 
3  91   LYS n 
3  92   GLU n 
3  93   LYS n 
3  94   LYS n 
3  95   THR n 
3  96   ASP n 
3  97   ALA n 
3  98   LYS n 
3  99   GLN n 
3  100  GLN n 
3  101  VAL n 
3  102  SER n 
3  103  GLY n 
3  104  TRP n 
3  105  THR n 
3  106  PRO n 
3  107  ALA n 
3  108  HIS n 
3  109  VAL n 
3  110  ARG n 
3  111  LYS n 
3  112  GLN n 
3  113  LEU n 
3  114  ALA n 
3  115  ILE n 
3  116  GLY n 
3  117  VAL n 
3  118  ASN n 
3  119  GLU n 
3  120  VAL n 
3  121  THR n 
3  122  ARG n 
3  123  ALA n 
3  124  LEU n 
3  125  GLU n 
3  126  ARG n 
3  127  ARG n 
3  128  GLU n 
3  129  LEU n 
3  130  LEU n 
3  131  LEU n 
3  132  VAL n 
3  133  LEU n 
3  134  VAL n 
3  135  CYS n 
3  136  LYS n 
3  137  SER n 
3  138  VAL n 
3  139  LYS n 
3  140  PRO n 
3  141  ALA n 
3  142  MET n 
3  143  ILE n 
3  144  THR n 
3  145  SER n 
3  146  HIS n 
3  147  LEU n 
3  148  ILE n 
3  149  GLN n 
3  150  LEU n 
3  151  SER n 
3  152  LEU n 
3  153  SER n 
3  154  ARG n 
3  155  SER n 
3  156  VAL n 
3  157  PRO n 
3  158  ALA n 
3  159  CYS n 
3  160  GLN n 
3  161  VAL n 
3  162  PRO n 
3  163  ARG n 
3  164  LEU n 
3  165  SER n 
3  166  GLU n 
3  167  ARG n 
3  168  ILE n 
3  169  ALA n 
3  170  PRO n 
3  171  VAL n 
3  172  ILE n 
3  173  GLY n 
3  174  LEU n 
3  175  LYS n 
3  176  CYS n 
3  177  VAL n 
3  178  LEU n 
3  179  ALA n 
3  180  LEU n 
3  181  ALA n 
3  182  PHE n 
3  183  LYS n 
3  184  LYS n 
3  185  ASN n 
3  186  THR n 
3  187  THR n 
3  188  ASP n 
3  189  PHE n 
3  190  VAL n 
3  191  ASP n 
3  192  GLU n 
3  193  VAL n 
3  194  ARG n 
3  195  ALA n 
3  196  ILE n 
3  197  ILE n 
3  198  PRO n 
3  199  ARG n 
3  200  VAL n 
3  201  PRO n 
3  202  SER n 
3  203  LEU n 
3  204  SER n 
3  205  VAL n 
3  206  PRO n 
3  207  TRP n 
3  208  LEU n 
3  209  GLN n 
3  210  ASP n 
3  211  ARG n 
3  212  ILE n 
3  213  GLU n 
3  214  ASP n 
3  215  SER n 
3  216  GLY n 
3  217  GLU n 
3  218  ASN n 
3  219  LEU n 
3  220  GLU n 
3  221  THR n 
3  222  GLU n 
3  223  PRO n 
3  224  LEU n 
3  225  GLU n 
3  226  SER n 
3  227  GLN n 
3  228  ASP n 
3  229  ARG n 
3  230  GLU n 
3  231  LEU n 
3  232  LEU n 
3  233  ASP n 
3  234  THR n 
3  235  SER n 
3  236  PHE n 
3  237  GLU n 
3  238  ASP n 
3  239  LEU n 
3  240  SER n 
3  241  LYS n 
3  242  PRO n 
3  243  LYS n 
3  244  ARG n 
3  245  LYS n 
3  246  LEU n 
3  247  ALA n 
3  248  ASP n 
3  249  GLY n 
3  250  ARG n 
3  251  GLN n 
3  252  ALA n 
3  253  SER n 
3  254  VAL n 
3  255  THR n 
3  256  LEU n 
3  257  GLN n 
3  258  PRO n 
3  259  LEU n 
3  260  LYS n 
3  261  ILE n 
3  262  LYS n 
3  263  LYS n 
3  264  LEU n 
3  265  ILE n 
3  266  PRO n 
3  267  ASN n 
3  268  PRO n 
3  269  ASN n 
3  270  LYS n 
3  271  ILE n 
3  272  ARG n 
3  273  LYS n 
3  274  PRO n 
3  275  PRO n 
3  276  LYS n 
3  277  SER n 
3  278  LYS n 
3  279  LYS n 
3  280  ALA n 
3  281  THR n 
3  282  PRO n 
3  283  LYS n 
4  1    MET n 
4  2    LYS n 
4  3    SER n 
4  4    VAL n 
4  5    ILE n 
4  6    TYR n 
4  7    HIS n 
4  8    ALA n 
4  9    LEU n 
4  10   SER n 
4  11   GLN n 
4  12   LYS n 
4  13   GLU n 
4  14   ALA n 
4  15   ASN n 
4  16   ASP n 
4  17   SER n 
4  18   ASP n 
4  19   VAL n 
4  20   GLN n 
4  21   PRO n 
4  22   SER n 
4  23   GLY n 
4  24   ALA n 
4  25   GLN n 
4  26   ARG n 
4  27   ALA n 
4  28   GLU n 
4  29   ALA n 
4  30   PHE n 
4  31   VAL n 
4  32   ARG n 
4  33   ALA n 
4  34   PHE n 
4  35   LEU n 
4  36   LYS n 
4  37   ARG n 
4  38   SER n 
4  39   THR n 
4  40   PRO n 
4  41   ARG n 
4  42   MET n 
4  43   SER n 
4  44   PRO n 
4  45   GLN n 
4  46   ALA n 
4  47   ARG n 
4  48   GLU n 
4  49   ASP n 
4  50   GLN n 
4  51   LEU n 
4  52   GLN n 
4  53   ARG n 
4  54   LYS n 
4  55   ALA n 
4  56   VAL n 
4  57   VAL n 
4  58   LEU n 
4  59   GLU n 
4  60   TYR n 
4  61   PHE n 
4  62   THR n 
4  63   ARG n 
4  64   HIS n 
4  65   LYS n 
4  66   ARG n 
4  67   LYS n 
4  68   GLU n 
4  69   LYS n 
4  70   LYS n 
4  71   LYS n 
4  72   LYS n 
4  73   ALA n 
4  74   LYS n 
4  75   GLY n 
4  76   LEU n 
4  77   SER n 
4  78   ALA n 
4  79   ARG n 
4  80   GLN n 
4  81   ARG n 
4  82   ARG n 
4  83   GLU n 
4  84   LEU n 
4  85   ARG n 
4  86   LEU n 
4  87   PHE n 
4  88   ASP n 
4  89   ILE n 
4  90   LYS n 
4  91   PRO n 
4  92   GLU n 
4  93   GLN n 
4  94   GLN n 
4  95   ARG n 
4  96   TYR n 
4  97   SER n 
4  98   LEU n 
4  99   PHE n 
4  100  LEU n 
4  101  PRO n 
4  102  LEU n 
4  103  HIS n 
4  104  GLU n 
4  105  LEU n 
4  106  TRP n 
4  107  LYS n 
4  108  GLN n 
4  109  TYR n 
4  110  ILE n 
4  111  ARG n 
4  112  ASP n 
4  113  LEU n 
4  114  CYS n 
4  115  SER n 
4  116  GLY n 
4  117  LEU n 
4  118  LYS n 
4  119  PRO n 
4  120  ASP n 
4  121  THR n 
4  122  GLN n 
4  123  PRO n 
4  124  GLN n 
4  125  MET n 
4  126  ILE n 
4  127  GLN n 
4  128  ALA n 
4  129  LYS n 
4  130  LEU n 
4  131  LEU n 
4  132  LYS n 
4  133  ALA n 
4  134  ASP n 
4  135  LEU n 
4  136  HIS n 
4  137  GLY n 
4  138  ALA n 
4  139  ILE n 
4  140  ILE n 
4  141  SER n 
4  142  VAL n 
4  143  THR n 
4  144  LYS n 
4  145  SER n 
4  146  LYS n 
4  147  CYS n 
4  148  PRO n 
4  149  SER n 
4  150  TYR n 
4  151  VAL n 
4  152  GLY n 
4  153  ILE n 
4  154  THR n 
4  155  GLY n 
4  156  ILE n 
4  157  LEU n 
4  158  LEU n 
4  159  GLN n 
4  160  GLU n 
4  161  THR n 
4  162  LYS n 
4  163  HIS n 
4  164  ILE n 
4  165  PHE n 
4  166  LYS n 
4  167  ILE n 
4  168  ILE n 
4  169  THR n 
4  170  LYS n 
4  171  GLU n 
4  172  ASP n 
4  173  ARG n 
4  174  LEU n 
4  175  LYS n 
4  176  VAL n 
4  177  ILE n 
4  178  PRO n 
4  179  LYS n 
4  180  LEU n 
4  181  ASN n 
4  182  CYS n 
4  183  VAL n 
4  184  PHE n 
4  185  THR n 
4  186  VAL n 
4  187  GLU n 
4  188  THR n 
4  189  ASP n 
4  190  GLY n 
4  191  PHE n 
4  192  ILE n 
4  193  SER n 
4  194  TYR n 
4  195  ILE n 
4  196  TYR n 
4  197  GLY n 
4  198  SER n 
4  199  LYS n 
4  200  PHE n 
4  201  GLN n 
4  202  LEU n 
4  203  ARG n 
4  204  SER n 
4  205  SER n 
4  206  GLU n 
4  207  ARG n 
4  208  SER n 
4  209  ALA n 
4  210  LYS n 
4  211  LYS n 
4  212  PHE n 
4  213  LYS n 
4  214  ALA n 
4  215  LYS n 
4  216  GLY n 
4  217  THR n 
4  218  ILE n 
4  219  ASP n 
4  220  LEU n 
5  1    MET n 
5  2    VAL n 
5  3    ARG n 
5  4    PHE n 
5  5    LYS n 
5  6    HIS n 
5  7    ARG n 
5  8    TYR n 
5  9    LEU n 
5  10   LEU n 
5  11   CYS n 
5  12   GLU n 
5  13   LEU n 
5  14   VAL n 
5  15   SER n 
5  16   ASP n 
5  17   ASP n 
5  18   PRO n 
5  19   ARG n 
5  20   CYS n 
5  21   ARG n 
5  22   LEU n 
5  23   SER n 
5  24   LEU n 
5  25   ASP n 
5  26   ASP n 
5  27   ARG n 
5  28   VAL n 
5  29   LEU n 
5  30   SER n 
5  31   SER n 
5  32   LEU n 
5  33   VAL n 
5  34   ARG n 
5  35   ASP n 
5  36   THR n 
5  37   ILE n 
5  38   ALA n 
5  39   ARG n 
5  40   VAL n 
5  41   HIS n 
5  42   GLY n 
5  43   THR n 
5  44   PHE n 
5  45   GLY n 
5  46   ALA n 
5  47   ALA n 
5  48   ALA n 
5  49   CYS n 
5  50   SER n 
5  51   ILE n 
5  52   GLY n 
5  53   PHE n 
5  54   ALA n 
5  55   VAL n 
5  56   ARG n 
5  57   TYR n 
5  58   LEU n 
5  59   ASN n 
5  60   ALA n 
5  61   TYR n 
5  62   THR n 
5  63   GLY n 
5  64   ILE n 
5  65   VAL n 
5  66   LEU n 
5  67   LEU n 
5  68   ARG n 
5  69   CYS n 
5  70   ARG n 
5  71   LYS n 
5  72   GLU n 
5  73   PHE n 
5  74   TYR n 
5  75   GLN n 
5  76   LEU n 
5  77   VAL n 
5  78   TRP n 
5  79   SER n 
5  80   ALA n 
5  81   LEU n 
5  82   PRO n 
5  83   PHE n 
5  84   ILE n 
5  85   THR n 
5  86   TYR n 
5  87   LEU n 
5  88   GLU n 
5  89   ASN n 
5  90   LYS n 
5  91   GLY n 
5  92   HIS n 
5  93   ARG n 
5  94   TYR n 
5  95   PRO n 
5  96   CYS n 
5  97   PHE n 
5  98   PHE n 
5  99   ASN n 
5  100  THR n 
5  101  LEU n 
5  102  HIS n 
5  103  VAL n 
5  104  GLY n 
5  105  GLY n 
5  106  THR n 
5  107  ILE n 
5  108  ARG n 
5  109  THR n 
5  110  CYS n 
5  111  GLN n 
5  112  LYS n 
5  113  PHE n 
5  114  LEU n 
5  115  ILE n 
5  116  GLN n 
5  117  TYR n 
5  118  ASN n 
5  119  ARG n 
5  120  ARG n 
5  121  GLN n 
5  122  LEU n 
5  123  LEU n 
5  124  ILE n 
5  125  LEU n 
5  126  LEU n 
5  127  GLN n 
5  128  ASN n 
5  129  CYS n 
5  130  THR n 
5  131  ASP n 
5  132  GLU n 
5  133  GLY n 
5  134  GLU n 
5  135  ARG n 
5  136  GLU n 
5  137  ALA n 
5  138  ILE n 
5  139  GLN n 
5  140  LYS n 
5  141  SER n 
5  142  VAL n 
5  143  THR n 
5  144  ARG n 
5  145  SER n 
5  146  CYS n 
5  147  LEU n 
5  148  LEU n 
5  149  GLU n 
5  150  GLU n 
5  151  GLU n 
5  152  GLU n 
5  153  GLU n 
5  154  SER n 
5  155  GLY n 
5  156  GLU n 
5  157  GLU n 
5  158  ALA n 
5  159  ALA n 
5  160  GLU n 
5  161  ALA n 
5  162  MET n 
5  163  GLU n 
6  1    MET n 
6  2    GLU n 
6  3    ASN n 
6  4    PHE n 
6  5    ARG n 
6  6    LYS n 
6  7    VAL n 
6  8    ARG n 
6  9    SER n 
6  10   GLU n 
6  11   GLU n 
6  12   ALA n 
6  13   PRO n 
6  14   ALA n 
6  15   GLY n 
6  16   CYS n 
6  17   GLY n 
6  18   ALA n 
6  19   GLU n 
6  20   GLY n 
6  21   GLY n 
6  22   GLY n 
6  23   PRO n 
6  24   GLY n 
6  25   SER n 
6  26   GLY n 
6  27   PRO n 
6  28   PHE n 
6  29   ALA n 
6  30   ASP n 
6  31   LEU n 
6  32   ALA n 
6  33   PRO n 
6  34   GLY n 
6  35   ALA n 
6  36   VAL n 
6  37   HIS n 
6  38   MET n 
6  39   ARG n 
6  40   VAL n 
6  41   LYS n 
6  42   GLU n 
6  43   GLY n 
6  44   SER n 
6  45   LYS n 
6  46   ILE n 
6  47   ARG n 
6  48   ASN n 
6  49   LEU n 
6  50   MET n 
6  51   ALA n 
6  52   PHE n 
6  53   ALA n 
6  54   THR n 
6  55   ALA n 
6  56   SER n 
6  57   MET n 
6  58   ALA n 
6  59   GLN n 
6  60   PRO n 
6  61   ALA n 
6  62   THR n 
6  63   ARG n 
6  64   ALA n 
6  65   ILE n 
6  66   VAL n 
6  67   PHE n 
6  68   SER n 
6  69   GLY n 
6  70   CYS n 
6  71   GLY n 
6  72   ARG n 
6  73   ALA n 
6  74   THR n 
6  75   THR n 
6  76   LYS n 
6  77   THR n 
6  78   VAL n 
6  79   THR n 
6  80   CYS n 
6  81   ALA n 
6  82   GLU n 
6  83   ILE n 
6  84   LEU n 
6  85   LYS n 
6  86   ARG n 
6  87   ARG n 
6  88   LEU n 
6  89   ALA n 
6  90   GLY n 
6  91   LEU n 
6  92   HIS n 
6  93   GLN n 
6  94   VAL n 
6  95   THR n 
6  96   ARG n 
6  97   LEU n 
6  98   ARG n 
6  99   TYR n 
6  100  ARG n 
6  101  SER n 
6  102  VAL n 
6  103  ARG n 
6  104  GLU n 
6  105  VAL n 
6  106  TRP n 
6  107  GLN n 
6  108  SER n 
6  109  LEU n 
6  110  PRO n 
6  111  PRO n 
6  112  GLY n 
6  113  PRO n 
6  114  THR n 
6  115  GLN n 
6  116  GLY n 
6  117  GLN n 
6  118  THR n 
6  119  PRO n 
6  120  GLY n 
6  121  GLU n 
6  122  PRO n 
6  123  ALA n 
6  124  ALA n 
6  125  SER n 
6  126  LEU n 
6  127  SER n 
6  128  VAL n 
6  129  LEU n 
6  130  LYS n 
6  131  ASN n 
6  132  VAL n 
6  133  PRO n 
6  134  GLY n 
6  135  LEU n 
6  136  ALA n 
6  137  ILE n 
6  138  LEU n 
6  139  LEU n 
6  140  SER n 
6  141  LYS n 
6  142  ASP n 
6  143  ALA n 
6  144  LEU n 
6  145  ASP n 
6  146  PRO n 
6  147  ARG n 
6  148  GLN n 
6  149  PRO n 
6  150  GLY n 
6  151  TYR n 
6  152  GLN n 
6  153  PRO n 
6  154  PRO n 
6  155  ASN n 
6  156  PRO n 
6  157  HIS n 
6  158  PRO n 
6  159  GLY n 
6  160  PRO n 
6  161  SER n 
6  162  SER n 
6  163  PRO n 
6  164  PRO n 
6  165  ALA n 
6  166  ALA n 
6  167  PRO n 
6  168  ALA n 
6  169  SER n 
6  170  LYS n 
6  171  ARG n 
6  172  SER n 
6  173  LEU n 
6  174  GLY n 
6  175  GLU n 
6  176  PRO n 
6  177  ALA n 
6  178  ALA n 
6  179  GLY n 
6  180  GLU n 
6  181  GLY n 
6  182  SER n 
6  183  ALA n 
6  184  LYS n 
6  185  ARG n 
6  186  SER n 
6  187  GLN n 
6  188  PRO n 
6  189  GLU n 
6  190  PRO n 
6  191  GLY n 
6  192  VAL n 
6  193  ALA n 
6  194  ASP n 
6  195  GLU n 
6  196  ASP n 
6  197  GLN n 
6  198  THR n 
6  199  ALA n 
7  1    MET n 
7  2    ALA n 
7  3    GLU n 
7  4    ASN n 
7  5    ARG n 
7  6    GLU n 
7  7    PRO n 
7  8    ARG n 
7  9    GLY n 
7  10   ALA n 
7  11   VAL n 
7  12   GLU n 
7  13   ALA n 
7  14   GLU n 
7  15   LEU n 
7  16   ASP n 
7  17   PRO n 
7  18   VAL n 
7  19   GLU n 
7  20   TYR n 
7  21   THR n 
7  22   LEU n 
7  23   ARG n 
7  24   LYS n 
7  25   ARG n 
7  26   LEU n 
7  27   PRO n 
7  28   SER n 
7  29   ARG n 
7  30   LEU n 
7  31   PRO n 
7  32   ARG n 
7  33   ARG n 
7  34   PRO n 
7  35   ASN n 
7  36   ASP n 
7  37   ILE n 
7  38   TYR n 
7  39   VAL n 
7  40   ASN n 
7  41   MET n 
7  42   LYS n 
7  43   THR n 
7  44   ASP n 
7  45   PHE n 
7  46   LYS n 
7  47   ALA n 
7  48   GLN n 
7  49   LEU n 
7  50   ALA n 
7  51   ARG n 
7  52   CYS n 
7  53   GLN n 
7  54   LYS n 
7  55   LEU n 
7  56   LEU n 
7  57   ASP n 
7  58   GLY n 
7  59   GLY n 
7  60   ALA n 
7  61   ARG n 
7  62   GLY n 
7  63   GLN n 
7  64   ASN n 
7  65   ALA n 
7  66   CYS n 
7  67   SER n 
7  68   GLU n 
7  69   ILE n 
7  70   TYR n 
7  71   ILE n 
7  72   HIS n 
7  73   GLY n 
7  74   LEU n 
7  75   GLY n 
7  76   LEU n 
7  77   ALA n 
7  78   ILE n 
7  79   ASN n 
7  80   ARG n 
7  81   ALA n 
7  82   ILE n 
7  83   ASN n 
7  84   ILE n 
7  85   ALA n 
7  86   LEU n 
7  87   GLN n 
7  88   LEU n 
7  89   GLN n 
7  90   ALA n 
7  91   GLY n 
7  92   SER n 
7  93   PHE n 
7  94   GLY n 
7  95   SER n 
7  96   LEU n 
7  97   GLN n 
7  98   VAL n 
7  99   ALA n 
7  100  ALA n 
7  101  ASN n 
7  102  THR n 
7  103  SER n 
7  104  THR n 
7  105  VAL n 
7  106  GLU n 
7  107  LEU n 
7  108  VAL n 
7  109  ASP n 
7  110  GLU n 
7  111  LEU n 
7  112  GLU n 
7  113  PRO n 
7  114  GLU n 
7  115  THR n 
7  116  ASP n 
7  117  THR n 
7  118  ARG n 
7  119  GLU n 
7  120  PRO n 
7  121  LEU n 
7  122  THR n 
7  123  ARG n 
7  124  ILE n 
7  125  ARG n 
7  126  ASN n 
7  127  ASN n 
7  128  SER n 
7  129  ALA n 
7  130  ILE n 
7  131  HIS n 
7  132  ILE n 
7  133  ARG n 
7  134  VAL n 
7  135  PHE n 
7  136  ARG n 
7  137  VAL n 
7  138  THR n 
7  139  PRO n 
7  140  LYS n 
8  1    MET n 
8  2    PRO n 
8  3    ALA n 
8  4    PRO n 
8  5    ALA n 
8  6    ALA n 
8  7    THR n 
8  8    TYR n 
8  9    GLU n 
8  10   ARG n 
8  11   VAL n 
8  12   VAL n 
8  13   TYR n 
8  14   LYS n 
8  15   ASN n 
8  16   PRO n 
8  17   SER n 
8  18   GLU n 
8  19   TYR n 
8  20   HIS n 
8  21   TYR n 
8  22   MET n 
8  23   LYS n 
8  24   VAL n 
8  25   CYS n 
8  26   LEU n 
8  27   GLU n 
8  28   PHE n 
8  29   GLN n 
8  30   ASP n 
8  31   CYS n 
8  32   GLY n 
8  33   VAL n 
8  34   GLY n 
8  35   LEU n 
8  36   ASN n 
8  37   ALA n 
8  38   ALA n 
8  39   GLN n 
8  40   PHE n 
8  41   LYS n 
8  42   GLN n 
8  43   LEU n 
8  44   LEU n 
8  45   ILE n 
8  46   SER n 
8  47   ALA n 
8  48   VAL n 
8  49   LYS n 
8  50   ASP n 
8  51   LEU n 
8  52   PHE n 
8  53   GLY n 
8  54   GLU n 
8  55   VAL n 
8  56   ASP n 
8  57   ALA n 
8  58   ALA n 
8  59   LEU n 
8  60   PRO n 
8  61   LEU n 
8  62   ASP n 
8  63   ILE n 
8  64   LEU n 
8  65   THR n 
8  66   TYR n 
8  67   GLU n 
8  68   GLU n 
8  69   LYS n 
8  70   THR n 
8  71   LEU n 
8  72   SER n 
8  73   ALA n 
8  74   ILE n 
8  75   LEU n 
8  76   ARG n 
8  77   ILE n 
8  78   CYS n 
8  79   SER n 
8  80   SER n 
8  81   GLY n 
8  82   LEU n 
8  83   VAL n 
8  84   LYS n 
8  85   LEU n 
8  86   TRP n 
8  87   SER n 
8  88   SER n 
8  89   LEU n 
8  90   THR n 
8  91   LEU n 
8  92   LEU n 
8  93   GLY n 
8  94   SER n 
8  95   TYR n 
8  96   LYS n 
8  97   GLY n 
8  98   LYS n 
8  99   LYS n 
8  100  CYS n 
8  101  ALA n 
8  102  PHE n 
8  103  ARG n 
8  104  VAL n 
8  105  ILE n 
8  106  GLN n 
8  107  VAL n 
8  108  SER n 
8  109  PRO n 
8  110  PHE n 
8  111  LEU n 
8  112  LEU n 
8  113  ALA n 
8  114  LEU n 
8  115  SER n 
8  116  GLY n 
8  117  ASN n 
8  118  SER n 
8  119  ARG n 
8  120  GLU n 
8  121  LEU n 
8  122  VAL n 
8  123  LEU n 
8  124  ASP n 
9  1    MET n 
9  2    ALA n 
9  3    VAL n 
9  4    PHE n 
9  5    ALA n 
9  6    ASP n 
9  7    LEU n 
9  8    ASP n 
9  9    LEU n 
9  10   ARG n 
9  11   ALA n 
9  12   GLY n 
9  13   SER n 
9  14   ASP n 
9  15   LEU n 
9  16   LYS n 
9  17   ALA n 
9  18   LEU n 
9  19   ARG n 
9  20   GLY n 
9  21   LEU n 
9  22   VAL n 
9  23   GLU n 
9  24   THR n 
9  25   ALA n 
9  26   ALA n 
9  27   HIS n 
9  28   LEU n 
9  29   GLY n 
9  30   TYR n 
9  31   SER n 
9  32   VAL n 
9  33   VAL n 
9  34   ALA n 
9  35   ILE n 
9  36   ASN n 
9  37   HIS n 
9  38   ILE n 
9  39   VAL n 
9  40   ASP n 
9  41   PHE n 
9  42   LYS n 
9  43   GLU n 
9  44   LYS n 
9  45   LYS n 
9  46   GLN n 
9  47   GLU n 
9  48   ILE n 
9  49   GLU n 
9  50   LYS n 
9  51   PRO n 
9  52   VAL n 
9  53   ALA n 
9  54   VAL n 
9  55   SER n 
9  56   GLU n 
9  57   LEU n 
9  58   PHE n 
9  59   THR n 
9  60   THR n 
9  61   LEU n 
9  62   PRO n 
9  63   ILE n 
9  64   VAL n 
9  65   GLN n 
9  66   GLY n 
9  67   LYS n 
9  68   SER n 
9  69   ARG n 
9  70   PRO n 
9  71   ILE n 
9  72   LYS n 
9  73   ILE n 
9  74   LEU n 
9  75   THR n 
9  76   ARG n 
9  77   LEU n 
9  78   THR n 
9  79   ILE n 
9  80   ILE n 
9  81   VAL n 
9  82   SER n 
9  83   ASP n 
9  84   PRO n 
9  85   SER n 
9  86   HIS n 
9  87   CYS n 
9  88   ASN n 
9  89   VAL n 
9  90   LEU n 
9  91   ARG n 
9  92   ALA n 
9  93   THR n 
9  94   SER n 
9  95   SER n 
9  96   ARG n 
9  97   ALA n 
9  98   ARG n 
9  99   LEU n 
9  100  TYR n 
9  101  ASP n 
9  102  VAL n 
9  103  VAL n 
9  104  ALA n 
9  105  VAL n 
9  106  PHE n 
9  107  PRO n 
9  108  LYS n 
9  109  THR n 
9  110  GLU n 
9  111  LYS n 
9  112  LEU n 
9  113  PHE n 
9  114  HIS n 
9  115  ILE n 
9  116  ALA n 
9  117  CYS n 
9  118  THR n 
9  119  HIS n 
9  120  LEU n 
9  121  ASP n 
9  122  VAL n 
9  123  ASP n 
9  124  LEU n 
9  125  VAL n 
9  126  CYS n 
9  127  ILE n 
9  128  THR n 
9  129  VAL n 
9  130  THR n 
9  131  GLU n 
9  132  LYS n 
9  133  LEU n 
9  134  PRO n 
9  135  PHE n 
9  136  TYR n 
9  137  PHE n 
9  138  LYS n 
9  139  ARG n 
9  140  PRO n 
9  141  PRO n 
9  142  ILE n 
9  143  ASN n 
9  144  VAL n 
9  145  ALA n 
9  146  ILE n 
9  147  ASP n 
9  148  ARG n 
9  149  GLY n 
9  150  LEU n 
9  151  ALA n 
9  152  PHE n 
9  153  GLU n 
9  154  LEU n 
9  155  VAL n 
9  156  TYR n 
9  157  SER n 
9  158  PRO n 
9  159  ALA n 
9  160  ILE n 
9  161  LYS n 
9  162  ASP n 
9  163  SER n 
9  164  THR n 
9  165  MET n 
9  166  ARG n 
9  167  ARG n 
9  168  TYR n 
9  169  THR n 
9  170  ILE n 
9  171  SER n 
9  172  SER n 
9  173  ALA n 
9  174  LEU n 
9  175  ASN n 
9  176  LEU n 
9  177  MET n 
9  178  GLN n 
9  179  ILE n 
9  180  CYS n 
9  181  LYS n 
9  182  GLY n 
9  183  LYS n 
9  184  ASN n 
9  185  VAL n 
9  186  ILE n 
9  187  ILE n 
9  188  SER n 
9  189  SER n 
9  190  ALA n 
9  191  ALA n 
9  192  GLU n 
9  193  ARG n 
9  194  PRO n 
9  195  LEU n 
9  196  GLU n 
9  197  ILE n 
9  198  ARG n 
9  199  GLY n 
9  200  PRO n 
9  201  TYR n 
9  202  ASP n 
9  203  VAL n 
9  204  ALA n 
9  205  ASN n 
9  206  LEU n 
9  207  GLY n 
9  208  LEU n 
9  209  LEU n 
9  210  PHE n 
9  211  GLY n 
9  212  LEU n 
9  213  SER n 
9  214  GLU n 
9  215  SER n 
9  216  ASP n 
9  217  ALA n 
9  218  LYS n 
9  219  ALA n 
9  220  ALA n 
9  221  VAL n 
9  222  SER n 
9  223  THR n 
9  224  ASN n 
9  225  CYS n 
9  226  ARG n 
9  227  ALA n 
9  228  ALA n 
9  229  LEU n 
9  230  LEU n 
9  231  HIS n 
9  232  GLY n 
9  233  GLU n 
9  234  THR n 
9  235  ARG n 
9  236  LYS n 
9  237  THR n 
9  238  ALA n 
9  239  PHE n 
9  240  GLY n 
9  241  ILE n 
9  242  ILE n 
9  243  SER n 
9  244  THR n 
9  245  VAL n 
9  246  LYS n 
9  247  LYS n 
9  248  PRO n 
9  249  ARG n 
9  250  PRO n 
9  251  SER n 
9  252  GLU n 
9  253  GLY n 
9  254  ASP n 
9  255  GLU n 
9  256  ASP n 
9  257  CYS n 
9  258  LEU n 
9  259  PRO n 
9  260  ALA n 
9  261  SER n 
9  262  LYS n 
9  263  LYS n 
9  264  ALA n 
9  265  LYS n 
9  266  CYS n 
9  267  GLU n 
9  268  GLY n 
10 1    MET n 
10 2    ALA n 
10 3    GLY n 
10 4    PRO n 
10 5    VAL n 
10 6    LYS n 
10 7    ASP n 
10 8    ARG n 
10 9    GLU n 
10 10   ALA n 
10 11   PHE n 
10 12   GLN n 
10 13   ARG n 
10 14   LEU n 
10 15   ASN n 
10 16   PHE n 
10 17   LEU n 
10 18   TYR n 
10 19   GLN n 
10 20   ALA n 
10 21   ALA n 
10 22   HIS n 
10 23   CYS n 
10 24   VAL n 
10 25   LEU n 
10 26   ALA n 
10 27   GLN n 
10 28   ASP n 
10 29   PRO n 
10 30   GLU n 
10 31   ASN n 
10 32   GLN n 
10 33   ALA n 
10 34   LEU n 
10 35   ALA n 
10 36   ARG n 
10 37   PHE n 
10 38   TYR n 
10 39   CYS n 
10 40   TYR n 
10 41   THR n 
10 42   GLU n 
10 43   ARG n 
10 44   THR n 
10 45   ILE n 
10 46   ALA n 
10 47   LYS n 
10 48   ARG n 
10 49   LEU n 
10 50   VAL n 
10 51   LEU n 
10 52   ARG n 
10 53   ARG n 
10 54   ASP n 
10 55   PRO n 
10 56   SER n 
10 57   VAL n 
10 58   LYS n 
10 59   ARG n 
10 60   THR n 
10 61   LEU n 
10 62   CYS n 
10 63   ARG n 
10 64   GLY n 
10 65   CYS n 
10 66   SER n 
10 67   SER n 
10 68   LEU n 
10 69   LEU n 
10 70   VAL n 
10 71   PRO n 
10 72   GLY n 
10 73   LEU n 
10 74   THR n 
10 75   CYS n 
10 76   THR n 
10 77   GLN n 
10 78   ARG n 
10 79   GLN n 
10 80   ARG n 
10 81   ARG n 
10 82   CYS n 
10 83   ARG n 
10 84   GLY n 
10 85   GLN n 
10 86   ARG n 
10 87   TRP n 
10 88   THR n 
10 89   VAL n 
10 90   GLN n 
10 91   THR n 
10 92   CYS n 
10 93   LEU n 
10 94   THR n 
10 95   CYS n 
10 96   GLN n 
10 97   ARG n 
10 98   SER n 
10 99   GLN n 
10 100  ARG n 
10 101  PHE n 
10 102  LEU n 
10 103  ASN n 
10 104  ASP n 
10 105  PRO n 
10 106  GLY n 
10 107  HIS n 
10 108  LEU n 
10 109  LEU n 
10 110  TRP n 
10 111  GLY n 
10 112  ASP n 
10 113  ARG n 
10 114  PRO n 
10 115  GLU n 
10 116  ALA n 
10 117  GLN n 
10 118  LEU n 
10 119  GLY n 
10 120  SER n 
10 121  GLN n 
10 122  ALA n 
10 123  ASP n 
10 124  SER n 
10 125  LYS n 
10 126  PRO n 
10 127  LEU n 
10 128  GLN n 
10 129  PRO n 
10 130  LEU n 
10 131  PRO n 
10 132  ASN n 
10 133  THR n 
10 134  ALA n 
10 135  HIS n 
10 136  SER n 
10 137  ILE n 
10 138  SER n 
10 139  ASP n 
10 140  ARG n 
10 141  LEU n 
10 142  PRO n 
10 143  GLU n 
10 144  GLU n 
10 145  LYS n 
10 146  MET n 
10 147  GLN n 
10 148  THR n 
10 149  GLN n 
10 150  GLY n 
10 151  SER n 
10 152  SER n 
10 153  ASN n 
10 154  GLN n 
11 1    MET n 
11 2    ALA n 
11 3    THR n 
11 4    LEU n 
11 5    ARG n 
11 6    ARG n 
11 7    LEU n 
11 8    ARG n 
11 9    GLU n 
11 10   ALA n 
11 11   PRO n 
11 12   ARG n 
11 13   HIS n 
11 14   LEU n 
11 15   LEU n 
11 16   VAL n 
11 17   CYS n 
11 18   GLU n 
11 19   LYS n 
11 20   SER n 
11 21   ASN n 
11 22   PHE n 
11 23   GLY n 
11 24   ASN n 
11 25   HIS n 
11 26   LYS n 
11 27   SER n 
11 28   ARG n 
11 29   HIS n 
11 30   ARG n 
11 31   HIS n 
11 32   LEU n 
11 33   VAL n 
11 34   GLN n 
11 35   THR n 
11 36   HIS n 
11 37   TYR n 
11 38   TYR n 
11 39   ASN n 
11 40   TYR n 
11 41   ARG n 
11 42   VAL n 
11 43   SER n 
11 44   PHE n 
11 45   LEU n 
11 46   ILE n 
11 47   PRO n 
11 48   GLU n 
11 49   CYS n 
11 50   GLY n 
11 51   ILE n 
11 52   LEU n 
11 53   SER n 
11 54   GLU n 
11 55   GLU n 
11 56   LEU n 
11 57   LYS n 
11 58   ASN n 
11 59   LEU n 
11 60   VAL n 
11 61   MET n 
11 62   ASN n 
11 63   THR n 
11 64   GLY n 
11 65   PRO n 
11 66   TYR n 
11 67   TYR n 
11 68   PHE n 
11 69   VAL n 
11 70   LYS n 
11 71   ASN n 
11 72   LEU n 
11 73   PRO n 
11 74   LEU n 
11 75   HIS n 
11 76   GLU n 
11 77   LEU n 
11 78   ILE n 
11 79   THR n 
11 80   PRO n 
11 81   GLU n 
11 82   PHE n 
11 83   ILE n 
11 84   SER n 
11 85   THR n 
11 86   PHE n 
11 87   ILE n 
11 88   LYS n 
11 89   LYS n 
11 90   GLY n 
11 91   SER n 
11 92   CYS n 
11 93   TYR n 
11 94   ALA n 
11 95   LEU n 
11 96   THR n 
11 97   TYR n 
11 98   ASN n 
11 99   THR n 
11 100  HIS n 
11 101  ILE n 
11 102  ASP n 
11 103  GLU n 
11 104  ASP n 
11 105  ASN n 
11 106  THR n 
11 107  VAL n 
11 108  ALA n 
11 109  LEU n 
11 110  LEU n 
11 111  PRO n 
11 112  ASN n 
11 113  GLY n 
11 114  LYS n 
11 115  LEU n 
11 116  ILE n 
11 117  LEU n 
11 118  SER n 
11 119  LEU n 
11 120  ASP n 
11 121  LYS n 
11 122  ASP n 
11 123  THR n 
11 124  TYR n 
11 125  GLU n 
11 126  GLU n 
11 127  THR n 
11 128  GLY n 
11 129  LEU n 
11 130  GLN n 
11 131  GLY n 
11 132  HIS n 
11 133  PRO n 
11 134  SER n 
11 135  GLN n 
11 136  PHE n 
11 137  SER n 
11 138  GLY n 
11 139  ARG n 
11 140  LYS n 
11 141  ILE n 
11 142  MET n 
11 143  LYS n 
11 144  PHE n 
11 145  ILE n 
11 146  VAL n 
11 147  SER n 
11 148  ILE n 
11 149  ASP n 
11 150  LEU n 
11 151  MET n 
11 152  GLU n 
11 153  LEU n 
11 154  SER n 
11 155  LEU n 
11 156  ASN n 
11 157  LEU n 
11 158  ASP n 
11 159  SER n 
11 160  LYS n 
11 161  LYS n 
11 162  TYR n 
11 163  GLU n 
11 164  ARG n 
11 165  ILE n 
11 166  SER n 
11 167  TRP n 
11 168  SER n 
11 169  PHE n 
11 170  LYS n 
11 171  GLU n 
11 172  LYS n 
11 173  LYS n 
11 174  PRO n 
11 175  LEU n 
11 176  LYS n 
11 177  PHE n 
11 178  ASP n 
11 179  PHE n 
11 180  LEU n 
11 181  LEU n 
11 182  ALA n 
11 183  TRP n 
11 184  HIS n 
11 185  LYS n 
11 186  THR n 
11 187  GLY n 
11 188  SER n 
11 189  GLU n 
11 190  GLU n 
11 191  SER n 
11 192  THR n 
11 193  MET n 
11 194  MET n 
11 195  SER n 
11 196  TYR n 
11 197  PHE n 
11 198  SER n 
11 199  LYS n 
11 200  TYR n 
11 201  GLN n 
11 202  ILE n 
11 203  GLN n 
11 204  GLU n 
11 205  HIS n 
11 206  GLN n 
11 207  PRO n 
11 208  LYS n 
11 209  VAL n 
11 210  ALA n 
11 211  LEU n 
11 212  SER n 
11 213  THR n 
11 214  LEU n 
11 215  ARG n 
11 216  ASP n 
11 217  LEU n 
11 218  GLN n 
11 219  CYS n 
11 220  PRO n 
11 221  VAL n 
11 222  LEU n 
11 223  GLN n 
11 224  SER n 
11 225  SER n 
11 226  GLU n 
11 227  LEU n 
11 228  GLU n 
11 229  GLY n 
11 230  THR n 
11 231  PRO n 
11 232  GLU n 
11 233  VAL n 
11 234  SER n 
11 235  CYS n 
11 236  ARG n 
11 237  ALA n 
11 238  LEU n 
11 239  GLU n 
11 240  LEU n 
11 241  PHE n 
11 242  ASP n 
11 243  TRP n 
11 244  LEU n 
11 245  GLY n 
11 246  ALA n 
11 247  VAL n 
11 248  PHE n 
11 249  SER n 
11 250  ASN n 
11 251  VAL n 
11 252  ASP n 
11 253  LEU n 
11 254  ASN n 
11 255  ASN n 
11 256  GLU n 
11 257  PRO n 
11 258  ASN n 
11 259  ASN n 
11 260  PHE n 
11 261  ILE n 
11 262  SER n 
11 263  THR n 
11 264  TYR n 
11 265  CYS n 
11 266  CYS n 
11 267  PRO n 
11 268  GLU n 
11 269  PRO n 
11 270  SER n 
11 271  THR n 
11 272  VAL n 
11 273  VAL n 
11 274  ALA n 
11 275  LYS n 
11 276  ALA n 
11 277  TYR n 
11 278  LEU n 
11 279  CYS n 
11 280  THR n 
11 281  ILE n 
11 282  THR n 
11 283  GLY n 
11 284  PHE n 
11 285  ILE n 
11 286  LEU n 
11 287  PRO n 
11 288  GLU n 
11 289  LYS n 
11 290  ILE n 
11 291  CYS n 
11 292  LEU n 
11 293  LEU n 
11 294  LEU n 
11 295  GLU n 
11 296  HIS n 
11 297  LEU n 
11 298  CYS n 
11 299  HIS n 
11 300  TYR n 
11 301  PHE n 
11 302  ASP n 
11 303  GLU n 
11 304  PRO n 
11 305  LYS n 
11 306  LEU n 
11 307  ALA n 
11 308  PRO n 
11 309  TRP n 
11 310  VAL n 
11 311  THR n 
11 312  LEU n 
11 313  SER n 
11 314  VAL n 
11 315  GLN n 
11 316  GLY n 
11 317  PHE n 
11 318  ALA n 
11 319  ASP n 
11 320  SER n 
11 321  PRO n 
11 322  VAL n 
11 323  SER n 
11 324  TRP n 
11 325  GLU n 
11 326  LYS n 
11 327  ASN n 
11 328  GLU n 
11 329  HIS n 
11 330  GLY n 
11 331  PHE n 
11 332  ARG n 
11 333  LYS n 
11 334  GLY n 
11 335  GLY n 
11 336  GLU n 
11 337  HIS n 
11 338  LEU n 
11 339  TYR n 
11 340  ASN n 
11 341  PHE n 
11 342  VAL n 
11 343  ILE n 
11 344  PHE n 
11 345  ASN n 
11 346  ASN n 
11 347  GLN n 
11 348  ASP n 
11 349  TYR n 
11 350  TRP n 
11 351  LEU n 
11 352  GLN n 
11 353  MET n 
11 354  ALA n 
11 355  VAL n 
11 356  GLY n 
11 357  ALA n 
11 358  ASN n 
11 359  ASP n 
11 360  HIS n 
11 361  CYS n 
11 362  PRO n 
11 363  PRO n 
12 1    G   n 
12 2    U   n 
12 3    U   n 
12 4    U   n 
12 5    C   n 
12 6    C   n 
12 7    G   n 
12 8    U   n 
12 9    A   n 
12 10   G   n 
12 11   U   n 
12 12   G   n 
12 13   U   n 
12 14   A   n 
12 15   G   n 
12 16   U   n 
12 17   G   n 
12 18   G   n 
12 19   U   n 
12 20   U   n 
12 21   A   n 
12 22   U   n 
12 23   C   n 
12 24   A   n 
12 25   C   n 
12 26   G   n 
12 27   U   n 
12 28   U   n 
12 29   C   n 
12 30   G   n 
12 31   C   n 
12 32   C   n 
12 33   U   n 
12 34   A   n 
12 35   A   n 
12 36   C   n 
12 37   A   n 
12 38   C   n 
12 39   G   n 
12 40   C   n 
12 41   G   n 
12 42   A   n 
12 43   A   n 
12 44   A   n 
12 45   G   n 
12 46   G   n 
12 47   U   n 
12 48   C   n 
12 49   C   n 
12 50   C   n 
12 51   C   n 
12 52   G   n 
12 53   G   n 
12 54   U   n 
12 55   U   n 
12 56   C   n 
12 57   G   n 
12 58   A   n 
12 59   A   n 
12 60   A   n 
12 61   C   n 
12 62   C   n 
12 63   G   n 
12 64   G   n 
12 65   G   n 
12 66   C   n 
12 67   G   n 
12 68   G   n 
12 69   A   n 
12 70   A   n 
12 71   A   n 
12 72   C   n 
# 
_entity_src_gen.entity_id                          12 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   72 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   'in vitro transcription' 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGlms 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample 1 341  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? cell 
2  1 sample 1 1024 Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? cell 
3  1 sample 1 283  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? cell 
4  1 sample 1 220  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? cell 
5  1 sample 1 163  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? cell 
6  1 sample 1 199  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? cell 
7  1 sample 1 140  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? cell 
8  1 sample 1 124  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? cell 
9  1 sample 1 268  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? cell 
10 1 sample 1 154  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? cell 
11 1 sample 1 363  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? cell 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1  GB  X16612.1    31969   ? 1  
;AUAGGGCGGAGGGAAGCUCAUCAGUGGGGCCACGAGCUGAGUGCGUCCUGUCACUCCACUCCCAUGUCCCUUGGGAAGGU
CUGAGACUAGGGCCAGAGGCGGCCCUAACAGGGCUCUCCCUGAGCUUCGGGGAGGUGAGUUCCCAGAGAACGGGGCUCCG
CGCGAGGUCAGACUGGGCAGGAGAUGCCGUGGACCCCGCCCUUCGGGGAGGGGCCCGGCGGAUGCCUCCUUUGCCGGAGC
UUGGAACAGACUCACGGCCAGCGAAGUGAGUUCAAUGGCUGAGGUGAGGUACCCCGCAGGGGACCUCAUAACCCAAUUCA
GACUACUCUCCUCCGCCCAUU
;
375   
2  UNP POP1_HUMAN  Q99575  ? 2  
;MSNAKERKHAKKMRNQPTNVTLSSGFVADRGVKHHSGGEKPFQAQKQEPHPGTSRQRQTRVNPHSLPDPEVNEQSSSKGM
FRKKGGWKAGPEGTSQEIPKYITASTFAQARAAEISAMLKAVTQKSSNSLVFQTLPRHMRRRAMSHNVKRLPRRLQEIAQ
KEAEKAVHQKKEHSKNKCHKARRCHMNRTLEFNRRQKKNIWLETHIWHAKRFHMVKKWGYCLGERPTVKSHRACYRAMTN
RCLLQDLSYYCCLELKGKEEEILKALSGMCNIDTGLTFAAVHCLSGKRQGSLVLYRVNKYPREMLGPVTFIWKSQRTPGD
PSESRQLWIWLHPTLKQDILEEIKAACQCVEPIKSAVCIADPLPTPSQEKSQTELPDEKIGKKRKRKDDGENAKPIKKII
GDGTRDPCLPYSWISPTTGIIISDLTMEMNRFRLIGPLSHSILTEAIKAASVHTVGEDTEETPHRWWIETCKKPDSVSLH
CRQEAIFELLGGITSPAEIPAGTILGLTVGDPRINLPQKKSKALPNPEKCQDNEKVRQLLLEGVPVECTHSFIWNQDICK
SVTENKISDQDLNRMRSELLVPGSQLILGPHESKIPILLIQQPGKVTGEDRLGWGSGWDVLLPKGWGMAFWIPFIYRGVR
VGGLKESAVHSQYKRSPNVPGDFPDCPAGMLFAEEQAKNLLEKYKRRPPAKRPNYVKLGTLAPFCCPWEQLTQDWESRVQ
AYEEPSVASSPNGKESDLRRSEVPCAPMPKKTHQPSDEVGTSIEHPREAEEVMDAGCQESAGPERITDQEASENHVAATG
SHLCVLRSRKLLKQLSAWCGPSSEDSRGGRRAPGRGQQGLTREACLSILGHFPRALVWVSLSLLSKGSPEPHTMICVPAK
EDFLQLHEDWHYCGPQESKHSDPFRSKILKQKEKKKREKRQKPGRASSDGPAGEEPVAGQEALTLGLWSGPLPRVTLHCS
RTLLGFVTQGDFSMAVGCGEALGFVSLTGLLDMLSSQPAAQRGLVLLRPPASLQYRFARIAIEV
;
1     
3  UNP RPP38_HUMAN P78345  ? 3  
;MAAAPQAPGRGSLRKTRPLVVKTSLNNPYIIRWSALESEDMHFILQTLEDRLKAIGLQKIEDKKKKNKTPFLKKESREKC
SIAVDISENLKEKKTDAKQQVSGWTPAHVRKQLAIGVNEVTRALERRELLLVLVCKSVKPAMITSHLIQLSLSRSVPACQ
VPRLSERIAPVIGLKCVLALAFKKNTTDFVDEVRAIIPRVPSLSVPWLQDRIEDSGENLETEPLESQDRELLDTSFEDLS
KPKRKLADGRQASVTLQPLKIKKLIPNPNKIRKPPKSKKATPK
;
1     
4  UNP RPP29_HUMAN O95707  ? 4  
;MKSVIYHALSQKEANDSDVQPSGAQRAEAFVRAFLKRSTPRMSPQAREDQLQRKAVVLEYFTRHKRKEKKKKAKGLSARQ
RRELRLFDIKPEQQRYSLFLPLHELWKQYIRDLCSGLKPDTQPQMIQAKLLKADLHGAIISVTKSKCPSYVGITGILLQE
TKHIFKIITKEDRLKVIPKLNCVFTVETDGFISYIYGSKFQLRSSERSAKKFKAKGTIDL
;
1     
5  UNP POP5_HUMAN  Q969H6  ? 5  
;MVRFKHRYLLCELVSDDPRCRLSLDDRVLSSLVRDTIARVHGTFGAAACSIGFAVRYLNAYTGIVLLRCRKEFYQLVWSA
LPFITYLENKGHRYPCFFNTLHVGGTIRTCQKFLIQYNRRQLLILLQNCTDEGEREAIQKSVTRSCLLEEEEESGEEAAE
AME
;
1     
6  UNP RPP25_HUMAN Q9BUL9  ? 6  
;MENFRKVRSEEAPAGCGAEGGGPGSGPFADLAPGAVHMRVKEGSKIRNLMAFATASMAQPATRAIVFSGCGRATTKTVTC
AEILKRRLAGLHQVTRLRYRSVREVWQSLPPGPTQGQTPGEPAASLSVLKNVPGLAILLSKDALDPRQPGYQPPNPHPGP
SSPPAAPASKRSLGEPAAGEGSAKRSQPEPGVADEDQTA
;
1     
7  UNP POP7_HUMAN  O75817  ? 7  
;MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGARGQNACSEIYIHGLGLAINR
AINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK
;
1     
8  UNP RPP14_HUMAN O95059  ? 8  
;MPAPAATYERVVYKNPSEYHYMKVCLEFQDCGVGLNAAQFKQLLISAVKDLFGEVDAALPLDILTYEEKTLSAILRICSS
GLVKLWSSLTLLGSYKGKKCAFRVIQVSPFLLALSGNSRELVLD
;
1     
9  UNP RPP30_HUMAN P78346  ? 9  
;MAVFADLDLRAGSDLKALRGLVETAAHLGYSVVAINHIVDFKEKKQEIEKPVAVSELFTTLPIVQGKSRPIKILTRLTII
VSDPSHCNVLRATSSRARLYDVVAVFPKTEKLFHIACTHLDVDLVCITVTEKLPFYFKRPPINVAIDRGLAFELVYSPAI
KDSTMRRYTISSALNLMQICKGKNVIISSAAERPLEIRGPYDVANLGLLFGLSESDAKAAVSTNCRAALLHGETRKTAFG
IISTVKKPRPSEGDEDCLPASKKAKCEG
;
1     
10 UNP RPP21_HUMAN Q9H633  ? 10 
;MAGPVKDREAFQRLNFLYQAAHCVLAQDPENQALARFYCYTERTIAKRLVLRRDPSVKRTLCRGCSSLLVPGLTCTQRQR
RCRGQRWTVQTCLTCQRSQRFLNDPGHLLWGDRPEAQLGSQADSKPLQPLPNTAHSISDRLPEEKMQTQGSSNQ
;
1     
11 UNP RPP40_HUMAN O75818  ? 11 
;MATLRRLREAPRHLLVCEKSNFGNHKSRHRHLVQTHYYNYRVSFLIPECGILSEELKNLVMNTGPYYFVKNLPLHELITP
EFISTFIKKGSCYALTYNTHIDEDNTVALLPNGKLILSLDKDTYEETGLQGHPSQFSGRKIMKFIVSIDLMELSLNLDSK
KYERISWSFKEKKPLKFDFLLAWHKTGSEESTMMSYFSKYQIQEHQPKVALSTLRDLQCPVLQSSELEGTPEVSCRALEL
FDWLGAVFSNVDLNNEPNNFISTYCCPEPSTVVAKAYLCTITGFILPEKICLLLEHLCHYFDEPKLAPWVTLSVQGFADS
PVSWEKNEHGFRKGGEHLYNFVIFNNQDYWLQMAVGANDHCPP
;
1     
12 GB  AL009179.1  3217024 ? 12 GUUUCCGUAGUGUAGUGGUUAUCACGUUCGCCUAACACGCGAAAGGUCCCCGGUUCGAAACCGGGCGGAAAC 81624 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  6AHU A 1 ? 341  ? 31969   375   ? 715   ? 1 341  
2  2  6AHU B 1 ? 1024 ? Q99575  1     ? 1024  ? 1 1024 
3  3  6AHU C 1 ? 283  ? P78345  1     ? 283   ? 1 283  
4  4  6AHU D 1 ? 220  ? O95707  1     ? 220   ? 1 220  
5  5  6AHU E 1 ? 163  ? Q969H6  1     ? 163   ? 1 163  
6  6  6AHU F 1 ? 199  ? Q9BUL9  1     ? 199   ? 1 199  
7  7  6AHU G 1 ? 140  ? O75817  1     ? 140   ? 1 140  
8  8  6AHU H 1 ? 124  ? O95059  1     ? 124   ? 1 124  
9  9  6AHU I 1 ? 268  ? P78346  1     ? 268   ? 1 268  
10 9  6AHU J 1 ? 268  ? P78346  1     ? 268   ? 1 268  
11 10 6AHU K 1 ? 154  ? Q9H633  1     ? 154   ? 1 154  
12 11 6AHU L 1 ? 363  ? O75818  1     ? 363   ? 1 363  
13 12 6AHU T 1 ? 72   ? 3217024 81624 ? 81553 ? 1 72   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O8 P'  323.197 
CYS 'L-peptide linking' y CYSTEINE                     ? 'C3 H7 N O2 S'    121.158 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"   ? 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                   ? 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6AHU 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_struct.entry_id                     6AHU 
_struct.title                        'Cryo-EM structure of human Ribonuclease P with mature tRNA' 
_struct.pdbx_descriptor              
;Ribonucleases P/MRP protein subunit POP1, Ribonuclease P protein subunit p38, Ribonuclease P protein subunit p29, Ribonuclease P/MRP protein subunit POP5, Ribonuclease P protein subunit p25, Ribonuclease P protein subunit p20, Ribonuclease P protein subunit p14, Ribonuclease P protein subunit p30, Ribonuclease P protein subunit p21, Ribonuclease P protein subunit p40/RNA Complex
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6AHU 
_struct_keywords.text            'Ribonuclease P, RNA-protein complex, HYDROLASE-RNA complex' 
_struct_keywords.pdbx_keywords   HYDROLASE/RNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 6  ? 
G N N 7  ? 
H N N 8  ? 
I N N 9  ? 
J N N 9  ? 
K N N 10 ? 
L N N 11 ? 
M N N 12 ? 
N N N 13 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 LYS B 100 ? SER B 127 ? LYS B 100 SER B 127 1 ? 28 
HELX_P HELX_P2  AA2 PRO B 136 ? ARG B 140 ? PRO B 136 ARG B 140 5 ? 5  
HELX_P HELX_P3  AA3 ASN B 147 ? LEU B 151 ? ASN B 147 LEU B 151 5 ? 5  
HELX_P HELX_P4  AA4 PRO B 152 ? ALA B 166 ? PRO B 152 ALA B 166 1 ? 15 
HELX_P HELX_P5  AA5 ASN B 187 ? GLN B 196 ? ASN B 187 GLN B 196 1 ? 10 
HELX_P HELX_P6  AA6 THR B 204 ? ARG B 211 ? THR B 204 ARG B 211 1 ? 8  
HELX_P HELX_P7  AA7 SER B 230 ? ASN B 240 ? SER B 230 ASN B 240 1 ? 11 
HELX_P HELX_P8  AA8 LEU B 266 ? ASN B 271 ? LEU B 266 ASN B 271 1 ? 6  
HELX_P HELX_P9  AA9 LEU B 335 ? CYS B 347 ? LEU B 335 CYS B 347 1 ? 13 
HELX_P HELX_P10 AB1 ILE B 399 ? THR B 404 ? ILE B 399 THR B 404 1 ? 6  
HELX_P HELX_P11 AB2 LEU B 438 ? ALA B 446 ? LEU B 438 ALA B 446 1 ? 9  
HELX_P HELX_P12 AB3 SER B 451 ? GLY B 456 ? SER B 451 GLY B 456 1 ? 6  
HELX_P HELX_P13 AB4 HIS B 464 ? LYS B 473 ? HIS B 464 LYS B 473 1 ? 10 
HELX_P HELX_P14 AB5 LYS B 473 ? LEU B 490 ? LYS B 473 LEU B 490 1 ? 18 
HELX_P HELX_P15 AB6 ASP B 532 ? GLU B 542 ? ASP B 532 GLU B 542 1 ? 11 
HELX_P HELX_P16 AB7 SER B 551 ? TRP B 554 ? SER B 551 TRP B 554 5 ? 4  
HELX_P HELX_P17 AB8 ASN B 555 ? ASN B 565 ? ASN B 555 ASN B 565 1 ? 11 
HELX_P HELX_P18 AB9 GLN B 570 ? LEU B 580 ? GLN B 570 LEU B 580 1 ? 11 
HELX_P HELX_P19 AC1 GLY B 627 ? TYR B 636 ? GLY B 627 TYR B 636 1 ? 10 
HELX_P HELX_P20 AC2 GLY B 643 ? TYR B 653 ? GLY B 643 TYR B 653 1 ? 11 
HELX_P HELX_P21 AC3 ALA B 668 ? ARG B 687 ? ALA B 668 ARG B 687 1 ? 20 
HELX_P HELX_P22 AC4 PRO B 707 ? GLN B 720 ? PRO B 707 GLN B 720 1 ? 14 
HELX_P HELX_P23 AC5 LEU B 811 ? GLY B 820 ? LEU B 811 GLY B 820 1 ? 10 
HELX_P HELX_P24 AC6 THR B 841 ? PHE B 852 ? THR B 841 PHE B 852 1 ? 12 
HELX_P HELX_P25 AC7 ALA B 879 ? ASP B 889 ? ALA B 879 ASP B 889 1 ? 11 
HELX_P HELX_P26 AC8 ASP B 902 ? PHE B 904 ? ASP B 902 PHE B 904 5 ? 3  
HELX_P HELX_P27 AC9 ARG B 905 ? ARG B 920 ? ARG B 905 ARG B 920 1 ? 16 
HELX_P HELX_P28 AD1 PRO B 951 ? LEU B 957 ? PRO B 951 LEU B 957 1 ? 7  
HELX_P HELX_P29 AD2 SER B 986 ? GLN B 997 ? SER B 986 GLN B 997 1 ? 12 
HELX_P HELX_P30 AD3 HIS C 42  ? ILE C 55  ? HIS C 42  ILE C 55  1 ? 14 
HELX_P HELX_P31 AD4 GLN C 58  ? LYS C 64  ? GLN C 58  LYS C 64  1 ? 7  
HELX_P HELX_P32 AD5 VAL C 117 ? ARG C 122 ? VAL C 117 ARG C 122 1 ? 6  
HELX_P HELX_P33 AD6 SER C 145 ? SER C 151 ? SER C 145 SER C 151 1 ? 7  
HELX_P HELX_P34 AD7 ARG C 163 ? ARG C 167 ? ARG C 163 ARG C 167 5 ? 5  
HELX_P HELX_P35 AD8 GLU C 192 ? ILE C 197 ? GLU C 192 ILE C 197 1 ? 6  
HELX_P HELX_P36 AD9 SER C 226 ? ASP C 233 ? SER C 226 ASP C 233 1 ? 8  
HELX_P HELX_P37 AE1 ILE D 89  ? GLN D 94  ? ILE D 89  GLN D 94  5 ? 6  
HELX_P HELX_P38 AE2 ARG D 95  ? LEU D 98  ? ARG D 95  LEU D 98  5 ? 4  
HELX_P HELX_P39 AE3 PHE D 99  ? ASP D 112 ? PHE D 99  ASP D 112 1 ? 14 
HELX_P HELX_P40 AE4 GLN D 122 ? LEU D 130 ? GLN D 122 LEU D 130 1 ? 9  
HELX_P HELX_P41 AE5 PRO E 18  ? SER E 23  ? PRO E 18  SER E 23  1 ? 6  
HELX_P HELX_P42 AE6 ASP E 25  ? HIS E 41  ? ASP E 25  HIS E 41  1 ? 17 
HELX_P HELX_P43 AE7 PHE E 44  ? CYS E 49  ? PHE E 44  CYS E 49  1 ? 6  
HELX_P HELX_P44 AE8 PHE E 73  ? LEU E 81  ? PHE E 73  LEU E 81  1 ? 9  
HELX_P HELX_P45 AE9 THR E 106 ? THR E 130 ? THR E 106 THR E 130 1 ? 25 
HELX_P HELX_P46 AF1 ASP E 131 ? LEU E 147 ? ASP E 131 LEU E 147 1 ? 17 
HELX_P HELX_P47 AF2 GLY F 24  ? ASP F 30  ? GLY F 24  ASP F 30  1 ? 7  
HELX_P HELX_P48 AF3 LYS F 45  ? GLN F 59  ? LYS F 45  GLN F 59  1 ? 15 
HELX_P HELX_P49 AF4 ARG F 72  ? THR F 75  ? ARG F 72  THR F 75  5 ? 4  
HELX_P HELX_P50 AF5 LYS F 76  ? ARG F 86  ? LYS F 76  ARG F 86  1 ? 11 
HELX_P HELX_P51 AF6 ARG G 25  ? ARG G 29  ? ARG G 25  ARG G 29  5 ? 5  
HELX_P HELX_P52 AF7 PHE G 45  ? ASP G 57  ? PHE G 45  ASP G 57  1 ? 13 
HELX_P HELX_P53 AF8 ALA G 77  ? PHE G 93  ? ALA G 77  PHE G 93  1 ? 17 
HELX_P HELX_P54 AF9 ASN H 36  ? PHE H 52  ? ASN H 36  PHE H 52  1 ? 17 
HELX_P HELX_P55 AG1 GLY H 53  ? ALA H 58  ? GLY H 53  ALA H 58  1 ? 6  
HELX_P HELX_P56 AG2 LEU H 82  ? LEU H 89  ? LEU H 82  LEU H 89  1 ? 8  
HELX_P HELX_P57 AG3 PHE H 110 ? SER H 115 ? PHE H 110 SER H 115 1 ? 6  
HELX_P HELX_P58 AG4 ASP I 14  ? GLY I 29  ? ASP I 14  GLY I 29  1 ? 16 
HELX_P HELX_P59 AG5 ALA I 53  ? LEU I 57  ? ALA I 53  LEU I 57  5 ? 5  
HELX_P HELX_P60 AG6 ASP I 83  ? ARG I 91  ? ASP I 83  ARG I 91  1 ? 9  
HELX_P HELX_P61 AG7 ALA I 92  ? ALA I 97  ? ALA I 92  ALA I 97  1 ? 6  
HELX_P HELX_P62 AG8 THR I 109 ? HIS I 119 ? THR I 109 HIS I 119 1 ? 11 
HELX_P HELX_P63 AG9 LYS I 138 ? GLY I 149 ? LYS I 138 GLY I 149 1 ? 12 
HELX_P HELX_P64 AH1 THR I 164 ? LYS I 181 ? THR I 164 LYS I 181 1 ? 18 
HELX_P HELX_P65 AH2 ASP I 202 ? PHE I 210 ? ASP I 202 PHE I 210 1 ? 9  
HELX_P HELX_P66 AH3 LYS I 218 ? THR I 237 ? LYS I 218 THR I 237 1 ? 20 
HELX_P HELX_P67 AH4 ASP J 14  ? GLY J 29  ? ASP J 14  GLY J 29  1 ? 16 
HELX_P HELX_P68 AH5 ASP J 83  ? ALA J 92  ? ASP J 83  ALA J 92  1 ? 10 
HELX_P HELX_P69 AH6 THR J 93  ? SER J 95  ? THR J 93  SER J 95  5 ? 3  
HELX_P HELX_P70 AH7 THR J 109 ? HIS J 119 ? THR J 109 HIS J 119 1 ? 11 
HELX_P HELX_P71 AH8 ARG J 139 ? GLY J 149 ? ARG J 139 GLY J 149 1 ? 11 
HELX_P HELX_P72 AH9 THR J 164 ? GLN J 178 ? THR J 164 GLN J 178 1 ? 15 
HELX_P HELX_P73 AI1 GLY J 199 ? PHE J 210 ? GLY J 199 PHE J 210 1 ? 12 
HELX_P HELX_P74 AI2 SER J 215 ? THR J 237 ? SER J 215 THR J 237 1 ? 23 
HELX_P HELX_P75 AI3 LYS K 6   ? ASP K 28  ? LYS K 6   ASP K 28  1 ? 23 
HELX_P HELX_P76 AI4 GLN K 32  ? LEU K 49  ? GLN K 32  LEU K 49  1 ? 18 
HELX_P HELX_P77 AI5 ASP K 54  ? ARG K 59  ? ASP K 54  ARG K 59  1 ? 6  
HELX_P HELX_P78 AI6 LEU K 69  ? THR K 74  ? LEU K 69  THR K 74  1 ? 6  
HELX_P HELX_P79 AI7 HIS K 107 ? ASP K 112 ? HIS K 107 ASP K 112 1 ? 6  
HELX_P HELX_P80 AI8 GLN K 117 ? ALA K 122 ? GLN K 117 ALA K 122 1 ? 6  
HELX_P HELX_P81 AI9 ARG L 30  ? THR L 35  ? ARG L 30  THR L 35  1 ? 6  
HELX_P HELX_P82 AJ1 SER L 53  ? MET L 61  ? SER L 53  MET L 61  1 ? 9  
HELX_P HELX_P83 AJ2 THR L 79  ? PHE L 86  ? THR L 79  PHE L 86  1 ? 8  
HELX_P HELX_P84 AJ3 LYS L 121 ? GLY L 128 ? LYS L 121 GLY L 128 1 ? 8  
HELX_P HELX_P85 AJ4 LEU L 150 ? SER L 154 ? LEU L 150 SER L 154 1 ? 5  
HELX_P HELX_P86 AJ5 SER L 159 ? GLU L 171 ? SER L 159 GLU L 171 1 ? 13 
HELX_P HELX_P87 AJ6 THR L 192 ? PHE L 197 ? THR L 192 PHE L 197 1 ? 6  
HELX_P HELX_P88 AJ7 ARG L 236 ? SER L 249 ? ARG L 236 SER L 249 1 ? 14 
HELX_P HELX_P89 AJ8 LEU L 286 ? HIS L 299 ? LEU L 286 HIS L 299 1 ? 14 
HELX_P HELX_P90 AJ9 TYR L 300 ? GLU L 303 ? TYR L 300 GLU L 303 5 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? K CYS 92  SG ? ? ? 1_555 N ZN .   ZN ? ? K CYS 92  K ZN 201 1_555 ? ? ? ? ? ? ?                    2.621 ? 
hydrog1   hydrog ? ? A A   1   N1 ? ? ? 1_555 A U  340 N3 ? ? A A   1   A U  340 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog2   hydrog ? ? A A   1   N6 ? ? ? 1_555 A U  340 O4 ? ? A A   1   A U  340 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog3   hydrog ? ? A U   2   N3 ? ? ? 1_555 A A  339 N1 ? ? A U   2   A A  339 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog4   hydrog ? ? A U   2   O4 ? ? ? 1_555 A A  339 N6 ? ? A U   2   A A  339 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog5   hydrog ? ? A G   4   N1 ? ? ? 1_555 A C  338 N3 ? ? A G   4   A C  338 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog6   hydrog ? ? A G   4   N2 ? ? ? 1_555 A C  338 O2 ? ? A G   4   A C  338 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog7   hydrog ? ? A G   4   O6 ? ? ? 1_555 A C  338 N4 ? ? A G   4   A C  338 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog8   hydrog ? ? A G   5   N1 ? ? ? 1_555 A C  337 N3 ? ? A G   5   A C  337 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog9   hydrog ? ? A G   5   N2 ? ? ? 1_555 A C  337 O2 ? ? A G   5   A C  337 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog10  hydrog ? ? A G   5   O6 ? ? ? 1_555 A C  337 N4 ? ? A G   5   A C  337 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog11  hydrog ? ? A G   6   N1 ? ? ? 1_555 A C  336 N3 ? ? A G   6   A C  336 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog12  hydrog ? ? A G   6   N2 ? ? ? 1_555 A C  336 O2 ? ? A G   6   A C  336 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog13  hydrog ? ? A G   6   O6 ? ? ? 1_555 A C  336 N4 ? ? A G   6   A C  336 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog14  hydrog ? ? A C   7   N3 ? ? ? 1_555 A G  335 N1 ? ? A C   7   A G  335 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog15  hydrog ? ? A C   7   N4 ? ? ? 1_555 A G  335 O6 ? ? A C   7   A G  335 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog16  hydrog ? ? A C   7   O2 ? ? ? 1_555 A G  335 N2 ? ? A C   7   A G  335 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog17  hydrog ? ? A G   8   N3 ? ? ? 1_555 A A  123 N6 ? ? A G   8   A A  123 1_555 ? ? ? ? ? ? 'G-A MISPAIR'        ?     ? 
hydrog18  hydrog ? ? A G   8   N1 ? ? ? 1_555 A C  334 N3 ? ? A G   8   A C  334 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog19  hydrog ? ? A G   8   N2 ? ? ? 1_555 A C  334 O2 ? ? A G   8   A C  334 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog20  hydrog ? ? A G   8   O6 ? ? ? 1_555 A C  334 N4 ? ? A G   8   A C  334 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog21  hydrog ? ? A G   9   N2 ? ? ? 1_555 A C  333 O2 ? ? A G   9   A C  333 1_555 ? ? ? ? ? ? 'G-C PAIR'           ?     ? 
hydrog22  hydrog ? ? A A   10  N1 ? ? ? 1_555 A U  332 N3 ? ? A A   10  A U  332 1_555 ? ? ? ? ? ? 'A-U PAIR'           ?     ? 
hydrog23  hydrog ? ? A G   11  N2 ? ? ? 1_555 A C  331 O2 ? ? A G   11  A C  331 1_555 ? ? ? ? ? ? 'G-C PAIR'           ?     ? 
hydrog24  hydrog ? ? A G   12  N2 ? ? ? 1_555 A C  331 O2 ? ? A G   12  A C  331 1_555 ? ? ? ? ? ? 'G-C PAIR'           ?     ? 
hydrog25  hydrog ? ? A A   14  N1 ? ? ? 1_555 A U  329 N3 ? ? A A   14  A U  329 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog26  hydrog ? ? A A   14  N6 ? ? ? 1_555 A U  329 O4 ? ? A A   14  A U  329 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog27  hydrog ? ? A A   15  N1 ? ? ? 1_555 A U  327 N3 ? ? A A   15  A U  327 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog28  hydrog ? ? A A   15  N6 ? ? ? 1_555 A U  327 O4 ? ? A A   15  A U  327 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog29  hydrog ? ? A G   16  N2 ? ? ? 1_555 A A  310 N1 ? ? A G   16  A A  310 1_555 ? ? ? ? ? ? TYPE_10_PAIR         ?     ? 
hydrog30  hydrog ? ? A G   16  N3 ? ? ? 1_555 A A  310 N6 ? ? A G   16  A A  310 1_555 ? ? ? ? ? ? TYPE_10_PAIR         ?     ? 
hydrog31  hydrog ? ? A G   16  N1 ? ? ? 1_555 A C  326 O2 ? ? A G   16  A C  326 1_555 ? ? ? ? ? ? 'G-C PAIR'           ?     ? 
hydrog32  hydrog ? ? A C   17  N3 ? ? ? 1_555 A G  283 N1 ? ? A C   17  A G  283 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog33  hydrog ? ? A C   17  N4 ? ? ? 1_555 A G  283 O6 ? ? A C   17  A G  283 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog34  hydrog ? ? A C   17  O2 ? ? ? 1_555 A G  283 N2 ? ? A C   17  A G  283 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog35  hydrog ? ? A C   17  N4 ? ? ? 1_555 A U  309 O2 ? ? A C   17  A U  309 1_555 ? ? ? ? ? ? 'C-U MISPAIR'        ?     ? 
hydrog36  hydrog ? ? A U   18  N3 ? ? ? 1_555 A A  282 N1 ? ? A U   18  A A  282 1_555 ? ? ? ? ? ? 'U-A PAIR'           ?     ? 
hydrog37  hydrog ? ? A C   19  N3 ? ? ? 1_555 A G  281 N1 ? ? A C   19  A G  281 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog38  hydrog ? ? A C   19  N4 ? ? ? 1_555 A G  281 O6 ? ? A C   19  A G  281 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog39  hydrog ? ? A C   19  O2 ? ? ? 1_555 A G  281 N2 ? ? A C   19  A G  281 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog40  hydrog ? ? A A   20  N1 ? ? ? 1_555 A U  280 N3 ? ? A A   20  A U  280 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog41  hydrog ? ? A A   20  N6 ? ? ? 1_555 A U  280 O4 ? ? A A   20  A U  280 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog42  hydrog ? ? A U   21  O4 ? ? ? 1_555 A C  279 N4 ? ? A U   21  A C  279 1_555 ? ? ? ? ? ? 'U-C MISPAIR'        ?     ? 
hydrog43  hydrog ? ? A C   22  N3 ? ? ? 1_555 A G  278 N1 ? ? A C   22  A G  278 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog44  hydrog ? ? A C   22  N4 ? ? ? 1_555 A G  278 O6 ? ? A C   22  A G  278 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog45  hydrog ? ? A C   22  O2 ? ? ? 1_555 A G  278 N2 ? ? A C   22  A G  278 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog46  hydrog ? ? A U   25  N3 ? ? ? 1_555 A U  72  O4 ? ? A U   25  A U  72  1_555 ? ? ? ? ? ? TYPE_16_PAIR         ?     ? 
hydrog47  hydrog ? ? A U   25  O2 ? ? ? 1_555 A U  72  N3 ? ? A U   25  A U  72  1_555 ? ? ? ? ? ? TYPE_16_PAIR         ?     ? 
hydrog48  hydrog ? ? A G   26  N1 ? ? ? 1_555 A U  71  O2 ? ? A G   26  A U  71  1_555 ? ? ? ? ? ? TYPE_28_PAIR         ?     ? 
hydrog49  hydrog ? ? A G   26  O6 ? ? ? 1_555 A U  71  N3 ? ? A G   26  A U  71  1_555 ? ? ? ? ? ? TYPE_28_PAIR         ?     ? 
hydrog50  hydrog ? ? A G   27  N1 ? ? ? 1_555 A C  70  N3 ? ? A G   27  A C  70  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog51  hydrog ? ? A G   27  N2 ? ? ? 1_555 A C  70  O2 ? ? A G   27  A C  70  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog52  hydrog ? ? A G   27  O6 ? ? ? 1_555 A C  70  N4 ? ? A G   27  A C  70  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog53  hydrog ? ? A G   28  N1 ? ? ? 1_555 A C  69  N3 ? ? A G   28  A C  69  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog54  hydrog ? ? A G   28  N2 ? ? ? 1_555 A C  69  O2 ? ? A G   28  A C  69  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog55  hydrog ? ? A G   28  O6 ? ? ? 1_555 A C  69  N4 ? ? A G   28  A C  69  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog56  hydrog ? ? A G   29  N1 ? ? ? 1_555 A C  68  N3 ? ? A G   29  A C  68  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog57  hydrog ? ? A G   29  N2 ? ? ? 1_555 A C  68  O2 ? ? A G   29  A C  68  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog58  hydrog ? ? A G   29  O6 ? ? ? 1_555 A C  68  N4 ? ? A G   29  A C  68  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog59  hydrog ? ? A C   30  N3 ? ? ? 1_555 A G  66  N1 ? ? A C   30  A G  66  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog60  hydrog ? ? A C   30  N4 ? ? ? 1_555 A G  66  O6 ? ? A C   30  A G  66  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog61  hydrog ? ? A C   30  O2 ? ? ? 1_555 A G  66  N2 ? ? A C   30  A G  66  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog62  hydrog ? ? A G   34  N2 ? ? ? 1_555 A U  60  O4 ? ? A G   34  A U  60  1_555 ? ? ? ? ? ? 'G-U MISPAIR'        ?     ? 
hydrog63  hydrog ? ? A G   39  N1 ? ? ? 1_555 A C  57  N3 ? ? A G   39  A C  57  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog64  hydrog ? ? A G   39  N2 ? ? ? 1_555 A C  57  O2 ? ? A G   39  A C  57  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog65  hydrog ? ? A G   39  O6 ? ? ? 1_555 A C  57  N4 ? ? A G   39  A C  57  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog66  hydrog ? ? A A   40  N1 ? ? ? 1_555 A U  55  N3 ? ? A A   40  A U  55  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog67  hydrog ? ? A A   40  N6 ? ? ? 1_555 A U  55  O4 ? ? A A   40  A U  55  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog68  hydrog ? ? A G   41  N1 ? ? ? 1_555 A C  54  N3 ? ? A G   41  A C  54  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog69  hydrog ? ? A G   41  N2 ? ? ? 1_555 A C  54  O2 ? ? A G   41  A C  54  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog70  hydrog ? ? A G   41  O6 ? ? ? 1_555 A C  54  N4 ? ? A G   41  A C  54  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog71  hydrog ? ? A U   42  N3 ? ? ? 1_555 A A  53  N1 ? ? A U   42  A A  53  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog72  hydrog ? ? A U   42  O4 ? ? ? 1_555 A A  53  N6 ? ? A U   42  A A  53  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog73  hydrog ? ? A G   43  N1 ? ? ? 1_555 A C  52  N3 ? ? A G   43  A C  52  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog74  hydrog ? ? A G   43  N2 ? ? ? 1_555 A C  52  O2 ? ? A G   43  A C  52  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog75  hydrog ? ? A G   43  O6 ? ? ? 1_555 A C  52  N4 ? ? A G   43  A C  52  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog76  hydrog ? ? A C   44  N3 ? ? ? 1_555 A G  50  N1 ? ? A C   44  A G  50  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog77  hydrog ? ? A C   44  N4 ? ? ? 1_555 A G  50  O6 ? ? A C   44  A G  50  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog78  hydrog ? ? A C   44  O2 ? ? ? 1_555 A G  50  N2 ? ? A C   44  A G  50  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog79  hydrog ? ? A G   74  O6 ? ? ? 1_555 A C  312 N4 ? ? A G   74  A C  312 1_555 ? ? ? ? ? ? 'G-C PAIR'           ?     ? 
hydrog80  hydrog ? ? A G   75  O6 ? ? ? 1_555 A A  311 N6 ? ? A G   75  A A  311 1_555 ? ? ? ? ? ? 'G-A MISPAIR'        ?     ? 
hydrog81  hydrog ? ? A A   76  N6 ? ? ? 1_555 A U  324 O2 ? ? A A   76  A U  324 1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ?     ? 
hydrog82  hydrog ? ? A A   76  N7 ? ? ? 1_555 A U  324 N3 ? ? A A   76  A U  324 1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ?     ? 
hydrog83  hydrog ? ? A A   77  N6 ? ? ? 1_555 A C  313 O2 ? ? A A   77  A C  313 1_555 ? ? ? ? ? ? 'A-C MISPAIR'        ?     ? 
hydrog84  hydrog ? ? A G   78  O6 ? ? ? 1_555 A C  323 N4 ? ? A G   78  A C  323 1_555 ? ? ? ? ? ? 'G-C PAIR'           ?     ? 
hydrog85  hydrog ? ? A G   79  O6 ? ? ? 1_555 A A  322 N6 ? ? A G   79  A A  322 1_555 ? ? ? ? ? ? 'G-A MISPAIR'        ?     ? 
hydrog86  hydrog ? ? A C   81  N3 ? ? ? 1_555 A G  321 N2 ? ? A C   81  A G  321 1_555 ? ? ? ? ? ? 'C-G PAIR'           ?     ? 
hydrog87  hydrog ? ? A U   82  N3 ? ? ? 1_555 A A  320 N1 ? ? A U   82  A A  320 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog88  hydrog ? ? A U   82  O4 ? ? ? 1_555 A A  320 N6 ? ? A U   82  A A  320 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog89  hydrog ? ? A G   83  N1 ? ? ? 1_555 A C  319 N3 ? ? A G   83  A C  319 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog90  hydrog ? ? A G   83  N2 ? ? ? 1_555 A C  319 O2 ? ? A G   83  A C  319 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog91  hydrog ? ? A G   83  O6 ? ? ? 1_555 A C  319 N4 ? ? A G   83  A C  319 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog92  hydrog ? ? A A   84  N1 ? ? ? 1_555 A U  318 N3 ? ? A A   84  A U  318 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog93  hydrog ? ? A A   84  N6 ? ? ? 1_555 A U  318 O4 ? ? A A   84  A U  318 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog94  hydrog ? ? A G   85  N1 ? ? ? 1_555 A U  317 O2 ? ? A G   85  A U  317 1_555 ? ? ? ? ? ? TYPE_28_PAIR         ?     ? 
hydrog95  hydrog ? ? A G   85  O6 ? ? ? 1_555 A U  317 N3 ? ? A G   85  A U  317 1_555 ? ? ? ? ? ? TYPE_28_PAIR         ?     ? 
hydrog96  hydrog ? ? A G   91  N2 ? ? ? 1_555 A C  259 N3 ? ? A G   91  A C  259 1_555 ? ? ? ? ? ? 'G-C PAIR'           ?     ? 
hydrog97  hydrog ? ? A G   92  N2 ? ? ? 1_555 A C  258 O2 ? ? A G   92  A C  258 1_555 ? ? ? ? ? ? 'G-C PAIR'           ?     ? 
hydrog98  hydrog ? ? A C   93  N3 ? ? ? 1_555 A G  257 N1 ? ? A C   93  A G  257 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog99  hydrog ? ? A C   93  N4 ? ? ? 1_555 A G  257 O6 ? ? A C   93  A G  257 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog100 hydrog ? ? A C   93  O2 ? ? ? 1_555 A G  257 N2 ? ? A C   93  A G  257 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog101 hydrog ? ? A C   94  N3 ? ? ? 1_555 A G  256 N1 ? ? A C   94  A G  256 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog102 hydrog ? ? A C   94  N4 ? ? ? 1_555 A G  256 O6 ? ? A C   94  A G  256 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog103 hydrog ? ? A C   94  O2 ? ? ? 1_555 A G  256 N2 ? ? A C   94  A G  256 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog104 hydrog ? ? A G   101 N1 ? ? ? 1_555 A U  115 O2 ? ? A G   101 A U  115 1_555 ? ? ? ? ? ? TYPE_28_PAIR         ?     ? 
hydrog105 hydrog ? ? A G   101 O6 ? ? ? 1_555 A U  115 N3 ? ? A G   101 A U  115 1_555 ? ? ? ? ? ? TYPE_28_PAIR         ?     ? 
hydrog106 hydrog ? ? A G   102 N1 ? ? ? 1_555 A C  114 N3 ? ? A G   102 A C  114 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog107 hydrog ? ? A G   102 N2 ? ? ? 1_555 A C  114 O2 ? ? A G   102 A C  114 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog108 hydrog ? ? A G   102 O6 ? ? ? 1_555 A C  114 N4 ? ? A G   102 A C  114 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog109 hydrog ? ? A C   103 N3 ? ? ? 1_555 A G  113 N1 ? ? A C   103 A G  113 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog110 hydrog ? ? A C   103 N4 ? ? ? 1_555 A G  113 O6 ? ? A C   103 A G  113 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog111 hydrog ? ? A C   103 O2 ? ? ? 1_555 A G  113 N2 ? ? A C   103 A G  113 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog112 hydrog ? ? A C   104 N3 ? ? ? 1_555 A G  112 N1 ? ? A C   104 A G  112 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog113 hydrog ? ? A C   104 N4 ? ? ? 1_555 A G  112 O6 ? ? A C   104 A G  112 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog114 hydrog ? ? A C   104 O2 ? ? ? 1_555 A G  112 N2 ? ? A C   104 A G  112 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog115 hydrog ? ? A C   105 N3 ? ? ? 1_555 A G  111 N1 ? ? A C   105 A G  111 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog116 hydrog ? ? A C   105 N4 ? ? ? 1_555 A G  111 O6 ? ? A C   105 A G  111 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog117 hydrog ? ? A C   105 O2 ? ? ? 1_555 A G  111 N2 ? ? A C   105 A G  111 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog118 hydrog ? ? A A   107 N1 ? ? ? 1_555 A C  109 N4 ? ? A A   107 A C  109 1_555 ? ? ? ? ? ? 'A-C MISPAIR'        ?     ? 
hydrog119 hydrog ? ? A C   116 N3 ? ? ? 1_555 A G  134 N1 ? ? A C   116 A G  134 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog120 hydrog ? ? A C   116 N4 ? ? ? 1_555 A G  134 O6 ? ? A C   116 A G  134 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog121 hydrog ? ? A C   116 O2 ? ? ? 1_555 A G  134 N2 ? ? A C   116 A G  134 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog122 hydrog ? ? A U   117 N3 ? ? ? 1_555 A A  133 N1 ? ? A U   117 A A  133 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog123 hydrog ? ? A U   117 O4 ? ? ? 1_555 A A  133 N6 ? ? A U   117 A A  133 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog124 hydrog ? ? A C   118 N3 ? ? ? 1_555 A G  132 N1 ? ? A C   118 A G  132 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog125 hydrog ? ? A C   118 N4 ? ? ? 1_555 A G  132 O6 ? ? A C   118 A G  132 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog126 hydrog ? ? A C   118 O2 ? ? ? 1_555 A G  132 N2 ? ? A C   118 A G  132 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog127 hydrog ? ? A C   119 N3 ? ? ? 1_555 A G  131 N1 ? ? A C   119 A G  131 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog128 hydrog ? ? A C   119 N4 ? ? ? 1_555 A G  131 O6 ? ? A C   119 A G  131 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog129 hydrog ? ? A C   119 O2 ? ? ? 1_555 A G  131 N2 ? ? A C   119 A G  131 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog130 hydrog ? ? A C   120 N3 ? ? ? 1_555 A G  130 N1 ? ? A C   120 A G  130 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog131 hydrog ? ? A C   120 N4 ? ? ? 1_555 A G  130 O6 ? ? A C   120 A G  130 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog132 hydrog ? ? A C   120 O2 ? ? ? 1_555 A G  130 N2 ? ? A C   120 A G  130 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog133 hydrog ? ? A C   120 N3 ? ? ? 1_555 A G  131 N1 ? ? A C   120 A G  131 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog134 hydrog ? ? A C   120 N4 ? ? ? 1_555 A G  131 O6 ? ? A C   120 A G  131 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog135 hydrog ? ? A C   120 O2 ? ? ? 1_555 A G  131 N2 ? ? A C   120 A G  131 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog136 hydrog ? ? A U   121 N3 ? ? ? 1_555 A G  129 O6 ? ? A U   121 A G  129 1_555 ? ? ? ? ? ? TYPE_28_PAIR         ?     ? 
hydrog137 hydrog ? ? A U   121 O2 ? ? ? 1_555 A G  129 N1 ? ? A U   121 A G  129 1_555 ? ? ? ? ? ? TYPE_28_PAIR         ?     ? 
hydrog138 hydrog ? ? A G   122 N1 ? ? ? 1_555 A C  128 N3 ? ? A G   122 A C  128 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog139 hydrog ? ? A G   122 N2 ? ? ? 1_555 A C  128 O2 ? ? A G   122 A C  128 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog140 hydrog ? ? A G   122 O6 ? ? ? 1_555 A C  128 N4 ? ? A G   122 A C  128 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog141 hydrog ? ? A A   123 N1 ? ? ? 1_555 A G  335 N2 ? ? A A   123 A G  335 1_555 ? ? ? ? ? ? TYPE_10_PAIR         ?     ? 
hydrog142 hydrog ? ? A A   123 N6 ? ? ? 1_555 A G  335 N3 ? ? A A   123 A G  335 1_555 ? ? ? ? ? ? TYPE_10_PAIR         ?     ? 
hydrog143 hydrog ? ? A G   135 N1 ? ? ? 1_555 A C  255 N3 ? ? A G   135 A C  255 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog144 hydrog ? ? A G   135 N2 ? ? ? 1_555 A C  255 O2 ? ? A G   135 A C  255 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog145 hydrog ? ? A G   135 O6 ? ? ? 1_555 A C  255 N4 ? ? A G   135 A C  255 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog146 hydrog ? ? A U   136 N3 ? ? ? 1_555 A A  254 N1 ? ? A U   136 A A  254 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog147 hydrog ? ? A U   136 O4 ? ? ? 1_555 A A  254 N6 ? ? A U   136 A A  254 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog148 hydrog ? ? A G   137 N1 ? ? ? 1_555 A C  253 N3 ? ? A G   137 A C  253 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog149 hydrog ? ? A G   137 N2 ? ? ? 1_555 A C  253 O2 ? ? A G   137 A C  253 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog150 hydrog ? ? A G   137 O6 ? ? ? 1_555 A C  253 N4 ? ? A G   137 A C  253 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog151 hydrog ? ? A A   138 N1 ? ? ? 1_555 A U  252 N3 ? ? A A   138 A U  252 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog152 hydrog ? ? A A   138 N6 ? ? ? 1_555 A U  252 O4 ? ? A A   138 A U  252 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog153 hydrog ? ? A G   139 N1 ? ? ? 1_555 A C  251 N3 ? ? A G   139 A C  251 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog154 hydrog ? ? A G   139 N2 ? ? ? 1_555 A C  251 O2 ? ? A G   139 A C  251 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog155 hydrog ? ? A G   139 O6 ? ? ? 1_555 A C  251 N4 ? ? A G   139 A C  251 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog156 hydrog ? ? A U   140 N3 ? ? ? 1_555 A A  250 N1 ? ? A U   140 A A  250 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog157 hydrog ? ? A U   140 O4 ? ? ? 1_555 A A  250 N6 ? ? A U   140 A A  250 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog158 hydrog ? ? A U   141 N3 ? ? ? 1_555 A G  249 O6 ? ? A U   141 A G  249 1_555 ? ? ? ? ? ? TYPE_28_PAIR         ?     ? 
hydrog159 hydrog ? ? A U   141 O2 ? ? ? 1_555 A G  249 N1 ? ? A U   141 A G  249 1_555 ? ? ? ? ? ? TYPE_28_PAIR         ?     ? 
hydrog160 hydrog ? ? A C   142 N4 ? ? ? 1_555 M C  56  O2 ? ? A C   142 T C  56  1_555 ? ? ? ? ? ? 'C-C MISPAIR'        ?     ? 
hydrog161 hydrog ? ? A A   145 N1 ? ? ? 1_555 A A  149 N6 ? ? A A   145 A A  149 1_555 ? ? ? ? ? ? TYPE_5_PAIR          ?     ? 
hydrog162 hydrog ? ? A A   145 N6 ? ? ? 1_555 A A  149 N7 ? ? A A   145 A A  149 1_555 ? ? ? ? ? ? TYPE_5_PAIR          ?     ? 
hydrog163 hydrog ? ? A G   146 N2 ? ? ? 1_555 A A  246 N1 ? ? A G   146 A A  246 1_555 ? ? ? ? ? ? 'G-A MISPAIR'        ?     ? 
hydrog164 hydrog ? ? A G   155 N1 ? ? ? 1_555 A C  240 N3 ? ? A G   155 A C  240 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog165 hydrog ? ? A G   155 N2 ? ? ? 1_555 A C  240 O2 ? ? A G   155 A C  240 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog166 hydrog ? ? A G   155 O6 ? ? ? 1_555 A C  240 N4 ? ? A G   155 A C  240 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog167 hydrog ? ? A C   156 N3 ? ? ? 1_555 A G  239 N1 ? ? A C   156 A G  239 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog168 hydrog ? ? A C   156 N4 ? ? ? 1_555 A G  239 O6 ? ? A C   156 A G  239 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog169 hydrog ? ? A C   156 O2 ? ? ? 1_555 A G  239 N2 ? ? A C   156 A G  239 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog170 hydrog ? ? A U   157 N3 ? ? ? 1_555 A A  238 N1 ? ? A U   157 A A  238 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog171 hydrog ? ? A U   157 O4 ? ? ? 1_555 A A  238 N6 ? ? A U   157 A A  238 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog172 hydrog ? ? A C   158 N3 ? ? ? 1_555 A G  237 N1 ? ? A C   158 A G  237 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog173 hydrog ? ? A C   158 N4 ? ? ? 1_555 A G  237 O6 ? ? A C   158 A G  237 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog174 hydrog ? ? A C   158 O2 ? ? ? 1_555 A G  237 N2 ? ? A C   158 A G  237 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog175 hydrog ? ? A C   159 N3 ? ? ? 1_555 A G  236 N1 ? ? A C   159 A G  236 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog176 hydrog ? ? A C   159 N4 ? ? ? 1_555 A G  236 O6 ? ? A C   159 A G  236 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog177 hydrog ? ? A C   159 O2 ? ? ? 1_555 A G  236 N2 ? ? A C   159 A G  236 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog178 hydrog ? ? A G   160 O6 ? ? ? 1_555 A C  235 N4 ? ? A G   160 A C  235 1_555 ? ? ? ? ? ? 'G-C PAIR'           ?     ? 
hydrog179 hydrog ? ? A G   162 N1 ? ? ? 1_555 A C  234 N3 ? ? A G   162 A C  234 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog180 hydrog ? ? A G   162 N2 ? ? ? 1_555 A C  234 O2 ? ? A G   162 A C  234 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog181 hydrog ? ? A G   162 O6 ? ? ? 1_555 A C  234 N4 ? ? A G   162 A C  234 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog182 hydrog ? ? A C   163 N3 ? ? ? 1_555 A G  233 N1 ? ? A C   163 A G  233 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog183 hydrog ? ? A C   163 N4 ? ? ? 1_555 A G  233 O6 ? ? A C   163 A G  233 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog184 hydrog ? ? A C   163 O2 ? ? ? 1_555 A G  233 N2 ? ? A C   163 A G  233 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog185 hydrog ? ? A G   164 N2 ? ? ? 1_555 A U  231 O2 ? ? A G   164 A U  231 1_555 ? ? ? ? ? ? 'G-U MISPAIR'        ?     ? 
hydrog186 hydrog ? ? A G   164 N1 ? ? ? 1_555 A U  232 O4 ? ? A G   164 A U  232 1_555 ? ? ? ? ? ? 'G-U MISPAIR'        ?     ? 
hydrog187 hydrog ? ? A A   165 N1 ? ? ? 1_555 A U  230 N3 ? ? A A   165 A U  230 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog188 hydrog ? ? A A   165 N6 ? ? ? 1_555 A U  230 O4 ? ? A A   165 A U  230 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog189 hydrog ? ? A G   166 N1 ? ? ? 1_555 A C  229 N3 ? ? A G   166 A C  229 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog190 hydrog ? ? A G   166 N2 ? ? ? 1_555 A C  229 O2 ? ? A G   166 A C  229 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog191 hydrog ? ? A G   166 O6 ? ? ? 1_555 A C  229 N4 ? ? A G   166 A C  229 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog192 hydrog ? ? A G   167 N1 ? ? ? 1_555 A C  228 N3 ? ? A G   167 A C  228 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog193 hydrog ? ? A G   167 N2 ? ? ? 1_555 A C  228 O2 ? ? A G   167 A C  228 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog194 hydrog ? ? A G   167 O6 ? ? ? 1_555 A C  228 N4 ? ? A G   167 A C  228 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog195 hydrog ? ? A G   175 N1 ? ? ? 1_555 A U  227 O2 ? ? A G   175 A U  227 1_555 ? ? ? ? ? ? TYPE_28_PAIR         ?     ? 
hydrog196 hydrog ? ? A G   175 O6 ? ? ? 1_555 A U  227 N3 ? ? A G   175 A U  227 1_555 ? ? ? ? ? ? TYPE_28_PAIR         ?     ? 
hydrog197 hydrog ? ? A G   176 N1 ? ? ? 1_555 A C  226 N3 ? ? A G   176 A C  226 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog198 hydrog ? ? A G   176 N2 ? ? ? 1_555 A C  226 O2 ? ? A G   176 A C  226 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog199 hydrog ? ? A G   176 O6 ? ? ? 1_555 A C  226 N4 ? ? A G   176 A C  226 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog200 hydrog ? ? A G   177 N1 ? ? ? 1_555 A C  225 N3 ? ? A G   177 A C  225 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog201 hydrog ? ? A G   177 N2 ? ? ? 1_555 A C  225 O2 ? ? A G   177 A C  225 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog202 hydrog ? ? A G   177 O6 ? ? ? 1_555 A C  225 N4 ? ? A G   177 A C  225 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog203 hydrog ? ? A C   178 N3 ? ? ? 1_555 A G  224 N1 ? ? A C   178 A G  224 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog204 hydrog ? ? A C   178 N4 ? ? ? 1_555 A G  224 O6 ? ? A C   178 A G  224 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog205 hydrog ? ? A C   178 O2 ? ? ? 1_555 A G  224 N2 ? ? A C   178 A G  224 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog206 hydrog ? ? A A   179 N1 ? ? ? 1_555 A U  223 N3 ? ? A A   179 A U  223 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog207 hydrog ? ? A A   179 N6 ? ? ? 1_555 A U  223 O4 ? ? A A   179 A U  223 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog208 hydrog ? ? A G   183 N2 ? ? ? 1_555 A A  222 N7 ? ? A G   183 A A  222 1_555 ? ? ? ? ? ? TYPE_11_PAIR         ?     ? 
hydrog209 hydrog ? ? A G   183 N3 ? ? ? 1_555 A A  222 N6 ? ? A G   183 A A  222 1_555 ? ? ? ? ? ? TYPE_11_PAIR         ?     ? 
hydrog210 hydrog ? ? A A   184 N6 ? ? ? 1_555 A G  221 N3 ? ? A A   184 A G  221 1_555 ? ? ? ? ? ? TYPE_11_PAIR         ?     ? 
hydrog211 hydrog ? ? A A   184 N7 ? ? ? 1_555 A G  221 N2 ? ? A A   184 A G  221 1_555 ? ? ? ? ? ? TYPE_11_PAIR         ?     ? 
hydrog212 hydrog ? ? A U   185 O4 ? ? ? 1_555 A G  220 N2 ? ? A U   185 A G  220 1_555 ? ? ? ? ? ? 'U-G MISPAIR'        ?     ? 
hydrog213 hydrog ? ? A G   186 N2 ? ? ? 1_555 A C  219 O2 ? ? A G   186 A C  219 1_555 ? ? ? ? ? ? 'G-C PAIR'           ?     ? 
hydrog214 hydrog ? ? A C   187 N3 ? ? ? 1_555 A G  218 N1 ? ? A C   187 A G  218 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog215 hydrog ? ? A C   187 N4 ? ? ? 1_555 A G  218 O6 ? ? A C   187 A G  218 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog216 hydrog ? ? A C   187 O2 ? ? ? 1_555 A G  218 N2 ? ? A C   187 A G  218 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog217 hydrog ? ? A C   188 N3 ? ? ? 1_555 A G  217 N1 ? ? A C   188 A G  217 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog218 hydrog ? ? A C   188 N4 ? ? ? 1_555 A G  217 O6 ? ? A C   188 A G  217 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog219 hydrog ? ? A C   188 O2 ? ? ? 1_555 A G  217 N2 ? ? A C   188 A G  217 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog220 hydrog ? ? A G   189 N1 ? ? ? 1_555 A C  216 N3 ? ? A G   189 A C  216 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog221 hydrog ? ? A G   189 N2 ? ? ? 1_555 A C  216 O2 ? ? A G   189 A C  216 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog222 hydrog ? ? A G   189 O6 ? ? ? 1_555 A C  216 N4 ? ? A G   189 A C  216 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog223 hydrog ? ? A G   191 N1 ? ? ? 1_555 A C  215 N3 ? ? A G   191 A C  215 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog224 hydrog ? ? A G   191 N2 ? ? ? 1_555 A C  215 O2 ? ? A G   191 A C  215 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog225 hydrog ? ? A G   191 O6 ? ? ? 1_555 A C  215 N4 ? ? A G   191 A C  215 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog226 hydrog ? ? A G   192 N1 ? ? ? 1_555 A C  214 N3 ? ? A G   192 A C  214 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog227 hydrog ? ? A G   192 N2 ? ? ? 1_555 A C  214 O2 ? ? A G   192 A C  214 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog228 hydrog ? ? A G   192 O6 ? ? ? 1_555 A C  214 N4 ? ? A G   192 A C  214 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog229 hydrog ? ? A C   194 N3 ? ? ? 1_555 A G  213 N1 ? ? A C   194 A G  213 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog230 hydrog ? ? A C   194 N4 ? ? ? 1_555 A G  213 O6 ? ? A C   194 A G  213 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog231 hydrog ? ? A C   194 O2 ? ? ? 1_555 A G  213 N2 ? ? A C   194 A G  213 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog232 hydrog ? ? A C   195 N3 ? ? ? 1_555 A G  212 N1 ? ? A C   195 A G  212 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog233 hydrog ? ? A C   195 N4 ? ? ? 1_555 A G  212 O6 ? ? A C   195 A G  212 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog234 hydrog ? ? A C   195 O2 ? ? ? 1_555 A G  212 N2 ? ? A C   195 A G  212 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog235 hydrog ? ? A C   196 N3 ? ? ? 1_555 A G  211 N1 ? ? A C   196 A G  211 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog236 hydrog ? ? A C   196 N4 ? ? ? 1_555 A G  211 O6 ? ? A C   196 A G  211 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog237 hydrog ? ? A C   196 O2 ? ? ? 1_555 A G  211 N2 ? ? A C   196 A G  211 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog238 hydrog ? ? A C   197 N3 ? ? ? 1_555 A G  210 N1 ? ? A C   197 A G  210 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog239 hydrog ? ? A C   197 N4 ? ? ? 1_555 A G  210 O6 ? ? A C   197 A G  210 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog240 hydrog ? ? A C   197 O2 ? ? ? 1_555 A G  210 N2 ? ? A C   197 A G  210 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog241 hydrog ? ? A C   199 N3 ? ? ? 1_555 A G  208 N1 ? ? A C   199 A G  208 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog242 hydrog ? ? A C   199 N4 ? ? ? 1_555 A G  208 O6 ? ? A C   199 A G  208 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog243 hydrog ? ? A C   199 O2 ? ? ? 1_555 A G  208 N2 ? ? A C   199 A G  208 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog244 hydrog ? ? A C   200 N3 ? ? ? 1_555 A G  207 N1 ? ? A C   200 A G  207 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog245 hydrog ? ? A C   200 N4 ? ? ? 1_555 A G  207 O6 ? ? A C   200 A G  207 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog246 hydrog ? ? A C   200 O2 ? ? ? 1_555 A G  207 N2 ? ? A C   200 A G  207 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog247 hydrog ? ? A C   201 N4 ? ? ? 1_555 A G  206 O6 ? ? A C   201 A G  206 1_555 ? ? ? ? ? ? 'C-G PAIR'           ?     ? 
hydrog248 hydrog ? ? A U   202 O2 ? ? ? 1_555 A G  206 N1 ? ? A U   202 A G  206 1_555 ? ? ? ? ? ? 'U-G MISPAIR'        ?     ? 
hydrog249 hydrog ? ? A U   242 N3 ? ? ? 1_555 A A  246 N7 ? ? A U   242 A A  246 1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ?     ? 
hydrog250 hydrog ? ? A U   242 O2 ? ? ? 1_555 A A  246 N6 ? ? A U   242 A A  246 1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ?     ? 
hydrog251 hydrog ? ? A A   269 N3 ? ? ? 1_555 A A  275 N6 ? ? A A   269 A A  275 1_555 ? ? ? ? ? ? 'A-A MISPAIR'        ?     ? 
hydrog252 hydrog ? ? A A   275 N7 ? ? ? 1_555 A A  316 N6 ? ? A A   275 A A  316 1_555 ? ? ? ? ? ? 'A-A MISPAIR'        ?     ? 
hydrog253 hydrog ? ? A U   276 N3 ? ? ? 1_555 A A  315 N7 ? ? A U   276 A A  315 1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ?     ? 
hydrog254 hydrog ? ? A U   276 O2 ? ? ? 1_555 A A  315 N6 ? ? A U   276 A A  315 1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ?     ? 
hydrog255 hydrog ? ? A G   277 N1 ? ? ? 1_555 A C  313 N3 ? ? A G   277 A C  313 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog256 hydrog ? ? A G   277 N2 ? ? ? 1_555 A C  313 O2 ? ? A G   277 A C  313 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog257 hydrog ? ? A G   277 O6 ? ? ? 1_555 A C  313 N4 ? ? A G   277 A C  313 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog258 hydrog ? ? A G   284 N1 ? ? ? 1_555 A U  309 O2 ? ? A G   284 A U  309 1_555 ? ? ? ? ? ? TYPE_28_PAIR         ?     ? 
hydrog259 hydrog ? ? A G   284 O6 ? ? ? 1_555 A U  309 N3 ? ? A G   284 A U  309 1_555 ? ? ? ? ? ? TYPE_28_PAIR         ?     ? 
hydrog260 hydrog ? ? A U   285 N3 ? ? ? 1_555 A A  308 N1 ? ? A U   285 A A  308 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog261 hydrog ? ? A U   285 O4 ? ? ? 1_555 A A  308 N6 ? ? A U   285 A A  308 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog262 hydrog ? ? A G   286 N2 ? ? ? 1_555 A C  307 O2 ? ? A G   286 A C  307 1_555 ? ? ? ? ? ? 'G-C PAIR'           ?     ? 
hydrog263 hydrog ? ? A A   287 N1 ? ? ? 1_555 A U  306 N3 ? ? A A   287 A U  306 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog264 hydrog ? ? A A   287 N6 ? ? ? 1_555 A U  306 O4 ? ? A A   287 A U  306 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog265 hydrog ? ? A G   288 N2 ? ? ? 1_555 A C  305 O2 ? ? A G   288 A C  305 1_555 ? ? ? ? ? ? 'G-C PAIR'           ?     ? 
hydrog266 hydrog ? ? A G   288 N1 ? ? ? 1_555 A U  306 O4 ? ? A G   288 A U  306 1_555 ? ? ? ? ? ? 'G-U MISPAIR'        ?     ? 
hydrog267 hydrog ? ? A G   289 N1 ? ? ? 1_555 A C  304 N3 ? ? A G   289 A C  304 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog268 hydrog ? ? A G   289 N2 ? ? ? 1_555 A C  304 O2 ? ? A G   289 A C  304 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog269 hydrog ? ? A G   289 O6 ? ? ? 1_555 A C  304 N4 ? ? A G   289 A C  304 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog270 hydrog ? ? A U   290 N3 ? ? ? 1_555 A A  303 N1 ? ? A U   290 A A  303 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog271 hydrog ? ? A U   290 O4 ? ? ? 1_555 A A  303 N6 ? ? A U   290 A A  303 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog272 hydrog ? ? A C   292 N3 ? ? ? 1_555 A G  302 N1 ? ? A C   292 A G  302 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog273 hydrog ? ? A C   292 N4 ? ? ? 1_555 A G  302 O6 ? ? A C   292 A G  302 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog274 hydrog ? ? A C   292 O2 ? ? ? 1_555 A G  302 N2 ? ? A C   292 A G  302 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog275 hydrog ? ? A C   293 N3 ? ? ? 1_555 A G  301 N1 ? ? A C   293 A G  301 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog276 hydrog ? ? A C   293 N4 ? ? ? 1_555 A G  301 O6 ? ? A C   293 A G  301 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog277 hydrog ? ? A C   293 O2 ? ? ? 1_555 A G  301 N2 ? ? A C   293 A G  301 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog278 hydrog ? ? A C   294 N3 ? ? ? 1_555 A G  300 N1 ? ? A C   294 A G  300 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog279 hydrog ? ? A C   294 N4 ? ? ? 1_555 A G  300 O6 ? ? A C   294 A G  300 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog280 hydrog ? ? A C   294 O2 ? ? ? 1_555 A G  300 N2 ? ? A C   294 A G  300 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog281 hydrog ? ? A C   295 N3 ? ? ? 1_555 A G  300 N1 ? ? A C   295 A G  300 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog282 hydrog ? ? A C   295 N4 ? ? ? 1_555 A G  300 O6 ? ? A C   295 A G  300 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog283 hydrog ? ? A C   295 O2 ? ? ? 1_555 A G  300 N2 ? ? A C   295 A G  300 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog284 hydrog ? ? A G   296 N2 ? ? ? 1_555 A G  299 O6 ? ? A G   296 A G  299 1_555 ? ? ? ? ? ? 'G-G MISPAIR'        ?     ? 
hydrog285 hydrog ? ? M G   1   O6 ? ? ? 1_555 M C  72  N4 ? ? T G   1   T C  72  1_555 ? ? ? ? ? ? 'G-C PAIR'           ?     ? 
hydrog286 hydrog ? ? M U   2   N3 ? ? ? 1_555 M A  71  N1 ? ? T U   2   T A  71  1_555 ? ? ? ? ? ? 'U-A PAIR'           ?     ? 
hydrog287 hydrog ? ? M U   3   N3 ? ? ? 1_555 M A  70  N1 ? ? T U   3   T A  70  1_555 ? ? ? ? ? ? 'U-A PAIR'           ?     ? 
hydrog288 hydrog ? ? M C   5   O2 ? ? ? 1_555 M G  68  N2 ? ? T C   5   T G  68  1_555 ? ? ? ? ? ? 'C-G PAIR'           ?     ? 
hydrog289 hydrog ? ? M C   6   N3 ? ? ? 1_555 M G  67  N1 ? ? T C   6   T G  67  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog290 hydrog ? ? M C   6   N4 ? ? ? 1_555 M G  67  O6 ? ? T C   6   T G  67  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog291 hydrog ? ? M C   6   O2 ? ? ? 1_555 M G  67  N2 ? ? T C   6   T G  67  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog292 hydrog ? ? M G   7   O6 ? ? ? 1_555 M C  66  N4 ? ? T G   7   T C  66  1_555 ? ? ? ? ? ? 'G-C PAIR'           ?     ? 
hydrog293 hydrog ? ? M G   10  N1 ? ? ? 1_555 M C  25  N3 ? ? T G   10  T C  25  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog294 hydrog ? ? M G   10  N2 ? ? ? 1_555 M C  25  O2 ? ? T G   10  T C  25  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog295 hydrog ? ? M G   10  O6 ? ? ? 1_555 M C  25  N4 ? ? T G   10  T C  25  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog296 hydrog ? ? M G   10  N7 ? ? ? 1_555 M G  45  N2 ? ? T G   10  T G  45  1_555 ? ? ? ? ? ? 'G-G MISPAIR'        ?     ? 
hydrog297 hydrog ? ? M U   11  N3 ? ? ? 1_555 M A  24  N1 ? ? T U   11  T A  24  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog298 hydrog ? ? M U   11  O4 ? ? ? 1_555 M A  24  N6 ? ? T U   11  T A  24  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog299 hydrog ? ? M U   11  N3 ? ? ? 1_555 M C  25  N3 ? ? T U   11  T C  25  1_555 ? ? ? ? ? ? TYPE_18_PAIR         ?     ? 
hydrog300 hydrog ? ? M U   11  O4 ? ? ? 1_555 M C  25  N4 ? ? T U   11  T C  25  1_555 ? ? ? ? ? ? TYPE_18_PAIR         ?     ? 
hydrog301 hydrog ? ? M G   12  O6 ? ? ? 1_555 M C  23  N4 ? ? T G   12  T C  23  1_555 ? ? ? ? ? ? 'G-C PAIR'           ?     ? 
hydrog302 hydrog ? ? M U   13  O2 ? ? ? 1_555 M C  23  N4 ? ? T U   13  T C  23  1_555 ? ? ? ? ? ? 'U-C MISPAIR'        ?     ? 
hydrog303 hydrog ? ? M G   18  N1 ? ? ? 1_555 M U  55  O2 ? ? T G   18  T U  55  1_555 ? ? ? ? ? ? 'G-U MISPAIR'        ?     ? 
hydrog304 hydrog ? ? M U   19  N3 ? ? ? 1_555 M C  56  N3 ? ? T U   19  T C  56  1_555 ? ? ? ? ? ? TYPE_18_PAIR         ?     ? 
hydrog305 hydrog ? ? M U   19  O4 ? ? ? 1_555 M C  56  N4 ? ? T U   19  T C  56  1_555 ? ? ? ? ? ? TYPE_18_PAIR         ?     ? 
hydrog306 hydrog ? ? M U   22  O4 ? ? ? 1_555 M G  46  N2 ? ? T U   22  T G  46  1_555 ? ? ? ? ? ? 'U-G MISPAIR'        ?     ? 
hydrog307 hydrog ? ? M G   26  O6 ? ? ? 1_555 M A  43  N6 ? ? T G   26  T A  43  1_555 ? ? ? ? ? ? 'G-A MISPAIR'        ?     ? 
hydrog308 hydrog ? ? M G   26  N2 ? ? ? 1_555 M A  44  N1 ? ? T G   26  T A  44  1_555 ? ? ? ? ? ? 'G-A MISPAIR'        ?     ? 
hydrog309 hydrog ? ? M U   27  N3 ? ? ? 1_555 M A  43  N1 ? ? T U   27  T A  43  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog310 hydrog ? ? M U   27  O4 ? ? ? 1_555 M A  43  N6 ? ? T U   27  T A  43  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog311 hydrog ? ? M U   28  N3 ? ? ? 1_555 M A  42  N1 ? ? T U   28  T A  42  1_555 ? ? ? ? ? ? 'U-A PAIR'           ?     ? 
hydrog312 hydrog ? ? M C   29  O2 ? ? ? 1_555 M G  41  N2 ? ? T C   29  T G  41  1_555 ? ? ? ? ? ? 'C-G PAIR'           ?     ? 
hydrog313 hydrog ? ? M G   30  N2 ? ? ? 1_555 M C  40  O2 ? ? T G   30  T C  40  1_555 ? ? ? ? ? ? 'G-C PAIR'           ?     ? 
hydrog314 hydrog ? ? M C   31  O2 ? ? ? 1_555 M G  39  N1 ? ? T C   31  T G  39  1_555 ? ? ? ? ? ? 'C-G PAIR'           ?     ? 
hydrog315 hydrog ? ? M C   49  N3 ? ? ? 1_555 M G  65  N1 ? ? T C   49  T G  65  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog316 hydrog ? ? M C   49  N4 ? ? ? 1_555 M G  65  O6 ? ? T C   49  T G  65  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog317 hydrog ? ? M C   49  O2 ? ? ? 1_555 M G  65  N2 ? ? T C   49  T G  65  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog318 hydrog ? ? M C   50  N3 ? ? ? 1_555 M G  64  N1 ? ? T C   50  T G  64  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog319 hydrog ? ? M C   50  N4 ? ? ? 1_555 M G  64  O6 ? ? T C   50  T G  64  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog320 hydrog ? ? M C   50  O2 ? ? ? 1_555 M G  64  N2 ? ? T C   50  T G  64  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog321 hydrog ? ? M C   51  N3 ? ? ? 1_555 M G  63  N1 ? ? T C   51  T G  63  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog322 hydrog ? ? M C   51  N4 ? ? ? 1_555 M G  63  O6 ? ? T C   51  T G  63  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog323 hydrog ? ? M C   51  O2 ? ? ? 1_555 M G  63  N2 ? ? T C   51  T G  63  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog324 hydrog ? ? M G   52  N1 ? ? ? 1_555 M C  62  N3 ? ? T G   52  T C  62  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog325 hydrog ? ? M G   52  N2 ? ? ? 1_555 M C  62  O2 ? ? T G   52  T C  62  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog326 hydrog ? ? M G   52  O6 ? ? ? 1_555 M C  62  N4 ? ? T G   52  T C  62  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog327 hydrog ? ? M G   53  N1 ? ? ? 1_555 M C  61  N3 ? ? T G   53  T C  61  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog328 hydrog ? ? M G   53  N2 ? ? ? 1_555 M C  61  O2 ? ? T G   53  T C  61  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog329 hydrog ? ? M G   53  O6 ? ? ? 1_555 M C  61  N4 ? ? T G   53  T C  61  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog330 hydrog ? ? M U   54  N3 ? ? ? 1_555 M A  58  N7 ? ? T U   54  T A  58  1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ?     ? 
hydrog331 hydrog ? ? M U   54  O2 ? ? ? 1_555 M A  58  N6 ? ? T U   54  T A  58  1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 409 B . ? LEU 409 B PRO 410 B ? PRO 410 B 1 6.39  
2 ALA 702 B . ? ALA 702 B PRO 703 B ? PRO 703 B 1 -4.68 
3 GLY 64  L . ? GLY 64  L PRO 65  L ? PRO 65  L 1 -2.99 
4 GLU 268 L . ? GLU 268 L PRO 269 L ? PRO 269 L 1 1.41  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 6 ? 
AA3 ? 3 ? 
AA4 ? 3 ? 
AA5 ? 6 ? 
AA6 ? 4 ? 
AA7 ? 2 ? 
AA8 ? 4 ? 
AA9 ? 7 ? 
AB1 ? 4 ? 
AB2 ? 4 ? 
AB3 ? 4 ? 
AB4 ? 4 ? 
AB5 ? 2 ? 
AB6 ? 8 ? 
AB7 ? 3 ? 
AB8 ? 4 ? 
AB9 ? 6 ? 
AC1 ? 3 ? 
AC2 ? 6 ? 
AC3 ? 3 ? 
AC4 ? 8 ? 
AC5 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? parallel      
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA5 4 5 ? anti-parallel 
AA5 5 6 ? anti-parallel 
AA6 1 2 ? parallel      
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? parallel      
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AA9 3 4 ? anti-parallel 
AA9 4 5 ? anti-parallel 
AA9 5 6 ? anti-parallel 
AA9 6 7 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? anti-parallel 
AB3 1 2 ? parallel      
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB4 1 2 ? parallel      
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB6 4 5 ? anti-parallel 
AB6 5 6 ? anti-parallel 
AB6 6 7 ? anti-parallel 
AB6 7 8 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB8 1 2 ? parallel      
AB8 2 3 ? parallel      
AB8 3 4 ? parallel      
AB9 1 2 ? parallel      
AB9 2 3 ? parallel      
AB9 3 4 ? parallel      
AB9 4 5 ? parallel      
AB9 5 6 ? parallel      
AC1 1 2 ? parallel      
AC1 2 3 ? parallel      
AC2 1 2 ? parallel      
AC2 2 3 ? parallel      
AC2 3 4 ? parallel      
AC2 4 5 ? parallel      
AC2 5 6 ? parallel      
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC4 2 3 ? anti-parallel 
AC4 3 4 ? anti-parallel 
AC4 4 5 ? anti-parallel 
AC4 5 6 ? anti-parallel 
AC4 6 7 ? anti-parallel 
AC4 7 8 ? anti-parallel 
AC5 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 PHE B 212  ? VAL B 215  ? PHE B 212  VAL B 215  
AA1 2 LEU B 222  ? PRO B 226  ? LEU B 222  PRO B 226  
AA2 1 LEU B 243  ? LEU B 244  ? LEU B 243  LEU B 244  
AA2 2 MET B 429  ? ILE B 435  ? MET B 429  ILE B 435  
AA2 3 GLY B 617  ? PRO B 623  ? GLY B 617  PRO B 623  
AA2 4 LYS B 594  ? GLN B 602  ? LYS B 594  GLN B 602  
AA2 5 LEU B 507  ? GLY B 510  ? LEU B 507  GLY B 510  
AA2 6 LYS B 448  ? ALA B 449  ? LYS B 448  ALA B 449  
AA3 1 CYS B 252  ? LYS B 256  ? CYS B 252  LYS B 256  
AA3 2 ILE B 421  ? LEU B 425  ? ILE B 421  LEU B 425  
AA3 3 SER B 412  ? TRP B 413  ? SER B 412  TRP B 413  
AA4 1 GLN B 289  ? LEU B 294  ? GLN B 289  LEU B 294  
AA4 2 GLY B 306  ? LYS B 313  ? GLY B 306  LYS B 313  
AA4 3 GLN B 326  ? TRP B 330  ? GLN B 326  TRP B 330  
AA5 1 CYS B 804  ? VAL B 805  ? CYS B 804  VAL B 805  
AA5 2 ALA B 855  ? LEU B 863  ? ALA B 855  LEU B 863  
AA5 3 ARG B 1016 ? ILE B 1020 ? ARG B 1016 ILE B 1020 
AA5 4 LEU B 1004 ? ARG B 1008 ? LEU B 1004 ARG B 1008 
AA5 5 MET B 874  ? VAL B 877  ? MET B 874  VAL B 877  
AA5 6 THR B 962  ? PHE B 966  ? THR B 962  PHE B 966  
AA6 1 CYS B 804  ? VAL B 805  ? CYS B 804  VAL B 805  
AA6 2 ALA B 855  ? LEU B 863  ? ALA B 855  LEU B 863  
AA6 3 GLY B 979  ? VAL B 985  ? GLY B 979  VAL B 985  
AA6 4 GLN B 969  ? PHE B 972  ? GLN B 969  PHE B 972  
AA7 1 VAL C 21   ? LEU C 25   ? VAL C 21   LEU C 25   
AA7 2 THR C 221  ? GLU C 225  ? THR C 221  GLU C 225  
AA8 1 GLN C 112  ? ILE C 115  ? GLN C 112  ILE C 115  
AA8 2 ALA C 179  ? LYS C 183  ? ALA C 179  LYS C 183  
AA8 3 LEU C 130  ? VAL C 134  ? LEU C 130  VAL C 134  
AA8 4 VAL C 156  ? ALA C 158  ? VAL C 156  ALA C 158  
AA9 1 LEU D 174  ? PRO D 178  ? LEU D 174  PRO D 178  
AA9 2 ILE D 164  ? ILE D 168  ? ILE D 164  ILE D 168  
AA9 3 THR D 154  ? LEU D 157  ? THR D 154  LEU D 157  
AA9 4 ILE D 139  ? SER D 145  ? ILE D 139  SER D 145  
AA9 5 CYS D 182  ? GLU D 187  ? CYS D 182  GLU D 187  
AA9 6 ILE D 192  ? TYR D 196  ? ILE D 192  TYR D 196  
AA9 7 ILE J 241  ? THR J 244  ? ILE J 241  THR J 244  
AB1 1 VAL E 55   ? ASN E 59   ? VAL E 55   ASN E 59   
AB1 2 ILE E 64   ? ARG E 70   ? ILE E 64   ARG E 70   
AB1 3 HIS E 6    ? LEU E 13   ? HIS E 6    LEU E 13   
AB1 4 PHE E 97   ? VAL E 103  ? PHE E 97   VAL E 103  
AB2 1 GLU F 2    ? ARG F 5    ? GLU F 2    ARG F 5    
AB2 2 TYR F 99   ? TRP F 106  ? TYR F 99   TRP F 106  
AB2 3 LEU F 126  ? SER F 140  ? LEU F 126  SER F 140  
AB2 4 GLY F 69   ? CYS F 70   ? GLY F 69   CYS F 70   
AB3 1 GLY F 34   ? ALA F 35   ? GLY F 34   ALA F 35   
AB3 2 ALA F 64   ? VAL F 66   ? ALA F 64   VAL F 66   
AB3 3 LEU F 126  ? SER F 140  ? LEU F 126  SER F 140  
AB3 4 HIS F 92   ? ARG F 96   ? HIS F 92   ARG F 96   
AB4 1 ASN G 35   ? TYR G 38   ? ASN G 35   TYR G 38   
AB4 2 ILE G 69   ? HIS G 72   ? ILE G 69   HIS G 72   
AB4 3 ILE G 132  ? VAL G 134  ? ILE G 132  VAL G 134  
AB4 4 VAL G 98   ? ALA G 99   ? VAL G 98   ALA G 99   
AB5 1 SER G 103  ? ASP G 109  ? SER G 103  ASP G 109  
AB5 2 ARG G 123  ? ALA G 129  ? ARG G 123  ALA G 129  
AB6 1 GLU H 9    ? LYS H 14   ? GLU H 9    LYS H 14   
AB6 2 LEU L 14   ? ASN L 21   ? LEU L 14   ASN L 21   
AB6 3 ASP L 348  ? VAL L 355  ? ASP L 348  VAL L 355  
AB6 4 LEU L 338  ? PHE L 344  ? LEU L 338  PHE L 344  
AB6 5 TRP L 309  ? GLN L 315  ? TRP L 309  GLN L 315  
AB6 6 ARG L 41   ? PRO L 47   ? ARG L 41   PRO L 47   
AB6 7 SER L 270  ? THR L 282  ? SER L 270  THR L 282  
AB6 8 LYS L 208  ? PRO L 220  ? LYS L 208  PRO L 220  
AB7 1 SER H 72   ? ILE H 77   ? SER H 72   ILE H 77   
AB7 2 HIS H 20   ? PHE H 28   ? HIS H 20   PHE H 28   
AB7 3 CYS H 100  ? SER H 108  ? CYS H 100  SER H 108  
AB8 1 ASP I 6    ? LEU I 9    ? ASP I 6    LEU I 9    
AB8 2 VAL I 32   ? ILE I 35   ? VAL I 32   ILE I 35   
AB8 3 LYS I 72   ? ILE I 80   ? LYS I 72   ILE I 80   
AB8 4 ILE I 38   ? VAL I 39   ? ILE I 38   VAL I 39   
AB9 1 ASP I 6    ? LEU I 9    ? ASP I 6    LEU I 9    
AB9 2 VAL I 32   ? ILE I 35   ? VAL I 32   ILE I 35   
AB9 3 LYS I 72   ? ILE I 80   ? LYS I 72   ILE I 80   
AB9 4 VAL I 102  ? PHE I 106  ? VAL I 102  PHE I 106  
AB9 5 LEU I 124  ? VAL I 125  ? LEU I 124  VAL I 125  
AB9 6 ALA I 151  ? PHE I 152  ? ALA I 151  PHE I 152  
AC1 1 ALA J 34   ? ILE J 35   ? ALA J 34   ILE J 35   
AC1 2 LEU J 74   ? ILE J 80   ? LEU J 74   ILE J 80   
AC1 3 ILE J 38   ? VAL J 39   ? ILE J 38   VAL J 39   
AC2 1 ALA J 34   ? ILE J 35   ? ALA J 34   ILE J 35   
AC2 2 LEU J 74   ? ILE J 80   ? LEU J 74   ILE J 80   
AC2 3 VAL J 102  ? PHE J 106  ? VAL J 102  PHE J 106  
AC2 4 LEU J 124  ? CYS J 126  ? LEU J 124  CYS J 126  
AC2 5 ALA J 151  ? VAL J 155  ? ALA J 151  VAL J 155  
AC2 6 ILE J 186  ? SER J 188  ? ILE J 186  SER J 188  
AC3 1 THR K 76   ? ARG K 81   ? THR K 76   ARG K 81   
AC3 2 ARG K 86   ? THR K 91   ? ARG K 86   THR K 91   
AC3 3 SER K 98   ? GLN K 99   ? SER K 98   GLN K 99   
AC4 1 GLY L 131  ? PRO L 133  ? GLY L 131  PRO L 133  
AC4 2 LYS L 143  ? ASP L 149  ? LYS L 143  ASP L 149  
AC4 3 LYS L 114  ? ASP L 120  ? LYS L 114  ASP L 120  
AC4 4 THR L 106  ? LEU L 109  ? THR L 106  LEU L 109  
AC4 5 GLY L 90   ? LEU L 95   ? GLY L 90   LEU L 95   
AC4 6 LYS L 176  ? LYS L 185  ? LYS L 176  LYS L 185  
AC4 7 TYR L 66   ? PRO L 73   ? TYR L 66   PRO L 73   
AC4 8 GLN L 201  ? HIS L 205  ? GLN L 201  HIS L 205  
AC5 1 VAL L 322  ? SER L 323  ? VAL L 322  SER L 323  
AC5 2 ASN L 327  ? GLU L 328  ? ASN L 327  GLU L 328  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N HIS B 213  ? N HIS B 213  O ARG B 225  ? O ARG B 225  
AA2 1 2 N LEU B 243  ? N LEU B 243  O ILE B 435  ? O ILE B 435  
AA2 2 3 N LEU B 434  ? N LEU B 434  O TRP B 618  ? O TRP B 618  
AA2 3 4 O ASP B 619  ? O ASP B 619  N ILE B 600  ? N ILE B 600  
AA2 4 5 O ILE B 597  ? O ILE B 597  N LEU B 507  ? N LEU B 507  
AA2 5 6 O GLY B 510  ? O GLY B 510  N LYS B 448  ? N LYS B 448  
AA3 1 2 N LYS B 256  ? N LYS B 256  O ILE B 421  ? O ILE B 421  
AA3 2 3 O ILE B 422  ? O ILE B 422  N TRP B 413  ? N TRP B 413  
AA4 1 2 N GLY B 290  ? N GLY B 290  O PHE B 310  ? O PHE B 310  
AA4 2 3 N ILE B 311  ? N ILE B 311  O TRP B 328  ? O TRP B 328  
AA5 1 2 N CYS B 804  ? N CYS B 804  O LEU B 856  ? O LEU B 856  
AA5 2 3 N SER B 862  ? N SER B 862  O ARG B 1019 ? O ARG B 1019 
AA5 3 4 O ARG B 1016 ? O ARG B 1016 N LEU B 1007 ? N LEU B 1007 
AA5 4 5 O ARG B 1008 ? O ARG B 1008 N MET B 874  ? N MET B 874  
AA5 5 6 N VAL B 877  ? N VAL B 877  O THR B 962  ? O THR B 962  
AA6 1 2 N CYS B 804  ? N CYS B 804  O LEU B 856  ? O LEU B 856  
AA6 2 3 N VAL B 857  ? N VAL B 857  O VAL B 985  ? O VAL B 985  
AA6 3 4 O LEU B 982  ? O LEU B 982  N GLN B 969  ? N GLN B 969  
AA7 1 2 N LYS C 22   ? N LYS C 22   O LEU C 224  ? O LEU C 224  
AA8 1 2 N GLN C 112  ? N GLN C 112  O LYS C 183  ? O LYS C 183  
AA8 2 3 O LEU C 180  ? O LEU C 180  N LEU C 133  ? N LEU C 133  
AA8 3 4 N VAL C 132  ? N VAL C 132  O VAL C 156  ? O VAL C 156  
AA9 1 2 O LYS D 175  ? O LYS D 175  N ILE D 167  ? N ILE D 167  
AA9 2 3 O ILE D 168  ? O ILE D 168  N ILE D 156  ? N ILE D 156  
AA9 3 4 O GLY D 155  ? O GLY D 155  N ILE D 140  ? N ILE D 140  
AA9 4 5 N LYS D 144  ? N LYS D 144  O VAL D 183  ? O VAL D 183  
AA9 5 6 N PHE D 184  ? N PHE D 184  O ILE D 195  ? O ILE D 195  
AA9 6 7 N ILE D 192  ? N ILE D 192  O THR J 244  ? O THR J 244  
AB1 1 2 N TYR E 57   ? N TYR E 57   O LEU E 66   ? O LEU E 66   
AB1 2 3 O CYS E 69   ? O CYS E 69   N ARG E 7    ? N ARG E 7    
AB1 3 4 N TYR E 8    ? N TYR E 8    O VAL E 103  ? O VAL E 103  
AB2 1 2 N PHE F 4    ? N PHE F 4    O ARG F 103  ? O ARG F 103  
AB2 2 3 N VAL F 102  ? N VAL F 102  O LYS F 130  ? O LYS F 130  
AB2 3 4 O LEU F 135  ? O LEU F 135  N GLY F 69   ? N GLY F 69   
AB3 1 2 N GLY F 34   ? N GLY F 34   O VAL F 66   ? O VAL F 66   
AB3 2 3 N ILE F 65   ? N ILE F 65   O LEU F 139  ? O LEU F 139  
AB3 3 4 O SER F 140  ? O SER F 140  N HIS F 92   ? N HIS F 92   
AB4 1 2 N ILE G 37   ? N ILE G 37   O HIS G 72   ? O HIS G 72   
AB4 2 3 N ILE G 69   ? N ILE G 69   O VAL G 134  ? O VAL G 134  
AB4 3 4 O ARG G 133  ? O ARG G 133  N ALA G 99   ? N ALA G 99   
AB5 1 2 N VAL G 105  ? N VAL G 105  O ASN G 127  ? O ASN G 127  
AB6 1 2 N TYR H 13   ? N TYR H 13   O LEU L 15   ? O LEU L 15   
AB6 2 3 N GLU L 18   ? N GLU L 18   O LEU L 351  ? O LEU L 351  
AB6 3 4 O ALA L 354  ? O ALA L 354  N LEU L 338  ? N LEU L 338  
AB6 4 5 O PHE L 341  ? O PHE L 341  N LEU L 312  ? N LEU L 312  
AB6 5 6 O GLN L 315  ? O GLN L 315  N ARG L 41   ? N ARG L 41   
AB6 6 7 N VAL L 42   ? N VAL L 42   O ILE L 281  ? O ILE L 281  
AB6 7 8 O THR L 282  ? O THR L 282  N LYS L 208  ? N LYS L 208  
AB7 1 2 O ALA H 73   ? O ALA H 73   N VAL H 24   ? N VAL H 24   
AB7 2 3 N LYS H 23   ? N LYS H 23   O GLN H 106  ? O GLN H 106  
AB8 1 2 N LEU I 9    ? N LEU I 9    O ALA I 34   ? O ALA I 34   
AB8 2 3 N ILE I 35   ? N ILE I 35   O ARG I 76   ? O ARG I 76   
AB8 3 4 O ILE I 80   ? O ILE I 80   N VAL I 39   ? N VAL I 39   
AB9 1 2 N LEU I 9    ? N LEU I 9    O ALA I 34   ? O ALA I 34   
AB9 2 3 N ILE I 35   ? N ILE I 35   O ARG I 76   ? O ARG I 76   
AB9 3 4 N ILE I 79   ? N ILE I 79   O PHE I 106  ? O PHE I 106  
AB9 4 5 O VAL I 103  ? O VAL I 103  N LEU I 124  ? N LEU I 124  
AB9 5 6 N VAL I 125  ? N VAL I 125  O ALA I 151  ? O ALA I 151  
AC1 1 2 N ILE J 35   ? N ILE J 35   O ARG J 76   ? O ARG J 76   
AC1 2 3 O ILE J 80   ? O ILE J 80   N VAL J 39   ? N VAL J 39   
AC2 1 2 N ILE J 35   ? N ILE J 35   O ARG J 76   ? O ARG J 76   
AC2 2 3 N LEU J 77   ? N LEU J 77   O ALA J 104  ? O ALA J 104  
AC2 3 4 N VAL J 105  ? N VAL J 105  O CYS J 126  ? O CYS J 126  
AC2 4 5 N VAL J 125  ? N VAL J 125  O GLU J 153  ? O GLU J 153  
AC2 5 6 N LEU J 154  ? N LEU J 154  O ILE J 186  ? O ILE J 186  
AC3 1 2 N ARG K 80   ? N ARG K 80   O TRP K 87   ? O TRP K 87   
AC3 2 3 N GLN K 90   ? N GLN K 90   O GLN K 99   ? O GLN K 99   
AC4 1 2 N HIS L 132  ? N HIS L 132  O ILE L 145  ? O ILE L 145  
AC4 2 3 O ILE L 148  ? O ILE L 148  N LEU L 115  ? N LEU L 115  
AC4 3 4 O SER L 118  ? O SER L 118  N THR L 106  ? N THR L 106  
AC4 4 5 O LEU L 109  ? O LEU L 109  N ALA L 94   ? N ALA L 94   
AC4 5 6 N LEU L 95   ? N LEU L 95   O LEU L 180  ? O LEU L 180  
AC4 6 7 O LEU L 181  ? O LEU L 181  N TYR L 67   ? N TYR L 67   
AC4 7 8 N TYR L 66   ? N TYR L 66   O HIS L 205  ? O HIS L 205  
AC5 1 2 N SER L 323  ? N SER L 323  O ASN L 327  ? O ASN L 327  
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    K 
_struct_site.pdbx_auth_comp_id    ZN 
_struct_site.pdbx_auth_seq_id     201 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    3 
_struct_site.details              'binding site for residue ZN K 201' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 3 CYS K 92 ? CYS K 92 . ? 1_555 ? 
2 AC1 3 THR K 94 ? THR K 94 . ? 1_555 ? 
3 AC1 3 CYS K 95 ? CYS K 95 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6AHU 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     P  P     . A   A 1  1    ? 164.500 144.905 135.095 1.00 155.40 ?  1    A   A P     1 
ATOM   2     O  OP1   . A   A 1  1    ? 163.247 144.820 134.303 1.00 155.40 ?  1    A   A OP1   1 
ATOM   3     O  OP2   . A   A 1  1    ? 165.801 145.059 134.395 1.00 155.40 ?  1    A   A OP2   1 
ATOM   4     O  "O5'" . A   A 1  1    ? 164.590 143.608 136.017 1.00 155.40 ?  1    A   A "O5'" 1 
ATOM   5     C  "C5'" . A   A 1  1    ? 163.489 142.719 136.135 1.00 155.40 ?  1    A   A "C5'" 1 
ATOM   6     C  "C4'" . A   A 1  1    ? 163.948 141.306 136.392 1.00 155.40 ?  1    A   A "C4'" 1 
ATOM   7     O  "O4'" . A   A 1  1    ? 164.733 140.835 135.266 1.00 155.40 ?  1    A   A "O4'" 1 
ATOM   8     C  "C3'" . A   A 1  1    ? 164.866 141.113 137.590 1.00 155.40 ?  1    A   A "C3'" 1 
ATOM   9     O  "O3'" . A   A 1  1    ? 164.166 141.031 138.820 1.00 155.40 ?  1    A   A "O3'" 1 
ATOM   10    C  "C2'" . A   A 1  1    ? 165.618 139.840 137.230 1.00 155.40 ?  1    A   A "C2'" 1 
ATOM   11    O  "O2'" . A   A 1  1    ? 164.811 138.696 137.468 1.00 155.40 ?  1    A   A "O2'" 1 
ATOM   12    C  "C1'" . A   A 1  1    ? 165.784 140.009 135.721 1.00 155.40 ?  1    A   A "C1'" 1 
ATOM   13    N  N9    . A   A 1  1    ? 167.064 140.655 135.375 1.00 155.40 ?  1    A   A N9    1 
ATOM   14    C  C8    . A   A 1  1    ? 167.248 141.919 134.870 1.00 155.40 ?  1    A   A C8    1 
ATOM   15    N  N7    . A   A 1  1    ? 168.504 142.228 134.656 1.00 155.40 ?  1    A   A N7    1 
ATOM   16    C  C5    . A   A 1  1    ? 169.194 141.090 135.047 1.00 155.40 ?  1    A   A C5    1 
ATOM   17    C  C6    . A   A 1  1    ? 170.564 140.770 135.069 1.00 155.40 ?  1    A   A C6    1 
ATOM   18    N  N6    . A   A 1  1    ? 171.523 141.608 134.672 1.00 155.40 ?  1    A   A N6    1 
ATOM   19    N  N1    . A   A 1  1    ? 170.922 139.544 135.518 1.00 155.40 ?  1    A   A N1    1 
ATOM   20    C  C2    . A   A 1  1    ? 169.965 138.696 135.919 1.00 155.40 ?  1    A   A C2    1 
ATOM   21    N  N3    . A   A 1  1    ? 168.647 138.884 135.944 1.00 155.40 ?  1    A   A N3    1 
ATOM   22    C  C4    . A   A 1  1    ? 168.322 140.110 135.492 1.00 155.40 ?  1    A   A C4    1 
ATOM   23    P  P     . U   A 1  2    ? 164.750 141.757 140.130 1.00 138.09 ?  2    U   A P     1 
ATOM   24    O  OP1   . U   A 1  2    ? 163.762 141.593 141.226 1.00 138.09 ?  2    U   A OP1   1 
ATOM   25    O  OP2   . U   A 1  2    ? 165.195 143.118 139.738 1.00 138.09 ?  2    U   A OP2   1 
ATOM   26    O  "O5'" . U   A 1  2    ? 166.044 140.905 140.501 1.00 138.09 ?  2    U   A "O5'" 1 
ATOM   27    C  "C5'" . U   A 1  2    ? 165.932 139.573 140.981 1.00 138.09 ?  2    U   A "C5'" 1 
ATOM   28    C  "C4'" . U   A 1  2    ? 167.267 139.037 141.433 1.00 138.09 ?  2    U   A "C4'" 1 
ATOM   29    O  "O4'" . U   A 1  2    ? 168.150 138.894 140.289 1.00 138.09 ?  2    U   A "O4'" 1 
ATOM   30    C  "C3'" . U   A 1  2    ? 168.047 139.923 142.392 1.00 138.09 ?  2    U   A "C3'" 1 
ATOM   31    O  "O3'" . U   A 1  2    ? 167.616 139.796 143.736 1.00 138.09 ?  2    U   A "O3'" 1 
ATOM   32    C  "C2'" . U   A 1  2    ? 169.486 139.474 142.171 1.00 138.09 ?  2    U   A "C2'" 1 
ATOM   33    O  "O2'" . U   A 1  2    ? 169.754 138.277 142.886 1.00 138.09 ?  2    U   A "O2'" 1 
ATOM   34    C  "C1'" . U   A 1  2    ? 169.484 139.152 140.673 1.00 138.09 ?  2    U   A "C1'" 1 
ATOM   35    N  N1    . U   A 1  2    ? 170.020 140.261 139.845 1.00 138.09 ?  2    U   A N1    1 
ATOM   36    C  C2    . U   A 1  2    ? 171.396 140.378 139.728 1.00 138.09 ?  2    U   A C2    1 
ATOM   37    O  O2    . U   A 1  2    ? 172.185 139.625 140.274 1.00 138.09 ?  2    U   A O2    1 
ATOM   38    N  N3    . U   A 1  2    ? 171.826 141.420 138.944 1.00 138.09 ?  2    U   A N3    1 
ATOM   39    C  C4    . U   A 1  2    ? 171.047 142.339 138.273 1.00 138.09 ?  2    U   A C4    1 
ATOM   40    O  O4    . U   A 1  2    ? 171.589 143.221 137.606 1.00 138.09 ?  2    U   A O4    1 
ATOM   41    C  C5    . U   A 1  2    ? 169.639 142.152 138.436 1.00 138.09 ?  2    U   A C5    1 
ATOM   42    C  C6    . U   A 1  2    ? 169.189 141.146 139.192 1.00 138.09 ?  2    U   A C6    1 
ATOM   43    P  P     . A   A 1  3    ? 166.916 141.035 144.483 1.00 125.32 ?  3    A   A P     1 
ATOM   44    O  OP1   . A   A 1  3    ? 166.936 140.753 145.940 1.00 125.32 ?  3    A   A OP1   1 
ATOM   45    O  OP2   . A   A 1  3    ? 165.619 141.310 143.813 1.00 125.32 ?  3    A   A OP2   1 
ATOM   46    O  "O5'" . A   A 1  3    ? 167.885 142.265 144.190 1.00 125.32 ?  3    A   A "O5'" 1 
ATOM   47    C  "C5'" . A   A 1  3    ? 167.375 143.469 143.635 1.00 125.32 ?  3    A   A "C5'" 1 
ATOM   48    C  "C4'" . A   A 1  3    ? 168.101 144.683 144.158 1.00 125.32 ?  3    A   A "C4'" 1 
ATOM   49    O  "O4'" . A   A 1  3    ? 167.263 145.854 143.980 1.00 125.32 ?  3    A   A "O4'" 1 
ATOM   50    C  "C3'" . A   A 1  3    ? 168.426 144.675 145.646 1.00 125.32 ?  3    A   A "C3'" 1 
ATOM   51    O  "O3'" . A   A 1  3    ? 169.621 143.970 145.935 1.00 125.32 ?  3    A   A "O3'" 1 
ATOM   52    C  "C2'" . A   A 1  3    ? 168.499 146.158 145.984 1.00 125.32 ?  3    A   A "C2'" 1 
ATOM   53    O  "O2'" . A   A 1  3    ? 169.749 146.702 145.587 1.00 125.32 ?  3    A   A "O2'" 1 
ATOM   54    C  "C1'" . A   A 1  3    ? 167.413 146.731 145.075 1.00 125.32 ?  3    A   A "C1'" 1 
ATOM   55    N  N9    . A   A 1  3    ? 166.111 146.841 145.761 1.00 125.32 ?  3    A   A N9    1 
ATOM   56    C  C8    . A   A 1  3    ? 165.073 145.942 145.735 1.00 125.32 ?  3    A   A C8    1 
ATOM   57    N  N7    . A   A 1  3    ? 164.033 146.310 146.443 1.00 125.32 ?  3    A   A N7    1 
ATOM   58    C  C5    . A   A 1  3    ? 164.412 147.536 146.970 1.00 125.32 ?  3    A   A C5    1 
ATOM   59    C  C6    . A   A 1  3    ? 163.757 148.453 147.811 1.00 125.32 ?  3    A   A C6    1 
ATOM   60    N  N6    . A   A 1  3    ? 162.524 148.266 148.289 1.00 125.32 ?  3    A   A N6    1 
ATOM   61    N  N1    . A   A 1  3    ? 164.416 149.586 148.150 1.00 125.32 ?  3    A   A N1    1 
ATOM   62    C  C2    . A   A 1  3    ? 165.654 149.783 147.675 1.00 125.32 ?  3    A   A C2    1 
ATOM   63    N  N3    . A   A 1  3    ? 166.372 148.994 146.877 1.00 125.32 ?  3    A   A N3    1 
ATOM   64    C  C4    . A   A 1  3    ? 165.690 147.878 146.559 1.00 125.32 ?  3    A   A C4    1 
ATOM   65    P  P     . G   A 1  4    ? 169.759 143.104 147.281 1.00 92.29  ?  4    G   A P     1 
ATOM   66    O  OP1   . G   A 1  4    ? 168.416 142.591 147.649 1.00 92.29  ?  4    G   A OP1   1 
ATOM   67    O  OP2   . G   A 1  4    ? 170.528 143.905 148.267 1.00 92.29  ?  4    G   A OP2   1 
ATOM   68    O  "O5'" . G   A 1  4    ? 170.662 141.869 146.839 1.00 92.29  ?  4    G   A "O5'" 1 
ATOM   69    C  "C5'" . G   A 1  4    ? 171.255 141.006 147.798 1.00 92.29  ?  4    G   A "C5'" 1 
ATOM   70    C  "C4'" . G   A 1  4    ? 172.714 140.775 147.492 1.00 92.29  ?  4    G   A "C4'" 1 
ATOM   71    O  "O4'" . G   A 1  4    ? 172.867 140.442 146.087 1.00 92.29  ?  4    G   A "O4'" 1 
ATOM   72    C  "C3'" . G   A 1  4    ? 173.628 141.975 147.691 1.00 92.29  ?  4    G   A "C3'" 1 
ATOM   73    O  "O3'" . G   A 1  4    ? 174.024 142.150 149.041 1.00 92.29  ?  4    G   A "O3'" 1 
ATOM   74    C  "C2'" . G   A 1  4    ? 174.785 141.674 146.748 1.00 92.29  ?  4    G   A "C2'" 1 
ATOM   75    O  "O2'" . G   A 1  4    ? 175.663 140.717 147.321 1.00 92.29  ?  4    G   A "O2'" 1 
ATOM   76    C  "C1'" . G   A 1  4    ? 174.053 141.017 145.579 1.00 92.29  ?  4    G   A "C1'" 1 
ATOM   77    N  N9    . G   A 1  4    ? 173.684 141.996 144.538 1.00 92.29  ?  4    G   A N9    1 
ATOM   78    C  C8    . G   A 1  4    ? 172.419 142.452 144.256 1.00 92.29  ?  4    G   A C8    1 
ATOM   79    N  N7    . G   A 1  4    ? 172.389 143.318 143.281 1.00 92.29  ?  4    G   A N7    1 
ATOM   80    C  C5    . G   A 1  4    ? 173.715 143.443 142.893 1.00 92.29  ?  4    G   A C5    1 
ATOM   81    C  C6    . G   A 1  4    ? 174.301 144.243 141.878 1.00 92.29  ?  4    G   A C6    1 
ATOM   82    O  O6    . G   A 1  4    ? 173.746 145.024 141.095 1.00 92.29  ?  4    G   A O6    1 
ATOM   83    N  N1    . G   A 1  4    ? 175.680 144.068 141.820 1.00 92.29  ?  4    G   A N1    1 
ATOM   84    C  C2    . G   A 1  4    ? 176.403 143.231 142.634 1.00 92.29  ?  4    G   A C2    1 
ATOM   85    N  N2    . G   A 1  4    ? 177.727 143.200 142.422 1.00 92.29  ?  4    G   A N2    1 
ATOM   86    N  N3    . G   A 1  4    ? 175.869 142.480 143.583 1.00 92.29  ?  4    G   A N3    1 
ATOM   87    C  C4    . G   A 1  4    ? 174.529 142.633 143.658 1.00 92.29  ?  4    G   A C4    1 
ATOM   88    P  P     . G   A 1  5    ? 174.292 143.625 149.620 1.00 74.93  ?  5    G   A P     1 
ATOM   89    O  OP1   . G   A 1  5    ? 174.364 143.531 151.101 1.00 74.93  ?  5    G   A OP1   1 
ATOM   90    O  OP2   . G   A 1  5    ? 173.320 144.553 148.990 1.00 74.93  ?  5    G   A OP2   1 
ATOM   91    O  "O5'" . G   A 1  5    ? 175.743 143.995 149.079 1.00 74.93  ?  5    G   A "O5'" 1 
ATOM   92    C  "C5'" . G   A 1  5    ? 176.883 143.245 149.474 1.00 74.93  ?  5    G   A "C5'" 1 
ATOM   93    C  "C4'" . G   A 1  5    ? 178.125 143.717 148.762 1.00 74.93  ?  5    G   A "C4'" 1 
ATOM   94    O  "O4'" . G   A 1  5    ? 178.012 143.444 147.341 1.00 74.93  ?  5    G   A "O4'" 1 
ATOM   95    C  "C3'" . G   A 1  5    ? 178.400 145.211 148.830 1.00 74.93  ?  5    G   A "C3'" 1 
ATOM   96    O  "O3'" . G   A 1  5    ? 179.018 145.606 150.042 1.00 74.93  ?  5    G   A "O3'" 1 
ATOM   97    C  "C2'" . G   A 1  5    ? 179.262 145.447 147.597 1.00 74.93  ?  5    G   A "C2'" 1 
ATOM   98    O  "O2'" . G   A 1  5    ? 180.601 145.036 147.835 1.00 74.93  ?  5    G   A "O2'" 1 
ATOM   99    C  "C1'" . G   A 1  5    ? 178.630 144.476 146.600 1.00 74.93  ?  5    G   A "C1'" 1 
ATOM   100   N  N9    . G   A 1  5    ? 177.603 145.129 145.766 1.00 74.93  ?  5    G   A N9    1 
ATOM   101   C  C8    . G   A 1  5    ? 176.242 144.968 145.860 1.00 74.93  ?  5    G   A C8    1 
ATOM   102   N  N7    . G   A 1  5    ? 175.580 145.676 144.986 1.00 74.93  ?  5    G   A N7    1 
ATOM   103   C  C5    . G   A 1  5    ? 176.563 146.346 144.271 1.00 74.93  ?  5    G   A C5    1 
ATOM   104   C  C6    . G   A 1  5    ? 176.452 147.262 143.192 1.00 74.93  ?  5    G   A C6    1 
ATOM   105   O  O6    . G   A 1  5    ? 175.428 147.677 142.636 1.00 74.93  ?  5    G   A O6    1 
ATOM   106   N  N1    . G   A 1  5    ? 177.700 147.702 142.764 1.00 74.93  ?  5    G   A N1    1 
ATOM   107   C  C2    . G   A 1  5    ? 178.902 147.314 143.302 1.00 74.93  ?  5    G   A C2    1 
ATOM   108   N  N2    . G   A 1  5    ? 179.999 147.851 142.749 1.00 74.93  ?  5    G   A N2    1 
ATOM   109   N  N3    . G   A 1  5    ? 179.019 146.461 144.306 1.00 74.93  ?  5    G   A N3    1 
ATOM   110   C  C4    . G   A 1  5    ? 177.819 146.019 144.739 1.00 74.93  ?  5    G   A C4    1 
ATOM   111   P  P     . G   A 1  6    ? 178.561 146.960 150.777 1.00 64.04  ?  6    G   A P     1 
ATOM   112   O  OP1   . G   A 1  6    ? 179.173 146.979 152.130 1.00 64.04  ?  6    G   A OP1   1 
ATOM   113   O  OP2   . G   A 1  6    ? 177.089 147.087 150.635 1.00 64.04  ?  6    G   A OP2   1 
ATOM   114   O  "O5'" . G   A 1  6    ? 179.241 148.114 149.915 1.00 64.04  ?  6    G   A "O5'" 1 
ATOM   115   C  "C5'" . G   A 1  6    ? 180.653 148.195 149.793 1.00 64.04  ?  6    G   A "C5'" 1 
ATOM   116   C  "C4'" . G   A 1  6    ? 181.062 149.172 148.720 1.00 64.04  ?  6    G   A "C4'" 1 
ATOM   117   O  "O4'" . G   A 1  6    ? 180.612 148.698 147.424 1.00 64.04  ?  6    G   A "O4'" 1 
ATOM   118   C  "C3'" . G   A 1  6    ? 180.468 150.567 148.826 1.00 64.04  ?  6    G   A "C3'" 1 
ATOM   119   O  "O3'" . G   A 1  6    ? 181.146 151.387 149.762 1.00 64.04  ?  6    G   A "O3'" 1 
ATOM   120   C  "C2'" . G   A 1  6    ? 180.553 151.072 147.393 1.00 64.04  ?  6    G   A "C2'" 1 
ATOM   121   O  "O2'" . G   A 1  6    ? 181.874 151.492 147.086 1.00 64.04  ?  6    G   A "O2'" 1 
ATOM   122   C  "C1'" . G   A 1  6    ? 180.257 149.794 146.607 1.00 64.04  ?  6    G   A "C1'" 1 
ATOM   123   N  N9    . G   A 1  6    ? 178.828 149.679 146.259 1.00 64.04  ?  6    G   A N9    1 
ATOM   124   C  C8    . G   A 1  6    ? 177.885 148.890 146.871 1.00 64.04  ?  6    G   A C8    1 
ATOM   125   N  N7    . G   A 1  6    ? 176.699 149.002 146.339 1.00 64.04  ?  6    G   A N7    1 
ATOM   126   C  C5    . G   A 1  6    ? 176.868 149.921 145.312 1.00 64.04  ?  6    G   A C5    1 
ATOM   127   C  C6    . G   A 1  6    ? 175.932 150.443 144.381 1.00 64.04  ?  6    G   A C6    1 
ATOM   128   O  O6    . G   A 1  6    ? 174.726 150.189 144.274 1.00 64.04  ?  6    G   A O6    1 
ATOM   129   N  N1    . G   A 1  6    ? 176.528 151.352 143.512 1.00 64.04  ?  6    G   A N1    1 
ATOM   130   C  C2    . G   A 1  6    ? 177.853 151.713 143.533 1.00 64.04  ?  6    G   A C2    1 
ATOM   131   N  N2    . G   A 1  6    ? 178.237 152.606 142.610 1.00 64.04  ?  6    G   A N2    1 
ATOM   132   N  N3    . G   A 1  6    ? 178.734 151.234 144.395 1.00 64.04  ?  6    G   A N3    1 
ATOM   133   C  C4    . G   A 1  6    ? 178.177 150.349 145.250 1.00 64.04  ?  6    G   A C4    1 
ATOM   134   P  P     . C   A 1  7    ? 180.315 152.374 150.721 1.00 57.16  ?  7    C   A P     1 
ATOM   135   O  OP1   . C   A 1  7    ? 181.210 152.802 151.826 1.00 57.16  ?  7    C   A OP1   1 
ATOM   136   O  OP2   . C   A 1  7    ? 179.017 151.725 151.036 1.00 57.16  ?  7    C   A OP2   1 
ATOM   137   O  "O5'" . C   A 1  7    ? 180.023 153.644 149.804 1.00 57.16  ?  7    C   A "O5'" 1 
ATOM   138   C  "C5'" . C   A 1  7    ? 181.087 154.372 149.212 1.00 57.16  ?  7    C   A "C5'" 1 
ATOM   139   C  "C4'" . C   A 1  7    ? 180.608 155.217 148.059 1.00 57.16  ?  7    C   A "C4'" 1 
ATOM   140   O  "O4'" . C   A 1  7    ? 179.962 154.377 147.068 1.00 57.16  ?  7    C   A "O4'" 1 
ATOM   141   C  "C3'" . C   A 1  7    ? 179.559 156.267 148.388 1.00 57.16  ?  7    C   A "C3'" 1 
ATOM   142   O  "O3'" . C   A 1  7    ? 180.111 157.442 148.957 1.00 57.16  ?  7    C   A "O3'" 1 
ATOM   143   C  "C2'" . C   A 1  7    ? 178.885 156.500 147.042 1.00 57.16  ?  7    C   A "C2'" 1 
ATOM   144   O  "O2'" . C   A 1  7    ? 179.662 157.373 146.235 1.00 57.16  ?  7    C   A "O2'" 1 
ATOM   145   C  "C1'" . C   A 1  7    ? 178.933 155.099 146.423 1.00 57.16  ?  7    C   A "C1'" 1 
ATOM   146   N  N1    . C   A 1  7    ? 177.653 154.361 146.558 1.00 57.16  ?  7    C   A N1    1 
ATOM   147   C  C2    . C   A 1  7    ? 176.654 154.575 145.600 1.00 57.16  ?  7    C   A C2    1 
ATOM   148   O  O2    . C   A 1  7    ? 176.859 155.371 144.671 1.00 57.16  ?  7    C   A O2    1 
ATOM   149   N  N3    . C   A 1  7    ? 175.481 153.908 145.703 1.00 57.16  ?  7    C   A N3    1 
ATOM   150   C  C4    . C   A 1  7    ? 175.282 153.054 146.708 1.00 57.16  ?  7    C   A C4    1 
ATOM   151   N  N4    . C   A 1  7    ? 174.108 152.421 146.767 1.00 57.16  ?  7    C   A N4    1 
ATOM   152   C  C5    . C   A 1  7    ? 176.278 152.812 147.697 1.00 57.16  ?  7    C   A C5    1 
ATOM   153   C  C6    . C   A 1  7    ? 177.434 153.477 147.581 1.00 57.16  ?  7    C   A C6    1 
ATOM   154   P  P     . G   A 1  8    ? 179.256 158.314 150.003 1.00 58.27  ?  8    G   A P     1 
ATOM   155   O  OP1   . G   A 1  8    ? 180.180 159.264 150.671 1.00 58.27  ?  8    G   A OP1   1 
ATOM   156   O  OP2   . G   A 1  8    ? 178.443 157.380 150.823 1.00 58.27  ?  8    G   A OP2   1 
ATOM   157   O  "O5'" . G   A 1  8    ? 178.264 159.157 149.085 1.00 58.27  ?  8    G   A "O5'" 1 
ATOM   158   C  "C5'" . G   A 1  8    ? 178.762 160.117 148.164 1.00 58.27  ?  8    G   A "C5'" 1 
ATOM   159   C  "C4'" . G   A 1  8    ? 177.717 160.508 147.149 1.00 58.27  ?  8    G   A "C4'" 1 
ATOM   160   O  "O4'" . G   A 1  8    ? 177.264 159.330 146.431 1.00 58.27  ?  8    G   A "O4'" 1 
ATOM   161   C  "C3'" . G   A 1  8    ? 176.439 161.116 147.703 1.00 58.27  ?  8    G   A "C3'" 1 
ATOM   162   O  "O3'" . G   A 1  8    ? 176.571 162.494 148.007 1.00 58.27  ?  8    G   A "O3'" 1 
ATOM   163   C  "C2'" . G   A 1  8    ? 175.428 160.827 146.600 1.00 58.27  ?  8    G   A "C2'" 1 
ATOM   164   O  "O2'" . G   A 1  8    ? 175.578 161.746 145.528 1.00 58.27  ?  8    G   A "O2'" 1 
ATOM   165   C  "C1'" . G   A 1  8    ? 175.891 159.451 146.123 1.00 58.27  ?  8    G   A "C1'" 1 
ATOM   166   N  N9    . G   A 1  8    ? 175.160 158.356 146.791 1.00 58.27  ?  8    G   A N9    1 
ATOM   167   C  C8    . G   A 1  8    ? 175.583 157.615 147.867 1.00 58.27  ?  8    G   A C8    1 
ATOM   168   N  N7    . G   A 1  8    ? 174.719 156.711 148.241 1.00 58.27  ?  8    G   A N7    1 
ATOM   169   C  C5    . G   A 1  8    ? 173.659 156.865 147.358 1.00 58.27  ?  8    G   A C5    1 
ATOM   170   C  C6    . G   A 1  8    ? 172.429 156.163 147.270 1.00 58.27  ?  8    G   A C6    1 
ATOM   171   O  O6    . G   A 1  8    ? 172.017 155.236 147.977 1.00 58.27  ?  8    G   A O6    1 
ATOM   172   N  N1    . G   A 1  8    ? 171.642 156.641 146.228 1.00 58.27  ?  8    G   A N1    1 
ATOM   173   C  C2    . G   A 1  8    ? 171.990 157.662 145.379 1.00 58.27  ?  8    G   A C2    1 
ATOM   174   N  N2    . G   A 1  8    ? 171.090 157.976 144.435 1.00 58.27  ?  8    G   A N2    1 
ATOM   175   N  N3    . G   A 1  8    ? 173.134 158.325 145.450 1.00 58.27  ?  8    G   A N3    1 
ATOM   176   C  C4    . G   A 1  8    ? 173.915 157.877 146.456 1.00 58.27  ?  8    G   A C4    1 
ATOM   177   P  P     . G   A 1  9    ? 175.628 163.172 149.118 1.00 61.49  ?  9    G   A P     1 
ATOM   178   O  OP1   . G   A 1  9    ? 176.261 164.447 149.542 1.00 61.49  ?  9    G   A OP1   1 
ATOM   179   O  OP2   . G   A 1  9    ? 175.301 162.140 150.135 1.00 61.49  ?  9    G   A OP2   1 
ATOM   180   O  "O5'" . G   A 1  9    ? 174.292 163.524 148.326 1.00 61.49  ?  9    G   A "O5'" 1 
ATOM   181   C  "C5'" . G   A 1  9    ? 174.321 164.376 147.190 1.00 61.49  ?  9    G   A "C5'" 1 
ATOM   182   C  "C4'" . G   A 1  9    ? 173.016 164.337 146.436 1.00 61.49  ?  9    G   A "C4'" 1 
ATOM   183   O  "O4'" . G   A 1  9    ? 172.772 162.995 145.939 1.00 61.49  ?  9    G   A "O4'" 1 
ATOM   184   C  "C3'" . G   A 1  9    ? 171.771 164.660 147.247 1.00 61.49  ?  9    G   A "C3'" 1 
ATOM   185   O  "O3'" . G   A 1  9    ? 171.570 166.052 147.421 1.00 61.49  ?  9    G   A "O3'" 1 
ATOM   186   C  "C2'" . G   A 1  9    ? 170.671 163.975 146.449 1.00 61.49  ?  9    G   A "C2'" 1 
ATOM   187   O  "O2'" . G   A 1  9    ? 170.322 164.747 145.309 1.00 61.49  ?  9    G   A "O2'" 1 
ATOM   188   C  "C1'" . G   A 1  9    ? 171.389 162.712 145.975 1.00 61.49  ?  9    G   A "C1'" 1 
ATOM   189   N  N9    . G   A 1  9    ? 171.167 161.574 146.888 1.00 61.49  ?  9    G   A N9    1 
ATOM   190   C  C8    . G   A 1  9    ? 172.068 161.050 147.783 1.00 61.49  ?  9    G   A C8    1 
ATOM   191   N  N7    . G   A 1  9    ? 171.595 160.041 148.461 1.00 61.49  ?  9    G   A N7    1 
ATOM   192   C  C5    . G   A 1  9    ? 170.300 159.888 147.987 1.00 61.49  ?  9    G   A C5    1 
ATOM   193   C  C6    . G   A 1  9    ? 169.296 158.953 148.349 1.00 61.49  ?  9    G   A C6    1 
ATOM   194   O  O6    . G   A 1  9    ? 169.353 158.046 149.188 1.00 61.49  ?  9    G   A O6    1 
ATOM   195   N  N1    . G   A 1  9    ? 168.128 159.151 147.622 1.00 61.49  ?  9    G   A N1    1 
ATOM   196   C  C2    . G   A 1  9    ? 167.947 160.122 146.669 1.00 61.49  ?  9    G   A C2    1 
ATOM   197   N  N2    . G   A 1  9    ? 166.744 160.149 146.078 1.00 61.49  ?  9    G   A N2    1 
ATOM   198   N  N3    . G   A 1  9    ? 168.874 161.000 146.321 1.00 61.49  ?  9    G   A N3    1 
ATOM   199   C  C4    . G   A 1  9    ? 170.019 160.826 147.015 1.00 61.49  ?  9    G   A C4    1 
ATOM   200   P  P     . A   A 1  10   ? 170.992 166.614 148.810 1.00 64.66  ?  10   A   A P     1 
ATOM   201   O  OP1   . A   A 1  10   ? 171.287 168.068 148.878 1.00 64.66  ?  10   A   A OP1   1 
ATOM   202   O  OP2   . A   A 1  10   ? 171.459 165.719 149.899 1.00 64.66  ?  10   A   A OP2   1 
ATOM   203   O  "O5'" . A   A 1  10   ? 169.416 166.436 148.669 1.00 64.66  ?  10   A   A "O5'" 1 
ATOM   204   C  "C5'" . A   A 1  10   ? 168.708 167.052 147.603 1.00 64.66  ?  10   A   A "C5'" 1 
ATOM   205   C  "C4'" . A   A 1  10   ? 167.348 166.431 147.408 1.00 64.66  ?  10   A   A "C4'" 1 
ATOM   206   O  "O4'" . A   A 1  10   ? 167.492 165.036 147.033 1.00 64.66  ?  10   A   A "O4'" 1 
ATOM   207   C  "C3'" . A   A 1  10   ? 166.451 166.390 148.635 1.00 64.66  ?  10   A   A "C3'" 1 
ATOM   208   O  "O3'" . A   A 1  10   ? 165.798 167.621 148.887 1.00 64.66  ?  10   A   A "O3'" 1 
ATOM   209   C  "C2'" . A   A 1  10   ? 165.500 165.247 148.308 1.00 64.66  ?  10   A   A "C2'" 1 
ATOM   210   O  "O2'" . A   A 1  10   ? 164.499 165.672 147.396 1.00 64.66  ?  10   A   A "O2'" 1 
ATOM   211   C  "C1'" . A   A 1  10   ? 166.434 164.278 147.582 1.00 64.66  ?  10   A   A "C1'" 1 
ATOM   212   N  N9    . A   A 1  10   ? 167.001 163.271 148.498 1.00 64.66  ?  10   A   A N9    1 
ATOM   213   C  C8    . A   A 1  10   ? 168.275 163.216 149.009 1.00 64.66  ?  10   A   A C8    1 
ATOM   214   N  N7    . A   A 1  10   ? 168.484 162.194 149.803 1.00 64.66  ?  10   A   A N7    1 
ATOM   215   C  C5    . A   A 1  10   ? 167.265 161.532 149.817 1.00 64.66  ?  10   A   A C5    1 
ATOM   216   C  C6    . A   A 1  10   ? 166.819 160.368 150.470 1.00 64.66  ?  10   A   A C6    1 
ATOM   217   N  N6    . A   A 1  10   ? 167.590 159.631 151.273 1.00 64.66  ?  10   A   A N6    1 
ATOM   218   N  N1    . A   A 1  10   ? 165.539 159.979 150.270 1.00 64.66  ?  10   A   A N1    1 
ATOM   219   C  C2    . A   A 1  10   ? 164.756 160.712 149.466 1.00 64.66  ?  10   A   A C2    1 
ATOM   220   N  N3    . A   A 1  10   ? 165.062 161.823 148.798 1.00 64.66  ?  10   A   A N3    1 
ATOM   221   C  C4    . A   A 1  10   ? 166.341 162.183 149.018 1.00 64.66  ?  10   A   A C4    1 
ATOM   222   P  P     . G   A 1  11   ? 165.587 168.129 150.397 1.00 64.87  ?  11   G   A P     1 
ATOM   223   O  OP1   . G   A 1  11   ? 165.160 169.550 150.349 1.00 64.87  ?  11   G   A OP1   1 
ATOM   224   O  OP2   . G   A 1  11   ? 166.789 167.750 151.181 1.00 64.87  ?  11   G   A OP2   1 
ATOM   225   O  "O5'" . G   A 1  11   ? 164.360 167.262 150.927 1.00 64.87  ?  11   G   A "O5'" 1 
ATOM   226   C  "C5'" . G   A 1  11   ? 163.088 167.342 150.300 1.00 64.87  ?  11   G   A "C5'" 1 
ATOM   227   C  "C4'" . G   A 1  11   ? 162.199 166.191 150.699 1.00 64.87  ?  11   G   A "C4'" 1 
ATOM   228   O  "O4'" . G   A 1  11   ? 162.816 164.935 150.315 1.00 64.87  ?  11   G   A "O4'" 1 
ATOM   229   C  "C3'" . G   A 1  11   ? 161.940 166.034 152.188 1.00 64.87  ?  11   G   A "C3'" 1 
ATOM   230   O  "O3'" . G   A 1  11   ? 160.930 166.906 152.666 1.00 64.87  ?  11   G   A "O3'" 1 
ATOM   231   C  "C2'" . G   A 1  11   ? 161.583 164.559 152.310 1.00 64.87  ?  11   G   A "C2'" 1 
ATOM   232   O  "O2'" . G   A 1  11   ? 160.241 164.332 151.904 1.00 64.87  ?  11   G   A "O2'" 1 
ATOM   233   C  "C1'" . G   A 1  11   ? 162.514 163.937 151.268 1.00 64.87  ?  11   G   A "C1'" 1 
ATOM   234   N  N9    . G   A 1  11   ? 163.776 163.461 151.866 1.00 64.87  ?  11   G   A N9    1 
ATOM   235   C  C8    . G   A 1  11   ? 165.016 164.039 151.751 1.00 64.87  ?  11   G   A C8    1 
ATOM   236   N  N7    . G   A 1  11   ? 165.948 163.388 152.392 1.00 64.87  ?  11   G   A N7    1 
ATOM   237   C  C5    . G   A 1  11   ? 165.283 162.313 152.966 1.00 64.87  ?  11   G   A C5    1 
ATOM   238   C  C6    . G   A 1  11   ? 165.772 161.258 153.780 1.00 64.87  ?  11   G   A C6    1 
ATOM   239   O  O6    . G   A 1  11   ? 166.929 161.057 154.169 1.00 64.87  ?  11   G   A O6    1 
ATOM   240   N  N1    . G   A 1  11   ? 164.756 160.380 154.144 1.00 64.87  ?  11   G   A N1    1 
ATOM   241   C  C2    . G   A 1  11   ? 163.439 160.499 153.775 1.00 64.87  ?  11   G   A C2    1 
ATOM   242   N  N2    . G   A 1  11   ? 162.609 159.549 154.229 1.00 64.87  ?  11   G   A N2    1 
ATOM   243   N  N3    . G   A 1  11   ? 162.971 161.477 153.017 1.00 64.87  ?  11   G   A N3    1 
ATOM   244   C  C4    . G   A 1  11   ? 163.941 162.342 152.650 1.00 64.87  ?  11   G   A C4    1 
ATOM   245   P  P     . G   A 1  12   ? 160.953 167.412 154.191 1.00 64.24  ?  12   G   A P     1 
ATOM   246   O  OP1   . G   A 1  12   ? 160.089 168.616 154.289 1.00 64.24  ?  12   G   A OP1   1 
ATOM   247   O  OP2   . G   A 1  12   ? 162.369 167.486 154.630 1.00 64.24  ?  12   G   A OP2   1 
ATOM   248   O  "O5'" . G   A 1  12   ? 160.248 166.233 154.997 1.00 64.24  ?  12   G   A "O5'" 1 
ATOM   249   C  "C5'" . G   A 1  12   ? 158.930 165.806 154.664 1.00 64.24  ?  12   G   A "C5'" 1 
ATOM   250   C  "C4'" . G   A 1  12   ? 158.456 164.669 155.540 1.00 64.24  ?  12   G   A "C4'" 1 
ATOM   251   O  "O4'" . G   A 1  12   ? 159.430 163.590 155.503 1.00 64.24  ?  12   G   A "O4'" 1 
ATOM   252   C  "C3'" . G   A 1  12   ? 158.247 165.010 157.015 1.00 64.24  ?  12   G   A "C3'" 1 
ATOM   253   O  "O3'" . G   A 1  12   ? 157.116 164.296 157.514 1.00 64.24  ?  12   G   A "O3'" 1 
ATOM   254   C  "C2'" . G   A 1  12   ? 159.517 164.480 157.675 1.00 64.24  ?  12   G   A "C2'" 1 
ATOM   255   O  "O2'" . G   A 1  12   ? 159.370 164.141 159.037 1.00 64.24  ?  12   G   A "O2'" 1 
ATOM   256   C  "C1'" . G   A 1  12   ? 159.823 163.254 156.820 1.00 64.24  ?  12   G   A "C1'" 1 
ATOM   257   N  N9    . G   A 1  12   ? 161.241 162.886 156.796 1.00 64.24  ?  12   G   A N9    1 
ATOM   258   C  C8    . G   A 1  12   ? 162.285 163.652 156.336 1.00 64.24  ?  12   G   A C8    1 
ATOM   259   N  N7    . G   A 1  12   ? 163.442 163.057 156.438 1.00 64.24  ?  12   G   A N7    1 
ATOM   260   C  C5    . G   A 1  12   ? 163.145 161.822 156.997 1.00 64.24  ?  12   G   A C5    1 
ATOM   261   C  C6    . G   A 1  12   ? 163.998 160.742 157.344 1.00 64.24  ?  12   G   A C6    1 
ATOM   262   O  O6    . G   A 1  12   ? 165.226 160.658 157.221 1.00 64.24  ?  12   G   A O6    1 
ATOM   263   N  N1    . G   A 1  12   ? 163.282 159.679 157.885 1.00 64.24  ?  12   G   A N1    1 
ATOM   264   C  C2    . G   A 1  12   ? 161.921 159.656 158.070 1.00 64.24  ?  12   G   A C2    1 
ATOM   265   N  N2    . G   A 1  12   ? 161.416 158.536 158.607 1.00 64.24  ?  12   G   A N2    1 
ATOM   266   N  N3    . G   A 1  12   ? 161.116 160.656 157.751 1.00 64.24  ?  12   G   A N3    1 
ATOM   267   C  C4    . G   A 1  12   ? 161.790 161.699 157.222 1.00 64.24  ?  12   G   A C4    1 
ATOM   268   P  P     . G   A 1  13   ? 155.661 164.979 157.489 1.00 71.90  ?  13   G   A P     1 
ATOM   269   O  OP1   . G   A 1  13   ? 154.764 164.108 156.688 1.00 71.90  ?  13   G   A OP1   1 
ATOM   270   O  OP2   . G   A 1  13   ? 155.830 166.404 157.107 1.00 71.90  ?  13   G   A OP2   1 
ATOM   271   O  "O5'" . G   A 1  13   ? 155.171 164.926 159.005 1.00 71.90  ?  13   G   A "O5'" 1 
ATOM   272   C  "C5'" . G   A 1  13   ? 156.099 164.856 160.083 1.00 71.90  ?  13   G   A "C5'" 1 
ATOM   273   C  "C4'" . G   A 1  13   ? 156.736 166.195 160.366 1.00 71.90  ?  13   G   A "C4'" 1 
ATOM   274   O  "O4'" . G   A 1  13   ? 155.797 167.254 160.033 1.00 71.90  ?  13   G   A "O4'" 1 
ATOM   275   C  "C3'" . G   A 1  13   ? 157.144 166.429 161.819 1.00 71.90  ?  13   G   A "C3'" 1 
ATOM   276   O  "O3'" . G   A 1  13   ? 158.323 167.234 161.857 1.00 71.90  ?  13   G   A "O3'" 1 
ATOM   277   C  "C2'" . G   A 1  13   ? 155.966 167.222 162.373 1.00 71.90  ?  13   G   A "C2'" 1 
ATOM   278   O  "O2'" . G   A 1  13   ? 156.269 168.018 163.499 1.00 71.90  ?  13   G   A "O2'" 1 
ATOM   279   C  "C1'" . G   A 1  13   ? 155.579 168.072 161.166 1.00 71.90  ?  13   G   A "C1'" 1 
ATOM   280   N  N9    . G   A 1  13   ? 154.180 168.503 161.159 1.00 71.90  ?  13   G   A N9    1 
ATOM   281   C  C8    . G   A 1  13   ? 153.064 167.702 161.190 1.00 71.90  ?  13   G   A C8    1 
ATOM   282   N  N7    . G   A 1  13   ? 151.948 168.379 161.169 1.00 71.90  ?  13   G   A N7    1 
ATOM   283   C  C5    . G   A 1  13   ? 152.351 169.707 161.119 1.00 71.90  ?  13   G   A C5    1 
ATOM   284   C  C6    . G   A 1  13   ? 151.586 170.901 161.077 1.00 71.90  ?  13   G   A C6    1 
ATOM   285   O  O6    . G   A 1  13   ? 150.355 171.028 161.077 1.00 71.90  ?  13   G   A O6    1 
ATOM   286   N  N1    . G   A 1  13   ? 152.399 172.029 161.033 1.00 71.90  ?  13   G   A N1    1 
ATOM   287   C  C2    . G   A 1  13   ? 153.772 172.013 161.029 1.00 71.90  ?  13   G   A C2    1 
ATOM   288   N  N2    . G   A 1  13   ? 154.378 173.209 160.983 1.00 71.90  ?  13   G   A N2    1 
ATOM   289   N  N3    . G   A 1  13   ? 154.497 170.908 161.067 1.00 71.90  ?  13   G   A N3    1 
ATOM   290   C  C4    . G   A 1  13   ? 153.727 169.800 161.109 1.00 71.90  ?  13   G   A C4    1 
ATOM   291   P  P     . A   A 1  14   ? 159.420 167.017 163.013 1.00 56.89  ?  14   A   A P     1 
ATOM   292   O  OP1   . A   A 1  14   ? 158.814 167.430 164.304 1.00 56.89  ?  14   A   A OP1   1 
ATOM   293   O  OP2   . A   A 1  14   ? 160.689 167.646 162.564 1.00 56.89  ?  14   A   A OP2   1 
ATOM   294   O  "O5'" . A   A 1  14   ? 159.642 165.440 163.055 1.00 56.89  ?  14   A   A "O5'" 1 
ATOM   295   C  "C5'" . A   A 1  14   ? 160.459 164.788 162.094 1.00 56.89  ?  14   A   A "C5'" 1 
ATOM   296   C  "C4'" . A   A 1  14   ? 160.309 163.290 162.171 1.00 56.89  ?  14   A   A "C4'" 1 
ATOM   297   O  "O4'" . A   A 1  14   ? 161.024 162.665 161.076 1.00 56.89  ?  14   A   A "O4'" 1 
ATOM   298   C  "C3'" . A   A 1  14   ? 160.878 162.632 163.417 1.00 56.89  ?  14   A   A "C3'" 1 
ATOM   299   O  "O3'" . A   A 1  14   ? 159.986 162.700 164.517 1.00 56.89  ?  14   A   A "O3'" 1 
ATOM   300   C  "C2'" . A   A 1  14   ? 161.160 161.208 162.953 1.00 56.89  ?  14   A   A "C2'" 1 
ATOM   301   O  "O2'" . A   A 1  14   ? 159.975 160.427 162.977 1.00 56.89  ?  14   A   A "O2'" 1 
ATOM   302   C  "C1'" . A   A 1  14   ? 161.559 161.427 161.491 1.00 56.89  ?  14   A   A "C1'" 1 
ATOM   303   N  N9    . A   A 1  14   ? 163.021 161.449 161.275 1.00 56.89  ?  14   A   A N9    1 
ATOM   304   C  C8    . A   A 1  14   ? 163.742 162.484 160.732 1.00 56.89  ?  14   A   A C8    1 
ATOM   305   N  N7    . A   A 1  14   ? 165.026 162.248 160.627 1.00 56.89  ?  14   A   A N7    1 
ATOM   306   C  C5    . A   A 1  14   ? 165.164 160.962 161.124 1.00 56.89  ?  14   A   A C5    1 
ATOM   307   C  C6    . A   A 1  14   ? 166.285 160.126 161.286 1.00 56.89  ?  14   A   A C6    1 
ATOM   308   N  N6    . A   A 1  14   ? 167.526 160.482 160.946 1.00 56.89  ?  14   A   A N6    1 
ATOM   309   N  N1    . A   A 1  14   ? 166.091 158.896 161.813 1.00 56.89  ?  14   A   A N1    1 
ATOM   310   C  C2    . A   A 1  14   ? 164.849 158.532 162.157 1.00 56.89  ?  14   A   A C2    1 
ATOM   311   N  N3    . A   A 1  14   ? 163.719 159.226 162.048 1.00 56.89  ?  14   A   A N3    1 
ATOM   312   C  C4    . A   A 1  14   ? 163.939 160.448 161.522 1.00 56.89  ?  14   A   A C4    1 
ATOM   313   P  P     . A   A 1  15   ? 160.447 163.370 165.903 1.00 52.57  ?  15   A   A P     1 
ATOM   314   O  OP1   . A   A 1  15   ? 159.293 164.127 166.451 1.00 52.57  ?  15   A   A OP1   1 
ATOM   315   O  OP2   . A   A 1  15   ? 161.737 164.069 165.676 1.00 52.57  ?  15   A   A OP2   1 
ATOM   316   O  "O5'" . A   A 1  15   ? 160.713 162.125 166.859 1.00 52.57  ?  15   A   A "O5'" 1 
ATOM   317   C  "C5'" . A   A 1  15   ? 161.692 162.190 167.885 1.00 52.57  ?  15   A   A "C5'" 1 
ATOM   318   C  "C4'" . A   A 1  15   ? 162.693 161.071 167.752 1.00 52.57  ?  15   A   A "C4'" 1 
ATOM   319   O  "O4'" . A   A 1  15   ? 162.965 160.828 166.349 1.00 52.57  ?  15   A   A "O4'" 1 
ATOM   320   C  "C3'" . A   A 1  15   ? 164.063 161.330 168.361 1.00 52.57  ?  15   A   A "C3'" 1 
ATOM   321   O  "O3'" . A   A 1  15   ? 164.098 161.077 169.755 1.00 52.57  ?  15   A   A "O3'" 1 
ATOM   322   C  "C2'" . A   A 1  15   ? 164.971 160.411 167.553 1.00 52.57  ?  15   A   A "C2'" 1 
ATOM   323   O  "O2'" . A   A 1  15   ? 164.890 159.077 168.033 1.00 52.57  ?  15   A   A "O2'" 1 
ATOM   324   C  "C1'" . A   A 1  15   ? 164.317 160.468 166.172 1.00 52.57  ?  15   A   A "C1'" 1 
ATOM   325   N  N9    . A   A 1  15   ? 164.952 161.456 165.280 1.00 52.57  ?  15   A   A N9    1 
ATOM   326   C  C8    . A   A 1  15   ? 164.412 162.633 164.826 1.00 52.57  ?  15   A   A C8    1 
ATOM   327   N  N7    . A   A 1  15   ? 165.205 163.311 164.033 1.00 52.57  ?  15   A   A N7    1 
ATOM   328   C  C5    . A   A 1  15   ? 166.342 162.521 163.955 1.00 52.57  ?  15   A   A C5    1 
ATOM   329   C  C6    . A   A 1  15   ? 167.559 162.676 163.269 1.00 52.57  ?  15   A   A C6    1 
ATOM   330   N  N6    . A   A 1  15   ? 167.843 163.728 162.497 1.00 52.57  ?  15   A   A N6    1 
ATOM   331   N  N1    . A   A 1  15   ? 168.491 161.703 163.403 1.00 52.57  ?  15   A   A N1    1 
ATOM   332   C  C2    . A   A 1  15   ? 168.217 160.644 164.176 1.00 52.57  ?  15   A   A C2    1 
ATOM   333   N  N3    . A   A 1  15   ? 167.108 160.387 164.868 1.00 52.57  ?  15   A   A N3    1 
ATOM   334   C  C4    . A   A 1  15   ? 166.202 161.373 164.715 1.00 52.57  ?  15   A   A C4    1 
ATOM   335   P  P     . G   A 1  16   ? 164.935 162.035 170.736 1.00 59.48  ?  16   G   A P     1 
ATOM   336   O  OP1   . G   A 1  16   ? 164.518 161.744 172.132 1.00 59.48  ?  16   G   A OP1   1 
ATOM   337   O  OP2   . G   A 1  16   ? 164.837 163.422 170.215 1.00 59.48  ?  16   G   A OP2   1 
ATOM   338   O  "O5'" . G   A 1  16   ? 166.443 161.549 170.560 1.00 59.48  ?  16   G   A "O5'" 1 
ATOM   339   C  "C5'" . G   A 1  16   ? 166.809 160.192 170.791 1.00 59.48  ?  16   G   A "C5'" 1 
ATOM   340   C  "C4'" . G   A 1  16   ? 168.120 159.839 170.127 1.00 59.48  ?  16   G   A "C4'" 1 
ATOM   341   O  "O4'" . G   A 1  16   ? 168.145 160.403 168.787 1.00 59.48  ?  16   G   A "O4'" 1 
ATOM   342   C  "C3'" . G   A 1  16   ? 169.372 160.356 170.833 1.00 59.48  ?  16   G   A "C3'" 1 
ATOM   343   O  "O3'" . G   A 1  16   ? 170.437 159.420 170.682 1.00 59.48  ?  16   G   A "O3'" 1 
ATOM   344   C  "C2'" . G   A 1  16   ? 169.702 161.623 170.054 1.00 59.48  ?  16   G   A "C2'" 1 
ATOM   345   O  "O2'" . G   A 1  16   ? 171.060 162.008 170.107 1.00 59.48  ?  16   G   A "O2'" 1 
ATOM   346   C  "C1'" . G   A 1  16   ? 169.275 161.241 168.641 1.00 59.48  ?  16   G   A "C1'" 1 
ATOM   347   N  N9    . G   A 1  16   ? 168.891 162.389 167.815 1.00 59.48  ?  16   G   A N9    1 
ATOM   348   C  C8    . G   A 1  16   ? 167.757 163.153 167.948 1.00 59.48  ?  16   G   A C8    1 
ATOM   349   N  N7    . G   A 1  16   ? 167.680 164.112 167.066 1.00 59.48  ?  16   G   A N7    1 
ATOM   350   C  C5    . G   A 1  16   ? 168.832 163.972 166.305 1.00 59.48  ?  16   G   A C5    1 
ATOM   351   C  C6    . G   A 1  16   ? 169.301 164.733 165.202 1.00 59.48  ?  16   G   A C6    1 
ATOM   352   O  O6    . G   A 1  16   ? 168.769 165.707 164.656 1.00 59.48  ?  16   G   A O6    1 
ATOM   353   N  N1    . G   A 1  16   ? 170.514 164.248 164.726 1.00 59.48  ?  16   G   A N1    1 
ATOM   354   C  C2    . G   A 1  16   ? 171.194 163.176 165.248 1.00 59.48  ?  16   G   A C2    1 
ATOM   355   N  N2    . G   A 1  16   ? 172.352 162.865 164.649 1.00 59.48  ?  16   G   A N2    1 
ATOM   356   N  N3    . G   A 1  16   ? 170.771 162.461 166.278 1.00 59.48  ?  16   G   A N3    1 
ATOM   357   C  C4    . G   A 1  16   ? 169.590 162.911 166.752 1.00 59.48  ?  16   G   A C4    1 
ATOM   358   P  P     . C   A 1  17   ? 171.319 159.011 171.960 1.00 49.39  ?  17   C   A P     1 
ATOM   359   O  OP1   . C   A 1  17   ? 172.354 160.057 172.158 1.00 49.39  ?  17   C   A OP1   1 
ATOM   360   O  OP2   . C   A 1  17   ? 171.733 157.594 171.804 1.00 49.39  ?  17   C   A OP2   1 
ATOM   361   O  "O5'" . C   A 1  17   ? 170.286 159.117 173.168 1.00 49.39  ?  17   C   A "O5'" 1 
ATOM   362   C  "C5'" . C   A 1  17   ? 170.426 158.315 174.330 1.00 49.39  ?  17   C   A "C5'" 1 
ATOM   363   C  "C4'" . C   A 1  17   ? 169.442 157.173 174.327 1.00 49.39  ?  17   C   A "C4'" 1 
ATOM   364   O  "O4'" . C   A 1  17   ? 169.985 156.068 173.559 1.00 49.39  ?  17   C   A "O4'" 1 
ATOM   365   C  "C3'" . C   A 1  17   ? 169.127 156.564 175.683 1.00 49.39  ?  17   C   A "C3'" 1 
ATOM   366   O  "O3'" . C   A 1  17   ? 168.154 157.305 176.399 1.00 49.39  ?  17   C   A "O3'" 1 
ATOM   367   C  "C2'" . C   A 1  17   ? 168.678 155.153 175.324 1.00 49.39  ?  17   C   A "C2'" 1 
ATOM   368   O  "O2'" . C   A 1  17   ? 167.324 155.150 174.897 1.00 49.39  ?  17   C   A "O2'" 1 
ATOM   369   C  "C1'" . C   A 1  17   ? 169.567 154.840 174.116 1.00 49.39  ?  17   C   A "C1'" 1 
ATOM   370   N  N1    . C   A 1  17   ? 170.764 154.034 174.467 1.00 49.39  ?  17   C   A N1    1 
ATOM   371   C  C2    . C   A 1  17   ? 170.640 152.641 174.555 1.00 49.39  ?  17   C   A C2    1 
ATOM   372   O  O2    . C   A 1  17   ? 169.538 152.111 174.346 1.00 49.39  ?  17   C   A O2    1 
ATOM   373   N  N3    . C   A 1  17   ? 171.727 151.897 174.868 1.00 49.39  ?  17   C   A N3    1 
ATOM   374   C  C4    . C   A 1  17   ? 172.904 152.484 175.087 1.00 49.39  ?  17   C   A C4    1 
ATOM   375   N  N4    . C   A 1  17   ? 173.945 151.706 175.393 1.00 49.39  ?  17   C   A N4    1 
ATOM   376   C  C5    . C   A 1  17   ? 173.065 153.896 175.002 1.00 49.39  ?  17   C   A C5    1 
ATOM   377   C  C6    . C   A 1  17   ? 171.984 154.619 174.689 1.00 49.39  ?  17   C   A C6    1 
ATOM   378   P  P     . U   A 1  18   ? 168.379 157.661 177.950 1.00 46.42  ?  18   U   A P     1 
ATOM   379   O  OP1   . U   A 1  18   ? 167.648 158.920 178.244 1.00 46.42  ?  18   U   A OP1   1 
ATOM   380   O  OP2   . U   A 1  18   ? 169.833 157.573 178.237 1.00 46.42  ?  18   U   A OP2   1 
ATOM   381   O  "O5'" . U   A 1  18   ? 167.650 156.476 178.724 1.00 46.42  ?  18   U   A "O5'" 1 
ATOM   382   C  "C5'" . U   A 1  18   ? 166.326 156.090 178.385 1.00 46.42  ?  18   U   A "C5'" 1 
ATOM   383   C  "C4'" . U   A 1  18   ? 166.095 154.627 178.667 1.00 46.42  ?  18   U   A "C4'" 1 
ATOM   384   O  "O4'" . U   A 1  18   ? 167.037 153.830 177.902 1.00 46.42  ?  18   U   A "O4'" 1 
ATOM   385   C  "C3'" . U   A 1  18   ? 166.323 154.187 180.104 1.00 46.42  ?  18   U   A "C3'" 1 
ATOM   386   O  "O3'" . U   A 1  18   ? 165.220 154.460 180.951 1.00 46.42  ?  18   U   A "O3'" 1 
ATOM   387   C  "C2'" . U   A 1  18   ? 166.632 152.703 179.954 1.00 46.42  ?  18   U   A "C2'" 1 
ATOM   388   O  "O2'" . U   A 1  18   ? 165.436 151.957 179.779 1.00 46.42  ?  18   U   A "O2'" 1 
ATOM   389   C  "C1'" . U   A 1  18   ? 167.411 152.684 178.637 1.00 46.42  ?  18   U   A "C1'" 1 
ATOM   390   N  N1    . U   A 1  18   ? 168.883 152.696 178.841 1.00 46.42  ?  18   U   A N1    1 
ATOM   391   C  C2    . U   A 1  18   ? 169.509 151.499 179.153 1.00 46.42  ?  18   U   A C2    1 
ATOM   392   O  O2    . U   A 1  18   ? 168.919 150.438 179.273 1.00 46.42  ?  18   U   A O2    1 
ATOM   393   N  N3    . U   A 1  18   ? 170.870 151.579 179.322 1.00 46.42  ?  18   U   A N3    1 
ATOM   394   C  C4    . U   A 1  18   ? 171.661 152.703 179.215 1.00 46.42  ?  18   U   A C4    1 
ATOM   395   O  O4    . U   A 1  18   ? 172.876 152.611 179.398 1.00 46.42  ?  18   U   A O4    1 
ATOM   396   C  C5    . U   A 1  18   ? 170.949 153.899 178.888 1.00 46.42  ?  18   U   A C5    1 
ATOM   397   C  C6    . U   A 1  18   ? 169.625 153.851 178.714 1.00 46.42  ?  18   U   A C6    1 
ATOM   398   P  P     . C   A 1  19   ? 165.466 154.929 182.468 1.00 46.73  ?  19   C   A P     1 
ATOM   399   O  OP1   . C   A 1  19   ? 164.166 155.383 183.025 1.00 46.73  ?  19   C   A OP1   1 
ATOM   400   O  OP2   . C   A 1  19   ? 166.632 155.848 182.484 1.00 46.73  ?  19   C   A OP2   1 
ATOM   401   O  "O5'" . C   A 1  19   ? 165.883 153.589 183.222 1.00 46.73  ?  19   C   A "O5'" 1 
ATOM   402   C  "C5'" . C   A 1  19   ? 164.988 152.490 183.290 1.00 46.73  ?  19   C   A "C5'" 1 
ATOM   403   C  "C4'" . C   A 1  19   ? 165.689 151.224 183.716 1.00 46.73  ?  19   C   A "C4'" 1 
ATOM   404   O  "O4'" . C   A 1  19   ? 166.718 150.878 182.752 1.00 46.73  ?  19   C   A "O4'" 1 
ATOM   405   C  "C3'" . C   A 1  19   ? 166.434 151.286 185.039 1.00 46.73  ?  19   C   A "C3'" 1 
ATOM   406   O  "O3'" . C   A 1  19   ? 165.584 151.146 186.162 1.00 46.73  ?  19   C   A "O3'" 1 
ATOM   407   C  "C2'" . C   A 1  19   ? 167.454 150.164 184.899 1.00 46.73  ?  19   C   A "C2'" 1 
ATOM   408   O  "O2'" . C   A 1  19   ? 166.850 148.903 185.149 1.00 46.73  ?  19   C   A "O2'" 1 
ATOM   409   C  "C1'" . C   A 1  19   ? 167.799 150.247 183.408 1.00 46.73  ?  19   C   A "C1'" 1 
ATOM   410   N  N1    . C   A 1  19   ? 169.044 151.014 183.147 1.00 46.73  ?  19   C   A N1    1 
ATOM   411   C  C2    . C   A 1  19   ? 170.282 150.369 183.285 1.00 46.73  ?  19   C   A C2    1 
ATOM   412   O  O2    . C   A 1  19   ? 170.320 149.177 183.626 1.00 46.73  ?  19   C   A O2    1 
ATOM   413   N  N3    . C   A 1  19   ? 171.420 151.061 183.044 1.00 46.73  ?  19   C   A N3    1 
ATOM   414   C  C4    . C   A 1  19   ? 171.366 152.341 182.676 1.00 46.73  ?  19   C   A C4    1 
ATOM   415   N  N4    . C   A 1  19   ? 172.517 152.977 182.451 1.00 46.73  ?  19   C   A N4    1 
ATOM   416   C  C5    . C   A 1  19   ? 170.127 153.025 182.523 1.00 46.73  ?  19   C   A C5    1 
ATOM   417   C  C6    . C   A 1  19   ? 169.009 152.329 182.761 1.00 46.73  ?  19   C   A C6    1 
ATOM   418   P  P     . A   A 1  20   ? 165.884 151.976 187.504 1.00 49.62  ?  20   A   A P     1 
ATOM   419   O  OP1   . A   A 1  20   ? 164.660 151.939 188.342 1.00 49.62  ?  20   A   A OP1   1 
ATOM   420   O  OP2   . A   A 1  20   ? 166.463 153.287 187.113 1.00 49.62  ?  20   A   A OP2   1 
ATOM   421   O  "O5'" . A   A 1  20   ? 167.024 151.133 188.232 1.00 49.62  ?  20   A   A "O5'" 1 
ATOM   422   C  "C5'" . A   A 1  20   ? 166.777 149.808 188.678 1.00 49.62  ?  20   A   A "C5'" 1 
ATOM   423   C  "C4'" . A   A 1  20   ? 168.026 149.160 189.222 1.00 49.62  ?  20   A   A "C4'" 1 
ATOM   424   O  "O4'" . A   A 1  20   ? 168.919 148.810 188.134 1.00 49.62  ?  20   A   A "O4'" 1 
ATOM   425   C  "C3'" . A   A 1  20   ? 168.883 150.020 190.138 1.00 49.62  ?  20   A   A "C3'" 1 
ATOM   426   O  "O3'" . A   A 1  20   ? 168.390 150.082 191.465 1.00 49.62  ?  20   A   A "O3'" 1 
ATOM   427   C  "C2'" . A   A 1  20   ? 170.251 149.360 190.024 1.00 49.62  ?  20   A   A "C2'" 1 
ATOM   428   O  "O2'" . A   A 1  20   ? 170.310 148.186 190.821 1.00 49.62  ?  20   A   A "O2'" 1 
ATOM   429   C  "C1'" . A   A 1  20   ? 170.262 148.945 188.552 1.00 49.62  ?  20   A   A "C1'" 1 
ATOM   430   N  N9    . A   A 1  20   ? 170.924 149.950 187.698 1.00 49.62  ?  20   A   A N9    1 
ATOM   431   C  C8    . A   A 1  20   ? 170.330 150.874 186.875 1.00 49.62  ?  20   A   A C8    1 
ATOM   432   N  N7    . A   A 1  20   ? 171.179 151.638 186.233 1.00 49.62  ?  20   A   A N7    1 
ATOM   433   C  C5    . A   A 1  20   ? 172.417 151.188 186.665 1.00 49.62  ?  20   A   A C5    1 
ATOM   434   C  C6    . A   A 1  20   ? 173.732 151.583 186.360 1.00 49.62  ?  20   A   A C6    1 
ATOM   435   N  N6    . A   A 1  20   ? 174.026 152.570 185.510 1.00 49.62  ?  20   A   A N6    1 
ATOM   436   N  N1    . A   A 1  20   ? 174.749 150.926 186.966 1.00 49.62  ?  20   A   A N1    1 
ATOM   437   C  C2    . A   A 1  20   ? 174.462 149.935 187.822 1.00 49.62  ?  20   A   A C2    1 
ATOM   438   N  N3    . A   A 1  20   ? 173.266 149.473 188.186 1.00 49.62  ?  20   A   A N3    1 
ATOM   439   C  C4    . A   A 1  20   ? 172.278 150.147 187.568 1.00 49.62  ?  20   A   A C4    1 
ATOM   440   P  P     . U   A 1  21   ? 168.642 151.395 192.358 1.00 55.27  ?  21   U   A P     1 
ATOM   441   O  OP1   . U   A 1  21   ? 167.706 151.356 193.509 1.00 55.27  ?  21   U   A OP1   1 
ATOM   442   O  OP2   . U   A 1  21   ? 168.641 152.572 191.453 1.00 55.27  ?  21   U   A OP2   1 
ATOM   443   O  "O5'" . U   A 1  21   ? 170.121 151.203 192.917 1.00 55.27  ?  21   U   A "O5'" 1 
ATOM   444   C  "C5'" . U   A 1  21   ? 170.446 150.101 193.752 1.00 55.27  ?  21   U   A "C5'" 1 
ATOM   445   C  "C4'" . U   A 1  21   ? 171.938 149.919 193.877 1.00 55.27  ?  21   U   A "C4'" 1 
ATOM   446   O  "O4'" . U   A 1  21   ? 172.520 149.705 192.564 1.00 55.27  ?  21   U   A "O4'" 1 
ATOM   447   C  "C3'" . U   A 1  21   ? 172.714 151.104 194.432 1.00 55.27  ?  21   U   A "C3'" 1 
ATOM   448   O  "O3'" . U   A 1  21   ? 172.655 151.197 195.845 1.00 55.27  ?  21   U   A "O3'" 1 
ATOM   449   C  "C2'" . U   A 1  21   ? 174.119 150.862 193.893 1.00 55.27  ?  21   U   A "C2'" 1 
ATOM   450   O  "O2'" . U   A 1  21   ? 174.797 149.892 194.677 1.00 55.27  ?  21   U   A "O2'" 1 
ATOM   451   C  "C1'" . U   A 1  21   ? 173.822 150.253 192.520 1.00 55.27  ?  21   U   A "C1'" 1 
ATOM   452   N  N1    . U   A 1  21   ? 173.896 151.251 191.423 1.00 55.27  ?  21   U   A N1    1 
ATOM   453   C  C2    . U   A 1  21   ? 175.148 151.543 190.906 1.00 55.27  ?  21   U   A C2    1 
ATOM   454   O  O2    . U   A 1  21   ? 176.177 151.025 191.305 1.00 55.27  ?  21   U   A O2    1 
ATOM   455   N  N3    . U   A 1  21   ? 175.158 152.470 189.893 1.00 55.27  ?  21   U   A N3    1 
ATOM   456   C  C4    . U   A 1  21   ? 174.072 153.124 189.350 1.00 55.27  ?  21   U   A C4    1 
ATOM   457   O  O4    . U   A 1  21   ? 174.246 153.935 188.439 1.00 55.27  ?  21   U   A O4    1 
ATOM   458   C  C5    . U   A 1  21   ? 172.815 152.771 189.932 1.00 55.27  ?  21   U   A C5    1 
ATOM   459   C  C6    . U   A 1  21   ? 172.773 151.870 190.918 1.00 55.27  ?  21   U   A C6    1 
ATOM   460   P  P     . C   A 1  22   ? 172.433 152.623 196.551 1.00 61.00  ?  22   C   A P     1 
ATOM   461   O  OP1   . C   A 1  22   ? 172.249 152.392 198.006 1.00 61.00  ?  22   C   A OP1   1 
ATOM   462   O  OP2   . C   A 1  22   ? 171.392 153.356 195.787 1.00 61.00  ?  22   C   A OP2   1 
ATOM   463   O  "O5'" . C   A 1  22   ? 173.820 153.380 196.344 1.00 61.00  ?  22   C   A "O5'" 1 
ATOM   464   C  "C5'" . C   A 1  22   ? 175.010 152.903 196.955 1.00 61.00  ?  22   C   A "C5'" 1 
ATOM   465   C  "C4'" . C   A 1  22   ? 176.239 153.514 196.331 1.00 61.00  ?  22   C   A "C4'" 1 
ATOM   466   O  "O4'" . C   A 1  22   ? 176.255 153.238 194.905 1.00 61.00  ?  22   C   A "O4'" 1 
ATOM   467   C  "C3'" . C   A 1  22   ? 176.349 155.029 196.410 1.00 61.00  ?  22   C   A "C3'" 1 
ATOM   468   O  "O3'" . C   A 1  22   ? 176.817 155.492 197.665 1.00 61.00  ?  22   C   A "O3'" 1 
ATOM   469   C  "C2'" . C   A 1  22   ? 177.282 155.356 195.250 1.00 61.00  ?  22   C   A "C2'" 1 
ATOM   470   O  "O2'" . C   A 1  22   ? 178.634 155.113 195.609 1.00 61.00  ?  22   C   A "O2'" 1 
ATOM   471   C  "C1'" . C   A 1  22   ? 176.861 154.310 194.213 1.00 61.00  ?  22   C   A "C1'" 1 
ATOM   472   N  N1    . C   A 1  22   ? 175.908 154.848 193.209 1.00 61.00  ?  22   C   A N1    1 
ATOM   473   C  C2    . C   A 1  22   ? 176.417 155.543 192.102 1.00 61.00  ?  22   C   A C2    1 
ATOM   474   O  O2    . C   A 1  22   ? 177.643 155.695 191.984 1.00 61.00  ?  22   C   A O2    1 
ATOM   475   N  N3    . C   A 1  22   ? 175.561 156.038 191.178 1.00 61.00  ?  22   C   A N3    1 
ATOM   476   C  C4    . C   A 1  22   ? 174.247 155.866 191.317 1.00 61.00  ?  22   C   A C4    1 
ATOM   477   N  N4    . C   A 1  22   ? 173.445 156.373 190.378 1.00 61.00  ?  22   C   A N4    1 
ATOM   478   C  C5    . C   A 1  22   ? 173.696 155.164 192.426 1.00 61.00  ?  22   C   A C5    1 
ATOM   479   C  C6    . C   A 1  22   ? 174.554 154.676 193.331 1.00 61.00  ?  22   C   A C6    1 
ATOM   480   P  P     . A   A 1  23   ? 176.319 156.909 198.237 1.00 63.80  ?  23   A   A P     1 
ATOM   481   O  OP1   . A   A 1  23   ? 176.740 157.004 199.658 1.00 63.80  ?  23   A   A OP1   1 
ATOM   482   O  OP2   . A   A 1  23   ? 174.886 157.069 197.883 1.00 63.80  ?  23   A   A OP2   1 
ATOM   483   O  "O5'" . A   A 1  23   ? 177.155 157.979 197.403 1.00 63.80  ?  23   A   A "O5'" 1 
ATOM   484   C  "C5'" . A   A 1  23   ? 178.566 158.063 197.536 1.00 63.80  ?  23   A   A "C5'" 1 
ATOM   485   C  "C4'" . A   A 1  23   ? 179.181 158.911 196.450 1.00 63.80  ?  23   A   A "C4'" 1 
ATOM   486   O  "O4'" . A   A 1  23   ? 178.908 158.329 195.149 1.00 63.80  ?  23   A   A "O4'" 1 
ATOM   487   C  "C3'" . A   A 1  23   ? 178.658 160.333 196.330 1.00 63.80  ?  23   A   A "C3'" 1 
ATOM   488   O  "O3'" . A   A 1  23   ? 179.221 161.216 197.285 1.00 63.80  ?  23   A   A "O3'" 1 
ATOM   489   C  "C2'" . A   A 1  23   ? 179.004 160.689 194.890 1.00 63.80  ?  23   A   A "C2'" 1 
ATOM   490   O  "O2'" . A   A 1  23   ? 180.380 161.019 194.771 1.00 63.80  ?  23   A   A "O2'" 1 
ATOM   491   C  "C1'" . A   A 1  23   ? 178.765 159.353 194.186 1.00 63.80  ?  23   A   A "C1'" 1 
ATOM   492   N  N9    . A   A 1  23   ? 177.413 159.275 193.602 1.00 63.80  ?  23   A   A N9    1 
ATOM   493   C  C8    . A   A 1  23   ? 176.316 158.604 194.084 1.00 63.80  ?  23   A   A C8    1 
ATOM   494   N  N7    . A   A 1  23   ? 175.248 158.729 193.334 1.00 63.80  ?  23   A   A N7    1 
ATOM   495   C  C5    . A   A 1  23   ? 175.669 159.539 192.289 1.00 63.80  ?  23   A   A C5    1 
ATOM   496   C  C6    . A   A 1  23   ? 175.015 160.050 191.153 1.00 63.80  ?  23   A   A C6    1 
ATOM   497   N  N6    . A   A 1  23   ? 173.734 159.808 190.867 1.00 63.80  ?  23   A   A N6    1 
ATOM   498   N  N1    . A   A 1  23   ? 175.729 160.830 190.307 1.00 63.80  ?  23   A   A N1    1 
ATOM   499   C  C2    . A   A 1  23   ? 177.016 161.078 190.583 1.00 63.80  ?  23   A   A C2    1 
ATOM   500   N  N3    . A   A 1  23   ? 177.739 160.655 191.619 1.00 63.80  ?  23   A   A N3    1 
ATOM   501   C  C4    . A   A 1  23   ? 177.001 159.884 192.441 1.00 63.80  ?  23   A   A C4    1 
ATOM   502   P  P     . G   A 1  24   ? 178.381 162.484 197.804 1.00 61.88  ?  24   G   A P     1 
ATOM   503   O  OP1   . G   A 1  24   ? 179.029 162.990 199.041 1.00 61.88  ?  24   G   A OP1   1 
ATOM   504   O  OP2   . G   A 1  24   ? 176.945 162.105 197.830 1.00 61.88  ?  24   G   A OP2   1 
ATOM   505   O  "O5'" . G   A 1  24   ? 178.582 163.575 196.660 1.00 61.88  ?  24   G   A "O5'" 1 
ATOM   506   C  "C5'" . G   A 1  24   ? 179.877 164.058 196.335 1.00 61.88  ?  24   G   A "C5'" 1 
ATOM   507   C  "C4'" . G   A 1  24   ? 179.880 164.798 195.021 1.00 61.88  ?  24   G   A "C4'" 1 
ATOM   508   O  "O4'" . G   A 1  24   ? 179.449 163.913 193.955 1.00 61.88  ?  24   G   A "O4'" 1 
ATOM   509   C  "C3'" . G   A 1  24   ? 178.933 165.983 194.918 1.00 61.88  ?  24   G   A "C3'" 1 
ATOM   510   O  "O3'" . G   A 1  24   ? 179.448 167.156 195.523 1.00 61.88  ?  24   G   A "O3'" 1 
ATOM   511   C  "C2'" . G   A 1  24   ? 178.725 166.110 193.415 1.00 61.88  ?  24   G   A "C2'" 1 
ATOM   512   O  "O2'" . G   A 1  24   ? 179.835 166.752 192.807 1.00 61.88  ?  24   G   A "O2'" 1 
ATOM   513   C  "C1'" . G   A 1  24   ? 178.722 164.642 192.987 1.00 61.88  ?  24   G   A "C1'" 1 
ATOM   514   N  N9    . G   A 1  24   ? 177.356 164.092 192.908 1.00 61.88  ?  24   G   A N9    1 
ATOM   515   C  C8    . G   A 1  24   ? 176.724 163.296 193.833 1.00 61.88  ?  24   G   A C8    1 
ATOM   516   N  N7    . G   A 1  24   ? 175.511 162.966 193.483 1.00 61.88  ?  24   G   A N7    1 
ATOM   517   C  C5    . G   A 1  24   ? 175.328 163.583 192.253 1.00 61.88  ?  24   G   A C5    1 
ATOM   518   C  C6    . G   A 1  24   ? 174.207 163.587 191.382 1.00 61.88  ?  24   G   A C6    1 
ATOM   519   O  O6    . G   A 1  24   ? 173.113 163.028 191.531 1.00 61.88  ?  24   G   A O6    1 
ATOM   520   N  N1    . G   A 1  24   ? 174.450 164.340 190.238 1.00 61.88  ?  24   G   A N1    1 
ATOM   521   C  C2    . G   A 1  24   ? 175.620 165.004 189.963 1.00 61.88  ?  24   G   A C2    1 
ATOM   522   N  N2    . G   A 1  24   ? 175.660 165.676 188.804 1.00 61.88  ?  24   G   A N2    1 
ATOM   523   N  N3    . G   A 1  24   ? 176.672 165.007 190.765 1.00 61.88  ?  24   G   A N3    1 
ATOM   524   C  C4    . G   A 1  24   ? 176.458 164.282 191.884 1.00 61.88  ?  24   G   A C4    1 
ATOM   525   P  P     . U   A 1  25   ? 178.495 168.085 196.425 1.00 57.88  ?  25   U   A P     1 
ATOM   526   O  OP1   . U   A 1  25   ? 179.350 169.072 197.132 1.00 57.88  ?  25   U   A OP1   1 
ATOM   527   O  OP2   . U   A 1  25   ? 177.596 167.199 197.207 1.00 57.88  ?  25   U   A OP2   1 
ATOM   528   O  "O5'" . U   A 1  25   ? 177.608 168.873 195.363 1.00 57.88  ?  25   U   A "O5'" 1 
ATOM   529   C  "C5'" . U   A 1  25   ? 178.210 169.723 194.398 1.00 57.88  ?  25   U   A "C5'" 1 
ATOM   530   C  "C4'" . U   A 1  25   ? 177.264 170.033 193.266 1.00 57.88  ?  25   U   A "C4'" 1 
ATOM   531   O  "O4'" . U   A 1  25   ? 176.887 168.805 192.589 1.00 57.88  ?  25   U   A "O4'" 1 
ATOM   532   C  "C3'" . U   A 1  25   ? 175.934 170.654 193.660 1.00 57.88  ?  25   U   A "C3'" 1 
ATOM   533   O  "O3'" . U   A 1  25   ? 176.019 172.046 193.913 1.00 57.88  ?  25   U   A "O3'" 1 
ATOM   534   C  "C2'" . U   A 1  25   ? 175.038 170.297 192.482 1.00 57.88  ?  25   U   A "C2'" 1 
ATOM   535   O  "O2'" . U   A 1  25   ? 175.275 171.170 191.388 1.00 57.88  ?  25   U   A "O2'" 1 
ATOM   536   C  "C1'" . U   A 1  25   ? 175.561 168.905 192.112 1.00 57.88  ?  25   U   A "C1'" 1 
ATOM   537   N  N1    . U   A 1  25   ? 174.745 167.813 192.700 1.00 57.88  ?  25   U   A N1    1 
ATOM   538   C  C2    . U   A 1  25   ? 173.586 167.446 192.035 1.00 57.88  ?  25   U   A C2    1 
ATOM   539   O  O2    . U   A 1  25   ? 173.209 167.972 191.001 1.00 57.88  ?  25   U   A O2    1 
ATOM   540   N  N3    . U   A 1  25   ? 172.872 166.430 192.623 1.00 57.88  ?  25   U   A N3    1 
ATOM   541   C  C4    . U   A 1  25   ? 173.185 165.753 193.783 1.00 57.88  ?  25   U   A C4    1 
ATOM   542   O  O4    . U   A 1  25   ? 172.438 164.859 194.184 1.00 57.88  ?  25   U   A O4    1 
ATOM   543   C  C5    . U   A 1  25   ? 174.394 166.183 194.412 1.00 57.88  ?  25   U   A C5    1 
ATOM   544   C  C6    . U   A 1  25   ? 175.112 167.167 193.862 1.00 57.88  ?  25   U   A C6    1 
ATOM   545   P  P     . G   A 1  26   ? 175.106 172.710 195.056 1.00 51.14  ?  26   G   A P     1 
ATOM   546   O  OP1   . G   A 1  26   ? 175.846 173.866 195.623 1.00 51.14  ?  26   G   A OP1   1 
ATOM   547   O  OP2   . G   A 1  26   ? 174.639 171.626 195.958 1.00 51.14  ?  26   G   A OP2   1 
ATOM   548   O  "O5'" . G   A 1  26   ? 173.841 173.268 194.264 1.00 51.14  ?  26   G   A "O5'" 1 
ATOM   549   C  "C5'" . G   A 1  26   ? 173.982 174.306 193.306 1.00 51.14  ?  26   G   A "C5'" 1 
ATOM   550   C  "C4'" . G   A 1  26   ? 172.791 174.377 192.384 1.00 51.14  ?  26   G   A "C4'" 1 
ATOM   551   O  "O4'" . G   A 1  26   ? 172.672 173.140 191.636 1.00 51.14  ?  26   G   A "O4'" 1 
ATOM   552   C  "C3'" . G   A 1  26   ? 171.434 174.533 193.053 1.00 51.14  ?  26   G   A "C3'" 1 
ATOM   553   O  "O3'" . G   A 1  26   ? 171.155 175.871 193.431 1.00 51.14  ?  26   G   A "O3'" 1 
ATOM   554   C  "C2'" . G   A 1  26   ? 170.479 173.983 192.000 1.00 51.14  ?  26   G   A "C2'" 1 
ATOM   555   O  "O2'" . G   A 1  26   ? 170.225 174.949 190.992 1.00 51.14  ?  26   G   A "O2'" 1 
ATOM   556   C  "C1'" . G   A 1  26   ? 171.311 172.855 191.389 1.00 51.14  ?  26   G   A "C1'" 1 
ATOM   557   N  N9    . G   A 1  26   ? 170.982 171.543 191.978 1.00 51.14  ?  26   G   A N9    1 
ATOM   558   C  C8    . G   A 1  26   ? 171.592 170.925 193.042 1.00 51.14  ?  26   G   A C8    1 
ATOM   559   N  N7    . G   A 1  26   ? 171.071 169.764 193.329 1.00 51.14  ?  26   G   A N7    1 
ATOM   560   C  C5    . G   A 1  26   ? 170.051 169.606 192.401 1.00 51.14  ?  26   G   A C5    1 
ATOM   561   C  C6    . G   A 1  26   ? 169.132 168.542 192.217 1.00 51.14  ?  26   G   A C6    1 
ATOM   562   O  O6    . G   A 1  26   ? 169.033 167.490 192.859 1.00 51.14  ?  26   G   A O6    1 
ATOM   563   N  N1    . G   A 1  26   ? 168.264 168.791 191.158 1.00 51.14  ?  26   G   A N1    1 
ATOM   564   C  C2    . G   A 1  26   ? 168.278 169.919 190.375 1.00 51.14  ?  26   G   A C2    1 
ATOM   565   N  N2    . G   A 1  26   ? 167.359 169.974 189.400 1.00 51.14  ?  26   G   A N2    1 
ATOM   566   N  N3    . G   A 1  26   ? 169.130 170.919 190.536 1.00 51.14  ?  26   G   A N3    1 
ATOM   567   C  C4    . G   A 1  26   ? 169.981 170.697 191.561 1.00 51.14  ?  26   G   A C4    1 
ATOM   568   P  P     . G   A 1  27   ? 170.402 176.182 194.817 1.00 43.16  ?  27   G   A P     1 
ATOM   569   O  OP1   . G   A 1  27   ? 169.493 177.336 194.599 1.00 43.16  ?  27   G   A OP1   1 
ATOM   570   O  OP2   . G   A 1  27   ? 171.425 176.248 195.892 1.00 43.16  ?  27   G   A OP2   1 
ATOM   571   O  "O5'" . G   A 1  27   ? 169.506 174.889 195.067 1.00 43.16  ?  27   G   A "O5'" 1 
ATOM   572   C  "C5'" . G   A 1  27   ? 168.168 175.000 195.529 1.00 43.16  ?  27   G   A "C5'" 1 
ATOM   573   C  "C4'" . G   A 1  27   ? 167.187 174.572 194.468 1.00 43.16  ?  27   G   A "C4'" 1 
ATOM   574   O  "O4'" . G   A 1  27   ? 167.716 173.430 193.747 1.00 43.16  ?  27   G   A "O4'" 1 
ATOM   575   C  "C3'" . G   A 1  27   ? 165.827 174.103 194.962 1.00 43.16  ?  27   G   A "C3'" 1 
ATOM   576   O  "O3'" . G   A 1  27   ? 164.943 175.174 195.246 1.00 43.16  ?  27   G   A "O3'" 1 
ATOM   577   C  "C2'" . G   A 1  27   ? 165.354 173.204 193.828 1.00 43.16  ?  27   G   A "C2'" 1 
ATOM   578   O  "O2'" . G   A 1  27   ? 164.848 173.978 192.750 1.00 43.16  ?  27   G   A "O2'" 1 
ATOM   579   C  "C1'" . G   A 1  27   ? 166.667 172.559 193.384 1.00 43.16  ?  27   G   A "C1'" 1 
ATOM   580   N  N9    . G   A 1  27   ? 166.900 171.257 194.037 1.00 43.16  ?  27   G   A N9    1 
ATOM   581   C  C8    . G   A 1  27   ? 167.794 170.994 195.046 1.00 43.16  ?  27   G   A C8    1 
ATOM   582   N  N7    . G   A 1  27   ? 167.788 169.746 195.426 1.00 43.16  ?  27   G   A N7    1 
ATOM   583   C  C5    . G   A 1  27   ? 166.832 169.148 194.616 1.00 43.16  ?  27   G   A C5    1 
ATOM   584   C  C6    . G   A 1  27   ? 166.386 167.802 194.567 1.00 43.16  ?  27   G   A C6    1 
ATOM   585   O  O6    . G   A 1  27   ? 166.759 166.843 195.253 1.00 43.16  ?  27   G   A O6    1 
ATOM   586   N  N1    . G   A 1  27   ? 165.403 167.625 193.599 1.00 43.16  ?  27   G   A N1    1 
ATOM   587   C  C2    . G   A 1  27   ? 164.912 168.613 192.781 1.00 43.16  ?  27   G   A C2    1 
ATOM   588   N  N2    . G   A 1  27   ? 163.964 168.244 191.908 1.00 43.16  ?  27   G   A N2    1 
ATOM   589   N  N3    . G   A 1  27   ? 165.321 169.871 192.817 1.00 43.16  ?  27   G   A N3    1 
ATOM   590   C  C4    . G   A 1  27   ? 166.276 170.066 193.751 1.00 43.16  ?  27   G   A C4    1 
ATOM   591   P  P     . G   A 1  28   ? 163.950 175.091 196.506 1.00 43.55  ?  28   G   A P     1 
ATOM   592   O  OP1   . G   A 1  28   ? 163.347 176.433 196.706 1.00 43.55  ?  28   G   A OP1   1 
ATOM   593   O  OP2   . G   A 1  28   ? 164.680 174.442 197.624 1.00 43.55  ?  28   G   A OP2   1 
ATOM   594   O  "O5'" . G   A 1  28   ? 162.799 174.100 196.026 1.00 43.55  ?  28   G   A "O5'" 1 
ATOM   595   C  "C5'" . G   A 1  28   ? 161.972 174.424 194.917 1.00 43.55  ?  28   G   A "C5'" 1 
ATOM   596   C  "C4'" . G   A 1  28   ? 161.192 173.224 194.442 1.00 43.55  ?  28   G   A "C4'" 1 
ATOM   597   O  "O4'" . G   A 1  28   ? 162.105 172.203 193.962 1.00 43.55  ?  28   G   A "O4'" 1 
ATOM   598   C  "C3'" . G   A 1  28   ? 160.362 172.512 195.497 1.00 43.55  ?  28   G   A "C3'" 1 
ATOM   599   O  "O3'" . G   A 1  28   ? 159.118 173.146 195.741 1.00 43.55  ?  28   G   A "O3'" 1 
ATOM   600   C  "C2'" . G   A 1  28   ? 160.231 171.106 194.925 1.00 43.55  ?  28   G   A "C2'" 1 
ATOM   601   O  "O2'" . G   A 1  28   ? 159.233 171.066 193.916 1.00 43.55  ?  28   G   A "O2'" 1 
ATOM   602   C  "C1'" . G   A 1  28   ? 161.596 170.921 194.262 1.00 43.55  ?  28   G   A "C1'" 1 
ATOM   603   N  N9    . G   A 1  28   ? 162.555 170.227 195.143 1.00 43.55  ?  28   G   A N9    1 
ATOM   604   C  C8    . G   A 1  28   ? 163.630 170.780 195.797 1.00 43.55  ?  28   G   A C8    1 
ATOM   605   N  N7    . G   A 1  28   ? 164.303 169.915 196.505 1.00 43.55  ?  28   G   A N7    1 
ATOM   606   C  C5    . G   A 1  28   ? 163.634 168.716 196.308 1.00 43.55  ?  28   G   A C5    1 
ATOM   607   C  C6    . G   A 1  28   ? 163.900 167.419 196.821 1.00 43.55  ?  28   G   A C6    1 
ATOM   608   O  O6    . G   A 1  28   ? 164.808 167.061 197.581 1.00 43.55  ?  28   G   A O6    1 
ATOM   609   N  N1    . G   A 1  28   ? 162.970 166.489 196.369 1.00 43.55  ?  28   G   A N1    1 
ATOM   610   C  C2    . G   A 1  28   ? 161.921 166.766 195.528 1.00 43.55  ?  28   G   A C2    1 
ATOM   611   N  N2    . G   A 1  28   ? 161.132 165.731 195.204 1.00 43.55  ?  28   G   A N2    1 
ATOM   612   N  N3    . G   A 1  28   ? 161.663 167.969 195.041 1.00 43.55  ?  28   G   A N3    1 
ATOM   613   C  C4    . G   A 1  28   ? 162.553 168.890 195.469 1.00 43.55  ?  28   G   A C4    1 
ATOM   614   P  P     . G   A 1  29   ? 158.549 173.263 197.240 1.00 48.15  ?  29   G   A P     1 
ATOM   615   O  OP1   . G   A 1  29   ? 157.399 174.202 197.222 1.00 48.15  ?  29   G   A OP1   1 
ATOM   616   O  OP2   . G   A 1  29   ? 159.693 173.522 198.151 1.00 48.15  ?  29   G   A OP2   1 
ATOM   617   O  "O5'" . G   A 1  29   ? 157.988 171.806 197.552 1.00 48.15  ?  29   G   A "O5'" 1 
ATOM   618   C  "C5'" . G   A 1  29   ? 156.958 171.238 196.757 1.00 48.15  ?  29   G   A "C5'" 1 
ATOM   619   C  "C4'" . G   A 1  29   ? 156.834 169.754 196.993 1.00 48.15  ?  29   G   A "C4'" 1 
ATOM   620   O  "O4'" . G   A 1  29   ? 158.041 169.080 196.551 1.00 48.15  ?  29   G   A "O4'" 1 
ATOM   621   C  "C3'" . G   A 1  29   ? 156.683 169.322 198.442 1.00 48.15  ?  29   G   A "C3'" 1 
ATOM   622   O  "O3'" . G   A 1  29   ? 155.358 169.460 198.925 1.00 48.15  ?  29   G   A "O3'" 1 
ATOM   623   C  "C2'" . G   A 1  29   ? 157.178 167.882 198.413 1.00 48.15  ?  29   G   A "C2'" 1 
ATOM   624   O  "O2'" . G   A 1  29   ? 156.174 167.013 197.914 1.00 48.15  ?  29   G   A "O2'" 1 
ATOM   625   C  "C1'" . G   A 1  29   ? 158.303 167.967 197.381 1.00 48.15  ?  29   G   A "C1'" 1 
ATOM   626   N  N9    . G   A 1  29   ? 159.620 168.146 198.019 1.00 48.15  ?  29   G   A N9    1 
ATOM   627   C  C8    . G   A 1  29   ? 160.373 169.294 198.070 1.00 48.15  ?  29   G   A C8    1 
ATOM   628   N  N7    . G   A 1  29   ? 161.499 169.138 198.710 1.00 48.15  ?  29   G   A N7    1 
ATOM   629   C  C5    . G   A 1  29   ? 161.489 167.808 199.108 1.00 48.15  ?  29   G   A C5    1 
ATOM   630   C  C6    . G   A 1  29   ? 162.449 167.058 199.837 1.00 48.15  ?  29   G   A C6    1 
ATOM   631   O  O6    . G   A 1  29   ? 163.534 167.434 200.294 1.00 48.15  ?  29   G   A O6    1 
ATOM   632   N  N1    . G   A 1  29   ? 162.040 165.741 200.020 1.00 48.15  ?  29   G   A N1    1 
ATOM   633   C  C2    . G   A 1  29   ? 160.861 165.210 199.560 1.00 48.15  ?  29   G   A C2    1 
ATOM   634   N  N2    . G   A 1  29   ? 160.646 163.916 199.838 1.00 48.15  ?  29   G   A N2    1 
ATOM   635   N  N3    . G   A 1  29   ? 159.960 165.898 198.877 1.00 48.15  ?  29   G   A N3    1 
ATOM   636   C  C4    . G   A 1  29   ? 160.336 167.181 198.688 1.00 48.15  ?  29   G   A C4    1 
ATOM   637   P  P     . C   A 1  30   ? 155.090 170.058 200.392 1.00 51.79  ?  30   C   A P     1 
ATOM   638   O  OP1   . C   A 1  30   ? 153.627 170.266 200.544 1.00 51.79  ?  30   C   A OP1   1 
ATOM   639   O  OP2   . C   A 1  30   ? 156.018 171.198 200.602 1.00 51.79  ?  30   C   A OP2   1 
ATOM   640   O  "O5'" . C   A 1  30   ? 155.523 168.880 201.373 1.00 51.79  ?  30   C   A "O5'" 1 
ATOM   641   C  "C5'" . C   A 1  30   ? 154.871 167.620 201.330 1.00 51.79  ?  30   C   A "C5'" 1 
ATOM   642   C  "C4'" . C   A 1  30   ? 155.675 166.558 202.037 1.00 51.79  ?  30   C   A "C4'" 1 
ATOM   643   O  "O4'" . C   A 1  30   ? 156.960 166.393 201.380 1.00 51.79  ?  30   C   A "O4'" 1 
ATOM   644   C  "C3'" . C   A 1  30   ? 156.044 166.857 203.480 1.00 51.79  ?  30   C   A "C3'" 1 
ATOM   645   O  "O3'" . C   A 1  30   ? 154.985 166.631 204.391 1.00 51.79  ?  30   C   A "O3'" 1 
ATOM   646   C  "C2'" . C   A 1  30   ? 157.259 165.965 203.699 1.00 51.79  ?  30   C   A "C2'" 1 
ATOM   647   O  "O2'" . C   A 1  30   ? 156.861 164.618 203.898 1.00 51.79  ?  30   C   A "O2'" 1 
ATOM   648   C  "C1'" . C   A 1  30   ? 157.949 166.059 202.334 1.00 51.79  ?  30   C   A "C1'" 1 
ATOM   649   N  N1    . C   A 1  30   ? 159.025 167.083 202.308 1.00 51.79  ?  30   C   A N1    1 
ATOM   650   C  C2    . C   A 1  30   ? 160.291 166.742 202.805 1.00 51.79  ?  30   C   A C2    1 
ATOM   651   O  O2    . C   A 1  30   ? 160.489 165.601 203.251 1.00 51.79  ?  30   C   A O2    1 
ATOM   652   N  N3    . C   A 1  30   ? 161.283 167.663 202.790 1.00 51.79  ?  30   C   A N3    1 
ATOM   653   C  C4    . C   A 1  30   ? 161.060 168.885 202.306 1.00 51.79  ?  30   C   A C4    1 
ATOM   654   N  N4    . C   A 1  30   ? 162.072 169.755 202.313 1.00 51.79  ?  30   C   A N4    1 
ATOM   655   C  C5    . C   A 1  30   ? 159.789 169.266 201.792 1.00 51.79  ?  30   C   A C5    1 
ATOM   656   C  C6    . C   A 1  30   ? 158.819 168.344 201.809 1.00 51.79  ?  30   C   A C6    1 
ATOM   657   P  P     . C   A 1  31   ? 154.171 167.884 204.981 1.00 58.67  ?  31   C   A P     1 
ATOM   658   O  OP1   . C   A 1  31   ? 154.798 169.122 204.451 1.00 58.67  ?  31   C   A OP1   1 
ATOM   659   O  OP2   . C   A 1  31   ? 154.034 167.704 206.447 1.00 58.67  ?  31   C   A OP2   1 
ATOM   660   O  "O5'" . C   A 1  31   ? 152.729 167.750 204.321 1.00 58.67  ?  31   C   A "O5'" 1 
ATOM   661   C  "C5'" . C   A 1  31   ? 151.893 168.889 204.148 1.00 58.67  ?  31   C   A "C5'" 1 
ATOM   662   C  "C4'" . C   A 1  31   ? 150.434 168.540 204.312 1.00 58.67  ?  31   C   A "C4'" 1 
ATOM   663   O  "O4'" . C   A 1  31   ? 150.199 167.216 203.760 1.00 58.67  ?  31   C   A "O4'" 1 
ATOM   664   C  "C3'" . C   A 1  31   ? 149.932 168.495 205.754 1.00 58.67  ?  31   C   A "C3'" 1 
ATOM   665   O  "O3'" . C   A 1  31   ? 148.574 168.931 205.797 1.00 58.67  ?  31   C   A "O3'" 1 
ATOM   666   C  "C2'" . C   A 1  31   ? 150.001 167.009 206.090 1.00 58.67  ?  31   C   A "C2'" 1 
ATOM   667   O  "O2'" . C   A 1  31   ? 149.126 166.597 207.119 1.00 58.67  ?  31   C   A "O2'" 1 
ATOM   668   C  "C1'" . C   A 1  31   ? 149.638 166.376 204.751 1.00 58.67  ?  31   C   A "C1'" 1 
ATOM   669   N  N1    . C   A 1  31   ? 150.174 165.020 204.561 1.00 58.67  ?  31   C   A N1    1 
ATOM   670   C  C2    . C   A 1  31   ? 149.290 163.992 204.226 1.00 58.67  ?  31   C   A C2    1 
ATOM   671   O  O2    . C   A 1  31   ? 148.086 164.257 204.097 1.00 58.67  ?  31   C   A O2    1 
ATOM   672   N  N3    . C   A 1  31   ? 149.770 162.740 204.048 1.00 58.67  ?  31   C   A N3    1 
ATOM   673   C  C4    . C   A 1  31   ? 151.073 162.498 204.196 1.00 58.67  ?  31   C   A C4    1 
ATOM   674   N  N4    . C   A 1  31   ? 151.502 161.248 204.011 1.00 58.67  ?  31   C   A N4    1 
ATOM   675   C  C5    . C   A 1  31   ? 151.997 163.528 204.539 1.00 58.67  ?  31   C   A C5    1 
ATOM   676   C  C6    . C   A 1  31   ? 151.508 164.762 204.711 1.00 58.67  ?  31   C   A C6    1 
ATOM   677   P  P     . A   A 1  32   ? 148.217 170.425 206.270 1.00 73.06  ?  32   A   A P     1 
ATOM   678   O  OP1   . A   A 1  32   ? 146.741 170.578 206.222 1.00 73.06  ?  32   A   A OP1   1 
ATOM   679   O  OP2   . A   A 1  32   ? 149.075 171.375 205.518 1.00 73.06  ?  32   A   A OP2   1 
ATOM   680   O  "O5'" . A   A 1  32   ? 148.666 170.462 207.798 1.00 73.06  ?  32   A   A "O5'" 1 
ATOM   681   C  "C5'" . A   A 1  32   ? 148.012 169.655 208.766 1.00 73.06  ?  32   A   A "C5'" 1 
ATOM   682   C  "C4'" . A   A 1  32   ? 148.508 169.945 210.159 1.00 73.06  ?  32   A   A "C4'" 1 
ATOM   683   O  "O4'" . A   A 1  32   ? 148.278 171.338 210.484 1.00 73.06  ?  32   A   A "O4'" 1 
ATOM   684   C  "C3'" . A   A 1  32   ? 147.817 169.187 211.281 1.00 73.06  ?  32   A   A "C3'" 1 
ATOM   685   O  "O3'" . A   A 1  32   ? 148.310 167.867 211.434 1.00 73.06  ?  32   A   A "O3'" 1 
ATOM   686   C  "C2'" . A   A 1  32   ? 148.070 170.078 212.493 1.00 73.06  ?  32   A   A "C2'" 1 
ATOM   687   O  "O2'" . A   A 1  32   ? 149.372 169.863 213.016 1.00 73.06  ?  32   A   A "O2'" 1 
ATOM   688   C  "C1'" . A   A 1  32   ? 148.027 171.475 211.867 1.00 73.06  ?  32   A   A "C1'" 1 
ATOM   689   N  N9    . A   A 1  32   ? 146.723 172.137 212.062 1.00 73.06  ?  32   A   A N9    1 
ATOM   690   C  C8    . A   A 1  32   ? 145.589 172.034 211.294 1.00 73.06  ?  32   A   A C8    1 
ATOM   691   N  N7    . A   A 1  32   ? 144.584 172.751 211.734 1.00 73.06  ?  32   A   A N7    1 
ATOM   692   C  C5    . A   A 1  32   ? 145.089 173.365 212.871 1.00 73.06  ?  32   A   A C5    1 
ATOM   693   C  C6    . A   A 1  32   ? 144.528 174.259 213.802 1.00 73.06  ?  32   A   A C6    1 
ATOM   694   N  N6    . A   A 1  32   ? 143.273 174.704 213.729 1.00 73.06  ?  32   A   A N6    1 
ATOM   695   N  N1    . A   A 1  32   ? 145.305 174.682 214.826 1.00 73.06  ?  32   A   A N1    1 
ATOM   696   C  C2    . A   A 1  32   ? 146.566 174.238 214.907 1.00 73.06  ?  32   A   A C2    1 
ATOM   697   N  N3    . A   A 1  32   ? 147.205 173.400 214.092 1.00 73.06  ?  32   A   A N3    1 
ATOM   698   C  C4    . A   A 1  32   ? 146.404 172.995 213.087 1.00 73.06  ?  32   A   A C4    1 
ATOM   699   P  P     . C   A 1  33   ? 147.378 166.603 211.086 1.00 79.57  ?  33   C   A P     1 
ATOM   700   O  OP1   . C   A 1  33   ? 148.219 165.382 211.167 1.00 79.57  ?  33   C   A OP1   1 
ATOM   701   O  OP2   . C   A 1  33   ? 146.617 166.885 209.843 1.00 79.57  ?  33   C   A OP2   1 
ATOM   702   O  "O5'" . C   A 1  33   ? 146.330 166.556 212.281 1.00 79.57  ?  33   C   A "O5'" 1 
ATOM   703   C  "C5'" . C   A 1  33   ? 146.740 166.235 213.601 1.00 79.57  ?  33   C   A "C5'" 1 
ATOM   704   C  "C4'" . C   A 1  33   ? 145.591 165.688 214.405 1.00 79.57  ?  33   C   A "C4'" 1 
ATOM   705   O  "O4'" . C   A 1  33   ? 144.530 166.677 214.467 1.00 79.57  ?  33   C   A "O4'" 1 
ATOM   706   C  "C3'" . C   A 1  33   ? 144.912 164.454 213.831 1.00 79.57  ?  33   C   A "C3'" 1 
ATOM   707   O  "O3'" . C   A 1  33   ? 145.603 163.255 214.133 1.00 79.57  ?  33   C   A "O3'" 1 
ATOM   708   C  "C2'" . C   A 1  33   ? 143.518 164.526 214.441 1.00 79.57  ?  33   C   A "C2'" 1 
ATOM   709   O  "O2'" . C   A 1  33   ? 143.535 164.056 215.781 1.00 79.57  ?  33   C   A "O2'" 1 
ATOM   710   C  "C1'" . C   A 1  33   ? 143.271 166.037 214.465 1.00 79.57  ?  33   C   A "C1'" 1 
ATOM   711   N  N1    . C   A 1  33   ? 142.488 166.511 213.296 1.00 79.57  ?  33   C   A N1    1 
ATOM   712   C  C2    . C   A 1  33   ? 141.093 166.376 213.311 1.00 79.57  ?  33   C   A C2    1 
ATOM   713   O  O2    . C   A 1  33   ? 140.532 165.859 214.289 1.00 79.57  ?  33   C   A O2    1 
ATOM   714   N  N3    . C   A 1  33   ? 140.377 166.814 212.252 1.00 79.57  ?  33   C   A N3    1 
ATOM   715   C  C4    . C   A 1  33   ? 140.983 167.369 211.204 1.00 79.57  ?  33   C   A C4    1 
ATOM   716   N  N4    . C   A 1  33   ? 140.224 167.781 210.186 1.00 79.57  ?  33   C   A N4    1 
ATOM   717   C  C5    . C   A 1  33   ? 142.396 167.526 211.155 1.00 79.57  ?  33   C   A C5    1 
ATOM   718   C  C6    . C   A 1  33   ? 143.094 167.092 212.211 1.00 79.57  ?  33   C   A C6    1 
ATOM   719   P  P     . G   A 1  34   ? 145.525 161.988 213.146 1.00 121.58 ?  34   G   A P     1 
ATOM   720   O  OP1   . G   A 1  34   ? 146.897 161.731 212.640 1.00 121.58 ?  34   G   A OP1   1 
ATOM   721   O  OP2   . G   A 1  34   ? 144.417 162.196 212.179 1.00 121.58 ?  34   G   A OP2   1 
ATOM   722   O  "O5'" . G   A 1  34   ? 145.127 160.783 214.109 1.00 121.58 ?  34   G   A "O5'" 1 
ATOM   723   C  "C5'" . G   A 1  34   ? 143.956 160.851 214.917 1.00 121.58 ?  34   G   A "C5'" 1 
ATOM   724   C  "C4'" . G   A 1  34   ? 143.795 159.629 215.786 1.00 121.58 ?  34   G   A "C4'" 1 
ATOM   725   O  "O4'" . G   A 1  34   ? 144.738 159.695 216.892 1.00 121.58 ?  34   G   A "O4'" 1 
ATOM   726   C  "C3'" . G   A 1  34   ? 142.410 159.459 216.414 1.00 121.58 ?  34   G   A "C3'" 1 
ATOM   727   O  "O3'" . G   A 1  34   ? 142.072 158.074 216.468 1.00 121.58 ?  34   G   A "O3'" 1 
ATOM   728   C  "C2'" . G   A 1  34   ? 142.611 159.990 217.829 1.00 121.58 ?  34   G   A "C2'" 1 
ATOM   729   O  "O2'" . G   A 1  34   ? 141.706 159.477 218.784 1.00 121.58 ?  34   G   A "O2'" 1 
ATOM   730   C  "C1'" . G   A 1  34   ? 144.043 159.554 218.116 1.00 121.58 ?  34   G   A "C1'" 1 
ATOM   731   N  N9    . G   A 1  34   ? 144.714 160.352 219.148 1.00 121.58 ?  34   G   A N9    1 
ATOM   732   C  C8    . G   A 1  34   ? 144.279 161.542 219.677 1.00 121.58 ?  34   G   A C8    1 
ATOM   733   N  N7    . G   A 1  34   ? 145.074 162.022 220.596 1.00 121.58 ?  34   G   A N7    1 
ATOM   734   C  C5    . G   A 1  34   ? 146.094 161.086 220.687 1.00 121.58 ?  34   G   A C5    1 
ATOM   735   C  C6    . G   A 1  34   ? 147.247 161.061 221.516 1.00 121.58 ?  34   G   A C6    1 
ATOM   736   O  O6    . G   A 1  34   ? 147.611 161.889 222.359 1.00 121.58 ?  34   G   A O6    1 
ATOM   737   N  N1    . G   A 1  34   ? 148.020 159.928 221.279 1.00 121.58 ?  34   G   A N1    1 
ATOM   738   C  C2    . G   A 1  34   ? 147.723 158.943 220.369 1.00 121.58 ?  34   G   A C2    1 
ATOM   739   N  N2    . G   A 1  34   ? 148.592 157.926 220.290 1.00 121.58 ?  34   G   A N2    1 
ATOM   740   N  N3    . G   A 1  34   ? 146.651 158.954 219.593 1.00 121.58 ?  34   G   A N3    1 
ATOM   741   C  C4    . G   A 1  34   ? 145.889 160.050 219.799 1.00 121.58 ?  34   G   A C4    1 
ATOM   742   P  P     . A   A 1  35   ? 140.722 157.548 215.772 1.00 116.67 ?  35   A   A P     1 
ATOM   743   O  OP1   . A   A 1  35   ? 140.669 156.073 215.927 1.00 116.67 ?  35   A   A OP1   1 
ATOM   744   O  OP2   . A   A 1  35   ? 140.647 158.147 214.415 1.00 116.67 ?  35   A   A OP2   1 
ATOM   745   O  "O5'" . A   A 1  35   ? 139.560 158.186 216.655 1.00 116.67 ?  35   A   A "O5'" 1 
ATOM   746   C  "C5'" . A   A 1  35   ? 138.228 158.262 216.167 1.00 116.67 ?  35   A   A "C5'" 1 
ATOM   747   C  "C4'" . A   A 1  35   ? 137.520 159.495 216.672 1.00 116.67 ?  35   A   A "C4'" 1 
ATOM   748   O  "O4'" . A   A 1  35   ? 136.183 159.560 216.107 1.00 116.67 ?  35   A   A "O4'" 1 
ATOM   749   C  "C3'" . A   A 1  35   ? 137.287 159.564 218.174 1.00 116.67 ?  35   A   A "C3'" 1 
ATOM   750   O  "O3'" . A   A 1  35   ? 138.426 160.001 218.895 1.00 116.67 ?  35   A   A "O3'" 1 
ATOM   751   C  "C2'" . A   A 1  35   ? 136.099 160.509 218.281 1.00 116.67 ?  35   A   A "C2'" 1 
ATOM   752   O  "O2'" . A   A 1  35   ? 136.512 161.857 218.116 1.00 116.67 ?  35   A   A "O2'" 1 
ATOM   753   C  "C1'" . A   A 1  35   ? 135.284 160.101 217.054 1.00 116.67 ?  35   A   A "C1'" 1 
ATOM   754   N  N9    . A   A 1  35   ? 134.277 159.073 217.380 1.00 116.67 ?  35   A   A N9    1 
ATOM   755   C  C8    . A   A 1  35   ? 134.286 157.755 216.995 1.00 116.67 ?  35   A   A C8    1 
ATOM   756   N  N7    . A   A 1  35   ? 133.260 157.068 217.432 1.00 116.67 ?  35   A   A N7    1 
ATOM   757   C  C5    . A   A 1  35   ? 132.524 157.996 218.155 1.00 116.67 ?  35   A   A C5    1 
ATOM   758   C  C6    . A   A 1  35   ? 131.318 157.900 218.874 1.00 116.67 ?  35   A   A C6    1 
ATOM   759   N  N6    . A   A 1  35   ? 130.613 156.772 218.985 1.00 116.67 ?  35   A   A N6    1 
ATOM   760   N  N1    . A   A 1  35   ? 130.852 159.015 219.483 1.00 116.67 ?  35   A   A N1    1 
ATOM   761   C  C2    . A   A 1  35   ? 131.553 160.152 219.377 1.00 116.67 ?  35   A   A C2    1 
ATOM   762   N  N3    . A   A 1  35   ? 132.698 160.364 218.729 1.00 116.67 ?  35   A   A N3    1 
ATOM   763   C  C4    . A   A 1  35   ? 133.137 159.238 218.133 1.00 116.67 ?  35   A   A C4    1 
ATOM   764   P  P     . G   A 1  36   ? 138.767 159.357 220.327 1.00 139.95 ?  36   G   A P     1 
ATOM   765   O  OP1   . G   A 1  36   ? 139.820 158.329 220.130 1.00 139.95 ?  36   G   A OP1   1 
ATOM   766   O  OP2   . G   A 1  36   ? 137.489 158.981 220.983 1.00 139.95 ?  36   G   A OP2   1 
ATOM   767   O  "O5'" . G   A 1  36   ? 139.401 160.563 221.151 1.00 139.95 ?  36   G   A "O5'" 1 
ATOM   768   C  "C5'" . G   A 1  36   ? 138.577 161.576 221.721 1.00 139.95 ?  36   G   A "C5'" 1 
ATOM   769   C  "C4'" . G   A 1  36   ? 139.035 161.968 223.108 1.00 139.95 ?  36   G   A "C4'" 1 
ATOM   770   O  "O4'" . G   A 1  36   ? 139.307 160.766 223.881 1.00 139.95 ?  36   G   A "O4'" 1 
ATOM   771   C  "C3'" . G   A 1  36   ? 140.306 162.814 223.174 1.00 139.95 ?  36   G   A "C3'" 1 
ATOM   772   O  "O3'" . G   A 1  36   ? 140.219 163.707 224.283 1.00 139.95 ?  36   G   A "O3'" 1 
ATOM   773   C  "C2'" . G   A 1  36   ? 141.387 161.774 223.451 1.00 139.95 ?  36   G   A "C2'" 1 
ATOM   774   O  "O2'" . G   A 1  36   ? 142.547 162.282 224.078 1.00 139.95 ?  36   G   A "O2'" 1 
ATOM   775   C  "C1'" . G   A 1  36   ? 140.643 160.791 224.350 1.00 139.95 ?  36   G   A "C1'" 1 
ATOM   776   N  N9    . G   A 1  36   ? 141.170 159.426 224.298 1.00 139.95 ?  36   G   A N9    1 
ATOM   777   C  C8    . G   A 1  36   ? 140.656 158.363 223.597 1.00 139.95 ?  36   G   A C8    1 
ATOM   778   N  N7    . G   A 1  36   ? 141.345 157.266 223.755 1.00 139.95 ?  36   G   A N7    1 
ATOM   779   C  C5    . G   A 1  36   ? 142.369 157.626 224.621 1.00 139.95 ?  36   G   A C5    1 
ATOM   780   C  C6    . G   A 1  36   ? 143.438 156.858 225.149 1.00 139.95 ?  36   G   A C6    1 
ATOM   781   O  O6    . G   A 1  36   ? 143.692 155.662 224.962 1.00 139.95 ?  36   G   A O6    1 
ATOM   782   N  N1    . G   A 1  36   ? 144.250 157.619 225.984 1.00 139.95 ?  36   G   A N1    1 
ATOM   783   C  C2    . G   A 1  36   ? 144.066 158.951 226.267 1.00 139.95 ?  36   G   A C2    1 
ATOM   784   N  N2    . G   A 1  36   ? 144.960 159.509 227.095 1.00 139.95 ?  36   G   A N2    1 
ATOM   785   N  N3    . G   A 1  36   ? 143.078 159.679 225.776 1.00 139.95 ?  36   G   A N3    1 
ATOM   786   C  C4    . G   A 1  36   ? 142.273 158.956 224.968 1.00 139.95 ?  36   G   A C4    1 
ATOM   787   P  P     . C   A 1  37   ? 140.915 165.154 224.219 1.00 107.79 ?  37   C   A P     1 
ATOM   788   O  OP1   . C   A 1  37   ? 140.838 165.643 222.819 1.00 107.79 ?  37   C   A OP1   1 
ATOM   789   O  OP2   . C   A 1  37   ? 142.235 165.060 224.892 1.00 107.79 ?  37   C   A OP2   1 
ATOM   790   O  "O5'" . C   A 1  37   ? 139.968 166.070 225.114 1.00 107.79 ?  37   C   A "O5'" 1 
ATOM   791   C  "C5'" . C   A 1  37   ? 139.265 165.525 226.226 1.00 107.79 ?  37   C   A "C5'" 1 
ATOM   792   C  "C4'" . C   A 1  37   ? 138.007 166.300 226.544 1.00 107.79 ?  37   C   A "C4'" 1 
ATOM   793   O  "O4'" . C   A 1  37   ? 138.331 167.712 226.672 1.00 107.79 ?  37   C   A "O4'" 1 
ATOM   794   C  "C3'" . C   A 1  37   ? 136.887 166.210 225.507 1.00 107.79 ?  37   C   A "C3'" 1 
ATOM   795   O  "O3'" . C   A 1  37   ? 135.624 166.215 226.169 1.00 107.79 ?  37   C   A "O3'" 1 
ATOM   796   C  "C2'" . C   A 1  37   ? 137.047 167.505 224.717 1.00 107.79 ?  37   C   A "C2'" 1 
ATOM   797   O  "O2'" . C   A 1  37   ? 135.868 167.958 224.087 1.00 107.79 ?  37   C   A "O2'" 1 
ATOM   798   C  "C1'" . C   A 1  37   ? 137.518 168.472 225.799 1.00 107.79 ?  37   C   A "C1'" 1 
ATOM   799   N  N1    . C   A 1  37   ? 138.324 169.584 225.280 1.00 107.79 ?  37   C   A N1    1 
ATOM   800   C  C2    . C   A 1  37   ? 137.885 170.895 225.476 1.00 107.79 ?  37   C   A C2    1 
ATOM   801   O  O2    . C   A 1  37   ? 136.823 171.088 226.088 1.00 107.79 ?  37   C   A O2    1 
ATOM   802   N  N3    . C   A 1  37   ? 138.626 171.917 224.989 1.00 107.79 ?  37   C   A N3    1 
ATOM   803   C  C4    . C   A 1  37   ? 139.760 171.663 224.334 1.00 107.79 ?  37   C   A C4    1 
ATOM   804   N  N4    . C   A 1  37   ? 140.461 172.699 223.871 1.00 107.79 ?  37   C   A N4    1 
ATOM   805   C  C5    . C   A 1  37   ? 140.230 170.335 224.122 1.00 107.79 ?  37   C   A C5    1 
ATOM   806   C  C6    . C   A 1  37   ? 139.485 169.336 224.605 1.00 107.79 ?  37   C   A C6    1 
ATOM   807   P  P     . U   A 1  38   ? 134.487 165.159 225.753 1.00 131.17 ?  38   U   A P     1 
ATOM   808   O  OP1   . U   A 1  38   ? 135.157 163.942 225.228 1.00 131.17 ?  38   U   A OP1   1 
ATOM   809   O  OP2   . U   A 1  38   ? 133.485 165.866 224.916 1.00 131.17 ?  38   U   A OP2   1 
ATOM   810   O  "O5'" . U   A 1  38   ? 133.796 164.781 227.136 1.00 131.17 ?  38   U   A "O5'" 1 
ATOM   811   C  "C5'" . U   A 1  38   ? 133.665 165.749 228.172 1.00 131.17 ?  38   U   A "C5'" 1 
ATOM   812   C  "C4'" . U   A 1  38   ? 134.601 165.462 229.320 1.00 131.17 ?  38   U   A "C4'" 1 
ATOM   813   O  "O4'" . U   A 1  38   ? 134.587 166.588 230.241 1.00 131.17 ?  38   U   A "O4'" 1 
ATOM   814   C  "C3'" . U   A 1  38   ? 134.254 164.228 230.149 1.00 131.17 ?  38   U   A "C3'" 1 
ATOM   815   O  "O3'" . U   A 1  38   ? 135.458 163.618 230.616 1.00 131.17 ?  38   U   A "O3'" 1 
ATOM   816   C  "C2'" . U   A 1  38   ? 133.487 164.823 231.326 1.00 131.17 ?  38   U   A "C2'" 1 
ATOM   817   O  "O2'" . U   A 1  38   ? 133.490 164.029 232.493 1.00 131.17 ?  38   U   A "O2'" 1 
ATOM   818   C  "C1'" . U   A 1  38   ? 134.223 166.143 231.533 1.00 131.17 ?  38   U   A "C1'" 1 
ATOM   819   N  N1    . U   A 1  38   ? 133.407 167.190 232.166 1.00 131.17 ?  38   U   A N1    1 
ATOM   820   C  C2    . U   A 1  38   ? 133.836 167.694 233.378 1.00 131.17 ?  38   U   A C2    1 
ATOM   821   O  O2    . U   A 1  38   ? 134.850 167.307 233.933 1.00 131.17 ?  38   U   A O2    1 
ATOM   822   N  N3    . U   A 1  38   ? 133.033 168.668 233.918 1.00 131.17 ?  38   U   A N3    1 
ATOM   823   C  C4    . U   A 1  38   ? 131.869 169.178 233.378 1.00 131.17 ?  38   U   A C4    1 
ATOM   824   O  O4    . U   A 1  38   ? 131.254 170.056 233.984 1.00 131.17 ?  38   U   A O4    1 
ATOM   825   C  C5    . U   A 1  38   ? 131.493 168.604 232.121 1.00 131.17 ?  38   U   A C5    1 
ATOM   826   C  C6    . U   A 1  38   ? 132.256 167.653 231.572 1.00 131.17 ?  38   U   A C6    1 
ATOM   827   P  P     . G   A 1  39   ? 135.609 162.017 230.615 1.00 150.03 ?  39   G   A P     1 
ATOM   828   O  OP1   . G   A 1  39   ? 134.279 161.432 230.309 1.00 150.03 ?  39   G   A OP1   1 
ATOM   829   O  OP2   . G   A 1  39   ? 136.316 161.621 231.859 1.00 150.03 ?  39   G   A OP2   1 
ATOM   830   O  "O5'" . G   A 1  39   ? 136.578 161.711 229.387 1.00 150.03 ?  39   G   A "O5'" 1 
ATOM   831   C  "C5'" . G   A 1  39   ? 136.097 161.754 228.051 1.00 150.03 ?  39   G   A "C5'" 1 
ATOM   832   C  "C4'" . G   A 1  39   ? 136.246 160.423 227.357 1.00 150.03 ?  39   G   A "C4'" 1 
ATOM   833   O  "O4'" . G   A 1  39   ? 137.542 160.336 226.710 1.00 150.03 ?  39   G   A "O4'" 1 
ATOM   834   C  "C3'" . G   A 1  39   ? 136.199 159.189 228.243 1.00 150.03 ?  39   G   A "C3'" 1 
ATOM   835   O  "O3'" . G   A 1  39   ? 134.885 158.816 228.620 1.00 150.03 ?  39   G   A "O3'" 1 
ATOM   836   C  "C2'" . G   A 1  39   ? 136.909 158.149 227.388 1.00 150.03 ?  39   G   A "C2'" 1 
ATOM   837   O  "O2'" . G   A 1  39   ? 136.046 157.658 226.374 1.00 150.03 ?  39   G   A "O2'" 1 
ATOM   838   C  "C1'" . G   A 1  39   ? 137.997 158.998 226.728 1.00 150.03 ?  39   G   A "C1'" 1 
ATOM   839   N  N9    . G   A 1  39   ? 139.268 158.937 227.474 1.00 150.03 ?  39   G   A N9    1 
ATOM   840   C  C8    . G   A 1  39   ? 139.828 159.923 228.250 1.00 150.03 ?  39   G   A C8    1 
ATOM   841   N  N7    . G   A 1  39   ? 140.963 159.568 228.788 1.00 150.03 ?  39   G   A N7    1 
ATOM   842   C  C5    . G   A 1  39   ? 141.164 158.268 228.343 1.00 150.03 ?  39   G   A C5    1 
ATOM   843   C  C6    . G   A 1  39   ? 142.226 157.361 228.597 1.00 150.03 ?  39   G   A C6    1 
ATOM   844   O  O6    . G   A 1  39   ? 143.237 157.533 229.288 1.00 150.03 ?  39   G   A O6    1 
ATOM   845   N  N1    . G   A 1  39   ? 142.031 156.148 227.945 1.00 150.03 ?  39   G   A N1    1 
ATOM   846   C  C2    . G   A 1  39   ? 140.953 155.841 227.151 1.00 150.03 ?  39   G   A C2    1 
ATOM   847   N  N2    . G   A 1  39   ? 140.945 154.615 226.609 1.00 150.03 ?  39   G   A N2    1 
ATOM   848   N  N3    . G   A 1  39   ? 139.957 156.677 226.907 1.00 150.03 ?  39   G   A N3    1 
ATOM   849   C  C4    . G   A 1  39   ? 140.126 157.864 227.530 1.00 150.03 ?  39   G   A C4    1 
ATOM   850   P  P     . A   A 1  40   ? 134.632 158.087 230.030 1.00 162.11 ?  40   A   A P     1 
ATOM   851   O  OP1   . A   A 1  40   ? 133.173 158.116 230.308 1.00 162.11 ?  40   A   A OP1   1 
ATOM   852   O  OP2   . A   A 1  40   ? 135.579 158.660 231.020 1.00 162.11 ?  40   A   A OP2   1 
ATOM   853   O  "O5'" . A   A 1  40   ? 135.054 156.573 229.765 1.00 162.11 ?  40   A   A "O5'" 1 
ATOM   854   C  "C5'" . A   A 1  40   ? 134.335 155.770 228.842 1.00 162.11 ?  40   A   A "C5'" 1 
ATOM   855   C  "C4'" . A   A 1  40   ? 135.062 154.486 228.528 1.00 162.11 ?  40   A   A "C4'" 1 
ATOM   856   O  "O4'" . A   A 1  40   ? 136.376 154.779 227.984 1.00 162.11 ?  40   A   A "O4'" 1 
ATOM   857   C  "C3'" . A   A 1  40   ? 135.353 153.568 229.704 1.00 162.11 ?  40   A   A "C3'" 1 
ATOM   858   O  "O3'" . A   A 1  40   ? 134.234 152.795 230.102 1.00 162.11 ?  40   A   A "O3'" 1 
ATOM   859   C  "C2'" . A   A 1  40   ? 136.517 152.735 229.187 1.00 162.11 ?  40   A   A "C2'" 1 
ATOM   860   O  "O2'" . A   A 1  40   ? 136.057 151.728 228.298 1.00 162.11 ?  40   A   A "O2'" 1 
ATOM   861   C  "C1'" . A   A 1  40   ? 137.291 153.776 228.377 1.00 162.11 ?  40   A   A "C1'" 1 
ATOM   862   N  N9    . A   A 1  40   ? 138.366 154.395 229.174 1.00 162.11 ?  40   A   A N9    1 
ATOM   863   C  C8    . A   A 1  40   ? 138.384 155.637 229.761 1.00 162.11 ?  40   A   A C8    1 
ATOM   864   N  N7    . A   A 1  40   ? 139.492 155.896 230.412 1.00 162.11 ?  40   A   A N7    1 
ATOM   865   C  C5    . A   A 1  40   ? 140.251 154.746 230.248 1.00 162.11 ?  40   A   A C5    1 
ATOM   866   C  C6    . A   A 1  40   ? 141.535 154.377 230.690 1.00 162.11 ?  40   A   A C6    1 
ATOM   867   N  N6    . A   A 1  40   ? 142.317 155.166 231.431 1.00 162.11 ?  40   A   A N6    1 
ATOM   868   N  N1    . A   A 1  40   ? 141.997 153.152 230.347 1.00 162.11 ?  40   A   A N1    1 
ATOM   869   C  C2    . A   A 1  40   ? 141.222 152.350 229.604 1.00 162.11 ?  40   A   A C2    1 
ATOM   870   N  N3    . A   A 1  40   ? 140.001 152.588 229.128 1.00 162.11 ?  40   A   A N3    1 
ATOM   871   C  C4    . A   A 1  40   ? 139.570 153.812 229.488 1.00 162.11 ?  40   A   A C4    1 
ATOM   872   P  P     . G   A 1  41   ? 134.024 152.421 231.652 1.00 170.48 ?  41   G   A P     1 
ATOM   873   O  OP1   . G   A 1  41   ? 132.675 151.818 231.800 1.00 170.48 ?  41   G   A OP1   1 
ATOM   874   O  OP2   . G   A 1  41   ? 134.391 153.609 232.464 1.00 170.48 ?  41   G   A OP2   1 
ATOM   875   O  "O5'" . G   A 1  41   ? 135.106 151.284 231.927 1.00 170.48 ?  41   G   A "O5'" 1 
ATOM   876   C  "C5'" . G   A 1  41   ? 135.010 150.017 231.292 1.00 170.48 ?  41   G   A "C5'" 1 
ATOM   877   C  "C4'" . G   A 1  41   ? 136.281 149.218 231.441 1.00 170.48 ?  41   G   A "C4'" 1 
ATOM   878   O  "O4'" . G   A 1  41   ? 137.402 149.966 230.901 1.00 170.48 ?  41   G   A "O4'" 1 
ATOM   879   C  "C3'" . G   A 1  41   ? 136.709 148.895 232.864 1.00 170.48 ?  41   G   A "C3'" 1 
ATOM   880   O  "O3'" . G   A 1  41   ? 136.009 147.794 233.416 1.00 170.48 ?  41   G   A "O3'" 1 
ATOM   881   C  "C2'" . G   A 1  41   ? 138.205 148.653 232.711 1.00 170.48 ?  41   G   A "C2'" 1 
ATOM   882   O  "O2'" . G   A 1  41   ? 138.452 147.358 232.181 1.00 170.48 ?  41   G   A "O2'" 1 
ATOM   883   C  "C1'" . G   A 1  41   ? 138.570 149.687 231.645 1.00 170.48 ?  41   G   A "C1'" 1 
ATOM   884   N  N9    . G   A 1  41   ? 139.063 150.942 232.243 1.00 170.48 ?  41   G   A N9    1 
ATOM   885   C  C8    . G   A 1  41   ? 138.373 152.120 232.400 1.00 170.48 ?  41   G   A C8    1 
ATOM   886   N  N7    . G   A 1  41   ? 139.083 153.057 232.968 1.00 170.48 ?  41   G   A N7    1 
ATOM   887   C  C5    . G   A 1  41   ? 140.315 152.461 233.203 1.00 170.48 ?  41   G   A C5    1 
ATOM   888   C  C6    . G   A 1  41   ? 141.493 152.985 233.798 1.00 170.48 ?  41   G   A C6    1 
ATOM   889   O  O6    . G   A 1  41   ? 141.690 154.119 234.251 1.00 170.48 ?  41   G   A O6    1 
ATOM   890   N  N1    . G   A 1  41   ? 142.512 152.038 233.837 1.00 170.48 ?  41   G   A N1    1 
ATOM   891   C  C2    . G   A 1  41   ? 142.413 150.752 233.366 1.00 170.48 ?  41   G   A C2    1 
ATOM   892   N  N2    . G   A 1  41   ? 143.508 149.988 233.495 1.00 170.48 ?  41   G   A N2    1 
ATOM   893   N  N3    . G   A 1  41   ? 141.321 150.252 232.810 1.00 170.48 ?  41   G   A N3    1 
ATOM   894   C  C4    . G   A 1  41   ? 140.319 151.155 232.762 1.00 170.48 ?  41   G   A C4    1 
ATOM   895   P  P     . U   A 1  42   ? 135.684 147.751 234.990 1.00 182.91 ?  42   U   A P     1 
ATOM   896   O  OP1   . U   A 1  42   ? 134.687 146.676 235.224 1.00 182.91 ?  42   U   A OP1   1 
ATOM   897   O  OP2   . U   A 1  42   ? 135.387 149.137 235.435 1.00 182.91 ?  42   U   A OP2   1 
ATOM   898   O  "O5'" . U   A 1  42   ? 137.059 147.303 235.657 1.00 182.91 ?  42   U   A "O5'" 1 
ATOM   899   C  "C5'" . U   A 1  42   ? 137.636 146.040 235.360 1.00 182.91 ?  42   U   A "C5'" 1 
ATOM   900   C  "C4'" . U   A 1  42   ? 139.033 145.925 235.918 1.00 182.91 ?  42   U   A "C4'" 1 
ATOM   901   O  "O4'" . U   A 1  42   ? 139.886 146.935 235.320 1.00 182.91 ?  42   U   A "O4'" 1 
ATOM   902   C  "C3'" . U   A 1  42   ? 139.174 146.162 237.413 1.00 182.91 ?  42   U   A "C3'" 1 
ATOM   903   O  "O3'" . U   A 1  42   ? 138.828 145.026 238.186 1.00 182.91 ?  42   U   A "O3'" 1 
ATOM   904   C  "C2'" . U   A 1  42   ? 140.635 146.575 237.551 1.00 182.91 ?  42   U   A "C2'" 1 
ATOM   905   O  "O2'" . U   A 1  42   ? 141.482 145.436 237.539 1.00 182.91 ?  42   U   A "O2'" 1 
ATOM   906   C  "C1'" . U   A 1  42   ? 140.859 147.358 236.253 1.00 182.91 ?  42   U   A "C1'" 1 
ATOM   907   N  N1    . U   A 1  42   ? 140.748 148.826 236.439 1.00 182.91 ?  42   U   A N1    1 
ATOM   908   C  C2    . U   A 1  42   ? 141.863 149.502 236.907 1.00 182.91 ?  42   U   A C2    1 
ATOM   909   O  O2    . U   A 1  42   ? 142.918 148.951 237.175 1.00 182.91 ?  42   U   A O2    1 
ATOM   910   N  N3    . U   A 1  42   ? 141.704 150.858 237.054 1.00 182.91 ?  42   U   A N3    1 
ATOM   911   C  C4    . U   A 1  42   ? 140.571 151.599 236.787 1.00 182.91 ?  42   U   A C4    1 
ATOM   912   O  O4    . U   A 1  42   ? 140.585 152.817 236.972 1.00 182.91 ?  42   U   A O4    1 
ATOM   913   C  C5    . U   A 1  42   ? 139.463 150.835 236.304 1.00 182.91 ?  42   U   A C5    1 
ATOM   914   C  C6    . U   A 1  42   ? 139.589 149.513 236.148 1.00 182.91 ?  42   U   A C6    1 
ATOM   915   P  P     . G   A 1  43   ? 137.798 145.166 239.413 1.00 197.50 ?  43   G   A P     1 
ATOM   916   O  OP1   . G   A 1  43   ? 137.186 143.835 239.654 1.00 197.50 ?  43   G   A OP1   1 
ATOM   917   O  OP2   . G   A 1  43   ? 136.926 146.339 239.148 1.00 197.50 ?  43   G   A OP2   1 
ATOM   918   O  "O5'" . G   A 1  43   ? 138.727 145.514 240.659 1.00 197.50 ?  43   G   A "O5'" 1 
ATOM   919   C  "C5'" . G   A 1  43   ? 139.698 144.589 241.127 1.00 197.50 ?  43   G   A "C5'" 1 
ATOM   920   C  "C4'" . G   A 1  43   ? 140.759 145.273 241.951 1.00 197.50 ?  43   G   A "C4'" 1 
ATOM   921   O  "O4'" . G   A 1  43   ? 141.485 146.218 241.124 1.00 197.50 ?  43   G   A "O4'" 1 
ATOM   922   C  "C3'" . G   A 1  43   ? 140.258 146.107 243.120 1.00 197.50 ?  43   G   A "C3'" 1 
ATOM   923   O  "O3'" . G   A 1  43   ? 139.975 145.325 244.268 1.00 197.50 ?  43   G   A "O3'" 1 
ATOM   924   C  "C2'" . G   A 1  43   ? 141.386 147.112 243.325 1.00 197.50 ?  43   G   A "C2'" 1 
ATOM   925   O  "O2'" . G   A 1  43   ? 142.456 146.524 244.050 1.00 197.50 ?  43   G   A "O2'" 1 
ATOM   926   C  "C1'" . G   A 1  43   ? 141.850 147.349 241.886 1.00 197.50 ?  43   G   A "C1'" 1 
ATOM   927   N  N9    . G   A 1  43   ? 141.226 148.541 241.280 1.00 197.50 ?  43   G   A N9    1 
ATOM   928   C  C8    . G   A 1  43   ? 140.088 148.579 240.509 1.00 197.50 ?  43   G   A C8    1 
ATOM   929   N  N7    . G   A 1  43   ? 139.779 149.780 240.106 1.00 197.50 ?  43   G   A N7    1 
ATOM   930   C  C5    . G   A 1  43   ? 140.773 150.588 240.641 1.00 197.50 ?  43   G   A C5    1 
ATOM   931   C  C6    . G   A 1  43   ? 140.969 151.990 240.542 1.00 197.50 ?  43   G   A C6    1 
ATOM   932   O  O6    . G   A 1  43   ? 140.279 152.826 239.946 1.00 197.50 ?  43   G   A O6    1 
ATOM   933   N  N1    . G   A 1  43   ? 142.103 152.398 241.238 1.00 197.50 ?  43   G   A N1    1 
ATOM   934   C  C2    . G   A 1  43   ? 142.943 151.566 241.936 1.00 197.50 ?  43   G   A C2    1 
ATOM   935   N  N2    . G   A 1  43   ? 143.987 152.151 242.540 1.00 197.50 ?  43   G   A N2    1 
ATOM   936   N  N3    . G   A 1  43   ? 142.772 150.257 242.034 1.00 197.50 ?  43   G   A N3    1 
ATOM   937   C  C4    . G   A 1  43   ? 141.675 149.839 241.368 1.00 197.50 ?  43   G   A C4    1 
ATOM   938   P  P     . C   A 1  44   ? 139.023 145.899 245.429 1.00 209.78 ?  44   C   A P     1 
ATOM   939   O  OP1   . C   A 1  44   ? 138.284 144.757 246.024 1.00 209.78 ?  44   C   A OP1   1 
ATOM   940   O  OP2   . C   A 1  44   ? 138.268 147.053 244.878 1.00 209.78 ?  44   C   A OP2   1 
ATOM   941   O  "O5'" . C   A 1  44   ? 140.042 146.449 246.523 1.00 209.78 ?  44   C   A "O5'" 1 
ATOM   942   C  "C5'" . C   A 1  44   ? 139.621 147.377 247.512 1.00 209.78 ?  44   C   A "C5'" 1 
ATOM   943   C  "C4'" . C   A 1  44   ? 140.561 148.553 247.591 1.00 209.78 ?  44   C   A "C4'" 1 
ATOM   944   O  "O4'" . C   A 1  44   ? 140.990 148.917 246.253 1.00 209.78 ?  44   C   A "O4'" 1 
ATOM   945   C  "C3'" . C   A 1  44   ? 139.975 149.838 248.156 1.00 209.78 ?  44   C   A "C3'" 1 
ATOM   946   O  "O3'" . C   A 1  44   ? 139.951 149.861 249.573 1.00 209.78 ?  44   C   A "O3'" 1 
ATOM   947   C  "C2'" . C   A 1  44   ? 140.863 150.913 247.542 1.00 209.78 ?  44   C   A "C2'" 1 
ATOM   948   O  "O2'" . C   A 1  44   ? 142.083 151.028 248.261 1.00 209.78 ?  44   C   A "O2'" 1 
ATOM   949   C  "C1'" . C   A 1  44   ? 141.169 150.314 246.164 1.00 209.78 ?  44   C   A "C1'" 1 
ATOM   950   N  N1    . C   A 1  44   ? 140.290 150.847 245.092 1.00 209.78 ?  44   C   A N1    1 
ATOM   951   C  C2    . C   A 1  44   ? 140.626 152.064 244.487 1.00 209.78 ?  44   C   A C2    1 
ATOM   952   O  O2    . C   A 1  44   ? 141.639 152.674 244.861 1.00 209.78 ?  44   C   A O2    1 
ATOM   953   N  N3    . C   A 1  44   ? 139.835 152.559 243.507 1.00 209.78 ?  44   C   A N3    1 
ATOM   954   C  C4    . C   A 1  44   ? 138.750 151.892 243.114 1.00 209.78 ?  44   C   A C4    1 
ATOM   955   N  N4    . C   A 1  44   ? 138.005 152.422 242.142 1.00 209.78 ?  44   C   A N4    1 
ATOM   956   C  C5    . C   A 1  44   ? 138.383 150.649 243.702 1.00 209.78 ?  44   C   A C5    1 
ATOM   957   C  C6    . C   A 1  44   ? 139.174 150.172 244.670 1.00 209.78 ?  44   C   A C6    1 
ATOM   958   P  P     . G   A 1  45   ? 138.619 150.312 250.352 1.00 227.43 ?  45   G   A P     1 
ATOM   959   O  OP1   . G   A 1  45   ? 138.827 150.060 251.800 1.00 227.43 ?  45   G   A OP1   1 
ATOM   960   O  OP2   . G   A 1  45   ? 137.456 149.701 249.661 1.00 227.43 ?  45   G   A OP2   1 
ATOM   961   O  "O5'" . G   A 1  45   ? 138.554 151.889 250.132 1.00 227.43 ?  45   G   A "O5'" 1 
ATOM   962   C  "C5'" . G   A 1  45   ? 139.482 152.754 250.771 1.00 227.43 ?  45   G   A "C5'" 1 
ATOM   963   C  "C4'" . G   A 1  45   ? 139.417 154.152 250.208 1.00 227.43 ?  45   G   A "C4'" 1 
ATOM   964   O  "O4'" . G   A 1  45   ? 139.762 154.130 248.798 1.00 227.43 ?  45   G   A "O4'" 1 
ATOM   965   C  "C3'" . G   A 1  45   ? 138.054 154.826 250.244 1.00 227.43 ?  45   G   A "C3'" 1 
ATOM   966   O  "O3'" . G   A 1  45   ? 137.743 155.395 251.505 1.00 227.43 ?  45   G   A "O3'" 1 
ATOM   967   C  "C2'" . G   A 1  45   ? 138.164 155.855 249.129 1.00 227.43 ?  45   G   A "C2'" 1 
ATOM   968   O  "O2'" . G   A 1  45   ? 138.907 156.985 249.561 1.00 227.43 ?  45   G   A "O2'" 1 
ATOM   969   C  "C1'" . G   A 1  45   ? 139.000 155.094 248.100 1.00 227.43 ?  45   G   A "C1'" 1 
ATOM   970   N  N9    . G   A 1  45   ? 138.160 154.398 247.107 1.00 227.43 ?  45   G   A N9    1 
ATOM   971   C  C8    . G   A 1  45   ? 137.995 153.040 246.984 1.00 227.43 ?  45   G   A C8    1 
ATOM   972   N  N7    . G   A 1  45   ? 137.191 152.706 246.012 1.00 227.43 ?  45   G   A N7    1 
ATOM   973   C  C5    . G   A 1  45   ? 136.801 153.916 245.457 1.00 227.43 ?  45   G   A C5    1 
ATOM   974   C  C6    . G   A 1  45   ? 135.932 154.186 244.367 1.00 227.43 ?  45   G   A C6    1 
ATOM   975   O  O6    . G   A 1  45   ? 135.317 153.384 243.654 1.00 227.43 ?  45   G   A O6    1 
ATOM   976   N  N1    . G   A 1  45   ? 135.810 155.552 244.135 1.00 227.43 ?  45   G   A N1    1 
ATOM   977   C  C2    . G   A 1  45   ? 136.442 156.534 244.858 1.00 227.43 ?  45   G   A C2    1 
ATOM   978   N  N2    . G   A 1  45   ? 136.198 157.797 244.480 1.00 227.43 ?  45   G   A N2    1 
ATOM   979   N  N3    . G   A 1  45   ? 137.256 156.295 245.874 1.00 227.43 ?  45   G   A N3    1 
ATOM   980   C  C4    . G   A 1  45   ? 137.390 154.973 246.119 1.00 227.43 ?  45   G   A C4    1 
ATOM   981   P  P     . U   A 1  46   ? 136.350 155.056 252.235 1.00 242.63 ?  46   U   A P     1 
ATOM   982   O  OP1   . U   A 1  46   ? 136.130 156.075 253.293 1.00 242.63 ?  46   U   A OP1   1 
ATOM   983   O  OP2   . U   A 1  46   ? 136.361 153.616 252.596 1.00 242.63 ?  46   U   A OP2   1 
ATOM   984   O  "O5'" . U   A 1  46   ? 135.243 155.273 251.108 1.00 242.63 ?  46   U   A "O5'" 1 
ATOM   985   C  "C5'" . U   A 1  46   ? 134.821 156.576 250.728 1.00 242.63 ?  46   U   A "C5'" 1 
ATOM   986   C  "C4'" . U   A 1  46   ? 134.116 156.559 249.394 1.00 242.63 ?  46   U   A "C4'" 1 
ATOM   987   O  "O4'" . U   A 1  46   ? 134.868 155.741 248.458 1.00 242.63 ?  46   U   A "O4'" 1 
ATOM   988   C  "C3'" . U   A 1  46   ? 132.725 155.944 249.382 1.00 242.63 ?  46   U   A "C3'" 1 
ATOM   989   O  "O3'" . U   A 1  46   ? 131.719 156.838 249.827 1.00 242.63 ?  46   U   A "O3'" 1 
ATOM   990   C  "C2'" . U   A 1  46   ? 132.561 155.516 247.929 1.00 242.63 ?  46   U   A "C2'" 1 
ATOM   991   O  "O2'" . U   A 1  46   ? 132.220 156.628 247.114 1.00 242.63 ?  46   U   A "O2'" 1 
ATOM   992   C  "C1'" . U   A 1  46   ? 133.985 155.080 247.575 1.00 242.63 ?  46   U   A "C1'" 1 
ATOM   993   N  N1    . U   A 1  46   ? 134.185 153.613 247.693 1.00 242.63 ?  46   U   A N1    1 
ATOM   994   C  C2    . U   A 1  46   ? 133.736 152.801 246.662 1.00 242.63 ?  46   U   A C2    1 
ATOM   995   O  O2    . U   A 1  46   ? 133.178 153.221 245.662 1.00 242.63 ?  46   U   A O2    1 
ATOM   996   N  N3    . U   A 1  46   ? 133.960 151.458 246.839 1.00 242.63 ?  46   U   A N3    1 
ATOM   997   C  C4    . U   A 1  46   ? 134.576 150.846 247.911 1.00 242.63 ?  46   U   A C4    1 
ATOM   998   O  O4    . U   A 1  46   ? 134.702 149.621 247.921 1.00 242.63 ?  46   U   A O4    1 
ATOM   999   C  C5    . U   A 1  46   ? 135.015 151.745 248.932 1.00 242.63 ?  46   U   A C5    1 
ATOM   1000  C  C6    . U   A 1  46   ? 134.814 153.058 248.787 1.00 242.63 ?  46   U   A C6    1 
ATOM   1001  P  P     . C   A 1  47   ? 130.340 156.272 250.430 1.00 262.82 ?  47   C   A P     1 
ATOM   1002  O  OP1   . C   A 1  47   ? 129.698 157.362 251.208 1.00 262.82 ?  47   C   A OP1   1 
ATOM   1003  O  OP2   . C   A 1  47   ? 130.626 154.971 251.087 1.00 262.82 ?  47   C   A OP2   1 
ATOM   1004  O  "O5'" . C   A 1  47   ? 129.441 155.988 249.145 1.00 262.82 ?  47   C   A "O5'" 1 
ATOM   1005  C  "C5'" . C   A 1  47   ? 129.103 157.038 248.244 1.00 262.82 ?  47   C   A "C5'" 1 
ATOM   1006  C  "C4'" . C   A 1  47   ? 128.835 156.520 246.852 1.00 262.82 ?  47   C   A "C4'" 1 
ATOM   1007  O  "O4'" . C   A 1  47   ? 129.412 155.192 246.715 1.00 262.82 ?  47   C   A "O4'" 1 
ATOM   1008  C  "C3'" . C   A 1  47   ? 127.361 156.385 246.475 1.00 262.82 ?  47   C   A "C3'" 1 
ATOM   1009  O  "O3'" . C   A 1  47   ? 127.203 156.655 245.083 1.00 262.82 ?  47   C   A "O3'" 1 
ATOM   1010  C  "C2'" . C   A 1  47   ? 127.084 154.908 246.738 1.00 262.82 ?  47   C   A "C2'" 1 
ATOM   1011  O  "O2'" . C   A 1  47   ? 125.998 154.375 246.010 1.00 262.82 ?  47   C   A "O2'" 1 
ATOM   1012  C  "C1'" . C   A 1  47   ? 128.408 154.274 246.324 1.00 262.82 ?  47   C   A "C1'" 1 
ATOM   1013  N  N1    . C   A 1  47   ? 128.685 152.984 246.972 1.00 262.82 ?  47   C   A N1    1 
ATOM   1014  C  C2    . C   A 1  47   ? 128.798 151.842 246.174 1.00 262.82 ?  47   C   A C2    1 
ATOM   1015  O  O2    . C   A 1  47   ? 128.662 151.952 244.946 1.00 262.82 ?  47   C   A O2    1 
ATOM   1016  N  N3    . C   A 1  47   ? 129.053 150.649 246.760 1.00 262.82 ?  47   C   A N3    1 
ATOM   1017  C  C4    . C   A 1  47   ? 129.192 150.573 248.084 1.00 262.82 ?  47   C   A C4    1 
ATOM   1018  N  N4    . C   A 1  47   ? 129.443 149.375 248.618 1.00 262.82 ?  47   C   A N4    1 
ATOM   1019  C  C5    . C   A 1  47   ? 129.082 151.720 248.922 1.00 262.82 ?  47   C   A C5    1 
ATOM   1020  C  C6    . C   A 1  47   ? 128.830 152.894 248.328 1.00 262.82 ?  47   C   A C6    1 
ATOM   1021  P  P     . C   A 1  48   ? 126.604 158.062 244.587 1.00 266.90 ?  48   C   A P     1 
ATOM   1022  O  OP1   . C   A 1  48   ? 125.347 158.316 245.337 1.00 266.90 ?  48   C   A OP1   1 
ATOM   1023  O  OP2   . C   A 1  48   ? 126.584 158.053 243.102 1.00 266.90 ?  48   C   A OP2   1 
ATOM   1024  O  "O5'" . C   A 1  48   ? 127.685 159.134 245.057 1.00 266.90 ?  48   C   A "O5'" 1 
ATOM   1025  C  "C5'" . C   A 1  48   ? 127.912 160.316 244.304 1.00 266.90 ?  48   C   A "C5'" 1 
ATOM   1026  C  "C4'" . C   A 1  48   ? 128.741 161.316 245.072 1.00 266.90 ?  48   C   A "C4'" 1 
ATOM   1027  O  "O4'" . C   A 1  48   ? 127.956 161.884 246.151 1.00 266.90 ?  48   C   A "O4'" 1 
ATOM   1028  C  "C3'" . C   A 1  48   ? 129.979 160.767 245.764 1.00 266.90 ?  48   C   A "C3'" 1 
ATOM   1029  O  "O3'" . C   A 1  48   ? 131.079 160.609 244.885 1.00 266.90 ?  48   C   A "O3'" 1 
ATOM   1030  C  "C2'" . C   A 1  48   ? 130.225 161.787 246.870 1.00 266.90 ?  48   C   A "C2'" 1 
ATOM   1031  O  "O2'" . C   A 1  48   ? 130.896 162.929 246.359 1.00 266.90 ?  48   C   A "O2'" 1 
ATOM   1032  C  "C1'" . C   A 1  48   ? 128.795 162.194 247.245 1.00 266.90 ?  48   C   A "C1'" 1 
ATOM   1033  N  N1    . C   A 1  48   ? 128.294 161.499 248.457 1.00 266.90 ?  48   C   A N1    1 
ATOM   1034  C  C2    . C   A 1  48   ? 128.638 162.000 249.721 1.00 266.90 ?  48   C   A C2    1 
ATOM   1035  O  O2    . C   A 1  48   ? 129.358 163.006 249.809 1.00 266.90 ?  48   C   A O2    1 
ATOM   1036  N  N3    . C   A 1  48   ? 128.180 161.373 250.830 1.00 266.90 ?  48   C   A N3    1 
ATOM   1037  C  C4    . C   A 1  48   ? 127.405 160.294 250.720 1.00 266.90 ?  48   C   A C4    1 
ATOM   1038  N  N4    . C   A 1  48   ? 126.979 159.712 251.843 1.00 266.90 ?  48   C   A N4    1 
ATOM   1039  C  C5    . C   A 1  48   ? 127.033 159.763 249.452 1.00 266.90 ?  48   C   A C5    1 
ATOM   1040  C  C6    . C   A 1  48   ? 127.492 160.392 248.363 1.00 266.90 ?  48   C   A C6    1 
ATOM   1041  P  P     . U   A 1  49   ? 131.909 159.232 244.862 1.00 242.68 ?  49   U   A P     1 
ATOM   1042  O  OP1   . U   A 1  49   ? 132.960 159.353 243.820 1.00 242.68 ?  49   U   A OP1   1 
ATOM   1043  O  OP2   . U   A 1  49   ? 130.942 158.108 244.794 1.00 242.68 ?  49   U   A OP2   1 
ATOM   1044  O  "O5'" . U   A 1  49   ? 132.633 159.191 246.281 1.00 242.68 ?  49   U   A "O5'" 1 
ATOM   1045  C  "C5'" . U   A 1  49   ? 133.948 159.702 246.438 1.00 242.68 ?  49   U   A "C5'" 1 
ATOM   1046  C  "C4'" . U   A 1  49   ? 133.939 161.080 247.051 1.00 242.68 ?  49   U   A "C4'" 1 
ATOM   1047  O  "O4'" . U   A 1  49   ? 134.024 160.976 248.497 1.00 242.68 ?  49   U   A "O4'" 1 
ATOM   1048  C  "C3'" . U   A 1  49   ? 135.107 161.977 246.680 1.00 242.68 ?  49   U   A "C3'" 1 
ATOM   1049  O  "O3'" . U   A 1  49   ? 134.957 162.590 245.412 1.00 242.68 ?  49   U   A "O3'" 1 
ATOM   1050  C  "C2'" . U   A 1  49   ? 135.149 162.967 247.838 1.00 242.68 ?  49   U   A "C2'" 1 
ATOM   1051  O  "O2'" . U   A 1  49   ? 134.161 163.973 247.674 1.00 242.68 ?  49   U   A "O2'" 1 
ATOM   1052  C  "C1'" . U   A 1  49   ? 134.743 162.076 249.017 1.00 242.68 ?  49   U   A "C1'" 1 
ATOM   1053  N  N1    . U   A 1  49   ? 135.912 161.577 249.785 1.00 242.68 ?  49   U   A N1    1 
ATOM   1054  C  C2    . U   A 1  49   ? 136.477 162.422 250.727 1.00 242.68 ?  49   U   A C2    1 
ATOM   1055  O  O2    . U   A 1  49   ? 136.067 163.549 250.953 1.00 242.68 ?  49   U   A O2    1 
ATOM   1056  N  N3    . U   A 1  49   ? 137.551 161.904 251.407 1.00 242.68 ?  49   U   A N3    1 
ATOM   1057  C  C4    . U   A 1  49   ? 138.112 160.653 251.252 1.00 242.68 ?  49   U   A C4    1 
ATOM   1058  O  O4    . U   A 1  49   ? 139.081 160.333 251.942 1.00 242.68 ?  49   U   A O4    1 
ATOM   1059  C  C5    . U   A 1  49   ? 137.476 159.837 250.266 1.00 242.68 ?  49   U   A C5    1 
ATOM   1060  C  C6    . U   A 1  49   ? 136.426 160.313 249.589 1.00 242.68 ?  49   U   A C6    1 
ATOM   1061  P  P     . G   A 1  50   ? 136.103 162.428 244.297 1.00 197.94 ?  50   G   A P     1 
ATOM   1062  O  OP1   . G   A 1  50   ? 136.416 163.777 243.761 1.00 197.94 ?  50   G   A OP1   1 
ATOM   1063  O  OP2   . G   A 1  50   ? 135.693 161.346 243.366 1.00 197.94 ?  50   G   A OP2   1 
ATOM   1064  O  "O5'" . G   A 1  50   ? 137.370 161.916 245.116 1.00 197.94 ?  50   G   A "O5'" 1 
ATOM   1065  C  "C5'" . G   A 1  50   ? 138.485 162.770 245.348 1.00 197.94 ?  50   G   A "C5'" 1 
ATOM   1066  C  "C4'" . G   A 1  50   ? 139.738 161.984 245.642 1.00 197.94 ?  50   G   A "C4'" 1 
ATOM   1067  O  "O4'" . G   A 1  50   ? 139.478 160.571 245.416 1.00 197.94 ?  50   G   A "O4'" 1 
ATOM   1068  C  "C3'" . G   A 1  50   ? 140.939 162.336 244.767 1.00 197.94 ?  50   G   A "C3'" 1 
ATOM   1069  O  "O3'" . G   A 1  50   ? 142.138 162.125 245.512 1.00 197.94 ?  50   G   A "O3'" 1 
ATOM   1070  C  "C2'" . G   A 1  50   ? 140.847 161.292 243.660 1.00 197.94 ?  50   G   A "C2'" 1 
ATOM   1071  O  "O2'" . G   A 1  50   ? 142.055 161.047 242.973 1.00 197.94 ?  50   G   A "O2'" 1 
ATOM   1072  C  "C1'" . G   A 1  50   ? 140.381 160.074 244.448 1.00 197.94 ?  50   G   A "C1'" 1 
ATOM   1073  N  N9    . G   A 1  50   ? 139.696 159.057 243.647 1.00 197.94 ?  50   G   A N9    1 
ATOM   1074  C  C8    . G   A 1  50   ? 138.775 159.236 242.645 1.00 197.94 ?  50   G   A C8    1 
ATOM   1075  N  N7    . G   A 1  50   ? 138.359 158.110 242.129 1.00 197.94 ?  50   G   A N7    1 
ATOM   1076  C  C5    . G   A 1  50   ? 139.049 157.132 242.834 1.00 197.94 ?  50   G   A C5    1 
ATOM   1077  C  C6    . G   A 1  50   ? 139.017 155.716 242.730 1.00 197.94 ?  50   G   A C6    1 
ATOM   1078  O  O6    . G   A 1  50   ? 138.350 155.014 241.961 1.00 197.94 ?  50   G   A O6    1 
ATOM   1079  N  N1    . G   A 1  50   ? 139.879 155.118 243.646 1.00 197.94 ?  50   G   A N1    1 
ATOM   1080  C  C2    . G   A 1  50   ? 140.668 155.791 244.547 1.00 197.94 ?  50   G   A C2    1 
ATOM   1081  N  N2    . G   A 1  50   ? 141.437 155.045 245.352 1.00 197.94 ?  50   G   A N2    1 
ATOM   1082  N  N3    . G   A 1  50   ? 140.705 157.106 244.653 1.00 197.94 ?  50   G   A N3    1 
ATOM   1083  C  C4    . G   A 1  50   ? 139.875 157.704 243.775 1.00 197.94 ?  50   G   A C4    1 
ATOM   1084  P  P     . U   A 1  51   ? 142.697 163.264 246.497 1.00 182.16 ?  51   U   A P     1 
ATOM   1085  O  OP1   . U   A 1  51   ? 142.817 162.674 247.855 1.00 182.16 ?  51   U   A OP1   1 
ATOM   1086  O  OP2   . U   A 1  51   ? 141.891 164.495 246.300 1.00 182.16 ?  51   U   A OP2   1 
ATOM   1087  O  "O5'" . U   A 1  51   ? 144.165 163.555 245.952 1.00 182.16 ?  51   U   A "O5'" 1 
ATOM   1088  C  "C5'" . U   A 1  51   ? 144.753 164.844 246.087 1.00 182.16 ?  51   U   A "C5'" 1 
ATOM   1089  C  "C4'" . U   A 1  51   ? 145.596 165.194 244.886 1.00 182.16 ?  51   U   A "C4'" 1 
ATOM   1090  O  "O4'" . U   A 1  51   ? 146.031 166.577 244.991 1.00 182.16 ?  51   U   A "O4'" 1 
ATOM   1091  C  "C3'" . U   A 1  51   ? 146.864 164.359 244.716 1.00 182.16 ?  51   U   A "C3'" 1 
ATOM   1092  O  "O3'" . U   A 1  51   ? 147.135 164.188 243.326 1.00 182.16 ?  51   U   A "O3'" 1 
ATOM   1093  C  "C2'" . U   A 1  51   ? 147.935 165.251 245.336 1.00 182.16 ?  51   U   A "C2'" 1 
ATOM   1094  O  "O2'" . U   A 1  51   ? 149.245 165.006 244.869 1.00 182.16 ?  51   U   A "O2'" 1 
ATOM   1095  C  "C1'" . U   A 1  51   ? 147.443 166.638 244.936 1.00 182.16 ?  51   U   A "C1'" 1 
ATOM   1096  N  N1    . U   A 1  51   ? 147.892 167.718 245.826 1.00 182.16 ?  51   U   A N1    1 
ATOM   1097  C  C2    . U   A 1  51   ? 148.911 168.530 245.371 1.00 182.16 ?  51   U   A C2    1 
ATOM   1098  O  O2    . U   A 1  51   ? 149.439 168.375 244.284 1.00 182.16 ?  51   U   A O2    1 
ATOM   1099  N  N3    . U   A 1  51   ? 149.291 169.524 246.239 1.00 182.16 ?  51   U   A N3    1 
ATOM   1100  C  C4    . U   A 1  51   ? 148.761 169.783 247.487 1.00 182.16 ?  51   U   A C4    1 
ATOM   1101  O  O4    . U   A 1  51   ? 149.209 170.717 248.152 1.00 182.16 ?  51   U   A O4    1 
ATOM   1102  C  C5    . U   A 1  51   ? 147.707 168.899 247.883 1.00 182.16 ?  51   U   A C5    1 
ATOM   1103  C  C6    . U   A 1  51   ? 147.317 167.921 247.058 1.00 182.16 ?  51   U   A C6    1 
ATOM   1104  P  P     . C   A 1  52   ? 146.489 162.957 242.518 1.00 184.08 ?  52   C   A P     1 
ATOM   1105  O  OP1   . C   A 1  52   ? 147.456 162.556 241.466 1.00 184.08 ?  52   C   A OP1   1 
ATOM   1106  O  OP2   . C   A 1  52   ? 145.103 163.328 242.133 1.00 184.08 ?  52   C   A OP2   1 
ATOM   1107  O  "O5'" . C   A 1  52   ? 146.406 161.783 243.593 1.00 184.08 ?  52   C   A "O5'" 1 
ATOM   1108  C  "C5'" . C   A 1  52   ? 145.266 160.939 243.661 1.00 184.08 ?  52   C   A "C5'" 1 
ATOM   1109  C  "C4'" . C   A 1  52   ? 145.639 159.516 243.996 1.00 184.08 ?  52   C   A "C4'" 1 
ATOM   1110  O  "O4'" . C   A 1  52   ? 144.438 158.728 244.210 1.00 184.08 ?  52   C   A "O4'" 1 
ATOM   1111  C  "C3'" . C   A 1  52   ? 146.387 158.752 242.916 1.00 184.08 ?  52   C   A "C3'" 1 
ATOM   1112  O  "O3'" . C   A 1  52   ? 147.769 159.058 242.874 1.00 184.08 ?  52   C   A "O3'" 1 
ATOM   1113  C  "C2'" . C   A 1  52   ? 146.094 157.300 243.272 1.00 184.08 ?  52   C   A "C2'" 1 
ATOM   1114  O  "O2'" . C   A 1  52   ? 146.925 156.866 244.338 1.00 184.08 ?  52   C   A "O2'" 1 
ATOM   1115  C  "C1'" . C   A 1  52   ? 144.655 157.395 243.789 1.00 184.08 ?  52   C   A "C1'" 1 
ATOM   1116  N  N1    . C   A 1  52   ? 143.647 157.038 242.757 1.00 184.08 ?  52   C   A N1    1 
ATOM   1117  C  C2    . C   A 1  52   ? 143.374 155.686 242.492 1.00 184.08 ?  52   C   A C2    1 
ATOM   1118  O  O2    . C   A 1  52   ? 143.975 154.798 243.116 1.00 184.08 ?  52   C   A O2    1 
ATOM   1119  N  N3    . C   A 1  52   ? 142.451 155.368 241.554 1.00 184.08 ?  52   C   A N3    1 
ATOM   1120  C  C4    . C   A 1  52   ? 141.806 156.326 240.888 1.00 184.08 ?  52   C   A C4    1 
ATOM   1121  N  N4    . C   A 1  52   ? 140.906 155.957 239.973 1.00 184.08 ?  52   C   A N4    1 
ATOM   1122  C  C5    . C   A 1  52   ? 142.057 157.705 241.132 1.00 184.08 ?  52   C   A C5    1 
ATOM   1123  C  C6    . C   A 1  52   ? 142.967 158.006 242.067 1.00 184.08 ?  52   C   A C6    1 
ATOM   1124  P  P     . A   A 1  53   ? 148.514 159.217 241.459 1.00 179.57 ?  53   A   A P     1 
ATOM   1125  O  OP1   . A   A 1  53   ? 149.801 159.910 241.716 1.00 179.57 ?  53   A   A OP1   1 
ATOM   1126  O  OP2   . A   A 1  53   ? 147.549 159.788 240.485 1.00 179.57 ?  53   A   A OP2   1 
ATOM   1127  O  "O5'" . A   A 1  53   ? 148.825 157.719 241.014 1.00 179.57 ?  53   A   A "O5'" 1 
ATOM   1128  C  "C5'" . A   A 1  53   ? 149.753 156.926 241.736 1.00 179.57 ?  53   A   A "C5'" 1 
ATOM   1129  C  "C4'" . A   A 1  53   ? 149.558 155.452 241.476 1.00 179.57 ?  53   A   A "C4'" 1 
ATOM   1130  O  "O4'" . A   A 1  53   ? 148.211 155.055 241.842 1.00 179.57 ?  53   A   A "O4'" 1 
ATOM   1131  C  "C3'" . A   A 1  53   ? 149.691 154.994 240.032 1.00 179.57 ?  53   A   A "C3'" 1 
ATOM   1132  O  "O3'" . A   A 1  53   ? 151.037 154.859 239.611 1.00 179.57 ?  53   A   A "O3'" 1 
ATOM   1133  C  "C2'" . A   A 1  53   ? 148.919 153.681 240.035 1.00 179.57 ?  53   A   A "C2'" 1 
ATOM   1134  O  "O2'" . A   A 1  53   ? 149.704 152.639 240.597 1.00 179.57 ?  53   A   A "O2'" 1 
ATOM   1135  C  "C1'" . A   A 1  53   ? 147.779 154.002 241.003 1.00 179.57 ?  53   A   A "C1'" 1 
ATOM   1136  N  N9    . A   A 1  53   ? 146.556 154.418 240.292 1.00 179.57 ?  53   A   A N9    1 
ATOM   1137  C  C8    . A   A 1  53   ? 146.070 155.687 240.091 1.00 179.57 ?  53   A   A C8    1 
ATOM   1138  N  N7    . A   A 1  53   ? 144.949 155.722 239.410 1.00 179.57 ?  53   A   A N7    1 
ATOM   1139  C  C5    . A   A 1  53   ? 144.682 154.387 239.141 1.00 179.57 ?  53   A   A C5    1 
ATOM   1140  C  C6    . A   A 1  53   ? 143.638 153.740 238.453 1.00 179.57 ?  53   A   A C6    1 
ATOM   1141  N  N6    . A   A 1  53   ? 142.619 154.384 237.880 1.00 179.57 ?  53   A   A N6    1 
ATOM   1142  N  N1    . A   A 1  53   ? 143.675 152.389 238.369 1.00 179.57 ?  53   A   A N1    1 
ATOM   1143  C  C2    . A   A 1  53   ? 144.694 151.731 238.939 1.00 179.57 ?  53   A   A C2    1 
ATOM   1144  N  N3    . A   A 1  53   ? 145.730 152.229 239.612 1.00 179.57 ?  53   A   A N3    1 
ATOM   1145  C  C4    . A   A 1  53   ? 145.664 153.573 239.677 1.00 179.57 ?  53   A   A C4    1 
ATOM   1146  P  P     . C   A 1  54   ? 151.434 155.122 238.075 1.00 173.39 ?  54   C   A P     1 
ATOM   1147  O  OP1   . C   A 1  54   ? 152.915 155.179 237.987 1.00 173.39 ?  54   C   A OP1   1 
ATOM   1148  O  OP2   . C   A 1  54   ? 150.625 156.265 237.582 1.00 173.39 ?  54   C   A OP2   1 
ATOM   1149  O  "O5'" . C   A 1  54   ? 150.945 153.809 237.315 1.00 173.39 ?  54   C   A "O5'" 1 
ATOM   1150  C  "C5'" . C   A 1  54   ? 151.527 152.543 237.594 1.00 173.39 ?  54   C   A "C5'" 1 
ATOM   1151  C  "C4'" . C   A 1  54   ? 150.701 151.414 237.029 1.00 173.39 ?  54   C   A "C4'" 1 
ATOM   1152  O  "O4'" . C   A 1  54   ? 149.343 151.496 237.535 1.00 173.39 ?  54   C   A "O4'" 1 
ATOM   1153  C  "C3'" . C   A 1  54   ? 150.529 151.404 235.518 1.00 173.39 ?  54   C   A "C3'" 1 
ATOM   1154  O  "O3'" . C   A 1  54   ? 151.646 150.862 234.836 1.00 173.39 ?  54   C   A "O3'" 1 
ATOM   1155  C  "C2'" . C   A 1  54   ? 149.248 150.598 235.334 1.00 173.39 ?  54   C   A "C2'" 1 
ATOM   1156  O  "O2'" . C   A 1  54   ? 149.513 149.206 235.430 1.00 173.39 ?  54   C   A "O2'" 1 
ATOM   1157  C  "C1'" . C   A 1  54   ? 148.436 151.022 236.561 1.00 173.39 ?  54   C   A "C1'" 1 
ATOM   1158  N  N1    . C   A 1  54   ? 147.445 152.085 236.256 1.00 173.39 ?  54   C   A N1    1 
ATOM   1159  C  C2    . C   A 1  54   ? 146.199 151.713 235.732 1.00 173.39 ?  54   C   A C2    1 
ATOM   1160  O  O2    . C   A 1  54   ? 145.950 150.514 235.533 1.00 173.39 ?  54   C   A O2    1 
ATOM   1161  N  N3    . C   A 1  54   ? 145.284 152.671 235.451 1.00 173.39 ?  54   C   A N3    1 
ATOM   1162  C  C4    . C   A 1  54   ? 145.565 153.955 235.672 1.00 173.39 ?  54   C   A C4    1 
ATOM   1163  N  N4    . C   A 1  54   ? 144.629 154.861 235.378 1.00 173.39 ?  54   C   A N4    1 
ATOM   1164  C  C5    . C   A 1  54   ? 146.819 154.367 236.205 1.00 173.39 ?  54   C   A C5    1 
ATOM   1165  C  C6    . C   A 1  54   ? 147.714 153.410 236.481 1.00 173.39 ?  54   C   A C6    1 
ATOM   1166  P  P     . U   A 1  55   ? 152.054 151.424 233.387 1.00 168.56 ?  55   U   A P     1 
ATOM   1167  O  OP1   . U   A 1  55   ? 153.351 150.811 233.004 1.00 168.56 ?  55   U   A OP1   1 
ATOM   1168  O  OP2   . U   A 1  55   ? 151.919 152.903 233.412 1.00 168.56 ?  55   U   A OP2   1 
ATOM   1169  O  "O5'" . U   A 1  55   ? 150.929 150.844 232.419 1.00 168.56 ?  55   U   A "O5'" 1 
ATOM   1170  C  "C5'" . U   A 1  55   ? 150.879 149.460 232.107 1.00 168.56 ?  55   U   A "C5'" 1 
ATOM   1171  C  "C4'" . U   A 1  55   ? 149.900 149.178 230.996 1.00 168.56 ?  55   U   A "C4'" 1 
ATOM   1172  O  "O4'" . U   A 1  55   ? 148.542 149.262 231.499 1.00 168.56 ?  55   U   A "O4'" 1 
ATOM   1173  C  "C3'" . U   A 1  55   ? 149.919 150.150 229.828 1.00 168.56 ?  55   U   A "C3'" 1 
ATOM   1174  O  "O3'" . U   A 1  55   ? 150.968 149.890 228.911 1.00 168.56 ?  55   U   A "O3'" 1 
ATOM   1175  C  "C2'" . U   A 1  55   ? 148.528 149.981 229.230 1.00 168.56 ?  55   U   A "C2'" 1 
ATOM   1176  O  "O2'" . U   A 1  55   ? 148.472 148.822 228.411 1.00 168.56 ?  55   U   A "O2'" 1 
ATOM   1177  C  "C1'" . U   A 1  55   ? 147.680 149.728 230.481 1.00 168.56 ?  55   U   A "C1'" 1 
ATOM   1178  N  N1    . U   A 1  55   ? 146.975 150.944 230.957 1.00 168.56 ?  55   U   A N1    1 
ATOM   1179  C  C2    . U   A 1  55   ? 145.770 151.263 230.354 1.00 168.56 ?  55   U   A C2    1 
ATOM   1180  O  O2    . U   A 1  55   ? 145.273 150.600 229.459 1.00 168.56 ?  55   U   A O2    1 
ATOM   1181  N  N3    . U   A 1  55   ? 145.159 152.395 230.835 1.00 168.56 ?  55   U   A N3    1 
ATOM   1182  C  C4    . U   A 1  55   ? 145.614 153.225 231.839 1.00 168.56 ?  55   U   A C4    1 
ATOM   1183  O  O4    . U   A 1  55   ? 144.947 154.209 232.160 1.00 168.56 ?  55   U   A O4    1 
ATOM   1184  C  C5    . U   A 1  55   ? 146.862 152.830 232.415 1.00 168.56 ?  55   U   A C5    1 
ATOM   1185  C  C6    . U   A 1  55   ? 147.480 151.731 231.969 1.00 168.56 ?  55   U   A C6    1 
ATOM   1186  P  P     . C   A 1  56   ? 152.289 150.807 228.911 1.00 174.44 ?  56   C   A P     1 
ATOM   1187  O  OP1   . C   A 1  56   ? 153.470 149.908 228.969 1.00 174.44 ?  56   C   A OP1   1 
ATOM   1188  O  OP2   . C   A 1  56   ? 152.118 151.865 229.938 1.00 174.44 ?  56   C   A OP2   1 
ATOM   1189  O  "O5'" . C   A 1  56   ? 152.274 151.511 227.483 1.00 174.44 ?  56   C   A "O5'" 1 
ATOM   1190  C  "C5'" . C   A 1  56   ? 151.269 152.456 227.146 1.00 174.44 ?  56   C   A "C5'" 1 
ATOM   1191  C  "C4'" . C   A 1  56   ? 151.416 152.931 225.723 1.00 174.44 ?  56   C   A "C4'" 1 
ATOM   1192  O  "O4'" . C   A 1  56   ? 152.620 153.728 225.592 1.00 174.44 ?  56   C   A "O4'" 1 
ATOM   1193  C  "C3'" . C   A 1  56   ? 151.578 151.842 224.674 1.00 174.44 ?  56   C   A "C3'" 1 
ATOM   1194  O  "O3'" . C   A 1  56   ? 150.346 151.255 224.295 1.00 174.44 ?  56   C   A "O3'" 1 
ATOM   1195  C  "C2'" . C   A 1  56   ? 152.284 152.572 223.537 1.00 174.44 ?  56   C   A "C2'" 1 
ATOM   1196  O  "O2'" . C   A 1  56   ? 151.353 153.315 222.764 1.00 174.44 ?  56   C   A "O2'" 1 
ATOM   1197  C  "C1'" . C   A 1  56   ? 153.173 153.558 224.304 1.00 174.44 ?  56   C   A "C1'" 1 
ATOM   1198  N  N1    . C   A 1  56   ? 154.578 153.096 224.431 1.00 174.44 ?  56   C   A N1    1 
ATOM   1199  C  C2    . C   A 1  56   ? 155.469 153.365 223.384 1.00 174.44 ?  56   C   A C2    1 
ATOM   1200  O  O2    . C   A 1  56   ? 155.065 153.973 222.381 1.00 174.44 ?  56   C   A O2    1 
ATOM   1201  N  N3    . C   A 1  56   ? 156.755 152.956 223.486 1.00 174.44 ?  56   C   A N3    1 
ATOM   1202  C  C4    . C   A 1  56   ? 157.169 152.306 224.574 1.00 174.44 ?  56   C   A C4    1 
ATOM   1203  N  N4    . C   A 1  56   ? 158.447 151.923 224.627 1.00 174.44 ?  56   C   A N4    1 
ATOM   1204  C  C5    . C   A 1  56   ? 156.289 152.020 225.657 1.00 174.44 ?  56   C   A C5    1 
ATOM   1205  C  C6    . C   A 1  56   ? 155.021 152.432 225.545 1.00 174.44 ?  56   C   A C6    1 
ATOM   1206  P  P     . C   A 1  57   ? 150.035 149.719 224.649 1.00 168.02 ?  57   C   A P     1 
ATOM   1207  O  OP1   . C   A 1  57   ? 150.717 149.389 225.926 1.00 168.02 ?  57   C   A OP1   1 
ATOM   1208  O  OP2   . C   A 1  57   ? 150.314 148.902 223.440 1.00 168.02 ?  57   C   A OP2   1 
ATOM   1209  O  "O5'" . C   A 1  57   ? 148.464 149.699 224.910 1.00 168.02 ?  57   C   A "O5'" 1 
ATOM   1210  C  "C5'" . C   A 1  57   ? 147.779 148.481 225.160 1.00 168.02 ?  57   C   A "C5'" 1 
ATOM   1211  C  "C4'" . C   A 1  57   ? 146.285 148.675 225.119 1.00 168.02 ?  57   C   A "C4'" 1 
ATOM   1212  O  "O4'" . C   A 1  57   ? 145.841 149.349 226.323 1.00 168.02 ?  57   C   A "O4'" 1 
ATOM   1213  C  "C3'" . C   A 1  57   ? 145.763 149.550 223.991 1.00 168.02 ?  57   C   A "C3'" 1 
ATOM   1214  O  "O3'" . C   A 1  57   ? 145.650 148.851 222.764 1.00 168.02 ?  57   C   A "O3'" 1 
ATOM   1215  C  "C2'" . C   A 1  57   ? 144.426 150.043 224.536 1.00 168.02 ?  57   C   A "C2'" 1 
ATOM   1216  O  "O2'" . C   A 1  57   ? 143.416 149.060 224.357 1.00 168.02 ?  57   C   A "O2'" 1 
ATOM   1217  C  "C1'" . C   A 1  57   ? 144.724 150.164 226.035 1.00 168.02 ?  57   C   A "C1'" 1 
ATOM   1218  N  N1    . C   A 1  57   ? 145.013 151.556 226.459 1.00 168.02 ?  57   C   A N1    1 
ATOM   1219  C  C2    . C   A 1  57   ? 143.938 152.394 226.782 1.00 168.02 ?  57   C   A C2    1 
ATOM   1220  O  O2    . C   A 1  57   ? 142.780 151.957 226.699 1.00 168.02 ?  57   C   A O2    1 
ATOM   1221  N  N3    . C   A 1  57   ? 144.182 153.665 227.177 1.00 168.02 ?  57   C   A N3    1 
ATOM   1222  C  C4    . C   A 1  57   ? 145.435 154.113 227.259 1.00 168.02 ?  57   C   A C4    1 
ATOM   1223  N  N4    . C   A 1  57   ? 145.624 155.374 227.653 1.00 168.02 ?  57   C   A N4    1 
ATOM   1224  C  C5    . C   A 1  57   ? 146.550 153.286 226.942 1.00 168.02 ?  57   C   A C5    1 
ATOM   1225  C  C6    . C   A 1  57   ? 146.295 152.029 226.555 1.00 168.02 ?  57   C   A C6    1 
ATOM   1226  P  P     . A   A 1  58   ? 146.694 149.125 221.572 1.00 152.87 ?  58   A   A P     1 
ATOM   1227  O  OP1   . A   A 1  58   ? 145.974 148.946 220.287 1.00 152.87 ?  58   A   A OP1   1 
ATOM   1228  O  OP2   . A   A 1  58   ? 147.920 148.331 221.833 1.00 152.87 ?  58   A   A OP2   1 
ATOM   1229  O  "O5'" . A   A 1  58   ? 147.058 150.668 221.726 1.00 152.87 ?  58   A   A "O5'" 1 
ATOM   1230  C  "C5'" . A   A 1  58   ? 147.658 151.387 220.659 1.00 152.87 ?  58   A   A "C5'" 1 
ATOM   1231  C  "C4'" . A   A 1  58   ? 146.644 152.244 219.946 1.00 152.87 ?  58   A   A "C4'" 1 
ATOM   1232  O  "O4'" . A   A 1  58   ? 145.792 152.901 220.918 1.00 152.87 ?  58   A   A "O4'" 1 
ATOM   1233  C  "C3'" . A   A 1  58   ? 147.198 153.386 219.107 1.00 152.87 ?  58   A   A "C3'" 1 
ATOM   1234  O  "O3'" . A   A 1  58   ? 147.642 152.968 217.829 1.00 152.87 ?  58   A   A "O3'" 1 
ATOM   1235  C  "C2'" . A   A 1  58   ? 146.026 154.358 219.056 1.00 152.87 ?  58   A   A "C2'" 1 
ATOM   1236  O  "O2'" . A   A 1  58   ? 145.069 153.940 218.094 1.00 152.87 ?  58   A   A "O2'" 1 
ATOM   1237  C  "C1'" . A   A 1  58   ? 145.421 154.179 220.449 1.00 152.87 ?  58   A   A "C1'" 1 
ATOM   1238  N  N9    . A   A 1  58   ? 145.913 155.192 221.402 1.00 152.87 ?  58   A   A N9    1 
ATOM   1239  C  C8    . A   A 1  58   ? 147.038 155.156 222.190 1.00 152.87 ?  58   A   A C8    1 
ATOM   1240  N  N7    . A   A 1  58   ? 147.198 156.226 222.931 1.00 152.87 ?  58   A   A N7    1 
ATOM   1241  C  C5    . A   A 1  58   ? 146.104 157.017 222.608 1.00 152.87 ?  58   A   A C5    1 
ATOM   1242  C  C6    . A   A 1  58   ? 145.679 158.285 223.043 1.00 152.87 ?  58   A   A C6    1 
ATOM   1243  N  N6    . A   A 1  58   ? 146.339 159.014 223.946 1.00 152.87 ?  58   A   A N6    1 
ATOM   1244  N  N1    . A   A 1  58   ? 144.537 158.785 222.514 1.00 152.87 ?  58   A   A N1    1 
ATOM   1245  C  C2    . A   A 1  58   ? 143.865 158.059 221.608 1.00 152.87 ?  58   A   A C2    1 
ATOM   1246  N  N3    . A   A 1  58   ? 144.168 156.860 221.121 1.00 152.87 ?  58   A   A N3    1 
ATOM   1247  C  C4    . A   A 1  58   ? 145.306 156.393 221.665 1.00 152.87 ?  58   A   A C4    1 
ATOM   1248  P  P     . C   A 1  59   ? 149.098 153.392 217.297 1.00 190.58 ?  59   C   A P     1 
ATOM   1249  O  OP1   . C   A 1  59   ? 149.514 154.614 218.031 1.00 190.58 ?  59   C   A OP1   1 
ATOM   1250  O  OP2   . C   A 1  59   ? 149.062 153.402 215.813 1.00 190.58 ?  59   C   A OP2   1 
ATOM   1251  O  "O5'" . C   A 1  59   ? 150.042 152.196 217.762 1.00 190.58 ?  59   C   A "O5'" 1 
ATOM   1252  C  "C5'" . C   A 1  59   ? 151.386 152.112 217.311 1.00 190.58 ?  59   C   A "C5'" 1 
ATOM   1253  C  "C4'" . C   A 1  59   ? 152.359 152.428 218.418 1.00 190.58 ?  59   C   A "C4'" 1 
ATOM   1254  O  "O4'" . C   A 1  59   ? 152.188 151.485 219.507 1.00 190.58 ?  59   C   A "O4'" 1 
ATOM   1255  C  "C3'" . C   A 1  59   ? 153.833 152.315 218.062 1.00 190.58 ?  59   C   A "C3'" 1 
ATOM   1256  O  "O3'" . C   A 1  59   ? 154.323 153.451 217.372 1.00 190.58 ?  59   C   A "O3'" 1 
ATOM   1257  C  "C2'" . C   A 1  59   ? 154.489 152.093 219.420 1.00 190.58 ?  59   C   A "C2'" 1 
ATOM   1258  O  "O2'" . C   A 1  59   ? 154.639 153.324 220.112 1.00 190.58 ?  59   C   A "O2'" 1 
ATOM   1259  C  "C1'" . C   A 1  59   ? 153.428 151.257 220.145 1.00 190.58 ?  59   C   A "C1'" 1 
ATOM   1260  N  N1    . C   A 1  59   ? 153.728 149.803 220.129 1.00 190.58 ?  59   C   A N1    1 
ATOM   1261  C  C2    . C   A 1  59   ? 154.577 149.284 221.115 1.00 190.58 ?  59   C   A C2    1 
ATOM   1262  O  O2    . C   A 1  59   ? 155.057 150.046 221.968 1.00 190.58 ?  59   C   A O2    1 
ATOM   1263  N  N3    . C   A 1  59   ? 154.858 147.960 221.119 1.00 190.58 ?  59   C   A N3    1 
ATOM   1264  C  C4    . C   A 1  59   ? 154.330 147.159 220.194 1.00 190.58 ?  59   C   A C4    1 
ATOM   1265  N  N4    . C   A 1  59   ? 154.638 145.861 220.240 1.00 190.58 ?  59   C   A N4    1 
ATOM   1266  C  C5    . C   A 1  59   ? 153.461 147.654 219.180 1.00 190.58 ?  59   C   A C5    1 
ATOM   1267  C  C6    . C   A 1  59   ? 153.189 148.964 219.189 1.00 190.58 ?  59   C   A C6    1 
ATOM   1268  P  P     . U   A 1  60   ? 155.379 153.274 216.174 1.00 193.91 ?  60   U   A P     1 
ATOM   1269  O  OP1   . U   A 1  60   ? 154.804 153.903 214.958 1.00 193.91 ?  60   U   A OP1   1 
ATOM   1270  O  OP2   . U   A 1  60   ? 155.798 151.850 216.135 1.00 193.91 ?  60   U   A OP2   1 
ATOM   1271  O  "O5'" . U   A 1  60   ? 156.631 154.145 216.633 1.00 193.91 ?  60   U   A "O5'" 1 
ATOM   1272  C  "C5'" . U   A 1  60   ? 156.966 155.356 215.962 1.00 193.91 ?  60   U   A "C5'" 1 
ATOM   1273  C  "C4'" . U   A 1  60   ? 156.975 156.547 216.894 1.00 193.91 ?  60   U   A "C4'" 1 
ATOM   1274  O  "O4'" . U   A 1  60   ? 155.757 157.320 216.708 1.00 193.91 ?  60   U   A "O4'" 1 
ATOM   1275  C  "C3'" . U   A 1  60   ? 157.057 156.230 218.388 1.00 193.91 ?  60   U   A "C3'" 1 
ATOM   1276  O  "O3'" . U   A 1  60   ? 157.839 157.232 219.036 1.00 193.91 ?  60   U   A "O3'" 1 
ATOM   1277  C  "C2'" . U   A 1  60   ? 155.605 156.356 218.840 1.00 193.91 ?  60   U   A "C2'" 1 
ATOM   1278  O  "O2'" . U   A 1  60   ? 155.440 156.652 220.211 1.00 193.91 ?  60   U   A "O2'" 1 
ATOM   1279  C  "C1'" . U   A 1  60   ? 155.105 157.490 217.951 1.00 193.91 ?  60   U   A "C1'" 1 
ATOM   1280  N  N1    . U   A 1  60   ? 153.654 157.475 217.717 1.00 193.91 ?  60   U   A N1    1 
ATOM   1281  C  C2    . U   A 1  60   ? 152.891 158.422 218.371 1.00 193.91 ?  60   U   A C2    1 
ATOM   1282  O  O2    . U   A 1  60   ? 153.370 159.251 219.125 1.00 193.91 ?  60   U   A O2    1 
ATOM   1283  N  N3    . U   A 1  60   ? 151.544 158.360 218.111 1.00 193.91 ?  60   U   A N3    1 
ATOM   1284  C  C4    . U   A 1  60   ? 150.900 157.467 217.280 1.00 193.91 ?  60   U   A C4    1 
ATOM   1285  O  O4    . U   A 1  60   ? 149.677 157.538 217.148 1.00 193.91 ?  60   U   A O4    1 
ATOM   1286  C  C5    . U   A 1  60   ? 151.761 156.521 216.639 1.00 193.91 ?  60   U   A C5    1 
ATOM   1287  C  C6    . U   A 1  60   ? 153.077 156.556 216.873 1.00 193.91 ?  60   U   A C6    1 
ATOM   1288  P  P     . C   A 1  61   ? 159.037 156.816 220.022 1.00 187.79 ?  61   C   A P     1 
ATOM   1289  O  OP1   . C   A 1  61   ? 158.682 157.268 221.392 1.00 187.79 ?  61   C   A OP1   1 
ATOM   1290  O  OP2   . C   A 1  61   ? 160.311 157.262 219.406 1.00 187.79 ?  61   C   A OP2   1 
ATOM   1291  O  "O5'" . C   A 1  61   ? 159.022 155.223 220.008 1.00 187.79 ?  61   C   A "O5'" 1 
ATOM   1292  C  "C5'" . C   A 1  61   ? 158.976 154.483 221.219 1.00 187.79 ?  61   C   A "C5'" 1 
ATOM   1293  C  "C4'" . C   A 1  61   ? 160.188 153.599 221.370 1.00 187.79 ?  61   C   A "C4'" 1 
ATOM   1294  O  "O4'" . C   A 1  61   ? 160.284 152.708 220.228 1.00 187.79 ?  61   C   A "O4'" 1 
ATOM   1295  C  "C3'" . C   A 1  61   ? 161.530 154.315 221.400 1.00 187.79 ?  61   C   A "C3'" 1 
ATOM   1296  O  "O3'" . C   A 1  61   ? 161.847 154.827 222.684 1.00 187.79 ?  61   C   A "O3'" 1 
ATOM   1297  C  "C2'" . C   A 1  61   ? 162.500 153.242 220.918 1.00 187.79 ?  61   C   A "C2'" 1 
ATOM   1298  O  "O2'" . C   A 1  61   ? 162.846 152.365 221.980 1.00 187.79 ?  61   C   A "O2'" 1 
ATOM   1299  C  "C1'" . C   A 1  61   ? 161.639 152.468 219.913 1.00 187.79 ?  61   C   A "C1'" 1 
ATOM   1300  N  N1    . C   A 1  61   ? 161.886 152.867 218.504 1.00 187.79 ?  61   C   A N1    1 
ATOM   1301  C  C2    . C   A 1  61   ? 162.990 152.339 217.817 1.00 187.79 ?  61   C   A C2    1 
ATOM   1302  O  O2    . C   A 1  61   ? 163.758 151.553 218.393 1.00 187.79 ?  61   C   A O2    1 
ATOM   1303  N  N3    . C   A 1  61   ? 163.203 152.700 216.530 1.00 187.79 ?  61   C   A N3    1 
ATOM   1304  C  C4    . C   A 1  61   ? 162.370 153.543 215.919 1.00 187.79 ?  61   C   A C4    1 
ATOM   1305  N  N4    . C   A 1  61   ? 162.626 153.867 214.649 1.00 187.79 ?  61   C   A N4    1 
ATOM   1306  C  C5    . C   A 1  61   ? 161.237 154.090 216.583 1.00 187.79 ?  61   C   A C5    1 
ATOM   1307  C  C6    . C   A 1  61   ? 161.037 153.725 217.856 1.00 187.79 ?  61   C   A C6    1 
ATOM   1308  P  P     . C   A 1  62   ? 162.428 156.317 222.851 1.00 176.22 ?  62   C   A P     1 
ATOM   1309  O  OP1   . C   A 1  62   ? 162.652 156.558 224.299 1.00 176.22 ?  62   C   A OP1   1 
ATOM   1310  O  OP2   . C   A 1  62   ? 161.568 157.248 222.081 1.00 176.22 ?  62   C   A OP2   1 
ATOM   1311  O  "O5'" . C   A 1  62   ? 163.852 156.261 222.141 1.00 176.22 ?  62   C   A "O5'" 1 
ATOM   1312  C  "C5'" . C   A 1  62   ? 164.919 155.510 222.702 1.00 176.22 ?  62   C   A "C5'" 1 
ATOM   1313  C  "C4'" . C   A 1  62   ? 166.118 155.499 221.789 1.00 176.22 ?  62   C   A "C4'" 1 
ATOM   1314  O  "O4'" . C   A 1  62   ? 165.779 154.825 220.548 1.00 176.22 ?  62   C   A "O4'" 1 
ATOM   1315  C  "C3'" . C   A 1  62   ? 166.619 156.863 221.343 1.00 176.22 ?  62   C   A "C3'" 1 
ATOM   1316  O  "O3'" . C   A 1  62   ? 167.443 157.493 222.310 1.00 176.22 ?  62   C   A "O3'" 1 
ATOM   1317  C  "C2'" . C   A 1  62   ? 167.342 156.546 220.038 1.00 176.22 ?  62   C   A "C2'" 1 
ATOM   1318  O  "O2'" . C   A 1  62   ? 168.641 156.034 220.295 1.00 176.22 ?  62   C   A "O2'" 1 
ATOM   1319  C  "C1'" . C   A 1  62   ? 166.479 155.414 219.472 1.00 176.22 ?  62   C   A "C1'" 1 
ATOM   1320  N  N1    . C   A 1  62   ? 165.505 155.885 218.456 1.00 176.22 ?  62   C   A N1    1 
ATOM   1321  C  C2    . C   A 1  62   ? 165.928 156.035 217.128 1.00 176.22 ?  62   C   A C2    1 
ATOM   1322  O  O2    . C   A 1  62   ? 167.103 155.777 216.828 1.00 176.22 ?  62   C   A O2    1 
ATOM   1323  N  N3    . C   A 1  62   ? 165.045 156.460 216.194 1.00 176.22 ?  62   C   A N3    1 
ATOM   1324  C  C4    . C   A 1  62   ? 163.785 156.731 216.535 1.00 176.22 ?  62   C   A C4    1 
ATOM   1325  N  N4    . C   A 1  62   ? 162.951 157.147 215.579 1.00 176.22 ?  62   C   A N4    1 
ATOM   1326  C  C5    . C   A 1  62   ? 163.324 156.586 217.874 1.00 176.22 ?  62   C   A C5    1 
ATOM   1327  C  C6    . C   A 1  62   ? 164.204 156.162 218.786 1.00 176.22 ?  62   C   A C6    1 
ATOM   1328  P  P     . C   A 1  63   ? 167.036 158.925 222.918 1.00 139.53 ?  63   C   A P     1 
ATOM   1329  O  OP1   . C   A 1  63   ? 167.176 158.849 224.395 1.00 139.53 ?  63   C   A OP1   1 
ATOM   1330  O  OP2   . C   A 1  63   ? 165.736 159.326 222.325 1.00 139.53 ?  63   C   A OP2   1 
ATOM   1331  O  "O5'" . C   A 1  63   ? 168.161 159.915 222.373 1.00 139.53 ?  63   C   A "O5'" 1 
ATOM   1332  C  "C5'" . C   A 1  63   ? 169.262 159.421 221.626 1.00 139.53 ?  63   C   A "C5'" 1 
ATOM   1333  C  "C4'" . C   A 1  63   ? 170.578 159.750 222.283 1.00 139.53 ?  63   C   A "C4'" 1 
ATOM   1334  O  "O4'" . C   A 1  63   ? 171.544 158.711 221.975 1.00 139.53 ?  63   C   A "O4'" 1 
ATOM   1335  C  "C3'" . C   A 1  63   ? 171.249 161.032 221.814 1.00 139.53 ?  63   C   A "C3'" 1 
ATOM   1336  O  "O3'" . C   A 1  63   ? 170.726 162.194 222.433 1.00 139.53 ?  63   C   A "O3'" 1 
ATOM   1337  C  "C2'" . C   A 1  63   ? 172.717 160.774 222.125 1.00 139.53 ?  63   C   A "C2'" 1 
ATOM   1338  O  "O2'" . C   A 1  63   ? 172.983 160.987 223.503 1.00 139.53 ?  63   C   A "O2'" 1 
ATOM   1339  C  "C1'" . C   A 1  63   ? 172.833 159.273 221.837 1.00 139.53 ?  63   C   A "C1'" 1 
ATOM   1340  N  N1    . C   A 1  63   ? 173.341 158.980 220.471 1.00 139.53 ?  63   C   A N1    1 
ATOM   1341  C  C2    . C   A 1  63   ? 174.718 159.053 220.212 1.00 139.53 ?  63   C   A C2    1 
ATOM   1342  O  O2    . C   A 1  63   ? 175.505 159.370 221.118 1.00 139.53 ?  63   C   A O2    1 
ATOM   1343  N  N3    . C   A 1  63   ? 175.173 158.779 218.967 1.00 139.53 ?  63   C   A N3    1 
ATOM   1344  C  C4    . C   A 1  63   ? 174.326 158.436 217.996 1.00 139.53 ?  63   C   A C4    1 
ATOM   1345  N  N4    . C   A 1  63   ? 174.828 158.176 216.787 1.00 139.53 ?  63   C   A N4    1 
ATOM   1346  C  C5    . C   A 1  63   ? 172.925 158.345 218.224 1.00 139.53 ?  63   C   A C5    1 
ATOM   1347  C  C6    . C   A 1  63   ? 172.488 158.614 219.460 1.00 139.53 ?  63   C   A C6    1 
ATOM   1348  P  P     . A   A 1  64   ? 170.192 163.412 221.531 1.00 124.75 ?  64   A   A P     1 
ATOM   1349  O  OP1   . A   A 1  64   ? 171.364 164.055 220.885 1.00 124.75 ?  64   A   A OP1   1 
ATOM   1350  O  OP2   . A   A 1  64   ? 169.268 164.230 222.358 1.00 124.75 ?  64   A   A OP2   1 
ATOM   1351  O  "O5'" . A   A 1  64   ? 169.335 162.697 220.394 1.00 124.75 ?  64   A   A "O5'" 1 
ATOM   1352  C  "C5'" . A   A 1  64   ? 168.821 163.436 219.291 1.00 124.75 ?  64   A   A "C5'" 1 
ATOM   1353  C  "C4'" . A   A 1  64   ? 168.412 162.532 218.153 1.00 124.75 ?  64   A   A "C4'" 1 
ATOM   1354  O  "O4'" . A   A 1  64   ? 167.403 161.597 218.626 1.00 124.75 ?  64   A   A "O4'" 1 
ATOM   1355  C  "C3'" . A   A 1  64   ? 167.798 163.246 216.951 1.00 124.75 ?  64   A   A "C3'" 1 
ATOM   1356  O  "O3'" . A   A 1  64   ? 168.121 162.531 215.758 1.00 124.75 ?  64   A   A "O3'" 1 
ATOM   1357  C  "C2'" . A   A 1  64   ? 166.303 163.130 217.226 1.00 124.75 ?  64   A   A "C2'" 1 
ATOM   1358  O  "O2'" . A   A 1  64   ? 165.486 163.226 216.078 1.00 124.75 ?  64   A   A "O2'" 1 
ATOM   1359  C  "C1'" . A   A 1  64   ? 166.217 161.749 217.869 1.00 124.75 ?  64   A   A "C1'" 1 
ATOM   1360  N  N9    . A   A 1  64   ? 165.078 161.578 218.774 1.00 124.75 ?  64   A   A N9    1 
ATOM   1361  C  C8    . A   A 1  64   ? 164.990 161.980 220.084 1.00 124.75 ?  64   A   A C8    1 
ATOM   1362  N  N7    . A   A 1  64   ? 163.848 161.685 220.655 1.00 124.75 ?  64   A   A N7    1 
ATOM   1363  C  C5    . A   A 1  64   ? 163.138 161.035 219.656 1.00 124.75 ?  64   A   A C5    1 
ATOM   1364  C  C6    . A   A 1  64   ? 161.852 160.466 219.618 1.00 124.75 ?  64   A   A C6    1 
ATOM   1365  N  N6    . A   A 1  64   ? 161.015 160.461 220.658 1.00 124.75 ?  64   A   A N6    1 
ATOM   1366  N  N1    . A   A 1  64   ? 161.447 159.894 218.461 1.00 124.75 ?  64   A   A N1    1 
ATOM   1367  C  C2    . A   A 1  64   ? 162.279 159.894 217.411 1.00 124.75 ?  64   A   A C2    1 
ATOM   1368  N  N3    . A   A 1  64   ? 163.510 160.395 217.326 1.00 124.75 ?  64   A   A N3    1 
ATOM   1369  C  C4    . A   A 1  64   ? 163.886 160.954 218.493 1.00 124.75 ?  64   A   A C4    1 
ATOM   1370  P  P     . U   A 1  65   ? 169.347 163.004 214.830 1.00 106.81 ?  65   U   A P     1 
ATOM   1371  O  OP1   . U   A 1  65   ? 169.361 162.140 213.624 1.00 106.81 ?  65   U   A OP1   1 
ATOM   1372  O  OP2   . U   A 1  65   ? 170.569 163.104 215.669 1.00 106.81 ?  65   U   A OP2   1 
ATOM   1373  O  "O5'" . U   A 1  65   ? 168.944 164.476 214.373 1.00 106.81 ?  65   U   A "O5'" 1 
ATOM   1374  C  "C5'" . U   A 1  65   ? 168.016 164.686 213.318 1.00 106.81 ?  65   U   A "C5'" 1 
ATOM   1375  C  "C4'" . U   A 1  65   ? 168.129 166.080 212.754 1.00 106.81 ?  65   U   A "C4'" 1 
ATOM   1376  O  "O4'" . U   A 1  65   ? 167.927 167.050 213.815 1.00 106.81 ?  65   U   A "O4'" 1 
ATOM   1377  C  "C3'" . U   A 1  65   ? 169.483 166.453 212.169 1.00 106.81 ?  65   U   A "C3'" 1 
ATOM   1378  O  "O3'" . U   A 1  65   ? 169.671 165.975 210.849 1.00 106.81 ?  65   U   A "O3'" 1 
ATOM   1379  C  "C2'" . U   A 1  65   ? 169.488 167.972 212.275 1.00 106.81 ?  65   U   A "C2'" 1 
ATOM   1380  O  "O2'" . U   A 1  65   ? 168.738 168.553 211.219 1.00 106.81 ?  65   U   A "O2'" 1 
ATOM   1381  C  "C1'" . U   A 1  65   ? 168.728 168.191 213.587 1.00 106.81 ?  65   U   A "C1'" 1 
ATOM   1382  N  N1    . U   A 1  65   ? 169.632 168.390 214.748 1.00 106.81 ?  65   U   A N1    1 
ATOM   1383  C  C2    . U   A 1  65   ? 170.169 169.652 214.945 1.00 106.81 ?  65   U   A C2    1 
ATOM   1384  O  O2    . U   A 1  65   ? 169.943 170.603 214.215 1.00 106.81 ?  65   U   A O2    1 
ATOM   1385  N  N3    . U   A 1  65   ? 170.994 169.768 216.037 1.00 106.81 ?  65   U   A N3    1 
ATOM   1386  C  C4    . U   A 1  65   ? 171.331 168.781 216.939 1.00 106.81 ?  65   U   A C4    1 
ATOM   1387  O  O4    . U   A 1  65   ? 172.089 169.046 217.874 1.00 106.81 ?  65   U   A O4    1 
ATOM   1388  C  C5    . U   A 1  65   ? 170.737 167.508 216.675 1.00 106.81 ?  65   U   A C5    1 
ATOM   1389  C  C6    . U   A 1  65   ? 169.929 167.365 215.621 1.00 106.81 ?  65   U   A C6    1 
ATOM   1390  P  P     . G   A 1  66   ? 171.154 165.674 210.310 1.00 74.52  ?  66   G   A P     1 
ATOM   1391  O  OP1   . G   A 1  66   ? 171.918 165.052 211.419 1.00 74.52  ?  66   G   A OP1   1 
ATOM   1392  O  OP2   . G   A 1  66   ? 171.672 166.905 209.661 1.00 74.52  ?  66   G   A OP2   1 
ATOM   1393  O  "O5'" . G   A 1  66   ? 170.938 164.575 209.180 1.00 74.52  ?  66   G   A "O5'" 1 
ATOM   1394  C  "C5'" . G   A 1  66   ? 170.236 164.889 207.987 1.00 74.52  ?  66   G   A "C5'" 1 
ATOM   1395  C  "C4'" . G   A 1  66   ? 168.956 164.101 207.879 1.00 74.52  ?  66   G   A "C4'" 1 
ATOM   1396  O  "O4'" . G   A 1  66   ? 167.821 164.997 207.990 1.00 74.52  ?  66   G   A "O4'" 1 
ATOM   1397  C  "C3'" . G   A 1  66   ? 168.734 163.375 206.561 1.00 74.52  ?  66   G   A "C3'" 1 
ATOM   1398  O  "O3'" . G   A 1  66   ? 169.400 162.124 206.511 1.00 74.52  ?  66   G   A "O3'" 1 
ATOM   1399  C  "C2'" . G   A 1  66   ? 167.216 163.252 206.494 1.00 74.52  ?  66   G   A "C2'" 1 
ATOM   1400  O  "O2'" . G   A 1  66   ? 166.764 162.167 207.291 1.00 74.52  ?  66   G   A "O2'" 1 
ATOM   1401  C  "C1'" . G   A 1  66   ? 166.772 164.557 207.157 1.00 74.52  ?  66   G   A "C1'" 1 
ATOM   1402  N  N9    . G   A 1  66   ? 166.483 165.616 206.172 1.00 74.52  ?  66   G   A N9    1 
ATOM   1403  C  C8    . G   A 1  66   ? 167.263 166.710 205.886 1.00 74.52  ?  66   G   A C8    1 
ATOM   1404  N  N7    . G   A 1  66   ? 166.747 167.483 204.971 1.00 74.52  ?  66   G   A N7    1 
ATOM   1405  C  C5    . G   A 1  66   ? 165.552 166.863 204.633 1.00 74.52  ?  66   G   A C5    1 
ATOM   1406  C  C6    . G   A 1  66   ? 164.559 167.238 203.694 1.00 74.52  ?  66   G   A C6    1 
ATOM   1407  O  O6    . G   A 1  66   ? 164.538 168.226 202.950 1.00 74.52  ?  66   G   A O6    1 
ATOM   1408  N  N1    . G   A 1  66   ? 163.508 166.326 203.669 1.00 74.52  ?  66   G   A N1    1 
ATOM   1409  C  C2    . G   A 1  66   ? 163.423 165.200 204.450 1.00 74.52  ?  66   G   A C2    1 
ATOM   1410  N  N2    . G   A 1  66   ? 162.331 164.442 204.278 1.00 74.52  ?  66   G   A N2    1 
ATOM   1411  N  N3    . G   A 1  66   ? 164.343 164.837 205.328 1.00 74.52  ?  66   G   A N3    1 
ATOM   1412  C  C4    . G   A 1  66   ? 165.373 165.710 205.368 1.00 74.52  ?  66   G   A C4    1 
ATOM   1413  P  P     . U   A 1  67   ? 170.809 161.977 205.750 1.00 96.15  ?  67   U   A P     1 
ATOM   1414  O  OP1   . U   A 1  67   ? 171.892 162.291 206.716 1.00 96.15  ?  67   U   A OP1   1 
ATOM   1415  O  OP2   . U   A 1  67   ? 170.727 162.729 204.473 1.00 96.15  ?  67   U   A OP2   1 
ATOM   1416  O  "O5'" . U   A 1  67   ? 170.900 160.421 205.419 1.00 96.15  ?  67   U   A "O5'" 1 
ATOM   1417  C  "C5'" . U   A 1  67   ? 171.902 159.915 204.550 1.00 96.15  ?  67   U   A "C5'" 1 
ATOM   1418  C  "C4'" . U   A 1  67   ? 171.670 158.459 204.231 1.00 96.15  ?  67   U   A "C4'" 1 
ATOM   1419  O  "O4'" . U   A 1  67   ? 172.160 157.632 205.317 1.00 96.15  ?  67   U   A "O4'" 1 
ATOM   1420  C  "C3'" . U   A 1  67   ? 170.218 158.033 204.067 1.00 96.15  ?  67   U   A "C3'" 1 
ATOM   1421  O  "O3'" . U   A 1  67   ? 169.699 158.326 202.781 1.00 96.15  ?  67   U   A "O3'" 1 
ATOM   1422  C  "C2'" . U   A 1  67   ? 170.270 156.538 204.366 1.00 96.15  ?  67   U   A "C2'" 1 
ATOM   1423  O  "O2'" . U   A 1  67   ? 170.700 155.813 203.223 1.00 96.15  ?  67   U   A "O2'" 1 
ATOM   1424  C  "C1'" . U   A 1  67   ? 171.372 156.466 205.428 1.00 96.15  ?  67   U   A "C1'" 1 
ATOM   1425  N  N1    . U   A 1  67   ? 170.839 156.367 206.808 1.00 96.15  ?  67   U   A N1    1 
ATOM   1426  C  C2    . U   A 1  67   ? 170.490 155.109 207.268 1.00 96.15  ?  67   U   A C2    1 
ATOM   1427  O  O2    . U   A 1  67   ? 170.595 154.097 206.595 1.00 96.15  ?  67   U   A O2    1 
ATOM   1428  N  N3    . U   A 1  67   ? 170.008 155.072 208.553 1.00 96.15  ?  67   U   A N3    1 
ATOM   1429  C  C4    . U   A 1  67   ? 169.843 156.139 209.411 1.00 96.15  ?  67   U   A C4    1 
ATOM   1430  O  O4    . U   A 1  67   ? 169.395 155.943 210.542 1.00 96.15  ?  67   U   A O4    1 
ATOM   1431  C  C5    . U   A 1  67   ? 170.229 157.404 208.867 1.00 96.15  ?  67   U   A C5    1 
ATOM   1432  C  C6    . U   A 1  67   ? 170.704 157.472 207.619 1.00 96.15  ?  67   U   A C6    1 
ATOM   1433  P  P     . C   A 1  68   ? 168.563 159.448 202.582 1.00 59.56  ?  68   C   A P     1 
ATOM   1434  O  OP1   . C   A 1  68   ? 168.070 159.336 201.186 1.00 59.56  ?  68   C   A OP1   1 
ATOM   1435  O  OP2   . C   A 1  68   ? 169.086 160.751 203.059 1.00 59.56  ?  68   C   A OP2   1 
ATOM   1436  O  "O5'" . C   A 1  68   ? 167.384 159.010 203.562 1.00 59.56  ?  68   C   A "O5'" 1 
ATOM   1437  C  "C5'" . C   A 1  68   ? 166.585 157.868 203.291 1.00 59.56  ?  68   C   A "C5'" 1 
ATOM   1438  C  "C4'" . C   A 1  68   ? 165.157 158.246 202.983 1.00 59.56  ?  68   C   A "C4'" 1 
ATOM   1439  O  "O4'" . C   A 1  68   ? 164.828 159.505 203.630 1.00 59.56  ?  68   C   A "O4'" 1 
ATOM   1440  C  "C3'" . C   A 1  68   ? 164.836 158.497 201.519 1.00 59.56  ?  68   C   A "C3'" 1 
ATOM   1441  O  "O3'" . C   A 1  68   ? 164.642 157.308 200.773 1.00 59.56  ?  68   C   A "O3'" 1 
ATOM   1442  C  "C2'" . C   A 1  68   ? 163.597 159.379 201.600 1.00 59.56  ?  68   C   A "C2'" 1 
ATOM   1443  O  "O2'" . C   A 1  68   ? 162.443 158.598 201.875 1.00 59.56  ?  68   C   A "O2'" 1 
ATOM   1444  C  "C1'" . C   A 1  68   ? 163.910 160.230 202.834 1.00 59.56  ?  68   C   A "C1'" 1 
ATOM   1445  N  N1    . C   A 1  68   ? 164.500 161.548 202.482 1.00 59.56  ?  68   C   A N1    1 
ATOM   1446  C  C2    . C   A 1  68   ? 163.672 162.585 202.018 1.00 59.56  ?  68   C   A C2    1 
ATOM   1447  O  O2    . C   A 1  68   ? 162.448 162.410 201.900 1.00 59.56  ?  68   C   A O2    1 
ATOM   1448  N  N3    . C   A 1  68   ? 164.223 163.780 201.702 1.00 59.56  ?  68   C   A N3    1 
ATOM   1449  C  C4    . C   A 1  68   ? 165.534 163.978 201.832 1.00 59.56  ?  68   C   A C4    1 
ATOM   1450  N  N4    . C   A 1  68   ? 166.023 165.177 201.507 1.00 59.56  ?  68   C   A N4    1 
ATOM   1451  C  C5    . C   A 1  68   ? 166.401 162.952 202.300 1.00 59.56  ?  68   C   A C5    1 
ATOM   1452  C  C6    . C   A 1  68   ? 165.845 161.776 202.611 1.00 59.56  ?  68   C   A C6    1 
ATOM   1453  P  P     . C   A 1  69   ? 165.113 157.238 199.238 1.00 42.98  ?  69   C   A P     1 
ATOM   1454  O  OP1   . C   A 1  69   ? 164.966 155.834 198.776 1.00 42.98  ?  69   C   A OP1   1 
ATOM   1455  O  OP2   . C   A 1  69   ? 166.431 157.912 199.130 1.00 42.98  ?  69   C   A OP2   1 
ATOM   1456  O  "O5'" . C   A 1  69   ? 164.040 158.126 198.463 1.00 42.98  ?  69   C   A "O5'" 1 
ATOM   1457  C  "C5'" . C   A 1  69   ? 162.677 157.731 198.404 1.00 42.98  ?  69   C   A "C5'" 1 
ATOM   1458  C  "C4'" . C   A 1  69   ? 161.830 158.746 197.680 1.00 42.98  ?  69   C   A "C4'" 1 
ATOM   1459  O  "O4'" . C   A 1  69   ? 161.782 159.982 198.440 1.00 42.98  ?  69   C   A "O4'" 1 
ATOM   1460  C  "C3'" . C   A 1  69   ? 162.328 159.178 196.311 1.00 42.98  ?  69   C   A "C3'" 1 
ATOM   1461  O  "O3'" . C   A 1  69   ? 162.022 158.248 195.285 1.00 42.98  ?  69   C   A "O3'" 1 
ATOM   1462  C  "C2'" . C   A 1  69   ? 161.659 160.534 196.129 1.00 42.98  ?  69   C   A "C2'" 1 
ATOM   1463  O  "O2'" . C   A 1  69   ? 160.304 160.377 195.735 1.00 42.98  ?  69   C   A "O2'" 1 
ATOM   1464  C  "C1'" . C   A 1  69   ? 161.687 161.083 197.560 1.00 42.98  ?  69   C   A "C1'" 1 
ATOM   1465  N  N1    . C   A 1  69   ? 162.827 162.004 197.804 1.00 42.98  ?  69   C   A N1    1 
ATOM   1466  C  C2    . C   A 1  69   ? 162.726 163.343 197.400 1.00 42.98  ?  69   C   A C2    1 
ATOM   1467  O  O2    . C   A 1  69   ? 161.693 163.744 196.842 1.00 42.98  ?  69   C   A O2    1 
ATOM   1468  N  N3    . C   A 1  69   ? 163.762 164.185 197.627 1.00 42.98  ?  69   C   A N3    1 
ATOM   1469  C  C4    . C   A 1  69   ? 164.867 163.748 198.230 1.00 42.98  ?  69   C   A C4    1 
ATOM   1470  N  N4    . C   A 1  69   ? 165.860 164.618 198.430 1.00 42.98  ?  69   C   A N4    1 
ATOM   1471  C  C5    . C   A 1  69   ? 165.002 162.396 198.656 1.00 42.98  ?  69   C   A C5    1 
ATOM   1472  C  C6    . C   A 1  69   ? 163.970 161.575 198.429 1.00 42.98  ?  69   C   A C6    1 
ATOM   1473  P  P     . C   A 1  70   ? 163.034 158.047 194.053 1.00 33.55  ?  70   C   A P     1 
ATOM   1474  O  OP1   . C   A 1  70   ? 162.645 156.810 193.330 1.00 33.55  ?  70   C   A OP1   1 
ATOM   1475  O  OP2   . C   A 1  70   ? 164.420 158.194 194.566 1.00 33.55  ?  70   C   A OP2   1 
ATOM   1476  O  "O5'" . C   A 1  70   ? 162.728 159.284 193.097 1.00 33.55  ?  70   C   A "O5'" 1 
ATOM   1477  C  "C5'" . C   A 1  70   ? 161.460 159.422 192.473 1.00 33.55  ?  70   C   A "C5'" 1 
ATOM   1478  C  "C4'" . C   A 1  70   ? 161.261 160.812 191.924 1.00 33.55  ?  70   C   A "C4'" 1 
ATOM   1479  O  "O4'" . C   A 1  70   ? 161.361 161.783 192.998 1.00 33.55  ?  70   C   A "O4'" 1 
ATOM   1480  C  "C3'" . C   A 1  70   ? 162.289 161.283 190.908 1.00 33.55  ?  70   C   A "C3'" 1 
ATOM   1481  O  "O3'" . C   A 1  70   ? 162.057 160.783 189.603 1.00 33.55  ?  70   C   A "O3'" 1 
ATOM   1482  C  "C2'" . C   A 1  70   ? 162.185 162.800 191.011 1.00 33.55  ?  70   C   A "C2'" 1 
ATOM   1483  O  "O2'" . C   A 1  70   ? 161.062 163.277 190.284 1.00 33.55  ?  70   C   A "O2'" 1 
ATOM   1484  C  "C1'" . C   A 1  70   ? 161.909 162.989 192.506 1.00 33.55  ?  70   C   A "C1'" 1 
ATOM   1485  N  N1    . C   A 1  70   ? 163.132 163.326 193.280 1.00 33.55  ?  70   C   A N1    1 
ATOM   1486  C  C2    . C   A 1  70   ? 163.540 164.664 193.344 1.00 33.55  ?  70   C   A C2    1 
ATOM   1487  O  O2    . C   A 1  70   ? 162.878 165.532 192.755 1.00 33.55  ?  70   C   A O2    1 
ATOM   1488  N  N3    . C   A 1  70   ? 164.648 164.988 194.051 1.00 33.55  ?  70   C   A N3    1 
ATOM   1489  C  C4    . C   A 1  70   ? 165.345 164.042 194.682 1.00 33.55  ?  70   C   A C4    1 
ATOM   1490  N  N4    . C   A 1  70   ? 166.432 164.411 195.362 1.00 33.55  ?  70   C   A N4    1 
ATOM   1491  C  C5    . C   A 1  70   ? 164.959 162.673 194.638 1.00 33.55  ?  70   C   A C5    1 
ATOM   1492  C  C6    . C   A 1  70   ? 163.861 162.369 193.937 1.00 33.55  ?  70   C   A C6    1 
ATOM   1493  P  P     . U   A 1  71   ? 163.298 160.451 188.637 1.00 40.72  ?  71   U   A P     1 
ATOM   1494  O  OP1   . U   A 1  71   ? 162.780 159.703 187.463 1.00 40.72  ?  71   U   A OP1   1 
ATOM   1495  O  OP2   . U   A 1  71   ? 164.380 159.860 189.465 1.00 40.72  ?  71   U   A OP2   1 
ATOM   1496  O  "O5'" . U   A 1  71   ? 163.790 161.881 188.133 1.00 40.72  ?  71   U   A "O5'" 1 
ATOM   1497  C  "C5'" . U   A 1  71   ? 162.964 162.680 187.299 1.00 40.72  ?  71   U   A "C5'" 1 
ATOM   1498  C  "C4'" . U   A 1  71   ? 163.442 164.110 187.241 1.00 40.72  ?  71   U   A "C4'" 1 
ATOM   1499  O  "O4'" . U   A 1  71   ? 163.451 164.684 188.574 1.00 40.72  ?  71   U   A "O4'" 1 
ATOM   1500  C  "C3'" . U   A 1  71   ? 164.862 164.327 186.743 1.00 40.72  ?  71   U   A "C3'" 1 
ATOM   1501  O  "O3'" . U   A 1  71   ? 164.976 164.268 185.332 1.00 40.72  ?  71   U   A "O3'" 1 
ATOM   1502  C  "C2'" . U   A 1  71   ? 165.210 165.691 187.328 1.00 40.72  ?  71   U   A "C2'" 1 
ATOM   1503  O  "O2'" . U   A 1  71   ? 164.636 166.729 186.549 1.00 40.72  ?  71   U   A "O2'" 1 
ATOM   1504  C  "C1'" . U   A 1  71   ? 164.486 165.641 188.676 1.00 40.72  ?  71   U   A "C1'" 1 
ATOM   1505  N  N1    . U   A 1  71   ? 165.392 165.277 189.794 1.00 40.72  ?  71   U   A N1    1 
ATOM   1506  C  C2    . U   A 1  71   ? 166.110 166.303 190.382 1.00 40.72  ?  71   U   A C2    1 
ATOM   1507  O  O2    . U   A 1  71   ? 166.025 167.466 190.024 1.00 40.72  ?  71   U   A O2    1 
ATOM   1508  N  N3    . U   A 1  71   ? 166.935 165.925 191.412 1.00 40.72  ?  71   U   A N3    1 
ATOM   1509  C  C4    . U   A 1  71   ? 167.119 164.651 191.906 1.00 40.72  ?  71   U   A C4    1 
ATOM   1510  O  O4    . U   A 1  71   ? 167.899 164.470 192.842 1.00 40.72  ?  71   U   A O4    1 
ATOM   1511  C  C5    . U   A 1  71   ? 166.345 163.643 191.251 1.00 40.72  ?  71   U   A C5    1 
ATOM   1512  C  C6    . U   A 1  71   ? 165.531 163.983 190.247 1.00 40.72  ?  71   U   A C6    1 
ATOM   1513  P  P     . U   A 1  72   ? 166.332 163.728 184.657 1.00 48.50  ?  72   U   A P     1 
ATOM   1514  O  OP1   . U   A 1  72   ? 166.086 163.564 183.202 1.00 48.50  ?  72   U   A OP1   1 
ATOM   1515  O  OP2   . U   A 1  72   ? 166.814 162.572 185.454 1.00 48.50  ?  72   U   A OP2   1 
ATOM   1516  O  "O5'" . U   A 1  72   ? 167.365 164.926 184.850 1.00 48.50  ?  72   U   A "O5'" 1 
ATOM   1517  C  "C5'" . U   A 1  72   ? 167.156 166.174 184.207 1.00 48.50  ?  72   U   A "C5'" 1 
ATOM   1518  C  "C4'" . U   A 1  72   ? 168.121 167.226 184.696 1.00 48.50  ?  72   U   A "C4'" 1 
ATOM   1519  O  "O4'" . U   A 1  72   ? 167.872 167.534 186.093 1.00 48.50  ?  72   U   A "O4'" 1 
ATOM   1520  C  "C3'" . U   A 1  72   ? 169.592 166.854 184.672 1.00 48.50  ?  72   U   A "C3'" 1 
ATOM   1521  O  "O3'" . U   A 1  72   ? 170.172 166.912 183.385 1.00 48.50  ?  72   U   A "O3'" 1 
ATOM   1522  C  "C2'" . U   A 1  72   ? 170.191 167.844 185.662 1.00 48.50  ?  72   U   A "C2'" 1 
ATOM   1523  O  "O2'" . U   A 1  72   ? 170.331 169.126 185.068 1.00 48.50  ?  72   U   A "O2'" 1 
ATOM   1524  C  "C1'" . U   A 1  72   ? 169.083 167.919 186.718 1.00 48.50  ?  72   U   A "C1'" 1 
ATOM   1525  N  N1    . U   A 1  72   ? 169.354 167.027 187.874 1.00 48.50  ?  72   U   A N1    1 
ATOM   1526  C  C2    . U   A 1  72   ? 170.204 167.507 188.858 1.00 48.50  ?  72   U   A C2    1 
ATOM   1527  O  O2    . U   A 1  72   ? 170.722 168.612 188.822 1.00 48.50  ?  72   U   A O2    1 
ATOM   1528  N  N3    . U   A 1  72   ? 170.430 166.648 189.903 1.00 48.50  ?  72   U   A N3    1 
ATOM   1529  C  C4    . U   A 1  72   ? 169.912 165.382 190.069 1.00 48.50  ?  72   U   A C4    1 
ATOM   1530  O  O4    . U   A 1  72   ? 170.215 164.731 191.070 1.00 48.50  ?  72   U   A O4    1 
ATOM   1531  C  C5    . U   A 1  72   ? 169.047 164.952 189.014 1.00 48.50  ?  72   U   A C5    1 
ATOM   1532  C  C6    . U   A 1  72   ? 168.805 165.768 187.984 1.00 48.50  ?  72   U   A C6    1 
ATOM   1533  P  P     . G   A 1  73   ? 171.274 165.823 182.963 1.00 57.01  ?  73   G   A P     1 
ATOM   1534  O  OP1   . G   A 1  73   ? 170.559 164.625 182.451 1.00 57.01  ?  73   G   A OP1   1 
ATOM   1535  O  OP2   . G   A 1  73   ? 172.244 165.676 184.077 1.00 57.01  ?  73   G   A OP2   1 
ATOM   1536  O  "O5'" . G   A 1  73   ? 172.024 166.504 181.739 1.00 57.01  ?  73   G   A "O5'" 1 
ATOM   1537  C  "C5'" . G   A 1  73   ? 171.380 166.632 180.484 1.00 57.01  ?  73   G   A "C5'" 1 
ATOM   1538  C  "C4'" . G   A 1  73   ? 171.156 168.078 180.119 1.00 57.01  ?  73   G   A "C4'" 1 
ATOM   1539  O  "O4'" . G   A 1  73   ? 172.084 168.900 180.864 1.00 57.01  ?  73   G   A "O4'" 1 
ATOM   1540  C  "C3'" . G   A 1  73   ? 171.397 168.435 178.656 1.00 57.01  ?  73   G   A "C3'" 1 
ATOM   1541  O  "O3'" . G   A 1  73   ? 170.234 168.260 177.855 1.00 57.01  ?  73   G   A "O3'" 1 
ATOM   1542  C  "C2'" . G   A 1  73   ? 171.853 169.893 178.709 1.00 57.01  ?  73   G   A "C2'" 1 
ATOM   1543  O  "O2'" . G   A 1  73   ? 170.739 170.772 178.668 1.00 57.01  ?  73   G   A "O2'" 1 
ATOM   1544  C  "C1'" . G   A 1  73   ? 172.509 169.994 180.089 1.00 57.01  ?  73   G   A "C1'" 1 
ATOM   1545  N  N9    . G   A 1  73   ? 173.984 169.991 180.043 1.00 57.01  ?  73   G   A N9    1 
ATOM   1546  C  C8    . G   A 1  73   ? 174.809 168.903 180.188 1.00 57.01  ?  73   G   A C8    1 
ATOM   1547  N  N7    . G   A 1  73   ? 176.075 169.206 180.121 1.00 57.01  ?  73   G   A N7    1 
ATOM   1548  C  C5    . G   A 1  73   ? 176.091 170.579 179.930 1.00 57.01  ?  73   G   A C5    1 
ATOM   1549  C  C6    . G   A 1  73   ? 177.185 171.471 179.788 1.00 57.01  ?  73   G   A C6    1 
ATOM   1550  O  O6    . G   A 1  73   ? 178.395 171.216 179.797 1.00 57.01  ?  73   G   A O6    1 
ATOM   1551  N  N1    . G   A 1  73   ? 176.755 172.782 179.612 1.00 57.01  ?  73   G   A N1    1 
ATOM   1552  C  C2    . G   A 1  73   ? 175.442 173.184 179.581 1.00 57.01  ?  73   G   A C2    1 
ATOM   1553  N  N2    . G   A 1  73   ? 175.230 174.496 179.404 1.00 57.01  ?  73   G   A N2    1 
ATOM   1554  N  N3    . G   A 1  73   ? 174.413 172.362 179.715 1.00 57.01  ?  73   G   A N3    1 
ATOM   1555  C  C4    . G   A 1  73   ? 174.808 171.082 179.885 1.00 57.01  ?  73   G   A C4    1 
ATOM   1556  P  P     . G   A 1  74   ? 169.825 166.823 177.250 1.00 57.92  ?  74   G   A P     1 
ATOM   1557  O  OP1   . G   A 1  74   ? 169.065 166.065 178.276 1.00 57.92  ?  74   G   A OP1   1 
ATOM   1558  O  OP2   . G   A 1  74   ? 171.028 166.225 176.620 1.00 57.92  ?  74   G   A OP2   1 
ATOM   1559  O  "O5'" . G   A 1  74   ? 168.772 167.169 176.107 1.00 57.92  ?  74   G   A "O5'" 1 
ATOM   1560  C  "C5'" . G   A 1  74   ? 167.651 168.000 176.369 1.00 57.92  ?  74   G   A "C5'" 1 
ATOM   1561  C  "C4'" . G   A 1  74   ? 167.281 168.821 175.159 1.00 57.92  ?  74   G   A "C4'" 1 
ATOM   1562  O  "O4'" . G   A 1  74   ? 168.457 169.526 174.679 1.00 57.92  ?  74   G   A "O4'" 1 
ATOM   1563  C  "C3'" . G   A 1  74   ? 166.785 168.041 173.946 1.00 57.92  ?  74   G   A "C3'" 1 
ATOM   1564  O  "O3'" . G   A 1  74   ? 165.415 167.643 174.102 1.00 57.92  ?  74   G   A "O3'" 1 
ATOM   1565  C  "C2'" . G   A 1  74   ? 167.138 168.976 172.786 1.00 57.92  ?  74   G   A "C2'" 1 
ATOM   1566  O  "O2'" . G   A 1  74   ? 166.218 170.054 172.691 1.00 57.92  ?  74   G   A "O2'" 1 
ATOM   1567  C  "C1'" . G   A 1  74   ? 168.470 169.555 173.269 1.00 57.92  ?  74   G   A "C1'" 1 
ATOM   1568  N  N9    . G   A 1  74   ? 169.655 168.793 172.817 1.00 57.92  ?  74   G   A N9    1 
ATOM   1569  C  C8    . G   A 1  74   ? 170.332 167.860 173.565 1.00 57.92  ?  74   G   A C8    1 
ATOM   1570  N  N7    . G   A 1  74   ? 171.363 167.337 172.971 1.00 57.92  ?  74   G   A N7    1 
ATOM   1571  C  C5    . G   A 1  74   ? 171.388 167.974 171.744 1.00 57.92  ?  74   G   A C5    1 
ATOM   1572  C  C6    . G   A 1  74   ? 172.299 167.813 170.672 1.00 57.92  ?  74   G   A C6    1 
ATOM   1573  O  O6    . G   A 1  74   ? 173.271 167.052 170.595 1.00 57.92  ?  74   G   A O6    1 
ATOM   1574  N  N1    . G   A 1  74   ? 171.976 168.640 169.607 1.00 57.92  ?  74   G   A N1    1 
ATOM   1575  C  C2    . G   A 1  74   ? 170.920 169.513 169.586 1.00 57.92  ?  74   G   A C2    1 
ATOM   1576  N  N2    . G   A 1  74   ? 170.792 170.221 168.461 1.00 57.92  ?  74   G   A N2    1 
ATOM   1577  N  N3    . G   A 1  74   ? 170.061 169.681 170.581 1.00 57.92  ?  74   G   A N3    1 
ATOM   1578  C  C4    . G   A 1  74   ? 170.351 168.882 171.629 1.00 57.92  ?  74   G   A C4    1 
ATOM   1579  P  P     . G   A 1  75   ? 164.308 167.548 172.925 1.00 74.62  ?  75   G   A P     1 
ATOM   1580  O  OP1   . G   A 1  75   ? 163.866 168.928 172.588 1.00 74.62  ?  75   G   A OP1   1 
ATOM   1581  O  OP2   . G   A 1  75   ? 163.275 166.601 173.415 1.00 74.62  ?  75   G   A OP2   1 
ATOM   1582  O  "O5'" . G   A 1  75   ? 165.011 166.826 171.688 1.00 74.62  ?  75   G   A "O5'" 1 
ATOM   1583  C  "C5'" . G   A 1  75   ? 164.356 166.745 170.421 1.00 74.62  ?  75   G   A "C5'" 1 
ATOM   1584  C  "C4'" . G   A 1  75   ? 164.653 167.958 169.573 1.00 74.62  ?  75   G   A "C4'" 1 
ATOM   1585  O  "O4'" . G   A 1  75   ? 166.093 168.169 169.534 1.00 74.62  ?  75   G   A "O4'" 1 
ATOM   1586  C  "C3'" . G   A 1  75   ? 164.197 167.899 168.116 1.00 74.62  ?  75   G   A "C3'" 1 
ATOM   1587  O  "O3'" . G   A 1  75   ? 163.925 169.248 167.716 1.00 74.62  ?  75   G   A "O3'" 1 
ATOM   1588  C  "C2'" . G   A 1  75   ? 165.455 167.377 167.421 1.00 74.62  ?  75   G   A "C2'" 1 
ATOM   1589  O  "O2'" . G   A 1  75   ? 165.537 167.610 166.030 1.00 74.62  ?  75   G   A "O2'" 1 
ATOM   1590  C  "C1'" . G   A 1  75   ? 166.539 168.121 168.192 1.00 74.62  ?  75   G   A "C1'" 1 
ATOM   1591  N  N9    . G   A 1  75   ? 167.876 167.519 168.130 1.00 74.62  ?  75   G   A N9    1 
ATOM   1592  C  C8    . G   A 1  75   ? 168.790 167.791 167.140 1.00 74.62  ?  75   G   A C8    1 
ATOM   1593  N  N7    . G   A 1  75   ? 169.912 167.148 167.274 1.00 74.62  ?  75   G   A N7    1 
ATOM   1594  C  C5    . G   A 1  75   ? 169.734 166.397 168.424 1.00 74.62  ?  75   G   A C5    1 
ATOM   1595  C  C6    . G   A 1  75   ? 170.622 165.493 169.056 1.00 74.62  ?  75   G   A C6    1 
ATOM   1596  O  O6    . G   A 1  75   ? 171.771 165.184 168.723 1.00 74.62  ?  75   G   A O6    1 
ATOM   1597  N  N1    . G   A 1  75   ? 170.066 164.944 170.202 1.00 74.62  ?  75   G   A N1    1 
ATOM   1598  C  C2    . G   A 1  75   ? 168.807 165.207 170.673 1.00 74.62  ?  75   G   A C2    1 
ATOM   1599  N  N2    . G   A 1  75   ? 168.446 164.566 171.794 1.00 74.62  ?  75   G   A N2    1 
ATOM   1600  N  N3    . G   A 1  75   ? 167.966 166.040 170.088 1.00 74.62  ?  75   G   A N3    1 
ATOM   1601  C  C4    . G   A 1  75   ? 168.482 166.603 168.970 1.00 74.62  ?  75   G   A C4    1 
ATOM   1602  P  P     . A   A 1  76   ? 163.122 169.632 166.370 1.00 61.51  ?  76   A   A P     1 
ATOM   1603  O  OP1   . A   A 1  76   ? 162.029 170.563 166.747 1.00 61.51  ?  76   A   A OP1   1 
ATOM   1604  O  OP2   . A   A 1  76   ? 162.797 168.380 165.641 1.00 61.51  ?  76   A   A OP2   1 
ATOM   1605  O  "O5'" . A   A 1  76   ? 164.184 170.455 165.498 1.00 61.51  ?  76   A   A "O5'" 1 
ATOM   1606  C  "C5'" . A   A 1  76   ? 164.736 171.692 165.948 1.00 61.51  ?  76   A   A "C5'" 1 
ATOM   1607  C  "C4'" . A   A 1  76   ? 166.004 171.459 166.734 1.00 61.51  ?  76   A   A "C4'" 1 
ATOM   1608  O  "O4'" . A   A 1  76   ? 167.151 171.308 165.869 1.00 61.51  ?  76   A   A "O4'" 1 
ATOM   1609  C  "C3'" . A   A 1  76   ? 166.442 172.505 167.743 1.00 61.51  ?  76   A   A "C3'" 1 
ATOM   1610  O  "O3'" . A   A 1  76   ? 165.611 172.478 168.904 1.00 61.51  ?  76   A   A "O3'" 1 
ATOM   1611  C  "C2'" . A   A 1  76   ? 167.906 172.119 167.982 1.00 61.51  ?  76   A   A "C2'" 1 
ATOM   1612  O  "O2'" . A   A 1  76   ? 168.008 171.061 168.924 1.00 61.51  ?  76   A   A "O2'" 1 
ATOM   1613  C  "C1'" . A   A 1  76   ? 168.323 171.573 166.608 1.00 61.51  ?  76   A   A "C1'" 1 
ATOM   1614  N  N9    . A   A 1  76   ? 169.206 172.479 165.852 1.00 61.51  ?  76   A   A N9    1 
ATOM   1615  C  C8    . A   A 1  76   ? 168.921 173.186 164.714 1.00 61.51  ?  76   A   A C8    1 
ATOM   1616  N  N7    . A   A 1  76   ? 169.931 173.892 164.265 1.00 61.51  ?  76   A   A N7    1 
ATOM   1617  C  C5    . A   A 1  76   ? 170.954 173.625 165.165 1.00 61.51  ?  76   A   A C5    1 
ATOM   1618  C  C6    . A   A 1  76   ? 172.289 174.063 165.258 1.00 61.51  ?  76   A   A C6    1 
ATOM   1619  N  N6    . A   A 1  76   ? 172.857 174.904 164.393 1.00 61.51  ?  76   A   A N6    1 
ATOM   1620  N  N1    . A   A 1  76   ? 173.042 173.602 166.284 1.00 61.51  ?  76   A   A N1    1 
ATOM   1621  C  C2    . A   A 1  76   ? 172.490 172.756 167.161 1.00 61.51  ?  76   A   A C2    1 
ATOM   1622  N  N3    . A   A 1  76   ? 171.248 172.275 167.177 1.00 61.51  ?  76   A   A N3    1 
ATOM   1623  C  C4    . A   A 1  76   ? 170.523 172.750 166.146 1.00 61.51  ?  76   A   A C4    1 
ATOM   1624  P  P     . A   A 1  77   ? 166.005 173.157 170.317 1.00 54.22  ?  77   A   A P     1 
ATOM   1625  O  OP1   . A   A 1  77   ? 166.876 172.202 171.053 1.00 54.22  ?  77   A   A OP1   1 
ATOM   1626  O  OP2   . A   A 1  77   ? 164.718 173.525 170.961 1.00 54.22  ?  77   A   A OP2   1 
ATOM   1627  O  "O5'" . A   A 1  77   ? 166.713 174.545 169.957 1.00 54.22  ?  77   A   A "O5'" 1 
ATOM   1628  C  "C5'" . A   A 1  77   ? 168.036 174.865 170.384 1.00 54.22  ?  77   A   A "C5'" 1 
ATOM   1629  C  "C4'" . A   A 1  77   ? 168.140 175.124 171.868 1.00 54.22  ?  77   A   A "C4'" 1 
ATOM   1630  O  "O4'" . A   A 1  77   ? 168.585 173.906 172.524 1.00 54.22  ?  77   A   A "O4'" 1 
ATOM   1631  C  "C3'" . A   A 1  77   ? 169.177 176.164 172.270 1.00 54.22  ?  77   A   A "C3'" 1 
ATOM   1632  O  "O3'" . A   A 1  77   ? 168.704 177.498 172.203 1.00 54.22  ?  77   A   A "O3'" 1 
ATOM   1633  C  "C2'" . A   A 1  77   ? 169.591 175.726 173.670 1.00 54.22  ?  77   A   A "C2'" 1 
ATOM   1634  O  "O2'" . A   A 1  77   ? 168.643 176.161 174.634 1.00 54.22  ?  77   A   A "O2'" 1 
ATOM   1635  C  "C1'" . A   A 1  77   ? 169.498 174.205 173.556 1.00 54.22  ?  77   A   A "C1'" 1 
ATOM   1636  N  N9    . A   A 1  77   ? 170.794 173.556 173.246 1.00 54.22  ?  77   A   A N9    1 
ATOM   1637  C  C8    . A   A 1  77   ? 171.757 173.887 172.317 1.00 54.22  ?  77   A   A C8    1 
ATOM   1638  N  N7    . A   A 1  77   ? 172.792 173.086 172.293 1.00 54.22  ?  77   A   A N7    1 
ATOM   1639  C  C5    . A   A 1  77   ? 172.494 172.150 173.268 1.00 54.22  ?  77   A   A C5    1 
ATOM   1640  C  C6    . A   A 1  77   ? 173.186 171.021 173.742 1.00 54.22  ?  77   A   A C6    1 
ATOM   1641  N  N6    . A   A 1  77   ? 174.374 170.633 173.274 1.00 54.22  ?  77   A   A N6    1 
ATOM   1642  N  N1    . A   A 1  77   ? 172.613 170.296 174.729 1.00 54.22  ?  77   A   A N1    1 
ATOM   1643  C  C2    . A   A 1  77   ? 171.422 170.682 175.204 1.00 54.22  ?  77   A   A C2    1 
ATOM   1644  N  N3    . A   A 1  77   ? 170.674 171.721 174.840 1.00 54.22  ?  77   A   A N3    1 
ATOM   1645  C  C4    . A   A 1  77   ? 171.271 172.422 173.858 1.00 54.22  ?  77   A   A C4    1 
ATOM   1646  P  P     . G   A 1  78   ? 169.754 178.707 172.069 1.00 64.02  ?  78   G   A P     1 
ATOM   1647  O  OP1   . G   A 1  78   ? 170.284 179.025 173.417 1.00 64.02  ?  78   G   A OP1   1 
ATOM   1648  O  OP2   . G   A 1  78   ? 169.114 179.775 171.259 1.00 64.02  ?  78   G   A OP2   1 
ATOM   1649  O  "O5'" . G   A 1  78   ? 170.948 178.083 171.219 1.00 64.02  ?  78   G   A "O5'" 1 
ATOM   1650  C  "C5'" . G   A 1  78   ? 172.283 178.091 171.707 1.00 64.02  ?  78   G   A "C5'" 1 
ATOM   1651  C  "C4'" . G   A 1  78   ? 173.271 178.079 170.571 1.00 64.02  ?  78   G   A "C4'" 1 
ATOM   1652  O  "O4'" . G   A 1  78   ? 173.089 176.869 169.783 1.00 64.02  ?  78   G   A "O4'" 1 
ATOM   1653  C  "C3'" . G   A 1  78   ? 173.110 179.208 169.564 1.00 64.02  ?  78   G   A "C3'" 1 
ATOM   1654  O  "O3'" . G   A 1  78   ? 173.736 180.413 169.972 1.00 64.02  ?  78   G   A "O3'" 1 
ATOM   1655  C  "C2'" . G   A 1  78   ? 173.695 178.608 168.295 1.00 64.02  ?  78   G   A "C2'" 1 
ATOM   1656  O  "O2'" . G   A 1  78   ? 175.115 178.619 168.344 1.00 64.02  ?  78   G   A "O2'" 1 
ATOM   1657  C  "C1'" . G   A 1  78   ? 173.221 177.161 168.408 1.00 64.02  ?  78   G   A "C1'" 1 
ATOM   1658  N  N9    . G   A 1  78   ? 171.901 176.947 167.776 1.00 64.02  ?  78   G   A N9    1 
ATOM   1659  C  C8    . G   A 1  78   ? 170.809 176.431 168.433 1.00 64.02  ?  78   G   A C8    1 
ATOM   1660  N  N7    . G   A 1  78   ? 169.750 176.322 167.684 1.00 64.02  ?  78   G   A N7    1 
ATOM   1661  C  C5    . G   A 1  78   ? 170.160 176.789 166.446 1.00 64.02  ?  78   G   A C5    1 
ATOM   1662  C  C6    . G   A 1  78   ? 169.424 176.912 165.239 1.00 64.02  ?  78   G   A C6    1 
ATOM   1663  O  O6    . G   A 1  78   ? 168.242 176.615 165.025 1.00 64.02  ?  78   G   A O6    1 
ATOM   1664  N  N1    . G   A 1  78   ? 170.202 177.432 164.211 1.00 64.02  ?  78   G   A N1    1 
ATOM   1665  C  C2    . G   A 1  78   ? 171.519 177.796 164.333 1.00 64.02  ?  78   G   A C2    1 
ATOM   1666  N  N2    . G   A 1  78   ? 172.103 178.278 163.226 1.00 64.02  ?  78   G   A N2    1 
ATOM   1667  N  N3    . G   A 1  78   ? 172.216 177.685 165.453 1.00 64.02  ?  78   G   A N3    1 
ATOM   1668  C  C4    . G   A 1  78   ? 171.486 177.181 166.475 1.00 64.02  ?  78   G   A C4    1 
ATOM   1669  P  P     . G   A 1  79   ? 172.870 181.581 170.659 1.00 76.97  ?  79   G   A P     1 
ATOM   1670  O  OP1   . G   A 1  79   ? 173.303 181.700 172.075 1.00 76.97  ?  79   G   A OP1   1 
ATOM   1671  O  OP2   . G   A 1  79   ? 171.440 181.338 170.347 1.00 76.97  ?  79   G   A OP2   1 
ATOM   1672  O  "O5'" . G   A 1  79   ? 173.321 182.903 169.893 1.00 76.97  ?  79   G   A "O5'" 1 
ATOM   1673  C  "C5'" . G   A 1  79   ? 172.628 183.352 168.736 1.00 76.97  ?  79   G   A "C5'" 1 
ATOM   1674  C  "C4'" . G   A 1  79   ? 173.176 182.713 167.485 1.00 76.97  ?  79   G   A "C4'" 1 
ATOM   1675  O  "O4'" . G   A 1  79   ? 172.457 181.487 167.212 1.00 76.97  ?  79   G   A "O4'" 1 
ATOM   1676  C  "C3'" . G   A 1  79   ? 173.034 183.508 166.199 1.00 76.97  ?  79   G   A "C3'" 1 
ATOM   1677  O  "O3'" . G   A 1  79   ? 174.023 184.516 166.062 1.00 76.97  ?  79   G   A "O3'" 1 
ATOM   1678  C  "C2'" . G   A 1  79   ? 173.124 182.424 165.129 1.00 76.97  ?  79   G   A "C2'" 1 
ATOM   1679  O  "O2'" . G   A 1  79   ? 174.478 182.066 164.890 1.00 76.97  ?  79   G   A "O2'" 1 
ATOM   1680  C  "C1'" . G   A 1  79   ? 172.428 181.246 165.821 1.00 76.97  ?  79   G   A "C1'" 1 
ATOM   1681  N  N9    . G   A 1  79   ? 171.031 181.075 165.368 1.00 76.97  ?  79   G   A N9    1 
ATOM   1682  C  C8    . G   A 1  79   ? 170.565 181.431 164.125 1.00 76.97  ?  79   G   A C8    1 
ATOM   1683  N  N7    . G   A 1  79   ? 169.303 181.166 163.944 1.00 76.97  ?  79   G   A N7    1 
ATOM   1684  C  C5    . G   A 1  79   ? 168.904 180.580 165.136 1.00 76.97  ?  79   G   A C5    1 
ATOM   1685  C  C6    . G   A 1  79   ? 167.629 180.089 165.522 1.00 76.97  ?  79   G   A C6    1 
ATOM   1686  O  O6    . G   A 1  79   ? 166.581 180.070 164.866 1.00 76.97  ?  79   G   A O6    1 
ATOM   1687  N  N1    . G   A 1  79   ? 167.644 179.578 166.815 1.00 76.97  ?  79   G   A N1    1 
ATOM   1688  C  C2    . G   A 1  79   ? 168.744 179.549 167.634 1.00 76.97  ?  79   G   A C2    1 
ATOM   1689  N  N2    . G   A 1  79   ? 168.561 179.013 168.849 1.00 76.97  ?  79   G   A N2    1 
ATOM   1690  N  N3    . G   A 1  79   ? 169.938 180.003 167.284 1.00 76.97  ?  79   G   A N3    1 
ATOM   1691  C  C4    . G   A 1  79   ? 169.956 180.506 166.028 1.00 76.97  ?  79   G   A C4    1 
ATOM   1692  P  P     . U   A 1  80   ? 173.655 186.068 166.273 1.00 84.89  ?  80   U   A P     1 
ATOM   1693  O  OP1   . U   A 1  80   ? 174.604 186.864 165.454 1.00 84.89  ?  80   U   A OP1   1 
ATOM   1694  O  OP2   . U   A 1  80   ? 173.547 186.346 167.727 1.00 84.89  ?  80   U   A OP2   1 
ATOM   1695  O  "O5'" . U   A 1  80   ? 172.209 186.225 165.623 1.00 84.89  ?  80   U   A "O5'" 1 
ATOM   1696  C  "C5'" . U   A 1  80   ? 172.060 186.533 164.245 1.00 84.89  ?  80   U   A "C5'" 1 
ATOM   1697  C  "C4'" . U   A 1  80   ? 170.709 186.113 163.725 1.00 84.89  ?  80   U   A "C4'" 1 
ATOM   1698  O  "O4'" . U   A 1  80   ? 170.386 184.788 164.217 1.00 84.89  ?  80   U   A "O4'" 1 
ATOM   1699  C  "C3'" . U   A 1  80   ? 169.526 186.962 164.163 1.00 84.89  ?  80   U   A "C3'" 1 
ATOM   1700  O  "O3'" . U   A 1  80   ? 169.393 188.159 163.418 1.00 84.89  ?  80   U   A "O3'" 1 
ATOM   1701  C  "C2'" . U   A 1  80   ? 168.351 186.004 164.000 1.00 84.89  ?  80   U   A "C2'" 1 
ATOM   1702  O  "O2'" . U   A 1  80   ? 167.944 185.936 162.641 1.00 84.89  ?  80   U   A "O2'" 1 
ATOM   1703  C  "C1'" . U   A 1  80   ? 168.989 184.664 164.381 1.00 84.89  ?  80   U   A "C1'" 1 
ATOM   1704  N  N1    . U   A 1  80   ? 168.685 184.262 165.777 1.00 84.89  ?  80   U   A N1    1 
ATOM   1705  C  C2    . U   A 1  80   ? 167.553 183.490 165.951 1.00 84.89  ?  80   U   A C2    1 
ATOM   1706  O  O2    . U   A 1  80   ? 166.850 183.142 165.019 1.00 84.89  ?  80   U   A O2    1 
ATOM   1707  N  N3    . U   A 1  80   ? 167.284 183.122 167.246 1.00 84.89  ?  80   U   A N3    1 
ATOM   1708  C  C4    . U   A 1  80   ? 168.013 183.450 168.370 1.00 84.89  ?  80   U   A C4    1 
ATOM   1709  O  O4    . U   A 1  80   ? 167.642 183.048 169.473 1.00 84.89  ?  80   U   A O4    1 
ATOM   1710  C  C5    . U   A 1  80   ? 169.167 184.256 168.113 1.00 84.89  ?  80   U   A C5    1 
ATOM   1711  C  C6    . U   A 1  80   ? 169.458 184.622 166.860 1.00 84.89  ?  80   U   A C6    1 
ATOM   1712  P  P     . C   A 1  81   ? 168.713 189.454 164.083 1.00 75.71  ?  81   C   A P     1 
ATOM   1713  O  OP1   . C   A 1  81   ? 169.615 190.612 163.860 1.00 75.71  ?  81   C   A OP1   1 
ATOM   1714  O  OP2   . C   A 1  81   ? 168.302 189.099 165.466 1.00 75.71  ?  81   C   A OP2   1 
ATOM   1715  O  "O5'" . C   A 1  81   ? 167.394 189.681 163.220 1.00 75.71  ?  81   C   A "O5'" 1 
ATOM   1716  C  "C5'" . C   A 1  81   ? 166.105 189.501 163.788 1.00 75.71  ?  81   C   A "C5'" 1 
ATOM   1717  C  "C4'" . C   A 1  81   ? 165.170 188.823 162.818 1.00 75.71  ?  81   C   A "C4'" 1 
ATOM   1718  O  "O4'" . C   A 1  81   ? 165.479 187.407 162.750 1.00 75.71  ?  81   C   A "O4'" 1 
ATOM   1719  C  "C3'" . C   A 1  81   ? 163.693 188.855 163.176 1.00 75.71  ?  81   C   A "C3'" 1 
ATOM   1720  O  "O3'" . C   A 1  81   ? 163.065 190.085 162.863 1.00 75.71  ?  81   C   A "O3'" 1 
ATOM   1721  C  "C2'" . C   A 1  81   ? 163.138 187.664 162.402 1.00 75.71  ?  81   C   A "C2'" 1 
ATOM   1722  O  "O2'" . C   A 1  81   ? 162.945 188.000 161.036 1.00 75.71  ?  81   C   A "O2'" 1 
ATOM   1723  C  "C1'" . C   A 1  81   ? 164.301 186.670 162.495 1.00 75.71  ?  81   C   A "C1'" 1 
ATOM   1724  N  N1    . C   A 1  81   ? 164.104 185.659 163.566 1.00 75.71  ?  81   C   A N1    1 
ATOM   1725  C  C2    . C   A 1  81   ? 163.437 184.477 163.228 1.00 75.71  ?  81   C   A C2    1 
ATOM   1726  O  O2    . C   A 1  81   ? 163.045 184.319 162.061 1.00 75.71  ?  81   C   A O2    1 
ATOM   1727  N  N3    . C   A 1  81   ? 163.237 183.531 164.174 1.00 75.71  ?  81   C   A N3    1 
ATOM   1728  C  C4    . C   A 1  81   ? 163.672 183.726 165.420 1.00 75.71  ?  81   C   A C4    1 
ATOM   1729  N  N4    . C   A 1  81   ? 163.448 182.765 166.318 1.00 75.71  ?  81   C   A N4    1 
ATOM   1730  C  C5    . C   A 1  81   ? 164.348 184.920 165.800 1.00 75.71  ?  81   C   A C5    1 
ATOM   1731  C  C6    . C   A 1  81   ? 164.546 185.842 164.851 1.00 75.71  ?  81   C   A C6    1 
ATOM   1732  P  P     . U   A 1  82   ? 161.947 190.684 163.848 1.00 71.52  ?  82   U   A P     1 
ATOM   1733  O  OP1   . U   A 1  82   ? 161.667 192.083 163.434 1.00 71.52  ?  82   U   A OP1   1 
ATOM   1734  O  OP2   . U   A 1  82   ? 162.367 190.396 165.243 1.00 71.52  ?  82   U   A OP2   1 
ATOM   1735  O  "O5'" . U   A 1  82   ? 160.653 189.808 163.540 1.00 71.52  ?  82   U   A "O5'" 1 
ATOM   1736  C  "C5'" . U   A 1  82   ? 160.035 189.852 162.263 1.00 71.52  ?  82   U   A "C5'" 1 
ATOM   1737  C  "C4'" . U   A 1  82   ? 158.916 188.847 162.151 1.00 71.52  ?  82   U   A "C4'" 1 
ATOM   1738  O  "O4'" . U   A 1  82   ? 159.455 187.500 162.136 1.00 71.52  ?  82   U   A "O4'" 1 
ATOM   1739  C  "C3'" . U   A 1  82   ? 157.915 188.825 163.294 1.00 71.52  ?  82   U   A "C3'" 1 
ATOM   1740  O  "O3'" . U   A 1  82   ? 156.954 189.863 163.217 1.00 71.52  ?  82   U   A "O3'" 1 
ATOM   1741  C  "C2'" . U   A 1  82   ? 157.320 187.427 163.185 1.00 71.52  ?  82   U   A "C2'" 1 
ATOM   1742  O  "O2'" . U   A 1  82   ? 156.341 187.376 162.158 1.00 71.52  ?  82   U   A "O2'" 1 
ATOM   1743  C  "C1'" . U   A 1  82   ? 158.536 186.610 162.736 1.00 71.52  ?  82   U   A "C1'" 1 
ATOM   1744  N  N1    . U   A 1  82   ? 159.197 185.906 163.863 1.00 71.52  ?  82   U   A N1    1 
ATOM   1745  C  C2    . U   A 1  82   ? 158.673 184.681 164.240 1.00 71.52  ?  82   U   A C2    1 
ATOM   1746  O  O2    . U   A 1  82   ? 157.711 184.168 163.693 1.00 71.52  ?  82   U   A O2    1 
ATOM   1747  N  N3    . U   A 1  82   ? 159.317 184.067 165.286 1.00 71.52  ?  82   U   A N3    1 
ATOM   1748  C  C4    . U   A 1  82   ? 160.409 184.539 165.983 1.00 71.52  ?  82   U   A C4    1 
ATOM   1749  O  O4    . U   A 1  82   ? 160.875 183.867 166.904 1.00 71.52  ?  82   U   A O4    1 
ATOM   1750  C  C5    . U   A 1  82   ? 160.894 185.808 165.538 1.00 71.52  ?  82   U   A C5    1 
ATOM   1751  C  C6    . U   A 1  82   ? 160.290 186.428 164.519 1.00 71.52  ?  82   U   A C6    1 
ATOM   1752  P  P     . G   A 1  83   ? 156.462 190.602 164.557 1.00 66.13  ?  83   G   A P     1 
ATOM   1753  O  OP1   . G   A 1  83   ? 155.636 191.771 164.162 1.00 66.13  ?  83   G   A OP1   1 
ATOM   1754  O  OP2   . G   A 1  83   ? 157.645 190.801 165.433 1.00 66.13  ?  83   G   A OP2   1 
ATOM   1755  O  "O5'" . G   A 1  83   ? 155.507 189.535 165.255 1.00 66.13  ?  83   G   A "O5'" 1 
ATOM   1756  C  "C5'" . G   A 1  83   ? 154.293 189.134 164.637 1.00 66.13  ?  83   G   A "C5'" 1 
ATOM   1757  C  "C4'" . G   A 1  83   ? 153.667 187.959 165.346 1.00 66.13  ?  83   G   A "C4'" 1 
ATOM   1758  O  "O4'" . G   A 1  83   ? 154.503 186.782 165.196 1.00 66.13  ?  83   G   A "O4'" 1 
ATOM   1759  C  "C3'" . G   A 1  83   ? 153.498 188.095 166.851 1.00 66.13  ?  83   G   A "C3'" 1 
ATOM   1760  O  "O3'" . G   A 1  83   ? 152.374 188.875 167.218 1.00 66.13  ?  83   G   A "O3'" 1 
ATOM   1761  C  "C2'" . G   A 1  83   ? 153.410 186.644 167.301 1.00 66.13  ?  83   G   A "C2'" 1 
ATOM   1762  O  "O2'" . G   A 1  83   ? 152.119 186.114 167.038 1.00 66.13  ?  83   G   A "O2'" 1 
ATOM   1763  C  "C1'" . G   A 1  83   ? 154.408 185.976 166.354 1.00 66.13  ?  83   G   A "C1'" 1 
ATOM   1764  N  N9    . G   A 1  83   ? 155.747 185.858 166.963 1.00 66.13  ?  83   G   A N9    1 
ATOM   1765  C  C8    . G   A 1  83   ? 156.869 186.589 166.658 1.00 66.13  ?  83   G   A C8    1 
ATOM   1766  N  N7    . G   A 1  83   ? 157.909 186.256 167.373 1.00 66.13  ?  83   G   A N7    1 
ATOM   1767  C  C5    . G   A 1  83   ? 157.446 185.244 168.203 1.00 66.13  ?  83   G   A C5    1 
ATOM   1768  C  C6    . G   A 1  83   ? 158.119 184.490 169.200 1.00 66.13  ?  83   G   A C6    1 
ATOM   1769  O  O6    . G   A 1  83   ? 159.300 184.569 169.560 1.00 66.13  ?  83   G   A O6    1 
ATOM   1770  N  N1    . G   A 1  83   ? 157.273 183.566 169.803 1.00 66.13  ?  83   G   A N1    1 
ATOM   1771  C  C2    . G   A 1  83   ? 155.949 183.385 169.489 1.00 66.13  ?  83   G   A C2    1 
ATOM   1772  N  N2    . G   A 1  83   ? 155.298 182.440 170.183 1.00 66.13  ?  83   G   A N2    1 
ATOM   1773  N  N3    . G   A 1  83   ? 155.310 184.080 168.563 1.00 66.13  ?  83   G   A N3    1 
ATOM   1774  C  C4    . G   A 1  83   ? 156.112 184.987 167.964 1.00 66.13  ?  83   G   A C4    1 
ATOM   1775  P  P     . A   A 1  84   ? 152.382 189.696 168.600 1.00 64.60  ?  84   A   A P     1 
ATOM   1776  O  OP1   . A   A 1  84   ? 151.276 190.686 168.554 1.00 64.60  ?  84   A   A OP1   1 
ATOM   1777  O  OP2   . A   A 1  84   ? 153.770 190.158 168.854 1.00 64.60  ?  84   A   A OP2   1 
ATOM   1778  O  "O5'" . A   A 1  84   ? 152.020 188.601 169.700 1.00 64.60  ?  84   A   A "O5'" 1 
ATOM   1779  C  "C5'" . A   A 1  84   ? 150.781 187.910 169.655 1.00 64.60  ?  84   A   A "C5'" 1 
ATOM   1780  C  "C4'" . A   A 1  84   ? 150.696 186.845 170.719 1.00 64.60  ?  84   A   A "C4'" 1 
ATOM   1781  O  "O4'" . A   A 1  84   ? 151.664 185.796 170.457 1.00 64.60  ?  84   A   A "O4'" 1 
ATOM   1782  C  "C3'" . A   A 1  84   ? 151.015 187.285 172.138 1.00 64.60  ?  84   A   A "C3'" 1 
ATOM   1783  O  "O3'" . A   A 1  84   ? 149.938 187.960 172.764 1.00 64.60  ?  84   A   A "O3'" 1 
ATOM   1784  C  "C2'" . A   A 1  84   ? 151.392 185.973 172.814 1.00 64.60  ?  84   A   A "C2'" 1 
ATOM   1785  O  "O2'" . A   A 1  84   ? 150.233 185.234 173.167 1.00 64.60  ?  84   A   A "O2'" 1 
ATOM   1786  C  "C1'" . A   A 1  84   ? 152.106 185.238 171.678 1.00 64.60  ?  84   A   A "C1'" 1 
ATOM   1787  N  N9    . A   A 1  84   ? 153.571 185.369 171.772 1.00 64.60  ?  84   A   A N9    1 
ATOM   1788  C  C8    . A   A 1  84   ? 154.417 186.151 171.024 1.00 64.60  ?  84   A   A C8    1 
ATOM   1789  N  N7    . A   A 1  84   ? 155.679 186.037 171.367 1.00 64.60  ?  84   A   A N7    1 
ATOM   1790  C  C5    . A   A 1  84   ? 155.659 185.121 172.410 1.00 64.60  ?  84   A   A C5    1 
ATOM   1791  C  C6    . A   A 1  84   ? 156.668 184.564 173.217 1.00 64.60  ?  84   A   A C6    1 
ATOM   1792  N  N6    . A   A 1  84   ? 157.962 184.863 173.093 1.00 64.60  ?  84   A   A N6    1 
ATOM   1793  N  N1    . A   A 1  84   ? 156.305 183.675 174.171 1.00 64.60  ?  84   A   A N1    1 
ATOM   1794  C  C2    . A   A 1  84   ? 155.010 183.364 174.307 1.00 64.60  ?  84   A   A C2    1 
ATOM   1795  N  N3    . A   A 1  84   ? 153.972 183.821 173.609 1.00 64.60  ?  84   A   A N3    1 
ATOM   1796  C  C4    . A   A 1  84   ? 154.368 184.702 172.670 1.00 64.60  ?  84   A   A C4    1 
ATOM   1797  P  P     . G   A 1  85   ? 150.229 189.145 173.810 1.00 69.65  ?  85   G   A P     1 
ATOM   1798  O  OP1   . G   A 1  85   ? 148.984 189.939 173.967 1.00 69.65  ?  85   G   A OP1   1 
ATOM   1799  O  OP2   . G   A 1  85   ? 151.485 189.822 173.401 1.00 69.65  ?  85   G   A OP2   1 
ATOM   1800  O  "O5'" . G   A 1  85   ? 150.512 188.384 175.181 1.00 69.65  ?  85   G   A "O5'" 1 
ATOM   1801  C  "C5'" . G   A 1  85   ? 149.557 187.484 175.723 1.00 69.65  ?  85   G   A "C5'" 1 
ATOM   1802  C  "C4'" . G   A 1  85   ? 150.157 186.627 176.808 1.00 69.65  ?  85   G   A "C4'" 1 
ATOM   1803  O  "O4'" . G   A 1  85   ? 151.225 185.813 176.264 1.00 69.65  ?  85   G   A "O4'" 1 
ATOM   1804  C  "C3'" . G   A 1  85   ? 150.805 187.371 177.964 1.00 69.65  ?  85   G   A "C3'" 1 
ATOM   1805  O  "O3'" . G   A 1  85   ? 149.859 187.814 178.924 1.00 69.65  ?  85   G   A "O3'" 1 
ATOM   1806  C  "C2'" . G   A 1  85   ? 151.789 186.345 178.514 1.00 69.65  ?  85   G   A "C2'" 1 
ATOM   1807  O  "O2'" . G   A 1  85   ? 151.124 185.411 179.352 1.00 69.65  ?  85   G   A "O2'" 1 
ATOM   1808  C  "C1'" . G   A 1  85   ? 152.227 185.621 177.238 1.00 69.65  ?  85   G   A "C1'" 1 
ATOM   1809  N  N9    . G   A 1  85   ? 153.505 186.130 176.704 1.00 69.65  ?  85   G   A N9    1 
ATOM   1810  C  C8    . G   A 1  85   ? 153.680 187.033 175.684 1.00 69.65  ?  85   G   A C8    1 
ATOM   1811  N  N7    . G   A 1  85   ? 154.936 187.281 175.429 1.00 69.65  ?  85   G   A N7    1 
ATOM   1812  C  C5    . G   A 1  85   ? 155.630 186.489 176.333 1.00 69.65  ?  85   G   A C5    1 
ATOM   1813  C  C6    . G   A 1  85   ? 157.025 186.332 176.535 1.00 69.65  ?  85   G   A C6    1 
ATOM   1814  O  O6    . G   A 1  85   ? 157.954 186.881 175.933 1.00 69.65  ?  85   G   A O6    1 
ATOM   1815  N  N1    . G   A 1  85   ? 157.297 185.428 177.557 1.00 69.65  ?  85   G   A N1    1 
ATOM   1816  C  C2    . G   A 1  85   ? 156.350 184.759 178.292 1.00 69.65  ?  85   G   A C2    1 
ATOM   1817  N  N2    . G   A 1  85   ? 156.811 183.926 179.237 1.00 69.65  ?  85   G   A N2    1 
ATOM   1818  N  N3    . G   A 1  85   ? 155.046 184.895 178.114 1.00 69.65  ?  85   G   A N3    1 
ATOM   1819  C  C4    . G   A 1  85   ? 154.762 185.770 177.125 1.00 69.65  ?  85   G   A C4    1 
ATOM   1820  P  P     . A   A 1  86   ? 149.623 189.384 179.182 1.00 85.02  ?  86   A   A P     1 
ATOM   1821  O  OP1   . A   A 1  86   ? 150.937 190.067 179.064 1.00 85.02  ?  86   A   A OP1   1 
ATOM   1822  O  OP2   . A   A 1  86   ? 148.835 189.524 180.433 1.00 85.02  ?  86   A   A OP2   1 
ATOM   1823  O  "O5'" . A   A 1  86   ? 148.718 189.852 177.956 1.00 85.02  ?  86   A   A "O5'" 1 
ATOM   1824  C  "C5'" . A   A 1  86   ? 147.559 190.651 178.157 1.00 85.02  ?  86   A   A "C5'" 1 
ATOM   1825  C  "C4'" . A   A 1  86   ? 147.916 192.082 178.474 1.00 85.02  ?  86   A   A "C4'" 1 
ATOM   1826  O  "O4'" . A   A 1  86   ? 149.131 192.450 177.780 1.00 85.02  ?  86   A   A "O4'" 1 
ATOM   1827  C  "C3'" . A   A 1  86   ? 146.908 193.141 178.051 1.00 85.02  ?  86   A   A "C3'" 1 
ATOM   1828  O  "O3'" . A   A 1  86   ? 145.851 193.289 178.985 1.00 85.02  ?  86   A   A "O3'" 1 
ATOM   1829  C  "C2'" . A   A 1  86   ? 147.764 194.399 177.921 1.00 85.02  ?  86   A   A "C2'" 1 
ATOM   1830  O  "O2'" . A   A 1  86   ? 147.939 195.018 179.187 1.00 85.02  ?  86   A   A "O2'" 1 
ATOM   1831  C  "C1'" . A   A 1  86   ? 149.112 193.826 177.474 1.00 85.02  ?  86   A   A "C1'" 1 
ATOM   1832  N  N9    . A   A 1  86   ? 149.389 194.011 176.036 1.00 85.02  ?  86   A   A N9    1 
ATOM   1833  C  C8    . A   A 1  86   ? 149.133 193.161 174.988 1.00 85.02  ?  86   A   A C8    1 
ATOM   1834  N  N7    . A   A 1  86   ? 149.525 193.625 173.824 1.00 85.02  ?  86   A   A N7    1 
ATOM   1835  C  C5    . A   A 1  86   ? 150.084 194.859 174.127 1.00 85.02  ?  86   A   A C5    1 
ATOM   1836  C  C6    . A   A 1  86   ? 150.684 195.864 173.341 1.00 85.02  ?  86   A   A C6    1 
ATOM   1837  N  N6    . A   A 1  86   ? 150.839 195.783 172.018 1.00 85.02  ?  86   A   A N6    1 
ATOM   1838  N  N1    . A   A 1  86   ? 151.138 196.974 173.968 1.00 85.02  ?  86   A   A N1    1 
ATOM   1839  C  C2    . A   A 1  86   ? 150.998 197.073 175.296 1.00 85.02  ?  86   A   A C2    1 
ATOM   1840  N  N3    . A   A 1  86   ? 150.450 196.199 176.137 1.00 85.02  ?  86   A   A N3    1 
ATOM   1841  C  C4    . A   A 1  86   ? 150.010 195.106 175.486 1.00 85.02  ?  86   A   A C4    1 
ATOM   1842  P  P     . C   A 1  87   ? 144.434 192.567 178.749 1.00 86.66  ?  87   C   A P     1 
ATOM   1843  O  OP1   . C   A 1  87   ? 144.154 191.727 179.941 1.00 86.66  ?  87   C   A OP1   1 
ATOM   1844  O  OP2   . C   A 1  87   ? 144.446 191.941 177.403 1.00 86.66  ?  87   C   A OP2   1 
ATOM   1845  O  "O5'" . C   A 1  87   ? 143.382 193.765 178.747 1.00 86.66  ?  87   C   A "O5'" 1 
ATOM   1846  C  "C5'" . C   A 1  87   ? 143.796 195.104 178.981 1.00 86.66  ?  87   C   A "C5'" 1 
ATOM   1847  C  "C4'" . C   A 1  87   ? 143.348 195.596 180.335 1.00 86.66  ?  87   C   A "C4'" 1 
ATOM   1848  O  "O4'" . C   A 1  87   ? 143.987 196.865 180.634 1.00 86.66  ?  87   C   A "O4'" 1 
ATOM   1849  C  "C3'" . C   A 1  87   ? 141.863 195.889 180.491 1.00 86.66  ?  87   C   A "C3'" 1 
ATOM   1850  O  "O3'" . C   A 1  87   ? 141.083 194.725 180.707 1.00 86.66  ?  87   C   A "O3'" 1 
ATOM   1851  C  "C2'" . C   A 1  87   ? 141.839 196.868 181.659 1.00 86.66  ?  87   C   A "C2'" 1 
ATOM   1852  O  "O2'" . C   A 1  87   ? 141.965 196.178 182.894 1.00 86.66  ?  87   C   A "O2'" 1 
ATOM   1853  C  "C1'" . C   A 1  87   ? 143.125 197.666 181.418 1.00 86.66  ?  87   C   A "C1'" 1 
ATOM   1854  N  N1    . C   A 1  87   ? 142.881 198.952 180.717 1.00 86.66  ?  87   C   A N1    1 
ATOM   1855  C  C2    . C   A 1  87   ? 142.453 200.063 181.460 1.00 86.66  ?  87   C   A C2    1 
ATOM   1856  O  O2    . C   A 1  87   ? 142.281 199.959 182.685 1.00 86.66  ?  87   C   A O2    1 
ATOM   1857  N  N3    . C   A 1  87   ? 142.232 201.239 180.827 1.00 86.66  ?  87   C   A N3    1 
ATOM   1858  C  C4    . C   A 1  87   ? 142.422 201.344 179.512 1.00 86.66  ?  87   C   A C4    1 
ATOM   1859  N  N4    . C   A 1  87   ? 142.190 202.526 178.937 1.00 86.66  ?  87   C   A N4    1 
ATOM   1860  C  C5    . C   A 1  87   ? 142.859 200.238 178.729 1.00 86.66  ?  87   C   A C5    1 
ATOM   1861  C  C6    . C   A 1  87   ? 143.077 199.081 179.367 1.00 86.66  ?  87   C   A C6    1 
ATOM   1862  P  P     . U   A 1  88   ? 139.480 194.788 180.583 1.00 80.70  ?  88   U   A P     1 
ATOM   1863  O  OP1   . U   A 1  88   ? 139.108 196.075 179.944 1.00 80.70  ?  88   U   A OP1   1 
ATOM   1864  O  OP2   . U   A 1  88   ? 138.901 194.439 181.904 1.00 80.70  ?  88   U   A OP2   1 
ATOM   1865  O  "O5'" . U   A 1  88   ? 139.130 193.634 179.543 1.00 80.70  ?  88   U   A "O5'" 1 
ATOM   1866  C  "C5'" . U   A 1  88   ? 139.306 193.847 178.150 1.00 80.70  ?  88   U   A "C5'" 1 
ATOM   1867  C  "C4'" . U   A 1  88   ? 139.752 192.597 177.435 1.00 80.70  ?  88   U   A "C4'" 1 
ATOM   1868  O  "O4'" . U   A 1  88   ? 138.597 191.801 177.062 1.00 80.70  ?  88   U   A "O4'" 1 
ATOM   1869  C  "C3'" . U   A 1  88   ? 140.478 192.828 176.120 1.00 80.70  ?  88   U   A "C3'" 1 
ATOM   1870  O  "O3'" . U   A 1  88   ? 141.846 193.144 176.295 1.00 80.70  ?  88   U   A "O3'" 1 
ATOM   1871  C  "C2'" . U   A 1  88   ? 140.246 191.525 175.366 1.00 80.70  ?  88   U   A "C2'" 1 
ATOM   1872  O  "O2'" . U   A 1  88   ? 141.163 190.529 175.789 1.00 80.70  ?  88   U   A "O2'" 1 
ATOM   1873  C  "C1'" . U   A 1  88   ? 138.841 191.138 175.838 1.00 80.70  ?  88   U   A "C1'" 1 
ATOM   1874  N  N1    . U   A 1  88   ? 137.794 191.520 174.858 1.00 80.70  ?  88   U   A N1    1 
ATOM   1875  C  C2    . U   A 1  88   ? 137.553 190.651 173.809 1.00 80.70  ?  88   U   A C2    1 
ATOM   1876  O  O2    . U   A 1  88   ? 138.156 189.600 173.664 1.00 80.70  ?  88   U   A O2    1 
ATOM   1877  N  N3    . U   A 1  88   ? 136.577 191.051 172.928 1.00 80.70  ?  88   U   A N3    1 
ATOM   1878  C  C4    . U   A 1  88   ? 135.828 192.208 172.983 1.00 80.70  ?  88   U   A C4    1 
ATOM   1879  O  O4    . U   A 1  88   ? 134.985 192.428 172.113 1.00 80.70  ?  88   U   A O4    1 
ATOM   1880  C  C5    . U   A 1  88   ? 136.134 193.057 174.092 1.00 80.70  ?  88   U   A C5    1 
ATOM   1881  C  C6    . U   A 1  88   ? 137.077 192.692 174.968 1.00 80.70  ?  88   U   A C6    1 
ATOM   1882  P  P     . A   A 1  89   ? 142.524 194.296 175.407 1.00 83.74  ?  89   A   A P     1 
ATOM   1883  O  OP1   . A   A 1  89   ? 143.977 194.283 175.706 1.00 83.74  ?  89   A   A OP1   1 
ATOM   1884  O  OP2   . A   A 1  89   ? 141.744 195.547 175.594 1.00 83.74  ?  89   A   A OP2   1 
ATOM   1885  O  "O5'" . A   A 1  89   ? 142.320 193.797 173.908 1.00 83.74  ?  89   A   A "O5'" 1 
ATOM   1886  C  "C5'" . A   A 1  89   ? 141.535 194.547 172.985 1.00 83.74  ?  89   A   A "C5'" 1 
ATOM   1887  C  "C4'" . A   A 1  89   ? 141.826 194.152 171.558 1.00 83.74  ?  89   A   A "C4'" 1 
ATOM   1888  O  "O4'" . A   A 1  89   ? 142.240 195.332 170.818 1.00 83.74  ?  89   A   A "O4'" 1 
ATOM   1889  C  "C3'" . A   A 1  89   ? 142.945 193.129 171.389 1.00 83.74  ?  89   A   A "C3'" 1 
ATOM   1890  O  "O3'" . A   A 1  89   ? 142.673 192.304 170.257 1.00 83.74  ?  89   A   A "O3'" 1 
ATOM   1891  C  "C2'" . A   A 1  89   ? 144.163 194.006 171.117 1.00 83.74  ?  89   A   A "C2'" 1 
ATOM   1892  O  "O2'" . A   A 1  89   ? 145.201 193.365 170.407 1.00 83.74  ?  89   A   A "O2'" 1 
ATOM   1893  C  "C1'" . A   A 1  89   ? 143.550 195.152 170.313 1.00 83.74  ?  89   A   A "C1'" 1 
ATOM   1894  N  N9    . A   A 1  89   ? 144.262 196.423 170.466 1.00 83.74  ?  89   A   A N9    1 
ATOM   1895  C  C8    . A   A 1  89   ? 144.060 197.366 171.443 1.00 83.74  ?  89   A   A C8    1 
ATOM   1896  N  N7    . A   A 1  89   ? 144.834 198.417 171.334 1.00 83.74  ?  89   A   A N7    1 
ATOM   1897  C  C5    . A   A 1  89   ? 145.593 198.149 170.204 1.00 83.74  ?  89   A   A C5    1 
ATOM   1898  C  C6    . A   A 1  89   ? 146.606 198.871 169.551 1.00 83.74  ?  89   A   A C6    1 
ATOM   1899  N  N6    . A   A 1  89   ? 147.041 200.061 169.970 1.00 83.74  ?  89   A   A N6    1 
ATOM   1900  N  N1    . A   A 1  89   ? 147.165 198.323 168.447 1.00 83.74  ?  89   A   A N1    1 
ATOM   1901  C  C2    . A   A 1  89   ? 146.731 197.126 168.028 1.00 83.74  ?  89   A   A C2    1 
ATOM   1902  N  N3    . A   A 1  89   ? 145.786 196.352 168.560 1.00 83.74  ?  89   A   A N3    1 
ATOM   1903  C  C4    . A   A 1  89   ? 145.249 196.926 169.653 1.00 83.74  ?  89   A   A C4    1 
ATOM   1904  P  P     . G   A 1  90   ? 142.169 190.792 170.468 1.00 72.72  ?  90   G   A P     1 
ATOM   1905  O  OP1   . G   A 1  90   ? 141.364 190.748 171.716 1.00 72.72  ?  90   G   A OP1   1 
ATOM   1906  O  OP2   . G   A 1  90   ? 143.341 189.892 170.319 1.00 72.72  ?  90   G   A OP2   1 
ATOM   1907  O  "O5'" . G   A 1  90   ? 141.188 190.531 169.240 1.00 72.72  ?  90   G   A "O5'" 1 
ATOM   1908  C  "C5'" . G   A 1  90   ? 139.896 191.120 169.198 1.00 72.72  ?  90   G   A "C5'" 1 
ATOM   1909  C  "C4'" . G   A 1  90   ? 138.994 190.407 168.222 1.00 72.72  ?  90   G   A "C4'" 1 
ATOM   1910  O  "O4'" . G   A 1  90   ? 138.712 189.065 168.700 1.00 72.72  ?  90   G   A "O4'" 1 
ATOM   1911  C  "C3'" . G   A 1  90   ? 137.618 191.023 168.013 1.00 72.72  ?  90   G   A "C3'" 1 
ATOM   1912  O  "O3'" . G   A 1  90   ? 137.636 192.103 167.095 1.00 72.72  ?  90   G   A "O3'" 1 
ATOM   1913  C  "C2'" . G   A 1  90   ? 136.787 189.838 167.539 1.00 72.72  ?  90   G   A "C2'" 1 
ATOM   1914  O  "O2'" . G   A 1  90   ? 137.010 189.584 166.161 1.00 72.72  ?  90   G   A "O2'" 1 
ATOM   1915  C  "C1'" . G   A 1  90   ? 137.397 188.691 168.347 1.00 72.72  ?  90   G   A "C1'" 1 
ATOM   1916  N  N9    . G   A 1  90   ? 136.640 188.408 169.583 1.00 72.72  ?  90   G   A N9    1 
ATOM   1917  C  C8    . G   A 1  90   ? 137.103 188.563 170.867 1.00 72.72  ?  90   G   A C8    1 
ATOM   1918  N  N7    . G   A 1  90   ? 136.227 188.234 171.775 1.00 72.72  ?  90   G   A N7    1 
ATOM   1919  C  C5    . G   A 1  90   ? 135.115 187.831 171.050 1.00 72.72  ?  90   G   A C5    1 
ATOM   1920  C  C6    . G   A 1  90   ? 133.853 187.363 171.499 1.00 72.72  ?  90   G   A C6    1 
ATOM   1921  O  O6    . G   A 1  90   ? 133.458 187.208 172.661 1.00 72.72  ?  90   G   A O6    1 
ATOM   1922  N  N1    . G   A 1  90   ? 133.010 187.061 170.435 1.00 72.72  ?  90   G   A N1    1 
ATOM   1923  C  C2    . G   A 1  90   ? 133.337 187.195 169.110 1.00 72.72  ?  90   G   A C2    1 
ATOM   1924  N  N2    . G   A 1  90   ? 132.388 186.852 168.228 1.00 72.72  ?  90   G   A N2    1 
ATOM   1925  N  N3    . G   A 1  90   ? 134.511 187.627 168.679 1.00 72.72  ?  90   G   A N3    1 
ATOM   1926  C  C4    . G   A 1  90   ? 135.351 187.928 169.694 1.00 72.72  ?  90   G   A C4    1 
ATOM   1927  P  P     . G   A 1  91   ? 136.611 193.332 167.257 1.00 81.00  ?  91   G   A P     1 
ATOM   1928  O  OP1   . G   A 1  91   ? 135.265 192.796 167.583 1.00 81.00  ?  91   G   A OP1   1 
ATOM   1929  O  OP2   . G   A 1  91   ? 136.777 194.214 166.075 1.00 81.00  ?  91   G   A OP2   1 
ATOM   1930  O  "O5'" . G   A 1  91   ? 137.147 194.119 168.533 1.00 81.00  ?  91   G   A "O5'" 1 
ATOM   1931  C  "C5'" . G   A 1  91   ? 136.250 194.806 169.392 1.00 81.00  ?  91   G   A "C5'" 1 
ATOM   1932  C  "C4'" . G   A 1  91   ? 136.743 196.193 169.718 1.00 81.00  ?  91   G   A "C4'" 1 
ATOM   1933  O  "O4'" . G   A 1  91   ? 138.124 196.132 170.160 1.00 81.00  ?  91   G   A "O4'" 1 
ATOM   1934  C  "C3'" . G   A 1  91   ? 136.773 197.183 168.563 1.00 81.00  ?  91   G   A "C3'" 1 
ATOM   1935  O  "O3'" . G   A 1  91   ? 135.506 197.754 168.283 1.00 81.00  ?  91   G   A "O3'" 1 
ATOM   1936  C  "C2'" . G   A 1  91   ? 137.811 198.195 169.025 1.00 81.00  ?  91   G   A "C2'" 1 
ATOM   1937  O  "O2'" . G   A 1  91   ? 137.254 199.087 169.979 1.00 81.00  ?  91   G   A "O2'" 1 
ATOM   1938  C  "C1'" . G   A 1  91   ? 138.816 197.289 169.736 1.00 81.00  ?  91   G   A "C1'" 1 
ATOM   1939  N  N9    . G   A 1  91   ? 139.913 196.884 168.837 1.00 81.00  ?  91   G   A N9    1 
ATOM   1940  C  C8    . G   A 1  91   ? 140.025 195.710 168.131 1.00 81.00  ?  91   G   A C8    1 
ATOM   1941  N  N7    . G   A 1  91   ? 141.112 195.647 167.412 1.00 81.00  ?  91   G   A N7    1 
ATOM   1942  C  C5    . G   A 1  91   ? 141.756 196.853 167.654 1.00 81.00  ?  91   G   A C5    1 
ATOM   1943  C  C6    . G   A 1  91   ? 142.983 197.357 167.151 1.00 81.00  ?  91   G   A C6    1 
ATOM   1944  O  O6    . G   A 1  91   ? 143.772 196.820 166.365 1.00 81.00  ?  91   G   A O6    1 
ATOM   1945  N  N1    . G   A 1  91   ? 143.261 198.624 167.656 1.00 81.00  ?  91   G   A N1    1 
ATOM   1946  C  C2    . G   A 1  91   ? 142.463 199.317 168.533 1.00 81.00  ?  91   G   A C2    1 
ATOM   1947  N  N2    . G   A 1  91   ? 142.905 200.528 168.904 1.00 81.00  ?  91   G   A N2    1 
ATOM   1948  N  N3    . G   A 1  91   ? 141.317 198.859 169.008 1.00 81.00  ?  91   G   A N3    1 
ATOM   1949  C  C4    . G   A 1  91   ? 141.027 197.629 168.530 1.00 81.00  ?  91   G   A C4    1 
ATOM   1950  P  P     . G   A 1  92   ? 135.206 198.380 166.833 1.00 85.27  ?  92   G   A P     1 
ATOM   1951  O  OP1   . G   A 1  92   ? 133.735 198.401 166.635 1.00 85.27  ?  92   G   A OP1   1 
ATOM   1952  O  OP2   . G   A 1  92   ? 136.070 197.683 165.846 1.00 85.27  ?  92   G   A OP2   1 
ATOM   1953  O  "O5'" . G   A 1  92   ? 135.710 199.887 166.949 1.00 85.27  ?  92   G   A "O5'" 1 
ATOM   1954  C  "C5'" . G   A 1  92   ? 135.109 200.785 167.870 1.00 85.27  ?  92   G   A "C5'" 1 
ATOM   1955  C  "C4'" . G   A 1  92   ? 136.010 201.954 168.178 1.00 85.27  ?  92   G   A "C4'" 1 
ATOM   1956  O  "O4'" . G   A 1  92   ? 137.317 201.473 168.588 1.00 85.27  ?  92   G   A "O4'" 1 
ATOM   1957  C  "C3'" . G   A 1  92   ? 136.312 202.897 167.024 1.00 85.27  ?  92   G   A "C3'" 1 
ATOM   1958  O  "O3'" . G   A 1  92   ? 135.275 203.834 166.789 1.00 85.27  ?  92   G   A "O3'" 1 
ATOM   1959  C  "C2'" . G   A 1  92   ? 137.624 203.539 167.457 1.00 85.27  ?  92   G   A "C2'" 1 
ATOM   1960  O  "O2'" . G   A 1  92   ? 137.392 204.556 168.420 1.00 85.27  ?  92   G   A "O2'" 1 
ATOM   1961  C  "C1'" . G   A 1  92   ? 138.319 202.367 168.150 1.00 85.27  ?  92   G   A "C1'" 1 
ATOM   1962  N  N9    . G   A 1  92   ? 139.233 201.649 167.241 1.00 85.27  ?  92   G   A N9    1 
ATOM   1963  C  C8    . G   A 1  92   ? 138.983 200.489 166.549 1.00 85.27  ?  92   G   A C8    1 
ATOM   1964  N  N7    . G   A 1  92   ? 139.994 200.097 165.822 1.00 85.27  ?  92   G   A N7    1 
ATOM   1965  C  C5    . G   A 1  92   ? 140.971 201.058 166.046 1.00 85.27  ?  92   G   A C5    1 
ATOM   1966  C  C6    . G   A 1  92   ? 142.288 201.169 165.530 1.00 85.27  ?  92   G   A C6    1 
ATOM   1967  O  O6    . G   A 1  92   ? 142.875 200.416 164.743 1.00 85.27  ?  92   G   A O6    1 
ATOM   1968  N  N1    . G   A 1  92   ? 142.936 202.300 166.019 1.00 85.27  ?  92   G   A N1    1 
ATOM   1969  C  C2    . G   A 1  92   ? 142.389 203.206 166.894 1.00 85.27  ?  92   G   A C2    1 
ATOM   1970  N  N2    . G   A 1  92   ? 143.173 204.234 167.250 1.00 85.27  ?  92   G   A N2    1 
ATOM   1971  N  N3    . G   A 1  92   ? 141.163 203.113 167.383 1.00 85.27  ?  92   G   A N3    1 
ATOM   1972  C  C4    . G   A 1  92   ? 140.516 202.023 166.919 1.00 85.27  ?  92   G   A C4    1 
ATOM   1973  P  P     . C   A 1  93   ? 135.018 204.401 165.307 1.00 90.39  ?  93   C   A P     1 
ATOM   1974  O  OP1   . C   A 1  93   ? 133.700 205.086 165.301 1.00 90.39  ?  93   C   A OP1   1 
ATOM   1975  O  OP2   . C   A 1  93   ? 135.277 203.301 164.344 1.00 90.39  ?  93   C   A OP2   1 
ATOM   1976  O  "O5'" . C   A 1  93   ? 136.149 205.506 165.110 1.00 90.39  ?  93   C   A "O5'" 1 
ATOM   1977  C  "C5'" . C   A 1  93   ? 136.173 206.678 165.912 1.00 90.39  ?  93   C   A "C5'" 1 
ATOM   1978  C  "C4'" . C   A 1  93   ? 137.497 207.394 165.810 1.00 90.39  ?  93   C   A "C4'" 1 
ATOM   1979  O  "O4'" . C   A 1  93   ? 138.570 206.488 166.177 1.00 90.39  ?  93   C   A "O4'" 1 
ATOM   1980  C  "C3'" . C   A 1  93   ? 137.887 207.883 164.424 1.00 90.39  ?  93   C   A "C3'" 1 
ATOM   1981  O  "O3'" . C   A 1  93   ? 137.262 209.105 164.068 1.00 90.39  ?  93   C   A "O3'" 1 
ATOM   1982  C  "C2'" . C   A 1  93   ? 139.406 207.975 164.518 1.00 90.39  ?  93   C   A "C2'" 1 
ATOM   1983  O  "O2'" . C   A 1  93   ? 139.797 209.167 165.181 1.00 90.39  ?  93   C   A "O2'" 1 
ATOM   1984  C  "C1'" . C   A 1  93   ? 139.731 206.786 165.428 1.00 90.39  ?  93   C   A "C1'" 1 
ATOM   1985  N  N1    . C   A 1  93   ? 140.149 205.577 164.672 1.00 90.39  ?  93   C   A N1    1 
ATOM   1986  C  C2    . C   A 1  93   ? 141.491 205.453 164.286 1.00 90.39  ?  93   C   A C2    1 
ATOM   1987  O  O2    . C   A 1  93   ? 142.295 206.352 164.578 1.00 90.39  ?  93   C   A O2    1 
ATOM   1988  N  N3    . C   A 1  93   ? 141.887 204.355 163.601 1.00 90.39  ?  93   C   A N3    1 
ATOM   1989  C  C4    . C   A 1  93   ? 141.010 203.398 163.297 1.00 90.39  ?  93   C   A C4    1 
ATOM   1990  N  N4    . C   A 1  93   ? 141.450 202.335 162.618 1.00 90.39  ?  93   C   A N4    1 
ATOM   1991  C  C5    . C   A 1  93   ? 139.641 203.489 163.675 1.00 90.39  ?  93   C   A C5    1 
ATOM   1992  C  C6    . C   A 1  93   ? 139.264 204.579 164.355 1.00 90.39  ?  93   C   A C6    1 
ATOM   1993  P  P     . C   A 1  94   ? 136.338 209.186 162.755 1.00 96.13  ?  94   C   A P     1 
ATOM   1994  O  OP1   . C   A 1  94   ? 135.264 210.179 163.013 1.00 96.13  ?  94   C   A OP1   1 
ATOM   1995  O  OP2   . C   A 1  94   ? 135.976 207.800 162.363 1.00 96.13  ?  94   C   A OP2   1 
ATOM   1996  O  "O5'" . C   A 1  94   ? 137.300 209.781 161.633 1.00 96.13  ?  94   C   A "O5'" 1 
ATOM   1997  C  "C5'" . C   A 1  94   ? 137.645 211.159 161.623 1.00 96.13  ?  94   C   A "C5'" 1 
ATOM   1998  C  "C4'" . C   A 1  94   ? 138.978 211.393 160.957 1.00 96.13  ?  94   C   A "C4'" 1 
ATOM   1999  O  "O4'" . C   A 1  94   ? 139.984 210.548 161.577 1.00 96.13  ?  94   C   A "O4'" 1 
ATOM   2000  C  "C3'" . C   A 1  94   ? 139.063 211.038 159.480 1.00 96.13  ?  94   C   A "C3'" 1 
ATOM   2001  O  "O3'" . C   A 1  94   ? 138.527 212.038 158.629 1.00 96.13  ?  94   C   A "O3'" 1 
ATOM   2002  C  "C2'" . C   A 1  94   ? 140.555 210.797 159.281 1.00 96.13  ?  94   C   A "C2'" 1 
ATOM   2003  O  "O2'" . C   A 1  94   ? 141.251 212.029 159.160 1.00 96.13  ?  94   C   A "O2'" 1 
ATOM   2004  C  "C1'" . C   A 1  94   ? 140.942 210.153 160.616 1.00 96.13  ?  94   C   A "C1'" 1 
ATOM   2005  N  N1    . C   A 1  94   ? 140.985 208.669 160.549 1.00 96.13  ?  94   C   A N1    1 
ATOM   2006  C  C2    . C   A 1  94   ? 142.157 208.049 160.098 1.00 96.13  ?  94   C   A C2    1 
ATOM   2007  O  O2    . C   A 1  94   ? 143.126 208.749 159.764 1.00 96.13  ?  94   C   A O2    1 
ATOM   2008  N  N3    . C   A 1  94   ? 142.213 206.698 160.034 1.00 96.13  ?  94   C   A N3    1 
ATOM   2009  C  C4    . C   A 1  94   ? 141.161 205.963 160.399 1.00 96.13  ?  94   C   A C4    1 
ATOM   2010  N  N4    . C   A 1  94   ? 141.259 204.635 160.319 1.00 96.13  ?  94   C   A N4    1 
ATOM   2011  C  C5    . C   A 1  94   ? 139.956 206.559 160.864 1.00 96.13  ?  94   C   A C5    1 
ATOM   2012  C  C6    . C   A 1  94   ? 139.918 207.894 160.923 1.00 96.13  ?  94   C   A C6    1 
ATOM   2013  P  P     . A   A 1  95   ? 137.418 211.651 157.530 1.00 96.69  ?  95   A   A P     1 
ATOM   2014  O  OP1   . A   A 1  95   ? 136.698 212.893 157.151 1.00 96.69  ?  95   A   A OP1   1 
ATOM   2015  O  OP2   . A   A 1  95   ? 136.652 210.487 158.044 1.00 96.69  ?  95   A   A OP2   1 
ATOM   2016  O  "O5'" . A   A 1  95   ? 138.264 211.167 156.269 1.00 96.69  ?  95   A   A "O5'" 1 
ATOM   2017  C  "C5'" . A   A 1  95   ? 138.842 212.108 155.374 1.00 96.69  ?  95   A   A "C5'" 1 
ATOM   2018  C  "C4'" . A   A 1  95   ? 140.074 211.555 154.702 1.00 96.69  ?  95   A   A "C4'" 1 
ATOM   2019  O  "O4'" . A   A 1  95   ? 140.907 210.885 155.686 1.00 96.69  ?  95   A   A "O4'" 1 
ATOM   2020  C  "C3'" . A   A 1  95   ? 139.846 210.496 153.633 1.00 96.69  ?  95   A   A "C3'" 1 
ATOM   2021  O  "O3'" . A   A 1  95   ? 139.485 211.036 152.373 1.00 96.69  ?  95   A   A "O3'" 1 
ATOM   2022  C  "C2'" . A   A 1  95   ? 141.178 209.760 153.615 1.00 96.69  ?  95   A   A "C2'" 1 
ATOM   2023  O  "O2'" . A   A 1  95   ? 142.157 210.511 152.912 1.00 96.69  ?  95   A   A "O2'" 1 
ATOM   2024  C  "C1'" . A   A 1  95   ? 141.540 209.766 155.099 1.00 96.69  ?  95   A   A "C1'" 1 
ATOM   2025  N  N9    . A   A 1  95   ? 141.067 208.547 155.782 1.00 96.69  ?  95   A   A N9    1 
ATOM   2026  C  C8    . A   A 1  95   ? 140.046 208.438 156.692 1.00 96.69  ?  95   A   A C8    1 
ATOM   2027  N  N7    . A   A 1  95   ? 139.852 207.220 157.134 1.00 96.69  ?  95   A   A N7    1 
ATOM   2028  C  C5    . A   A 1  95   ? 140.809 206.473 156.464 1.00 96.69  ?  95   A   A C5    1 
ATOM   2029  C  C6    . A   A 1  95   ? 141.132 205.104 156.485 1.00 96.69  ?  95   A   A C6    1 
ATOM   2030  N  N6    . A   A 1  95   ? 140.493 204.209 157.242 1.00 96.69  ?  95   A   A N6    1 
ATOM   2031  N  N1    . A   A 1  95   ? 142.145 204.679 155.695 1.00 96.69  ?  95   A   A N1    1 
ATOM   2032  C  C2    . A   A 1  95   ? 142.792 205.571 154.932 1.00 96.69  ?  95   A   A C2    1 
ATOM   2033  N  N3    . A   A 1  95   ? 142.579 206.882 154.830 1.00 96.69  ?  95   A   A N3    1 
ATOM   2034  C  C4    . A   A 1  95   ? 141.566 207.274 155.627 1.00 96.69  ?  95   A   A C4    1 
ATOM   2035  P  P     . G   A 1  96   ? 138.324 210.349 151.496 1.00 99.83  ?  96   G   A P     1 
ATOM   2036  O  OP1   . G   A 1  96   ? 138.290 211.022 150.173 1.00 99.83  ?  96   G   A OP1   1 
ATOM   2037  O  OP2   . G   A 1  96   ? 137.093 210.300 152.325 1.00 99.83  ?  96   G   A OP2   1 
ATOM   2038  O  "O5'" . G   A 1  96   ? 138.824 208.851 151.273 1.00 99.83  ?  96   G   A "O5'" 1 
ATOM   2039  C  "C5'" . G   A 1  96   ? 139.854 208.547 150.341 1.00 99.83  ?  96   G   A "C5'" 1 
ATOM   2040  C  "C4'" . G   A 1  96   ? 140.569 207.271 150.713 1.00 99.83  ?  96   G   A "C4'" 1 
ATOM   2041  O  "O4'" . G   A 1  96   ? 140.287 206.950 152.099 1.00 99.83  ?  96   G   A "O4'" 1 
ATOM   2042  C  "C3'" . G   A 1  96   ? 140.154 206.021 149.951 1.00 99.83  ?  96   G   A "C3'" 1 
ATOM   2043  O  "O3'" . G   A 1  96   ? 140.798 205.904 148.692 1.00 99.83  ?  96   G   A "O3'" 1 
ATOM   2044  C  "C2'" . G   A 1  96   ? 140.517 204.901 150.919 1.00 99.83  ?  96   G   A "C2'" 1 
ATOM   2045  O  "O2'" . G   A 1  96   ? 141.907 204.617 150.857 1.00 99.83  ?  96   G   A "O2'" 1 
ATOM   2046  C  "C1'" . G   A 1  96   ? 140.217 205.552 152.270 1.00 99.83  ?  96   G   A "C1'" 1 
ATOM   2047  N  N9    . G   A 1  96   ? 138.876 205.205 152.781 1.00 99.83  ?  96   G   A N9    1 
ATOM   2048  C  C8    . G   A 1  96   ? 137.680 205.812 152.478 1.00 99.83  ?  96   G   A C8    1 
ATOM   2049  N  N7    . G   A 1  96   ? 136.660 205.277 153.093 1.00 99.83  ?  96   G   A N7    1 
ATOM   2050  C  C5    . G   A 1  96   ? 137.215 204.255 153.850 1.00 99.83  ?  96   G   A C5    1 
ATOM   2051  C  C6    . G   A 1  96   ? 136.600 203.324 154.727 1.00 99.83  ?  96   G   A C6    1 
ATOM   2052  O  O6    . G   A 1  96   ? 135.403 203.213 155.019 1.00 99.83  ?  96   G   A O6    1 
ATOM   2053  N  N1    . G   A 1  96   ? 137.533 202.459 155.290 1.00 99.83  ?  96   G   A N1    1 
ATOM   2054  C  C2    . G   A 1  96   ? 138.883 202.485 155.043 1.00 99.83  ?  96   G   A C2    1 
ATOM   2055  N  N2    . G   A 1  96   ? 139.620 201.566 155.684 1.00 99.83  ?  96   G   A N2    1 
ATOM   2056  N  N3    . G   A 1  96   ? 139.468 203.347 154.228 1.00 99.83  ?  96   G   A N3    1 
ATOM   2057  C  C4    . G   A 1  96   ? 138.581 204.196 153.668 1.00 99.83  ?  96   G   A C4    1 
ATOM   2058  P  P     . A   A 1  97   ? 139.939 205.684 147.350 1.00 102.21 ?  97   A   A P     1 
ATOM   2059  O  OP1   . A   A 1  97   ? 140.889 205.548 146.217 1.00 102.21 ?  97   A   A OP1   1 
ATOM   2060  O  OP2   . A   A 1  97   ? 138.888 206.732 147.304 1.00 102.21 ?  97   A   A OP2   1 
ATOM   2061  O  "O5'" . A   A 1  97   ? 139.222 204.277 147.564 1.00 102.21 ?  97   A   A "O5'" 1 
ATOM   2062  C  "C5'" . A   A 1  97   ? 139.971 203.073 147.665 1.00 102.21 ?  97   A   A "C5'" 1 
ATOM   2063  C  "C4'" . A   A 1  97   ? 139.146 201.974 148.286 1.00 102.21 ?  97   A   A "C4'" 1 
ATOM   2064  O  "O4'" . A   A 1  97   ? 138.587 202.448 149.537 1.00 102.21 ?  97   A   A "O4'" 1 
ATOM   2065  C  "C3'" . A   A 1  97   ? 137.938 201.512 147.482 1.00 102.21 ?  97   A   A "C3'" 1 
ATOM   2066  O  "O3'" . A   A 1  97   ? 138.272 200.536 146.509 1.00 102.21 ?  97   A   A "O3'" 1 
ATOM   2067  C  "C2'" . A   A 1  97   ? 136.995 200.980 148.556 1.00 102.21 ?  97   A   A "C2'" 1 
ATOM   2068  O  "O2'" . A   A 1  97   ? 137.352 199.657 148.930 1.00 102.21 ?  97   A   A "O2'" 1 
ATOM   2069  C  "C1'" . A   A 1  97   ? 137.297 201.913 149.730 1.00 102.21 ?  97   A   A "C1'" 1 
ATOM   2070  N  N9    . A   A 1  97   ? 136.335 203.027 149.829 1.00 102.21 ?  97   A   A N9    1 
ATOM   2071  C  C8    . A   A 1  97   ? 136.378 204.245 149.195 1.00 102.21 ?  97   A   A C8    1 
ATOM   2072  N  N7    . A   A 1  97   ? 135.372 205.031 149.490 1.00 102.21 ?  97   A   A N7    1 
ATOM   2073  C  C5    . A   A 1  97   ? 134.616 204.281 150.380 1.00 102.21 ?  97   A   A C5    1 
ATOM   2074  C  C6    . A   A 1  97   ? 133.417 204.540 151.069 1.00 102.21 ?  97   A   A C6    1 
ATOM   2075  N  N6    . A   A 1  97   ? 132.737 205.685 150.963 1.00 102.21 ?  97   A   A N6    1 
ATOM   2076  N  N1    . A   A 1  97   ? 132.930 203.574 151.882 1.00 102.21 ?  97   A   A N1    1 
ATOM   2077  C  C2    . A   A 1  97   ? 133.604 202.421 151.995 1.00 102.21 ?  97   A   A C2    1 
ATOM   2078  N  N3    . A   A 1  97   ? 134.740 202.062 151.399 1.00 102.21 ?  97   A   A N3    1 
ATOM   2079  C  C4    . A   A 1  97   ? 135.196 203.043 150.598 1.00 102.21 ?  97   A   A C4    1 
ATOM   2080  P  P     . G   A 1  98   ? 138.508 200.944 144.971 1.00 101.87 ?  98   G   A P     1 
ATOM   2081  O  OP1   . G   A 1  98   ? 138.422 202.420 144.839 1.00 101.87 ?  98   G   A OP1   1 
ATOM   2082  O  OP2   . G   A 1  98   ? 137.621 200.090 144.140 1.00 101.87 ?  98   G   A OP2   1 
ATOM   2083  O  "O5'" . G   A 1  98   ? 140.010 200.492 144.689 1.00 101.87 ?  98   G   A "O5'" 1 
ATOM   2084  C  "C5'" . G   A 1  98   ? 140.406 199.140 144.871 1.00 101.87 ?  98   G   A "C5'" 1 
ATOM   2085  C  "C4'" . G   A 1  98   ? 141.681 199.033 145.670 1.00 101.87 ?  98   G   A "C4'" 1 
ATOM   2086  O  "O4'" . G   A 1  98   ? 141.631 199.950 146.794 1.00 101.87 ?  98   G   A "O4'" 1 
ATOM   2087  C  "C3'" . G   A 1  98   ? 141.953 197.679 146.309 1.00 101.87 ?  98   G   A "C3'" 1 
ATOM   2088  O  "O3'" . G   A 1  98   ? 142.512 196.735 145.411 1.00 101.87 ?  98   G   A "O3'" 1 
ATOM   2089  C  "C2'" . G   A 1  98   ? 142.866 198.032 147.478 1.00 101.87 ?  98   G   A "C2'" 1 
ATOM   2090  O  "O2'" . G   A 1  98   ? 144.205 198.201 147.037 1.00 101.87 ?  98   G   A "O2'" 1 
ATOM   2091  C  "C1'" . G   A 1  98   ? 142.319 199.400 147.898 1.00 101.87 ?  98   G   A "C1'" 1 
ATOM   2092  N  N9    . G   A 1  98   ? 141.403 199.329 149.057 1.00 101.87 ?  98   G   A N9    1 
ATOM   2093  C  C8    . G   A 1  98   ? 140.291 198.534 149.229 1.00 101.87 ?  98   G   A C8    1 
ATOM   2094  N  N7    . G   A 1  98   ? 139.688 198.716 150.370 1.00 101.87 ?  98   G   A N7    1 
ATOM   2095  C  C5    . G   A 1  98   ? 140.443 199.695 150.996 1.00 101.87 ?  98   G   A C5    1 
ATOM   2096  C  C6    . G   A 1  98   ? 140.274 200.306 152.264 1.00 101.87 ?  98   G   A C6    1 
ATOM   2097  O  O6    . G   A 1  98   ? 139.396 200.085 153.106 1.00 101.87 ?  98   G   A O6    1 
ATOM   2098  N  N1    . G   A 1  98   ? 141.263 201.251 152.514 1.00 101.87 ?  98   G   A N1    1 
ATOM   2099  C  C2    . G   A 1  98   ? 142.282 201.571 151.652 1.00 101.87 ?  98   G   A C2    1 
ATOM   2100  N  N2    . G   A 1  98   ? 143.139 202.513 152.073 1.00 101.87 ?  98   G   A N2    1 
ATOM   2101  N  N3    . G   A 1  98   ? 142.450 201.010 150.465 1.00 101.87 ?  98   G   A N3    1 
ATOM   2102  C  C4    . G   A 1  98   ? 141.501 200.086 150.202 1.00 101.87 ?  98   G   A C4    1 
ATOM   2103  P  P     . G   A 1  99   ? 142.050 195.197 145.471 1.00 95.73  ?  99   G   A P     1 
ATOM   2104  O  OP1   . G   A 1  99   ? 142.552 194.519 144.248 1.00 95.73  ?  99   G   A OP1   1 
ATOM   2105  O  OP2   . G   A 1  99   ? 140.599 195.166 145.783 1.00 95.73  ?  99   G   A OP2   1 
ATOM   2106  O  "O5'" . G   A 1  99   ? 142.837 194.601 146.723 1.00 95.73  ?  99   G   A "O5'" 1 
ATOM   2107  C  "C5'" . G   A 1  99   ? 144.250 194.464 146.696 1.00 95.73  ?  99   G   A "C5'" 1 
ATOM   2108  C  "C4'" . G   A 1  99   ? 144.828 194.320 148.082 1.00 95.73  ?  99   G   A "C4'" 1 
ATOM   2109  O  "O4'" . G   A 1  99   ? 144.300 195.360 148.945 1.00 95.73  ?  99   G   A "O4'" 1 
ATOM   2110  C  "C3'" . G   A 1  99   ? 144.501 193.030 148.818 1.00 95.73  ?  99   G   A "C3'" 1 
ATOM   2111  O  "O3'" . G   A 1  99   ? 145.324 191.945 148.427 1.00 95.73  ?  99   G   A "O3'" 1 
ATOM   2112  C  "C2'" . G   A 1  99   ? 144.671 193.425 150.282 1.00 95.73  ?  99   G   A "C2'" 1 
ATOM   2113  O  "O2'" . G   A 1  99   ? 146.042 193.399 150.652 1.00 95.73  ?  99   G   A "O2'" 1 
ATOM   2114  C  "C1'" . G   A 1  99   ? 144.201 194.882 150.270 1.00 95.73  ?  99   G   A "C1'" 1 
ATOM   2115  N  N9    . G   A 1  99   ? 142.813 195.046 150.751 1.00 95.73  ?  99   G   A N9    1 
ATOM   2116  C  C8    . G   A 1  99   ? 141.677 194.365 150.373 1.00 95.73  ?  99   G   A C8    1 
ATOM   2117  N  N7    . G   A 1  99   ? 140.603 194.760 151.000 1.00 95.73  ?  99   G   A N7    1 
ATOM   2118  C  C5    . G   A 1  99   ? 141.052 195.764 151.845 1.00 95.73  ?  99   G   A C5    1 
ATOM   2119  C  C6    . G   A 1  99   ? 140.344 196.569 152.774 1.00 95.73  ?  99   G   A C6    1 
ATOM   2120  O  O6    . G   A 1  99   ? 139.137 196.556 153.045 1.00 95.73  ?  99   G   A O6    1 
ATOM   2121  N  N1    . G   A 1  99   ? 141.190 197.463 153.422 1.00 95.73  ?  99   G   A N1    1 
ATOM   2122  C  C2    . G   A 1  99   ? 142.541 197.573 153.206 1.00 95.73  ?  99   G   A C2    1 
ATOM   2123  N  N2    . G   A 1  99   ? 143.185 198.499 153.931 1.00 95.73  ?  99   G   A N2    1 
ATOM   2124  N  N3    . G   A 1  99   ? 143.213 196.828 152.344 1.00 95.73  ?  99   G   A N3    1 
ATOM   2125  C  C4    . G   A 1  99   ? 142.410 195.953 151.702 1.00 95.73  ?  99   G   A C4    1 
ATOM   2126  P  P     . C   A 1  100  ? 144.812 190.431 148.604 1.00 81.60  ?  100  C   A P     1 
ATOM   2127  O  OP1   . C   A 1  100  ? 143.567 190.273 147.809 1.00 81.60  ?  100  C   A OP1   1 
ATOM   2128  O  OP2   . C   A 1  100  ? 144.806 190.097 150.050 1.00 81.60  ?  100  C   A OP2   1 
ATOM   2129  O  "O5'" . C   A 1  100  ? 145.951 189.560 147.913 1.00 81.60  ?  100  C   A "O5'" 1 
ATOM   2130  C  "C5'" . C   A 1  100  ? 146.188 189.643 146.512 1.00 81.60  ?  100  C   A "C5'" 1 
ATOM   2131  C  "C4'" . C   A 1  100  ? 147.618 189.313 146.144 1.00 81.60  ?  100  C   A "C4'" 1 
ATOM   2132  O  "O4'" . C   A 1  100  ? 148.467 190.468 146.385 1.00 81.60  ?  100  C   A "O4'" 1 
ATOM   2133  C  "C3'" . C   A 1  100  ? 148.256 188.142 146.894 1.00 81.60  ?  100  C   A "C3'" 1 
ATOM   2134  O  "O3'" . C   A 1  100  ? 149.071 187.391 145.995 1.00 81.60  ?  100  C   A "O3'" 1 
ATOM   2135  C  "C2'" . C   A 1  100  ? 149.141 188.834 147.930 1.00 81.60  ?  100  C   A "C2'" 1 
ATOM   2136  O  "O2'" . C   A 1  100  ? 150.249 188.072 148.360 1.00 81.60  ?  100  C   A "O2'" 1 
ATOM   2137  C  "C1'" . C   A 1  100  ? 149.574 190.090 147.179 1.00 81.60  ?  100  C   A "C1'" 1 
ATOM   2138  N  N1    . C   A 1  100  ? 149.916 191.221 148.055 1.00 81.60  ?  100  C   A N1    1 
ATOM   2139  C  C2    . C   A 1  100  ? 151.239 191.667 148.099 1.00 81.60  ?  100  C   A C2    1 
ATOM   2140  O  O2    . C   A 1  100  ? 152.088 191.096 147.398 1.00 81.60  ?  100  C   A O2    1 
ATOM   2141  N  N3    . C   A 1  100  ? 151.559 192.707 148.903 1.00 81.60  ?  100  C   A N3    1 
ATOM   2142  C  C4    . C   A 1  100  ? 150.616 193.295 149.641 1.00 81.60  ?  100  C   A C4    1 
ATOM   2143  N  N4    . C   A 1  100  ? 150.977 194.317 150.419 1.00 81.60  ?  100  C   A N4    1 
ATOM   2144  C  C5    . C   A 1  100  ? 149.259 192.860 149.615 1.00 81.60  ?  100  C   A C5    1 
ATOM   2145  C  C6    . C   A 1  100  ? 148.957 191.830 148.815 1.00 81.60  ?  100  C   A C6    1 
ATOM   2146  P  P     . G   A 1  101  ? 148.807 185.818 145.793 1.00 78.54  ?  101  G   A P     1 
ATOM   2147  O  OP1   . G   A 1  101  ? 147.632 185.439 146.616 1.00 78.54  ?  101  G   A OP1   1 
ATOM   2148  O  OP2   . G   A 1  101  ? 150.098 185.111 145.993 1.00 78.54  ?  101  G   A OP2   1 
ATOM   2149  O  "O5'" . G   A 1  101  ? 148.406 185.680 144.256 1.00 78.54  ?  101  G   A "O5'" 1 
ATOM   2150  C  "C5'" . G   A 1  101  ? 147.337 186.436 143.705 1.00 78.54  ?  101  G   A "C5'" 1 
ATOM   2151  C  "C4'" . G   A 1  101  ? 146.325 185.553 143.019 1.00 78.54  ?  101  G   A "C4'" 1 
ATOM   2152  O  "O4'" . G   A 1  101  ? 147.009 184.476 142.326 1.00 78.54  ?  101  G   A "O4'" 1 
ATOM   2153  C  "C3'" . G   A 1  101  ? 145.337 184.838 143.929 1.00 78.54  ?  101  G   A "C3'" 1 
ATOM   2154  O  "O3'" . G   A 1  101  ? 144.248 185.660 144.317 1.00 78.54  ?  101  G   A "O3'" 1 
ATOM   2155  C  "C2'" . G   A 1  101  ? 144.923 183.637 143.089 1.00 78.54  ?  101  G   A "C2'" 1 
ATOM   2156  O  "O2'" . G   A 1  101  ? 143.976 184.017 142.102 1.00 78.54  ?  101  G   A "O2'" 1 
ATOM   2157  C  "C1'" . G   A 1  101  ? 146.238 183.295 142.390 1.00 78.54  ?  101  G   A "C1'" 1 
ATOM   2158  N  N9    . G   A 1  101  ? 147.005 182.276 143.130 1.00 78.54  ?  101  G   A N9    1 
ATOM   2159  C  C8    . G   A 1  101  ? 148.102 182.483 143.930 1.00 78.54  ?  101  G   A C8    1 
ATOM   2160  N  N7    . G   A 1  101  ? 148.566 181.383 144.457 1.00 78.54  ?  101  G   A N7    1 
ATOM   2161  C  C5    . G   A 1  101  ? 147.725 180.389 143.976 1.00 78.54  ?  101  G   A C5    1 
ATOM   2162  C  C6    . G   A 1  101  ? 147.733 178.988 144.202 1.00 78.54  ?  101  G   A C6    1 
ATOM   2163  O  O6    . G   A 1  101  ? 148.511 178.324 144.897 1.00 78.54  ?  101  G   A O6    1 
ATOM   2164  N  N1    . G   A 1  101  ? 146.699 178.355 143.520 1.00 78.54  ?  101  G   A N1    1 
ATOM   2165  C  C2    . G   A 1  101  ? 145.776 178.985 142.722 1.00 78.54  ?  101  G   A C2    1 
ATOM   2166  N  N2    . G   A 1  101  ? 144.854 178.198 142.147 1.00 78.54  ?  101  G   A N2    1 
ATOM   2167  N  N3    . G   A 1  101  ? 145.759 180.289 142.502 1.00 78.54  ?  101  G   A N3    1 
ATOM   2168  C  C4    . G   A 1  101  ? 146.755 180.924 143.156 1.00 78.54  ?  101  G   A C4    1 
ATOM   2169  P  P     . G   A 1  102  ? 143.604 185.516 145.783 1.00 81.62  ?  102  G   A P     1 
ATOM   2170  O  OP1   . G   A 1  102  ? 142.621 186.615 145.959 1.00 81.62  ?  102  G   A OP1   1 
ATOM   2171  O  OP2   . G   A 1  102  ? 144.706 185.355 146.763 1.00 81.62  ?  102  G   A OP2   1 
ATOM   2172  O  "O5'" . G   A 1  102  ? 142.798 184.142 145.722 1.00 81.62  ?  102  G   A "O5'" 1 
ATOM   2173  C  "C5'" . G   A 1  102  ? 141.639 184.012 144.913 1.00 81.62  ?  102  G   A "C5'" 1 
ATOM   2174  C  "C4'" . G   A 1  102  ? 141.212 182.571 144.786 1.00 81.62  ?  102  G   A "C4'" 1 
ATOM   2175  O  "O4'" . G   A 1  102  ? 142.289 181.789 144.205 1.00 81.62  ?  102  G   A "O4'" 1 
ATOM   2176  C  "C3'" . G   A 1  102  ? 140.894 181.849 146.086 1.00 81.62  ?  102  G   A "C3'" 1 
ATOM   2177  O  "O3'" . G   A 1  102  ? 139.593 182.128 146.574 1.00 81.62  ?  102  G   A "O3'" 1 
ATOM   2178  C  "C2'" . G   A 1  102  ? 141.106 180.389 145.714 1.00 81.62  ?  102  G   A "C2'" 1 
ATOM   2179  O  "O2'" . G   A 1  102  ? 139.994 179.891 144.984 1.00 81.62  ?  102  G   A "O2'" 1 
ATOM   2180  C  "C1'" . G   A 1  102  ? 142.299 180.492 144.765 1.00 81.62  ?  102  G   A "C1'" 1 
ATOM   2181  N  N9    . G   A 1  102  ? 143.580 180.293 145.468 1.00 81.62  ?  102  G   A N9    1 
ATOM   2182  C  C8    . G   A 1  102  ? 144.504 181.256 145.796 1.00 81.62  ?  102  G   A C8    1 
ATOM   2183  N  N7    . G   A 1  102  ? 145.545 180.777 146.420 1.00 81.62  ?  102  G   A N7    1 
ATOM   2184  C  C5    . G   A 1  102  ? 145.293 179.415 146.513 1.00 81.62  ?  102  G   A C5    1 
ATOM   2185  C  C6    . G   A 1  102  ? 146.067 178.374 147.090 1.00 81.62  ?  102  G   A C6    1 
ATOM   2186  O  O6    . G   A 1  102  ? 147.166 178.451 147.653 1.00 81.62  ?  102  G   A O6    1 
ATOM   2187  N  N1    . G   A 1  102  ? 145.439 177.139 146.963 1.00 81.62  ?  102  G   A N1    1 
ATOM   2188  C  C2    . G   A 1  102  ? 144.224 176.929 146.360 1.00 81.62  ?  102  G   A C2    1 
ATOM   2189  N  N2    . G   A 1  102  ? 143.785 175.662 146.338 1.00 81.62  ?  102  G   A N2    1 
ATOM   2190  N  N3    . G   A 1  102  ? 143.494 177.890 145.818 1.00 81.62  ?  102  G   A N3    1 
ATOM   2191  C  C4    . G   A 1  102  ? 144.084 179.099 145.930 1.00 81.62  ?  102  G   A C4    1 
ATOM   2192  P  P     . C   A 1  103  ? 139.341 182.304 148.152 1.00 83.90  ?  103  C   A P     1 
ATOM   2193  O  OP1   . C   A 1  103  ? 137.959 182.812 148.343 1.00 83.90  ?  103  C   A OP1   1 
ATOM   2194  O  OP2   . C   A 1  103  ? 140.486 183.062 148.718 1.00 83.90  ?  103  C   A OP2   1 
ATOM   2195  O  "O5'" . C   A 1  103  ? 139.403 180.818 148.724 1.00 83.90  ?  103  C   A "O5'" 1 
ATOM   2196  C  "C5'" . C   A 1  103  ? 138.446 179.844 148.332 1.00 83.90  ?  103  C   A "C5'" 1 
ATOM   2197  C  "C4'" . C   A 1  103  ? 138.898 178.449 148.685 1.00 83.90  ?  103  C   A "C4'" 1 
ATOM   2198  O  "O4'" . C   A 1  103  ? 140.206 178.197 148.106 1.00 83.90  ?  103  C   A "O4'" 1 
ATOM   2199  C  "C3'" . C   A 1  103  ? 139.091 178.163 150.166 1.00 83.90  ?  103  C   A "C3'" 1 
ATOM   2200  O  "O3'" . C   A 1  103  ? 137.877 177.878 150.840 1.00 83.90  ?  103  C   A "O3'" 1 
ATOM   2201  C  "C2'" . C   A 1  103  ? 140.073 176.998 150.158 1.00 83.90  ?  103  C   A "C2'" 1 
ATOM   2202  O  "O2'" . C   A 1  103  ? 139.400 175.776 149.891 1.00 83.90  ?  103  C   A "O2'" 1 
ATOM   2203  C  "C1'" . C   A 1  103  ? 140.950 177.341 148.948 1.00 83.90  ?  103  C   A "C1'" 1 
ATOM   2204  N  N1    . C   A 1  103  ? 142.220 178.010 149.328 1.00 83.90  ?  103  C   A N1    1 
ATOM   2205  C  C2    . C   A 1  103  ? 143.309 177.220 149.723 1.00 83.90  ?  103  C   A C2    1 
ATOM   2206  O  O2    . C   A 1  103  ? 143.192 175.985 149.751 1.00 83.90  ?  103  C   A O2    1 
ATOM   2207  N  N3    . C   A 1  103  ? 144.473 177.819 150.067 1.00 83.90  ?  103  C   A N3    1 
ATOM   2208  C  C4    . C   A 1  103  ? 144.584 179.147 150.031 1.00 83.90  ?  103  C   A C4    1 
ATOM   2209  N  N4    . C   A 1  103  ? 145.753 179.689 150.380 1.00 83.90  ?  103  C   A N4    1 
ATOM   2210  C  C5    . C   A 1  103  ? 143.500 179.979 149.632 1.00 83.90  ?  103  C   A C5    1 
ATOM   2211  C  C6    . C   A 1  103  ? 142.355 179.374 149.291 1.00 83.90  ?  103  C   A C6    1 
ATOM   2212  P  P     . C   A 1  104  ? 137.669 178.349 152.362 1.00 78.26  ?  104  C   A P     1 
ATOM   2213  O  OP1   . C   A 1  104  ? 136.240 178.147 152.714 1.00 78.26  ?  104  C   A OP1   1 
ATOM   2214  O  OP2   . C   A 1  104  ? 138.279 179.694 152.516 1.00 78.26  ?  104  C   A OP2   1 
ATOM   2215  O  "O5'" . C   A 1  104  ? 138.535 177.315 153.210 1.00 78.26  ?  104  C   A "O5'" 1 
ATOM   2216  C  "C5'" . C   A 1  104  ? 138.186 175.939 153.260 1.00 78.26  ?  104  C   A "C5'" 1 
ATOM   2217  C  "C4'" . C   A 1  104  ? 139.274 175.114 153.901 1.00 78.26  ?  104  C   A "C4'" 1 
ATOM   2218  O  "O4'" . C   A 1  104  ? 140.494 175.219 153.121 1.00 78.26  ?  104  C   A "O4'" 1 
ATOM   2219  C  "C3'" . C   A 1  104  ? 139.695 175.533 155.300 1.00 78.26  ?  104  C   A "C3'" 1 
ATOM   2220  O  "O3'" . C   A 1  104  ? 138.818 175.067 156.310 1.00 78.26  ?  104  C   A "O3'" 1 
ATOM   2221  C  "C2'" . C   A 1  104  ? 141.106 174.966 155.407 1.00 78.26  ?  104  C   A "C2'" 1 
ATOM   2222  O  "O2'" . C   A 1  104  ? 141.068 173.578 155.704 1.00 78.26  ?  104  C   A "O2'" 1 
ATOM   2223  C  "C1'" . C   A 1  104  ? 141.619 175.141 153.974 1.00 78.26  ?  104  C   A "C1'" 1 
ATOM   2224  N  N1    . C   A 1  104  ? 142.448 176.361 153.803 1.00 78.26  ?  104  C   A N1    1 
ATOM   2225  C  C2    . C   A 1  104  ? 143.800 176.327 154.175 1.00 78.26  ?  104  C   A C2    1 
ATOM   2226  O  O2    . C   A 1  104  ? 144.284 175.288 154.649 1.00 78.26  ?  104  C   A O2    1 
ATOM   2227  N  N3    . C   A 1  104  ? 144.559 177.437 154.018 1.00 78.26  ?  104  C   A N3    1 
ATOM   2228  C  C4    . C   A 1  104  ? 144.030 178.550 153.509 1.00 78.26  ?  104  C   A C4    1 
ATOM   2229  N  N4    . C   A 1  104  ? 144.821 179.616 153.373 1.00 78.26  ?  104  C   A N4    1 
ATOM   2230  C  C5    . C   A 1  104  ? 142.663 178.617 153.116 1.00 78.26  ?  104  C   A C5    1 
ATOM   2231  C  C6    . C   A 1  104  ? 141.923 177.513 153.277 1.00 78.26  ?  104  C   A C6    1 
ATOM   2232  P  P     . C   A 1  105  ? 138.629 175.909 157.667 1.00 69.86  ?  105  C   A P     1 
ATOM   2233  O  OP1   . C   A 1  105  ? 137.454 175.360 158.389 1.00 69.86  ?  105  C   A OP1   1 
ATOM   2234  O  OP2   . C   A 1  105  ? 138.672 177.352 157.320 1.00 69.86  ?  105  C   A OP2   1 
ATOM   2235  O  "O5'" . C   A 1  105  ? 139.933 175.571 158.518 1.00 69.86  ?  105  C   A "O5'" 1 
ATOM   2236  C  "C5'" . C   A 1  105  ? 140.166 174.258 159.005 1.00 69.86  ?  105  C   A "C5'" 1 
ATOM   2237  C  "C4'" . C   A 1  105  ? 141.527 174.135 159.644 1.00 69.86  ?  105  C   A "C4'" 1 
ATOM   2238  O  "O4'" . C   A 1  105  ? 142.561 174.314 158.643 1.00 69.86  ?  105  C   A "O4'" 1 
ATOM   2239  C  "C3'" . C   A 1  105  ? 141.865 175.168 160.706 1.00 69.86  ?  105  C   A "C3'" 1 
ATOM   2240  O  "O3'" . C   A 1  105  ? 141.290 174.877 161.968 1.00 69.86  ?  105  C   A "O3'" 1 
ATOM   2241  C  "C2'" . C   A 1  105  ? 143.389 175.158 160.710 1.00 69.86  ?  105  C   A "C2'" 1 
ATOM   2242  O  "O2'" . C   A 1  105  ? 143.883 174.061 161.465 1.00 69.86  ?  105  C   A "O2'" 1 
ATOM   2243  C  "C1'" . C   A 1  105  ? 143.702 174.907 159.230 1.00 69.86  ?  105  C   A "C1'" 1 
ATOM   2244  N  N1    . C   A 1  105  ? 144.046 176.149 158.495 1.00 69.86  ?  105  C   A N1    1 
ATOM   2245  C  C2    . C   A 1  105  ? 145.378 176.580 158.508 1.00 69.86  ?  105  C   A C2    1 
ATOM   2246  O  O2    . C   A 1  105  ? 146.224 175.918 159.130 1.00 69.86  ?  105  C   A O2    1 
ATOM   2247  N  N3    . C   A 1  105  ? 145.720 177.707 157.841 1.00 69.86  ?  105  C   A N3    1 
ATOM   2248  C  C4    . C   A 1  105  ? 144.794 178.400 157.177 1.00 69.86  ?  105  C   A C4    1 
ATOM   2249  N  N4    . C   A 1  105  ? 145.179 179.507 156.537 1.00 69.86  ?  105  C   A N4    1 
ATOM   2250  C  C5    . C   A 1  105  ? 143.431 177.991 157.145 1.00 69.86  ?  105  C   A C5    1 
ATOM   2251  C  C6    . C   A 1  105  ? 143.109 176.871 157.805 1.00 69.86  ?  105  C   A C6    1 
ATOM   2252  P  P     . U   A 1  106  ? 140.694 176.063 162.873 1.00 65.67  ?  106  U   A P     1 
ATOM   2253  O  OP1   . U   A 1  106  ? 140.013 175.452 164.043 1.00 65.67  ?  106  U   A OP1   1 
ATOM   2254  O  OP2   . U   A 1  106  ? 139.942 176.986 161.985 1.00 65.67  ?  106  U   A OP2   1 
ATOM   2255  O  "O5'" . U   A 1  106  ? 141.987 176.831 163.399 1.00 65.67  ?  106  U   A "O5'" 1 
ATOM   2256  C  "C5'" . U   A 1  106  ? 142.890 176.203 164.297 1.00 65.67  ?  106  U   A "C5'" 1 
ATOM   2257  C  "C4'" . U   A 1  106  ? 144.027 177.119 164.675 1.00 65.67  ?  106  U   A "C4'" 1 
ATOM   2258  O  "O4'" . U   A 1  106  ? 144.956 177.245 163.566 1.00 65.67  ?  106  U   A "O4'" 1 
ATOM   2259  C  "C3'" . U   A 1  106  ? 143.649 178.556 164.992 1.00 65.67  ?  106  U   A "C3'" 1 
ATOM   2260  O  "O3'" . U   A 1  106  ? 143.104 178.727 166.286 1.00 65.67  ?  106  U   A "O3'" 1 
ATOM   2261  C  "C2'" . U   A 1  106  ? 144.961 179.297 164.770 1.00 65.67  ?  106  U   A "C2'" 1 
ATOM   2262  O  "O2'" . U   A 1  106  ? 145.830 179.123 165.880 1.00 65.67  ?  106  U   A "O2'" 1 
ATOM   2263  C  "C1'" . U   A 1  106  ? 145.541 178.533 163.576 1.00 65.67  ?  106  U   A "C1'" 1 
ATOM   2264  N  N1    . U   A 1  106  ? 145.265 179.210 162.285 1.00 65.67  ?  106  U   A N1    1 
ATOM   2265  C  C2    . U   A 1  106  ? 146.129 180.222 161.901 1.00 65.67  ?  106  U   A C2    1 
ATOM   2266  O  O2    . U   A 1  106  ? 147.091 180.568 162.566 1.00 65.67  ?  106  U   A O2    1 
ATOM   2267  N  N3    . U   A 1  106  ? 145.832 180.821 160.702 1.00 65.67  ?  106  U   A N3    1 
ATOM   2268  C  C4    . U   A 1  106  ? 144.781 180.523 159.860 1.00 65.67  ?  106  U   A C4    1 
ATOM   2269  O  O4    . U   A 1  106  ? 144.645 181.154 158.811 1.00 65.67  ?  106  U   A O4    1 
ATOM   2270  C  C5    . U   A 1  106  ? 143.931 179.471 160.323 1.00 65.67  ?  106  U   A C5    1 
ATOM   2271  C  C6    . U   A 1  106  ? 144.198 178.866 161.483 1.00 65.67  ?  106  U   A C6    1 
ATOM   2272  P  P     . A   A 1  107  ? 142.028 179.891 166.541 1.00 63.96  ?  107  A   A P     1 
ATOM   2273  O  OP1   . A   A 1  107  ? 141.369 179.625 167.842 1.00 63.96  ?  107  A   A OP1   1 
ATOM   2274  O  OP2   . A   A 1  107  ? 141.201 180.033 165.315 1.00 63.96  ?  107  A   A OP2   1 
ATOM   2275  O  "O5'" . A   A 1  107  ? 142.914 181.205 166.692 1.00 63.96  ?  107  A   A "O5'" 1 
ATOM   2276  C  "C5'" . A   A 1  107  ? 143.284 181.689 167.978 1.00 63.96  ?  107  A   A "C5'" 1 
ATOM   2277  C  "C4'" . A   A 1  107  ? 144.667 182.293 167.979 1.00 63.96  ?  107  A   A "C4'" 1 
ATOM   2278  O  "O4'" . A   A 1  107  ? 144.834 183.111 166.791 1.00 63.96  ?  107  A   A "O4'" 1 
ATOM   2279  C  "C3'" . A   A 1  107  ? 144.966 183.202 169.171 1.00 63.96  ?  107  A   A "C3'" 1 
ATOM   2280  O  "O3'" . A   A 1  107  ? 146.347 183.171 169.585 1.00 63.96  ?  107  A   A "O3'" 1 
ATOM   2281  C  "C2'" . A   A 1  107  ? 144.655 184.585 168.606 1.00 63.96  ?  107  A   A "C2'" 1 
ATOM   2282  O  "O2'" . A   A 1  107  ? 145.299 185.651 169.272 1.00 63.96  ?  107  A   A "O2'" 1 
ATOM   2283  C  "C1'" . A   A 1  107  ? 145.143 184.438 167.166 1.00 63.96  ?  107  A   A "C1'" 1 
ATOM   2284  N  N9    . A   A 1  107  ? 144.491 185.334 166.210 1.00 63.96  ?  107  A   A N9    1 
ATOM   2285  C  C8    . A   A 1  107  ? 143.607 186.353 166.460 1.00 63.96  ?  107  A   A C8    1 
ATOM   2286  N  N7    . A   A 1  107  ? 143.203 186.973 165.378 1.00 63.96  ?  107  A   A N7    1 
ATOM   2287  C  C5    . A   A 1  107  ? 143.865 186.319 164.348 1.00 63.96  ?  107  A   A C5    1 
ATOM   2288  C  C6    . A   A 1  107  ? 143.871 186.493 162.952 1.00 63.96  ?  107  A   A C6    1 
ATOM   2289  N  N6    . A   A 1  107  ? 143.154 187.426 162.320 1.00 63.96  ?  107  A   A N6    1 
ATOM   2290  N  N1    . A   A 1  107  ? 144.647 185.666 162.212 1.00 63.96  ?  107  A   A N1    1 
ATOM   2291  C  C2    . A   A 1  107  ? 145.371 184.727 162.835 1.00 63.96  ?  107  A   A C2    1 
ATOM   2292  N  N3    . A   A 1  107  ? 145.447 184.469 164.140 1.00 63.96  ?  107  A   A N3    1 
ATOM   2293  C  C4    . A   A 1  107  ? 144.666 185.308 164.847 1.00 63.96  ?  107  A   A C4    1 
ATOM   2294  P  P     . A   A 1  108  ? 147.412 181.998 169.247 1.00 68.92  ?  108  A   A P     1 
ATOM   2295  O  OP1   . A   A 1  108  ? 146.946 180.585 169.319 1.00 68.92  ?  108  A   A OP1   1 
ATOM   2296  O  OP2   . A   A 1  108  ? 148.546 182.329 170.142 1.00 68.92  ?  108  A   A OP2   1 
ATOM   2297  O  "O5'" . A   A 1  108  ? 147.940 182.364 167.792 1.00 68.92  ?  108  A   A "O5'" 1 
ATOM   2298  C  "C5'" . A   A 1  108  ? 148.819 183.464 167.606 1.00 68.92  ?  108  A   A "C5'" 1 
ATOM   2299  C  "C4'" . A   A 1  108  ? 150.208 182.998 167.256 1.00 68.92  ?  108  A   A "C4'" 1 
ATOM   2300  O  "O4'" . A   A 1  108  ? 150.388 181.636 167.728 1.00 68.92  ?  108  A   A "O4'" 1 
ATOM   2301  C  "C3'" . A   A 1  108  ? 150.523 182.926 165.770 1.00 68.92  ?  108  A   A "C3'" 1 
ATOM   2302  O  "O3'" . A   A 1  108  ? 150.924 184.176 165.236 1.00 68.92  ?  108  A   A "O3'" 1 
ATOM   2303  C  "C2'" . A   A 1  108  ? 151.608 181.860 165.707 1.00 68.92  ?  108  A   A "C2'" 1 
ATOM   2304  O  "O2'" . A   A 1  108  ? 152.864 182.400 166.092 1.00 68.92  ?  108  A   A "O2'" 1 
ATOM   2305  C  "C1'" . A   A 1  108  ? 151.144 180.895 166.796 1.00 68.92  ?  108  A   A "C1'" 1 
ATOM   2306  N  N9    . A   A 1  108  ? 150.283 179.825 166.257 1.00 68.92  ?  108  A   A N9    1 
ATOM   2307  C  C8    . A   A 1  108  ? 148.928 179.686 166.431 1.00 68.92  ?  108  A   A C8    1 
ATOM   2308  N  N7    . A   A 1  108  ? 148.419 178.633 165.839 1.00 68.92  ?  108  A   A N7    1 
ATOM   2309  C  C5    . A   A 1  108  ? 149.516 178.037 165.234 1.00 68.92  ?  108  A   A C5    1 
ATOM   2310  C  C6    . A   A 1  108  ? 149.654 176.880 164.447 1.00 68.92  ?  108  A   A C6    1 
ATOM   2311  N  N6    . A   A 1  108  ? 148.634 176.082 164.122 1.00 68.92  ?  108  A   A N6    1 
ATOM   2312  N  N1    . A   A 1  108  ? 150.891 176.562 163.999 1.00 68.92  ?  108  A   A N1    1 
ATOM   2313  C  C2    . A   A 1  108  ? 151.921 177.357 164.320 1.00 68.92  ?  108  A   A C2    1 
ATOM   2314  N  N3    . A   A 1  108  ? 151.915 178.469 165.052 1.00 68.92  ?  108  A   A N3    1 
ATOM   2315  C  C4    . A   A 1  108  ? 150.672 178.758 165.483 1.00 68.92  ?  108  A   A C4    1 
ATOM   2316  P  P     . C   A 1  109  ? 149.920 185.023 164.310 1.00 78.23  ?  109  C   A P     1 
ATOM   2317  O  OP1   . C   A 1  109  ? 149.762 186.369 164.917 1.00 78.23  ?  109  C   A OP1   1 
ATOM   2318  O  OP2   . C   A 1  109  ? 148.719 184.190 164.048 1.00 78.23  ?  109  C   A OP2   1 
ATOM   2319  O  "O5'" . C   A 1  109  ? 150.713 185.194 162.938 1.00 78.23  ?  109  C   A "O5'" 1 
ATOM   2320  C  "C5'" . C   A 1  109  ? 151.252 184.067 162.263 1.00 78.23  ?  109  C   A "C5'" 1 
ATOM   2321  C  "C4'" . C   A 1  109  ? 150.901 184.081 160.797 1.00 78.23  ?  109  C   A "C4'" 1 
ATOM   2322  O  "O4'" . C   A 1  109  ? 149.460 184.113 160.639 1.00 78.23  ?  109  C   A "O4'" 1 
ATOM   2323  C  "C3'" . C   A 1  109  ? 151.388 185.284 160.005 1.00 78.23  ?  109  C   A "C3'" 1 
ATOM   2324  O  "O3'" . C   A 1  109  ? 152.745 185.169 159.614 1.00 78.23  ?  109  C   A "O3'" 1 
ATOM   2325  C  "C2'" . C   A 1  109  ? 150.416 185.330 158.830 1.00 78.23  ?  109  C   A "C2'" 1 
ATOM   2326  O  "O2'" . C   A 1  109  ? 150.794 184.394 157.831 1.00 78.23  ?  109  C   A "O2'" 1 
ATOM   2327  C  "C1'" . C   A 1  109  ? 149.116 184.844 159.481 1.00 78.23  ?  109  C   A "C1'" 1 
ATOM   2328  N  N1    . C   A 1  109  ? 148.208 185.955 159.861 1.00 78.23  ?  109  C   A N1    1 
ATOM   2329  C  C2    . C   A 1  109  ? 147.351 186.490 158.890 1.00 78.23  ?  109  C   A C2    1 
ATOM   2330  O  O2    . C   A 1  109  ? 147.373 186.033 157.737 1.00 78.23  ?  109  C   A O2    1 
ATOM   2331  N  N3    . C   A 1  109  ? 146.515 187.499 159.228 1.00 78.23  ?  109  C   A N3    1 
ATOM   2332  C  C4    . C   A 1  109  ? 146.504 187.975 160.474 1.00 78.23  ?  109  C   A C4    1 
ATOM   2333  N  N4    . C   A 1  109  ? 145.662 188.971 160.756 1.00 78.23  ?  109  C   A N4    1 
ATOM   2334  C  C5    . C   A 1  109  ? 147.360 187.452 161.485 1.00 78.23  ?  109  C   A C5    1 
ATOM   2335  C  C6    . C   A 1  109  ? 148.179 186.453 161.138 1.00 78.23  ?  109  C   A C6    1 
ATOM   2336  P  P     . A   A 1  110  ? 153.631 186.483 159.346 1.00 73.52  ?  110  A   A P     1 
ATOM   2337  O  OP1   . A   A 1  110  ? 154.842 186.398 160.201 1.00 73.52  ?  110  A   A OP1   1 
ATOM   2338  O  OP2   . A   A 1  110  ? 152.749 187.673 159.445 1.00 73.52  ?  110  A   A OP2   1 
ATOM   2339  O  "O5'" . A   A 1  110  ? 154.091 186.329 157.828 1.00 73.52  ?  110  A   A "O5'" 1 
ATOM   2340  C  "C5'" . A   A 1  110  ? 155.101 187.171 157.282 1.00 73.52  ?  110  A   A "C5'" 1 
ATOM   2341  C  "C4'" . A   A 1  110  ? 156.245 186.370 156.711 1.00 73.52  ?  110  A   A "C4'" 1 
ATOM   2342  O  "O4'" . A   A 1  110  ? 157.359 187.266 156.447 1.00 73.52  ?  110  A   A "O4'" 1 
ATOM   2343  C  "C3'" . A   A 1  110  ? 156.788 185.279 157.631 1.00 73.52  ?  110  A   A "C3'" 1 
ATOM   2344  O  "O3'" . A   A 1  110  ? 157.276 184.185 156.849 1.00 73.52  ?  110  A   A "O3'" 1 
ATOM   2345  C  "C2'" . A   A 1  110  ? 157.956 185.977 158.319 1.00 73.52  ?  110  A   A "C2'" 1 
ATOM   2346  O  "O2'" . A   A 1  110  ? 158.949 185.106 158.818 1.00 73.52  ?  110  A   A "O2'" 1 
ATOM   2347  C  "C1'" . A   A 1  110  ? 158.490 186.863 157.196 1.00 73.52  ?  110  A   A "C1'" 1 
ATOM   2348  N  N9    . A   A 1  110  ? 159.170 188.071 157.669 1.00 73.52  ?  110  A   A N9    1 
ATOM   2349  C  C8    . A   A 1  110  ? 158.700 188.990 158.574 1.00 73.52  ?  110  A   A C8    1 
ATOM   2350  N  N7    . A   A 1  110  ? 159.528 189.979 158.805 1.00 73.52  ?  110  A   A N7    1 
ATOM   2351  C  C5    . A   A 1  110  ? 160.616 189.694 157.993 1.00 73.52  ?  110  A   A C5    1 
ATOM   2352  C  C6    . A   A 1  110  ? 161.837 190.356 157.771 1.00 73.52  ?  110  A   A C6    1 
ATOM   2353  N  N6    . A   A 1  110  ? 162.181 191.494 158.379 1.00 73.52  ?  110  A   A N6    1 
ATOM   2354  N  N1    . A   A 1  110  ? 162.707 189.803 156.894 1.00 73.52  ?  110  A   A N1    1 
ATOM   2355  C  C2    . A   A 1  110  ? 162.371 188.661 156.279 1.00 73.52  ?  110  A   A C2    1 
ATOM   2356  N  N3    . A   A 1  110  ? 161.253 187.947 156.406 1.00 73.52  ?  110  A   A N3    1 
ATOM   2357  C  C4    . A   A 1  110  ? 160.409 188.522 157.284 1.00 73.52  ?  110  A   A C4    1 
ATOM   2358  P  P     . G   A 1  111  ? 156.351 182.898 156.560 1.00 65.88  ?  111  G   A P     1 
ATOM   2359  O  OP1   . G   A 1  111  ? 157.053 182.064 155.554 1.00 65.88  ?  111  G   A OP1   1 
ATOM   2360  O  OP2   . G   A 1  111  ? 154.961 183.347 156.291 1.00 65.88  ?  111  G   A OP2   1 
ATOM   2361  O  "O5'" . G   A 1  111  ? 156.340 182.095 157.937 1.00 65.88  ?  111  G   A "O5'" 1 
ATOM   2362  C  "C5'" . G   A 1  111  ? 155.205 182.136 158.789 1.00 65.88  ?  111  G   A "C5'" 1 
ATOM   2363  C  "C4'" . G   A 1  111  ? 154.855 180.777 159.342 1.00 65.88  ?  111  G   A "C4'" 1 
ATOM   2364  O  "O4'" . G   A 1  111  ? 153.650 180.890 160.145 1.00 65.88  ?  111  G   A "O4'" 1 
ATOM   2365  C  "C3'" . G   A 1  111  ? 154.519 179.702 158.316 1.00 65.88  ?  111  G   A "C3'" 1 
ATOM   2366  O  "O3'" . G   A 1  111  ? 155.662 179.067 157.770 1.00 65.88  ?  111  G   A "O3'" 1 
ATOM   2367  C  "C2'" . G   A 1  111  ? 153.617 178.762 159.104 1.00 65.88  ?  111  G   A "C2'" 1 
ATOM   2368  O  "O2'" . G   A 1  111  ? 154.386 177.931 159.961 1.00 65.88  ?  111  G   A "O2'" 1 
ATOM   2369  C  "C1'" . G   A 1  111  ? 152.836 179.751 159.964 1.00 65.88  ?  111  G   A "C1'" 1 
ATOM   2370  N  N9    . G   A 1  111  ? 151.583 180.175 159.310 1.00 65.88  ?  111  G   A N9    1 
ATOM   2371  C  C8    . G   A 1  111  ? 151.375 181.329 158.592 1.00 65.88  ?  111  G   A C8    1 
ATOM   2372  N  N7    . G   A 1  111  ? 150.162 181.436 158.125 1.00 65.88  ?  111  G   A N7    1 
ATOM   2373  C  C5    . G   A 1  111  ? 149.529 180.280 158.557 1.00 65.88  ?  111  G   A C5    1 
ATOM   2374  C  C6    . G   A 1  111  ? 148.196 179.838 158.356 1.00 65.88  ?  111  G   A C6    1 
ATOM   2375  O  O6    . G   A 1  111  ? 147.285 180.398 157.736 1.00 65.88  ?  111  G   A O6    1 
ATOM   2376  N  N1    . G   A 1  111  ? 147.968 178.609 158.966 1.00 65.88  ?  111  G   A N1    1 
ATOM   2377  C  C2    . G   A 1  111  ? 148.902 177.896 159.679 1.00 65.88  ?  111  G   A C2    1 
ATOM   2378  N  N2    . G   A 1  111  ? 148.488 176.728 160.192 1.00 65.88  ?  111  G   A N2    1 
ATOM   2379  N  N3    . G   A 1  111  ? 150.148 178.298 159.873 1.00 65.88  ?  111  G   A N3    1 
ATOM   2380  C  C4    . G   A 1  111  ? 150.391 179.490 159.289 1.00 65.88  ?  111  G   A C4    1 
ATOM   2381  P  P     . G   A 1  112  ? 155.634 178.507 156.262 1.00 68.98  ?  112  G   A P     1 
ATOM   2382  O  OP1   . G   A 1  112  ? 157.015 178.099 155.900 1.00 68.98  ?  112  G   A OP1   1 
ATOM   2383  O  OP2   . G   A 1  112  ? 154.917 179.496 155.419 1.00 68.98  ?  112  G   A OP2   1 
ATOM   2384  O  "O5'" . G   A 1  112  ? 154.738 177.190 156.347 1.00 68.98  ?  112  G   A "O5'" 1 
ATOM   2385  C  "C5'" . G   A 1  112  ? 155.204 176.031 157.022 1.00 68.98  ?  112  G   A "C5'" 1 
ATOM   2386  C  "C4'" . G   A 1  112  ? 154.092 175.039 157.262 1.00 68.98  ?  112  G   A "C4'" 1 
ATOM   2387  O  "O4'" . G   A 1  112  ? 152.993 175.691 157.950 1.00 68.98  ?  112  G   A "O4'" 1 
ATOM   2388  C  "C3'" . G   A 1  112  ? 153.447 174.439 156.021 1.00 68.98  ?  112  G   A "C3'" 1 
ATOM   2389  O  "O3'" . G   A 1  112  ? 154.192 173.366 155.472 1.00 68.98  ?  112  G   A "O3'" 1 
ATOM   2390  C  "C2'" . G   A 1  112  ? 152.072 174.029 156.528 1.00 68.98  ?  112  G   A "C2'" 1 
ATOM   2391  O  "O2'" . G   A 1  112  ? 152.149 172.816 157.262 1.00 68.98  ?  112  G   A "O2'" 1 
ATOM   2392  C  "C1'" . G   A 1  112  ? 151.762 175.164 157.503 1.00 68.98  ?  112  G   A "C1'" 1 
ATOM   2393  N  N9    . G   A 1  112  ? 150.994 176.247 156.861 1.00 68.98  ?  112  G   A N9    1 
ATOM   2394  C  C8    . G   A 1  112  ? 151.459 177.491 156.507 1.00 68.98  ?  112  G   A C8    1 
ATOM   2395  N  N7    . G   A 1  112  ? 150.546 178.242 155.953 1.00 68.98  ?  112  G   A N7    1 
ATOM   2396  C  C5    . G   A 1  112  ? 149.409 177.447 155.939 1.00 68.98  ?  112  G   A C5    1 
ATOM   2397  C  C6    . G   A 1  112  ? 148.102 177.721 155.459 1.00 68.98  ?  112  G   A C6    1 
ATOM   2398  O  O6    . G   A 1  112  ? 147.676 178.757 154.933 1.00 68.98  ?  112  G   A O6    1 
ATOM   2399  N  N1    . G   A 1  112  ? 147.251 176.636 155.640 1.00 68.98  ?  112  G   A N1    1 
ATOM   2400  C  C2    . G   A 1  112  ? 147.610 175.439 156.210 1.00 68.98  ?  112  G   A C2    1 
ATOM   2401  N  N2    . G   A 1  112  ? 146.644 174.512 156.297 1.00 68.98  ?  112  G   A N2    1 
ATOM   2402  N  N3    . G   A 1  112  ? 148.824 175.171 156.662 1.00 68.98  ?  112  G   A N3    1 
ATOM   2403  C  C4    . G   A 1  112  ? 149.668 176.212 156.496 1.00 68.98  ?  112  G   A C4    1 
ATOM   2404  P  P     . G   A 1  113  ? 154.159 173.082 153.889 1.00 76.04  ?  113  G   A P     1 
ATOM   2405  O  OP1   . G   A 1  113  ? 155.220 172.091 153.579 1.00 76.04  ?  113  G   A OP1   1 
ATOM   2406  O  OP2   . G   A 1  113  ? 154.150 174.391 153.189 1.00 76.04  ?  113  G   A OP2   1 
ATOM   2407  O  "O5'" . G   A 1  113  ? 152.747 172.384 153.647 1.00 76.04  ?  113  G   A "O5'" 1 
ATOM   2408  C  "C5'" . G   A 1  113  ? 152.460 171.105 154.196 1.00 76.04  ?  113  G   A "C5'" 1 
ATOM   2409  C  "C4'" . G   A 1  113  ? 151.007 170.741 154.020 1.00 76.04  ?  113  G   A "C4'" 1 
ATOM   2410  O  "O4'" . G   A 1  113  ? 150.171 171.716 154.697 1.00 76.04  ?  113  G   A "O4'" 1 
ATOM   2411  C  "C3'" . G   A 1  113  ? 150.488 170.738 152.590 1.00 76.04  ?  113  G   A "C3'" 1 
ATOM   2412  O  "O3'" . G   A 1  113  ? 150.803 169.546 151.891 1.00 76.04  ?  113  G   A "O3'" 1 
ATOM   2413  C  "C2'" . G   A 1  113  ? 148.993 170.957 152.778 1.00 76.04  ?  113  G   A "C2'" 1 
ATOM   2414  O  "O2'" . G   A 1  113  ? 148.353 169.750 153.163 1.00 76.04  ?  113  G   A "O2'" 1 
ATOM   2415  C  "C1'" . G   A 1  113  ? 148.976 171.914 153.970 1.00 76.04  ?  113  G   A "C1'" 1 
ATOM   2416  N  N9    . G   A 1  113  ? 148.911 173.328 153.551 1.00 76.04  ?  113  G   A N9    1 
ATOM   2417  C  C8    . G   A 1  113  ? 149.911 174.264 153.667 1.00 76.04  ?  113  G   A C8    1 
ATOM   2418  N  N7    . G   A 1  113  ? 149.571 175.439 153.215 1.00 76.04  ?  113  G   A N7    1 
ATOM   2419  C  C5    . G   A 1  113  ? 148.267 175.273 152.773 1.00 76.04  ?  113  G   A C5    1 
ATOM   2420  C  C6    . G   A 1  113  ? 147.373 176.204 152.182 1.00 76.04  ?  113  G   A C6    1 
ATOM   2421  O  O6    . G   A 1  113  ? 147.565 177.398 151.922 1.00 76.04  ?  113  G   A O6    1 
ATOM   2422  N  N1    . G   A 1  113  ? 146.147 175.619 151.884 1.00 76.04  ?  113  G   A N1    1 
ATOM   2423  C  C2    . G   A 1  113  ? 145.821 174.307 152.123 1.00 76.04  ?  113  G   A C2    1 
ATOM   2424  N  N2    . G   A 1  113  ? 144.583 173.931 151.768 1.00 76.04  ?  113  G   A N2    1 
ATOM   2425  N  N3    . G   A 1  113  ? 146.642 173.430 152.677 1.00 76.04  ?  113  G   A N3    1 
ATOM   2426  C  C4    . G   A 1  113  ? 147.842 173.976 152.974 1.00 76.04  ?  113  G   A C4    1 
ATOM   2427  P  P     . C   A 1  114  ? 151.084 169.585 150.309 1.00 77.52  ?  114  C   A P     1 
ATOM   2428  O  OP1   . C   A 1  114  ? 151.671 168.279 149.915 1.00 77.52  ?  114  C   A OP1   1 
ATOM   2429  O  OP2   . C   A 1  114  ? 151.816 170.841 150.004 1.00 77.52  ?  114  C   A OP2   1 
ATOM   2430  O  "O5'" . C   A 1  114  ? 149.634 169.690 149.659 1.00 77.52  ?  114  C   A "O5'" 1 
ATOM   2431  C  "C5'" . C   A 1  114  ? 148.683 168.648 149.823 1.00 77.52  ?  114  C   A "C5'" 1 
ATOM   2432  C  "C4'" . C   A 1  114  ? 147.318 169.062 149.332 1.00 77.52  ?  114  C   A "C4'" 1 
ATOM   2433  O  "O4'" . C   A 1  114  ? 146.863 170.225 150.072 1.00 77.52  ?  114  C   A "O4'" 1 
ATOM   2434  C  "C3'" . C   A 1  114  ? 147.238 169.499 147.877 1.00 77.52  ?  114  C   A "C3'" 1 
ATOM   2435  O  "O3'" . C   A 1  114  ? 147.173 168.410 146.972 1.00 77.52  ?  114  C   A "O3'" 1 
ATOM   2436  C  "C2'" . C   A 1  114  ? 145.997 170.381 147.862 1.00 77.52  ?  114  C   A "C2'" 1 
ATOM   2437  O  "O2'" . C   A 1  114  ? 144.819 169.590 147.815 1.00 77.52  ?  114  C   A "O2'" 1 
ATOM   2438  C  "C1'" . C   A 1  114  ? 146.075 171.050 149.238 1.00 77.52  ?  114  C   A "C1'" 1 
ATOM   2439  N  N1    . C   A 1  114  ? 146.677 172.407 149.186 1.00 77.52  ?  114  C   A N1    1 
ATOM   2440  C  C2    . C   A 1  114  ? 145.880 173.498 148.808 1.00 77.52  ?  114  C   A C2    1 
ATOM   2441  O  O2    . C   A 1  114  ? 144.686 173.321 148.519 1.00 77.52  ?  114  C   A O2    1 
ATOM   2442  N  N3    . C   A 1  114  ? 146.426 174.735 148.764 1.00 77.52  ?  114  C   A N3    1 
ATOM   2443  C  C4    . C   A 1  114  ? 147.709 174.917 149.077 1.00 77.52  ?  114  C   A C4    1 
ATOM   2444  N  N4    . C   A 1  114  ? 148.199 176.157 149.018 1.00 77.52  ?  114  C   A N4    1 
ATOM   2445  C  C5    . C   A 1  114  ? 148.546 173.834 149.470 1.00 77.52  ?  114  C   A C5    1 
ATOM   2446  C  C6    . C   A 1  114  ? 147.993 172.616 149.511 1.00 77.52  ?  114  C   A C6    1 
ATOM   2447  P  P     . U   A 1  115  ? 148.095 168.399 145.655 1.00 76.22  ?  115  U   A P     1 
ATOM   2448  O  OP1   . U   A 1  115  ? 147.901 167.096 144.970 1.00 76.22  ?  115  U   A OP1   1 
ATOM   2449  O  OP2   . U   A 1  115  ? 149.462 168.825 146.048 1.00 76.22  ?  115  U   A OP2   1 
ATOM   2450  O  "O5'" . U   A 1  115  ? 147.470 169.538 144.733 1.00 76.22  ?  115  U   A "O5'" 1 
ATOM   2451  C  "C5'" . U   A 1  115  ? 146.155 169.415 144.211 1.00 76.22  ?  115  U   A "C5'" 1 
ATOM   2452  C  "C4'" . U   A 1  115  ? 145.631 170.738 143.711 1.00 76.22  ?  115  U   A "C4'" 1 
ATOM   2453  O  "O4'" . U   A 1  115  ? 145.661 171.715 144.785 1.00 76.22  ?  115  U   A "O4'" 1 
ATOM   2454  C  "C3'" . U   A 1  115  ? 146.428 171.396 142.595 1.00 76.22  ?  115  U   A "C3'" 1 
ATOM   2455  O  "O3'" . U   A 1  115  ? 146.142 170.859 141.316 1.00 76.22  ?  115  U   A "O3'" 1 
ATOM   2456  C  "C2'" . U   A 1  115  ? 146.055 172.866 142.740 1.00 76.22  ?  115  U   A "C2'" 1 
ATOM   2457  O  "O2'" . U   A 1  115  ? 144.789 173.124 142.151 1.00 76.22  ?  115  U   A "O2'" 1 
ATOM   2458  C  "C1'" . U   A 1  115  ? 145.918 173.001 144.260 1.00 76.22  ?  115  U   A "C1'" 1 
ATOM   2459  N  N1    . U   A 1  115  ? 147.138 173.554 144.899 1.00 76.22  ?  115  U   A N1    1 
ATOM   2460  C  C2    . U   A 1  115  ? 147.284 174.931 144.913 1.00 76.22  ?  115  U   A C2    1 
ATOM   2461  O  O2    . U   A 1  115  ? 146.467 175.696 144.428 1.00 76.22  ?  115  U   A O2    1 
ATOM   2462  N  N3    . U   A 1  115  ? 148.428 175.391 145.518 1.00 76.22  ?  115  U   A N3    1 
ATOM   2463  C  C4    . U   A 1  115  ? 149.424 174.637 146.102 1.00 76.22  ?  115  U   A C4    1 
ATOM   2464  O  O4    . U   A 1  115  ? 150.396 175.201 146.607 1.00 76.22  ?  115  U   A O4    1 
ATOM   2465  C  C5    . U   A 1  115  ? 149.204 173.225 146.051 1.00 76.22  ?  115  U   A C5    1 
ATOM   2466  C  C6    . U   A 1  115  ? 148.098 172.748 145.472 1.00 76.22  ?  115  U   A C6    1 
ATOM   2467  P  P     . C   A 1  116  ? 147.228 170.964 140.136 1.00 79.61  ?  116  C   A P     1 
ATOM   2468  O  OP1   . C   A 1  116  ? 146.886 169.953 139.104 1.00 79.61  ?  116  C   A OP1   1 
ATOM   2469  O  OP2   . C   A 1  116  ? 148.579 170.955 140.753 1.00 79.61  ?  116  C   A OP2   1 
ATOM   2470  O  "O5'" . C   A 1  116  ? 146.981 172.409 139.512 1.00 79.61  ?  116  C   A "O5'" 1 
ATOM   2471  C  "C5'" . C   A 1  116  ? 145.738 172.739 138.910 1.00 79.61  ?  116  C   A "C5'" 1 
ATOM   2472  C  "C4'" . C   A 1  116  ? 145.681 174.192 138.511 1.00 79.61  ?  116  C   A "C4'" 1 
ATOM   2473  O  "O4'" . C   A 1  116  ? 145.724 175.032 139.694 1.00 79.61  ?  116  C   A "O4'" 1 
ATOM   2474  C  "C3'" . C   A 1  116  ? 146.835 174.699 137.661 1.00 79.61  ?  116  C   A "C3'" 1 
ATOM   2475  O  "O3'" . C   A 1  116  ? 146.711 174.360 136.291 1.00 79.61  ?  116  C   A "O3'" 1 
ATOM   2476  C  "C2'" . C   A 1  116  ? 146.810 176.199 137.927 1.00 79.61  ?  116  C   A "C2'" 1 
ATOM   2477  O  "O2'" . C   A 1  116  ? 145.801 176.829 137.151 1.00 79.61  ?  116  C   A "O2'" 1 
ATOM   2478  C  "C1'" . C   A 1  116  ? 146.387 176.245 139.399 1.00 79.61  ?  116  C   A "C1'" 1 
ATOM   2479  N  N1    . C   A 1  116  ? 147.536 176.413 140.324 1.00 79.61  ?  116  C   A N1    1 
ATOM   2480  C  C2    . C   A 1  116  ? 148.035 177.702 140.559 1.00 79.61  ?  116  C   A C2    1 
ATOM   2481  O  O2    . C   A 1  116  ? 147.513 178.675 139.993 1.00 79.61  ?  116  C   A O2    1 
ATOM   2482  N  N3    . C   A 1  116  ? 149.079 177.866 141.404 1.00 79.61  ?  116  C   A N3    1 
ATOM   2483  C  C4    . C   A 1  116  ? 149.629 176.812 142.008 1.00 79.61  ?  116  C   A C4    1 
ATOM   2484  N  N4    . C   A 1  116  ? 150.658 177.027 142.832 1.00 79.61  ?  116  C   A N4    1 
ATOM   2485  C  C5    . C   A 1  116  ? 149.146 175.490 141.794 1.00 79.61  ?  116  C   A C5    1 
ATOM   2486  C  C6    . C   A 1  116  ? 148.111 175.342 140.958 1.00 79.61  ?  116  C   A C6    1 
ATOM   2487  P  P     . U   A 1  117  ? 148.020 174.008 135.428 1.00 79.22  ?  117  U   A P     1 
ATOM   2488  O  OP1   . U   A 1  117  ? 147.575 173.434 134.132 1.00 79.22  ?  117  U   A OP1   1 
ATOM   2489  O  OP2   . U   A 1  117  ? 148.947 173.235 136.293 1.00 79.22  ?  117  U   A OP2   1 
ATOM   2490  O  "O5'" . U   A 1  117  ? 148.685 175.426 135.136 1.00 79.22  ?  117  U   A "O5'" 1 
ATOM   2491  C  "C5'" . U   A 1  117  ? 148.027 176.383 134.320 1.00 79.22  ?  117  U   A "C5'" 1 
ATOM   2492  C  "C4'" . U   A 1  117  ? 148.684 177.738 134.408 1.00 79.22  ?  117  U   A "C4'" 1 
ATOM   2493  O  "O4'" . U   A 1  117  ? 148.618 178.233 135.771 1.00 79.22  ?  117  U   A "O4'" 1 
ATOM   2494  C  "C3'" . U   A 1  117  ? 150.167 177.789 134.073 1.00 79.22  ?  117  U   A "C3'" 1 
ATOM   2495  O  "O3'" . U   A 1  117  ? 150.427 177.799 132.680 1.00 79.22  ?  117  U   A "O3'" 1 
ATOM   2496  C  "C2'" . U   A 1  117  ? 150.623 179.055 134.788 1.00 79.22  ?  117  U   A "C2'" 1 
ATOM   2497  O  "O2'" . U   A 1  117  ? 150.281 180.208 134.035 1.00 79.22  ?  117  U   A "O2'" 1 
ATOM   2498  C  "C1'" . U   A 1  117  ? 149.755 179.026 136.050 1.00 79.22  ?  117  U   A "C1'" 1 
ATOM   2499  N  N1    . U   A 1  117  ? 150.470 178.465 137.224 1.00 79.22  ?  117  U   A N1    1 
ATOM   2500  C  C2    . U   A 1  117  ? 151.303 179.312 137.935 1.00 79.22  ?  117  U   A C2    1 
ATOM   2501  O  O2    . U   A 1  117  ? 151.474 180.485 137.646 1.00 79.22  ?  117  U   A O2    1 
ATOM   2502  N  N3    . U   A 1  117  ? 151.934 178.742 139.013 1.00 79.22  ?  117  U   A N3    1 
ATOM   2503  C  C4    . U   A 1  117  ? 151.826 177.438 139.449 1.00 79.22  ?  117  U   A C4    1 
ATOM   2504  O  O4    . U   A 1  117  ? 152.463 177.074 140.439 1.00 79.22  ?  117  U   A O4    1 
ATOM   2505  C  C5    . U   A 1  117  ? 150.949 176.623 138.667 1.00 79.22  ?  117  U   A C5    1 
ATOM   2506  C  C6    . U   A 1  117  ? 150.319 177.152 137.613 1.00 79.22  ?  117  U   A C6    1 
ATOM   2507  P  P     . C   A 1  118  ? 151.753 177.097 132.104 1.00 78.09  ?  118  C   A P     1 
ATOM   2508  O  OP1   . C   A 1  118  ? 151.632 177.032 130.625 1.00 78.09  ?  118  C   A OP1   1 
ATOM   2509  O  OP2   . C   A 1  118  ? 151.985 175.850 132.876 1.00 78.09  ?  118  C   A OP2   1 
ATOM   2510  O  "O5'" . C   A 1  118  ? 152.922 178.120 132.459 1.00 78.09  ?  118  C   A "O5'" 1 
ATOM   2511  C  "C5'" . C   A 1  118  ? 152.989 179.394 131.835 1.00 78.09  ?  118  C   A "C5'" 1 
ATOM   2512  C  "C4'" . C   A 1  118  ? 153.941 180.320 132.553 1.00 78.09  ?  118  C   A "C4'" 1 
ATOM   2513  O  "O4'" . C   A 1  118  ? 153.543 180.455 133.942 1.00 78.09  ?  118  C   A "O4'" 1 
ATOM   2514  C  "C3'" . C   A 1  118  ? 155.391 179.868 132.630 1.00 78.09  ?  118  C   A "C3'" 1 
ATOM   2515  O  "O3'" . C   A 1  118  ? 156.118 180.119 131.441 1.00 78.09  ?  118  C   A "O3'" 1 
ATOM   2516  C  "C2'" . C   A 1  118  ? 155.914 180.634 133.840 1.00 78.09  ?  118  C   A "C2'" 1 
ATOM   2517  O  "O2'" . C   A 1  118  ? 156.227 181.974 133.488 1.00 78.09  ?  118  C   A "O2'" 1 
ATOM   2518  C  "C1'" . C   A 1  118  ? 154.683 180.649 134.753 1.00 78.09  ?  118  C   A "C1'" 1 
ATOM   2519  N  N1    . C   A 1  118  ? 154.731 179.595 135.798 1.00 78.09  ?  118  C   A N1    1 
ATOM   2520  C  C2    . C   A 1  118  ? 155.421 179.865 136.988 1.00 78.09  ?  118  C   A C2    1 
ATOM   2521  O  O2    . C   A 1  118  ? 155.971 180.967 137.138 1.00 78.09  ?  118  C   A O2    1 
ATOM   2522  N  N3    . C   A 1  118  ? 155.475 178.919 137.955 1.00 78.09  ?  118  C   A N3    1 
ATOM   2523  C  C4    . C   A 1  118  ? 154.876 177.741 137.777 1.00 78.09  ?  118  C   A C4    1 
ATOM   2524  N  N4    . C   A 1  118  ? 154.958 176.842 138.760 1.00 78.09  ?  118  C   A N4    1 
ATOM   2525  C  C5    . C   A 1  118  ? 154.165 177.435 136.581 1.00 78.09  ?  118  C   A C5    1 
ATOM   2526  C  C6    . C   A 1  118  ? 154.118 178.380 135.635 1.00 78.09  ?  118  C   A C6    1 
ATOM   2527  P  P     . C   A 1  119  ? 157.349 179.169 131.032 1.00 80.23  ?  119  C   A P     1 
ATOM   2528  O  OP1   . C   A 1  119  ? 157.681 179.434 129.609 1.00 80.23  ?  119  C   A OP1   1 
ATOM   2529  O  OP2   . C   A 1  119  ? 157.023 177.786 131.463 1.00 80.23  ?  119  C   A OP2   1 
ATOM   2530  O  "O5'" . C   A 1  119  ? 158.560 179.692 131.927 1.00 80.23  ?  119  C   A "O5'" 1 
ATOM   2531  C  "C5'" . C   A 1  119  ? 159.075 181.005 131.762 1.00 80.23  ?  119  C   A "C5'" 1 
ATOM   2532  C  "C4'" . C   A 1  119  ? 159.950 181.409 132.922 1.00 80.23  ?  119  C   A "C4'" 1 
ATOM   2533  O  "O4'" . C   A 1  119  ? 159.203 181.297 134.162 1.00 80.23  ?  119  C   A "O4'" 1 
ATOM   2534  C  "C3'" . C   A 1  119  ? 161.186 180.556 133.160 1.00 80.23  ?  119  C   A "C3'" 1 
ATOM   2535  O  "O3'" . C   A 1  119  ? 162.265 180.891 132.304 1.00 80.23  ?  119  C   A "O3'" 1 
ATOM   2536  C  "C2'" . C   A 1  119  ? 161.481 180.796 134.636 1.00 80.23  ?  119  C   A "C2'" 1 
ATOM   2537  O  "O2'" . C   A 1  119  ? 162.162 182.029 134.818 1.00 80.23  ?  119  C   A "O2'" 1 
ATOM   2538  C  "C1'" . C   A 1  119  ? 160.070 180.933 135.216 1.00 80.23  ?  119  C   A "C1'" 1 
ATOM   2539  N  N1    . C   A 1  119  ? 159.578 179.681 135.845 1.00 80.23  ?  119  C   A N1    1 
ATOM   2540  C  C2    . C   A 1  119  ? 159.938 179.407 137.171 1.00 80.23  ?  119  C   A C2    1 
ATOM   2541  O  O2    . C   A 1  119  ? 160.658 180.208 137.788 1.00 80.23  ?  119  C   A O2    1 
ATOM   2542  N  N3    . C   A 1  119  ? 159.492 178.273 137.760 1.00 80.23  ?  119  C   A N3    1 
ATOM   2543  C  C4    . C   A 1  119  ? 158.717 177.424 137.085 1.00 80.23  ?  119  C   A C4    1 
ATOM   2544  N  N4    . C   A 1  119  ? 158.303 176.319 137.709 1.00 80.23  ?  119  C   A N4    1 
ATOM   2545  C  C5    . C   A 1  119  ? 158.331 177.673 135.737 1.00 80.23  ?  119  C   A C5    1 
ATOM   2546  C  C6    . C   A 1  119  ? 158.777 178.800 135.169 1.00 80.23  ?  119  C   A C6    1 
ATOM   2547  P  P     . C   A 1  120  ? 163.281 179.753 131.801 1.00 83.40  ?  120  C   A P     1 
ATOM   2548  O  OP1   . C   A 1  120  ? 164.140 180.337 130.739 1.00 83.40  ?  120  C   A OP1   1 
ATOM   2549  O  OP2   . C   A 1  120  ? 162.494 178.527 131.520 1.00 83.40  ?  120  C   A OP2   1 
ATOM   2550  O  "O5'" . C   A 1  120  ? 164.197 179.461 133.072 1.00 83.40  ?  120  C   A "O5'" 1 
ATOM   2551  C  "C5'" . C   A 1  120  ? 165.083 180.450 133.574 1.00 83.40  ?  120  C   A "C5'" 1 
ATOM   2552  C  "C4'" . C   A 1  120  ? 165.678 180.041 134.897 1.00 83.40  ?  120  C   A "C4'" 1 
ATOM   2553  O  "O4'" . C   A 1  120  ? 164.629 179.905 135.891 1.00 83.40  ?  120  C   A "O4'" 1 
ATOM   2554  C  "C3'" . C   A 1  120  ? 166.384 178.695 134.928 1.00 83.40  ?  120  C   A "C3'" 1 
ATOM   2555  O  "O3'" . C   A 1  120  ? 167.696 178.739 134.394 1.00 83.40  ?  120  C   A "O3'" 1 
ATOM   2556  C  "C2'" . C   A 1  120  ? 166.337 178.330 136.406 1.00 83.40  ?  120  C   A "C2'" 1 
ATOM   2557  O  "O2'" . C   A 1  120  ? 167.349 179.019 137.126 1.00 83.40  ?  120  C   A "O2'" 1 
ATOM   2558  C  "C1'" . C   A 1  120  ? 164.976 178.899 136.821 1.00 83.40  ?  120  C   A "C1'" 1 
ATOM   2559  N  N1    . C   A 1  120  ? 163.908 177.867 136.854 1.00 83.40  ?  120  C   A N1    1 
ATOM   2560  C  C2    . C   A 1  120  ? 163.787 177.054 137.990 1.00 83.40  ?  120  C   A C2    1 
ATOM   2561  O  O2    . C   A 1  120  ? 164.567 177.207 138.943 1.00 83.40  ?  120  C   A O2    1 
ATOM   2562  N  N3    . C   A 1  120  ? 162.816 176.113 138.032 1.00 83.40  ?  120  C   A N3    1 
ATOM   2563  C  C4    . C   A 1  120  ? 161.982 175.961 137.004 1.00 83.40  ?  120  C   A C4    1 
ATOM   2564  N  N4    . C   A 1  120  ? 161.043 175.017 137.095 1.00 83.40  ?  120  C   A N4    1 
ATOM   2565  C  C5    . C   A 1  120  ? 162.076 176.770 135.837 1.00 83.40  ?  120  C   A C5    1 
ATOM   2566  C  C6    . C   A 1  120  ? 163.040 177.699 135.808 1.00 83.40  ?  120  C   A C6    1 
ATOM   2567  P  P     . U   A 1  121  ? 168.221 177.552 133.445 1.00 84.83  ?  121  U   A P     1 
ATOM   2568  O  OP1   . U   A 1  121  ? 169.576 177.917 132.960 1.00 84.83  ?  121  U   A OP1   1 
ATOM   2569  O  OP2   . U   A 1  121  ? 167.150 177.240 132.465 1.00 84.83  ?  121  U   A OP2   1 
ATOM   2570  O  "O5'" . U   A 1  121  ? 168.370 176.305 134.427 1.00 84.83  ?  121  U   A "O5'" 1 
ATOM   2571  C  "C5'" . U   A 1  121  ? 169.354 176.299 135.451 1.00 84.83  ?  121  U   A "C5'" 1 
ATOM   2572  C  "C4'" . U   A 1  121  ? 169.090 175.222 136.474 1.00 84.83  ?  121  U   A "C4'" 1 
ATOM   2573  O  "O4'" . U   A 1  121  ? 167.755 175.378 137.021 1.00 84.83  ?  121  U   A "O4'" 1 
ATOM   2574  C  "C3'" . U   A 1  121  ? 169.109 173.790 135.963 1.00 84.83  ?  121  U   A "C3'" 1 
ATOM   2575  O  "O3'" . U   A 1  121  ? 170.417 173.267 135.812 1.00 84.83  ?  121  U   A "O3'" 1 
ATOM   2576  C  "C2'" . U   A 1  121  ? 168.272 173.057 137.005 1.00 84.83  ?  121  U   A "C2'" 1 
ATOM   2577  O  "O2'" . U   A 1  121  ? 169.037 172.800 138.173 1.00 84.83  ?  121  U   A "O2'" 1 
ATOM   2578  C  "C1'" . U   A 1  121  ? 167.217 174.113 137.349 1.00 84.83  ?  121  U   A "C1'" 1 
ATOM   2579  N  N1    . U   A 1  121  ? 165.946 173.912 136.610 1.00 84.83  ?  121  U   A N1    1 
ATOM   2580  C  C2    . U   A 1  121  ? 165.042 173.002 137.132 1.00 84.83  ?  121  U   A C2    1 
ATOM   2581  O  O2    . U   A 1  121  ? 165.243 172.369 138.155 1.00 84.83  ?  121  U   A O2    1 
ATOM   2582  N  N3    . U   A 1  121  ? 163.881 172.854 136.414 1.00 84.83  ?  121  U   A N3    1 
ATOM   2583  C  C4    . U   A 1  121  ? 163.532 173.506 135.250 1.00 84.83  ?  121  U   A C4    1 
ATOM   2584  O  O4    . U   A 1  121  ? 162.447 173.262 134.720 1.00 84.83  ?  121  U   A O4    1 
ATOM   2585  C  C5    . U   A 1  121  ? 164.513 174.430 134.771 1.00 84.83  ?  121  U   A C5    1 
ATOM   2586  C  C6    . U   A 1  121  ? 165.651 174.598 135.451 1.00 84.83  ?  121  U   A C6    1 
ATOM   2587  P  P     . G   A 1  122  ? 170.674 172.007 134.848 1.00 82.58  ?  122  G   A P     1 
ATOM   2588  O  OP1   . G   A 1  122  ? 172.091 172.050 134.404 1.00 82.58  ?  122  G   A OP1   1 
ATOM   2589  O  OP2   . G   A 1  122  ? 169.587 171.970 133.837 1.00 82.58  ?  122  G   A OP2   1 
ATOM   2590  O  "O5'" . G   A 1  122  ? 170.493 170.746 135.805 1.00 82.58  ?  122  G   A "O5'" 1 
ATOM   2591  C  "C5'" . G   A 1  122  ? 171.247 170.634 137.003 1.00 82.58  ?  122  G   A "C5'" 1 
ATOM   2592  C  "C4'" . G   A 1  122  ? 170.586 169.712 137.997 1.00 82.58  ?  122  G   A "C4'" 1 
ATOM   2593  O  "O4'" . G   A 1  122  ? 169.167 169.997 138.078 1.00 82.58  ?  122  G   A "O4'" 1 
ATOM   2594  C  "C3'" . G   A 1  122  ? 170.648 168.226 137.681 1.00 82.58  ?  122  G   A "C3'" 1 
ATOM   2595  O  "O3'" . G   A 1  122  ? 171.895 167.658 138.043 1.00 82.58  ?  122  G   A "O3'" 1 
ATOM   2596  C  "C2'" . G   A 1  122  ? 169.468 167.670 138.470 1.00 82.58  ?  122  G   A "C2'" 1 
ATOM   2597  O  "O2'" . G   A 1  122  ? 169.809 167.515 139.839 1.00 82.58  ?  122  G   A "O2'" 1 
ATOM   2598  C  "C1'" . G   A 1  122  ? 168.453 168.810 138.351 1.00 82.58  ?  122  G   A "C1'" 1 
ATOM   2599  N  N9    . G   A 1  122  ? 167.474 168.586 137.271 1.00 82.58  ?  122  G   A N9    1 
ATOM   2600  C  C8    . G   A 1  122  ? 167.402 169.255 136.073 1.00 82.58  ?  122  G   A C8    1 
ATOM   2601  N  N7    . G   A 1  122  ? 166.422 168.845 135.317 1.00 82.58  ?  122  G   A N7    1 
ATOM   2602  C  C5    . G   A 1  122  ? 165.805 167.849 136.059 1.00 82.58  ?  122  G   A C5    1 
ATOM   2603  C  C6    . G   A 1  122  ? 164.680 167.039 135.754 1.00 82.58  ?  122  G   A C6    1 
ATOM   2604  O  O6    . G   A 1  122  ? 163.985 167.045 134.731 1.00 82.58  ?  122  G   A O6    1 
ATOM   2605  N  N1    . G   A 1  122  ? 164.390 166.155 136.788 1.00 82.58  ?  122  G   A N1    1 
ATOM   2606  C  C2    . G   A 1  122  ? 165.090 166.061 137.965 1.00 82.58  ?  122  G   A C2    1 
ATOM   2607  N  N2    . G   A 1  122  ? 164.655 165.145 138.842 1.00 82.58  ?  122  G   A N2    1 
ATOM   2608  N  N3    . G   A 1  122  ? 166.140 166.811 138.262 1.00 82.58  ?  122  G   A N3    1 
ATOM   2609  C  C4    . G   A 1  122  ? 166.440 167.678 137.271 1.00 82.58  ?  122  G   A C4    1 
ATOM   2610  P  P     . A   A 1  123  ? 172.252 166.128 137.699 1.00 68.55  ?  123  A   A P     1 
ATOM   2611  O  OP1   . A   A 1  123  ? 171.668 165.241 138.737 1.00 68.55  ?  123  A   A OP1   1 
ATOM   2612  O  OP2   . A   A 1  123  ? 173.710 166.068 137.432 1.00 68.55  ?  123  A   A OP2   1 
ATOM   2613  O  "O5'" . A   A 1  123  ? 171.502 165.826 136.325 1.00 68.55  ?  123  A   A "O5'" 1 
ATOM   2614  C  "C5'" . A   A 1  123  ? 170.602 164.729 136.208 1.00 68.55  ?  123  A   A "C5'" 1 
ATOM   2615  C  "C4'" . A   A 1  123  ? 171.296 163.463 135.759 1.00 68.55  ?  123  A   A "C4'" 1 
ATOM   2616  O  "O4'" . A   A 1  123  ? 172.367 163.136 136.680 1.00 68.55  ?  123  A   A "O4'" 1 
ATOM   2617  C  "C3'" . A   A 1  123  ? 170.429 162.212 135.726 1.00 68.55  ?  123  A   A "C3'" 1 
ATOM   2618  O  "O3'" . A   A 1  123  ? 169.684 162.104 134.525 1.00 68.55  ?  123  A   A "O3'" 1 
ATOM   2619  C  "C2'" . A   A 1  123  ? 171.439 161.084 135.919 1.00 68.55  ?  123  A   A "C2'" 1 
ATOM   2620  O  "O2'" . A   A 1  123  ? 172.072 160.763 134.689 1.00 68.55  ?  123  A   A "O2'" 1 
ATOM   2621  C  "C1'" . A   A 1  123  ? 172.473 161.741 136.836 1.00 68.55  ?  123  A   A "C1'" 1 
ATOM   2622  N  N9    . A   A 1  123  ? 172.280 161.416 138.264 1.00 68.55  ?  123  A   A N9    1 
ATOM   2623  C  C8    . A   A 1  123  ? 171.302 161.858 139.123 1.00 68.55  ?  123  A   A C8    1 
ATOM   2624  N  N7    . A   A 1  123  ? 171.417 161.392 140.343 1.00 68.55  ?  123  A   A N7    1 
ATOM   2625  C  C5    . A   A 1  123  ? 172.552 160.597 140.286 1.00 68.55  ?  123  A   A C5    1 
ATOM   2626  C  C6    . A   A 1  123  ? 173.220 159.818 141.247 1.00 68.55  ?  123  A   A C6    1 
ATOM   2627  N  N6    . A   A 1  123  ? 172.818 159.709 142.515 1.00 68.55  ?  123  A   A N6    1 
ATOM   2628  N  N1    . A   A 1  123  ? 174.329 159.146 140.861 1.00 68.55  ?  123  A   A N1    1 
ATOM   2629  C  C2    . A   A 1  123  ? 174.740 159.248 139.590 1.00 68.55  ?  123  A   A C2    1 
ATOM   2630  N  N3    . A   A 1  123  ? 174.195 159.948 138.598 1.00 68.55  ?  123  A   A N3    1 
ATOM   2631  C  C4    . A   A 1  123  ? 173.096 160.605 139.014 1.00 68.55  ?  123  A   A C4    1 
ATOM   2632  P  P     . G   A 1  124  ? 168.328 161.244 134.473 1.00 93.62  ?  124  G   A P     1 
ATOM   2633  O  OP1   . G   A 1  124  ? 168.681 159.802 134.530 1.00 93.62  ?  124  G   A OP1   1 
ATOM   2634  O  OP2   . G   A 1  124  ? 167.516 161.751 133.339 1.00 93.62  ?  124  G   A OP2   1 
ATOM   2635  O  "O5'" . G   A 1  124  ? 167.570 161.623 135.821 1.00 93.62  ?  124  G   A "O5'" 1 
ATOM   2636  C  "C5'" . G   A 1  124  ? 166.181 161.367 135.964 1.00 93.62  ?  124  G   A "C5'" 1 
ATOM   2637  C  "C4'" . G   A 1  124  ? 165.927 159.988 136.518 1.00 93.62  ?  124  G   A "C4'" 1 
ATOM   2638  O  "O4'" . G   A 1  124  ? 165.685 160.071 137.943 1.00 93.62  ?  124  G   A "O4'" 1 
ATOM   2639  C  "C3'" . G   A 1  124  ? 164.705 159.268 135.969 1.00 93.62  ?  124  G   A "C3'" 1 
ATOM   2640  O  "O3'" . G   A 1  124  ? 164.983 158.618 134.739 1.00 93.62  ?  124  G   A "O3'" 1 
ATOM   2641  C  "C2'" . G   A 1  124  ? 164.338 158.299 137.090 1.00 93.62  ?  124  G   A "C2'" 1 
ATOM   2642  O  "O2'" . G   A 1  124  ? 165.104 157.109 136.997 1.00 93.62  ?  124  G   A "O2'" 1 
ATOM   2643  C  "C1'" . G   A 1  124  ? 164.774 159.070 138.340 1.00 93.62  ?  124  G   A "C1'" 1 
ATOM   2644  N  N9    . G   A 1  124  ? 163.646 159.700 139.052 1.00 93.62  ?  124  G   A N9    1 
ATOM   2645  C  C8    . G   A 1  124  ? 162.375 159.952 138.591 1.00 93.62  ?  124  G   A C8    1 
ATOM   2646  N  N7    . G   A 1  124  ? 161.612 160.520 139.485 1.00 93.62  ?  124  G   A N7    1 
ATOM   2647  C  C5    . G   A 1  124  ? 162.425 160.648 140.604 1.00 93.62  ?  124  G   A C5    1 
ATOM   2648  C  C6    . G   A 1  124  ? 162.155 161.191 141.888 1.00 93.62  ?  124  G   A C6    1 
ATOM   2649  O  O6    . G   A 1  124  ? 161.103 161.687 142.309 1.00 93.62  ?  124  G   A O6    1 
ATOM   2650  N  N1    . G   A 1  124  ? 163.267 161.119 142.721 1.00 93.62  ?  124  G   A N1    1 
ATOM   2651  C  C2    . G   A 1  124  ? 164.484 160.593 142.367 1.00 93.62  ?  124  G   A C2    1 
ATOM   2652  N  N2    . G   A 1  124  ? 165.436 160.613 143.310 1.00 93.62  ?  124  G   A N2    1 
ATOM   2653  N  N3    . G   A 1  124  ? 164.749 160.084 141.175 1.00 93.62  ?  124  G   A N3    1 
ATOM   2654  C  C4    . G   A 1  124  ? 163.681 160.143 140.351 1.00 93.62  ?  124  G   A C4    1 
ATOM   2655  P  P     . C   A 1  125  ? 163.833 158.406 133.636 1.00 115.10 ?  125  C   A P     1 
ATOM   2656  O  OP1   . C   A 1  125  ? 162.702 157.676 134.261 1.00 115.10 ?  125  C   A OP1   1 
ATOM   2657  O  OP2   . C   A 1  125  ? 164.477 157.844 132.422 1.00 115.10 ?  125  C   A OP2   1 
ATOM   2658  O  "O5'" . C   A 1  125  ? 163.352 159.883 133.286 1.00 115.10 ?  125  C   A "O5'" 1 
ATOM   2659  C  "C5'" . C   A 1  125  ? 163.478 160.394 131.963 1.00 115.10 ?  125  C   A "C5'" 1 
ATOM   2660  C  "C4'" . C   A 1  125  ? 162.129 160.672 131.347 1.00 115.10 ?  125  C   A "C4'" 1 
ATOM   2661  O  "O4'" . C   A 1  125  ? 162.314 161.329 130.064 1.00 115.10 ?  125  C   A "O4'" 1 
ATOM   2662  C  "C3'" . C   A 1  125  ? 161.273 159.438 131.075 1.00 115.10 ?  125  C   A "C3'" 1 
ATOM   2663  O  "O3'" . C   A 1  125  ? 159.897 159.770 131.253 1.00 115.10 ?  125  C   A "O3'" 1 
ATOM   2664  C  "C2'" . C   A 1  125  ? 161.547 159.160 129.600 1.00 115.10 ?  125  C   A "C2'" 1 
ATOM   2665  O  "O2'" . C   A 1  125  ? 160.530 158.436 128.940 1.00 115.10 ?  125  C   A "O2'" 1 
ATOM   2666  C  "C1'" . C   A 1  125  ? 161.688 160.574 129.045 1.00 115.10 ?  125  C   A "C1'" 1 
ATOM   2667  N  N1    . C   A 1  125  ? 162.518 160.663 127.835 1.00 115.10 ?  125  C   A N1    1 
ATOM   2668  C  C2    . C   A 1  125  ? 161.897 160.894 126.605 1.00 115.10 ?  125  C   A C2    1 
ATOM   2669  O  O2    . C   A 1  125  ? 160.663 161.014 126.568 1.00 115.10 ?  125  C   A O2    1 
ATOM   2670  N  N3    . C   A 1  125  ? 162.657 160.978 125.488 1.00 115.10 ?  125  C   A N3    1 
ATOM   2671  C  C4    . C   A 1  125  ? 163.982 160.844 125.570 1.00 115.10 ?  125  C   A C4    1 
ATOM   2672  N  N4    . C   A 1  125  ? 164.691 160.935 124.443 1.00 115.10 ?  125  C   A N4    1 
ATOM   2673  C  C5    . C   A 1  125  ? 164.640 160.609 126.812 1.00 115.10 ?  125  C   A C5    1 
ATOM   2674  C  C6    . C   A 1  125  ? 163.876 160.528 127.909 1.00 115.10 ?  125  C   A C6    1 
ATOM   2675  P  P     . U   A 1  126  ? 159.171 159.481 132.657 1.00 113.68 ?  126  U   A P     1 
ATOM   2676  O  OP1   . U   A 1  126  ? 160.061 158.616 133.471 1.00 113.68 ?  126  U   A OP1   1 
ATOM   2677  O  OP2   . U   A 1  126  ? 157.787 159.030 132.369 1.00 113.68 ?  126  U   A OP2   1 
ATOM   2678  O  "O5'" . U   A 1  126  ? 159.103 160.910 133.358 1.00 113.68 ?  126  U   A "O5'" 1 
ATOM   2679  C  "C5'" . U   A 1  126  ? 157.853 161.546 133.614 1.00 113.68 ?  126  U   A "C5'" 1 
ATOM   2680  C  "C4'" . U   A 1  126  ? 157.820 162.972 133.111 1.00 113.68 ?  126  U   A "C4'" 1 
ATOM   2681  O  "O4'" . U   A 1  126  ? 158.970 163.692 133.634 1.00 113.68 ?  126  U   A "O4'" 1 
ATOM   2682  C  "C3'" . U   A 1  126  ? 157.865 163.140 131.589 1.00 113.68 ?  126  U   A "C3'" 1 
ATOM   2683  O  "O3'" . U   A 1  126  ? 157.046 164.223 131.091 1.00 113.68 ?  126  U   A "O3'" 1 
ATOM   2684  C  "C2'" . U   A 1  126  ? 159.338 163.453 131.325 1.00 113.68 ?  126  U   A "C2'" 1 
ATOM   2685  O  "O2'" . U   A 1  126  ? 159.581 164.180 130.139 1.00 113.68 ?  126  U   A "O2'" 1 
ATOM   2686  C  "C1'" . U   A 1  126  ? 159.712 164.256 132.568 1.00 113.68 ?  126  U   A "C1'" 1 
ATOM   2687  N  N1    . U   A 1  126  ? 161.137 164.200 132.923 1.00 113.68 ?  126  U   A N1    1 
ATOM   2688  C  C2    . U   A 1  126  ? 161.991 165.114 132.335 1.00 113.68 ?  126  U   A C2    1 
ATOM   2689  O  O2    . U   A 1  126  ? 161.617 165.947 131.528 1.00 113.68 ?  126  U   A O2    1 
ATOM   2690  N  N3    . U   A 1  126  ? 163.306 165.007 132.718 1.00 113.68 ?  126  U   A N3    1 
ATOM   2691  C  C4    . U   A 1  126  ? 163.839 164.104 133.616 1.00 113.68 ?  126  U   A C4    1 
ATOM   2692  O  O4    . U   A 1  126  ? 165.046 164.135 133.861 1.00 113.68 ?  126  U   A O4    1 
ATOM   2693  C  C5    . U   A 1  126  ? 162.889 163.201 134.189 1.00 113.68 ?  126  U   A C5    1 
ATOM   2694  C  C6    . U   A 1  126  ? 161.603 163.281 133.834 1.00 113.68 ?  126  U   A C6    1 
ATOM   2695  P  P     . U   A 1  127  ? 156.183 165.270 131.981 1.00 124.18 ?  127  U   A P     1 
ATOM   2696  O  OP1   . U   A 1  127  ? 155.519 166.099 130.948 1.00 124.18 ?  127  U   A OP1   1 
ATOM   2697  O  OP2   . U   A 1  127  ? 156.951 166.032 133.003 1.00 124.18 ?  127  U   A OP2   1 
ATOM   2698  O  "O5'" . U   A 1  127  ? 154.993 164.428 132.627 1.00 124.18 ?  127  U   A "O5'" 1 
ATOM   2699  C  "C5'" . U   A 1  127  ? 153.759 165.059 132.940 1.00 124.18 ?  127  U   A "C5'" 1 
ATOM   2700  C  "C4'" . U   A 1  127  ? 153.020 164.355 134.052 1.00 124.18 ?  127  U   A "C4'" 1 
ATOM   2701  O  "O4'" . U   A 1  127  ? 152.471 163.101 133.574 1.00 124.18 ?  127  U   A "O4'" 1 
ATOM   2702  C  "C3'" . U   A 1  127  ? 153.837 163.964 135.274 1.00 124.18 ?  127  U   A "C3'" 1 
ATOM   2703  O  "O3'" . U   A 1  127  ? 154.040 165.058 136.155 1.00 124.18 ?  127  U   A "O3'" 1 
ATOM   2704  C  "C2'" . U   A 1  127  ? 153.012 162.832 135.879 1.00 124.18 ?  127  U   A "C2'" 1 
ATOM   2705  O  "O2'" . U   A 1  127  ? 151.942 163.350 136.656 1.00 124.18 ?  127  U   A "O2'" 1 
ATOM   2706  C  "C1'" . U   A 1  127  ? 152.424 162.165 134.629 1.00 124.18 ?  127  U   A "C1'" 1 
ATOM   2707  N  N1    . U   A 1  127  ? 153.156 160.942 134.220 1.00 124.18 ?  127  U   A N1    1 
ATOM   2708  C  C2    . U   A 1  127  ? 152.893 159.756 134.888 1.00 124.18 ?  127  U   A C2    1 
ATOM   2709  O  O2    . U   A 1  127  ? 152.100 159.662 135.810 1.00 124.18 ?  127  U   A O2    1 
ATOM   2710  N  N3    . U   A 1  127  ? 153.603 158.668 134.443 1.00 124.18 ?  127  U   A N3    1 
ATOM   2711  C  C4    . U   A 1  127  ? 154.524 158.638 133.417 1.00 124.18 ?  127  U   A C4    1 
ATOM   2712  O  O4    . U   A 1  127  ? 155.083 157.577 133.133 1.00 124.18 ?  127  U   A O4    1 
ATOM   2713  C  C5    . U   A 1  127  ? 154.732 159.896 132.771 1.00 124.18 ?  127  U   A C5    1 
ATOM   2714  C  C6    . U   A 1  127  ? 154.058 160.973 133.181 1.00 124.18 ?  127  U   A C6    1 
ATOM   2715  P  P     . C   A 1  128  ? 154.916 164.907 137.497 1.00 104.17 ?  128  C   A P     1 
ATOM   2716  O  OP1   . C   A 1  128  ? 154.029 164.452 138.598 1.00 104.17 ?  128  C   A OP1   1 
ATOM   2717  O  OP2   . C   A 1  128  ? 155.690 166.162 137.666 1.00 104.17 ?  128  C   A OP2   1 
ATOM   2718  O  "O5'" . C   A 1  128  ? 155.954 163.743 137.175 1.00 104.17 ?  128  C   A "O5'" 1 
ATOM   2719  C  "C5'" . C   A 1  128  ? 156.115 162.649 138.066 1.00 104.17 ?  128  C   A "C5'" 1 
ATOM   2720  C  "C4'" . C   A 1  128  ? 157.495 162.619 138.674 1.00 104.17 ?  128  C   A "C4'" 1 
ATOM   2721  O  "O4'" . C   A 1  128  ? 158.496 162.684 137.626 1.00 104.17 ?  128  C   A "O4'" 1 
ATOM   2722  C  "C3'" . C   A 1  128  ? 157.855 163.778 139.592 1.00 104.17 ?  128  C   A "C3'" 1 
ATOM   2723  O  "O3'" . C   A 1  128  ? 157.324 163.646 140.900 1.00 104.17 ?  128  C   A "O3'" 1 
ATOM   2724  C  "C2'" . C   A 1  128  ? 159.378 163.773 139.550 1.00 104.17 ?  128  C   A "C2'" 1 
ATOM   2725  O  "O2'" . C   A 1  128  ? 159.897 162.770 140.410 1.00 104.17 ?  128  C   A "O2'" 1 
ATOM   2726  C  "C1'" . C   A 1  128  ? 159.647 163.353 138.101 1.00 104.17 ?  128  C   A "C1'" 1 
ATOM   2727  N  N1    . C   A 1  128  ? 159.950 164.508 137.220 1.00 104.17 ?  128  C   A N1    1 
ATOM   2728  C  C2    . C   A 1  128  ? 161.279 164.943 137.138 1.00 104.17 ?  128  C   A C2    1 
ATOM   2729  O  O2    . C   A 1  128  ? 162.151 164.355 137.796 1.00 104.17 ?  128  C   A O2    1 
ATOM   2730  N  N3    . C   A 1  128  ? 161.587 165.993 136.342 1.00 104.17 ?  128  C   A N3    1 
ATOM   2731  C  C4    . C   A 1  128  ? 160.633 166.608 135.643 1.00 104.17 ?  128  C   A C4    1 
ATOM   2732  N  N4    . C   A 1  128  ? 160.986 167.639 134.873 1.00 104.17 ?  128  C   A N4    1 
ATOM   2733  C  C5    . C   A 1  128  ? 159.272 166.192 135.704 1.00 104.17 ?  128  C   A C5    1 
ATOM   2734  C  C6    . C   A 1  128  ? 158.982 165.150 136.493 1.00 104.17 ?  128  C   A C6    1 
ATOM   2735  P  P     . G   A 1  129  ? 157.068 164.953 141.801 1.00 88.82  ?  129  G   A P     1 
ATOM   2736  O  OP1   . G   A 1  129  ? 156.165 164.570 142.917 1.00 88.82  ?  129  G   A OP1   1 
ATOM   2737  O  OP2   . G   A 1  129  ? 156.685 166.066 140.896 1.00 88.82  ?  129  G   A OP2   1 
ATOM   2738  O  "O5'" . G   A 1  129  ? 158.498 165.291 142.420 1.00 88.82  ?  129  G   A "O5'" 1 
ATOM   2739  C  "C5'" . G   A 1  129  ? 159.090 164.440 143.390 1.00 88.82  ?  129  G   A "C5'" 1 
ATOM   2740  C  "C4'" . G   A 1  129  ? 160.523 164.822 143.676 1.00 88.82  ?  129  G   A "C4'" 1 
ATOM   2741  O  "O4'" . G   A 1  129  ? 161.309 164.749 142.458 1.00 88.82  ?  129  G   A "O4'" 1 
ATOM   2742  C  "C3'" . G   A 1  129  ? 160.760 166.238 144.179 1.00 88.82  ?  129  G   A "C3'" 1 
ATOM   2743  O  "O3'" . G   A 1  129  ? 160.487 166.392 145.561 1.00 88.82  ?  129  G   A "O3'" 1 
ATOM   2744  C  "C2'" . G   A 1  129  ? 162.221 166.473 143.817 1.00 88.82  ?  129  G   A "C2'" 1 
ATOM   2745  O  "O2'" . G   A 1  129  ? 163.078 165.835 144.752 1.00 88.82  ?  129  G   A "O2'" 1 
ATOM   2746  C  "C1'" . G   A 1  129  ? 162.324 165.732 142.484 1.00 88.82  ?  129  G   A "C1'" 1 
ATOM   2747  N  N9    . G   A 1  129  ? 162.141 166.640 141.335 1.00 88.82  ?  129  G   A N9    1 
ATOM   2748  C  C8    . G   A 1  129  ? 161.028 166.772 140.541 1.00 88.82  ?  129  G   A C8    1 
ATOM   2749  N  N7    . G   A 1  129  ? 161.171 167.664 139.600 1.00 88.82  ?  129  G   A N7    1 
ATOM   2750  C  C5    . G   A 1  129  ? 162.457 168.155 139.784 1.00 88.82  ?  129  G   A C5    1 
ATOM   2751  C  C6    . G   A 1  129  ? 163.176 169.145 139.067 1.00 88.82  ?  129  G   A C6    1 
ATOM   2752  O  O6    . G   A 1  129  ? 162.808 169.811 138.091 1.00 88.82  ?  129  G   A O6    1 
ATOM   2753  N  N1    . G   A 1  129  ? 164.451 169.333 139.592 1.00 88.82  ?  129  G   A N1    1 
ATOM   2754  C  C2    . G   A 1  129  ? 164.969 168.657 140.669 1.00 88.82  ?  129  G   A C2    1 
ATOM   2755  N  N2    . G   A 1  129  ? 166.221 168.979 141.025 1.00 88.82  ?  129  G   A N2    1 
ATOM   2756  N  N3    . G   A 1  129  ? 164.309 167.731 141.345 1.00 88.82  ?  129  G   A N3    1 
ATOM   2757  C  C4    . G   A 1  129  ? 163.068 167.533 140.852 1.00 88.82  ?  129  G   A C4    1 
ATOM   2758  P  P     . G   A 1  130  ? 159.893 167.778 146.118 1.00 82.48  ?  130  G   A P     1 
ATOM   2759  O  OP1   . G   A 1  130  ? 159.551 167.588 147.550 1.00 82.48  ?  130  G   A OP1   1 
ATOM   2760  O  OP2   . G   A 1  130  ? 158.850 168.245 145.169 1.00 82.48  ?  130  G   A OP2   1 
ATOM   2761  O  "O5'" . G   A 1  130  ? 161.122 168.791 146.037 1.00 82.48  ?  130  G   A "O5'" 1 
ATOM   2762  C  "C5'" . G   A 1  130  ? 162.248 168.642 146.889 1.00 82.48  ?  130  G   A "C5'" 1 
ATOM   2763  C  "C4'" . G   A 1  130  ? 163.371 169.569 146.494 1.00 82.48  ?  130  G   A "C4'" 1 
ATOM   2764  O  "O4'" . G   A 1  130  ? 163.789 169.284 145.133 1.00 82.48  ?  130  G   A "O4'" 1 
ATOM   2765  C  "C3'" . G   A 1  130  ? 163.039 171.053 146.474 1.00 82.48  ?  130  G   A "C3'" 1 
ATOM   2766  O  "O3'" . G   A 1  130  ? 163.082 171.648 147.759 1.00 82.48  ?  130  G   A "O3'" 1 
ATOM   2767  C  "C2'" . G   A 1  130  ? 164.075 171.611 145.509 1.00 82.48  ?  130  G   A "C2'" 1 
ATOM   2768  O  "O2'" . G   A 1  130  ? 165.336 171.747 146.149 1.00 82.48  ?  130  G   A "O2'" 1 
ATOM   2769  C  "C1'" . G   A 1  130  ? 164.173 170.479 144.486 1.00 82.48  ?  130  G   A "C1'" 1 
ATOM   2770  N  N9    . G   A 1  130  ? 163.277 170.697 143.334 1.00 82.48  ?  130  G   A N9    1 
ATOM   2771  C  C8    . G   A 1  130  ? 162.107 170.030 143.061 1.00 82.48  ?  130  G   A C8    1 
ATOM   2772  N  N7    . G   A 1  130  ? 161.527 170.440 141.967 1.00 82.48  ?  130  G   A N7    1 
ATOM   2773  C  C5    . G   A 1  130  ? 162.363 171.439 141.487 1.00 82.48  ?  130  G   A C5    1 
ATOM   2774  C  C6    . G   A 1  130  ? 162.253 172.251 140.329 1.00 82.48  ?  130  G   A C6    1 
ATOM   2775  O  O6    . G   A 1  130  ? 161.365 172.251 139.468 1.00 82.48  ?  130  G   A O6    1 
ATOM   2776  N  N1    . G   A 1  130  ? 163.322 173.136 140.221 1.00 82.48  ?  130  G   A N1    1 
ATOM   2777  C  C2    . G   A 1  130  ? 164.363 173.229 141.112 1.00 82.48  ?  130  G   A C2    1 
ATOM   2778  N  N2    . G   A 1  130  ? 165.300 174.147 140.833 1.00 82.48  ?  130  G   A N2    1 
ATOM   2779  N  N3    . G   A 1  130  ? 164.477 172.477 142.194 1.00 82.48  ?  130  G   A N3    1 
ATOM   2780  C  C4    . G   A 1  130  ? 163.449 171.610 142.320 1.00 82.48  ?  130  G   A C4    1 
ATOM   2781  P  P     . G   A 1  131  ? 162.070 172.840 148.131 1.00 79.81  ?  131  G   A P     1 
ATOM   2782  O  OP1   . G   A 1  131  ? 162.165 173.084 149.593 1.00 79.81  ?  131  G   A OP1   1 
ATOM   2783  O  OP2   . G   A 1  131  ? 160.751 172.530 147.523 1.00 79.81  ?  131  G   A OP2   1 
ATOM   2784  O  "O5'" . G   A 1  131  ? 162.672 174.110 147.380 1.00 79.81  ?  131  G   A "O5'" 1 
ATOM   2785  C  "C5'" . G   A 1  131  ? 163.921 174.663 147.769 1.00 79.81  ?  131  G   A "C5'" 1 
ATOM   2786  C  "C4'" . G   A 1  131  ? 164.340 175.786 146.853 1.00 79.81  ?  131  G   A "C4'" 1 
ATOM   2787  O  "O4'" . G   A 1  131  ? 164.563 175.270 145.514 1.00 79.81  ?  131  G   A "O4'" 1 
ATOM   2788  C  "C3'" . G   A 1  131  ? 163.324 176.900 146.654 1.00 79.81  ?  131  G   A "C3'" 1 
ATOM   2789  O  "O3'" . G   A 1  131  ? 163.323 177.847 147.709 1.00 79.81  ?  131  G   A "O3'" 1 
ATOM   2790  C  "C2'" . G   A 1  131  ? 163.734 177.487 145.311 1.00 79.81  ?  131  G   A "C2'" 1 
ATOM   2791  O  "O2'" . G   A 1  131  ? 164.863 178.336 145.458 1.00 79.81  ?  131  G   A "O2'" 1 
ATOM   2792  C  "C1'" . G   A 1  131  ? 164.171 176.231 144.555 1.00 79.81  ?  131  G   A "C1'" 1 
ATOM   2793  N  N9    . G   A 1  131  ? 163.078 175.663 143.742 1.00 79.81  ?  131  G   A N9    1 
ATOM   2794  C  C8    . G   A 1  131  ? 162.433 174.469 143.960 1.00 79.81  ?  131  G   A C8    1 
ATOM   2795  N  N7    . G   A 1  131  ? 161.505 174.217 143.078 1.00 79.81  ?  131  G   A N7    1 
ATOM   2796  C  C5    . G   A 1  131  ? 161.538 175.309 142.223 1.00 79.81  ?  131  G   A C5    1 
ATOM   2797  C  C6    . G   A 1  131  ? 160.758 175.596 141.073 1.00 79.81  ?  131  G   A C6    1 
ATOM   2798  O  O6    . G   A 1  131  ? 159.854 174.920 140.566 1.00 79.81  ?  131  G   A O6    1 
ATOM   2799  N  N1    . G   A 1  131  ? 161.117 176.812 140.499 1.00 79.81  ?  131  G   A N1    1 
ATOM   2800  C  C2    . G   A 1  131  ? 162.101 177.645 140.970 1.00 79.81  ?  131  G   A C2    1 
ATOM   2801  N  N2    . G   A 1  131  ? 162.300 178.778 140.280 1.00 79.81  ?  131  G   A N2    1 
ATOM   2802  N  N3    . G   A 1  131  ? 162.835 177.389 142.040 1.00 79.81  ?  131  G   A N3    1 
ATOM   2803  C  C4    . G   A 1  131  ? 162.504 176.212 142.616 1.00 79.81  ?  131  G   A C4    1 
ATOM   2804  P  P     . G   A 1  132  ? 161.958 178.582 148.135 1.00 79.75  ?  132  G   A P     1 
ATOM   2805  O  OP1   . G   A 1  132  ? 162.200 179.291 149.418 1.00 79.75  ?  132  G   A OP1   1 
ATOM   2806  O  OP2   . G   A 1  132  ? 160.855 177.592 148.040 1.00 79.75  ?  132  G   A OP2   1 
ATOM   2807  O  "O5'" . G   A 1  132  ? 161.735 179.679 147.001 1.00 79.75  ?  132  G   A "O5'" 1 
ATOM   2808  C  "C5'" . G   A 1  132  ? 162.649 180.752 146.832 1.00 79.75  ?  132  G   A "C5'" 1 
ATOM   2809  C  "C4'" . G   A 1  132  ? 162.434 181.464 145.520 1.00 79.75  ?  132  G   A "C4'" 1 
ATOM   2810  O  "O4'" . G   A 1  132  ? 162.517 180.513 144.426 1.00 79.75  ?  132  G   A "O4'" 1 
ATOM   2811  C  "C3'" . G   A 1  132  ? 161.077 182.125 145.332 1.00 79.75  ?  132  G   A "C3'" 1 
ATOM   2812  O  "O3'" . G   A 1  132  ? 160.985 183.393 145.958 1.00 79.75  ?  132  G   A "O3'" 1 
ATOM   2813  C  "C2'" . G   A 1  132  ? 160.945 182.184 143.817 1.00 79.75  ?  132  G   A "C2'" 1 
ATOM   2814  O  "O2'" . G   A 1  132  ? 161.709 183.258 143.288 1.00 79.75  ?  132  G   A "O2'" 1 
ATOM   2815  C  "C1'" . G   A 1  132  ? 161.609 180.871 143.405 1.00 79.75  ?  132  G   A "C1'" 1 
ATOM   2816  N  N9    . G   A 1  132  ? 160.629 179.779 143.244 1.00 79.75  ?  132  G   A N9    1 
ATOM   2817  C  C8    . G   A 1  132  ? 160.488 178.677 144.053 1.00 79.75  ?  132  G   A C8    1 
ATOM   2818  N  N7    . G   A 1  132  ? 159.534 177.874 143.667 1.00 79.75  ?  132  G   A N7    1 
ATOM   2819  C  C5    . G   A 1  132  ? 159.012 178.481 142.533 1.00 79.75  ?  132  G   A C5    1 
ATOM   2820  C  C6    . G   A 1  132  ? 157.954 178.073 141.679 1.00 79.75  ?  132  G   A C6    1 
ATOM   2821  O  O6    . G   A 1  132  ? 157.246 177.062 141.758 1.00 79.75  ?  132  G   A O6    1 
ATOM   2822  N  N1    . G   A 1  132  ? 157.751 178.981 140.645 1.00 79.75  ?  132  G   A N1    1 
ATOM   2823  C  C2    . G   A 1  132  ? 158.472 180.133 140.454 1.00 79.75  ?  132  G   A C2    1 
ATOM   2824  N  N2    . G   A 1  132  ? 158.124 180.882 139.398 1.00 79.75  ?  132  G   A N2    1 
ATOM   2825  N  N3    . G   A 1  132  ? 159.459 180.524 141.242 1.00 79.75  ?  132  G   A N3    1 
ATOM   2826  C  C4    . G   A 1  132  ? 159.676 179.658 142.256 1.00 79.75  ?  132  G   A C4    1 
ATOM   2827  P  P     . A   A 1  133  ? 159.573 183.920 146.519 1.00 82.21  ?  133  A   A P     1 
ATOM   2828  O  OP1   . A   A 1  133  ? 159.833 185.105 147.375 1.00 82.21  ?  133  A   A OP1   1 
ATOM   2829  O  OP2   . A   A 1  133  ? 158.839 182.757 147.079 1.00 82.21  ?  133  A   A OP2   1 
ATOM   2830  O  "O5'" . A   A 1  133  ? 158.796 184.412 145.218 1.00 82.21  ?  133  A   A "O5'" 1 
ATOM   2831  C  "C5'" . A   A 1  133  ? 159.286 185.494 144.439 1.00 82.21  ?  133  A   A "C5'" 1 
ATOM   2832  C  "C4'" . A   A 1  133  ? 158.601 185.568 143.097 1.00 82.21  ?  133  A   A "C4'" 1 
ATOM   2833  O  "O4'" . A   A 1  133  ? 158.739 184.299 142.405 1.00 82.21  ?  133  A   A "O4'" 1 
ATOM   2834  C  "C3'" . A   A 1  133  ? 157.099 185.809 143.127 1.00 82.21  ?  133  A   A "C3'" 1 
ATOM   2835  O  "O3'" . A   A 1  133  ? 156.760 187.174 143.303 1.00 82.21  ?  133  A   A "O3'" 1 
ATOM   2836  C  "C2'" . A   A 1  133  ? 156.645 185.234 141.792 1.00 82.21  ?  133  A   A "C2'" 1 
ATOM   2837  O  "O2'" . A   A 1  133  ? 156.926 186.138 140.734 1.00 82.21  ?  133  A   A "O2'" 1 
ATOM   2838  C  "C1'" . A   A 1  133  ? 157.574 184.028 141.655 1.00 82.21  ?  133  A   A "C1'" 1 
ATOM   2839  N  N9    . A   A 1  133  ? 156.956 182.795 142.180 1.00 82.21  ?  133  A   A N9    1 
ATOM   2840  C  C8    . A   A 1  133  ? 157.263 182.132 143.343 1.00 82.21  ?  133  A   A C8    1 
ATOM   2841  N  N7    . A   A 1  133  ? 156.541 181.057 143.547 1.00 82.21  ?  133  A   A N7    1 
ATOM   2842  C  C5    . A   A 1  133  ? 155.701 181.009 142.444 1.00 82.21  ?  133  A   A C5    1 
ATOM   2843  C  C6    . A   A 1  133  ? 154.691 180.110 142.054 1.00 82.21  ?  133  A   A C6    1 
ATOM   2844  N  N6    . A   A 1  133  ? 154.341 179.037 142.768 1.00 82.21  ?  133  A   A N6    1 
ATOM   2845  N  N1    . A   A 1  133  ? 154.042 180.350 140.891 1.00 82.21  ?  133  A   A N1    1 
ATOM   2846  C  C2    . A   A 1  133  ? 154.386 181.423 140.166 1.00 82.21  ?  133  A   A C2    1 
ATOM   2847  N  N3    . A   A 1  133  ? 155.318 182.339 140.429 1.00 82.21  ?  133  A   A N3    1 
ATOM   2848  C  C4    . A   A 1  133  ? 155.944 182.073 141.592 1.00 82.21  ?  133  A   A C4    1 
ATOM   2849  P  P     . G   A 1  134  ? 155.467 187.580 144.167 1.00 81.84  ?  134  G   A P     1 
ATOM   2850  O  OP1   . G   A 1  134  ? 155.329 189.058 144.126 1.00 81.84  ?  134  G   A OP1   1 
ATOM   2851  O  OP2   . G   A 1  134  ? 155.555 186.887 145.478 1.00 81.84  ?  134  G   A OP2   1 
ATOM   2852  O  "O5'" . G   A 1  134  ? 154.250 186.947 143.358 1.00 81.84  ?  134  G   A "O5'" 1 
ATOM   2853  C  "C5'" . G   A 1  134  ? 153.250 187.772 142.770 1.00 81.84  ?  134  G   A "C5'" 1 
ATOM   2854  C  "C4'" . G   A 1  134  ? 152.799 187.236 141.433 1.00 81.84  ?  134  G   A "C4'" 1 
ATOM   2855  O  "O4'" . G   A 1  134  ? 153.038 185.802 141.386 1.00 81.84  ?  134  G   A "O4'" 1 
ATOM   2856  C  "C3'" . G   A 1  134  ? 151.316 187.428 141.127 1.00 81.84  ?  134  G   A "C3'" 1 
ATOM   2857  O  "O3'" . G   A 1  134  ? 151.141 187.585 139.719 1.00 81.84  ?  134  G   A "O3'" 1 
ATOM   2858  C  "C2'" . G   A 1  134  ? 150.717 186.095 141.561 1.00 81.84  ?  134  G   A "C2'" 1 
ATOM   2859  O  "O2'" . G   A 1  134  ? 149.483 185.779 140.952 1.00 81.84  ?  134  G   A "O2'" 1 
ATOM   2860  C  "C1'" . G   A 1  134  ? 151.818 185.125 141.147 1.00 81.84  ?  134  G   A "C1'" 1 
ATOM   2861  N  N9    . G   A 1  134  ? 151.833 183.866 141.895 1.00 81.84  ?  134  G   A N9    1 
ATOM   2862  C  C8    . G   A 1  134  ? 152.534 183.585 143.043 1.00 81.84  ?  134  G   A C8    1 
ATOM   2863  N  N7    . G   A 1  134  ? 152.353 182.363 143.465 1.00 81.84  ?  134  G   A N7    1 
ATOM   2864  C  C5    . G   A 1  134  ? 151.488 181.801 142.536 1.00 81.84  ?  134  G   A C5    1 
ATOM   2865  C  C6    . G   A 1  134  ? 150.932 180.498 142.463 1.00 81.84  ?  134  G   A C6    1 
ATOM   2866  O  O6    . G   A 1  134  ? 151.097 179.545 143.234 1.00 81.84  ?  134  G   A O6    1 
ATOM   2867  N  N1    . G   A 1  134  ? 150.103 180.356 141.354 1.00 81.84  ?  134  G   A N1    1 
ATOM   2868  C  C2    . G   A 1  134  ? 149.843 181.339 140.431 1.00 81.84  ?  134  G   A C2    1 
ATOM   2869  N  N2    . G   A 1  134  ? 149.015 181.009 139.429 1.00 81.84  ?  134  G   A N2    1 
ATOM   2870  N  N3    . G   A 1  134  ? 150.355 182.557 140.487 1.00 81.84  ?  134  G   A N3    1 
ATOM   2871  C  C4    . G   A 1  134  ? 151.165 182.715 141.555 1.00 81.84  ?  134  G   A C4    1 
ATOM   2872  P  P     . G   A 1  135  ? 150.636 188.985 139.115 1.00 87.33  ?  135  G   A P     1 
ATOM   2873  O  OP1   . G   A 1  135  ? 150.117 188.735 137.746 1.00 87.33  ?  135  G   A OP1   1 
ATOM   2874  O  OP2   . G   A 1  135  ? 151.710 189.990 139.320 1.00 87.33  ?  135  G   A OP2   1 
ATOM   2875  O  "O5'" . G   A 1  135  ? 149.405 189.384 140.043 1.00 87.33  ?  135  G   A "O5'" 1 
ATOM   2876  C  "C5'" . G   A 1  135  ? 148.103 188.870 139.799 1.00 87.33  ?  135  G   A "C5'" 1 
ATOM   2877  C  "C4'" . G   A 1  135  ? 147.051 189.724 140.459 1.00 87.33  ?  135  G   A "C4'" 1 
ATOM   2878  O  "O4'" . G   A 1  135  ? 147.221 189.676 141.900 1.00 87.33  ?  135  G   A "O4'" 1 
ATOM   2879  C  "C3'" . G   A 1  135  ? 147.111 191.207 140.122 1.00 87.33  ?  135  G   A "C3'" 1 
ATOM   2880  O  "O3'" . G   A 1  135  ? 146.464 191.519 138.901 1.00 87.33  ?  135  G   A "O3'" 1 
ATOM   2881  C  "C2'" . G   A 1  135  ? 146.466 191.855 141.339 1.00 87.33  ?  135  G   A "C2'" 1 
ATOM   2882  O  "O2'" . G   A 1  135  ? 145.051 191.756 141.270 1.00 87.33  ?  135  G   A "O2'" 1 
ATOM   2883  C  "C1'" . G   A 1  135  ? 146.959 190.944 142.463 1.00 87.33  ?  135  G   A "C1'" 1 
ATOM   2884  N  N9    . G   A 1  135  ? 148.207 191.434 143.081 1.00 87.33  ?  135  G   A N9    1 
ATOM   2885  C  C8    . G   A 1  135  ? 149.428 190.806 143.026 1.00 87.33  ?  135  G   A C8    1 
ATOM   2886  N  N7    . G   A 1  135  ? 150.369 191.446 143.662 1.00 87.33  ?  135  G   A N7    1 
ATOM   2887  C  C5    . G   A 1  135  ? 149.733 192.567 144.174 1.00 87.33  ?  135  G   A C5    1 
ATOM   2888  C  C6    . G   A 1  135  ? 150.251 193.631 144.957 1.00 87.33  ?  135  G   A C6    1 
ATOM   2889  O  O6    . G   A 1  135  ? 151.408 193.798 145.362 1.00 87.33  ?  135  G   A O6    1 
ATOM   2890  N  N1    . G   A 1  135  ? 149.269 194.565 145.264 1.00 87.33  ?  135  G   A N1    1 
ATOM   2891  C  C2    . G   A 1  135  ? 147.956 194.486 144.871 1.00 87.33  ?  135  G   A C2    1 
ATOM   2892  N  N2    . G   A 1  135  ? 147.162 195.490 145.269 1.00 87.33  ?  135  G   A N2    1 
ATOM   2893  N  N3    . G   A 1  135  ? 147.460 193.499 144.143 1.00 87.33  ?  135  G   A N3    1 
ATOM   2894  C  C4    . G   A 1  135  ? 148.396 192.577 143.829 1.00 87.33  ?  135  G   A C4    1 
ATOM   2895  P  P     . U   A 1  136  ? 147.199 192.435 137.804 1.00 90.26  ?  136  U   A P     1 
ATOM   2896  O  OP1   . U   A 1  136  ? 146.501 192.248 136.507 1.00 90.26  ?  136  U   A OP1   1 
ATOM   2897  O  OP2   . U   A 1  136  ? 148.660 192.179 137.896 1.00 90.26  ?  136  U   A OP2   1 
ATOM   2898  O  "O5'" . U   A 1  136  ? 146.927 193.923 138.301 1.00 90.26  ?  136  U   A "O5'" 1 
ATOM   2899  C  "C5'" . U   A 1  136  ? 145.601 194.407 138.457 1.00 90.26  ?  136  U   A "C5'" 1 
ATOM   2900  C  "C4'" . U   A 1  136  ? 145.560 195.621 139.350 1.00 90.26  ?  136  U   A "C4'" 1 
ATOM   2901  O  "O4'" . U   A 1  136  ? 146.071 195.277 140.665 1.00 90.26  ?  136  U   A "O4'" 1 
ATOM   2902  C  "C3'" . U   A 1  136  ? 146.425 196.794 138.916 1.00 90.26  ?  136  U   A "C3'" 1 
ATOM   2903  O  "O3'" . U   A 1  136  ? 145.832 197.585 137.902 1.00 90.26  ?  136  U   A "O3'" 1 
ATOM   2904  C  "C2'" . U   A 1  136  ? 146.652 197.541 140.224 1.00 90.26  ?  136  U   A "C2'" 1 
ATOM   2905  O  "O2'" . U   A 1  136  ? 145.517 198.324 140.559 1.00 90.26  ?  136  U   A "O2'" 1 
ATOM   2906  C  "C1'" . U   A 1  136  ? 146.752 196.383 141.222 1.00 90.26  ?  136  U   A "C1'" 1 
ATOM   2907  N  N1    . U   A 1  136  ? 148.157 195.994 141.509 1.00 90.26  ?  136  U   A N1    1 
ATOM   2908  C  C2    . U   A 1  136  ? 148.860 196.745 142.438 1.00 90.26  ?  136  U   A C2    1 
ATOM   2909  O  O2    . U   A 1  136  ? 148.389 197.703 143.027 1.00 90.26  ?  136  U   A O2    1 
ATOM   2910  N  N3    . U   A 1  136  ? 150.152 196.334 142.661 1.00 90.26  ?  136  U   A N3    1 
ATOM   2911  C  C4    . U   A 1  136  ? 150.807 195.274 142.070 1.00 90.26  ?  136  U   A C4    1 
ATOM   2912  O  O4    . U   A 1  136  ? 151.975 195.033 142.380 1.00 90.26  ?  136  U   A O4    1 
ATOM   2913  C  C5    . U   A 1  136  ? 150.020 194.544 141.126 1.00 90.26  ?  136  U   A C5    1 
ATOM   2914  C  C6    . U   A 1  136  ? 148.759 194.918 140.890 1.00 90.26  ?  136  U   A C6    1 
ATOM   2915  P  P     . G   A 1  137  ? 146.745 198.218 136.740 1.00 91.43  ?  137  G   A P     1 
ATOM   2916  O  OP1   . G   A 1  137  ? 145.846 198.711 135.666 1.00 91.43  ?  137  G   A OP1   1 
ATOM   2917  O  OP2   . G   A 1  137  ? 147.812 197.240 136.411 1.00 91.43  ?  137  G   A OP2   1 
ATOM   2918  O  "O5'" . G   A 1  137  ? 147.429 199.481 137.430 1.00 91.43  ?  137  G   A "O5'" 1 
ATOM   2919  C  "C5'" . G   A 1  137  ? 146.658 200.618 137.789 1.00 91.43  ?  137  G   A "C5'" 1 
ATOM   2920  C  "C4'" . G   A 1  137  ? 147.429 201.560 138.680 1.00 91.43  ?  137  G   A "C4'" 1 
ATOM   2921  O  "O4'" . G   A 1  137  ? 147.771 200.898 139.926 1.00 91.43  ?  137  G   A "O4'" 1 
ATOM   2922  C  "C3'" . G   A 1  137  ? 148.766 202.050 138.149 1.00 91.43  ?  137  G   A "C3'" 1 
ATOM   2923  O  "O3'" . G   A 1  137  ? 148.643 203.102 137.208 1.00 91.43  ?  137  G   A "O3'" 1 
ATOM   2924  C  "C2'" . G   A 1  137  ? 149.495 202.454 139.424 1.00 91.43  ?  137  G   A "C2'" 1 
ATOM   2925  O  "O2'" . G   A 1  137  ? 149.035 203.714 139.887 1.00 91.43  ?  137  G   A "O2'" 1 
ATOM   2926  C  "C1'" . G   A 1  137  ? 149.015 201.377 140.397 1.00 91.43  ?  137  G   A "C1'" 1 
ATOM   2927  N  N9    . G   A 1  137  ? 149.961 200.248 140.477 1.00 91.43  ?  137  G   A N9    1 
ATOM   2928  C  C8    . G   A 1  137  ? 149.869 199.032 139.843 1.00 91.43  ?  137  G   A C8    1 
ATOM   2929  N  N7    . G   A 1  137  ? 150.868 198.237 140.111 1.00 91.43  ?  137  G   A N7    1 
ATOM   2930  C  C5    . G   A 1  137  ? 151.672 198.972 140.971 1.00 91.43  ?  137  G   A C5    1 
ATOM   2931  C  C6    . G   A 1  137  ? 152.900 198.634 141.598 1.00 91.43  ?  137  G   A C6    1 
ATOM   2932  O  O6    . G   A 1  137  ? 153.543 197.581 141.516 1.00 91.43  ?  137  G   A O6    1 
ATOM   2933  N  N1    . G   A 1  137  ? 153.373 199.675 142.390 1.00 91.43  ?  137  G   A N1    1 
ATOM   2934  C  C2    . G   A 1  137  ? 152.749 200.886 142.559 1.00 91.43  ?  137  G   A C2    1 
ATOM   2935  N  N2    . G   A 1  137  ? 153.365 201.763 143.365 1.00 91.43  ?  137  G   A N2    1 
ATOM   2936  N  N3    . G   A 1  137  ? 151.605 201.214 141.980 1.00 91.43  ?  137  G   A N3    1 
ATOM   2937  C  C4    . G   A 1  137  ? 151.127 200.216 141.205 1.00 91.43  ?  137  G   A C4    1 
ATOM   2938  P  P     . A   A 1  138  ? 149.710 203.242 136.013 1.00 93.93  ?  138  A   A P     1 
ATOM   2939  O  OP1   . A   A 1  138  ? 149.185 204.238 135.044 1.00 93.93  ?  138  A   A OP1   1 
ATOM   2940  O  OP2   . A   A 1  138  ? 150.058 201.877 135.546 1.00 93.93  ?  138  A   A OP2   1 
ATOM   2941  O  "O5'" . A   A 1  138  ? 150.998 203.867 136.713 1.00 93.93  ?  138  A   A "O5'" 1 
ATOM   2942  C  "C5'" . A   A 1  138  ? 150.972 205.184 137.243 1.00 93.93  ?  138  A   A "C5'" 1 
ATOM   2943  C  "C4'" . A   A 1  138  ? 152.163 205.453 138.130 1.00 93.93  ?  138  A   A "C4'" 1 
ATOM   2944  O  "O4'" . A   A 1  138  ? 152.191 204.496 139.222 1.00 93.93  ?  138  A   A "O4'" 1 
ATOM   2945  C  "C3'" . A   A 1  138  ? 153.531 205.309 137.482 1.00 93.93  ?  138  A   A "C3'" 1 
ATOM   2946  O  "O3'" . A   A 1  138  ? 153.909 206.444 136.722 1.00 93.93  ?  138  A   A "O3'" 1 
ATOM   2947  C  "C2'" . A   A 1  138  ? 154.436 205.050 138.679 1.00 93.93  ?  138  A   A "C2'" 1 
ATOM   2948  O  "O2'" . A   A 1  138  ? 154.718 206.259 139.367 1.00 93.93  ?  138  A   A "O2'" 1 
ATOM   2949  C  "C1'" . A   A 1  138  ? 153.528 204.193 139.562 1.00 93.93  ?  138  A   A "C1'" 1 
ATOM   2950  N  N9    . A   A 1  138  ? 153.756 202.751 139.350 1.00 93.93  ?  138  A   A N9    1 
ATOM   2951  C  C8    . A   A 1  138  ? 152.948 201.854 138.696 1.00 93.93  ?  138  A   A C8    1 
ATOM   2952  N  N7    . A   A 1  138  ? 153.422 200.632 138.671 1.00 93.93  ?  138  A   A N7    1 
ATOM   2953  C  C5    . A   A 1  138  ? 154.626 200.731 139.353 1.00 93.93  ?  138  A   A C5    1 
ATOM   2954  C  C6    . A   A 1  138  ? 155.619 199.788 139.677 1.00 93.93  ?  138  A   A C6    1 
ATOM   2955  N  N6    . A   A 1  138  ? 155.551 198.499 139.338 1.00 93.93  ?  138  A   A N6    1 
ATOM   2956  N  N1    . A   A 1  138  ? 156.699 200.218 140.369 1.00 93.93  ?  138  A   A N1    1 
ATOM   2957  C  C2    . A   A 1  138  ? 156.777 201.510 140.714 1.00 93.93  ?  138  A   A C2    1 
ATOM   2958  N  N3    . A   A 1  138  ? 155.908 202.488 140.467 1.00 93.93  ?  138  A   A N3    1 
ATOM   2959  C  C4    . A   A 1  138  ? 154.846 202.030 139.778 1.00 93.93  ?  138  A   A C4    1 
ATOM   2960  P  P     . G   A 1  139  ? 154.794 206.267 135.391 1.00 97.82  ?  139  G   A P     1 
ATOM   2961  O  OP1   . G   A 1  139  ? 154.834 207.575 134.690 1.00 97.82  ?  139  G   A OP1   1 
ATOM   2962  O  OP2   . G   A 1  139  ? 154.306 205.063 134.672 1.00 97.82  ?  139  G   A OP2   1 
ATOM   2963  O  "O5'" . G   A 1  139  ? 156.259 205.955 135.936 1.00 97.82  ?  139  G   A "O5'" 1 
ATOM   2964  C  "C5'" . G   A 1  139  ? 156.997 206.935 136.651 1.00 97.82  ?  139  G   A "C5'" 1 
ATOM   2965  C  "C4'" . G   A 1  139  ? 158.196 206.334 137.342 1.00 97.82  ?  139  G   A "C4'" 1 
ATOM   2966  O  "O4'" . G   A 1  139  ? 157.766 205.266 138.227 1.00 97.82  ?  139  G   A "O4'" 1 
ATOM   2967  C  "C3'" . G   A 1  139  ? 159.227 205.672 136.440 1.00 97.82  ?  139  G   A "C3'" 1 
ATOM   2968  O  "O3'" . G   A 1  139  ? 160.119 206.599 135.846 1.00 97.82  ?  139  G   A "O3'" 1 
ATOM   2969  C  "C2'" . G   A 1  139  ? 159.909 204.689 137.381 1.00 97.82  ?  139  G   A "C2'" 1 
ATOM   2970  O  "O2'" . G   A 1  139  ? 160.846 205.358 138.212 1.00 97.82  ?  139  G   A "O2'" 1 
ATOM   2971  C  "C1'" . G   A 1  139  ? 158.733 204.237 138.247 1.00 97.82  ?  139  G   A "C1'" 1 
ATOM   2972  N  N9    . G   A 1  139  ? 158.113 203.000 137.736 1.00 97.82  ?  139  G   A N9    1 
ATOM   2973  C  C8    . G   A 1  139  ? 156.894 202.881 137.114 1.00 97.82  ?  139  G   A C8    1 
ATOM   2974  N  N7    . G   A 1  139  ? 156.609 201.654 136.772 1.00 97.82  ?  139  G   A N7    1 
ATOM   2975  C  C5    . G   A 1  139  ? 157.707 200.916 137.193 1.00 97.82  ?  139  G   A C5    1 
ATOM   2976  C  C6    . G   A 1  139  ? 157.972 199.525 137.095 1.00 97.82  ?  139  G   A C6    1 
ATOM   2977  O  O6    . G   A 1  139  ? 157.265 198.639 136.600 1.00 97.82  ?  139  G   A O6    1 
ATOM   2978  N  N1    . G   A 1  139  ? 159.205 199.198 137.651 1.00 97.82  ?  139  G   A N1    1 
ATOM   2979  C  C2    . G   A 1  139  ? 160.072 200.093 138.228 1.00 97.82  ?  139  G   A C2    1 
ATOM   2980  N  N2    . G   A 1  139  ? 161.216 199.585 138.708 1.00 97.82  ?  139  G   A N2    1 
ATOM   2981  N  N3    . G   A 1  139  ? 159.837 201.391 138.325 1.00 97.82  ?  139  G   A N3    1 
ATOM   2982  C  C4    . G   A 1  139  ? 158.645 201.732 137.791 1.00 97.82  ?  139  G   A C4    1 
ATOM   2983  P  P     . U   A 1  140  ? 160.748 206.304 134.396 1.00 97.31  ?  140  U   A P     1 
ATOM   2984  O  OP1   . U   A 1  140  ? 161.359 207.562 133.896 1.00 97.31  ?  140  U   A OP1   1 
ATOM   2985  O  OP2   . U   A 1  140  ? 159.716 205.615 133.580 1.00 97.31  ?  140  U   A OP2   1 
ATOM   2986  O  "O5'" . U   A 1  140  ? 161.922 205.266 134.684 1.00 97.31  ?  140  U   A "O5'" 1 
ATOM   2987  C  "C5'" . U   A 1  140  ? 163.035 205.626 135.491 1.00 97.31  ?  140  U   A "C5'" 1 
ATOM   2988  C  "C4'" . U   A 1  140  ? 163.824 204.413 135.919 1.00 97.31  ?  140  U   A "C4'" 1 
ATOM   2989  O  "O4'" . U   A 1  140  ? 162.942 203.463 136.572 1.00 97.31  ?  140  U   A "O4'" 1 
ATOM   2990  C  "C3'" . U   A 1  140  ? 164.470 203.608 134.802 1.00 97.31  ?  140  U   A "C3'" 1 
ATOM   2991  O  "O3'" . U   A 1  140  ? 165.692 204.165 134.350 1.00 97.31  ?  140  U   A "O3'" 1 
ATOM   2992  C  "C2'" . U   A 1  140  ? 164.625 202.229 135.431 1.00 97.31  ?  140  U   A "C2'" 1 
ATOM   2993  O  "O2'" . U   A 1  140  ? 165.761 202.190 136.282 1.00 97.31  ?  140  U   A "O2'" 1 
ATOM   2994  C  "C1'" . U   A 1  140  ? 163.367 202.143 136.300 1.00 97.31  ?  140  U   A "C1'" 1 
ATOM   2995  N  N1    . U   A 1  140  ? 162.263 201.402 135.639 1.00 97.31  ?  140  U   A N1    1 
ATOM   2996  C  C2    . U   A 1  140  ? 162.296 200.016 135.675 1.00 97.31  ?  140  U   A C2    1 
ATOM   2997  O  O2    . U   A 1  140  ? 163.181 199.375 136.217 1.00 97.31  ?  140  U   A O2    1 
ATOM   2998  N  N3    . U   A 1  140  ? 161.244 199.392 135.051 1.00 97.31  ?  140  U   A N3    1 
ATOM   2999  C  C4    . U   A 1  140  ? 160.181 199.990 134.407 1.00 97.31  ?  140  U   A C4    1 
ATOM   3000  O  O4    . U   A 1  140  ? 159.311 199.286 133.891 1.00 97.31  ?  140  U   A O4    1 
ATOM   3001  C  C5    . U   A 1  140  ? 160.213 201.419 134.412 1.00 97.31  ?  140  U   A C5    1 
ATOM   3002  C  C6    . U   A 1  140  ? 161.222 202.055 135.015 1.00 97.31  ?  140  U   A C6    1 
ATOM   3003  P  P     . U   A 1  141  ? 166.057 204.153 132.784 1.00 93.36  ?  141  U   A P     1 
ATOM   3004  O  OP1   . U   A 1  141  ? 167.311 204.927 132.600 1.00 93.36  ?  141  U   A OP1   1 
ATOM   3005  O  OP2   . U   A 1  141  ? 164.839 204.538 132.026 1.00 93.36  ?  141  U   A OP2   1 
ATOM   3006  O  "O5'" . U   A 1  141  ? 166.371 202.623 132.467 1.00 93.36  ?  141  U   A "O5'" 1 
ATOM   3007  C  "C5'" . U   A 1  141  ? 167.494 201.972 133.045 1.00 93.36  ?  141  U   A "C5'" 1 
ATOM   3008  C  "C4'" . U   A 1  141  ? 167.409 200.474 132.882 1.00 93.36  ?  141  U   A "C4'" 1 
ATOM   3009  O  "O4'" . U   A 1  141  ? 166.161 199.990 133.442 1.00 93.36  ?  141  U   A "O4'" 1 
ATOM   3010  C  "C3'" . U   A 1  141  ? 167.396 199.959 131.451 1.00 93.36  ?  141  U   A "C3'" 1 
ATOM   3011  O  "O3'" . U   A 1  141  ? 168.690 199.886 130.881 1.00 93.36  ?  141  U   A "O3'" 1 
ATOM   3012  C  "C2'" . U   A 1  141  ? 166.713 198.603 131.588 1.00 93.36  ?  141  U   A "C2'" 1 
ATOM   3013  O  "O2'" . U   A 1  141  ? 167.632 197.624 132.050 1.00 93.36  ?  141  U   A "O2'" 1 
ATOM   3014  C  "C1'" . U   A 1  141  ? 165.699 198.878 132.703 1.00 93.36  ?  141  U   A "C1'" 1 
ATOM   3015  N  N1    . U   A 1  141  ? 164.339 199.170 132.184 1.00 93.36  ?  141  U   A N1    1 
ATOM   3016  C  C2    . U   A 1  141  ? 163.530 198.095 131.856 1.00 93.36  ?  141  U   A C2    1 
ATOM   3017  O  O2    . U   A 1  141  ? 163.880 196.932 131.968 1.00 93.36  ?  141  U   A O2    1 
ATOM   3018  N  N3    . U   A 1  141  ? 162.282 198.426 131.387 1.00 93.36  ?  141  U   A N3    1 
ATOM   3019  C  C4    . U   A 1  141  ? 161.765 199.693 131.215 1.00 93.36  ?  141  U   A C4    1 
ATOM   3020  O  O4    . U   A 1  141  ? 160.620 199.826 130.780 1.00 93.36  ?  141  U   A O4    1 
ATOM   3021  C  C5    . U   A 1  141  ? 162.655 200.751 131.577 1.00 93.36  ?  141  U   A C5    1 
ATOM   3022  C  C6    . U   A 1  141  ? 163.875 200.460 132.040 1.00 93.36  ?  141  U   A C6    1 
ATOM   3023  P  P     . C   A 1  142  ? 168.952 200.437 129.395 1.00 90.80  ?  142  C   A P     1 
ATOM   3024  O  OP1   . C   A 1  142  ? 168.130 201.659 129.204 1.00 90.80  ?  142  C   A OP1   1 
ATOM   3025  O  OP2   . C   A 1  142  ? 168.810 199.301 128.449 1.00 90.80  ?  142  C   A OP2   1 
ATOM   3026  O  "O5'" . C   A 1  142  ? 170.484 200.872 129.415 1.00 90.80  ?  142  C   A "O5'" 1 
ATOM   3027  C  "C5'" . C   A 1  142  ? 170.958 201.815 130.366 1.00 90.80  ?  142  C   A "C5'" 1 
ATOM   3028  C  "C4'" . C   A 1  142  ? 172.463 201.901 130.356 1.00 90.80  ?  142  C   A "C4'" 1 
ATOM   3029  O  "O4'" . C   A 1  142  ? 173.031 200.657 130.838 1.00 90.80  ?  142  C   A "O4'" 1 
ATOM   3030  C  "C3'" . C   A 1  142  ? 173.108 202.097 128.994 1.00 90.80  ?  142  C   A "C3'" 1 
ATOM   3031  O  "O3'" . C   A 1  142  ? 173.074 203.444 128.558 1.00 90.80  ?  142  C   A "O3'" 1 
ATOM   3032  C  "C2'" . C   A 1  142  ? 174.517 201.554 129.208 1.00 90.80  ?  142  C   A "C2'" 1 
ATOM   3033  O  "O2'" . C   A 1  142  ? 175.337 202.523 129.846 1.00 90.80  ?  142  C   A "O2'" 1 
ATOM   3034  C  "C1'" . C   A 1  142  ? 174.264 200.409 130.195 1.00 90.80  ?  142  C   A "C1'" 1 
ATOM   3035  N  N1    . C   A 1  142  ? 174.215 199.077 129.540 1.00 90.80  ?  142  C   A N1    1 
ATOM   3036  C  C2    . C   A 1  142  ? 175.418 198.387 129.346 1.00 90.80  ?  142  C   A C2    1 
ATOM   3037  O  O2    . C   A 1  142  ? 176.481 198.907 129.717 1.00 90.80  ?  142  C   A O2    1 
ATOM   3038  N  N3    . C   A 1  142  ? 175.397 197.169 128.757 1.00 90.80  ?  142  C   A N3    1 
ATOM   3039  C  C4    . C   A 1  142  ? 174.241 196.630 128.369 1.00 90.80  ?  142  C   A C4    1 
ATOM   3040  N  N4    . C   A 1  142  ? 174.274 195.426 127.793 1.00 90.80  ?  142  C   A N4    1 
ATOM   3041  C  C5    . C   A 1  142  ? 173.000 197.304 128.554 1.00 90.80  ?  142  C   A C5    1 
ATOM   3042  C  C6    . C   A 1  142  ? 173.035 198.508 129.140 1.00 90.80  ?  142  C   A C6    1 
ATOM   3043  P  P     . C   A 1  143  ? 172.624 203.795 127.056 1.00 96.90  ?  143  C   A P     1 
ATOM   3044  O  OP1   . C   A 1  143  ? 172.349 205.253 126.986 1.00 96.90  ?  143  C   A OP1   1 
ATOM   3045  O  OP2   . C   A 1  143  ? 171.570 202.829 126.653 1.00 96.90  ?  143  C   A OP2   1 
ATOM   3046  O  "O5'" . C   A 1  143  ? 173.925 203.496 126.188 1.00 96.90  ?  143  C   A "O5'" 1 
ATOM   3047  C  "C5'" . C   A 1  143  ? 175.148 204.162 126.461 1.00 96.90  ?  143  C   A "C5'" 1 
ATOM   3048  C  "C4'" . C   A 1  143  ? 176.313 203.469 125.802 1.00 96.90  ?  143  C   A "C4'" 1 
ATOM   3049  O  "O4'" . C   A 1  143  ? 176.525 202.169 126.413 1.00 96.90  ?  143  C   A "O4'" 1 
ATOM   3050  C  "C3'" . C   A 1  143  ? 176.151 203.155 124.324 1.00 96.90  ?  143  C   A "C3'" 1 
ATOM   3051  O  "O3'" . C   A 1  143  ? 176.388 204.272 123.485 1.00 96.90  ?  143  C   A "O3'" 1 
ATOM   3052  C  "C2'" . C   A 1  143  ? 177.135 202.010 124.119 1.00 96.90  ?  143  C   A "C2'" 1 
ATOM   3053  O  "O2'" . C   A 1  143  ? 178.462 202.503 124.002 1.00 96.90  ?  143  C   A "O2'" 1 
ATOM   3054  C  "C1'" . C   A 1  143  ? 177.014 201.259 125.449 1.00 96.90  ?  143  C   A "C1'" 1 
ATOM   3055  N  N1    . C   A 1  143  ? 176.098 200.092 125.367 1.00 96.90  ?  143  C   A N1    1 
ATOM   3056  C  C2    . C   A 1  143  ? 176.591 198.877 124.871 1.00 96.90  ?  143  C   A C2    1 
ATOM   3057  O  O2    . C   A 1  143  ? 177.776 198.797 124.511 1.00 96.90  ?  143  C   A O2    1 
ATOM   3058  N  N3    . C   A 1  143  ? 175.766 197.807 124.794 1.00 96.90  ?  143  C   A N3    1 
ATOM   3059  C  C4    . C   A 1  143  ? 174.496 197.907 125.187 1.00 96.90  ?  143  C   A C4    1 
ATOM   3060  N  N4    . C   A 1  143  ? 173.722 196.824 125.089 1.00 96.90  ?  143  C   A N4    1 
ATOM   3061  C  C5    . C   A 1  143  ? 173.963 199.125 125.697 1.00 96.90  ?  143  C   A C5    1 
ATOM   3062  C  C6    . C   A 1  143  ? 174.790 200.174 125.771 1.00 96.90  ?  143  C   A C6    1 
ATOM   3063  P  P     . C   A 1  144  ? 175.362 204.616 122.297 1.00 100.92 ?  144  C   A P     1 
ATOM   3064  O  OP1   . C   A 1  144  ? 175.743 205.933 121.726 1.00 100.92 ?  144  C   A OP1   1 
ATOM   3065  O  OP2   . C   A 1  144  ? 173.982 204.407 122.805 1.00 100.92 ?  144  C   A OP2   1 
ATOM   3066  O  "O5'" . C   A 1  144  ? 175.656 203.499 121.199 1.00 100.92 ?  144  C   A "O5'" 1 
ATOM   3067  C  "C5'" . C   A 1  144  ? 176.934 203.401 120.589 1.00 100.92 ?  144  C   A "C5'" 1 
ATOM   3068  C  "C4'" . C   A 1  144  ? 177.143 202.054 119.943 1.00 100.92 ?  144  C   A "C4'" 1 
ATOM   3069  O  "O4'" . C   A 1  144  ? 176.996 201.004 120.934 1.00 100.92 ?  144  C   A "O4'" 1 
ATOM   3070  C  "C3'" . C   A 1  144  ? 176.154 201.670 118.855 1.00 100.92 ?  144  C   A "C3'" 1 
ATOM   3071  O  "O3'" . C   A 1  144  ? 176.435 202.270 117.603 1.00 100.92 ?  144  C   A "O3'" 1 
ATOM   3072  C  "C2'" . C   A 1  144  ? 176.249 200.149 118.843 1.00 100.92 ?  144  C   A "C2'" 1 
ATOM   3073  O  "O2'" . C   A 1  144  ? 177.399 199.724 118.128 1.00 100.92 ?  144  C   A "O2'" 1 
ATOM   3074  C  "C1'" . C   A 1  144  ? 176.464 199.843 120.329 1.00 100.92 ?  144  C   A "C1'" 1 
ATOM   3075  N  N1    . C   A 1  144  ? 175.208 199.456 121.021 1.00 100.92 ?  144  C   A N1    1 
ATOM   3076  C  C2    . C   A 1  144  ? 174.793 198.119 120.957 1.00 100.92 ?  144  C   A C2    1 
ATOM   3077  O  O2    . C   A 1  144  ? 175.478 197.296 120.330 1.00 100.92 ?  144  C   A O2    1 
ATOM   3078  N  N3    . C   A 1  144  ? 173.652 197.746 121.582 1.00 100.92 ?  144  C   A N3    1 
ATOM   3079  C  C4    . C   A 1  144  ? 172.929 198.643 122.252 1.00 100.92 ?  144  C   A C4    1 
ATOM   3080  N  N4    . C   A 1  144  ? 171.811 198.225 122.852 1.00 100.92 ?  144  C   A N4    1 
ATOM   3081  C  C5    . C   A 1  144  ? 173.321 200.009 122.338 1.00 100.92 ?  144  C   A C5    1 
ATOM   3082  C  C6    . C   A 1  144  ? 174.453 200.364 121.719 1.00 100.92 ?  144  C   A C6    1 
ATOM   3083  P  P     . A   A 1  145  ? 175.241 202.881 116.719 1.00 107.60 ?  145  A   A P     1 
ATOM   3084  O  OP1   . A   A 1  145  ? 175.831 203.737 115.661 1.00 107.60 ?  145  A   A OP1   1 
ATOM   3085  O  OP2   . A   A 1  145  ? 174.240 203.460 117.651 1.00 107.60 ?  145  A   A OP2   1 
ATOM   3086  O  "O5'" . A   A 1  145  ? 174.579 201.608 116.026 1.00 107.60 ?  145  A   A "O5'" 1 
ATOM   3087  C  "C5'" . A   A 1  145  ? 175.343 200.738 115.202 1.00 107.60 ?  145  A   A "C5'" 1 
ATOM   3088  C  "C4'" . A   A 1  145  ? 174.670 199.398 115.051 1.00 107.60 ?  145  A   A "C4'" 1 
ATOM   3089  O  "O4'" . A   A 1  145  ? 174.564 198.759 116.350 1.00 107.60 ?  145  A   A "O4'" 1 
ATOM   3090  C  "C3'" . A   A 1  145  ? 173.239 199.432 114.534 1.00 107.60 ?  145  A   A "C3'" 1 
ATOM   3091  O  "O3'" . A   A 1  145  ? 173.165 199.524 113.122 1.00 107.60 ?  145  A   A "O3'" 1 
ATOM   3092  C  "C2'" . A   A 1  145  ? 172.648 198.145 115.092 1.00 107.60 ?  145  A   A "C2'" 1 
ATOM   3093  O  "O2'" . A   A 1  145  ? 173.051 197.029 114.313 1.00 107.60 ?  145  A   A "O2'" 1 
ATOM   3094  C  "C1'" . A   A 1  145  ? 173.342 198.061 116.451 1.00 107.60 ?  145  A   A "C1'" 1 
ATOM   3095  N  N9    . A   A 1  145  ? 172.541 198.683 117.523 1.00 107.60 ?  145  A   A N9    1 
ATOM   3096  C  C8    . A   A 1  145  ? 172.696 199.937 118.062 1.00 107.60 ?  145  A   A C8    1 
ATOM   3097  N  N7    . A   A 1  145  ? 171.834 200.220 119.008 1.00 107.60 ?  145  A   A N7    1 
ATOM   3098  C  C5    . A   A 1  145  ? 171.059 199.073 119.100 1.00 107.60 ?  145  A   A C5    1 
ATOM   3099  C  C6    . A   A 1  145  ? 169.967 198.726 119.917 1.00 107.60 ?  145  A   A C6    1 
ATOM   3100  N  N6    . A   A 1  145  ? 169.445 199.540 120.838 1.00 107.60 ?  145  A   A N6    1 
ATOM   3101  N  N1    . A   A 1  145  ? 169.419 197.499 119.755 1.00 107.60 ?  145  A   A N1    1 
ATOM   3102  C  C2    . A   A 1  145  ? 169.936 196.675 118.833 1.00 107.60 ?  145  A   A C2    1 
ATOM   3103  N  N3    . A   A 1  145  ? 170.960 196.890 118.008 1.00 107.60 ?  145  A   A N3    1 
ATOM   3104  C  C4    . A   A 1  145  ? 171.482 198.117 118.192 1.00 107.60 ?  145  A   A C4    1 
ATOM   3105  P  P     . G   A 1  146  ? 172.283 200.677 112.432 1.00 114.72 ?  146  G   A P     1 
ATOM   3106  O  OP1   . G   A 1  146  ? 172.505 200.604 110.966 1.00 114.72 ?  146  G   A OP1   1 
ATOM   3107  O  OP2   . G   A 1  146  ? 172.544 201.948 113.153 1.00 114.72 ?  146  G   A OP2   1 
ATOM   3108  O  "O5'" . G   A 1  146  ? 170.779 200.244 112.728 1.00 114.72 ?  146  G   A "O5'" 1 
ATOM   3109  C  "C5'" . G   A 1  146  ? 170.260 199.016 112.239 1.00 114.72 ?  146  G   A "C5'" 1 
ATOM   3110  C  "C4'" . G   A 1  146  ? 169.022 198.605 112.994 1.00 114.72 ?  146  G   A "C4'" 1 
ATOM   3111  O  "O4'" . G   A 1  146  ? 169.346 198.416 114.395 1.00 114.72 ?  146  G   A "O4'" 1 
ATOM   3112  C  "C3'" . G   A 1  146  ? 167.887 199.618 113.009 1.00 114.72 ?  146  G   A "C3'" 1 
ATOM   3113  O  "O3'" . G   A 1  146  ? 167.096 199.577 111.834 1.00 114.72 ?  146  G   A "O3'" 1 
ATOM   3114  C  "C2'" . G   A 1  146  ? 167.124 199.245 114.273 1.00 114.72 ?  146  G   A "C2'" 1 
ATOM   3115  O  "O2'" . G   A 1  146  ? 166.299 198.111 114.045 1.00 114.72 ?  146  G   A "O2'" 1 
ATOM   3116  C  "C1'" . G   A 1  146  ? 168.265 198.832 115.203 1.00 114.72 ?  146  G   A "C1'" 1 
ATOM   3117  N  N9    . G   A 1  146  ? 168.718 199.946 116.056 1.00 114.72 ?  146  G   A N9    1 
ATOM   3118  C  C8    . G   A 1  146  ? 169.830 200.732 115.872 1.00 114.72 ?  146  G   A C8    1 
ATOM   3119  N  N7    . G   A 1  146  ? 169.974 201.642 116.796 1.00 114.72 ?  146  G   A N7    1 
ATOM   3120  C  C5    . G   A 1  146  ? 168.892 201.445 117.644 1.00 114.72 ?  146  G   A C5    1 
ATOM   3121  C  C6    . G   A 1  146  ? 168.514 202.130 118.827 1.00 114.72 ?  146  G   A C6    1 
ATOM   3122  O  O6    . G   A 1  146  ? 169.078 203.082 119.381 1.00 114.72 ?  146  G   A O6    1 
ATOM   3123  N  N1    . G   A 1  146  ? 167.348 201.604 119.373 1.00 114.72 ?  146  G   A N1    1 
ATOM   3124  C  C2    . G   A 1  146  ? 166.635 200.553 118.850 1.00 114.72 ?  146  G   A C2    1 
ATOM   3125  N  N2    . G   A 1  146  ? 165.534 200.190 119.524 1.00 114.72 ?  146  G   A N2    1 
ATOM   3126  N  N3    . G   A 1  146  ? 166.977 199.905 117.748 1.00 114.72 ?  146  G   A N3    1 
ATOM   3127  C  C4    . G   A 1  146  ? 168.108 200.401 117.201 1.00 114.72 ?  146  G   A C4    1 
ATOM   3128  P  P     . A   A 1  147  ? 166.883 200.906 110.956 1.00 129.20 ?  147  A   A P     1 
ATOM   3129  O  OP1   . A   A 1  147  ? 166.094 200.539 109.752 1.00 129.20 ?  147  A   A OP1   1 
ATOM   3130  O  OP2   . A   A 1  147  ? 168.203 201.568 110.796 1.00 129.20 ?  147  A   A OP2   1 
ATOM   3131  O  "O5'" . A   A 1  147  ? 165.973 201.835 111.875 1.00 129.20 ?  147  A   A "O5'" 1 
ATOM   3132  C  "C5'" . A   A 1  147  ? 165.571 203.126 111.439 1.00 129.20 ?  147  A   A "C5'" 1 
ATOM   3133  C  "C4'" . A   A 1  147  ? 164.183 203.461 111.920 1.00 129.20 ?  147  A   A "C4'" 1 
ATOM   3134  O  "O4'" . A   A 1  147  ? 163.220 202.579 111.286 1.00 129.20 ?  147  A   A "O4'" 1 
ATOM   3135  C  "C3'" . A   A 1  147  ? 163.935 203.276 113.409 1.00 129.20 ?  147  A   A "C3'" 1 
ATOM   3136  O  "O3'" . A   A 1  147  ? 164.382 204.378 114.180 1.00 129.20 ?  147  A   A "O3'" 1 
ATOM   3137  C  "C2'" . A   A 1  147  ? 162.429 203.058 113.475 1.00 129.20 ?  147  A   A "C2'" 1 
ATOM   3138  O  "O2'" . A   A 1  147  ? 161.739 204.296 113.388 1.00 129.20 ?  147  A   A "O2'" 1 
ATOM   3139  C  "C1'" . A   A 1  147  ? 162.177 202.274 112.187 1.00 129.20 ?  147  A   A "C1'" 1 
ATOM   3140  N  N9    . A   A 1  147  ? 162.163 200.815 112.408 1.00 129.20 ?  147  A   A N9    1 
ATOM   3141  C  C8    . A   A 1  147  ? 163.090 199.901 111.968 1.00 129.20 ?  147  A   A C8    1 
ATOM   3142  N  N7    . A   A 1  147  ? 162.820 198.665 112.306 1.00 129.20 ?  147  A   A N7    1 
ATOM   3143  C  C5    . A   A 1  147  ? 161.631 198.769 113.014 1.00 129.20 ?  147  A   A C5    1 
ATOM   3144  C  C6    . A   A 1  147  ? 160.814 197.812 113.644 1.00 129.20 ?  147  A   A C6    1 
ATOM   3145  N  N6    . A   A 1  147  ? 161.087 196.506 113.662 1.00 129.20 ?  147  A   A N6    1 
ATOM   3146  N  N1    . A   A 1  147  ? 159.693 198.245 114.266 1.00 129.20 ?  147  A   A N1    1 
ATOM   3147  C  C2    . A   A 1  147  ? 159.412 199.555 114.255 1.00 129.20 ?  147  A   A C2    1 
ATOM   3148  N  N3    . A   A 1  147  ? 160.101 200.548 113.694 1.00 129.20 ?  147  A   A N3    1 
ATOM   3149  C  C4    . A   A 1  147  ? 161.211 200.086 113.084 1.00 129.20 ?  147  A   A C4    1 
ATOM   3150  P  P     . G   A 1  148  ? 165.456 204.165 115.357 1.00 122.38 ?  148  G   A P     1 
ATOM   3151  O  OP1   . G   A 1  148  ? 166.129 205.465 115.606 1.00 122.38 ?  148  G   A OP1   1 
ATOM   3152  O  OP2   . G   A 1  148  ? 166.271 202.969 115.023 1.00 122.38 ?  148  G   A OP2   1 
ATOM   3153  O  "O5'" . G   A 1  148  ? 164.570 203.815 116.633 1.00 122.38 ?  148  G   A "O5'" 1 
ATOM   3154  C  "C5'" . G   A 1  148  ? 163.561 204.705 117.089 1.00 122.38 ?  148  G   A "C5'" 1 
ATOM   3155  C  "C4'" . G   A 1  148  ? 162.425 203.957 117.739 1.00 122.38 ?  148  G   A "C4'" 1 
ATOM   3156  O  "O4'" . G   A 1  148  ? 161.857 203.020 116.787 1.00 122.38 ?  148  G   A "O4'" 1 
ATOM   3157  C  "C3'" . G   A 1  148  ? 162.800 203.091 118.933 1.00 122.38 ?  148  G   A "C3'" 1 
ATOM   3158  O  "O3'" . G   A 1  148  ? 162.901 203.824 120.141 1.00 122.38 ?  148  G   A "O3'" 1 
ATOM   3159  C  "C2'" . G   A 1  148  ? 161.698 202.040 118.942 1.00 122.38 ?  148  G   A "C2'" 1 
ATOM   3160  O  "O2'" . G   A 1  148  ? 160.507 202.566 119.508 1.00 122.38 ?  148  G   A "O2'" 1 
ATOM   3161  C  "C1'" . G   A 1  148  ? 161.471 201.833 117.445 1.00 122.38 ?  148  G   A "C1'" 1 
ATOM   3162  N  N9    . G   A 1  148  ? 162.281 200.721 116.912 1.00 122.38 ?  148  G   A N9    1 
ATOM   3163  C  C8    . G   A 1  148  ? 163.509 200.808 116.299 1.00 122.38 ?  148  G   A C8    1 
ATOM   3164  N  N7    . G   A 1  148  ? 163.986 199.651 115.932 1.00 122.38 ?  148  G   A N7    1 
ATOM   3165  C  C5    . G   A 1  148  ? 163.015 198.741 116.324 1.00 122.38 ?  148  G   A C5    1 
ATOM   3166  C  C6    . G   A 1  148  ? 162.974 197.329 116.191 1.00 122.38 ?  148  G   A C6    1 
ATOM   3167  O  O6    . G   A 1  148  ? 163.814 196.578 115.682 1.00 122.38 ?  148  G   A O6    1 
ATOM   3168  N  N1    . G   A 1  148  ? 161.803 196.801 116.724 1.00 122.38 ?  148  G   A N1    1 
ATOM   3169  C  C2    . G   A 1  148  ? 160.801 197.533 117.312 1.00 122.38 ?  148  G   A C2    1 
ATOM   3170  N  N2    . G   A 1  148  ? 159.749 196.837 117.768 1.00 122.38 ?  148  G   A N2    1 
ATOM   3171  N  N3    . G   A 1  148  ? 160.828 198.849 117.443 1.00 122.38 ?  148  G   A N3    1 
ATOM   3172  C  C4    . G   A 1  148  ? 161.956 199.385 116.931 1.00 122.38 ?  148  G   A C4    1 
ATOM   3173  P  P     . A   A 1  149  ? 164.122 203.550 121.149 1.00 117.96 ?  149  A   A P     1 
ATOM   3174  O  OP1   . A   A 1  149  ? 164.996 204.751 121.146 1.00 117.96 ?  149  A   A OP1   1 
ATOM   3175  O  OP2   . A   A 1  149  ? 164.700 202.221 120.824 1.00 117.96 ?  149  A   A OP2   1 
ATOM   3176  O  "O5'" . A   A 1  149  ? 163.428 203.451 122.579 1.00 117.96 ?  149  A   A "O5'" 1 
ATOM   3177  C  "C5'" . A   A 1  149  ? 162.209 202.734 122.752 1.00 117.96 ?  149  A   A "C5'" 1 
ATOM   3178  C  "C4'" . A   A 1  149  ? 162.250 201.795 123.938 1.00 117.96 ?  149  A   A "C4'" 1 
ATOM   3179  O  "O4'" . A   A 1  149  ? 162.783 200.507 123.526 1.00 117.96 ?  149  A   A "O4'" 1 
ATOM   3180  C  "C3'" . A   A 1  149  ? 163.092 202.249 125.132 1.00 117.96 ?  149  A   A "C3'" 1 
ATOM   3181  O  "O3'" . A   A 1  149  ? 162.439 201.867 126.342 1.00 117.96 ?  149  A   A "O3'" 1 
ATOM   3182  C  "C2'" . A   A 1  149  ? 164.377 201.438 124.974 1.00 117.96 ?  149  A   A "C2'" 1 
ATOM   3183  O  "O2'" . A   A 1  149  ? 165.084 201.216 126.176 1.00 117.96 ?  149  A   A "O2'" 1 
ATOM   3184  C  "C1'" . A   A 1  149  ? 163.849 200.137 124.378 1.00 117.96 ?  149  A   A "C1'" 1 
ATOM   3185  N  N9    . A   A 1  149  ? 164.835 199.400 123.583 1.00 117.96 ?  149  A   A N9    1 
ATOM   3186  C  C8    . A   A 1  149  ? 166.016 199.867 123.059 1.00 117.96 ?  149  A   A C8    1 
ATOM   3187  N  N7    . A   A 1  149  ? 166.690 198.964 122.388 1.00 117.96 ?  149  A   A N7    1 
ATOM   3188  C  C5    . A   A 1  149  ? 165.898 197.827 122.478 1.00 117.96 ?  149  A   A C5    1 
ATOM   3189  C  C6    . A   A 1  149  ? 166.046 196.520 121.978 1.00 117.96 ?  149  A   A C6    1 
ATOM   3190  N  N6    . A   A 1  149  ? 167.094 196.119 121.254 1.00 117.96 ?  149  A   A N6    1 
ATOM   3191  N  N1    . A   A 1  149  ? 165.069 195.623 122.250 1.00 117.96 ?  149  A   A N1    1 
ATOM   3192  C  C2    . A   A 1  149  ? 164.013 196.014 122.976 1.00 117.96 ?  149  A   A C2    1 
ATOM   3193  N  N3    . A   A 1  149  ? 163.763 197.214 123.498 1.00 117.96 ?  149  A   A N3    1 
ATOM   3194  C  C4    . A   A 1  149  ? 164.752 198.081 123.211 1.00 117.96 ?  149  A   A C4    1 
ATOM   3195  P  P     . A   A 1  150  ? 161.812 202.987 127.308 1.00 149.31 ?  150  A   A P     1 
ATOM   3196  O  OP1   . A   A 1  150  ? 162.666 204.199 127.222 1.00 149.31 ?  150  A   A OP1   1 
ATOM   3197  O  OP2   . A   A 1  150  ? 161.554 202.363 128.630 1.00 149.31 ?  150  A   A OP2   1 
ATOM   3198  O  "O5'" . A   A 1  150  ? 160.406 203.329 126.641 1.00 149.31 ?  150  A   A "O5'" 1 
ATOM   3199  C  "C5'" . A   A 1  150  ? 159.260 202.532 126.904 1.00 149.31 ?  150  A   A "C5'" 1 
ATOM   3200  C  "C4'" . A   A 1  150  ? 158.013 203.376 126.980 1.00 149.31 ?  150  A   A "C4'" 1 
ATOM   3201  O  "O4'" . A   A 1  150  ? 158.223 204.465 127.917 1.00 149.31 ?  150  A   A "O4'" 1 
ATOM   3202  C  "C3'" . A   A 1  150  ? 157.602 204.070 125.690 1.00 149.31 ?  150  A   A "C3'" 1 
ATOM   3203  O  "O3'" . A   A 1  150  ? 156.874 203.225 124.815 1.00 149.31 ?  150  A   A "O3'" 1 
ATOM   3204  C  "C2'" . A   A 1  150  ? 156.800 205.262 126.193 1.00 149.31 ?  150  A   A "C2'" 1 
ATOM   3205  O  "O2'" . A   A 1  150  ? 155.491 204.863 126.573 1.00 149.31 ?  150  A   A "O2'" 1 
ATOM   3206  C  "C1'" . A   A 1  150  ? 157.577 205.632 127.456 1.00 149.31 ?  150  A   A "C1'" 1 
ATOM   3207  N  N9    . A   A 1  150  ? 158.604 206.657 127.191 1.00 149.31 ?  150  A   A N9    1 
ATOM   3208  C  C8    . A   A 1  150  ? 159.961 206.475 127.091 1.00 149.31 ?  150  A   A C8    1 
ATOM   3209  N  N7    . A   A 1  150  ? 160.628 207.576 126.847 1.00 149.31 ?  150  A   A N7    1 
ATOM   3210  C  C5    . A   A 1  150  ? 159.642 208.550 126.782 1.00 149.31 ?  150  A   A C5    1 
ATOM   3211  C  C6    . A   A 1  150  ? 159.688 209.938 126.551 1.00 149.31 ?  150  A   A C6    1 
ATOM   3212  N  N6    . A   A 1  150  ? 160.819 210.613 126.332 1.00 149.31 ?  150  A   A N6    1 
ATOM   3213  N  N1    . A   A 1  150  ? 158.519 210.619 126.551 1.00 149.31 ?  150  A   A N1    1 
ATOM   3214  C  C2    . A   A 1  150  ? 157.378 209.950 126.770 1.00 149.31 ?  150  A   A C2    1 
ATOM   3215  N  N3    . A   A 1  150  ? 157.210 208.649 126.998 1.00 149.31 ?  150  A   A N3    1 
ATOM   3216  C  C4    . A   A 1  150  ? 158.389 208.000 126.992 1.00 149.31 ?  150  A   A C4    1 
ATOM   3217  P  P     . C   A 1  151  ? 157.037 203.373 123.222 1.00 162.60 ?  151  C   A P     1 
ATOM   3218  O  OP1   . C   A 1  151  ? 156.478 202.152 122.588 1.00 162.60 ?  151  C   A OP1   1 
ATOM   3219  O  OP2   . C   A 1  151  ? 158.440 203.770 122.939 1.00 162.60 ?  151  C   A OP2   1 
ATOM   3220  O  "O5'" . C   A 1  151  ? 156.092 204.599 122.847 1.00 162.60 ?  151  C   A "O5'" 1 
ATOM   3221  C  "C5'" . C   A 1  151  ? 154.694 204.547 123.096 1.00 162.60 ?  151  C   A "C5'" 1 
ATOM   3222  C  "C4'" . C   A 1  151  ? 154.073 205.920 123.053 1.00 162.60 ?  151  C   A "C4'" 1 
ATOM   3223  O  "O4'" . C   A 1  151  ? 154.761 206.794 123.986 1.00 162.60 ?  151  C   A "O4'" 1 
ATOM   3224  C  "C3'" . C   A 1  151  ? 154.167 206.653 121.723 1.00 162.60 ?  151  C   A "C3'" 1 
ATOM   3225  O  "O3'" . C   A 1  151  ? 153.176 206.248 120.794 1.00 162.60 ?  151  C   A "O3'" 1 
ATOM   3226  C  "C2'" . C   A 1  151  ? 154.054 208.115 122.137 1.00 162.60 ?  151  C   A "C2'" 1 
ATOM   3227  O  "O2'" . C   A 1  151  ? 152.697 208.469 122.364 1.00 162.60 ?  151  C   A "O2'" 1 
ATOM   3228  C  "C1'" . C   A 1  151  ? 154.785 208.114 123.484 1.00 162.60 ?  151  C   A "C1'" 1 
ATOM   3229  N  N1    . C   A 1  151  ? 156.194 208.571 123.377 1.00 162.60 ?  151  C   A N1    1 
ATOM   3230  C  C2    . C   A 1  151  ? 156.463 209.947 123.381 1.00 162.60 ?  151  C   A C2    1 
ATOM   3231  O  O2    . C   A 1  151  ? 155.525 210.755 123.470 1.00 162.60 ?  151  C   A O2    1 
ATOM   3232  N  N3    . C   A 1  151  ? 157.744 210.373 123.289 1.00 162.60 ?  151  C   A N3    1 
ATOM   3233  C  C4    . C   A 1  151  ? 158.742 209.494 123.197 1.00 162.60 ?  151  C   A C4    1 
ATOM   3234  N  N4    . C   A 1  151  ? 159.988 209.965 123.107 1.00 162.60 ?  151  C   A N4    1 
ATOM   3235  C  C5    . C   A 1  151  ? 158.505 208.090 123.193 1.00 162.60 ?  151  C   A C5    1 
ATOM   3236  C  C6    . C   A 1  151  ? 157.233 207.682 123.288 1.00 162.60 ?  151  C   A C6    1 
ATOM   3237  P  P     . G   A 1  152  ? 153.560 206.007 119.252 1.00 169.38 ?  152  G   A P     1 
ATOM   3238  O  OP1   . G   A 1  152  ? 152.395 205.375 118.583 1.00 169.38 ?  152  G   A OP1   1 
ATOM   3239  O  OP2   . G   A 1  152  ? 154.885 205.336 119.209 1.00 169.38 ?  152  G   A OP2   1 
ATOM   3240  O  "O5'" . G   A 1  152  ? 153.732 207.476 118.658 1.00 169.38 ?  152  G   A "O5'" 1 
ATOM   3241  C  "C5'" . G   A 1  152  ? 152.621 208.354 118.545 1.00 169.38 ?  152  G   A "C5'" 1 
ATOM   3242  C  "C4'" . G   A 1  152  ? 153.063 209.787 118.384 1.00 169.38 ?  152  G   A "C4'" 1 
ATOM   3243  O  "O4'" . G   A 1  152  ? 153.912 210.162 119.500 1.00 169.38 ?  152  G   A "O4'" 1 
ATOM   3244  C  "C3'" . G   A 1  152  ? 153.908 210.092 117.156 1.00 169.38 ?  152  G   A "C3'" 1 
ATOM   3245  O  "O3'" . G   A 1  152  ? 153.134 210.284 115.983 1.00 169.38 ?  152  G   A "O3'" 1 
ATOM   3246  C  "C2'" . G   A 1  152  ? 154.681 211.332 117.584 1.00 169.38 ?  152  G   A "C2'" 1 
ATOM   3247  O  "O2'" . G   A 1  152  ? 153.863 212.489 117.494 1.00 169.38 ?  152  G   A "O2'" 1 
ATOM   3248  C  "C1'" . G   A 1  152  ? 154.932 211.033 119.061 1.00 169.38 ?  152  G   A "C1'" 1 
ATOM   3249  N  N9    . G   A 1  152  ? 156.234 210.373 119.275 1.00 169.38 ?  152  G   A N9    1 
ATOM   3250  C  C8    . G   A 1  152  ? 156.449 209.046 119.562 1.00 169.38 ?  152  G   A C8    1 
ATOM   3251  N  N7    . G   A 1  152  ? 157.712 208.749 119.700 1.00 169.38 ?  152  G   A N7    1 
ATOM   3252  C  C5    . G   A 1  152  ? 158.373 209.951 119.490 1.00 169.38 ?  152  G   A C5    1 
ATOM   3253  C  C6    . G   A 1  152  ? 159.759 210.254 119.511 1.00 169.38 ?  152  G   A C6    1 
ATOM   3254  O  O6    . G   A 1  152  ? 160.711 209.493 119.725 1.00 169.38 ?  152  G   A O6    1 
ATOM   3255  N  N1    . G   A 1  152  ? 159.993 211.599 119.247 1.00 169.38 ?  152  G   A N1    1 
ATOM   3256  C  C2    . G   A 1  152  ? 159.021 212.535 118.995 1.00 169.38 ?  152  G   A C2    1 
ATOM   3257  N  N2    . G   A 1  152  ? 159.448 213.785 118.762 1.00 169.38 ?  152  G   A N2    1 
ATOM   3258  N  N3    . G   A 1  152  ? 157.725 212.267 118.973 1.00 169.38 ?  152  G   A N3    1 
ATOM   3259  C  C4    . G   A 1  152  ? 157.474 210.964 119.227 1.00 169.38 ?  152  G   A C4    1 
ATOM   3260  P  P     . G   A 1  153  ? 153.679 209.776 114.559 1.00 169.74 ?  153  G   A P     1 
ATOM   3261  O  OP1   . G   A 1  153  ? 152.576 209.906 113.573 1.00 169.74 ?  153  G   A OP1   1 
ATOM   3262  O  OP2   . G   A 1  153  ? 154.331 208.457 114.761 1.00 169.74 ?  153  G   A OP2   1 
ATOM   3263  O  "O5'" . G   A 1  153  ? 154.810 210.830 114.173 1.00 169.74 ?  153  G   A "O5'" 1 
ATOM   3264  C  "C5'" . G   A 1  153  ? 154.489 212.190 113.917 1.00 169.74 ?  153  G   A "C5'" 1 
ATOM   3265  C  "C4'" . G   A 1  153  ? 155.721 213.060 113.932 1.00 169.74 ?  153  G   A "C4'" 1 
ATOM   3266  O  "O4'" . G   A 1  153  ? 156.416 212.895 115.196 1.00 169.74 ?  153  G   A "O4'" 1 
ATOM   3267  C  "C3'" . G   A 1  153  ? 156.775 212.740 112.883 1.00 169.74 ?  153  G   A "C3'" 1 
ATOM   3268  O  "O3'" . G   A 1  153  ? 156.489 213.315 111.620 1.00 169.74 ?  153  G   A "O3'" 1 
ATOM   3269  C  "C2'" . G   A 1  153  ? 158.052 213.272 113.520 1.00 169.74 ?  153  G   A "C2'" 1 
ATOM   3270  O  "O2'" . G   A 1  153  ? 158.133 214.683 113.379 1.00 169.74 ?  153  G   A "O2'" 1 
ATOM   3271  C  "C1'" . G   A 1  153  ? 157.811 212.947 114.993 1.00 169.74 ?  153  G   A "C1'" 1 
ATOM   3272  N  N9    . G   A 1  153  ? 158.385 211.642 115.373 1.00 169.74 ?  153  G   A N9    1 
ATOM   3273  C  C8    . G   A 1  153  ? 157.702 210.464 115.557 1.00 169.74 ?  153  G   A C8    1 
ATOM   3274  N  N7    . G   A 1  153  ? 158.475 209.468 115.893 1.00 169.74 ?  153  G   A N7    1 
ATOM   3275  C  C5    . G   A 1  153  ? 159.748 210.021 115.934 1.00 169.74 ?  153  G   A C5    1 
ATOM   3276  C  C6    . G   A 1  153  ? 160.998 209.424 116.241 1.00 169.74 ?  153  G   A C6    1 
ATOM   3277  O  O6    . G   A 1  153  ? 161.238 208.249 116.547 1.00 169.74 ?  153  G   A O6    1 
ATOM   3278  N  N1    . G   A 1  153  ? 162.037 210.346 116.165 1.00 169.74 ?  153  G   A N1    1 
ATOM   3279  C  C2    . G   A 1  153  ? 161.894 211.672 115.837 1.00 169.74 ?  153  G   A C2    1 
ATOM   3280  N  N2    . G   A 1  153  ? 163.019 212.401 115.818 1.00 169.74 ?  153  G   A N2    1 
ATOM   3281  N  N3    . G   A 1  153  ? 160.734 212.240 115.549 1.00 169.74 ?  153  G   A N3    1 
ATOM   3282  C  C4    . G   A 1  153  ? 159.710 211.362 115.617 1.00 169.74 ?  153  G   A C4    1 
ATOM   3283  P  P     . G   A 1  154  ? 156.363 212.387 110.313 1.00 161.84 ?  154  G   A P     1 
ATOM   3284  O  OP1   . G   A 1  154  ? 155.711 213.184 109.244 1.00 161.84 ?  154  G   A OP1   1 
ATOM   3285  O  OP2   . G   A 1  154  ? 155.769 211.091 110.728 1.00 161.84 ?  154  G   A OP2   1 
ATOM   3286  O  "O5'" . G   A 1  154  ? 157.873 212.120 109.879 1.00 161.84 ?  154  G   A "O5'" 1 
ATOM   3287  C  "C5'" . G   A 1  154  ? 158.735 213.192 109.526 1.00 161.84 ?  154  G   A "C5'" 1 
ATOM   3288  C  "C4'" . G   A 1  154  ? 160.177 212.850 109.801 1.00 161.84 ?  154  G   A "C4'" 1 
ATOM   3289  O  "O4'" . G   A 1  154  ? 160.334 212.508 111.203 1.00 161.84 ?  154  G   A "O4'" 1 
ATOM   3290  C  "C3'" . G   A 1  154  ? 160.726 211.640 109.058 1.00 161.84 ?  154  G   A "C3'" 1 
ATOM   3291  O  "O3'" . G   A 1  154  ? 161.142 211.944 107.738 1.00 161.84 ?  154  G   A "O3'" 1 
ATOM   3292  C  "C2'" . G   A 1  154  ? 161.858 211.176 109.965 1.00 161.84 ?  154  G   A "C2'" 1 
ATOM   3293  O  "O2'" . G   A 1  154  ? 163.009 211.989 109.787 1.00 161.84 ?  154  G   A "O2'" 1 
ATOM   3294  C  "C1'" . G   A 1  154  ? 161.273 211.464 111.346 1.00 161.84 ?  154  G   A "C1'" 1 
ATOM   3295  N  N9    . G   A 1  154  ? 160.579 210.290 111.908 1.00 161.84 ?  154  G   A N9    1 
ATOM   3296  C  C8    . G   A 1  154  ? 159.224 210.054 111.911 1.00 161.84 ?  154  G   A C8    1 
ATOM   3297  N  N7    . G   A 1  154  ? 158.900 208.927 112.482 1.00 161.84 ?  154  G   A N7    1 
ATOM   3298  C  C5    . G   A 1  154  ? 160.113 208.384 112.881 1.00 161.84 ?  154  G   A C5    1 
ATOM   3299  C  C6    . G   A 1  154  ? 160.397 207.169 113.555 1.00 161.84 ?  154  G   A C6    1 
ATOM   3300  O  O6    . G   A 1  154  ? 159.607 206.300 113.946 1.00 161.84 ?  154  G   A O6    1 
ATOM   3301  N  N1    . G   A 1  154  ? 161.763 207.008 113.766 1.00 161.84 ?  154  G   A N1    1 
ATOM   3302  C  C2    . G   A 1  154  ? 162.732 207.900 113.378 1.00 161.84 ?  154  G   A C2    1 
ATOM   3303  N  N2    . G   A 1  154  ? 163.997 207.565 113.672 1.00 161.84 ?  154  G   A N2    1 
ATOM   3304  N  N3    . G   A 1  154  ? 162.481 209.037 112.750 1.00 161.84 ?  154  G   A N3    1 
ATOM   3305  C  C4    . G   A 1  154  ? 161.160 209.213 112.535 1.00 161.84 ?  154  G   A C4    1 
ATOM   3306  P  P     . G   A 1  155  ? 160.887 210.894 106.549 1.00 150.94 ?  155  G   A P     1 
ATOM   3307  O  OP1   . G   A 1  155  ? 161.332 211.522 105.279 1.00 150.94 ?  155  G   A OP1   1 
ATOM   3308  O  OP2   . G   A 1  155  ? 159.495 210.390 106.670 1.00 150.94 ?  155  G   A OP2   1 
ATOM   3309  O  "O5'" . G   A 1  155  ? 161.878 209.691 106.875 1.00 150.94 ?  155  G   A "O5'" 1 
ATOM   3310  C  "C5'" . G   A 1  155  ? 163.283 209.844 106.737 1.00 150.94 ?  155  G   A "C5'" 1 
ATOM   3311  C  "C4'" . G   A 1  155  ? 163.964 208.514 106.537 1.00 150.94 ?  155  G   A "C4'" 1 
ATOM   3312  O  "O4'" . G   A 1  155  ? 163.949 207.760 107.776 1.00 150.94 ?  155  G   A "O4'" 1 
ATOM   3313  C  "C3'" . G   A 1  155  ? 163.310 207.583 105.529 1.00 150.94 ?  155  G   A "C3'" 1 
ATOM   3314  O  "O3'" . G   A 1  155  ? 163.652 207.893 104.189 1.00 150.94 ?  155  G   A "O3'" 1 
ATOM   3315  C  "C2'" . G   A 1  155  ? 163.789 206.210 105.982 1.00 150.94 ?  155  G   A "C2'" 1 
ATOM   3316  O  "O2'" . G   A 1  155  ? 165.119 205.973 105.546 1.00 150.94 ?  155  G   A "O2'" 1 
ATOM   3317  C  "C1'" . G   A 1  155  ? 163.803 206.382 107.502 1.00 150.94 ?  155  G   A "C1'" 1 
ATOM   3318  N  N9    . G   A 1  155  ? 162.552 205.912 108.128 1.00 150.94 ?  155  G   A N9    1 
ATOM   3319  C  C8    . G   A 1  155  ? 161.549 206.694 108.650 1.00 150.94 ?  155  G   A C8    1 
ATOM   3320  N  N7    . G   A 1  155  ? 160.561 205.999 109.143 1.00 150.94 ?  155  G   A N7    1 
ATOM   3321  C  C5    . G   A 1  155  ? 160.934 204.678 108.938 1.00 150.94 ?  155  G   A C5    1 
ATOM   3322  C  C6    . G   A 1  155  ? 160.260 203.472 109.265 1.00 150.94 ?  155  G   A C6    1 
ATOM   3323  O  O6    . G   A 1  155  ? 159.164 203.327 109.820 1.00 150.94 ?  155  G   A O6    1 
ATOM   3324  N  N1    . G   A 1  155  ? 160.994 202.355 108.878 1.00 150.94 ?  155  G   A N1    1 
ATOM   3325  C  C2    . G   A 1  155  ? 162.218 202.391 108.257 1.00 150.94 ?  155  G   A C2    1 
ATOM   3326  N  N2    . G   A 1  155  ? 162.767 201.203 107.964 1.00 150.94 ?  155  G   A N2    1 
ATOM   3327  N  N3    . G   A 1  155  ? 162.856 203.508 107.947 1.00 150.94 ?  155  G   A N3    1 
ATOM   3328  C  C4    . G   A 1  155  ? 162.161 204.606 108.313 1.00 150.94 ?  155  G   A C4    1 
ATOM   3329  P  P     . C   A 1  156  ? 162.511 208.322 103.142 1.00 155.21 ?  156  C   A P     1 
ATOM   3330  O  OP1   . C   A 1  156  ? 163.137 209.178 102.102 1.00 155.21 ?  156  C   A OP1   1 
ATOM   3331  O  OP2   . C   A 1  156  ? 161.348 208.830 103.911 1.00 155.21 ?  156  C   A OP2   1 
ATOM   3332  O  "O5'" . C   A 1  156  ? 162.083 206.949 102.457 1.00 155.21 ?  156  C   A "O5'" 1 
ATOM   3333  C  "C5'" . C   A 1  156  ? 163.029 206.167 101.744 1.00 155.21 ?  156  C   A "C5'" 1 
ATOM   3334  C  "C4'" . C   A 1  156  ? 162.683 204.701 101.795 1.00 155.21 ?  156  C   A "C4'" 1 
ATOM   3335  O  "O4'" . C   A 1  156  ? 162.643 204.254 103.176 1.00 155.21 ?  156  C   A "O4'" 1 
ATOM   3336  C  "C3'" . C   A 1  156  ? 161.318 204.318 101.247 1.00 155.21 ?  156  C   A "C3'" 1 
ATOM   3337  O  "O3'" . C   A 1  156  ? 161.291 204.223 99.833  1.00 155.21 ?  156  C   A "O3'" 1 
ATOM   3338  C  "C2'" . C   A 1  156  ? 161.033 202.999 101.953 1.00 155.21 ?  156  C   A "C2'" 1 
ATOM   3339  O  "O2'" . C   A 1  156  ? 161.719 201.932 101.317 1.00 155.21 ?  156  C   A "O2'" 1 
ATOM   3340  C  "C1'" . C   A 1  156  ? 161.673 203.237 103.325 1.00 155.21 ?  156  C   A "C1'" 1 
ATOM   3341  N  N1    . C   A 1  156  ? 160.686 203.646 104.356 1.00 155.21 ?  156  C   A N1    1 
ATOM   3342  C  C2    . C   A 1  156  ? 159.945 202.655 105.015 1.00 155.21 ?  156  C   A C2    1 
ATOM   3343  O  O2    . C   A 1  156  ? 160.124 201.461 104.728 1.00 155.21 ?  156  C   A O2    1 
ATOM   3344  N  N3    . C   A 1  156  ? 159.043 203.016 105.958 1.00 155.21 ?  156  C   A N3    1 
ATOM   3345  C  C4    . C   A 1  156  ? 158.862 204.302 106.258 1.00 155.21 ?  156  C   A C4    1 
ATOM   3346  N  N4    . C   A 1  156  ? 157.961 204.607 107.195 1.00 155.21 ?  156  C   A N4    1 
ATOM   3347  C  C5    . C   A 1  156  ? 159.599 205.334 105.610 1.00 155.21 ?  156  C   A C5    1 
ATOM   3348  C  C6    . C   A 1  156  ? 160.490 204.963 104.681 1.00 155.21 ?  156  C   A C6    1 
ATOM   3349  P  P     . U   A 1  157  ? 159.916 204.456 99.035  1.00 166.72 ?  157  U   A P     1 
ATOM   3350  O  OP1   . U   A 1  157  ? 160.250 204.739 97.616  1.00 166.72 ?  157  U   A OP1   1 
ATOM   3351  O  OP2   . U   A 1  157  ? 159.099 205.428 99.805  1.00 166.72 ?  157  U   A OP2   1 
ATOM   3352  O  "O5'" . U   A 1  157  ? 159.186 203.040 99.099  1.00 166.72 ?  157  U   A "O5'" 1 
ATOM   3353  C  "C5'" . U   A 1  157  ? 159.788 201.886 98.530  1.00 166.72 ?  157  U   A "C5'" 1 
ATOM   3354  C  "C4'" . U   A 1  157  ? 159.145 200.617 99.031  1.00 166.72 ?  157  U   A "C4'" 1 
ATOM   3355  O  "O4'" . U   A 1  157  ? 159.241 200.552 100.478 1.00 166.72 ?  157  U   A "O4'" 1 
ATOM   3356  C  "C3'" . U   A 1  157  ? 157.658 200.461 98.756  1.00 166.72 ?  157  U   A "C3'" 1 
ATOM   3357  O  "O3'" . U   A 1  157  ? 157.380 200.031 97.435  1.00 166.72 ?  157  U   A "O3'" 1 
ATOM   3358  C  "C2'" . U   A 1  157  ? 157.224 199.467 99.828  1.00 166.72 ?  157  U   A "C2'" 1 
ATOM   3359  O  "O2'" . U   A 1  157  ? 157.551 198.139 99.443  1.00 166.72 ?  157  U   A "O2'" 1 
ATOM   3360  C  "C1'" . U   A 1  157  ? 158.123 199.865 101.003 1.00 166.72 ?  157  U   A "C1'" 1 
ATOM   3361  N  N1    . U   A 1  157  ? 157.429 200.731 101.988 1.00 166.72 ?  157  U   A N1    1 
ATOM   3362  C  C2    . U   A 1  157  ? 156.696 200.099 102.975 1.00 166.72 ?  157  U   A C2    1 
ATOM   3363  O  O2    . U   A 1  157  ? 156.602 198.886 103.060 1.00 166.72 ?  157  U   A O2    1 
ATOM   3364  N  N3    . U   A 1  157  ? 156.072 200.936 103.868 1.00 166.72 ?  157  U   A N3    1 
ATOM   3365  C  C4    . U   A 1  157  ? 156.104 202.315 103.877 1.00 166.72 ?  157  U   A C4    1 
ATOM   3366  O  O4    . U   A 1  157  ? 155.488 202.929 104.749 1.00 166.72 ?  157  U   A O4    1 
ATOM   3367  C  C5    . U   A 1  157  ? 156.882 202.898 102.828 1.00 166.72 ?  157  U   A C5    1 
ATOM   3368  C  C6    . U   A 1  157  ? 157.502 202.107 101.946 1.00 166.72 ?  157  U   A C6    1 
ATOM   3369  P  P     . C   A 1  158  ? 156.082 200.582 96.664  1.00 186.84 ?  158  C   A P     1 
ATOM   3370  O  OP1   . C   A 1  158  ? 156.203 200.206 95.232  1.00 186.84 ?  158  C   A OP1   1 
ATOM   3371  O  OP2   . C   A 1  158  ? 155.898 202.008 97.036  1.00 186.84 ?  158  C   A OP2   1 
ATOM   3372  O  "O5'" . C   A 1  158  ? 154.878 199.750 97.293  1.00 186.84 ?  158  C   A "O5'" 1 
ATOM   3373  C  "C5'" . C   A 1  158  ? 154.825 198.337 97.165  1.00 186.84 ?  158  C   A "C5'" 1 
ATOM   3374  C  "C4'" . C   A 1  158  ? 153.791 197.735 98.084  1.00 186.84 ?  158  C   A "C4'" 1 
ATOM   3375  O  "O4'" . C   A 1  158  ? 154.155 197.981 99.467  1.00 186.84 ?  158  C   A "O4'" 1 
ATOM   3376  C  "C3'" . C   A 1  158  ? 152.386 198.303 97.969  1.00 186.84 ?  158  C   A "C3'" 1 
ATOM   3377  O  "O3'" . C   A 1  158  ? 151.662 197.770 96.873  1.00 186.84 ?  158  C   A "O3'" 1 
ATOM   3378  C  "C2'" . C   A 1  158  ? 151.778 197.968 99.327  1.00 186.84 ?  158  C   A "C2'" 1 
ATOM   3379  O  "O2'" . C   A 1  158  ? 151.347 196.615 99.364  1.00 186.84 ?  158  C   A "O2'" 1 
ATOM   3380  C  "C1'" . C   A 1  158  ? 152.989 198.116 100.254 1.00 186.84 ?  158  C   A "C1'" 1 
ATOM   3381  N  N1    . C   A 1  158  ? 153.020 199.422 100.959 1.00 186.84 ?  158  C   A N1    1 
ATOM   3382  C  C2    . C   A 1  158  ? 152.291 199.561 102.147 1.00 186.84 ?  158  C   A C2    1 
ATOM   3383  O  O2    . C   A 1  158  ? 151.640 198.597 102.579 1.00 186.84 ?  158  C   A O2    1 
ATOM   3384  N  N3    . C   A 1  158  ? 152.311 200.743 102.805 1.00 186.84 ?  158  C   A N3    1 
ATOM   3385  C  C4    . C   A 1  158  ? 153.018 201.767 102.326 1.00 186.84 ?  158  C   A C4    1 
ATOM   3386  N  N4    . C   A 1  158  ? 153.005 202.913 103.010 1.00 186.84 ?  158  C   A N4    1 
ATOM   3387  C  C5    . C   A 1  158  ? 153.772 201.659 101.122 1.00 186.84 ?  158  C   A C5    1 
ATOM   3388  C  C6    . C   A 1  158  ? 153.746 200.483 100.483 1.00 186.84 ?  158  C   A C6    1 
ATOM   3389  P  P     . C   A 1  159  ? 150.735 198.729 95.978  1.00 198.78 ?  159  C   A P     1 
ATOM   3390  O  OP1   . C   A 1  159  ? 150.357 197.989 94.747  1.00 198.78 ?  159  C   A OP1   1 
ATOM   3391  O  OP2   . C   A 1  159  ? 151.411 200.047 95.864  1.00 198.78 ?  159  C   A OP2   1 
ATOM   3392  O  "O5'" . C   A 1  159  ? 149.423 198.925 96.859  1.00 198.78 ?  159  C   A "O5'" 1 
ATOM   3393  C  "C5'" . C   A 1  159  ? 148.632 197.810 97.243  1.00 198.78 ?  159  C   A "C5'" 1 
ATOM   3394  C  "C4'" . C   A 1  159  ? 147.589 198.197 98.260  1.00 198.78 ?  159  C   A "C4'" 1 
ATOM   3395  O  "O4'" . C   A 1  159  ? 148.228 198.560 99.510  1.00 198.78 ?  159  C   A "O4'" 1 
ATOM   3396  C  "C3'" . C   A 1  159  ? 146.742 199.410 97.913  1.00 198.78 ?  159  C   A "C3'" 1 
ATOM   3397  O  "O3'" . C   A 1  159  ? 145.689 199.106 97.015  1.00 198.78 ?  159  C   A "O3'" 1 
ATOM   3398  C  "C2'" . C   A 1  159  ? 146.264 199.888 99.280  1.00 198.78 ?  159  C   A "C2'" 1 
ATOM   3399  O  "O2'" . C   A 1  159  ? 145.159 199.115 99.724  1.00 198.78 ?  159  C   A "O2'" 1 
ATOM   3400  C  "C1'" . C   A 1  159  ? 147.472 199.559 100.165 1.00 198.78 ?  159  C   A "C1'" 1 
ATOM   3401  N  N1    . C   A 1  159  ? 148.339 200.736 100.423 1.00 198.78 ?  159  C   A N1    1 
ATOM   3402  C  C2    . C   A 1  159  ? 148.003 201.601 101.473 1.00 198.78 ?  159  C   A C2    1 
ATOM   3403  O  O2    . C   A 1  159  ? 146.993 201.369 102.154 1.00 198.78 ?  159  C   A O2    1 
ATOM   3404  N  N3    . C   A 1  159  ? 148.787 202.675 101.724 1.00 198.78 ?  159  C   A N3    1 
ATOM   3405  C  C4    . C   A 1  159  ? 149.870 202.906 100.982 1.00 198.78 ?  159  C   A C4    1 
ATOM   3406  N  N4    . C   A 1  159  ? 150.610 203.979 101.269 1.00 198.78 ?  159  C   A N4    1 
ATOM   3407  C  C5    . C   A 1  159  ? 150.242 202.044 99.910  1.00 198.78 ?  159  C   A C5    1 
ATOM   3408  C  C6    . C   A 1  159  ? 149.459 200.984 99.674  1.00 198.78 ?  159  C   A C6    1 
ATOM   3409  P  P     . G   A 1  160  ? 145.284 200.146 95.860  1.00 217.61 ?  160  G   A P     1 
ATOM   3410  O  OP1   . G   A 1  160  ? 145.042 199.379 94.611  1.00 217.61 ?  160  G   A OP1   1 
ATOM   3411  O  OP2   . G   A 1  160  ? 146.279 201.249 95.863  1.00 217.61 ?  160  G   A OP2   1 
ATOM   3412  O  "O5'" . G   A 1  160  ? 143.891 200.739 96.354  1.00 217.61 ?  160  G   A "O5'" 1 
ATOM   3413  C  "C5'" . G   A 1  160  ? 142.876 199.882 96.867  1.00 217.61 ?  160  G   A "C5'" 1 
ATOM   3414  C  "C4'" . G   A 1  160  ? 142.114 200.521 98.004  1.00 217.61 ?  160  G   A "C4'" 1 
ATOM   3415  O  "O4'" . G   A 1  160  ? 143.051 201.181 98.898  1.00 217.61 ?  160  G   A "O4'" 1 
ATOM   3416  C  "C3'" . G   A 1  160  ? 141.092 201.582 97.599  1.00 217.61 ?  160  G   A "C3'" 1 
ATOM   3417  O  "O3'" . G   A 1  160  ? 139.981 201.531 98.493  1.00 217.61 ?  160  G   A "O3'" 1 
ATOM   3418  C  "C2'" . G   A 1  160  ? 141.855 202.886 97.812  1.00 217.61 ?  160  G   A "C2'" 1 
ATOM   3419  O  "O2'" . G   A 1  160  ? 141.039 204.015 98.040  1.00 217.61 ?  160  G   A "O2'" 1 
ATOM   3420  C  "C1'" . G   A 1  160  ? 142.707 202.547 99.032  1.00 217.61 ?  160  G   A "C1'" 1 
ATOM   3421  N  N9    . G   A 1  160  ? 143.948 203.320 99.127  1.00 217.61 ?  160  G   A N9    1 
ATOM   3422  C  C8    . G   A 1  160  ? 144.968 203.360 98.207  1.00 217.61 ?  160  G   A C8    1 
ATOM   3423  N  N7    . G   A 1  160  ? 145.953 204.136 98.568  1.00 217.61 ?  160  G   A N7    1 
ATOM   3424  C  C5    . G   A 1  160  ? 145.562 204.636 99.802  1.00 217.61 ?  160  G   A C5    1 
ATOM   3425  C  C6    . G   A 1  160  ? 146.224 205.530 100.682 1.00 217.61 ?  160  G   A C6    1 
ATOM   3426  O  O6    . G   A 1  160  ? 147.324 206.076 100.539 1.00 217.61 ?  160  G   A O6    1 
ATOM   3427  N  N1    . G   A 1  160  ? 145.472 205.772 101.828 1.00 217.61 ?  160  G   A N1    1 
ATOM   3428  C  C2    . G   A 1  160  ? 144.241 205.224 102.094 1.00 217.61 ?  160  G   A C2    1 
ATOM   3429  N  N2    . G   A 1  160  ? 143.675 205.580 103.256 1.00 217.61 ?  160  G   A N2    1 
ATOM   3430  N  N3    . G   A 1  160  ? 143.614 204.388 101.283 1.00 217.61 ?  160  G   A N3    1 
ATOM   3431  C  C4    . G   A 1  160  ? 144.328 204.139 100.164 1.00 217.61 ?  160  G   A C4    1 
ATOM   3432  P  P     . C   A 1  161  ? 138.646 200.735 98.085  1.00 256.39 ?  161  C   A P     1 
ATOM   3433  O  OP1   . C   A 1  161  ? 138.980 199.293 97.963  1.00 256.39 ?  161  C   A OP1   1 
ATOM   3434  O  OP2   . C   A 1  161  ? 138.023 201.442 96.937  1.00 256.39 ?  161  C   A OP2   1 
ATOM   3435  O  "O5'" . C   A 1  161  ? 137.695 200.911 99.351  1.00 256.39 ?  161  C   A "O5'" 1 
ATOM   3436  C  "C5'" . C   A 1  161  ? 137.728 202.108 100.121 1.00 256.39 ?  161  C   A "C5'" 1 
ATOM   3437  C  "C4'" . C   A 1  161  ? 136.762 203.137 99.590  1.00 256.39 ?  161  C   A "C4'" 1 
ATOM   3438  O  "O4'" . C   A 1  161  ? 135.406 202.743 99.935  1.00 256.39 ?  161  C   A "O4'" 1 
ATOM   3439  C  "C3'" . C   A 1  161  ? 136.948 204.549 100.139 1.00 256.39 ?  161  C   A "C3'" 1 
ATOM   3440  O  "O3'" . C   A 1  161  ? 136.619 205.495 99.123  1.00 256.39 ?  161  C   A "O3'" 1 
ATOM   3441  C  "C2'" . C   A 1  161  ? 135.912 204.615 101.256 1.00 256.39 ?  161  C   A "C2'" 1 
ATOM   3442  O  "O2'" . C   A 1  161  ? 135.483 205.919 101.584 1.00 256.39 ?  161  C   A "O2'" 1 
ATOM   3443  C  "C1'" . C   A 1  161  ? 134.780 203.776 100.671 1.00 256.39 ?  161  C   A "C1'" 1 
ATOM   3444  N  N1    . C   A 1  161  ? 133.910 203.158 101.682 1.00 256.39 ?  161  C   A N1    1 
ATOM   3445  C  C2    . C   A 1  161  ? 132.583 203.583 101.781 1.00 256.39 ?  161  C   A C2    1 
ATOM   3446  O  O2    . C   A 1  161  ? 132.178 204.468 101.012 1.00 256.39 ?  161  C   A O2    1 
ATOM   3447  N  N3    . C   A 1  161  ? 131.776 203.019 102.709 1.00 256.39 ?  161  C   A N3    1 
ATOM   3448  C  C4    . C   A 1  161  ? 132.251 202.069 103.517 1.00 256.39 ?  161  C   A C4    1 
ATOM   3449  N  N4    . C   A 1  161  ? 131.419 201.541 104.418 1.00 256.39 ?  161  C   A N4    1 
ATOM   3450  C  C5    . C   A 1  161  ? 133.600 201.617 103.438 1.00 256.39 ?  161  C   A C5    1 
ATOM   3451  C  C6    . C   A 1  161  ? 134.387 202.184 102.515 1.00 256.39 ?  161  C   A C6    1 
ATOM   3452  P  P     . G   A 1  162  ? 137.770 206.082 98.167  1.00 248.96 ?  162  G   A P     1 
ATOM   3453  O  OP1   . G   A 1  162  ? 137.444 205.703 96.769  1.00 248.96 ?  162  G   A OP1   1 
ATOM   3454  O  OP2   . G   A 1  162  ? 139.084 205.700 98.743  1.00 248.96 ?  162  G   A OP2   1 
ATOM   3455  O  "O5'" . G   A 1  162  ? 137.612 207.662 98.298  1.00 248.96 ?  162  G   A "O5'" 1 
ATOM   3456  C  "C5'" . G   A 1  162  ? 136.732 208.228 99.258  1.00 248.96 ?  162  G   A "C5'" 1 
ATOM   3457  C  "C4'" . G   A 1  162  ? 137.335 209.446 99.910  1.00 248.96 ?  162  G   A "C4'" 1 
ATOM   3458  O  "O4'" . G   A 1  162  ? 138.428 209.050 100.778 1.00 248.96 ?  162  G   A "O4'" 1 
ATOM   3459  C  "C3'" . G   A 1  162  ? 137.960 210.465 98.970  1.00 248.96 ?  162  G   A "C3'" 1 
ATOM   3460  O  "O3'" . G   A 1  162  ? 137.004 211.325 98.374  1.00 248.96 ?  162  G   A "O3'" 1 
ATOM   3461  C  "C2'" . G   A 1  162  ? 138.952 211.184 99.873  1.00 248.96 ?  162  G   A "C2'" 1 
ATOM   3462  O  "O2'" . G   A 1  162  ? 138.288 212.136 100.692 1.00 248.96 ?  162  G   A "O2'" 1 
ATOM   3463  C  "C1'" . G   A 1  162  ? 139.437 210.038 100.762 1.00 248.96 ?  162  G   A "C1'" 1 
ATOM   3464  N  N9    . G   A 1  162  ? 140.682 209.431 100.255 1.00 248.96 ?  162  G   A N9    1 
ATOM   3465  C  C8    . G   A 1  162  ? 140.807 208.263 99.543  1.00 248.96 ?  162  G   A C8    1 
ATOM   3466  N  N7    . G   A 1  162  ? 142.044 207.982 99.232  1.00 248.96 ?  162  G   A N7    1 
ATOM   3467  C  C5    . G   A 1  162  ? 142.780 209.026 99.773  1.00 248.96 ?  162  G   A C5    1 
ATOM   3468  C  C6    . G   A 1  162  ? 144.178 209.271 99.759  1.00 248.96 ?  162  G   A C6    1 
ATOM   3469  O  O6    . G   A 1  162  ? 145.075 208.589 99.248  1.00 248.96 ?  162  G   A O6    1 
ATOM   3470  N  N1    . G   A 1  162  ? 144.498 210.449 100.427 1.00 248.96 ?  162  G   A N1    1 
ATOM   3471  C  C2    . G   A 1  162  ? 143.592 211.285 101.031 1.00 248.96 ?  162  G   A C2    1 
ATOM   3472  N  N2    . G   A 1  162  ? 144.097 212.376 101.626 1.00 248.96 ?  162  G   A N2    1 
ATOM   3473  N  N3    . G   A 1  162  ? 142.287 211.069 101.052 1.00 248.96 ?  162  G   A N3    1 
ATOM   3474  C  C4    . G   A 1  162  ? 141.954 209.930 100.408 1.00 248.96 ?  162  G   A C4    1 
ATOM   3475  P  P     . C   A 1  163  ? 136.981 211.529 96.780  1.00 257.05 ?  163  C   A P     1 
ATOM   3476  O  OP1   . C   A 1  163  ? 135.591 211.862 96.377  1.00 257.05 ?  163  C   A OP1   1 
ATOM   3477  O  OP2   . C   A 1  163  ? 137.665 210.366 96.158  1.00 257.05 ?  163  C   A OP2   1 
ATOM   3478  O  "O5'" . C   A 1  163  ? 137.887 212.817 96.542  1.00 257.05 ?  163  C   A "O5'" 1 
ATOM   3479  C  "C5'" . C   A 1  163  ? 137.601 214.041 97.202  1.00 257.05 ?  163  C   A "C5'" 1 
ATOM   3480  C  "C4'" . C   A 1  163  ? 138.860 214.826 97.473  1.00 257.05 ?  163  C   A "C4'" 1 
ATOM   3481  O  "O4'" . C   A 1  163  ? 139.778 214.015 98.250  1.00 257.05 ?  163  C   A "O4'" 1 
ATOM   3482  C  "C3'" . C   A 1  163  ? 139.667 215.229 96.248  1.00 257.05 ?  163  C   A "C3'" 1 
ATOM   3483  O  "O3'" . C   A 1  163  ? 139.163 216.395 95.620  1.00 257.05 ?  163  C   A "O3'" 1 
ATOM   3484  C  "C2'" . C   A 1  163  ? 141.075 215.397 96.809  1.00 257.05 ?  163  C   A "C2'" 1 
ATOM   3485  O  "O2'" . C   A 1  163  ? 141.218 216.663 97.436  1.00 257.05 ?  163  C   A "O2'" 1 
ATOM   3486  C  "C1'" . C   A 1  163  ? 141.111 214.314 97.893  1.00 257.05 ?  163  C   A "C1'" 1 
ATOM   3487  N  N1    . C   A 1  163  ? 141.787 213.069 97.448  1.00 257.05 ?  163  C   A N1    1 
ATOM   3488  C  C2    . C   A 1  163  ? 143.179 212.986 97.566  1.00 257.05 ?  163  C   A C2    1 
ATOM   3489  O  O2    . C   A 1  163  ? 143.809 213.949 98.029  1.00 257.05 ?  163  C   A O2    1 
ATOM   3490  N  N3    . C   A 1  163  ? 143.814 211.857 97.172  1.00 257.05 ?  163  C   A N3    1 
ATOM   3491  C  C4    . C   A 1  163  ? 143.118 210.832 96.679  1.00 257.05 ?  163  C   A C4    1 
ATOM   3492  N  N4    . C   A 1  163  ? 143.789 209.741 96.303  1.00 257.05 ?  163  C   A N4    1 
ATOM   3493  C  C5    . C   A 1  163  ? 141.701 210.882 96.549  1.00 257.05 ?  163  C   A C5    1 
ATOM   3494  C  C6    . C   A 1  163  ? 141.086 212.003 96.946  1.00 257.05 ?  163  C   A C6    1 
ATOM   3495  P  P     . G   A 1  164  ? 138.581 216.323 94.124  1.00 277.57 ?  164  G   A P     1 
ATOM   3496  O  OP1   . G   A 1  164  ? 137.610 217.434 93.954  1.00 277.57 ?  164  G   A OP1   1 
ATOM   3497  O  OP2   . G   A 1  164  ? 138.150 214.926 93.865  1.00 277.57 ?  164  G   A OP2   1 
ATOM   3498  O  "O5'" . G   A 1  164  ? 139.844 216.627 93.203  1.00 277.57 ?  164  G   A "O5'" 1 
ATOM   3499  C  "C5'" . G   A 1  164  ? 140.552 217.854 93.315  1.00 277.57 ?  164  G   A "C5'" 1 
ATOM   3500  C  "C4'" . G   A 1  164  ? 141.881 217.786 92.607  1.00 277.57 ?  164  G   A "C4'" 1 
ATOM   3501  O  "O4'" . G   A 1  164  ? 142.712 216.771 93.228  1.00 277.57 ?  164  G   A "O4'" 1 
ATOM   3502  C  "C3'" . G   A 1  164  ? 141.829 217.380 91.141  1.00 277.57 ?  164  G   A "C3'" 1 
ATOM   3503  O  "O3'" . G   A 1  164  ? 141.516 218.461 90.280  1.00 277.57 ?  164  G   A "O3'" 1 
ATOM   3504  C  "C2'" . G   A 1  164  ? 143.214 216.793 90.908  1.00 277.57 ?  164  G   A "C2'" 1 
ATOM   3505  O  "O2'" . G   A 1  164  ? 144.176 217.825 90.742  1.00 277.57 ?  164  G   A "O2'" 1 
ATOM   3506  C  "C1'" . G   A 1  164  ? 143.475 216.102 92.246  1.00 277.57 ?  164  G   A "C1'" 1 
ATOM   3507  N  N9    . G   A 1  164  ? 143.062 214.686 92.228  1.00 277.57 ?  164  G   A N9    1 
ATOM   3508  C  C8    . G   A 1  164  ? 141.979 214.143 92.877  1.00 277.57 ?  164  G   A C8    1 
ATOM   3509  N  N7    . G   A 1  164  ? 141.855 212.859 92.685  1.00 277.57 ?  164  G   A N7    1 
ATOM   3510  C  C5    . G   A 1  164  ? 142.922 212.531 91.861  1.00 277.57 ?  164  G   A C5    1 
ATOM   3511  C  C6    . G   A 1  164  ? 143.308 211.279 91.316  1.00 277.57 ?  164  G   A C6    1 
ATOM   3512  O  O6    . G   A 1  164  ? 142.767 210.176 91.459  1.00 277.57 ?  164  G   A O6    1 
ATOM   3513  N  N1    . G   A 1  164  ? 144.452 211.394 90.534  1.00 277.57 ?  164  G   A N1    1 
ATOM   3514  C  C2    . G   A 1  164  ? 145.138 212.561 90.303  1.00 277.57 ?  164  G   A C2    1 
ATOM   3515  N  N2    . G   A 1  164  ? 146.220 212.465 89.517  1.00 277.57 ?  164  G   A N2    1 
ATOM   3516  N  N3    . G   A 1  164  ? 144.788 213.734 90.805  1.00 277.57 ?  164  G   A N3    1 
ATOM   3517  C  C4    . G   A 1  164  ? 143.679 213.647 91.569  1.00 277.57 ?  164  G   A C4    1 
ATOM   3518  P  P     . A   A 1  165  ? 140.733 218.197 88.901  1.00 293.71 ?  165  A   A P     1 
ATOM   3519  O  OP1   . A   A 1  165  ? 140.138 219.483 88.456  1.00 293.71 ?  165  A   A OP1   1 
ATOM   3520  O  OP2   . A   A 1  165  ? 139.860 217.010 89.088  1.00 293.71 ?  165  A   A OP2   1 
ATOM   3521  O  "O5'" . A   A 1  165  ? 141.884 217.804 87.873  1.00 293.71 ?  165  A   A "O5'" 1 
ATOM   3522  C  "C5'" . A   A 1  165  ? 142.972 218.683 87.626  1.00 293.71 ?  165  A   A "C5'" 1 
ATOM   3523  C  "C4'" . A   A 1  165  ? 144.107 217.974 86.932  1.00 293.71 ?  165  A   A "C4'" 1 
ATOM   3524  O  "O4'" . A   A 1  165  ? 144.572 216.872 87.755  1.00 293.71 ?  165  A   A "O4'" 1 
ATOM   3525  C  "C3'" . A   A 1  165  ? 143.769 217.322 85.599  1.00 293.71 ?  165  A   A "C3'" 1 
ATOM   3526  O  "O3'" . A   A 1  165  ? 143.770 218.240 84.519  1.00 293.71 ?  165  A   A "O3'" 1 
ATOM   3527  C  "C2'" . A   A 1  165  ? 144.829 216.236 85.482  1.00 293.71 ?  165  A   A "C2'" 1 
ATOM   3528  O  "O2'" . A   A 1  165  ? 146.070 216.789 85.070  1.00 293.71 ?  165  A   A "O2'" 1 
ATOM   3529  C  "C1'" . A   A 1  165  ? 144.960 215.788 86.937  1.00 293.71 ?  165  A   A "C1'" 1 
ATOM   3530  N  N9    . A   A 1  165  ? 144.087 214.639 87.242  1.00 293.71 ?  165  A   A N9    1 
ATOM   3531  C  C8    . A   A 1  165  ? 142.901 214.648 87.934  1.00 293.71 ?  165  A   A C8    1 
ATOM   3532  N  N7    . A   A 1  165  ? 142.345 213.466 88.048  1.00 293.71 ?  165  A   A N7    1 
ATOM   3533  C  C5    . A   A 1  165  ? 143.225 212.622 87.386  1.00 293.71 ?  165  A   A C5    1 
ATOM   3534  C  C6    . A   A 1  165  ? 143.217 211.236 87.145  1.00 293.71 ?  165  A   A C6    1 
ATOM   3535  N  N6    . A   A 1  165  ? 142.248 210.419 87.565  1.00 293.71 ?  165  A   A N6    1 
ATOM   3536  N  N1    . A   A 1  165  ? 144.250 210.707 86.449  1.00 293.71 ?  165  A   A N1    1 
ATOM   3537  C  C2    . A   A 1  165  ? 145.229 211.518 86.024  1.00 293.71 ?  165  A   A C2    1 
ATOM   3538  N  N3    . A   A 1  165  ? 145.346 212.835 86.189  1.00 293.71 ?  165  A   A N3    1 
ATOM   3539  C  C4    . A   A 1  165  ? 144.304 213.330 86.884  1.00 293.71 ?  165  A   A C4    1 
ATOM   3540  P  P     . G   A 1  166  ? 142.671 218.118 83.353  1.00 305.06 ?  166  G   A P     1 
ATOM   3541  O  OP1   . G   A 1  166  ? 142.627 219.412 82.626  1.00 305.06 ?  166  G   A OP1   1 
ATOM   3542  O  OP2   . G   A 1  166  ? 141.427 217.569 83.950  1.00 305.06 ?  166  G   A OP2   1 
ATOM   3543  O  "O5'" . G   A 1  166  ? 143.272 217.019 82.370  1.00 305.06 ?  166  G   A "O5'" 1 
ATOM   3544  C  "C5'" . G   A 1  166  ? 144.515 217.229 81.715  1.00 305.06 ?  166  G   A "C5'" 1 
ATOM   3545  C  "C4'" . G   A 1  166  ? 145.087 215.938 81.187  1.00 305.06 ?  166  G   A "C4'" 1 
ATOM   3546  O  "O4'" . G   A 1  166  ? 145.319 215.019 82.287  1.00 305.06 ?  166  G   A "O4'" 1 
ATOM   3547  C  "C3'" . G   A 1  166  ? 144.199 215.155 80.233  1.00 305.06 ?  166  G   A "C3'" 1 
ATOM   3548  O  "O3'" . G   A 1  166  ? 144.243 215.647 78.904  1.00 305.06 ?  166  G   A "O3'" 1 
ATOM   3549  C  "C2'" . G   A 1  166  ? 144.730 213.735 80.378  1.00 305.06 ?  166  G   A "C2'" 1 
ATOM   3550  O  "O2'" . G   A 1  166  ? 145.932 213.570 79.641  1.00 305.06 ?  166  G   A "O2'" 1 
ATOM   3551  C  "C1'" . G   A 1  166  ? 145.067 213.694 81.869  1.00 305.06 ?  166  G   A "C1'" 1 
ATOM   3552  N  N9    . G   A 1  166  ? 143.954 213.153 82.672  1.00 305.06 ?  166  G   A N9    1 
ATOM   3553  C  C8    . G   A 1  166  ? 143.049 213.868 83.418  1.00 305.06 ?  166  G   A C8    1 
ATOM   3554  N  N7    . G   A 1  166  ? 142.172 213.115 84.023  1.00 305.06 ?  166  G   A N7    1 
ATOM   3555  C  C5    . G   A 1  166  ? 142.518 211.822 83.654  1.00 305.06 ?  166  G   A C5    1 
ATOM   3556  C  C6    . G   A 1  166  ? 141.928 210.578 84.001  1.00 305.06 ?  166  G   A C6    1 
ATOM   3557  O  O6    . G   A 1  166  ? 140.950 210.365 84.727  1.00 305.06 ?  166  G   A O6    1 
ATOM   3558  N  N1    . G   A 1  166  ? 142.596 209.513 83.405  1.00 305.06 ?  166  G   A N1    1 
ATOM   3559  C  C2    . G   A 1  166  ? 143.689 209.626 82.583  1.00 305.06 ?  166  G   A C2    1 
ATOM   3560  N  N2    . G   A 1  166  ? 144.192 208.478 82.106  1.00 305.06 ?  166  G   A N2    1 
ATOM   3561  N  N3    . G   A 1  166  ? 144.248 210.779 82.252  1.00 305.06 ?  166  G   A N3    1 
ATOM   3562  C  C4    . G   A 1  166  ? 143.616 211.828 82.819  1.00 305.06 ?  166  G   A C4    1 
ATOM   3563  P  P     . G   A 1  167  ? 142.880 215.916 78.096  1.00 321.09 ?  167  G   A P     1 
ATOM   3564  O  OP1   . G   A 1  167  ? 143.152 216.952 77.068  1.00 321.09 ?  167  G   A OP1   1 
ATOM   3565  O  OP2   . G   A 1  167  ? 141.794 216.132 79.086  1.00 321.09 ?  167  G   A OP2   1 
ATOM   3566  O  "O5'" . G   A 1  167  ? 142.595 214.539 77.346  1.00 321.09 ?  167  G   A "O5'" 1 
ATOM   3567  C  "C5'" . G   A 1  167  ? 143.489 214.049 76.358  1.00 321.09 ?  167  G   A "C5'" 1 
ATOM   3568  C  "C4'" . G   A 1  167  ? 143.483 212.542 76.304  1.00 321.09 ?  167  G   A "C4'" 1 
ATOM   3569  O  "O4'" . G   A 1  167  ? 143.723 212.006 77.631  1.00 321.09 ?  167  G   A "O4'" 1 
ATOM   3570  C  "C3'" . G   A 1  167  ? 142.177 211.891 75.876  1.00 321.09 ?  167  G   A "C3'" 1 
ATOM   3571  O  "O3'" . G   A 1  167  ? 141.999 211.871 74.469  1.00 321.09 ?  167  G   A "O3'" 1 
ATOM   3572  C  "C2'" . G   A 1  167  ? 142.281 210.503 76.492  1.00 321.09 ?  167  G   A "C2'" 1 
ATOM   3573  O  "O2'" . G   A 1  167  ? 143.128 209.670 75.713  1.00 321.09 ?  167  G   A "O2'" 1 
ATOM   3574  C  "C1'" . G   A 1  167  ? 142.989 210.812 77.810  1.00 321.09 ?  167  G   A "C1'" 1 
ATOM   3575  N  N9    . G   A 1  167  ? 142.032 211.008 78.915  1.00 321.09 ?  167  G   A N9    1 
ATOM   3576  C  C8    . G   A 1  167  ? 141.627 212.198 79.469  1.00 321.09 ?  167  G   A C8    1 
ATOM   3577  N  N7    . G   A 1  167  ? 140.764 212.046 80.436  1.00 321.09 ?  167  G   A N7    1 
ATOM   3578  C  C5    . G   A 1  167  ? 140.586 210.672 80.525  1.00 321.09 ?  167  G   A C5    1 
ATOM   3579  C  C6    . G   A 1  167  ? 139.766 209.904 81.392  1.00 321.09 ?  167  G   A C6    1 
ATOM   3580  O  O6    . G   A 1  167  ? 139.006 210.298 82.285  1.00 321.09 ?  167  G   A O6    1 
ATOM   3581  N  N1    . G   A 1  167  ? 139.889 208.542 81.139  1.00 321.09 ?  167  G   A N1    1 
ATOM   3582  C  C2    . G   A 1  167  ? 140.697 207.987 80.177  1.00 321.09 ?  167  G   A C2    1 
ATOM   3583  N  N2    . G   A 1  167  ? 140.680 206.649 80.086  1.00 321.09 ?  167  G   A N2    1 
ATOM   3584  N  N3    . G   A 1  167  ? 141.466 208.691 79.363  1.00 321.09 ?  167  G   A N3    1 
ATOM   3585  C  C4    . G   A 1  167  ? 141.361 210.018 79.592  1.00 321.09 ?  167  G   A C4    1 
ATOM   3586  P  P     . U   A 1  168  ? 140.655 212.455 73.807  1.00 361.53 ?  168  U   A P     1 
ATOM   3587  O  OP1   . U   A 1  168  ? 140.729 212.223 72.342  1.00 361.53 ?  168  U   A OP1   1 
ATOM   3588  O  OP2   . U   A 1  168  ? 140.453 213.833 74.322  1.00 361.53 ?  168  U   A OP2   1 
ATOM   3589  O  "O5'" . U   A 1  168  ? 139.491 211.535 74.392  1.00 361.53 ?  168  U   A "O5'" 1 
ATOM   3590  C  "C5'" . U   A 1  168  ? 139.420 210.150 74.081  1.00 361.53 ?  168  U   A "C5'" 1 
ATOM   3591  C  "C4'" . U   A 1  168  ? 138.350 209.459 74.889  1.00 361.53 ?  168  U   A "C4'" 1 
ATOM   3592  O  "O4'" . U   A 1  168  ? 138.348 209.984 76.242  1.00 361.53 ?  168  U   A "O4'" 1 
ATOM   3593  C  "C3'" . U   A 1  168  ? 136.920 209.662 74.412  1.00 361.53 ?  168  U   A "C3'" 1 
ATOM   3594  O  "O3'" . U   A 1  168  ? 136.571 208.800 73.343  1.00 361.53 ?  168  U   A "O3'" 1 
ATOM   3595  C  "C2'" . U   A 1  168  ? 136.105 209.422 75.677  1.00 361.53 ?  168  U   A "C2'" 1 
ATOM   3596  O  "O2'" . U   A 1  168  ? 135.941 208.032 75.913  1.00 361.53 ?  168  U   A "O2'" 1 
ATOM   3597  C  "C1'" . U   A 1  168  ? 137.032 209.990 76.757  1.00 361.53 ?  168  U   A "C1'" 1 
ATOM   3598  N  N1    . U   A 1  168  ? 136.672 211.373 77.158  1.00 361.53 ?  168  U   A N1    1 
ATOM   3599  C  C2    . U   A 1  168  ? 135.669 211.528 78.101  1.00 361.53 ?  168  U   A C2    1 
ATOM   3600  O  O2    . U   A 1  168  ? 135.074 210.591 78.606  1.00 361.53 ?  168  U   A O2    1 
ATOM   3601  N  N3    . U   A 1  168  ? 135.381 212.828 78.437  1.00 361.53 ?  168  U   A N3    1 
ATOM   3602  C  C4    . U   A 1  168  ? 135.978 213.970 77.943  1.00 361.53 ?  168  U   A C4    1 
ATOM   3603  O  O4    . U   A 1  168  ? 135.606 215.072 78.347  1.00 361.53 ?  168  U   A O4    1 
ATOM   3604  C  C5    . U   A 1  168  ? 137.005 213.731 76.978  1.00 361.53 ?  168  U   A C5    1 
ATOM   3605  C  C6    . U   A 1  168  ? 137.309 212.476 76.632  1.00 361.53 ?  168  U   A C6    1 
ATOM   3606  P  P     . C   A 1  169  ? 136.272 209.398 71.882  1.00 375.59 ?  169  C   A P     1 
ATOM   3607  O  OP1   . C   A 1  169  ? 137.041 210.659 71.733  1.00 375.59 ?  169  C   A OP1   1 
ATOM   3608  O  OP2   . C   A 1  169  ? 134.801 209.407 71.682  1.00 375.59 ?  169  C   A OP2   1 
ATOM   3609  O  "O5'" . C   A 1  169  ? 136.897 208.318 70.890  1.00 375.59 ?  169  C   A "O5'" 1 
ATOM   3610  C  "C5'" . C   A 1  169  ? 136.289 207.041 70.718  1.00 375.59 ?  169  C   A "C5'" 1 
ATOM   3611  C  "C4'" . C   A 1  169  ? 137.254 205.910 70.990  1.00 375.59 ?  169  C   A "C4'" 1 
ATOM   3612  O  "O4'" . C   A 1  169  ? 138.538 206.214 70.378  1.00 375.59 ?  169  C   A "O4'" 1 
ATOM   3613  C  "C3'" . C   A 1  169  ? 137.540 205.628 72.466  1.00 375.59 ?  169  C   A "C3'" 1 
ATOM   3614  O  "O3'" . C   A 1  169  ? 137.735 204.226 72.656  1.00 375.59 ?  169  C   A "O3'" 1 
ATOM   3615  C  "C2'" . C   A 1  169  ? 138.860 206.357 72.699  1.00 375.59 ?  169  C   A "C2'" 1 
ATOM   3616  O  "O2'" . C   A 1  169  ? 139.629 205.851 73.769  1.00 375.59 ?  169  C   A "O2'" 1 
ATOM   3617  C  "C1'" . C   A 1  169  ? 139.558 206.161 71.357  1.00 375.59 ?  169  C   A "C1'" 1 
ATOM   3618  N  N1    . C   A 1  169  ? 140.552 207.197 71.041  1.00 375.59 ?  169  C   A N1    1 
ATOM   3619  C  C2    . C   A 1  169  ? 141.898 206.836 70.950  1.00 375.59 ?  169  C   A C2    1 
ATOM   3620  O  O2    . C   A 1  169  ? 142.216 205.652 71.137  1.00 375.59 ?  169  C   A O2    1 
ATOM   3621  N  N3    . C   A 1  169  ? 142.818 207.784 70.659  1.00 375.59 ?  169  C   A N3    1 
ATOM   3622  C  C4    . C   A 1  169  ? 142.436 209.048 70.464  1.00 375.59 ?  169  C   A C4    1 
ATOM   3623  N  N4    . C   A 1  169  ? 143.378 209.950 70.180  1.00 375.59 ?  169  C   A N4    1 
ATOM   3624  C  C5    . C   A 1  169  ? 141.070 209.444 70.551  1.00 375.59 ?  169  C   A C5    1 
ATOM   3625  C  C6    . C   A 1  169  ? 140.170 208.495 70.839  1.00 375.59 ?  169  C   A C6    1 
ATOM   3626  P  P     . A   A 1  170  ? 136.485 203.256 72.950  1.00 341.89 ?  170  A   A P     1 
ATOM   3627  O  OP1   . A   A 1  170  ? 136.631 202.062 72.079  1.00 341.89 ?  170  A   A OP1   1 
ATOM   3628  O  OP2   . A   A 1  170  ? 135.236 204.058 72.892  1.00 341.89 ?  170  A   A OP2   1 
ATOM   3629  O  "O5'" . A   A 1  170  ? 136.688 202.796 74.462  1.00 341.89 ?  170  A   A "O5'" 1 
ATOM   3630  C  "C5'" . A   A 1  170  ? 136.586 203.730 75.527  1.00 341.89 ?  170  A   A "C5'" 1 
ATOM   3631  C  "C4'" . A   A 1  170  ? 135.684 203.230 76.627  1.00 341.89 ?  170  A   A "C4'" 1 
ATOM   3632  O  "O4'" . A   A 1  170  ? 134.977 204.353 77.218  1.00 341.89 ?  170  A   A "O4'" 1 
ATOM   3633  C  "C3'" . A   A 1  170  ? 134.575 202.277 76.202  1.00 341.89 ?  170  A   A "C3'" 1 
ATOM   3634  O  "O3'" . A   A 1  170  ? 135.012 200.935 76.070  1.00 341.89 ?  170  A   A "O3'" 1 
ATOM   3635  C  "C2'" . A   A 1  170  ? 133.533 202.475 77.294  1.00 341.89 ?  170  A   A "C2'" 1 
ATOM   3636  O  "O2'" . A   A 1  170  ? 133.907 201.781 78.475  1.00 341.89 ?  170  A   A "O2'" 1 
ATOM   3637  C  "C1'" . A   A 1  170  ? 133.659 203.973 77.555  1.00 341.89 ?  170  A   A "C1'" 1 
ATOM   3638  N  N9    . A   A 1  170  ? 132.725 204.752 76.720  1.00 341.89 ?  170  A   A N9    1 
ATOM   3639  C  C8    . A   A 1  170  ? 133.030 205.540 75.637  1.00 341.89 ?  170  A   A C8    1 
ATOM   3640  N  N7    . A   A 1  170  ? 131.987 206.111 75.085  1.00 341.89 ?  170  A   A N7    1 
ATOM   3641  C  C5    . A   A 1  170  ? 130.922 205.667 75.856  1.00 341.89 ?  170  A   A C5    1 
ATOM   3642  C  C6    . A   A 1  170  ? 129.537 205.909 75.796  1.00 341.89 ?  170  A   A C6    1 
ATOM   3643  N  N6    . A   A 1  170  ? 128.964 206.693 74.880  1.00 341.89 ?  170  A   A N6    1 
ATOM   3644  N  N1    . A   A 1  170  ? 128.748 205.310 76.718  1.00 341.89 ?  170  A   A N1    1 
ATOM   3645  C  C2    . A   A 1  170  ? 129.313 204.520 77.641  1.00 341.89 ?  170  A   A C2    1 
ATOM   3646  N  N3    . A   A 1  170  ? 130.601 204.218 77.798  1.00 341.89 ?  170  A   A N3    1 
ATOM   3647  C  C4    . A   A 1  170  ? 131.360 204.828 76.867  1.00 341.89 ?  170  A   A C4    1 
ATOM   3648  P  P     . G   A 1  171  ? 134.327 199.963 74.987  1.00 311.65 ?  171  G   A P     1 
ATOM   3649  O  OP1   . G   A 1  171  ? 134.916 200.273 73.660  1.00 311.65 ?  171  G   A OP1   1 
ATOM   3650  O  OP2   . G   A 1  171  ? 132.853 200.011 75.162  1.00 311.65 ?  171  G   A OP2   1 
ATOM   3651  O  "O5'" . G   A 1  171  ? 134.816 198.508 75.408  1.00 311.65 ?  171  G   A "O5'" 1 
ATOM   3652  C  "C5'" . G   A 1  171  ? 135.960 197.920 74.807  1.00 311.65 ?  171  G   A "C5'" 1 
ATOM   3653  C  "C4'" . G   A 1  171  ? 135.831 196.419 74.737  1.00 311.65 ?  171  G   A "C4'" 1 
ATOM   3654  O  "O4'" . G   A 1  171  ? 135.827 195.865 76.077  1.00 311.65 ?  171  G   A "O4'" 1 
ATOM   3655  C  "C3'" . G   A 1  171  ? 134.548 195.891 74.114  1.00 311.65 ?  171  G   A "C3'" 1 
ATOM   3656  O  "O3'" . G   A 1  171  ? 134.584 195.889 72.698  1.00 311.65 ?  171  G   A "O3'" 1 
ATOM   3657  C  "C2'" . G   A 1  171  ? 134.428 194.500 74.724  1.00 311.65 ?  171  G   A "C2'" 1 
ATOM   3658  O  "O2'" . G   A 1  171  ? 135.282 193.583 74.055  1.00 311.65 ?  171  G   A "O2'" 1 
ATOM   3659  C  "C1'" . G   A 1  171  ? 134.981 194.736 76.131  1.00 311.65 ?  171  G   A "C1'" 1 
ATOM   3660  N  N9    . G   A 1  171  ? 133.912 194.995 77.115  1.00 311.65 ?  171  G   A N9    1 
ATOM   3661  C  C8    . G   A 1  171  ? 133.410 196.217 77.495  1.00 311.65 ?  171  G   A C8    1 
ATOM   3662  N  N7    . G   A 1  171  ? 132.465 196.127 78.391  1.00 311.65 ?  171  G   A N7    1 
ATOM   3663  C  C5    . G   A 1  171  ? 132.336 194.764 78.619  1.00 311.65 ?  171  G   A C5    1 
ATOM   3664  C  C6    . G   A 1  171  ? 131.469 194.056 79.491  1.00 311.65 ?  171  G   A C6    1 
ATOM   3665  O  O6    . G   A 1  171  ? 130.613 194.508 80.262  1.00 311.65 ?  171  G   A O6    1 
ATOM   3666  N  N1    . G   A 1  171  ? 131.670 192.682 79.409  1.00 311.65 ?  171  G   A N1    1 
ATOM   3667  C  C2    . G   A 1  171  ? 132.587 192.066 78.593  1.00 311.65 ?  171  G   A C2    1 
ATOM   3668  N  N2    . G   A 1  171  ? 132.630 190.727 78.657  1.00 311.65 ?  171  G   A N2    1 
ATOM   3669  N  N3    . G   A 1  171  ? 133.401 192.714 77.776  1.00 311.65 ?  171  G   A N3    1 
ATOM   3670  C  C4    . G   A 1  171  ? 133.222 194.051 77.839  1.00 311.65 ?  171  G   A C4    1 
ATOM   3671  P  P     . A   A 1  172  ? 133.314 196.395 71.853  1.00 308.37 ?  172  A   A P     1 
ATOM   3672  O  OP1   . A   A 1  172  ? 133.332 197.881 71.841  1.00 308.37 ?  172  A   A OP1   1 
ATOM   3673  O  OP2   . A   A 1  172  ? 132.111 195.680 72.349  1.00 308.37 ?  172  A   A OP2   1 
ATOM   3674  O  "O5'" . A   A 1  172  ? 133.616 195.889 70.373  1.00 308.37 ?  172  A   A "O5'" 1 
ATOM   3675  C  "C5'" . A   A 1  172  ? 134.040 194.550 70.137  1.00 308.37 ?  172  A   A "C5'" 1 
ATOM   3676  C  "C4'" . A   A 1  172  ? 135.054 194.472 69.022  1.00 308.37 ?  172  A   A "C4'" 1 
ATOM   3677  O  "O4'" . A   A 1  172  ? 135.954 195.610 69.115  1.00 308.37 ?  172  A   A "O4'" 1 
ATOM   3678  C  "C3'" . A   A 1  172  ? 135.939 193.228 69.038  1.00 308.37 ?  172  A   A "C3'" 1 
ATOM   3679  O  "O3'" . A   A 1  172  ? 136.268 192.862 67.698  1.00 308.37 ?  172  A   A "O3'" 1 
ATOM   3680  C  "C2'" . A   A 1  172  ? 137.192 193.721 69.753  1.00 308.37 ?  172  A   A "C2'" 1 
ATOM   3681  O  "O2'" . A   A 1  172  ? 138.361 192.983 69.468  1.00 308.37 ?  172  A   A "O2'" 1 
ATOM   3682  C  "C1'" . A   A 1  172  ? 137.288 195.156 69.242  1.00 308.37 ?  172  A   A "C1'" 1 
ATOM   3683  N  N9    . A   A 1  172  ? 137.997 196.067 70.143  1.00 308.37 ?  172  A   A N9    1 
ATOM   3684  C  C8    . A   A 1  172  ? 137.768 196.278 71.481  1.00 308.37 ?  172  A   A C8    1 
ATOM   3685  N  N7    . A   A 1  172  ? 138.568 197.164 72.022  1.00 308.37 ?  172  A   A N7    1 
ATOM   3686  C  C5    . A   A 1  172  ? 139.377 197.566 70.968  1.00 308.37 ?  172  A   A C5    1 
ATOM   3687  C  C6    . A   A 1  172  ? 140.436 198.489 70.875  1.00 308.37 ?  172  A   A C6    1 
ATOM   3688  N  N6    . A   A 1  172  ? 140.881 199.208 71.908  1.00 308.37 ?  172  A   A N6    1 
ATOM   3689  N  N1    . A   A 1  172  ? 141.031 198.652 69.671  1.00 308.37 ?  172  A   A N1    1 
ATOM   3690  C  C2    . A   A 1  172  ? 140.592 197.935 68.627  1.00 308.37 ?  172  A   A C2    1 
ATOM   3691  N  N3    . A   A 1  172  ? 139.607 197.039 68.592  1.00 308.37 ?  172  A   A N3    1 
ATOM   3692  C  C4    . A   A 1  172  ? 139.036 196.900 69.803  1.00 308.37 ?  172  A   A C4    1 
ATOM   3693  P  P     . C   A 1  173  ? 135.413 191.737 66.932  1.00 311.51 ?  173  C   A P     1 
ATOM   3694  O  OP1   . C   A 1  173  ? 135.277 192.150 65.513  1.00 311.51 ?  173  C   A OP1   1 
ATOM   3695  O  OP2   . C   A 1  173  ? 134.195 191.457 67.735  1.00 311.51 ?  173  C   A OP2   1 
ATOM   3696  O  "O5'" . C   A 1  173  ? 136.340 190.441 66.983  1.00 311.51 ?  173  C   A "O5'" 1 
ATOM   3697  C  "C5'" . C   A 1  173  ? 135.822 189.162 66.629  1.00 311.51 ?  173  C   A "C5'" 1 
ATOM   3698  C  "C4'" . C   A 1  173  ? 136.589 188.024 67.265  1.00 311.51 ?  173  C   A "C4'" 1 
ATOM   3699  O  "O4'" . C   A 1  173  ? 137.863 187.846 66.588  1.00 311.51 ?  173  C   A "O4'" 1 
ATOM   3700  C  "C3'" . C   A 1  173  ? 136.908 188.172 68.755  1.00 311.51 ?  173  C   A "C3'" 1 
ATOM   3701  O  "O3'" . C   A 1  173  ? 136.777 186.903 69.394  1.00 311.51 ?  173  C   A "O3'" 1 
ATOM   3702  C  "C2'" . C   A 1  173  ? 138.378 188.587 68.752  1.00 311.51 ?  173  C   A "C2'" 1 
ATOM   3703  O  "O2'" . C   A 1  173  ? 139.086 188.254 69.928  1.00 311.51 ?  173  C   A "O2'" 1 
ATOM   3704  C  "C1'" . C   A 1  173  ? 138.910 187.831 67.538  1.00 311.51 ?  173  C   A "C1'" 1 
ATOM   3705  N  N1    . C   A 1  173  ? 140.101 188.437 66.925  1.00 311.51 ?  173  C   A N1    1 
ATOM   3706  C  C2    . C   A 1  173  ? 141.303 187.725 66.946  1.00 311.51 ?  173  C   A C2    1 
ATOM   3707  O  O2    . C   A 1  173  ? 141.328 186.605 67.479  1.00 311.51 ?  173  C   A O2    1 
ATOM   3708  N  N3    . C   A 1  173  ? 142.405 188.273 66.384  1.00 311.51 ?  173  C   A N3    1 
ATOM   3709  C  C4    . C   A 1  173  ? 142.337 189.480 65.820  1.00 311.51 ?  173  C   A C4    1 
ATOM   3710  N  N4    . C   A 1  173  ? 143.450 189.980 65.279  1.00 311.51 ?  173  C   A N4    1 
ATOM   3711  C  C5    . C   A 1  173  ? 141.125 190.228 65.786  1.00 311.51 ?  173  C   A C5    1 
ATOM   3712  C  C6    . C   A 1  173  ? 140.041 189.674 66.345  1.00 311.51 ?  173  C   A C6    1 
ATOM   3713  P  P     . U   A 1  174  ? 135.744 186.716 70.611  1.00 296.61 ?  174  U   A P     1 
ATOM   3714  O  OP1   . U   A 1  174  ? 135.309 185.296 70.633  1.00 296.61 ?  174  U   A OP1   1 
ATOM   3715  O  OP2   . U   A 1  174  ? 134.727 187.794 70.519  1.00 296.61 ?  174  U   A OP2   1 
ATOM   3716  O  "O5'" . U   A 1  174  ? 136.628 186.983 71.908  1.00 296.61 ?  174  U   A "O5'" 1 
ATOM   3717  C  "C5'" . U   A 1  174  ? 136.022 187.297 73.158  1.00 296.61 ?  174  U   A "C5'" 1 
ATOM   3718  C  "C4'" . U   A 1  174  ? 136.912 188.180 73.997  1.00 296.61 ?  174  U   A "C4'" 1 
ATOM   3719  O  "O4'" . U   A 1  174  ? 136.244 188.478 75.254  1.00 296.61 ?  174  U   A "O4'" 1 
ATOM   3720  C  "C3'" . U   A 1  174  ? 138.266 187.576 74.366  1.00 296.61 ?  174  U   A "C3'" 1 
ATOM   3721  O  "O3'" . U   A 1  174  ? 139.248 188.609 74.420  1.00 296.61 ?  174  U   A "O3'" 1 
ATOM   3722  C  "C2'" . U   A 1  174  ? 138.019 187.034 75.770  1.00 296.61 ?  174  U   A "C2'" 1 
ATOM   3723  O  "O2'" . U   A 1  174  ? 139.181 186.902 76.561  1.00 296.61 ?  174  U   A "O2'" 1 
ATOM   3724  C  "C1'" . U   A 1  174  ? 137.064 188.079 76.336  1.00 296.61 ?  174  U   A "C1'" 1 
ATOM   3725  N  N1    . U   A 1  174  ? 136.196 187.577 77.412  1.00 296.61 ?  174  U   A N1    1 
ATOM   3726  C  C2    . U   A 1  174  ? 136.389 188.087 78.681  1.00 296.61 ?  174  U   A C2    1 
ATOM   3727  O  O2    . U   A 1  174  ? 137.239 188.924 78.934  1.00 296.61 ?  174  U   A O2    1 
ATOM   3728  N  N3    . U   A 1  174  ? 135.551 187.581 79.643  1.00 296.61 ?  174  U   A N3    1 
ATOM   3729  C  C4    . U   A 1  174  ? 134.561 186.636 79.467  1.00 296.61 ?  174  U   A C4    1 
ATOM   3730  O  O4    . U   A 1  174  ? 133.886 186.280 80.434  1.00 296.61 ?  174  U   A O4    1 
ATOM   3731  C  C5    . U   A 1  174  ? 134.424 186.158 78.125  1.00 296.61 ?  174  U   A C5    1 
ATOM   3732  C  C6    . U   A 1  174  ? 135.227 186.633 77.167  1.00 296.61 ?  174  U   A C6    1 
ATOM   3733  P  P     . G   A 1  175  ? 140.565 188.520 73.504  1.00 288.04 ?  175  G   A P     1 
ATOM   3734  O  OP1   . G   A 1  175  ? 140.179 187.926 72.199  1.00 288.04 ?  175  G   A OP1   1 
ATOM   3735  O  OP2   . G   A 1  175  ? 141.642 187.887 74.308  1.00 288.04 ?  175  G   A OP2   1 
ATOM   3736  O  "O5'" . G   A 1  175  ? 140.966 190.041 73.254  1.00 288.04 ?  175  G   A "O5'" 1 
ATOM   3737  C  "C5'" . G   A 1  175  ? 140.555 190.722 72.077  1.00 288.04 ?  175  G   A "C5'" 1 
ATOM   3738  C  "C4'" . G   A 1  175  ? 140.360 192.195 72.336  1.00 288.04 ?  175  G   A "C4'" 1 
ATOM   3739  O  "O4'" . G   A 1  175  ? 139.051 192.424 72.920  1.00 288.04 ?  175  G   A "O4'" 1 
ATOM   3740  C  "C3'" . G   A 1  175  ? 141.325 192.827 73.328  1.00 288.04 ?  175  G   A "C3'" 1 
ATOM   3741  O  "O3'" . G   A 1  175  ? 142.576 193.161 72.750  1.00 288.04 ?  175  G   A "O3'" 1 
ATOM   3742  C  "C2'" . G   A 1  175  ? 140.542 194.030 73.833  1.00 288.04 ?  175  G   A "C2'" 1 
ATOM   3743  O  "O2'" . G   A 1  175  ? 140.586 195.090 72.888  1.00 288.04 ?  175  G   A "O2'" 1 
ATOM   3744  C  "C1'" . G   A 1  175  ? 139.120 193.471 73.865  1.00 288.04 ?  175  G   A "C1'" 1 
ATOM   3745  N  N9    . G   A 1  175  ? 138.767 192.923 75.188  1.00 288.04 ?  175  G   A N9    1 
ATOM   3746  C  C8    . G   A 1  175  ? 138.553 191.598 75.486  1.00 288.04 ?  175  G   A C8    1 
ATOM   3747  N  N7    . G   A 1  175  ? 138.250 191.393 76.737  1.00 288.04 ?  175  G   A N7    1 
ATOM   3748  C  C5    . G   A 1  175  ? 138.261 192.660 77.303  1.00 288.04 ?  175  G   A C5    1 
ATOM   3749  C  C6    . G   A 1  175  ? 138.006 193.066 78.638  1.00 288.04 ?  175  G   A C6    1 
ATOM   3750  O  O6    . G   A 1  175  ? 137.711 192.363 79.612  1.00 288.04 ?  175  G   A O6    1 
ATOM   3751  N  N1    . G   A 1  175  ? 138.123 194.444 78.787  1.00 288.04 ?  175  G   A N1    1 
ATOM   3752  C  C2    . G   A 1  175  ? 138.445 195.320 77.781  1.00 288.04 ?  175  G   A C2    1 
ATOM   3753  N  N2    . G   A 1  175  ? 138.509 196.616 78.122  1.00 288.04 ?  175  G   A N2    1 
ATOM   3754  N  N3    . G   A 1  175  ? 138.684 194.955 76.532  1.00 288.04 ?  175  G   A N3    1 
ATOM   3755  C  C4    . G   A 1  175  ? 138.576 193.618 76.362  1.00 288.04 ?  175  G   A C4    1 
ATOM   3756  P  P     . G   A 1  176  ? 143.936 192.900 73.565  1.00 260.40 ?  176  G   A P     1 
ATOM   3757  O  OP1   . G   A 1  176  ? 145.076 193.098 72.634  1.00 260.40 ?  176  G   A OP1   1 
ATOM   3758  O  OP2   . G   A 1  176  ? 143.797 191.613 74.292  1.00 260.40 ?  176  G   A OP2   1 
ATOM   3759  O  "O5'" . G   A 1  176  ? 143.972 194.072 74.643  1.00 260.40 ?  176  G   A "O5'" 1 
ATOM   3760  C  "C5'" . G   A 1  176  ? 144.007 195.433 74.240  1.00 260.40 ?  176  G   A "C5'" 1 
ATOM   3761  C  "C4'" . G   A 1  176  ? 143.683 196.358 75.387  1.00 260.40 ?  176  G   A "C4'" 1 
ATOM   3762  O  "O4'" . G   A 1  176  ? 142.351 196.071 75.888  1.00 260.40 ?  176  G   A "O4'" 1 
ATOM   3763  C  "C3'" . G   A 1  176  ? 144.573 196.234 76.613  1.00 260.40 ?  176  G   A "C3'" 1 
ATOM   3764  O  "O3'" . G   A 1  176  ? 145.800 196.931 76.476  1.00 260.40 ?  176  G   A "O3'" 1 
ATOM   3765  C  "C2'" . G   A 1  176  ? 143.683 196.773 77.725  1.00 260.40 ?  176  G   A "C2'" 1 
ATOM   3766  O  "O2'" . G   A 1  176  ? 143.658 198.192 77.705  1.00 260.40 ?  176  G   A "O2'" 1 
ATOM   3767  C  "C1'" . G   A 1  176  ? 142.311 196.259 77.287  1.00 260.40 ?  176  G   A "C1'" 1 
ATOM   3768  N  N9    . G   A 1  176  ? 141.973 194.972 77.923  1.00 260.40 ?  176  G   A N9    1 
ATOM   3769  C  C8    . G   A 1  176  ? 142.039 193.724 77.352  1.00 260.40 ?  176  G   A C8    1 
ATOM   3770  N  N7    . G   A 1  176  ? 141.675 192.768 78.162  1.00 260.40 ?  176  G   A N7    1 
ATOM   3771  C  C5    . G   A 1  176  ? 141.348 193.423 79.341  1.00 260.40 ?  176  G   A C5    1 
ATOM   3772  C  C6    . G   A 1  176  ? 140.885 192.909 80.581  1.00 260.40 ?  176  G   A C6    1 
ATOM   3773  O  O6    . G   A 1  176  ? 140.665 191.732 80.894  1.00 260.40 ?  176  G   A O6    1 
ATOM   3774  N  N1    . G   A 1  176  ? 140.677 193.923 81.510  1.00 260.40 ?  176  G   A N1    1 
ATOM   3775  C  C2    . G   A 1  176  ? 140.886 195.261 81.279  1.00 260.40 ?  176  G   A C2    1 
ATOM   3776  N  N2    . G   A 1  176  ? 140.627 196.085 82.304  1.00 260.40 ?  176  G   A N2    1 
ATOM   3777  N  N3    . G   A 1  176  ? 141.317 195.753 80.128  1.00 260.40 ?  176  G   A N3    1 
ATOM   3778  C  C4    . G   A 1  176  ? 141.526 194.784 79.211  1.00 260.40 ?  176  G   A C4    1 
ATOM   3779  P  P     . G   A 1  177  ? 147.195 196.157 76.666  1.00 235.10 ?  177  G   A P     1 
ATOM   3780  O  OP1   . G   A 1  177  ? 148.212 196.828 75.816  1.00 235.10 ?  177  G   A OP1   1 
ATOM   3781  O  OP2   . G   A 1  177  ? 146.942 194.703 76.498  1.00 235.10 ?  177  G   A OP2   1 
ATOM   3782  O  "O5'" . G   A 1  177  ? 147.576 196.417 78.190  1.00 235.10 ?  177  G   A "O5'" 1 
ATOM   3783  C  "C5'" . G   A 1  177  ? 147.725 197.739 78.688  1.00 235.10 ?  177  G   A "C5'" 1 
ATOM   3784  C  "C4'" . G   A 1  177  ? 147.273 197.842 80.122  1.00 235.10 ?  177  G   A "C4'" 1 
ATOM   3785  O  "O4'" . G   A 1  177  ? 145.896 197.394 80.232  1.00 235.10 ?  177  G   A "O4'" 1 
ATOM   3786  C  "C3'" . G   A 1  177  ? 148.024 196.976 81.122  1.00 235.10 ?  177  G   A "C3'" 1 
ATOM   3787  O  "O3'" . G   A 1  177  ? 149.251 197.550 81.539  1.00 235.10 ?  177  G   A "O3'" 1 
ATOM   3788  C  "C2'" . G   A 1  177  ? 147.011 196.815 82.247  1.00 235.10 ?  177  G   A "C2'" 1 
ATOM   3789  O  "O2'" . G   A 1  177  ? 146.970 197.980 83.057  1.00 235.10 ?  177  G   A "O2'" 1 
ATOM   3790  C  "C1'" . G   A 1  177  ? 145.703 196.727 81.462  1.00 235.10 ?  177  G   A "C1'" 1 
ATOM   3791  N  N9    . G   A 1  177  ? 145.320 195.330 81.182  1.00 235.10 ?  177  G   A N9    1 
ATOM   3792  C  C8    . G   A 1  177  ? 145.490 194.644 80.003  1.00 235.10 ?  177  G   A C8    1 
ATOM   3793  N  N7    . G   A 1  177  ? 145.052 193.416 80.056  1.00 235.10 ?  177  G   A N7    1 
ATOM   3794  C  C5    . G   A 1  177  ? 144.563 193.281 81.348  1.00 235.10 ?  177  G   A C5    1 
ATOM   3795  C  C6    . G   A 1  177  ? 143.962 192.168 81.992  1.00 235.10 ?  177  G   A C6    1 
ATOM   3796  O  O6    . G   A 1  177  ? 143.734 191.042 81.533  1.00 235.10 ?  177  G   A O6    1 
ATOM   3797  N  N1    . G   A 1  177  ? 143.614 192.464 83.306  1.00 235.10 ?  177  G   A N1    1 
ATOM   3798  C  C2    . G   A 1  177  ? 143.816 193.674 83.923  1.00 235.10 ?  177  G   A C2    1 
ATOM   3799  N  N2    . G   A 1  177  ? 143.410 193.763 85.198  1.00 235.10 ?  177  G   A N2    1 
ATOM   3800  N  N3    . G   A 1  177  ? 144.375 194.719 83.334  1.00 235.10 ?  177  G   A N3    1 
ATOM   3801  C  C4    . G   A 1  177  ? 144.722 194.454 82.056  1.00 235.10 ?  177  G   A C4    1 
ATOM   3802  P  P     . C   A 1  178  ? 150.496 196.608 81.920  1.00 211.21 ?  178  C   A P     1 
ATOM   3803  O  OP1   . C   A 1  178  ? 151.721 197.447 81.932  1.00 211.21 ?  178  C   A OP1   1 
ATOM   3804  O  OP2   . C   A 1  178  ? 150.442 195.401 81.056  1.00 211.21 ?  178  C   A OP2   1 
ATOM   3805  O  "O5'" . C   A 1  178  ? 150.195 196.155 83.417  1.00 211.21 ?  178  C   A "O5'" 1 
ATOM   3806  C  "C5'" . C   A 1  178  ? 150.073 197.113 84.458  1.00 211.21 ?  178  C   A "C5'" 1 
ATOM   3807  C  "C4'" . C   A 1  178  ? 149.411 196.523 85.678  1.00 211.21 ?  178  C   A "C4'" 1 
ATOM   3808  O  "O4'" . C   A 1  178  ? 148.098 196.015 85.324  1.00 211.21 ?  178  C   A "O4'" 1 
ATOM   3809  C  "C3'" . C   A 1  178  ? 150.111 195.327 86.304  1.00 211.21 ?  178  C   A "C3'" 1 
ATOM   3810  O  "O3'" . C   A 1  178  ? 151.196 195.693 87.139  1.00 211.21 ?  178  C   A "O3'" 1 
ATOM   3811  C  "C2'" . C   A 1  178  ? 148.979 194.624 87.042  1.00 211.21 ?  178  C   A "C2'" 1 
ATOM   3812  O  "O2'" . C   A 1  178  ? 148.713 195.265 88.281  1.00 211.21 ?  178  C   A "O2'" 1 
ATOM   3813  C  "C1'" . C   A 1  178  ? 147.794 194.877 86.104  1.00 211.21 ?  178  C   A "C1'" 1 
ATOM   3814  N  N1    . C   A 1  178  ? 147.516 193.727 85.205  1.00 211.21 ?  178  C   A N1    1 
ATOM   3815  C  C2    . C   A 1  178  ? 146.730 192.670 85.683  1.00 211.21 ?  178  C   A C2    1 
ATOM   3816  O  O2    . C   A 1  178  ? 146.288 192.712 86.842  1.00 211.21 ?  178  C   A O2    1 
ATOM   3817  N  N3    . C   A 1  178  ? 146.466 191.619 84.873  1.00 211.21 ?  178  C   A N3    1 
ATOM   3818  C  C4    . C   A 1  178  ? 146.946 191.590 83.629  1.00 211.21 ?  178  C   A C4    1 
ATOM   3819  N  N4    . C   A 1  178  ? 146.659 190.531 82.869  1.00 211.21 ?  178  C   A N4    1 
ATOM   3820  C  C5    . C   A 1  178  ? 147.745 192.647 83.110  1.00 211.21 ?  178  C   A C5    1 
ATOM   3821  C  C6    . C   A 1  178  ? 147.996 193.682 83.921  1.00 211.21 ?  178  C   A C6    1 
ATOM   3822  P  P     . A   A 1  179  ? 152.507 194.766 87.212  1.00 189.70 ?  179  A   A P     1 
ATOM   3823  O  OP1   . A   A 1  179  ? 153.567 195.522 87.926  1.00 189.70 ?  179  A   A OP1   1 
ATOM   3824  O  OP2   . A   A 1  179  ? 152.773 194.237 85.849  1.00 189.70 ?  179  A   A OP2   1 
ATOM   3825  O  "O5'" . A   A 1  179  ? 152.064 193.546 88.135  1.00 189.70 ?  179  A   A "O5'" 1 
ATOM   3826  C  "C5'" . A   A 1  179  ? 151.691 193.756 89.489  1.00 189.70 ?  179  A   A "C5'" 1 
ATOM   3827  C  "C4'" . A   A 1  179  ? 151.081 192.517 90.095  1.00 189.70 ?  179  A   A "C4'" 1 
ATOM   3828  O  "O4'" . A   A 1  179  ? 149.833 192.200 89.426  1.00 189.70 ?  179  A   A "O4'" 1 
ATOM   3829  C  "C3'" . A   A 1  179  ? 151.898 191.242 89.970  1.00 189.70 ?  179  A   A "C3'" 1 
ATOM   3830  O  "O3'" . A   A 1  179  ? 152.934 191.149 90.932  1.00 189.70 ?  179  A   A "O3'" 1 
ATOM   3831  C  "C2'" . A   A 1  179  ? 150.838 190.157 90.104  1.00 189.70 ?  179  A   A "C2'" 1 
ATOM   3832  O  "O2'" . A   A 1  179  ? 150.476 189.975 91.464  1.00 189.70 ?  179  A   A "O2'" 1 
ATOM   3833  C  "C1'" . A   A 1  179  ? 149.659 190.799 89.372  1.00 189.70 ?  179  A   A "C1'" 1 
ATOM   3834  N  N9    . A   A 1  179  ? 149.595 190.384 87.957  1.00 189.70 ?  179  A   A N9    1 
ATOM   3835  C  C8    . A   A 1  179  ? 149.860 191.147 86.846  1.00 189.70 ?  179  A   A C8    1 
ATOM   3836  N  N7    . A   A 1  179  ? 149.716 190.504 85.713  1.00 189.70 ?  179  A   A N7    1 
ATOM   3837  C  C5    . A   A 1  179  ? 149.329 189.230 86.104  1.00 189.70 ?  179  A   A C5    1 
ATOM   3838  C  C6    . A   A 1  179  ? 149.018 188.065 85.379  1.00 189.70 ?  179  A   A C6    1 
ATOM   3839  N  N6    . A   A 1  179  ? 149.050 187.995 84.046  1.00 189.70 ?  179  A   A N6    1 
ATOM   3840  N  N1    . A   A 1  179  ? 148.669 186.958 86.075  1.00 189.70 ?  179  A   A N1    1 
ATOM   3841  C  C2    . A   A 1  179  ? 148.635 187.017 87.413  1.00 189.70 ?  179  A   A C2    1 
ATOM   3842  N  N3    . A   A 1  179  ? 148.905 188.054 88.204  1.00 189.70 ?  179  A   A N3    1 
ATOM   3843  C  C4    . A   A 1  179  ? 149.250 189.140 87.483  1.00 189.70 ?  179  A   A C4    1 
ATOM   3844  P  P     . G   A 1  180  ? 154.390 190.625 90.499  1.00 172.74 ?  180  G   A P     1 
ATOM   3845  O  OP1   . G   A 1  180  ? 155.296 190.763 91.668  1.00 172.74 ?  180  G   A OP1   1 
ATOM   3846  O  OP2   . G   A 1  180  ? 154.749 191.271 89.211  1.00 172.74 ?  180  G   A OP2   1 
ATOM   3847  O  "O5'" . G   A 1  180  ? 154.173 189.070 90.226  1.00 172.74 ?  180  G   A "O5'" 1 
ATOM   3848  C  "C5'" . G   A 1  180  ? 153.791 188.194 91.276  1.00 172.74 ?  180  G   A "C5'" 1 
ATOM   3849  C  "C4'" . G   A 1  180  ? 153.559 186.793 90.771  1.00 172.74 ?  180  G   A "C4'" 1 
ATOM   3850  O  "O4'" . G   A 1  180  ? 152.363 186.747 89.951  1.00 172.74 ?  180  G   A "O4'" 1 
ATOM   3851  C  "C3'" . G   A 1  180  ? 154.639 186.224 89.868  1.00 172.74 ?  180  G   A "C3'" 1 
ATOM   3852  O  "O3'" . G   A 1  180  ? 155.768 185.753 90.580  1.00 172.74 ?  180  G   A "O3'" 1 
ATOM   3853  C  "C2'" . G   A 1  180  ? 153.892 185.135 89.110  1.00 172.74 ?  180  G   A "C2'" 1 
ATOM   3854  O  "O2'" . G   A 1  180  ? 153.724 183.982 89.922  1.00 172.74 ?  180  G   A "O2'" 1 
ATOM   3855  C  "C1'" . G   A 1  180  ? 152.525 185.794 88.920  1.00 172.74 ?  180  G   A "C1'" 1 
ATOM   3856  N  N9    . G   A 1  180  ? 152.427 186.481 87.618  1.00 172.74 ?  180  G   A N9    1 
ATOM   3857  C  C8    . G   A 1  180  ? 152.523 187.830 87.378  1.00 172.74 ?  180  G   A C8    1 
ATOM   3858  N  N7    . G   A 1  180  ? 152.400 188.134 86.114  1.00 172.74 ?  180  G   A N7    1 
ATOM   3859  C  C5    . G   A 1  180  ? 152.213 186.913 85.482  1.00 172.74 ?  180  G   A C5    1 
ATOM   3860  C  C6    . G   A 1  180  ? 152.020 186.606 84.109  1.00 172.74 ?  180  G   A C6    1 
ATOM   3861  O  O6    . G   A 1  180  ? 151.975 187.379 83.145  1.00 172.74 ?  180  G   A O6    1 
ATOM   3862  N  N1    . G   A 1  180  ? 151.871 185.237 83.906  1.00 172.74 ?  180  G   A N1    1 
ATOM   3863  C  C2    . G   A 1  180  ? 151.903 184.284 84.894  1.00 172.74 ?  180  G   A C2    1 
ATOM   3864  N  N2    . G   A 1  180  ? 151.740 183.014 84.498  1.00 172.74 ?  180  G   A N2    1 
ATOM   3865  N  N3    . G   A 1  180  ? 152.082 184.557 86.177  1.00 172.74 ?  180  G   A N3    1 
ATOM   3866  C  C4    . G   A 1  180  ? 152.229 185.881 86.397  1.00 172.74 ?  180  G   A C4    1 
ATOM   3867  P  P     . G   A 1  181  ? 157.243 185.979 89.987  1.00 151.44 ?  181  G   A P     1 
ATOM   3868  O  OP1   . G   A 1  181  ? 157.824 187.181 90.636  1.00 151.44 ?  181  G   A OP1   1 
ATOM   3869  O  OP2   . G   A 1  181  ? 157.161 185.912 88.505  1.00 151.44 ?  181  G   A OP2   1 
ATOM   3870  O  "O5'" . G   A 1  181  ? 158.048 184.703 90.492  1.00 151.44 ?  181  G   A "O5'" 1 
ATOM   3871  C  "C5'" . G   A 1  181  ? 157.460 183.409 90.437  1.00 151.44 ?  181  G   A "C5'" 1 
ATOM   3872  C  "C4'" . G   A 1  181  ? 158.392 182.347 90.963  1.00 151.44 ?  181  G   A "C4'" 1 
ATOM   3873  O  "O4'" . G   A 1  181  ? 157.731 181.058 90.867  1.00 151.44 ?  181  G   A "O4'" 1 
ATOM   3874  C  "C3'" . G   A 1  181  ? 159.707 182.209 90.201  1.00 151.44 ?  181  G   A "C3'" 1 
ATOM   3875  O  "O3'" . G   A 1  181  ? 160.742 181.809 91.098  1.00 151.44 ?  181  G   A "O3'" 1 
ATOM   3876  C  "C2'" . G   A 1  181  ? 159.414 181.077 89.225  1.00 151.44 ?  181  G   A "C2'" 1 
ATOM   3877  O  "O2'" . G   A 1  181  ? 160.561 180.382 88.788  1.00 151.44 ?  181  G   A "O2'" 1 
ATOM   3878  C  "C1'" . G   A 1  181  ? 158.493 180.185 90.055  1.00 151.44 ?  181  G   A "C1'" 1 
ATOM   3879  N  N9    . G   A 1  181  ? 157.561 179.373 89.265  1.00 151.44 ?  181  G   A N9    1 
ATOM   3880  C  C8    . G   A 1  181  ? 157.541 178.001 89.191  1.00 151.44 ?  181  G   A C8    1 
ATOM   3881  N  N7    . G   A 1  181  ? 156.603 177.538 88.412  1.00 151.44 ?  181  G   A N7    1 
ATOM   3882  C  C5    . G   A 1  181  ? 155.957 178.672 87.942  1.00 151.44 ?  181  G   A C5    1 
ATOM   3883  C  C6    . G   A 1  181  ? 154.855 178.794 87.057  1.00 151.44 ?  181  G   A C6    1 
ATOM   3884  O  O6    . G   A 1  181  ? 154.212 177.896 86.501  1.00 151.44 ?  181  G   A O6    1 
ATOM   3885  N  N1    . G   A 1  181  ? 154.511 180.125 86.845  1.00 151.44 ?  181  G   A N1    1 
ATOM   3886  C  C2    . G   A 1  181  ? 155.151 181.202 87.404  1.00 151.44 ?  181  G   A C2    1 
ATOM   3887  N  N2    . G   A 1  181  ? 154.673 182.411 87.075  1.00 151.44 ?  181  G   A N2    1 
ATOM   3888  N  N3    . G   A 1  181  ? 156.179 181.101 88.232  1.00 151.44 ?  181  G   A N3    1 
ATOM   3889  C  C4    . G   A 1  181  ? 156.534 179.816 88.457  1.00 151.44 ?  181  G   A C4    1 
ATOM   3890  P  P     . A   A 1  182  ? 162.215 182.434 90.952  1.00 145.04 ?  182  A   A P     1 
ATOM   3891  O  OP1   . A   A 1  182  ? 162.184 183.372 89.805  1.00 145.04 ?  182  A   A OP1   1 
ATOM   3892  O  OP2   . A   A 1  182  ? 163.217 181.340 90.971  1.00 145.04 ?  182  A   A OP2   1 
ATOM   3893  O  "O5'" . A   A 1  182  ? 162.401 183.295 92.278  1.00 145.04 ?  182  A   A "O5'" 1 
ATOM   3894  C  "C5'" . A   A 1  182  ? 161.620 183.036 93.441  1.00 145.04 ?  182  A   A "C5'" 1 
ATOM   3895  C  "C4'" . A   A 1  182  ? 161.223 184.318 94.130  1.00 145.04 ?  182  A   A "C4'" 1 
ATOM   3896  O  "O4'" . A   A 1  182  ? 162.229 185.326 93.845  1.00 145.04 ?  182  A   A "O4'" 1 
ATOM   3897  C  "C3'" . A   A 1  182  ? 159.889 184.909 93.681  1.00 145.04 ?  182  A   A "C3'" 1 
ATOM   3898  O  "O3'" . A   A 1  182  ? 159.273 185.588 94.775  1.00 145.04 ?  182  A   A "O3'" 1 
ATOM   3899  C  "C2'" . A   A 1  182  ? 160.310 185.920 92.619  1.00 145.04 ?  182  A   A "C2'" 1 
ATOM   3900  O  "O2'" . A   A 1  182  ? 159.392 186.973 92.417  1.00 145.04 ?  182  A   A "O2'" 1 
ATOM   3901  C  "C1'" . A   A 1  182  ? 161.639 186.425 93.175  1.00 145.04 ?  182  A   A "C1'" 1 
ATOM   3902  N  N9    . A   A 1  182  ? 162.575 186.870 92.140  1.00 145.04 ?  182  A   A N9    1 
ATOM   3903  C  C8    . A   A 1  182  ? 162.769 186.322 90.896  1.00 145.04 ?  182  A   A C8    1 
ATOM   3904  N  N7    . A   A 1  182  ? 163.681 186.934 90.181  1.00 145.04 ?  182  A   A N7    1 
ATOM   3905  C  C5    . A   A 1  182  ? 164.119 187.956 91.011  1.00 145.04 ?  182  A   A C5    1 
ATOM   3906  C  C6    . A   A 1  182  ? 165.081 188.970 90.850  1.00 145.04 ?  182  A   A C6    1 
ATOM   3907  N  N6    . A   A 1  182  ? 165.813 189.132 89.745  1.00 145.04 ?  182  A   A N6    1 
ATOM   3908  N  N1    . A   A 1  182  ? 165.271 189.828 91.879  1.00 145.04 ?  182  A   A N1    1 
ATOM   3909  C  C2    . A   A 1  182  ? 164.543 189.676 92.992  1.00 145.04 ?  182  A   A C2    1 
ATOM   3910  N  N3    . A   A 1  182  ? 163.611 188.764 93.262  1.00 145.04 ?  182  A   A N3    1 
ATOM   3911  C  C4    . A   A 1  182  ? 163.445 187.928 92.221  1.00 145.04 ?  182  A   A C4    1 
ATOM   3912  P  P     . G   A 1  183  ? 158.146 184.853 95.657  1.00 146.56 ?  183  G   A P     1 
ATOM   3913  O  OP1   . G   A 1  183  ? 157.485 185.880 96.499  1.00 146.56 ?  183  G   A OP1   1 
ATOM   3914  O  OP2   . G   A 1  183  ? 158.751 183.658 96.299  1.00 146.56 ?  183  G   A OP2   1 
ATOM   3915  O  "O5'" . G   A 1  183  ? 157.080 184.348 94.586  1.00 146.56 ?  183  G   A "O5'" 1 
ATOM   3916  C  "C5'" . G   A 1  183  ? 155.967 185.158 94.219  1.00 146.56 ?  183  G   A "C5'" 1 
ATOM   3917  C  "C4'" . G   A 1  183  ? 154.738 184.329 93.929  1.00 146.56 ?  183  G   A "C4'" 1 
ATOM   3918  O  "O4'" . G   A 1  183  ? 155.130 183.137 93.194  1.00 146.56 ?  183  G   A "O4'" 1 
ATOM   3919  C  "C3'" . G   A 1  183  ? 153.968 183.838 95.154  1.00 146.56 ?  183  G   A "C3'" 1 
ATOM   3920  O  "O3'" . G   A 1  183  ? 152.576 183.779 94.843  1.00 146.56 ?  183  G   A "O3'" 1 
ATOM   3921  C  "C2'" . G   A 1  183  ? 154.503 182.422 95.341  1.00 146.56 ?  183  G   A "C2'" 1 
ATOM   3922  O  "O2'" . G   A 1  183  ? 153.633 181.553 96.035  1.00 146.56 ?  183  G   A "O2'" 1 
ATOM   3923  C  "C1'" . G   A 1  183  ? 154.710 181.982 93.895  1.00 146.56 ?  183  G   A "C1'" 1 
ATOM   3924  N  N9    . G   A 1  183  ? 155.735 180.949 93.723  1.00 146.56 ?  183  G   A N9    1 
ATOM   3925  C  C8    . G   A 1  183  ? 157.033 180.983 94.173  1.00 146.56 ?  183  G   A C8    1 
ATOM   3926  N  N7    . G   A 1  183  ? 157.712 179.913 93.858  1.00 146.56 ?  183  G   A N7    1 
ATOM   3927  C  C5    . G   A 1  183  ? 156.809 179.126 93.157  1.00 146.56 ?  183  G   A C5    1 
ATOM   3928  C  C6    . G   A 1  183  ? 156.968 177.848 92.560  1.00 146.56 ?  183  G   A C6    1 
ATOM   3929  O  O6    . G   A 1  183  ? 157.969 177.126 92.528  1.00 146.56 ?  183  G   A O6    1 
ATOM   3930  N  N1    . G   A 1  183  ? 155.798 177.417 91.948  1.00 146.56 ?  183  G   A N1    1 
ATOM   3931  C  C2    . G   A 1  183  ? 154.624 178.124 91.910  1.00 146.56 ?  183  G   A C2    1 
ATOM   3932  N  N2    . G   A 1  183  ? 153.606 177.532 91.272  1.00 146.56 ?  183  G   A N2    1 
ATOM   3933  N  N3    . G   A 1  183  ? 154.458 179.316 92.461  1.00 146.56 ?  183  G   A N3    1 
ATOM   3934  C  C4    . G   A 1  183  ? 155.585 179.754 93.061  1.00 146.56 ?  183  G   A C4    1 
ATOM   3935  P  P     . A   A 1  184  ? 151.497 184.478 95.806  1.00 153.02 ?  184  A   A P     1 
ATOM   3936  O  OP1   . A   A 1  184  ? 151.932 185.877 96.049  1.00 153.02 ?  184  A   A OP1   1 
ATOM   3937  O  OP2   . A   A 1  184  ? 151.253 183.574 96.958  1.00 153.02 ?  184  A   A OP2   1 
ATOM   3938  O  "O5'" . A   A 1  184  ? 150.169 184.520 94.927  1.00 153.02 ?  184  A   A "O5'" 1 
ATOM   3939  C  "C5'" . A   A 1  184  ? 149.925 185.585 94.020  1.00 153.02 ?  184  A   A "C5'" 1 
ATOM   3940  C  "C4'" . A   A 1  184  ? 149.107 185.129 92.838  1.00 153.02 ?  184  A   A "C4'" 1 
ATOM   3941  O  "O4'" . A   A 1  184  ? 149.922 184.309 91.960  1.00 153.02 ?  184  A   A "O4'" 1 
ATOM   3942  C  "C3'" . A   A 1  184  ? 147.907 184.250 93.154  1.00 153.02 ?  184  A   A "C3'" 1 
ATOM   3943  O  "O3'" . A   A 1  184  ? 146.774 184.989 93.578  1.00 153.02 ?  184  A   A "O3'" 1 
ATOM   3944  C  "C2'" . A   A 1  184  ? 147.690 183.502 91.847  1.00 153.02 ?  184  A   A "C2'" 1 
ATOM   3945  O  "O2'" . A   A 1  184  ? 147.016 184.323 90.904  1.00 153.02 ?  184  A   A "O2'" 1 
ATOM   3946  C  "C1'" . A   A 1  184  ? 149.129 183.300 91.369  1.00 153.02 ?  184  A   A "C1'" 1 
ATOM   3947  N  N9    . A   A 1  184  ? 149.672 181.984 91.760  1.00 153.02 ?  184  A   A N9    1 
ATOM   3948  C  C8    . A   A 1  184  ? 150.698 181.735 92.638  1.00 153.02 ?  184  A   A C8    1 
ATOM   3949  N  N7    . A   A 1  184  ? 150.973 180.462 92.789  1.00 153.02 ?  184  A   A N7    1 
ATOM   3950  C  C5    . A   A 1  184  ? 150.068 179.827 91.950  1.00 153.02 ?  184  A   A C5    1 
ATOM   3951  C  C6    . A   A 1  184  ? 149.838 178.471 91.650  1.00 153.02 ?  184  A   A C6    1 
ATOM   3952  N  N6    . A   A 1  184  ? 150.533 177.467 92.190  1.00 153.02 ?  184  A   A N6    1 
ATOM   3953  N  N1    . A   A 1  184  ? 148.856 178.172 90.769  1.00 153.02 ?  184  A   A N1    1 
ATOM   3954  C  C2    . A   A 1  184  ? 148.150 179.171 90.223  1.00 153.02 ?  184  A   A C2    1 
ATOM   3955  N  N3    . A   A 1  184  ? 148.277 180.481 90.424  1.00 153.02 ?  184  A   A N3    1 
ATOM   3956  C  C4    . A   A 1  184  ? 149.260 180.750 91.307  1.00 153.02 ?  184  A   A C4    1 
ATOM   3957  P  P     . U   A 1  185  ? 145.934 184.516 94.864  1.00 152.63 ?  185  U   A P     1 
ATOM   3958  O  OP1   . U   A 1  185  ? 144.846 185.501 95.089  1.00 152.63 ?  185  U   A OP1   1 
ATOM   3959  O  OP2   . U   A 1  185  ? 146.895 184.221 95.957  1.00 152.63 ?  185  U   A OP2   1 
ATOM   3960  O  "O5'" . U   A 1  185  ? 145.267 183.141 94.411  1.00 152.63 ?  185  U   A "O5'" 1 
ATOM   3961  C  "C5'" . U   A 1  185  ? 144.285 183.106 93.385  1.00 152.63 ?  185  U   A "C5'" 1 
ATOM   3962  C  "C4'" . U   A 1  185  ? 144.074 181.704 92.871  1.00 152.63 ?  185  U   A "C4'" 1 
ATOM   3963  O  "O4'" . U   A 1  185  ? 145.338 181.159 92.408  1.00 152.63 ?  185  U   A "O4'" 1 
ATOM   3964  C  "C3'" . U   A 1  185  ? 143.588 180.686 93.892  1.00 152.63 ?  185  U   A "C3'" 1 
ATOM   3965  O  "O3'" . U   A 1  185  ? 142.190 180.748 94.116  1.00 152.63 ?  185  U   A "O3'" 1 
ATOM   3966  C  "C2'" . U   A 1  185  ? 144.053 179.364 93.294  1.00 152.63 ?  185  U   A "C2'" 1 
ATOM   3967  O  "O2'" . U   A 1  185  ? 143.172 178.940 92.265  1.00 152.63 ?  185  U   A "O2'" 1 
ATOM   3968  C  "C1'" . U   A 1  185  ? 145.385 179.768 92.654  1.00 152.63 ?  185  U   A "C1'" 1 
ATOM   3969  N  N1    . U   A 1  185  ? 146.552 179.467 93.521  1.00 152.63 ?  185  U   A N1    1 
ATOM   3970  C  C2    . U   A 1  185  ? 147.035 178.168 93.533  1.00 152.63 ?  185  U   A C2    1 
ATOM   3971  O  O2    . U   A 1  185  ? 146.554 177.261 92.873  1.00 152.63 ?  185  U   A O2    1 
ATOM   3972  N  N3    . U   A 1  185  ? 148.116 177.957 94.352  1.00 152.63 ?  185  U   A N3    1 
ATOM   3973  C  C4    . U   A 1  185  ? 148.758 178.885 95.145  1.00 152.63 ?  185  U   A C4    1 
ATOM   3974  O  O4    . U   A 1  185  ? 149.722 178.536 95.829  1.00 152.63 ?  185  U   A O4    1 
ATOM   3975  C  C5    . U   A 1  185  ? 148.207 180.202 95.080  1.00 152.63 ?  185  U   A C5    1 
ATOM   3976  C  C6    . U   A 1  185  ? 147.156 180.439 94.289  1.00 152.63 ?  185  U   A C6    1 
ATOM   3977  P  P     . G   A 1  186  ? 141.603 180.576 95.603  1.00 149.44 ?  186  G   A P     1 
ATOM   3978  O  OP1   . G   A 1  186  ? 140.142 180.837 95.553  1.00 149.44 ?  186  G   A OP1   1 
ATOM   3979  O  OP2   . G   A 1  186  ? 142.459 181.362 96.528  1.00 149.44 ?  186  G   A OP2   1 
ATOM   3980  O  "O5'" . G   A 1  186  ? 141.816 179.031 95.928  1.00 149.44 ?  186  G   A "O5'" 1 
ATOM   3981  C  "C5'" . G   A 1  186  ? 141.116 178.029 95.204  1.00 149.44 ?  186  G   A "C5'" 1 
ATOM   3982  C  "C4'" . G   A 1  186  ? 141.697 176.659 95.449  1.00 149.44 ?  186  G   A "C4'" 1 
ATOM   3983  O  "O4'" . G   A 1  186  ? 143.089 176.633 95.038  1.00 149.44 ?  186  G   A "O4'" 1 
ATOM   3984  C  "C3'" . G   A 1  186  ? 141.732 176.197 96.897  1.00 149.44 ?  186  G   A "C3'" 1 
ATOM   3985  O  "O3'" . G   A 1  186  ? 140.488 175.689 97.345  1.00 149.44 ?  186  G   A "O3'" 1 
ATOM   3986  C  "C2'" . G   A 1  186  ? 142.848 175.161 96.887  1.00 149.44 ?  186  G   A "C2'" 1 
ATOM   3987  O  "O2'" . G   A 1  186  ? 142.385 173.930 96.350  1.00 149.44 ?  186  G   A "O2'" 1 
ATOM   3988  C  "C1'" . G   A 1  186  ? 143.828 175.783 95.891  1.00 149.44 ?  186  G   A "C1'" 1 
ATOM   3989  N  N9    . G   A 1  186  ? 144.870 176.581 96.566  1.00 149.44 ?  186  G   A N9    1 
ATOM   3990  C  C8    . G   A 1  186  ? 144.969 177.951 96.603  1.00 149.44 ?  186  G   A C8    1 
ATOM   3991  N  N7    . G   A 1  186  ? 146.002 178.372 97.279  1.00 149.44 ?  186  G   A N7    1 
ATOM   3992  C  C5    . G   A 1  186  ? 146.625 177.211 97.716  1.00 149.44 ?  186  G   A C5    1 
ATOM   3993  C  C6    . G   A 1  186  ? 147.797 177.034 98.496  1.00 149.44 ?  186  G   A C6    1 
ATOM   3994  O  O6    . G   A 1  186  ? 148.544 177.897 98.973  1.00 149.44 ?  186  G   A O6    1 
ATOM   3995  N  N1    . G   A 1  186  ? 148.073 175.687 98.707  1.00 149.44 ?  186  G   A N1    1 
ATOM   3996  C  C2    . G   A 1  186  ? 147.321 174.643 98.230  1.00 149.44 ?  186  G   A C2    1 
ATOM   3997  N  N2    . G   A 1  186  ? 147.752 173.411 98.541  1.00 149.44 ?  186  G   A N2    1 
ATOM   3998  N  N3    . G   A 1  186  ? 146.227 174.794 97.501  1.00 149.44 ?  186  G   A N3    1 
ATOM   3999  C  C4    . G   A 1  186  ? 145.938 176.096 97.283  1.00 149.44 ?  186  G   A C4    1 
ATOM   4000  P  P     . C   A 1  187  ? 140.013 175.933 98.861  1.00 146.12 ?  187  C   A P     1 
ATOM   4001  O  OP1   . C   A 1  187  ? 138.559 175.642 98.941  1.00 146.12 ?  187  C   A OP1   1 
ATOM   4002  O  OP2   . C   A 1  187  ? 140.521 177.260 99.293  1.00 146.12 ?  187  C   A OP2   1 
ATOM   4003  O  "O5'" . C   A 1  187  ? 140.787 174.816 99.693  1.00 146.12 ?  187  C   A "O5'" 1 
ATOM   4004  C  "C5'" . C   A 1  187  ? 140.614 173.437 99.397  1.00 146.12 ?  187  C   A "C5'" 1 
ATOM   4005  C  "C4'" . C   A 1  187  ? 141.713 172.601 100.002 1.00 146.12 ?  187  C   A "C4'" 1 
ATOM   4006  O  "O4'" . C   A 1  187  ? 143.001 173.058 99.513  1.00 146.12 ?  187  C   A "O4'" 1 
ATOM   4007  C  "C3'" . C   A 1  187  ? 141.848 172.670 101.515 1.00 146.12 ?  187  C   A "C3'" 1 
ATOM   4008  O  "O3'" . C   A 1  187  ? 140.922 171.836 102.189 1.00 146.12 ?  187  C   A "O3'" 1 
ATOM   4009  C  "C2'" . C   A 1  187  ? 143.303 172.277 101.741 1.00 146.12 ?  187  C   A "C2'" 1 
ATOM   4010  O  "O2'" . C   A 1  187  ? 143.457 170.867 101.684 1.00 146.12 ?  187  C   A "O2'" 1 
ATOM   4011  C  "C1'" . C   A 1  187  ? 143.985 172.888 100.512 1.00 146.12 ?  187  C   A "C1'" 1 
ATOM   4012  N  N1    . C   A 1  187  ? 144.625 174.197 100.797 1.00 146.12 ?  187  C   A N1    1 
ATOM   4013  C  C2    . C   A 1  187  ? 145.914 174.215 101.347 1.00 146.12 ?  187  C   A C2    1 
ATOM   4014  O  O2    . C   A 1  187  ? 146.491 173.143 101.589 1.00 146.12 ?  187  C   A O2    1 
ATOM   4015  N  N3    . C   A 1  187  ? 146.509 175.402 101.606 1.00 146.12 ?  187  C   A N3    1 
ATOM   4016  C  C4    . C   A 1  187  ? 145.876 176.545 101.338 1.00 146.12 ?  187  C   A C4    1 
ATOM   4017  N  N4    . C   A 1  187  ? 146.505 177.690 101.613 1.00 146.12 ?  187  C   A N4    1 
ATOM   4018  C  C5    . C   A 1  187  ? 144.568 176.563 100.777 1.00 146.12 ?  187  C   A C5    1 
ATOM   4019  C  C6    . C   A 1  187  ? 143.991 175.382 100.522 1.00 146.12 ?  187  C   A C6    1 
ATOM   4020  P  P     . C   A 1  188  ? 140.387 172.235 103.651 1.00 146.72 ?  188  C   A P     1 
ATOM   4021  O  OP1   . C   A 1  188  ? 139.145 171.464 103.913 1.00 146.72 ?  188  C   A OP1   1 
ATOM   4022  O  OP2   . C   A 1  188  ? 140.365 173.717 103.743 1.00 146.72 ?  188  C   A OP2   1 
ATOM   4023  O  "O5'" . C   A 1  188  ? 141.518 171.698 104.635 1.00 146.72 ?  188  C   A "O5'" 1 
ATOM   4024  C  "C5'" . C   A 1  188  ? 141.888 170.327 104.641 1.00 146.72 ?  188  C   A "C5'" 1 
ATOM   4025  C  "C4'" . C   A 1  188  ? 143.208 170.114 105.339 1.00 146.72 ?  188  C   A "C4'" 1 
ATOM   4026  O  "O4'" . C   A 1  188  ? 144.241 170.893 104.681 1.00 146.72 ?  188  C   A "O4'" 1 
ATOM   4027  C  "C3'" . C   A 1  188  ? 143.273 170.567 106.789 1.00 146.72 ?  188  C   A "C3'" 1 
ATOM   4028  O  "O3'" . C   A 1  188  ? 142.709 169.628 107.688 1.00 146.72 ?  188  C   A "O3'" 1 
ATOM   4029  C  "C2'" . C   A 1  188  ? 144.764 170.800 107.001 1.00 146.72 ?  188  C   A "C2'" 1 
ATOM   4030  O  "O2'" . C   A 1  188  ? 145.435 169.571 107.236 1.00 146.72 ?  188  C   A "O2'" 1 
ATOM   4031  C  "C1'" . C   A 1  188  ? 145.192 171.331 105.629 1.00 146.72 ?  188  C   A "C1'" 1 
ATOM   4032  N  N1    . C   A 1  188  ? 145.279 172.813 105.585 1.00 146.72 ?  188  C   A N1    1 
ATOM   4033  C  C2    . C   A 1  188  ? 146.444 173.438 106.051 1.00 146.72 ?  188  C   A C2    1 
ATOM   4034  O  O2    . C   A 1  188  ? 147.377 172.748 106.492 1.00 146.72 ?  188  C   A O2    1 
ATOM   4035  N  N3    . C   A 1  188  ? 146.536 174.787 106.011 1.00 146.72 ?  188  C   A N3    1 
ATOM   4036  C  C4    . C   A 1  188  ? 145.528 175.516 105.532 1.00 146.72 ?  188  C   A C4    1 
ATOM   4037  N  N4    . C   A 1  188  ? 145.667 176.844 105.515 1.00 146.72 ?  188  C   A N4    1 
ATOM   4038  C  C5    . C   A 1  188  ? 144.331 174.915 105.049 1.00 146.72 ?  188  C   A C5    1 
ATOM   4039  C  C6    . C   A 1  188  ? 144.255 173.579 105.091 1.00 146.72 ?  188  C   A C6    1 
ATOM   4040  P  P     . G   A 1  189  ? 141.796 170.131 108.911 1.00 149.62 ?  189  G   A P     1 
ATOM   4041  O  OP1   . G   A 1  189  ? 141.170 168.939 109.538 1.00 149.62 ?  189  G   A OP1   1 
ATOM   4042  O  OP2   . G   A 1  189  ? 140.938 171.238 108.419 1.00 149.62 ?  189  G   A OP2   1 
ATOM   4043  O  "O5'" . G   A 1  189  ? 142.842 170.740 109.946 1.00 149.62 ?  189  G   A "O5'" 1 
ATOM   4044  C  "C5'" . G   A 1  189  ? 143.846 169.921 110.537 1.00 149.62 ?  189  G   A "C5'" 1 
ATOM   4045  C  "C4'" . G   A 1  189  ? 144.689 170.673 111.542 1.00 149.62 ?  189  G   A "C4'" 1 
ATOM   4046  O  "O4'" . G   A 1  189  ? 145.386 171.765 110.881 1.00 149.62 ?  189  G   A "O4'" 1 
ATOM   4047  C  "C3'" . G   A 1  189  ? 143.934 171.293 112.720 1.00 149.62 ?  189  G   A "C3'" 1 
ATOM   4048  O  "O3'" . G   A 1  189  ? 144.725 171.175 113.902 1.00 149.62 ?  189  G   A "O3'" 1 
ATOM   4049  C  "C2'" . G   A 1  189  ? 143.828 172.765 112.324 1.00 149.62 ?  189  G   A "C2'" 1 
ATOM   4050  O  "O2'" . G   A 1  189  ? 143.701 173.658 113.411 1.00 149.62 ?  189  G   A "O2'" 1 
ATOM   4051  C  "C1'" . G   A 1  189  ? 145.136 172.976 111.567 1.00 149.62 ?  189  G   A "C1'" 1 
ATOM   4052  N  N9    . G   A 1  189  ? 145.087 174.060 110.582 1.00 149.62 ?  189  G   A N9    1 
ATOM   4053  C  C8    . G   A 1  189  ? 144.176 174.214 109.565 1.00 149.62 ?  189  G   A C8    1 
ATOM   4054  N  N7    . G   A 1  189  ? 144.389 175.280 108.843 1.00 149.62 ?  189  G   A N7    1 
ATOM   4055  C  C5    . G   A 1  189  ? 145.510 175.865 109.415 1.00 149.62 ?  189  G   A C5    1 
ATOM   4056  C  C6    . G   A 1  189  ? 146.212 177.047 109.062 1.00 149.62 ?  189  G   A C6    1 
ATOM   4057  O  O6    . G   A 1  189  ? 145.974 177.840 108.143 1.00 149.62 ?  189  G   A O6    1 
ATOM   4058  N  N1    . G   A 1  189  ? 147.292 177.272 109.909 1.00 149.62 ?  189  G   A N1    1 
ATOM   4059  C  C2    . G   A 1  189  ? 147.654 176.466 110.959 1.00 149.62 ?  189  G   A C2    1 
ATOM   4060  N  N2    . G   A 1  189  ? 148.730 176.853 111.660 1.00 149.62 ?  189  G   A N2    1 
ATOM   4061  N  N3    . G   A 1  189  ? 147.009 175.361 111.298 1.00 149.62 ?  189  G   A N3    1 
ATOM   4062  C  C4    . G   A 1  189  ? 145.955 175.122 110.488 1.00 149.62 ?  189  G   A C4    1 
ATOM   4063  P  P     . U   A 1  190  ? 144.673 169.827 114.776 1.00 160.69 ?  190  U   A P     1 
ATOM   4064  O  OP1   . U   A 1  190  ? 146.055 169.296 114.881 1.00 160.69 ?  190  U   A OP1   1 
ATOM   4065  O  OP2   . U   A 1  190  ? 143.593 168.963 114.234 1.00 160.69 ?  190  U   A OP2   1 
ATOM   4066  O  "O5'" . U   A 1  190  ? 144.223 170.319 116.223 1.00 160.69 ?  190  U   A "O5'" 1 
ATOM   4067  C  "C5'" . U   A 1  190  ? 143.095 171.164 116.394 1.00 160.69 ?  190  U   A "C5'" 1 
ATOM   4068  C  "C4'" . U   A 1  190  ? 142.927 171.566 117.837 1.00 160.69 ?  190  U   A "C4'" 1 
ATOM   4069  O  "O4'" . U   A 1  190  ? 142.605 170.396 118.632 1.00 160.69 ?  190  U   A "O4'" 1 
ATOM   4070  C  "C3'" . U   A 1  190  ? 144.164 172.143 118.511 1.00 160.69 ?  190  U   A "C3'" 1 
ATOM   4071  O  "O3'" . U   A 1  190  ? 144.361 173.518 118.227 1.00 160.69 ?  190  U   A "O3'" 1 
ATOM   4072  C  "C2'" . U   A 1  190  ? 143.909 171.855 119.986 1.00 160.69 ?  190  U   A "C2'" 1 
ATOM   4073  O  "O2'" . U   A 1  190  ? 143.026 172.819 120.540 1.00 160.69 ?  190  U   A "O2'" 1 
ATOM   4074  C  "C1'" . U   A 1  190  ? 143.177 170.511 119.918 1.00 160.69 ?  190  U   A "C1'" 1 
ATOM   4075  N  N1    . U   A 1  190  ? 144.075 169.352 120.154 1.00 160.69 ?  190  U   A N1    1 
ATOM   4076  C  C2    . U   A 1  190  ? 144.352 169.008 121.466 1.00 160.69 ?  190  U   A C2    1 
ATOM   4077  O  O2    . U   A 1  190  ? 143.902 169.611 122.427 1.00 160.69 ?  190  U   A O2    1 
ATOM   4078  N  N3    . U   A 1  190  ? 145.182 167.926 121.623 1.00 160.69 ?  190  U   A N3    1 
ATOM   4079  C  C4    . U   A 1  190  ? 145.753 167.161 120.627 1.00 160.69 ?  190  U   A C4    1 
ATOM   4080  O  O4    . U   A 1  190  ? 146.482 166.215 120.930 1.00 160.69 ?  190  U   A O4    1 
ATOM   4081  C  C5    . U   A 1  190  ? 145.419 167.572 119.299 1.00 160.69 ?  190  U   A C5    1 
ATOM   4082  C  C6    . U   A 1  190  ? 144.611 168.621 119.116 1.00 160.69 ?  190  U   A C6    1 
ATOM   4083  P  P     . G   A 1  191  ? 145.375 173.967 117.063 1.00 160.20 ?  191  G   A P     1 
ATOM   4084  O  OP1   . G   A 1  191  ? 144.594 174.135 115.812 1.00 160.20 ?  191  G   A OP1   1 
ATOM   4085  O  OP2   . G   A 1  191  ? 146.538 173.044 117.085 1.00 160.20 ?  191  G   A OP2   1 
ATOM   4086  O  "O5'" . G   A 1  191  ? 145.880 175.407 117.521 1.00 160.20 ?  191  G   A "O5'" 1 
ATOM   4087  C  "C5'" . G   A 1  191  ? 146.931 175.545 118.466 1.00 160.20 ?  191  G   A "C5'" 1 
ATOM   4088  C  "C4'" . G   A 1  191  ? 147.675 176.842 118.275 1.00 160.20 ?  191  G   A "C4'" 1 
ATOM   4089  O  "O4'" . G   A 1  191  ? 148.176 176.921 116.914 1.00 160.20 ?  191  G   A "O4'" 1 
ATOM   4090  C  "C3'" . G   A 1  191  ? 146.852 178.110 118.441 1.00 160.20 ?  191  G   A "C3'" 1 
ATOM   4091  O  "O3'" . G   A 1  191  ? 146.686 178.490 119.797 1.00 160.20 ?  191  G   A "O3'" 1 
ATOM   4092  C  "C2'" . G   A 1  191  ? 147.632 179.123 117.615 1.00 160.20 ?  191  G   A "C2'" 1 
ATOM   4093  O  "O2'" . G   A 1  191  ? 148.770 179.584 118.329 1.00 160.20 ?  191  G   A "O2'" 1 
ATOM   4094  C  "C1'" . G   A 1  191  ? 148.111 178.255 116.453 1.00 160.20 ?  191  G   A "C1'" 1 
ATOM   4095  N  N9    . G   A 1  191  ? 147.185 178.306 115.306 1.00 160.20 ?  191  G   A N9    1 
ATOM   4096  C  C8    . G   A 1  191  ? 146.369 177.291 114.866 1.00 160.20 ?  191  G   A C8    1 
ATOM   4097  N  N7    . G   A 1  191  ? 145.655 177.619 113.825 1.00 160.20 ?  191  G   A N7    1 
ATOM   4098  C  C5    . G   A 1  191  ? 146.020 178.932 113.559 1.00 160.20 ?  191  G   A C5    1 
ATOM   4099  C  C6    . G   A 1  191  ? 145.577 179.819 112.544 1.00 160.20 ?  191  G   A C6    1 
ATOM   4100  O  O6    . G   A 1  191  ? 144.746 179.615 111.650 1.00 160.20 ?  191  G   A O6    1 
ATOM   4101  N  N1    . G   A 1  191  ? 146.205 181.057 112.637 1.00 160.20 ?  191  G   A N1    1 
ATOM   4102  C  C2    . G   A 1  191  ? 147.138 181.400 113.582 1.00 160.20 ?  191  G   A C2    1 
ATOM   4103  N  N2    . G   A 1  191  ? 147.630 182.646 113.505 1.00 160.20 ?  191  G   A N2    1 
ATOM   4104  N  N3    . G   A 1  191  ? 147.561 180.582 114.532 1.00 160.20 ?  191  G   A N3    1 
ATOM   4105  C  C4    . G   A 1  191  ? 146.964 179.372 114.463 1.00 160.20 ?  191  G   A C4    1 
ATOM   4106  P  P     . G   A 1  192  ? 145.324 179.196 120.277 1.00 179.56 ?  192  G   A P     1 
ATOM   4107  O  OP1   . G   A 1  192  ? 145.330 179.246 121.761 1.00 179.56 ?  192  G   A OP1   1 
ATOM   4108  O  OP2   . G   A 1  192  ? 144.194 178.543 119.569 1.00 179.56 ?  192  G   A OP2   1 
ATOM   4109  O  "O5'" . G   A 1  192  ? 145.449 180.688 119.733 1.00 179.56 ?  192  G   A "O5'" 1 
ATOM   4110  C  "C5'" . G   A 1  192  ? 146.455 181.563 120.223 1.00 179.56 ?  192  G   A "C5'" 1 
ATOM   4111  C  "C4'" . G   A 1  192  ? 146.321 182.944 119.630 1.00 179.56 ?  192  G   A "C4'" 1 
ATOM   4112  O  "O4'" . G   A 1  192  ? 146.578 182.890 118.205 1.00 179.56 ?  192  G   A "O4'" 1 
ATOM   4113  C  "C3'" . G   A 1  192  ? 144.946 183.588 119.738 1.00 179.56 ?  192  G   A "C3'" 1 
ATOM   4114  O  "O3'" . G   A 1  192  ? 144.730 184.203 120.997 1.00 179.56 ?  192  G   A "O3'" 1 
ATOM   4115  C  "C2'" . G   A 1  192  ? 144.950 184.583 118.583 1.00 179.56 ?  192  G   A "C2'" 1 
ATOM   4116  O  "O2'" . G   A 1  192  ? 145.645 185.768 118.944 1.00 179.56 ?  192  G   A "O2'" 1 
ATOM   4117  C  "C1'" . G   A 1  192  ? 145.779 183.839 117.533 1.00 179.56 ?  192  G   A "C1'" 1 
ATOM   4118  N  N9    . G   A 1  192  ? 144.938 183.138 116.545 1.00 179.56 ?  192  G   A N9    1 
ATOM   4119  C  C8    . G   A 1  192  ? 144.556 181.818 116.560 1.00 179.56 ?  192  G   A C8    1 
ATOM   4120  N  N7    . G   A 1  192  ? 143.811 181.490 115.539 1.00 179.56 ?  192  G   A N7    1 
ATOM   4121  C  C5    . G   A 1  192  ? 143.695 182.663 114.805 1.00 179.56 ?  192  G   A C5    1 
ATOM   4122  C  C6    . G   A 1  192  ? 143.005 182.928 113.593 1.00 179.56 ?  192  G   A C6    1 
ATOM   4123  O  O6    . G   A 1  192  ? 142.334 182.152 112.902 1.00 179.56 ?  192  G   A O6    1 
ATOM   4124  N  N1    . G   A 1  192  ? 143.151 184.255 113.201 1.00 179.56 ?  192  G   A N1    1 
ATOM   4125  C  C2    . G   A 1  192  ? 143.867 185.206 113.883 1.00 179.56 ?  192  G   A C2    1 
ATOM   4126  N  N2    . G   A 1  192  ? 143.890 186.433 113.341 1.00 179.56 ?  192  G   A N2    1 
ATOM   4127  N  N3    . G   A 1  192  ? 144.515 184.973 115.013 1.00 179.56 ?  192  G   A N3    1 
ATOM   4128  C  C4    . G   A 1  192  ? 144.386 183.690 115.413 1.00 179.56 ?  192  G   A C4    1 
ATOM   4129  P  P     . A   A 1  193  ? 143.667 183.605 122.046 1.00 188.59 ?  193  A   A P     1 
ATOM   4130  O  OP1   . A   A 1  193  ? 144.009 182.188 122.325 1.00 188.59 ?  193  A   A OP1   1 
ATOM   4131  O  OP2   . A   A 1  193  ? 142.302 183.941 121.572 1.00 188.59 ?  193  A   A OP2   1 
ATOM   4132  O  "O5'" . A   A 1  193  ? 143.951 184.436 123.376 1.00 188.59 ?  193  A   A "O5'" 1 
ATOM   4133  C  "C5'" . A   A 1  193  ? 143.037 185.418 123.841 1.00 188.59 ?  193  A   A "C5'" 1 
ATOM   4134  C  "C4'" . A   A 1  193  ? 143.622 186.807 123.760 1.00 188.59 ?  193  A   A "C4'" 1 
ATOM   4135  O  "O4'" . A   A 1  193  ? 145.027 186.773 124.122 1.00 188.59 ?  193  A   A "O4'" 1 
ATOM   4136  C  "C3'" . A   A 1  193  ? 143.608 187.457 122.385 1.00 188.59 ?  193  A   A "C3'" 1 
ATOM   4137  O  "O3'" . A   A 1  193  ? 142.357 188.046 122.072 1.00 188.59 ?  193  A   A "O3'" 1 
ATOM   4138  C  "C2'" . A   A 1  193  ? 144.743 188.467 122.479 1.00 188.59 ?  193  A   A "C2'" 1 
ATOM   4139  O  "O2'" . A   A 1  193  ? 144.321 189.634 123.171 1.00 188.59 ?  193  A   A "O2'" 1 
ATOM   4140  C  "C1'" . A   A 1  193  ? 145.747 187.720 123.360 1.00 188.59 ?  193  A   A "C1'" 1 
ATOM   4141  N  N9    . A   A 1  193  ? 146.775 187.007 122.574 1.00 188.59 ?  193  A   A N9    1 
ATOM   4142  C  C8    . A   A 1  193  ? 146.996 185.652 122.563 1.00 188.59 ?  193  A   A C8    1 
ATOM   4143  N  N7    . A   A 1  193  ? 147.977 185.273 121.783 1.00 188.59 ?  193  A   A N7    1 
ATOM   4144  C  C5    . A   A 1  193  ? 148.445 186.463 121.245 1.00 188.59 ?  193  A   A C5    1 
ATOM   4145  C  C6    . A   A 1  193  ? 149.484 186.747 120.339 1.00 188.59 ?  193  A   A C6    1 
ATOM   4146  N  N6    . A   A 1  193  ? 150.265 185.810 119.796 1.00 188.59 ?  193  A   A N6    1 
ATOM   4147  N  N1    . A   A 1  193  ? 149.698 188.039 120.002 1.00 188.59 ?  193  A   A N1    1 
ATOM   4148  C  C2    . A   A 1  193  ? 148.919 188.985 120.541 1.00 188.59 ?  193  A   A C2    1 
ATOM   4149  N  N3    . A   A 1  193  ? 147.914 188.839 121.403 1.00 188.59 ?  193  A   A N3    1 
ATOM   4150  C  C4    . A   A 1  193  ? 147.721 187.543 121.723 1.00 188.59 ?  193  A   A C4    1 
ATOM   4151  P  P     . C   A 1  194  ? 141.720 187.877 120.607 1.00 211.94 ?  194  C   A P     1 
ATOM   4152  O  OP1   . C   A 1  194  ? 140.374 188.503 120.624 1.00 211.94 ?  194  C   A OP1   1 
ATOM   4153  O  OP2   . C   A 1  194  ? 141.862 186.460 120.192 1.00 211.94 ?  194  C   A OP2   1 
ATOM   4154  O  "O5'" . C   A 1  194  ? 142.661 188.753 119.667 1.00 211.94 ?  194  C   A "O5'" 1 
ATOM   4155  C  "C5'" . C   A 1  194  ? 142.524 190.165 119.600 1.00 211.94 ?  194  C   A "C5'" 1 
ATOM   4156  C  "C4'" . C   A 1  194  ? 142.150 190.612 118.210 1.00 211.94 ?  194  C   A "C4'" 1 
ATOM   4157  O  "O4'" . C   A 1  194  ? 142.747 189.713 117.238 1.00 211.94 ?  194  C   A "O4'" 1 
ATOM   4158  C  "C3'" . C   A 1  194  ? 140.665 190.578 117.878 1.00 211.94 ?  194  C   A "C3'" 1 
ATOM   4159  O  "O3'" . C   A 1  194  ? 139.963 191.714 118.354 1.00 211.94 ?  194  C   A "O3'" 1 
ATOM   4160  C  "C2'" . C   A 1  194  ? 140.663 190.450 116.359 1.00 211.94 ?  194  C   A "C2'" 1 
ATOM   4161  O  "O2'" . C   A 1  194  ? 140.891 191.712 115.749 1.00 211.94 ?  194  C   A "O2'" 1 
ATOM   4162  C  "C1'" . C   A 1  194  ? 141.894 189.569 116.121 1.00 211.94 ?  194  C   A "C1'" 1 
ATOM   4163  N  N1    . C   A 1  194  ? 141.550 188.134 115.949 1.00 211.94 ?  194  C   A N1    1 
ATOM   4164  C  C2    . C   A 1  194  ? 141.142 187.680 114.687 1.00 211.94 ?  194  C   A C2    1 
ATOM   4165  O  O2    . C   A 1  194  ? 141.071 188.479 113.741 1.00 211.94 ?  194  C   A O2    1 
ATOM   4166  N  N3    . C   A 1  194  ? 140.830 186.373 114.520 1.00 211.94 ?  194  C   A N3    1 
ATOM   4167  C  C4    . C   A 1  194  ? 140.913 185.524 115.545 1.00 211.94 ?  194  C   A C4    1 
ATOM   4168  N  N4    . C   A 1  194  ? 140.594 184.245 115.329 1.00 211.94 ?  194  C   A N4    1 
ATOM   4169  C  C5    . C   A 1  194  ? 141.327 185.949 116.838 1.00 211.94 ?  194  C   A C5    1 
ATOM   4170  C  C6    . C   A 1  194  ? 141.635 187.243 116.988 1.00 211.94 ?  194  C   A C6    1 
ATOM   4171  P  P     . C   A 1  195  ? 138.446 191.573 118.865 1.00 234.89 ?  195  C   A P     1 
ATOM   4172  O  OP1   . C   A 1  195  ? 138.110 192.791 119.644 1.00 234.89 ?  195  C   A OP1   1 
ATOM   4173  O  OP2   . C   A 1  195  ? 138.289 190.236 119.491 1.00 234.89 ?  195  C   A OP2   1 
ATOM   4174  O  "O5'" . C   A 1  195  ? 137.581 191.589 117.527 1.00 234.89 ?  195  C   A "O5'" 1 
ATOM   4175  C  "C5'" . C   A 1  195  ? 137.450 192.774 116.756 1.00 234.89 ?  195  C   A "C5'" 1 
ATOM   4176  C  "C4'" . C   A 1  195  ? 136.720 192.515 115.462 1.00 234.89 ?  195  C   A "C4'" 1 
ATOM   4177  O  "O4'" . C   A 1  195  ? 137.480 191.582 114.651 1.00 234.89 ?  195  C   A "O4'" 1 
ATOM   4178  C  "C3'" . C   A 1  195  ? 135.351 191.864 115.587 1.00 234.89 ?  195  C   A "C3'" 1 
ATOM   4179  O  "O3'" . C   A 1  195  ? 134.325 192.785 115.915 1.00 234.89 ?  195  C   A "O3'" 1 
ATOM   4180  C  "C2'" . C   A 1  195  ? 135.169 191.205 114.225 1.00 234.89 ?  195  C   A "C2'" 1 
ATOM   4181  O  "O2'" . C   A 1  195  ? 134.752 192.158 113.258 1.00 234.89 ?  195  C   A "O2'" 1 
ATOM   4182  C  "C1'" . C   A 1  195  ? 136.602 190.775 113.894 1.00 234.89 ?  195  C   A "C1'" 1 
ATOM   4183  N  N1    . C   A 1  195  ? 136.862 189.346 114.204 1.00 234.89 ?  195  C   A N1    1 
ATOM   4184  C  C2    . C   A 1  195  ? 136.505 188.375 113.258 1.00 234.89 ?  195  C   A C2    1 
ATOM   4185  O  O2    . C   A 1  195  ? 135.979 188.725 112.191 1.00 234.89 ?  195  C   A O2    1 
ATOM   4186  N  N3    . C   A 1  195  ? 136.741 187.070 113.526 1.00 234.89 ?  195  C   A N3    1 
ATOM   4187  C  C4    . C   A 1  195  ? 137.310 186.711 114.678 1.00 234.89 ?  195  C   A C4    1 
ATOM   4188  N  N4    . C   A 1  195  ? 137.521 185.410 114.894 1.00 234.89 ?  195  C   A N4    1 
ATOM   4189  C  C5    . C   A 1  195  ? 137.688 187.671 115.658 1.00 234.89 ?  195  C   A C5    1 
ATOM   4190  C  C6    . C   A 1  195  ? 137.451 188.959 115.379 1.00 234.89 ?  195  C   A C6    1 
ATOM   4191  P  P     . C   A 1  196  ? 133.151 192.358 116.927 1.00 258.50 ?  196  C   A P     1 
ATOM   4192  O  OP1   . C   A 1  196  ? 132.416 193.587 117.322 1.00 258.50 ?  196  C   A OP1   1 
ATOM   4193  O  OP2   . C   A 1  196  ? 133.742 191.489 117.976 1.00 258.50 ?  196  C   A OP2   1 
ATOM   4194  O  "O5'" . C   A 1  196  ? 132.176 191.465 116.038 1.00 258.50 ?  196  C   A "O5'" 1 
ATOM   4195  C  "C5'" . C   A 1  196  ? 131.458 192.030 114.951 1.00 258.50 ?  196  C   A "C5'" 1 
ATOM   4196  C  "C4'" . C   A 1  196  ? 130.923 190.966 114.026 1.00 258.50 ?  196  C   A "C4'" 1 
ATOM   4197  O  "O4'" . C   A 1  196  ? 132.017 190.145 113.540 1.00 258.50 ?  196  C   A "O4'" 1 
ATOM   4198  C  "C3'" . C   A 1  196  ? 129.958 189.964 114.643 1.00 258.50 ?  196  C   A "C3'" 1 
ATOM   4199  O  "O3'" . C   A 1  196  ? 128.633 190.459 114.742 1.00 258.50 ?  196  C   A "O3'" 1 
ATOM   4200  C  "C2'" . C   A 1  196  ? 130.091 188.759 113.720 1.00 258.50 ?  196  C   A "C2'" 1 
ATOM   4201  O  "O2'" . C   A 1  196  ? 129.319 188.941 112.542 1.00 258.50 ?  196  C   A "O2'" 1 
ATOM   4202  C  "C1'" . C   A 1  196  ? 131.574 188.819 113.340 1.00 258.50 ?  196  C   A "C1'" 1 
ATOM   4203  N  N1    . C   A 1  196  ? 132.414 187.896 114.145 1.00 258.50 ?  196  C   A N1    1 
ATOM   4204  C  C2    . C   A 1  196  ? 132.509 186.554 113.752 1.00 258.50 ?  196  C   A C2    1 
ATOM   4205  O  O2    . C   A 1  196  ? 131.892 186.164 112.749 1.00 258.50 ?  196  C   A O2    1 
ATOM   4206  N  N3    . C   A 1  196  ? 133.275 185.703 114.475 1.00 258.50 ?  196  C   A N3    1 
ATOM   4207  C  C4    . C   A 1  196  ? 133.933 186.139 115.549 1.00 258.50 ?  196  C   A C4    1 
ATOM   4208  N  N4    . C   A 1  196  ? 134.674 185.261 116.229 1.00 258.50 ?  196  C   A N4    1 
ATOM   4209  C  C5    . C   A 1  196  ? 133.860 187.495 115.975 1.00 258.50 ?  196  C   A C5    1 
ATOM   4210  C  C6    . C   A 1  196  ? 133.102 188.327 115.249 1.00 258.50 ?  196  C   A C6    1 
ATOM   4211  P  P     . C   A 1  197  ? 127.644 189.903 115.881 1.00 280.59 ?  197  C   A P     1 
ATOM   4212  O  OP1   . C   A 1  197  ? 126.534 190.877 116.041 1.00 280.59 ?  197  C   A OP1   1 
ATOM   4213  O  OP2   . C   A 1  197  ? 128.467 189.529 117.060 1.00 280.59 ?  197  C   A OP2   1 
ATOM   4214  O  "O5'" . C   A 1  197  ? 127.041 188.566 115.258 1.00 280.59 ?  197  C   A "O5'" 1 
ATOM   4215  C  "C5'" . C   A 1  197  ? 126.244 188.602 114.083 1.00 280.59 ?  197  C   A "C5'" 1 
ATOM   4216  C  "C4'" . C   A 1  197  ? 126.150 187.243 113.435 1.00 280.59 ?  197  C   A "C4'" 1 
ATOM   4217  O  "O4'" . C   A 1  197  ? 127.484 186.703 113.243 1.00 280.59 ?  197  C   A "O4'" 1 
ATOM   4218  C  "C3'" . C   A 1  197  ? 125.430 186.168 114.235 1.00 280.59 ?  197  C   A "C3'" 1 
ATOM   4219  O  "O3'" . C   A 1  197  ? 124.018 186.240 114.124 1.00 280.59 ?  197  C   A "O3'" 1 
ATOM   4220  C  "C2'" . C   A 1  197  ? 126.017 184.880 113.668 1.00 280.59 ?  197  C   A "C2'" 1 
ATOM   4221  O  "O2'" . C   A 1  197  ? 125.395 184.545 112.436 1.00 280.59 ?  197  C   A "O2'" 1 
ATOM   4222  C  "C1'" . C   A 1  197  ? 127.462 185.298 113.383 1.00 280.59 ?  197  C   A "C1'" 1 
ATOM   4223  N  N1    . C   A 1  197  ? 128.402 184.898 114.462 1.00 280.59 ?  197  C   A N1    1 
ATOM   4224  C  C2    . C   A 1  197  ? 128.915 183.593 114.464 1.00 280.59 ?  197  C   A C2    1 
ATOM   4225  O  O2    . C   A 1  197  ? 128.577 182.799 113.573 1.00 280.59 ?  197  C   A O2    1 
ATOM   4226  N  N3    . C   A 1  197  ? 129.776 183.219 115.440 1.00 280.59 ?  197  C   A N3    1 
ATOM   4227  C  C4    . C   A 1  197  ? 130.133 184.083 116.390 1.00 280.59 ?  197  C   A C4    1 
ATOM   4228  N  N4    . C   A 1  197  ? 130.984 183.666 117.331 1.00 280.59 ?  197  C   A N4    1 
ATOM   4229  C  C5    . C   A 1  197  ? 129.634 185.416 116.417 1.00 280.59 ?  197  C   A C5    1 
ATOM   4230  C  C6    . C   A 1  197  ? 128.786 185.773 115.445 1.00 280.59 ?  197  C   A C6    1 
ATOM   4231  P  P     . G   A 1  198  ? 123.100 186.337 115.442 1.00 294.11 ?  198  G   A P     1 
ATOM   4232  O  OP1   . G   A 1  198  ? 121.684 186.177 115.024 1.00 294.11 ?  198  G   A OP1   1 
ATOM   4233  O  OP2   . G   A 1  198  ? 123.509 187.549 116.196 1.00 294.11 ?  198  G   A OP2   1 
ATOM   4234  O  "O5'" . G   A 1  198  ? 123.505 185.060 116.306 1.00 294.11 ?  198  G   A "O5'" 1 
ATOM   4235  C  "C5'" . G   A 1  198  ? 123.141 183.748 115.899 1.00 294.11 ?  198  G   A "C5'" 1 
ATOM   4236  C  "C4'" . G   A 1  198  ? 124.022 182.710 116.549 1.00 294.11 ?  198  G   A "C4'" 1 
ATOM   4237  O  "O4'" . G   A 1  198  ? 125.412 183.110 116.420 1.00 294.11 ?  198  G   A "O4'" 1 
ATOM   4238  C  "C3'" . G   A 1  198  ? 123.830 182.514 118.046 1.00 294.11 ?  198  G   A "C3'" 1 
ATOM   4239  O  "O3'" . G   A 1  198  ? 122.742 181.660 118.357 1.00 294.11 ?  198  G   A "O3'" 1 
ATOM   4240  C  "C2'" . G   A 1  198  ? 125.181 181.969 118.488 1.00 294.11 ?  198  G   A "C2'" 1 
ATOM   4241  O  "O2'" . G   A 1  198  ? 125.291 180.588 118.177 1.00 294.11 ?  198  G   A "O2'" 1 
ATOM   4242  C  "C1'" . G   A 1  198  ? 126.132 182.745 117.579 1.00 294.11 ?  198  G   A "C1'" 1 
ATOM   4243  N  N9    . G   A 1  198  ? 126.635 183.975 118.223 1.00 294.11 ?  198  G   A N9    1 
ATOM   4244  C  C8    . G   A 1  198  ? 126.143 185.249 118.068 1.00 294.11 ?  198  G   A C8    1 
ATOM   4245  N  N7    . G   A 1  198  ? 126.792 186.140 118.766 1.00 294.11 ?  198  G   A N7    1 
ATOM   4246  C  C5    . G   A 1  198  ? 127.774 185.412 119.423 1.00 294.11 ?  198  G   A C5    1 
ATOM   4247  C  C6    . G   A 1  198  ? 128.783 185.839 120.324 1.00 294.11 ?  198  G   A C6    1 
ATOM   4248  O  O6    . G   A 1  198  ? 129.018 186.982 120.734 1.00 294.11 ?  198  G   A O6    1 
ATOM   4249  N  N1    . G   A 1  198  ? 129.567 184.774 120.755 1.00 294.11 ?  198  G   A N1    1 
ATOM   4250  C  C2    . G   A 1  198  ? 129.403 183.467 120.370 1.00 294.11 ?  198  G   A C2    1 
ATOM   4251  N  N2    . G   A 1  198  ? 130.264 182.585 120.899 1.00 294.11 ?  198  G   A N2    1 
ATOM   4252  N  N3    . G   A 1  198  ? 128.466 183.055 119.531 1.00 294.11 ?  198  G   A N3    1 
ATOM   4253  C  C4    . G   A 1  198  ? 127.691 184.073 119.099 1.00 294.11 ?  198  G   A C4    1 
ATOM   4254  P  P     . C   A 1  199  ? 121.882 181.897 119.694 1.00 327.73 ?  199  C   A P     1 
ATOM   4255  O  OP1   . C   A 1  199  ? 120.451 181.988 119.309 1.00 327.73 ?  199  C   A OP1   1 
ATOM   4256  O  OP2   . C   A 1  199  ? 122.509 183.010 120.452 1.00 327.73 ?  199  C   A OP2   1 
ATOM   4257  O  "O5'" . C   A 1  199  ? 122.083 180.556 120.531 1.00 327.73 ?  199  C   A "O5'" 1 
ATOM   4258  C  "C5'" . C   A 1  199  ? 121.532 179.325 120.083 1.00 327.73 ?  199  C   A "C5'" 1 
ATOM   4259  C  "C4'" . C   A 1  199  ? 122.322 178.147 120.595 1.00 327.73 ?  199  C   A "C4'" 1 
ATOM   4260  O  "O4'" . C   A 1  199  ? 123.713 178.290 120.206 1.00 327.73 ?  199  C   A "O4'" 1 
ATOM   4261  C  "C3'" . C   A 1  199  ? 122.375 177.982 122.106 1.00 327.73 ?  199  C   A "C3'" 1 
ATOM   4262  O  "O3'" . C   A 1  199  ? 121.223 177.348 122.635 1.00 327.73 ?  199  C   A "O3'" 1 
ATOM   4263  C  "C2'" . C   A 1  199  ? 123.659 177.185 122.313 1.00 327.73 ?  199  C   A "C2'" 1 
ATOM   4264  O  "O2'" . C   A 1  199  ? 123.437 175.804 122.070 1.00 327.73 ?  199  C   A "O2'" 1 
ATOM   4265  C  "C1'" . C   A 1  199  ? 124.552 177.736 121.197 1.00 327.73 ?  199  C   A "C1'" 1 
ATOM   4266  N  N1    . C   A 1  199  ? 125.500 178.775 121.672 1.00 327.73 ?  199  C   A N1    1 
ATOM   4267  C  C2    . C   A 1  199  ? 126.730 178.371 122.204 1.00 327.73 ?  199  C   A C2    1 
ATOM   4268  O  O2    . C   A 1  199  ? 126.993 177.161 122.271 1.00 327.73 ?  199  C   A O2    1 
ATOM   4269  N  N3    . C   A 1  199  ? 127.607 179.308 122.635 1.00 327.73 ?  199  C   A N3    1 
ATOM   4270  C  C4    . C   A 1  199  ? 127.303 180.604 122.550 1.00 327.73 ?  199  C   A C4    1 
ATOM   4271  N  N4    . C   A 1  199  ? 128.198 181.492 122.988 1.00 327.73 ?  199  C   A N4    1 
ATOM   4272  C  C5    . C   A 1  199  ? 126.063 181.049 122.013 1.00 327.73 ?  199  C   A C5    1 
ATOM   4273  C  C6    . C   A 1  199  ? 125.208 180.111 121.590 1.00 327.73 ?  199  C   A C6    1 
ATOM   4274  P  P     . C   A 1  200  ? 120.405 178.026 123.843 1.00 345.39 ?  200  C   A P     1 
ATOM   4275  O  OP1   . C   A 1  200  ? 119.052 177.415 123.880 1.00 345.39 ?  200  C   A OP1   1 
ATOM   4276  O  OP2   . C   A 1  200  ? 120.542 179.499 123.718 1.00 345.39 ?  200  C   A OP2   1 
ATOM   4277  O  "O5'" . C   A 1  200  ? 121.189 177.567 125.153 1.00 345.39 ?  200  C   A "O5'" 1 
ATOM   4278  C  "C5'" . C   A 1  200  ? 121.206 176.205 125.554 1.00 345.39 ?  200  C   A "C5'" 1 
ATOM   4279  C  "C4'" . C   A 1  200  ? 122.468 175.868 126.309 1.00 345.39 ?  200  C   A "C4'" 1 
ATOM   4280  O  "O4'" . C   A 1  200  ? 123.620 176.293 125.535 1.00 345.39 ?  200  C   A "O4'" 1 
ATOM   4281  C  "C3'" . C   A 1  200  ? 122.651 176.560 127.651 1.00 345.39 ?  200  C   A "C3'" 1 
ATOM   4282  O  "O3'" . C   A 1  200  ? 121.934 175.939 128.704 1.00 345.39 ?  200  C   A "O3'" 1 
ATOM   4283  C  "C2'" . C   A 1  200  ? 124.163 176.532 127.839 1.00 345.39 ?  200  C   A "C2'" 1 
ATOM   4284  O  "O2'" . C   A 1  200  ? 124.589 175.259 128.302 1.00 345.39 ?  200  C   A "O2'" 1 
ATOM   4285  C  "C1'" . C   A 1  200  ? 124.656 176.712 126.399 1.00 345.39 ?  200  C   A "C1'" 1 
ATOM   4286  N  N1    . C   A 1  200  ? 125.016 178.120 126.089 1.00 345.39 ?  200  C   A N1    1 
ATOM   4287  C  C2    . C   A 1  200  ? 126.311 178.554 126.395 1.00 345.39 ?  200  C   A C2    1 
ATOM   4288  O  O2    . C   A 1  200  ? 127.110 177.759 126.913 1.00 345.39 ?  200  C   A O2    1 
ATOM   4289  N  N3    . C   A 1  200  ? 126.666 179.832 126.124 1.00 345.39 ?  200  C   A N3    1 
ATOM   4290  C  C4    . C   A 1  200  ? 125.790 180.669 125.567 1.00 345.39 ?  200  C   A C4    1 
ATOM   4291  N  N4    . C   A 1  200  ? 126.186 181.919 125.318 1.00 345.39 ?  200  C   A N4    1 
ATOM   4292  C  C5    . C   A 1  200  ? 124.467 180.261 125.239 1.00 345.39 ?  200  C   A C5    1 
ATOM   4293  C  C6    . C   A 1  200  ? 124.131 178.994 125.511 1.00 345.39 ?  200  C   A C6    1 
ATOM   4294  P  P     . C   A 1  201  ? 121.344 176.826 129.908 1.00 352.31 ?  201  C   A P     1 
ATOM   4295  O  OP1   . C   A 1  201  ? 120.400 175.979 130.681 1.00 352.31 ?  201  C   A OP1   1 
ATOM   4296  O  OP2   . C   A 1  201  ? 120.877 178.117 129.342 1.00 352.31 ?  201  C   A OP2   1 
ATOM   4297  O  "O5'" . C   A 1  201  ? 122.609 177.120 130.831 1.00 352.31 ?  201  C   A "O5'" 1 
ATOM   4298  C  "C5'" . C   A 1  201  ? 123.180 176.094 131.629 1.00 352.31 ?  201  C   A "C5'" 1 
ATOM   4299  C  "C4'" . C   A 1  201  ? 124.377 176.586 132.403 1.00 352.31 ?  201  C   A "C4'" 1 
ATOM   4300  O  "O4'" . C   A 1  201  ? 125.465 176.896 131.492 1.00 352.31 ?  201  C   A "O4'" 1 
ATOM   4301  C  "C3'" . C   A 1  201  ? 124.190 177.872 133.192 1.00 352.31 ?  201  C   A "C3'" 1 
ATOM   4302  O  "O3'" . C   A 1  201  ? 123.502 177.693 134.418 1.00 352.31 ?  201  C   A "O3'" 1 
ATOM   4303  C  "C2'" . C   A 1  201  ? 125.622 178.366 133.357 1.00 352.31 ?  201  C   A "C2'" 1 
ATOM   4304  O  "O2'" . C   A 1  201  ? 126.282 177.656 134.394 1.00 352.31 ?  201  C   A "O2'" 1 
ATOM   4305  C  "C1'" . C   A 1  201  ? 126.242 177.954 132.017 1.00 352.31 ?  201  C   A "C1'" 1 
ATOM   4306  N  N1    . C   A 1  201  ? 126.282 179.072 131.039 1.00 352.31 ?  201  C   A N1    1 
ATOM   4307  C  C2    . C   A 1  201  ? 127.357 179.969 131.092 1.00 352.31 ?  201  C   A C2    1 
ATOM   4308  O  O2    . C   A 1  201  ? 128.245 179.810 131.944 1.00 352.31 ?  201  C   A O2    1 
ATOM   4309  N  N3    . C   A 1  201  ? 127.412 180.994 130.210 1.00 352.31 ?  201  C   A N3    1 
ATOM   4310  C  C4    . C   A 1  201  ? 126.451 181.150 129.299 1.00 352.31 ?  201  C   A C4    1 
ATOM   4311  N  N4    . C   A 1  201  ? 126.550 182.177 128.452 1.00 352.31 ?  201  C   A N4    1 
ATOM   4312  C  C5    . C   A 1  201  ? 125.345 180.258 129.218 1.00 352.31 ?  201  C   A C5    1 
ATOM   4313  C  C6    . C   A 1  201  ? 125.306 179.246 130.093 1.00 352.31 ?  201  C   A C6    1 
ATOM   4314  P  P     . U   A 1  202  ? 122.158 178.525 134.716 1.00 352.85 ?  202  U   A P     1 
ATOM   4315  O  OP1   . U   A 1  202  ? 121.778 178.290 136.132 1.00 352.85 ?  202  U   A OP1   1 
ATOM   4316  O  OP2   . U   A 1  202  ? 121.185 178.223 133.635 1.00 352.85 ?  202  U   A OP2   1 
ATOM   4317  O  "O5'" . U   A 1  202  ? 122.598 180.051 134.569 1.00 352.85 ?  202  U   A "O5'" 1 
ATOM   4318  C  "C5'" . U   A 1  202  ? 123.402 180.679 135.558 1.00 352.85 ?  202  U   A "C5'" 1 
ATOM   4319  C  "C4'" . U   A 1  202  ? 124.226 181.803 134.979 1.00 352.85 ?  202  U   A "C4'" 1 
ATOM   4320  O  "O4'" . U   A 1  202  ? 124.574 181.497 133.603 1.00 352.85 ?  202  U   A "O4'" 1 
ATOM   4321  C  "C3'" . U   A 1  202  ? 123.551 183.163 134.890 1.00 352.85 ?  202  U   A "C3'" 1 
ATOM   4322  O  "O3'" . U   A 1  202  ? 123.556 183.866 136.122 1.00 352.85 ?  202  U   A "O3'" 1 
ATOM   4323  C  "C2'" . U   A 1  202  ? 124.348 183.858 133.792 1.00 352.85 ?  202  U   A "C2'" 1 
ATOM   4324  O  "O2'" . U   A 1  202  ? 125.570 184.369 134.306 1.00 352.85 ?  202  U   A "O2'" 1 
ATOM   4325  C  "C1'" . U   A 1  202  ? 124.669 182.691 132.854 1.00 352.85 ?  202  U   A "C1'" 1 
ATOM   4326  N  N1    . U   A 1  202  ? 123.747 182.619 131.694 1.00 352.85 ?  202  U   A N1    1 
ATOM   4327  C  C2    . U   A 1  202  ? 124.042 183.413 130.599 1.00 352.85 ?  202  U   A C2    1 
ATOM   4328  O  O2    . U   A 1  202  ? 125.008 184.156 130.551 1.00 352.85 ?  202  U   A O2    1 
ATOM   4329  N  N3    . U   A 1  202  ? 123.162 183.310 129.550 1.00 352.85 ?  202  U   A N3    1 
ATOM   4330  C  C4    . U   A 1  202  ? 122.040 182.512 129.479 1.00 352.85 ?  202  U   A C4    1 
ATOM   4331  O  O4    . U   A 1  202  ? 121.346 182.531 128.461 1.00 352.85 ?  202  U   A O4    1 
ATOM   4332  C  C5    . U   A 1  202  ? 121.801 181.719 130.645 1.00 352.85 ?  202  U   A C5    1 
ATOM   4333  C  C6    . U   A 1  202  ? 122.642 181.796 131.682 1.00 352.85 ?  202  U   A C6    1 
ATOM   4334  P  P     . U   A 1  203  ? 122.261 184.695 136.591 1.00 347.69 ?  203  U   A P     1 
ATOM   4335  O  OP1   . U   A 1  203  ? 122.481 185.133 137.993 1.00 347.69 ?  203  U   A OP1   1 
ATOM   4336  O  OP2   . U   A 1  203  ? 121.057 183.894 136.254 1.00 347.69 ?  203  U   A OP2   1 
ATOM   4337  O  "O5'" . U   A 1  203  ? 122.266 185.991 135.664 1.00 347.69 ?  203  U   A "O5'" 1 
ATOM   4338  C  "C5'" . U   A 1  203  ? 123.354 186.910 135.690 1.00 347.69 ?  203  U   A "C5'" 1 
ATOM   4339  C  "C4'" . U   A 1  203  ? 123.443 187.714 134.414 1.00 347.69 ?  203  U   A "C4'" 1 
ATOM   4340  O  "O4'" . U   A 1  203  ? 123.024 186.884 133.295 1.00 347.69 ?  203  U   A "O4'" 1 
ATOM   4341  C  "C3'" . U   A 1  203  ? 122.571 188.967 134.363 1.00 347.69 ?  203  U   A "C3'" 1 
ATOM   4342  O  "O3'" . U   A 1  203  ? 123.236 189.969 133.596 1.00 347.69 ?  203  U   A "O3'" 1 
ATOM   4343  C  "C2'" . U   A 1  203  ? 121.339 188.485 133.605 1.00 347.69 ?  203  U   A "C2'" 1 
ATOM   4344  O  "O2'" . U   A 1  203  ? 120.610 189.507 132.957 1.00 347.69 ?  203  U   A "O2'" 1 
ATOM   4345  C  "C1'" . U   A 1  203  ? 121.959 187.512 132.607 1.00 347.69 ?  203  U   A "C1'" 1 
ATOM   4346  N  N1    . U   A 1  203  ? 121.037 186.470 132.130 1.00 347.69 ?  203  U   A N1    1 
ATOM   4347  C  C2    . U   A 1  203  ? 120.678 186.496 130.796 1.00 347.69 ?  203  U   A C2    1 
ATOM   4348  O  O2    . U   A 1  203  ? 121.092 187.337 130.017 1.00 347.69 ?  203  U   A O2    1 
ATOM   4349  N  N3    . U   A 1  203  ? 119.816 185.500 130.407 1.00 347.69 ?  203  U   A N3    1 
ATOM   4350  C  C4    . U   A 1  203  ? 119.289 184.502 131.201 1.00 347.69 ?  203  U   A C4    1 
ATOM   4351  O  O4    . U   A 1  203  ? 118.523 183.675 130.704 1.00 347.69 ?  203  U   A O4    1 
ATOM   4352  C  C5    . U   A 1  203  ? 119.708 184.544 132.568 1.00 347.69 ?  203  U   A C5    1 
ATOM   4353  C  C6    . U   A 1  203  ? 120.547 185.503 132.975 1.00 347.69 ?  203  U   A C6    1 
ATOM   4354  P  P     . C   A 1  204  ? 123.787 191.302 134.305 1.00 344.94 ?  204  C   A P     1 
ATOM   4355  O  OP1   . C   A 1  204  ? 124.123 190.967 135.712 1.00 344.94 ?  204  C   A OP1   1 
ATOM   4356  O  OP2   . C   A 1  204  ? 122.832 192.403 134.021 1.00 344.94 ?  204  C   A OP2   1 
ATOM   4357  O  "O5'" . C   A 1  204  ? 125.145 191.617 133.533 1.00 344.94 ?  204  C   A "O5'" 1 
ATOM   4358  C  "C5'" . C   A 1  204  ? 125.473 192.946 133.153 1.00 344.94 ?  204  C   A "C5'" 1 
ATOM   4359  C  "C4'" . C   A 1  204  ? 126.878 193.314 133.560 1.00 344.94 ?  204  C   A "C4'" 1 
ATOM   4360  O  "O4'" . C   A 1  204  ? 127.049 193.100 134.985 1.00 344.94 ?  204  C   A "O4'" 1 
ATOM   4361  C  "C3'" . C   A 1  204  ? 127.998 192.502 132.929 1.00 344.94 ?  204  C   A "C3'" 1 
ATOM   4362  O  "O3'" . C   A 1  204  ? 128.322 192.929 131.617 1.00 344.94 ?  204  C   A "O3'" 1 
ATOM   4363  C  "C2'" . C   A 1  204  ? 129.139 192.677 133.925 1.00 344.94 ?  204  C   A "C2'" 1 
ATOM   4364  O  "O2'" . C   A 1  204  ? 129.787 193.926 133.731 1.00 344.94 ?  204  C   A "O2'" 1 
ATOM   4365  C  "C1'" . C   A 1  204  ? 128.384 192.727 135.258 1.00 344.94 ?  204  C   A "C1'" 1 
ATOM   4366  N  N1    . C   A 1  204  ? 128.395 191.426 135.974 1.00 344.94 ?  204  C   A N1    1 
ATOM   4367  C  C2    . C   A 1  204  ? 129.496 191.116 136.784 1.00 344.94 ?  204  C   A C2    1 
ATOM   4368  O  O2    . C   A 1  204  ? 130.430 191.926 136.881 1.00 344.94 ?  204  C   A O2    1 
ATOM   4369  N  N3    . C   A 1  204  ? 129.521 189.936 137.446 1.00 344.94 ?  204  C   A N3    1 
ATOM   4370  C  C4    . C   A 1  204  ? 128.506 189.079 137.331 1.00 344.94 ?  204  C   A C4    1 
ATOM   4371  N  N4    . C   A 1  204  ? 128.579 187.929 138.004 1.00 344.94 ?  204  C   A N4    1 
ATOM   4372  C  C5    . C   A 1  204  ? 127.372 189.364 136.518 1.00 344.94 ?  204  C   A C5    1 
ATOM   4373  C  C6    . C   A 1  204  ? 127.359 190.536 135.870 1.00 344.94 ?  204  C   A C6    1 
ATOM   4374  P  P     . G   A 1  205  ? 128.950 191.893 130.559 1.00 343.15 ?  205  G   A P     1 
ATOM   4375  O  OP1   . G   A 1  205  ? 128.820 192.485 129.203 1.00 343.15 ?  205  G   A OP1   1 
ATOM   4376  O  OP2   . G   A 1  205  ? 128.376 190.551 130.832 1.00 343.15 ?  205  G   A OP2   1 
ATOM   4377  O  "O5'" . G   A 1  205  ? 130.500 191.850 130.930 1.00 343.15 ?  205  G   A "O5'" 1 
ATOM   4378  C  "C5'" . G   A 1  205  ? 131.306 193.015 130.838 1.00 343.15 ?  205  G   A "C5'" 1 
ATOM   4379  C  "C4'" . G   A 1  205  ? 132.614 192.842 131.568 1.00 343.15 ?  205  G   A "C4'" 1 
ATOM   4380  O  "O4'" . G   A 1  205  ? 132.358 192.501 132.956 1.00 343.15 ?  205  G   A "O4'" 1 
ATOM   4381  C  "C3'" . G   A 1  205  ? 133.512 191.719 131.072 1.00 343.15 ?  205  G   A "C3'" 1 
ATOM   4382  O  "O3'" . G   A 1  205  ? 134.270 192.074 129.928 1.00 343.15 ?  205  G   A "O3'" 1 
ATOM   4383  C  "C2'" . G   A 1  205  ? 134.359 191.408 132.298 1.00 343.15 ?  205  G   A "C2'" 1 
ATOM   4384  O  "O2'" . G   A 1  205  ? 135.385 192.377 132.459 1.00 343.15 ?  205  G   A "O2'" 1 
ATOM   4385  C  "C1'" . G   A 1  205  ? 133.339 191.595 133.419 1.00 343.15 ?  205  G   A "C1'" 1 
ATOM   4386  N  N9    . G   A 1  205  ? 132.673 190.327 133.772 1.00 343.15 ?  205  G   A N9    1 
ATOM   4387  C  C8    . G   A 1  205  ? 131.410 189.926 133.406 1.00 343.15 ?  205  G   A C8    1 
ATOM   4388  N  N7    . G   A 1  205  ? 131.091 188.747 133.867 1.00 343.15 ?  205  G   A N7    1 
ATOM   4389  C  C5    . G   A 1  205  ? 132.211 188.343 134.580 1.00 343.15 ?  205  G   A C5    1 
ATOM   4390  C  C6    . G   A 1  205  ? 132.457 187.147 135.304 1.00 343.15 ?  205  G   A C6    1 
ATOM   4391  O  O6    . G   A 1  205  ? 131.708 186.176 135.465 1.00 343.15 ?  205  G   A O6    1 
ATOM   4392  N  N1    . G   A 1  205  ? 133.725 187.147 135.876 1.00 343.15 ?  205  G   A N1    1 
ATOM   4393  C  C2    . G   A 1  205  ? 134.640 188.165 135.767 1.00 343.15 ?  205  G   A C2    1 
ATOM   4394  N  N2    . G   A 1  205  ? 135.811 187.976 136.392 1.00 343.15 ?  205  G   A N2    1 
ATOM   4395  N  N3    . G   A 1  205  ? 134.424 189.284 135.095 1.00 343.15 ?  205  G   A N3    1 
ATOM   4396  C  C4    . G   A 1  205  ? 133.197 189.306 134.531 1.00 343.15 ?  205  G   A C4    1 
ATOM   4397  P  P     . G   A 1  206  ? 134.511 190.999 128.758 1.00 348.89 ?  206  G   A P     1 
ATOM   4398  O  OP1   . G   A 1  206  ? 135.530 191.550 127.829 1.00 348.89 ?  206  G   A OP1   1 
ATOM   4399  O  OP2   . G   A 1  206  ? 133.185 190.584 128.232 1.00 348.89 ?  206  G   A OP2   1 
ATOM   4400  O  "O5'" . G   A 1  206  ? 135.156 189.754 129.513 1.00 348.89 ?  206  G   A "O5'" 1 
ATOM   4401  C  "C5'" . G   A 1  206  ? 134.858 188.422 129.121 1.00 348.89 ?  206  G   A "C5'" 1 
ATOM   4402  C  "C4'" . G   A 1  206  ? 134.351 187.610 130.286 1.00 348.89 ?  206  G   A "C4'" 1 
ATOM   4403  O  "O4'" . G   A 1  206  ? 132.969 187.958 130.563 1.00 348.89 ?  206  G   A "O4'" 1 
ATOM   4404  C  "C3'" . G   A 1  206  ? 134.318 186.104 130.085 1.00 348.89 ?  206  G   A "C3'" 1 
ATOM   4405  O  "O3'" . G   A 1  206  ? 135.582 185.497 130.292 1.00 348.89 ?  206  G   A "O3'" 1 
ATOM   4406  C  "C2'" . G   A 1  206  ? 133.256 185.658 131.082 1.00 348.89 ?  206  G   A "C2'" 1 
ATOM   4407  O  "O2'" . G   A 1  206  ? 133.790 185.613 132.398 1.00 348.89 ?  206  G   A "O2'" 1 
ATOM   4408  C  "C1'" . G   A 1  206  ? 132.263 186.818 131.004 1.00 348.89 ?  206  G   A "C1'" 1 
ATOM   4409  N  N9    . G   A 1  206  ? 131.167 186.546 130.054 1.00 348.89 ?  206  G   A N9    1 
ATOM   4410  C  C8    . G   A 1  206  ? 131.055 187.003 128.763 1.00 348.89 ?  206  G   A C8    1 
ATOM   4411  N  N7    . G   A 1  206  ? 129.969 186.593 128.167 1.00 348.89 ?  206  G   A N7    1 
ATOM   4412  C  C5    . G   A 1  206  ? 129.323 185.819 129.121 1.00 348.89 ?  206  G   A C5    1 
ATOM   4413  C  C6    . G   A 1  206  ? 128.096 185.109 129.053 1.00 348.89 ?  206  G   A C6    1 
ATOM   4414  O  O6    . G   A 1  206  ? 127.307 185.021 128.104 1.00 348.89 ?  206  G   A O6    1 
ATOM   4415  N  N1    . G   A 1  206  ? 127.816 184.456 130.249 1.00 348.89 ?  206  G   A N1    1 
ATOM   4416  C  C2    . G   A 1  206  ? 128.612 184.479 131.367 1.00 348.89 ?  206  G   A C2    1 
ATOM   4417  N  N2    . G   A 1  206  ? 128.169 183.784 132.425 1.00 348.89 ?  206  G   A N2    1 
ATOM   4418  N  N3    . G   A 1  206  ? 129.758 185.136 131.443 1.00 348.89 ?  206  G   A N3    1 
ATOM   4419  C  C4    . G   A 1  206  ? 130.050 185.779 130.292 1.00 348.89 ?  206  G   A C4    1 
ATOM   4420  P  P     . G   A 1  207  ? 136.318 184.732 129.087 1.00 342.91 ?  207  G   A P     1 
ATOM   4421  O  OP1   . G   A 1  207  ? 137.784 184.848 129.295 1.00 342.91 ?  207  G   A OP1   1 
ATOM   4422  O  OP2   . G   A 1  207  ? 135.718 185.198 127.811 1.00 342.91 ?  207  G   A OP2   1 
ATOM   4423  O  "O5'" . G   A 1  207  ? 135.911 183.206 129.295 1.00 342.91 ?  207  G   A "O5'" 1 
ATOM   4424  C  "C5'" . G   A 1  207  ? 136.327 182.492 130.449 1.00 342.91 ?  207  G   A "C5'" 1 
ATOM   4425  C  "C4'" . G   A 1  207  ? 135.536 181.220 130.623 1.00 342.91 ?  207  G   A "C4'" 1 
ATOM   4426  O  "O4'" . G   A 1  207  ? 134.163 181.540 130.969 1.00 342.91 ?  207  G   A "O4'" 1 
ATOM   4427  C  "C3'" . G   A 1  207  ? 135.412 180.343 129.387 1.00 342.91 ?  207  G   A "C3'" 1 
ATOM   4428  O  "O3'" . G   A 1  207  ? 136.552 179.531 129.168 1.00 342.91 ?  207  G   A "O3'" 1 
ATOM   4429  C  "C2'" . G   A 1  207  ? 134.140 179.555 129.666 1.00 342.91 ?  207  G   A "C2'" 1 
ATOM   4430  O  "O2'" . G   A 1  207  ? 134.395 178.497 130.578 1.00 342.91 ?  207  G   A "O2'" 1 
ATOM   4431  C  "C1'" . G   A 1  207  ? 133.286 180.607 130.374 1.00 342.91 ?  207  G   A "C1'" 1 
ATOM   4432  N  N9    . G   A 1  207  ? 132.407 181.330 129.435 1.00 342.91 ?  207  G   A N9    1 
ATOM   4433  C  C8    . G   A 1  207  ? 132.568 182.615 128.976 1.00 342.91 ?  207  G   A C8    1 
ATOM   4434  N  N7    . G   A 1  207  ? 131.628 182.987 128.151 1.00 342.91 ?  207  G   A N7    1 
ATOM   4435  C  C5    . G   A 1  207  ? 130.795 181.881 128.058 1.00 342.91 ?  207  G   A C5    1 
ATOM   4436  C  C6    . G   A 1  207  ? 129.605 181.687 127.310 1.00 342.91 ?  207  G   A C6    1 
ATOM   4437  O  O6    . G   A 1  207  ? 129.031 182.480 126.554 1.00 342.91 ?  207  G   A O6    1 
ATOM   4438  N  N1    . G   A 1  207  ? 129.079 180.414 127.507 1.00 342.91 ?  207  G   A N1    1 
ATOM   4439  C  C2    . G   A 1  207  ? 129.626 179.451 128.320 1.00 342.91 ?  207  G   A C2    1 
ATOM   4440  N  N2    . G   A 1  207  ? 128.971 178.283 128.381 1.00 342.91 ?  207  G   A N2    1 
ATOM   4441  N  N3    . G   A 1  207  ? 130.734 179.620 129.023 1.00 342.91 ?  207  G   A N3    1 
ATOM   4442  C  C4    . G   A 1  207  ? 131.262 180.849 128.846 1.00 342.91 ?  207  G   A C4    1 
ATOM   4443  P  P     . G   A 1  208  ? 137.274 179.523 127.732 1.00 333.05 ?  208  G   A P     1 
ATOM   4444  O  OP1   . G   A 1  208  ? 138.714 179.227 127.943 1.00 333.05 ?  208  G   A OP1   1 
ATOM   4445  O  OP2   . G   A 1  208  ? 136.877 180.759 127.012 1.00 333.05 ?  208  G   A OP2   1 
ATOM   4446  O  "O5'" . G   A 1  208  ? 136.621 178.282 126.978 1.00 333.05 ?  208  G   A "O5'" 1 
ATOM   4447  C  "C5'" . G   A 1  208  ? 136.770 176.963 127.482 1.00 333.05 ?  208  G   A "C5'" 1 
ATOM   4448  C  "C4'" . G   A 1  208  ? 135.596 176.092 127.111 1.00 333.05 ?  208  G   A "C4'" 1 
ATOM   4449  O  "O4'" . G   A 1  208  ? 134.368 176.696 127.596 1.00 333.05 ?  208  G   A "O4'" 1 
ATOM   4450  C  "C3'" . G   A 1  208  ? 135.348 175.902 125.623 1.00 333.05 ?  208  G   A "C3'" 1 
ATOM   4451  O  "O3'" . G   A 1  208  ? 136.183 174.915 125.041 1.00 333.05 ?  208  G   A "O3'" 1 
ATOM   4452  C  "C2'" . G   A 1  208  ? 133.867 175.554 125.576 1.00 333.05 ?  208  G   A "C2'" 1 
ATOM   4453  O  "O2'" . G   A 1  208  ? 133.657 174.200 125.947 1.00 333.05 ?  208  G   A "O2'" 1 
ATOM   4454  C  "C1'" . G   A 1  208  ? 133.316 176.449 126.686 1.00 333.05 ?  208  G   A "C1'" 1 
ATOM   4455  N  N9    . G   A 1  208  ? 132.837 177.741 126.161 1.00 333.05 ?  208  G   A N9    1 
ATOM   4456  C  C8    . G   A 1  208  ? 133.501 178.944 126.178 1.00 333.05 ?  208  G   A C8    1 
ATOM   4457  N  N7    . G   A 1  208  ? 132.819 179.914 125.633 1.00 333.05 ?  208  G   A N7    1 
ATOM   4458  C  C5    . G   A 1  208  ? 131.634 179.315 125.229 1.00 333.05 ?  208  G   A C5    1 
ATOM   4459  C  C6    . G   A 1  208  ? 130.501 179.864 124.576 1.00 333.05 ?  208  G   A C6    1 
ATOM   4460  O  O6    . G   A 1  208  ? 130.312 181.031 124.211 1.00 333.05 ?  208  G   A O6    1 
ATOM   4461  N  N1    . G   A 1  208  ? 129.521 178.902 124.353 1.00 333.05 ?  208  G   A N1    1 
ATOM   4462  C  C2    . G   A 1  208  ? 129.616 177.580 124.712 1.00 333.05 ?  208  G   A C2    1 
ATOM   4463  N  N2    . G   A 1  208  ? 128.563 176.806 124.411 1.00 333.05 ?  208  G   A N2    1 
ATOM   4464  N  N3    . G   A 1  208  ? 130.666 177.055 125.321 1.00 333.05 ?  208  G   A N3    1 
ATOM   4465  C  C4    . G   A 1  208  ? 131.630 177.973 125.547 1.00 333.05 ?  208  G   A C4    1 
ATOM   4466  P  P     . A   A 1  209  ? 136.578 175.009 123.486 1.00 309.91 ?  209  A   A P     1 
ATOM   4467  O  OP1   . A   A 1  209  ? 137.731 174.103 123.250 1.00 309.91 ?  209  A   A OP1   1 
ATOM   4468  O  OP2   . A   A 1  209  ? 136.687 176.445 123.125 1.00 309.91 ?  209  A   A OP2   1 
ATOM   4469  O  "O5'" . A   A 1  209  ? 135.313 174.404 122.729 1.00 309.91 ?  209  A   A "O5'" 1 
ATOM   4470  C  "C5'" . A   A 1  209  ? 134.963 173.036 122.875 1.00 309.91 ?  209  A   A "C5'" 1 
ATOM   4471  C  "C4'" . A   A 1  209  ? 133.730 172.689 122.078 1.00 309.91 ?  209  A   A "C4'" 1 
ATOM   4472  O  "O4'" . A   A 1  209  ? 132.566 173.329 122.664 1.00 309.91 ?  209  A   A "O4'" 1 
ATOM   4473  C  "C3'" . A   A 1  209  ? 133.715 173.155 120.631 1.00 309.91 ?  209  A   A "C3'" 1 
ATOM   4474  O  "O3'" . A   A 1  209  ? 134.453 172.311 119.765 1.00 309.91 ?  209  A   A "O3'" 1 
ATOM   4475  C  "C2'" . A   A 1  209  ? 132.226 173.203 120.317 1.00 309.91 ?  209  A   A "C2'" 1 
ATOM   4476  O  "O2'" . A   A 1  209  ? 131.723 171.898 120.071 1.00 309.91 ?  209  A   A "O2'" 1 
ATOM   4477  C  "C1'" . A   A 1  209  ? 131.656 173.696 121.647 1.00 309.91 ?  209  A   A "C1'" 1 
ATOM   4478  N  N9    . A   A 1  209  ? 131.498 175.163 121.666 1.00 309.91 ?  209  A   A N9    1 
ATOM   4479  C  C8    . A   A 1  209  ? 132.247 176.080 122.362 1.00 309.91 ?  209  A   A C8    1 
ATOM   4480  N  N7    . A   A 1  209  ? 131.868 177.321 122.178 1.00 309.91 ?  209  A   A N7    1 
ATOM   4481  C  C5    . A   A 1  209  ? 130.797 177.213 121.301 1.00 309.91 ?  209  A   A C5    1 
ATOM   4482  C  C6    . A   A 1  209  ? 129.950 178.168 120.710 1.00 309.91 ?  209  A   A C6    1 
ATOM   4483  N  N6    . A   A 1  209  ? 130.055 179.480 120.925 1.00 309.91 ?  209  A   A N6    1 
ATOM   4484  N  N1    . A   A 1  209  ? 128.977 177.726 119.879 1.00 309.91 ?  209  A   A N1    1 
ATOM   4485  C  C2    . A   A 1  209  ? 128.863 176.410 119.657 1.00 309.91 ?  209  A   A C2    1 
ATOM   4486  N  N3    . A   A 1  209  ? 129.599 175.418 120.155 1.00 309.91 ?  209  A   A N3    1 
ATOM   4487  C  C4    . A   A 1  209  ? 130.557 175.889 120.976 1.00 309.91 ?  209  A   A C4    1 
ATOM   4488  P  P     . G   A 1  210  ? 135.373 172.949 118.612 1.00 284.66 ?  210  G   A P     1 
ATOM   4489  O  OP1   . G   A 1  210  ? 136.127 171.846 117.963 1.00 284.66 ?  210  G   A OP1   1 
ATOM   4490  O  OP2   . G   A 1  210  ? 136.110 174.098 119.196 1.00 284.66 ?  210  G   A OP2   1 
ATOM   4491  O  "O5'" . G   A 1  210  ? 134.328 173.520 117.553 1.00 284.66 ?  210  G   A "O5'" 1 
ATOM   4492  C  "C5'" . G   A 1  210  ? 133.495 172.645 116.807 1.00 284.66 ?  210  G   A "C5'" 1 
ATOM   4493  C  "C4'" . G   A 1  210  ? 132.512 173.406 115.953 1.00 284.66 ?  210  G   A "C4'" 1 
ATOM   4494  O  "O4'" . G   A 1  210  ? 131.597 174.153 116.795 1.00 284.66 ?  210  G   A "O4'" 1 
ATOM   4495  C  "C3'" . G   A 1  210  ? 133.101 174.459 115.028 1.00 284.66 ?  210  G   A "C3'" 1 
ATOM   4496  O  "O3'" . G   A 1  210  ? 133.639 173.911 113.837 1.00 284.66 ?  210  G   A "O3'" 1 
ATOM   4497  C  "C2'" . G   A 1  210  ? 131.921 175.391 114.793 1.00 284.66 ?  210  G   A "C2'" 1 
ATOM   4498  O  "O2'" . G   A 1  210  ? 131.028 174.840 113.835 1.00 284.66 ?  210  G   A "O2'" 1 
ATOM   4499  C  "C1'" . G   A 1  210  ? 131.238 175.364 116.161 1.00 284.66 ?  210  G   A "C1'" 1 
ATOM   4500  N  N9    . G   A 1  210  ? 131.662 176.489 117.015 1.00 284.66 ?  210  G   A N9    1 
ATOM   4501  C  C8    . G   A 1  210  ? 132.535 176.446 118.075 1.00 284.66 ?  210  G   A C8    1 
ATOM   4502  N  N7    . G   A 1  210  ? 132.715 177.610 118.638 1.00 284.66 ?  210  G   A N7    1 
ATOM   4503  C  C5    . G   A 1  210  ? 131.912 178.475 117.907 1.00 284.66 ?  210  G   A C5    1 
ATOM   4504  C  C6    . G   A 1  210  ? 131.693 179.870 118.049 1.00 284.66 ?  210  G   A C6    1 
ATOM   4505  O  O6    . G   A 1  210  ? 132.182 180.646 118.878 1.00 284.66 ?  210  G   A O6    1 
ATOM   4506  N  N1    . G   A 1  210  ? 130.801 180.348 117.094 1.00 284.66 ?  210  G   A N1    1 
ATOM   4507  C  C2    . G   A 1  210  ? 130.196 179.585 116.126 1.00 284.66 ?  210  G   A C2    1 
ATOM   4508  N  N2    . G   A 1  210  ? 129.365 180.232 115.296 1.00 284.66 ?  210  G   A N2    1 
ATOM   4509  N  N3    . G   A 1  210  ? 130.392 178.284 115.983 1.00 284.66 ?  210  G   A N3    1 
ATOM   4510  C  C4    . G   A 1  210  ? 131.255 177.798 116.900 1.00 284.66 ?  210  G   A C4    1 
ATOM   4511  P  P     . G   A 1  211  ? 134.819 174.675 113.057 1.00 259.44 ?  211  G   A P     1 
ATOM   4512  O  OP1   . G   A 1  211  ? 135.483 173.698 112.156 1.00 259.44 ?  211  G   A OP1   1 
ATOM   4513  O  OP2   . G   A 1  211  ? 135.626 175.418 114.057 1.00 259.44 ?  211  G   A OP2   1 
ATOM   4514  O  "O5'" . G   A 1  211  ? 134.055 175.741 112.151 1.00 259.44 ?  211  G   A "O5'" 1 
ATOM   4515  C  "C5'" . G   A 1  211  ? 133.109 175.324 111.178 1.00 259.44 ?  211  G   A "C5'" 1 
ATOM   4516  C  "C4'" . G   A 1  211  ? 132.338 176.493 110.617 1.00 259.44 ?  211  G   A "C4'" 1 
ATOM   4517  O  "O4'" . G   A 1  211  ? 131.597 177.148 111.679 1.00 259.44 ?  211  G   A "O4'" 1 
ATOM   4518  C  "C3'" . G   A 1  211  ? 133.170 177.609 110.006 1.00 259.44 ?  211  G   A "C3'" 1 
ATOM   4519  O  "O3'" . G   A 1  211  ? 133.587 177.326 108.681 1.00 259.44 ?  211  G   A "O3'" 1 
ATOM   4520  C  "C2'" . G   A 1  211  ? 132.242 178.811 110.110 1.00 259.44 ?  211  G   A "C2'" 1 
ATOM   4521  O  "O2'" . G   A 1  211  ? 131.263 178.780 109.082 1.00 259.44 ?  211  G   A "O2'" 1 
ATOM   4522  C  "C1'" . G   A 1  211  ? 131.547 178.540 111.445 1.00 259.44 ?  211  G   A "C1'" 1 
ATOM   4523  N  N9    . G   A 1  211  ? 132.214 179.229 112.567 1.00 259.44 ?  211  G   A N9    1 
ATOM   4524  C  C8    . G   A 1  211  ? 132.987 178.654 113.547 1.00 259.44 ?  211  G   A C8    1 
ATOM   4525  N  N7    . G   A 1  211  ? 133.444 179.518 114.412 1.00 259.44 ?  211  G   A N7    1 
ATOM   4526  C  C5    . G   A 1  211  ? 132.943 180.738 113.978 1.00 259.44 ?  211  G   A C5    1 
ATOM   4527  C  C6    . G   A 1  211  ? 133.102 182.041 114.516 1.00 259.44 ?  211  G   A C6    1 
ATOM   4528  O  O6    . G   A 1  211  ? 133.740 182.389 115.517 1.00 259.44 ?  211  G   A O6    1 
ATOM   4529  N  N1    . G   A 1  211  ? 132.423 182.993 113.762 1.00 259.44 ?  211  G   A N1    1 
ATOM   4530  C  C2    . G   A 1  211  ? 131.685 182.728 112.635 1.00 259.44 ?  211  G   A C2    1 
ATOM   4531  N  N2    . G   A 1  211  ? 131.103 183.783 112.046 1.00 259.44 ?  211  G   A N2    1 
ATOM   4532  N  N3    . G   A 1  211  ? 131.528 181.518 112.124 1.00 259.44 ?  211  G   A N3    1 
ATOM   4533  C  C4    . G   A 1  211  ? 132.180 180.577 112.840 1.00 259.44 ?  211  G   A C4    1 
ATOM   4534  P  P     . G   A 1  212  ? 134.985 177.899 108.133 1.00 239.45 ?  212  G   A P     1 
ATOM   4535  O  OP1   . G   A 1  212  ? 135.329 177.161 106.891 1.00 239.45 ?  212  G   A OP1   1 
ATOM   4536  O  OP2   . G   A 1  212  ? 135.948 177.922 109.264 1.00 239.45 ?  212  G   A OP2   1 
ATOM   4537  O  "O5'" . G   A 1  212  ? 134.656 179.406 107.736 1.00 239.45 ?  212  G   A "O5'" 1 
ATOM   4538  C  "C5'" . G   A 1  212  ? 133.702 179.704 106.727 1.00 239.45 ?  212  G   A "C5'" 1 
ATOM   4539  C  "C4'" . G   A 1  212  ? 133.367 181.174 106.699 1.00 239.45 ?  212  G   A "C4'" 1 
ATOM   4540  O  "O4'" . G   A 1  212  ? 132.790 181.569 107.971 1.00 239.45 ?  212  G   A "O4'" 1 
ATOM   4541  C  "C3'" . G   A 1  212  ? 134.544 182.121 106.516 1.00 239.45 ?  212  G   A "C3'" 1 
ATOM   4542  O  "O3'" . G   A 1  212  ? 134.942 182.254 105.163 1.00 239.45 ?  212  G   A "O3'" 1 
ATOM   4543  C  "C2'" . G   A 1  212  ? 134.028 183.414 107.132 1.00 239.45 ?  212  G   A "C2'" 1 
ATOM   4544  O  "O2'" . G   A 1  212  ? 133.156 184.084 106.234 1.00 239.45 ?  212  G   A "O2'" 1 
ATOM   4545  C  "C1'" . G   A 1  212  ? 133.199 182.880 108.300 1.00 239.45 ?  212  G   A "C1'" 1 
ATOM   4546  N  N9    . G   A 1  212  ? 133.980 182.824 109.551 1.00 239.45 ?  212  G   A N9    1 
ATOM   4547  C  C8    . G   A 1  212  ? 134.474 181.699 110.165 1.00 239.45 ?  212  G   A C8    1 
ATOM   4548  N  N7    . G   A 1  212  ? 135.128 181.959 111.264 1.00 239.45 ?  212  G   A N7    1 
ATOM   4549  C  C5    . G   A 1  212  ? 135.061 183.340 111.385 1.00 239.45 ?  212  G   A C5    1 
ATOM   4550  C  C6    . G   A 1  212  ? 135.589 184.201 112.381 1.00 239.45 ?  212  G   A C6    1 
ATOM   4551  O  O6    . G   A 1  212  ? 136.243 183.906 113.388 1.00 239.45 ?  212  G   A O6    1 
ATOM   4552  N  N1    . G   A 1  212  ? 135.288 185.534 112.116 1.00 239.45 ?  212  G   A N1    1 
ATOM   4553  C  C2    . G   A 1  212  ? 134.573 185.982 111.033 1.00 239.45 ?  212  G   A C2    1 
ATOM   4554  N  N2    . G   A 1  212  ? 134.387 187.308 110.954 1.00 239.45 ?  212  G   A N2    1 
ATOM   4555  N  N3    . G   A 1  212  ? 134.075 185.189 110.099 1.00 239.45 ?  212  G   A N3    1 
ATOM   4556  C  C4    . G   A 1  212  ? 134.355 183.890 110.335 1.00 239.45 ?  212  G   A C4    1 
ATOM   4557  P  P     . G   A 1  213  ? 136.502 182.329 104.783 1.00 217.15 ?  213  G   A P     1 
ATOM   4558  O  OP1   . G   A 1  213  ? 136.623 182.191 103.310 1.00 217.15 ?  213  G   A OP1   1 
ATOM   4559  O  OP2   . G   A 1  213  ? 137.237 181.392 105.671 1.00 217.15 ?  213  G   A OP2   1 
ATOM   4560  O  "O5'" . G   A 1  213  ? 136.925 183.814 105.176 1.00 217.15 ?  213  G   A "O5'" 1 
ATOM   4561  C  "C5'" . G   A 1  213  ? 136.356 184.933 104.514 1.00 217.15 ?  213  G   A "C5'" 1 
ATOM   4562  C  "C4'" . G   A 1  213  ? 136.667 186.220 105.236 1.00 217.15 ?  213  G   A "C4'" 1 
ATOM   4563  O  "O4'" . G   A 1  213  ? 136.091 186.188 106.567 1.00 217.15 ?  213  G   A "O4'" 1 
ATOM   4564  C  "C3'" . G   A 1  213  ? 138.141 186.509 105.478 1.00 217.15 ?  213  G   A "C3'" 1 
ATOM   4565  O  "O3'" . G   A 1  213  ? 138.790 187.064 104.346 1.00 217.15 ?  213  G   A "O3'" 1 
ATOM   4566  C  "C2'" . G   A 1  213  ? 138.103 187.445 106.678 1.00 217.15 ?  213  G   A "C2'" 1 
ATOM   4567  O  "O2'" . G   A 1  213  ? 137.759 188.763 106.276 1.00 217.15 ?  213  G   A "O2'" 1 
ATOM   4568  C  "C1'" . G   A 1  213  ? 136.935 186.864 107.475 1.00 217.15 ?  213  G   A "C1'" 1 
ATOM   4569  N  N9    . G   A 1  213  ? 137.386 185.903 108.500 1.00 217.15 ?  213  G   A N9    1 
ATOM   4570  C  C8    . G   A 1  213  ? 137.215 184.540 108.481 1.00 217.15 ?  213  G   A C8    1 
ATOM   4571  N  N7    . G   A 1  213  ? 137.718 183.944 109.527 1.00 217.15 ?  213  G   A N7    1 
ATOM   4572  C  C5    . G   A 1  213  ? 138.254 184.975 110.286 1.00 217.15 ?  213  G   A C5    1 
ATOM   4573  C  C6    . G   A 1  213  ? 138.932 184.941 111.532 1.00 217.15 ?  213  G   A C6    1 
ATOM   4574  O  O6    . G   A 1  213  ? 139.203 183.960 112.236 1.00 217.15 ?  213  G   A O6    1 
ATOM   4575  N  N1    . G   A 1  213  ? 139.308 186.215 111.946 1.00 217.15 ?  213  G   A N1    1 
ATOM   4576  C  C2    . G   A 1  213  ? 139.064 187.374 111.251 1.00 217.15 ?  213  G   A C2    1 
ATOM   4577  N  N2    . G   A 1  213  ? 139.505 188.507 111.817 1.00 217.15 ?  213  G   A N2    1 
ATOM   4578  N  N3    . G   A 1  213  ? 138.432 187.419 110.090 1.00 217.15 ?  213  G   A N3    1 
ATOM   4579  C  C4    . G   A 1  213  ? 138.057 186.192 109.667 1.00 217.15 ?  213  G   A C4    1 
ATOM   4580  P  P     . C   A 1  214  ? 140.272 186.585 103.945 1.00 192.29 ?  214  C   A P     1 
ATOM   4581  O  OP1   . C   A 1  214  ? 140.593 187.154 102.612 1.00 192.29 ?  214  C   A OP1   1 
ATOM   4582  O  OP2   . C   A 1  214  ? 140.351 185.117 104.155 1.00 192.29 ?  214  C   A OP2   1 
ATOM   4583  O  "O5'" . C   A 1  214  ? 141.214 187.288 105.021 1.00 192.29 ?  214  C   A "O5'" 1 
ATOM   4584  C  "C5'" . C   A 1  214  ? 141.310 188.703 105.095 1.00 192.29 ?  214  C   A "C5'" 1 
ATOM   4585  C  "C4'" . C   A 1  214  ? 141.911 189.148 106.405 1.00 192.29 ?  214  C   A "C4'" 1 
ATOM   4586  O  "O4'" . C   A 1  214  ? 141.141 188.597 107.505 1.00 192.29 ?  214  C   A "O4'" 1 
ATOM   4587  C  "C3'" . C   A 1  214  ? 143.333 188.682 106.679 1.00 192.29 ?  214  C   A "C3'" 1 
ATOM   4588  O  "O3'" . C   A 1  214  ? 144.311 189.484 106.037 1.00 192.29 ?  214  C   A "O3'" 1 
ATOM   4589  C  "C2'" . C   A 1  214  ? 143.412 188.722 108.202 1.00 192.29 ?  214  C   A "C2'" 1 
ATOM   4590  O  "O2'" . C   A 1  214  ? 143.643 190.046 108.658 1.00 192.29 ?  214  C   A "O2'" 1 
ATOM   4591  C  "C1'" . C   A 1  214  ? 141.990 188.314 108.598 1.00 192.29 ?  214  C   A "C1'" 1 
ATOM   4592  N  N1    . C   A 1  214  ? 141.875 186.874 108.944 1.00 192.29 ?  214  C   A N1    1 
ATOM   4593  C  C2    . C   A 1  214  ? 142.216 186.455 110.238 1.00 192.29 ?  214  C   A C2    1 
ATOM   4594  O  O2    . C   A 1  214  ? 142.614 187.288 111.068 1.00 192.29 ?  214  C   A O2    1 
ATOM   4595  N  N3    . C   A 1  214  ? 142.108 185.145 110.562 1.00 192.29 ?  214  C   A N3    1 
ATOM   4596  C  C4    . C   A 1  214  ? 141.677 184.262 109.661 1.00 192.29 ?  214  C   A C4    1 
ATOM   4597  N  N4    . C   A 1  214  ? 141.587 182.982 110.029 1.00 192.29 ?  214  C   A N4    1 
ATOM   4598  C  C5    . C   A 1  214  ? 141.317 184.653 108.340 1.00 192.29 ?  214  C   A C5    1 
ATOM   4599  C  C6    . C   A 1  214  ? 141.427 185.952 108.034 1.00 192.29 ?  214  C   A C6    1 
ATOM   4600  P  P     . C   A 1  215  ? 145.642 188.816 105.429 1.00 166.39 ?  215  C   A P     1 
ATOM   4601  O  OP1   . C   A 1  215  ? 146.597 189.906 105.103 1.00 166.39 ?  215  C   A OP1   1 
ATOM   4602  O  OP2   . C   A 1  215  ? 145.233 187.858 104.371 1.00 166.39 ?  215  C   A OP2   1 
ATOM   4603  O  "O5'" . C   A 1  215  ? 146.242 187.981 106.644 1.00 166.39 ?  215  C   A "O5'" 1 
ATOM   4604  C  "C5'" . C   A 1  215  ? 147.642 187.885 106.855 1.00 166.39 ?  215  C   A "C5'" 1 
ATOM   4605  C  "C4'" . C   A 1  215  ? 147.967 187.877 108.328 1.00 166.39 ?  215  C   A "C4'" 1 
ATOM   4606  O  "O4'" . C   A 1  215  ? 146.776 187.534 109.084 1.00 166.39 ?  215  C   A "O4'" 1 
ATOM   4607  C  "C3'" . C   A 1  215  ? 149.001 186.856 108.778 1.00 166.39 ?  215  C   A "C3'" 1 
ATOM   4608  O  "O3'" . C   A 1  215  ? 150.334 187.289 108.568 1.00 166.39 ?  215  C   A "O3'" 1 
ATOM   4609  C  "C2'" . C   A 1  215  ? 148.654 186.649 110.247 1.00 166.39 ?  215  C   A "C2'" 1 
ATOM   4610  O  "O2'" . C   A 1  215  ? 149.189 187.697 111.042 1.00 166.39 ?  215  C   A "O2'" 1 
ATOM   4611  C  "C1'" . C   A 1  215  ? 147.128 186.788 110.229 1.00 166.39 ?  215  C   A "C1'" 1 
ATOM   4612  N  N1    . C   A 1  215  ? 146.426 185.479 110.186 1.00 166.39 ?  215  C   A N1    1 
ATOM   4613  C  C2    . C   A 1  215  ? 146.250 184.751 111.372 1.00 166.39 ?  215  C   A C2    1 
ATOM   4614  O  O2    . C   A 1  215  ? 146.688 185.199 112.443 1.00 166.39 ?  215  C   A O2    1 
ATOM   4615  N  N3    . C   A 1  215  ? 145.604 183.562 111.329 1.00 166.39 ?  215  C   A N3    1 
ATOM   4616  C  C4    . C   A 1  215  ? 145.135 183.090 110.173 1.00 166.39 ?  215  C   A C4    1 
ATOM   4617  N  N4    . C   A 1  215  ? 144.506 181.913 110.182 1.00 166.39 ?  215  C   A N4    1 
ATOM   4618  C  C5    . C   A 1  215  ? 145.291 183.806 108.953 1.00 166.39 ?  215  C   A C5    1 
ATOM   4619  C  C6    . C   A 1  215  ? 145.930 184.980 109.010 1.00 166.39 ?  215  C   A C6    1 
ATOM   4620  P  P     . C   A 1  216  ? 151.421 186.288 107.935 1.00 151.99 ?  216  C   A P     1 
ATOM   4621  O  OP1   . C   A 1  216  ? 152.726 186.995 107.899 1.00 151.99 ?  216  C   A OP1   1 
ATOM   4622  O  OP2   . C   A 1  216  ? 150.853 185.722 106.685 1.00 151.99 ?  216  C   A OP2   1 
ATOM   4623  O  "O5'" . C   A 1  216  ? 151.536 185.110 109.001 1.00 151.99 ?  216  C   A "O5'" 1 
ATOM   4624  C  "C5'" . C   A 1  216  ? 152.158 185.323 110.260 1.00 151.99 ?  216  C   A "C5'" 1 
ATOM   4625  C  "C4'" . C   A 1  216  ? 152.087 184.090 111.125 1.00 151.99 ?  216  C   A "C4'" 1 
ATOM   4626  O  "O4'" . C   A 1  216  ? 150.698 183.745 111.374 1.00 151.99 ?  216  C   A "O4'" 1 
ATOM   4627  C  "C3'" . C   A 1  216  ? 152.677 182.823 110.527 1.00 151.99 ?  216  C   A "C3'" 1 
ATOM   4628  O  "O3'" . C   A 1  216  ? 154.089 182.760 110.638 1.00 151.99 ?  216  C   A "O3'" 1 
ATOM   4629  C  "C2'" . C   A 1  216  ? 151.950 181.723 111.290 1.00 151.99 ?  216  C   A "C2'" 1 
ATOM   4630  O  "O2'" . C   A 1  216  ? 152.528 181.537 112.574 1.00 151.99 ?  216  C   A "O2'" 1 
ATOM   4631  C  "C1'" . C   A 1  216  ? 150.560 182.342 111.470 1.00 151.99 ?  216  C   A "C1'" 1 
ATOM   4632  N  N1    . C   A 1  216  ? 149.584 181.877 110.451 1.00 151.99 ?  216  C   A N1    1 
ATOM   4633  C  C2    . C   A 1  216  ? 148.935 180.648 110.637 1.00 151.99 ?  216  C   A C2    1 
ATOM   4634  O  O2    . C   A 1  216  ? 149.186 179.965 111.642 1.00 151.99 ?  216  C   A O2    1 
ATOM   4635  N  N3    . C   A 1  216  ? 148.041 180.221 109.714 1.00 151.99 ?  216  C   A N3    1 
ATOM   4636  C  C4    . C   A 1  216  ? 147.778 180.964 108.638 1.00 151.99 ?  216  C   A C4    1 
ATOM   4637  N  N4    . C   A 1  216  ? 146.889 180.499 107.757 1.00 151.99 ?  216  C   A N4    1 
ATOM   4638  C  C5    . C   A 1  216  ? 148.416 182.217 108.419 1.00 151.99 ?  216  C   A C5    1 
ATOM   4639  C  C6    . C   A 1  216  ? 149.294 182.628 109.341 1.00 151.99 ?  216  C   A C6    1 
ATOM   4640  P  P     . G   A 1  217  ? 154.984 182.439 109.342 1.00 138.51 ?  217  G   A P     1 
ATOM   4641  O  OP1   . G   A 1  217  ? 156.385 182.827 109.645 1.00 138.51 ?  217  G   A OP1   1 
ATOM   4642  O  OP2   . G   A 1  217  ? 154.302 183.019 108.158 1.00 138.51 ?  217  G   A OP2   1 
ATOM   4643  O  "O5'" . G   A 1  217  ? 154.927 180.852 109.215 1.00 138.51 ?  217  G   A "O5'" 1 
ATOM   4644  C  "C5'" . G   A 1  217  ? 155.533 180.022 110.195 1.00 138.51 ?  217  G   A "C5'" 1 
ATOM   4645  C  "C4'" . G   A 1  217  ? 154.886 178.660 110.248 1.00 138.51 ?  217  G   A "C4'" 1 
ATOM   4646  O  "O4'" . G   A 1  217  ? 153.461 178.803 110.487 1.00 138.51 ?  217  G   A "O4'" 1 
ATOM   4647  C  "C3'" . G   A 1  217  ? 154.961 177.829 108.977 1.00 138.51 ?  217  G   A "C3'" 1 
ATOM   4648  O  "O3'" . G   A 1  217  ? 156.206 177.173 108.808 1.00 138.51 ?  217  G   A "O3'" 1 
ATOM   4649  C  "C2'" . G   A 1  217  ? 153.784 176.878 109.138 1.00 138.51 ?  217  G   A "C2'" 1 
ATOM   4650  O  "O2'" . G   A 1  217  ? 154.106 175.831 110.042 1.00 138.51 ?  217  G   A "O2'" 1 
ATOM   4651  C  "C1'" . G   A 1  217  ? 152.754 177.789 109.803 1.00 138.51 ?  217  G   A "C1'" 1 
ATOM   4652  N  N9    . G   A 1  217  ? 151.863 178.421 108.811 1.00 138.51 ?  217  G   A N9    1 
ATOM   4653  C  C8    . G   A 1  217  ? 151.921 179.710 108.338 1.00 138.51 ?  217  G   A C8    1 
ATOM   4654  N  N7    . G   A 1  217  ? 150.994 179.977 107.459 1.00 138.51 ?  217  G   A N7    1 
ATOM   4655  C  C5    . G   A 1  217  ? 150.282 178.791 107.340 1.00 138.51 ?  217  G   A C5    1 
ATOM   4656  C  C6    . G   A 1  217  ? 149.160 178.468 106.534 1.00 138.51 ?  217  G   A C6    1 
ATOM   4657  O  O6    . G   A 1  217  ? 148.550 179.190 105.736 1.00 138.51 ?  217  G   A O6    1 
ATOM   4658  N  N1    . G   A 1  217  ? 148.755 177.150 106.725 1.00 138.51 ?  217  G   A N1    1 
ATOM   4659  C  C2    . G   A 1  217  ? 149.352 176.257 107.580 1.00 138.51 ?  217  G   A C2    1 
ATOM   4660  N  N2    . G   A 1  217  ? 148.815 175.029 107.625 1.00 138.51 ?  217  G   A N2    1 
ATOM   4661  N  N3    . G   A 1  217  ? 150.398 176.546 108.337 1.00 138.51 ?  217  G   A N3    1 
ATOM   4662  C  C4    . G   A 1  217  ? 150.807 177.821 108.167 1.00 138.51 ?  217  G   A C4    1 
ATOM   4663  P  P     . G   A 1  218  ? 156.749 176.843 107.331 1.00 133.40 ?  218  G   A P     1 
ATOM   4664  O  OP1   . G   A 1  218  ? 158.186 176.485 107.429 1.00 133.40 ?  218  G   A OP1   1 
ATOM   4665  O  OP2   . G   A 1  218  ? 156.331 177.949 106.435 1.00 133.40 ?  218  G   A OP2   1 
ATOM   4666  O  "O5'" . G   A 1  218  ? 155.948 175.533 106.906 1.00 133.40 ?  218  G   A "O5'" 1 
ATOM   4667  C  "C5'" . G   A 1  218  ? 156.099 174.320 107.628 1.00 133.40 ?  218  G   A "C5'" 1 
ATOM   4668  C  "C4'" . G   A 1  218  ? 155.024 173.324 107.270 1.00 133.40 ?  218  G   A "C4'" 1 
ATOM   4669  O  "O4'" . G   A 1  218  ? 153.717 173.890 107.549 1.00 133.40 ?  218  G   A "O4'" 1 
ATOM   4670  C  "C3'" . G   A 1  218  ? 154.947 172.921 105.806 1.00 133.40 ?  218  G   A "C3'" 1 
ATOM   4671  O  "O3'" . G   A 1  218  ? 155.898 171.931 105.454 1.00 133.40 ?  218  G   A "O3'" 1 
ATOM   4672  C  "C2'" . G   A 1  218  ? 153.503 172.458 105.665 1.00 133.40 ?  218  G   A "C2'" 1 
ATOM   4673  O  "O2'" . G   A 1  218  ? 153.343 171.147 106.187 1.00 133.40 ?  218  G   A "O2'" 1 
ATOM   4674  C  "C1'" . G   A 1  218  ? 152.781 173.437 106.592 1.00 133.40 ?  218  G   A "C1'" 1 
ATOM   4675  N  N9    . G   A 1  218  ? 152.250 174.605 105.863 1.00 133.40 ?  218  G   A N9    1 
ATOM   4676  C  C8    . G   A 1  218  ? 152.758 175.881 105.865 1.00 133.40 ?  218  G   A C8    1 
ATOM   4677  N  N7    . G   A 1  218  ? 152.074 176.709 105.125 1.00 133.40 ?  218  G   A N7    1 
ATOM   4678  C  C5    . G   A 1  218  ? 151.050 175.934 104.599 1.00 133.40 ?  218  G   A C5    1 
ATOM   4679  C  C6    . G   A 1  218  ? 149.991 176.284 103.723 1.00 133.40 ?  218  G   A C6    1 
ATOM   4680  O  O6    . G   A 1  218  ? 149.739 177.385 103.219 1.00 133.40 ?  218  G   A O6    1 
ATOM   4681  N  N1    . G   A 1  218  ? 149.177 175.192 103.442 1.00 133.40 ?  218  G   A N1    1 
ATOM   4682  C  C2    . G   A 1  218  ? 149.356 173.925 103.941 1.00 133.40 ?  218  G   A C2    1 
ATOM   4683  N  N2    . G   A 1  218  ? 148.462 173.004 103.551 1.00 133.40 ?  218  G   A N2    1 
ATOM   4684  N  N3    . G   A 1  218  ? 150.339 173.585 104.759 1.00 133.40 ?  218  G   A N3    1 
ATOM   4685  C  C4    . G   A 1  218  ? 151.144 174.632 105.045 1.00 133.40 ?  218  G   A C4    1 
ATOM   4686  P  P     . C   A 1  219  ? 156.642 171.991 104.031 1.00 137.53 ?  219  C   A P     1 
ATOM   4687  O  OP1   . C   A 1  219  ? 157.916 171.237 104.146 1.00 137.53 ?  219  C   A OP1   1 
ATOM   4688  O  OP2   . C   A 1  219  ? 156.664 173.407 103.584 1.00 137.53 ?  219  C   A OP2   1 
ATOM   4689  O  "O5'" . C   A 1  219  ? 155.677 171.182 103.054 1.00 137.53 ?  219  C   A "O5'" 1 
ATOM   4690  C  "C5'" . C   A 1  219  ? 155.371 169.817 103.296 1.00 137.53 ?  219  C   A "C5'" 1 
ATOM   4691  C  "C4'" . C   A 1  219  ? 154.057 169.425 102.666 1.00 137.53 ?  219  C   A "C4'" 1 
ATOM   4692  O  "O4'" . C   A 1  219  ? 153.014 170.328 103.118 1.00 137.53 ?  219  C   A "O4'" 1 
ATOM   4693  C  "C3'" . C   A 1  219  ? 153.991 169.515 101.149 1.00 137.53 ?  219  C   A "C3'" 1 
ATOM   4694  O  "O3'" . C   A 1  219  ? 154.559 168.390 100.501 1.00 137.53 ?  219  C   A "O3'" 1 
ATOM   4695  C  "C2'" . C   A 1  219  ? 152.498 169.681 100.887 1.00 137.53 ?  219  C   A "C2'" 1 
ATOM   4696  O  "O2'" . C   A 1  219  ? 151.835 168.427 100.951 1.00 137.53 ?  219  C   A "O2'" 1 
ATOM   4697  C  "C1'" . C   A 1  219  ? 152.063 170.520 102.093 1.00 137.53 ?  219  C   A "C1'" 1 
ATOM   4698  N  N1    . C   A 1  219  ? 151.964 171.970 101.783 1.00 137.53 ?  219  C   A N1    1 
ATOM   4699  C  C2    . C   A 1  219  ? 150.782 172.457 101.207 1.00 137.53 ?  219  C   A C2    1 
ATOM   4700  O  O2    . C   A 1  219  ? 149.852 171.672 100.966 1.00 137.53 ?  219  C   A O2    1 
ATOM   4701  N  N3    . C   A 1  219  ? 150.676 173.776 100.924 1.00 137.53 ?  219  C   A N3    1 
ATOM   4702  C  C4    . C   A 1  219  ? 151.685 174.606 101.192 1.00 137.53 ?  219  C   A C4    1 
ATOM   4703  N  N4    . C   A 1  219  ? 151.532 175.898 100.894 1.00 137.53 ?  219  C   A N4    1 
ATOM   4704  C  C5    . C   A 1  219  ? 152.897 174.145 101.779 1.00 137.53 ?  219  C   A C5    1 
ATOM   4705  C  C6    . C   A 1  219  ? 152.988 172.839 102.056 1.00 137.53 ?  219  C   A C6    1 
ATOM   4706  P  P     . G   A 1  220  ? 155.466 168.584 99.188  1.00 142.68 ?  220  G   A P     1 
ATOM   4707  O  OP1   . G   A 1  220  ? 156.081 167.273 98.857  1.00 142.68 ?  220  G   A OP1   1 
ATOM   4708  O  OP2   . G   A 1  220  ? 156.335 169.769 99.402  1.00 142.68 ?  220  G   A OP2   1 
ATOM   4709  O  "O5'" . G   A 1  220  ? 154.420 168.941 98.040  1.00 142.68 ?  220  G   A "O5'" 1 
ATOM   4710  C  "C5'" . G   A 1  220  ? 153.472 167.983 97.590  1.00 142.68 ?  220  G   A "C5'" 1 
ATOM   4711  C  "C4'" . G   A 1  220  ? 152.354 168.635 96.816  1.00 142.68 ?  220  G   A "C4'" 1 
ATOM   4712  O  "O4'" . G   A 1  220  ? 151.682 169.607 97.658  1.00 142.68 ?  220  G   A "O4'" 1 
ATOM   4713  C  "C3'" . G   A 1  220  ? 152.770 169.432 95.588  1.00 142.68 ?  220  G   A "C3'" 1 
ATOM   4714  O  "O3'" . G   A 1  220  ? 152.980 168.618 94.446  1.00 142.68 ?  220  G   A "O3'" 1 
ATOM   4715  C  "C2'" . G   A 1  220  ? 151.626 170.425 95.431  1.00 142.68 ?  220  G   A "C2'" 1 
ATOM   4716  O  "O2'" . G   A 1  220  ? 150.502 169.805 94.824  1.00 142.68 ?  220  G   A "O2'" 1 
ATOM   4717  C  "C1'" . G   A 1  220  ? 151.283 170.722 96.890  1.00 142.68 ?  220  G   A "C1'" 1 
ATOM   4718  N  N9    . G   A 1  220  ? 151.993 171.914 97.394  1.00 142.68 ?  220  G   A N9    1 
ATOM   4719  C  C8    . G   A 1  220  ? 153.147 171.937 98.140  1.00 142.68 ?  220  G   A C8    1 
ATOM   4720  N  N7    . G   A 1  220  ? 153.540 173.144 98.441  1.00 142.68 ?  220  G   A N7    1 
ATOM   4721  C  C5    . G   A 1  220  ? 152.588 173.969 97.859  1.00 142.68 ?  220  G   A C5    1 
ATOM   4722  C  C6    . G   A 1  220  ? 152.483 175.384 97.846  1.00 142.68 ?  220  G   A C6    1 
ATOM   4723  O  O6    . G   A 1  220  ? 153.235 176.218 98.365  1.00 142.68 ?  220  G   A O6    1 
ATOM   4724  N  N1    . G   A 1  220  ? 151.362 175.807 97.140  1.00 142.68 ?  220  G   A N1    1 
ATOM   4725  C  C2    . G   A 1  220  ? 150.458 174.978 96.523  1.00 142.68 ?  220  G   A C2    1 
ATOM   4726  N  N2    . G   A 1  220  ? 149.441 175.579 95.889  1.00 142.68 ?  220  G   A N2    1 
ATOM   4727  N  N3    . G   A 1  220  ? 150.544 173.658 96.527  1.00 142.68 ?  220  G   A N3    1 
ATOM   4728  C  C4    . G   A 1  220  ? 151.626 173.225 97.208  1.00 142.68 ?  220  G   A C4    1 
ATOM   4729  P  P     . G   A 1  221  ? 153.789 169.190 93.180  1.00 143.81 ?  221  G   A P     1 
ATOM   4730  O  OP1   . G   A 1  221  ? 154.307 168.035 92.404  1.00 143.81 ?  221  G   A OP1   1 
ATOM   4731  O  OP2   . G   A 1  221  ? 154.731 170.228 93.670  1.00 143.81 ?  221  G   A OP2   1 
ATOM   4732  O  "O5'" . G   A 1  221  ? 152.672 169.912 92.304  1.00 143.81 ?  221  G   A "O5'" 1 
ATOM   4733  C  "C5'" . G   A 1  221  ? 153.020 170.666 91.148  1.00 143.81 ?  221  G   A "C5'" 1 
ATOM   4734  C  "C4'" . G   A 1  221  ? 152.180 171.914 91.026  1.00 143.81 ?  221  G   A "C4'" 1 
ATOM   4735  O  "O4'" . G   A 1  221  ? 152.305 172.691 92.248  1.00 143.81 ?  221  G   A "O4'" 1 
ATOM   4736  C  "C3'" . G   A 1  221  ? 152.570 172.849 89.885  1.00 143.81 ?  221  G   A "C3'" 1 
ATOM   4737  O  "O3'" . G   A 1  221  ? 151.402 173.496 89.379  1.00 143.81 ?  221  G   A "O3'" 1 
ATOM   4738  C  "C2'" . G   A 1  221  ? 153.467 173.869 90.579  1.00 143.81 ?  221  G   A "C2'" 1 
ATOM   4739  O  "O2'" . G   A 1  221  ? 153.544 175.121 89.931  1.00 143.81 ?  221  G   A "O2'" 1 
ATOM   4740  C  "C1'" . G   A 1  221  ? 152.804 173.981 91.950  1.00 143.81 ?  221  G   A "C1'" 1 
ATOM   4741  N  N9    . G   A 1  221  ? 153.725 174.368 93.022  1.00 143.81 ?  221  G   A N9    1 
ATOM   4742  C  C8    . G   A 1  221  ? 154.857 173.695 93.412  1.00 143.81 ?  221  G   A C8    1 
ATOM   4743  N  N7    . G   A 1  221  ? 155.485 174.272 94.400  1.00 143.81 ?  221  G   A N7    1 
ATOM   4744  C  C5    . G   A 1  221  ? 154.718 175.394 94.682  1.00 143.81 ?  221  G   A C5    1 
ATOM   4745  C  C6    . G   A 1  221  ? 154.902 176.407 95.658  1.00 143.81 ?  221  G   A C6    1 
ATOM   4746  O  O6    . G   A 1  221  ? 155.805 176.518 96.496  1.00 143.81 ?  221  G   A O6    1 
ATOM   4747  N  N1    . G   A 1  221  ? 153.891 177.360 95.601  1.00 143.81 ?  221  G   A N1    1 
ATOM   4748  C  C2    . G   A 1  221  ? 152.839 177.344 94.719  1.00 143.81 ?  221  G   A C2    1 
ATOM   4749  N  N2    . G   A 1  221  ? 151.967 178.357 94.825  1.00 143.81 ?  221  G   A N2    1 
ATOM   4750  N  N3    . G   A 1  221  ? 152.655 176.405 93.805  1.00 143.81 ?  221  G   A N3    1 
ATOM   4751  C  C4    . G   A 1  221  ? 153.626 175.468 93.842  1.00 143.81 ?  221  G   A C4    1 
ATOM   4752  P  P     . A   A 1  222  ? 150.742 172.998 88.001  1.00 158.95 ?  222  A   A P     1 
ATOM   4753  O  OP1   . A   A 1  222  ? 149.648 172.050 88.332  1.00 158.95 ?  222  A   A OP1   1 
ATOM   4754  O  OP2   . A   A 1  222  ? 151.839 172.564 87.100  1.00 158.95 ?  222  A   A OP2   1 
ATOM   4755  O  "O5'" . A   A 1  222  ? 150.089 174.313 87.383  1.00 158.95 ?  222  A   A "O5'" 1 
ATOM   4756  C  "C5'" . A   A 1  222  ? 148.675 174.495 87.371  1.00 158.95 ?  222  A   A "C5'" 1 
ATOM   4757  C  "C4'" . A   A 1  222  ? 148.269 175.881 86.916  1.00 158.95 ?  222  A   A "C4'" 1 
ATOM   4758  O  "O4'" . A   A 1  222  ? 148.816 176.877 87.823  1.00 158.95 ?  222  A   A "O4'" 1 
ATOM   4759  C  "C3'" . A   A 1  222  ? 148.717 176.291 85.511  1.00 158.95 ?  222  A   A "C3'" 1 
ATOM   4760  O  "O3'" . A   A 1  222  ? 147.717 177.123 84.927  1.00 158.95 ?  222  A   A "O3'" 1 
ATOM   4761  C  "C2'" . A   A 1  222  ? 149.949 177.148 85.790  1.00 158.95 ?  222  A   A "C2'" 1 
ATOM   4762  O  "O2'" . A   A 1  222  ? 150.261 178.078 84.774  1.00 158.95 ?  222  A   A "O2'" 1 
ATOM   4763  C  "C1'" . A   A 1  222  ? 149.545 177.840 87.087  1.00 158.95 ?  222  A   A "C1'" 1 
ATOM   4764  N  N9    . A   A 1  222  ? 150.667 178.297 87.909  1.00 158.95 ?  222  A   A N9    1 
ATOM   4765  C  C8    . A   A 1  222  ? 151.640 177.537 88.510  1.00 158.95 ?  222  A   A C8    1 
ATOM   4766  N  N7    . A   A 1  222  ? 152.507 178.241 89.194  1.00 158.95 ?  222  A   A N7    1 
ATOM   4767  C  C5    . A   A 1  222  ? 152.075 179.550 89.038  1.00 158.95 ?  222  A   A C5    1 
ATOM   4768  C  C6    . A   A 1  222  ? 152.562 180.781 89.516  1.00 158.95 ?  222  A   A C6    1 
ATOM   4769  N  N6    . A   A 1  222  ? 153.647 180.896 90.285  1.00 158.95 ?  222  A   A N6    1 
ATOM   4770  N  N1    . A   A 1  222  ? 151.892 181.905 89.172  1.00 158.95 ?  222  A   A N1    1 
ATOM   4771  C  C2    . A   A 1  222  ? 150.802 181.800 88.399  1.00 158.95 ?  222  A   A C2    1 
ATOM   4772  N  N3    . A   A 1  222  ? 150.249 180.699 87.892  1.00 158.95 ?  222  A   A N3    1 
ATOM   4773  C  C4    . A   A 1  222  ? 150.939 179.600 88.251  1.00 158.95 ?  222  A   A C4    1 
ATOM   4774  P  P     . U   A 1  223  ? 146.507 176.503 84.068  1.00 179.09 ?  223  U   A P     1 
ATOM   4775  O  OP1   . U   A 1  223  ? 145.529 175.877 84.996  1.00 179.09 ?  223  U   A OP1   1 
ATOM   4776  O  OP2   . U   A 1  223  ? 147.098 175.684 82.980  1.00 179.09 ?  223  U   A OP2   1 
ATOM   4777  O  "O5'" . U   A 1  223  ? 145.823 177.783 83.403  1.00 179.09 ?  223  U   A "O5'" 1 
ATOM   4778  C  "C5'" . U   A 1  223  ? 144.750 178.472 84.036  1.00 179.09 ?  223  U   A "C5'" 1 
ATOM   4779  C  "C4'" . U   A 1  223  ? 145.197 179.177 85.295  1.00 179.09 ?  223  U   A "C4'" 1 
ATOM   4780  O  "O4'" . U   A 1  223  ? 146.511 179.759 85.100  1.00 179.09 ?  223  U   A "O4'" 1 
ATOM   4781  C  "C3'" . U   A 1  223  ? 144.347 180.346 85.762  1.00 179.09 ?  223  U   A "C3'" 1 
ATOM   4782  O  "O3'" . U   A 1  223  ? 143.172 179.942 86.444  1.00 179.09 ?  223  U   A "O3'" 1 
ATOM   4783  C  "C2'" . U   A 1  223  ? 145.318 181.132 86.636  1.00 179.09 ?  223  U   A "C2'" 1 
ATOM   4784  O  "O2'" . U   A 1  223  ? 145.426 180.542 87.923  1.00 179.09 ?  223  U   A "O2'" 1 
ATOM   4785  C  "C1'" . U   A 1  223  ? 146.643 180.919 85.895  1.00 179.09 ?  223  U   A "C1'" 1 
ATOM   4786  N  N1    . U   A 1  223  ? 147.011 182.067 85.031  1.00 179.09 ?  223  U   A N1    1 
ATOM   4787  C  C2    . U   A 1  223  ? 147.667 183.128 85.628  1.00 179.09 ?  223  U   A C2    1 
ATOM   4788  O  O2    . U   A 1  223  ? 147.947 183.159 86.815  1.00 179.09 ?  223  U   A O2    1 
ATOM   4789  N  N3    . U   A 1  223  ? 147.989 184.163 84.786  1.00 179.09 ?  223  U   A N3    1 
ATOM   4790  C  C4    . U   A 1  223  ? 147.731 184.247 83.434  1.00 179.09 ?  223  U   A C4    1 
ATOM   4791  O  O4    . U   A 1  223  ? 148.084 185.250 82.811  1.00 179.09 ?  223  U   A O4    1 
ATOM   4792  C  C5    . U   A 1  223  ? 147.053 183.113 82.887  1.00 179.09 ?  223  U   A C5    1 
ATOM   4793  C  C6    . U   A 1  223  ? 146.728 182.088 83.683  1.00 179.09 ?  223  U   A C6    1 
ATOM   4794  P  P     . G   A 1  224  ? 141.811 180.779 86.272  1.00 201.80 ?  224  G   A P     1 
ATOM   4795  O  OP1   . G   A 1  224  ? 140.714 180.008 86.909  1.00 201.80 ?  224  G   A OP1   1 
ATOM   4796  O  OP2   . G   A 1  224  ? 141.695 181.180 84.847  1.00 201.80 ?  224  G   A OP2   1 
ATOM   4797  O  "O5'" . G   A 1  224  ? 142.053 182.096 87.135  1.00 201.80 ?  224  G   A "O5'" 1 
ATOM   4798  C  "C5'" . G   A 1  224  ? 142.197 182.025 88.547  1.00 201.80 ?  224  G   A "C5'" 1 
ATOM   4799  C  "C4'" . G   A 1  224  ? 142.722 183.318 89.118  1.00 201.80 ?  224  G   A "C4'" 1 
ATOM   4800  O  "O4'" . G   A 1  224  ? 144.039 183.599 88.576  1.00 201.80 ?  224  G   A "O4'" 1 
ATOM   4801  C  "C3'" . G   A 1  224  ? 141.918 184.568 88.796  1.00 201.80 ?  224  G   A "C3'" 1 
ATOM   4802  O  "O3'" . G   A 1  224  ? 140.782 184.723 89.628  1.00 201.80 ?  224  G   A "O3'" 1 
ATOM   4803  C  "C2'" . G   A 1  224  ? 142.950 185.676 88.958  1.00 201.80 ?  224  G   A "C2'" 1 
ATOM   4804  O  "O2'" . G   A 1  224  ? 143.150 185.980 90.330  1.00 201.80 ?  224  G   A "O2'" 1 
ATOM   4805  C  "C1'" . G   A 1  224  ? 144.211 184.993 88.426  1.00 201.80 ?  224  G   A "C1'" 1 
ATOM   4806  N  N9    . G   A 1  224  ? 144.442 185.291 87.000  1.00 201.80 ?  224  G   A N9    1 
ATOM   4807  C  C8    . G   A 1  224  ? 144.224 184.457 85.931  1.00 201.80 ?  224  G   A C8    1 
ATOM   4808  N  N7    . G   A 1  224  ? 144.525 185.002 84.784  1.00 201.80 ?  224  G   A N7    1 
ATOM   4809  C  C5    . G   A 1  224  ? 144.967 186.275 85.115  1.00 201.80 ?  224  G   A C5    1 
ATOM   4810  C  C6    . G   A 1  224  ? 145.428 187.332 84.288  1.00 201.80 ?  224  G   A C6    1 
ATOM   4811  O  O6    . G   A 1  224  ? 145.541 187.354 83.056  1.00 201.80 ?  224  G   A O6    1 
ATOM   4812  N  N1    . G   A 1  224  ? 145.777 188.452 85.035  1.00 201.80 ?  224  G   A N1    1 
ATOM   4813  C  C2    . G   A 1  224  ? 145.695 188.546 86.403  1.00 201.80 ?  224  G   A C2    1 
ATOM   4814  N  N2    . G   A 1  224  ? 146.080 189.712 86.941  1.00 201.80 ?  224  G   A N2    1 
ATOM   4815  N  N3    . G   A 1  224  ? 145.268 187.568 87.185  1.00 201.80 ?  224  G   A N3    1 
ATOM   4816  C  C4    . G   A 1  224  ? 144.922 186.470 86.479  1.00 201.80 ?  224  G   A C4    1 
ATOM   4817  P  P     . C   A 1  225  ? 139.466 185.459 89.071  1.00 222.76 ?  225  C   A P     1 
ATOM   4818  O  OP1   . C   A 1  225  ? 138.339 185.140 89.984  1.00 222.76 ?  225  C   A OP1   1 
ATOM   4819  O  OP2   . C   A 1  225  ? 139.346 185.154 87.622  1.00 222.76 ?  225  C   A OP2   1 
ATOM   4820  O  "O5'" . C   A 1  225  ? 139.799 187.010 89.221  1.00 222.76 ?  225  C   A "O5'" 1 
ATOM   4821  C  "C5'" . C   A 1  225  ? 140.096 187.571 90.491  1.00 222.76 ?  225  C   A "C5'" 1 
ATOM   4822  C  "C4'" . C   A 1  225  ? 140.710 188.942 90.360  1.00 222.76 ?  225  C   A "C4'" 1 
ATOM   4823  O  "O4'" . C   A 1  225  ? 141.943 188.859 89.598  1.00 222.76 ?  225  C   A "O4'" 1 
ATOM   4824  C  "C3'" . C   A 1  225  ? 139.883 189.972 89.608  1.00 222.76 ?  225  C   A "C3'" 1 
ATOM   4825  O  "O3'" . C   A 1  225  ? 138.866 190.554 90.404  1.00 222.76 ?  225  C   A "O3'" 1 
ATOM   4826  C  "C2'" . C   A 1  225  ? 140.937 190.965 89.133  1.00 222.76 ?  225  C   A "C2'" 1 
ATOM   4827  O  "O2'" . C   A 1  225  ? 141.299 191.852 90.182  1.00 222.76 ?  225  C   A "O2'" 1 
ATOM   4828  C  "C1'" . C   A 1  225  ? 142.126 190.042 88.848  1.00 222.76 ?  225  C   A "C1'" 1 
ATOM   4829  N  N1    . C   A 1  225  ? 142.254 189.694 87.410  1.00 222.76 ?  225  C   A N1    1 
ATOM   4830  C  C2    . C   A 1  225  ? 142.921 190.584 86.556  1.00 222.76 ?  225  C   A C2    1 
ATOM   4831  O  O2    . C   A 1  225  ? 143.385 191.640 87.014  1.00 222.76 ?  225  C   A O2    1 
ATOM   4832  N  N3    . C   A 1  225  ? 143.048 190.277 85.244  1.00 222.76 ?  225  C   A N3    1 
ATOM   4833  C  C4    . C   A 1  225  ? 142.546 189.138 84.768  1.00 222.76 ?  225  C   A C4    1 
ATOM   4834  N  N4    . C   A 1  225  ? 142.696 188.882 83.466  1.00 222.76 ?  225  C   A N4    1 
ATOM   4835  C  C5    . C   A 1  225  ? 141.866 188.210 85.607  1.00 222.76 ?  225  C   A C5    1 
ATOM   4836  C  C6    . C   A 1  225  ? 141.750 188.525 86.903  1.00 222.76 ?  225  C   A C6    1 
ATOM   4837  P  P     . C   A 1  226  ? 137.353 190.611 89.864  1.00 248.86 ?  226  C   A P     1 
ATOM   4838  O  OP1   . C   A 1  226  ? 136.446 190.644 91.040  1.00 248.86 ?  226  C   A OP1   1 
ATOM   4839  O  OP2   . C   A 1  226  ? 137.190 189.548 88.841  1.00 248.86 ?  226  C   A OP2   1 
ATOM   4840  O  "O5'" . C   A 1  226  ? 137.260 192.021 89.129  1.00 248.86 ?  226  C   A "O5'" 1 
ATOM   4841  C  "C5'" . C   A 1  226  ? 137.437 193.231 89.851  1.00 248.86 ?  226  C   A "C5'" 1 
ATOM   4842  C  "C4'" . C   A 1  226  ? 137.815 194.370 88.939  1.00 248.86 ?  226  C   A "C4'" 1 
ATOM   4843  O  "O4'" . C   A 1  226  ? 139.083 194.083 88.295  1.00 248.86 ?  226  C   A "O4'" 1 
ATOM   4844  C  "C3'" . C   A 1  226  ? 136.868 194.642 87.781  1.00 248.86 ?  226  C   A "C3'" 1 
ATOM   4845  O  "O3'" . C   A 1  226  ? 135.731 195.397 88.165  1.00 248.86 ?  226  C   A "O3'" 1 
ATOM   4846  C  "C2'" . C   A 1  226  ? 137.764 195.354 86.773  1.00 248.86 ?  226  C   A "C2'" 1 
ATOM   4847  O  "O2'" . C   A 1  226  ? 137.908 196.726 87.111  1.00 248.86 ?  226  C   A "O2'" 1 
ATOM   4848  C  "C1'" . C   A 1  226  ? 139.108 194.655 87.004  1.00 248.86 ?  226  C   A "C1'" 1 
ATOM   4849  N  N1    . C   A 1  226  ? 139.389 193.595 86.003  1.00 248.86 ?  226  C   A N1    1 
ATOM   4850  C  C2    . C   A 1  226  ? 139.988 193.962 84.792  1.00 248.86 ?  226  C   A C2    1 
ATOM   4851  O  O2    . C   A 1  226  ? 140.261 195.154 84.586  1.00 248.86 ?  226  C   A O2    1 
ATOM   4852  N  N3    . C   A 1  226  ? 140.256 193.010 83.868  1.00 248.86 ?  226  C   A N3    1 
ATOM   4853  C  C4    . C   A 1  226  ? 139.955 191.734 84.112  1.00 248.86 ?  226  C   A C4    1 
ATOM   4854  N  N4    . C   A 1  226  ? 140.239 190.832 83.169  1.00 248.86 ?  226  C   A N4    1 
ATOM   4855  C  C5    . C   A 1  226  ? 139.349 191.327 85.334  1.00 248.86 ?  226  C   A C5    1 
ATOM   4856  C  C6    . C   A 1  226  ? 139.091 192.279 86.240  1.00 248.86 ?  226  C   A C6    1 
ATOM   4857  P  P     . U   A 1  227  ? 134.269 194.983 87.642  1.00 277.00 ?  227  U   A P     1 
ATOM   4858  O  OP1   . U   A 1  227  ? 133.267 195.543 88.584  1.00 277.00 ?  227  U   A OP1   1 
ATOM   4859  O  OP2   . U   A 1  227  ? 134.278 193.525 87.361  1.00 277.00 ?  227  U   A OP2   1 
ATOM   4860  O  "O5'" . U   A 1  227  ? 134.125 195.751 86.254  1.00 277.00 ?  227  U   A "O5'" 1 
ATOM   4861  C  "C5'" . U   A 1  227  ? 134.264 197.166 86.185  1.00 277.00 ?  227  U   A "C5'" 1 
ATOM   4862  C  "C4'" . U   A 1  227  ? 134.603 197.637 84.790  1.00 277.00 ?  227  U   A "C4'" 1 
ATOM   4863  O  "O4'" . U   A 1  227  ? 135.648 196.790 84.238  1.00 277.00 ?  227  U   A "O4'" 1 
ATOM   4864  C  "C3'" . U   A 1  227  ? 133.454 197.610 83.782  1.00 277.00 ?  227  U   A "C3'" 1 
ATOM   4865  O  "O3'" . U   A 1  227  ? 133.589 198.709 82.883  1.00 277.00 ?  227  U   A "O3'" 1 
ATOM   4866  C  "C2'" . U   A 1  227  ? 133.697 196.307 83.026  1.00 277.00 ?  227  U   A "C2'" 1 
ATOM   4867  O  "O2'" . U   A 1  227  ? 133.152 196.273 81.724  1.00 277.00 ?  227  U   A "O2'" 1 
ATOM   4868  C  "C1'" . U   A 1  227  ? 135.221 196.244 83.005  1.00 277.00 ?  227  U   A "C1'" 1 
ATOM   4869  N  N1    . U   A 1  227  ? 135.759 194.880 82.896  1.00 277.00 ?  227  U   A N1    1 
ATOM   4870  C  C2    . U   A 1  227  ? 136.546 194.584 81.801  1.00 277.00 ?  227  U   A C2    1 
ATOM   4871  O  O2    . U   A 1  227  ? 136.809 195.401 80.935  1.00 277.00 ?  227  U   A O2    1 
ATOM   4872  N  N3    . U   A 1  227  ? 137.015 193.295 81.758  1.00 277.00 ?  227  U   A N3    1 
ATOM   4873  C  C4    . U   A 1  227  ? 136.780 192.294 82.679  1.00 277.00 ?  227  U   A C4    1 
ATOM   4874  O  O4    . U   A 1  227  ? 137.273 191.179 82.500  1.00 277.00 ?  227  U   A O4    1 
ATOM   4875  C  C5    . U   A 1  227  ? 135.955 192.680 83.782  1.00 277.00 ?  227  U   A C5    1 
ATOM   4876  C  C6    . U   A 1  227  ? 135.484 193.930 83.851  1.00 277.00 ?  227  U   A C6    1 
ATOM   4877  P  P     . C   A 1  228  ? 132.692 200.028 83.074  1.00 310.59 ?  228  C   A P     1 
ATOM   4878  O  OP1   . C   A 1  228  ? 131.886 199.864 84.311  1.00 310.59 ?  228  C   A OP1   1 
ATOM   4879  O  OP2   . C   A 1  228  ? 132.010 200.311 81.785  1.00 310.59 ?  228  C   A OP2   1 
ATOM   4880  O  "O5'" . C   A 1  228  ? 133.761 201.181 83.329  1.00 310.59 ?  228  C   A "O5'" 1 
ATOM   4881  C  "C5'" . C   A 1  228  ? 133.719 202.392 82.589  1.00 310.59 ?  228  C   A "C5'" 1 
ATOM   4882  C  "C4'" . C   A 1  228  ? 134.899 202.501 81.656  1.00 310.59 ?  228  C   A "C4'" 1 
ATOM   4883  O  "O4'" . C   A 1  228  ? 134.809 203.728 80.886  1.00 310.59 ?  228  C   A "O4'" 1 
ATOM   4884  C  "C3'" . C   A 1  228  ? 136.267 202.581 82.316  1.00 310.59 ?  228  C   A "C3'" 1 
ATOM   4885  O  "O3'" . C   A 1  228  ? 136.760 201.314 82.716  1.00 310.59 ?  228  C   A "O3'" 1 
ATOM   4886  C  "C2'" . C   A 1  228  ? 137.116 203.258 81.246  1.00 310.59 ?  228  C   A "C2'" 1 
ATOM   4887  O  "O2'" . C   A 1  228  ? 137.527 202.319 80.264  1.00 310.59 ?  228  C   A "O2'" 1 
ATOM   4888  C  "C1'" . C   A 1  228  ? 136.104 204.216 80.606  1.00 310.59 ?  228  C   A "C1'" 1 
ATOM   4889  N  N1    . C   A 1  228  ? 136.223 205.606 81.113  1.00 310.59 ?  228  C   A N1    1 
ATOM   4890  C  C2    . C   A 1  228  ? 137.172 206.456 80.531  1.00 310.59 ?  228  C   A C2    1 
ATOM   4891  O  O2    . C   A 1  228  ? 137.892 206.032 79.614  1.00 310.59 ?  228  C   A O2    1 
ATOM   4892  N  N3    . C   A 1  228  ? 137.288 207.728 80.981  1.00 310.59 ?  228  C   A N3    1 
ATOM   4893  C  C4    . C   A 1  228  ? 136.505 208.166 81.966  1.00 310.59 ?  228  C   A C4    1 
ATOM   4894  N  N4    . C   A 1  228  ? 136.658 209.428 82.375  1.00 310.59 ?  228  C   A N4    1 
ATOM   4895  C  C5    . C   A 1  228  ? 135.528 207.329 82.577  1.00 310.59 ?  228  C   A C5    1 
ATOM   4896  C  C6    . C   A 1  228  ? 135.422 206.074 82.121  1.00 310.59 ?  228  C   A C6    1 
ATOM   4897  P  P     . C   A 1  229  ? 137.443 201.128 84.159  1.00 302.67 ?  229  C   A P     1 
ATOM   4898  O  OP1   . C   A 1  229  ? 137.408 199.684 84.502  1.00 302.67 ?  229  C   A OP1   1 
ATOM   4899  O  OP2   . C   A 1  229  ? 136.836 202.117 85.085  1.00 302.67 ?  229  C   A OP2   1 
ATOM   4900  O  "O5'" . C   A 1  229  ? 138.963 201.542 83.924  1.00 302.67 ?  229  C   A "O5'" 1 
ATOM   4901  C  "C5'" . C   A 1  229  ? 139.754 200.886 82.943  1.00 302.67 ?  229  C   A "C5'" 1 
ATOM   4902  C  "C4'" . C   A 1  229  ? 140.898 201.754 82.485  1.00 302.67 ?  229  C   A "C4'" 1 
ATOM   4903  O  "O4'" . C   A 1  229  ? 140.388 203.045 82.057  1.00 302.67 ?  229  C   A "O4'" 1 
ATOM   4904  C  "C3'" . C   A 1  229  ? 141.937 202.103 83.541  1.00 302.67 ?  229  C   A "C3'" 1 
ATOM   4905  O  "O3'" . C   A 1  229  ? 142.886 201.072 83.754  1.00 302.67 ?  229  C   A "O3'" 1 
ATOM   4906  C  "C2'" . C   A 1  229  ? 142.545 203.389 82.998  1.00 302.67 ?  229  C   A "C2'" 1 
ATOM   4907  O  "O2'" . C   A 1  229  ? 143.492 203.106 81.979  1.00 302.67 ?  229  C   A "O2'" 1 
ATOM   4908  C  "C1'" . C   A 1  229  ? 141.327 204.058 82.354  1.00 302.67 ?  229  C   A "C1'" 1 
ATOM   4909  N  N1    . C   A 1  229  ? 140.691 205.071 83.236  1.00 302.67 ?  229  C   A N1    1 
ATOM   4910  C  C2    . C   A 1  229  ? 141.234 206.363 83.296  1.00 302.67 ?  229  C   A C2    1 
ATOM   4911  O  O2    . C   A 1  229  ? 142.236 206.643 82.620  1.00 302.67 ?  229  C   A O2    1 
ATOM   4912  N  N3    . C   A 1  229  ? 140.656 207.290 84.095  1.00 302.67 ?  229  C   A N3    1 
ATOM   4913  C  C4    . C   A 1  229  ? 139.578 206.981 84.816  1.00 302.67 ?  229  C   A C4    1 
ATOM   4914  N  N4    . C   A 1  229  ? 139.046 207.931 85.589  1.00 302.67 ?  229  C   A N4    1 
ATOM   4915  C  C5    . C   A 1  229  ? 138.998 205.682 84.777  1.00 302.67 ?  229  C   A C5    1 
ATOM   4916  C  C6    . C   A 1  229  ? 139.578 204.775 83.981  1.00 302.67 ?  229  C   A C6    1 
ATOM   4917  P  P     . U   A 1  230  ? 143.576 200.894 85.195  1.00 292.25 ?  230  U   A P     1 
ATOM   4918  O  OP1   . U   A 1  230  ? 144.233 199.563 85.227  1.00 292.25 ?  230  U   A OP1   1 
ATOM   4919  O  OP2   . U   A 1  230  ? 142.571 201.242 86.231  1.00 292.25 ?  230  U   A OP2   1 
ATOM   4920  O  "O5'" . U   A 1  230  ? 144.717 202.006 85.221  1.00 292.25 ?  230  U   A "O5'" 1 
ATOM   4921  C  "C5'" . U   A 1  230  ? 145.846 201.911 84.364  1.00 292.25 ?  230  U   A "C5'" 1 
ATOM   4922  C  "C4'" . U   A 1  230  ? 146.585 203.223 84.264  1.00 292.25 ?  230  U   A "C4'" 1 
ATOM   4923  O  "O4'" . U   A 1  230  ? 145.667 204.274 83.865  1.00 292.25 ?  230  U   A "O4'" 1 
ATOM   4924  C  "C3'" . U   A 1  230  ? 147.205 203.749 85.549  1.00 292.25 ?  230  U   A "C3'" 1 
ATOM   4925  O  "O3'" . U   A 1  230  ? 148.441 203.133 85.868  1.00 292.25 ?  230  U   A "O3'" 1 
ATOM   4926  C  "C2'" . U   A 1  230  ? 147.322 205.243 85.273  1.00 292.25 ?  230  U   A "C2'" 1 
ATOM   4927  O  "O2'" . U   A 1  230  ? 148.457 205.517 84.465  1.00 292.25 ?  230  U   A "O2'" 1 
ATOM   4928  C  "C1'" . U   A 1  230  ? 146.062 205.503 84.441  1.00 292.25 ?  230  U   A "C1'" 1 
ATOM   4929  N  N1    . U   A 1  230  ? 144.944 206.050 85.251  1.00 292.25 ?  230  U   A N1    1 
ATOM   4930  C  C2    . U   A 1  230  ? 144.919 207.419 85.453  1.00 292.25 ?  230  U   A C2    1 
ATOM   4931  O  O2    . U   A 1  230  ? 145.762 208.175 85.001  1.00 292.25 ?  230  U   A O2    1 
ATOM   4932  N  N3    . U   A 1  230  ? 143.867 207.880 86.206  1.00 292.25 ?  230  U   A N3    1 
ATOM   4933  C  C4    . U   A 1  230  ? 142.853 207.133 86.769  1.00 292.25 ?  230  U   A C4    1 
ATOM   4934  O  O4    . U   A 1  230  ? 141.974 207.696 87.422  1.00 292.25 ?  230  U   A O4    1 
ATOM   4935  C  C5    . U   A 1  230  ? 142.944 205.728 86.518  1.00 292.25 ?  230  U   A C5    1 
ATOM   4936  C  C6    . U   A 1  230  ? 143.957 205.251 85.787  1.00 292.25 ?  230  U   A C6    1 
ATOM   4937  P  P     . U   A 1  231  ? 148.877 202.948 87.405  1.00 284.31 ?  231  U   A P     1 
ATOM   4938  O  OP1   . U   A 1  231  ? 149.994 201.971 87.450  1.00 284.31 ?  231  U   A OP1   1 
ATOM   4939  O  OP2   . U   A 1  231  ? 147.650 202.697 88.203  1.00 284.31 ?  231  U   A OP2   1 
ATOM   4940  O  "O5'" . U   A 1  231  ? 149.453 204.375 87.822  1.00 284.31 ?  231  U   A "O5'" 1 
ATOM   4941  C  "C5'" . U   A 1  231  ? 150.682 204.847 87.291  1.00 284.31 ?  231  U   A "C5'" 1 
ATOM   4942  C  "C4'" . U   A 1  231  ? 150.825 206.341 87.454  1.00 284.31 ?  231  U   A "C4'" 1 
ATOM   4943  O  "O4'" . U   A 1  231  ? 149.645 207.006 86.933  1.00 284.31 ?  231  U   A "O4'" 1 
ATOM   4944  C  "C3'" . U   A 1  231  ? 150.936 206.858 88.880  1.00 284.31 ?  231  U   A "C3'" 1 
ATOM   4945  O  "O3'" . U   A 1  231  ? 152.237 206.724 89.425  1.00 284.31 ?  231  U   A "O3'" 1 
ATOM   4946  C  "C2'" . U   A 1  231  ? 150.477 208.305 88.745  1.00 284.31 ?  231  U   A "C2'" 1 
ATOM   4947  O  "O2'" . U   A 1  231  ? 151.524 209.118 88.237  1.00 284.31 ?  231  U   A "O2'" 1 
ATOM   4948  C  "C1'" . U   A 1  231  ? 149.393 208.185 87.669  1.00 284.31 ?  231  U   A "C1'" 1 
ATOM   4949  N  N1    . U   A 1  231  ? 148.024 208.126 88.241  1.00 284.31 ?  231  U   A N1    1 
ATOM   4950  C  C2    . U   A 1  231  ? 147.404 209.331 88.520  1.00 284.31 ?  231  U   A C2    1 
ATOM   4951  O  O2    . U   A 1  231  ? 147.929 210.413 88.318  1.00 284.31 ?  231  U   A O2    1 
ATOM   4952  N  N3    . U   A 1  231  ? 146.139 209.230 89.045  1.00 284.31 ?  231  U   A N3    1 
ATOM   4953  C  C4    . U   A 1  231  ? 145.439 208.074 89.318  1.00 284.31 ?  231  U   A C4    1 
ATOM   4954  O  O4    . U   A 1  231  ? 144.305 208.148 89.793  1.00 284.31 ?  231  U   A O4    1 
ATOM   4955  C  C5    . U   A 1  231  ? 146.142 206.869 89.004  1.00 284.31 ?  231  U   A C5    1 
ATOM   4956  C  C6    . U   A 1  231  ? 147.374 206.937 88.490  1.00 284.31 ?  231  U   A C6    1 
ATOM   4957  P  P     . U   A 1  232  ? 152.446 206.706 91.019  1.00 275.85 ?  232  U   A P     1 
ATOM   4958  O  OP1   . U   A 1  232  ? 153.765 206.085 91.302  1.00 275.85 ?  232  U   A OP1   1 
ATOM   4959  O  OP2   . U   A 1  232  ? 151.221 206.138 91.636  1.00 275.85 ?  232  U   A OP2   1 
ATOM   4960  O  "O5'" . U   A 1  232  ? 152.531 208.246 91.420  1.00 275.85 ?  232  U   A "O5'" 1 
ATOM   4961  C  "C5'" . U   A 1  232  ? 153.600 209.060 90.960  1.00 275.85 ?  232  U   A "C5'" 1 
ATOM   4962  C  "C4'" . U   A 1  232  ? 153.329 210.526 91.188  1.00 275.85 ?  232  U   A "C4'" 1 
ATOM   4963  O  "O4'" . U   A 1  232  ? 152.094 210.909 90.529  1.00 275.85 ?  232  U   A "O4'" 1 
ATOM   4964  C  "C3'" . U   A 1  232  ? 153.121 210.958 92.631  1.00 275.85 ?  232  U   A "C3'" 1 
ATOM   4965  O  "O3'" . U   A 1  232  ? 154.336 211.116 93.345  1.00 275.85 ?  232  U   A "O3'" 1 
ATOM   4966  C  "C2'" . U   A 1  232  ? 152.330 212.253 92.481  1.00 275.85 ?  232  U   A "C2'" 1 
ATOM   4967  O  "O2'" . U   A 1  232  ? 153.194 213.335 92.163  1.00 275.85 ?  232  U   A "O2'" 1 
ATOM   4968  C  "C1'" . U   A 1  232  ? 151.466 211.947 91.253  1.00 275.85 ?  232  U   A "C1'" 1 
ATOM   4969  N  N1    . U   A 1  232  ? 150.086 211.534 91.611  1.00 275.85 ?  232  U   A N1    1 
ATOM   4970  C  C2    . U   A 1  232  ? 149.158 212.541 91.810  1.00 275.85 ?  232  U   A C2    1 
ATOM   4971  O  O2    . U   A 1  232  ? 149.429 213.725 91.705  1.00 275.85 ?  232  U   A O2    1 
ATOM   4972  N  N3    . U   A 1  232  ? 147.895 212.114 92.136  1.00 275.85 ?  232  U   A N3    1 
ATOM   4973  C  C4    . U   A 1  232  ? 147.467 210.811 92.281  1.00 275.85 ?  232  U   A C4    1 
ATOM   4974  O  O4    . U   A 1  232  ? 146.293 210.587 92.579  1.00 275.85 ?  232  U   A O4    1 
ATOM   4975  C  C5    . U   A 1  232  ? 148.481 209.826 92.060  1.00 275.85 ?  232  U   A C5    1 
ATOM   4976  C  C6    . U   A 1  232  ? 149.720 210.213 91.740  1.00 275.85 ?  232  U   A C6    1 
ATOM   4977  P  P     . G   A 1  233  ? 154.417 210.717 94.900  1.00 257.19 ?  233  G   A P     1 
ATOM   4978  O  OP1   . G   A 1  233  ? 155.842 210.779 95.315  1.00 257.19 ?  233  G   A OP1   1 
ATOM   4979  O  OP2   . G   A 1  233  ? 153.651 209.460 95.092  1.00 257.19 ?  233  G   A OP2   1 
ATOM   4980  O  "O5'" . G   A 1  233  ? 153.636 211.890 95.644  1.00 257.19 ?  233  G   A "O5'" 1 
ATOM   4981  C  "C5'" . G   A 1  233  ? 154.169 213.205 95.694  1.00 257.19 ?  233  G   A "C5'" 1 
ATOM   4982  C  "C4'" . G   A 1  233  ? 153.134 214.207 96.141  1.00 257.19 ?  233  G   A "C4'" 1 
ATOM   4983  O  "O4'" . G   A 1  233  ? 152.013 214.199 95.220  1.00 257.19 ?  233  G   A "O4'" 1 
ATOM   4984  C  "C3'" . G   A 1  233  ? 152.497 213.952 97.499  1.00 257.19 ?  233  G   A "C3'" 1 
ATOM   4985  O  "O3'" . G   A 1  233  ? 153.300 214.395 98.580  1.00 257.19 ?  233  G   A "O3'" 1 
ATOM   4986  C  "C2'" . G   A 1  233  ? 151.168 214.687 97.386  1.00 257.19 ?  233  G   A "C2'" 1 
ATOM   4987  O  "O2'" . G   A 1  233  ? 151.348 216.083 97.572  1.00 257.19 ?  233  G   A "O2'" 1 
ATOM   4988  C  "C1'" . G   A 1  233  ? 150.810 214.437 95.920  1.00 257.19 ?  233  G   A "C1'" 1 
ATOM   4989  N  N9    . G   A 1  233  ? 149.929 213.265 95.757  1.00 257.19 ?  233  G   A N9    1 
ATOM   4990  C  C8    . G   A 1  233  ? 150.302 211.977 95.453  1.00 257.19 ?  233  G   A C8    1 
ATOM   4991  N  N7    . G   A 1  233  ? 149.292 211.155 95.377  1.00 257.19 ?  233  G   A N7    1 
ATOM   4992  C  C5    . G   A 1  233  ? 148.184 211.946 95.647  1.00 257.19 ?  233  G   A C5    1 
ATOM   4993  C  C6    . G   A 1  233  ? 146.806 211.612 95.706  1.00 257.19 ?  233  G   A C6    1 
ATOM   4994  O  O6    . G   A 1  233  ? 146.271 210.511 95.528  1.00 257.19 ?  233  G   A O6    1 
ATOM   4995  N  N1    . G   A 1  233  ? 146.023 212.720 96.012  1.00 257.19 ?  233  G   A N1    1 
ATOM   4996  C  C2    . G   A 1  233  ? 146.501 213.989 96.232  1.00 257.19 ?  233  G   A C2    1 
ATOM   4997  N  N2    . G   A 1  233  ? 145.586 214.927 96.514  1.00 257.19 ?  233  G   A N2    1 
ATOM   4998  N  N3    . G   A 1  233  ? 147.782 214.314 96.179  1.00 257.19 ?  233  G   A N3    1 
ATOM   4999  C  C4    . G   A 1  233  ? 148.561 213.251 95.884  1.00 257.19 ?  233  G   A C4    1 
ATOM   5000  P  P     . C   A 1  234  ? 153.411 213.514 99.920  1.00 243.22 ?  234  C   A P     1 
ATOM   5001  O  OP1   . C   A 1  234  ? 154.561 214.023 100.710 1.00 243.22 ?  234  C   A OP1   1 
ATOM   5002  O  OP2   . C   A 1  234  ? 153.364 212.082 99.533  1.00 243.22 ?  234  C   A OP2   1 
ATOM   5003  O  "O5'" . C   A 1  234  ? 152.075 213.853 100.720 1.00 243.22 ?  234  C   A "O5'" 1 
ATOM   5004  C  "C5'" . C   A 1  234  ? 151.824 215.166 101.199 1.00 243.22 ?  234  C   A "C5'" 1 
ATOM   5005  C  "C4'" . C   A 1  234  ? 150.366 215.364 101.530 1.00 243.22 ?  234  C   A "C4'" 1 
ATOM   5006  O  "O4'" . C   A 1  234  ? 149.559 215.084 100.356 1.00 243.22 ?  234  C   A "O4'" 1 
ATOM   5007  C  "C3'" . C   A 1  234  ? 149.793 214.448 102.600 1.00 243.22 ?  234  C   A "C3'" 1 
ATOM   5008  O  "O3'" . C   A 1  234  ? 150.080 214.888 103.916 1.00 243.22 ?  234  C   A "O3'" 1 
ATOM   5009  C  "C2'" . C   A 1  234  ? 148.304 214.437 102.273 1.00 243.22 ?  234  C   A "C2'" 1 
ATOM   5010  O  "O2'" . C   A 1  234  ? 147.668 215.599 102.784 1.00 243.22 ?  234  C   A "O2'" 1 
ATOM   5011  C  "C1'" . C   A 1  234  ? 148.320 214.528 100.743 1.00 243.22 ?  234  C   A "C1'" 1 
ATOM   5012  N  N1    . C   A 1  234  ? 148.150 213.209 100.083 1.00 243.22 ?  234  C   A N1    1 
ATOM   5013  C  C2    . C   A 1  234  ? 146.853 212.721 99.882  1.00 243.22 ?  234  C   A C2    1 
ATOM   5014  O  O2    . C   A 1  234  ? 145.883 213.394 100.262 1.00 243.22 ?  234  C   A O2    1 
ATOM   5015  N  N3    . C   A 1  234  ? 146.680 211.522 99.277  1.00 243.22 ?  234  C   A N3    1 
ATOM   5016  C  C4    . C   A 1  234  ? 147.735 210.814 98.874  1.00 243.22 ?  234  C   A C4    1 
ATOM   5017  N  N4    . C   A 1  234  ? 147.513 209.639 98.282  1.00 243.22 ?  234  C   A N4    1 
ATOM   5018  C  C5    . C   A 1  234  ? 149.067 211.283 99.059  1.00 243.22 ?  234  C   A C5    1 
ATOM   5019  C  C6    . C   A 1  234  ? 149.223 212.471 99.656  1.00 243.22 ?  234  C   A C6    1 
ATOM   5020  P  P     . C   A 1  235  ? 150.549 213.836 105.038 1.00 226.40 ?  235  C   A P     1 
ATOM   5021  O  OP1   . C   A 1  235  ? 151.077 214.604 106.195 1.00 226.40 ?  235  C   A OP1   1 
ATOM   5022  O  OP2   . C   A 1  235  ? 151.406 212.816 104.382 1.00 226.40 ?  235  C   A OP2   1 
ATOM   5023  O  "O5'" . C   A 1  235  ? 149.198 213.125 105.494 1.00 226.40 ?  235  C   A "O5'" 1 
ATOM   5024  C  "C5'" . C   A 1  235  ? 148.201 213.840 106.210 1.00 226.40 ?  235  C   A "C5'" 1 
ATOM   5025  C  "C4'" . C   A 1  235  ? 146.922 213.048 106.312 1.00 226.40 ?  235  C   A "C4'" 1 
ATOM   5026  O  "O4'" . C   A 1  235  ? 146.400 212.794 104.981 1.00 226.40 ?  235  C   A "O4'" 1 
ATOM   5027  C  "C3'" . C   A 1  235  ? 147.044 211.664 106.931 1.00 226.40 ?  235  C   A "C3'" 1 
ATOM   5028  O  "O3'" . C   A 1  235  ? 147.063 211.688 108.348 1.00 226.40 ?  235  C   A "O3'" 1 
ATOM   5029  C  "C2'" . C   A 1  235  ? 145.844 210.927 106.348 1.00 226.40 ?  235  C   A "C2'" 1 
ATOM   5030  O  "O2'" . C   A 1  235  ? 144.658 211.262 107.054 1.00 226.40 ?  235  C   A "O2'" 1 
ATOM   5031  C  "C1'" . C   A 1  235  ? 145.759 211.536 104.944 1.00 226.40 ?  235  C   A "C1'" 1 
ATOM   5032  N  N1    . C   A 1  235  ? 146.407 210.691 103.908 1.00 226.40 ?  235  C   A N1    1 
ATOM   5033  C  C2    . C   A 1  235  ? 145.693 209.617 103.358 1.00 226.40 ?  235  C   A C2    1 
ATOM   5034  O  O2    . C   A 1  235  ? 144.537 209.384 103.744 1.00 226.40 ?  235  C   A O2    1 
ATOM   5035  N  N3    . C   A 1  235  ? 146.279 208.849 102.409 1.00 226.40 ?  235  C   A N3    1 
ATOM   5036  C  C4    . C   A 1  235  ? 147.520 209.112 102.001 1.00 226.40 ?  235  C   A C4    1 
ATOM   5037  N  N4    . C   A 1  235  ? 148.055 208.326 101.065 1.00 226.40 ?  235  C   A N4    1 
ATOM   5038  C  C5    . C   A 1  235  ? 148.272 210.196 102.535 1.00 226.40 ?  235  C   A C5    1 
ATOM   5039  C  C6    . C   A 1  235  ? 147.680 210.949 103.469 1.00 226.40 ?  235  C   A C6    1 
ATOM   5040  P  P     . G   A 1  236  ? 147.978 210.647 109.162 1.00 204.89 ?  236  G   A P     1 
ATOM   5041  O  OP1   . G   A 1  236  ? 148.012 211.079 110.583 1.00 204.89 ?  236  G   A OP1   1 
ATOM   5042  O  OP2   . G   A 1  236  ? 149.251 210.475 108.417 1.00 204.89 ?  236  G   A OP2   1 
ATOM   5043  O  "O5'" . G   A 1  236  ? 147.172 209.275 109.083 1.00 204.89 ?  236  G   A "O5'" 1 
ATOM   5044  C  "C5'" . G   A 1  236  ? 145.905 209.136 109.710 1.00 204.89 ?  236  G   A "C5'" 1 
ATOM   5045  C  "C4'" . G   A 1  236  ? 145.182 207.902 109.233 1.00 204.89 ?  236  G   A "C4'" 1 
ATOM   5046  O  "O4'" . G   A 1  236  ? 145.006 207.963 107.793 1.00 204.89 ?  236  G   A "O4'" 1 
ATOM   5047  C  "C3'" . G   A 1  236  ? 145.895 206.577 109.461 1.00 204.89 ?  236  G   A "C3'" 1 
ATOM   5048  O  "O3'" . G   A 1  236  ? 145.737 206.081 110.779 1.00 204.89 ?  236  G   A "O3'" 1 
ATOM   5049  C  "C2'" . G   A 1  236  ? 145.280 205.682 108.395 1.00 204.89 ?  236  G   A "C2'" 1 
ATOM   5050  O  "O2'" . G   A 1  236  ? 143.994 205.233 108.797 1.00 204.89 ?  236  G   A "O2'" 1 
ATOM   5051  C  "C1'" . G   A 1  236  ? 145.108 206.667 107.239 1.00 204.89 ?  236  G   A "C1'" 1 
ATOM   5052  N  N9    . G   A 1  236  ? 146.259 206.642 106.317 1.00 204.89 ?  236  G   A N9    1 
ATOM   5053  C  C8    . G   A 1  236  ? 147.239 207.596 106.191 1.00 204.89 ?  236  G   A C8    1 
ATOM   5054  N  N7    . G   A 1  236  ? 148.133 207.298 105.288 1.00 204.89 ?  236  G   A N7    1 
ATOM   5055  C  C5    . G   A 1  236  ? 147.719 206.072 104.787 1.00 204.89 ?  236  G   A C5    1 
ATOM   5056  C  C6    . G   A 1  236  ? 148.291 205.248 103.782 1.00 204.89 ?  236  G   A C6    1 
ATOM   5057  O  O6    . G   A 1  236  ? 149.312 205.446 103.113 1.00 204.89 ?  236  G   A O6    1 
ATOM   5058  N  N1    . G   A 1  236  ? 147.547 204.089 103.585 1.00 204.89 ?  236  G   A N1    1 
ATOM   5059  C  C2    . G   A 1  236  ? 146.401 203.761 104.266 1.00 204.89 ?  236  G   A C2    1 
ATOM   5060  N  N2    . G   A 1  236  ? 145.826 202.597 103.933 1.00 204.89 ?  236  G   A N2    1 
ATOM   5061  N  N3    . G   A 1  236  ? 145.857 204.520 105.203 1.00 204.89 ?  236  G   A N3    1 
ATOM   5062  C  C4    . G   A 1  236  ? 146.563 205.652 105.412 1.00 204.89 ?  236  G   A C4    1 
ATOM   5063  P  P     . G   A 1  237  ? 146.916 205.236 111.473 1.00 186.27 ?  237  G   A P     1 
ATOM   5064  O  OP1   . G   A 1  237  ? 146.575 205.065 112.908 1.00 186.27 ?  237  G   A OP1   1 
ATOM   5065  O  OP2   . G   A 1  237  ? 148.210 205.858 111.095 1.00 186.27 ?  237  G   A OP2   1 
ATOM   5066  O  "O5'" . G   A 1  237  ? 146.834 203.807 110.774 1.00 186.27 ?  237  G   A "O5'" 1 
ATOM   5067  C  "C5'" . G   A 1  237  ? 145.706 202.964 110.964 1.00 186.27 ?  237  G   A "C5'" 1 
ATOM   5068  C  "C4'" . G   A 1  237  ? 145.739 201.775 110.037 1.00 186.27 ?  237  G   A "C4'" 1 
ATOM   5069  O  "O4'" . G   A 1  237  ? 145.720 202.227 108.657 1.00 186.27 ?  237  G   A "O4'" 1 
ATOM   5070  C  "C3'" . G   A 1  237  ? 146.979 200.898 110.120 1.00 186.27 ?  237  G   A "C3'" 1 
ATOM   5071  O  "O3'" . G   A 1  237  ? 146.936 199.980 111.199 1.00 186.27 ?  237  G   A "O3'" 1 
ATOM   5072  C  "C2'" . G   A 1  237  ? 147.006 200.231 108.751 1.00 186.27 ?  237  G   A "C2'" 1 
ATOM   5073  O  "O2'" . G   A 1  237  ? 146.071 199.164 108.694 1.00 186.27 ?  237  G   A "O2'" 1 
ATOM   5074  C  "C1'" . G   A 1  237  ? 146.501 201.363 107.857 1.00 186.27 ?  237  G   A "C1'" 1 
ATOM   5075  N  N9    . G   A 1  237  ? 147.609 202.141 107.271 1.00 186.27 ?  237  G   A N9    1 
ATOM   5076  C  C8    . G   A 1  237  ? 148.029 203.394 107.646 1.00 186.27 ?  237  G   A C8    1 
ATOM   5077  N  N7    . G   A 1  237  ? 149.039 203.829 106.942 1.00 186.27 ?  237  G   A N7    1 
ATOM   5078  C  C5    . G   A 1  237  ? 149.303 202.800 106.048 1.00 186.27 ?  237  G   A C5    1 
ATOM   5079  C  C6    . G   A 1  237  ? 150.289 202.695 105.033 1.00 186.27 ?  237  G   A C6    1 
ATOM   5080  O  O6    . G   A 1  237  ? 151.154 203.518 104.710 1.00 186.27 ?  237  G   A O6    1 
ATOM   5081  N  N1    . G   A 1  237  ? 150.204 201.481 104.360 1.00 186.27 ?  237  G   A N1    1 
ATOM   5082  C  C2    . G   A 1  237  ? 149.289 200.492 104.628 1.00 186.27 ?  237  G   A C2    1 
ATOM   5083  N  N2    . G   A 1  237  ? 149.368 199.391 103.867 1.00 186.27 ?  237  G   A N2    1 
ATOM   5084  N  N3    . G   A 1  237  ? 148.365 200.578 105.571 1.00 186.27 ?  237  G   A N3    1 
ATOM   5085  C  C4    . G   A 1  237  ? 148.429 201.750 106.238 1.00 186.27 ?  237  G   A C4    1 
ATOM   5086  P  P     . A   A 1  238  ? 148.276 199.624 112.011 1.00 167.09 ?  238  A   A P     1 
ATOM   5087  O  OP1   . A   A 1  238  ? 147.888 198.874 113.232 1.00 167.09 ?  238  A   A OP1   1 
ATOM   5088  O  OP2   . A   A 1  238  ? 149.082 200.865 112.135 1.00 167.09 ?  238  A   A OP2   1 
ATOM   5089  O  "O5'" . A   A 1  238  ? 149.057 198.625 111.047 1.00 167.09 ?  238  A   A "O5'" 1 
ATOM   5090  C  "C5'" . A   A 1  238  ? 148.516 197.352 110.725 1.00 167.09 ?  238  A   A "C5'" 1 
ATOM   5091  C  "C4'" . A   A 1  238  ? 149.321 196.664 109.652 1.00 167.09 ?  238  A   A "C4'" 1 
ATOM   5092  O  "O4'" . A   A 1  238  ? 149.244 197.422 108.416 1.00 167.09 ?  238  A   A "O4'" 1 
ATOM   5093  C  "C3'" . A   A 1  238  ? 150.814 196.538 109.914 1.00 167.09 ?  238  A   A "C3'" 1 
ATOM   5094  O  "O3'" . A   A 1  238  ? 151.137 195.455 110.770 1.00 167.09 ?  238  A   A "O3'" 1 
ATOM   5095  C  "C2'" . A   A 1  238  ? 151.387 196.400 108.511 1.00 167.09 ?  238  A   A "C2'" 1 
ATOM   5096  O  "O2'" . A   A 1  238  ? 151.212 195.078 108.025 1.00 167.09 ?  238  A   A "O2'" 1 
ATOM   5097  C  "C1'" . A   A 1  238  ? 150.469 197.331 107.718 1.00 167.09 ?  238  A   A "C1'" 1 
ATOM   5098  N  N9    . A   A 1  238  ? 151.036 198.687 107.586 1.00 167.09 ?  238  A   A N9    1 
ATOM   5099  C  C8    . A   A 1  238  ? 150.637 199.832 108.231 1.00 167.09 ?  238  A   A C8    1 
ATOM   5100  N  N7    . A   A 1  238  ? 151.336 200.893 107.908 1.00 167.09 ?  238  A   A N7    1 
ATOM   5101  C  C5    . A   A 1  238  ? 152.258 200.414 106.988 1.00 167.09 ?  238  A   A C5    1 
ATOM   5102  C  C6    . A   A 1  238  ? 153.291 201.035 106.262 1.00 167.09 ?  238  A   A C6    1 
ATOM   5103  N  N6    . A   A 1  238  ? 153.580 202.335 106.355 1.00 167.09 ?  238  A   A N6    1 
ATOM   5104  N  N1    . A   A 1  238  ? 154.028 200.268 105.426 1.00 167.09 ?  238  A   A N1    1 
ATOM   5105  C  C2    . A   A 1  238  ? 153.747 198.962 105.325 1.00 167.09 ?  238  A   A C2    1 
ATOM   5106  N  N3    . A   A 1  238  ? 152.802 198.266 105.956 1.00 167.09 ?  238  A   A N3    1 
ATOM   5107  C  C4    . A   A 1  238  ? 152.086 199.056 106.779 1.00 167.09 ?  238  A   A C4    1 
ATOM   5108  P  P     . G   A 1  239  ? 152.405 195.551 111.753 1.00 148.53 ?  239  G   A P     1 
ATOM   5109  O  OP1   . G   A 1  239  ? 152.253 194.511 112.802 1.00 148.53 ?  239  G   A OP1   1 
ATOM   5110  O  OP2   . G   A 1  239  ? 152.573 196.972 112.149 1.00 148.53 ?  239  G   A OP2   1 
ATOM   5111  O  "O5'" . G   A 1  239  ? 153.640 195.147 110.832 1.00 148.53 ?  239  G   A "O5'" 1 
ATOM   5112  C  "C5'" . G   A 1  239  ? 153.691 193.879 110.195 1.00 148.53 ?  239  G   A "C5'" 1 
ATOM   5113  C  "C4'" . G   A 1  239  ? 154.688 193.868 109.063 1.00 148.53 ?  239  G   A "C4'" 1 
ATOM   5114  O  "O4'" . G   A 1  239  ? 154.362 194.918 108.115 1.00 148.53 ?  239  G   A "O4'" 1 
ATOM   5115  C  "C3'" . G   A 1  239  ? 156.134 194.150 109.443 1.00 148.53 ?  239  G   A "C3'" 1 
ATOM   5116  O  "O3'" . G   A 1  239  ? 156.805 193.010 109.952 1.00 148.53 ?  239  G   A "O3'" 1 
ATOM   5117  C  "C2'" . G   A 1  239  ? 156.722 194.673 108.141 1.00 148.53 ?  239  G   A "C2'" 1 
ATOM   5118  O  "O2'" . G   A 1  239  ? 157.002 193.603 107.250 1.00 148.53 ?  239  G   A "O2'" 1 
ATOM   5119  C  "C1'" . G   A 1  239  ? 155.546 195.472 107.580 1.00 148.53 ?  239  G   A "C1'" 1 
ATOM   5120  N  N9    . G   A 1  239  ? 155.613 196.895 107.966 1.00 148.53 ?  239  G   A N9    1 
ATOM   5121  C  C8    . G   A 1  239  ? 154.831 197.534 108.898 1.00 148.53 ?  239  G   A C8    1 
ATOM   5122  N  N7    . G   A 1  239  ? 155.119 198.801 109.027 1.00 148.53 ?  239  G   A N7    1 
ATOM   5123  C  C5    . G   A 1  239  ? 156.154 199.012 108.126 1.00 148.53 ?  239  G   A C5    1 
ATOM   5124  C  C6    . G   A 1  239  ? 156.879 200.193 107.820 1.00 148.53 ?  239  G   A C6    1 
ATOM   5125  O  O6    . G   A 1  239  ? 156.747 201.325 108.300 1.00 148.53 ?  239  G   A O6    1 
ATOM   5126  N  N1    . G   A 1  239  ? 157.844 199.962 106.845 1.00 148.53 ?  239  G   A N1    1 
ATOM   5127  C  C2    . G   A 1  239  ? 158.083 198.753 106.241 1.00 148.53 ?  239  G   A C2    1 
ATOM   5128  N  N2    . G   A 1  239  ? 159.060 198.733 105.322 1.00 148.53 ?  239  G   A N2    1 
ATOM   5129  N  N3    . G   A 1  239  ? 157.415 197.645 106.517 1.00 148.53 ?  239  G   A N3    1 
ATOM   5130  C  C4    . G   A 1  239  ? 156.471 197.845 107.462 1.00 148.53 ?  239  G   A C4    1 
ATOM   5131  P  P     . C   A 1  240  ? 157.735 193.132 111.258 1.00 138.17 ?  240  C   A P     1 
ATOM   5132  O  OP1   . C   A 1  240  ? 158.111 191.761 111.686 1.00 138.17 ?  240  C   A OP1   1 
ATOM   5133  O  OP2   . C   A 1  240  ? 157.062 194.043 112.218 1.00 138.17 ?  240  C   A OP2   1 
ATOM   5134  O  "O5'" . C   A 1  240  ? 159.051 193.861 110.732 1.00 138.17 ?  240  C   A "O5'" 1 
ATOM   5135  C  "C5'" . C   A 1  240  ? 159.850 193.283 109.710 1.00 138.17 ?  240  C   A "C5'" 1 
ATOM   5136  C  "C4'" . C   A 1  240  ? 160.746 194.312 109.067 1.00 138.17 ?  240  C   A "C4'" 1 
ATOM   5137  O  "O4'" . C   A 1  240  ? 159.941 195.416 108.583 1.00 138.17 ?  240  C   A "O4'" 1 
ATOM   5138  C  "C3'" . C   A 1  240  ? 161.771 194.967 109.980 1.00 138.17 ?  240  C   A "C3'" 1 
ATOM   5139  O  "O3'" . C   A 1  240  ? 162.942 194.181 110.135 1.00 138.17 ?  240  C   A "O3'" 1 
ATOM   5140  C  "C2'" . C   A 1  240  ? 162.031 196.307 109.297 1.00 138.17 ?  240  C   A "C2'" 1 
ATOM   5141  O  "O2'" . C   A 1  240  ? 162.966 196.159 108.241 1.00 138.17 ?  240  C   A "O2'" 1 
ATOM   5142  C  "C1'" . C   A 1  240  ? 160.663 196.623 108.684 1.00 138.17 ?  240  C   A "C1'" 1 
ATOM   5143  N  N1    . C   A 1  240  ? 159.876 197.601 109.475 1.00 138.17 ?  240  C   A N1    1 
ATOM   5144  C  C2    . C   A 1  240  ? 160.087 198.966 109.246 1.00 138.17 ?  240  C   A C2    1 
ATOM   5145  O  O2    . C   A 1  240  ? 160.928 199.317 108.404 1.00 138.17 ?  240  C   A O2    1 
ATOM   5146  N  N3    . C   A 1  240  ? 159.373 199.876 109.948 1.00 138.17 ?  240  C   A N3    1 
ATOM   5147  C  C4    . C   A 1  240  ? 158.474 199.473 110.846 1.00 138.17 ?  240  C   A C4    1 
ATOM   5148  N  N4    . C   A 1  240  ? 157.796 200.411 111.512 1.00 138.17 ?  240  C   A N4    1 
ATOM   5149  C  C5    . C   A 1  240  ? 158.232 198.092 111.099 1.00 138.17 ?  240  C   A C5    1 
ATOM   5150  C  C6    . C   A 1  240  ? 158.944 197.201 110.395 1.00 138.17 ?  240  C   A C6    1 
ATOM   5151  P  P     . U   A 1  241  ? 163.298 193.506 111.551 1.00 128.61 ?  241  U   A P     1 
ATOM   5152  O  OP1   . U   A 1  241  ? 162.225 192.543 111.902 1.00 128.61 ?  241  U   A OP1   1 
ATOM   5153  O  OP2   . U   A 1  241  ? 163.642 194.596 112.500 1.00 128.61 ?  241  U   A OP2   1 
ATOM   5154  O  "O5'" . U   A 1  241  ? 164.625 192.673 111.261 1.00 128.61 ?  241  U   A "O5'" 1 
ATOM   5155  C  "C5'" . U   A 1  241  ? 164.773 191.912 110.064 1.00 128.61 ?  241  U   A "C5'" 1 
ATOM   5156  C  "C4'" . U   A 1  241  ? 166.037 191.085 110.083 1.00 128.61 ?  241  U   A "C4'" 1 
ATOM   5157  O  "O4'" . U   A 1  241  ? 166.405 190.734 108.720 1.00 128.61 ?  241  U   A "O4'" 1 
ATOM   5158  C  "C3'" . U   A 1  241  ? 167.258 191.789 110.679 1.00 128.61 ?  241  U   A "C3'" 1 
ATOM   5159  O  "O3'" . U   A 1  241  ? 168.130 190.824 111.281 1.00 128.61 ?  241  U   A "O3'" 1 
ATOM   5160  C  "C2'" . U   A 1  241  ? 167.944 192.342 109.436 1.00 128.61 ?  241  U   A "C2'" 1 
ATOM   5161  O  "O2'" . U   A 1  241  ? 169.318 192.625 109.599 1.00 128.61 ?  241  U   A "O2'" 1 
ATOM   5162  C  "C1'" . U   A 1  241  ? 167.713 191.200 108.453 1.00 128.61 ?  241  U   A "C1'" 1 
ATOM   5163  N  N1    . U   A 1  241  ? 167.805 191.566 107.032 1.00 128.61 ?  241  U   A N1    1 
ATOM   5164  C  C2    . U   A 1  241  ? 169.059 191.575 106.451 1.00 128.61 ?  241  U   A C2    1 
ATOM   5165  O  O2    . U   A 1  241  ? 170.080 191.321 107.068 1.00 128.61 ?  241  U   A O2    1 
ATOM   5166  N  N3    . U   A 1  241  ? 169.079 191.912 105.121 1.00 128.61 ?  241  U   A N3    1 
ATOM   5167  C  C4    . U   A 1  241  ? 167.993 192.219 104.327 1.00 128.61 ?  241  U   A C4    1 
ATOM   5168  O  O4    . U   A 1  241  ? 168.170 192.501 103.141 1.00 128.61 ?  241  U   A O4    1 
ATOM   5169  C  C5    . U   A 1  241  ? 166.732 192.172 104.999 1.00 128.61 ?  241  U   A C5    1 
ATOM   5170  C  C6    . U   A 1  241  ? 166.680 191.849 106.295 1.00 128.61 ?  241  U   A C6    1 
ATOM   5171  P  P     . U   A 1  242  ? 167.897 190.260 112.774 1.00 107.28 ?  242  U   A P     1 
ATOM   5172  O  OP1   . U   A 1  242  ? 168.401 188.865 112.775 1.00 107.28 ?  242  U   A OP1   1 
ATOM   5173  O  OP2   . U   A 1  242  ? 166.512 190.516 113.240 1.00 107.28 ?  242  U   A OP2   1 
ATOM   5174  O  "O5'" . U   A 1  242  ? 168.881 191.114 113.695 1.00 107.28 ?  242  U   A "O5'" 1 
ATOM   5175  C  "C5'" . U   A 1  242  ? 169.945 191.884 113.152 1.00 107.28 ?  242  U   A "C5'" 1 
ATOM   5176  C  "C4'" . U   A 1  242  ? 170.060 193.214 113.853 1.00 107.28 ?  242  U   A "C4'" 1 
ATOM   5177  O  "O4'" . U   A 1  242  ? 168.792 193.914 113.763 1.00 107.28 ?  242  U   A "O4'" 1 
ATOM   5178  C  "C3'" . U   A 1  242  ? 170.350 193.147 115.345 1.00 107.28 ?  242  U   A "C3'" 1 
ATOM   5179  O  "O3'" . U   A 1  242  ? 171.734 193.011 115.623 1.00 107.28 ?  242  U   A "O3'" 1 
ATOM   5180  C  "C2'" . U   A 1  242  ? 169.758 194.451 115.871 1.00 107.28 ?  242  U   A "C2'" 1 
ATOM   5181  O  "O2'" . U   A 1  242  ? 170.664 195.526 115.679 1.00 107.28 ?  242  U   A "O2'" 1 
ATOM   5182  C  "C1'" . U   A 1  242  ? 168.559 194.655 114.941 1.00 107.28 ?  242  U   A "C1'" 1 
ATOM   5183  N  N1    . U   A 1  242  ? 167.272 194.219 115.539 1.00 107.28 ?  242  U   A N1    1 
ATOM   5184  C  C2    . U   A 1  242  ? 166.630 195.054 116.439 1.00 107.28 ?  242  U   A C2    1 
ATOM   5185  O  O2    . U   A 1  242  ? 167.068 196.135 116.790 1.00 107.28 ?  242  U   A O2    1 
ATOM   5186  N  N3    . U   A 1  242  ? 165.440 194.573 116.932 1.00 107.28 ?  242  U   A N3    1 
ATOM   5187  C  C4    . U   A 1  242  ? 164.830 193.375 116.622 1.00 107.28 ?  242  U   A C4    1 
ATOM   5188  O  O4    . U   A 1  242  ? 163.756 193.081 117.148 1.00 107.28 ?  242  U   A O4    1 
ATOM   5189  C  C5    . U   A 1  242  ? 165.546 192.573 115.682 1.00 107.28 ?  242  U   A C5    1 
ATOM   5190  C  C6    . U   A 1  242  ? 166.705 193.017 115.189 1.00 107.28 ?  242  U   A C6    1 
ATOM   5191  P  P     . G   A 1  243  ? 172.318 191.662 116.273 1.00 98.33  ?  243  G   A P     1 
ATOM   5192  O  OP1   . G   A 1  243  ? 173.799 191.728 116.198 1.00 98.33  ?  243  G   A OP1   1 
ATOM   5193  O  OP2   . G   A 1  243  ? 171.606 190.504 115.677 1.00 98.33  ?  243  G   A OP2   1 
ATOM   5194  O  "O5'" . G   A 1  243  ? 171.901 191.755 117.807 1.00 98.33  ?  243  G   A "O5'" 1 
ATOM   5195  C  "C5'" . G   A 1  243  ? 172.282 192.866 118.604 1.00 98.33  ?  243  G   A "C5'" 1 
ATOM   5196  C  "C4'" . G   A 1  243  ? 171.252 193.147 119.668 1.00 98.33  ?  243  G   A "C4'" 1 
ATOM   5197  O  "O4'" . G   A 1  243  ? 169.971 193.407 119.036 1.00 98.33  ?  243  G   A "O4'" 1 
ATOM   5198  C  "C3'" . G   A 1  243  ? 170.967 192.001 120.626 1.00 98.33  ?  243  G   A "C3'" 1 
ATOM   5199  O  "O3'" . G   A 1  243  ? 171.910 191.902 121.679 1.00 98.33  ?  243  G   A "O3'" 1 
ATOM   5200  C  "C2'" . G   A 1  243  ? 169.546 192.297 121.090 1.00 98.33  ?  243  G   A "C2'" 1 
ATOM   5201  O  "O2'" . G   A 1  243  ? 169.542 193.317 122.077 1.00 98.33  ?  243  G   A "O2'" 1 
ATOM   5202  C  "C1'" . G   A 1  243  ? 168.926 192.860 119.811 1.00 98.33  ?  243  G   A "C1'" 1 
ATOM   5203  N  N9    . G   A 1  243  ? 168.245 191.819 119.012 1.00 98.33  ?  243  G   A N9    1 
ATOM   5204  C  C8    . G   A 1  243  ? 168.805 190.989 118.066 1.00 98.33  ?  243  G   A C8    1 
ATOM   5205  N  N7    . G   A 1  243  ? 167.951 190.166 117.526 1.00 98.33  ?  243  G   A N7    1 
ATOM   5206  C  C5    . G   A 1  243  ? 166.749 190.468 118.147 1.00 98.33  ?  243  G   A C5    1 
ATOM   5207  C  C6    . G   A 1  243  ? 165.460 189.903 117.967 1.00 98.33  ?  243  G   A C6    1 
ATOM   5208  O  O6    . G   A 1  243  ? 165.116 188.994 117.201 1.00 98.33  ?  243  G   A O6    1 
ATOM   5209  N  N1    . G   A 1  243  ? 164.520 190.502 118.797 1.00 98.33  ?  243  G   A N1    1 
ATOM   5210  C  C2    . G   A 1  243  ? 164.785 191.515 119.685 1.00 98.33  ?  243  G   A C2    1 
ATOM   5211  N  N2    . G   A 1  243  ? 163.738 191.959 120.393 1.00 98.33  ?  243  G   A N2    1 
ATOM   5212  N  N3    . G   A 1  243  ? 165.981 192.053 119.862 1.00 98.33  ?  243  G   A N3    1 
ATOM   5213  C  C4    . G   A 1  243  ? 166.912 191.484 119.066 1.00 98.33  ?  243  G   A C4    1 
ATOM   5214  P  P     . G   A 1  244  ? 172.432 190.458 122.153 1.00 94.88  ?  244  G   A P     1 
ATOM   5215  O  OP1   . G   A 1  244  ? 173.195 190.628 123.415 1.00 94.88  ?  244  G   A OP1   1 
ATOM   5216  O  OP2   . G   A 1  244  ? 173.079 189.800 120.989 1.00 94.88  ?  244  G   A OP2   1 
ATOM   5217  O  "O5'" . G   A 1  244  ? 171.091 189.664 122.483 1.00 94.88  ?  244  G   A "O5'" 1 
ATOM   5218  C  "C5'" . G   A 1  244  ? 171.124 188.350 123.017 1.00 94.88  ?  244  G   A "C5'" 1 
ATOM   5219  C  "C4'" . G   A 1  244  ? 170.242 188.237 124.234 1.00 94.88  ?  244  G   A "C4'" 1 
ATOM   5220  O  "O4'" . G   A 1  244  ? 170.851 188.952 125.340 1.00 94.88  ?  244  G   A "O4'" 1 
ATOM   5221  C  "C3'" . G   A 1  244  ? 168.858 188.856 124.108 1.00 94.88  ?  244  G   A "C3'" 1 
ATOM   5222  O  "O3'" . G   A 1  244  ? 167.928 188.008 123.456 1.00 94.88  ?  244  G   A "O3'" 1 
ATOM   5223  C  "C2'" . G   A 1  244  ? 168.493 189.159 125.555 1.00 94.88  ?  244  G   A "C2'" 1 
ATOM   5224  O  "O2'" . G   A 1  244  ? 168.048 187.984 126.217 1.00 94.88  ?  244  G   A "O2'" 1 
ATOM   5225  C  "C1'" . G   A 1  244  ? 169.852 189.554 126.134 1.00 94.88  ?  244  G   A "C1'" 1 
ATOM   5226  N  N9    . G   A 1  244  ? 170.064 191.014 126.134 1.00 94.88  ?  244  G   A N9    1 
ATOM   5227  C  C8    . G   A 1  244  ? 170.925 191.721 125.330 1.00 94.88  ?  244  G   A C8    1 
ATOM   5228  N  N7    . G   A 1  244  ? 170.906 193.005 125.558 1.00 94.88  ?  244  G   A N7    1 
ATOM   5229  C  C5    . G   A 1  244  ? 169.978 193.158 126.578 1.00 94.88  ?  244  G   A C5    1 
ATOM   5230  C  C6    . G   A 1  244  ? 169.533 194.329 127.245 1.00 94.88  ?  244  G   A C6    1 
ATOM   5231  O  O6    . G   A 1  244  ? 169.883 195.501 127.060 1.00 94.88  ?  244  G   A O6    1 
ATOM   5232  N  N1    . G   A 1  244  ? 168.582 194.035 128.216 1.00 94.88  ?  244  G   A N1    1 
ATOM   5233  C  C2    . G   A 1  244  ? 168.117 192.777 128.510 1.00 94.88  ?  244  G   A C2    1 
ATOM   5234  N  N2    . G   A 1  244  ? 167.198 192.697 129.483 1.00 94.88  ?  244  G   A N2    1 
ATOM   5235  N  N3    . G   A 1  244  ? 168.525 191.678 127.897 1.00 94.88  ?  244  G   A N3    1 
ATOM   5236  C  C4    . G   A 1  244  ? 169.449 191.939 126.948 1.00 94.88  ?  244  G   A C4    1 
ATOM   5237  P  P     . A   A 1  245  ? 166.857 188.620 122.427 1.00 104.39 ?  245  A   A P     1 
ATOM   5238  O  OP1   . A   A 1  245  ? 166.091 187.493 121.838 1.00 104.39 ?  245  A   A OP1   1 
ATOM   5239  O  OP2   . A   A 1  245  ? 167.570 189.567 121.533 1.00 104.39 ?  245  A   A OP2   1 
ATOM   5240  O  "O5'" . A   A 1  245  ? 165.866 189.461 123.349 1.00 104.39 ?  245  A   A "O5'" 1 
ATOM   5241  C  "C5'" . A   A 1  245  ? 164.994 188.813 124.271 1.00 104.39 ?  245  A   A "C5'" 1 
ATOM   5242  C  "C4'" . A   A 1  245  ? 164.065 189.785 124.965 1.00 104.39 ?  245  A   A "C4'" 1 
ATOM   5243  O  "O4'" . A   A 1  245  ? 164.842 190.865 125.553 1.00 104.39 ?  245  A   A "O4'" 1 
ATOM   5244  C  "C3'" . A   A 1  245  ? 163.011 190.448 124.076 1.00 104.39 ?  245  A   A "C3'" 1 
ATOM   5245  O  "O3'" . A   A 1  245  ? 161.798 190.607 124.810 1.00 104.39 ?  245  A   A "O3'" 1 
ATOM   5246  C  "C2'" . A   A 1  245  ? 163.616 191.820 123.795 1.00 104.39 ?  245  A   A "C2'" 1 
ATOM   5247  O  "O2'" . A   A 1  245  ? 162.673 192.826 123.486 1.00 104.39 ?  245  A   A "O2'" 1 
ATOM   5248  C  "C1'" . A   A 1  245  ? 164.346 192.111 125.101 1.00 104.39 ?  245  A   A "C1'" 1 
ATOM   5249  N  N9    . A   A 1  245  ? 165.473 193.035 124.957 1.00 104.39 ?  245  A   A N9    1 
ATOM   5250  C  C8    . A   A 1  245  ? 166.629 192.849 124.238 1.00 104.39 ?  245  A   A C8    1 
ATOM   5251  N  N7    . A   A 1  245  ? 167.459 193.863 124.299 1.00 104.39 ?  245  A   A N7    1 
ATOM   5252  C  C5    . A   A 1  245  ? 166.804 194.777 125.112 1.00 104.39 ?  245  A   A C5    1 
ATOM   5253  C  C6    . A   A 1  245  ? 167.147 196.062 125.571 1.00 104.39 ?  245  A   A C6    1 
ATOM   5254  N  N6    . A   A 1  245  ? 168.292 196.675 125.261 1.00 104.39 ?  245  A   A N6    1 
ATOM   5255  N  N1    . A   A 1  245  ? 166.267 196.706 126.373 1.00 104.39 ?  245  A   A N1    1 
ATOM   5256  C  C2    . A   A 1  245  ? 165.116 196.099 126.691 1.00 104.39 ?  245  A   A C2    1 
ATOM   5257  N  N3    . A   A 1  245  ? 164.683 194.895 126.320 1.00 104.39 ?  245  A   A N3    1 
ATOM   5258  C  C4    . A   A 1  245  ? 165.581 194.280 125.528 1.00 104.39 ?  245  A   A C4    1 
ATOM   5259  P  P     . A   A 1  246  ? 160.382 190.384 124.084 1.00 118.40 ?  246  A   A P     1 
ATOM   5260  O  OP1   . A   A 1  246  ? 159.393 189.985 125.118 1.00 118.40 ?  246  A   A OP1   1 
ATOM   5261  O  OP2   . A   A 1  246  ? 160.604 189.510 122.905 1.00 118.40 ?  246  A   A OP2   1 
ATOM   5262  O  "O5'" . A   A 1  246  ? 159.986 191.834 123.556 1.00 118.40 ?  246  A   A "O5'" 1 
ATOM   5263  C  "C5'" . A   A 1  246  ? 158.999 192.000 122.542 1.00 118.40 ?  246  A   A "C5'" 1 
ATOM   5264  C  "C4'" . A   A 1  246  ? 158.507 193.425 122.470 1.00 118.40 ?  246  A   A "C4'" 1 
ATOM   5265  O  "O4'" . A   A 1  246  ? 159.646 194.314 122.303 1.00 118.40 ?  246  A   A "O4'" 1 
ATOM   5266  C  "C3'" . A   A 1  246  ? 157.556 193.730 121.314 1.00 118.40 ?  246  A   A "C3'" 1 
ATOM   5267  O  "O3'" . A   A 1  246  ? 156.608 194.716 121.727 1.00 118.40 ?  246  A   A "O3'" 1 
ATOM   5268  C  "C2'" . A   A 1  246  ? 158.490 194.319 120.261 1.00 118.40 ?  246  A   A "C2'" 1 
ATOM   5269  O  "O2'" . A   A 1  246  ? 157.864 195.157 119.313 1.00 118.40 ?  246  A   A "O2'" 1 
ATOM   5270  C  "C1'" . A   A 1  246  ? 159.482 195.087 121.129 1.00 118.40 ?  246  A   A "C1'" 1 
ATOM   5271  N  N9    . A   A 1  246  ? 160.798 195.266 120.509 1.00 118.40 ?  246  A   A N9    1 
ATOM   5272  C  C8    . A   A 1  246  ? 161.543 194.325 119.843 1.00 118.40 ?  246  A   A C8    1 
ATOM   5273  N  N7    . A   A 1  246  ? 162.687 194.778 119.392 1.00 118.40 ?  246  A   A N7    1 
ATOM   5274  C  C5    . A   A 1  246  ? 162.694 196.108 119.785 1.00 118.40 ?  246  A   A C5    1 
ATOM   5275  C  C6    . A   A 1  246  ? 163.629 197.147 119.615 1.00 118.40 ?  246  A   A C6    1 
ATOM   5276  N  N6    . A   A 1  246  ? 164.791 196.997 118.974 1.00 118.40 ?  246  A   A N6    1 
ATOM   5277  N  N1    . A   A 1  246  ? 163.328 198.361 120.132 1.00 118.40 ?  246  A   A N1    1 
ATOM   5278  C  C2    . A   A 1  246  ? 162.165 198.520 120.778 1.00 118.40 ?  246  A   A C2    1 
ATOM   5279  N  N3    . A   A 1  246  ? 161.208 197.620 121.000 1.00 118.40 ?  246  A   A N3    1 
ATOM   5280  C  C4    . A   A 1  246  ? 161.537 196.425 120.475 1.00 118.40 ?  246  A   A C4    1 
ATOM   5281  P  P     . C   A 1  247  ? 155.144 194.764 121.064 1.00 144.56 ?  247  C   A P     1 
ATOM   5282  O  OP1   . C   A 1  247  ? 155.064 193.680 120.053 1.00 144.56 ?  247  C   A OP1   1 
ATOM   5283  O  OP2   . C   A 1  247  ? 154.871 196.166 120.658 1.00 144.56 ?  247  C   A OP2   1 
ATOM   5284  O  "O5'" . C   A 1  247  ? 154.156 194.396 122.259 1.00 144.56 ?  247  C   A "O5'" 1 
ATOM   5285  C  "C5'" . C   A 1  247  ? 153.364 193.218 122.209 1.00 144.56 ?  247  C   A "C5'" 1 
ATOM   5286  C  "C4'" . C   A 1  247  ? 151.936 193.490 122.613 1.00 144.56 ?  247  C   A "C4'" 1 
ATOM   5287  O  "O4'" . C   A 1  247  ? 151.086 192.399 122.172 1.00 144.56 ?  247  C   A "O4'" 1 
ATOM   5288  C  "C3'" . C   A 1  247  ? 151.669 193.582 124.108 1.00 144.56 ?  247  C   A "C3'" 1 
ATOM   5289  O  "O3'" . C   A 1  247  ? 152.005 194.842 124.662 1.00 144.56 ?  247  C   A "O3'" 1 
ATOM   5290  C  "C2'" . C   A 1  247  ? 150.186 193.250 124.205 1.00 144.56 ?  247  C   A "C2'" 1 
ATOM   5291  O  "O2'" . C   A 1  247  ? 149.395 194.383 123.877 1.00 144.56 ?  247  C   A "O2'" 1 
ATOM   5292  C  "C1'" . C   A 1  247  ? 150.028 192.210 123.090 1.00 144.56 ?  247  C   A "C1'" 1 
ATOM   5293  N  N1    . C   A 1  247  ? 150.063 190.814 123.594 1.00 144.56 ?  247  C   A N1    1 
ATOM   5294  C  C2    . C   A 1  247  ? 148.895 190.253 124.131 1.00 144.56 ?  247  C   A C2    1 
ATOM   5295  O  O2    . C   A 1  247  ? 147.854 190.927 124.180 1.00 144.56 ?  247  C   A O2    1 
ATOM   5296  N  N3    . C   A 1  247  ? 148.919 188.979 124.586 1.00 144.56 ?  247  C   A N3    1 
ATOM   5297  C  C4    . C   A 1  247  ? 150.042 188.263 124.525 1.00 144.56 ?  247  C   A C4    1 
ATOM   5298  N  N4    . C   A 1  247  ? 150.014 187.012 124.990 1.00 144.56 ?  247  C   A N4    1 
ATOM   5299  C  C5    . C   A 1  247  ? 151.245 188.800 123.985 1.00 144.56 ?  247  C   A C5    1 
ATOM   5300  C  C6    . C   A 1  247  ? 151.207 190.060 123.534 1.00 144.56 ?  247  C   A C6    1 
ATOM   5301  P  P     . A   A 1  248  ? 152.554 194.928 126.169 1.00 114.86 ?  248  A   A P     1 
ATOM   5302  O  OP1   . A   A 1  248  ? 151.446 194.561 127.087 1.00 114.86 ?  248  A   A OP1   1 
ATOM   5303  O  OP2   . A   A 1  248  ? 153.245 196.232 126.337 1.00 114.86 ?  248  A   A OP2   1 
ATOM   5304  O  "O5'" . A   A 1  248  ? 153.650 193.775 126.235 1.00 114.86 ?  248  A   A "O5'" 1 
ATOM   5305  C  "C5'" . A   A 1  248  ? 153.650 192.820 127.285 1.00 114.86 ?  248  A   A "C5'" 1 
ATOM   5306  C  "C4'" . A   A 1  248  ? 154.765 191.822 127.109 1.00 114.86 ?  248  A   A "C4'" 1 
ATOM   5307  O  "O4'" . A   A 1  248  ? 155.740 192.350 126.172 1.00 114.86 ?  248  A   A "O4'" 1 
ATOM   5308  C  "C3'" . A   A 1  248  ? 155.575 191.507 128.359 1.00 114.86 ?  248  A   A "C3'" 1 
ATOM   5309  O  "O3'" . A   A 1  248  ? 154.963 190.527 129.179 1.00 114.86 ?  248  A   A "O3'" 1 
ATOM   5310  C  "C2'" . A   A 1  248  ? 156.920 191.075 127.789 1.00 114.86 ?  248  A   A "C2'" 1 
ATOM   5311  O  "O2'" . A   A 1  248  ? 156.861 189.734 127.326 1.00 114.86 ?  248  A   A "O2'" 1 
ATOM   5312  C  "C1'" . A   A 1  248  ? 157.044 191.999 126.578 1.00 114.86 ?  248  A   A "C1'" 1 
ATOM   5313  N  N9    . A   A 1  248  ? 157.772 193.241 126.897 1.00 114.86 ?  248  A   A N9    1 
ATOM   5314  C  C8    . A   A 1  248  ? 157.233 194.483 127.128 1.00 114.86 ?  248  A   A C8    1 
ATOM   5315  N  N7    . A   A 1  248  ? 158.122 195.409 127.386 1.00 114.86 ?  248  A   A N7    1 
ATOM   5316  C  C5    . A   A 1  248  ? 159.331 194.731 127.318 1.00 114.86 ?  248  A   A C5    1 
ATOM   5317  C  C6    . A   A 1  248  ? 160.664 195.144 127.494 1.00 114.86 ?  248  A   A C6    1 
ATOM   5318  N  N6    . A   A 1  248  ? 161.014 196.398 127.788 1.00 114.86 ?  248  A   A N6    1 
ATOM   5319  N  N1    . A   A 1  248  ? 161.638 194.215 127.357 1.00 114.86 ?  248  A   A N1    1 
ATOM   5320  C  C2    . A   A 1  248  ? 161.295 192.953 127.062 1.00 114.86 ?  248  A   A C2    1 
ATOM   5321  N  N3    . A   A 1  248  ? 160.078 192.446 126.873 1.00 114.86 ?  248  A   A N3    1 
ATOM   5322  C  C4    . A   A 1  248  ? 159.132 193.394 127.017 1.00 114.86 ?  248  A   A C4    1 
ATOM   5323  P  P     . G   A 1  249  ? 154.902 190.727 130.773 1.00 103.09 ?  249  G   A P     1 
ATOM   5324  O  OP1   . G   A 1  249  ? 153.918 189.758 131.320 1.00 103.09 ?  249  G   A OP1   1 
ATOM   5325  O  OP2   . G   A 1  249  ? 154.736 192.176 131.048 1.00 103.09 ?  249  G   A OP2   1 
ATOM   5326  O  "O5'" . G   A 1  249  ? 156.350 190.292 131.272 1.00 103.09 ?  249  G   A "O5'" 1 
ATOM   5327  C  "C5'" . G   A 1  249  ? 156.840 188.980 131.040 1.00 103.09 ?  249  G   A "C5'" 1 
ATOM   5328  C  "C4'" . G   A 1  249  ? 158.341 188.921 131.172 1.00 103.09 ?  249  G   A "C4'" 1 
ATOM   5329  O  "O4'" . G   A 1  249  ? 158.951 189.794 130.186 1.00 103.09 ?  249  G   A "O4'" 1 
ATOM   5330  C  "C3'" . G   A 1  249  ? 158.909 189.404 132.498 1.00 103.09 ?  249  G   A "C3'" 1 
ATOM   5331  O  "O3'" . G   A 1  249  ? 158.857 188.416 133.513 1.00 103.09 ?  249  G   A "O3'" 1 
ATOM   5332  C  "C2'" . G   A 1  249  ? 160.324 189.822 132.123 1.00 103.09 ?  249  G   A "C2'" 1 
ATOM   5333  O  "O2'" . G   A 1  249  ? 161.169 188.687 132.007 1.00 103.09 ?  249  G   A "O2'" 1 
ATOM   5334  C  "C1'" . G   A 1  249  ? 160.104 190.404 130.727 1.00 103.09 ?  249  G   A "C1'" 1 
ATOM   5335  N  N9    . G   A 1  249  ? 159.884 191.862 130.763 1.00 103.09 ?  249  G   A N9    1 
ATOM   5336  C  C8    . G   A 1  249  ? 158.681 192.517 130.656 1.00 103.09 ?  249  G   A C8    1 
ATOM   5337  N  N7    . G   A 1  249  ? 158.796 193.816 130.722 1.00 103.09 ?  249  G   A N7    1 
ATOM   5338  C  C5    . G   A 1  249  ? 160.158 194.032 130.882 1.00 103.09 ?  249  G   A C5    1 
ATOM   5339  C  C6    . G   A 1  249  ? 160.886 195.242 131.013 1.00 103.09 ?  249  G   A C6    1 
ATOM   5340  O  O6    . G   A 1  249  ? 160.459 196.403 131.014 1.00 103.09 ?  249  G   A O6    1 
ATOM   5341  N  N1    . G   A 1  249  ? 162.250 195.005 131.155 1.00 103.09 ?  249  G   A N1    1 
ATOM   5342  C  C2    . G   A 1  249  ? 162.839 193.765 131.169 1.00 103.09 ?  249  G   A C2    1 
ATOM   5343  N  N2    . G   A 1  249  ? 164.171 193.744 131.316 1.00 103.09 ?  249  G   A N2    1 
ATOM   5344  N  N3    . G   A 1  249  ? 162.171 192.629 131.048 1.00 103.09 ?  249  G   A N3    1 
ATOM   5345  C  C4    . G   A 1  249  ? 160.844 192.836 130.909 1.00 103.09 ?  249  G   A C4    1 
ATOM   5346  P  P     . A   A 1  250  ? 158.439 188.816 135.012 1.00 95.51  ?  250  A   A P     1 
ATOM   5347  O  OP1   . A   A 1  250  ? 158.113 187.568 135.748 1.00 95.51  ?  250  A   A OP1   1 
ATOM   5348  O  OP2   . A   A 1  250  ? 157.434 189.906 134.934 1.00 95.51  ?  250  A   A OP2   1 
ATOM   5349  O  "O5'" . A   A 1  250  ? 159.774 189.422 135.636 1.00 95.51  ?  250  A   A "O5'" 1 
ATOM   5350  C  "C5'" . A   A 1  250  ? 160.951 188.634 135.745 1.00 95.51  ?  250  A   A "C5'" 1 
ATOM   5351  C  "C4'" . A   A 1  250  ? 162.168 189.492 135.979 1.00 95.51  ?  250  A   A "C4'" 1 
ATOM   5352  O  "O4'" . A   A 1  250  ? 162.367 190.378 134.848 1.00 95.51  ?  250  A   A "O4'" 1 
ATOM   5353  C  "C3'" . A   A 1  250  ? 162.102 190.427 137.177 1.00 95.51  ?  250  A   A "C3'" 1 
ATOM   5354  O  "O3'" . A   A 1  250  ? 162.414 189.778 138.399 1.00 95.51  ?  250  A   A "O3'" 1 
ATOM   5355  C  "C2'" . A   A 1  250  ? 163.090 191.523 136.801 1.00 95.51  ?  250  A   A "C2'" 1 
ATOM   5356  O  "O2'" . A   A 1  250  ? 164.424 191.102 137.041 1.00 95.51  ?  250  A   A "O2'" 1 
ATOM   5357  C  "C1'" . A   A 1  250  ? 162.876 191.619 135.290 1.00 95.51  ?  250  A   A "C1'" 1 
ATOM   5358  N  N9    . A   A 1  250  ? 161.911 192.675 134.932 1.00 95.51  ?  250  A   A N9    1 
ATOM   5359  C  C8    . A   A 1  250  ? 160.595 192.523 134.568 1.00 95.51  ?  250  A   A C8    1 
ATOM   5360  N  N7    . A   A 1  250  ? 159.985 193.653 134.305 1.00 95.51  ?  250  A   A N7    1 
ATOM   5361  C  C5    . A   A 1  250  ? 160.966 194.614 134.508 1.00 95.51  ?  250  A   A C5    1 
ATOM   5362  C  C6    . A   A 1  250  ? 160.964 196.016 134.397 1.00 95.51  ?  250  A   A C6    1 
ATOM   5363  N  N6    . A   A 1  250  ? 159.893 196.726 134.035 1.00 95.51  ?  250  A   A N6    1 
ATOM   5364  N  N1    . A   A 1  250  ? 162.114 196.675 134.672 1.00 95.51  ?  250  A   A N1    1 
ATOM   5365  C  C2    . A   A 1  250  ? 163.195 195.971 135.036 1.00 95.51  ?  250  A   A C2    1 
ATOM   5366  N  N3    . A   A 1  250  ? 163.317 194.652 135.176 1.00 95.51  ?  250  A   A N3    1 
ATOM   5367  C  C4    . A   A 1  250  ? 162.158 194.026 134.895 1.00 95.51  ?  250  A   A C4    1 
ATOM   5368  P  P     . C   A 1  251  ? 161.536 190.062 139.715 1.00 93.84  ?  251  C   A P     1 
ATOM   5369  O  OP1   . C   A 1  251  ? 161.793 188.965 140.683 1.00 93.84  ?  251  C   A OP1   1 
ATOM   5370  O  OP2   . C   A 1  251  ? 160.144 190.350 139.285 1.00 93.84  ?  251  C   A OP2   1 
ATOM   5371  O  "O5'" . C   A 1  251  ? 162.155 191.402 140.313 1.00 93.84  ?  251  C   A "O5'" 1 
ATOM   5372  C  "C5'" . C   A 1  251  ? 163.516 191.463 140.714 1.00 93.84  ?  251  C   A "C5'" 1 
ATOM   5373  C  "C4'" . C   A 1  251  ? 164.020 192.884 140.738 1.00 93.84  ?  251  C   A "C4'" 1 
ATOM   5374  O  "O4'" . C   A 1  251  ? 163.849 193.481 139.427 1.00 93.84  ?  251  C   A "O4'" 1 
ATOM   5375  C  "C3'" . C   A 1  251  ? 163.289 193.833 141.676 1.00 93.84  ?  251  C   A "C3'" 1 
ATOM   5376  O  "O3'" . C   A 1  251  ? 163.730 193.730 143.019 1.00 93.84  ?  251  C   A "O3'" 1 
ATOM   5377  C  "C2'" . C   A 1  251  ? 163.552 195.197 141.049 1.00 93.84  ?  251  C   A "C2'" 1 
ATOM   5378  O  "O2'" . C   A 1  251  ? 164.842 195.673 141.405 1.00 93.84  ?  251  C   A "O2'" 1 
ATOM   5379  C  "C1'" . C   A 1  251  ? 163.558 194.857 139.555 1.00 93.84  ?  251  C   A "C1'" 1 
ATOM   5380  N  N1    . C   A 1  251  ? 162.262 195.145 138.890 1.00 93.84  ?  251  C   A N1    1 
ATOM   5381  C  C2    . C   A 1  251  ? 162.011 196.447 138.438 1.00 93.84  ?  251  C   A C2    1 
ATOM   5382  O  O2    . C   A 1  251  ? 162.868 197.328 138.608 1.00 93.84  ?  251  C   A O2    1 
ATOM   5383  N  N3    . C   A 1  251  ? 160.836 196.723 137.826 1.00 93.84  ?  251  C   A N3    1 
ATOM   5384  C  C4    . C   A 1  251  ? 159.927 195.764 137.650 1.00 93.84  ?  251  C   A C4    1 
ATOM   5385  N  N4    . C   A 1  251  ? 158.784 196.087 137.040 1.00 93.84  ?  251  C   A N4    1 
ATOM   5386  C  C5    . C   A 1  251  ? 160.151 194.429 138.092 1.00 93.84  ?  251  C   A C5    1 
ATOM   5387  C  C6    . C   A 1  251  ? 161.319 194.170 138.694 1.00 93.84  ?  251  C   A C6    1 
ATOM   5388  P  P     . U   A 1  252  ? 162.699 193.959 144.230 1.00 95.54  ?  252  U   A P     1 
ATOM   5389  O  OP1   . U   A 1  252  ? 163.324 193.436 145.472 1.00 95.54  ?  252  U   A OP1   1 
ATOM   5390  O  OP2   . U   A 1  252  ? 161.371 193.447 143.806 1.00 95.54  ?  252  U   A OP2   1 
ATOM   5391  O  "O5'" . U   A 1  252  ? 162.598 195.543 144.359 1.00 95.54  ?  252  U   A "O5'" 1 
ATOM   5392  C  "C5'" . U   A 1  252  ? 163.744 196.327 144.658 1.00 95.54  ?  252  U   A "C5'" 1 
ATOM   5393  C  "C4'" . U   A 1  252  ? 163.481 197.795 144.436 1.00 95.54  ?  252  U   A "C4'" 1 
ATOM   5394  O  "O4'" . U   A 1  252  ? 163.120 198.021 143.049 1.00 95.54  ?  252  U   A "O4'" 1 
ATOM   5395  C  "C3'" . U   A 1  252  ? 162.321 198.387 145.221 1.00 95.54  ?  252  U   A "C3'" 1 
ATOM   5396  O  "O3'" . U   A 1  252  ? 162.667 198.717 146.556 1.00 95.54  ?  252  U   A "O3'" 1 
ATOM   5397  C  "C2'" . U   A 1  252  ? 161.925 199.592 144.377 1.00 95.54  ?  252  U   A "C2'" 1 
ATOM   5398  O  "O2'" . U   A 1  252  ? 162.799 200.684 144.619 1.00 95.54  ?  252  U   A "O2'" 1 
ATOM   5399  C  "C1'" . U   A 1  252  ? 162.181 199.073 142.959 1.00 95.54  ?  252  U   A "C1'" 1 
ATOM   5400  N  N1    . U   A 1  252  ? 160.950 198.568 142.298 1.00 95.54  ?  252  U   A N1    1 
ATOM   5401  C  C2    . U   A 1  252  ? 160.090 199.491 141.725 1.00 95.54  ?  252  U   A C2    1 
ATOM   5402  O  O2    . U   A 1  252  ? 160.285 200.695 141.738 1.00 95.54  ?  252  U   A O2    1 
ATOM   5403  N  N3    . U   A 1  252  ? 158.976 198.955 141.126 1.00 95.54  ?  252  U   A N3    1 
ATOM   5404  C  C4    . U   A 1  252  ? 158.636 197.621 141.035 1.00 95.54  ?  252  U   A C4    1 
ATOM   5405  O  O4    . U   A 1  252  ? 157.594 197.297 140.463 1.00 95.54  ?  252  U   A O4    1 
ATOM   5406  C  C5    . U   A 1  252  ? 159.571 196.729 141.646 1.00 95.54  ?  252  U   A C5    1 
ATOM   5407  C  C6    . U   A 1  252  ? 160.665 197.221 142.234 1.00 95.54  ?  252  U   A C6    1 
ATOM   5408  P  P     . C   A 1  253  ? 161.632 198.433 147.753 1.00 94.93  ?  253  C   A P     1 
ATOM   5409  O  OP1   . C   A 1  253  ? 162.340 198.671 149.037 1.00 94.93  ?  253  C   A OP1   1 
ATOM   5410  O  OP2   . C   A 1  253  ? 160.988 197.119 147.502 1.00 94.93  ?  253  C   A OP2   1 
ATOM   5411  O  "O5'" . C   A 1  253  ? 160.524 199.566 147.584 1.00 94.93  ?  253  C   A "O5'" 1 
ATOM   5412  C  "C5'" . C   A 1  253  ? 160.855 200.938 147.737 1.00 94.93  ?  253  C   A "C5'" 1 
ATOM   5413  C  "C4'" . C   A 1  253  ? 159.761 201.833 147.211 1.00 94.93  ?  253  C   A "C4'" 1 
ATOM   5414  O  "O4'" . C   A 1  253  ? 159.566 201.588 145.793 1.00 94.93  ?  253  C   A "O4'" 1 
ATOM   5415  C  "C3'" . C   A 1  253  ? 158.380 201.622 147.812 1.00 94.93  ?  253  C   A "C3'" 1 
ATOM   5416  O  "O3'" . C   A 1  253  ? 158.218 202.249 149.072 1.00 94.93  ?  253  C   A "O3'" 1 
ATOM   5417  C  "C2'" . C   A 1  253  ? 157.459 202.172 146.731 1.00 94.93  ?  253  C   A "C2'" 1 
ATOM   5418  O  "O2'" . C   A 1  253  ? 157.408 203.590 146.789 1.00 94.93  ?  253  C   A "O2'" 1 
ATOM   5419  C  "C1'" . C   A 1  253  ? 158.205 201.767 145.455 1.00 94.93  ?  253  C   A "C1'" 1 
ATOM   5420  N  N1    . C   A 1  253  ? 157.680 200.514 144.856 1.00 94.93  ?  253  C   A N1    1 
ATOM   5421  C  C2    . C   A 1  253  ? 156.532 200.568 144.052 1.00 94.93  ?  253  C   A C2    1 
ATOM   5422  O  O2    . C   A 1  253  ? 155.967 201.655 143.852 1.00 94.93  ?  253  C   A O2    1 
ATOM   5423  N  N3    . C   A 1  253  ? 156.053 199.428 143.500 1.00 94.93  ?  253  C   A N3    1 
ATOM   5424  C  C4    . C   A 1  253  ? 156.667 198.265 143.718 1.00 94.93  ?  253  C   A C4    1 
ATOM   5425  N  N4    . C   A 1  253  ? 156.155 197.170 143.151 1.00 94.93  ?  253  C   A N4    1 
ATOM   5426  C  C5    . C   A 1  253  ? 157.835 198.174 144.525 1.00 94.93  ?  253  C   A C5    1 
ATOM   5427  C  C6    . C   A 1  253  ? 158.300 199.308 145.062 1.00 94.93  ?  253  C   A C6    1 
ATOM   5428  P  P     . A   A 1  254  ? 157.312 201.555 150.205 1.00 91.36  ?  254  A   A P     1 
ATOM   5429  O  OP1   . A   A 1  254  ? 157.473 202.332 151.460 1.00 91.36  ?  254  A   A OP1   1 
ATOM   5430  O  OP2   . A   A 1  254  ? 157.606 200.100 150.200 1.00 91.36  ?  254  A   A OP2   1 
ATOM   5431  O  "O5'" . A   A 1  254  ? 155.820 201.759 149.686 1.00 91.36  ?  254  A   A "O5'" 1 
ATOM   5432  C  "C5'" . A   A 1  254  ? 155.246 203.056 149.612 1.00 91.36  ?  254  A   A "C5'" 1 
ATOM   5433  C  "C4'" . A   A 1  254  ? 153.914 203.037 148.903 1.00 91.36  ?  254  A   A "C4'" 1 
ATOM   5434  O  "O4'" . A   A 1  254  ? 154.093 202.665 147.512 1.00 91.36  ?  254  A   A "O4'" 1 
ATOM   5435  C  "C3'" . A   A 1  254  ? 152.894 202.036 149.419 1.00 91.36  ?  254  A   A "C3'" 1 
ATOM   5436  O  "O3'" . A   A 1  254  ? 152.229 202.475 150.589 1.00 91.36  ?  254  A   A "O3'" 1 
ATOM   5437  C  "C2'" . A   A 1  254  ? 151.972 201.859 148.221 1.00 91.36  ?  254  A   A "C2'" 1 
ATOM   5438  O  "O2'" . A   A 1  254  ? 151.076 202.955 148.111 1.00 91.36  ?  254  A   A "O2'" 1 
ATOM   5439  C  "C1'" . A   A 1  254  ? 152.970 201.934 147.063 1.00 91.36  ?  254  A   A "C1'" 1 
ATOM   5440  N  N9    . A   A 1  254  ? 153.414 200.594 146.634 1.00 91.36  ?  254  A   A N9    1 
ATOM   5441  C  C8    . A   A 1  254  ? 154.618 199.981 146.877 1.00 91.36  ?  254  A   A C8    1 
ATOM   5442  N  N7    . A   A 1  254  ? 154.713 198.779 146.361 1.00 91.36  ?  254  A   A N7    1 
ATOM   5443  C  C5    . A   A 1  254  ? 153.488 198.588 145.739 1.00 91.36  ?  254  A   A C5    1 
ATOM   5444  C  C6    . A   A 1  254  ? 152.945 197.516 145.006 1.00 91.36  ?  254  A   A C6    1 
ATOM   5445  N  N6    . A   A 1  254  ? 153.601 196.378 144.766 1.00 91.36  ?  254  A   A N6    1 
ATOM   5446  N  N1    . A   A 1  254  ? 151.689 197.650 144.522 1.00 91.36  ?  254  A   A N1    1 
ATOM   5447  C  C2    . A   A 1  254  ? 151.020 198.787 144.757 1.00 91.36  ?  254  A   A C2    1 
ATOM   5448  N  N3    . A   A 1  254  ? 151.425 199.862 145.431 1.00 91.36  ?  254  A   A N3    1 
ATOM   5449  C  C4    . A   A 1  254  ? 152.676 199.698 145.899 1.00 91.36  ?  254  A   A C4    1 
ATOM   5450  P  P     . C   A 1  255  ? 151.924 201.437 151.777 1.00 84.82  ?  255  C   A P     1 
ATOM   5451  O  OP1   . C   A 1  255  ? 151.655 202.225 153.006 1.00 84.82  ?  255  C   A OP1   1 
ATOM   5452  O  OP2   . C   A 1  255  ? 153.005 200.418 151.784 1.00 84.82  ?  255  C   A OP2   1 
ATOM   5453  O  "O5'" . C   A 1  255  ? 150.577 200.717 151.324 1.00 84.82  ?  255  C   A "O5'" 1 
ATOM   5454  C  "C5'" . C   A 1  255  ? 149.406 201.471 151.044 1.00 84.82  ?  255  C   A "C5'" 1 
ATOM   5455  C  "C4'" . C   A 1  255  ? 148.332 200.618 150.415 1.00 84.82  ?  255  C   A "C4'" 1 
ATOM   5456  O  "O4'" . C   A 1  255  ? 148.748 200.200 149.089 1.00 84.82  ?  255  C   A "O4'" 1 
ATOM   5457  C  "C3'" . C   A 1  255  ? 148.010 199.313 151.126 1.00 84.82  ?  255  C   A "C3'" 1 
ATOM   5458  O  "O3'" . C   A 1  255  ? 147.150 199.487 152.239 1.00 84.82  ?  255  C   A "O3'" 1 
ATOM   5459  C  "C2'" . C   A 1  255  ? 147.406 198.464 150.014 1.00 84.82  ?  255  C   A "C2'" 1 
ATOM   5460  O  "O2'" . C   A 1  255  ? 146.045 198.809 149.802 1.00 84.82  ?  255  C   A "O2'" 1 
ATOM   5461  C  "C1'" . C   A 1  255  ? 148.217 198.925 148.796 1.00 84.82  ?  255  C   A "C1'" 1 
ATOM   5462  N  N1    . C   A 1  255  ? 149.326 197.999 148.457 1.00 84.82  ?  255  C   A N1    1 
ATOM   5463  C  C2    . C   A 1  255  ? 149.048 196.876 147.667 1.00 84.82  ?  255  C   A C2    1 
ATOM   5464  O  O2    . C   A 1  255  ? 147.889 196.677 147.274 1.00 84.82  ?  255  C   A O2    1 
ATOM   5465  N  N3    . C   A 1  255  ? 150.051 196.025 147.346 1.00 84.82  ?  255  C   A N3    1 
ATOM   5466  C  C4    . C   A 1  255  ? 151.292 196.256 147.776 1.00 84.82  ?  255  C   A C4    1 
ATOM   5467  N  N4    . C   A 1  255  ? 152.245 195.388 147.432 1.00 84.82  ?  255  C   A N4    1 
ATOM   5468  C  C5    . C   A 1  255  ? 151.609 197.390 148.577 1.00 84.82  ?  255  C   A C5    1 
ATOM   5469  C  C6    . C   A 1  255  ? 150.608 198.224 148.886 1.00 84.82  ?  255  C   A C6    1 
ATOM   5470  P  P     . G   A 1  256  ? 147.206 198.461 153.475 1.00 85.21  ?  256  G   A P     1 
ATOM   5471  O  OP1   . G   A 1  256  ? 148.258 197.452 153.188 1.00 85.21  ?  256  G   A OP1   1 
ATOM   5472  O  OP2   . G   A 1  256  ? 145.820 198.014 153.764 1.00 85.21  ?  256  G   A OP2   1 
ATOM   5473  O  "O5'" . G   A 1  256  ? 147.701 199.355 154.698 1.00 85.21  ?  256  G   A "O5'" 1 
ATOM   5474  C  "C5'" . G   A 1  256  ? 149.001 199.924 154.703 1.00 85.21  ?  256  G   A "C5'" 1 
ATOM   5475  C  "C4'" . G   A 1  256  ? 148.946 201.429 154.779 1.00 85.21  ?  256  G   A "C4'" 1 
ATOM   5476  O  "O4'" . G   A 1  256  ? 147.604 201.888 154.472 1.00 85.21  ?  256  G   A "O4'" 1 
ATOM   5477  C  "C3'" . G   A 1  256  ? 149.245 202.042 156.138 1.00 85.21  ?  256  G   A "C3'" 1 
ATOM   5478  O  "O3'" . G   A 1  256  ? 150.634 202.147 156.399 1.00 85.21  ?  256  G   A "O3'" 1 
ATOM   5479  C  "C2'" . G   A 1  256  ? 148.539 203.389 156.057 1.00 85.21  ?  256  G   A "C2'" 1 
ATOM   5480  O  "O2'" . G   A 1  256  ? 149.309 204.315 155.306 1.00 85.21  ?  256  G   A "O2'" 1 
ATOM   5481  C  "C1'" . G   A 1  256  ? 147.294 203.027 155.247 1.00 85.21  ?  256  G   A "C1'" 1 
ATOM   5482  N  N9    . G   A 1  256  ? 146.146 202.701 156.113 1.00 85.21  ?  256  G   A N9    1 
ATOM   5483  C  C8    . G   A 1  256  ? 145.604 201.456 156.318 1.00 85.21  ?  256  G   A C8    1 
ATOM   5484  N  N7    . G   A 1  256  ? 144.588 201.467 157.137 1.00 85.21  ?  256  G   A N7    1 
ATOM   5485  C  C5    . G   A 1  256  ? 144.451 202.801 157.493 1.00 85.21  ?  256  G   A C5    1 
ATOM   5486  C  C6    . G   A 1  256  ? 143.518 203.426 158.359 1.00 85.21  ?  256  G   A C6    1 
ATOM   5487  O  O6    . G   A 1  256  ? 142.598 202.909 159.003 1.00 85.21  ?  256  G   A O6    1 
ATOM   5488  N  N1    . G   A 1  256  ? 143.732 204.799 158.436 1.00 85.21  ?  256  G   A N1    1 
ATOM   5489  C  C2    . G   A 1  256  ? 144.720 205.483 157.772 1.00 85.21  ?  256  G   A C2    1 
ATOM   5490  N  N2    . G   A 1  256  ? 144.764 206.807 157.979 1.00 85.21  ?  256  G   A N2    1 
ATOM   5491  N  N3    . G   A 1  256  ? 145.595 204.912 156.961 1.00 85.21  ?  256  G   A N3    1 
ATOM   5492  C  C4    . G   A 1  256  ? 145.404 203.578 156.869 1.00 85.21  ?  256  G   A C4    1 
ATOM   5493  P  P     . G   A 1  257  ? 151.194 201.957 157.894 1.00 84.93  ?  257  G   A P     1 
ATOM   5494  O  OP1   . G   A 1  257  ? 152.673 201.849 157.820 1.00 84.93  ?  257  G   A OP1   1 
ATOM   5495  O  OP2   . G   A 1  257  ? 150.410 200.879 158.546 1.00 84.93  ?  257  G   A OP2   1 
ATOM   5496  O  "O5'" . G   A 1  257  ? 150.835 203.329 158.618 1.00 84.93  ?  257  G   A "O5'" 1 
ATOM   5497  C  "C5'" . G   A 1  257  ? 151.425 204.551 158.199 1.00 84.93  ?  257  G   A "C5'" 1 
ATOM   5498  C  "C4'" . G   A 1  257  ? 150.787 205.734 158.882 1.00 84.93  ?  257  G   A "C4'" 1 
ATOM   5499  O  "O4'" . G   A 1  257  ? 149.397 205.846 158.478 1.00 84.93  ?  257  G   A "O4'" 1 
ATOM   5500  C  "C3'" . G   A 1  257  ? 150.724 205.673 160.400 1.00 84.93  ?  257  G   A "C3'" 1 
ATOM   5501  O  "O3'" . G   A 1  257  ? 151.943 206.035 161.024 1.00 84.93  ?  257  G   A "O3'" 1 
ATOM   5502  C  "C2'" . G   A 1  257  ? 149.569 206.612 160.719 1.00 84.93  ?  257  G   A "C2'" 1 
ATOM   5503  O  "O2'" . G   A 1  257  ? 149.984 207.967 160.629 1.00 84.93  ?  257  G   A "O2'" 1 
ATOM   5504  C  "C1'" . G   A 1  257  ? 148.619 206.320 159.558 1.00 84.93  ?  257  G   A "C1'" 1 
ATOM   5505  N  N9    . G   A 1  257  ? 147.624 205.288 159.909 1.00 84.93  ?  257  G   A N9    1 
ATOM   5506  C  C8    . G   A 1  257  ? 147.625 203.970 159.520 1.00 84.93  ?  257  G   A C8    1 
ATOM   5507  N  N7    . G   A 1  257  ? 146.611 203.296 159.991 1.00 84.93  ?  257  G   A N7    1 
ATOM   5508  C  C5    . G   A 1  257  ? 145.899 204.224 160.738 1.00 84.93  ?  257  G   A C5    1 
ATOM   5509  C  C6    . G   A 1  257  ? 144.701 204.078 161.485 1.00 84.93  ?  257  G   A C6    1 
ATOM   5510  O  O6    . G   A 1  257  ? 144.010 203.065 161.643 1.00 84.93  ?  257  G   A O6    1 
ATOM   5511  N  N1    . G   A 1  257  ? 144.325 205.274 162.089 1.00 84.93  ?  257  G   A N1    1 
ATOM   5512  C  C2    . G   A 1  257  ? 145.010 206.459 161.987 1.00 84.93  ?  257  G   A C2    1 
ATOM   5513  N  N2    . G   A 1  257  ? 144.485 207.504 162.643 1.00 84.93  ?  257  G   A N2    1 
ATOM   5514  N  N3    . G   A 1  257  ? 146.127 206.609 161.292 1.00 84.93  ?  257  G   A N3    1 
ATOM   5515  C  C4    . G   A 1  257  ? 146.511 205.459 160.697 1.00 84.93  ?  257  G   A C4    1 
ATOM   5516  P  P     . C   A 1  258  ? 152.506 205.169 162.256 1.00 85.01  ?  258  C   A P     1 
ATOM   5517  O  OP1   . C   A 1  258  ? 153.877 205.647 162.565 1.00 85.01  ?  258  C   A OP1   1 
ATOM   5518  O  OP2   . C   A 1  258  ? 152.279 203.734 161.949 1.00 85.01  ?  258  C   A OP2   1 
ATOM   5519  O  "O5'" . C   A 1  258  ? 151.559 205.568 163.473 1.00 85.01  ?  258  C   A "O5'" 1 
ATOM   5520  C  "C5'" . C   A 1  258  ? 151.509 206.906 163.948 1.00 85.01  ?  258  C   A "C5'" 1 
ATOM   5521  C  "C4'" . C   A 1  258  ? 150.285 207.151 164.794 1.00 85.01  ?  258  C   A "C4'" 1 
ATOM   5522  O  "O4'" . C   A 1  258  ? 149.089 206.831 164.036 1.00 85.01  ?  258  C   A "O4'" 1 
ATOM   5523  C  "C3'" . C   A 1  258  ? 150.157 206.306 166.051 1.00 85.01  ?  258  C   A "C3'" 1 
ATOM   5524  O  "O3'" . C   A 1  258  ? 150.945 206.786 167.127 1.00 85.01  ?  258  C   A "O3'" 1 
ATOM   5525  C  "C2'" . C   A 1  258  ? 148.658 206.341 166.326 1.00 85.01  ?  258  C   A "C2'" 1 
ATOM   5526  O  "O2'" . C   A 1  258  ? 148.293 207.557 166.962 1.00 85.01  ?  258  C   A "O2'" 1 
ATOM   5527  C  "C1'" . C   A 1  258  ? 148.084 206.348 164.904 1.00 85.01  ?  258  C   A "C1'" 1 
ATOM   5528  N  N1    . C   A 1  258  ? 147.650 205.000 164.455 1.00 85.01  ?  258  C   A N1    1 
ATOM   5529  C  C2    . C   A 1  258  ? 146.363 204.567 164.797 1.00 85.01  ?  258  C   A C2    1 
ATOM   5530  O  O2    . C   A 1  258  ? 145.626 205.310 165.463 1.00 85.01  ?  258  C   A O2    1 
ATOM   5531  N  N3    . C   A 1  258  ? 145.946 203.342 164.399 1.00 85.01  ?  258  C   A N3    1 
ATOM   5532  C  C4    . C   A 1  258  ? 146.753 202.557 163.684 1.00 85.01  ?  258  C   A C4    1 
ATOM   5533  N  N4    . C   A 1  258  ? 146.293 201.360 163.314 1.00 85.01  ?  258  C   A N4    1 
ATOM   5534  C  C5    . C   A 1  258  ? 148.066 202.968 163.316 1.00 85.01  ?  258  C   A C5    1 
ATOM   5535  C  C6    . C   A 1  258  ? 148.465 204.182 163.715 1.00 85.01  ?  258  C   A C6    1 
ATOM   5536  P  P     . C   A 1  259  ? 151.523 205.761 168.221 1.00 85.96  ?  259  C   A P     1 
ATOM   5537  O  OP1   . C   A 1  259  ? 152.576 206.462 168.999 1.00 85.96  ?  259  C   A OP1   1 
ATOM   5538  O  OP2   . C   A 1  259  ? 151.847 204.486 167.532 1.00 85.96  ?  259  C   A OP2   1 
ATOM   5539  O  "O5'" . C   A 1  259  ? 150.287 205.496 169.191 1.00 85.96  ?  259  C   A "O5'" 1 
ATOM   5540  C  "C5'" . C   A 1  259  ? 149.740 206.547 169.974 1.00 85.96  ?  259  C   A "C5'" 1 
ATOM   5541  C  "C4'" . C   A 1  259  ? 148.526 206.093 170.745 1.00 85.96  ?  259  C   A "C4'" 1 
ATOM   5542  O  "O4'" . C   A 1  259  ? 147.422 205.853 169.836 1.00 85.96  ?  259  C   A "O4'" 1 
ATOM   5543  C  "C3'" . C   A 1  259  ? 148.668 204.785 171.506 1.00 85.96  ?  259  C   A "C3'" 1 
ATOM   5544  O  "O3'" . C   A 1  259  ? 149.340 204.940 172.743 1.00 85.96  ?  259  C   A "O3'" 1 
ATOM   5545  C  "C2'" . C   A 1  259  ? 147.223 204.319 171.648 1.00 85.96  ?  259  C   A "C2'" 1 
ATOM   5546  O  "O2'" . C   A 1  259  ? 146.585 204.984 172.728 1.00 85.96  ?  259  C   A "O2'" 1 
ATOM   5547  C  "C1'" . C   A 1  259  ? 146.602 204.818 170.338 1.00 85.96  ?  259  C   A "C1'" 1 
ATOM   5548  N  N1    . C   A 1  259  ? 146.472 203.754 169.312 1.00 85.96  ?  259  C   A N1    1 
ATOM   5549  C  C2    . C   A 1  259  ? 145.322 202.956 169.320 1.00 85.96  ?  259  C   A C2    1 
ATOM   5550  O  O2    . C   A 1  259  ? 144.453 203.156 170.182 1.00 85.96  ?  259  C   A O2    1 
ATOM   5551  N  N3    . C   A 1  259  ? 145.180 201.985 168.388 1.00 85.96  ?  259  C   A N3    1 
ATOM   5552  C  C4    . C   A 1  259  ? 146.126 201.794 167.467 1.00 85.96  ?  259  C   A C4    1 
ATOM   5553  N  N4    . C   A 1  259  ? 145.943 200.821 166.572 1.00 85.96  ?  259  C   A N4    1 
ATOM   5554  C  C5    . C   A 1  259  ? 147.308 202.587 167.433 1.00 85.96  ?  259  C   A C5    1 
ATOM   5555  C  C6    . C   A 1  259  ? 147.433 203.547 168.358 1.00 85.96  ?  259  C   A C6    1 
ATOM   5556  P  P     . A   A 1  260  ? 150.273 203.763 173.313 1.00 88.06  ?  260  A   A P     1 
ATOM   5557  O  OP1   . A   A 1  260  ? 151.240 204.361 174.267 1.00 88.06  ?  260  A   A OP1   1 
ATOM   5558  O  OP2   . A   A 1  260  ? 150.773 202.972 172.159 1.00 88.06  ?  260  A   A OP2   1 
ATOM   5559  O  "O5'" . A   A 1  260  ? 149.269 202.845 174.141 1.00 88.06  ?  260  A   A "O5'" 1 
ATOM   5560  C  "C5'" . A   A 1  260  ? 148.504 203.383 175.210 1.00 88.06  ?  260  A   A "C5'" 1 
ATOM   5561  C  "C4'" . A   A 1  260  ? 147.845 202.294 176.017 1.00 88.06  ?  260  A   A "C4'" 1 
ATOM   5562  O  "O4'" . A   A 1  260  ? 146.888 201.585 175.189 1.00 88.06  ?  260  A   A "O4'" 1 
ATOM   5563  C  "C3'" . A   A 1  260  ? 148.769 201.202 176.535 1.00 88.06  ?  260  A   A "C3'" 1 
ATOM   5564  O  "O3'" . A   A 1  260  ? 149.443 201.571 177.725 1.00 88.06  ?  260  A   A "O3'" 1 
ATOM   5565  C  "C2'" . A   A 1  260  ? 147.825 200.021 176.713 1.00 88.06  ?  260  A   A "C2'" 1 
ATOM   5566  O  "O2'" . A   A 1  260  ? 147.082 200.150 177.917 1.00 88.06  ?  260  A   A "O2'" 1 
ATOM   5567  C  "C1'" . A   A 1  260  ? 146.871 200.216 175.535 1.00 88.06  ?  260  A   A "C1'" 1 
ATOM   5568  N  N9    . A   A 1  260  ? 147.275 199.431 174.354 1.00 88.06  ?  260  A   A N9    1 
ATOM   5569  C  C8    . A   A 1  260  ? 147.980 199.860 173.256 1.00 88.06  ?  260  A   A C8    1 
ATOM   5570  N  N7    . A   A 1  260  ? 148.186 198.924 172.361 1.00 88.06  ?  260  A   A N7    1 
ATOM   5571  C  C5    . A   A 1  260  ? 147.576 197.804 172.907 1.00 88.06  ?  260  A   A C5    1 
ATOM   5572  C  C6    . A   A 1  260  ? 147.431 196.477 172.456 1.00 88.06  ?  260  A   A C6    1 
ATOM   5573  N  N6    . A   A 1  260  ? 147.913 196.030 171.295 1.00 88.06  ?  260  A   A N6    1 
ATOM   5574  N  N1    . A   A 1  260  ? 146.761 195.609 173.246 1.00 88.06  ?  260  A   A N1    1 
ATOM   5575  C  C2    . A   A 1  260  ? 146.270 196.046 174.412 1.00 88.06  ?  260  A   A C2    1 
ATOM   5576  N  N3    . A   A 1  260  ? 146.337 197.264 174.944 1.00 88.06  ?  260  A   A N3    1 
ATOM   5577  C  C4    . A   A 1  260  ? 147.009 198.102 174.134 1.00 88.06  ?  260  A   A C4    1 
ATOM   5578  P  P     . G   A 1  261  ? 151.018 201.884 177.702 1.00 94.72  ?  261  G   A P     1 
ATOM   5579  O  OP1   . G   A 1  261  ? 151.209 203.269 177.200 1.00 94.72  ?  261  G   A OP1   1 
ATOM   5580  O  OP2   . G   A 1  261  ? 151.704 200.755 177.024 1.00 94.72  ?  261  G   A OP2   1 
ATOM   5581  O  "O5'" . G   A 1  261  ? 151.432 201.863 179.240 1.00 94.72  ?  261  G   A "O5'" 1 
ATOM   5582  C  "C5'" . G   A 1  261  ? 152.210 200.803 179.773 1.00 94.72  ?  261  G   A "C5'" 1 
ATOM   5583  C  "C4'" . G   A 1  261  ? 151.399 199.931 180.697 1.00 94.72  ?  261  G   A "C4'" 1 
ATOM   5584  O  "O4'" . G   A 1  261  ? 150.638 198.975 179.903 1.00 94.72  ?  261  G   A "O4'" 1 
ATOM   5585  C  "C3'" . G   A 1  261  ? 152.200 199.046 181.635 1.00 94.72  ?  261  G   A "C3'" 1 
ATOM   5586  O  "O3'" . G   A 1  261  ? 152.886 199.719 182.703 1.00 94.72  ?  261  G   A "O3'" 1 
ATOM   5587  C  "C2'" . G   A 1  261  ? 151.212 197.915 181.944 1.00 94.72  ?  261  G   A "C2'" 1 
ATOM   5588  O  "O2'" . G   A 1  261  ? 150.150 198.315 182.799 1.00 94.72  ?  261  G   A "O2'" 1 
ATOM   5589  C  "C1'" . G   A 1  261  ? 150.594 197.720 180.564 1.00 94.72  ?  261  G   A "C1'" 1 
ATOM   5590  N  N9    . G   A 1  261  ? 151.344 196.733 179.764 1.00 94.72  ?  261  G   A N9    1 
ATOM   5591  C  C8    . G   A 1  261  ? 152.215 196.982 178.730 1.00 94.72  ?  261  G   A C8    1 
ATOM   5592  N  N7    . G   A 1  261  ? 152.730 195.897 178.220 1.00 94.72  ?  261  G   A N7    1 
ATOM   5593  C  C5    . G   A 1  261  ? 152.170 194.867 178.961 1.00 94.72  ?  261  G   A C5    1 
ATOM   5594  C  C6    . G   A 1  261  ? 152.349 193.461 178.865 1.00 94.72  ?  261  G   A C6    1 
ATOM   5595  O  O6    . G   A 1  261  ? 153.065 192.825 178.082 1.00 94.72  ?  261  G   A O6    1 
ATOM   5596  N  N1    . G   A 1  261  ? 151.586 192.784 179.811 1.00 94.72  ?  261  G   A N1    1 
ATOM   5597  C  C2    . G   A 1  261  ? 150.756 193.379 180.730 1.00 94.72  ?  261  G   A C2    1 
ATOM   5598  N  N2    . G   A 1  261  ? 150.103 192.552 181.561 1.00 94.72  ?  261  G   A N2    1 
ATOM   5599  N  N3    . G   A 1  261  ? 150.580 194.686 180.828 1.00 94.72  ?  261  G   A N3    1 
ATOM   5600  C  C4    . G   A 1  261  ? 151.311 195.366 179.918 1.00 94.72  ?  261  G   A C4    1 
ATOM   5601  P  P     . C   A 1  262  ? 152.240 200.132 184.123 1.00 99.89  ?  262  C   A P     1 
ATOM   5602  O  OP1   . C   A 1  262  ? 150.816 200.514 183.942 1.00 99.89  ?  262  C   A OP1   1 
ATOM   5603  O  OP2   . C   A 1  262  ? 153.167 201.100 184.762 1.00 99.89  ?  262  C   A OP2   1 
ATOM   5604  O  "O5'" . C   A 1  262  ? 152.308 198.783 184.968 1.00 99.89  ?  262  C   A "O5'" 1 
ATOM   5605  C  "C5'" . C   A 1  262  ? 151.711 198.684 186.252 1.00 99.89  ?  262  C   A "C5'" 1 
ATOM   5606  C  "C4'" . C   A 1  262  ? 151.869 197.296 186.819 1.00 99.89  ?  262  C   A "C4'" 1 
ATOM   5607  O  "O4'" . C   A 1  262  ? 151.447 196.320 185.833 1.00 99.89  ?  262  C   A "O4'" 1 
ATOM   5608  C  "C3'" . C   A 1  262  ? 153.289 196.876 187.165 1.00 99.89  ?  262  C   A "C3'" 1 
ATOM   5609  O  "O3'" . C   A 1  262  ? 153.731 197.378 188.414 1.00 99.89  ?  262  C   A "O3'" 1 
ATOM   5610  C  "C2'" . C   A 1  262  ? 153.216 195.352 187.101 1.00 99.89  ?  262  C   A "C2'" 1 
ATOM   5611  O  "O2'" . C   A 1  262  ? 152.672 194.823 188.301 1.00 99.89  ?  262  C   A "O2'" 1 
ATOM   5612  C  "C1'" . C   A 1  262  ? 152.202 195.135 185.971 1.00 99.89  ?  262  C   A "C1'" 1 
ATOM   5613  N  N1    . C   A 1  262  ? 152.841 194.794 184.673 1.00 99.89  ?  262  C   A N1    1 
ATOM   5614  C  C2    . C   A 1  262  ? 152.907 193.443 184.322 1.00 99.89  ?  262  C   A C2    1 
ATOM   5615  O  O2    . C   A 1  262  ? 152.435 192.601 185.098 1.00 99.89  ?  262  C   A O2    1 
ATOM   5616  N  N3    . C   A 1  262  ? 153.474 193.085 183.147 1.00 99.89  ?  262  C   A N3    1 
ATOM   5617  C  C4    . C   A 1  262  ? 153.976 194.013 182.333 1.00 99.89  ?  262  C   A C4    1 
ATOM   5618  N  N4    . C   A 1  262  ? 154.532 193.609 181.189 1.00 99.89  ?  262  C   A N4    1 
ATOM   5619  C  C5    . C   A 1  262  ? 153.929 195.397 182.657 1.00 99.89  ?  262  C   A C5    1 
ATOM   5620  C  C6    . C   A 1  262  ? 153.359 195.733 183.820 1.00 99.89  ?  262  C   A C6    1 
ATOM   5621  P  P     . G   A 1  263  ? 155.249 197.876 188.587 1.00 115.72 ?  263  G   A P     1 
ATOM   5622  O  OP1   . G   A 1  263  ? 155.275 198.910 189.652 1.00 115.72 ?  263  G   A OP1   1 
ATOM   5623  O  OP2   . G   A 1  263  ? 155.785 198.196 187.239 1.00 115.72 ?  263  G   A OP2   1 
ATOM   5624  O  "O5'" . G   A 1  263  ? 156.015 196.590 189.130 1.00 115.72 ?  263  G   A "O5'" 1 
ATOM   5625  C  "C5'" . G   A 1  263  ? 157.256 196.185 188.571 1.00 115.72 ?  263  G   A "C5'" 1 
ATOM   5626  C  "C4'" . G   A 1  263  ? 158.187 195.656 189.632 1.00 115.72 ?  263  G   A "C4'" 1 
ATOM   5627  O  "O4'" . G   A 1  263  ? 159.000 196.738 190.157 1.00 115.72 ?  263  G   A "O4'" 1 
ATOM   5628  C  "C3'" . G   A 1  263  ? 157.515 195.064 190.862 1.00 115.72 ?  263  G   A "C3'" 1 
ATOM   5629  O  "O3'" . G   A 1  263  ? 157.088 193.727 190.668 1.00 115.72 ?  263  G   A "O3'" 1 
ATOM   5630  C  "C2'" . G   A 1  263  ? 158.587 195.216 191.934 1.00 115.72 ?  263  G   A "C2'" 1 
ATOM   5631  O  "O2'" . G   A 1  263  ? 159.570 194.199 191.809 1.00 115.72 ?  263  G   A "O2'" 1 
ATOM   5632  C  "C1'" . G   A 1  263  ? 159.219 196.551 191.539 1.00 115.72 ?  263  G   A "C1'" 1 
ATOM   5633  N  N9    . G   A 1  263  ? 158.615 197.687 192.261 1.00 115.72 ?  263  G   A N9    1 
ATOM   5634  C  C8    . G   A 1  263  ? 157.731 198.606 191.751 1.00 115.72 ?  263  G   A C8    1 
ATOM   5635  N  N7    . G   A 1  263  ? 157.365 199.504 192.624 1.00 115.72 ?  263  G   A N7    1 
ATOM   5636  C  C5    . G   A 1  263  ? 158.050 199.158 193.780 1.00 115.72 ?  263  G   A C5    1 
ATOM   5637  C  C6    . G   A 1  263  ? 158.054 199.767 195.062 1.00 115.72 ?  263  G   A C6    1 
ATOM   5638  O  O6    . G   A 1  263  ? 157.432 200.766 195.443 1.00 115.72 ?  263  G   A O6    1 
ATOM   5639  N  N1    . G   A 1  263  ? 158.891 199.092 195.946 1.00 115.72 ?  263  G   A N1    1 
ATOM   5640  C  C2    . G   A 1  263  ? 159.629 197.976 195.638 1.00 115.72 ?  263  G   A C2    1 
ATOM   5641  N  N2    . G   A 1  263  ? 160.377 197.469 196.629 1.00 115.72 ?  263  G   A N2    1 
ATOM   5642  N  N3    . G   A 1  263  ? 159.634 197.399 194.447 1.00 115.72 ?  263  G   A N3    1 
ATOM   5643  C  C4    . G   A 1  263  ? 158.828 198.038 193.573 1.00 115.72 ?  263  G   A C4    1 
ATOM   5644  P  P     . A   A 1  264  ? 155.527 193.398 190.470 1.00 114.96 ?  264  A   A P     1 
ATOM   5645  O  OP1   . A   A 1  264  ? 155.322 192.980 189.059 1.00 114.96 ?  264  A   A OP1   1 
ATOM   5646  O  OP2   . A   A 1  264  ? 154.743 194.532 191.020 1.00 114.96 ?  264  A   A OP2   1 
ATOM   5647  O  "O5'" . A   A 1  264  ? 155.282 192.130 191.402 1.00 114.96 ?  264  A   A "O5'" 1 
ATOM   5648  C  "C5'" . A   A 1  264  ? 156.148 191.007 191.345 1.00 114.96 ?  264  A   A "C5'" 1 
ATOM   5649  C  "C4'" . A   A 1  264  ? 156.835 190.775 192.667 1.00 114.96 ?  264  A   A "C4'" 1 
ATOM   5650  O  "O4'" . A   A 1  264  ? 157.420 192.020 193.135 1.00 114.96 ?  264  A   A "O4'" 1 
ATOM   5651  C  "C3'" . A   A 1  264  ? 155.941 190.335 193.816 1.00 114.96 ?  264  A   A "C3'" 1 
ATOM   5652  O  "O3'" . A   A 1  264  ? 155.654 188.947 193.799 1.00 114.96 ?  264  A   A "O3'" 1 
ATOM   5653  C  "C2'" . A   A 1  264  ? 156.729 190.784 195.039 1.00 114.96 ?  264  A   A "C2'" 1 
ATOM   5654  O  "O2'" . A   A 1  264  ? 157.797 189.888 195.305 1.00 114.96 ?  264  A   A "O2'" 1 
ATOM   5655  C  "C1'" . A   A 1  264  ? 157.322 192.101 194.541 1.00 114.96 ?  264  A   A "C1'" 1 
ATOM   5656  N  N9    . A   A 1  264  ? 156.466 193.251 194.885 1.00 114.96 ?  264  A   A N9    1 
ATOM   5657  C  C8    . A   A 1  264  ? 155.668 193.987 194.043 1.00 114.96 ?  264  A   A C8    1 
ATOM   5658  N  N7    . A   A 1  264  ? 155.018 194.956 194.642 1.00 114.96 ?  264  A   A N7    1 
ATOM   5659  C  C5    . A   A 1  264  ? 155.414 194.849 195.968 1.00 114.96 ?  264  A   A C5    1 
ATOM   5660  C  C6    . A   A 1  264  ? 155.085 195.581 197.123 1.00 114.96 ?  264  A   A C6    1 
ATOM   5661  N  N6    . A   A 1  264  ? 154.242 196.616 197.126 1.00 114.96 ?  264  A   A N6    1 
ATOM   5662  N  N1    . A   A 1  264  ? 155.658 195.213 198.293 1.00 114.96 ?  264  A   A N1    1 
ATOM   5663  C  C2    . A   A 1  264  ? 156.506 194.175 198.302 1.00 114.96 ?  264  A   A C2    1 
ATOM   5664  N  N3    . A   A 1  264  ? 156.892 193.411 197.281 1.00 114.96 ?  264  A   A N3    1 
ATOM   5665  C  C4    . A   A 1  264  ? 156.305 193.803 196.134 1.00 114.96 ?  264  A   A C4    1 
ATOM   5666  P  P     . A   A 1  265  ? 154.442 188.361 194.676 1.00 98.97  ?  265  A   A P     1 
ATOM   5667  O  OP1   . A   A 1  265  ? 153.840 187.229 193.926 1.00 98.97  ?  265  A   A OP1   1 
ATOM   5668  O  OP2   . A   A 1  265  ? 153.585 189.497 195.101 1.00 98.97  ?  265  A   A OP2   1 
ATOM   5669  O  "O5'" . A   A 1  265  ? 155.155 187.765 195.971 1.00 98.97  ?  265  A   A "O5'" 1 
ATOM   5670  C  "C5'" . A   A 1  265  ? 155.779 186.490 195.934 1.00 98.97  ?  265  A   A "C5'" 1 
ATOM   5671  C  "C4'" . A   A 1  265  ? 157.255 186.605 195.651 1.00 98.97  ?  265  A   A "C4'" 1 
ATOM   5672  O  "O4'" . A   A 1  265  ? 158.010 186.398 196.873 1.00 98.97  ?  265  A   A "O4'" 1 
ATOM   5673  C  "C3'" . A   A 1  265  ? 157.829 185.581 194.686 1.00 98.97  ?  265  A   A "C3'" 1 
ATOM   5674  O  "O3'" . A   A 1  265  ? 157.598 185.911 193.328 1.00 98.97  ?  265  A   A "O3'" 1 
ATOM   5675  C  "C2'" . A   A 1  265  ? 159.302 185.554 195.067 1.00 98.97  ?  265  A   A "C2'" 1 
ATOM   5676  O  "O2'" . A   A 1  265  ? 159.983 186.673 194.519 1.00 98.97  ?  265  A   A "O2'" 1 
ATOM   5677  C  "C1'" . A   A 1  265  ? 159.222 185.733 196.584 1.00 98.97  ?  265  A   A "C1'" 1 
ATOM   5678  N  N9    . A   A 1  265  ? 159.230 184.441 197.294 1.00 98.97  ?  265  A   A N9    1 
ATOM   5679  C  C8    . A   A 1  265  ? 158.172 183.800 197.891 1.00 98.97  ?  265  A   A C8    1 
ATOM   5680  N  N7    . A   A 1  265  ? 158.491 182.656 198.446 1.00 98.97  ?  265  A   A N7    1 
ATOM   5681  C  C5    . A   A 1  265  ? 159.851 182.537 198.197 1.00 98.97  ?  265  A   A C5    1 
ATOM   5682  C  C6    . A   A 1  265  ? 160.797 181.547 198.522 1.00 98.97  ?  265  A   A C6    1 
ATOM   5683  N  N6    . A   A 1  265  ? 160.501 180.438 199.202 1.00 98.97  ?  265  A   A N6    1 
ATOM   5684  N  N1    . A   A 1  265  ? 162.076 181.737 198.123 1.00 98.97  ?  265  A   A N1    1 
ATOM   5685  C  C2    . A   A 1  265  ? 162.385 182.848 197.440 1.00 98.97  ?  265  A   A C2    1 
ATOM   5686  N  N3    . A   A 1  265  ? 161.584 183.847 197.075 1.00 98.97  ?  265  A   A N3    1 
ATOM   5687  C  C4    . A   A 1  265  ? 160.321 183.629 197.488 1.00 98.97  ?  265  A   A C4    1 
ATOM   5688  P  P     . G   A 1  266  ? 157.153 184.771 192.287 1.00 71.15  ?  266  G   A P     1 
ATOM   5689  O  OP1   . G   A 1  266  ? 156.976 185.405 190.956 1.00 71.15  ?  266  G   A OP1   1 
ATOM   5690  O  OP2   . G   A 1  266  ? 156.032 184.008 192.892 1.00 71.15  ?  266  G   A OP2   1 
ATOM   5691  O  "O5'" . G   A 1  266  ? 158.420 183.809 192.213 1.00 71.15  ?  266  G   A "O5'" 1 
ATOM   5692  C  "C5'" . G   A 1  266  ? 158.288 182.463 191.784 1.00 71.15  ?  266  G   A "C5'" 1 
ATOM   5693  C  "C4'" . G   A 1  266  ? 159.476 181.633 192.200 1.00 71.15  ?  266  G   A "C4'" 1 
ATOM   5694  O  "O4'" . G   A 1  266  ? 159.802 181.907 193.589 1.00 71.15  ?  266  G   A "O4'" 1 
ATOM   5695  C  "C3'" . G   A 1  266  ? 159.280 180.126 192.158 1.00 71.15  ?  266  G   A "C3'" 1 
ATOM   5696  O  "O3'" . G   A 1  266  ? 159.427 179.576 190.861 1.00 71.15  ?  266  G   A "O3'" 1 
ATOM   5697  C  "C2'" . G   A 1  266  ? 160.311 179.631 193.161 1.00 71.15  ?  266  G   A "C2'" 1 
ATOM   5698  O  "O2'" . G   A 1  266  ? 161.614 179.659 192.596 1.00 71.15  ?  266  G   A "O2'" 1 
ATOM   5699  C  "C1'" . G   A 1  266  ? 160.225 180.720 194.229 1.00 71.15  ?  266  G   A "C1'" 1 
ATOM   5700  N  N9    . G   A 1  266  ? 159.239 180.386 195.274 1.00 71.15  ?  266  G   A N9    1 
ATOM   5701  C  C8    . G   A 1  266  ? 158.025 180.999 195.473 1.00 71.15  ?  266  G   A C8    1 
ATOM   5702  N  N7    . G   A 1  266  ? 157.352 180.499 196.472 1.00 71.15  ?  266  G   A N7    1 
ATOM   5703  C  C5    . G   A 1  266  ? 158.171 179.493 196.966 1.00 71.15  ?  266  G   A C5    1 
ATOM   5704  C  C6    . G   A 1  266  ? 157.971 178.600 198.050 1.00 71.15  ?  266  G   A C6    1 
ATOM   5705  O  O6    . G   A 1  266  ? 157.001 178.519 198.814 1.00 71.15  ?  266  G   A O6    1 
ATOM   5706  N  N1    . G   A 1  266  ? 159.051 177.737 198.208 1.00 71.15  ?  266  G   A N1    1 
ATOM   5707  C  C2    . G   A 1  266  ? 160.178 177.732 197.425 1.00 71.15  ?  266  G   A C2    1 
ATOM   5708  N  N2    . G   A 1  266  ? 161.112 176.822 197.736 1.00 71.15  ?  266  G   A N2    1 
ATOM   5709  N  N3    . G   A 1  266  ? 160.377 178.560 196.412 1.00 71.15  ?  266  G   A N3    1 
ATOM   5710  C  C4    . G   A 1  266  ? 159.340 179.409 196.238 1.00 71.15  ?  266  G   A C4    1 
ATOM   5711  P  P     . U   A 1  267  ? 158.202 178.785 190.184 1.00 56.58  ?  267  U   A P     1 
ATOM   5712  O  OP1   . U   A 1  267  ? 157.061 179.727 190.056 1.00 56.58  ?  267  U   A OP1   1 
ATOM   5713  O  OP2   . U   A 1  267  ? 158.021 177.508 190.921 1.00 56.58  ?  267  U   A OP2   1 
ATOM   5714  O  "O5'" . U   A 1  267  ? 158.721 178.439 188.719 1.00 56.58  ?  267  U   A "O5'" 1 
ATOM   5715  C  "C5'" . U   A 1  267  ? 159.387 177.210 188.448 1.00 56.58  ?  267  U   A "C5'" 1 
ATOM   5716  C  "C4'" . U   A 1  267  ? 159.144 176.749 187.033 1.00 56.58  ?  267  U   A "C4'" 1 
ATOM   5717  O  "O4'" . U   A 1  267  ? 159.541 177.805 186.116 1.00 56.58  ?  267  U   A "O4'" 1 
ATOM   5718  C  "C3'" . U   A 1  267  ? 159.921 175.504 186.610 1.00 56.58  ?  267  U   A "C3'" 1 
ATOM   5719  O  "O3'" . U   A 1  267  ? 159.142 174.748 185.683 1.00 56.58  ?  267  U   A "O3'" 1 
ATOM   5720  C  "C2'" . U   A 1  267  ? 161.127 176.091 185.890 1.00 56.58  ?  267  U   A "C2'" 1 
ATOM   5721  O  "O2'" . U   A 1  267  ? 161.728 175.224 184.952 1.00 56.58  ?  267  U   A "O2'" 1 
ATOM   5722  C  "C1'" . U   A 1  267  ? 160.515 177.315 185.216 1.00 56.58  ?  267  U   A "C1'" 1 
ATOM   5723  N  N1    . U   A 1  267  ? 161.481 178.391 184.954 1.00 56.58  ?  267  U   A N1    1 
ATOM   5724  C  C2    . U   A 1  267  ? 161.598 178.847 183.656 1.00 56.58  ?  267  U   A C2    1 
ATOM   5725  O  O2    . U   A 1  267  ? 160.935 178.402 182.735 1.00 56.58  ?  267  U   A O2    1 
ATOM   5726  N  N3    . U   A 1  267  ? 162.520 179.848 183.478 1.00 56.58  ?  267  U   A N3    1 
ATOM   5727  C  C4    . U   A 1  267  ? 163.318 180.419 184.448 1.00 56.58  ?  267  U   A C4    1 
ATOM   5728  O  O4    . U   A 1  267  ? 164.104 181.312 184.135 1.00 56.58  ?  267  U   A O4    1 
ATOM   5729  C  C5    . U   A 1  267  ? 163.138 179.889 185.764 1.00 56.58  ?  267  U   A C5    1 
ATOM   5730  C  C6    . U   A 1  267  ? 162.247 178.914 185.967 1.00 56.58  ?  267  U   A C6    1 
ATOM   5731  P  P     . G   A 1  268  ? 158.107 173.646 186.219 1.00 49.18  ?  268  G   A P     1 
ATOM   5732  O  OP1   . G   A 1  268  ? 156.742 174.220 186.125 1.00 49.18  ?  268  G   A OP1   1 
ATOM   5733  O  OP2   . G   A 1  268  ? 158.613 173.165 187.528 1.00 49.18  ?  268  G   A OP2   1 
ATOM   5734  O  "O5'" . G   A 1  268  ? 158.216 172.452 185.169 1.00 49.18  ?  268  G   A "O5'" 1 
ATOM   5735  C  "C5'" . G   A 1  268  ? 159.439 171.757 184.967 1.00 49.18  ?  268  G   A "C5'" 1 
ATOM   5736  C  "C4'" . G   A 1  268  ? 159.470 170.465 185.746 1.00 49.18  ?  268  G   A "C4'" 1 
ATOM   5737  O  "O4'" . G   A 1  268  ? 158.121 169.964 185.921 1.00 49.18  ?  268  G   A "O4'" 1 
ATOM   5738  C  "C3'" . G   A 1  268  ? 160.216 169.308 185.101 1.00 49.18  ?  268  G   A "C3'" 1 
ATOM   5739  O  "O3'" . G   A 1  268  ? 161.617 169.379 185.294 1.00 49.18  ?  268  G   A "O3'" 1 
ATOM   5740  C  "C2'" . G   A 1  268  ? 159.576 168.091 185.758 1.00 49.18  ?  268  G   A "C2'" 1 
ATOM   5741  O  "O2'" . G   A 1  268  ? 160.121 167.875 187.052 1.00 49.18  ?  268  G   A "O2'" 1 
ATOM   5742  C  "C1'" . G   A 1  268  ? 158.126 168.553 185.915 1.00 49.18  ?  268  G   A "C1'" 1 
ATOM   5743  N  N9    . G   A 1  268  ? 157.265 168.082 184.814 1.00 49.18  ?  268  G   A N9    1 
ATOM   5744  C  C8    . G   A 1  268  ? 156.992 168.728 183.632 1.00 49.18  ?  268  G   A C8    1 
ATOM   5745  N  N7    . G   A 1  268  ? 156.190 168.053 182.854 1.00 49.18  ?  268  G   A N7    1 
ATOM   5746  C  C5    . G   A 1  268  ? 155.917 166.893 183.565 1.00 49.18  ?  268  G   A C5    1 
ATOM   5747  C  C6    . G   A 1  268  ? 155.105 165.777 183.230 1.00 49.18  ?  268  G   A C6    1 
ATOM   5748  O  O6    . G   A 1  268  ? 154.442 165.587 182.203 1.00 49.18  ?  268  G   A O6    1 
ATOM   5749  N  N1    . G   A 1  268  ? 155.108 164.820 184.240 1.00 49.18  ?  268  G   A N1    1 
ATOM   5750  C  C2    . G   A 1  268  ? 155.803 164.920 185.420 1.00 49.18  ?  268  G   A C2    1 
ATOM   5751  N  N2    . G   A 1  268  ? 155.678 163.890 186.270 1.00 49.18  ?  268  G   A N2    1 
ATOM   5752  N  N3    . G   A 1  268  ? 156.563 165.953 185.744 1.00 49.18  ?  268  G   A N3    1 
ATOM   5753  C  C4    . G   A 1  268  ? 156.574 166.895 184.776 1.00 49.18  ?  268  G   A C4    1 
ATOM   5754  P  P     . A   A 1  269  ? 162.607 169.509 184.036 1.00 54.27  ?  269  A   A P     1 
ATOM   5755  O  OP1   . A   A 1  269  ? 162.442 170.866 183.457 1.00 54.27  ?  269  A   A OP1   1 
ATOM   5756  O  OP2   . A   A 1  269  ? 162.418 168.315 183.173 1.00 54.27  ?  269  A   A OP2   1 
ATOM   5757  O  "O5'" . A   A 1  269  ? 164.059 169.424 184.686 1.00 54.27  ?  269  A   A "O5'" 1 
ATOM   5758  C  "C5'" . A   A 1  269  ? 164.312 169.983 185.967 1.00 54.27  ?  269  A   A "C5'" 1 
ATOM   5759  C  "C4'" . A   A 1  269  ? 165.651 170.673 186.017 1.00 54.27  ?  269  A   A "C4'" 1 
ATOM   5760  O  "O4'" . A   A 1  269  ? 166.256 170.667 184.699 1.00 54.27  ?  269  A   A "O4'" 1 
ATOM   5761  C  "C3'" . A   A 1  269  ? 165.620 172.141 186.413 1.00 54.27  ?  269  A   A "C3'" 1 
ATOM   5762  O  "O3'" . A   A 1  269  ? 165.578 172.319 187.818 1.00 54.27  ?  269  A   A "O3'" 1 
ATOM   5763  C  "C2'" . A   A 1  269  ? 166.885 172.695 185.772 1.00 54.27  ?  269  A   A "C2'" 1 
ATOM   5764  O  "O2'" . A   A 1  269  ? 168.018 172.413 186.579 1.00 54.27  ?  269  A   A "O2'" 1 
ATOM   5765  C  "C1'" . A   A 1  269  ? 166.983 171.858 184.494 1.00 54.27  ?  269  A   A "C1'" 1 
ATOM   5766  N  N9    . A   A 1  269  ? 166.435 172.541 183.304 1.00 54.27  ?  269  A   A N9    1 
ATOM   5767  C  C8    . A   A 1  269  ? 165.392 172.101 182.526 1.00 54.27  ?  269  A   A C8    1 
ATOM   5768  N  N7    . A   A 1  269  ? 165.111 172.883 181.515 1.00 54.27  ?  269  A   A N7    1 
ATOM   5769  C  C5    . A   A 1  269  ? 166.038 173.908 181.626 1.00 54.27  ?  269  A   A C5    1 
ATOM   5770  C  C6    . A   A 1  269  ? 166.275 175.056 180.849 1.00 54.27  ?  269  A   A C6    1 
ATOM   5771  N  N6    . A   A 1  269  ? 165.555 175.379 179.772 1.00 54.27  ?  269  A   A N6    1 
ATOM   5772  N  N1    . A   A 1  269  ? 167.276 175.884 181.226 1.00 54.27  ?  269  A   A N1    1 
ATOM   5773  C  C2    . A   A 1  269  ? 167.997 175.572 182.310 1.00 54.27  ?  269  A   A C2    1 
ATOM   5774  N  N3    . A   A 1  269  ? 167.876 174.516 183.112 1.00 54.27  ?  269  A   A N3    1 
ATOM   5775  C  C4    . A   A 1  269  ? 166.868 173.712 182.718 1.00 54.27  ?  269  A   A C4    1 
ATOM   5776  P  P     . G   A 1  270  ? 164.495 173.299 188.488 1.00 54.64  ?  270  G   A P     1 
ATOM   5777  O  OP1   . G   A 1  270  ? 164.292 172.866 189.894 1.00 54.64  ?  270  G   A OP1   1 
ATOM   5778  O  OP2   . G   A 1  270  ? 163.329 173.388 187.572 1.00 54.64  ?  270  G   A OP2   1 
ATOM   5779  O  "O5'" . G   A 1  270  ? 165.217 174.719 188.508 1.00 54.64  ?  270  G   A "O5'" 1 
ATOM   5780  C  "C5'" . G   A 1  270  ? 166.496 174.890 189.113 1.00 54.64  ?  270  G   A "C5'" 1 
ATOM   5781  C  "C4'" . G   A 1  270  ? 167.295 175.991 188.453 1.00 54.64  ?  270  G   A "C4'" 1 
ATOM   5782  O  "O4'" . G   A 1  270  ? 167.154 175.880 187.011 1.00 54.64  ?  270  G   A "O4'" 1 
ATOM   5783  C  "C3'" . G   A 1  270  ? 166.880 177.417 188.810 1.00 54.64  ?  270  G   A "C3'" 1 
ATOM   5784  O  "O3'" . G   A 1  270  ? 168.026 178.264 188.768 1.00 54.64  ?  270  G   A "O3'" 1 
ATOM   5785  C  "C2'" . G   A 1  270  ? 165.946 177.791 187.665 1.00 54.64  ?  270  G   A "C2'" 1 
ATOM   5786  O  "O2'" . G   A 1  270  ? 165.828 179.179 187.434 1.00 54.64  ?  270  G   A "O2'" 1 
ATOM   5787  C  "C1'" . G   A 1  270  ? 166.603 177.074 186.487 1.00 54.64  ?  270  G   A "C1'" 1 
ATOM   5788  N  N9    . G   A 1  270  ? 165.667 176.702 185.427 1.00 54.64  ?  270  G   A N9    1 
ATOM   5789  C  C8    . G   A 1  270  ? 164.820 175.622 185.438 1.00 54.64  ?  270  G   A C8    1 
ATOM   5790  N  N7    . G   A 1  270  ? 164.103 175.524 184.354 1.00 54.64  ?  270  G   A N7    1 
ATOM   5791  C  C5    . G   A 1  270  ? 164.503 176.604 183.583 1.00 54.64  ?  270  G   A C5    1 
ATOM   5792  C  C6    . G   A 1  270  ? 164.067 177.018 182.301 1.00 54.64  ?  270  G   A C6    1 
ATOM   5793  O  O6    . G   A 1  270  ? 163.219 176.483 181.578 1.00 54.64  ?  270  G   A O6    1 
ATOM   5794  N  N1    . G   A 1  270  ? 164.736 178.163 181.880 1.00 54.64  ?  270  G   A N1    1 
ATOM   5795  C  C2    . G   A 1  270  ? 165.696 178.828 182.605 1.00 54.64  ?  270  G   A C2    1 
ATOM   5796  N  N2    . G   A 1  270  ? 166.225 179.919 182.031 1.00 54.64  ?  270  G   A N2    1 
ATOM   5797  N  N3    . G   A 1  270  ? 166.109 178.453 183.804 1.00 54.64  ?  270  G   A N3    1 
ATOM   5798  C  C4    . G   A 1  270  ? 165.475 177.339 184.226 1.00 54.64  ?  270  G   A C4    1 
ATOM   5799  P  P     . U   A 1  271  ? 168.771 178.700 190.123 1.00 64.84  ?  271  U   A P     1 
ATOM   5800  O  OP1   . U   A 1  271  ? 168.665 177.584 191.096 1.00 64.84  ?  271  U   A OP1   1 
ATOM   5801  O  OP2   . U   A 1  271  ? 168.284 180.052 190.501 1.00 64.84  ?  271  U   A OP2   1 
ATOM   5802  O  "O5'" . U   A 1  271  ? 170.296 178.833 189.687 1.00 64.84  ?  271  U   A "O5'" 1 
ATOM   5803  C  "C5'" . U   A 1  271  ? 171.070 177.680 189.390 1.00 64.84  ?  271  U   A "C5'" 1 
ATOM   5804  C  "C4'" . U   A 1  271  ? 172.185 177.992 188.427 1.00 64.84  ?  271  U   A "C4'" 1 
ATOM   5805  O  "O4'" . U   A 1  271  ? 171.661 178.088 187.076 1.00 64.84  ?  271  U   A "O4'" 1 
ATOM   5806  C  "C3'" . U   A 1  271  ? 172.889 179.321 188.641 1.00 64.84  ?  271  U   A "C3'" 1 
ATOM   5807  O  "O3'" . U   A 1  271  ? 173.852 179.287 189.678 1.00 64.84  ?  271  U   A "O3'" 1 
ATOM   5808  C  "C2'" . U   A 1  271  ? 173.477 179.613 187.267 1.00 64.84  ?  271  U   A "C2'" 1 
ATOM   5809  O  "O2'" . U   A 1  271  ? 174.669 178.869 187.064 1.00 64.84  ?  271  U   A "O2'" 1 
ATOM   5810  C  "C1'" . U   A 1  271  ? 172.392 179.051 186.343 1.00 64.84  ?  271  U   A "C1'" 1 
ATOM   5811  N  N1    . U   A 1  271  ? 171.460 180.097 185.851 1.00 64.84  ?  271  U   A N1    1 
ATOM   5812  C  C2    . U   A 1  271  ? 171.874 180.910 184.806 1.00 64.84  ?  271  U   A C2    1 
ATOM   5813  O  O2    . U   A 1  271  ? 172.964 180.822 184.264 1.00 64.84  ?  271  U   A O2    1 
ATOM   5814  N  N3    . U   A 1  271  ? 170.957 181.849 184.402 1.00 64.84  ?  271  U   A N3    1 
ATOM   5815  C  C4    . U   A 1  271  ? 169.695 182.061 184.915 1.00 64.84  ?  271  U   A C4    1 
ATOM   5816  O  O4    . U   A 1  271  ? 168.988 182.951 184.441 1.00 64.84  ?  271  U   A O4    1 
ATOM   5817  C  C5    . U   A 1  271  ? 169.338 181.184 185.986 1.00 64.84  ?  271  U   A C5    1 
ATOM   5818  C  C6    . U   A 1  271  ? 170.208 180.258 186.401 1.00 64.84  ?  271  U   A C6    1 
ATOM   5819  P  P     . U   A 1  272  ? 174.254 180.648 190.428 1.00 74.64  ?  272  U   A P     1 
ATOM   5820  O  OP1   . U   A 1  272  ? 174.908 180.307 191.717 1.00 74.64  ?  272  U   A OP1   1 
ATOM   5821  O  OP2   . U   A 1  272  ? 173.048 181.514 190.413 1.00 74.64  ?  272  U   A OP2   1 
ATOM   5822  O  "O5'" . U   A 1  272  ? 175.342 181.306 189.468 1.00 74.64  ?  272  U   A "O5'" 1 
ATOM   5823  C  "C5'" . U   A 1  272  ? 175.505 182.715 189.406 1.00 74.64  ?  272  U   A "C5'" 1 
ATOM   5824  C  "C4'" . U   A 1  272  ? 175.246 183.237 188.015 1.00 74.64  ?  272  U   A "C4'" 1 
ATOM   5825  O  "O4'" . U   A 1  272  ? 173.875 182.953 187.633 1.00 74.64  ?  272  U   A "O4'" 1 
ATOM   5826  C  "C3'" . U   A 1  272  ? 175.377 184.740 187.831 1.00 74.64  ?  272  U   A "C3'" 1 
ATOM   5827  O  "O3'" . U   A 1  272  ? 176.721 185.153 187.666 1.00 74.64  ?  272  U   A "O3'" 1 
ATOM   5828  C  "C2'" . U   A 1  272  ? 174.505 185.008 186.610 1.00 74.64  ?  272  U   A "C2'" 1 
ATOM   5829  O  "O2'" . U   A 1  272  ? 175.207 184.700 185.415 1.00 74.64  ?  272  U   A "O2'" 1 
ATOM   5830  C  "C1'" . U   A 1  272  ? 173.386 183.978 186.793 1.00 74.64  ?  272  U   A "C1'" 1 
ATOM   5831  N  N1    . U   A 1  272  ? 172.161 184.558 187.398 1.00 74.64  ?  272  U   A N1    1 
ATOM   5832  C  C2    . U   A 1  272  ? 171.274 185.215 186.561 1.00 74.64  ?  272  U   A C2    1 
ATOM   5833  O  O2    . U   A 1  272  ? 171.453 185.343 185.362 1.00 74.64  ?  272  U   A O2    1 
ATOM   5834  N  N3    . U   A 1  272  ? 170.158 185.725 187.180 1.00 74.64  ?  272  U   A N3    1 
ATOM   5835  C  C4    . U   A 1  272  ? 169.838 185.648 188.519 1.00 74.64  ?  272  U   A C4    1 
ATOM   5836  O  O4    . U   A 1  272  ? 168.793 186.160 188.924 1.00 74.64  ?  272  U   A O4    1 
ATOM   5837  C  C5    . U   A 1  272  ? 170.798 184.953 189.319 1.00 74.64  ?  272  U   A C5    1 
ATOM   5838  C  C6    . U   A 1  272  ? 171.892 184.443 188.743 1.00 74.64  ?  272  U   A C6    1 
ATOM   5839  P  P     . C   A 1  273  ? 177.336 186.319 188.585 1.00 71.92  ?  273  C   A P     1 
ATOM   5840  O  OP1   . C   A 1  273  ? 177.205 185.905 190.005 1.00 71.92  ?  273  C   A OP1   1 
ATOM   5841  O  OP2   . C   A 1  273  ? 176.756 187.613 188.141 1.00 71.92  ?  273  C   A OP2   1 
ATOM   5842  O  "O5'" . C   A 1  273  ? 178.883 186.317 188.208 1.00 71.92  ?  273  C   A "O5'" 1 
ATOM   5843  C  "C5'" . C   A 1  273  ? 179.299 186.298 186.846 1.00 71.92  ?  273  C   A "C5'" 1 
ATOM   5844  C  "C4'" . C   A 1  273  ? 180.650 185.646 186.660 1.00 71.92  ?  273  C   A "C4'" 1 
ATOM   5845  O  "O4'" . C   A 1  273  ? 181.673 186.459 187.297 1.00 71.92  ?  273  C   A "O4'" 1 
ATOM   5846  C  "C3'" . C   A 1  273  ? 180.800 184.234 187.230 1.00 71.92  ?  273  C   A "C3'" 1 
ATOM   5847  O  "O3'" . C   A 1  273  ? 181.583 183.434 186.344 1.00 71.92  ?  273  C   A "O3'" 1 
ATOM   5848  C  "C2'" . C   A 1  273  ? 181.572 184.460 188.528 1.00 71.92  ?  273  C   A "C2'" 1 
ATOM   5849  O  "O2'" . C   A 1  273  ? 182.357 183.362 188.941 1.00 71.92  ?  273  C   A "O2'" 1 
ATOM   5850  C  "C1'" . C   A 1  273  ? 182.442 185.663 188.176 1.00 71.92  ?  273  C   A "C1'" 1 
ATOM   5851  N  N1    . C   A 1  273  ? 182.805 186.485 189.339 1.00 71.92  ?  273  C   A N1    1 
ATOM   5852  C  C2    . C   A 1  273  ? 184.110 186.422 189.831 1.00 71.92  ?  273  C   A C2    1 
ATOM   5853  O  O2    . C   A 1  273  ? 184.928 185.677 189.271 1.00 71.92  ?  273  C   A O2    1 
ATOM   5854  N  N3    . C   A 1  273  ? 184.445 187.175 190.904 1.00 71.92  ?  273  C   A N3    1 
ATOM   5855  C  C4    . C   A 1  273  ? 183.534 187.964 191.479 1.00 71.92  ?  273  C   A C4    1 
ATOM   5856  N  N4    . C   A 1  273  ? 183.914 188.688 192.534 1.00 71.92  ?  273  C   A N4    1 
ATOM   5857  C  C5    . C   A 1  273  ? 182.196 188.046 190.998 1.00 71.92  ?  273  C   A C5    1 
ATOM   5858  C  C6    . C   A 1  273  ? 181.879 187.295 189.936 1.00 71.92  ?  273  C   A C6    1 
ATOM   5859  P  P     . A   A 1  274  ? 181.313 181.852 186.241 1.00 73.30  ?  274  A   A P     1 
ATOM   5860  O  OP1   . A   A 1  274  ? 182.420 181.153 186.942 1.00 73.30  ?  274  A   A OP1   1 
ATOM   5861  O  OP2   . A   A 1  274  ? 181.019 181.522 184.824 1.00 73.30  ?  274  A   A OP2   1 
ATOM   5862  O  "O5'" . A   A 1  274  ? 179.980 181.632 187.086 1.00 73.30  ?  274  A   A "O5'" 1 
ATOM   5863  C  "C5'" . A   A 1  274  ? 179.297 180.387 187.065 1.00 73.30  ?  274  A   A "C5'" 1 
ATOM   5864  C  "C4'" . A   A 1  274  ? 177.994 180.486 186.312 1.00 73.30  ?  274  A   A "C4'" 1 
ATOM   5865  O  "O4'" . A   A 1  274  ? 177.879 181.803 185.718 1.00 73.30  ?  274  A   A "O4'" 1 
ATOM   5866  C  "C3'" . A   A 1  274  ? 177.834 179.527 185.142 1.00 73.30  ?  274  A   A "C3'" 1 
ATOM   5867  O  "O3'" . A   A 1  274  ? 177.392 178.242 185.546 1.00 73.30  ?  274  A   A "O3'" 1 
ATOM   5868  C  "C2'" . A   A 1  274  ? 176.848 180.254 184.232 1.00 73.30  ?  274  A   A "C2'" 1 
ATOM   5869  O  "O2'" . A   A 1  274  ? 175.512 180.046 184.664 1.00 73.30  ?  274  A   A "O2'" 1 
ATOM   5870  C  "C1'" . A   A 1  274  ? 177.214 181.721 184.477 1.00 73.30  ?  274  A   A "C1'" 1 
ATOM   5871  N  N9    . A   A 1  274  ? 178.094 182.276 183.429 1.00 73.30  ?  274  A   A N9    1 
ATOM   5872  C  C8    . A   A 1  274  ? 178.862 181.615 182.501 1.00 73.30  ?  274  A   A C8    1 
ATOM   5873  N  N7    . A   A 1  274  ? 179.535 182.408 181.704 1.00 73.30  ?  274  A   A N7    1 
ATOM   5874  C  C5    . A   A 1  274  ? 179.185 183.680 182.133 1.00 73.30  ?  274  A   A C5    1 
ATOM   5875  C  C6    . A   A 1  274  ? 179.553 184.968 181.703 1.00 73.30  ?  274  A   A C6    1 
ATOM   5876  N  N6    . A   A 1  274  ? 180.397 185.196 180.694 1.00 73.30  ?  274  A   A N6    1 
ATOM   5877  N  N1    . A   A 1  274  ? 179.020 186.030 182.350 1.00 73.30  ?  274  A   A N1    1 
ATOM   5878  C  C2    . A   A 1  274  ? 178.171 185.813 183.364 1.00 73.30  ?  274  A   A C2    1 
ATOM   5879  N  N3    . A   A 1  274  ? 177.750 184.650 183.858 1.00 73.30  ?  274  A   A N3    1 
ATOM   5880  C  C4    . A   A 1  274  ? 178.298 183.615 183.193 1.00 73.30  ?  274  A   A C4    1 
ATOM   5881  P  P     . A   A 1  275  ? 178.042 176.919 184.904 1.00 74.62  ?  275  A   A P     1 
ATOM   5882  O  OP1   . A   A 1  275  ? 179.518 177.035 185.016 1.00 74.62  ?  275  A   A OP1   1 
ATOM   5883  O  OP2   . A   A 1  275  ? 177.421 176.697 183.574 1.00 74.62  ?  275  A   A OP2   1 
ATOM   5884  O  "O5'" . A   A 1  275  ? 177.566 175.746 185.873 1.00 74.62  ?  275  A   A "O5'" 1 
ATOM   5885  C  "C5'" . A   A 1  275  ? 178.123 175.606 187.172 1.00 74.62  ?  275  A   A "C5'" 1 
ATOM   5886  C  "C4'" . A   A 1  275  ? 177.256 174.751 188.063 1.00 74.62  ?  275  A   A "C4'" 1 
ATOM   5887  O  "O4'" . A   A 1  275  ? 175.952 175.366 188.223 1.00 74.62  ?  275  A   A "O4'" 1 
ATOM   5888  C  "C3'" . A   A 1  275  ? 176.947 173.349 187.561 1.00 74.62  ?  275  A   A "C3'" 1 
ATOM   5889  O  "O3'" . A   A 1  275  ? 177.997 172.430 187.811 1.00 74.62  ?  275  A   A "O3'" 1 
ATOM   5890  C  "C2'" . A   A 1  275  ? 175.660 173.008 188.299 1.00 74.62  ?  275  A   A "C2'" 1 
ATOM   5891  O  "O2'" . A   A 1  275  ? 175.937 172.609 189.633 1.00 74.62  ?  275  A   A "O2'" 1 
ATOM   5892  C  "C1'" . A   A 1  275  ? 174.960 174.369 188.339 1.00 74.62  ?  275  A   A "C1'" 1 
ATOM   5893  N  N9    . A   A 1  275  ? 173.998 174.532 187.233 1.00 74.62  ?  275  A   A N9    1 
ATOM   5894  C  C8    . A   A 1  275  ? 174.106 175.351 186.137 1.00 74.62  ?  275  A   A C8    1 
ATOM   5895  N  N7    . A   A 1  275  ? 173.082 175.280 185.322 1.00 74.62  ?  275  A   A N7    1 
ATOM   5896  C  C5    . A   A 1  275  ? 172.244 174.353 185.924 1.00 74.62  ?  275  A   A C5    1 
ATOM   5897  C  C6    . A   A 1  275  ? 170.989 173.827 185.567 1.00 74.62  ?  275  A   A C6    1 
ATOM   5898  N  N6    . A   A 1  275  ? 170.330 174.179 184.460 1.00 74.62  ?  275  A   A N6    1 
ATOM   5899  N  N1    . A   A 1  275  ? 170.425 172.915 186.393 1.00 74.62  ?  275  A   A N1    1 
ATOM   5900  C  C2    . A   A 1  275  ? 171.080 172.555 187.506 1.00 74.62  ?  275  A   A C2    1 
ATOM   5901  N  N3    . A   A 1  275  ? 172.260 172.980 187.947 1.00 74.62  ?  275  A   A N3    1 
ATOM   5902  C  C4    . A   A 1  275  ? 172.794 173.884 187.104 1.00 74.62  ?  275  A   A C4    1 
ATOM   5903  P  P     . U   A 1  276  ? 178.579 171.516 186.623 1.00 74.62  ?  276  U   A P     1 
ATOM   5904  O  OP1   . U   A 1  276  ? 179.640 170.647 187.192 1.00 74.62  ?  276  U   A OP1   1 
ATOM   5905  O  OP2   . U   A 1  276  ? 178.896 172.403 185.475 1.00 74.62  ?  276  U   A OP2   1 
ATOM   5906  O  "O5'" . U   A 1  276  ? 177.353 170.588 186.205 1.00 74.62  ?  276  U   A "O5'" 1 
ATOM   5907  C  "C5'" . U   A 1  276  ? 176.892 169.550 187.059 1.00 74.62  ?  276  U   A "C5'" 1 
ATOM   5908  C  "C4'" . U   A 1  276  ? 175.616 168.939 186.538 1.00 74.62  ?  276  U   A "C4'" 1 
ATOM   5909  O  "O4'" . U   A 1  276  ? 174.586 169.958 186.469 1.00 74.62  ?  276  U   A "O4'" 1 
ATOM   5910  C  "C3'" . U   A 1  276  ? 175.679 168.374 185.126 1.00 74.62  ?  276  U   A "C3'" 1 
ATOM   5911  O  "O3'" . U   A 1  276  ? 176.216 167.062 185.085 1.00 74.62  ?  276  U   A "O3'" 1 
ATOM   5912  C  "C2'" . U   A 1  276  ? 174.229 168.450 184.662 1.00 74.62  ?  276  U   A "C2'" 1 
ATOM   5913  O  "O2'" . U   A 1  276  ? 173.486 167.352 185.168 1.00 74.62  ?  276  U   A "O2'" 1 
ATOM   5914  C  "C1'" . U   A 1  276  ? 173.744 169.725 185.360 1.00 74.62  ?  276  U   A "C1'" 1 
ATOM   5915  N  N1    . U   A 1  276  ? 173.770 170.918 184.477 1.00 74.62  ?  276  U   A N1    1 
ATOM   5916  C  C2    . U   A 1  276  ? 172.708 171.116 183.611 1.00 74.62  ?  276  U   A C2    1 
ATOM   5917  O  O2    . U   A 1  276  ? 171.759 170.355 183.529 1.00 74.62  ?  276  U   A O2    1 
ATOM   5918  N  N3    . U   A 1  276  ? 172.795 172.245 182.833 1.00 74.62  ?  276  U   A N3    1 
ATOM   5919  C  C4    . U   A 1  276  ? 173.808 173.183 182.831 1.00 74.62  ?  276  U   A C4    1 
ATOM   5920  O  O4    . U   A 1  276  ? 173.745 174.149 182.070 1.00 74.62  ?  276  U   A O4    1 
ATOM   5921  C  C5    . U   A 1  276  ? 174.866 172.914 183.753 1.00 74.62  ?  276  U   A C5    1 
ATOM   5922  C  C6    . U   A 1  276  ? 174.806 171.826 184.525 1.00 74.62  ?  276  U   A C6    1 
ATOM   5923  P  P     . G   A 1  277  ? 177.326 166.668 183.991 1.00 54.90  ?  277  G   A P     1 
ATOM   5924  O  OP1   . G   A 1  277  ? 178.158 165.577 184.558 1.00 54.90  ?  277  G   A OP1   1 
ATOM   5925  O  OP2   . G   A 1  277  ? 177.974 167.919 183.523 1.00 54.90  ?  277  G   A OP2   1 
ATOM   5926  O  "O5'" . G   A 1  277  ? 176.484 166.065 182.779 1.00 54.90  ?  277  G   A "O5'" 1 
ATOM   5927  C  "C5'" . G   A 1  277  ? 175.520 165.043 182.994 1.00 54.90  ?  277  G   A "C5'" 1 
ATOM   5928  C  "C4'" . G   A 1  277  ? 174.840 164.645 181.708 1.00 54.90  ?  277  G   A "C4'" 1 
ATOM   5929  O  "O4'" . G   A 1  277  ? 174.766 165.793 180.824 1.00 54.90  ?  277  G   A "O4'" 1 
ATOM   5930  C  "C3'" . G   A 1  277  ? 175.544 163.584 180.876 1.00 54.90  ?  277  G   A "C3'" 1 
ATOM   5931  O  "O3'" . G   A 1  277  ? 175.294 162.266 181.333 1.00 54.90  ?  277  G   A "O3'" 1 
ATOM   5932  C  "C2'" . G   A 1  277  ? 175.015 163.854 179.473 1.00 54.90  ?  277  G   A "C2'" 1 
ATOM   5933  O  "O2'" . G   A 1  277  ? 173.716 163.304 179.311 1.00 54.90  ?  277  G   A "O2'" 1 
ATOM   5934  C  "C1'" . G   A 1  277  ? 174.897 165.379 179.481 1.00 54.90  ?  277  G   A "C1'" 1 
ATOM   5935  N  N9    . G   A 1  277  ? 176.080 166.039 178.891 1.00 54.90  ?  277  G   A N9    1 
ATOM   5936  C  C8    . G   A 1  277  ? 177.288 166.304 179.494 1.00 54.90  ?  277  G   A C8    1 
ATOM   5937  N  N7    . G   A 1  277  ? 178.139 166.901 178.706 1.00 54.90  ?  277  G   A N7    1 
ATOM   5938  C  C5    . G   A 1  277  ? 177.454 167.041 177.507 1.00 54.90  ?  277  G   A C5    1 
ATOM   5939  C  C6    . G   A 1  277  ? 177.863 167.617 176.277 1.00 54.90  ?  277  G   A C6    1 
ATOM   5940  O  O6    . G   A 1  277  ? 178.950 168.136 175.992 1.00 54.90  ?  277  G   A O6    1 
ATOM   5941  N  N1    . G   A 1  277  ? 176.856 167.550 175.320 1.00 54.90  ?  277  G   A N1    1 
ATOM   5942  C  C2    . G   A 1  277  ? 175.613 167.000 175.519 1.00 54.90  ?  277  G   A C2    1 
ATOM   5943  N  N2    . G   A 1  277  ? 174.778 167.030 174.470 1.00 54.90  ?  277  G   A N2    1 
ATOM   5944  N  N3    . G   A 1  277  ? 175.219 166.460 176.661 1.00 54.90  ?  277  G   A N3    1 
ATOM   5945  C  C4    . G   A 1  277  ? 176.183 166.513 177.604 1.00 54.90  ?  277  G   A C4    1 
ATOM   5946  P  P     . G   A 1  278  ? 176.449 161.150 181.265 1.00 58.67  ?  278  G   A P     1 
ATOM   5947  O  OP1   . G   A 1  278  ? 177.270 161.403 180.054 1.00 58.67  ?  278  G   A OP1   1 
ATOM   5948  O  OP2   . G   A 1  278  ? 175.812 159.822 181.455 1.00 58.67  ?  278  G   A OP2   1 
ATOM   5949  O  "O5'" . G   A 1  278  ? 177.353 161.446 182.543 1.00 58.67  ?  278  G   A "O5'" 1 
ATOM   5950  C  "C5'" . G   A 1  278  ? 178.608 162.100 182.418 1.00 58.67  ?  278  G   A "C5'" 1 
ATOM   5951  C  "C4'" . G   A 1  278  ? 179.555 161.676 183.512 1.00 58.67  ?  278  G   A "C4'" 1 
ATOM   5952  O  "O4'" . G   A 1  278  ? 178.991 162.022 184.804 1.00 58.67  ?  278  G   A "O4'" 1 
ATOM   5953  C  "C3'" . G   A 1  278  ? 179.821 160.182 183.609 1.00 58.67  ?  278  G   A "C3'" 1 
ATOM   5954  O  "O3'" . G   A 1  278  ? 180.803 159.733 182.692 1.00 58.67  ?  278  G   A "O3'" 1 
ATOM   5955  C  "C2'" . G   A 1  278  ? 180.217 160.008 185.068 1.00 58.67  ?  278  G   A "C2'" 1 
ATOM   5956  O  "O2'" . G   A 1  278  ? 181.561 160.418 185.276 1.00 58.67  ?  278  G   A "O2'" 1 
ATOM   5957  C  "C1'" . G   A 1  278  ? 179.294 161.018 185.749 1.00 58.67  ?  278  G   A "C1'" 1 
ATOM   5958  N  N9    . G   A 1  278  ? 178.028 160.400 186.186 1.00 58.67  ?  278  G   A N9    1 
ATOM   5959  C  C8    . G   A 1  278  ? 176.792 160.577 185.613 1.00 58.67  ?  278  G   A C8    1 
ATOM   5960  N  N7    . G   A 1  278  ? 175.847 159.905 186.211 1.00 58.67  ?  278  G   A N7    1 
ATOM   5961  C  C5    . G   A 1  278  ? 176.498 159.244 187.243 1.00 58.67  ?  278  G   A C5    1 
ATOM   5962  C  C6    . G   A 1  278  ? 175.990 158.363 188.232 1.00 58.67  ?  278  G   A C6    1 
ATOM   5963  O  O6    . G   A 1  278  ? 174.825 157.980 188.398 1.00 58.67  ?  278  G   A O6    1 
ATOM   5964  N  N1    . G   A 1  278  ? 176.994 157.919 189.086 1.00 58.67  ?  278  G   A N1    1 
ATOM   5965  C  C2    . G   A 1  278  ? 178.318 158.274 189.001 1.00 58.67  ?  278  G   A C2    1 
ATOM   5966  N  N2    . G   A 1  278  ? 179.135 157.738 189.920 1.00 58.67  ?  278  G   A N2    1 
ATOM   5967  N  N3    . G   A 1  278  ? 178.804 159.094 188.084 1.00 58.67  ?  278  G   A N3    1 
ATOM   5968  C  C4    . G   A 1  278  ? 177.846 159.539 187.243 1.00 58.67  ?  278  G   A C4    1 
ATOM   5969  P  P     . C   A 1  279  ? 180.672 158.283 182.013 1.00 56.46  ?  279  C   A P     1 
ATOM   5970  O  OP1   . C   A 1  279  ? 181.565 158.248 180.827 1.00 56.46  ?  279  C   A OP1   1 
ATOM   5971  O  OP2   . C   A 1  279  ? 179.228 157.977 181.854 1.00 56.46  ?  279  C   A OP2   1 
ATOM   5972  O  "O5'" . C   A 1  279  ? 181.269 157.291 183.107 1.00 56.46  ?  279  C   A "O5'" 1 
ATOM   5973  C  "C5'" . C   A 1  279  ? 182.602 157.439 183.573 1.00 56.46  ?  279  C   A "C5'" 1 
ATOM   5974  C  "C4'" . C   A 1  279  ? 182.841 156.646 184.833 1.00 56.46  ?  279  C   A "C4'" 1 
ATOM   5975  O  "O4'" . C   A 1  279  ? 181.942 157.103 185.878 1.00 56.46  ?  279  C   A "O4'" 1 
ATOM   5976  C  "C3'" . C   A 1  279  ? 182.569 155.153 184.742 1.00 56.46  ?  279  C   A "C3'" 1 
ATOM   5977  O  "O3'" . C   A 1  279  ? 183.631 154.430 184.145 1.00 56.46  ?  279  C   A "O3'" 1 
ATOM   5978  C  "C2'" . C   A 1  279  ? 182.307 154.773 186.194 1.00 56.46  ?  279  C   A "C2'" 1 
ATOM   5979  O  "O2'" . C   A 1  279  ? 183.529 154.629 186.903 1.00 56.46  ?  279  C   A "O2'" 1 
ATOM   5980  C  "C1'" . C   A 1  279  ? 181.589 156.022 186.716 1.00 56.46  ?  279  C   A "C1'" 1 
ATOM   5981  N  N1    . C   A 1  279  ? 180.111 155.875 186.729 1.00 56.46  ?  279  C   A N1    1 
ATOM   5982  C  C2    . C   A 1  279  ? 179.504 155.231 187.816 1.00 56.46  ?  279  C   A C2    1 
ATOM   5983  O  O2    . C   A 1  279  ? 180.206 154.795 188.741 1.00 56.46  ?  279  C   A O2    1 
ATOM   5984  N  N3    . C   A 1  279  ? 178.157 155.094 187.839 1.00 56.46  ?  279  C   A N3    1 
ATOM   5985  C  C4    . C   A 1  279  ? 177.415 155.570 186.838 1.00 56.46  ?  279  C   A C4    1 
ATOM   5986  N  N4    . C   A 1  279  ? 176.092 155.408 186.908 1.00 56.46  ?  279  C   A N4    1 
ATOM   5987  C  C5    . C   A 1  279  ? 177.999 156.231 185.721 1.00 56.46  ?  279  C   A C5    1 
ATOM   5988  C  C6    . C   A 1  279  ? 179.331 156.362 185.712 1.00 56.46  ?  279  C   A C6    1 
ATOM   5989  P  P     . U   A 1  280  ? 183.319 153.275 183.072 1.00 51.13  ?  280  U   A P     1 
ATOM   5990  O  OP1   . U   A 1  280  ? 184.586 152.942 182.374 1.00 51.13  ?  280  U   A OP1   1 
ATOM   5991  O  OP2   . U   A 1  280  ? 182.133 153.691 182.280 1.00 51.13  ?  280  U   A OP2   1 
ATOM   5992  O  "O5'" . U   A 1  280  ? 182.903 152.022 183.962 1.00 51.13  ?  280  U   A "O5'" 1 
ATOM   5993  C  "C5'" . U   A 1  280  ? 183.831 151.423 184.854 1.00 51.13  ?  280  U   A "C5'" 1 
ATOM   5994  C  "C4'" . U   A 1  280  ? 183.137 150.595 185.906 1.00 51.13  ?  280  U   A "C4'" 1 
ATOM   5995  O  "O4'" . U   A 1  280  ? 182.213 151.429 186.655 1.00 51.13  ?  280  U   A "O4'" 1 
ATOM   5996  C  "C3'" . U   A 1  280  ? 182.270 149.455 185.397 1.00 51.13  ?  280  U   A "C3'" 1 
ATOM   5997  O  "O3'" . U   A 1  280  ? 183.013 148.299 185.050 1.00 51.13  ?  280  U   A "O3'" 1 
ATOM   5998  C  "C2'" . U   A 1  280  ? 181.299 149.235 186.551 1.00 51.13  ?  280  U   A "C2'" 1 
ATOM   5999  O  "O2'" . U   A 1  280  ? 181.911 148.479 187.585 1.00 51.13  ?  280  U   A "O2'" 1 
ATOM   6000  C  "C1'" . U   A 1  280  ? 181.093 150.667 187.056 1.00 51.13  ?  280  U   A "C1'" 1 
ATOM   6001  N  N1    . U   A 1  280  ? 179.858 151.290 186.517 1.00 51.13  ?  280  U   A N1    1 
ATOM   6002  C  C2    . U   A 1  280  ? 178.665 151.011 187.164 1.00 51.13  ?  280  U   A C2    1 
ATOM   6003  O  O2    . U   A 1  280  ? 178.586 150.284 188.141 1.00 51.13  ?  280  U   A O2    1 
ATOM   6004  N  N3    . U   A 1  280  ? 177.555 151.614 186.627 1.00 51.13  ?  280  U   A N3    1 
ATOM   6005  C  C4    . U   A 1  280  ? 177.508 152.452 185.533 1.00 51.13  ?  280  U   A C4    1 
ATOM   6006  O  O4    . U   A 1  280  ? 176.427 152.919 185.171 1.00 51.13  ?  280  U   A O4    1 
ATOM   6007  C  C5    . U   A 1  280  ? 178.775 152.697 184.919 1.00 51.13  ?  280  U   A C5    1 
ATOM   6008  C  C6    . U   A 1  280  ? 179.874 152.125 185.421 1.00 51.13  ?  280  U   A C6    1 
ATOM   6009  P  P     . G   A 1  281  ? 182.586 147.420 183.774 1.00 49.77  ?  281  G   A P     1 
ATOM   6010  O  OP1   . G   A 1  281  ? 183.639 146.397 183.548 1.00 49.77  ?  281  G   A OP1   1 
ATOM   6011  O  OP2   . G   A 1  281  ? 182.220 148.351 182.676 1.00 49.77  ?  281  G   A OP2   1 
ATOM   6012  O  "O5'" . G   A 1  281  ? 181.262 146.669 184.244 1.00 49.77  ?  281  G   A "O5'" 1 
ATOM   6013  C  "C5'" . G   A 1  281  ? 181.306 145.691 185.273 1.00 49.77  ?  281  G   A "C5'" 1 
ATOM   6014  C  "C4'" . G   A 1  281  ? 179.927 145.354 185.781 1.00 49.77  ?  281  G   A "C4'" 1 
ATOM   6015  O  "O4'" . G   A 1  281  ? 179.291 146.546 186.312 1.00 49.77  ?  281  G   A "O4'" 1 
ATOM   6016  C  "C3'" . G   A 1  281  ? 178.937 144.842 184.746 1.00 49.77  ?  281  G   A "C3'" 1 
ATOM   6017  O  "O3'" . G   A 1  281  ? 179.105 143.467 184.447 1.00 49.77  ?  281  G   A "O3'" 1 
ATOM   6018  C  "C2'" . G   A 1  281  ? 177.595 145.168 185.385 1.00 49.77  ?  281  G   A "C2'" 1 
ATOM   6019  O  "O2'" . G   A 1  281  ? 177.275 144.219 186.392 1.00 49.77  ?  281  G   A "O2'" 1 
ATOM   6020  C  "C1'" . G   A 1  281  ? 177.901 146.504 186.061 1.00 49.77  ?  281  G   A "C1'" 1 
ATOM   6021  N  N9    . G   A 1  281  ? 177.541 147.650 185.205 1.00 49.77  ?  281  G   A N9    1 
ATOM   6022  C  C8    . G   A 1  281  ? 178.402 148.496 184.549 1.00 49.77  ?  281  G   A C8    1 
ATOM   6023  N  N7    . G   A 1  281  ? 177.791 149.423 183.863 1.00 49.77  ?  281  G   A N7    1 
ATOM   6024  C  C5    . G   A 1  281  ? 176.442 149.176 184.078 1.00 49.77  ?  281  G   A C5    1 
ATOM   6025  C  C6    . G   A 1  281  ? 175.295 149.855 183.591 1.00 49.77  ?  281  G   A C6    1 
ATOM   6026  O  O6    . G   A 1  281  ? 175.241 150.842 182.848 1.00 49.77  ?  281  G   A O6    1 
ATOM   6027  N  N1    . G   A 1  281  ? 174.119 149.273 184.054 1.00 49.77  ?  281  G   A N1    1 
ATOM   6028  C  C2    . G   A 1  281  ? 174.053 148.178 184.880 1.00 49.77  ?  281  G   A C2    1 
ATOM   6029  N  N2    . G   A 1  281  ? 172.823 147.765 185.219 1.00 49.77  ?  281  G   A N2    1 
ATOM   6030  N  N3    . G   A 1  281  ? 175.114 147.537 185.342 1.00 49.77  ?  281  G   A N3    1 
ATOM   6031  C  C4    . G   A 1  281  ? 176.269 148.085 184.905 1.00 49.77  ?  281  G   A C4    1 
ATOM   6032  P  P     . A   A 1  282  ? 178.808 142.920 182.965 1.00 52.18  ?  282  A   A P     1 
ATOM   6033  O  OP1   . A   A 1  282  ? 179.316 141.528 182.878 1.00 52.18  ?  282  A   A OP1   1 
ATOM   6034  O  OP2   . A   A 1  282  ? 179.287 143.938 181.995 1.00 52.18  ?  282  A   A OP2   1 
ATOM   6035  O  "O5'" . A   A 1  282  ? 177.218 142.870 182.881 1.00 52.18  ?  282  A   A "O5'" 1 
ATOM   6036  C  "C5'" . A   A 1  282  ? 176.470 141.999 183.718 1.00 52.18  ?  282  A   A "C5'" 1 
ATOM   6037  C  "C4'" . A   A 1  282  ? 175.004 142.352 183.717 1.00 52.18  ?  282  A   A "C4'" 1 
ATOM   6038  O  "O4'" . A   A 1  282  ? 174.827 143.722 184.165 1.00 52.18  ?  282  A   A "O4'" 1 
ATOM   6039  C  "C3'" . A   A 1  282  ? 174.308 142.316 182.365 1.00 52.18  ?  282  A   A "C3'" 1 
ATOM   6040  O  "O3'" . A   A 1  282  ? 173.938 141.008 181.964 1.00 52.18  ?  282  A   A "O3'" 1 
ATOM   6041  C  "C2'" . A   A 1  282  ? 173.126 143.251 182.578 1.00 52.18  ?  282  A   A "C2'" 1 
ATOM   6042  O  "O2'" . A   A 1  282  ? 172.097 142.600 183.310 1.00 52.18  ?  282  A   A "O2'" 1 
ATOM   6043  C  "C1'" . A   A 1  282  ? 173.751 144.321 183.472 1.00 52.18  ?  282  A   A "C1'" 1 
ATOM   6044  N  N9    . A   A 1  282  ? 174.272 145.456 182.686 1.00 52.18  ?  282  A   A N9    1 
ATOM   6045  C  C8    . A   A 1  282  ? 175.585 145.782 182.455 1.00 52.18  ?  282  A   A C8    1 
ATOM   6046  N  N7    . A   A 1  282  ? 175.745 146.853 181.715 1.00 52.18  ?  282  A   A N7    1 
ATOM   6047  C  C5    . A   A 1  282  ? 174.447 147.259 181.439 1.00 52.18  ?  282  A   A C5    1 
ATOM   6048  C  C6    . A   A 1  282  ? 173.924 148.335 180.698 1.00 52.18  ?  282  A   A C6    1 
ATOM   6049  N  N6    . A   A 1  282  ? 174.681 149.237 180.071 1.00 52.18  ?  282  A   A N6    1 
ATOM   6050  N  N1    . A   A 1  282  ? 172.578 148.456 180.619 1.00 52.18  ?  282  A   A N1    1 
ATOM   6051  C  C2    . A   A 1  282  ? 171.809 147.554 181.244 1.00 52.18  ?  282  A   A C2    1 
ATOM   6052  N  N3    . A   A 1  282  ? 172.185 146.503 181.970 1.00 52.18  ?  282  A   A N3    1 
ATOM   6053  C  C4    . A   A 1  282  ? 173.528 146.409 182.030 1.00 52.18  ?  282  A   A C4    1 
ATOM   6054  P  P     . G   A 1  283  ? 173.744 140.669 180.405 1.00 51.24  ?  283  G   A P     1 
ATOM   6055  O  OP1   . G   A 1  283  ? 173.684 139.193 180.257 1.00 51.24  ?  283  G   A OP1   1 
ATOM   6056  O  OP2   . G   A 1  283  ? 174.751 141.444 179.636 1.00 51.24  ?  283  G   A OP2   1 
ATOM   6057  O  "O5'" . G   A 1  283  ? 172.305 141.258 180.062 1.00 51.24  ?  283  G   A "O5'" 1 
ATOM   6058  C  "C5'" . G   A 1  283  ? 171.990 141.708 178.753 1.00 51.24  ?  283  G   A "C5'" 1 
ATOM   6059  C  "C4'" . G   A 1  283  ? 170.801 142.635 178.763 1.00 51.24  ?  283  G   A "C4'" 1 
ATOM   6060  O  "O4'" . G   A 1  283  ? 171.152 143.875 179.432 1.00 51.24  ?  283  G   A "O4'" 1 
ATOM   6061  C  "C3'" . G   A 1  283  ? 170.294 143.080 177.400 1.00 51.24  ?  283  G   A "C3'" 1 
ATOM   6062  O  "O3'" . G   A 1  283  ? 169.451 142.120 176.787 1.00 51.24  ?  283  G   A "O3'" 1 
ATOM   6063  C  "C2'" . G   A 1  283  ? 169.594 144.393 177.718 1.00 51.24  ?  283  G   A "C2'" 1 
ATOM   6064  O  "O2'" . G   A 1  283  ? 168.313 144.155 178.283 1.00 51.24  ?  283  G   A "O2'" 1 
ATOM   6065  C  "C1'" . G   A 1  283  ? 170.503 144.963 178.807 1.00 51.24  ?  283  G   A "C1'" 1 
ATOM   6066  N  N9    . G   A 1  283  ? 171.533 145.866 178.258 1.00 51.24  ?  283  G   A N9    1 
ATOM   6067  C  C8    . G   A 1  283  ? 172.889 145.642 178.263 1.00 51.24  ?  283  G   A C8    1 
ATOM   6068  N  N7    . G   A 1  283  ? 173.574 146.606 177.716 1.00 51.24  ?  283  G   A N7    1 
ATOM   6069  C  C5    . G   A 1  283  ? 172.615 147.530 177.326 1.00 51.24  ?  283  G   A C5    1 
ATOM   6070  C  C6    . G   A 1  283  ? 172.763 148.783 176.676 1.00 51.24  ?  283  G   A C6    1 
ATOM   6071  O  O6    . G   A 1  283  ? 173.804 149.340 176.306 1.00 51.24  ?  283  G   A O6    1 
ATOM   6072  N  N1    . G   A 1  283  ? 171.535 149.400 176.464 1.00 51.24  ?  283  G   A N1    1 
ATOM   6073  C  C2    . G   A 1  283  ? 170.319 148.879 176.829 1.00 51.24  ?  283  G   A C2    1 
ATOM   6074  N  N2    . G   A 1  283  ? 169.243 149.625 176.538 1.00 51.24  ?  283  G   A N2    1 
ATOM   6075  N  N3    . G   A 1  283  ? 170.167 147.714 177.436 1.00 51.24  ?  283  G   A N3    1 
ATOM   6076  C  C4    . G   A 1  283  ? 171.348 147.092 177.654 1.00 51.24  ?  283  G   A C4    1 
ATOM   6077  P  P     . G   A 1  284  ? 169.570 141.826 175.211 1.00 48.12  ?  284  G   A P     1 
ATOM   6078  O  OP1   . G   A 1  284  ? 168.755 140.623 174.903 1.00 48.12  ?  284  G   A OP1   1 
ATOM   6079  O  OP2   . G   A 1  284  ? 171.010 141.850 174.848 1.00 48.12  ?  284  G   A OP2   1 
ATOM   6080  O  "O5'" . G   A 1  284  ? 168.870 143.084 174.529 1.00 48.12  ?  284  G   A "O5'" 1 
ATOM   6081  C  "C5'" . G   A 1  284  ? 167.507 143.389 174.785 1.00 48.12  ?  284  G   A "C5'" 1 
ATOM   6082  C  "C4'" . G   A 1  284  ? 167.150 144.766 174.285 1.00 48.12  ?  284  G   A "C4'" 1 
ATOM   6083  O  "O4'" . G   A 1  284  ? 167.922 145.765 174.999 1.00 48.12  ?  284  G   A "O4'" 1 
ATOM   6084  C  "C3'" . G   A 1  284  ? 167.457 145.037 172.820 1.00 48.12  ?  284  G   A "C3'" 1 
ATOM   6085  O  "O3'" . G   A 1  284  ? 166.461 144.531 171.948 1.00 48.12  ?  284  G   A "O3'" 1 
ATOM   6086  C  "C2'" . G   A 1  284  ? 167.592 146.553 172.783 1.00 48.12  ?  284  G   A "C2'" 1 
ATOM   6087  O  "O2'" . G   A 1  284  ? 166.314 147.171 172.777 1.00 48.12  ?  284  G   A "O2'" 1 
ATOM   6088  C  "C1'" . G   A 1  284  ? 168.255 146.829 174.133 1.00 48.12  ?  284  G   A "C1'" 1 
ATOM   6089  N  N9    . G   A 1  284  ? 169.725 146.902 174.029 1.00 48.12  ?  284  G   A N9    1 
ATOM   6090  C  C8    . G   A 1  284  ? 170.624 145.977 174.503 1.00 48.12  ?  284  G   A C8    1 
ATOM   6091  N  N7    . G   A 1  284  ? 171.867 146.303 174.274 1.00 48.12  ?  284  G   A N7    1 
ATOM   6092  C  C5    . G   A 1  284  ? 171.786 147.518 173.609 1.00 48.12  ?  284  G   A C5    1 
ATOM   6093  C  C6    . G   A 1  284  ? 172.813 148.358 173.106 1.00 48.12  ?  284  G   A C6    1 
ATOM   6094  O  O6    . G   A 1  284  ? 174.038 148.188 173.149 1.00 48.12  ?  284  G   A O6    1 
ATOM   6095  N  N1    . G   A 1  284  ? 172.293 149.497 172.501 1.00 48.12  ?  284  G   A N1    1 
ATOM   6096  C  C2    . G   A 1  284  ? 170.957 149.793 172.393 1.00 48.12  ?  284  G   A C2    1 
ATOM   6097  N  N2    . G   A 1  284  ? 170.654 150.943 171.773 1.00 48.12  ?  284  G   A N2    1 
ATOM   6098  N  N3    . G   A 1  284  ? 169.989 149.019 172.858 1.00 48.12  ?  284  G   A N3    1 
ATOM   6099  C  C4    . G   A 1  284  ? 170.471 147.905 173.451 1.00 48.12  ?  284  G   A C4    1 
ATOM   6100  P  P     . U   A 1  285  ? 166.822 143.376 170.890 1.00 46.89  ?  285  U   A P     1 
ATOM   6101  O  OP1   . U   A 1  285  ? 165.566 142.671 170.531 1.00 46.89  ?  285  U   A OP1   1 
ATOM   6102  O  OP2   . U   A 1  285  ? 167.969 142.603 171.430 1.00 46.89  ?  285  U   A OP2   1 
ATOM   6103  O  "O5'" . U   A 1  285  ? 167.325 144.173 169.607 1.00 46.89  ?  285  U   A "O5'" 1 
ATOM   6104  C  "C5'" . U   A 1  285  ? 166.502 145.152 168.990 1.00 46.89  ?  285  U   A "C5'" 1 
ATOM   6105  C  "C4'" . U   A 1  285  ? 167.325 146.274 168.411 1.00 46.89  ?  285  U   A "C4'" 1 
ATOM   6106  O  "O4'" . U   A 1  285  ? 168.131 146.875 169.457 1.00 46.89  ?  285  U   A "O4'" 1 
ATOM   6107  C  "C3'" . U   A 1  285  ? 168.338 145.875 167.349 1.00 46.89  ?  285  U   A "C3'" 1 
ATOM   6108  O  "O3'" . U   A 1  285  ? 167.763 145.718 166.064 1.00 46.89  ?  285  U   A "O3'" 1 
ATOM   6109  C  "C2'" . U   A 1  285  ? 169.364 146.999 167.427 1.00 46.89  ?  285  U   A "C2'" 1 
ATOM   6110  O  "O2'" . U   A 1  285  ? 168.906 148.144 166.724 1.00 46.89  ?  285  U   A "O2'" 1 
ATOM   6111  C  "C1'" . U   A 1  285  ? 169.363 147.315 168.925 1.00 46.89  ?  285  U   A "C1'" 1 
ATOM   6112  N  N1    . U   A 1  285  ? 170.474 146.655 169.655 1.00 46.89  ?  285  U   A N1    1 
ATOM   6113  C  C2    . U   A 1  285  ? 171.712 147.275 169.637 1.00 46.89  ?  285  U   A C2    1 
ATOM   6114  O  O2    . U   A 1  285  ? 171.930 148.323 169.052 1.00 46.89  ?  285  U   A O2    1 
ATOM   6115  N  N3    . U   A 1  285  ? 172.701 146.622 170.331 1.00 46.89  ?  285  U   A N3    1 
ATOM   6116  C  C4    . U   A 1  285  ? 172.588 145.439 171.031 1.00 46.89  ?  285  U   A C4    1 
ATOM   6117  O  O4    . U   A 1  285  ? 173.574 144.978 171.607 1.00 46.89  ?  285  U   A O4    1 
ATOM   6118  C  C5    . U   A 1  285  ? 171.280 144.860 171.009 1.00 46.89  ?  285  U   A C5    1 
ATOM   6119  C  C6    . U   A 1  285  ? 170.297 145.474 170.343 1.00 46.89  ?  285  U   A C6    1 
ATOM   6120  P  P     . G   A 1  286  ? 168.289 144.562 165.080 1.00 47.15  ?  286  G   A P     1 
ATOM   6121  O  OP1   . G   A 1  286  ? 167.400 144.532 163.891 1.00 47.15  ?  286  G   A OP1   1 
ATOM   6122  O  OP2   . G   A 1  286  ? 168.484 143.328 165.883 1.00 47.15  ?  286  G   A OP2   1 
ATOM   6123  O  "O5'" . G   A 1  286  ? 169.722 145.076 164.611 1.00 47.15  ?  286  G   A "O5'" 1 
ATOM   6124  C  "C5'" . G   A 1  286  ? 169.849 146.217 163.775 1.00 47.15  ?  286  G   A "C5'" 1 
ATOM   6125  C  "C4'" . G   A 1  286  ? 171.294 146.598 163.571 1.00 47.15  ?  286  G   A "C4'" 1 
ATOM   6126  O  "O4'" . G   A 1  286  ? 171.858 147.089 164.815 1.00 47.15  ?  286  G   A "O4'" 1 
ATOM   6127  C  "C3'" . G   A 1  286  ? 172.230 145.471 163.165 1.00 47.15  ?  286  G   A "C3'" 1 
ATOM   6128  O  "O3'" . G   A 1  286  ? 172.162 145.164 161.783 1.00 47.15  ?  286  G   A "O3'" 1 
ATOM   6129  C  "C2'" . G   A 1  286  ? 173.589 145.992 163.612 1.00 47.15  ?  286  G   A "C2'" 1 
ATOM   6130  O  "O2'" . G   A 1  286  ? 174.092 146.943 162.686 1.00 47.15  ?  286  G   A "O2'" 1 
ATOM   6131  C  "C1'" . G   A 1  286  ? 173.220 146.723 164.904 1.00 47.15  ?  286  G   A "C1'" 1 
ATOM   6132  N  N9    . G   A 1  286  ? 173.403 145.871 166.094 1.00 47.15  ?  286  G   A N9    1 
ATOM   6133  C  C8    . G   A 1  286  ? 172.423 145.243 166.824 1.00 47.15  ?  286  G   A C8    1 
ATOM   6134  N  N7    . G   A 1  286  ? 172.891 144.555 167.829 1.00 47.15  ?  286  G   A N7    1 
ATOM   6135  C  C5    . G   A 1  286  ? 174.265 144.737 167.759 1.00 47.15  ?  286  G   A C5    1 
ATOM   6136  C  C6    . G   A 1  286  ? 175.303 144.233 168.586 1.00 47.15  ?  286  G   A C6    1 
ATOM   6137  O  O6    . G   A 1  286  ? 175.210 143.499 169.578 1.00 47.15  ?  286  G   A O6    1 
ATOM   6138  N  N1    . G   A 1  286  ? 176.554 144.665 168.158 1.00 47.15  ?  286  G   A N1    1 
ATOM   6139  C  C2    . G   A 1  286  ? 176.781 145.478 167.075 1.00 47.15  ?  286  G   A C2    1 
ATOM   6140  N  N2    . G   A 1  286  ? 178.062 145.784 166.823 1.00 47.15  ?  286  G   A N2    1 
ATOM   6141  N  N3    . G   A 1  286  ? 175.823 145.955 166.296 1.00 47.15  ?  286  G   A N3    1 
ATOM   6142  C  C4    . G   A 1  286  ? 174.598 145.547 166.694 1.00 47.15  ?  286  G   A C4    1 
ATOM   6143  P  P     . A   A 1  287  ? 172.514 143.683 161.270 1.00 47.04  ?  287  A   A P     1 
ATOM   6144  O  OP1   . A   A 1  287  ? 172.036 143.552 159.870 1.00 47.04  ?  287  A   A OP1   1 
ATOM   6145  O  OP2   . A   A 1  287  ? 172.049 142.717 162.298 1.00 47.04  ?  287  A   A OP2   1 
ATOM   6146  O  "O5'" . A   A 1  287  ? 174.107 143.653 161.253 1.00 47.04  ?  287  A   A "O5'" 1 
ATOM   6147  C  "C5'" . A   A 1  287  ? 174.814 142.423 161.229 1.00 47.04  ?  287  A   A "C5'" 1 
ATOM   6148  C  "C4'" . A   A 1  287  ? 176.301 142.641 161.354 1.00 47.04  ?  287  A   A "C4'" 1 
ATOM   6149  O  "O4'" . A   A 1  287  ? 176.579 143.480 162.506 1.00 47.04  ?  287  A   A "O4'" 1 
ATOM   6150  C  "C3'" . A   A 1  287  ? 177.137 141.395 161.594 1.00 47.04  ?  287  A   A "C3'" 1 
ATOM   6151  O  "O3'" . A   A 1  287  ? 177.406 140.673 160.404 1.00 47.04  ?  287  A   A "O3'" 1 
ATOM   6152  C  "C2'" . A   A 1  287  ? 178.384 141.955 162.264 1.00 47.04  ?  287  A   A "C2'" 1 
ATOM   6153  O  "O2'" . A   A 1  287  ? 179.256 142.531 161.303 1.00 47.04  ?  287  A   A "O2'" 1 
ATOM   6154  C  "C1'" . A   A 1  287  ? 177.790 143.079 163.113 1.00 47.04  ?  287  A   A "C1'" 1 
ATOM   6155  N  N9    . A   A 1  287  ? 177.500 142.643 164.492 1.00 47.04  ?  287  A   A N9    1 
ATOM   6156  C  C8    . A   A 1  287  ? 176.267 142.453 165.066 1.00 47.04  ?  287  A   A C8    1 
ATOM   6157  N  N7    . A   A 1  287  ? 176.318 142.063 166.317 1.00 47.04  ?  287  A   A N7    1 
ATOM   6158  C  C5    . A   A 1  287  ? 177.678 141.993 166.585 1.00 47.04  ?  287  A   A C5    1 
ATOM   6159  C  C6    . A   A 1  287  ? 178.404 141.640 167.738 1.00 47.04  ?  287  A   A C6    1 
ATOM   6160  N  N6    . A   A 1  287  ? 177.832 141.275 168.888 1.00 47.04  ?  287  A   A N6    1 
ATOM   6161  N  N1    . A   A 1  287  ? 179.755 141.673 167.672 1.00 47.04  ?  287  A   A N1    1 
ATOM   6162  C  C2    . A   A 1  287  ? 180.339 142.038 166.523 1.00 47.04  ?  287  A   A C2    1 
ATOM   6163  N  N3    . A   A 1  287  ? 179.763 142.392 165.375 1.00 47.04  ?  287  A   A N3    1 
ATOM   6164  C  C4    . A   A 1  287  ? 178.420 142.348 165.472 1.00 47.04  ?  287  A   A C4    1 
ATOM   6165  P  P     . G   A 1  288  ? 177.184 139.083 160.357 1.00 50.71  ?  288  G   A P     1 
ATOM   6166  O  OP1   . G   A 1  288  ? 177.429 138.625 158.966 1.00 50.71  ?  288  G   A OP1   1 
ATOM   6167  O  OP2   . G   A 1  288  ? 175.886 138.780 161.012 1.00 50.71  ?  288  G   A OP2   1 
ATOM   6168  O  "O5'" . G   A 1  288  ? 178.347 138.504 161.279 1.00 50.71  ?  288  G   A "O5'" 1 
ATOM   6169  C  "C5'" . G   A 1  288  ? 179.711 138.677 160.925 1.00 50.71  ?  288  G   A "C5'" 1 
ATOM   6170  C  "C4'" . G   A 1  288  ? 180.630 138.228 162.032 1.00 50.71  ?  288  G   A "C4'" 1 
ATOM   6171  O  "O4'" . G   A 1  288  ? 180.505 139.120 163.171 1.00 50.71  ?  288  G   A "O4'" 1 
ATOM   6172  C  "C3'" . G   A 1  288  ? 180.348 136.852 162.614 1.00 50.71  ?  288  G   A "C3'" 1 
ATOM   6173  O  "O3'" . G   A 1  288  ? 180.855 135.794 161.822 1.00 50.71  ?  288  G   A "O3'" 1 
ATOM   6174  C  "C2'" . G   A 1  288  ? 180.978 136.945 163.996 1.00 50.71  ?  288  G   A "C2'" 1 
ATOM   6175  O  "O2'" . G   A 1  288  ? 182.389 136.807 163.914 1.00 50.71  ?  288  G   A "O2'" 1 
ATOM   6176  C  "C1'" . G   A 1  288  ? 180.656 138.391 164.372 1.00 50.71  ?  288  G   A "C1'" 1 
ATOM   6177  N  N9    . G   A 1  288  ? 179.401 138.488 165.142 1.00 50.71  ?  288  G   A N9    1 
ATOM   6178  C  C8    . G   A 1  288  ? 178.179 138.924 164.688 1.00 50.71  ?  288  G   A C8    1 
ATOM   6179  N  N7    . G   A 1  288  ? 177.252 138.894 165.606 1.00 50.71  ?  288  G   A N7    1 
ATOM   6180  C  C5    . G   A 1  288  ? 177.899 138.406 166.734 1.00 50.71  ?  288  G   A C5    1 
ATOM   6181  C  C6    . G   A 1  288  ? 177.406 138.154 168.041 1.00 50.71  ?  288  G   A C6    1 
ATOM   6182  O  O6    . G   A 1  288  ? 176.261 138.317 168.478 1.00 50.71  ?  288  G   A O6    1 
ATOM   6183  N  N1    . G   A 1  288  ? 178.403 137.663 168.877 1.00 50.71  ?  288  G   A N1    1 
ATOM   6184  C  C2    . G   A 1  288  ? 179.707 137.441 168.507 1.00 50.71  ?  288  G   A C2    1 
ATOM   6185  N  N2    . G   A 1  288  ? 180.520 136.962 169.459 1.00 50.71  ?  288  G   A N2    1 
ATOM   6186  N  N3    . G   A 1  288  ? 180.178 137.672 167.293 1.00 50.71  ?  288  G   A N3    1 
ATOM   6187  C  C4    . G   A 1  288  ? 179.226 138.150 166.463 1.00 50.71  ?  288  G   A C4    1 
ATOM   6188  P  P     . G   A 1  289  ? 180.059 134.401 161.742 1.00 56.58  ?  289  G   A P     1 
ATOM   6189  O  OP1   . G   A 1  289  ? 180.537 133.658 160.549 1.00 56.58  ?  289  G   A OP1   1 
ATOM   6190  O  OP2   . G   A 1  289  ? 178.611 134.699 161.881 1.00 56.58  ?  289  G   A OP2   1 
ATOM   6191  O  "O5'" . G   A 1  289  ? 180.528 133.616 163.047 1.00 56.58  ?  289  G   A "O5'" 1 
ATOM   6192  C  "C5'" . G   A 1  289  ? 181.903 133.343 163.275 1.00 56.58  ?  289  G   A "C5'" 1 
ATOM   6193  C  "C4'" . G   A 1  289  ? 182.149 132.844 164.677 1.00 56.58  ?  289  G   A "C4'" 1 
ATOM   6194  O  "O4'" . G   A 1  289  ? 181.852 133.891 165.636 1.00 56.58  ?  289  G   A "O4'" 1 
ATOM   6195  C  "C3'" . G   A 1  289  ? 181.292 131.675 165.133 1.00 56.58  ?  289  G   A "C3'" 1 
ATOM   6196  O  "O3'" . G   A 1  289  ? 181.767 130.427 164.656 1.00 56.58  ?  289  G   A "O3'" 1 
ATOM   6197  C  "C2'" . G   A 1  289  ? 181.336 131.803 166.650 1.00 56.58  ?  289  G   A "C2'" 1 
ATOM   6198  O  "O2'" . G   A 1  289  ? 182.552 131.281 167.161 1.00 56.58  ?  289  G   A "O2'" 1 
ATOM   6199  C  "C1'" . G   A 1  289  ? 181.349 133.322 166.828 1.00 56.58  ?  289  G   A "C1'" 1 
ATOM   6200  N  N9    . G   A 1  289  ? 180.002 133.865 167.083 1.00 56.58  ?  289  G   A N9    1 
ATOM   6201  C  C8    . G   A 1  289  ? 179.166 134.490 166.190 1.00 56.58  ?  289  G   A C8    1 
ATOM   6202  N  N7    . G   A 1  289  ? 178.033 134.859 166.723 1.00 56.58  ?  289  G   A N7    1 
ATOM   6203  C  C5    . G   A 1  289  ? 178.125 134.453 168.047 1.00 56.58  ?  289  G   A C5    1 
ATOM   6204  C  C6    . G   A 1  289  ? 177.202 134.579 169.119 1.00 56.58  ?  289  G   A C6    1 
ATOM   6205  O  O6    . G   A 1  289  ? 176.077 135.092 169.113 1.00 56.58  ?  289  G   A O6    1 
ATOM   6206  N  N1    . G   A 1  289  ? 177.704 134.028 170.294 1.00 56.58  ?  289  G   A N1    1 
ATOM   6207  C  C2    . G   A 1  289  ? 178.935 133.433 170.424 1.00 56.58  ?  289  G   A C2    1 
ATOM   6208  N  N2    . G   A 1  289  ? 179.243 132.959 171.640 1.00 56.58  ?  289  G   A N2    1 
ATOM   6209  N  N3    . G   A 1  289  ? 179.803 133.310 169.435 1.00 56.58  ?  289  G   A N3    1 
ATOM   6210  C  C4    . G   A 1  289  ? 179.336 133.838 168.284 1.00 56.58  ?  289  G   A C4    1 
ATOM   6211  P  P     . U   A 1  290  ? 180.733 129.256 164.280 1.00 66.39  ?  290  U   A P     1 
ATOM   6212  O  OP1   . U   A 1  290  ? 181.374 128.390 163.258 1.00 66.39  ?  290  U   A OP1   1 
ATOM   6213  O  OP2   . U   A 1  290  ? 179.417 129.880 163.991 1.00 66.39  ?  290  U   A OP2   1 
ATOM   6214  O  "O5'" . U   A 1  290  ? 180.597 128.413 165.625 1.00 66.39  ?  290  U   A "O5'" 1 
ATOM   6215  C  "C5'" . U   A 1  290  ? 181.738 127.827 166.235 1.00 66.39  ?  290  U   A "C5'" 1 
ATOM   6216  C  "C4'" . U   A 1  290  ? 181.532 127.626 167.715 1.00 66.39  ?  290  U   A "C4'" 1 
ATOM   6217  O  "O4'" . U   A 1  290  ? 181.135 128.880 168.327 1.00 66.39  ?  290  U   A "O4'" 1 
ATOM   6218  C  "C3'" . U   A 1  290  ? 180.429 126.656 168.111 1.00 66.39  ?  290  U   A "C3'" 1 
ATOM   6219  O  "O3'" . U   A 1  290  ? 180.841 125.302 168.052 1.00 66.39  ?  290  U   A "O3'" 1 
ATOM   6220  C  "C2'" . U   A 1  290  ? 180.062 127.120 169.516 1.00 66.39  ?  290  U   A "C2'" 1 
ATOM   6221  O  "O2'" . U   A 1  290  ? 180.989 126.620 170.468 1.00 66.39  ?  290  U   A "O2'" 1 
ATOM   6222  C  "C1'" . U   A 1  290  ? 180.255 128.635 169.404 1.00 66.39  ?  290  U   A "C1'" 1 
ATOM   6223  N  N1    . U   A 1  290  ? 178.983 129.362 169.168 1.00 66.39  ?  290  U   A N1    1 
ATOM   6224  C  C2    . U   A 1  290  ? 178.221 129.685 170.276 1.00 66.39  ?  290  U   A C2    1 
ATOM   6225  O  O2    . U   A 1  290  ? 178.546 129.398 171.416 1.00 66.39  ?  290  U   A O2    1 
ATOM   6226  N  N3    . U   A 1  290  ? 177.056 130.361 170.007 1.00 66.39  ?  290  U   A N3    1 
ATOM   6227  C  C4    . U   A 1  290  ? 176.581 130.743 168.769 1.00 66.39  ?  290  U   A C4    1 
ATOM   6228  O  O4    . U   A 1  290  ? 175.511 131.348 168.691 1.00 66.39  ?  290  U   A O4    1 
ATOM   6229  C  C5    . U   A 1  290  ? 177.422 130.378 167.672 1.00 66.39  ?  290  U   A C5    1 
ATOM   6230  C  C6    . U   A 1  290  ? 178.563 129.722 167.905 1.00 66.39  ?  290  U   A C6    1 
ATOM   6231  P  P     . A   A 1  291  ? 179.824 124.165 167.546 1.00 67.04  ?  291  A   A P     1 
ATOM   6232  O  OP1   . A   A 1  291  ? 180.251 123.737 166.189 1.00 67.04  ?  291  A   A OP1   1 
ATOM   6233  O  OP2   . A   A 1  291  ? 178.439 124.656 167.759 1.00 67.04  ?  291  A   A OP2   1 
ATOM   6234  O  "O5'" . A   A 1  291  ? 180.079 122.952 168.547 1.00 67.04  ?  291  A   A "O5'" 1 
ATOM   6235  C  "C5'" . A   A 1  291  ? 181.403 122.520 168.845 1.00 67.04  ?  291  A   A "C5'" 1 
ATOM   6236  C  "C4'" . A   A 1  291  ? 181.438 121.613 170.050 1.00 67.04  ?  291  A   A "C4'" 1 
ATOM   6237  O  "O4'" . A   A 1  291  ? 182.819 121.258 170.337 1.00 67.04  ?  291  A   A "O4'" 1 
ATOM   6238  C  "C3'" . A   A 1  291  ? 180.881 122.219 171.336 1.00 67.04  ?  291  A   A "C3'" 1 
ATOM   6239  O  "O3'" . A   A 1  291  ? 180.287 121.187 172.122 1.00 67.04  ?  291  A   A "O3'" 1 
ATOM   6240  C  "C2'" . A   A 1  291  ? 182.136 122.727 172.034 1.00 67.04  ?  291  A   A "C2'" 1 
ATOM   6241  O  "O2'" . A   A 1  291  ? 182.015 122.865 173.435 1.00 67.04  ?  291  A   A "O2'" 1 
ATOM   6242  C  "C1'" . A   A 1  291  ? 183.147 121.649 171.657 1.00 67.04  ?  291  A   A "C1'" 1 
ATOM   6243  N  N9    . A   A 1  291  ? 184.540 122.101 171.671 1.00 67.04  ?  291  A   A N9    1 
ATOM   6244  C  C8    . A   A 1  291  ? 185.074 123.228 171.095 1.00 67.04  ?  291  A   A C8    1 
ATOM   6245  N  N7    . A   A 1  291  ? 186.365 123.355 171.284 1.00 67.04  ?  291  A   A N7    1 
ATOM   6246  C  C5    . A   A 1  291  ? 186.702 122.237 172.034 1.00 67.04  ?  291  A   A C5    1 
ATOM   6247  C  C6    . A   A 1  291  ? 187.919 121.774 172.567 1.00 67.04  ?  291  A   A C6    1 
ATOM   6248  N  N6    . A   A 1  291  ? 189.083 122.411 172.420 1.00 67.04  ?  291  A   A N6    1 
ATOM   6249  N  N1    . A   A 1  291  ? 187.901 120.616 173.268 1.00 67.04  ?  291  A   A N1    1 
ATOM   6250  C  C2    . A   A 1  291  ? 186.740 119.966 173.426 1.00 67.04  ?  291  A   A C2    1 
ATOM   6251  N  N3    . A   A 1  291  ? 185.536 120.302 172.971 1.00 67.04  ?  291  A   A N3    1 
ATOM   6252  C  C4    . A   A 1  291  ? 185.587 121.456 172.279 1.00 67.04  ?  291  A   A C4    1 
ATOM   6253  P  P     . C   A 1  292  ? 178.694 120.983 172.121 1.00 83.84  ?  292  C   A P     1 
ATOM   6254  O  OP1   . C   A 1  292  ? 178.409 119.594 171.679 1.00 83.84  ?  292  C   A OP1   1 
ATOM   6255  O  OP2   . C   A 1  292  ? 178.086 122.125 171.392 1.00 83.84  ?  292  C   A OP2   1 
ATOM   6256  O  "O5'" . C   A 1  292  ? 178.287 121.104 173.657 1.00 83.84  ?  292  C   A "O5'" 1 
ATOM   6257  C  "C5'" . C   A 1  292  ? 178.797 122.152 174.468 1.00 83.84  ?  292  C   A "C5'" 1 
ATOM   6258  C  "C4'" . C   A 1  292  ? 177.690 122.869 175.199 1.00 83.84  ?  292  C   A "C4'" 1 
ATOM   6259  O  "O4'" . C   A 1  292  ? 177.711 124.279 174.858 1.00 83.84  ?  292  C   A "O4'" 1 
ATOM   6260  C  "C3'" . C   A 1  292  ? 176.276 122.427 174.855 1.00 83.84  ?  292  C   A "C3'" 1 
ATOM   6261  O  "O3'" . C   A 1  292  ? 175.885 121.248 175.536 1.00 83.84  ?  292  C   A "O3'" 1 
ATOM   6262  C  "C2'" . C   A 1  292  ? 175.444 123.651 175.218 1.00 83.84  ?  292  C   A "C2'" 1 
ATOM   6263  O  "O2'" . C   A 1  292  ? 175.207 123.700 176.618 1.00 83.84  ?  292  C   A "O2'" 1 
ATOM   6264  C  "C1'" . C   A 1  292  ? 176.396 124.794 174.849 1.00 83.84  ?  292  C   A "C1'" 1 
ATOM   6265  N  N1    . C   A 1  292  ? 176.111 125.376 173.512 1.00 83.84  ?  292  C   A N1    1 
ATOM   6266  C  C2    . C   A 1  292  ? 175.106 126.345 173.392 1.00 83.84  ?  292  C   A C2    1 
ATOM   6267  O  O2    . C   A 1  292  ? 174.469 126.696 174.396 1.00 83.84  ?  292  C   A O2    1 
ATOM   6268  N  N3    . C   A 1  292  ? 174.846 126.884 172.177 1.00 83.84  ?  292  C   A N3    1 
ATOM   6269  C  C4    . C   A 1  292  ? 175.541 126.499 171.106 1.00 83.84  ?  292  C   A C4    1 
ATOM   6270  N  N4    . C   A 1  292  ? 175.246 127.060 169.931 1.00 83.84  ?  292  C   A N4    1 
ATOM   6271  C  C5    . C   A 1  292  ? 176.571 125.521 171.194 1.00 83.84  ?  292  C   A C5    1 
ATOM   6272  C  C6    . C   A 1  292  ? 176.820 124.998 172.401 1.00 83.84  ?  292  C   A C6    1 
ATOM   6273  P  P     . C   A 1  293  ? 174.920 120.183 174.817 1.00 100.57 ?  293  C   A P     1 
ATOM   6274  O  OP1   . C   A 1  293  ? 175.141 118.860 175.455 1.00 100.57 ?  293  C   A OP1   1 
ATOM   6275  O  OP2   . C   A 1  293  ? 175.088 120.327 173.349 1.00 100.57 ?  293  C   A OP2   1 
ATOM   6276  O  "O5'" . C   A 1  293  ? 173.454 120.676 175.196 1.00 100.57 ?  293  C   A "O5'" 1 
ATOM   6277  C  "C5'" . C   A 1  293  ? 173.052 120.786 176.553 1.00 100.57 ?  293  C   A "C5'" 1 
ATOM   6278  C  "C4'" . C   A 1  293  ? 171.797 121.611 176.692 1.00 100.57 ?  293  C   A "C4'" 1 
ATOM   6279  O  "O4'" . C   A 1  293  ? 172.034 122.951 176.186 1.00 100.57 ?  293  C   A "O4'" 1 
ATOM   6280  C  "C3'" . C   A 1  293  ? 170.591 121.128 175.902 1.00 100.57 ?  293  C   A "C3'" 1 
ATOM   6281  O  "O3'" . C   A 1  293  ? 169.899 120.066 176.534 1.00 100.57 ?  293  C   A "O3'" 1 
ATOM   6282  C  "C2'" . C   A 1  293  ? 169.762 122.397 175.751 1.00 100.57 ?  293  C   A "C2'" 1 
ATOM   6283  O  "O2'" . C   A 1  293  ? 169.032 122.664 176.939 1.00 100.57 ?  293  C   A "O2'" 1 
ATOM   6284  C  "C1'" . C   A 1  293  ? 170.853 123.463 175.604 1.00 100.57 ?  293  C   A "C1'" 1 
ATOM   6285  N  N1    . C   A 1  293  ? 171.122 123.823 174.188 1.00 100.57 ?  293  C   A N1    1 
ATOM   6286  C  C2    . C   A 1  293  ? 170.286 124.750 173.548 1.00 100.57 ?  293  C   A C2    1 
ATOM   6287  O  O2    . C   A 1  293  ? 169.336 125.253 174.168 1.00 100.57 ?  293  C   A O2    1 
ATOM   6288  N  N3    . C   A 1  293  ? 170.531 125.085 172.260 1.00 100.57 ?  293  C   A N3    1 
ATOM   6289  C  C4    . C   A 1  293  ? 171.556 124.541 171.605 1.00 100.57 ?  293  C   A C4    1 
ATOM   6290  N  N4    . C   A 1  293  ? 171.754 124.904 170.335 1.00 100.57 ?  293  C   A N4    1 
ATOM   6291  C  C5    . C   A 1  293  ? 172.426 123.599 172.224 1.00 100.57 ?  293  C   A C5    1 
ATOM   6292  C  C6    . C   A 1  293  ? 172.175 123.279 173.499 1.00 100.57 ?  293  C   A C6    1 
ATOM   6293  P  P     . C   A 1  294  ? 169.185 118.929 175.651 1.00 124.07 ?  294  C   A P     1 
ATOM   6294  O  OP1   . C   A 1  294  ? 168.851 117.793 176.547 1.00 124.07 ?  294  C   A OP1   1 
ATOM   6295  O  OP2   . C   A 1  294  ? 170.020 118.692 174.445 1.00 124.07 ?  294  C   A OP2   1 
ATOM   6296  O  "O5'" . C   A 1  294  ? 167.820 119.603 175.181 1.00 124.07 ?  294  C   A "O5'" 1 
ATOM   6297  C  "C5'" . C   A 1  294  ? 166.824 119.965 176.126 1.00 124.07 ?  294  C   A "C5'" 1 
ATOM   6298  C  "C4'" . C   A 1  294  ? 165.803 120.900 175.529 1.00 124.07 ?  294  C   A "C4'" 1 
ATOM   6299  O  "O4'" . C   A 1  294  ? 166.461 122.094 175.031 1.00 124.07 ?  294  C   A "O4'" 1 
ATOM   6300  C  "C3'" . C   A 1  294  ? 165.035 120.376 174.325 1.00 124.07 ?  294  C   A "C3'" 1 
ATOM   6301  O  "O3'" . C   A 1  294  ? 163.967 119.513 174.676 1.00 124.07 ?  294  C   A "O3'" 1 
ATOM   6302  C  "C2'" . C   A 1  294  ? 164.582 121.658 173.637 1.00 124.07 ?  294  C   A "C2'" 1 
ATOM   6303  O  "O2'" . C   A 1  294  ? 163.438 122.198 174.283 1.00 124.07 ?  294  C   A "O2'" 1 
ATOM   6304  C  "C1'" . C   A 1  294  ? 165.771 122.588 173.901 1.00 124.07 ?  294  C   A "C1'" 1 
ATOM   6305  N  N1    . C   A 1  294  ? 166.705 122.669 172.750 1.00 124.07 ?  294  C   A N1    1 
ATOM   6306  C  C2    . C   A 1  294  ? 166.417 123.562 171.710 1.00 124.07 ?  294  C   A C2    1 
ATOM   6307  O  O2    . C   A 1  294  ? 165.393 124.261 171.769 1.00 124.07 ?  294  C   A O2    1 
ATOM   6308  N  N3    . C   A 1  294  ? 167.262 123.652 170.656 1.00 124.07 ?  294  C   A N3    1 
ATOM   6309  C  C4    . C   A 1  294  ? 168.359 122.896 170.608 1.00 124.07 ?  294  C   A C4    1 
ATOM   6310  N  N4    . C   A 1  294  ? 169.160 123.020 169.547 1.00 124.07 ?  294  C   A N4    1 
ATOM   6311  C  C5    . C   A 1  294  ? 168.684 121.980 171.648 1.00 124.07 ?  294  C   A C5    1 
ATOM   6312  C  C6    . C   A 1  294  ? 167.841 121.904 172.686 1.00 124.07 ?  294  C   A C6    1 
ATOM   6313  P  P     . C   A 1  295  ? 163.546 118.311 173.694 1.00 148.25 ?  295  C   A P     1 
ATOM   6314  O  OP1   . C   A 1  295  ? 162.611 117.423 174.431 1.00 148.25 ?  295  C   A OP1   1 
ATOM   6315  O  OP2   . C   A 1  295  ? 164.785 117.745 173.104 1.00 148.25 ?  295  C   A OP2   1 
ATOM   6316  O  "O5'" . C   A 1  295  ? 162.728 119.029 172.529 1.00 148.25 ?  295  C   A "O5'" 1 
ATOM   6317  C  "C5'" . C   A 1  295  ? 161.475 119.644 172.789 1.00 148.25 ?  295  C   A "C5'" 1 
ATOM   6318  C  "C4'" . C   A 1  295  ? 161.047 120.540 171.653 1.00 148.25 ?  295  C   A "C4'" 1 
ATOM   6319  O  "O4'" . C   A 1  295  ? 162.064 121.548 171.413 1.00 148.25 ?  295  C   A "O4'" 1 
ATOM   6320  C  "C3'" . C   A 1  295  ? 160.868 119.870 170.299 1.00 148.25 ?  295  C   A "C3'" 1 
ATOM   6321  O  "O3'" . C   A 1  295  ? 159.623 119.205 170.170 1.00 148.25 ?  295  C   A "O3'" 1 
ATOM   6322  C  "C2'" . C   A 1  295  ? 161.043 121.030 169.325 1.00 148.25 ?  295  C   A "C2'" 1 
ATOM   6323  O  "O2'" . C   A 1  295  ? 159.847 121.790 169.228 1.00 148.25 ?  295  C   A "O2'" 1 
ATOM   6324  C  "C1'" . C   A 1  295  ? 162.099 121.880 170.040 1.00 148.25 ?  295  C   A "C1'" 1 
ATOM   6325  N  N1    . C   A 1  295  ? 163.470 121.657 169.516 1.00 148.25 ?  295  C   A N1    1 
ATOM   6326  C  C2    . C   A 1  295  ? 163.883 122.390 168.396 1.00 148.25 ?  295  C   A C2    1 
ATOM   6327  O  O2    . C   A 1  295  ? 163.098 123.197 167.874 1.00 148.25 ?  295  C   A O2    1 
ATOM   6328  N  N3    . C   A 1  295  ? 165.130 122.205 167.904 1.00 148.25 ?  295  C   A N3    1 
ATOM   6329  C  C4    . C   A 1  295  ? 165.958 121.334 168.481 1.00 148.25 ?  295  C   A C4    1 
ATOM   6330  N  N4    . C   A 1  295  ? 167.177 121.186 167.958 1.00 148.25 ?  295  C   A N4    1 
ATOM   6331  C  C5    . C   A 1  295  ? 165.571 120.574 169.622 1.00 148.25 ?  295  C   A C5    1 
ATOM   6332  C  C6    . C   A 1  295  ? 164.336 120.769 170.099 1.00 148.25 ?  295  C   A C6    1 
ATOM   6333  P  P     . G   A 1  296  ? 159.525 117.823 169.357 1.00 173.00 ?  296  G   A P     1 
ATOM   6334  O  OP1   . G   A 1  296  ? 158.108 117.381 169.369 1.00 173.00 ?  296  G   A OP1   1 
ATOM   6335  O  OP2   . G   A 1  296  ? 160.582 116.913 169.869 1.00 173.00 ?  296  G   A OP2   1 
ATOM   6336  O  "O5'" . G   A 1  296  ? 159.904 118.225 167.862 1.00 173.00 ?  296  G   A "O5'" 1 
ATOM   6337  C  "C5'" . G   A 1  296  ? 159.968 117.241 166.834 1.00 173.00 ?  296  G   A "C5'" 1 
ATOM   6338  C  "C4'" . G   A 1  296  ? 160.761 117.725 165.645 1.00 173.00 ?  296  G   A "C4'" 1 
ATOM   6339  O  "O4'" . G   A 1  296  ? 162.053 118.213 166.101 1.00 173.00 ?  296  G   A "O4'" 1 
ATOM   6340  C  "C3'" . G   A 1  296  ? 161.058 116.662 164.590 1.00 173.00 ?  296  G   A "C3'" 1 
ATOM   6341  O  "O3'" . G   A 1  296  ? 161.107 117.276 163.302 1.00 173.00 ?  296  G   A "O3'" 1 
ATOM   6342  C  "C2'" . G   A 1  296  ? 162.454 116.190 164.980 1.00 173.00 ?  296  G   A "C2'" 1 
ATOM   6343  O  "O2'" . G   A 1  296  ? 163.192 115.605 163.928 1.00 173.00 ?  296  G   A "O2'" 1 
ATOM   6344  C  "C1'" . G   A 1  296  ? 163.089 117.491 165.463 1.00 173.00 ?  296  G   A "C1'" 1 
ATOM   6345  N  N9    . G   A 1  296  ? 164.179 117.306 166.425 1.00 173.00 ?  296  G   A N9    1 
ATOM   6346  C  C8    . G   A 1  296  ? 164.084 116.793 167.696 1.00 173.00 ?  296  G   A C8    1 
ATOM   6347  N  N7    . G   A 1  296  ? 165.229 116.758 168.321 1.00 173.00 ?  296  G   A N7    1 
ATOM   6348  C  C5    . G   A 1  296  ? 166.135 117.283 167.409 1.00 173.00 ?  296  G   A C5    1 
ATOM   6349  C  C6    . G   A 1  296  ? 167.534 117.496 167.520 1.00 173.00 ?  296  G   A C6    1 
ATOM   6350  O  O6    . G   A 1  296  ? 168.277 117.255 168.479 1.00 173.00 ?  296  G   A O6    1 
ATOM   6351  N  N1    . G   A 1  296  ? 168.061 118.050 166.357 1.00 173.00 ?  296  G   A N1    1 
ATOM   6352  C  C2    . G   A 1  296  ? 167.338 118.360 165.232 1.00 173.00 ?  296  G   A C2    1 
ATOM   6353  N  N2    . G   A 1  296  ? 168.028 118.888 164.211 1.00 173.00 ?  296  G   A N2    1 
ATOM   6354  N  N3    . G   A 1  296  ? 166.034 118.165 165.116 1.00 173.00 ?  296  G   A N3    1 
ATOM   6355  C  C4    . G   A 1  296  ? 165.501 117.630 166.235 1.00 173.00 ?  296  G   A C4    1 
ATOM   6356  P  P     . C   A 1  297  ? 159.832 117.216 162.325 1.00 193.91 ?  297  C   A P     1 
ATOM   6357  O  OP1   . C   A 1  297  ? 158.919 118.328 162.691 1.00 193.91 ?  297  C   A OP1   1 
ATOM   6358  O  OP2   . C   A 1  297  ? 159.323 115.820 162.317 1.00 193.91 ?  297  C   A OP2   1 
ATOM   6359  O  "O5'" . C   A 1  297  ? 160.437 117.528 160.885 1.00 193.91 ?  297  C   A "O5'" 1 
ATOM   6360  C  "C5'" . C   A 1  297  ? 161.559 116.801 160.392 1.00 193.91 ?  297  C   A "C5'" 1 
ATOM   6361  C  "C4'" . C   A 1  297  ? 162.532 117.680 159.637 1.00 193.91 ?  297  C   A "C4'" 1 
ATOM   6362  O  "O4'" . C   A 1  297  ? 161.850 118.322 158.524 1.00 193.91 ?  297  C   A "O4'" 1 
ATOM   6363  C  "C3'" . C   A 1  297  ? 163.189 118.801 160.445 1.00 193.91 ?  297  C   A "C3'" 1 
ATOM   6364  O  "O3'" . C   A 1  297  ? 164.542 118.962 160.021 1.00 193.91 ?  297  C   A "O3'" 1 
ATOM   6365  C  "C2'" . C   A 1  297  ? 162.382 120.033 160.040 1.00 193.91 ?  297  C   A "C2'" 1 
ATOM   6366  O  "O2'" . C   A 1  297  ? 163.072 121.257 160.171 1.00 193.91 ?  297  C   A "O2'" 1 
ATOM   6367  C  "C1'" . C   A 1  297  ? 162.055 119.720 158.583 1.00 193.91 ?  297  C   A "C1'" 1 
ATOM   6368  N  N1    . C   A 1  297  ? 160.841 120.384 158.084 1.00 193.91 ?  297  C   A N1    1 
ATOM   6369  C  C2    . C   A 1  297  ? 160.964 121.341 157.074 1.00 193.91 ?  297  C   A C2    1 
ATOM   6370  O  O2    . C   A 1  297  ? 162.092 121.603 156.629 1.00 193.91 ?  297  C   A O2    1 
ATOM   6371  N  N3    . C   A 1  297  ? 159.853 121.957 156.609 1.00 193.91 ?  297  C   A N3    1 
ATOM   6372  C  C4    . C   A 1  297  ? 158.657 121.647 157.114 1.00 193.91 ?  297  C   A C4    1 
ATOM   6373  N  N4    . C   A 1  297  ? 157.589 122.280 156.624 1.00 193.91 ?  297  C   A N4    1 
ATOM   6374  C  C5    . C   A 1  297  ? 158.503 120.675 158.144 1.00 193.91 ?  297  C   A C5    1 
ATOM   6375  C  C6    . C   A 1  297  ? 159.611 120.073 158.595 1.00 193.91 ?  297  C   A C6    1 
ATOM   6376  P  P     . A   A 1  298  ? 165.741 118.321 160.878 1.00 183.30 ?  298  A   A P     1 
ATOM   6377  O  OP1   . A   A 1  298  ? 165.481 116.867 161.034 1.00 183.30 ?  298  A   A OP1   1 
ATOM   6378  O  OP2   . A   A 1  298  ? 165.941 119.163 162.084 1.00 183.30 ?  298  A   A OP2   1 
ATOM   6379  O  "O5'" . A   A 1  298  ? 167.019 118.492 159.942 1.00 183.30 ?  298  A   A "O5'" 1 
ATOM   6380  C  "C5'" . A   A 1  298  ? 167.541 119.779 159.648 1.00 183.30 ?  298  A   A "C5'" 1 
ATOM   6381  C  "C4'" . A   A 1  298  ? 168.407 119.757 158.414 1.00 183.30 ?  298  A   A "C4'" 1 
ATOM   6382  O  "O4'" . A   A 1  298  ? 167.593 119.449 157.251 1.00 183.30 ?  298  A   A "O4'" 1 
ATOM   6383  C  "C3'" . A   A 1  298  ? 169.084 121.070 158.052 1.00 183.30 ?  298  A   A "C3'" 1 
ATOM   6384  O  "O3'" . A   A 1  298  ? 170.265 121.313 158.798 1.00 183.30 ?  298  A   A "O3'" 1 
ATOM   6385  C  "C2'" . A   A 1  298  ? 169.322 120.918 156.556 1.00 183.30 ?  298  A   A "C2'" 1 
ATOM   6386  O  "O2'" . A   A 1  298  ? 170.443 120.082 156.309 1.00 183.30 ?  298  A   A "O2'" 1 
ATOM   6387  C  "C1'" . A   A 1  298  ? 168.060 120.171 156.130 1.00 183.30 ?  298  A   A "C1'" 1 
ATOM   6388  N  N9    . A   A 1  298  ? 166.996 121.095 155.695 1.00 183.30 ?  298  A   A N9    1 
ATOM   6389  C  C8    . A   A 1  298  ? 165.843 121.419 156.367 1.00 183.30 ?  298  A   A C8    1 
ATOM   6390  N  N7    . A   A 1  298  ? 165.081 122.276 155.732 1.00 183.30 ?  298  A   A N7    1 
ATOM   6391  C  C5    . A   A 1  298  ? 165.781 122.535 154.562 1.00 183.30 ?  298  A   A C5    1 
ATOM   6392  C  C6    . A   A 1  298  ? 165.514 123.363 153.456 1.00 183.30 ?  298  A   A C6    1 
ATOM   6393  N  N6    . A   A 1  298  ? 164.418 124.117 153.345 1.00 183.30 ?  298  A   A N6    1 
ATOM   6394  N  N1    . A   A 1  298  ? 166.422 123.392 152.452 1.00 183.30 ?  298  A   A N1    1 
ATOM   6395  C  C2    . A   A 1  298  ? 167.525 122.639 152.553 1.00 183.30 ?  298  A   A C2    1 
ATOM   6396  N  N3    . A   A 1  298  ? 167.885 121.823 153.542 1.00 183.30 ?  298  A   A N3    1 
ATOM   6397  C  C4    . A   A 1  298  ? 166.963 121.815 154.524 1.00 183.30 ?  298  A   A C4    1 
ATOM   6398  P  P     . G   A 1  299  ? 170.798 122.816 159.017 1.00 163.66 ?  299  G   A P     1 
ATOM   6399  O  OP1   . G   A 1  299  ? 171.372 123.301 157.736 1.00 163.66 ?  299  G   A OP1   1 
ATOM   6400  O  OP2   . G   A 1  299  ? 171.637 122.824 160.241 1.00 163.66 ?  299  G   A OP2   1 
ATOM   6401  O  "O5'" . G   A 1  299  ? 169.481 123.661 159.321 1.00 163.66 ?  299  G   A "O5'" 1 
ATOM   6402  C  "C5'" . G   A 1  299  ? 169.105 124.753 158.493 1.00 163.66 ?  299  G   A "C5'" 1 
ATOM   6403  C  "C4'" . G   A 1  299  ? 167.677 125.169 158.744 1.00 163.66 ?  299  G   A "C4'" 1 
ATOM   6404  O  "O4'" . G   A 1  299  ? 166.870 123.994 159.017 1.00 163.66 ?  299  G   A "O4'" 1 
ATOM   6405  C  "C3'" . G   A 1  299  ? 167.447 126.064 159.951 1.00 163.66 ?  299  G   A "C3'" 1 
ATOM   6406  O  "O3'" . G   A 1  299  ? 167.721 127.429 159.684 1.00 163.66 ?  299  G   A "O3'" 1 
ATOM   6407  C  "C2'" . G   A 1  299  ? 165.989 125.791 160.295 1.00 163.66 ?  299  G   A "C2'" 1 
ATOM   6408  O  "O2'" . G   A 1  299  ? 165.125 126.501 159.420 1.00 163.66 ?  299  G   A "O2'" 1 
ATOM   6409  C  "C1'" . G   A 1  299  ? 165.879 124.300 159.976 1.00 163.66 ?  299  G   A "C1'" 1 
ATOM   6410  N  N9    . G   A 1  299  ? 166.107 123.462 161.169 1.00 163.66 ?  299  G   A N9    1 
ATOM   6411  C  C8    . G   A 1  299  ? 167.271 122.826 161.526 1.00 163.66 ?  299  G   A C8    1 
ATOM   6412  N  N7    . G   A 1  299  ? 167.169 122.155 162.641 1.00 163.66 ?  299  G   A N7    1 
ATOM   6413  C  C5    . G   A 1  299  ? 165.857 122.361 163.046 1.00 163.66 ?  299  G   A C5    1 
ATOM   6414  C  C6    . G   A 1  299  ? 165.162 121.883 164.186 1.00 163.66 ?  299  G   A C6    1 
ATOM   6415  O  O6    . G   A 1  299  ? 165.582 121.159 165.096 1.00 163.66 ?  299  G   A O6    1 
ATOM   6416  N  N1    . G   A 1  299  ? 163.846 122.333 164.210 1.00 163.66 ?  299  G   A N1    1 
ATOM   6417  C  C2    . G   A 1  299  ? 163.270 123.139 163.259 1.00 163.66 ?  299  G   A C2    1 
ATOM   6418  N  N2    . G   A 1  299  ? 161.985 123.466 163.459 1.00 163.66 ?  299  G   A N2    1 
ATOM   6419  N  N3    . G   A 1  299  ? 163.907 123.591 162.191 1.00 163.66 ?  299  G   A N3    1 
ATOM   6420  C  C4    . G   A 1  299  ? 165.188 123.167 162.149 1.00 163.66 ?  299  G   A C4    1 
ATOM   6421  P  P     . G   A 1  300  ? 168.546 128.313 160.743 1.00 133.31 ?  300  G   A P     1 
ATOM   6422  O  OP1   . G   A 1  300  ? 168.952 129.574 160.072 1.00 133.31 ?  300  G   A OP1   1 
ATOM   6423  O  OP2   . G   A 1  300  ? 169.579 127.444 161.362 1.00 133.31 ?  300  G   A OP2   1 
ATOM   6424  O  "O5'" . G   A 1  300  ? 167.471 128.675 161.862 1.00 133.31 ?  300  G   A "O5'" 1 
ATOM   6425  C  "C5'" . G   A 1  300  ? 166.273 129.360 161.529 1.00 133.31 ?  300  G   A "C5'" 1 
ATOM   6426  C  "C4'" . G   A 1  300  ? 165.256 129.258 162.636 1.00 133.31 ?  300  G   A "C4'" 1 
ATOM   6427  O  "O4'" . G   A 1  300  ? 164.935 127.862 162.877 1.00 133.31 ?  300  G   A "O4'" 1 
ATOM   6428  C  "C3'" . G   A 1  300  ? 165.702 129.775 163.996 1.00 133.31 ?  300  G   A "C3'" 1 
ATOM   6429  O  "O3'" . G   A 1  300  ? 165.592 131.182 164.120 1.00 133.31 ?  300  G   A "O3'" 1 
ATOM   6430  C  "C2'" . G   A 1  300  ? 164.806 129.003 164.953 1.00 133.31 ?  300  G   A "C2'" 1 
ATOM   6431  O  "O2'" . G   A 1  300  ? 163.502 129.565 164.984 1.00 133.31 ?  300  G   A "O2'" 1 
ATOM   6432  C  "C1'" . G   A 1  300  ? 164.729 127.645 164.257 1.00 133.31 ?  300  G   A "C1'" 1 
ATOM   6433  N  N9    . G   A 1  300  ? 165.771 126.718 164.740 1.00 133.31 ?  300  G   A N9    1 
ATOM   6434  C  C8    . G   A 1  300  ? 166.876 126.296 164.041 1.00 133.31 ?  300  G   A C8    1 
ATOM   6435  N  N7    . G   A 1  300  ? 167.630 125.474 164.718 1.00 133.31 ?  300  G   A N7    1 
ATOM   6436  C  C5    . G   A 1  300  ? 166.984 125.343 165.939 1.00 133.31 ?  300  G   A C5    1 
ATOM   6437  C  C6    . G   A 1  300  ? 167.332 124.577 167.082 1.00 133.31 ?  300  G   A C6    1 
ATOM   6438  O  O6    . G   A 1  300  ? 168.312 123.840 167.247 1.00 133.31 ?  300  G   A O6    1 
ATOM   6439  N  N1    . G   A 1  300  ? 166.401 124.731 168.104 1.00 133.31 ?  300  G   A N1    1 
ATOM   6440  C  C2    . G   A 1  300  ? 165.279 125.519 168.037 1.00 133.31 ?  300  G   A C2    1 
ATOM   6441  N  N2    . G   A 1  300  ? 164.502 125.536 169.130 1.00 133.31 ?  300  G   A N2    1 
ATOM   6442  N  N3    . G   A 1  300  ? 164.943 126.237 166.977 1.00 133.31 ?  300  G   A N3    1 
ATOM   6443  C  C4    . G   A 1  300  ? 165.834 126.104 165.970 1.00 133.31 ?  300  G   A C4    1 
ATOM   6444  P  P     . G   A 1  301  ? 166.675 132.005 164.975 1.00 114.62 ?  301  G   A P     1 
ATOM   6445  O  OP1   . G   A 1  301  ? 166.526 133.444 164.642 1.00 114.62 ?  301  G   A OP1   1 
ATOM   6446  O  OP2   . G   A 1  301  ? 167.995 131.345 164.802 1.00 114.62 ?  301  G   A OP2   1 
ATOM   6447  O  "O5'" . G   A 1  301  ? 166.215 131.796 166.486 1.00 114.62 ?  301  G   A "O5'" 1 
ATOM   6448  C  "C5'" . G   A 1  301  ? 164.951 132.263 166.933 1.00 114.62 ?  301  G   A "C5'" 1 
ATOM   6449  C  "C4'" . G   A 1  301  ? 164.561 131.641 168.250 1.00 114.62 ?  301  G   A "C4'" 1 
ATOM   6450  O  "O4'" . G   A 1  301  ? 164.513 130.195 168.117 1.00 114.62 ?  301  G   A "O4'" 1 
ATOM   6451  C  "C3'" . G   A 1  301  ? 165.520 131.868 169.409 1.00 114.62 ?  301  G   A "C3'" 1 
ATOM   6452  O  "O3'" . G   A 1  301  ? 165.370 133.136 170.024 1.00 114.62 ?  301  G   A "O3'" 1 
ATOM   6453  C  "C2'" . G   A 1  301  ? 165.199 130.701 170.330 1.00 114.62 ?  301  G   A "C2'" 1 
ATOM   6454  O  "O2'" . G   A 1  301  ? 163.997 130.943 171.046 1.00 114.62 ?  301  G   A "O2'" 1 
ATOM   6455  C  "C1'" . G   A 1  301  ? 164.943 129.587 169.318 1.00 114.62 ?  301  G   A "C1'" 1 
ATOM   6456  N  N9    . G   A 1  301  ? 166.166 128.808 169.040 1.00 114.62 ?  301  G   A N9    1 
ATOM   6457  C  C8    . G   A 1  301  ? 166.874 128.785 167.863 1.00 114.62 ?  301  G   A C8    1 
ATOM   6458  N  N7    . G   A 1  301  ? 167.918 128.005 167.904 1.00 114.62 ?  301  G   A N7    1 
ATOM   6459  C  C5    . G   A 1  301  ? 167.903 127.479 169.188 1.00 114.62 ?  301  G   A C5    1 
ATOM   6460  C  C6    . G   A 1  301  ? 168.791 126.567 169.816 1.00 114.62 ?  301  G   A C6    1 
ATOM   6461  O  O6    . G   A 1  301  ? 169.800 126.027 169.346 1.00 114.62 ?  301  G   A O6    1 
ATOM   6462  N  N1    . G   A 1  301  ? 168.409 126.298 171.126 1.00 114.62 ?  301  G   A N1    1 
ATOM   6463  C  C2    . G   A 1  301  ? 167.314 126.836 171.754 1.00 114.62 ?  301  G   A C2    1 
ATOM   6464  N  N2    . G   A 1  301  ? 167.110 126.454 173.023 1.00 114.62 ?  301  G   A N2    1 
ATOM   6465  N  N3    . G   A 1  301  ? 166.478 127.684 171.179 1.00 114.62 ?  301  G   A N3    1 
ATOM   6466  C  C4    . G   A 1  301  ? 166.828 127.963 169.904 1.00 114.62 ?  301  G   A C4    1 
ATOM   6467  P  P     . G   A 1  302  ? 166.658 133.906 170.603 1.00 99.26  ?  302  G   A P     1 
ATOM   6468  O  OP1   . G   A 1  302  ? 166.264 135.295 170.942 1.00 99.26  ?  302  G   A OP1   1 
ATOM   6469  O  OP2   . G   A 1  302  ? 167.784 133.674 169.664 1.00 99.26  ?  302  G   A OP2   1 
ATOM   6470  O  "O5'" . G   A 1  302  ? 166.995 133.143 171.961 1.00 99.26  ?  302  G   A "O5'" 1 
ATOM   6471  C  "C5'" . G   A 1  302  ? 166.070 133.111 173.040 1.00 99.26  ?  302  G   A "C5'" 1 
ATOM   6472  C  "C4'" . G   A 1  302  ? 166.437 132.043 174.040 1.00 99.26  ?  302  G   A "C4'" 1 
ATOM   6473  O  "O4'" . G   A 1  302  ? 166.600 130.774 173.353 1.00 99.26  ?  302  G   A "O4'" 1 
ATOM   6474  C  "C3'" . G   A 1  302  ? 167.757 132.247 174.768 1.00 99.26  ?  302  G   A "C3'" 1 
ATOM   6475  O  "O3'" . G   A 1  302  ? 167.642 133.111 175.885 1.00 99.26  ?  302  G   A "O3'" 1 
ATOM   6476  C  "C2'" . G   A 1  302  ? 168.160 130.827 175.139 1.00 99.26  ?  302  G   A "C2'" 1 
ATOM   6477  O  "O2'" . G   A 1  302  ? 167.435 130.380 176.275 1.00 99.26  ?  302  G   A "O2'" 1 
ATOM   6478  C  "C1'" . G   A 1  302  ? 167.671 130.049 173.918 1.00 99.26  ?  302  G   A "C1'" 1 
ATOM   6479  N  N9    . G   A 1  302  ? 168.721 129.906 172.891 1.00 99.26  ?  302  G   A N9    1 
ATOM   6480  C  C8    . G   A 1  302  ? 168.704 130.465 171.635 1.00 99.26  ?  302  G   A C8    1 
ATOM   6481  N  N7    . G   A 1  302  ? 169.759 130.176 170.925 1.00 99.26  ?  302  G   A N7    1 
ATOM   6482  C  C5    . G   A 1  302  ? 170.522 129.374 171.760 1.00 99.26  ?  302  G   A C5    1 
ATOM   6483  C  C6    . G   A 1  302  ? 171.780 128.756 171.533 1.00 99.26  ?  302  G   A C6    1 
ATOM   6484  O  O6    . G   A 1  302  ? 172.487 128.799 170.519 1.00 99.26  ?  302  G   A O6    1 
ATOM   6485  N  N1    . G   A 1  302  ? 172.201 128.028 172.641 1.00 99.26  ?  302  G   A N1    1 
ATOM   6486  C  C2    . G   A 1  302  ? 171.504 127.909 173.817 1.00 99.26  ?  302  G   A C2    1 
ATOM   6487  N  N2    . G   A 1  302  ? 172.076 127.163 174.773 1.00 99.26  ?  302  G   A N2    1 
ATOM   6488  N  N3    . G   A 1  302  ? 170.330 128.478 174.040 1.00 99.26  ?  302  G   A N3    1 
ATOM   6489  C  C4    . G   A 1  302  ? 169.898 129.193 172.977 1.00 99.26  ?  302  G   A C4    1 
ATOM   6490  P  P     . A   A 1  303  ? 168.823 134.143 176.236 1.00 83.66  ?  303  A   A P     1 
ATOM   6491  O  OP1   . A   A 1  303  ? 168.377 134.964 177.389 1.00 83.66  ?  303  A   A OP1   1 
ATOM   6492  O  OP2   . A   A 1  303  ? 169.249 134.806 174.978 1.00 83.66  ?  303  A   A OP2   1 
ATOM   6493  O  "O5'" . A   A 1  303  ? 170.016 133.214 176.738 1.00 83.66  ?  303  A   A "O5'" 1 
ATOM   6494  C  "C5'" . A   A 1  303  ? 169.932 132.519 177.973 1.00 83.66  ?  303  A   A "C5'" 1 
ATOM   6495  C  "C4'" . A   A 1  303  ? 171.116 131.608 178.171 1.00 83.66  ?  303  A   A "C4'" 1 
ATOM   6496  O  "O4'" . A   A 1  303  ? 171.159 130.626 177.102 1.00 83.66  ?  303  A   A "O4'" 1 
ATOM   6497  C  "C3'" . A   A 1  303  ? 172.481 132.277 178.115 1.00 83.66  ?  303  A   A "C3'" 1 
ATOM   6498  O  "O3'" . A   A 1  303  ? 172.846 132.888 179.341 1.00 83.66  ?  303  A   A "O3'" 1 
ATOM   6499  C  "C2'" . A   A 1  303  ? 173.398 131.133 177.705 1.00 83.66  ?  303  A   A "C2'" 1 
ATOM   6500  O  "O2'" . A   A 1  303  ? 173.690 130.300 178.817 1.00 83.66  ?  303  A   A "O2'" 1 
ATOM   6501  C  "C1'" . A   A 1  303  ? 172.498 130.358 176.744 1.00 83.66  ?  303  A   A "C1'" 1 
ATOM   6502  N  N9    . A   A 1  303  ? 172.694 130.774 175.342 1.00 83.66  ?  303  A   A N9    1 
ATOM   6503  C  C8    . A   A 1  303  ? 171.835 131.513 174.566 1.00 83.66  ?  303  A   A C8    1 
ATOM   6504  N  N7    . A   A 1  303  ? 172.272 131.731 173.350 1.00 83.66  ?  303  A   A N7    1 
ATOM   6505  C  C5    . A   A 1  303  ? 173.503 131.091 173.323 1.00 83.66  ?  303  A   A C5    1 
ATOM   6506  C  C6    . A   A 1  303  ? 174.477 130.946 172.319 1.00 83.66  ?  303  A   A C6    1 
ATOM   6507  N  N6    . A   A 1  303  ? 174.354 131.464 171.095 1.00 83.66  ?  303  A   A N6    1 
ATOM   6508  N  N1    . A   A 1  303  ? 175.596 130.245 172.617 1.00 83.66  ?  303  A   A N1    1 
ATOM   6509  C  C2    . A   A 1  303  ? 175.726 129.724 173.845 1.00 83.66  ?  303  A   A C2    1 
ATOM   6510  N  N3    . A   A 1  303  ? 174.879 129.792 174.870 1.00 83.66  ?  303  A   A N3    1 
ATOM   6511  C  C4    . A   A 1  303  ? 173.777 130.495 174.543 1.00 83.66  ?  303  A   A C4    1 
ATOM   6512  P  P     . C   A 1  304  ? 173.468 134.370 179.353 1.00 69.18  ?  304  C   A P     1 
ATOM   6513  O  OP1   . C   A 1  304  ? 173.458 134.862 180.754 1.00 69.18  ?  304  C   A OP1   1 
ATOM   6514  O  OP2   . C   A 1  304  ? 172.793 135.161 178.293 1.00 69.18  ?  304  C   A OP2   1 
ATOM   6515  O  "O5'" . C   A 1  304  ? 174.984 134.155 178.917 1.00 69.18  ?  304  C   A "O5'" 1 
ATOM   6516  C  "C5'" . C   A 1  304  ? 175.844 133.306 179.664 1.00 69.18  ?  304  C   A "C5'" 1 
ATOM   6517  C  "C4'" . C   A 1  304  ? 177.046 132.891 178.854 1.00 69.18  ?  304  C   A "C4'" 1 
ATOM   6518  O  "O4'" . C   A 1  304  ? 176.611 132.174 177.669 1.00 69.18  ?  304  C   A "O4'" 1 
ATOM   6519  C  "C3'" . C   A 1  304  ? 177.900 134.024 178.306 1.00 69.18  ?  304  C   A "C3'" 1 
ATOM   6520  O  "O3'" . C   A 1  304  ? 178.801 134.554 179.262 1.00 69.18  ?  304  C   A "O3'" 1 
ATOM   6521  C  "C2'" . C   A 1  304  ? 178.585 133.377 177.108 1.00 69.18  ?  304  C   A "C2'" 1 
ATOM   6522  O  "O2'" . C   A 1  304  ? 179.689 132.589 177.527 1.00 69.18  ?  304  C   A "O2'" 1 
ATOM   6523  C  "C1'" . C   A 1  304  ? 177.488 132.439 176.594 1.00 69.18  ?  304  C   A "C1'" 1 
ATOM   6524  N  N1    . C   A 1  304  ? 176.715 133.018 175.466 1.00 69.18  ?  304  C   A N1    1 
ATOM   6525  C  C2    . C   A 1  304  ? 177.231 132.906 174.168 1.00 69.18  ?  304  C   A C2    1 
ATOM   6526  O  O2    . C   A 1  304  ? 178.316 132.333 173.987 1.00 69.18  ?  304  C   A O2    1 
ATOM   6527  N  N3    . C   A 1  304  ? 176.536 133.426 173.129 1.00 69.18  ?  304  C   A N3    1 
ATOM   6528  C  C4    . C   A 1  304  ? 175.370 134.038 173.337 1.00 69.18  ?  304  C   A C4    1 
ATOM   6529  N  N4    . C   A 1  304  ? 174.724 134.533 172.279 1.00 69.18  ?  304  C   A N4    1 
ATOM   6530  C  C5    . C   A 1  304  ? 174.815 134.167 174.642 1.00 69.18  ?  304  C   A C5    1 
ATOM   6531  C  C6    . C   A 1  304  ? 175.511 133.645 175.659 1.00 69.18  ?  304  C   A C6    1 
ATOM   6532  P  P     . C   A 1  305  ? 179.151 136.122 179.256 1.00 54.28  ?  305  C   A P     1 
ATOM   6533  O  OP1   . C   A 1  305  ? 179.830 136.447 180.536 1.00 54.28  ?  305  C   A OP1   1 
ATOM   6534  O  OP2   . C   A 1  305  ? 177.926 136.865 178.864 1.00 54.28  ?  305  C   A OP2   1 
ATOM   6535  O  "O5'" . C   A 1  305  ? 180.215 136.274 178.080 1.00 54.28  ?  305  C   A "O5'" 1 
ATOM   6536  C  "C5'" . C   A 1  305  ? 181.474 135.622 178.151 1.00 54.28  ?  305  C   A "C5'" 1 
ATOM   6537  C  "C4'" . C   A 1  305  ? 182.206 135.679 176.834 1.00 54.28  ?  305  C   A "C4'" 1 
ATOM   6538  O  "O4'" . C   A 1  305  ? 181.466 134.943 175.825 1.00 54.28  ?  305  C   A "O4'" 1 
ATOM   6539  C  "C3'" . C   A 1  305  ? 182.381 137.060 176.224 1.00 54.28  ?  305  C   A "C3'" 1 
ATOM   6540  O  "O3'" . C   A 1  305  ? 183.447 137.793 176.801 1.00 54.28  ?  305  C   A "O3'" 1 
ATOM   6541  C  "C2'" . C   A 1  305  ? 182.580 136.749 174.745 1.00 54.28  ?  305  C   A "C2'" 1 
ATOM   6542  O  "O2'" . C   A 1  305  ? 183.917 136.343 174.492 1.00 54.28  ?  305  C   A "O2'" 1 
ATOM   6543  C  "C1'" . C   A 1  305  ? 181.663 135.535 174.557 1.00 54.28  ?  305  C   A "C1'" 1 
ATOM   6544  N  N1    . C   A 1  305  ? 180.346 135.895 173.973 1.00 54.28  ?  305  C   A N1    1 
ATOM   6545  C  C2    . C   A 1  305  ? 180.238 135.995 172.580 1.00 54.28  ?  305  C   A C2    1 
ATOM   6546  O  O2    . C   A 1  305  ? 181.236 135.785 171.873 1.00 54.28  ?  305  C   A O2    1 
ATOM   6547  N  N3    . C   A 1  305  ? 179.045 136.319 172.028 1.00 54.28  ?  305  C   A N3    1 
ATOM   6548  C  C4    . C   A 1  305  ? 177.984 136.539 172.804 1.00 54.28  ?  305  C   A C4    1 
ATOM   6549  N  N4    . C   A 1  305  ? 176.830 136.857 172.212 1.00 54.28  ?  305  C   A N4    1 
ATOM   6550  C  C5    . C   A 1  305  ? 178.059 136.444 174.223 1.00 54.28  ?  305  C   A C5    1 
ATOM   6551  C  C6    . C   A 1  305  ? 179.244 136.121 174.755 1.00 54.28  ?  305  C   A C6    1 
ATOM   6552  P  P     . U   A 1  306  ? 183.372 139.396 176.882 1.00 45.42  ?  306  U   A P     1 
ATOM   6553  O  OP1   . U   A 1  306  ? 184.408 139.857 177.840 1.00 45.42  ?  306  U   A OP1   1 
ATOM   6554  O  OP2   . U   A 1  306  ? 181.953 139.781 177.092 1.00 45.42  ?  306  U   A OP2   1 
ATOM   6555  O  "O5'" . U   A 1  306  ? 183.802 139.874 175.425 1.00 45.42  ?  306  U   A "O5'" 1 
ATOM   6556  C  "C5'" . U   A 1  306  ? 185.109 139.617 174.933 1.00 45.42  ?  306  U   A "C5'" 1 
ATOM   6557  C  "C4'" . U   A 1  306  ? 185.257 140.047 173.495 1.00 45.42  ?  306  U   A "C4'" 1 
ATOM   6558  O  "O4'" . U   A 1  306  ? 184.444 139.204 172.638 1.00 45.42  ?  306  U   A "O4'" 1 
ATOM   6559  C  "C3'" . U   A 1  306  ? 184.798 141.458 173.165 1.00 45.42  ?  306  U   A "C3'" 1 
ATOM   6560  O  "O3'" . U   A 1  306  ? 185.749 142.447 173.517 1.00 45.42  ?  306  U   A "O3'" 1 
ATOM   6561  C  "C2'" . U   A 1  306  ? 184.525 141.377 171.668 1.00 45.42  ?  306  U   A "C2'" 1 
ATOM   6562  O  "O2'" . U   A 1  306  ? 185.737 141.470 170.933 1.00 45.42  ?  306  U   A "O2'" 1 
ATOM   6563  C  "C1'" . U   A 1  306  ? 183.985 139.949 171.529 1.00 45.42  ?  306  U   A "C1'" 1 
ATOM   6564  N  N1    . U   A 1  306  ? 182.502 139.897 171.487 1.00 45.42  ?  306  U   A N1    1 
ATOM   6565  C  C2    . U   A 1  306  ? 181.886 140.122 170.268 1.00 45.42  ?  306  U   A C2    1 
ATOM   6566  O  O2    . U   A 1  306  ? 182.499 140.364 169.242 1.00 45.42  ?  306  U   A O2    1 
ATOM   6567  N  N3    . U   A 1  306  ? 180.515 140.057 170.288 1.00 45.42  ?  306  U   A N3    1 
ATOM   6568  C  C4    . U   A 1  306  ? 179.708 139.792 171.375 1.00 45.42  ?  306  U   A C4    1 
ATOM   6569  O  O4    . U   A 1  306  ? 178.484 139.769 171.231 1.00 45.42  ?  306  U   A O4    1 
ATOM   6570  C  C5    . U   A 1  306  ? 180.414 139.567 172.598 1.00 45.42  ?  306  U   A C5    1 
ATOM   6571  C  C6    . U   A 1  306  ? 181.750 139.622 172.608 1.00 45.42  ?  306  U   A C6    1 
ATOM   6572  P  P     . C   A 1  307  ? 185.264 143.856 174.120 1.00 45.29  ?  307  C   A P     1 
ATOM   6573  O  OP1   . C   A 1  307  ? 186.460 144.572 174.632 1.00 45.29  ?  307  C   A OP1   1 
ATOM   6574  O  OP2   . C   A 1  307  ? 184.118 143.597 175.028 1.00 45.29  ?  307  C   A OP2   1 
ATOM   6575  O  "O5'" . C   A 1  307  ? 184.719 144.652 172.853 1.00 45.29  ?  307  C   A "O5'" 1 
ATOM   6576  C  "C5'" . C   A 1  307  ? 185.591 145.019 171.794 1.00 45.29  ?  307  C   A "C5'" 1 
ATOM   6577  C  "C4'" . C   A 1  307  ? 184.826 145.460 170.572 1.00 45.29  ?  307  C   A "C4'" 1 
ATOM   6578  O  "O4'" . C   A 1  307  ? 184.000 144.369 170.087 1.00 45.29  ?  307  C   A "O4'" 1 
ATOM   6579  C  "C3'" . C   A 1  307  ? 183.842 146.602 170.773 1.00 45.29  ?  307  C   A "C3'" 1 
ATOM   6580  O  "O3'" . C   A 1  307  ? 184.462 147.876 170.790 1.00 45.29  ?  307  C   A "O3'" 1 
ATOM   6581  C  "C2'" . C   A 1  307  ? 182.868 146.409 169.617 1.00 45.29  ?  307  C   A "C2'" 1 
ATOM   6582  O  "O2'" . C   A 1  307  ? 183.412 146.924 168.410 1.00 45.29  ?  307  C   A "O2'" 1 
ATOM   6583  C  "C1'" . C   A 1  307  ? 182.817 144.882 169.508 1.00 45.29  ?  307  C   A "C1'" 1 
ATOM   6584  N  N1    . C   A 1  307  ? 181.640 144.294 170.196 1.00 45.29  ?  307  C   A N1    1 
ATOM   6585  C  C2    . C   A 1  307  ? 180.410 144.262 169.525 1.00 45.29  ?  307  C   A C2    1 
ATOM   6586  O  O2    . C   A 1  307  ? 180.323 144.724 168.377 1.00 45.29  ?  307  C   A O2    1 
ATOM   6587  N  N3    . C   A 1  307  ? 179.331 143.725 170.142 1.00 45.29  ?  307  C   A N3    1 
ATOM   6588  C  C4    . C   A 1  307  ? 179.439 143.229 171.375 1.00 45.29  ?  307  C   A C4    1 
ATOM   6589  N  N4    . C   A 1  307  ? 178.346 142.712 171.939 1.00 45.29  ?  307  C   A N4    1 
ATOM   6590  C  C5    . C   A 1  307  ? 180.673 143.243 172.084 1.00 45.29  ?  307  C   A C5    1 
ATOM   6591  C  C6    . C   A 1  307  ? 181.732 143.775 171.461 1.00 45.29  ?  307  C   A C6    1 
ATOM   6592  P  P     . A   A 1  308  ? 183.739 149.115 171.515 1.00 45.51  ?  308  A   A P     1 
ATOM   6593  O  OP1   . A   A 1  308  ? 184.767 150.141 171.819 1.00 45.51  ?  308  A   A OP1   1 
ATOM   6594  O  OP2   . A   A 1  308  ? 182.892 148.576 172.609 1.00 45.51  ?  308  A   A OP2   1 
ATOM   6595  O  "O5'" . A   A 1  308  ? 182.774 149.706 170.394 1.00 45.51  ?  308  A   A "O5'" 1 
ATOM   6596  C  "C5'" . A   A 1  308  ? 183.293 150.168 169.155 1.00 45.51  ?  308  A   A "C5'" 1 
ATOM   6597  C  "C4'" . A   A 1  308  ? 182.187 150.480 168.180 1.00 45.51  ?  308  A   A "C4'" 1 
ATOM   6598  O  "O4'" . A   A 1  308  ? 181.438 149.272 167.885 1.00 45.51  ?  308  A   A "O4'" 1 
ATOM   6599  C  "C3'" . A   A 1  308  ? 181.131 151.459 168.669 1.00 45.51  ?  308  A   A "C3'" 1 
ATOM   6600  O  "O3'" . A   A 1  308  ? 181.535 152.811 168.545 1.00 45.51  ?  308  A   A "O3'" 1 
ATOM   6601  C  "C2'" . A   A 1  308  ? 179.922 151.099 167.817 1.00 45.51  ?  308  A   A "C2'" 1 
ATOM   6602  O  "O2'" . A   A 1  308  ? 180.043 151.651 166.514 1.00 45.51  ?  308  A   A "O2'" 1 
ATOM   6603  C  "C1'" . A   A 1  308  ? 180.071 149.581 167.713 1.00 45.51  ?  308  A   A "C1'" 1 
ATOM   6604  N  N9    . A   A 1  308  ? 179.300 148.878 168.756 1.00 45.51  ?  308  A   A N9    1 
ATOM   6605  C  C8    . A   A 1  308  ? 179.781 148.289 169.900 1.00 45.51  ?  308  A   A C8    1 
ATOM   6606  N  N7    . A   A 1  308  ? 178.853 147.737 170.642 1.00 45.51  ?  308  A   A N7    1 
ATOM   6607  C  C5    . A   A 1  308  ? 177.681 147.981 169.940 1.00 45.51  ?  308  A   A C5    1 
ATOM   6608  C  C6    . A   A 1  308  ? 176.336 147.655 170.190 1.00 45.51  ?  308  A   A C6    1 
ATOM   6609  N  N6    . A   A 1  308  ? 175.929 146.982 171.269 1.00 45.51  ?  308  A   A N6    1 
ATOM   6610  N  N1    . A   A 1  308  ? 175.410 148.047 169.285 1.00 45.51  ?  308  A   A N1    1 
ATOM   6611  C  C2    . A   A 1  308  ? 175.809 148.724 168.199 1.00 45.51  ?  308  A   A C2    1 
ATOM   6612  N  N3    . A   A 1  308  ? 177.044 149.088 167.856 1.00 45.51  ?  308  A   A N3    1 
ATOM   6613  C  C4    . A   A 1  308  ? 177.940 148.683 168.775 1.00 45.51  ?  308  A   A C4    1 
ATOM   6614  P  P     . U   A 1  309  ? 181.560 153.766 169.837 1.00 50.01  ?  309  U   A P     1 
ATOM   6615  O  OP1   . U   A 1  309  ? 182.265 155.020 169.470 1.00 50.01  ?  309  U   A OP1   1 
ATOM   6616  O  OP2   . U   A 1  309  ? 182.040 152.964 170.991 1.00 50.01  ?  309  U   A OP2   1 
ATOM   6617  O  "O5'" . U   A 1  309  ? 180.026 154.114 170.085 1.00 50.01  ?  309  U   A "O5'" 1 
ATOM   6618  C  "C5'" . U   A 1  309  ? 179.256 154.759 169.083 1.00 50.01  ?  309  U   A "C5'" 1 
ATOM   6619  C  "C4'" . U   A 1  309  ? 177.795 154.803 169.452 1.00 50.01  ?  309  U   A "C4'" 1 
ATOM   6620  O  "O4'" . U   A 1  309  ? 177.252 153.457 169.463 1.00 50.01  ?  309  U   A "O4'" 1 
ATOM   6621  C  "C3'" . U   A 1  309  ? 177.474 155.343 170.837 1.00 50.01  ?  309  U   A "C3'" 1 
ATOM   6622  O  "O3'" . U   A 1  309  ? 177.464 156.759 170.885 1.00 50.01  ?  309  U   A "O3'" 1 
ATOM   6623  C  "C2'" . U   A 1  309  ? 176.120 154.711 171.141 1.00 50.01  ?  309  U   A "C2'" 1 
ATOM   6624  O  "O2'" . U   A 1  309  ? 175.076 155.435 170.508 1.00 50.01  ?  309  U   A "O2'" 1 
ATOM   6625  C  "C1'" . U   A 1  309  ? 176.250 153.348 170.452 1.00 50.01  ?  309  U   A "C1'" 1 
ATOM   6626  N  N1    . U   A 1  309  ? 176.612 152.257 171.390 1.00 50.01  ?  309  U   A N1    1 
ATOM   6627  C  C2    . U   A 1  309  ? 175.586 151.654 172.098 1.00 50.01  ?  309  U   A C2    1 
ATOM   6628  O  O2    . U   A 1  309  ? 174.416 151.982 171.990 1.00 50.01  ?  309  U   A O2    1 
ATOM   6629  N  N3    . U   A 1  309  ? 175.977 150.647 172.947 1.00 50.01  ?  309  U   A N3    1 
ATOM   6630  C  C4    . U   A 1  309  ? 177.259 150.184 173.156 1.00 50.01  ?  309  U   A C4    1 
ATOM   6631  O  O4    . U   A 1  309  ? 177.450 149.267 173.957 1.00 50.01  ?  309  U   A O4    1 
ATOM   6632  C  C5    . U   A 1  309  ? 178.264 150.852 172.388 1.00 50.01  ?  309  U   A C5    1 
ATOM   6633  C  C6    . U   A 1  309  ? 177.913 151.834 171.552 1.00 50.01  ?  309  U   A C6    1 
ATOM   6634  P  P     . A   A 1  310  ? 178.356 157.543 171.969 1.00 53.54  ?  310  A   A P     1 
ATOM   6635  O  OP1   . A   A 1  310  ? 179.351 156.589 172.521 1.00 53.54  ?  310  A   A OP1   1 
ATOM   6636  O  OP2   . A   A 1  310  ? 177.439 158.262 172.890 1.00 53.54  ?  310  A   A OP2   1 
ATOM   6637  O  "O5'" . A   A 1  310  ? 179.144 158.627 171.108 1.00 53.54  ?  310  A   A "O5'" 1 
ATOM   6638  C  "C5'" . A   A 1  310  ? 180.260 158.252 170.315 1.00 53.54  ?  310  A   A "C5'" 1 
ATOM   6639  C  "C4'" . A   A 1  310  ? 180.015 158.511 168.849 1.00 53.54  ?  310  A   A "C4'" 1 
ATOM   6640  O  "O4'" . A   A 1  310  ? 178.719 157.981 168.469 1.00 53.54  ?  310  A   A "O4'" 1 
ATOM   6641  C  "C3'" . A   A 1  310  ? 179.954 159.970 168.423 1.00 53.54  ?  310  A   A "C3'" 1 
ATOM   6642  O  "O3'" . A   A 1  310  ? 181.237 160.550 168.250 1.00 53.54  ?  310  A   A "O3'" 1 
ATOM   6643  C  "C2'" . A   A 1  310  ? 179.138 159.904 167.139 1.00 53.54  ?  310  A   A "C2'" 1 
ATOM   6644  O  "O2'" . A   A 1  310  ? 179.941 159.459 166.057 1.00 53.54  ?  310  A   A "O2'" 1 
ATOM   6645  C  "C1'" . A   A 1  310  ? 178.137 158.798 167.476 1.00 53.54  ?  310  A   A "C1'" 1 
ATOM   6646  N  N9    . A   A 1  310  ? 176.867 159.341 167.991 1.00 53.54  ?  310  A   A N9    1 
ATOM   6647  C  C8    . A   A 1  310  ? 176.411 159.351 169.286 1.00 53.54  ?  310  A   A C8    1 
ATOM   6648  N  N7    . A   A 1  310  ? 175.234 159.911 169.426 1.00 53.54  ?  310  A   A N7    1 
ATOM   6649  C  C5    . A   A 1  310  ? 174.895 160.296 168.136 1.00 53.54  ?  310  A   A C5    1 
ATOM   6650  C  C6    . A   A 1  310  ? 173.769 160.946 167.598 1.00 53.54  ?  310  A   A C6    1 
ATOM   6651  N  N6    . A   A 1  310  ? 172.726 161.341 168.330 1.00 53.54  ?  310  A   A N6    1 
ATOM   6652  N  N1    . A   A 1  310  ? 173.749 161.180 166.265 1.00 53.54  ?  310  A   A N1    1 
ATOM   6653  C  C2    . A   A 1  310  ? 174.792 160.787 165.520 1.00 53.54  ?  310  A   A C2    1 
ATOM   6654  N  N3    . A   A 1  310  ? 175.904 160.169 165.913 1.00 53.54  ?  310  A   A N3    1 
ATOM   6655  C  C4    . A   A 1  310  ? 175.892 159.952 167.242 1.00 53.54  ?  310  A   A C4    1 
ATOM   6656  P  P     . A   A 1  311  ? 181.556 162.008 168.849 1.00 54.11  ?  311  A   A P     1 
ATOM   6657  O  OP1   . A   A 1  311  ? 183.025 162.113 169.041 1.00 54.11  ?  311  A   A OP1   1 
ATOM   6658  O  OP2   . A   A 1  311  ? 180.650 162.237 170.003 1.00 54.11  ?  311  A   A OP2   1 
ATOM   6659  O  "O5'" . A   A 1  311  ? 181.140 163.010 167.681 1.00 54.11  ?  311  A   A "O5'" 1 
ATOM   6660  C  "C5'" . A   A 1  311  ? 181.827 163.009 166.438 1.00 54.11  ?  311  A   A "C5'" 1 
ATOM   6661  C  "C4'" . A   A 1  311  ? 180.939 163.484 165.315 1.00 54.11  ?  311  A   A "C4'" 1 
ATOM   6662  O  "O4'" . A   A 1  311  ? 179.692 162.740 165.339 1.00 54.11  ?  311  A   A "O4'" 1 
ATOM   6663  C  "C3'" . A   A 1  311  ? 180.503 164.942 165.375 1.00 54.11  ?  311  A   A "C3'" 1 
ATOM   6664  O  "O3'" . A   A 1  311  ? 181.479 165.833 164.860 1.00 54.11  ?  311  A   A "O3'" 1 
ATOM   6665  C  "C2'" . A   A 1  311  ? 179.206 164.935 164.579 1.00 54.11  ?  311  A   A "C2'" 1 
ATOM   6666  O  "O2'" . A   A 1  311  ? 179.471 164.918 163.184 1.00 54.11  ?  311  A   A "O2'" 1 
ATOM   6667  C  "C1'" . A   A 1  311  ? 178.619 163.581 164.974 1.00 54.11  ?  311  A   A "C1'" 1 
ATOM   6668  N  N9    . A   A 1  311  ? 177.705 163.693 166.125 1.00 54.11  ?  311  A   A N9    1 
ATOM   6669  C  C8    . A   A 1  311  ? 177.933 163.280 167.414 1.00 54.11  ?  311  A   A C8    1 
ATOM   6670  N  N7    . A   A 1  311  ? 176.934 163.510 168.230 1.00 54.11  ?  311  A   A N7    1 
ATOM   6671  C  C5    . A   A 1  311  ? 175.984 164.117 167.421 1.00 54.11  ?  311  A   A C5    1 
ATOM   6672  C  C6    . A   A 1  311  ? 174.693 164.610 167.678 1.00 54.11  ?  311  A   A C6    1 
ATOM   6673  N  N6    . A   A 1  311  ? 174.114 164.566 168.880 1.00 54.11  ?  311  A   A N6    1 
ATOM   6674  N  N1    . A   A 1  311  ? 174.006 165.159 166.650 1.00 54.11  ?  311  A   A N1    1 
ATOM   6675  C  C2    . A   A 1  311  ? 174.580 165.209 165.440 1.00 54.11  ?  311  A   A C2    1 
ATOM   6676  N  N3    . A   A 1  311  ? 175.786 164.777 165.077 1.00 54.11  ?  311  A   A N3    1 
ATOM   6677  C  C4    . A   A 1  311  ? 176.443 164.238 166.121 1.00 54.11  ?  311  A   A C4    1 
ATOM   6678  P  P     . C   A 1  312  ? 181.762 167.240 165.586 1.00 51.37  ?  312  C   A P     1 
ATOM   6679  O  OP1   . C   A 1  312  ? 182.863 167.918 164.858 1.00 51.37  ?  312  C   A OP1   1 
ATOM   6680  O  OP2   . C   A 1  312  ? 181.889 166.992 167.045 1.00 51.37  ?  312  C   A OP2   1 
ATOM   6681  O  "O5'" . C   A 1  312  ? 180.431 168.082 165.343 1.00 51.37  ?  312  C   A "O5'" 1 
ATOM   6682  C  "C5'" . C   A 1  312  ? 180.078 168.535 164.044 1.00 51.37  ?  312  C   A "C5'" 1 
ATOM   6683  C  "C4'" . C   A 1  312  ? 178.673 169.081 164.016 1.00 51.37  ?  312  C   A "C4'" 1 
ATOM   6684  O  "O4'" . C   A 1  312  ? 177.746 168.061 164.477 1.00 51.37  ?  312  C   A "O4'" 1 
ATOM   6685  C  "C3'" . C   A 1  312  ? 178.402 170.264 164.932 1.00 51.37  ?  312  C   A "C3'" 1 
ATOM   6686  O  "O3'" . C   A 1  312  ? 178.831 171.503 164.392 1.00 51.37  ?  312  C   A "O3'" 1 
ATOM   6687  C  "C2'" . C   A 1  312  ? 176.896 170.178 165.153 1.00 51.37  ?  312  C   A "C2'" 1 
ATOM   6688  O  "O2'" . C   A 1  312  ? 176.193 170.713 164.042 1.00 51.37  ?  312  C   A "O2'" 1 
ATOM   6689  C  "C1'" . C   A 1  312  ? 176.677 168.662 165.180 1.00 51.37  ?  312  C   A "C1'" 1 
ATOM   6690  N  N1    . C   A 1  312  ? 176.632 168.113 166.561 1.00 51.37  ?  312  C   A N1    1 
ATOM   6691  C  C2    . C   A 1  312  ? 175.437 168.196 167.290 1.00 51.37  ?  312  C   A C2    1 
ATOM   6692  O  O2    . C   A 1  312  ? 174.437 168.726 166.780 1.00 51.37  ?  312  C   A O2    1 
ATOM   6693  N  N3    . C   A 1  312  ? 175.391 167.696 168.546 1.00 51.37  ?  312  C   A N3    1 
ATOM   6694  C  C4    . C   A 1  312  ? 176.467 167.126 169.088 1.00 51.37  ?  312  C   A C4    1 
ATOM   6695  N  N4    . C   A 1  312  ? 176.366 166.648 170.331 1.00 51.37  ?  312  C   A N4    1 
ATOM   6696  C  C5    . C   A 1  312  ? 177.695 167.021 168.376 1.00 51.37  ?  312  C   A C5    1 
ATOM   6697  C  C6    . C   A 1  312  ? 177.727 167.517 167.134 1.00 51.37  ?  312  C   A C6    1 
ATOM   6698  P  P     . C   A 1  313  ? 179.417 172.642 165.363 1.00 46.66  ?  313  C   A P     1 
ATOM   6699  O  OP1   . C   A 1  313  ? 179.770 173.821 164.533 1.00 46.66  ?  313  C   A OP1   1 
ATOM   6700  O  OP2   . C   A 1  313  ? 180.448 172.019 166.232 1.00 46.66  ?  313  C   A OP2   1 
ATOM   6701  O  "O5'" . C   A 1  313  ? 178.175 173.038 166.278 1.00 46.66  ?  313  C   A "O5'" 1 
ATOM   6702  C  "C5'" . C   A 1  313  ? 178.354 173.450 167.625 1.00 46.66  ?  313  C   A "C5'" 1 
ATOM   6703  C  "C4'" . C   A 1  313  ? 177.193 173.020 168.486 1.00 46.66  ?  313  C   A "C4'" 1 
ATOM   6704  O  "O4'" . C   A 1  313  ? 177.212 171.578 168.651 1.00 46.66  ?  313  C   A "O4'" 1 
ATOM   6705  C  "C3'" . C   A 1  313  ? 177.182 173.552 169.910 1.00 46.66  ?  313  C   A "C3'" 1 
ATOM   6706  O  "O3'" . C   A 1  313  ? 176.693 174.879 169.998 1.00 46.66  ?  313  C   A "O3'" 1 
ATOM   6707  C  "C2'" . C   A 1  313  ? 176.318 172.531 170.642 1.00 46.66  ?  313  C   A "C2'" 1 
ATOM   6708  O  "O2'" . C   A 1  313  ? 174.940 172.787 170.420 1.00 46.66  ?  313  C   A "O2'" 1 
ATOM   6709  C  "C1'" . C   A 1  313  ? 176.691 171.232 169.918 1.00 46.66  ?  313  C   A "C1'" 1 
ATOM   6710  N  N1    . C   A 1  313  ? 177.694 170.426 170.659 1.00 46.66  ?  313  C   A N1    1 
ATOM   6711  C  C2    . C   A 1  313  ? 177.245 169.550 171.656 1.00 46.66  ?  313  C   A C2    1 
ATOM   6712  O  O2    . C   A 1  313  ? 176.031 169.472 171.897 1.00 46.66  ?  313  C   A O2    1 
ATOM   6713  N  N3    . C   A 1  313  ? 178.144 168.803 172.339 1.00 46.66  ?  313  C   A N3    1 
ATOM   6714  C  C4    . C   A 1  313  ? 179.445 168.900 172.064 1.00 46.66  ?  313  C   A C4    1 
ATOM   6715  N  N4    . C   A 1  313  ? 180.291 168.144 172.767 1.00 46.66  ?  313  C   A N4    1 
ATOM   6716  C  C5    . C   A 1  313  ? 179.934 169.778 171.056 1.00 46.66  ?  313  C   A C5    1 
ATOM   6717  C  C6    . C   A 1  313  ? 179.035 170.509 170.385 1.00 46.66  ?  313  C   A C6    1 
ATOM   6718  P  P     . C   A 1  314  ? 177.667 176.068 170.467 1.00 47.40  ?  314  C   A P     1 
ATOM   6719  O  OP1   . C   A 1  314  ? 177.088 177.350 169.990 1.00 47.40  ?  314  C   A OP1   1 
ATOM   6720  O  OP2   . C   A 1  314  ? 179.055 175.704 170.087 1.00 47.40  ?  314  C   A OP2   1 
ATOM   6721  O  "O5'" . C   A 1  314  ? 177.567 176.044 172.056 1.00 47.40  ?  314  C   A "O5'" 1 
ATOM   6722  C  "C5'" . C   A 1  314  ? 176.575 176.798 172.736 1.00 47.40  ?  314  C   A "C5'" 1 
ATOM   6723  C  "C4'" . C   A 1  314  ? 175.534 175.905 173.363 1.00 47.40  ?  314  C   A "C4'" 1 
ATOM   6724  O  "O4'" . C   A 1  314  ? 175.984 174.528 173.330 1.00 47.40  ?  314  C   A "O4'" 1 
ATOM   6725  C  "C3'" . C   A 1  314  ? 175.233 176.164 174.830 1.00 47.40  ?  314  C   A "C3'" 1 
ATOM   6726  O  "O3'" . C   A 1  314  ? 174.329 177.239 175.018 1.00 47.40  ?  314  C   A "O3'" 1 
ATOM   6727  C  "C2'" . C   A 1  314  ? 174.691 174.821 175.310 1.00 47.40  ?  314  C   A "C2'" 1 
ATOM   6728  O  "O2'" . C   A 1  314  ? 173.317 174.687 174.979 1.00 47.40  ?  314  C   A "O2'" 1 
ATOM   6729  C  "C1'" . C   A 1  314  ? 175.496 173.833 174.456 1.00 47.40  ?  314  C   A "C1'" 1 
ATOM   6730  N  N1    . C   A 1  314  ? 176.637 173.227 175.184 1.00 47.40  ?  314  C   A N1    1 
ATOM   6731  C  C2    . C   A 1  314  ? 176.410 172.081 175.955 1.00 47.40  ?  314  C   A C2    1 
ATOM   6732  O  O2    . C   A 1  314  ? 175.265 171.609 176.021 1.00 47.40  ?  314  C   A O2    1 
ATOM   6733  N  N3    . C   A 1  314  ? 177.443 171.511 176.615 1.00 47.40  ?  314  C   A N3    1 
ATOM   6734  C  C4    . C   A 1  314  ? 178.666 172.035 176.532 1.00 47.40  ?  314  C   A C4    1 
ATOM   6735  N  N4    . C   A 1  314  ? 179.650 171.436 177.206 1.00 47.40  ?  314  C   A N4    1 
ATOM   6736  C  C5    . C   A 1  314  ? 178.932 173.197 175.753 1.00 47.40  ?  314  C   A C5    1 
ATOM   6737  C  C6    . C   A 1  314  ? 177.901 173.749 175.101 1.00 47.40  ?  314  C   A C6    1 
ATOM   6738  P  P     . A   A 1  315  ? 174.643 178.389 176.095 1.00 53.43  ?  315  A   A P     1 
ATOM   6739  O  OP1   . A   A 1  315  ? 174.825 179.667 175.360 1.00 53.43  ?  315  A   A OP1   1 
ATOM   6740  O  OP2   . A   A 1  315  ? 175.719 177.900 176.995 1.00 53.43  ?  315  A   A OP2   1 
ATOM   6741  O  "O5'" . A   A 1  315  ? 173.299 178.494 176.941 1.00 53.43  ?  315  A   A "O5'" 1 
ATOM   6742  C  "C5'" . A   A 1  315  ? 172.766 177.351 177.602 1.00 53.43  ?  315  A   A "C5'" 1 
ATOM   6743  C  "C4'" . A   A 1  315  ? 171.312 177.133 177.261 1.00 53.43  ?  315  A   A "C4'" 1 
ATOM   6744  O  "O4'" . A   A 1  315  ? 170.921 175.800 177.690 1.00 53.43  ?  315  A   A "O4'" 1 
ATOM   6745  C  "C3'" . A   A 1  315  ? 170.335 178.099 177.928 1.00 53.43  ?  315  A   A "C3'" 1 
ATOM   6746  O  "O3'" . A   A 1  315  ? 169.227 178.334 177.058 1.00 53.43  ?  315  A   A "O3'" 1 
ATOM   6747  C  "C2'" . A   A 1  315  ? 169.866 177.310 179.146 1.00 53.43  ?  315  A   A "C2'" 1 
ATOM   6748  O  "O2'" . A   A 1  315  ? 168.607 177.703 179.652 1.00 53.43  ?  315  A   A "O2'" 1 
ATOM   6749  C  "C1'" . A   A 1  315  ? 169.837 175.887 178.595 1.00 53.43  ?  315  A   A "C1'" 1 
ATOM   6750  N  N9    . A   A 1  315  ? 170.010 174.852 179.617 1.00 53.43  ?  315  A   A N9    1 
ATOM   6751  C  C8    . A   A 1  315  ? 170.910 174.844 180.655 1.00 53.43  ?  315  A   A C8    1 
ATOM   6752  N  N7    . A   A 1  315  ? 170.828 173.780 181.416 1.00 53.43  ?  315  A   A N7    1 
ATOM   6753  C  C5    . A   A 1  315  ? 169.809 173.036 180.840 1.00 53.43  ?  315  A   A C5    1 
ATOM   6754  C  C6    . A   A 1  315  ? 169.229 171.798 181.172 1.00 53.43  ?  315  A   A C6    1 
ATOM   6755  N  N6    . A   A 1  315  ? 169.618 171.054 182.210 1.00 53.43  ?  315  A   A N6    1 
ATOM   6756  N  N1    . A   A 1  315  ? 168.227 171.338 180.386 1.00 53.43  ?  315  A   A N1    1 
ATOM   6757  C  C2    . A   A 1  315  ? 167.831 172.076 179.339 1.00 53.43  ?  315  A   A C2    1 
ATOM   6758  N  N3    . A   A 1  315  ? 168.298 173.256 178.931 1.00 53.43  ?  315  A   A N3    1 
ATOM   6759  C  C4    . A   A 1  315  ? 169.294 173.684 179.730 1.00 53.43  ?  315  A   A C4    1 
ATOM   6760  P  P     . A   A 1  316  ? 169.038 179.769 176.361 1.00 62.61  ?  316  A   A P     1 
ATOM   6761  O  OP1   . A   A 1  316  ? 168.054 179.621 175.259 1.00 62.61  ?  316  A   A OP1   1 
ATOM   6762  O  OP2   . A   A 1  316  ? 170.386 180.324 176.078 1.00 62.61  ?  316  A   A OP2   1 
ATOM   6763  O  "O5'" . A   A 1  316  ? 168.368 180.664 177.494 1.00 62.61  ?  316  A   A "O5'" 1 
ATOM   6764  C  "C5'" . A   A 1  316  ? 168.675 182.050 177.606 1.00 62.61  ?  316  A   A "C5'" 1 
ATOM   6765  C  "C4'" . A   A 1  316  ? 168.471 182.546 179.016 1.00 62.61  ?  316  A   A "C4'" 1 
ATOM   6766  O  "O4'" . A   A 1  316  ? 168.957 181.540 179.945 1.00 62.61  ?  316  A   A "O4'" 1 
ATOM   6767  C  "C3'" . A   A 1  316  ? 169.205 183.838 179.364 1.00 62.61  ?  316  A   A "C3'" 1 
ATOM   6768  O  "O3'" . A   A 1  316  ? 168.435 184.578 180.311 1.00 62.61  ?  316  A   A "O3'" 1 
ATOM   6769  C  "C2'" . A   A 1  316  ? 170.479 183.327 180.029 1.00 62.61  ?  316  A   A "C2'" 1 
ATOM   6770  O  "O2'" . A   A 1  316  ? 171.092 184.246 180.908 1.00 62.61  ?  316  A   A "O2'" 1 
ATOM   6771  C  "C1'" . A   A 1  316  ? 169.966 182.093 180.768 1.00 62.61  ?  316  A   A "C1'" 1 
ATOM   6772  N  N9    . A   A 1  316  ? 170.984 181.061 180.981 1.00 62.61  ?  316  A   A N9    1 
ATOM   6773  C  C8    . A   A 1  316  ? 172.254 181.007 180.460 1.00 62.61  ?  316  A   A C8    1 
ATOM   6774  N  N7    . A   A 1  316  ? 172.934 179.950 180.834 1.00 62.61  ?  316  A   A N7    1 
ATOM   6775  C  C5    . A   A 1  316  ? 172.051 179.262 181.654 1.00 62.61  ?  316  A   A C5    1 
ATOM   6776  C  C6    . A   A 1  316  ? 172.157 178.056 182.372 1.00 62.61  ?  316  A   A C6    1 
ATOM   6777  N  N6    . A   A 1  316  ? 173.253 177.294 182.377 1.00 62.61  ?  316  A   A N6    1 
ATOM   6778  N  N1    . A   A 1  316  ? 171.087 177.652 183.094 1.00 62.61  ?  316  A   A N1    1 
ATOM   6779  C  C2    . A   A 1  316  ? 169.981 178.410 183.096 1.00 62.61  ?  316  A   A C2    1 
ATOM   6780  N  N3    . A   A 1  316  ? 169.763 179.560 182.462 1.00 62.61  ?  316  A   A N3    1 
ATOM   6781  C  C4    . A   A 1  316  ? 170.845 179.934 181.753 1.00 62.61  ?  316  A   A C4    1 
ATOM   6782  P  P     . U   A 1  317  ? 167.223 185.511 179.818 1.00 70.00  ?  317  U   A P     1 
ATOM   6783  O  OP1   . U   A 1  317  ? 167.341 185.685 178.348 1.00 70.00  ?  317  U   A OP1   1 
ATOM   6784  O  OP2   . U   A 1  317  ? 167.181 186.709 180.696 1.00 70.00  ?  317  U   A OP2   1 
ATOM   6785  O  "O5'" . U   A 1  317  ? 165.923 184.640 180.114 1.00 70.00  ?  317  U   A "O5'" 1 
ATOM   6786  C  "C5'" . U   A 1  317  ? 165.820 183.874 181.305 1.00 70.00  ?  317  U   A "C5'" 1 
ATOM   6787  C  "C4'" . U   A 1  317  ? 164.424 183.343 181.513 1.00 70.00  ?  317  U   A "C4'" 1 
ATOM   6788  O  "O4'" . U   A 1  317  ? 163.478 184.445 181.555 1.00 70.00  ?  317  U   A "O4'" 1 
ATOM   6789  C  "C3'" . U   A 1  317  ? 163.873 182.436 180.423 1.00 70.00  ?  317  U   A "C3'" 1 
ATOM   6790  O  "O3'" . U   A 1  317  ? 164.354 181.105 180.488 1.00 70.00  ?  317  U   A "O3'" 1 
ATOM   6791  C  "C2'" . U   A 1  317  ? 162.370 182.555 180.632 1.00 70.00  ?  317  U   A "C2'" 1 
ATOM   6792  O  "O2'" . U   A 1  317  ? 161.950 181.756 181.728 1.00 70.00  ?  317  U   A "O2'" 1 
ATOM   6793  C  "C1'" . U   A 1  317  ? 162.234 184.028 181.028 1.00 70.00  ?  317  U   A "C1'" 1 
ATOM   6794  N  N1    . U   A 1  317  ? 161.878 184.886 179.870 1.00 70.00  ?  317  U   A N1    1 
ATOM   6795  C  C2    . U   A 1  317  ? 160.542 184.940 179.504 1.00 70.00  ?  317  U   A C2    1 
ATOM   6796  O  O2    . U   A 1  317  ? 159.655 184.334 180.081 1.00 70.00  ?  317  U   A O2    1 
ATOM   6797  N  N3    . U   A 1  317  ? 160.271 185.743 178.426 1.00 70.00  ?  317  U   A N3    1 
ATOM   6798  C  C4    . U   A 1  317  ? 161.172 186.480 177.688 1.00 70.00  ?  317  U   A C4    1 
ATOM   6799  O  O4    . U   A 1  317  ? 160.767 187.152 176.743 1.00 70.00  ?  317  U   A O4    1 
ATOM   6800  C  C5    . U   A 1  317  ? 162.529 186.375 178.121 1.00 70.00  ?  317  U   A C5    1 
ATOM   6801  C  C6    . U   A 1  317  ? 162.824 185.604 179.170 1.00 70.00  ?  317  U   A C6    1 
ATOM   6802  P  P     . U   A 1  318  ? 164.488 180.235 179.141 1.00 58.43  ?  318  U   A P     1 
ATOM   6803  O  OP1   . U   A 1  318  ? 165.240 178.996 179.464 1.00 58.43  ?  318  U   A OP1   1 
ATOM   6804  O  OP2   . U   A 1  318  ? 164.982 181.132 178.065 1.00 58.43  ?  318  U   A OP2   1 
ATOM   6805  O  "O5'" . U   A 1  318  ? 162.989 179.823 178.788 1.00 58.43  ?  318  U   A "O5'" 1 
ATOM   6806  C  "C5'" . U   A 1  318  ? 162.258 178.947 179.633 1.00 58.43  ?  318  U   A "C5'" 1 
ATOM   6807  C  "C4'" . U   A 1  318  ? 160.786 178.943 179.303 1.00 58.43  ?  318  U   A "C4'" 1 
ATOM   6808  O  "O4'" . U   A 1  318  ? 160.265 180.296 179.359 1.00 58.43  ?  318  U   A "O4'" 1 
ATOM   6809  C  "C3'" . U   A 1  318  ? 160.411 178.461 177.911 1.00 58.43  ?  318  U   A "C3'" 1 
ATOM   6810  O  "O3'" . U   A 1  318  ? 160.385 177.048 177.804 1.00 58.43  ?  318  U   A "O3'" 1 
ATOM   6811  C  "C2'" . U   A 1  318  ? 159.053 179.115 177.685 1.00 58.43  ?  318  U   A "C2'" 1 
ATOM   6812  O  "O2'" . U   A 1  318  ? 158.028 178.382 178.339 1.00 58.43  ?  318  U   A "O2'" 1 
ATOM   6813  C  "C1'" . U   A 1  318  ? 159.229 180.453 178.411 1.00 58.43  ?  318  U   A "C1'" 1 
ATOM   6814  N  N1    . U   A 1  318  ? 159.575 181.565 177.491 1.00 58.43  ?  318  U   A N1    1 
ATOM   6815  C  C2    . U   A 1  318  ? 158.534 182.198 176.833 1.00 58.43  ?  318  U   A C2    1 
ATOM   6816  O  O2    . U   A 1  318  ? 157.364 181.882 176.971 1.00 58.43  ?  318  U   A O2    1 
ATOM   6817  N  N3    . U   A 1  318  ? 158.908 183.222 175.997 1.00 58.43  ?  318  U   A N3    1 
ATOM   6818  C  C4    . U   A 1  318  ? 160.188 183.675 175.756 1.00 58.43  ?  318  U   A C4    1 
ATOM   6819  O  O4    . U   A 1  318  ? 160.363 184.610 174.973 1.00 58.43  ?  318  U   A O4    1 
ATOM   6820  C  C5    . U   A 1  318  ? 161.210 182.976 176.472 1.00 58.43  ?  318  U   A C5    1 
ATOM   6821  C  C6    . U   A 1  318  ? 160.875 181.976 177.294 1.00 58.43  ?  318  U   A C6    1 
ATOM   6822  P  P     . C   A 1  319  ? 160.741 176.334 176.409 1.00 56.14  ?  319  C   A P     1 
ATOM   6823  O  OP1   . C   A 1  319  ? 160.990 174.895 176.679 1.00 56.14  ?  319  C   A OP1   1 
ATOM   6824  O  OP2   . C   A 1  319  ? 161.784 177.144 175.730 1.00 56.14  ?  319  C   A OP2   1 
ATOM   6825  O  "O5'" . C   A 1  319  ? 159.397 176.450 175.560 1.00 56.14  ?  319  C   A "O5'" 1 
ATOM   6826  C  "C5'" . C   A 1  319  ? 158.196 175.841 176.011 1.00 56.14  ?  319  C   A "C5'" 1 
ATOM   6827  C  "C4'" . C   A 1  319  ? 156.995 176.366 175.264 1.00 56.14  ?  319  C   A "C4'" 1 
ATOM   6828  O  "O4'" . C   A 1  319  ? 156.897 177.803 175.442 1.00 56.14  ?  319  C   A "O4'" 1 
ATOM   6829  C  "C3'" . C   A 1  319  ? 157.017 176.184 173.755 1.00 56.14  ?  319  C   A "C3'" 1 
ATOM   6830  O  "O3'" . C   A 1  319  ? 156.635 174.882 173.347 1.00 56.14  ?  319  C   A "O3'" 1 
ATOM   6831  C  "C2'" . C   A 1  319  ? 156.074 177.280 173.271 1.00 56.14  ?  319  C   A "C2'" 1 
ATOM   6832  O  "O2'" . C   A 1  319  ? 154.721 176.876 173.412 1.00 56.14  ?  319  C   A "O2'" 1 
ATOM   6833  C  "C1'" . C   A 1  319  ? 156.354 178.397 174.281 1.00 56.14  ?  319  C   A "C1'" 1 
ATOM   6834  N  N1    . C   A 1  319  ? 157.301 179.418 173.765 1.00 56.14  ?  319  C   A N1    1 
ATOM   6835  C  C2    . C   A 1  319  ? 156.801 180.461 172.974 1.00 56.14  ?  319  C   A C2    1 
ATOM   6836  O  O2    . C   A 1  319  ? 155.588 180.508 172.719 1.00 56.14  ?  319  C   A O2    1 
ATOM   6837  N  N3    . C   A 1  319  ? 157.652 181.401 172.499 1.00 56.14  ?  319  C   A N3    1 
ATOM   6838  C  C4    . C   A 1  319  ? 158.953 181.337 172.784 1.00 56.14  ?  319  C   A C4    1 
ATOM   6839  N  N4    . C   A 1  319  ? 159.751 182.287 172.292 1.00 56.14  ?  319  C   A N4    1 
ATOM   6840  C  C5    . C   A 1  319  ? 159.493 180.293 173.587 1.00 56.14  ?  319  C   A C5    1 
ATOM   6841  C  C6    . C   A 1  319  ? 158.640 179.372 174.051 1.00 56.14  ?  319  C   A C6    1 
ATOM   6842  P  P     . A   A 1  320  ? 157.311 174.211 172.053 1.00 58.06  ?  320  A   A P     1 
ATOM   6843  O  OP1   . A   A 1  320  ? 157.062 172.748 172.111 1.00 58.06  ?  320  A   A OP1   1 
ATOM   6844  O  OP2   . A   A 1  320  ? 158.703 174.716 171.948 1.00 58.06  ?  320  A   A OP2   1 
ATOM   6845  O  "O5'" . A   A 1  320  ? 156.478 174.804 170.831 1.00 58.06  ?  320  A   A "O5'" 1 
ATOM   6846  C  "C5'" . A   A 1  320  ? 155.104 174.484 170.664 1.00 58.06  ?  320  A   A "C5'" 1 
ATOM   6847  C  "C4'" . A   A 1  320  ? 154.463 175.328 169.591 1.00 58.06  ?  320  A   A "C4'" 1 
ATOM   6848  O  "O4'" . A   A 1  320  ? 154.473 176.724 169.991 1.00 58.06  ?  320  A   A "O4'" 1 
ATOM   6849  C  "C3'" . A   A 1  320  ? 155.155 175.330 168.237 1.00 58.06  ?  320  A   A "C3'" 1 
ATOM   6850  O  "O3'" . A   A 1  320  ? 154.847 174.191 167.453 1.00 58.06  ?  320  A   A "O3'" 1 
ATOM   6851  C  "C2'" . A   A 1  320  ? 154.679 176.640 167.626 1.00 58.06  ?  320  A   A "C2'" 1 
ATOM   6852  O  "O2'" . A   A 1  320  ? 153.355 176.510 167.130 1.00 58.06  ?  320  A   A "O2'" 1 
ATOM   6853  C  "C1'" . A   A 1  320  ? 154.645 177.548 168.856 1.00 58.06  ?  320  A   A "C1'" 1 
ATOM   6854  N  N9    . A   A 1  320  ? 155.900 178.306 169.012 1.00 58.06  ?  320  A   A N9    1 
ATOM   6855  C  C8    . A   A 1  320  ? 156.931 178.061 169.885 1.00 58.06  ?  320  A   A C8    1 
ATOM   6856  N  N7    . A   A 1  320  ? 157.922 178.913 169.788 1.00 58.06  ?  320  A   A N7    1 
ATOM   6857  C  C5    . A   A 1  320  ? 157.516 179.776 168.780 1.00 58.06  ?  320  A   A C5    1 
ATOM   6858  C  C6    . A   A 1  320  ? 158.118 180.904 168.192 1.00 58.06  ?  320  A   A C6    1 
ATOM   6859  N  N6    . A   A 1  320  ? 159.312 181.377 168.554 1.00 58.06  ?  320  A   A N6    1 
ATOM   6860  N  N1    . A   A 1  320  ? 157.443 181.541 167.207 1.00 58.06  ?  320  A   A N1    1 
ATOM   6861  C  C2    . A   A 1  320  ? 156.242 181.075 166.836 1.00 58.06  ?  320  A   A C2    1 
ATOM   6862  N  N3    . A   A 1  320  ? 155.576 180.026 167.314 1.00 58.06  ?  320  A   A N3    1 
ATOM   6863  C  C4    . A   A 1  320  ? 156.273 179.415 168.291 1.00 58.06  ?  320  A   A C4    1 
ATOM   6864  P  P     . G   A 1  321  ? 155.988 173.494 166.561 1.00 62.02  ?  321  G   A P     1 
ATOM   6865  O  OP1   . G   A 1  321  ? 155.426 172.242 165.993 1.00 62.02  ?  321  G   A OP1   1 
ATOM   6866  O  OP2   . G   A 1  321  ? 157.233 173.440 167.368 1.00 62.02  ?  321  G   A OP2   1 
ATOM   6867  O  "O5'" . G   A 1  321  ? 156.222 174.517 165.362 1.00 62.02  ?  321  G   A "O5'" 1 
ATOM   6868  C  "C5'" . G   A 1  321  ? 155.206 174.753 164.398 1.00 62.02  ?  321  G   A "C5'" 1 
ATOM   6869  C  "C4'" . G   A 1  321  ? 155.554 175.910 163.494 1.00 62.02  ?  321  G   A "C4'" 1 
ATOM   6870  O  "O4'" . G   A 1  321  ? 155.677 177.128 164.274 1.00 62.02  ?  321  G   A "O4'" 1 
ATOM   6871  C  "C3'" . G   A 1  321  ? 156.881 175.810 162.759 1.00 62.02  ?  321  G   A "C3'" 1 
ATOM   6872  O  "O3'" . G   A 1  321  ? 156.818 174.990 161.605 1.00 62.02  ?  321  G   A "O3'" 1 
ATOM   6873  C  "C2'" . G   A 1  321  ? 157.200 177.268 162.456 1.00 62.02  ?  321  G   A "C2'" 1 
ATOM   6874  O  "O2'" . G   A 1  321  ? 156.441 177.728 161.348 1.00 62.02  ?  321  G   A "O2'" 1 
ATOM   6875  C  "C1'" . G   A 1  321  ? 156.677 177.956 163.718 1.00 62.02  ?  321  G   A "C1'" 1 
ATOM   6876  N  N9    . G   A 1  321  ? 157.743 178.147 164.720 1.00 62.02  ?  321  G   A N9    1 
ATOM   6877  C  C8    . G   A 1  321  ? 157.947 177.418 165.866 1.00 62.02  ?  321  G   A C8    1 
ATOM   6878  N  N7    . G   A 1  321  ? 158.979 177.824 166.555 1.00 62.02  ?  321  G   A N7    1 
ATOM   6879  C  C5    . G   A 1  321  ? 159.488 178.885 165.818 1.00 62.02  ?  321  G   A C5    1 
ATOM   6880  C  C6    . G   A 1  321  ? 160.606 179.724 166.064 1.00 62.02  ?  321  G   A C6    1 
ATOM   6881  O  O6    . G   A 1  321  ? 161.396 179.697 167.016 1.00 62.02  ?  321  G   A O6    1 
ATOM   6882  N  N1    . G   A 1  321  ? 160.764 180.674 165.060 1.00 62.02  ?  321  G   A N1    1 
ATOM   6883  C  C2    . G   A 1  321  ? 159.954 180.803 163.960 1.00 62.02  ?  321  G   A C2    1 
ATOM   6884  N  N2    . G   A 1  321  ? 160.271 181.783 163.101 1.00 62.02  ?  321  G   A N2    1 
ATOM   6885  N  N3    . G   A 1  321  ? 158.909 180.027 163.718 1.00 62.02  ?  321  G   A N3    1 
ATOM   6886  C  C4    . G   A 1  321  ? 158.736 179.097 164.682 1.00 62.02  ?  321  G   A C4    1 
ATOM   6887  P  P     . A   A 1  322  ? 158.133 174.224 161.088 1.00 60.26  ?  322  A   A P     1 
ATOM   6888  O  OP1   . A   A 1  322  ? 157.702 173.150 160.157 1.00 60.26  ?  322  A   A OP1   1 
ATOM   6889  O  OP2   . A   A 1  322  ? 158.961 173.880 162.272 1.00 60.26  ?  322  A   A OP2   1 
ATOM   6890  O  "O5'" . A   A 1  322  ? 158.914 175.325 160.242 1.00 60.26  ?  322  A   A "O5'" 1 
ATOM   6891  C  "C5'" . A   A 1  322  ? 158.325 175.911 159.091 1.00 60.26  ?  322  A   A "C5'" 1 
ATOM   6892  C  "C4'" . A   A 1  322  ? 159.068 177.148 158.653 1.00 60.26  ?  322  A   A "C4'" 1 
ATOM   6893  O  "O4'" . A   A 1  322  ? 159.083 178.121 159.730 1.00 60.26  ?  322  A   A "O4'" 1 
ATOM   6894  C  "C3'" . A   A 1  322  ? 160.537 176.960 158.307 1.00 60.26  ?  322  A   A "C3'" 1 
ATOM   6895  O  "O3'" . A   A 1  322  ? 160.736 176.447 157.002 1.00 60.26  ?  322  A   A "O3'" 1 
ATOM   6896  C  "C2'" . A   A 1  322  ? 161.106 178.359 158.507 1.00 60.26  ?  322  A   A "C2'" 1 
ATOM   6897  O  "O2'" . A   A 1  322  ? 160.798 179.188 157.396 1.00 60.26  ?  322  A   A "O2'" 1 
ATOM   6898  C  "C1'" . A   A 1  322  ? 160.297 178.844 159.710 1.00 60.26  ?  322  A   A "C1'" 1 
ATOM   6899  N  N9    . A   A 1  322  ? 161.005 178.609 160.982 1.00 60.26  ?  322  A   A N9    1 
ATOM   6900  C  C8    . A   A 1  322  ? 160.770 177.625 161.911 1.00 60.26  ?  322  A   A C8    1 
ATOM   6901  N  N7    . A   A 1  322  ? 161.571 177.674 162.948 1.00 60.26  ?  322  A   A N7    1 
ATOM   6902  C  C5    . A   A 1  322  ? 162.389 178.763 162.683 1.00 60.26  ?  322  A   A C5    1 
ATOM   6903  C  C6    . A   A 1  322  ? 163.453 179.352 163.392 1.00 60.26  ?  322  A   A C6    1 
ATOM   6904  N  N6    . A   A 1  322  ? 163.894 178.903 164.569 1.00 60.26  ?  322  A   A N6    1 
ATOM   6905  N  N1    . A   A 1  322  ? 164.057 180.433 162.845 1.00 60.26  ?  322  A   A N1    1 
ATOM   6906  C  C2    . A   A 1  322  ? 163.622 180.892 161.664 1.00 60.26  ?  322  A   A C2    1 
ATOM   6907  N  N3    . A   A 1  322  ? 162.633 180.422 160.905 1.00 60.26  ?  322  A   A N3    1 
ATOM   6908  C  C4    . A   A 1  322  ? 162.053 179.349 161.475 1.00 60.26  ?  322  A   A C4    1 
ATOM   6909  P  P     . C   A 1  323  ? 161.820 175.288 156.744 1.00 63.05  ?  323  C   A P     1 
ATOM   6910  O  OP1   . C   A 1  323  ? 161.643 174.794 155.355 1.00 63.05  ?  323  C   A OP1   1 
ATOM   6911  O  OP2   . C   A 1  323  ? 161.749 174.332 157.878 1.00 63.05  ?  323  C   A OP2   1 
ATOM   6912  O  "O5'" . C   A 1  323  ? 163.220 176.044 156.823 1.00 63.05  ?  323  C   A "O5'" 1 
ATOM   6913  C  "C5'" . C   A 1  323  ? 163.541 177.084 155.910 1.00 63.05  ?  323  C   A "C5'" 1 
ATOM   6914  C  "C4'" . C   A 1  323  ? 164.719 177.895 156.388 1.00 63.05  ?  323  C   A "C4'" 1 
ATOM   6915  O  "O4'" . C   A 1  323  ? 164.422 178.471 157.686 1.00 63.05  ?  323  C   A "O4'" 1 
ATOM   6916  C  "C3'" . C   A 1  323  ? 166.011 177.124 156.613 1.00 63.05  ?  323  C   A "C3'" 1 
ATOM   6917  O  "O3'" . C   A 1  323  ? 166.732 176.899 155.414 1.00 63.05  ?  323  C   A "O3'" 1 
ATOM   6918  C  "C2'" . C   A 1  323  ? 166.754 177.997 157.618 1.00 63.05  ?  323  C   A "C2'" 1 
ATOM   6919  O  "O2'" . C   A 1  323  ? 167.398 179.080 156.963 1.00 63.05  ?  323  C   A "O2'" 1 
ATOM   6920  C  "C1'" . C   A 1  323  ? 165.601 178.556 158.458 1.00 63.05  ?  323  C   A "C1'" 1 
ATOM   6921  N  N1    . C   A 1  323  ? 165.403 177.822 159.733 1.00 63.05  ?  323  C   A N1    1 
ATOM   6922  C  C2    . C   A 1  323  ? 166.186 178.170 160.842 1.00 63.05  ?  323  C   A C2    1 
ATOM   6923  O  O2    . C   A 1  323  ? 167.028 179.075 160.737 1.00 63.05  ?  323  C   A O2    1 
ATOM   6924  N  N3    . C   A 1  323  ? 166.011 177.511 162.012 1.00 63.05  ?  323  C   A N3    1 
ATOM   6925  C  C4    . C   A 1  323  ? 165.100 176.542 162.107 1.00 63.05  ?  323  C   A C4    1 
ATOM   6926  N  N4    . C   A 1  323  ? 164.966 175.922 163.282 1.00 63.05  ?  323  C   A N4    1 
ATOM   6927  C  C5    . C   A 1  323  ? 164.286 176.166 161.001 1.00 63.05  ?  323  C   A C5    1 
ATOM   6928  C  C6    . C   A 1  323  ? 164.467 176.828 159.852 1.00 63.05  ?  323  C   A C6    1 
ATOM   6929  P  P     . U   A 1  324  ? 167.433 175.478 155.144 1.00 65.58  ?  324  U   A P     1 
ATOM   6930  O  OP1   . U   A 1  324  ? 167.800 175.410 153.707 1.00 65.58  ?  324  U   A OP1   1 
ATOM   6931  O  OP2   . U   A 1  324  ? 166.570 174.421 155.732 1.00 65.58  ?  324  U   A OP2   1 
ATOM   6932  O  "O5'" . U   A 1  324  ? 168.779 175.542 155.994 1.00 65.58  ?  324  U   A "O5'" 1 
ATOM   6933  C  "C5'" . U   A 1  324  ? 169.761 176.535 155.735 1.00 65.58  ?  324  U   A "C5'" 1 
ATOM   6934  C  "C4'" . U   A 1  324  ? 170.754 176.630 156.865 1.00 65.58  ?  324  U   A "C4'" 1 
ATOM   6935  O  "O4'" . U   A 1  324  ? 170.066 177.013 158.083 1.00 65.58  ?  324  U   A "O4'" 1 
ATOM   6936  C  "C3'" . U   A 1  324  ? 171.466 175.336 157.229 1.00 65.58  ?  324  U   A "C3'" 1 
ATOM   6937  O  "O3'" . U   A 1  324  ? 172.573 175.062 156.388 1.00 65.58  ?  324  U   A "O3'" 1 
ATOM   6938  C  "C2'" . U   A 1  324  ? 171.847 175.555 158.689 1.00 65.58  ?  324  U   A "C2'" 1 
ATOM   6939  O  "O2'" . U   A 1  324  ? 173.033 176.327 158.792 1.00 65.58  ?  324  U   A "O2'" 1 
ATOM   6940  C  "C1'" . U   A 1  324  ? 170.671 176.395 159.198 1.00 65.58  ?  324  U   A "C1'" 1 
ATOM   6941  N  N1    . U   A 1  324  ? 169.655 175.585 159.913 1.00 65.58  ?  324  U   A N1    1 
ATOM   6942  C  C2    . U   A 1  324  ? 169.879 175.320 161.251 1.00 65.58  ?  324  U   A C2    1 
ATOM   6943  O  O2    . U   A 1  324  ? 170.862 175.711 161.858 1.00 65.58  ?  324  U   A O2    1 
ATOM   6944  N  N3    . U   A 1  324  ? 168.905 174.572 161.861 1.00 65.58  ?  324  U   A N3    1 
ATOM   6945  C  C4    . U   A 1  324  ? 167.753 174.070 161.295 1.00 65.58  ?  324  U   A C4    1 
ATOM   6946  O  O4    . U   A 1  324  ? 166.975 173.411 161.987 1.00 65.58  ?  324  U   A O4    1 
ATOM   6947  C  C5    . U   A 1  324  ? 167.588 174.388 159.912 1.00 65.58  ?  324  U   A C5    1 
ATOM   6948  C  C6    . U   A 1  324  ? 168.518 175.118 159.288 1.00 65.58  ?  324  U   A C6    1 
ATOM   6949  P  P     . A   A 1  325  ? 173.037 173.546 156.126 1.00 63.03  ?  325  A   A P     1 
ATOM   6950  O  OP1   . A   A 1  325  ? 173.928 173.539 154.938 1.00 63.03  ?  325  A   A OP1   1 
ATOM   6951  O  OP2   . A   A 1  325  ? 171.827 172.685 156.143 1.00 63.03  ?  325  A   A OP2   1 
ATOM   6952  O  "O5'" . A   A 1  325  ? 173.918 173.185 157.403 1.00 63.03  ?  325  A   A "O5'" 1 
ATOM   6953  C  "C5'" . A   A 1  325  ? 175.104 173.909 157.700 1.00 63.03  ?  325  A   A "C5'" 1 
ATOM   6954  C  "C4'" . A   A 1  325  ? 175.647 173.545 159.059 1.00 63.03  ?  325  A   A "C4'" 1 
ATOM   6955  O  "O4'" . A   A 1  325  ? 174.696 173.927 160.087 1.00 63.03  ?  325  A   A "O4'" 1 
ATOM   6956  C  "C3'" . A   A 1  325  ? 175.880 172.063 159.305 1.00 63.03  ?  325  A   A "C3'" 1 
ATOM   6957  O  "O3'" . A   A 1  325  ? 177.100 171.594 158.756 1.00 63.03  ?  325  A   A "O3'" 1 
ATOM   6958  C  "C2'" . A   A 1  325  ? 175.812 171.964 160.823 1.00 63.03  ?  325  A   A "C2'" 1 
ATOM   6959  O  "O2'" . A   A 1  325  ? 177.026 172.408 161.410 1.00 63.03  ?  325  A   A "O2'" 1 
ATOM   6960  C  "C1'" . A   A 1  325  ? 174.720 172.986 161.140 1.00 63.03  ?  325  A   A "C1'" 1 
ATOM   6961  N  N9    . A   A 1  325  ? 173.389 172.358 161.238 1.00 63.03  ?  325  A   A N9    1 
ATOM   6962  C  C8    . A   A 1  325  ? 172.382 172.373 160.304 1.00 63.03  ?  325  A   A C8    1 
ATOM   6963  N  N7    . A   A 1  325  ? 171.305 171.725 160.674 1.00 63.03  ?  325  A   A N7    1 
ATOM   6964  C  C5    . A   A 1  325  ? 171.624 171.250 161.938 1.00 63.03  ?  325  A   A C5    1 
ATOM   6965  C  C6    . A   A 1  325  ? 170.909 170.483 162.877 1.00 63.03  ?  325  A   A C6    1 
ATOM   6966  N  N6    . A   A 1  325  ? 169.666 170.040 162.674 1.00 63.03  ?  325  A   A N6    1 
ATOM   6967  N  N1    . A   A 1  325  ? 171.520 170.181 164.046 1.00 63.03  ?  325  A   A N1    1 
ATOM   6968  C  C2    . A   A 1  325  ? 172.768 170.621 164.259 1.00 63.03  ?  325  A   A C2    1 
ATOM   6969  N  N3    . A   A 1  325  ? 173.540 171.349 163.453 1.00 63.03  ?  325  A   A N3    1 
ATOM   6970  C  C4    . A   A 1  325  ? 172.905 171.632 162.300 1.00 63.03  ?  325  A   A C4    1 
ATOM   6971  P  P     . C   A 1  326  ? 177.140 170.193 157.972 1.00 59.45  ?  326  C   A P     1 
ATOM   6972  O  OP1   . C   A 1  326  ? 178.561 169.848 157.715 1.00 59.45  ?  326  C   A OP1   1 
ATOM   6973  O  OP2   . C   A 1  326  ? 176.187 170.273 156.835 1.00 59.45  ?  326  C   A OP2   1 
ATOM   6974  O  "O5'" . C   A 1  326  ? 176.562 169.150 159.028 1.00 59.45  ?  326  C   A "O5'" 1 
ATOM   6975  C  "C5'" . C   A 1  326  ? 176.175 167.844 158.630 1.00 59.45  ?  326  C   A "C5'" 1 
ATOM   6976  C  "C4'" . C   A 1  326  ? 176.019 166.933 159.820 1.00 59.45  ?  326  C   A "C4'" 1 
ATOM   6977  O  "O4'" . C   A 1  326  ? 175.134 167.556 160.792 1.00 59.45  ?  326  C   A "O4'" 1 
ATOM   6978  C  "C3'" . C   A 1  326  ? 175.363 165.588 159.547 1.00 59.45  ?  326  C   A "C3'" 1 
ATOM   6979  O  "O3'" . C   A 1  326  ? 176.149 164.623 158.828 1.00 59.45  ?  326  C   A "O3'" 1 
ATOM   6980  C  "C2'" . C   A 1  326  ? 174.792 165.200 160.917 1.00 59.45  ?  326  C   A "C2'" 1 
ATOM   6981  O  "O2'" . C   A 1  326  ? 175.775 164.702 161.812 1.00 59.45  ?  326  C   A "O2'" 1 
ATOM   6982  C  "C1'" . C   A 1  326  ? 174.356 166.570 161.449 1.00 59.45  ?  326  C   A "C1'" 1 
ATOM   6983  N  N1    . C   A 1  326  ? 172.913 166.850 161.227 1.00 59.45  ?  326  C   A N1    1 
ATOM   6984  C  C2    . C   A 1  326  ? 171.975 166.331 162.131 1.00 59.45  ?  326  C   A C2    1 
ATOM   6985  O  O2    . C   A 1  326  ? 172.358 165.644 163.090 1.00 59.45  ?  326  C   A O2    1 
ATOM   6986  N  N3    . C   A 1  326  ? 170.659 166.585 161.943 1.00 59.45  ?  326  C   A N3    1 
ATOM   6987  C  C4    . C   A 1  326  ? 170.257 167.327 160.910 1.00 59.45  ?  326  C   A C4    1 
ATOM   6988  N  N4    . C   A 1  326  ? 168.948 167.548 160.769 1.00 59.45  ?  326  C   A N4    1 
ATOM   6989  C  C5    . C   A 1  326  ? 171.181 167.874 159.977 1.00 59.45  ?  326  C   A C5    1 
ATOM   6990  C  C6    . C   A 1  326  ? 172.480 167.618 160.176 1.00 59.45  ?  326  C   A C6    1 
ATOM   6991  P  P     . U   A 1  327  ? 177.492 163.900 159.370 1.00 56.45  ?  327  U   A P     1 
ATOM   6992  O  OP1   . U   A 1  327  ? 178.278 164.716 160.328 1.00 56.45  ?  327  U   A OP1   1 
ATOM   6993  O  OP2   . U   A 1  327  ? 178.177 163.368 158.168 1.00 56.45  ?  327  U   A OP2   1 
ATOM   6994  O  "O5'" . U   A 1  327  ? 176.939 162.648 160.185 1.00 56.45  ?  327  U   A "O5'" 1 
ATOM   6995  C  "C5'" . U   A 1  327  ? 177.758 161.987 161.144 1.00 56.45  ?  327  U   A "C5'" 1 
ATOM   6996  C  "C4'" . U   A 1  327  ? 177.025 160.864 161.839 1.00 56.45  ?  327  U   A "C4'" 1 
ATOM   6997  O  "O4'" . U   A 1  327  ? 175.670 161.291 162.148 1.00 56.45  ?  327  U   A "O4'" 1 
ATOM   6998  C  "C3'" . U   A 1  327  ? 176.895 159.566 161.041 1.00 56.45  ?  327  U   A "C3'" 1 
ATOM   6999  O  "O3'" . U   A 1  327  ? 176.982 158.454 161.931 1.00 56.45  ?  327  U   A "O3'" 1 
ATOM   7000  C  "C2'" . U   A 1  327  ? 175.480 159.656 160.476 1.00 56.45  ?  327  U   A "C2'" 1 
ATOM   7001  O  "O2'" . U   A 1  327  ? 174.889 158.411 160.169 1.00 56.45  ?  327  U   A "O2'" 1 
ATOM   7002  C  "C1'" . U   A 1  327  ? 174.743 160.370 161.606 1.00 56.45  ?  327  U   A "C1'" 1 
ATOM   7003  N  N1    . U   A 1  327  ? 173.556 161.118 161.166 1.00 56.45  ?  327  U   A N1    1 
ATOM   7004  C  C2    . U   A 1  327  ? 172.412 161.019 161.933 1.00 56.45  ?  327  U   A C2    1 
ATOM   7005  O  O2    . U   A 1  327  ? 172.355 160.352 162.951 1.00 56.45  ?  327  U   A O2    1 
ATOM   7006  N  N3    . U   A 1  327  ? 171.339 161.739 161.469 1.00 56.45  ?  327  U   A N3    1 
ATOM   7007  C  C4    . U   A 1  327  ? 171.294 162.525 160.336 1.00 56.45  ?  327  U   A C4    1 
ATOM   7008  O  O4    . U   A 1  327  ? 170.250 163.112 160.047 1.00 56.45  ?  327  U   A O4    1 
ATOM   7009  C  C5    . U   A 1  327  ? 172.517 162.571 159.594 1.00 56.45  ?  327  U   A C5    1 
ATOM   7010  C  C6    . U   A 1  327  ? 173.578 161.880 160.022 1.00 56.45  ?  327  U   A C6    1 
ATOM   7011  P  P     . C   A 1  328  ? 178.387 158.076 162.615 1.00 54.08  ?  328  C   A P     1 
ATOM   7012  O  OP1   . C   A 1  328  ? 178.339 158.512 164.033 1.00 54.08  ?  328  C   A OP1   1 
ATOM   7013  O  OP2   . C   A 1  328  ? 179.478 158.562 161.732 1.00 54.08  ?  328  C   A OP2   1 
ATOM   7014  O  "O5'" . C   A 1  328  ? 178.417 156.484 162.588 1.00 54.08  ?  328  C   A "O5'" 1 
ATOM   7015  C  "C5'" . C   A 1  328  ? 177.216 155.728 162.616 1.00 54.08  ?  328  C   A "C5'" 1 
ATOM   7016  C  "C4'" . C   A 1  328  ? 177.014 155.059 163.952 1.00 54.08  ?  328  C   A "C4'" 1 
ATOM   7017  O  "O4'" . C   A 1  328  ? 176.657 156.055 164.946 1.00 54.08  ?  328  C   A "O4'" 1 
ATOM   7018  C  "C3'" . C   A 1  328  ? 175.881 154.048 164.022 1.00 54.08  ?  328  C   A "C3'" 1 
ATOM   7019  O  "O3'" . C   A 1  328  ? 176.238 152.778 163.504 1.00 54.08  ?  328  C   A "O3'" 1 
ATOM   7020  C  "C2'" . C   A 1  328  ? 175.534 154.033 165.506 1.00 54.08  ?  328  C   A "C2'" 1 
ATOM   7021  O  "O2'" . C   A 1  328  ? 176.452 153.226 166.229 1.00 54.08  ?  328  C   A "O2'" 1 
ATOM   7022  C  "C1'" . C   A 1  328  ? 175.769 155.497 165.893 1.00 54.08  ?  328  C   A "C1'" 1 
ATOM   7023  N  N1    . C   A 1  328  ? 174.517 156.296 165.918 1.00 54.08  ?  328  C   A N1    1 
ATOM   7024  C  C2    . C   A 1  328  ? 173.725 156.273 167.074 1.00 54.08  ?  328  C   A C2    1 
ATOM   7025  O  O2    . C   A 1  328  ? 174.081 155.587 168.044 1.00 54.08  ?  328  C   A O2    1 
ATOM   7026  N  N3    . C   A 1  328  ? 172.584 157.000 167.112 1.00 54.08  ?  328  C   A N3    1 
ATOM   7027  C  C4    . C   A 1  328  ? 172.217 157.734 166.061 1.00 54.08  ?  328  C   A C4    1 
ATOM   7028  N  N4    . C   A 1  328  ? 171.083 158.433 166.147 1.00 54.08  ?  328  C   A N4    1 
ATOM   7029  C  C5    . C   A 1  328  ? 172.999 157.782 164.873 1.00 54.08  ?  328  C   A C5    1 
ATOM   7030  C  C6    . C   A 1  328  ? 174.127 157.062 164.850 1.00 54.08  ?  328  C   A C6    1 
ATOM   7031  P  P     . U   A 1  329  ? 175.261 152.035 162.467 1.00 51.29  ?  329  U   A P     1 
ATOM   7032  O  OP1   . U   A 1  329  ? 174.620 150.894 163.169 1.00 51.29  ?  329  U   A OP1   1 
ATOM   7033  O  OP2   . U   A 1  329  ? 176.019 151.794 161.213 1.00 51.29  ?  329  U   A OP2   1 
ATOM   7034  O  "O5'" . U   A 1  329  ? 174.139 153.123 162.163 1.00 51.29  ?  329  U   A "O5'" 1 
ATOM   7035  C  "C5'" . U   A 1  329  ? 172.882 152.747 161.622 1.00 51.29  ?  329  U   A "C5'" 1 
ATOM   7036  C  "C4'" . U   A 1  329  ? 171.759 153.066 162.576 1.00 51.29  ?  329  U   A "C4'" 1 
ATOM   7037  O  "O4'" . U   A 1  329  ? 171.887 154.431 163.048 1.00 51.29  ?  329  U   A "O4'" 1 
ATOM   7038  C  "C3'" . U   A 1  329  ? 170.355 153.005 161.996 1.00 51.29  ?  329  U   A "C3'" 1 
ATOM   7039  O  "O3'" . U   A 1  329  ? 169.846 151.685 161.925 1.00 51.29  ?  329  U   A "O3'" 1 
ATOM   7040  C  "C2'" . U   A 1  329  ? 169.566 153.916 162.931 1.00 51.29  ?  329  U   A "C2'" 1 
ATOM   7041  O  "O2'" . U   A 1  329  ? 169.216 153.229 164.124 1.00 51.29  ?  329  U   A "O2'" 1 
ATOM   7042  C  "C1'" . U   A 1  329  ? 170.609 154.985 163.277 1.00 51.29  ?  329  U   A "C1'" 1 
ATOM   7043  N  N1    . U   A 1  329  ? 170.462 156.218 162.465 1.00 51.29  ?  329  U   A N1    1 
ATOM   7044  C  C2    . U   A 1  329  ? 169.539 157.159 162.888 1.00 51.29  ?  329  U   A C2    1 
ATOM   7045  O  O2    . U   A 1  329  ? 168.846 157.018 163.882 1.00 51.29  ?  329  U   A O2    1 
ATOM   7046  N  N3    . U   A 1  329  ? 169.450 158.282 162.102 1.00 51.29  ?  329  U   A N3    1 
ATOM   7047  C  C4    . U   A 1  329  ? 170.174 158.561 160.962 1.00 51.29  ?  329  U   A C4    1 
ATOM   7048  O  O4    . U   A 1  329  ? 169.977 159.619 160.363 1.00 51.29  ?  329  U   A O4    1 
ATOM   7049  C  C5    . U   A 1  329  ? 171.110 157.546 160.589 1.00 51.29  ?  329  U   A C5    1 
ATOM   7050  C  C6    . U   A 1  329  ? 171.220 156.443 161.336 1.00 51.29  ?  329  U   A C6    1 
ATOM   7051  P  P     . C   A 1  330  ? 169.559 151.005 160.497 1.00 55.72  ?  330  C   A P     1 
ATOM   7052  O  OP1   . C   A 1  330  ? 169.835 149.551 160.616 1.00 55.72  ?  330  C   A OP1   1 
ATOM   7053  O  OP2   . C   A 1  330  ? 170.261 151.803 159.459 1.00 55.72  ?  330  C   A OP2   1 
ATOM   7054  O  "O5'" . C   A 1  330  ? 167.992 151.196 160.288 1.00 55.72  ?  330  C   A "O5'" 1 
ATOM   7055  C  "C5'" . C   A 1  330  ? 167.061 150.605 161.183 1.00 55.72  ?  330  C   A "C5'" 1 
ATOM   7056  C  "C4'" . C   A 1  330  ? 165.759 151.363 161.202 1.00 55.72  ?  330  C   A "C4'" 1 
ATOM   7057  O  "O4'" . C   A 1  330  ? 165.985 152.712 161.688 1.00 55.72  ?  330  C   A "O4'" 1 
ATOM   7058  C  "C3'" . C   A 1  330  ? 165.087 151.565 159.853 1.00 55.72  ?  330  C   A "C3'" 1 
ATOM   7059  O  "O3'" . C   A 1  330  ? 164.353 150.432 159.422 1.00 55.72  ?  330  C   A "O3'" 1 
ATOM   7060  C  "C2'" . C   A 1  330  ? 164.224 152.798 160.091 1.00 55.72  ?  330  C   A "C2'" 1 
ATOM   7061  O  "O2'" . C   A 1  330  ? 163.027 152.449 160.770 1.00 55.72  ?  330  C   A "O2'" 1 
ATOM   7062  C  "C1'" . C   A 1  330  ? 165.103 153.611 161.046 1.00 55.72  ?  330  C   A "C1'" 1 
ATOM   7063  N  N1    . C   A 1  330  ? 165.896 154.657 160.353 1.00 55.72  ?  330  C   A N1    1 
ATOM   7064  C  C2    . C   A 1  330  ? 165.283 155.870 160.003 1.00 55.72  ?  330  C   A C2    1 
ATOM   7065  O  O2    . C   A 1  330  ? 164.084 156.059 160.265 1.00 55.72  ?  330  C   A O2    1 
ATOM   7066  N  N3    . C   A 1  330  ? 166.010 156.824 159.376 1.00 55.72  ?  330  C   A N3    1 
ATOM   7067  C  C4    . C   A 1  330  ? 167.297 156.617 159.097 1.00 55.72  ?  330  C   A C4    1 
ATOM   7068  N  N4    . C   A 1  330  ? 167.970 157.590 158.477 1.00 55.72  ?  330  C   A N4    1 
ATOM   7069  C  C5    . C   A 1  330  ? 167.952 155.401 159.442 1.00 55.72  ?  330  C   A C5    1 
ATOM   7070  C  C6    . C   A 1  330  ? 167.222 154.467 160.063 1.00 55.72  ?  330  C   A C6    1 
ATOM   7071  P  P     . C   A 1  331  ? 164.207 150.112 157.854 1.00 63.38  ?  331  C   A P     1 
ATOM   7072  O  OP1   . C   A 1  331  ? 163.622 148.754 157.715 1.00 63.38  ?  331  C   A OP1   1 
ATOM   7073  O  OP2   . C   A 1  331  ? 165.503 150.424 157.199 1.00 63.38  ?  331  C   A OP2   1 
ATOM   7074  O  "O5'" . C   A 1  331  ? 163.129 151.167 157.341 1.00 63.38  ?  331  C   A "O5'" 1 
ATOM   7075  C  "C5'" . C   A 1  331  ? 161.784 151.113 157.795 1.00 63.38  ?  331  C   A "C5'" 1 
ATOM   7076  C  "C4'" . C   A 1  331  ? 160.983 152.290 157.297 1.00 63.38  ?  331  C   A "C4'" 1 
ATOM   7077  O  "O4'" . C   A 1  331  ? 161.494 153.519 157.876 1.00 63.38  ?  331  C   A "O4'" 1 
ATOM   7078  C  "C3'" . C   A 1  331  ? 161.030 152.545 155.800 1.00 63.38  ?  331  C   A "C3'" 1 
ATOM   7079  O  "O3'" . C   A 1  331  ? 160.170 151.694 155.063 1.00 63.38  ?  331  C   A "O3'" 1 
ATOM   7080  C  "C2'" . C   A 1  331  ? 160.664 154.022 155.702 1.00 63.38  ?  331  C   A "C2'" 1 
ATOM   7081  O  "O2'" . C   A 1  331  ? 159.260 154.200 155.809 1.00 63.38  ?  331  C   A "O2'" 1 
ATOM   7082  C  "C1'" . C   A 1  331  ? 161.321 154.587 156.967 1.00 63.38  ?  331  C   A "C1'" 1 
ATOM   7083  N  N1    . C   A 1  331  ? 162.636 155.221 156.698 1.00 63.38  ?  331  C   A N1    1 
ATOM   7084  C  C2    . C   A 1  331  ? 162.665 156.554 156.264 1.00 63.38  ?  331  C   A C2    1 
ATOM   7085  O  O2    . C   A 1  331  ? 161.598 157.169 156.112 1.00 63.38  ?  331  C   A O2    1 
ATOM   7086  N  N3    . C   A 1  331  ? 163.856 157.147 156.018 1.00 63.38  ?  331  C   A N3    1 
ATOM   7087  C  C4    . C   A 1  331  ? 164.992 156.471 156.188 1.00 63.38  ?  331  C   A C4    1 
ATOM   7088  N  N4    . C   A 1  331  ? 166.141 157.100 155.932 1.00 63.38  ?  331  C   A N4    1 
ATOM   7089  C  C5    . C   A 1  331  ? 164.999 155.117 156.629 1.00 63.38  ?  331  C   A C5    1 
ATOM   7090  C  C6    . C   A 1  331  ? 163.814 154.543 156.872 1.00 63.38  ?  331  C   A C6    1 
ATOM   7091  P  P     . U   A 1  332  ? 160.596 151.195 153.597 1.00 66.73  ?  332  U   A P     1 
ATOM   7092  O  OP1   . U   A 1  332  ? 159.719 150.056 153.224 1.00 66.73  ?  332  U   A OP1   1 
ATOM   7093  O  OP2   . U   A 1  332  ? 162.071 151.022 153.581 1.00 66.73  ?  332  U   A OP2   1 
ATOM   7094  O  "O5'" . U   A 1  332  ? 160.235 152.426 152.652 1.00 66.73  ?  332  U   A "O5'" 1 
ATOM   7095  C  "C5'" . U   A 1  332  ? 158.897 152.888 152.542 1.00 66.73  ?  332  U   A "C5'" 1 
ATOM   7096  C  "C4'" . U   A 1  332  ? 158.821 154.208 151.816 1.00 66.73  ?  332  U   A "C4'" 1 
ATOM   7097  O  "O4'" . U   A 1  332  ? 159.479 155.240 152.596 1.00 66.73  ?  332  U   A "O4'" 1 
ATOM   7098  C  "C3'" . U   A 1  332  ? 159.517 154.270 150.466 1.00 66.73  ?  332  U   A "C3'" 1 
ATOM   7099  O  "O3'" . U   A 1  332  ? 158.750 153.697 149.421 1.00 66.73  ?  332  U   A "O3'" 1 
ATOM   7100  C  "C2'" . U   A 1  332  ? 159.772 155.763 150.292 1.00 66.73  ?  332  U   A "C2'" 1 
ATOM   7101  O  "O2'" . U   A 1  332  ? 158.597 156.424 149.846 1.00 66.73  ?  332  U   A "O2'" 1 
ATOM   7102  C  "C1'" . U   A 1  332  ? 160.056 156.199 151.733 1.00 66.73  ?  332  U   A "C1'" 1 
ATOM   7103  N  N1    . U   A 1  332  ? 161.507 156.311 152.023 1.00 66.73  ?  332  U   A N1    1 
ATOM   7104  C  C2    . U   A 1  332  ? 162.137 157.494 151.676 1.00 66.73  ?  332  U   A C2    1 
ATOM   7105  O  O2    . U   A 1  332  ? 161.559 158.430 151.148 1.00 66.73  ?  332  U   A O2    1 
ATOM   7106  N  N3    . U   A 1  332  ? 163.477 157.549 151.968 1.00 66.73  ?  332  U   A N3    1 
ATOM   7107  C  C4    . U   A 1  332  ? 164.242 156.566 152.562 1.00 66.73  ?  332  U   A C4    1 
ATOM   7108  O  O4    . U   A 1  332  ? 165.441 156.766 152.759 1.00 66.73  ?  332  U   A O4    1 
ATOM   7109  C  C5    . U   A 1  332  ? 163.522 155.375 152.894 1.00 66.73  ?  332  U   A C5    1 
ATOM   7110  C  C6    . U   A 1  332  ? 162.216 155.294 152.623 1.00 66.73  ?  332  U   A C6    1 
ATOM   7111  P  P     . C   A 1  333  ? 159.474 152.870 148.249 1.00 65.18  ?  333  C   A P     1 
ATOM   7112  O  OP1   . C   A 1  333  ? 158.434 152.110 147.511 1.00 65.18  ?  333  C   A OP1   1 
ATOM   7113  O  OP2   . C   A 1  333  ? 160.629 152.149 148.841 1.00 65.18  ?  333  C   A OP2   1 
ATOM   7114  O  "O5'" . C   A 1  333  ? 160.043 153.998 147.278 1.00 65.18  ?  333  C   A "O5'" 1 
ATOM   7115  C  "C5'" . C   A 1  333  ? 159.173 154.938 146.666 1.00 65.18  ?  333  C   A "C5'" 1 
ATOM   7116  C  "C4'" . C   A 1  333  ? 159.935 156.113 146.107 1.00 65.18  ?  333  C   A "C4'" 1 
ATOM   7117  O  "O4'" . C   A 1  333  ? 160.618 156.813 147.179 1.00 65.18  ?  333  C   A "O4'" 1 
ATOM   7118  C  "C3'" . C   A 1  333  ? 161.042 155.780 145.121 1.00 65.18  ?  333  C   A "C3'" 1 
ATOM   7119  O  "O3'" . C   A 1  333  ? 160.558 155.535 143.812 1.00 65.18  ?  333  C   A "O3'" 1 
ATOM   7120  C  "C2'" . C   A 1  333  ? 161.956 156.996 145.219 1.00 65.18  ?  333  C   A "C2'" 1 
ATOM   7121  O  "O2'" . C   A 1  333  ? 161.444 158.072 144.446 1.00 65.18  ?  333  C   A "O2'" 1 
ATOM   7122  C  "C1'" . C   A 1  333  ? 161.828 157.362 146.702 1.00 65.18  ?  333  C   A "C1'" 1 
ATOM   7123  N  N1    . C   A 1  333  ? 162.955 156.851 147.523 1.00 65.18  ?  333  C   A N1    1 
ATOM   7124  C  C2    . C   A 1  333  ? 164.137 157.601 147.588 1.00 65.18  ?  333  C   A C2    1 
ATOM   7125  O  O2    . C   A 1  333  ? 164.220 158.668 146.959 1.00 65.18  ?  333  C   A O2    1 
ATOM   7126  N  N3    . C   A 1  333  ? 165.170 157.149 148.337 1.00 65.18  ?  333  C   A N3    1 
ATOM   7127  C  C4    . C   A 1  333  ? 165.062 156.002 149.008 1.00 65.18  ?  333  C   A C4    1 
ATOM   7128  N  N4    . C   A 1  333  ? 166.109 155.599 149.732 1.00 65.18  ?  333  C   A N4    1 
ATOM   7129  C  C5    . C   A 1  333  ? 163.875 155.218 148.966 1.00 65.18  ?  333  C   A C5    1 
ATOM   7130  C  C6    . C   A 1  333  ? 162.860 155.678 148.224 1.00 65.18  ?  333  C   A C6    1 
ATOM   7131  P  P     . C   A 1  334  ? 160.791 154.105 143.118 1.00 60.43  ?  334  C   A P     1 
ATOM   7132  O  OP1   . C   A 1  334  ? 159.530 153.711 142.440 1.00 60.43  ?  334  C   A OP1   1 
ATOM   7133  O  OP2   . C   A 1  334  ? 161.397 153.197 144.125 1.00 60.43  ?  334  C   A OP2   1 
ATOM   7134  O  "O5'" . C   A 1  334  ? 161.885 154.395 141.997 1.00 60.43  ?  334  C   A "O5'" 1 
ATOM   7135  C  "C5'" . C   A 1  334  ? 163.252 154.075 142.208 1.00 60.43  ?  334  C   A "C5'" 1 
ATOM   7136  C  "C4'" . C   A 1  334  ? 164.143 155.260 141.932 1.00 60.43  ?  334  C   A "C4'" 1 
ATOM   7137  O  "O4'" . C   A 1  334  ? 164.424 155.961 143.171 1.00 60.43  ?  334  C   A "O4'" 1 
ATOM   7138  C  "C3'" . C   A 1  334  ? 165.520 154.940 141.372 1.00 60.43  ?  334  C   A "C3'" 1 
ATOM   7139  O  "O3'" . C   A 1  334  ? 165.502 154.696 139.976 1.00 60.43  ?  334  C   A "O3'" 1 
ATOM   7140  C  "C2'" . C   A 1  334  ? 166.337 156.164 141.770 1.00 60.43  ?  334  C   A "C2'" 1 
ATOM   7141  O  "O2'" . C   A 1  334  ? 166.101 157.239 140.873 1.00 60.43  ?  334  C   A "O2'" 1 
ATOM   7142  C  "C1'" . C   A 1  334  ? 165.719 156.522 143.126 1.00 60.43  ?  334  C   A "C1'" 1 
ATOM   7143  N  N1    . C   A 1  334  ? 166.513 156.016 144.273 1.00 60.43  ?  334  C   A N1    1 
ATOM   7144  C  C2    . C   A 1  334  ? 167.594 156.782 144.732 1.00 60.43  ?  334  C   A C2    1 
ATOM   7145  O  O2    . C   A 1  334  ? 167.863 157.856 144.173 1.00 60.43  ?  334  C   A O2    1 
ATOM   7146  N  N3    . C   A 1  334  ? 168.326 156.336 145.780 1.00 60.43  ?  334  C   A N3    1 
ATOM   7147  C  C4    . C   A 1  334  ? 168.020 155.180 146.370 1.00 60.43  ?  334  C   A C4    1 
ATOM   7148  N  N4    . C   A 1  334  ? 168.773 154.784 147.399 1.00 60.43  ?  334  C   A N4    1 
ATOM   7149  C  C5    . C   A 1  334  ? 166.928 154.380 145.931 1.00 60.43  ?  334  C   A C5    1 
ATOM   7150  C  C6    . C   A 1  334  ? 166.210 154.833 144.896 1.00 60.43  ?  334  C   A C6    1 
ATOM   7151  P  P     . G   A 1  335  ? 166.563 153.686 139.317 1.00 58.36  ?  335  G   A P     1 
ATOM   7152  O  OP1   . G   A 1  335  ? 166.044 153.278 137.987 1.00 58.36  ?  335  G   A OP1   1 
ATOM   7153  O  OP2   . G   A 1  335  ? 166.901 152.648 140.324 1.00 58.36  ?  335  G   A OP2   1 
ATOM   7154  O  "O5'" . G   A 1  335  ? 167.855 154.587 139.084 1.00 58.36  ?  335  G   A "O5'" 1 
ATOM   7155  C  "C5'" . G   A 1  335  ? 167.780 155.775 138.311 1.00 58.36  ?  335  G   A "C5'" 1 
ATOM   7156  C  "C4'" . G   A 1  335  ? 169.023 156.612 138.461 1.00 58.36  ?  335  G   A "C4'" 1 
ATOM   7157  O  "O4'" . G   A 1  335  ? 169.187 157.000 139.849 1.00 58.36  ?  335  G   A "O4'" 1 
ATOM   7158  C  "C3'" . G   A 1  335  ? 170.328 155.918 138.109 1.00 58.36  ?  335  G   A "C3'" 1 
ATOM   7159  O  "O3'" . G   A 1  335  ? 170.586 155.922 136.716 1.00 58.36  ?  335  G   A "O3'" 1 
ATOM   7160  C  "C2'" . G   A 1  335  ? 171.352 156.696 138.923 1.00 58.36  ?  335  G   A "C2'" 1 
ATOM   7161  O  "O2'" . G   A 1  335  ? 171.673 157.921 138.280 1.00 58.36  ?  335  G   A "O2'" 1 
ATOM   7162  C  "C1'" . G   A 1  335  ? 170.557 157.009 140.190 1.00 58.36  ?  335  G   A "C1'" 1 
ATOM   7163  N  N9    . G   A 1  335  ? 170.774 156.006 141.250 1.00 58.36  ?  335  G   A N9    1 
ATOM   7164  C  C8    . G   A 1  335  ? 169.883 155.045 141.661 1.00 58.36  ?  335  G   A C8    1 
ATOM   7165  N  N7    . G   A 1  335  ? 170.342 154.295 142.625 1.00 58.36  ?  335  G   A N7    1 
ATOM   7166  C  C5    . G   A 1  335  ? 171.614 154.793 142.869 1.00 58.36  ?  335  G   A C5    1 
ATOM   7167  C  C6    . G   A 1  335  ? 172.596 154.382 143.808 1.00 58.36  ?  335  G   A C6    1 
ATOM   7168  O  O6    . G   A 1  335  ? 172.535 153.466 144.636 1.00 58.36  ?  335  G   A O6    1 
ATOM   7169  N  N1    . G   A 1  335  ? 173.747 155.160 143.719 1.00 58.36  ?  335  G   A N1    1 
ATOM   7170  C  C2    . G   A 1  335  ? 173.930 156.200 142.842 1.00 58.36  ?  335  G   A C2    1 
ATOM   7171  N  N2    . G   A 1  335  ? 175.111 156.831 142.910 1.00 58.36  ?  335  G   A N2    1 
ATOM   7172  N  N3    . G   A 1  335  ? 173.022 156.592 141.963 1.00 58.36  ?  335  G   A N3    1 
ATOM   7173  C  C4    . G   A 1  335  ? 171.896 155.851 142.031 1.00 58.36  ?  335  G   A C4    1 
ATOM   7174  P  P     . C   A 1  336  ? 171.019 154.569 135.966 1.00 56.33  ?  336  C   A P     1 
ATOM   7175  O  OP1   . C   A 1  336  ? 170.633 154.691 134.537 1.00 56.33  ?  336  C   A OP1   1 
ATOM   7176  O  OP2   . C   A 1  336  ? 170.524 153.419 136.765 1.00 56.33  ?  336  C   A OP2   1 
ATOM   7177  O  "O5'" . C   A 1  336  ? 172.609 154.583 136.049 1.00 56.33  ?  336  C   A "O5'" 1 
ATOM   7178  C  "C5'" . C   A 1  336  ? 173.347 155.723 135.637 1.00 56.33  ?  336  C   A "C5'" 1 
ATOM   7179  C  "C4'" . C   A 1  336  ? 174.676 155.800 136.343 1.00 56.33  ?  336  C   A "C4'" 1 
ATOM   7180  O  "O4'" . C   A 1  336  ? 174.464 155.984 137.766 1.00 56.33  ?  336  C   A "O4'" 1 
ATOM   7181  C  "C3'" . C   A 1  336  ? 175.544 154.556 136.256 1.00 56.33  ?  336  C   A "C3'" 1 
ATOM   7182  O  "O3'" . C   A 1  336  ? 176.258 154.465 135.035 1.00 56.33  ?  336  C   A "O3'" 1 
ATOM   7183  C  "C2'" . C   A 1  336  ? 176.438 154.684 137.485 1.00 56.33  ?  336  C   A "C2'" 1 
ATOM   7184  O  "O2'" . C   A 1  336  ? 177.508 155.583 137.235 1.00 56.33  ?  336  C   A "O2'" 1 
ATOM   7185  C  "C1'" . C   A 1  336  ? 175.486 155.334 138.494 1.00 56.33  ?  336  C   A "C1'" 1 
ATOM   7186  N  N1    . C   A 1  336  ? 174.871 154.355 139.426 1.00 56.33  ?  336  C   A N1    1 
ATOM   7187  C  C2    . C   A 1  336  ? 175.582 153.979 140.574 1.00 56.33  ?  336  C   A C2    1 
ATOM   7188  O  O2    . C   A 1  336  ? 176.704 154.463 140.782 1.00 56.33  ?  336  C   A O2    1 
ATOM   7189  N  N3    . C   A 1  336  ? 175.031 153.091 141.435 1.00 56.33  ?  336  C   A N3    1 
ATOM   7190  C  C4    . C   A 1  336  ? 173.822 152.582 141.195 1.00 56.33  ?  336  C   A C4    1 
ATOM   7191  N  N4    . C   A 1  336  ? 173.323 151.711 142.074 1.00 56.33  ?  336  C   A N4    1 
ATOM   7192  C  C5    . C   A 1  336  ? 173.071 152.946 140.041 1.00 56.33  ?  336  C   A C5    1 
ATOM   7193  C  C6    . C   A 1  336  ? 173.627 153.826 139.200 1.00 56.33  ?  336  C   A C6    1 
ATOM   7194  P  P     . C   A 1  337  ? 176.072 153.183 134.085 1.00 61.05  ?  337  C   A P     1 
ATOM   7195  O  OP1   . C   A 1  337  ? 176.396 153.589 132.694 1.00 61.05  ?  337  C   A OP1   1 
ATOM   7196  O  OP2   . C   A 1  337  ? 174.750 152.576 134.384 1.00 61.05  ?  337  C   A OP2   1 
ATOM   7197  O  "O5'" . C   A 1  337  ? 177.200 152.173 134.578 1.00 61.05  ?  337  C   A "O5'" 1 
ATOM   7198  C  "C5'" . C   A 1  337  ? 178.571 152.537 134.528 1.00 61.05  ?  337  C   A "C5'" 1 
ATOM   7199  C  "C4'" . C   A 1  337  ? 179.355 151.902 135.648 1.00 61.05  ?  337  C   A "C4'" 1 
ATOM   7200  O  "O4'" . C   A 1  337  ? 178.769 152.265 136.926 1.00 61.05  ?  337  C   A "O4'" 1 
ATOM   7201  C  "C3'" . C   A 1  337  ? 179.375 150.382 135.675 1.00 61.05  ?  337  C   A "C3'" 1 
ATOM   7202  O  "O3'" . C   A 1  337  ? 180.305 149.820 134.765 1.00 61.05  ?  337  C   A "O3'" 1 
ATOM   7203  C  "C2'" . C   A 1  337  ? 179.687 150.080 137.135 1.00 61.05  ?  337  C   A "C2'" 1 
ATOM   7204  O  "O2'" . C   A 1  337  ? 181.076 150.228 137.391 1.00 61.05  ?  337  C   A "O2'" 1 
ATOM   7205  C  "C1'" . C   A 1  337  ? 178.941 151.211 137.851 1.00 61.05  ?  337  C   A "C1'" 1 
ATOM   7206  N  N1    . C   A 1  337  ? 177.615 150.787 138.368 1.00 61.05  ?  337  C   A N1    1 
ATOM   7207  C  C2    . C   A 1  337  ? 177.552 150.153 139.616 1.00 61.05  ?  337  C   A C2    1 
ATOM   7208  O  O2    . C   A 1  337  ? 178.597 149.960 140.257 1.00 61.05  ?  337  C   A O2    1 
ATOM   7209  N  N3    . C   A 1  337  ? 176.351 149.761 140.103 1.00 61.05  ?  337  C   A N3    1 
ATOM   7210  C  C4    . C   A 1  337  ? 175.238 149.978 139.401 1.00 61.05  ?  337  C   A C4    1 
ATOM   7211  N  N4    . C   A 1  337  ? 174.078 149.573 139.923 1.00 61.05  ?  337  C   A N4    1 
ATOM   7212  C  C5    . C   A 1  337  ? 175.266 150.621 138.131 1.00 61.05  ?  337  C   A C5    1 
ATOM   7213  C  C6    . C   A 1  337  ? 176.459 151.005 137.663 1.00 61.05  ?  337  C   A C6    1 
ATOM   7214  P  P     . C   A 1  338  ? 180.028 148.373 134.123 1.00 76.66  ?  338  C   A P     1 
ATOM   7215  O  OP1   . C   A 1  338  ? 180.967 148.179 132.989 1.00 76.66  ?  338  C   A OP1   1 
ATOM   7216  O  OP2   . C   A 1  338  ? 178.566 148.244 133.898 1.00 76.66  ?  338  C   A OP2   1 
ATOM   7217  O  "O5'" . C   A 1  338  ? 180.450 147.354 135.272 1.00 76.66  ?  338  C   A "O5'" 1 
ATOM   7218  C  "C5'" . C   A 1  338  ? 181.798 147.275 135.710 1.00 76.66  ?  338  C   A "C5'" 1 
ATOM   7219  C  "C4'" . C   A 1  338  ? 181.925 146.461 136.973 1.00 76.66  ?  338  C   A "C4'" 1 
ATOM   7220  O  "O4'" . C   A 1  338  ? 181.132 147.064 138.029 1.00 76.66  ?  338  C   A "O4'" 1 
ATOM   7221  C  "C3'" . C   A 1  338  ? 181.415 145.032 136.902 1.00 76.66  ?  338  C   A "C3'" 1 
ATOM   7222  O  "O3'" . C   A 1  338  ? 182.341 144.147 136.297 1.00 76.66  ?  338  C   A "O3'" 1 
ATOM   7223  C  "C2'" . C   A 1  338  ? 181.125 144.707 138.363 1.00 76.66  ?  338  C   A "C2'" 1 
ATOM   7224  O  "O2'" . C   A 1  338  ? 182.321 144.366 139.048 1.00 76.66  ?  338  C   A "O2'" 1 
ATOM   7225  C  "C1'" . C   A 1  338  ? 180.635 146.061 138.890 1.00 76.66  ?  338  C   A "C1'" 1 
ATOM   7226  N  N1    . C   A 1  338  ? 179.154 146.156 138.950 1.00 76.66  ?  338  C   A N1    1 
ATOM   7227  C  C2    . C   A 1  338  ? 178.493 145.650 140.077 1.00 76.66  ?  338  C   A C2    1 
ATOM   7228  O  O2    . C   A 1  338  ? 179.154 145.133 140.990 1.00 76.66  ?  338  C   A O2    1 
ATOM   7229  N  N3    . C   A 1  338  ? 177.144 145.734 140.149 1.00 76.66  ?  338  C   A N3    1 
ATOM   7230  C  C4    . C   A 1  338  ? 176.451 146.295 139.157 1.00 76.66  ?  338  C   A C4    1 
ATOM   7231  N  N4    . C   A 1  338  ? 175.123 146.353 139.275 1.00 76.66  ?  338  C   A N4    1 
ATOM   7232  C  C5    . C   A 1  338  ? 177.092 146.822 138.000 1.00 76.66  ?  338  C   A C5    1 
ATOM   7233  C  C6    . C   A 1  338  ? 178.427 146.734 137.943 1.00 76.66  ?  338  C   A C6    1 
ATOM   7234  P  P     . A   A 1  339  ? 181.878 143.202 135.083 1.00 101.79 ?  339  A   A P     1 
ATOM   7235  O  OP1   . A   A 1  339  ? 183.093 142.804 134.328 1.00 101.79 ?  339  A   A OP1   1 
ATOM   7236  O  OP2   . A   A 1  339  ? 180.763 143.878 134.373 1.00 101.79 ?  339  A   A OP2   1 
ATOM   7237  O  "O5'" . A   A 1  339  ? 181.288 141.910 135.805 1.00 101.79 ?  339  A   A "O5'" 1 
ATOM   7238  C  "C5'" . A   A 1  339  ? 182.085 141.144 136.696 1.00 101.79 ?  339  A   A "C5'" 1 
ATOM   7239  C  "C4'" . A   A 1  339  ? 181.240 140.438 137.726 1.00 101.79 ?  339  A   A "C4'" 1 
ATOM   7240  O  "O4'" . A   A 1  339  ? 180.512 141.413 138.515 1.00 101.79 ?  339  A   A "O4'" 1 
ATOM   7241  C  "C3'" . A   A 1  339  ? 180.157 139.518 137.184 1.00 101.79 ?  339  A   A "C3'" 1 
ATOM   7242  O  "O3'" . A   A 1  339  ? 180.654 138.243 136.815 1.00 101.79 ?  339  A   A "O3'" 1 
ATOM   7243  C  "C2'" . A   A 1  339  ? 179.152 139.474 138.328 1.00 101.79 ?  339  A   A "C2'" 1 
ATOM   7244  O  "O2'" . A   A 1  339  ? 179.580 138.576 139.341 1.00 101.79 ?  339  A   A "O2'" 1 
ATOM   7245  C  "C1'" . A   A 1  339  ? 179.247 140.899 138.873 1.00 101.79 ?  339  A   A "C1'" 1 
ATOM   7246  N  N9    . A   A 1  339  ? 178.203 141.778 138.312 1.00 101.79 ?  339  A   A N9    1 
ATOM   7247  C  C8    . A   A 1  339  ? 178.320 142.686 137.289 1.00 101.79 ?  339  A   A C8    1 
ATOM   7248  N  N7    . A   A 1  339  ? 177.205 143.321 137.016 1.00 101.79 ?  339  A   A N7    1 
ATOM   7249  C  C5    . A   A 1  339  ? 176.294 142.794 137.921 1.00 101.79 ?  339  A   A C5    1 
ATOM   7250  C  C6    . A   A 1  339  ? 174.929 143.043 138.157 1.00 101.79 ?  339  A   A C6    1 
ATOM   7251  N  N6    . A   A 1  339  ? 174.210 143.930 137.466 1.00 101.79 ?  339  A   A N6    1 
ATOM   7252  N  N1    . A   A 1  339  ? 174.318 142.341 139.140 1.00 101.79 ?  339  A   A N1    1 
ATOM   7253  C  C2    . A   A 1  339  ? 175.030 141.447 139.840 1.00 101.79 ?  339  A   A C2    1 
ATOM   7254  N  N3    . A   A 1  339  ? 176.317 141.127 139.710 1.00 101.79 ?  339  A   A N3    1 
ATOM   7255  C  C4    . A   A 1  339  ? 176.895 141.841 138.726 1.00 101.79 ?  339  A   A C4    1 
ATOM   7256  P  P     . U   A 1  340  ? 180.049 137.472 135.542 1.00 132.06 ?  340  U   A P     1 
ATOM   7257  O  OP1   . U   A 1  340  ? 181.010 136.411 135.147 1.00 132.06 ?  340  U   A OP1   1 
ATOM   7258  O  OP2   . U   A 1  340  ? 179.627 138.488 134.544 1.00 132.06 ?  340  U   A OP2   1 
ATOM   7259  O  "O5'" . U   A 1  340  ? 178.739 136.763 136.107 1.00 132.06 ?  340  U   A "O5'" 1 
ATOM   7260  C  "C5'" . U   A 1  340  ? 178.807 135.886 137.222 1.00 132.06 ?  340  U   A "C5'" 1 
ATOM   7261  C  "C4'" . U   A 1  340  ? 177.449 135.680 137.843 1.00 132.06 ?  340  U   A "C4'" 1 
ATOM   7262  O  "O4'" . U   A 1  340  ? 176.886 136.965 138.218 1.00 132.06 ?  340  U   A "O4'" 1 
ATOM   7263  C  "C3'" . U   A 1  340  ? 176.393 135.063 136.940 1.00 132.06 ?  340  U   A "C3'" 1 
ATOM   7264  O  "O3'" . U   A 1  340  ? 176.493 133.652 136.859 1.00 132.06 ?  340  U   A "O3'" 1 
ATOM   7265  C  "C2'" . U   A 1  340  ? 175.090 135.549 137.564 1.00 132.06 ?  340  U   A "C2'" 1 
ATOM   7266  O  "O2'" . U   A 1  340  ? 174.748 134.757 138.691 1.00 132.06 ?  340  U   A "O2'" 1 
ATOM   7267  C  "C1'" . U   A 1  340  ? 175.483 136.945 138.055 1.00 132.06 ?  340  U   A "C1'" 1 
ATOM   7268  N  N1    . U   A 1  340  ? 175.090 138.022 137.111 1.00 132.06 ?  340  U   A N1    1 
ATOM   7269  C  C2    . U   A 1  340  ? 173.781 138.474 137.148 1.00 132.06 ?  340  U   A C2    1 
ATOM   7270  O  O2    . U   A 1  340  ? 172.937 138.029 137.908 1.00 132.06 ?  340  U   A O2    1 
ATOM   7271  N  N3    . U   A 1  340  ? 173.484 139.473 136.255 1.00 132.06 ?  340  U   A N3    1 
ATOM   7272  C  C4    . U   A 1  340  ? 174.339 140.063 135.347 1.00 132.06 ?  340  U   A C4    1 
ATOM   7273  O  O4    . U   A 1  340  ? 173.918 140.954 134.607 1.00 132.06 ?  340  U   A O4    1 
ATOM   7274  C  C5    . U   A 1  340  ? 175.673 139.549 135.369 1.00 132.06 ?  340  U   A C5    1 
ATOM   7275  C  C6    . U   A 1  340  ? 175.992 138.578 136.229 1.00 132.06 ?  340  U   A C6    1 
ATOM   7276  P  P     . U   A 1  341  ? 176.277 132.903 135.454 1.00 152.56 ?  341  U   A P     1 
ATOM   7277  O  OP1   . U   A 1  341  ? 176.750 131.503 135.602 1.00 152.56 ?  341  U   A OP1   1 
ATOM   7278  O  OP2   . U   A 1  341  ? 176.846 133.761 134.383 1.00 152.56 ?  341  U   A OP2   1 
ATOM   7279  O  "O5'" . U   A 1  341  ? 174.695 132.872 135.273 1.00 152.56 ?  341  U   A "O5'" 1 
ATOM   7280  C  "C5'" . U   A 1  341  ? 173.862 132.237 136.232 1.00 152.56 ?  341  U   A "C5'" 1 
ATOM   7281  C  "C4'" . U   A 1  341  ? 172.409 132.565 136.004 1.00 152.56 ?  341  U   A "C4'" 1 
ATOM   7282  O  "O4'" . U   A 1  341  ? 172.214 134.001 136.086 1.00 152.56 ?  341  U   A "O4'" 1 
ATOM   7283  C  "C3'" . U   A 1  341  ? 171.850 132.194 134.639 1.00 152.56 ?  341  U   A "C3'" 1 
ATOM   7284  O  "O3'" . U   A 1  341  ? 171.492 130.827 134.541 1.00 152.56 ?  341  U   A "O3'" 1 
ATOM   7285  C  "C2'" . U   A 1  341  ? 170.670 133.147 134.489 1.00 152.56 ?  341  U   A "C2'" 1 
ATOM   7286  O  "O2'" . U   A 1  341  ? 169.543 132.668 135.207 1.00 152.56 ?  341  U   A "O2'" 1 
ATOM   7287  C  "C1'" . U   A 1  341  ? 171.194 134.402 135.194 1.00 152.56 ?  341  U   A "C1'" 1 
ATOM   7288  N  N1    . U   A 1  341  ? 171.743 135.407 134.249 1.00 152.56 ?  341  U   A N1    1 
ATOM   7289  C  C2    . U   A 1  341  ? 170.850 136.253 133.613 1.00 152.56 ?  341  U   A C2    1 
ATOM   7290  O  O2    . U   A 1  341  ? 169.643 136.210 133.785 1.00 152.56 ?  341  U   A O2    1 
ATOM   7291  N  N3    . U   A 1  341  ? 171.419 137.164 132.756 1.00 152.56 ?  341  U   A N3    1 
ATOM   7292  C  C4    . U   A 1  341  ? 172.760 137.319 132.473 1.00 152.56 ?  341  U   A C4    1 
ATOM   7293  O  O4    . U   A 1  341  ? 173.115 138.188 131.675 1.00 152.56 ?  341  U   A O4    1 
ATOM   7294  C  C5    . U   A 1  341  ? 173.621 136.415 133.169 1.00 152.56 ?  341  U   A C5    1 
ATOM   7295  C  C6    . U   A 1  341  ? 173.096 135.519 134.012 1.00 152.56 ?  341  U   A C6    1 
ATOM   7296  N  N     . LYS B 2  100  ? 193.473 191.309 223.069 1.00 108.72 ?  100  LYS B N     1 
ATOM   7297  C  CA    . LYS B 2  100  ? 192.188 191.623 222.457 1.00 108.72 ?  100  LYS B CA    1 
ATOM   7298  C  C     . LYS B 2  100  ? 192.013 190.888 221.132 1.00 108.72 ?  100  LYS B C     1 
ATOM   7299  O  O     . LYS B 2  100  ? 191.376 191.400 220.211 1.00 108.72 ?  100  LYS B O     1 
ATOM   7300  C  CB    . LYS B 2  100  ? 192.050 193.131 222.236 1.00 108.72 ?  100  LYS B CB    1 
ATOM   7301  C  CG    . LYS B 2  100  ? 191.938 193.947 223.513 1.00 108.72 ?  100  LYS B CG    1 
ATOM   7302  C  CD    . LYS B 2  100  ? 191.768 195.426 223.201 1.00 108.72 ?  100  LYS B CD    1 
ATOM   7303  C  CE    . LYS B 2  100  ? 191.672 196.255 224.472 1.00 108.72 ?  100  LYS B CE    1 
ATOM   7304  N  NZ    . LYS B 2  100  ? 191.510 197.707 224.179 1.00 108.72 ?  100  LYS B NZ    1 
ATOM   7305  N  N     . TYR B 2  101  ? 192.583 189.685 221.039 1.00 103.23 ?  101  TYR B N     1 
ATOM   7306  C  CA    . TYR B 2  101  ? 192.472 188.912 219.806 1.00 103.23 ?  101  TYR B CA    1 
ATOM   7307  C  C     . TYR B 2  101  ? 191.085 188.296 219.668 1.00 103.23 ?  101  TYR B C     1 
ATOM   7308  O  O     . TYR B 2  101  ? 190.563 188.162 218.555 1.00 103.23 ?  101  TYR B O     1 
ATOM   7309  C  CB    . TYR B 2  101  ? 193.552 187.831 219.761 1.00 103.23 ?  101  TYR B CB    1 
ATOM   7310  C  CG    . TYR B 2  101  ? 193.524 187.012 218.491 1.00 103.23 ?  101  TYR B CG    1 
ATOM   7311  C  CD1   . TYR B 2  101  ? 193.973 187.548 217.289 1.00 103.23 ?  101  TYR B CD1   1 
ATOM   7312  C  CD2   . TYR B 2  101  ? 193.050 185.704 218.492 1.00 103.23 ?  101  TYR B CD2   1 
ATOM   7313  C  CE1   . TYR B 2  101  ? 193.948 186.807 216.123 1.00 103.23 ?  101  TYR B CE1   1 
ATOM   7314  C  CE2   . TYR B 2  101  ? 193.022 184.953 217.330 1.00 103.23 ?  101  TYR B CE2   1 
ATOM   7315  C  CZ    . TYR B 2  101  ? 193.472 185.512 216.150 1.00 103.23 ?  101  TYR B CZ    1 
ATOM   7316  O  OH    . TYR B 2  101  ? 193.450 184.773 214.990 1.00 103.23 ?  101  TYR B OH    1 
ATOM   7317  N  N     . ILE B 2  102  ? 190.476 187.909 220.792 1.00 105.96 ?  102  ILE B N     1 
ATOM   7318  C  CA    . ILE B 2  102  ? 189.114 187.382 220.762 1.00 105.96 ?  102  ILE B CA    1 
ATOM   7319  C  C     . ILE B 2  102  ? 188.110 188.482 220.438 1.00 105.96 ?  102  ILE B C     1 
ATOM   7320  O  O     . ILE B 2  102  ? 187.033 188.211 219.892 1.00 105.96 ?  102  ILE B O     1 
ATOM   7321  C  CB    . ILE B 2  102  ? 188.796 186.663 222.091 1.00 105.96 ?  102  ILE B CB    1 
ATOM   7322  C  CG1   . ILE B 2  102  ? 189.177 187.517 223.311 1.00 105.96 ?  102  ILE B CG1   1 
ATOM   7323  C  CG2   . ILE B 2  102  ? 189.485 185.308 222.146 1.00 105.96 ?  102  ILE B CG2   1 
ATOM   7324  C  CD1   . ILE B 2  102  ? 188.055 188.362 223.901 1.00 105.96 ?  102  ILE B CD1   1 
ATOM   7325  N  N     . THR B 2  103  ? 188.436 189.733 220.770 1.00 104.78 ?  103  THR B N     1 
ATOM   7326  C  CA    . THR B 2  103  ? 187.578 190.851 220.393 1.00 104.78 ?  103  THR B CA    1 
ATOM   7327  C  C     . THR B 2  103  ? 187.776 191.220 218.926 1.00 104.78 ?  103  THR B C     1 
ATOM   7328  O  O     . THR B 2  103  ? 186.801 191.454 218.202 1.00 104.78 ?  103  THR B O     1 
ATOM   7329  C  CB    . THR B 2  103  ? 187.861 192.050 221.302 1.00 104.78 ?  103  THR B CB    1 
ATOM   7330  O  OG1   . THR B 2  103  ? 187.647 191.675 222.668 1.00 104.78 ?  103  THR B OG1   1 
ATOM   7331  C  CG2   . THR B 2  103  ? 186.949 193.224 220.965 1.00 104.78 ?  103  THR B CG2   1 
ATOM   7332  N  N     . ALA B 2  104  ? 189.032 191.251 218.467 1.00 102.40 ?  104  ALA B N     1 
ATOM   7333  C  CA    . ALA B 2  104  ? 189.327 191.652 217.094 1.00 102.40 ?  104  ALA B CA    1 
ATOM   7334  C  C     . ALA B 2  104  ? 188.887 190.600 216.081 1.00 102.40 ?  104  ALA B C     1 
ATOM   7335  O  O     . ALA B 2  104  ? 188.609 190.937 214.925 1.00 102.40 ?  104  ALA B O     1 
ATOM   7336  C  CB    . ALA B 2  104  ? 190.820 191.942 216.940 1.00 102.40 ?  104  ALA B CB    1 
ATOM   7337  N  N     . SER B 2  105  ? 188.818 189.330 216.489 1.00 101.68 ?  105  SER B N     1 
ATOM   7338  C  CA    . SER B 2  105  ? 188.312 188.294 215.596 1.00 101.68 ?  105  SER B CA    1 
ATOM   7339  C  C     . SER B 2  105  ? 186.801 188.369 215.424 1.00 101.68 ?  105  SER B C     1 
ATOM   7340  O  O     . SER B 2  105  ? 186.272 187.813 214.456 1.00 101.68 ?  105  SER B O     1 
ATOM   7341  C  CB    . SER B 2  105  ? 188.707 186.909 216.111 1.00 101.68 ?  105  SER B CB    1 
ATOM   7342  O  OG    . SER B 2  105  ? 190.114 186.743 216.100 1.00 101.68 ?  105  SER B OG    1 
ATOM   7343  N  N     . THR B 2  106  ? 186.099 189.041 216.339 1.00 101.15 ?  106  THR B N     1 
ATOM   7344  C  CA    . THR B 2  106  ? 184.653 189.184 216.220 1.00 101.15 ?  106  THR B CA    1 
ATOM   7345  C  C     . THR B 2  106  ? 184.288 190.191 215.133 1.00 101.15 ?  106  THR B C     1 
ATOM   7346  O  O     . THR B 2  106  ? 183.306 189.996 214.407 1.00 101.15 ?  106  THR B O     1 
ATOM   7347  C  CB    . THR B 2  106  ? 184.062 189.593 217.574 1.00 101.15 ?  106  THR B CB    1 
ATOM   7348  O  OG1   . THR B 2  106  ? 184.477 188.655 218.574 1.00 101.15 ?  106  THR B OG1   1 
ATOM   7349  C  CG2   . THR B 2  106  ? 182.538 189.605 217.532 1.00 101.15 ?  106  THR B CG2   1 
ATOM   7350  N  N     . PHE B 2  107  ? 185.089 191.254 214.987 1.00 99.26  ?  107  PHE B N     1 
ATOM   7351  C  CA    . PHE B 2  107  ? 184.831 192.260 213.958 1.00 99.26  ?  107  PHE B CA    1 
ATOM   7352  C  C     . PHE B 2  107  ? 185.046 191.691 212.560 1.00 99.26  ?  107  PHE B C     1 
ATOM   7353  O  O     . PHE B 2  107  ? 184.373 192.090 211.603 1.00 99.26  ?  107  PHE B O     1 
ATOM   7354  C  CB    . PHE B 2  107  ? 185.726 193.482 214.174 1.00 99.26  ?  107  PHE B CB    1 
ATOM   7355  C  CG    . PHE B 2  107  ? 185.408 194.261 215.418 1.00 99.26  ?  107  PHE B CG    1 
ATOM   7356  C  CD1   . PHE B 2  107  ? 184.335 195.139 215.448 1.00 99.26  ?  107  PHE B CD1   1 
ATOM   7357  C  CD2   . PHE B 2  107  ? 186.197 194.133 216.551 1.00 99.26  ?  107  PHE B CD2   1 
ATOM   7358  C  CE1   . PHE B 2  107  ? 184.044 195.864 216.592 1.00 99.26  ?  107  PHE B CE1   1 
ATOM   7359  C  CE2   . PHE B 2  107  ? 185.913 194.853 217.699 1.00 99.26  ?  107  PHE B CE2   1 
ATOM   7360  C  CZ    . PHE B 2  107  ? 184.835 195.720 217.719 1.00 99.26  ?  107  PHE B CZ    1 
ATOM   7361  N  N     . ALA B 2  108  ? 185.989 190.756 212.422 1.00 93.13  ?  108  ALA B N     1 
ATOM   7362  C  CA    . ALA B 2  108  ? 186.242 190.149 211.120 1.00 93.13  ?  108  ALA B CA    1 
ATOM   7363  C  C     . ALA B 2  108  ? 185.151 189.152 210.751 1.00 93.13  ?  108  ALA B C     1 
ATOM   7364  O  O     . ALA B 2  108  ? 184.708 189.106 209.598 1.00 93.13  ?  108  ALA B O     1 
ATOM   7365  C  CB    . ALA B 2  108  ? 187.611 189.471 211.114 1.00 93.13  ?  108  ALA B CB    1 
ATOM   7366  N  N     . GLN B 2  109  ? 184.708 188.343 211.716 1.00 84.39  ?  109  GLN B N     1 
ATOM   7367  C  CA    . GLN B 2  109  ? 183.677 187.350 211.440 1.00 84.39  ?  109  GLN B CA    1 
ATOM   7368  C  C     . GLN B 2  109  ? 182.293 187.973 211.310 1.00 84.39  ?  109  GLN B C     1 
ATOM   7369  O  O     . GLN B 2  109  ? 181.417 187.374 210.675 1.00 84.39  ?  109  GLN B O     1 
ATOM   7370  C  CB    . GLN B 2  109  ? 183.685 186.278 212.531 1.00 84.39  ?  109  GLN B CB    1 
ATOM   7371  C  CG    . GLN B 2  109  ? 184.948 185.427 212.527 1.00 84.39  ?  109  GLN B CG    1 
ATOM   7372  C  CD    . GLN B 2  109  ? 184.979 184.404 213.644 1.00 84.39  ?  109  GLN B CD    1 
ATOM   7373  O  OE1   . GLN B 2  109  ? 184.083 184.358 214.487 1.00 84.39  ?  109  GLN B OE1   1 
ATOM   7374  N  NE2   . GLN B 2  109  ? 186.018 183.578 213.659 1.00 84.39  ?  109  GLN B NE2   1 
ATOM   7375  N  N     . ALA B 2  110  ? 182.075 189.156 211.889 1.00 92.28  ?  110  ALA B N     1 
ATOM   7376  C  CA    . ALA B 2  110  ? 180.818 189.865 211.668 1.00 92.28  ?  110  ALA B CA    1 
ATOM   7377  C  C     . ALA B 2  110  ? 180.765 190.443 210.260 1.00 92.28  ?  110  ALA B C     1 
ATOM   7378  O  O     . ALA B 2  110  ? 179.733 190.370 209.584 1.00 92.28  ?  110  ALA B O     1 
ATOM   7379  C  CB    . ALA B 2  110  ? 180.640 190.968 212.711 1.00 92.28  ?  110  ALA B CB    1 
ATOM   7380  N  N     . ARG B 2  111  ? 181.879 191.020 209.799 1.00 91.27  ?  111  ARG B N     1 
ATOM   7381  C  CA    . ARG B 2  111  ? 181.938 191.549 208.440 1.00 91.27  ?  111  ARG B CA    1 
ATOM   7382  C  C     . ARG B 2  111  ? 181.982 190.435 207.402 1.00 91.27  ?  111  ARG B C     1 
ATOM   7383  O  O     . ARG B 2  111  ? 181.631 190.663 206.239 1.00 91.27  ?  111  ARG B O     1 
ATOM   7384  C  CB    . ARG B 2  111  ? 183.148 192.470 208.284 1.00 91.27  ?  111  ARG B CB    1 
ATOM   7385  C  CG    . ARG B 2  111  ? 183.039 193.772 209.060 1.00 91.27  ?  111  ARG B CG    1 
ATOM   7386  C  CD    . ARG B 2  111  ? 184.278 194.632 208.874 1.00 91.27  ?  111  ARG B CD    1 
ATOM   7387  N  NE    . ARG B 2  111  ? 184.197 195.878 209.631 1.00 91.27  ?  111  ARG B NE    1 
ATOM   7388  C  CZ    . ARG B 2  111  ? 185.172 196.779 209.693 1.00 91.27  ?  111  ARG B CZ    1 
ATOM   7389  N  NH1   . ARG B 2  111  ? 186.310 196.574 209.044 1.00 91.27  ?  111  ARG B NH1   1 
ATOM   7390  N  NH2   . ARG B 2  111  ? 185.010 197.884 210.407 1.00 91.27  ?  111  ARG B NH2   1 
ATOM   7391  N  N     . ALA B 2  112  ? 182.413 189.233 207.797 1.00 89.81  ?  112  ALA B N     1 
ATOM   7392  C  CA    . ALA B 2  112  ? 182.338 188.087 206.897 1.00 89.81  ?  112  ALA B CA    1 
ATOM   7393  C  C     . ALA B 2  112  ? 180.891 187.681 206.646 1.00 89.81  ?  112  ALA B C     1 
ATOM   7394  O  O     . ALA B 2  112  ? 180.561 187.164 205.573 1.00 89.81  ?  112  ALA B O     1 
ATOM   7395  C  CB    . ALA B 2  112  ? 183.137 186.916 207.467 1.00 89.81  ?  112  ALA B CB    1 
ATOM   7396  N  N     . ALA B 2  113  ? 180.013 187.907 207.627 1.00 88.00  ?  113  ALA B N     1 
ATOM   7397  C  CA    . ALA B 2  113  ? 178.588 187.683 207.422 1.00 88.00  ?  113  ALA B CA    1 
ATOM   7398  C  C     . ALA B 2  113  ? 177.910 188.865 206.741 1.00 88.00  ?  113  ALA B C     1 
ATOM   7399  O  O     . ALA B 2  113  ? 176.807 188.706 206.210 1.00 88.00  ?  113  ALA B O     1 
ATOM   7400  C  CB    . ALA B 2  113  ? 177.903 187.387 208.756 1.00 88.00  ?  113  ALA B CB    1 
ATOM   7401  N  N     . GLU B 2  114  ? 178.537 190.044 206.751 1.00 100.92 ?  114  GLU B N     1 
ATOM   7402  C  CA    . GLU B 2  114  ? 177.943 191.217 206.117 1.00 100.92 ?  114  GLU B CA    1 
ATOM   7403  C  C     . GLU B 2  114  ? 178.301 191.300 204.637 1.00 100.92 ?  114  GLU B C     1 
ATOM   7404  O  O     . GLU B 2  114  ? 177.427 191.532 203.795 1.00 100.92 ?  114  GLU B O     1 
ATOM   7405  C  CB    . GLU B 2  114  ? 178.386 192.492 206.837 1.00 100.92 ?  114  GLU B CB    1 
ATOM   7406  C  CG    . GLU B 2  114  ? 177.807 192.670 208.228 1.00 100.92 ?  114  GLU B CG    1 
ATOM   7407  C  CD    . GLU B 2  114  ? 178.304 193.935 208.901 1.00 100.92 ?  114  GLU B CD    1 
ATOM   7408  O  OE1   . GLU B 2  114  ? 179.187 194.606 208.326 1.00 100.92 ?  114  GLU B OE1   1 
ATOM   7409  O  OE2   . GLU B 2  114  ? 177.817 194.257 210.004 1.00 100.92 ?  114  GLU B OE2   1 
ATOM   7410  N  N     . ILE B 2  115  ? 179.584 191.124 204.308 1.00 94.33  ?  115  ILE B N     1 
ATOM   7411  C  CA    . ILE B 2  115  ? 180.043 191.286 202.930 1.00 94.33  ?  115  ILE B CA    1 
ATOM   7412  C  C     . ILE B 2  115  ? 179.537 190.142 202.055 1.00 94.33  ?  115  ILE B C     1 
ATOM   7413  O  O     . ILE B 2  115  ? 179.128 190.357 200.907 1.00 94.33  ?  115  ILE B O     1 
ATOM   7414  C  CB    . ILE B 2  115  ? 181.581 191.407 202.902 1.00 94.33  ?  115  ILE B CB    1 
ATOM   7415  C  CG1   . ILE B 2  115  ? 182.025 192.665 203.652 1.00 94.33  ?  115  ILE B CG1   1 
ATOM   7416  C  CG2   . ILE B 2  115  ? 182.120 191.454 201.477 1.00 94.33  ?  115  ILE B CG2   1 
ATOM   7417  C  CD1   . ILE B 2  115  ? 183.516 192.734 203.899 1.00 94.33  ?  115  ILE B CD1   1 
ATOM   7418  N  N     . SER B 2  116  ? 179.511 188.920 202.597 1.00 94.79  ?  116  SER B N     1 
ATOM   7419  C  CA    . SER B 2  116  ? 179.020 187.778 201.830 1.00 94.79  ?  116  SER B CA    1 
ATOM   7420  C  C     . SER B 2  116  ? 177.509 187.845 201.634 1.00 94.79  ?  116  SER B C     1 
ATOM   7421  O  O     . SER B 2  116  ? 176.973 187.264 200.683 1.00 94.79  ?  116  SER B O     1 
ATOM   7422  C  CB    . SER B 2  116  ? 179.414 186.473 202.520 1.00 94.79  ?  116  SER B CB    1 
ATOM   7423  O  OG    . SER B 2  116  ? 180.823 186.320 202.551 1.00 94.79  ?  116  SER B OG    1 
ATOM   7424  N  N     . ALA B 2  117  ? 176.803 188.550 202.522 1.00 99.72  ?  117  ALA B N     1 
ATOM   7425  C  CA    . ALA B 2  117  ? 175.371 188.744 202.330 1.00 99.72  ?  117  ALA B CA    1 
ATOM   7426  C  C     . ALA B 2  117  ? 175.082 189.886 201.364 1.00 99.72  ?  117  ALA B C     1 
ATOM   7427  O  O     . ALA B 2  117  ? 174.072 189.852 200.653 1.00 99.72  ?  117  ALA B O     1 
ATOM   7428  C  CB    . ALA B 2  117  ? 174.685 188.999 203.671 1.00 99.72  ?  117  ALA B CB    1 
ATOM   7429  N  N     . MET B 2  118  ? 175.947 190.902 201.323 1.00 106.85 ?  118  MET B N     1 
ATOM   7430  C  CA    . MET B 2  118  ? 175.744 192.006 200.390 1.00 106.85 ?  118  MET B CA    1 
ATOM   7431  C  C     . MET B 2  118  ? 176.259 191.666 198.997 1.00 106.85 ?  118  MET B C     1 
ATOM   7432  O  O     . MET B 2  118  ? 175.850 192.292 198.013 1.00 106.85 ?  118  MET B O     1 
ATOM   7433  C  CB    . MET B 2  118  ? 176.417 193.276 200.913 1.00 106.85 ?  118  MET B CB    1 
ATOM   7434  C  CG    . MET B 2  118  ? 175.751 193.871 202.144 1.00 106.85 ?  118  MET B CG    1 
ATOM   7435  S  SD    . MET B 2  118  ? 176.507 195.420 202.675 1.00 106.85 ?  118  MET B SD    1 
ATOM   7436  C  CE    . MET B 2  118  ? 178.027 194.826 203.413 1.00 106.85 ?  118  MET B CE    1 
ATOM   7437  N  N     . LEU B 2  119  ? 177.158 190.684 198.891 1.00 108.66 ?  119  LEU B N     1 
ATOM   7438  C  CA    . LEU B 2  119  ? 177.640 190.269 197.578 1.00 108.66 ?  119  LEU B CA    1 
ATOM   7439  C  C     . LEU B 2  119  ? 176.594 189.437 196.845 1.00 108.66 ?  119  LEU B C     1 
ATOM   7440  O  O     . LEU B 2  119  ? 176.608 189.374 195.611 1.00 108.66 ?  119  LEU B O     1 
ATOM   7441  C  CB    . LEU B 2  119  ? 178.960 189.501 197.726 1.00 108.66 ?  119  LEU B CB    1 
ATOM   7442  C  CG    . LEU B 2  119  ? 179.846 189.169 196.517 1.00 108.66 ?  119  LEU B CG    1 
ATOM   7443  C  CD1   . LEU B 2  119  ? 181.306 189.212 196.933 1.00 108.66 ?  119  LEU B CD1   1 
ATOM   7444  C  CD2   . LEU B 2  119  ? 179.536 187.801 195.921 1.00 108.66 ?  119  LEU B CD2   1 
ATOM   7445  N  N     . LYS B 2  120  ? 175.682 188.801 197.580 1.00 103.27 ?  120  LYS B N     1 
ATOM   7446  C  CA    . LYS B 2  120  ? 174.634 187.993 196.972 1.00 103.27 ?  120  LYS B CA    1 
ATOM   7447  C  C     . LYS B 2  120  ? 173.296 188.715 196.873 1.00 103.27 ?  120  LYS B C     1 
ATOM   7448  O  O     . LYS B 2  120  ? 172.427 188.268 196.118 1.00 103.27 ?  120  LYS B O     1 
ATOM   7449  C  CB    . LYS B 2  120  ? 174.445 186.690 197.758 1.00 103.27 ?  120  LYS B CB    1 
ATOM   7450  C  CG    . LYS B 2  120  ? 173.926 186.887 199.173 1.00 103.27 ?  120  LYS B CG    1 
ATOM   7451  C  CD    . LYS B 2  120  ? 173.780 185.564 199.903 1.00 103.27 ?  120  LYS B CD    1 
ATOM   7452  C  CE    . LYS B 2  120  ? 172.623 184.756 199.343 1.00 103.27 ?  120  LYS B CE    1 
ATOM   7453  N  NZ    . LYS B 2  120  ? 171.307 185.399 199.610 1.00 103.27 ?  120  LYS B NZ    1 
ATOM   7454  N  N     . ALA B 2  121  ? 173.107 189.811 197.611 1.00 115.67 ?  121  ALA B N     1 
ATOM   7455  C  CA    . ALA B 2  121  ? 171.832 190.521 197.565 1.00 115.67 ?  121  ALA B CA    1 
ATOM   7456  C  C     . ALA B 2  121  ? 171.824 191.599 196.487 1.00 115.67 ?  121  ALA B C     1 
ATOM   7457  O  O     . ALA B 2  121  ? 170.809 191.792 195.809 1.00 115.67 ?  121  ALA B O     1 
ATOM   7458  C  CB    . ALA B 2  121  ? 171.520 191.134 198.931 1.00 115.67 ?  121  ALA B CB    1 
ATOM   7459  N  N     . VAL B 2  122  ? 172.941 192.311 196.323 1.00 125.10 ?  122  VAL B N     1 
ATOM   7460  C  CA    . VAL B 2  122  ? 173.022 193.353 195.303 1.00 125.10 ?  122  VAL B CA    1 
ATOM   7461  C  C     . VAL B 2  122  ? 173.118 192.728 193.914 1.00 125.10 ?  122  VAL B C     1 
ATOM   7462  O  O     . VAL B 2  122  ? 172.558 193.250 192.940 1.00 125.10 ?  122  VAL B O     1 
ATOM   7463  C  CB    . VAL B 2  122  ? 174.211 194.287 195.610 1.00 125.10 ?  122  VAL B CB    1 
ATOM   7464  C  CG1   . VAL B 2  122  ? 174.369 195.377 194.553 1.00 125.10 ?  122  VAL B CG1   1 
ATOM   7465  C  CG2   . VAL B 2  122  ? 174.045 194.913 196.987 1.00 125.10 ?  122  VAL B CG2   1 
ATOM   7466  N  N     . THR B 2  123  ? 173.785 191.573 193.813 1.00 119.96 ?  123  THR B N     1 
ATOM   7467  C  CA    . THR B 2  123  ? 174.010 190.932 192.520 1.00 119.96 ?  123  THR B CA    1 
ATOM   7468  C  C     . THR B 2  123  ? 172.714 190.362 191.944 1.00 119.96 ?  123  THR B C     1 
ATOM   7469  O  O     . THR B 2  123  ? 172.549 190.311 190.718 1.00 119.96 ?  123  THR B O     1 
ATOM   7470  C  CB    . THR B 2  123  ? 175.079 189.844 192.675 1.00 119.96 ?  123  THR B CB    1 
ATOM   7471  O  OG1   . THR B 2  123  ? 176.206 190.391 193.371 1.00 119.96 ?  123  THR B OG1   1 
ATOM   7472  C  CG2   . THR B 2  123  ? 175.576 189.354 191.320 1.00 119.96 ?  123  THR B CG2   1 
ATOM   7473  N  N     . GLN B 2  124  ? 171.773 189.961 192.807 1.00 124.96 ?  124  GLN B N     1 
ATOM   7474  C  CA    . GLN B 2  124  ? 170.446 189.577 192.331 1.00 124.96 ?  124  GLN B CA    1 
ATOM   7475  C  C     . GLN B 2  124  ? 169.683 190.770 191.769 1.00 124.96 ?  124  GLN B C     1 
ATOM   7476  O  O     . GLN B 2  124  ? 168.911 190.619 190.815 1.00 124.96 ?  124  GLN B O     1 
ATOM   7477  C  CB    . GLN B 2  124  ? 169.642 188.924 193.458 1.00 124.96 ?  124  GLN B CB    1 
ATOM   7478  C  CG    . GLN B 2  124  ? 170.131 187.546 193.868 1.00 124.96 ?  124  GLN B CG    1 
ATOM   7479  C  CD    . GLN B 2  124  ? 169.322 186.955 195.008 1.00 124.96 ?  124  GLN B CD    1 
ATOM   7480  O  OE1   . GLN B 2  124  ? 168.427 187.603 195.550 1.00 124.96 ?  124  GLN B OE1   1 
ATOM   7481  N  NE2   . GLN B 2  124  ? 169.634 185.717 195.376 1.00 124.96 ?  124  GLN B NE2   1 
ATOM   7482  N  N     . LYS B 2  125  ? 169.885 191.956 192.340 1.00 138.76 ?  125  LYS B N     1 
ATOM   7483  C  CA    . LYS B 2  125  ? 169.261 193.170 191.834 1.00 138.76 ?  125  LYS B CA    1 
ATOM   7484  C  C     . LYS B 2  125  ? 170.058 193.825 190.715 1.00 138.76 ?  125  LYS B C     1 
ATOM   7485  O  O     . LYS B 2  125  ? 169.515 194.679 190.006 1.00 138.76 ?  125  LYS B O     1 
ATOM   7486  C  CB    . LYS B 2  125  ? 169.062 194.177 192.973 1.00 138.76 ?  125  LYS B CB    1 
ATOM   7487  C  CG    . LYS B 2  125  ? 168.037 193.747 194.010 1.00 138.76 ?  125  LYS B CG    1 
ATOM   7488  C  CD    . LYS B 2  125  ? 167.873 194.800 195.093 1.00 138.76 ?  125  LYS B CD    1 
ATOM   7489  C  CE    . LYS B 2  125  ? 166.867 194.361 196.145 1.00 138.76 ?  125  LYS B CE    1 
ATOM   7490  N  NZ    . LYS B 2  125  ? 166.708 195.383 197.217 1.00 138.76 ?  125  LYS B NZ    1 
ATOM   7491  N  N     . SER B 2  126  ? 171.326 193.449 190.540 1.00 148.72 ?  126  SER B N     1 
ATOM   7492  C  CA    . SER B 2  126  ? 172.138 194.018 189.464 1.00 148.72 ?  126  SER B CA    1 
ATOM   7493  C  C     . SER B 2  126  ? 171.870 193.302 188.143 1.00 148.72 ?  126  SER B C     1 
ATOM   7494  O  O     . SER B 2  126  ? 171.425 193.924 187.172 1.00 148.72 ?  126  SER B O     1 
ATOM   7495  C  CB    . SER B 2  126  ? 173.623 193.951 189.835 1.00 148.72 ?  126  SER B CB    1 
ATOM   7496  O  OG    . SER B 2  126  ? 174.432 194.464 188.792 1.00 148.72 ?  126  SER B OG    1 
ATOM   7497  N  N     . SER B 2  127  ? 172.132 191.990 188.113 1.00 152.78 ?  127  SER B N     1 
ATOM   7498  C  CA    . SER B 2  127  ? 171.989 191.114 186.942 1.00 152.78 ?  127  SER B CA    1 
ATOM   7499  C  C     . SER B 2  127  ? 172.800 191.637 185.753 1.00 152.78 ?  127  SER B C     1 
ATOM   7500  O  O     . SER B 2  127  ? 172.255 192.060 184.730 1.00 152.78 ?  127  SER B O     1 
ATOM   7501  C  CB    . SER B 2  127  ? 170.516 190.911 186.569 1.00 152.78 ?  127  SER B CB    1 
ATOM   7502  O  OG    . SER B 2  127  ? 170.390 190.067 185.438 1.00 152.78 ?  127  SER B OG    1 
ATOM   7503  N  N     . ASN B 2  128  ? 174.128 191.620 185.941 1.00 155.03 ?  128  ASN B N     1 
ATOM   7504  C  CA    . ASN B 2  128  ? 175.129 192.118 184.985 1.00 155.03 ?  128  ASN B CA    1 
ATOM   7505  C  C     . ASN B 2  128  ? 174.924 193.595 184.653 1.00 155.03 ?  128  ASN B C     1 
ATOM   7506  O  O     . ASN B 2  128  ? 175.187 194.021 183.523 1.00 155.03 ?  128  ASN B O     1 
ATOM   7507  C  CB    . ASN B 2  128  ? 175.166 191.277 183.701 1.00 155.03 ?  128  ASN B CB    1 
ATOM   7508  C  CG    . ASN B 2  128  ? 175.723 189.886 183.930 1.00 155.03 ?  128  ASN B CG    1 
ATOM   7509  O  OD1   . ASN B 2  128  ? 176.705 189.708 184.652 1.00 155.03 ?  128  ASN B OD1   1 
ATOM   7510  N  ND2   . ASN B 2  128  ? 175.097 188.890 183.315 1.00 155.03 ?  128  ASN B ND2   1 
ATOM   7511  N  N     . SER B 2  129  ? 174.472 194.367 185.655 1.00 164.31 ?  129  SER B N     1 
ATOM   7512  C  CA    . SER B 2  129  ? 174.204 195.811 185.561 1.00 164.31 ?  129  SER B CA    1 
ATOM   7513  C  C     . SER B 2  129  ? 173.231 196.143 184.430 1.00 164.31 ?  129  SER B C     1 
ATOM   7514  O  O     . SER B 2  129  ? 173.405 197.123 183.702 1.00 164.31 ?  129  SER B O     1 
ATOM   7515  C  CB    . SER B 2  129  ? 175.499 196.622 185.421 1.00 164.31 ?  129  SER B CB    1 
ATOM   7516  O  OG    . SER B 2  129  ? 176.120 196.413 184.164 1.00 164.31 ?  129  SER B OG    1 
ATOM   7517  N  N     . LEU B 2  130  ? 172.196 195.320 184.282 1.00 164.65 ?  130  LEU B N     1 
ATOM   7518  C  CA    . LEU B 2  130  ? 171.209 195.479 183.225 1.00 164.65 ?  130  LEU B CA    1 
ATOM   7519  C  C     . LEU B 2  130  ? 169.846 195.788 183.828 1.00 164.65 ?  130  LEU B C     1 
ATOM   7520  O  O     . LEU B 2  130  ? 169.468 195.225 184.860 1.00 164.65 ?  130  LEU B O     1 
ATOM   7521  C  CB    . LEU B 2  130  ? 171.124 194.221 182.355 1.00 164.65 ?  130  LEU B CB    1 
ATOM   7522  C  CG    . LEU B 2  130  ? 172.375 193.900 181.534 1.00 164.65 ?  130  LEU B CG    1 
ATOM   7523  C  CD1   . LEU B 2  130  ? 172.228 192.562 180.829 1.00 164.65 ?  130  LEU B CD1   1 
ATOM   7524  C  CD2   . LEU B 2  130  ? 172.660 195.009 180.532 1.00 164.65 ?  130  LEU B CD2   1 
ATOM   7525  N  N     . VAL B 2  131  ? 169.113 196.690 183.173 1.00 157.86 ?  131  VAL B N     1 
ATOM   7526  C  CA    . VAL B 2  131  ? 167.786 197.064 183.651 1.00 157.86 ?  131  VAL B CA    1 
ATOM   7527  C  C     . VAL B 2  131  ? 166.737 196.096 183.112 1.00 157.86 ?  131  VAL B C     1 
ATOM   7528  O  O     . VAL B 2  131  ? 165.790 195.726 183.818 1.00 157.86 ?  131  VAL B O     1 
ATOM   7529  C  CB    . VAL B 2  131  ? 167.489 198.526 183.263 1.00 157.86 ?  131  VAL B CB    1 
ATOM   7530  C  CG1   . VAL B 2  131  ? 166.100 198.960 183.721 1.00 157.86 ?  131  VAL B CG1   1 
ATOM   7531  C  CG2   . VAL B 2  131  ? 168.554 199.446 183.839 1.00 157.86 ?  131  VAL B CG2   1 
ATOM   7532  N  N     . PHE B 2  132  ? 166.910 195.641 181.870 1.00 146.10 ?  132  PHE B N     1 
ATOM   7533  C  CA    . PHE B 2  132  ? 165.970 194.739 181.214 1.00 146.10 ?  132  PHE B CA    1 
ATOM   7534  C  C     . PHE B 2  132  ? 165.943 193.342 181.823 1.00 146.10 ?  132  PHE B C     1 
ATOM   7535  O  O     . PHE B 2  132  ? 164.950 192.628 181.644 1.00 146.10 ?  132  PHE B O     1 
ATOM   7536  C  CB    . PHE B 2  132  ? 166.299 194.634 179.720 1.00 146.10 ?  132  PHE B CB    1 
ATOM   7537  C  CG    . PHE B 2  132  ? 165.972 195.873 178.929 1.00 146.10 ?  132  PHE B CG    1 
ATOM   7538  C  CD1   . PHE B 2  132  ? 165.096 196.829 179.426 1.00 146.10 ?  132  PHE B CD1   1 
ATOM   7539  C  CD2   . PHE B 2  132  ? 166.549 196.082 177.685 1.00 146.10 ?  132  PHE B CD2   1 
ATOM   7540  C  CE1   . PHE B 2  132  ? 164.799 197.967 178.696 1.00 146.10 ?  132  PHE B CE1   1 
ATOM   7541  C  CE2   . PHE B 2  132  ? 166.258 197.218 176.949 1.00 146.10 ?  132  PHE B CE2   1 
ATOM   7542  C  CZ    . PHE B 2  132  ? 165.382 198.161 177.455 1.00 146.10 ?  132  PHE B CZ    1 
ATOM   7543  N  N     . GLN B 2  133  ? 166.995 192.933 182.536 1.00 142.13 ?  133  GLN B N     1 
ATOM   7544  C  CA    . GLN B 2  133  ? 167.022 191.637 183.198 1.00 142.13 ?  133  GLN B CA    1 
ATOM   7545  C  C     . GLN B 2  133  ? 166.778 191.715 184.697 1.00 142.13 ?  133  GLN B C     1 
ATOM   7546  O  O     . GLN B 2  133  ? 166.857 190.684 185.372 1.00 142.13 ?  133  GLN B O     1 
ATOM   7547  C  CB    . GLN B 2  133  ? 168.364 190.933 182.945 1.00 142.13 ?  133  GLN B CB    1 
ATOM   7548  C  CG    . GLN B 2  133  ? 168.587 190.523 181.497 1.00 142.13 ?  133  GLN B CG    1 
ATOM   7549  C  CD    . GLN B 2  133  ? 169.921 189.832 181.283 1.00 142.13 ?  133  GLN B CD    1 
ATOM   7550  O  OE1   . GLN B 2  133  ? 170.725 189.712 182.207 1.00 142.13 ?  133  GLN B OE1   1 
ATOM   7551  N  NE2   . GLN B 2  133  ? 170.161 189.374 180.060 1.00 142.13 ?  133  GLN B NE2   1 
ATOM   7552  N  N     . THR B 2  134  ? 166.492 192.901 185.227 1.00 136.75 ?  134  THR B N     1 
ATOM   7553  C  CA    . THR B 2  134  ? 166.142 193.095 186.627 1.00 136.75 ?  134  THR B CA    1 
ATOM   7554  C  C     . THR B 2  134  ? 164.686 192.703 186.899 1.00 136.75 ?  134  THR B C     1 
ATOM   7555  O  O     . THR B 2  134  ? 164.324 192.415 188.048 1.00 136.75 ?  134  THR B O     1 
ATOM   7556  C  CB    . THR B 2  134  ? 166.414 194.563 187.008 1.00 136.75 ?  134  THR B CB    1 
ATOM   7557  O  OG1   . THR B 2  134  ? 167.724 194.923 186.550 1.00 136.75 ?  134  THR B OG1   1 
ATOM   7558  C  CG2   . THR B 2  134  ? 166.393 194.789 188.521 1.00 136.75 ?  134  THR B CG2   1 
ATOM   7559  N  N     . LEU B 2  135  ? 163.866 192.627 185.849 1.00 117.78 ?  135  LEU B N     1 
ATOM   7560  C  CA    . LEU B 2  135  ? 162.454 192.297 185.967 1.00 117.78 ?  135  LEU B CA    1 
ATOM   7561  C  C     . LEU B 2  135  ? 162.277 190.841 186.403 1.00 117.78 ?  135  LEU B C     1 
ATOM   7562  O  O     . LEU B 2  135  ? 163.157 190.007 186.172 1.00 117.78 ?  135  LEU B O     1 
ATOM   7563  C  CB    . LEU B 2  135  ? 161.744 192.536 184.631 1.00 117.78 ?  135  LEU B CB    1 
ATOM   7564  C  CG    . LEU B 2  135  ? 161.370 193.956 184.175 1.00 117.78 ?  135  LEU B CG    1 
ATOM   7565  C  CD1   . LEU B 2  135  ? 162.565 194.751 183.649 1.00 117.78 ?  135  LEU B CD1   1 
ATOM   7566  C  CD2   . LEU B 2  135  ? 160.265 193.919 183.129 1.00 117.78 ?  135  LEU B CD2   1 
ATOM   7567  N  N     . PRO B 2  136  ? 161.165 190.521 187.077 1.00 96.67  ?  136  PRO B N     1 
ATOM   7568  C  CA    . PRO B 2  136  ? 160.900 189.122 187.438 1.00 96.67  ?  136  PRO B CA    1 
ATOM   7569  C  C     . PRO B 2  136  ? 160.663 188.252 186.212 1.00 96.67  ?  136  PRO B C     1 
ATOM   7570  O  O     . PRO B 2  136  ? 160.243 188.727 185.155 1.00 96.67  ?  136  PRO B O     1 
ATOM   7571  C  CB    . PRO B 2  136  ? 159.642 189.212 188.312 1.00 96.67  ?  136  PRO B CB    1 
ATOM   7572  C  CG    . PRO B 2  136  ? 159.667 190.597 188.858 1.00 96.67  ?  136  PRO B CG    1 
ATOM   7573  C  CD    . PRO B 2  136  ? 160.239 191.442 187.760 1.00 96.67  ?  136  PRO B CD    1 
ATOM   7574  N  N     . ARG B 2  137  ? 160.936 186.953 186.377 1.00 79.76  ?  137  ARG B N     1 
ATOM   7575  C  CA    . ARG B 2  137  ? 160.970 186.029 185.244 1.00 79.76  ?  137  ARG B CA    1 
ATOM   7576  C  C     . ARG B 2  137  ? 159.580 185.740 184.690 1.00 79.76  ?  137  ARG B C     1 
ATOM   7577  O  O     . ARG B 2  137  ? 159.449 185.341 183.527 1.00 79.76  ?  137  ARG B O     1 
ATOM   7578  C  CB    . ARG B 2  137  ? 161.659 184.733 185.662 1.00 79.76  ?  137  ARG B CB    1 
ATOM   7579  C  CG    . ARG B 2  137  ? 163.125 184.924 186.008 1.00 79.76  ?  137  ARG B CG    1 
ATOM   7580  C  CD    . ARG B 2  137  ? 163.766 183.634 186.477 1.00 79.76  ?  137  ARG B CD    1 
ATOM   7581  N  NE    . ARG B 2  137  ? 165.168 183.830 186.832 1.00 79.76  ?  137  ARG B NE    1 
ATOM   7582  C  CZ    . ARG B 2  137  ? 165.952 182.880 187.328 1.00 79.76  ?  137  ARG B CZ    1 
ATOM   7583  N  NH1   . ARG B 2  137  ? 167.216 183.148 187.624 1.00 79.76  ?  137  ARG B NH1   1 
ATOM   7584  N  NH2   . ARG B 2  137  ? 165.471 181.661 187.530 1.00 79.76  ?  137  ARG B NH2   1 
ATOM   7585  N  N     . HIS B 2  138  ? 158.536 185.931 185.498 1.00 80.99  ?  138  HIS B N     1 
ATOM   7586  C  CA    . HIS B 2  138  ? 157.175 185.860 184.983 1.00 80.99  ?  138  HIS B CA    1 
ATOM   7587  C  C     . HIS B 2  138  ? 156.825 187.088 184.150 1.00 80.99  ?  138  HIS B C     1 
ATOM   7588  O  O     . HIS B 2  138  ? 155.907 187.028 183.324 1.00 80.99  ?  138  HIS B O     1 
ATOM   7589  C  CB    . HIS B 2  138  ? 156.191 185.696 186.148 1.00 80.99  ?  138  HIS B CB    1 
ATOM   7590  C  CG    . HIS B 2  138  ? 154.765 185.521 185.726 1.00 80.99  ?  138  HIS B CG    1 
ATOM   7591  N  ND1   . HIS B 2  138  ? 154.285 184.346 185.188 1.00 80.99  ?  138  HIS B ND1   1 
ATOM   7592  C  CD2   . HIS B 2  138  ? 153.714 186.374 185.762 1.00 80.99  ?  138  HIS B CD2   1 
ATOM   7593  C  CE1   . HIS B 2  138  ? 153.000 184.482 184.913 1.00 80.99  ?  138  HIS B CE1   1 
ATOM   7594  N  NE2   . HIS B 2  138  ? 152.629 185.703 185.251 1.00 80.99  ?  138  HIS B NE2   1 
ATOM   7595  N  N     . MET B 2  139  ? 157.561 188.182 184.320 1.00 91.51  ?  139  MET B N     1 
ATOM   7596  C  CA    . MET B 2  139  ? 157.253 189.463 183.698 1.00 91.51  ?  139  MET B CA    1 
ATOM   7597  C  C     . MET B 2  139  ? 158.343 189.838 182.687 1.00 91.51  ?  139  MET B C     1 
ATOM   7598  O  O     . MET B 2  139  ? 158.825 190.971 182.638 1.00 91.51  ?  139  MET B O     1 
ATOM   7599  C  CB    . MET B 2  139  ? 157.065 190.527 184.782 1.00 91.51  ?  139  MET B CB    1 
ATOM   7600  C  CG    . MET B 2  139  ? 156.311 191.789 184.378 1.00 91.51  ?  139  MET B CG    1 
ATOM   7601  S  SD    . MET B 2  139  ? 156.099 192.933 185.753 1.00 91.51  ?  139  MET B SD    1 
ATOM   7602  C  CE    . MET B 2  139  ? 157.771 193.546 185.942 1.00 91.51  ?  139  MET B CE    1 
ATOM   7603  N  N     . ARG B 2  140  ? 158.774 188.868 181.883 1.00 89.12  ?  140  ARG B N     1 
ATOM   7604  C  CA    . ARG B 2  140  ? 159.780 189.093 180.850 1.00 89.12  ?  140  ARG B CA    1 
ATOM   7605  C  C     . ARG B 2  140  ? 159.144 188.904 179.481 1.00 89.12  ?  140  ARG B C     1 
ATOM   7606  O  O     . ARG B 2  140  ? 158.546 187.858 179.211 1.00 89.12  ?  140  ARG B O     1 
ATOM   7607  C  CB    . ARG B 2  140  ? 160.970 188.145 181.015 1.00 89.12  ?  140  ARG B CB    1 
ATOM   7608  C  CG    . ARG B 2  140  ? 161.781 188.364 182.276 1.00 89.12  ?  140  ARG B CG    1 
ATOM   7609  C  CD    . ARG B 2  140  ? 162.518 189.691 182.236 1.00 89.12  ?  140  ARG B CD    1 
ATOM   7610  N  NE    . ARG B 2  140  ? 163.460 189.763 181.124 1.00 89.12  ?  140  ARG B NE    1 
ATOM   7611  C  CZ    . ARG B 2  140  ? 164.716 189.331 181.178 1.00 89.12  ?  140  ARG B CZ    1 
ATOM   7612  N  NH1   . ARG B 2  140  ? 165.501 189.438 180.115 1.00 89.12  ?  140  ARG B NH1   1 
ATOM   7613  N  NH2   . ARG B 2  140  ? 165.190 188.794 182.295 1.00 89.12  ?  140  ARG B NH2   1 
ATOM   7614  N  N     . ARG B 2  141  ? 159.276 189.914 178.624 1.00 90.47  ?  141  ARG B N     1 
ATOM   7615  C  CA    . ARG B 2  141  ? 158.828 189.849 177.240 1.00 90.47  ?  141  ARG B CA    1 
ATOM   7616  C  C     . ARG B 2  141  ? 160.005 190.162 176.328 1.00 90.47  ?  141  ARG B C     1 
ATOM   7617  O  O     . ARG B 2  141  ? 160.748 191.119 176.568 1.00 90.47  ?  141  ARG B O     1 
ATOM   7618  C  CB    . ARG B 2  141  ? 157.672 190.827 176.961 1.00 90.47  ?  141  ARG B CB    1 
ATOM   7619  C  CG    . ARG B 2  141  ? 156.265 190.277 177.223 1.00 90.47  ?  141  ARG B CG    1 
ATOM   7620  C  CD    . ARG B 2  141  ? 155.947 190.167 178.707 1.00 90.47  ?  141  ARG B CD    1 
ATOM   7621  N  NE    . ARG B 2  141  ? 154.568 189.757 178.963 1.00 90.47  ?  141  ARG B NE    1 
ATOM   7622  C  CZ    . ARG B 2  141  ? 154.084 189.493 180.172 1.00 90.47  ?  141  ARG B CZ    1 
ATOM   7623  N  NH1   . ARG B 2  141  ? 152.820 189.126 180.319 1.00 90.47  ?  141  ARG B NH1   1 
ATOM   7624  N  NH2   . ARG B 2  141  ? 154.867 189.598 181.234 1.00 90.47  ?  141  ARG B NH2   1 
ATOM   7625  N  N     . ARG B 2  142  ? 160.176 189.352 175.282 1.00 94.16  ?  142  ARG B N     1 
ATOM   7626  C  CA    . ARG B 2  142  ? 161.305 189.490 174.368 1.00 94.16  ?  142  ARG B CA    1 
ATOM   7627  C  C     . ARG B 2  142  ? 161.102 190.585 173.328 1.00 94.16  ?  142  ARG B C     1 
ATOM   7628  O  O     . ARG B 2  142  ? 162.016 190.844 172.537 1.00 94.16  ?  142  ARG B O     1 
ATOM   7629  C  CB    . ARG B 2  142  ? 161.584 188.159 173.663 1.00 94.16  ?  142  ARG B CB    1 
ATOM   7630  C  CG    . ARG B 2  142  ? 160.479 187.701 172.727 1.00 94.16  ?  142  ARG B CG    1 
ATOM   7631  C  CD    . ARG B 2  142  ? 160.827 186.371 172.076 1.00 94.16  ?  142  ARG B CD    1 
ATOM   7632  N  NE    . ARG B 2  142  ? 161.975 186.477 171.179 1.00 94.16  ?  142  ARG B NE    1 
ATOM   7633  C  CZ    . ARG B 2  142  ? 161.901 186.853 169.906 1.00 94.16  ?  142  ARG B CZ    1 
ATOM   7634  N  NH1   . ARG B 2  142  ? 163.001 186.918 169.169 1.00 94.16  ?  142  ARG B NH1   1 
ATOM   7635  N  NH2   . ARG B 2  142  ? 160.729 187.162 169.368 1.00 94.16  ?  142  ARG B NH2   1 
ATOM   7636  N  N     . ALA B 2  143  ? 159.937 191.231 173.309 1.00 115.53 ?  143  ALA B N     1 
ATOM   7637  C  CA    . ALA B 2  143  ? 159.659 192.326 172.394 1.00 115.53 ?  143  ALA B CA    1 
ATOM   7638  C  C     . ALA B 2  143  ? 159.971 193.691 173.001 1.00 115.53 ?  143  ALA B C     1 
ATOM   7639  O  O     . ALA B 2  143  ? 159.373 194.691 172.591 1.00 115.53 ?  143  ALA B O     1 
ATOM   7640  C  CB    . ALA B 2  143  ? 158.199 192.274 171.938 1.00 115.53 ?  143  ALA B CB    1 
ATOM   7641  N  N     . MET B 2  144  ? 160.893 193.754 173.963 1.00 131.19 ?  144  MET B N     1 
ATOM   7642  C  CA    . MET B 2  144  ? 161.223 195.018 174.612 1.00 131.19 ?  144  MET B CA    1 
ATOM   7643  C  C     . MET B 2  144  ? 162.096 195.920 173.749 1.00 131.19 ?  144  MET B C     1 
ATOM   7644  O  O     . MET B 2  144  ? 162.252 197.100 174.082 1.00 131.19 ?  144  MET B O     1 
ATOM   7645  C  CB    . MET B 2  144  ? 161.917 194.756 175.951 1.00 131.19 ?  144  MET B CB    1 
ATOM   7646  C  CG    . MET B 2  144  ? 163.344 194.242 175.833 1.00 131.19 ?  144  MET B CG    1 
ATOM   7647  S  SD    . MET B 2  144  ? 163.437 192.515 175.326 1.00 131.19 ?  144  MET B SD    1 
ATOM   7648  C  CE    . MET B 2  144  ? 165.103 192.104 175.835 1.00 131.19 ?  144  MET B CE    1 
ATOM   7649  N  N     . SER B 2  145  ? 162.664 195.404 172.660 1.00 145.88 ?  145  SER B N     1 
ATOM   7650  C  CA    . SER B 2  145  ? 163.520 196.195 171.786 1.00 145.88 ?  145  SER B CA    1 
ATOM   7651  C  C     . SER B 2  145  ? 162.789 196.766 170.580 1.00 145.88 ?  145  SER B C     1 
ATOM   7652  O  O     . SER B 2  145  ? 163.150 197.850 170.111 1.00 145.88 ?  145  SER B O     1 
ATOM   7653  C  CB    . SER B 2  145  ? 164.703 195.352 171.299 1.00 145.88 ?  145  SER B CB    1 
ATOM   7654  O  OG    . SER B 2  145  ? 164.265 194.288 170.472 1.00 145.88 ?  145  SER B OG    1 
ATOM   7655  N  N     . HIS B 2  146  ? 161.778 196.064 170.064 1.00 127.69 ?  146  HIS B N     1 
ATOM   7656  C  CA    . HIS B 2  146  ? 161.035 196.559 168.909 1.00 127.69 ?  146  HIS B CA    1 
ATOM   7657  C  C     . HIS B 2  146  ? 160.120 197.714 169.299 1.00 127.69 ?  146  HIS B C     1 
ATOM   7658  O  O     . HIS B 2  146  ? 160.264 198.833 168.793 1.00 127.69 ?  146  HIS B O     1 
ATOM   7659  C  CB    . HIS B 2  146  ? 160.233 195.420 168.273 1.00 127.69 ?  146  HIS B CB    1 
ATOM   7660  C  CG    . HIS B 2  146  ? 161.087 194.340 167.688 1.00 127.69 ?  146  HIS B CG    1 
ATOM   7661  N  ND1   . HIS B 2  146  ? 161.776 194.496 166.505 1.00 127.69 ?  146  HIS B ND1   1 
ATOM   7662  C  CD2   . HIS B 2  146  ? 161.367 193.089 168.124 1.00 127.69 ?  146  HIS B CD2   1 
ATOM   7663  C  CE1   . HIS B 2  146  ? 162.443 193.388 166.237 1.00 127.69 ?  146  HIS B CE1   1 
ATOM   7664  N  NE2   . HIS B 2  146  ? 162.211 192.518 167.203 1.00 127.69 ?  146  HIS B NE2   1 
ATOM   7665  N  N     . ASN B 2  147  ? 159.174 197.462 170.199 1.00 124.85 ?  147  ASN B N     1 
ATOM   7666  C  CA    . ASN B 2  147  ? 158.338 198.509 170.775 1.00 124.85 ?  147  ASN B CA    1 
ATOM   7667  C  C     . ASN B 2  147  ? 158.636 198.605 172.269 1.00 124.85 ?  147  ASN B C     1 
ATOM   7668  O  O     . ASN B 2  147  ? 158.862 197.589 172.935 1.00 124.85 ?  147  ASN B O     1 
ATOM   7669  C  CB    . ASN B 2  147  ? 156.852 198.266 170.483 1.00 124.85 ?  147  ASN B CB    1 
ATOM   7670  C  CG    . ASN B 2  147  ? 156.391 196.853 170.814 1.00 124.85 ?  147  ASN B CG    1 
ATOM   7671  O  OD1   . ASN B 2  147  ? 157.147 196.029 171.320 1.00 124.85 ?  147  ASN B OD1   1 
ATOM   7672  N  ND2   . ASN B 2  147  ? 155.130 196.568 170.509 1.00 124.85 ?  147  ASN B ND2   1 
ATOM   7673  N  N     . VAL B 2  148  ? 158.680 199.834 172.779 1.00 117.09 ?  148  VAL B N     1 
ATOM   7674  C  CA    . VAL B 2  148  ? 159.088 200.103 174.153 1.00 117.09 ?  148  VAL B CA    1 
ATOM   7675  C  C     . VAL B 2  148  ? 157.834 200.052 175.023 1.00 117.09 ?  148  VAL B C     1 
ATOM   7676  O  O     . VAL B 2  148  ? 157.905 199.939 176.253 1.00 117.09 ?  148  VAL B O     1 
ATOM   7677  C  CB    . VAL B 2  148  ? 159.820 201.462 174.225 1.00 117.09 ?  148  VAL B CB    1 
ATOM   7678  C  CG1   . VAL B 2  148  ? 160.446 201.732 175.592 1.00 117.09 ?  148  VAL B CG1   1 
ATOM   7679  C  CG2   . VAL B 2  148  ? 160.878 201.549 173.134 1.00 117.09 ?  148  VAL B CG2   1 
ATOM   7680  N  N     . LYS B 2  149  ? 156.666 200.060 174.374 1.00 108.38 ?  149  LYS B N     1 
ATOM   7681  C  CA    . LYS B 2  149  ? 155.382 200.124 175.066 1.00 108.38 ?  149  LYS B CA    1 
ATOM   7682  C  C     . LYS B 2  149  ? 155.011 198.837 175.798 1.00 108.38 ?  149  LYS B C     1 
ATOM   7683  O  O     . LYS B 2  149  ? 153.998 198.825 176.506 1.00 108.38 ?  149  LYS B O     1 
ATOM   7684  C  CB    . LYS B 2  149  ? 154.277 200.483 174.071 1.00 108.38 ?  149  LYS B CB    1 
ATOM   7685  C  CG    . LYS B 2  149  ? 154.492 201.817 173.379 1.00 108.38 ?  149  LYS B CG    1 
ATOM   7686  C  CD    . LYS B 2  149  ? 154.407 202.969 174.366 1.00 108.38 ?  149  LYS B CD    1 
ATOM   7687  C  CE    . LYS B 2  149  ? 154.561 204.311 173.668 1.00 108.38 ?  149  LYS B CE    1 
ATOM   7688  N  NZ    . LYS B 2  149  ? 154.527 205.447 174.632 1.00 108.38 ?  149  LYS B NZ    1 
ATOM   7689  N  N     . ARG B 2  150  ? 155.787 197.762 175.651 1.00 94.88  ?  150  ARG B N     1 
ATOM   7690  C  CA    . ARG B 2  150  ? 155.574 196.530 176.398 1.00 94.88  ?  150  ARG B CA    1 
ATOM   7691  C  C     . ARG B 2  150  ? 156.280 196.537 177.750 1.00 94.88  ?  150  ARG B C     1 
ATOM   7692  O  O     . ARG B 2  150  ? 156.352 195.494 178.408 1.00 94.88  ?  150  ARG B O     1 
ATOM   7693  C  CB    . ARG B 2  150  ? 156.034 195.325 175.575 1.00 94.88  ?  150  ARG B CB    1 
ATOM   7694  C  CG    . ARG B 2  150  ? 155.265 195.130 174.279 1.00 94.88  ?  150  ARG B CG    1 
ATOM   7695  C  CD    . ARG B 2  150  ? 153.814 194.772 174.550 1.00 94.88  ?  150  ARG B CD    1 
ATOM   7696  N  NE    . ARG B 2  150  ? 153.675 193.516 175.280 1.00 94.88  ?  150  ARG B NE    1 
ATOM   7697  C  CZ    . ARG B 2  150  ? 153.600 192.321 174.704 1.00 94.88  ?  150  ARG B CZ    1 
ATOM   7698  N  NH1   . ARG B 2  150  ? 153.646 192.216 173.383 1.00 94.88  ?  150  ARG B NH1   1 
ATOM   7699  N  NH2   . ARG B 2  150  ? 153.474 191.231 175.448 1.00 94.88  ?  150  ARG B NH2   1 
ATOM   7700  N  N     . LEU B 2  151  ? 156.795 197.679 178.174 1.00 110.01 ?  151  LEU B N     1 
ATOM   7701  C  CA    . LEU B 2  151  ? 157.497 197.858 179.434 1.00 110.01 ?  151  LEU B CA    1 
ATOM   7702  C  C     . LEU B 2  151  ? 156.672 198.725 180.375 1.00 110.01 ?  151  LEU B C     1 
ATOM   7703  O  O     . LEU B 2  151  ? 155.787 199.468 179.942 1.00 110.01 ?  151  LEU B O     1 
ATOM   7704  C  CB    . LEU B 2  151  ? 158.867 198.493 179.172 1.00 110.01 ?  151  LEU B CB    1 
ATOM   7705  C  CG    . LEU B 2  151  ? 159.855 197.635 178.379 1.00 110.01 ?  151  LEU B CG    1 
ATOM   7706  C  CD1   . LEU B 2  151  ? 161.118 198.420 178.059 1.00 110.01 ?  151  LEU B CD1   1 
ATOM   7707  C  CD2   . LEU B 2  151  ? 160.189 196.361 179.141 1.00 110.01 ?  151  LEU B CD2   1 
ATOM   7708  N  N     . PRO B 2  152  ? 156.915 198.639 181.686 1.00 109.88 ?  152  PRO B N     1 
ATOM   7709  C  CA    . PRO B 2  152  ? 156.248 199.554 182.624 1.00 109.88 ?  152  PRO B CA    1 
ATOM   7710  C  C     . PRO B 2  152  ? 156.721 200.993 182.455 1.00 109.88 ?  152  PRO B C     1 
ATOM   7711  O  O     . PRO B 2  152  ? 157.703 201.290 181.771 1.00 109.88 ?  152  PRO B O     1 
ATOM   7712  C  CB    . PRO B 2  152  ? 156.629 198.999 183.999 1.00 109.88 ?  152  PRO B CB    1 
ATOM   7713  C  CG    . PRO B 2  152  ? 156.913 197.562 183.752 1.00 109.88 ?  152  PRO B CG    1 
ATOM   7714  C  CD    . PRO B 2  152  ? 157.551 197.513 182.396 1.00 109.88 ?  152  PRO B CD    1 
ATOM   7715  N  N     . ARG B 2  153  ? 155.992 201.900 183.114 1.00 112.71 ?  153  ARG B N     1 
ATOM   7716  C  CA    . ARG B 2  153  ? 156.221 203.330 182.926 1.00 112.71 ?  153  ARG B CA    1 
ATOM   7717  C  C     . ARG B 2  153  ? 157.511 203.792 183.596 1.00 112.71 ?  153  ARG B C     1 
ATOM   7718  O  O     . ARG B 2  153  ? 158.273 204.571 183.011 1.00 112.71 ?  153  ARG B O     1 
ATOM   7719  C  CB    . ARG B 2  153  ? 155.030 204.125 183.463 1.00 112.71 ?  153  ARG B CB    1 
ATOM   7720  C  CG    . ARG B 2  153  ? 153.715 203.835 182.760 1.00 112.71 ?  153  ARG B CG    1 
ATOM   7721  C  CD    . ARG B 2  153  ? 153.717 204.375 181.339 1.00 112.71 ?  153  ARG B CD    1 
ATOM   7722  N  NE    . ARG B 2  153  ? 152.460 204.101 180.649 1.00 112.71 ?  153  ARG B NE    1 
ATOM   7723  C  CZ    . ARG B 2  153  ? 151.407 204.911 180.665 1.00 112.71 ?  153  ARG B CZ    1 
ATOM   7724  N  NH1   . ARG B 2  153  ? 150.303 204.580 180.008 1.00 112.71 ?  153  ARG B NH1   1 
ATOM   7725  N  NH2   . ARG B 2  153  ? 151.456 206.053 181.337 1.00 112.71 ?  153  ARG B NH2   1 
ATOM   7726  N  N     . ARG B 2  154  ? 157.770 203.330 184.821 1.00 122.83 ?  154  ARG B N     1 
ATOM   7727  C  CA    . ARG B 2  154  ? 158.977 203.741 185.531 1.00 122.83 ?  154  ARG B CA    1 
ATOM   7728  C  C     . ARG B 2  154  ? 160.230 203.098 184.952 1.00 122.83 ?  154  ARG B C     1 
ATOM   7729  O  O     . ARG B 2  154  ? 161.318 203.678 185.043 1.00 122.83 ?  154  ARG B O     1 
ATOM   7730  C  CB    . ARG B 2  154  ? 158.853 203.407 187.018 1.00 122.83 ?  154  ARG B CB    1 
ATOM   7731  C  CG    . ARG B 2  154  ? 157.804 204.229 187.745 1.00 122.83 ?  154  ARG B CG    1 
ATOM   7732  C  CD    . ARG B 2  154  ? 157.731 203.858 189.215 1.00 122.83 ?  154  ARG B CD    1 
ATOM   7733  N  NE    . ARG B 2  154  ? 156.715 204.634 189.919 1.00 122.83 ?  154  ARG B NE    1 
ATOM   7734  C  CZ    . ARG B 2  154  ? 156.409 204.473 191.202 1.00 122.83 ?  154  ARG B CZ    1 
ATOM   7735  N  NH1   . ARG B 2  154  ? 155.471 205.225 191.761 1.00 122.83 ?  154  ARG B NH1   1 
ATOM   7736  N  NH2   . ARG B 2  154  ? 157.043 203.562 191.928 1.00 122.83 ?  154  ARG B NH2   1 
ATOM   7737  N  N     . LEU B 2  155  ? 160.100 201.911 184.358 1.00 130.55 ?  155  LEU B N     1 
ATOM   7738  C  CA    . LEU B 2  155  ? 161.238 201.267 183.716 1.00 130.55 ?  155  LEU B CA    1 
ATOM   7739  C  C     . LEU B 2  155  ? 161.475 201.793 182.306 1.00 130.55 ?  155  LEU B C     1 
ATOM   7740  O  O     . LEU B 2  155  ? 162.536 201.531 181.730 1.00 130.55 ?  155  LEU B O     1 
ATOM   7741  C  CB    . LEU B 2  155  ? 161.027 199.753 183.688 1.00 130.55 ?  155  LEU B CB    1 
ATOM   7742  C  CG    . LEU B 2  155  ? 160.978 199.095 185.069 1.00 130.55 ?  155  LEU B CG    1 
ATOM   7743  C  CD1   . LEU B 2  155  ? 160.579 197.635 184.958 1.00 130.55 ?  155  LEU B CD1   1 
ATOM   7744  C  CD2   . LEU B 2  155  ? 162.316 199.238 185.779 1.00 130.55 ?  155  LEU B CD2   1 
ATOM   7745  N  N     . GLN B 2  156  ? 160.512 202.527 181.743 1.00 138.12 ?  156  GLN B N     1 
ATOM   7746  C  CA    . GLN B 2  156  ? 160.661 203.076 180.401 1.00 138.12 ?  156  GLN B CA    1 
ATOM   7747  C  C     . GLN B 2  156  ? 161.599 204.278 180.373 1.00 138.12 ?  156  GLN B C     1 
ATOM   7748  O  O     . GLN B 2  156  ? 162.262 204.507 179.354 1.00 138.12 ?  156  GLN B O     1 
ATOM   7749  C  CB    . GLN B 2  156  ? 159.282 203.458 179.850 1.00 138.12 ?  156  GLN B CB    1 
ATOM   7750  C  CG    . GLN B 2  156  ? 159.248 203.867 178.384 1.00 138.12 ?  156  GLN B CG    1 
ATOM   7751  C  CD    . GLN B 2  156  ? 157.847 204.165 177.890 1.00 138.12 ?  156  GLN B CD    1 
ATOM   7752  O  OE1   . GLN B 2  156  ? 156.884 204.125 178.657 1.00 138.12 ?  156  GLN B OE1   1 
ATOM   7753  N  NE2   . GLN B 2  156  ? 157.724 204.458 176.601 1.00 138.12 ?  156  GLN B NE2   1 
ATOM   7754  N  N     . GLU B 2  157  ? 161.688 205.026 181.477 1.00 151.74 ?  157  GLU B N     1 
ATOM   7755  C  CA    . GLU B 2  157  ? 162.484 206.251 181.507 1.00 151.74 ?  157  GLU B CA    1 
ATOM   7756  C  C     . GLU B 2  157  ? 163.977 205.949 181.424 1.00 151.74 ?  157  GLU B C     1 
ATOM   7757  O  O     . GLU B 2  157  ? 164.743 206.714 180.827 1.00 151.74 ?  157  GLU B O     1 
ATOM   7758  C  CB    . GLU B 2  157  ? 162.167 207.044 182.775 1.00 151.74 ?  157  GLU B CB    1 
ATOM   7759  C  CG    . GLU B 2  157  ? 160.745 207.576 182.837 1.00 151.74 ?  157  GLU B CG    1 
ATOM   7760  C  CD    . GLU B 2  157  ? 160.455 208.309 184.132 1.00 151.74 ?  157  GLU B CD    1 
ATOM   7761  O  OE1   . GLU B 2  157  ? 161.323 208.296 185.030 1.00 151.74 ?  157  GLU B OE1   1 
ATOM   7762  O  OE2   . GLU B 2  157  ? 159.359 208.895 184.253 1.00 151.74 ?  157  GLU B OE2   1 
ATOM   7763  N  N     . ILE B 2  158  ? 164.408 204.839 182.025 1.00 158.07 ?  158  ILE B N     1 
ATOM   7764  C  CA    . ILE B 2  158  ? 165.798 204.419 181.888 1.00 158.07 ?  158  ILE B CA    1 
ATOM   7765  C  C     . ILE B 2  158  ? 166.039 203.851 180.493 1.00 158.07 ?  158  ILE B C     1 
ATOM   7766  O  O     . ILE B 2  158  ? 167.111 204.052 179.905 1.00 158.07 ?  158  ILE B O     1 
ATOM   7767  C  CB    . ILE B 2  158  ? 166.146 203.409 183.001 1.00 158.07 ?  158  ILE B CB    1 
ATOM   7768  C  CG1   . ILE B 2  158  ? 165.895 204.033 184.374 1.00 158.07 ?  158  ILE B CG1   1 
ATOM   7769  C  CG2   . ILE B 2  158  ? 167.602 202.974 182.923 1.00 158.07 ?  158  ILE B CG2   1 
ATOM   7770  C  CD1   . ILE B 2  158  ? 165.961 203.043 185.515 1.00 158.07 ?  158  ILE B CD1   1 
ATOM   7771  N  N     . ALA B 2  159  ? 165.036 203.174 179.924 1.00 164.01 ?  159  ALA B N     1 
ATOM   7772  C  CA    . ALA B 2  159  ? 165.162 202.596 178.590 1.00 164.01 ?  159  ALA B CA    1 
ATOM   7773  C  C     . ALA B 2  159  ? 165.203 203.650 177.490 1.00 164.01 ?  159  ALA B C     1 
ATOM   7774  O  O     . ALA B 2  159  ? 165.704 203.362 176.398 1.00 164.01 ?  159  ALA B O     1 
ATOM   7775  C  CB    . ALA B 2  159  ? 164.013 201.620 178.331 1.00 164.01 ?  159  ALA B CB    1 
ATOM   7776  N  N     . GLN B 2  160  ? 164.680 204.853 177.745 1.00 169.18 ?  160  GLN B N     1 
ATOM   7777  C  CA    . GLN B 2  160  ? 164.819 205.936 176.776 1.00 169.18 ?  160  GLN B CA    1 
ATOM   7778  C  C     . GLN B 2  160  ? 166.263 206.416 176.694 1.00 169.18 ?  160  GLN B C     1 
ATOM   7779  O  O     . GLN B 2  160  ? 166.735 206.802 175.618 1.00 169.18 ?  160  GLN B O     1 
ATOM   7780  C  CB    . GLN B 2  160  ? 163.887 207.094 177.133 1.00 169.18 ?  160  GLN B CB    1 
ATOM   7781  C  CG    . GLN B 2  160  ? 162.409 206.789 176.944 1.00 169.18 ?  160  GLN B CG    1 
ATOM   7782  C  CD    . GLN B 2  160  ? 161.520 207.956 177.326 1.00 169.18 ?  160  GLN B CD    1 
ATOM   7783  O  OE1   . GLN B 2  160  ? 161.998 208.984 177.805 1.00 169.18 ?  160  GLN B OE1   1 
ATOM   7784  N  NE2   . GLN B 2  160  ? 160.218 207.803 177.113 1.00 169.18 ?  160  GLN B NE2   1 
ATOM   7785  N  N     . LYS B 2  161  ? 166.978 206.401 177.821 1.00 175.39 ?  161  LYS B N     1 
ATOM   7786  C  CA    . LYS B 2  161  ? 168.402 206.708 177.804 1.00 175.39 ?  161  LYS B CA    1 
ATOM   7787  C  C     . LYS B 2  161  ? 169.223 205.575 177.204 1.00 175.39 ?  161  LYS B C     1 
ATOM   7788  O  O     . LYS B 2  161  ? 170.303 205.828 176.660 1.00 175.39 ?  161  LYS B O     1 
ATOM   7789  C  CB    . LYS B 2  161  ? 168.892 207.016 179.219 1.00 175.39 ?  161  LYS B CB    1 
ATOM   7790  C  CG    . LYS B 2  161  ? 168.331 208.302 179.804 1.00 175.39 ?  161  LYS B CG    1 
ATOM   7791  C  CD    . LYS B 2  161  ? 168.877 208.557 181.199 1.00 175.39 ?  161  LYS B CD    1 
ATOM   7792  C  CE    . LYS B 2  161  ? 168.299 209.830 181.795 1.00 175.39 ?  161  LYS B CE    1 
ATOM   7793  N  NZ    . LYS B 2  161  ? 168.820 210.085 183.166 1.00 175.39 ?  161  LYS B NZ    1 
ATOM   7794  N  N     . GLU B 2  162  ? 168.735 204.337 177.290 1.00 185.06 ?  162  GLU B N     1 
ATOM   7795  C  CA    . GLU B 2  162  ? 169.411 203.199 176.683 1.00 185.06 ?  162  GLU B CA    1 
ATOM   7796  C  C     . GLU B 2  162  ? 169.177 203.103 175.183 1.00 185.06 ?  162  GLU B C     1 
ATOM   7797  O  O     . GLU B 2  162  ? 169.935 202.408 174.495 1.00 185.06 ?  162  GLU B O     1 
ATOM   7798  C  CB    . GLU B 2  162  ? 168.958 201.895 177.350 1.00 185.06 ?  162  GLU B CB    1 
ATOM   7799  C  CG    . GLU B 2  162  ? 169.397 201.750 178.797 1.00 185.06 ?  162  GLU B CG    1 
ATOM   7800  C  CD    . GLU B 2  162  ? 168.914 200.458 179.426 1.00 185.06 ?  162  GLU B CD    1 
ATOM   7801  O  OE1   . GLU B 2  162  ? 168.128 199.736 178.776 1.00 185.06 ?  162  GLU B OE1   1 
ATOM   7802  O  OE2   . GLU B 2  162  ? 169.319 200.163 180.570 1.00 185.06 ?  162  GLU B OE2   1 
ATOM   7803  N  N     . ALA B 2  163  ? 168.146 203.775 174.662 1.00 193.15 ?  163  ALA B N     1 
ATOM   7804  C  CA    . ALA B 2  163  ? 167.898 203.773 173.225 1.00 193.15 ?  163  ALA B CA    1 
ATOM   7805  C  C     . ALA B 2  163  ? 168.927 204.595 172.461 1.00 193.15 ?  163  ALA B C     1 
ATOM   7806  O  O     . ALA B 2  163  ? 169.154 204.332 171.275 1.00 193.15 ?  163  ALA B O     1 
ATOM   7807  C  CB    . ALA B 2  163  ? 166.491 204.296 172.932 1.00 193.15 ?  163  ALA B CB    1 
ATOM   7808  N  N     . GLU B 2  164  ? 169.547 205.583 173.109 1.00 201.59 ?  164  GLU B N     1 
ATOM   7809  C  CA    . GLU B 2  164  ? 170.612 206.340 172.459 1.00 201.59 ?  164  GLU B CA    1 
ATOM   7810  C  C     . GLU B 2  164  ? 171.887 205.513 172.353 1.00 201.59 ?  164  GLU B C     1 
ATOM   7811  O  O     . GLU B 2  164  ? 172.663 205.675 171.405 1.00 201.59 ?  164  GLU B O     1 
ATOM   7812  C  CB    . GLU B 2  164  ? 170.875 207.637 173.224 1.00 201.59 ?  164  GLU B CB    1 
ATOM   7813  C  CG    . GLU B 2  164  ? 169.726 208.631 173.181 1.00 201.59 ?  164  GLU B CG    1 
ATOM   7814  C  CD    . GLU B 2  164  ? 170.016 209.890 173.974 1.00 201.59 ?  164  GLU B CD    1 
ATOM   7815  O  OE1   . GLU B 2  164  ? 171.060 209.936 174.659 1.00 201.59 ?  164  GLU B OE1   1 
ATOM   7816  O  OE2   . GLU B 2  164  ? 169.201 210.834 173.914 1.00 201.59 ?  164  GLU B OE2   1 
ATOM   7817  N  N     . LYS B 2  165  ? 172.118 204.623 173.320 1.00 205.79 ?  165  LYS B N     1 
ATOM   7818  C  CA    . LYS B 2  165  ? 173.307 203.779 173.293 1.00 205.79 ?  165  LYS B CA    1 
ATOM   7819  C  C     . LYS B 2  165  ? 173.086 202.502 172.493 1.00 205.79 ?  165  LYS B C     1 
ATOM   7820  O  O     . LYS B 2  165  ? 174.023 202.005 171.858 1.00 205.79 ?  165  LYS B O     1 
ATOM   7821  C  CB    . LYS B 2  165  ? 173.735 203.434 174.720 1.00 205.79 ?  165  LYS B CB    1 
ATOM   7822  C  CG    . LYS B 2  165  ? 174.253 204.620 175.518 1.00 205.79 ?  165  LYS B CG    1 
ATOM   7823  C  CD    . LYS B 2  165  ? 174.689 204.198 176.912 1.00 205.79 ?  165  LYS B CD    1 
ATOM   7824  C  CE    . LYS B 2  165  ? 175.187 205.385 177.719 1.00 205.79 ?  165  LYS B CE    1 
ATOM   7825  N  NZ    . LYS B 2  165  ? 175.606 204.988 179.091 1.00 205.79 ?  165  LYS B NZ    1 
ATOM   7826  N  N     . ALA B 2  166  ? 171.872 201.961 172.510 1.00 196.62 ?  166  ALA B N     1 
ATOM   7827  C  CA    . ALA B 2  166  ? 171.567 200.738 171.777 1.00 196.62 ?  166  ALA B CA    1 
ATOM   7828  C  C     . ALA B 2  166  ? 170.587 201.012 170.641 1.00 196.62 ?  166  ALA B C     1 
ATOM   7829  O  O     . ALA B 2  166  ? 170.992 201.279 169.510 1.00 196.62 ?  166  ALA B O     1 
ATOM   7830  C  CB    . ALA B 2  166  ? 171.008 199.682 172.718 1.00 196.62 ?  166  ALA B CB    1 
ATOM   7831  N  N     . ALA B 2  181  ? 155.750 190.888 156.274 1.00 70.67  ?  181  ALA B N     1 
ATOM   7832  C  CA    . ALA B 2  181  ? 154.743 191.397 157.198 1.00 70.67  ?  181  ALA B CA    1 
ATOM   7833  C  C     . ALA B 2  181  ? 154.013 192.597 156.604 1.00 70.67  ?  181  ALA B C     1 
ATOM   7834  O  O     . ALA B 2  181  ? 154.633 193.488 156.023 1.00 70.67  ?  181  ALA B O     1 
ATOM   7835  C  CB    . ALA B 2  181  ? 155.383 191.770 158.527 1.00 70.67  ?  181  ALA B CB    1 
ATOM   7836  N  N     . ARG B 2  182  ? 152.691 192.614 156.754 1.00 72.35  ?  182  ARG B N     1 
ATOM   7837  C  CA    . ARG B 2  182  ? 151.868 193.698 156.240 1.00 72.35  ?  182  ARG B CA    1 
ATOM   7838  C  C     . ARG B 2  182  ? 150.718 193.939 157.210 1.00 72.35  ?  182  ARG B C     1 
ATOM   7839  O  O     . ARG B 2  182  ? 150.592 193.265 158.236 1.00 72.35  ?  182  ARG B O     1 
ATOM   7840  C  CB    . ARG B 2  182  ? 151.357 193.383 154.830 1.00 72.35  ?  182  ARG B CB    1 
ATOM   7841  C  CG    . ARG B 2  182  ? 150.388 192.213 154.768 1.00 72.35  ?  182  ARG B CG    1 
ATOM   7842  C  CD    . ARG B 2  182  ? 150.012 191.884 153.332 1.00 72.35  ?  182  ARG B CD    1 
ATOM   7843  N  NE    . ARG B 2  182  ? 149.018 190.817 153.253 1.00 72.35  ?  182  ARG B NE    1 
ATOM   7844  C  CZ    . ARG B 2  182  ? 149.313 189.522 153.219 1.00 72.35  ?  182  ARG B CZ    1 
ATOM   7845  N  NH1   . ARG B 2  182  ? 150.578 189.126 153.254 1.00 72.35  ?  182  ARG B NH1   1 
ATOM   7846  N  NH2   . ARG B 2  182  ? 148.343 188.621 153.147 1.00 72.35  ?  182  ARG B NH2   1 
ATOM   7847  N  N     . ARG B 2  183  ? 149.875 194.912 156.875 1.00 78.73  ?  183  ARG B N     1 
ATOM   7848  C  CA    . ARG B 2  183  ? 148.725 195.238 157.702 1.00 78.73  ?  183  ARG B CA    1 
ATOM   7849  C  C     . ARG B 2  183  ? 147.607 194.221 157.484 1.00 78.73  ?  183  ARG B C     1 
ATOM   7850  O  O     . ARG B 2  183  ? 147.660 193.372 156.589 1.00 78.73  ?  183  ARG B O     1 
ATOM   7851  C  CB    . ARG B 2  183  ? 148.244 196.657 157.408 1.00 78.73  ?  183  ARG B CB    1 
ATOM   7852  C  CG    . ARG B 2  183  ? 149.233 197.739 157.805 1.00 78.73  ?  183  ARG B CG    1 
ATOM   7853  C  CD    . ARG B 2  183  ? 149.384 197.807 159.317 1.00 78.73  ?  183  ARG B CD    1 
ATOM   7854  N  NE    . ARG B 2  183  ? 148.117 198.105 159.979 1.00 78.73  ?  183  ARG B NE    1 
ATOM   7855  C  CZ    . ARG B 2  183  ? 147.651 199.333 160.190 1.00 78.73  ?  183  ARG B CZ    1 
ATOM   7856  N  NH1   . ARG B 2  183  ? 148.348 200.388 159.791 1.00 78.73  ?  183  ARG B NH1   1 
ATOM   7857  N  NH2   . ARG B 2  183  ? 146.487 199.505 160.800 1.00 78.73  ?  183  ARG B NH2   1 
ATOM   7858  N  N     . CYS B 2  184  ? 146.574 194.309 158.320 1.00 77.64  ?  184  CYS B N     1 
ATOM   7859  C  CA    . CYS B 2  184  ? 145.438 193.397 158.271 1.00 77.64  ?  184  CYS B CA    1 
ATOM   7860  C  C     . CYS B 2  184  ? 144.159 194.207 158.408 1.00 77.64  ?  184  CYS B C     1 
ATOM   7861  O  O     . CYS B 2  184  ? 143.913 194.806 159.460 1.00 77.64  ?  184  CYS B O     1 
ATOM   7862  C  CB    . CYS B 2  184  ? 145.527 192.343 159.378 1.00 77.64  ?  184  CYS B CB    1 
ATOM   7863  S  SG    . CYS B 2  184  ? 146.939 191.225 159.232 1.00 77.64  ?  184  CYS B SG    1 
ATOM   7864  N  N     . HIS B 2  185  ? 143.346 194.224 157.349 1.00 77.23  ?  185  HIS B N     1 
ATOM   7865  C  CA    . HIS B 2  185  ? 142.067 194.937 157.349 1.00 77.23  ?  185  HIS B CA    1 
ATOM   7866  C  C     . HIS B 2  185  ? 140.990 193.955 156.894 1.00 77.23  ?  185  HIS B C     1 
ATOM   7867  O  O     . HIS B 2  185  ? 140.622 193.910 155.718 1.00 77.23  ?  185  HIS B O     1 
ATOM   7868  C  CB    . HIS B 2  185  ? 142.130 196.171 156.458 1.00 77.23  ?  185  HIS B CB    1 
ATOM   7869  C  CG    . HIS B 2  185  ? 143.098 197.207 156.936 1.00 77.23  ?  185  HIS B CG    1 
ATOM   7870  N  ND1   . HIS B 2  185  ? 144.427 197.205 156.574 1.00 77.23  ?  185  HIS B ND1   1 
ATOM   7871  C  CD2   . HIS B 2  185  ? 142.931 198.276 157.750 1.00 77.23  ?  185  HIS B CD2   1 
ATOM   7872  C  CE1   . HIS B 2  185  ? 145.038 198.229 157.144 1.00 77.23  ?  185  HIS B CE1   1 
ATOM   7873  N  NE2   . HIS B 2  185  ? 144.152 198.895 157.862 1.00 77.23  ?  185  HIS B NE2   1 
ATOM   7874  N  N     . MET B 2  186  ? 140.484 193.174 157.846 1.00 75.71  ?  186  MET B N     1 
ATOM   7875  C  CA    . MET B 2  186  ? 139.407 192.223 157.619 1.00 75.71  ?  186  MET B CA    1 
ATOM   7876  C  C     . MET B 2  186  ? 138.525 192.186 158.857 1.00 75.71  ?  186  MET B C     1 
ATOM   7877  O  O     . MET B 2  186  ? 138.982 192.464 159.969 1.00 75.71  ?  186  MET B O     1 
ATOM   7878  C  CB    . MET B 2  186  ? 139.924 190.804 157.320 1.00 75.71  ?  186  MET B CB    1 
ATOM   7879  C  CG    . MET B 2  186  ? 140.592 190.614 155.964 1.00 75.71  ?  186  MET B CG    1 
ATOM   7880  S  SD    . MET B 2  186  ? 139.470 190.937 154.591 1.00 75.71  ?  186  MET B SD    1 
ATOM   7881  C  CE    . MET B 2  186  ? 138.348 189.548 154.737 1.00 75.71  ?  186  MET B CE    1 
ATOM   7882  N  N     . ASN B 2  187  ? 137.258 191.840 158.657 1.00 74.13  ?  187  ASN B N     1 
ATOM   7883  C  CA    . ASN B 2  187  ? 136.324 191.702 159.771 1.00 74.13  ?  187  ASN B CA    1 
ATOM   7884  C  C     . ASN B 2  187  ? 136.638 190.397 160.489 1.00 74.13  ?  187  ASN B C     1 
ATOM   7885  O  O     . ASN B 2  187  ? 136.276 189.312 160.028 1.00 74.13  ?  187  ASN B O     1 
ATOM   7886  C  CB    . ASN B 2  187  ? 134.883 191.740 159.273 1.00 74.13  ?  187  ASN B CB    1 
ATOM   7887  C  CG    . ASN B 2  187  ? 133.879 191.949 160.397 1.00 74.13  ?  187  ASN B CG    1 
ATOM   7888  O  OD1   . ASN B 2  187  ? 134.244 192.048 161.569 1.00 74.13  ?  187  ASN B OD1   1 
ATOM   7889  N  ND2   . ASN B 2  187  ? 132.604 192.032 160.038 1.00 74.13  ?  187  ASN B ND2   1 
ATOM   7890  N  N     . ARG B 2  188  ? 137.329 190.504 161.627 1.00 66.60  ?  188  ARG B N     1 
ATOM   7891  C  CA    . ARG B 2  188  ? 137.757 189.330 162.379 1.00 66.60  ?  188  ARG B CA    1 
ATOM   7892  C  C     . ARG B 2  188  ? 136.585 188.627 163.060 1.00 66.60  ?  188  ARG B C     1 
ATOM   7893  O  O     . ARG B 2  188  ? 136.671 187.424 163.335 1.00 66.60  ?  188  ARG B O     1 
ATOM   7894  C  CB    . ARG B 2  188  ? 138.826 189.752 163.396 1.00 66.60  ?  188  ARG B CB    1 
ATOM   7895  C  CG    . ARG B 2  188  ? 139.533 188.624 164.137 1.00 66.60  ?  188  ARG B CG    1 
ATOM   7896  C  CD    . ARG B 2  188  ? 140.630 189.159 165.039 1.00 66.60  ?  188  ARG B CD    1 
ATOM   7897  N  NE    . ARG B 2  188  ? 141.744 189.713 164.274 1.00 66.60  ?  188  ARG B NE    1 
ATOM   7898  C  CZ    . ARG B 2  188  ? 142.762 190.376 164.812 1.00 66.60  ?  188  ARG B CZ    1 
ATOM   7899  N  NH1   . ARG B 2  188  ? 142.813 190.569 166.123 1.00 66.60  ?  188  ARG B NH1   1 
ATOM   7900  N  NH2   . ARG B 2  188  ? 143.733 190.845 164.039 1.00 66.60  ?  188  ARG B NH2   1 
ATOM   7901  N  N     . THR B 2  189  ? 135.484 189.346 163.308 1.00 70.26  ?  189  THR B N     1 
ATOM   7902  C  CA    . THR B 2  189  ? 134.295 188.732 163.893 1.00 70.26  ?  189  THR B CA    1 
ATOM   7903  C  C     . THR B 2  189  ? 133.662 187.729 162.932 1.00 70.26  ?  189  THR B C     1 
ATOM   7904  O  O     . THR B 2  189  ? 133.250 186.638 163.345 1.00 70.26  ?  189  THR B O     1 
ATOM   7905  C  CB    . THR B 2  189  ? 133.292 189.821 164.285 1.00 70.26  ?  189  THR B CB    1 
ATOM   7906  O  OG1   . THR B 2  189  ? 133.917 190.739 165.191 1.00 70.26  ?  189  THR B OG1   1 
ATOM   7907  C  CG2   . THR B 2  189  ? 132.067 189.221 164.967 1.00 70.26  ?  189  THR B CG2   1 
ATOM   7908  N  N     . LEU B 2  190  ? 133.608 188.064 161.640 1.00 73.29  ?  190  LEU B N     1 
ATOM   7909  C  CA    . LEU B 2  190  ? 133.112 187.114 160.651 1.00 73.29  ?  190  LEU B CA    1 
ATOM   7910  C  C     . LEU B 2  190  ? 134.113 186.004 160.357 1.00 73.29  ?  190  LEU B C     1 
ATOM   7911  O  O     . LEU B 2  190  ? 133.712 184.945 159.862 1.00 73.29  ?  190  LEU B O     1 
ATOM   7912  C  CB    . LEU B 2  190  ? 132.744 187.839 159.355 1.00 73.29  ?  190  LEU B CB    1 
ATOM   7913  C  CG    . LEU B 2  190  ? 131.541 188.780 159.424 1.00 73.29  ?  190  LEU B CG    1 
ATOM   7914  C  CD1   . LEU B 2  190  ? 131.359 189.511 158.104 1.00 73.29  ?  190  LEU B CD1   1 
ATOM   7915  C  CD2   . LEU B 2  190  ? 130.282 188.010 159.791 1.00 73.29  ?  190  LEU B CD2   1 
ATOM   7916  N  N     . GLU B 2  191  ? 135.400 186.221 160.642 1.00 70.75  ?  191  GLU B N     1 
ATOM   7917  C  CA    . GLU B 2  191  ? 136.384 185.155 160.487 1.00 70.75  ?  191  GLU B CA    1 
ATOM   7918  C  C     . GLU B 2  191  ? 136.205 184.089 161.560 1.00 70.75  ?  191  GLU B C     1 
ATOM   7919  O  O     . GLU B 2  191  ? 136.246 182.887 161.275 1.00 70.75  ?  191  GLU B O     1 
ATOM   7920  C  CB    . GLU B 2  191  ? 137.801 185.729 160.538 1.00 70.75  ?  191  GLU B CB    1 
ATOM   7921  C  CG    . GLU B 2  191  ? 138.183 186.589 159.348 1.00 70.75  ?  191  GLU B CG    1 
ATOM   7922  C  CD    . GLU B 2  191  ? 139.599 187.122 159.454 1.00 70.75  ?  191  GLU B CD    1 
ATOM   7923  O  OE1   . GLU B 2  191  ? 140.226 186.943 160.520 1.00 70.75  ?  191  GLU B OE1   1 
ATOM   7924  O  OE2   . GLU B 2  191  ? 140.091 187.709 158.469 1.00 70.75  ?  191  GLU B OE2   1 
ATOM   7925  N  N     . PHE B 2  192  ? 136.004 184.517 162.808 1.00 64.71  ?  192  PHE B N     1 
ATOM   7926  C  CA    . PHE B 2  192  ? 135.799 183.579 163.905 1.00 64.71  ?  192  PHE B CA    1 
ATOM   7927  C  C     . PHE B 2  192  ? 134.410 182.956 163.873 1.00 64.71  ?  192  PHE B C     1 
ATOM   7928  O  O     . PHE B 2  192  ? 134.198 181.894 164.470 1.00 64.71  ?  192  PHE B O     1 
ATOM   7929  C  CB    . PHE B 2  192  ? 136.034 184.280 165.244 1.00 64.71  ?  192  PHE B CB    1 
ATOM   7930  C  CG    . PHE B 2  192  ? 137.482 184.581 165.534 1.00 64.71  ?  192  PHE B CG    1 
ATOM   7931  C  CD1   . PHE B 2  192  ? 138.499 183.931 164.845 1.00 64.71  ?  192  PHE B CD1   1 
ATOM   7932  C  CD2   . PHE B 2  192  ? 137.826 185.517 166.499 1.00 64.71  ?  192  PHE B CD2   1 
ATOM   7933  C  CE1   . PHE B 2  192  ? 139.829 184.208 165.114 1.00 64.71  ?  192  PHE B CE1   1 
ATOM   7934  C  CE2   . PHE B 2  192  ? 139.155 185.800 166.773 1.00 64.71  ?  192  PHE B CE2   1 
ATOM   7935  C  CZ    . PHE B 2  192  ? 140.157 185.144 166.079 1.00 64.71  ?  192  PHE B CZ    1 
ATOM   7936  N  N     . ASN B 2  193  ? 133.457 183.602 163.197 1.00 75.00  ?  193  ASN B N     1 
ATOM   7937  C  CA    . ASN B 2  193  ? 132.142 183.001 163.006 1.00 75.00  ?  193  ASN B CA    1 
ATOM   7938  C  C     . ASN B 2  193  ? 132.221 181.816 162.050 1.00 75.00  ?  193  ASN B C     1 
ATOM   7939  O  O     . ASN B 2  193  ? 131.513 180.818 162.233 1.00 75.00  ?  193  ASN B O     1 
ATOM   7940  C  CB    . ASN B 2  193  ? 131.166 184.060 162.485 1.00 75.00  ?  193  ASN B CB    1 
ATOM   7941  C  CG    . ASN B 2  193  ? 129.710 183.646 162.618 1.00 75.00  ?  193  ASN B CG    1 
ATOM   7942  O  OD1   . ASN B 2  193  ? 129.395 182.566 163.111 1.00 75.00  ?  193  ASN B OD1   1 
ATOM   7943  N  ND2   . ASN B 2  193  ? 128.812 184.520 162.179 1.00 75.00  ?  193  ASN B ND2   1 
ATOM   7944  N  N     . ARG B 2  194  ? 133.085 181.903 161.037 1.00 75.39  ?  194  ARG B N     1 
ATOM   7945  C  CA    . ARG B 2  194  ? 133.286 180.785 160.121 1.00 75.39  ?  194  ARG B CA    1 
ATOM   7946  C  C     . ARG B 2  194  ? 134.058 179.656 160.797 1.00 75.39  ?  194  ARG B C     1 
ATOM   7947  O  O     . ARG B 2  194  ? 133.816 178.473 160.527 1.00 75.39  ?  194  ARG B O     1 
ATOM   7948  C  CB    . ARG B 2  194  ? 134.012 181.273 158.865 1.00 75.39  ?  194  ARG B CB    1 
ATOM   7949  C  CG    . ARG B 2  194  ? 134.216 180.219 157.785 1.00 75.39  ?  194  ARG B CG    1 
ATOM   7950  C  CD    . ARG B 2  194  ? 134.921 180.802 156.568 1.00 75.39  ?  194  ARG B CD    1 
ATOM   7951  N  NE    . ARG B 2  194  ? 136.262 181.287 156.886 1.00 75.39  ?  194  ARG B NE    1 
ATOM   7952  C  CZ    . ARG B 2  194  ? 137.348 180.521 156.925 1.00 75.39  ?  194  ARG B CZ    1 
ATOM   7953  N  NH1   . ARG B 2  194  ? 137.261 179.225 156.659 1.00 75.39  ?  194  ARG B NH1   1 
ATOM   7954  N  NH2   . ARG B 2  194  ? 138.524 181.053 157.226 1.00 75.39  ?  194  ARG B NH2   1 
ATOM   7955  N  N     . ARG B 2  195  ? 134.983 180.004 161.696 1.00 66.27  ?  195  ARG B N     1 
ATOM   7956  C  CA    . ARG B 2  195  ? 135.791 178.988 162.365 1.00 66.27  ?  195  ARG B CA    1 
ATOM   7957  C  C     . ARG B 2  195  ? 134.992 178.252 163.435 1.00 66.27  ?  195  ARG B C     1 
ATOM   7958  O  O     . ARG B 2  195  ? 135.350 177.134 163.822 1.00 66.27  ?  195  ARG B O     1 
ATOM   7959  C  CB    . ARG B 2  195  ? 137.039 179.628 162.971 1.00 66.27  ?  195  ARG B CB    1 
ATOM   7960  C  CG    . ARG B 2  195  ? 138.032 180.140 161.942 1.00 66.27  ?  195  ARG B CG    1 
ATOM   7961  C  CD    . ARG B 2  195  ? 139.246 180.762 162.609 1.00 66.27  ?  195  ARG B CD    1 
ATOM   7962  N  NE    . ARG B 2  195  ? 140.199 181.280 161.633 1.00 66.27  ?  195  ARG B NE    1 
ATOM   7963  C  CZ    . ARG B 2  195  ? 141.323 181.913 161.951 1.00 66.27  ?  195  ARG B CZ    1 
ATOM   7964  N  NH1   . ARG B 2  195  ? 141.640 182.108 163.223 1.00 66.27  ?  195  ARG B NH1   1 
ATOM   7965  N  NH2   . ARG B 2  195  ? 142.132 182.351 160.996 1.00 66.27  ?  195  ARG B NH2   1 
ATOM   7966  N  N     . GLN B 2  196  ? 133.904 178.857 163.917 1.00 75.28  ?  196  GLN B N     1 
ATOM   7967  C  CA    . GLN B 2  196  ? 133.059 178.245 164.938 1.00 75.28  ?  196  GLN B CA    1 
ATOM   7968  C  C     . GLN B 2  196  ? 132.170 177.139 164.367 1.00 75.28  ?  196  GLN B C     1 
ATOM   7969  O  O     . GLN B 2  196  ? 131.559 176.387 165.134 1.00 75.28  ?  196  GLN B O     1 
ATOM   7970  C  CB    . GLN B 2  196  ? 132.228 179.352 165.611 1.00 75.28  ?  196  GLN B CB    1 
ATOM   7971  C  CG    . GLN B 2  196  ? 131.526 178.994 166.925 1.00 75.28  ?  196  GLN B CG    1 
ATOM   7972  C  CD    . GLN B 2  196  ? 130.755 180.157 167.506 1.00 75.28  ?  196  GLN B CD    1 
ATOM   7973  O  OE1   . GLN B 2  196  ? 130.711 181.238 166.922 1.00 75.28  ?  196  GLN B OE1   1 
ATOM   7974  N  NE2   . GLN B 2  196  ? 130.138 179.940 168.662 1.00 75.28  ?  196  GLN B NE2   1 
ATOM   7975  N  N     . LYS B 2  197  ? 132.107 176.998 163.040 1.00 79.82  ?  197  LYS B N     1 
ATOM   7976  C  CA    . LYS B 2  197  ? 131.312 175.932 162.437 1.00 79.82  ?  197  LYS B CA    1 
ATOM   7977  C  C     . LYS B 2  197  ? 131.939 174.560 162.675 1.00 79.82  ?  197  LYS B C     1 
ATOM   7978  O  O     . LYS B 2  197  ? 131.225 173.551 162.722 1.00 79.82  ?  197  LYS B O     1 
ATOM   7979  C  CB    . LYS B 2  197  ? 131.143 176.207 160.940 1.00 79.82  ?  197  LYS B CB    1 
ATOM   7980  C  CG    . LYS B 2  197  ? 130.147 175.313 160.217 1.00 79.82  ?  197  LYS B CG    1 
ATOM   7981  C  CD    . LYS B 2  197  ? 130.078 175.662 158.741 1.00 79.82  ?  197  LYS B CD    1 
ATOM   7982  C  CE    . LYS B 2  197  ? 129.345 176.977 158.529 1.00 79.82  ?  197  LYS B CE    1 
ATOM   7983  N  NZ    . LYS B 2  197  ? 129.177 177.298 157.086 1.00 79.82  ?  197  LYS B NZ    1 
ATOM   7984  N  N     . LYS B 2  198  ? 133.259 174.505 162.858 1.00 70.05  ?  198  LYS B N     1 
ATOM   7985  C  CA    . LYS B 2  198  ? 133.937 173.231 163.078 1.00 70.05  ?  198  LYS B CA    1 
ATOM   7986  C  C     . LYS B 2  198  ? 133.963 172.860 164.558 1.00 70.05  ?  198  LYS B C     1 
ATOM   7987  O  O     . LYS B 2  198  ? 133.452 171.807 164.955 1.00 70.05  ?  198  LYS B O     1 
ATOM   7988  C  CB    . LYS B 2  198  ? 135.358 173.294 162.512 1.00 70.05  ?  198  LYS B CB    1 
ATOM   7989  C  CG    . LYS B 2  198  ? 135.419 173.581 161.020 1.00 70.05  ?  198  LYS B CG    1 
ATOM   7990  C  CD    . LYS B 2  198  ? 134.886 172.413 160.207 1.00 70.05  ?  198  LYS B CD    1 
ATOM   7991  C  CE    . LYS B 2  198  ? 134.927 172.713 158.717 1.00 70.05  ?  198  LYS B CE    1 
ATOM   7992  N  NZ    . LYS B 2  198  ? 136.322 172.805 158.204 1.00 70.05  ?  198  LYS B NZ    1 
ATOM   7993  N  N     . ASN B 2  199  ? 134.559 173.712 165.388 1.00 71.42  ?  199  ASN B N     1 
ATOM   7994  C  CA    . ASN B 2  199  ? 134.692 173.445 166.814 1.00 71.42  ?  199  ASN B CA    1 
ATOM   7995  C  C     . ASN B 2  199  ? 133.497 174.043 167.565 1.00 71.42  ?  199  ASN B C     1 
ATOM   7996  O  O     . ASN B 2  199  ? 132.480 174.391 166.961 1.00 71.42  ?  199  ASN B O     1 
ATOM   7997  C  CB    . ASN B 2  199  ? 136.057 173.948 167.312 1.00 71.42  ?  199  ASN B CB    1 
ATOM   7998  C  CG    . ASN B 2  199  ? 136.296 175.431 167.034 1.00 71.42  ?  199  ASN B CG    1 
ATOM   7999  O  OD1   . ASN B 2  199  ? 135.424 176.146 166.541 1.00 71.42  ?  199  ASN B OD1   1 
ATOM   8000  N  ND2   . ASN B 2  199  ? 137.498 175.895 167.356 1.00 71.42  ?  199  ASN B ND2   1 
ATOM   8001  N  N     . ILE B 2  200  ? 133.593 174.142 168.887 1.00 69.56  ?  200  ILE B N     1 
ATOM   8002  C  CA    . ILE B 2  200  ? 132.548 174.750 169.701 1.00 69.56  ?  200  ILE B CA    1 
ATOM   8003  C  C     . ILE B 2  200  ? 132.851 176.215 169.995 1.00 69.56  ?  200  ILE B C     1 
ATOM   8004  O  O     . ILE B 2  200  ? 131.942 177.049 169.974 1.00 69.56  ?  200  ILE B O     1 
ATOM   8005  C  CB    . ILE B 2  200  ? 132.354 173.932 170.998 1.00 69.56  ?  200  ILE B CB    1 
ATOM   8006  C  CG1   . ILE B 2  200  ? 132.023 172.478 170.650 1.00 69.56  ?  200  ILE B CG1   1 
ATOM   8007  C  CG2   . ILE B 2  200  ? 131.238 174.503 171.862 1.00 69.56  ?  200  ILE B CG2   1 
ATOM   8008  C  CD1   . ILE B 2  200  ? 130.762 172.313 169.836 1.00 69.56  ?  200  ILE B CD1   1 
ATOM   8009  N  N     . TRP B 2  201  ? 134.133 176.531 170.231 1.00 63.67  ?  201  TRP B N     1 
ATOM   8010  C  CA    . TRP B 2  201  ? 134.673 177.891 170.311 1.00 63.67  ?  201  TRP B CA    1 
ATOM   8011  C  C     . TRP B 2  201  ? 134.027 178.727 171.415 1.00 63.67  ?  201  TRP B C     1 
ATOM   8012  O  O     . TRP B 2  201  ? 133.196 179.596 171.131 1.00 63.67  ?  201  TRP B O     1 
ATOM   8013  C  CB    . TRP B 2  201  ? 134.555 178.610 168.960 1.00 63.67  ?  201  TRP B CB    1 
ATOM   8014  C  CG    . TRP B 2  201  ? 135.339 179.890 168.901 1.00 63.67  ?  201  TRP B CG    1 
ATOM   8015  C  CD1   . TRP B 2  201  ? 136.695 180.010 168.921 1.00 63.67  ?  201  TRP B CD1   1 
ATOM   8016  C  CD2   . TRP B 2  201  ? 134.819 181.224 168.836 1.00 63.67  ?  201  TRP B CD2   1 
ATOM   8017  N  NE1   . TRP B 2  201  ? 137.057 181.332 168.864 1.00 63.67  ?  201  TRP B NE1   1 
ATOM   8018  C  CE2   . TRP B 2  201  ? 135.923 182.099 168.812 1.00 63.67  ?  201  TRP B CE2   1 
ATOM   8019  C  CE3   . TRP B 2  201  ? 133.528 181.764 168.792 1.00 63.67  ?  201  TRP B CE3   1 
ATOM   8020  C  CZ2   . TRP B 2  201  ? 135.778 183.483 168.747 1.00 63.67  ?  201  TRP B CZ2   1 
ATOM   8021  C  CZ3   . TRP B 2  201  ? 133.389 183.139 168.726 1.00 63.67  ?  201  TRP B CZ3   1 
ATOM   8022  C  CH2   . TRP B 2  201  ? 134.506 183.981 168.703 1.00 63.67  ?  201  TRP B CH2   1 
ATOM   8023  N  N     . LEU B 2  202  ? 134.355 178.420 172.673 1.00 59.76  ?  202  LEU B N     1 
ATOM   8024  C  CA    . LEU B 2  202  ? 133.838 179.115 173.850 1.00 59.76  ?  202  LEU B CA    1 
ATOM   8025  C  C     . LEU B 2  202  ? 134.160 180.616 173.830 1.00 59.76  ?  202  LEU B C     1 
ATOM   8026  O  O     . LEU B 2  202  ? 134.975 181.107 173.043 1.00 59.76  ?  202  LEU B O     1 
ATOM   8027  C  CB    . LEU B 2  202  ? 134.427 178.513 175.124 1.00 59.76  ?  202  LEU B CB    1 
ATOM   8028  C  CG    . LEU B 2  202  ? 134.121 177.067 175.505 1.00 59.76  ?  202  LEU B CG    1 
ATOM   8029  C  CD1   . LEU B 2  202  ? 134.951 176.698 176.720 1.00 59.76  ?  202  LEU B CD1   1 
ATOM   8030  C  CD2   . LEU B 2  202  ? 132.641 176.877 175.785 1.00 59.76  ?  202  LEU B CD2   1 
ATOM   8031  N  N     . GLU B 2  203  ? 133.504 181.342 174.742 1.00 62.46  ?  203  GLU B N     1 
ATOM   8032  C  CA    . GLU B 2  203  ? 133.673 182.792 174.821 1.00 62.46  ?  203  GLU B CA    1 
ATOM   8033  C  C     . GLU B 2  203  ? 135.072 183.160 175.301 1.00 62.46  ?  203  GLU B C     1 
ATOM   8034  O  O     . GLU B 2  203  ? 135.625 184.192 174.903 1.00 62.46  ?  203  GLU B O     1 
ATOM   8035  C  CB    . GLU B 2  203  ? 132.620 183.403 175.750 1.00 62.46  ?  203  GLU B CB    1 
ATOM   8036  C  CG    . GLU B 2  203  ? 131.179 183.233 175.301 1.00 62.46  ?  203  GLU B CG    1 
ATOM   8037  C  CD    . GLU B 2  203  ? 130.556 181.946 175.809 1.00 62.46  ?  203  GLU B CD    1 
ATOM   8038  O  OE1   . GLU B 2  203  ? 131.225 181.219 176.574 1.00 62.46  ?  203  GLU B OE1   1 
ATOM   8039  O  OE2   . GLU B 2  203  ? 129.396 181.662 175.448 1.00 62.46  ?  203  GLU B OE2   1 
ATOM   8040  N  N     . THR B 2  204  ? 135.663 182.321 176.152 1.00 49.77  ?  204  THR B N     1 
ATOM   8041  C  CA    . THR B 2  204  ? 136.982 182.591 176.708 1.00 49.77  ?  204  THR B CA    1 
ATOM   8042  C  C     . THR B 2  204  ? 138.084 181.917 175.887 1.00 49.77  ?  204  THR B C     1 
ATOM   8043  O  O     . THR B 2  204  ? 139.175 181.652 176.406 1.00 49.77  ?  204  THR B O     1 
ATOM   8044  C  CB    . THR B 2  204  ? 137.005 182.141 178.178 1.00 49.77  ?  204  THR B CB    1 
ATOM   8045  O  OG1   . THR B 2  204  ? 135.710 182.373 178.740 1.00 49.77  ?  204  THR B OG1   1 
ATOM   8046  C  CG2   . THR B 2  204  ? 137.954 183.014 179.005 1.00 49.77  ?  204  THR B CG2   1 
ATOM   8047  N  N     . HIS B 2  205  ? 137.816 181.625 174.611 1.00 47.64  ?  205  HIS B N     1 
ATOM   8048  C  CA    . HIS B 2  205  ? 138.819 180.996 173.758 1.00 47.64  ?  205  HIS B CA    1 
ATOM   8049  C  C     . HIS B 2  205  ? 139.909 181.986 173.367 1.00 47.64  ?  205  HIS B C     1 
ATOM   8050  O  O     . HIS B 2  205  ? 141.065 181.604 173.158 1.00 47.64  ?  205  HIS B O     1 
ATOM   8051  C  CB    . HIS B 2  205  ? 138.154 180.412 172.511 1.00 47.64  ?  205  HIS B CB    1 
ATOM   8052  C  CG    . HIS B 2  205  ? 139.102 179.709 171.590 1.00 47.64  ?  205  HIS B CG    1 
ATOM   8053  N  ND1   . HIS B 2  205  ? 139.590 178.444 171.842 1.00 47.64  ?  205  HIS B ND1   1 
ATOM   8054  C  CD2   . HIS B 2  205  ? 139.662 180.103 170.422 1.00 47.64  ?  205  HIS B CD2   1 
ATOM   8055  C  CE1   . HIS B 2  205  ? 140.398 178.083 170.861 1.00 47.64  ?  205  HIS B CE1   1 
ATOM   8056  N  NE2   . HIS B 2  205  ? 140.461 179.072 169.988 1.00 47.64  ?  205  HIS B NE2   1 
ATOM   8057  N  N     . ILE B 2  206  ? 139.557 183.272 173.270 1.00 52.27  ?  206  ILE B N     1 
ATOM   8058  C  CA    . ILE B 2  206  ? 140.547 184.284 172.920 1.00 52.27  ?  206  ILE B CA    1 
ATOM   8059  C  C     . ILE B 2  206  ? 141.487 184.559 174.095 1.00 52.27  ?  206  ILE B C     1 
ATOM   8060  O  O     . ILE B 2  206  ? 142.598 185.066 173.900 1.00 52.27  ?  206  ILE B O     1 
ATOM   8061  C  CB    . ILE B 2  206  ? 139.833 185.559 172.414 1.00 52.27  ?  206  ILE B CB    1 
ATOM   8062  C  CG1   . ILE B 2  206  ? 140.792 186.470 171.639 1.00 52.27  ?  206  ILE B CG1   1 
ATOM   8063  C  CG2   . ILE B 2  206  ? 139.166 186.313 173.555 1.00 52.27  ?  206  ILE B CG2   1 
ATOM   8064  C  CD1   . ILE B 2  206  ? 141.312 185.857 170.357 1.00 52.27  ?  206  ILE B CD1   1 
ATOM   8065  N  N     . TRP B 2  207  ? 141.084 184.200 175.317 1.00 49.64  ?  207  TRP B N     1 
ATOM   8066  C  CA    . TRP B 2  207  ? 142.009 184.259 176.443 1.00 49.64  ?  207  TRP B CA    1 
ATOM   8067  C  C     . TRP B 2  207  ? 142.929 183.044 176.454 1.00 49.64  ?  207  TRP B C     1 
ATOM   8068  O  O     . TRP B 2  207  ? 144.146 183.178 176.633 1.00 49.64  ?  207  TRP B O     1 
ATOM   8069  C  CB    . TRP B 2  207  ? 141.237 184.330 177.759 1.00 49.64  ?  207  TRP B CB    1 
ATOM   8070  C  CG    . TRP B 2  207  ? 142.101 184.624 178.942 1.00 49.64  ?  207  TRP B CG    1 
ATOM   8071  C  CD1   . TRP B 2  207  ? 142.546 185.842 179.349 1.00 49.64  ?  207  TRP B CD1   1 
ATOM   8072  C  CD2   . TRP B 2  207  ? 142.712 183.662 179.812 1.00 49.64  ?  207  TRP B CD2   1 
ATOM   8073  N  NE1   . TRP B 2  207  ? 143.351 185.708 180.466 1.00 49.64  ?  207  TRP B NE1   1 
ATOM   8074  C  CE2   . TRP B 2  207  ? 143.480 184.376 180.754 1.00 49.64  ?  207  TRP B CE2   1 
ATOM   8075  C  CE3   . TRP B 2  207  ? 142.668 182.266 179.895 1.00 49.64  ?  207  TRP B CE3   1 
ATOM   8076  C  CZ2   . TRP B 2  207  ? 144.184 183.749 181.766 1.00 49.64  ?  207  TRP B CZ2   1 
ATOM   8077  C  CZ3   . TRP B 2  207  ? 143.375 181.643 180.903 1.00 49.64  ?  207  TRP B CZ3   1 
ATOM   8078  C  CH2   . TRP B 2  207  ? 144.125 182.384 181.824 1.00 49.64  ?  207  TRP B CH2   1 
ATOM   8079  N  N     . HIS B 2  208  ? 142.364 181.852 176.245 1.00 49.98  ?  208  HIS B N     1 
ATOM   8080  C  CA    . HIS B 2  208  ? 143.116 180.619 176.461 1.00 49.98  ?  208  HIS B CA    1 
ATOM   8081  C  C     . HIS B 2  208  ? 144.078 180.334 175.316 1.00 49.98  ?  208  HIS B C     1 
ATOM   8082  O  O     . HIS B 2  208  ? 145.249 180.023 175.551 1.00 49.98  ?  208  HIS B O     1 
ATOM   8083  C  CB    . HIS B 2  208  ? 142.155 179.448 176.670 1.00 49.98  ?  208  HIS B CB    1 
ATOM   8084  C  CG    . HIS B 2  208  ? 141.429 179.499 177.977 1.00 49.98  ?  208  HIS B CG    1 
ATOM   8085  N  ND1   . HIS B 2  208  ? 140.249 180.193 178.146 1.00 49.98  ?  208  HIS B ND1   1 
ATOM   8086  C  CD2   . HIS B 2  208  ? 141.722 178.952 179.180 1.00 49.98  ?  208  HIS B CD2   1 
ATOM   8087  C  CE1   . HIS B 2  208  ? 139.847 180.071 179.398 1.00 49.98  ?  208  HIS B CE1   1 
ATOM   8088  N  NE2   . HIS B 2  208  ? 140.722 179.324 180.046 1.00 49.98  ?  208  HIS B NE2   1 
ATOM   8089  N  N     . ALA B 2  209  ? 143.606 180.452 174.068 1.00 50.24  ?  209  ALA B N     1 
ATOM   8090  C  CA    . ALA B 2  209  ? 144.436 180.107 172.914 1.00 50.24  ?  209  ALA B CA    1 
ATOM   8091  C  C     . ALA B 2  209  ? 145.622 181.049 172.754 1.00 50.24  ?  209  ALA B C     1 
ATOM   8092  O  O     . ALA B 2  209  ? 146.631 180.675 172.148 1.00 50.24  ?  209  ALA B O     1 
ATOM   8093  C  CB    . ALA B 2  209  ? 143.594 180.107 171.638 1.00 50.24  ?  209  ALA B CB    1 
ATOM   8094  N  N     . LYS B 2  210  ? 145.532 182.255 173.313 1.00 54.81  ?  210  LYS B N     1 
ATOM   8095  C  CA    . LYS B 2  210  ? 146.618 183.221 173.230 1.00 54.81  ?  210  LYS B CA    1 
ATOM   8096  C  C     . LYS B 2  210  ? 147.836 182.809 174.058 1.00 54.81  ?  210  LYS B C     1 
ATOM   8097  O  O     . LYS B 2  210  ? 148.959 183.199 173.716 1.00 54.81  ?  210  LYS B O     1 
ATOM   8098  C  CB    . LYS B 2  210  ? 146.096 184.591 173.670 1.00 54.81  ?  210  LYS B CB    1 
ATOM   8099  C  CG    . LYS B 2  210  ? 146.994 185.777 173.381 1.00 54.81  ?  210  LYS B CG    1 
ATOM   8100  C  CD    . LYS B 2  210  ? 146.356 187.059 173.880 1.00 54.81  ?  210  LYS B CD    1 
ATOM   8101  C  CE    . LYS B 2  210  ? 145.193 187.464 172.990 1.00 54.81  ?  210  LYS B CE    1 
ATOM   8102  N  NZ    . LYS B 2  210  ? 144.621 188.782 173.377 1.00 54.81  ?  210  LYS B NZ    1 
ATOM   8103  N  N     . ARG B 2  211  ? 147.653 182.016 175.128 1.00 50.15  ?  211  ARG B N     1 
ATOM   8104  C  CA    . ARG B 2  211  ? 148.770 181.667 176.004 1.00 50.15  ?  211  ARG B CA    1 
ATOM   8105  C  C     . ARG B 2  211  ? 148.720 180.217 176.499 1.00 50.15  ?  211  ARG B C     1 
ATOM   8106  O  O     . ARG B 2  211  ? 149.276 179.904 177.558 1.00 50.15  ?  211  ARG B O     1 
ATOM   8107  C  CB    . ARG B 2  211  ? 148.838 182.624 177.200 1.00 50.15  ?  211  ARG B CB    1 
ATOM   8108  C  CG    . ARG B 2  211  ? 147.582 182.627 178.064 1.00 50.15  ?  211  ARG B CG    1 
ATOM   8109  C  CD    . ARG B 2  211  ? 147.689 183.596 179.235 1.00 50.15  ?  211  ARG B CD    1 
ATOM   8110  N  NE    . ARG B 2  211  ? 147.849 184.983 178.799 1.00 50.15  ?  211  ARG B NE    1 
ATOM   8111  C  CZ    . ARG B 2  211  ? 146.842 185.779 178.452 1.00 50.15  ?  211  ARG B CZ    1 
ATOM   8112  N  NH1   . ARG B 2  211  ? 145.603 185.322 178.478 1.00 50.15  ?  211  ARG B NH1   1 
ATOM   8113  N  NH2   . ARG B 2  211  ? 147.068 187.028 178.071 1.00 50.15  ?  211  ARG B NH2   1 
ATOM   8114  N  N     . PHE B 2  212  ? 148.084 179.315 175.751 1.00 45.68  ?  212  PHE B N     1 
ATOM   8115  C  CA    . PHE B 2  212  ? 148.068 177.897 176.101 1.00 45.68  ?  212  PHE B CA    1 
ATOM   8116  C  C     . PHE B 2  212  ? 148.244 177.048 174.850 1.00 45.68  ?  212  PHE B C     1 
ATOM   8117  O  O     . PHE B 2  212  ? 147.984 177.507 173.735 1.00 45.68  ?  212  PHE B O     1 
ATOM   8118  C  CB    . PHE B 2  212  ? 146.765 177.487 176.812 1.00 45.68  ?  212  PHE B CB    1 
ATOM   8119  C  CG    . PHE B 2  212  ? 146.662 177.973 178.233 1.00 45.68  ?  212  PHE B CG    1 
ATOM   8120  C  CD1   . PHE B 2  212  ? 147.148 177.204 179.279 1.00 45.68  ?  212  PHE B CD1   1 
ATOM   8121  C  CD2   . PHE B 2  212  ? 146.098 179.204 178.522 1.00 45.68  ?  212  PHE B CD2   1 
ATOM   8122  C  CE1   . PHE B 2  212  ? 147.063 177.648 180.590 1.00 45.68  ?  212  PHE B CE1   1 
ATOM   8123  C  CE2   . PHE B 2  212  ? 146.012 179.657 179.829 1.00 45.68  ?  212  PHE B CE2   1 
ATOM   8124  C  CZ    . PHE B 2  212  ? 146.494 178.876 180.865 1.00 45.68  ?  212  PHE B CZ    1 
ATOM   8125  N  N     . HIS B 2  213  ? 148.683 175.805 175.047 1.00 44.10  ?  213  HIS B N     1 
ATOM   8126  C  CA    . HIS B 2  213  ? 148.840 174.859 173.948 1.00 44.10  ?  213  HIS B CA    1 
ATOM   8127  C  C     . HIS B 2  213  ? 147.496 174.236 173.593 1.00 44.10  ?  213  HIS B C     1 
ATOM   8128  O  O     . HIS B 2  213  ? 146.945 173.452 174.373 1.00 44.10  ?  213  HIS B O     1 
ATOM   8129  C  CB    . HIS B 2  213  ? 149.851 173.771 174.315 1.00 44.10  ?  213  HIS B CB    1 
ATOM   8130  C  CG    . HIS B 2  213  ? 151.251 174.275 174.473 1.00 44.10  ?  213  HIS B CG    1 
ATOM   8131  N  ND1   . HIS B 2  213  ? 152.267 173.501 174.990 1.00 44.10  ?  213  HIS B ND1   1 
ATOM   8132  C  CD2   . HIS B 2  213  ? 151.804 175.477 174.183 1.00 44.10  ?  213  HIS B CD2   1 
ATOM   8133  C  CE1   . HIS B 2  213  ? 153.385 174.203 175.014 1.00 44.10  ?  213  HIS B CE1   1 
ATOM   8134  N  NE2   . HIS B 2  213  ? 153.132 175.406 174.529 1.00 44.10  ?  213  HIS B NE2   1 
ATOM   8135  N  N     . MET B 2  214  ? 146.963 174.574 172.423 1.00 45.39  ?  214  MET B N     1 
ATOM   8136  C  CA    . MET B 2  214  ? 145.634 174.109 172.051 1.00 45.39  ?  214  MET B CA    1 
ATOM   8137  C  C     . MET B 2  214  ? 145.724 172.779 171.312 1.00 45.39  ?  214  MET B C     1 
ATOM   8138  O  O     . MET B 2  214  ? 146.365 172.681 170.262 1.00 45.39  ?  214  MET B O     1 
ATOM   8139  C  CB    . MET B 2  214  ? 144.933 175.152 171.185 1.00 45.39  ?  214  MET B CB    1 
ATOM   8140  C  CG    . MET B 2  214  ? 144.783 176.504 171.859 1.00 45.39  ?  214  MET B CG    1 
ATOM   8141  S  SD    . MET B 2  214  ? 143.936 176.413 173.448 1.00 45.39  ?  214  MET B SD    1 
ATOM   8142  C  CE    . MET B 2  214  ? 142.287 175.959 172.928 1.00 45.39  ?  214  MET B CE    1 
ATOM   8143  N  N     . VAL B 2  215  ? 145.074 171.755 171.863 1.00 46.67  ?  215  VAL B N     1 
ATOM   8144  C  CA    . VAL B 2  215  ? 145.066 170.412 171.293 1.00 46.67  ?  215  VAL B CA    1 
ATOM   8145  C  C     . VAL B 2  215  ? 143.615 170.001 171.084 1.00 46.67  ?  215  VAL B C     1 
ATOM   8146  O  O     . VAL B 2  215  ? 142.826 169.998 172.037 1.00 46.67  ?  215  VAL B O     1 
ATOM   8147  C  CB    . VAL B 2  215  ? 145.788 169.394 172.195 1.00 46.67  ?  215  VAL B CB    1 
ATOM   8148  C  CG1   . VAL B 2  215  ? 145.649 167.986 171.631 1.00 46.67  ?  215  VAL B CG1   1 
ATOM   8149  C  CG2   . VAL B 2  215  ? 147.257 169.761 172.359 1.00 46.67  ?  215  VAL B CG2   1 
ATOM   8150  N  N     . LYS B 2  216  ? 143.264 169.661 169.846 1.00 51.72  ?  216  LYS B N     1 
ATOM   8151  C  CA    . LYS B 2  216  ? 141.922 169.174 169.556 1.00 51.72  ?  216  LYS B CA    1 
ATOM   8152  C  C     . LYS B 2  216  ? 141.731 167.777 170.136 1.00 51.72  ?  216  LYS B C     1 
ATOM   8153  O  O     . LYS B 2  216  ? 142.652 166.957 170.141 1.00 51.72  ?  216  LYS B O     1 
ATOM   8154  C  CB    . LYS B 2  216  ? 141.669 169.166 168.049 1.00 51.72  ?  216  LYS B CB    1 
ATOM   8155  C  CG    . LYS B 2  216  ? 141.569 170.555 167.438 1.00 51.72  ?  216  LYS B CG    1 
ATOM   8156  C  CD    . LYS B 2  216  ? 141.262 170.489 165.951 1.00 51.72  ?  216  LYS B CD    1 
ATOM   8157  C  CE    . LYS B 2  216  ? 141.150 171.881 165.352 1.00 51.72  ?  216  LYS B CE    1 
ATOM   8158  N  NZ    . LYS B 2  216  ? 140.848 171.832 163.895 1.00 51.72  ?  216  LYS B NZ    1 
ATOM   8159  N  N     . LYS B 2  217  ? 140.522 167.510 170.617 1.00 54.59  ?  217  LYS B N     1 
ATOM   8160  C  CA    . LYS B 2  217  ? 140.232 166.316 171.406 1.00 54.59  ?  217  LYS B CA    1 
ATOM   8161  C  C     . LYS B 2  217  ? 138.913 165.735 170.899 1.00 54.59  ?  217  LYS B C     1 
ATOM   8162  O  O     . LYS B 2  217  ? 138.480 166.012 169.772 1.00 54.59  ?  217  LYS B O     1 
ATOM   8163  C  CB    . LYS B 2  217  ? 140.184 166.624 172.913 1.00 54.59  ?  217  LYS B CB    1 
ATOM   8164  C  CG    . LYS B 2  217  ? 141.480 167.164 173.523 1.00 54.59  ?  217  LYS B CG    1 
ATOM   8165  C  CD    . LYS B 2  217  ? 142.642 166.190 173.360 1.00 54.59  ?  217  LYS B CD    1 
ATOM   8166  C  CE    . LYS B 2  217  ? 142.468 164.950 174.216 1.00 54.59  ?  217  LYS B CE    1 
ATOM   8167  N  NZ    . LYS B 2  217  ? 142.521 165.277 175.667 1.00 54.59  ?  217  LYS B NZ    1 
ATOM   8168  N  N     . TRP B 2  218  ? 138.296 164.874 171.721 1.00 55.78  ?  218  TRP B N     1 
ATOM   8169  C  CA    . TRP B 2  218  ? 137.019 164.245 171.379 1.00 55.78  ?  218  TRP B CA    1 
ATOM   8170  C  C     . TRP B 2  218  ? 135.906 165.264 171.155 1.00 55.78  ?  218  TRP B C     1 
ATOM   8171  O  O     . TRP B 2  218  ? 135.003 165.030 170.344 1.00 55.78  ?  218  TRP B O     1 
ATOM   8172  C  CB    . TRP B 2  218  ? 136.613 163.265 172.484 1.00 55.78  ?  218  TRP B CB    1 
ATOM   8173  C  CG    . TRP B 2  218  ? 136.455 163.911 173.836 1.00 55.78  ?  218  TRP B CG    1 
ATOM   8174  C  CD1   . TRP B 2  218  ? 135.324 164.481 174.350 1.00 55.78  ?  218  TRP B CD1   1 
ATOM   8175  C  CD2   . TRP B 2  218  ? 137.468 164.060 174.838 1.00 55.78  ?  218  TRP B CD2   1 
ATOM   8176  N  NE1   . TRP B 2  218  ? 135.571 164.974 175.608 1.00 55.78  ?  218  TRP B NE1   1 
ATOM   8177  C  CE2   . TRP B 2  218  ? 136.879 164.727 175.932 1.00 55.78  ?  218  TRP B CE2   1 
ATOM   8178  C  CE3   . TRP B 2  218  ? 138.814 163.693 174.918 1.00 55.78  ?  218  TRP B CE3   1 
ATOM   8179  C  CZ2   . TRP B 2  218  ? 137.592 165.035 177.089 1.00 55.78  ?  218  TRP B CZ2   1 
ATOM   8180  C  CZ3   . TRP B 2  218  ? 139.517 163.997 176.070 1.00 55.78  ?  218  TRP B CZ3   1 
ATOM   8181  C  CH2   . TRP B 2  218  ? 138.905 164.661 177.139 1.00 55.78  ?  218  TRP B CH2   1 
ATOM   8182  N  N     . GLY B 2  219  ? 135.954 166.393 171.856 1.00 53.64  ?  219  GLY B N     1 
ATOM   8183  C  CA    . GLY B 2  219  ? 134.991 167.454 171.657 1.00 53.64  ?  219  GLY B CA    1 
ATOM   8184  C  C     . GLY B 2  219  ? 135.571 168.592 170.846 1.00 53.64  ?  219  GLY B C     1 
ATOM   8185  O  O     . GLY B 2  219  ? 135.640 168.522 169.615 1.00 53.64  ?  219  GLY B O     1 
ATOM   8186  N  N     . TYR B 2  220  ? 135.993 169.647 171.532 1.00 57.67  ?  220  TYR B N     1 
ATOM   8187  C  CA    . TYR B 2  220  ? 136.564 170.824 170.891 1.00 57.67  ?  220  TYR B CA    1 
ATOM   8188  C  C     . TYR B 2  220  ? 137.983 171.009 171.426 1.00 57.67  ?  220  TYR B C     1 
ATOM   8189  O  O     . TYR B 2  220  ? 138.439 170.236 172.276 1.00 57.67  ?  220  TYR B O     1 
ATOM   8190  C  CB    . TYR B 2  220  ? 135.658 172.047 171.121 1.00 57.67  ?  220  TYR B CB    1 
ATOM   8191  C  CG    . TYR B 2  220  ? 135.433 172.407 172.579 1.00 57.67  ?  220  TYR B CG    1 
ATOM   8192  C  CD1   . TYR B 2  220  ? 134.391 171.837 173.306 1.00 57.67  ?  220  TYR B CD1   1 
ATOM   8193  C  CD2   . TYR B 2  220  ? 136.248 173.333 173.220 1.00 57.67  ?  220  TYR B CD2   1 
ATOM   8194  C  CE1   . TYR B 2  220  ? 134.181 172.164 174.632 1.00 57.67  ?  220  TYR B CE1   1 
ATOM   8195  C  CE2   . TYR B 2  220  ? 136.045 173.666 174.547 1.00 57.67  ?  220  TYR B CE2   1 
ATOM   8196  C  CZ    . TYR B 2  220  ? 135.011 173.080 175.246 1.00 57.67  ?  220  TYR B CZ    1 
ATOM   8197  O  OH    . TYR B 2  220  ? 134.805 173.410 176.564 1.00 57.67  ?  220  TYR B OH    1 
ATOM   8198  N  N     . CYS B 2  221  ? 138.679 172.028 170.931 1.00 55.32  ?  221  CYS B N     1 
ATOM   8199  C  CA    . CYS B 2  221  ? 140.024 172.332 171.396 1.00 55.32  ?  221  CYS B CA    1 
ATOM   8200  C  C     . CYS B 2  221  ? 139.952 173.163 172.672 1.00 55.32  ?  221  CYS B C     1 
ATOM   8201  O  O     . CYS B 2  221  ? 139.280 174.199 172.718 1.00 55.32  ?  221  CYS B O     1 
ATOM   8202  C  CB    . CYS B 2  221  ? 140.829 173.047 170.305 1.00 55.32  ?  221  CYS B CB    1 
ATOM   8203  S  SG    . CYS B 2  221  ? 140.152 174.607 169.675 1.00 55.32  ?  221  CYS B SG    1 
ATOM   8204  N  N     . LEU B 2  222  ? 140.627 172.690 173.716 1.00 48.04  ?  222  LEU B N     1 
ATOM   8205  C  CA    . LEU B 2  222  ? 140.604 173.360 175.007 1.00 48.04  ?  222  LEU B CA    1 
ATOM   8206  C  C     . LEU B 2  222  ? 142.021 173.398 175.559 1.00 48.04  ?  222  LEU B C     1 
ATOM   8207  O  O     . LEU B 2  222  ? 142.893 172.648 175.112 1.00 48.04  ?  222  LEU B O     1 
ATOM   8208  C  CB    . LEU B 2  222  ? 139.627 172.671 175.973 1.00 48.04  ?  222  LEU B CB    1 
ATOM   8209  C  CG    . LEU B 2  222  ? 139.740 171.176 176.304 1.00 48.04  ?  222  LEU B CG    1 
ATOM   8210  C  CD1   . LEU B 2  222  ? 140.619 170.888 177.519 1.00 48.04  ?  222  LEU B CD1   1 
ATOM   8211  C  CD2   . LEU B 2  222  ? 138.353 170.575 176.490 1.00 48.04  ?  222  LEU B CD2   1 
ATOM   8212  N  N     . GLY B 2  223  ? 142.237 174.288 176.525 1.00 39.67  ?  223  GLY B N     1 
ATOM   8213  C  CA    . GLY B 2  223  ? 143.572 174.489 177.057 1.00 39.67  ?  223  GLY B CA    1 
ATOM   8214  C  C     . GLY B 2  223  ? 144.045 173.319 177.899 1.00 39.67  ?  223  GLY B C     1 
ATOM   8215  O  O     . GLY B 2  223  ? 143.359 172.850 178.807 1.00 39.67  ?  223  GLY B O     1 
ATOM   8216  N  N     . GLU B 2  224  ? 145.250 172.843 177.580 1.00 39.04  ?  224  GLU B N     1 
ATOM   8217  C  CA    . GLU B 2  224  ? 145.841 171.699 178.265 1.00 39.04  ?  224  GLU B CA    1 
ATOM   8218  C  C     . GLU B 2  224  ? 147.086 172.084 179.054 1.00 39.04  ?  224  GLU B C     1 
ATOM   8219  O  O     . GLU B 2  224  ? 147.151 171.816 180.258 1.00 39.04  ?  224  GLU B O     1 
ATOM   8220  C  CB    . GLU B 2  224  ? 146.166 170.592 177.253 1.00 39.04  ?  224  GLU B CB    1 
ATOM   8221  C  CG    . GLU B 2  224  ? 146.722 169.326 177.883 1.00 39.04  ?  224  GLU B CG    1 
ATOM   8222  C  CD    . GLU B 2  224  ? 146.996 168.234 176.866 1.00 39.04  ?  224  GLU B CD    1 
ATOM   8223  O  OE1   . GLU B 2  224  ? 146.773 168.470 175.660 1.00 39.04  ?  224  GLU B OE1   1 
ATOM   8224  O  OE2   . GLU B 2  224  ? 147.435 167.139 177.275 1.00 39.04  ?  224  GLU B OE2   1 
ATOM   8225  N  N     . ARG B 2  225  ? 148.077 172.705 178.416 1.00 41.77  ?  225  ARG B N     1 
ATOM   8226  C  CA    . ARG B 2  225  ? 149.326 173.040 179.078 1.00 41.77  ?  225  ARG B CA    1 
ATOM   8227  C  C     . ARG B 2  225  ? 149.664 174.509 178.861 1.00 41.77  ?  225  ARG B C     1 
ATOM   8228  O  O     . ARG B 2  225  ? 149.417 175.051 177.777 1.00 41.77  ?  225  ARG B O     1 
ATOM   8229  C  CB    . ARG B 2  225  ? 150.478 172.166 178.558 1.00 41.77  ?  225  ARG B CB    1 
ATOM   8230  C  CG    . ARG B 2  225  ? 150.354 170.692 178.910 1.00 41.77  ?  225  ARG B CG    1 
ATOM   8231  C  CD    . ARG B 2  225  ? 151.514 169.890 178.345 1.00 41.77  ?  225  ARG B CD    1 
ATOM   8232  N  NE    . ARG B 2  225  ? 151.487 169.844 176.886 1.00 41.77  ?  225  ARG B NE    1 
ATOM   8233  C  CZ    . ARG B 2  225  ? 152.457 169.330 176.137 1.00 41.77  ?  225  ARG B CZ    1 
ATOM   8234  N  NH1   . ARG B 2  225  ? 153.537 168.816 176.708 1.00 41.77  ?  225  ARG B NH1   1 
ATOM   8235  N  NH2   . ARG B 2  225  ? 152.347 169.331 174.815 1.00 41.77  ?  225  ARG B NH2   1 
ATOM   8236  N  N     . PRO B 2  226  ? 150.221 175.179 179.870 1.00 42.53  ?  226  PRO B N     1 
ATOM   8237  C  CA    . PRO B 2  226  ? 150.621 176.579 179.685 1.00 42.53  ?  226  PRO B CA    1 
ATOM   8238  C  C     . PRO B 2  226  ? 151.915 176.694 178.896 1.00 42.53  ?  226  PRO B C     1 
ATOM   8239  O  O     . PRO B 2  226  ? 152.757 175.793 178.910 1.00 42.53  ?  226  PRO B O     1 
ATOM   8240  C  CB    . PRO B 2  226  ? 150.789 177.092 181.119 1.00 42.53  ?  226  PRO B CB    1 
ATOM   8241  C  CG    . PRO B 2  226  ? 151.119 175.875 181.910 1.00 42.53  ?  226  PRO B CG    1 
ATOM   8242  C  CD    . PRO B 2  226  ? 150.361 174.744 181.271 1.00 42.53  ?  226  PRO B CD    1 
ATOM   8243  N  N     . THR B 2  227  ? 152.057 177.819 178.189 1.00 45.72  ?  227  THR B N     1 
ATOM   8244  C  CA    . THR B 2  227  ? 153.296 178.090 177.469 1.00 45.72  ?  227  THR B CA    1 
ATOM   8245  C  C     . THR B 2  227  ? 154.443 178.378 178.427 1.00 45.72  ?  227  THR B C     1 
ATOM   8246  O  O     . THR B 2  227  ? 155.585 177.982 178.165 1.00 45.72  ?  227  THR B O     1 
ATOM   8247  C  CB    . THR B 2  227  ? 153.105 179.262 176.506 1.00 45.72  ?  227  THR B CB    1 
ATOM   8248  O  OG1   . THR B 2  227  ? 152.760 180.440 177.247 1.00 45.72  ?  227  THR B OG1   1 
ATOM   8249  C  CG2   . THR B 2  227  ? 151.999 178.955 175.508 1.00 45.72  ?  227  THR B CG2   1 
ATOM   8250  N  N     . VAL B 2  228  ? 154.163 179.062 179.537 1.00 47.53  ?  228  VAL B N     1 
ATOM   8251  C  CA    . VAL B 2  228  ? 155.162 179.221 180.583 1.00 47.53  ?  228  VAL B CA    1 
ATOM   8252  C  C     . VAL B 2  228  ? 155.169 177.965 181.454 1.00 47.53  ?  228  VAL B C     1 
ATOM   8253  O  O     . VAL B 2  228  ? 154.138 177.304 181.648 1.00 47.53  ?  228  VAL B O     1 
ATOM   8254  C  CB    . VAL B 2  228  ? 154.892 180.510 181.391 1.00 47.53  ?  228  VAL B CB    1 
ATOM   8255  C  CG1   . VAL B 2  228  ? 153.578 180.440 182.177 1.00 47.53  ?  228  VAL B CG1   1 
ATOM   8256  C  CG2   . VAL B 2  228  ? 156.072 180.875 182.297 1.00 47.53  ?  228  VAL B CG2   1 
ATOM   8257  N  N     . LYS B 2  229  ? 156.356 177.585 181.923 1.00 50.66  ?  229  LYS B N     1 
ATOM   8258  C  CA    . LYS B 2  229  ? 156.494 176.381 182.733 1.00 50.66  ?  229  LYS B CA    1 
ATOM   8259  C  C     . LYS B 2  229  ? 155.928 176.626 184.126 1.00 50.66  ?  229  LYS B C     1 
ATOM   8260  O  O     . LYS B 2  229  ? 156.521 177.357 184.927 1.00 50.66  ?  229  LYS B O     1 
ATOM   8261  C  CB    . LYS B 2  229  ? 157.960 175.965 182.810 1.00 50.66  ?  229  LYS B CB    1 
ATOM   8262  C  CG    . LYS B 2  229  ? 158.538 175.497 181.487 1.00 50.66  ?  229  LYS B CG    1 
ATOM   8263  C  CD    . LYS B 2  229  ? 159.991 175.081 181.636 1.00 50.66  ?  229  LYS B CD    1 
ATOM   8264  C  CE    . LYS B 2  229  ? 160.573 174.641 180.304 1.00 50.66  ?  229  LYS B CE    1 
ATOM   8265  N  NZ    . LYS B 2  229  ? 162.002 174.243 180.427 1.00 50.66  ?  229  LYS B NZ    1 
ATOM   8266  N  N     . SER B 2  230  ? 154.776 176.014 184.416 1.00 50.52  ?  230  SER B N     1 
ATOM   8267  C  CA    . SER B 2  230  ? 154.094 176.227 185.686 1.00 50.52  ?  230  SER B CA    1 
ATOM   8268  C  C     . SER B 2  230  ? 153.579 174.920 186.279 1.00 50.52  ?  230  SER B C     1 
ATOM   8269  O  O     . SER B 2  230  ? 152.504 174.896 186.888 1.00 50.52  ?  230  SER B O     1 
ATOM   8270  C  CB    . SER B 2  230  ? 152.936 177.217 185.528 1.00 50.52  ?  230  SER B CB    1 
ATOM   8271  O  OG    . SER B 2  230  ? 153.408 178.503 185.165 1.00 50.52  ?  230  SER B OG    1 
ATOM   8272  N  N     . HIS B 2  231  ? 154.326 173.825 186.111 1.00 47.78  ?  231  HIS B N     1 
ATOM   8273  C  CA    . HIS B 2  231  ? 153.897 172.537 186.653 1.00 47.78  ?  231  HIS B CA    1 
ATOM   8274  C  C     . HIS B 2  231  ? 153.988 172.508 188.174 1.00 47.78  ?  231  HIS B C     1 
ATOM   8275  O  O     . HIS B 2  231  ? 153.076 172.009 188.843 1.00 47.78  ?  231  HIS B O     1 
ATOM   8276  C  CB    . HIS B 2  231  ? 154.732 171.407 186.051 1.00 47.78  ?  231  HIS B CB    1 
ATOM   8277  C  CG    . HIS B 2  231  ? 154.323 170.043 186.512 1.00 47.78  ?  231  HIS B CG    1 
ATOM   8278  N  ND1   . HIS B 2  231  ? 153.180 169.417 186.062 1.00 47.78  ?  231  HIS B ND1   1 
ATOM   8279  C  CD2   . HIS B 2  231  ? 154.900 169.187 187.388 1.00 47.78  ?  231  HIS B CD2   1 
ATOM   8280  C  CE1   . HIS B 2  231  ? 153.073 168.233 186.637 1.00 47.78  ?  231  HIS B CE1   1 
ATOM   8281  N  NE2   . HIS B 2  231  ? 154.104 168.069 187.446 1.00 47.78  ?  231  HIS B NE2   1 
ATOM   8282  N  N     . ARG B 2  232  ? 155.079 173.035 188.735 1.00 45.57  ?  232  ARG B N     1 
ATOM   8283  C  CA    . ARG B 2  232  ? 155.176 173.163 190.185 1.00 45.57  ?  232  ARG B CA    1 
ATOM   8284  C  C     . ARG B 2  232  ? 154.380 174.357 190.694 1.00 45.57  ?  232  ARG B C     1 
ATOM   8285  O  O     . ARG B 2  232  ? 154.051 174.419 191.884 1.00 45.57  ?  232  ARG B O     1 
ATOM   8286  C  CB    . ARG B 2  232  ? 156.640 173.291 190.605 1.00 45.57  ?  232  ARG B CB    1 
ATOM   8287  C  CG    . ARG B 2  232  ? 157.468 172.036 190.395 1.00 45.57  ?  232  ARG B CG    1 
ATOM   8288  C  CD    . ARG B 2  232  ? 158.924 172.282 190.756 1.00 45.57  ?  232  ARG B CD    1 
ATOM   8289  N  NE    . ARG B 2  232  ? 159.760 171.111 190.509 1.00 45.57  ?  232  ARG B NE    1 
ATOM   8290  C  CZ    . ARG B 2  232  ? 161.081 171.095 190.650 1.00 45.57  ?  232  ARG B CZ    1 
ATOM   8291  N  NH1   . ARG B 2  232  ? 161.723 172.191 191.031 1.00 45.57  ?  232  ARG B NH1   1 
ATOM   8292  N  NH2   . ARG B 2  232  ? 161.763 169.984 190.404 1.00 45.57  ?  232  ARG B NH2   1 
ATOM   8293  N  N     . ALA B 2  233  ? 154.067 175.311 189.816 1.00 47.73  ?  233  ALA B N     1 
ATOM   8294  C  CA    . ALA B 2  233  ? 153.358 176.514 190.235 1.00 47.73  ?  233  ALA B CA    1 
ATOM   8295  C  C     . ALA B 2  233  ? 151.863 176.277 190.403 1.00 47.73  ?  233  ALA B C     1 
ATOM   8296  O  O     . ALA B 2  233  ? 151.222 176.965 191.205 1.00 47.73  ?  233  ALA B O     1 
ATOM   8297  C  CB    . ALA B 2  233  ? 153.598 177.641 189.231 1.00 47.73  ?  233  ALA B CB    1 
ATOM   8298  N  N     . CYS B 2  234  ? 151.291 175.325 189.659 1.00 47.80  ?  234  CYS B N     1 
ATOM   8299  C  CA    . CYS B 2  234  ? 149.860 175.057 189.774 1.00 47.80  ?  234  CYS B CA    1 
ATOM   8300  C  C     . CYS B 2  234  ? 149.523 174.357 191.085 1.00 47.80  ?  234  CYS B C     1 
ATOM   8301  O  O     . CYS B 2  234  ? 148.476 174.629 191.684 1.00 47.80  ?  234  CYS B O     1 
ATOM   8302  C  CB    . CYS B 2  234  ? 149.378 174.228 188.586 1.00 47.80  ?  234  CYS B CB    1 
ATOM   8303  S  SG    . CYS B 2  234  ? 149.278 175.126 187.019 1.00 47.80  ?  234  CYS B SG    1 
ATOM   8304  N  N     . TYR B 2  235  ? 150.385 173.447 191.542 1.00 46.95  ?  235  TYR B N     1 
ATOM   8305  C  CA    . TYR B 2  235  ? 150.158 172.813 192.838 1.00 46.95  ?  235  TYR B CA    1 
ATOM   8306  C  C     . TYR B 2  235  ? 150.445 173.787 193.974 1.00 46.95  ?  235  TYR B C     1 
ATOM   8307  O  O     . TYR B 2  235  ? 149.805 173.735 195.031 1.00 46.95  ?  235  TYR B O     1 
ATOM   8308  C  CB    . TYR B 2  235  ? 151.016 171.554 192.977 1.00 46.95  ?  235  TYR B CB    1 
ATOM   8309  C  CG    . TYR B 2  235  ? 150.812 170.850 194.300 1.00 46.95  ?  235  TYR B CG    1 
ATOM   8310  C  CD1   . TYR B 2  235  ? 149.662 170.106 194.540 1.00 46.95  ?  235  TYR B CD1   1 
ATOM   8311  C  CD2   . TYR B 2  235  ? 151.758 170.946 195.317 1.00 46.95  ?  235  TYR B CD2   1 
ATOM   8312  C  CE1   . TYR B 2  235  ? 149.464 169.469 195.752 1.00 46.95  ?  235  TYR B CE1   1 
ATOM   8313  C  CE2   . TYR B 2  235  ? 151.568 170.315 196.532 1.00 46.95  ?  235  TYR B CE2   1 
ATOM   8314  C  CZ    . TYR B 2  235  ? 150.420 169.577 196.742 1.00 46.95  ?  235  TYR B CZ    1 
ATOM   8315  O  OH    . TYR B 2  235  ? 150.226 168.948 197.948 1.00 46.95  ?  235  TYR B OH    1 
ATOM   8316  N  N     . ARG B 2  236  ? 151.414 174.683 193.772 1.00 49.72  ?  236  ARG B N     1 
ATOM   8317  C  CA    . ARG B 2  236  ? 151.742 175.672 194.792 1.00 49.72  ?  236  ARG B CA    1 
ATOM   8318  C  C     . ARG B 2  236  ? 150.646 176.723 194.915 1.00 49.72  ?  236  ARG B C     1 
ATOM   8319  O  O     . ARG B 2  236  ? 150.427 177.274 196.000 1.00 49.72  ?  236  ARG B O     1 
ATOM   8320  C  CB    . ARG B 2  236  ? 153.091 176.314 194.461 1.00 49.72  ?  236  ARG B CB    1 
ATOM   8321  C  CG    . ARG B 2  236  ? 153.652 177.256 195.511 1.00 49.72  ?  236  ARG B CG    1 
ATOM   8322  C  CD    . ARG B 2  236  ? 155.049 177.691 195.118 1.00 49.72  ?  236  ARG B CD    1 
ATOM   8323  N  NE    . ARG B 2  236  ? 155.988 176.574 195.176 1.00 49.72  ?  236  ARG B NE    1 
ATOM   8324  C  CZ    . ARG B 2  236  ? 157.215 176.601 194.670 1.00 49.72  ?  236  ARG B CZ    1 
ATOM   8325  N  NH1   . ARG B 2  236  ? 158.002 175.539 194.770 1.00 49.72  ?  236  ARG B NH1   1 
ATOM   8326  N  NH2   . ARG B 2  236  ? 157.651 177.688 194.052 1.00 49.72  ?  236  ARG B NH2   1 
ATOM   8327  N  N     . ALA B 2  237  ? 149.926 176.991 193.823 1.00 50.57  ?  237  ALA B N     1 
ATOM   8328  C  CA    . ALA B 2  237  ? 148.765 177.871 193.843 1.00 50.57  ?  237  ALA B CA    1 
ATOM   8329  C  C     . ALA B 2  237  ? 147.465 177.123 194.117 1.00 50.57  ?  237  ALA B C     1 
ATOM   8330  O  O     . ALA B 2  237  ? 146.384 177.627 193.791 1.00 50.57  ?  237  ALA B O     1 
ATOM   8331  C  CB    . ALA B 2  237  ? 148.665 178.645 192.528 1.00 50.57  ?  237  ALA B CB    1 
ATOM   8332  N  N     . MET B 2  238  ? 147.540 175.934 194.715 1.00 48.97  ?  238  MET B N     1 
ATOM   8333  C  CA    . MET B 2  238  ? 146.347 175.146 194.999 1.00 48.97  ?  238  MET B CA    1 
ATOM   8334  C  C     . MET B 2  238  ? 146.218 174.755 196.463 1.00 48.97  ?  238  MET B C     1 
ATOM   8335  O  O     . MET B 2  238  ? 145.092 174.696 196.965 1.00 48.97  ?  238  MET B O     1 
ATOM   8336  C  CB    . MET B 2  238  ? 146.336 173.878 194.127 1.00 48.97  ?  238  MET B CB    1 
ATOM   8337  C  CG    . MET B 2  238  ? 145.043 173.076 194.151 1.00 48.97  ?  238  MET B CG    1 
ATOM   8338  S  SD    . MET B 2  238  ? 145.079 171.681 193.010 1.00 48.97  ?  238  MET B SD    1 
ATOM   8339  C  CE    . MET B 2  238  ? 143.476 170.952 193.323 1.00 48.97  ?  238  MET B CE    1 
ATOM   8340  N  N     . THR B 2  239  ? 147.320 174.520 197.174 1.00 46.60  ?  239  THR B N     1 
ATOM   8341  C  CA    . THR B 2  239  ? 147.277 174.234 198.602 1.00 46.60  ?  239  THR B CA    1 
ATOM   8342  C  C     . THR B 2  239  ? 147.522 175.465 199.460 1.00 46.60  ?  239  THR B C     1 
ATOM   8343  O  O     . THR B 2  239  ? 147.085 175.499 200.615 1.00 46.60  ?  239  THR B O     1 
ATOM   8344  C  CB    . THR B 2  239  ? 148.311 173.161 198.961 1.00 46.60  ?  239  THR B CB    1 
ATOM   8345  O  OG1   . THR B 2  239  ? 149.626 173.637 198.646 1.00 46.60  ?  239  THR B OG1   1 
ATOM   8346  C  CG2   . THR B 2  239  ? 148.041 171.881 198.185 1.00 46.60  ?  239  THR B CG2   1 
ATOM   8347  N  N     . ASN B 2  240  ? 148.208 176.476 198.926 1.00 47.39  ?  240  ASN B N     1 
ATOM   8348  C  CA    . ASN B 2  240  ? 148.466 177.716 199.645 1.00 47.39  ?  240  ASN B CA    1 
ATOM   8349  C  C     . ASN B 2  240  ? 147.777 178.908 198.993 1.00 47.39  ?  240  ASN B C     1 
ATOM   8350  O  O     . ASN B 2  240  ? 147.037 179.637 199.660 1.00 47.39  ?  240  ASN B O     1 
ATOM   8351  C  CB    . ASN B 2  240  ? 149.978 177.961 199.745 1.00 47.39  ?  240  ASN B CB    1 
ATOM   8352  C  CG    . ASN B 2  240  ? 150.666 176.982 200.676 1.00 47.39  ?  240  ASN B CG    1 
ATOM   8353  O  OD1   . ASN B 2  240  ? 150.153 176.664 201.749 1.00 47.39  ?  240  ASN B OD1   1 
ATOM   8354  N  ND2   . ASN B 2  240  ? 151.834 176.498 200.269 1.00 47.39  ?  240  ASN B ND2   1 
ATOM   8355  N  N     . ARG B 2  241  ? 148.002 179.128 197.701 1.00 52.64  ?  241  ARG B N     1 
ATOM   8356  C  CA    . ARG B 2  241  ? 147.439 180.262 196.989 1.00 52.64  ?  241  ARG B CA    1 
ATOM   8357  C  C     . ARG B 2  241  ? 146.160 179.848 196.261 1.00 52.64  ?  241  ARG B C     1 
ATOM   8358  O  O     . ARG B 2  241  ? 145.624 178.754 196.464 1.00 52.64  ?  241  ARG B O     1 
ATOM   8359  C  CB    . ARG B 2  241  ? 148.476 180.849 196.029 1.00 52.64  ?  241  ARG B CB    1 
ATOM   8360  C  CG    . ARG B 2  241  ? 149.671 181.485 196.713 1.00 52.64  ?  241  ARG B CG    1 
ATOM   8361  C  CD    . ARG B 2  241  ? 150.648 182.039 195.691 1.00 52.64  ?  241  ARG B CD    1 
ATOM   8362  N  NE    . ARG B 2  241  ? 151.821 182.633 196.322 1.00 52.64  ?  241  ARG B NE    1 
ATOM   8363  C  CZ    . ARG B 2  241  ? 152.848 183.146 195.653 1.00 52.64  ?  241  ARG B CZ    1 
ATOM   8364  N  NH1   . ARG B 2  241  ? 152.848 183.139 194.327 1.00 52.64  ?  241  ARG B NH1   1 
ATOM   8365  N  NH2   . ARG B 2  241  ? 153.875 183.666 196.310 1.00 52.64  ?  241  ARG B NH2   1 
ATOM   8366  N  N     . CYS B 2  242  ? 145.664 180.732 195.404 1.00 51.70  ?  242  CYS B N     1 
ATOM   8367  C  CA    . CYS B 2  242  ? 144.389 180.558 194.725 1.00 51.70  ?  242  CYS B CA    1 
ATOM   8368  C  C     . CYS B 2  242  ? 144.585 180.153 193.266 1.00 51.70  ?  242  CYS B C     1 
ATOM   8369  O  O     . CYS B 2  242  ? 145.652 180.336 192.674 1.00 51.70  ?  242  CYS B O     1 
ATOM   8370  C  CB    . CYS B 2  242  ? 143.570 181.846 194.818 1.00 51.70  ?  242  CYS B CB    1 
ATOM   8371  S  SG    . CYS B 2  242  ? 144.400 183.286 194.122 1.00 51.70  ?  242  CYS B SG    1 
ATOM   8372  N  N     . LEU B 2  243  ? 143.517 179.602 192.688 1.00 46.62  ?  243  LEU B N     1 
ATOM   8373  C  CA    . LEU B 2  243  ? 143.523 179.075 191.329 1.00 46.62  ?  243  LEU B CA    1 
ATOM   8374  C  C     . LEU B 2  243  ? 142.080 178.975 190.851 1.00 46.62  ?  243  LEU B C     1 
ATOM   8375  O  O     . LEU B 2  243  ? 141.164 178.836 191.665 1.00 46.62  ?  243  LEU B O     1 
ATOM   8376  C  CB    . LEU B 2  243  ? 144.216 177.701 191.275 1.00 46.62  ?  243  LEU B CB    1 
ATOM   8377  C  CG    . LEU B 2  243  ? 144.549 176.970 189.966 1.00 46.62  ?  243  LEU B CG    1 
ATOM   8378  C  CD1   . LEU B 2  243  ? 145.824 176.166 190.144 1.00 46.62  ?  243  LEU B CD1   1 
ATOM   8379  C  CD2   . LEU B 2  243  ? 143.427 176.037 189.516 1.00 46.62  ?  243  LEU B CD2   1 
ATOM   8380  N  N     . LEU B 2  244  ? 141.883 179.057 189.536 1.00 46.13  ?  244  LEU B N     1 
ATOM   8381  C  CA    . LEU B 2  244  ? 140.584 178.802 188.930 1.00 46.13  ?  244  LEU B CA    1 
ATOM   8382  C  C     . LEU B 2  244  ? 140.755 178.344 187.489 1.00 46.13  ?  244  LEU B C     1 
ATOM   8383  O  O     . LEU B 2  244  ? 141.759 178.634 186.834 1.00 46.13  ?  244  LEU B O     1 
ATOM   8384  C  CB    . LEU B 2  244  ? 139.667 180.034 189.011 1.00 46.13  ?  244  LEU B CB    1 
ATOM   8385  C  CG    . LEU B 2  244  ? 140.034 181.403 188.435 1.00 46.13  ?  244  LEU B CG    1 
ATOM   8386  C  CD1   . LEU B 2  244  ? 139.574 181.598 187.003 1.00 46.13  ?  244  LEU B CD1   1 
ATOM   8387  C  CD2   . LEU B 2  244  ? 139.471 182.486 189.330 1.00 46.13  ?  244  LEU B CD2   1 
ATOM   8388  N  N     . GLN B 2  245  ? 139.743 177.631 186.999 1.00 43.52  ?  245  GLN B N     1 
ATOM   8389  C  CA    . GLN B 2  245  ? 139.784 176.980 185.699 1.00 43.52  ?  245  GLN B CA    1 
ATOM   8390  C  C     . GLN B 2  245  ? 138.626 177.467 184.838 1.00 43.52  ?  245  GLN B C     1 
ATOM   8391  O  O     . GLN B 2  245  ? 137.810 178.294 185.255 1.00 43.52  ?  245  GLN B O     1 
ATOM   8392  C  CB    . GLN B 2  245  ? 139.716 175.452 185.839 1.00 43.52  ?  245  GLN B CB    1 
ATOM   8393  C  CG    . GLN B 2  245  ? 140.889 174.819 186.568 1.00 43.52  ?  245  GLN B CG    1 
ATOM   8394  C  CD    . GLN B 2  245  ? 140.750 173.312 186.678 1.00 43.52  ?  245  GLN B CD    1 
ATOM   8395  O  OE1   . GLN B 2  245  ? 139.752 172.737 186.245 1.00 43.52  ?  245  GLN B OE1   1 
ATOM   8396  N  NE2   . GLN B 2  245  ? 141.749 172.665 187.266 1.00 43.52  ?  245  GLN B NE2   1 
ATOM   8397  N  N     . ASP B 2  246  ? 138.570 176.941 183.616 1.00 47.75  ?  246  ASP B N     1 
ATOM   8398  C  CA    . ASP B 2  246  ? 137.443 177.122 182.708 1.00 47.75  ?  246  ASP B CA    1 
ATOM   8399  C  C     . ASP B 2  246  ? 136.932 175.740 182.323 1.00 47.75  ?  246  ASP B C     1 
ATOM   8400  O  O     . ASP B 2  246  ? 137.489 175.097 181.427 1.00 47.75  ?  246  ASP B O     1 
ATOM   8401  C  CB    . ASP B 2  246  ? 137.854 177.914 181.464 1.00 47.75  ?  246  ASP B CB    1 
ATOM   8402  C  CG    . ASP B 2  246  ? 136.663 178.345 180.607 1.00 47.75  ?  246  ASP B CG    1 
ATOM   8403  O  OD1   . ASP B 2  246  ? 135.500 178.061 180.966 1.00 47.75  ?  246  ASP B OD1   1 
ATOM   8404  O  OD2   . ASP B 2  246  ? 136.898 178.972 179.553 1.00 47.75  ?  246  ASP B OD2   1 
ATOM   8405  N  N     . LEU B 2  247  ? 135.874 175.293 182.989 1.00 46.91  ?  247  LEU B N     1 
ATOM   8406  C  CA    . LEU B 2  247  ? 135.248 174.005 182.707 1.00 46.91  ?  247  LEU B CA    1 
ATOM   8407  C  C     . LEU B 2  247  ? 133.828 174.260 182.209 1.00 46.91  ?  247  LEU B C     1 
ATOM   8408  O  O     . LEU B 2  247  ? 132.865 174.196 182.977 1.00 46.91  ?  247  LEU B O     1 
ATOM   8409  C  CB    . LEU B 2  247  ? 135.256 173.115 183.958 1.00 46.91  ?  247  LEU B CB    1 
ATOM   8410  C  CG    . LEU B 2  247  ? 136.628 172.735 184.521 1.00 46.91  ?  247  LEU B CG    1 
ATOM   8411  C  CD1   . LEU B 2  247  ? 136.478 171.953 185.817 1.00 46.91  ?  247  LEU B CD1   1 
ATOM   8412  C  CD2   . LEU B 2  247  ? 137.441 171.950 183.507 1.00 46.91  ?  247  LEU B CD2   1 
ATOM   8413  N  N     . SER B 2  248  ? 133.698 174.531 180.911 1.00 44.91  ?  248  SER B N     1 
ATOM   8414  C  CA    . SER B 2  248  ? 132.410 174.849 180.309 1.00 44.91  ?  248  SER B CA    1 
ATOM   8415  C  C     . SER B 2  248  ? 131.876 173.739 179.416 1.00 44.91  ?  248  SER B C     1 
ATOM   8416  O  O     . SER B 2  248  ? 130.758 173.860 178.904 1.00 44.91  ?  248  SER B O     1 
ATOM   8417  C  CB    . SER B 2  248  ? 132.509 176.149 179.500 1.00 44.91  ?  248  SER B CB    1 
ATOM   8418  O  OG    . SER B 2  248  ? 131.274 176.459 178.877 1.00 44.91  ?  248  SER B OG    1 
ATOM   8419  N  N     . TYR B 2  249  ? 132.644 172.667 179.216 1.00 47.13  ?  249  TYR B N     1 
ATOM   8420  C  CA    . TYR B 2  249  ? 132.182 171.550 178.401 1.00 47.13  ?  249  TYR B CA    1 
ATOM   8421  C  C     . TYR B 2  249  ? 131.206 170.647 179.144 1.00 47.13  ?  249  TYR B C     1 
ATOM   8422  O  O     . TYR B 2  249  ? 130.567 169.799 178.511 1.00 47.13  ?  249  TYR B O     1 
ATOM   8423  C  CB    . TYR B 2  249  ? 133.381 170.745 177.884 1.00 47.13  ?  249  TYR B CB    1 
ATOM   8424  C  CG    . TYR B 2  249  ? 134.342 170.246 178.946 1.00 47.13  ?  249  TYR B CG    1 
ATOM   8425  C  CD1   . TYR B 2  249  ? 135.437 171.014 179.338 1.00 47.13  ?  249  TYR B CD1   1 
ATOM   8426  C  CD2   . TYR B 2  249  ? 134.170 169.000 179.541 1.00 47.13  ?  249  TYR B CD2   1 
ATOM   8427  C  CE1   . TYR B 2  249  ? 136.320 170.563 180.302 1.00 47.13  ?  249  TYR B CE1   1 
ATOM   8428  C  CE2   . TYR B 2  249  ? 135.050 168.541 180.507 1.00 47.13  ?  249  TYR B CE2   1 
ATOM   8429  C  CZ    . TYR B 2  249  ? 136.122 169.326 180.882 1.00 47.13  ?  249  TYR B CZ    1 
ATOM   8430  O  OH    . TYR B 2  249  ? 136.999 168.873 181.840 1.00 47.13  ?  249  TYR B OH    1 
ATOM   8431  N  N     . TYR B 2  250  ? 131.074 170.807 180.460 1.00 48.34  ?  250  TYR B N     1 
ATOM   8432  C  CA    . TYR B 2  250  ? 130.120 170.017 181.229 1.00 48.34  ?  250  TYR B CA    1 
ATOM   8433  C  C     . TYR B 2  250  ? 128.696 170.459 180.906 1.00 48.34  ?  250  TYR B C     1 
ATOM   8434  O  O     . TYR B 2  250  ? 128.262 171.538 181.321 1.00 48.34  ?  250  TYR B O     1 
ATOM   8435  C  CB    . TYR B 2  250  ? 130.403 170.150 182.723 1.00 48.34  ?  250  TYR B CB    1 
ATOM   8436  C  CG    . TYR B 2  250  ? 131.700 169.501 183.153 1.00 48.34  ?  250  TYR B CG    1 
ATOM   8437  C  CD1   . TYR B 2  250  ? 131.773 168.128 183.367 1.00 48.34  ?  250  TYR B CD1   1 
ATOM   8438  C  CD2   . TYR B 2  250  ? 132.851 170.258 183.343 1.00 48.34  ?  250  TYR B CD2   1 
ATOM   8439  C  CE1   . TYR B 2  250  ? 132.958 167.527 183.758 1.00 48.34  ?  250  TYR B CE1   1 
ATOM   8440  C  CE2   . TYR B 2  250  ? 134.041 169.666 183.735 1.00 48.34  ?  250  TYR B CE2   1 
ATOM   8441  C  CZ    . TYR B 2  250  ? 134.087 168.300 183.941 1.00 48.34  ?  250  TYR B CZ    1 
ATOM   8442  O  OH    . TYR B 2  250  ? 135.265 167.705 184.330 1.00 48.34  ?  250  TYR B OH    1 
ATOM   8443  N  N     . CYS B 2  251  ? 127.976 169.622 180.163 1.00 62.04  ?  251  CYS B N     1 
ATOM   8444  C  CA    . CYS B 2  251  ? 126.620 169.938 179.743 1.00 62.04  ?  251  CYS B CA    1 
ATOM   8445  C  C     . CYS B 2  251  ? 125.643 169.784 180.907 1.00 62.04  ?  251  CYS B C     1 
ATOM   8446  O  O     . CYS B 2  251  ? 125.986 169.287 181.982 1.00 62.04  ?  251  CYS B O     1 
ATOM   8447  C  CB    . CYS B 2  251  ? 126.197 169.032 178.586 1.00 62.04  ?  251  CYS B CB    1 
ATOM   8448  S  SG    . CYS B 2  251  ? 127.182 169.224 177.081 1.00 62.04  ?  251  CYS B SG    1 
ATOM   8449  N  N     . CYS B 2  252  ? 124.408 170.228 180.681 1.00 68.50  ?  252  CYS B N     1 
ATOM   8450  C  CA    . CYS B 2  252  ? 123.344 170.116 181.669 1.00 68.50  ?  252  CYS B CA    1 
ATOM   8451  C  C     . CYS B 2  252  ? 122.043 169.724 180.983 1.00 68.50  ?  252  CYS B C     1 
ATOM   8452  O  O     . CYS B 2  252  ? 121.766 170.160 179.861 1.00 68.50  ?  252  CYS B O     1 
ATOM   8453  C  CB    . CYS B 2  252  ? 123.165 171.426 182.452 1.00 68.50  ?  252  CYS B CB    1 
ATOM   8454  S  SG    . CYS B 2  252  ? 122.661 172.855 181.466 1.00 68.50  ?  252  CYS B SG    1 
ATOM   8455  N  N     . LEU B 2  253  ? 121.254 168.887 181.655 1.00 73.82  ?  253  LEU B N     1 
ATOM   8456  C  CA    . LEU B 2  253  ? 119.976 168.413 181.135 1.00 73.82  ?  253  LEU B CA    1 
ATOM   8457  C  C     . LEU B 2  253  ? 118.871 168.777 182.115 1.00 73.82  ?  253  LEU B C     1 
ATOM   8458  O  O     . LEU B 2  253  ? 118.753 168.159 183.178 1.00 73.82  ?  253  LEU B O     1 
ATOM   8459  C  CB    . LEU B 2  253  ? 120.000 166.902 180.897 1.00 73.82  ?  253  LEU B CB    1 
ATOM   8460  C  CG    . LEU B 2  253  ? 120.934 166.389 179.801 1.00 73.82  ?  253  LEU B CG    1 
ATOM   8461  C  CD1   . LEU B 2  253  ? 120.906 164.869 179.739 1.00 73.82  ?  253  LEU B CD1   1 
ATOM   8462  C  CD2   . LEU B 2  253  ? 120.563 166.993 178.459 1.00 73.82  ?  253  LEU B CD2   1 
ATOM   8463  N  N     . GLU B 2  254  ? 118.058 169.763 181.749 1.00 82.49  ?  254  GLU B N     1 
ATOM   8464  C  CA    . GLU B 2  254  ? 116.931 170.186 182.570 1.00 82.49  ?  254  GLU B CA    1 
ATOM   8465  C  C     . GLU B 2  254  ? 115.729 169.293 182.290 1.00 82.49  ?  254  GLU B C     1 
ATOM   8466  O  O     . GLU B 2  254  ? 115.375 169.064 181.129 1.00 82.49  ?  254  GLU B O     1 
ATOM   8467  C  CB    . GLU B 2  254  ? 116.585 171.650 182.292 1.00 82.49  ?  254  GLU B CB    1 
ATOM   8468  C  CG    . GLU B 2  254  ? 115.455 172.198 183.147 1.00 82.49  ?  254  GLU B CG    1 
ATOM   8469  C  CD    . GLU B 2  254  ? 115.165 173.657 182.860 1.00 82.49  ?  254  GLU B CD    1 
ATOM   8470  O  OE1   . GLU B 2  254  ? 115.846 174.241 181.991 1.00 82.49  ?  254  GLU B OE1   1 
ATOM   8471  O  OE2   . GLU B 2  254  ? 114.250 174.219 183.496 1.00 82.49  ?  254  GLU B OE2   1 
ATOM   8472  N  N     . LEU B 2  255  ? 115.111 168.785 183.354 1.00 86.51  ?  255  LEU B N     1 
ATOM   8473  C  CA    . LEU B 2  255  ? 113.957 167.897 183.250 1.00 86.51  ?  255  LEU B CA    1 
ATOM   8474  C  C     . LEU B 2  255  ? 112.788 168.521 184.007 1.00 86.51  ?  255  LEU B C     1 
ATOM   8475  O  O     . LEU B 2  255  ? 112.763 168.511 185.242 1.00 86.51  ?  255  LEU B O     1 
ATOM   8476  C  CB    . LEU B 2  255  ? 114.288 166.505 183.788 1.00 86.51  ?  255  LEU B CB    1 
ATOM   8477  C  CG    . LEU B 2  255  ? 115.337 165.707 183.003 1.00 86.51  ?  255  LEU B CG    1 
ATOM   8478  C  CD1   . LEU B 2  255  ? 115.647 164.375 183.672 1.00 86.51  ?  255  LEU B CD1   1 
ATOM   8479  C  CD2   . LEU B 2  255  ? 114.885 165.488 181.572 1.00 86.51  ?  255  LEU B CD2   1 
ATOM   8480  N  N     . LYS B 2  256  ? 111.827 169.064 183.263 1.00 96.06  ?  256  LYS B N     1 
ATOM   8481  C  CA    . LYS B 2  256  ? 110.608 169.644 183.818 1.00 96.06  ?  256  LYS B CA    1 
ATOM   8482  C  C     . LYS B 2  256  ? 109.511 168.588 183.801 1.00 96.06  ?  256  LYS B C     1 
ATOM   8483  O  O     . LYS B 2  256  ? 109.263 167.967 182.763 1.00 96.06  ?  256  LYS B O     1 
ATOM   8484  C  CB    . LYS B 2  256  ? 110.176 170.874 183.019 1.00 96.06  ?  256  LYS B CB    1 
ATOM   8485  C  CG    . LYS B 2  256  ? 108.896 171.533 183.521 1.00 96.06  ?  256  LYS B CG    1 
ATOM   8486  C  CD    . LYS B 2  256  ? 109.070 172.113 184.912 1.00 96.06  ?  256  LYS B CD    1 
ATOM   8487  C  CE    . LYS B 2  256  ? 110.029 173.291 184.895 1.00 96.06  ?  256  LYS B CE    1 
ATOM   8488  N  NZ    . LYS B 2  256  ? 109.466 174.465 184.172 1.00 96.06  ?  256  LYS B NZ    1 
ATOM   8489  N  N     . GLY B 2  257  ? 108.856 168.391 184.939 1.00 100.71 ?  257  GLY B N     1 
ATOM   8490  C  CA    . GLY B 2  257  ? 107.777 167.428 185.007 1.00 100.71 ?  257  GLY B CA    1 
ATOM   8491  C  C     . GLY B 2  257  ? 107.216 167.329 186.412 1.00 100.71 ?  257  GLY B C     1 
ATOM   8492  O  O     . GLY B 2  257  ? 107.696 167.979 187.343 1.00 100.71 ?  257  GLY B O     1 
ATOM   8493  N  N     . LYS B 2  258  ? 106.181 166.498 186.537 1.00 104.59 ?  258  LYS B N     1 
ATOM   8494  C  CA    . LYS B 2  258  ? 105.554 166.255 187.829 1.00 104.59 ?  258  LYS B CA    1 
ATOM   8495  C  C     . LYS B 2  258  ? 106.479 165.427 188.712 1.00 104.59 ?  258  LYS B C     1 
ATOM   8496  O  O     . LYS B 2  258  ? 107.281 164.636 188.209 1.00 104.59 ?  258  LYS B O     1 
ATOM   8497  C  CB    . LYS B 2  258  ? 104.217 165.536 187.647 1.00 104.59 ?  258  LYS B CB    1 
ATOM   8498  C  CG    . LYS B 2  258  ? 103.137 166.365 186.969 1.00 104.59 ?  258  LYS B CG    1 
ATOM   8499  C  CD    . LYS B 2  258  ? 101.841 165.573 186.862 1.00 104.59 ?  258  LYS B CD    1 
ATOM   8500  C  CE    . LYS B 2  258  ? 100.754 166.365 186.155 1.00 104.59 ?  258  LYS B CE    1 
ATOM   8501  N  NZ    . LYS B 2  258  ? 99.494  165.578 186.037 1.00 104.59 ?  258  LYS B NZ    1 
ATOM   8502  N  N     . GLU B 2  259  ? 106.346 165.602 190.033 1.00 103.62 ?  259  GLU B N     1 
ATOM   8503  C  CA    . GLU B 2  259  ? 107.260 164.981 190.990 1.00 103.62 ?  259  GLU B CA    1 
ATOM   8504  C  C     . GLU B 2  259  ? 107.114 163.463 191.024 1.00 103.62 ?  259  GLU B C     1 
ATOM   8505  O  O     . GLU B 2  259  ? 108.082 162.753 191.321 1.00 103.62 ?  259  GLU B O     1 
ATOM   8506  C  CB    . GLU B 2  259  ? 107.023 165.584 192.381 1.00 103.62 ?  259  GLU B CB    1 
ATOM   8507  C  CG    . GLU B 2  259  ? 108.051 165.237 193.462 1.00 103.62 ?  259  GLU B CG    1 
ATOM   8508  C  CD    . GLU B 2  259  ? 107.702 163.980 194.242 1.00 103.62 ?  259  GLU B CD    1 
ATOM   8509  O  OE1   . GLU B 2  259  ? 106.499 163.664 194.352 1.00 103.62 ?  259  GLU B OE1   1 
ATOM   8510  O  OE2   . GLU B 2  259  ? 108.629 163.314 194.748 1.00 103.62 ?  259  GLU B OE2   1 
ATOM   8511  N  N     . GLU B 2  260  ? 105.926 162.945 190.707 1.00 105.39 ?  260  GLU B N     1 
ATOM   8512  C  CA    . GLU B 2  260  ? 105.717 161.502 190.757 1.00 105.39 ?  260  GLU B CA    1 
ATOM   8513  C  C     . GLU B 2  260  ? 106.298 160.798 189.537 1.00 105.39 ?  260  GLU B C     1 
ATOM   8514  O  O     . GLU B 2  260  ? 106.428 159.569 189.536 1.00 105.39 ?  260  GLU B O     1 
ATOM   8515  C  CB    . GLU B 2  260  ? 104.225 161.191 190.881 1.00 105.39 ?  260  GLU B CB    1 
ATOM   8516  C  CG    . GLU B 2  260  ? 103.605 161.618 192.201 1.00 105.39 ?  260  GLU B CG    1 
ATOM   8517  C  CD    . GLU B 2  260  ? 102.120 161.319 192.270 1.00 105.39 ?  260  GLU B CD    1 
ATOM   8518  O  OE1   . GLU B 2  260  ? 101.551 160.889 191.244 1.00 105.39 ?  260  GLU B OE1   1 
ATOM   8519  O  OE2   . GLU B 2  260  ? 101.522 161.516 193.348 1.00 105.39 ?  260  GLU B OE2   1 
ATOM   8520  N  N     . GLU B 2  261  ? 106.653 161.548 188.493 1.00 107.78 ?  261  GLU B N     1 
ATOM   8521  C  CA    . GLU B 2  261  ? 107.094 160.957 187.235 1.00 107.78 ?  261  GLU B CA    1 
ATOM   8522  C  C     . GLU B 2  261  ? 108.589 161.126 186.981 1.00 107.78 ?  261  GLU B C     1 
ATOM   8523  O  O     . GLU B 2  261  ? 109.165 160.381 186.183 1.00 107.78 ?  261  GLU B O     1 
ATOM   8524  C  CB    . GLU B 2  261  ? 106.294 161.553 186.069 1.00 107.78 ?  261  GLU B CB    1 
ATOM   8525  C  CG    . GLU B 2  261  ? 104.807 161.226 186.115 1.00 107.78 ?  261  GLU B CG    1 
ATOM   8526  C  CD    . GLU B 2  261  ? 104.522 159.744 185.940 1.00 107.78 ?  261  GLU B CD    1 
ATOM   8527  O  OE1   . GLU B 2  261  ? 105.273 159.069 185.204 1.00 107.78 ?  261  GLU B OE1   1 
ATOM   8528  O  OE2   . GLU B 2  261  ? 103.546 159.252 186.545 1.00 107.78 ?  261  GLU B OE2   1 
ATOM   8529  N  N     . ILE B 2  262  ? 109.234 162.088 187.641 1.00 96.96  ?  262  ILE B N     1 
ATOM   8530  C  CA    . ILE B 2  262  ? 110.655 162.344 187.417 1.00 96.96  ?  262  ILE B CA    1 
ATOM   8531  C  C     . ILE B 2  262  ? 111.512 161.476 188.333 1.00 96.96  ?  262  ILE B C     1 
ATOM   8532  O  O     . ILE B 2  262  ? 112.745 161.541 188.289 1.00 96.96  ?  262  ILE B O     1 
ATOM   8533  C  CB    . ILE B 2  262  ? 110.983 163.846 187.578 1.00 96.96  ?  262  ILE B CB    1 
ATOM   8534  C  CG1   . ILE B 2  262  ? 110.444 164.424 188.896 1.00 96.96  ?  262  ILE B CG1   1 
ATOM   8535  C  CG2   . ILE B 2  262  ? 110.468 164.641 186.386 1.00 96.96  ?  262  ILE B CG2   1 
ATOM   8536  C  CD1   . ILE B 2  262  ? 111.422 164.470 190.050 1.00 96.96  ?  262  ILE B CD1   1 
ATOM   8537  N  N     . LEU B 2  263  ? 110.869 160.666 189.173 1.00 93.83  ?  263  LEU B N     1 
ATOM   8538  C  CA    . LEU B 2  263  ? 111.574 159.730 190.039 1.00 93.83  ?  263  LEU B CA    1 
ATOM   8539  C  C     . LEU B 2  263  ? 111.329 158.274 189.670 1.00 93.83  ?  263  LEU B C     1 
ATOM   8540  O  O     . LEU B 2  263  ? 112.234 157.449 189.816 1.00 93.83  ?  263  LEU B O     1 
ATOM   8541  C  CB    . LEU B 2  263  ? 111.182 159.954 191.503 1.00 93.83  ?  263  LEU B CB    1 
ATOM   8542  C  CG    . LEU B 2  263  ? 111.658 161.265 192.128 1.00 93.83  ?  263  LEU B CG    1 
ATOM   8543  C  CD1   . LEU B 2  263  ? 111.127 161.397 193.545 1.00 93.83  ?  263  LEU B CD1   1 
ATOM   8544  C  CD2   . LEU B 2  263  ? 113.177 161.347 192.107 1.00 93.83  ?  263  LEU B CD2   1 
ATOM   8545  N  N     . LYS B 2  264  ? 110.124 157.939 189.197 1.00 88.56  ?  264  LYS B N     1 
ATOM   8546  C  CA    . LYS B 2  264  ? 109.835 156.560 188.816 1.00 88.56  ?  264  LYS B CA    1 
ATOM   8547  C  C     . LYS B 2  264  ? 110.563 156.161 187.539 1.00 88.56  ?  264  LYS B C     1 
ATOM   8548  O  O     . LYS B 2  264  ? 110.884 154.982 187.354 1.00 88.56  ?  264  LYS B O     1 
ATOM   8549  C  CB    . LYS B 2  264  ? 108.329 156.361 188.647 1.00 88.56  ?  264  LYS B CB    1 
ATOM   8550  C  CG    . LYS B 2  264  ? 107.544 156.428 189.946 1.00 88.56  ?  264  LYS B CG    1 
ATOM   8551  C  CD    . LYS B 2  264  ? 106.063 156.175 189.710 1.00 88.56  ?  264  LYS B CD    1 
ATOM   8552  C  CE    . LYS B 2  264  ? 105.270 156.272 191.003 1.00 88.56  ?  264  LYS B CE    1 
ATOM   8553  N  NZ    . LYS B 2  264  ? 103.817 156.036 190.780 1.00 88.56  ?  264  LYS B NZ    1 
ATOM   8554  N  N     . ALA B 2  265  ? 110.829 157.118 186.651 1.00 89.05  ?  265  ALA B N     1 
ATOM   8555  C  CA    . ALA B 2  265  ? 111.603 156.833 185.452 1.00 89.05  ?  265  ALA B CA    1 
ATOM   8556  C  C     . ALA B 2  265  ? 113.104 156.828 185.706 1.00 89.05  ?  265  ALA B C     1 
ATOM   8557  O  O     . ALA B 2  265  ? 113.864 156.445 184.810 1.00 89.05  ?  265  ALA B O     1 
ATOM   8558  C  CB    . ALA B 2  265  ? 111.271 157.847 184.356 1.00 89.05  ?  265  ALA B CB    1 
ATOM   8559  N  N     . LEU B 2  266  ? 113.547 157.238 186.895 1.00 84.75  ?  266  LEU B N     1 
ATOM   8560  C  CA    . LEU B 2  266  ? 114.964 157.305 187.213 1.00 84.75  ?  266  LEU B CA    1 
ATOM   8561  C  C     . LEU B 2  266  ? 115.340 156.493 188.447 1.00 84.75  ?  266  LEU B C     1 
ATOM   8562  O  O     . LEU B 2  266  ? 116.505 156.531 188.860 1.00 84.75  ?  266  LEU B O     1 
ATOM   8563  C  CB    . LEU B 2  266  ? 115.396 158.766 187.416 1.00 84.75  ?  266  LEU B CB    1 
ATOM   8564  C  CG    . LEU B 2  266  ? 115.107 159.764 186.286 1.00 84.75  ?  266  LEU B CG    1 
ATOM   8565  C  CD1   . LEU B 2  266  ? 115.627 161.157 186.640 1.00 84.75  ?  266  LEU B CD1   1 
ATOM   8566  C  CD2   . LEU B 2  266  ? 115.630 159.302 184.932 1.00 84.75  ?  266  LEU B CD2   1 
ATOM   8567  N  N     . SER B 2  267  ? 114.391 155.770 189.054 1.00 95.42  ?  267  SER B N     1 
ATOM   8568  C  CA    . SER B 2  267  ? 114.695 154.997 190.257 1.00 95.42  ?  267  SER B CA    1 
ATOM   8569  C  C     . SER B 2  267  ? 115.504 153.747 189.939 1.00 95.42  ?  267  SER B C     1 
ATOM   8570  O  O     . SER B 2  267  ? 116.289 153.288 190.777 1.00 95.42  ?  267  SER B O     1 
ATOM   8571  C  CB    . SER B 2  267  ? 113.406 154.612 190.984 1.00 95.42  ?  267  SER B CB    1 
ATOM   8572  O  OG    . SER B 2  267  ? 112.634 153.709 190.212 1.00 95.42  ?  267  SER B OG    1 
ATOM   8573  N  N     . GLY B 2  268  ? 115.333 153.185 188.745 1.00 98.50  ?  268  GLY B N     1 
ATOM   8574  C  CA    . GLY B 2  268  ? 116.101 152.026 188.338 1.00 98.50  ?  268  GLY B CA    1 
ATOM   8575  C  C     . GLY B 2  268  ? 117.356 152.393 187.575 1.00 98.50  ?  268  GLY B C     1 
ATOM   8576  O  O     . GLY B 2  268  ? 117.810 151.643 186.706 1.00 98.50  ?  268  GLY B O     1 
ATOM   8577  N  N     . MET B 2  269  ? 117.926 153.553 187.895 1.00 90.26  ?  269  MET B N     1 
ATOM   8578  C  CA    . MET B 2  269  ? 119.112 154.054 187.217 1.00 90.26  ?  269  MET B CA    1 
ATOM   8579  C  C     . MET B 2  269  ? 120.243 154.423 188.172 1.00 90.26  ?  269  MET B C     1 
ATOM   8580  O  O     . MET B 2  269  ? 121.410 154.364 187.768 1.00 90.26  ?  269  MET B O     1 
ATOM   8581  C  CB    . MET B 2  269  ? 118.738 155.272 186.352 1.00 90.26  ?  269  MET B CB    1 
ATOM   8582  C  CG    . MET B 2  269  ? 119.800 155.759 185.384 1.00 90.26  ?  269  MET B CG    1 
ATOM   8583  S  SD    . MET B 2  269  ? 119.236 157.111 184.338 1.00 90.26  ?  269  MET B SD    1 
ATOM   8584  C  CE    . MET B 2  269  ? 119.202 158.454 185.521 1.00 90.26  ?  269  MET B CE    1 
ATOM   8585  N  N     . CYS B 2  270  ? 119.949 154.756 189.427 1.00 97.98  ?  270  CYS B N     1 
ATOM   8586  C  CA    . CYS B 2  270  ? 120.989 155.162 190.363 1.00 97.98  ?  270  CYS B CA    1 
ATOM   8587  C  C     . CYS B 2  270  ? 121.382 154.075 191.357 1.00 97.98  ?  270  CYS B C     1 
ATOM   8588  O  O     . CYS B 2  270  ? 122.406 154.238 192.034 1.00 97.98  ?  270  CYS B O     1 
ATOM   8589  C  CB    . CYS B 2  270  ? 120.546 156.413 191.126 1.00 97.98  ?  270  CYS B CB    1 
ATOM   8590  S  SG    . CYS B 2  270  ? 119.070 156.174 192.128 1.00 97.98  ?  270  CYS B SG    1 
ATOM   8591  N  N     . ASN B 2  271  ? 120.599 152.987 191.456 1.00 103.21 ?  271  ASN B N     1 
ATOM   8592  C  CA    . ASN B 2  271  ? 120.858 151.841 192.334 1.00 103.21 ?  271  ASN B CA    1 
ATOM   8593  C  C     . ASN B 2  271  ? 120.972 152.237 193.805 1.00 103.21 ?  271  ASN B C     1 
ATOM   8594  O  O     . ASN B 2  271  ? 122.080 152.261 194.355 1.00 103.21 ?  271  ASN B O     1 
ATOM   8595  C  CB    . ASN B 2  271  ? 122.099 151.059 191.883 1.00 103.21 ?  271  ASN B CB    1 
ATOM   8596  C  CG    . ASN B 2  271  ? 121.840 150.218 190.646 1.00 103.21 ?  271  ASN B CG    1 
ATOM   8597  O  OD1   . ASN B 2  271  ? 120.788 149.590 190.517 1.00 103.21 ?  271  ASN B OD1   1 
ATOM   8598  N  ND2   . ASN B 2  271  ? 122.802 150.194 189.734 1.00 103.21 ?  271  ASN B ND2   1 
ATOM   8599  N  N     . ILE B 2  272  ? 119.827 152.606 194.401 1.00 105.38 ?  272  ILE B N     1 
ATOM   8600  C  CA    . ILE B 2  272  ? 119.622 153.116 195.762 1.00 105.38 ?  272  ILE B CA    1 
ATOM   8601  C  C     . ILE B 2  272  ? 120.459 152.418 196.832 1.00 105.38 ?  272  ILE B C     1 
ATOM   8602  O  O     . ILE B 2  272  ? 121.146 153.074 197.624 1.00 105.38 ?  272  ILE B O     1 
ATOM   8603  C  CB    . ILE B 2  272  ? 118.126 153.008 196.128 1.00 105.38 ?  272  ILE B CB    1 
ATOM   8604  C  CG1   . ILE B 2  272  ? 117.259 153.849 195.187 1.00 105.38 ?  272  ILE B CG1   1 
ATOM   8605  C  CG2   . ILE B 2  272  ? 117.875 153.402 197.582 1.00 105.38 ?  272  ILE B CG2   1 
ATOM   8606  C  CD1   . ILE B 2  272  ? 117.478 155.338 195.310 1.00 105.38 ?  272  ILE B CD1   1 
ATOM   8607  N  N     . ASP B 2  273  ? 120.439 151.086 196.843 1.00 106.25 ?  273  ASP B N     1 
ATOM   8608  C  CA    . ASP B 2  273  ? 121.071 150.322 197.913 1.00 106.25 ?  273  ASP B CA    1 
ATOM   8609  C  C     . ASP B 2  273  ? 122.579 150.162 197.752 1.00 106.25 ?  273  ASP B C     1 
ATOM   8610  O  O     . ASP B 2  273  ? 123.188 149.430 198.539 1.00 106.25 ?  273  ASP B O     1 
ATOM   8611  C  CB    . ASP B 2  273  ? 120.424 148.938 198.019 1.00 106.25 ?  273  ASP B CB    1 
ATOM   8612  C  CG    . ASP B 2  273  ? 119.003 148.996 198.541 1.00 106.25 ?  273  ASP B CG    1 
ATOM   8613  O  OD1   . ASP B 2  273  ? 118.687 149.930 199.308 1.00 106.25 ?  273  ASP B OD1   1 
ATOM   8614  O  OD2   . ASP B 2  273  ? 118.202 148.106 198.187 1.00 106.25 ?  273  ASP B OD2   1 
ATOM   8615  N  N     . THR B 2  274  ? 123.201 150.817 196.770 1.00 101.31 ?  274  THR B N     1 
ATOM   8616  C  CA    . THR B 2  274  ? 124.635 150.686 196.540 1.00 101.31 ?  274  THR B CA    1 
ATOM   8617  C  C     . THR B 2  274  ? 125.389 151.980 196.824 1.00 101.31 ?  274  THR B C     1 
ATOM   8618  O  O     . THR B 2  274  ? 126.331 151.984 197.621 1.00 101.31 ?  274  THR B O     1 
ATOM   8619  C  CB    . THR B 2  274  ? 124.903 150.231 195.098 1.00 101.31 ?  274  THR B CB    1 
ATOM   8620  O  OG1   . THR B 2  274  ? 124.453 151.240 194.187 1.00 101.31 ?  274  THR B OG1   1 
ATOM   8621  C  CG2   . THR B 2  274  ? 124.172 148.928 194.804 1.00 101.31 ?  274  THR B CG2   1 
ATOM   8622  N  N     . GLY B 2  275  ? 125.000 153.080 196.194 1.00 105.29 ?  275  GLY B N     1 
ATOM   8623  C  CA    . GLY B 2  275  ? 125.700 154.345 196.302 1.00 105.29 ?  275  GLY B CA    1 
ATOM   8624  C  C     . GLY B 2  275  ? 124.858 155.436 196.930 1.00 105.29 ?  275  GLY B C     1 
ATOM   8625  O  O     . GLY B 2  275  ? 123.886 155.171 197.648 1.00 105.29 ?  275  GLY B O     1 
ATOM   8626  N  N     . LEU B 2  276  ? 125.236 156.683 196.658 1.00 100.96 ?  276  LEU B N     1 
ATOM   8627  C  CA    . LEU B 2  276  ? 124.533 157.843 197.186 1.00 100.96 ?  276  LEU B CA    1 
ATOM   8628  C  C     . LEU B 2  276  ? 123.243 158.068 196.407 1.00 100.96 ?  276  LEU B C     1 
ATOM   8629  O  O     . LEU B 2  276  ? 123.220 157.969 195.177 1.00 100.96 ?  276  LEU B O     1 
ATOM   8630  C  CB    . LEU B 2  276  ? 125.420 159.089 197.117 1.00 100.96 ?  276  LEU B CB    1 
ATOM   8631  C  CG    . LEU B 2  276  ? 124.865 160.382 197.722 1.00 100.96 ?  276  LEU B CG    1 
ATOM   8632  C  CD1   . LEU B 2  276  ? 124.621 160.216 199.214 1.00 100.96 ?  276  LEU B CD1   1 
ATOM   8633  C  CD2   . LEU B 2  276  ? 125.799 161.554 197.458 1.00 100.96 ?  276  LEU B CD2   1 
ATOM   8634  N  N     . THR B 2  277  ? 122.166 158.359 197.136 1.00 106.50 ?  277  THR B N     1 
ATOM   8635  C  CA    . THR B 2  277  ? 120.844 158.487 196.534 1.00 106.50 ?  277  THR B CA    1 
ATOM   8636  C  C     . THR B 2  277  ? 120.453 159.946 196.339 1.00 106.50 ?  277  THR B C     1 
ATOM   8637  O  O     . THR B 2  277  ? 121.085 160.845 196.904 1.00 106.50 ?  277  THR B O     1 
ATOM   8638  C  CB    . THR B 2  277  ? 119.804 157.782 197.401 1.00 106.50 ?  277  THR B CB    1 
ATOM   8639  O  OG1   . THR B 2  277  ? 119.700 158.455 198.661 1.00 106.50 ?  277  THR B OG1   1 
ATOM   8640  C  CG2   . THR B 2  277  ? 120.223 156.346 197.653 1.00 106.50 ?  277  THR B CG2   1 
ATOM   8641  N  N     . PHE B 2  278  ? 119.409 160.193 195.547 1.00 96.23  ?  278  PHE B N     1 
ATOM   8642  C  CA    . PHE B 2  278  ? 118.944 161.556 195.318 1.00 96.23  ?  278  PHE B CA    1 
ATOM   8643  C  C     . PHE B 2  278  ? 117.424 161.640 195.398 1.00 96.23  ?  278  PHE B C     1 
ATOM   8644  O  O     . PHE B 2  278  ? 116.861 162.739 195.418 1.00 96.23  ?  278  PHE B O     1 
ATOM   8645  C  CB    . PHE B 2  278  ? 119.452 162.082 193.965 1.00 96.23  ?  278  PHE B CB    1 
ATOM   8646  C  CG    . PHE B 2  278  ? 118.834 161.410 192.758 1.00 96.23  ?  278  PHE B CG    1 
ATOM   8647  C  CD1   . PHE B 2  278  ? 119.350 160.221 192.261 1.00 96.23  ?  278  PHE B CD1   1 
ATOM   8648  C  CD2   . PHE B 2  278  ? 117.775 162.003 192.077 1.00 96.23  ?  278  PHE B CD2   1 
ATOM   8649  C  CE1   . PHE B 2  278  ? 118.794 159.617 191.143 1.00 96.23  ?  278  PHE B CE1   1 
ATOM   8650  C  CE2   . PHE B 2  278  ? 117.215 161.407 190.964 1.00 96.23  ?  278  PHE B CE2   1 
ATOM   8651  C  CZ    . PHE B 2  278  ? 117.726 160.212 190.494 1.00 96.23  ?  278  PHE B CZ    1 
ATOM   8652  N  N     . ALA B 2  279  ? 116.756 160.487 195.448 1.00 108.47 ?  279  ALA B N     1 
ATOM   8653  C  CA    . ALA B 2  279  ? 115.306 160.445 195.274 1.00 108.47 ?  279  ALA B CA    1 
ATOM   8654  C  C     . ALA B 2  279  ? 114.563 160.959 196.503 1.00 108.47 ?  279  ALA B C     1 
ATOM   8655  O  O     . ALA B 2  279  ? 113.865 161.977 196.438 1.00 108.47 ?  279  ALA B O     1 
ATOM   8656  C  CB    . ALA B 2  279  ? 114.866 159.016 194.941 1.00 108.47 ?  279  ALA B CB    1 
ATOM   8657  N  N     . ALA B 2  280  ? 114.705 160.272 197.637 1.00 118.05 ?  280  ALA B N     1 
ATOM   8658  C  CA    . ALA B 2  280  ? 113.974 160.613 198.851 1.00 118.05 ?  280  ALA B CA    1 
ATOM   8659  C  C     . ALA B 2  280  ? 114.897 160.867 200.038 1.00 118.05 ?  280  ALA B C     1 
ATOM   8660  O  O     . ALA B 2  280  ? 114.517 160.597 201.181 1.00 118.05 ?  280  ALA B O     1 
ATOM   8661  C  CB    . ALA B 2  280  ? 112.968 159.512 199.190 1.00 118.05 ?  280  ALA B CB    1 
ATOM   8662  N  N     . VAL B 2  281  ? 116.100 161.387 199.789 1.00 111.38 ?  281  VAL B N     1 
ATOM   8663  C  CA    . VAL B 2  281  ? 117.076 161.561 200.862 1.00 111.38 ?  281  VAL B CA    1 
ATOM   8664  C  C     . VAL B 2  281  ? 116.715 162.769 201.731 1.00 111.38 ?  281  VAL B C     1 
ATOM   8665  O  O     . VAL B 2  281  ? 117.083 162.831 202.913 1.00 111.38 ?  281  VAL B O     1 
ATOM   8666  C  CB    . VAL B 2  281  ? 118.495 161.645 200.254 1.00 111.38 ?  281  VAL B CB    1 
ATOM   8667  C  CG1   . VAL B 2  281  ? 118.654 162.867 199.356 1.00 111.38 ?  281  VAL B CG1   1 
ATOM   8668  C  CG2   . VAL B 2  281  ? 119.592 161.575 201.322 1.00 111.38 ?  281  VAL B CG2   1 
ATOM   8669  N  N     . HIS B 2  282  ? 116.014 163.757 201.149 1.00 105.40 ?  282  HIS B N     1 
ATOM   8670  C  CA    . HIS B 2  282  ? 115.347 164.893 201.799 1.00 105.40 ?  282  HIS B CA    1 
ATOM   8671  C  C     . HIS B 2  282  ? 116.319 165.908 202.416 1.00 105.40 ?  282  HIS B C     1 
ATOM   8672  O  O     . HIS B 2  282  ? 115.896 166.967 202.893 1.00 105.40 ?  282  HIS B O     1 
ATOM   8673  C  CB    . HIS B 2  282  ? 114.331 164.388 202.843 1.00 105.40 ?  282  HIS B CB    1 
ATOM   8674  C  CG    . HIS B 2  282  ? 113.337 165.419 203.285 1.00 105.40 ?  282  HIS B CG    1 
ATOM   8675  N  ND1   . HIS B 2  282  ? 113.585 166.298 204.317 1.00 105.40 ?  282  HIS B ND1   1 
ATOM   8676  C  CD2   . HIS B 2  282  ? 112.097 165.714 202.830 1.00 105.40 ?  282  HIS B CD2   1 
ATOM   8677  C  CE1   . HIS B 2  282  ? 112.539 167.088 204.481 1.00 105.40 ?  282  HIS B CE1   1 
ATOM   8678  N  NE2   . HIS B 2  282  ? 111.622 166.754 203.591 1.00 105.40 ?  282  HIS B NE2   1 
ATOM   8679  N  N     . CYS B 2  283  ? 117.625 165.635 202.379 1.00 93.14  ?  283  CYS B N     1 
ATOM   8680  C  CA    . CYS B 2  283  ? 118.626 166.608 202.791 1.00 93.14  ?  283  CYS B CA    1 
ATOM   8681  C  C     . CYS B 2  283  ? 119.390 167.204 201.621 1.00 93.14  ?  283  CYS B C     1 
ATOM   8682  O  O     . CYS B 2  283  ? 119.841 168.351 201.718 1.00 93.14  ?  283  CYS B O     1 
ATOM   8683  C  CB    . CYS B 2  283  ? 119.623 165.978 203.779 1.00 93.14  ?  283  CYS B CB    1 
ATOM   8684  S  SG    . CYS B 2  283  ? 120.787 167.150 204.526 1.00 93.14  ?  283  CYS B SG    1 
ATOM   8685  N  N     . LEU B 2  284  ? 119.513 166.482 200.509 1.00 90.70  ?  284  LEU B N     1 
ATOM   8686  C  CA    . LEU B 2  284  ? 120.099 167.012 199.288 1.00 90.70  ?  284  LEU B CA    1 
ATOM   8687  C  C     . LEU B 2  284  ? 119.096 167.800 198.454 1.00 90.70  ?  284  LEU B C     1 
ATOM   8688  O  O     . LEU B 2  284  ? 119.370 168.078 197.283 1.00 90.70  ?  284  LEU B O     1 
ATOM   8689  C  CB    . LEU B 2  284  ? 120.677 165.869 198.443 1.00 90.70  ?  284  LEU B CB    1 
ATOM   8690  C  CG    . LEU B 2  284  ? 121.746 164.962 199.064 1.00 90.70  ?  284  LEU B CG    1 
ATOM   8691  C  CD1   . LEU B 2  284  ? 122.109 163.834 198.108 1.00 90.70  ?  284  LEU B CD1   1 
ATOM   8692  C  CD2   . LEU B 2  284  ? 122.983 165.726 199.480 1.00 90.70  ?  284  LEU B CD2   1 
ATOM   8693  N  N     . SER B 2  285  ? 117.946 168.165 199.025 1.00 85.46  ?  285  SER B N     1 
ATOM   8694  C  CA    . SER B 2  285  ? 116.839 168.747 198.272 1.00 85.46  ?  285  SER B CA    1 
ATOM   8695  C  C     . SER B 2  285  ? 116.911 170.271 198.226 1.00 85.46  ?  285  SER B C     1 
ATOM   8696  O  O     . SER B 2  285  ? 116.988 170.863 197.146 1.00 85.46  ?  285  SER B O     1 
ATOM   8697  C  CB    . SER B 2  285  ? 115.506 168.292 198.876 1.00 85.46  ?  285  SER B CB    1 
ATOM   8698  O  OG    . SER B 2  285  ? 115.332 168.823 200.179 1.00 85.46  ?  285  SER B OG    1 
ATOM   8699  N  N     . GLY B 2  286  ? 116.874 170.915 199.388 1.00 85.12  ?  286  GLY B N     1 
ATOM   8700  C  CA    . GLY B 2  286  ? 116.916 172.362 199.448 1.00 85.12  ?  286  GLY B CA    1 
ATOM   8701  C  C     . GLY B 2  286  ? 118.284 172.905 199.800 1.00 85.12  ?  286  GLY B C     1 
ATOM   8702  O  O     . GLY B 2  286  ? 118.646 174.013 199.394 1.00 85.12  ?  286  GLY B O     1 
ATOM   8703  N  N     . LYS B 2  287  ? 119.056 172.123 200.556 1.00 81.25  ?  287  LYS B N     1 
ATOM   8704  C  CA    . LYS B 2  287  ? 120.300 172.629 201.125 1.00 81.25  ?  287  LYS B CA    1 
ATOM   8705  C  C     . LYS B 2  287  ? 121.438 172.590 200.110 1.00 81.25  ?  287  LYS B C     1 
ATOM   8706  O  O     . LYS B 2  287  ? 122.022 173.626 199.773 1.00 81.25  ?  287  LYS B O     1 
ATOM   8707  C  CB    . LYS B 2  287  ? 120.674 171.829 202.379 1.00 81.25  ?  287  LYS B CB    1 
ATOM   8708  C  CG    . LYS B 2  287  ? 120.004 172.289 203.673 1.00 81.25  ?  287  LYS B CG    1 
ATOM   8709  C  CD    . LYS B 2  287  ? 118.581 171.763 203.828 1.00 81.25  ?  287  LYS B CD    1 
ATOM   8710  C  CE    . LYS B 2  287  ? 118.576 170.269 204.113 1.00 81.25  ?  287  LYS B CE    1 
ATOM   8711  N  NZ    . LYS B 2  287  ? 117.203 169.740 204.342 1.00 81.25  ?  287  LYS B NZ    1 
ATOM   8712  N  N     . ARG B 2  288  ? 121.771 171.400 199.612 1.00 80.57  ?  288  ARG B N     1 
ATOM   8713  C  CA    . ARG B 2  288  ? 123.014 171.192 198.884 1.00 80.57  ?  288  ARG B CA    1 
ATOM   8714  C  C     . ARG B 2  288  ? 122.808 170.253 197.702 1.00 80.57  ?  288  ARG B C     1 
ATOM   8715  O  O     . ARG B 2  288  ? 121.698 169.790 197.431 1.00 80.57  ?  288  ARG B O     1 
ATOM   8716  C  CB    . ARG B 2  288  ? 124.101 170.636 199.811 1.00 80.57  ?  288  ARG B CB    1 
ATOM   8717  C  CG    . ARG B 2  288  ? 123.850 169.217 200.303 1.00 80.57  ?  288  ARG B CG    1 
ATOM   8718  C  CD    . ARG B 2  288  ? 123.211 169.188 201.681 1.00 80.57  ?  288  ARG B CD    1 
ATOM   8719  N  NE    . ARG B 2  288  ? 123.093 167.830 202.203 1.00 80.57  ?  288  ARG B NE    1 
ATOM   8720  C  CZ    . ARG B 2  288  ? 123.973 167.266 203.024 1.00 80.57  ?  288  ARG B CZ    1 
ATOM   8721  N  NH1   . ARG B 2  288  ? 125.043 167.942 203.418 1.00 80.57  ?  288  ARG B NH1   1 
ATOM   8722  N  NH2   . ARG B 2  288  ? 123.784 166.024 203.450 1.00 80.57  ?  288  ARG B NH2   1 
ATOM   8723  N  N     . GLN B 2  289  ? 123.906 169.981 196.994 1.00 71.50  ?  289  GLN B N     1 
ATOM   8724  C  CA    . GLN B 2  289  ? 123.884 169.120 195.822 1.00 71.50  ?  289  GLN B CA    1 
ATOM   8725  C  C     . GLN B 2  289  ? 124.360 167.711 196.174 1.00 71.50  ?  289  GLN B C     1 
ATOM   8726  O  O     . GLN B 2  289  ? 124.805 167.432 197.290 1.00 71.50  ?  289  GLN B O     1 
ATOM   8727  C  CB    . GLN B 2  289  ? 124.771 169.684 194.713 1.00 71.50  ?  289  GLN B CB    1 
ATOM   8728  C  CG    . GLN B 2  289  ? 126.257 169.592 195.023 1.00 71.50  ?  289  GLN B CG    1 
ATOM   8729  C  CD    . GLN B 2  289  ? 127.134 170.062 193.880 1.00 71.50  ?  289  GLN B CD    1 
ATOM   8730  O  OE1   . GLN B 2  289  ? 126.643 170.439 192.816 1.00 71.50  ?  289  GLN B OE1   1 
ATOM   8731  N  NE2   . GLN B 2  289  ? 128.445 170.027 194.091 1.00 71.50  ?  289  GLN B NE2   1 
ATOM   8732  N  N     . GLY B 2  290  ? 124.285 166.816 195.181 1.00 72.55  ?  290  GLY B N     1 
ATOM   8733  C  CA    . GLY B 2  290  ? 124.757 165.460 195.340 1.00 72.55  ?  290  GLY B CA    1 
ATOM   8734  C  C     . GLY B 2  290  ? 125.707 165.074 194.220 1.00 72.55  ?  290  GLY B C     1 
ATOM   8735  O  O     . GLY B 2  290  ? 125.850 165.783 193.223 1.00 72.55  ?  290  GLY B O     1 
ATOM   8736  N  N     . SER B 2  291  ? 126.366 163.932 194.412 1.00 70.78  ?  291  SER B N     1 
ATOM   8737  C  CA    . SER B 2  291  ? 127.272 163.377 193.417 1.00 70.78  ?  291  SER B CA    1 
ATOM   8738  C  C     . SER B 2  291  ? 127.141 161.863 193.420 1.00 70.78  ?  291  SER B C     1 
ATOM   8739  O  O     . SER B 2  291  ? 127.279 161.226 194.468 1.00 70.78  ?  291  SER B O     1 
ATOM   8740  C  CB    . SER B 2  291  ? 128.727 163.776 193.691 1.00 70.78  ?  291  SER B CB    1 
ATOM   8741  O  OG    . SER B 2  291  ? 129.198 163.174 194.883 1.00 70.78  ?  291  SER B OG    1 
ATOM   8742  N  N     . LEU B 2  292  ? 126.884 161.292 192.246 1.00 72.42  ?  292  LEU B N     1 
ATOM   8743  C  CA    . LEU B 2  292  ? 126.636 159.861 192.122 1.00 72.42  ?  292  LEU B CA    1 
ATOM   8744  C  C     . LEU B 2  292  ? 126.915 159.437 190.683 1.00 72.42  ?  292  LEU B C     1 
ATOM   8745  O  O     . LEU B 2  292  ? 127.331 160.242 189.846 1.00 72.42  ?  292  LEU B O     1 
ATOM   8746  C  CB    . LEU B 2  292  ? 125.211 159.521 192.580 1.00 72.42  ?  292  LEU B CB    1 
ATOM   8747  C  CG    . LEU B 2  292  ? 124.007 160.224 191.938 1.00 72.42  ?  292  LEU B CG    1 
ATOM   8748  C  CD1   . LEU B 2  292  ? 123.433 159.458 190.753 1.00 72.42  ?  292  LEU B CD1   1 
ATOM   8749  C  CD2   . LEU B 2  292  ? 122.927 160.497 192.972 1.00 72.42  ?  292  LEU B CD2   1 
ATOM   8750  N  N     . VAL B 2  293  ? 126.684 158.154 190.404 1.00 73.92  ?  293  VAL B N     1 
ATOM   8751  C  CA    . VAL B 2  293  ? 126.990 157.543 189.114 1.00 73.92  ?  293  VAL B CA    1 
ATOM   8752  C  C     . VAL B 2  293  ? 125.714 156.924 188.560 1.00 73.92  ?  293  VAL B C     1 
ATOM   8753  O  O     . VAL B 2  293  ? 125.084 156.092 189.226 1.00 73.92  ?  293  VAL B O     1 
ATOM   8754  C  CB    . VAL B 2  293  ? 128.098 156.479 189.228 1.00 73.92  ?  293  VAL B CB    1 
ATOM   8755  C  CG1   . VAL B 2  293  ? 128.323 155.797 187.888 1.00 73.92  ?  293  VAL B CG1   1 
ATOM   8756  C  CG2   . VAL B 2  293  ? 129.388 157.103 189.738 1.00 73.92  ?  293  VAL B CG2   1 
ATOM   8757  N  N     . LEU B 2  294  ? 125.340 157.316 187.343 1.00 81.27  ?  294  LEU B N     1 
ATOM   8758  C  CA    . LEU B 2  294  ? 124.150 156.778 186.705 1.00 81.27  ?  294  LEU B CA    1 
ATOM   8759  C  C     . LEU B 2  294  ? 124.437 155.396 186.126 1.00 81.27  ?  294  LEU B C     1 
ATOM   8760  O  O     . LEU B 2  294  ? 125.579 154.938 186.079 1.00 81.27  ?  294  LEU B O     1 
ATOM   8761  C  CB    . LEU B 2  294  ? 123.661 157.707 185.598 1.00 81.27  ?  294  LEU B CB    1 
ATOM   8762  C  CG    . LEU B 2  294  ? 123.354 159.153 185.984 1.00 81.27  ?  294  LEU B CG    1 
ATOM   8763  C  CD1   . LEU B 2  294  ? 122.797 159.906 184.786 1.00 81.27  ?  294  LEU B CD1   1 
ATOM   8764  C  CD2   . LEU B 2  294  ? 122.425 159.241 187.176 1.00 81.27  ?  294  LEU B CD2   1 
ATOM   8765  N  N     . TYR B 2  295  ? 123.380 154.729 185.678 1.00 89.24  ?  295  TYR B N     1 
ATOM   8766  C  CA    . TYR B 2  295  ? 123.497 153.402 185.078 1.00 89.24  ?  295  TYR B CA    1 
ATOM   8767  C  C     . TYR B 2  295  ? 122.479 153.297 183.947 1.00 89.24  ?  295  TYR B C     1 
ATOM   8768  O  O     . TYR B 2  295  ? 121.974 154.301 183.434 1.00 89.24  ?  295  TYR B O     1 
ATOM   8769  C  CB    . TYR B 2  295  ? 123.313 152.294 186.127 1.00 89.24  ?  295  TYR B CB    1 
ATOM   8770  C  CG    . TYR B 2  295  ? 124.423 152.205 187.149 1.00 89.24  ?  295  TYR B CG    1 
ATOM   8771  C  CD1   . TYR B 2  295  ? 125.606 151.532 186.863 1.00 89.24  ?  295  TYR B CD1   1 
ATOM   8772  C  CD2   . TYR B 2  295  ? 124.287 152.798 188.399 1.00 89.24  ?  295  TYR B CD2   1 
ATOM   8773  C  CE1   . TYR B 2  295  ? 126.621 151.447 187.798 1.00 89.24  ?  295  TYR B CE1   1 
ATOM   8774  C  CE2   . TYR B 2  295  ? 125.295 152.719 189.339 1.00 89.24  ?  295  TYR B CE2   1 
ATOM   8775  C  CZ    . TYR B 2  295  ? 126.458 152.043 189.033 1.00 89.24  ?  295  TYR B CZ    1 
ATOM   8776  O  OH    . TYR B 2  295  ? 127.459 151.966 189.969 1.00 89.24  ?  295  TYR B OH    1 
ATOM   8777  N  N     . ARG B 2  296  ? 122.199 152.067 183.531 1.00 90.20  ?  296  ARG B N     1 
ATOM   8778  C  CA    . ARG B 2  296  ? 121.207 151.782 182.509 1.00 90.20  ?  296  ARG B CA    1 
ATOM   8779  C  C     . ARG B 2  296  ? 119.869 151.533 183.223 1.00 90.20  ?  296  ARG B C     1 
ATOM   8780  O  O     . ARG B 2  296  ? 119.703 151.865 184.400 1.00 90.20  ?  296  ARG B O     1 
ATOM   8781  C  CB    . ARG B 2  296  ? 121.706 150.623 181.637 1.00 90.20  ?  296  ARG B CB    1 
ATOM   8782  C  CG    . ARG B 2  296  ? 121.122 150.534 180.218 1.00 90.20  ?  296  ARG B CG    1 
ATOM   8783  C  CD    . ARG B 2  296  ? 121.665 149.336 179.453 1.00 90.20  ?  296  ARG B CD    1 
ATOM   8784  N  NE    . ARG B 2  296  ? 121.288 148.063 180.064 1.00 90.20  ?  296  ARG B NE    1 
ATOM   8785  C  CZ    . ARG B 2  296  ? 120.124 147.452 179.867 1.00 90.20  ?  296  ARG B CZ    1 
ATOM   8786  N  NH1   . ARG B 2  296  ? 119.211 147.996 179.071 1.00 90.20  ?  296  ARG B NH1   1 
ATOM   8787  N  NH2   . ARG B 2  296  ? 119.873 146.297 180.465 1.00 90.20  ?  296  ARG B NH2   1 
ATOM   8788  N  N     . VAL B 2  297  ? 118.893 150.961 182.519 1.00 92.26  ?  297  VAL B N     1 
ATOM   8789  C  CA    . VAL B 2  297  ? 117.545 150.700 183.016 1.00 92.26  ?  297  VAL B CA    1 
ATOM   8790  C  C     . VAL B 2  297  ? 117.633 149.574 184.054 1.00 92.26  ?  297  VAL B C     1 
ATOM   8791  O  O     . VAL B 2  297  ? 118.651 148.877 184.140 1.00 92.26  ?  297  VAL B O     1 
ATOM   8792  C  CB    . VAL B 2  297  ? 116.626 150.374 181.813 1.00 92.26  ?  297  VAL B CB    1 
ATOM   8793  C  CG1   . VAL B 2  297  ? 115.126 150.410 182.147 1.00 92.26  ?  297  VAL B CG1   1 
ATOM   8794  C  CG2   . VAL B 2  297  ? 116.921 151.321 180.652 1.00 92.26  ?  297  VAL B CG2   1 
ATOM   8795  N  N     . ASN B 2  298  ? 116.567 149.370 184.839 1.00 107.03 ?  298  ASN B N     1 
ATOM   8796  C  CA    . ASN B 2  298  ? 116.542 148.539 186.044 1.00 107.03 ?  298  ASN B CA    1 
ATOM   8797  C  C     . ASN B 2  298  ? 116.759 147.036 185.856 1.00 107.03 ?  298  ASN B C     1 
ATOM   8798  O  O     . ASN B 2  298  ? 116.579 146.268 186.806 1.00 107.03 ?  298  ASN B O     1 
ATOM   8799  C  CB    . ASN B 2  298  ? 115.217 148.766 186.785 1.00 107.03 ?  298  ASN B CB    1 
ATOM   8800  C  CG    . ASN B 2  298  ? 113.988 148.500 185.917 1.00 107.03 ?  298  ASN B CG    1 
ATOM   8801  O  OD1   . ASN B 2  298  ? 114.090 148.060 184.772 1.00 107.03 ?  298  ASN B OD1   1 
ATOM   8802  N  ND2   . ASN B 2  298  ? 112.812 148.778 186.471 1.00 107.03 ?  298  ASN B ND2   1 
ATOM   8803  N  N     . LYS B 2  299  ? 117.130 146.594 184.649 1.00 112.78 ?  299  LYS B N     1 
ATOM   8804  C  CA    . LYS B 2  299  ? 117.473 145.191 184.423 1.00 112.78 ?  299  LYS B CA    1 
ATOM   8805  C  C     . LYS B 2  299  ? 118.795 144.786 185.075 1.00 112.78 ?  299  LYS B C     1 
ATOM   8806  O  O     . LYS B 2  299  ? 119.133 143.595 185.061 1.00 112.78 ?  299  LYS B O     1 
ATOM   8807  C  CB    . LYS B 2  299  ? 117.532 144.906 182.922 1.00 112.78 ?  299  LYS B CB    1 
ATOM   8808  C  CG    . LYS B 2  299  ? 116.184 144.990 182.231 1.00 112.78 ?  299  LYS B CG    1 
ATOM   8809  C  CD    . LYS B 2  299  ? 116.294 144.684 180.748 1.00 112.78 ?  299  LYS B CD    1 
ATOM   8810  C  CE    . LYS B 2  299  ? 114.936 144.789 180.073 1.00 112.78 ?  299  LYS B CE    1 
ATOM   8811  N  NZ    . LYS B 2  299  ? 115.009 144.500 178.616 1.00 112.78 ?  299  LYS B NZ    1 
ATOM   8812  N  N     . TYR B 2  300  ? 119.548 145.754 185.629 1.00 110.36 ?  300  TYR B N     1 
ATOM   8813  C  CA    . TYR B 2  300  ? 120.786 145.614 186.396 1.00 110.36 ?  300  TYR B CA    1 
ATOM   8814  C  C     . TYR B 2  300  ? 121.885 144.936 185.576 1.00 110.36 ?  300  TYR B C     1 
ATOM   8815  O  O     . TYR B 2  300  ? 122.182 143.757 185.805 1.00 110.36 ?  300  TYR B O     1 
ATOM   8816  C  CB    . TYR B 2  300  ? 120.500 144.847 187.696 1.00 110.36 ?  300  TYR B CB    1 
ATOM   8817  C  CG    . TYR B 2  300  ? 121.623 144.829 188.708 1.00 110.36 ?  300  TYR B CG    1 
ATOM   8818  C  CD1   . TYR B 2  300  ? 121.925 145.965 189.450 1.00 110.36 ?  300  TYR B CD1   1 
ATOM   8819  C  CD2   . TYR B 2  300  ? 122.353 143.670 188.952 1.00 110.36 ?  300  TYR B CD2   1 
ATOM   8820  C  CE1   . TYR B 2  300  ? 122.939 145.957 190.383 1.00 110.36 ?  300  TYR B CE1   1 
ATOM   8821  C  CE2   . TYR B 2  300  ? 123.374 143.652 189.884 1.00 110.36 ?  300  TYR B CE2   1 
ATOM   8822  C  CZ    . TYR B 2  300  ? 123.658 144.799 190.597 1.00 110.36 ?  300  TYR B CZ    1 
ATOM   8823  O  OH    . TYR B 2  300  ? 124.668 144.794 191.529 1.00 110.36 ?  300  TYR B OH    1 
ATOM   8824  N  N     . PRO B 2  301  ? 122.492 145.617 184.596 1.00 105.51 ?  301  PRO B N     1 
ATOM   8825  C  CA    . PRO B 2  301  ? 123.519 144.963 183.775 1.00 105.51 ?  301  PRO B CA    1 
ATOM   8826  C  C     . PRO B 2  301  ? 124.947 145.076 184.289 1.00 105.51 ?  301  PRO B C     1 
ATOM   8827  O  O     . PRO B 2  301  ? 125.765 144.216 183.928 1.00 105.51 ?  301  PRO B O     1 
ATOM   8828  C  CB    . PRO B 2  301  ? 123.386 145.698 182.435 1.00 105.51 ?  301  PRO B CB    1 
ATOM   8829  C  CG    . PRO B 2  301  ? 123.015 147.077 182.831 1.00 105.51 ?  301  PRO B CG    1 
ATOM   8830  C  CD    . PRO B 2  301  ? 122.151 146.951 184.062 1.00 105.51 ?  301  PRO B CD    1 
ATOM   8831  N  N     . ARG B 2  302  ? 125.248 146.086 185.121 1.00 97.42  ?  302  ARG B N     1 
ATOM   8832  C  CA    . ARG B 2  302  ? 126.613 146.458 185.529 1.00 97.42  ?  302  ARG B CA    1 
ATOM   8833  C  C     . ARG B 2  302  ? 127.533 146.653 184.324 1.00 97.42  ?  302  ARG B C     1 
ATOM   8834  O  O     . ARG B 2  302  ? 128.688 146.222 184.316 1.00 97.42  ?  302  ARG B O     1 
ATOM   8835  C  CB    . ARG B 2  302  ? 127.206 145.447 186.516 1.00 97.42  ?  302  ARG B CB    1 
ATOM   8836  C  CG    . ARG B 2  302  ? 126.513 145.420 187.865 1.00 97.42  ?  302  ARG B CG    1 
ATOM   8837  C  CD    . ARG B 2  302  ? 126.788 146.698 188.635 1.00 97.42  ?  302  ARG B CD    1 
ATOM   8838  N  NE    . ARG B 2  302  ? 126.178 146.681 189.963 1.00 97.42  ?  302  ARG B NE    1 
ATOM   8839  C  CZ    . ARG B 2  302  ? 126.189 147.707 190.804 1.00 97.42  ?  302  ARG B CZ    1 
ATOM   8840  N  NH1   . ARG B 2  302  ? 126.782 148.839 190.459 1.00 97.42  ?  302  ARG B NH1   1 
ATOM   8841  N  NH2   . ARG B 2  302  ? 125.607 147.600 191.988 1.00 97.42  ?  302  ARG B NH2   1 
ATOM   8842  N  N     . GLU B 2  303  ? 127.010 147.312 183.289 1.00 99.42  ?  303  GLU B N     1 
ATOM   8843  C  CA    . GLU B 2  303  ? 127.739 147.527 182.044 1.00 99.42  ?  303  GLU B CA    1 
ATOM   8844  C  C     . GLU B 2  303  ? 127.991 149.008 181.778 1.00 99.42  ?  303  GLU B C     1 
ATOM   8845  O  O     . GLU B 2  303  ? 129.137 149.423 181.577 1.00 99.42  ?  303  GLU B O     1 
ATOM   8846  C  CB    . GLU B 2  303  ? 126.967 146.895 180.877 1.00 99.42  ?  303  GLU B CB    1 
ATOM   8847  C  CG    . GLU B 2  303  ? 126.870 145.377 180.941 1.00 99.42  ?  303  GLU B CG    1 
ATOM   8848  C  CD    . GLU B 2  303  ? 126.074 144.798 179.787 1.00 99.42  ?  303  GLU B CD    1 
ATOM   8849  O  OE1   . GLU B 2  303  ? 125.477 145.584 179.022 1.00 99.42  ?  303  GLU B OE1   1 
ATOM   8850  O  OE2   . GLU B 2  303  ? 126.050 143.557 179.641 1.00 99.42  ?  303  GLU B OE2   1 
ATOM   8851  N  N     . MET B 2  304  ? 126.934 149.817 181.780 1.00 87.15  ?  304  MET B N     1 
ATOM   8852  C  CA    . MET B 2  304  ? 127.052 151.233 181.460 1.00 87.15  ?  304  MET B CA    1 
ATOM   8853  C  C     . MET B 2  304  ? 126.962 152.070 182.731 1.00 87.15  ?  304  MET B C     1 
ATOM   8854  O  O     . MET B 2  304  ? 126.080 151.861 183.568 1.00 87.15  ?  304  MET B O     1 
ATOM   8855  C  CB    . MET B 2  304  ? 125.960 151.635 180.464 1.00 87.15  ?  304  MET B CB    1 
ATOM   8856  C  CG    . MET B 2  304  ? 125.999 153.077 179.968 1.00 87.15  ?  304  MET B CG    1 
ATOM   8857  S  SD    . MET B 2  304  ? 124.992 154.236 180.917 1.00 87.15  ?  304  MET B SD    1 
ATOM   8858  C  CE    . MET B 2  304  ? 125.418 155.773 180.108 1.00 87.15  ?  304  MET B CE    1 
ATOM   8859  N  N     . LEU B 2  305  ? 127.878 153.028 182.866 1.00 78.86  ?  305  LEU B N     1 
ATOM   8860  C  CA    . LEU B 2  305  ? 127.970 153.835 184.075 1.00 78.86  ?  305  LEU B CA    1 
ATOM   8861  C  C     . LEU B 2  305  ? 128.625 155.173 183.762 1.00 78.86  ?  305  LEU B C     1 
ATOM   8862  O  O     . LEU B 2  305  ? 129.519 155.251 182.915 1.00 78.86  ?  305  LEU B O     1 
ATOM   8863  C  CB    . LEU B 2  305  ? 128.732 153.076 185.175 1.00 78.86  ?  305  LEU B CB    1 
ATOM   8864  C  CG    . LEU B 2  305  ? 130.126 152.479 184.924 1.00 78.86  ?  305  LEU B CG    1 
ATOM   8865  C  CD1   . LEU B 2  305  ? 131.264 153.437 185.246 1.00 78.86  ?  305  LEU B CD1   1 
ATOM   8866  C  CD2   . LEU B 2  305  ? 130.282 151.181 185.707 1.00 78.86  ?  305  LEU B CD2   1 
ATOM   8867  N  N     . GLY B 2  306  ? 128.169 156.222 184.446 1.00 70.16  ?  306  GLY B N     1 
ATOM   8868  C  CA    . GLY B 2  306  ? 128.702 157.552 184.260 1.00 70.16  ?  306  GLY B CA    1 
ATOM   8869  C  C     . GLY B 2  306  ? 128.445 158.455 185.452 1.00 70.16  ?  306  GLY B C     1 
ATOM   8870  O  O     . GLY B 2  306  ? 127.313 158.581 185.930 1.00 70.16  ?  306  GLY B O     1 
ATOM   8871  N  N     . PRO B 2  307  ? 129.496 159.110 185.954 1.00 69.42  ?  307  PRO B N     1 
ATOM   8872  C  CA    . PRO B 2  307  ? 129.345 159.956 187.149 1.00 69.42  ?  307  PRO B CA    1 
ATOM   8873  C  C     . PRO B 2  307  ? 128.670 161.282 186.822 1.00 69.42  ?  307  PRO B C     1 
ATOM   8874  O  O     . PRO B 2  307  ? 129.006 161.942 185.835 1.00 69.42  ?  307  PRO B O     1 
ATOM   8875  C  CB    . PRO B 2  307  ? 130.790 160.164 187.620 1.00 69.42  ?  307  PRO B CB    1 
ATOM   8876  C  CG    . PRO B 2  307  ? 131.610 160.011 186.384 1.00 69.42  ?  307  PRO B CG    1 
ATOM   8877  C  CD    . PRO B 2  307  ? 130.904 158.989 185.535 1.00 69.42  ?  307  PRO B CD    1 
ATOM   8878  N  N     . VAL B 2  308  ? 127.701 161.664 187.655 1.00 73.02  ?  308  VAL B N     1 
ATOM   8879  C  CA    . VAL B 2  308  ? 126.943 162.903 187.499 1.00 73.02  ?  308  VAL B CA    1 
ATOM   8880  C  C     . VAL B 2  308  ? 126.845 163.593 188.853 1.00 73.02  ?  308  VAL B C     1 
ATOM   8881  O  O     . VAL B 2  308  ? 126.379 162.994 189.828 1.00 73.02  ?  308  VAL B O     1 
ATOM   8882  C  CB    . VAL B 2  308  ? 125.534 162.651 186.920 1.00 73.02  ?  308  VAL B CB    1 
ATOM   8883  C  CG1   . VAL B 2  308  ? 124.663 163.897 187.044 1.00 73.02  ?  308  VAL B CG1   1 
ATOM   8884  C  CG2   . VAL B 2  308  ? 125.619 162.243 185.458 1.00 73.02  ?  308  VAL B CG2   1 
ATOM   8885  N  N     . THR B 2  309  ? 127.284 164.849 188.910 1.00 73.49  ?  309  THR B N     1 
ATOM   8886  C  CA    . THR B 2  309  ? 127.055 165.708 190.065 1.00 73.49  ?  309  THR B CA    1 
ATOM   8887  C  C     . THR B 2  309  ? 125.649 166.288 189.969 1.00 73.49  ?  309  THR B C     1 
ATOM   8888  O  O     . THR B 2  309  ? 125.377 167.127 189.104 1.00 73.49  ?  309  THR B O     1 
ATOM   8889  C  CB    . THR B 2  309  ? 128.097 166.823 190.123 1.00 73.49  ?  309  THR B CB    1 
ATOM   8890  O  OG1   . THR B 2  309  ? 128.013 167.613 188.931 1.00 73.49  ?  309  THR B OG1   1 
ATOM   8891  C  CG2   . THR B 2  309  ? 129.495 166.236 190.236 1.00 73.49  ?  309  THR B CG2   1 
ATOM   8892  N  N     . PHE B 2  310  ? 124.764 165.847 190.857 1.00 85.04  ?  310  PHE B N     1 
ATOM   8893  C  CA    . PHE B 2  310  ? 123.335 166.101 190.737 1.00 85.04  ?  310  PHE B CA    1 
ATOM   8894  C  C     . PHE B 2  310  ? 122.906 167.212 191.690 1.00 85.04  ?  310  PHE B C     1 
ATOM   8895  O  O     . PHE B 2  310  ? 123.456 167.352 192.786 1.00 85.04  ?  310  PHE B O     1 
ATOM   8896  C  CB    . PHE B 2  310  ? 122.546 164.827 191.032 1.00 85.04  ?  310  PHE B CB    1 
ATOM   8897  C  CG    . PHE B 2  310  ? 121.100 164.916 190.665 1.00 85.04  ?  310  PHE B CG    1 
ATOM   8898  C  CD1   . PHE B 2  310  ? 120.703 164.765 189.349 1.00 85.04  ?  310  PHE B CD1   1 
ATOM   8899  C  CD2   . PHE B 2  310  ? 120.135 165.160 191.631 1.00 85.04  ?  310  PHE B CD2   1 
ATOM   8900  C  CE1   . PHE B 2  310  ? 119.374 164.844 189.001 1.00 85.04  ?  310  PHE B CE1   1 
ATOM   8901  C  CE2   . PHE B 2  310  ? 118.809 165.248 191.280 1.00 85.04  ?  310  PHE B CE2   1 
ATOM   8902  C  CZ    . PHE B 2  310  ? 118.423 165.081 189.969 1.00 85.04  ?  310  PHE B CZ    1 
ATOM   8903  N  N     . ILE B 2  311  ? 121.910 167.993 191.273 1.00 83.23  ?  311  ILE B N     1 
ATOM   8904  C  CA    . ILE B 2  311  ? 121.434 169.152 192.026 1.00 83.23  ?  311  ILE B CA    1 
ATOM   8905  C  C     . ILE B 2  311  ? 119.915 169.076 192.131 1.00 83.23  ?  311  ILE B C     1 
ATOM   8906  O  O     . ILE B 2  311  ? 119.226 168.965 191.110 1.00 83.23  ?  311  ILE B O     1 
ATOM   8907  C  CB    . ILE B 2  311  ? 121.859 170.478 191.366 1.00 83.23  ?  311  ILE B CB    1 
ATOM   8908  C  CG1   . ILE B 2  311  ? 123.382 170.638 191.383 1.00 83.23  ?  311  ILE B CG1   1 
ATOM   8909  C  CG2   . ILE B 2  311  ? 121.188 171.664 192.047 1.00 83.23  ?  311  ILE B CG2   1 
ATOM   8910  C  CD1   . ILE B 2  311  ? 123.887 171.743 190.497 1.00 83.23  ?  311  ILE B CD1   1 
ATOM   8911  N  N     . TRP B 2  312  ? 119.397 169.130 193.356 1.00 95.77  ?  312  TRP B N     1 
ATOM   8912  C  CA    . TRP B 2  312  ? 117.984 169.378 193.603 1.00 95.77  ?  312  TRP B CA    1 
ATOM   8913  C  C     . TRP B 2  312  ? 117.769 170.815 194.069 1.00 95.77  ?  312  TRP B C     1 
ATOM   8914  O  O     . TRP B 2  312  ? 118.625 171.417 194.722 1.00 95.77  ?  312  TRP B O     1 
ATOM   8915  C  CB    . TRP B 2  312  ? 117.418 168.440 194.673 1.00 95.77  ?  312  TRP B CB    1 
ATOM   8916  C  CG    . TRP B 2  312  ? 117.171 167.016 194.303 1.00 95.77  ?  312  TRP B CG    1 
ATOM   8917  C  CD1   . TRP B 2  312  ? 117.966 165.945 194.583 1.00 95.77  ?  312  TRP B CD1   1 
ATOM   8918  C  CD2   . TRP B 2  312  ? 116.017 166.497 193.631 1.00 95.77  ?  312  TRP B CD2   1 
ATOM   8919  N  NE1   . TRP B 2  312  ? 117.382 164.792 194.114 1.00 95.77  ?  312  TRP B NE1   1 
ATOM   8920  C  CE2   . TRP B 2  312  ? 116.191 165.106 193.517 1.00 95.77  ?  312  TRP B CE2   1 
ATOM   8921  C  CE3   . TRP B 2  312  ? 114.860 167.077 193.102 1.00 95.77  ?  312  TRP B CE3   1 
ATOM   8922  C  CZ2   . TRP B 2  312  ? 115.255 164.286 192.898 1.00 95.77  ?  312  TRP B CZ2   1 
ATOM   8923  C  CZ3   . TRP B 2  312  ? 113.932 166.260 192.486 1.00 95.77  ?  312  TRP B CZ3   1 
ATOM   8924  C  CH2   . TRP B 2  312  ? 114.135 164.879 192.390 1.00 95.77  ?  312  TRP B CH2   1 
ATOM   8925  N  N     . LYS B 2  313  ? 116.595 171.356 193.725 1.00 84.85  ?  313  LYS B N     1 
ATOM   8926  C  CA    . LYS B 2  313  ? 116.050 172.559 194.354 1.00 84.85  ?  313  LYS B CA    1 
ATOM   8927  C  C     . LYS B 2  313  ? 114.550 172.670 194.115 1.00 84.85  ?  313  LYS B C     1 
ATOM   8928  O  O     . LYS B 2  313  ? 114.095 172.668 192.968 1.00 84.85  ?  313  LYS B O     1 
ATOM   8929  C  CB    . LYS B 2  313  ? 116.716 173.836 193.869 1.00 84.85  ?  313  LYS B CB    1 
ATOM   8930  C  CG    . LYS B 2  313  ? 116.243 175.068 194.620 1.00 84.85  ?  313  LYS B CG    1 
ATOM   8931  C  CD    . LYS B 2  313  ? 116.897 176.340 194.133 1.00 84.85  ?  313  LYS B CD    1 
ATOM   8932  C  CE    . LYS B 2  313  ? 116.485 177.527 194.990 1.00 84.85  ?  313  LYS B CE    1 
ATOM   8933  N  NZ    . LYS B 2  313  ? 115.035 177.849 194.860 1.00 84.85  ?  313  LYS B NZ    1 
ATOM   8934  N  N     . SER B 2  314  ? 113.773 172.788 195.190 1.00 103.20 ?  314  SER B N     1 
ATOM   8935  C  CA    . SER B 2  314  ? 112.350 173.079 195.110 1.00 103.20 ?  314  SER B CA    1 
ATOM   8936  C  C     . SER B 2  314  ? 112.050 174.356 195.884 1.00 103.20 ?  314  SER B C     1 
ATOM   8937  O  O     . SER B 2  314  ? 112.817 174.780 196.755 1.00 103.20 ?  314  SER B O     1 
ATOM   8938  C  CB    . SER B 2  314  ? 111.519 171.918 195.659 1.00 103.20 ?  314  SER B CB    1 
ATOM   8939  O  OG    . SER B 2  314  ? 111.759 171.732 197.044 1.00 103.20 ?  314  SER B OG    1 
ATOM   8940  N  N     . GLN B 2  315  ? 110.922 174.974 195.550 1.00 111.90 ?  315  GLN B N     1 
ATOM   8941  C  CA    . GLN B 2  315  ? 110.522 176.203 196.218 1.00 111.90 ?  315  GLN B CA    1 
ATOM   8942  C  C     . GLN B 2  315  ? 109.993 175.903 197.617 1.00 111.90 ?  315  GLN B C     1 
ATOM   8943  O  O     . GLN B 2  315  ? 109.261 174.935 197.838 1.00 111.90 ?  315  GLN B O     1 
ATOM   8944  C  CB    . GLN B 2  315  ? 109.467 176.939 195.393 1.00 111.90 ?  315  GLN B CB    1 
ATOM   8945  C  CG    . GLN B 2  315  ? 109.985 177.478 194.068 1.00 111.90 ?  315  GLN B CG    1 
ATOM   8946  C  CD    . GLN B 2  315  ? 108.920 178.224 193.290 1.00 111.90 ?  315  GLN B CD    1 
ATOM   8947  O  OE1   . GLN B 2  315  ? 107.759 178.276 193.694 1.00 111.90 ?  315  GLN B OE1   1 
ATOM   8948  N  NE2   . GLN B 2  315  ? 109.315 178.818 192.169 1.00 111.90 ?  315  GLN B NE2   1 
ATOM   8949  N  N     . ARG B 2  316  ? 110.375 176.756 198.570 1.00 109.55 ?  316  ARG B N     1 
ATOM   8950  C  CA    . ARG B 2  316  ? 110.109 176.476 199.978 1.00 109.55 ?  316  ARG B CA    1 
ATOM   8951  C  C     . ARG B 2  316  ? 108.681 176.836 200.372 1.00 109.55 ?  316  ARG B C     1 
ATOM   8952  O  O     . ARG B 2  316  ? 107.988 176.035 201.011 1.00 109.55 ?  316  ARG B O     1 
ATOM   8953  C  CB    . ARG B 2  316  ? 111.110 177.230 200.856 1.00 109.55 ?  316  ARG B CB    1 
ATOM   8954  C  CG    . ARG B 2  316  ? 110.953 176.970 202.345 1.00 109.55 ?  316  ARG B CG    1 
ATOM   8955  C  CD    . ARG B 2  316  ? 111.976 177.754 203.153 1.00 109.55 ?  316  ARG B CD    1 
ATOM   8956  N  NE    . ARG B 2  316  ? 111.811 179.198 203.002 1.00 109.55 ?  316  ARG B NE    1 
ATOM   8957  C  CZ    . ARG B 2  316  ? 110.964 179.935 203.714 1.00 109.55 ?  316  ARG B CZ    1 
ATOM   8958  N  NH1   . ARG B 2  316  ? 110.200 179.368 204.639 1.00 109.55 ?  316  ARG B NH1   1 
ATOM   8959  N  NH2   . ARG B 2  316  ? 110.884 181.242 203.505 1.00 109.55 ?  316  ARG B NH2   1 
ATOM   8960  N  N     . THR B 2  317  ? 108.228 178.037 200.010 1.00 121.10 ?  317  THR B N     1 
ATOM   8961  C  CA    . THR B 2  317  ? 106.920 178.538 200.429 1.00 121.10 ?  317  THR B CA    1 
ATOM   8962  C  C     . THR B 2  317  ? 105.694 177.802 199.865 1.00 121.10 ?  317  THR B C     1 
ATOM   8963  O  O     . THR B 2  317  ? 104.659 177.801 200.545 1.00 121.10 ?  317  THR B O     1 
ATOM   8964  C  CB    . THR B 2  317  ? 106.817 180.045 200.140 1.00 121.10 ?  317  THR B CB    1 
ATOM   8965  O  OG1   . THR B 2  317  ? 107.105 180.323 198.765 1.00 121.10 ?  317  THR B OG1   1 
ATOM   8966  C  CG2   . THR B 2  317  ? 107.783 180.823 201.023 1.00 121.10 ?  317  THR B CG2   1 
ATOM   8967  N  N     . PRO B 2  318  ? 105.708 177.175 198.642 1.00 122.23 ?  318  PRO B N     1 
ATOM   8968  C  CA    . PRO B 2  318  ? 104.636 176.206 198.356 1.00 122.23 ?  318  PRO B CA    1 
ATOM   8969  C  C     . PRO B 2  318  ? 104.700 174.977 199.251 1.00 122.23 ?  318  PRO B C     1 
ATOM   8970  O  O     . PRO B 2  318  ? 103.732 174.661 199.949 1.00 122.23 ?  318  PRO B O     1 
ATOM   8971  C  CB    . PRO B 2  318  ? 104.868 175.841 196.884 1.00 122.23 ?  318  PRO B CB    1 
ATOM   8972  C  CG    . PRO B 2  318  ? 105.531 177.008 196.318 1.00 122.23 ?  318  PRO B CG    1 
ATOM   8973  C  CD    . PRO B 2  318  ? 106.431 177.510 197.397 1.00 122.23 ?  318  PRO B CD    1 
ATOM   8974  N  N     . GLY B 2  319  ? 105.843 174.293 199.243 1.00 120.70 ?  319  GLY B N     1 
ATOM   8975  C  CA    . GLY B 2  319  ? 106.045 173.128 200.092 1.00 120.70 ?  319  GLY B CA    1 
ATOM   8976  C  C     . GLY B 2  319  ? 105.188 171.931 199.747 1.00 120.70 ?  319  GLY B C     1 
ATOM   8977  O  O     . GLY B 2  319  ? 104.792 171.183 200.647 1.00 120.70 ?  319  GLY B O     1 
ATOM   8978  N  N     . ASP B 2  320  ? 104.890 171.726 198.472 1.00 120.30 ?  320  ASP B N     1 
ATOM   8979  C  CA    . ASP B 2  320  ? 104.052 170.623 198.030 1.00 120.30 ?  320  ASP B CA    1 
ATOM   8980  C  C     . ASP B 2  320  ? 104.465 170.195 196.629 1.00 120.30 ?  320  ASP B C     1 
ATOM   8981  O  O     . ASP B 2  320  ? 105.010 170.999 195.865 1.00 120.30 ?  320  ASP B O     1 
ATOM   8982  C  CB    . ASP B 2  320  ? 102.563 171.007 198.082 1.00 120.30 ?  320  ASP B CB    1 
ATOM   8983  C  CG    . ASP B 2  320  ? 102.244 172.298 197.333 1.00 120.30 ?  320  ASP B CG    1 
ATOM   8984  O  OD1   . ASP B 2  320  ? 103.164 172.972 196.828 1.00 120.30 ?  320  ASP B OD1   1 
ATOM   8985  O  OD2   . ASP B 2  320  ? 101.047 172.648 197.261 1.00 120.30 ?  320  ASP B OD2   1 
ATOM   8986  N  N     . PRO B 2  321  ? 104.245 168.917 196.269 1.00 119.82 ?  321  PRO B N     1 
ATOM   8987  C  CA    . PRO B 2  321  ? 104.566 168.481 194.901 1.00 119.82 ?  321  PRO B CA    1 
ATOM   8988  C  C     . PRO B 2  321  ? 103.510 168.885 193.881 1.00 119.82 ?  321  PRO B C     1 
ATOM   8989  O  O     . PRO B 2  321  ? 102.848 168.029 193.287 1.00 119.82 ?  321  PRO B O     1 
ATOM   8990  C  CB    . PRO B 2  321  ? 104.661 166.957 195.033 1.00 119.82 ?  321  PRO B CB    1 
ATOM   8991  C  CG    . PRO B 2  321  ? 103.790 166.629 196.189 1.00 119.82 ?  321  PRO B CG    1 
ATOM   8992  C  CD    . PRO B 2  321  ? 103.929 167.775 197.148 1.00 119.82 ?  321  PRO B CD    1 
ATOM   8993  N  N     . SER B 2  322  ? 103.351 170.192 193.669 1.00 113.01 ?  322  SER B N     1 
ATOM   8994  C  CA    . SER B 2  322  ? 102.402 170.707 192.686 1.00 113.01 ?  322  SER B CA    1 
ATOM   8995  C  C     . SER B 2  322  ? 102.970 171.790 191.783 1.00 113.01 ?  322  SER B C     1 
ATOM   8996  O  O     . SER B 2  322  ? 102.362 172.072 190.745 1.00 113.01 ?  322  SER B O     1 
ATOM   8997  C  CB    . SER B 2  322  ? 101.150 171.252 193.384 1.00 113.01 ?  322  SER B CB    1 
ATOM   8998  O  OG    . SER B 2  322  ? 101.458 172.396 194.162 1.00 113.01 ?  322  SER B OG    1 
ATOM   8999  N  N     . GLU B 2  323  ? 104.097 172.408 192.123 1.00 102.72 ?  323  GLU B N     1 
ATOM   9000  C  CA    . GLU B 2  323  ? 104.699 173.456 191.319 1.00 102.72 ?  323  GLU B CA    1 
ATOM   9001  C  C     . GLU B 2  323  ? 105.676 172.842 190.317 1.00 102.72 ?  323  GLU B C     1 
ATOM   9002  O  O     . GLU B 2  323  ? 105.717 171.624 190.116 1.00 102.72 ?  323  GLU B O     1 
ATOM   9003  C  CB    . GLU B 2  323  ? 105.385 174.482 192.224 1.00 102.72 ?  323  GLU B CB    1 
ATOM   9004  C  CG    . GLU B 2  323  ? 104.434 175.272 193.110 1.00 102.72 ?  323  GLU B CG    1 
ATOM   9005  C  CD    . GLU B 2  323  ? 103.543 176.216 192.324 1.00 102.72 ?  323  GLU B CD    1 
ATOM   9006  O  OE1   . GLU B 2  323  ? 103.995 176.740 191.284 1.00 102.72 ?  323  GLU B OE1   1 
ATOM   9007  O  OE2   . GLU B 2  323  ? 102.389 176.434 192.749 1.00 102.72 ?  323  GLU B OE2   1 
ATOM   9008  N  N     . SER B 2  324  ? 106.476 173.692 189.678 1.00 96.08  ?  324  SER B N     1 
ATOM   9009  C  CA    . SER B 2  324  ? 107.461 173.261 188.696 1.00 96.08  ?  324  SER B CA    1 
ATOM   9010  C  C     . SER B 2  324  ? 108.737 172.848 189.419 1.00 96.08  ?  324  SER B C     1 
ATOM   9011  O  O     . SER B 2  324  ? 109.303 173.635 190.186 1.00 96.08  ?  324  SER B O     1 
ATOM   9012  C  CB    . SER B 2  324  ? 107.749 174.373 187.688 1.00 96.08  ?  324  SER B CB    1 
ATOM   9013  O  OG    . SER B 2  324  ? 108.391 175.472 188.311 1.00 96.08  ?  324  SER B OG    1 
ATOM   9014  N  N     . ARG B 2  325  ? 109.185 171.619 189.174 1.00 95.71  ?  325  ARG B N     1 
ATOM   9015  C  CA    . ARG B 2  325  ? 110.370 171.056 189.810 1.00 95.71  ?  325  ARG B CA    1 
ATOM   9016  C  C     . ARG B 2  325  ? 111.439 170.830 188.749 1.00 95.71  ?  325  ARG B C     1 
ATOM   9017  O  O     . ARG B 2  325  ? 111.172 170.202 187.718 1.00 95.71  ?  325  ARG B O     1 
ATOM   9018  C  CB    . ARG B 2  325  ? 110.029 169.750 190.527 1.00 95.71  ?  325  ARG B CB    1 
ATOM   9019  C  CG    . ARG B 2  325  ? 111.172 169.153 191.328 1.00 95.71  ?  325  ARG B CG    1 
ATOM   9020  C  CD    . ARG B 2  325  ? 110.734 167.881 192.038 1.00 95.71  ?  325  ARG B CD    1 
ATOM   9021  N  NE    . ARG B 2  325  ? 109.740 168.138 193.077 1.00 95.71  ?  325  ARG B NE    1 
ATOM   9022  C  CZ    . ARG B 2  325  ? 110.034 168.465 194.332 1.00 95.71  ?  325  ARG B CZ    1 
ATOM   9023  N  NH1   . ARG B 2  325  ? 111.300 168.575 194.712 1.00 95.71  ?  325  ARG B NH1   1 
ATOM   9024  N  NH2   . ARG B 2  325  ? 109.063 168.678 195.209 1.00 95.71  ?  325  ARG B NH2   1 
ATOM   9025  N  N     . GLN B 2  326  ? 112.644 171.335 189.004 1.00 86.08  ?  326  GLN B N     1 
ATOM   9026  C  CA    . GLN B 2  326  ? 113.737 171.283 188.044 1.00 86.08  ?  326  GLN B CA    1 
ATOM   9027  C  C     . GLN B 2  326  ? 114.918 170.516 188.623 1.00 86.08  ?  326  GLN B C     1 
ATOM   9028  O  O     . GLN B 2  326  ? 115.098 170.463 189.844 1.00 86.08  ?  326  GLN B O     1 
ATOM   9029  C  CB    . GLN B 2  326  ? 114.179 172.692 187.642 1.00 86.08  ?  326  GLN B CB    1 
ATOM   9030  C  CG    . GLN B 2  326  ? 113.109 173.485 186.911 1.00 86.08  ?  326  GLN B CG    1 
ATOM   9031  C  CD    . GLN B 2  326  ? 113.581 174.865 186.503 1.00 86.08  ?  326  GLN B CD    1 
ATOM   9032  O  OE1   . GLN B 2  326  ? 114.705 175.259 186.805 1.00 86.08  ?  326  GLN B OE1   1 
ATOM   9033  N  NE2   . GLN B 2  326  ? 112.724 175.606 185.809 1.00 86.08  ?  326  GLN B NE2   1 
ATOM   9034  N  N     . LEU B 2  327  ? 115.720 169.929 187.734 1.00 78.34  ?  327  LEU B N     1 
ATOM   9035  C  CA    . LEU B 2  327  ? 116.901 169.154 188.090 1.00 78.34  ?  327  LEU B CA    1 
ATOM   9036  C  C     . LEU B 2  327  ? 117.808 169.036 186.869 1.00 78.34  ?  327  LEU B C     1 
ATOM   9037  O  O     . LEU B 2  327  ? 117.343 168.875 185.738 1.00 78.34  ?  327  LEU B O     1 
ATOM   9038  C  CB    . LEU B 2  327  ? 116.507 167.772 188.642 1.00 78.34  ?  327  LEU B CB    1 
ATOM   9039  C  CG    . LEU B 2  327  ? 115.646 166.783 187.844 1.00 78.34  ?  327  LEU B CG    1 
ATOM   9040  C  CD1   . LEU B 2  327  ? 116.472 165.842 186.978 1.00 78.34  ?  327  LEU B CD1   1 
ATOM   9041  C  CD2   . LEU B 2  327  ? 114.754 165.987 188.786 1.00 78.34  ?  327  LEU B CD2   1 
ATOM   9042  N  N     . TRP B 2  328  ? 119.119 169.106 187.105 1.00 71.27  ?  328  TRP B N     1 
ATOM   9043  C  CA    . TRP B 2  328  ? 120.105 169.182 186.031 1.00 71.27  ?  328  TRP B CA    1 
ATOM   9044  C  C     . TRP B 2  328  ? 121.039 167.981 186.082 1.00 71.27  ?  328  TRP B C     1 
ATOM   9045  O  O     . TRP B 2  328  ? 121.441 167.547 187.166 1.00 71.27  ?  328  TRP B O     1 
ATOM   9046  C  CB    . TRP B 2  328  ? 120.908 170.485 186.109 1.00 71.27  ?  328  TRP B CB    1 
ATOM   9047  C  CG    . TRP B 2  328  ? 120.134 171.689 185.667 1.00 71.27  ?  328  TRP B CG    1 
ATOM   9048  C  CD1   . TRP B 2  328  ? 118.875 171.704 185.147 1.00 71.27  ?  328  TRP B CD1   1 
ATOM   9049  C  CD2   . TRP B 2  328  ? 120.582 173.050 185.669 1.00 71.27  ?  328  TRP B CD2   1 
ATOM   9050  N  NE1   . TRP B 2  328  ? 118.500 172.989 184.841 1.00 71.27  ?  328  TRP B NE1   1 
ATOM   9051  C  CE2   . TRP B 2  328  ? 119.531 173.834 185.151 1.00 71.27  ?  328  TRP B CE2   1 
ATOM   9052  C  CE3   . TRP B 2  328  ? 121.764 173.682 186.065 1.00 71.27  ?  328  TRP B CE3   1 
ATOM   9053  C  CZ2   . TRP B 2  328  ? 119.628 175.215 185.019 1.00 71.27  ?  328  TRP B CZ2   1 
ATOM   9054  C  CZ3   . TRP B 2  328  ? 121.856 175.054 185.932 1.00 71.27  ?  328  TRP B CZ3   1 
ATOM   9055  C  CH2   . TRP B 2  328  ? 120.795 175.804 185.414 1.00 71.27  ?  328  TRP B CH2   1 
ATOM   9056  N  N     . ILE B 2  329  ? 121.385 167.454 184.909 1.00 70.83  ?  329  ILE B N     1 
ATOM   9057  C  CA    . ILE B 2  329  ? 122.325 166.344 184.786 1.00 70.83  ?  329  ILE B CA    1 
ATOM   9058  C  C     . ILE B 2  329  ? 123.649 166.906 184.278 1.00 70.83  ?  329  ILE B C     1 
ATOM   9059  O  O     . ILE B 2  329  ? 123.812 167.145 183.078 1.00 70.83  ?  329  ILE B O     1 
ATOM   9060  C  CB    . ILE B 2  329  ? 121.794 165.256 183.843 1.00 70.83  ?  329  ILE B CB    1 
ATOM   9061  C  CG1   . ILE B 2  329  ? 120.419 164.758 184.292 1.00 70.83  ?  329  ILE B CG1   1 
ATOM   9062  C  CG2   . ILE B 2  329  ? 122.760 164.082 183.787 1.00 70.83  ?  329  ILE B CG2   1 
ATOM   9063  C  CD1   . ILE B 2  329  ? 120.419 164.063 185.631 1.00 70.83  ?  329  ILE B CD1   1 
ATOM   9064  N  N     . TRP B 2  330  ? 124.598 167.122 185.186 1.00 65.72  ?  330  TRP B N     1 
ATOM   9065  C  CA    . TRP B 2  330  ? 125.940 167.543 184.802 1.00 65.72  ?  330  TRP B CA    1 
ATOM   9066  C  C     . TRP B 2  330  ? 126.773 166.335 184.392 1.00 65.72  ?  330  TRP B C     1 
ATOM   9067  O  O     . TRP B 2  330  ? 126.969 165.403 185.176 1.00 65.72  ?  330  TRP B O     1 
ATOM   9068  C  CB    . TRP B 2  330  ? 126.628 168.311 185.934 1.00 65.72  ?  330  TRP B CB    1 
ATOM   9069  C  CG    . TRP B 2  330  ? 126.125 169.719 186.066 1.00 65.72  ?  330  TRP B CG    1 
ATOM   9070  C  CD1   . TRP B 2  330  ? 125.246 170.348 185.233 1.00 65.72  ?  330  TRP B CD1   1 
ATOM   9071  C  CD2   . TRP B 2  330  ? 126.491 170.683 187.062 1.00 65.72  ?  330  TRP B CD2   1 
ATOM   9072  N  NE1   . TRP B 2  330  ? 125.028 171.635 185.656 1.00 65.72  ?  330  TRP B NE1   1 
ATOM   9073  C  CE2   . TRP B 2  330  ? 125.781 171.867 186.776 1.00 65.72  ?  330  TRP B CE2   1 
ATOM   9074  C  CE3   . TRP B 2  330  ? 127.342 170.659 188.173 1.00 65.72  ?  330  TRP B CE3   1 
ATOM   9075  C  CZ2   . TRP B 2  330  ? 125.897 173.015 187.558 1.00 65.72  ?  330  TRP B CZ2   1 
ATOM   9076  C  CZ3   . TRP B 2  330  ? 127.456 171.802 188.947 1.00 65.72  ?  330  TRP B CZ3   1 
ATOM   9077  C  CH2   . TRP B 2  330  ? 126.737 172.962 188.634 1.00 65.72  ?  330  TRP B CH2   1 
ATOM   9078  N  N     . LEU B 2  331  ? 127.278 166.370 183.161 1.00 60.65  ?  331  LEU B N     1 
ATOM   9079  C  CA    . LEU B 2  331  ? 127.856 165.186 182.541 1.00 60.65  ?  331  LEU B CA    1 
ATOM   9080  C  C     . LEU B 2  331  ? 129.043 165.580 181.674 1.00 60.65  ?  331  LEU B C     1 
ATOM   9081  O  O     . LEU B 2  331  ? 129.330 166.763 181.474 1.00 60.65  ?  331  LEU B O     1 
ATOM   9082  C  CB    . LEU B 2  331  ? 126.794 164.428 181.728 1.00 60.65  ?  331  LEU B CB    1 
ATOM   9083  C  CG    . LEU B 2  331  ? 125.989 165.175 180.649 1.00 60.65  ?  331  LEU B CG    1 
ATOM   9084  C  CD1   . LEU B 2  331  ? 126.613 165.144 179.256 1.00 60.65  ?  331  LEU B CD1   1 
ATOM   9085  C  CD2   . LEU B 2  331  ? 124.569 164.651 180.591 1.00 60.65  ?  331  LEU B CD2   1 
ATOM   9086  N  N     . HIS B 2  332  ? 129.723 164.556 181.155 1.00 58.76  ?  332  HIS B N     1 
ATOM   9087  C  CA    . HIS B 2  332  ? 130.899 164.697 180.314 1.00 58.76  ?  332  HIS B CA    1 
ATOM   9088  C  C     . HIS B 2  332  ? 130.503 164.547 178.842 1.00 58.76  ?  332  HIS B C     1 
ATOM   9089  O  O     . HIS B 2  332  ? 129.569 163.807 178.526 1.00 58.76  ?  332  HIS B O     1 
ATOM   9090  C  CB    . HIS B 2  332  ? 131.936 163.641 180.699 1.00 58.76  ?  332  HIS B CB    1 
ATOM   9091  C  CG    . HIS B 2  332  ? 133.293 163.882 180.118 1.00 58.76  ?  332  HIS B CG    1 
ATOM   9092  N  ND1   . HIS B 2  332  ? 134.136 164.866 180.595 1.00 58.76  ?  332  HIS B ND1   1 
ATOM   9093  C  CD2   . HIS B 2  332  ? 133.943 163.293 179.087 1.00 58.76  ?  332  HIS B CD2   1 
ATOM   9094  C  CE1   . HIS B 2  332  ? 135.253 164.862 179.891 1.00 58.76  ?  332  HIS B CE1   1 
ATOM   9095  N  NE2   . HIS B 2  332  ? 135.160 163.918 178.970 1.00 58.76  ?  332  HIS B NE2   1 
ATOM   9096  N  N     . PRO B 2  333  ? 131.177 165.259 177.924 1.00 53.56  ?  333  PRO B N     1 
ATOM   9097  C  CA    . PRO B 2  333  ? 130.783 165.191 176.501 1.00 53.56  ?  333  PRO B CA    1 
ATOM   9098  C  C     . PRO B 2  333  ? 130.971 163.833 175.835 1.00 53.56  ?  333  PRO B C     1 
ATOM   9099  O  O     . PRO B 2  333  ? 130.368 163.606 174.778 1.00 53.56  ?  333  PRO B O     1 
ATOM   9100  C  CB    . PRO B 2  333  ? 131.667 166.258 175.841 1.00 53.56  ?  333  PRO B CB    1 
ATOM   9101  C  CG    . PRO B 2  333  ? 131.942 167.223 176.927 1.00 53.56  ?  333  PRO B CG    1 
ATOM   9102  C  CD    . PRO B 2  333  ? 132.068 166.406 178.176 1.00 53.56  ?  333  PRO B CD    1 
ATOM   9103  N  N     . THR B 2  334  ? 131.779 162.927 176.395 1.00 60.19  ?  334  THR B N     1 
ATOM   9104  C  CA    . THR B 2  334  ? 131.766 161.558 175.892 1.00 60.19  ?  334  THR B CA    1 
ATOM   9105  C  C     . THR B 2  334  ? 130.487 160.832 176.282 1.00 60.19  ?  334  THR B C     1 
ATOM   9106  O  O     . THR B 2  334  ? 130.066 159.914 175.570 1.00 60.19  ?  334  THR B O     1 
ATOM   9107  C  CB    . THR B 2  334  ? 132.974 160.771 176.404 1.00 60.19  ?  334  THR B CB    1 
ATOM   9108  O  OG1   . THR