data_6AN8
# 
_entry.id   6AN8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6AN8         
WWPDB D_1000229497 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6AN8 
_pdbx_database_status.recvd_initial_deposition_date   2017-08-12 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Martinez, S.E.' 1 ? 
'Das, K.'        2 ? 
'Arnold, E.'     3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Protein Sci.' 
_citation.journal_id_ASTM           PRCIEI 
_citation.journal_id_CSD            0795 
_citation.journal_id_ISSN           1469-896X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            28 
_citation.language                  ? 
_citation.page_first                587 
_citation.page_last                 597 
_citation.title                     
'Structure of HIV-1 reverse transcriptase/d4TTP complex: Novel DNA cross-linking site and pH-dependent conformational changes.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1002/pro.3559 
_citation.pdbx_database_id_PubMed   30499174 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Martinez, S.E.' 1 0000-0001-5523-6940 
primary 'Bauman, J.D.'   2 ?                   
primary 'Das, K.'        3 0000-0002-8897-324X 
primary 'Arnold, E.'     4 ?                   
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   97.830 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6AN8 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     89.959 
_cell.length_a_esd                 ? 
_cell.length_b                     132.824 
_cell.length_b_esd                 ? 
_cell.length_c                     138.909 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6AN8 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'HIV-1 REVERSE TRANSCRIPTASE P66 SUBUNIT'                                                                   
64038.367 2   2.7.7.49,2.7.7.7 'C280S, I63C' ? ? 
2 polymer     man 'HIV-1 REVERSE TRANSCRIPTASE P51 SUBUNIT'                                                                   
51928.629 2   2.7.7.49,2.7.7.7 C879S         ? ? 
3 polymer     syn 
;DNA TEMPLATE (5'- D(*AP*TP*GP*AP*AP*CP*GP*GP*CP*GP*CP*CP*CP*GP*AP*AP*CP*AP*GP*GP*GP*AP*CP*TP*GP*TP*G)-3')
;
8376.399  2   ?                ?             ? ? 
4 polymer     syn 
;DNA PRIMER (5'- D(*AP*CP*AP*GP*TP*CP*CP*CP*TP*GP*TP*TP*CP*GP*GP*GP*CP*GP*CP*CP*GP)-3')
;
6400.123  2   ?                ?             ? ? 
5 non-polymer syn 'MAGNESIUM ION'                                                                                             
24.305    4   ?                ?             ? ? 
6 non-polymer syn 
;2',3'-DEHYDRO-2',3'-DEOXY-THYMIDINE 5'-TRIPHOSPHATE
;
464.153   2   ?                ?             ? ? 
7 non-polymer syn GLYCEROL                                                                                                    
92.094    13  ?                ?             ? ? 
8 water       nat water                                                                                                       
18.015    695 ?                ?             ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFACKKKDSTKWRKLVDFR
ELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPA
IFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDK
WTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVY
YDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETW
ETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTE
LQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
;
;MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFACKKKDSTKWRKLVDFR
ELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPA
IFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDK
WTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVY
YDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETW
ETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTE
LQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
;
A,C ? 
2 'polypeptide(L)'        no no  
;MAHHHHHHALEVLFQGPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIK
KKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRY
QYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKE
PPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELA
ENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWG
KTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
;
;MAHHHHHHALEVLFQGPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIK
KKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRY
QYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKE
PPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELA
ENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWG
KTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
;
B,D ? 
3 polydeoxyribonucleotide no no  
;(DA)(DT)(DG)(DA)(DA)(DC)(DG)(DG)(DC)(DG)(DC)(DC)(DC)(DG)(DA)(DA)(DC)(DA)(DG)(DG)
(DG)(DA)(DC)(DT)(DG)(DT)(DG)
;
ATGAACGGCGCCCGAACAGGGACTGTG T,E ? 
4 polydeoxyribonucleotide no yes 
;(DA)(DC)(DA)(DG)(DT)(DC)(DC)(DC)(DT)(DG)(DT)(DT)(DC)(DG)(DG)(DG)(DC)(DG)(DC)(DC)
(DDG)
;
ACAGTCCCTGTTCGGGCGCCG P,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   VAL n 
1 3   PRO n 
1 4   ILE n 
1 5   SER n 
1 6   PRO n 
1 7   ILE n 
1 8   GLU n 
1 9   THR n 
1 10  VAL n 
1 11  PRO n 
1 12  VAL n 
1 13  LYS n 
1 14  LEU n 
1 15  LYS n 
1 16  PRO n 
1 17  GLY n 
1 18  MET n 
1 19  ASP n 
1 20  GLY n 
1 21  PRO n 
1 22  LYS n 
1 23  VAL n 
1 24  LYS n 
1 25  GLN n 
1 26  TRP n 
1 27  PRO n 
1 28  LEU n 
1 29  THR n 
1 30  GLU n 
1 31  GLU n 
1 32  LYS n 
1 33  ILE n 
1 34  LYS n 
1 35  ALA n 
1 36  LEU n 
1 37  VAL n 
1 38  GLU n 
1 39  ILE n 
1 40  CYS n 
1 41  THR n 
1 42  GLU n 
1 43  MET n 
1 44  GLU n 
1 45  LYS n 
1 46  GLU n 
1 47  GLY n 
1 48  LYS n 
1 49  ILE n 
1 50  SER n 
1 51  LYS n 
1 52  ILE n 
1 53  GLY n 
1 54  PRO n 
1 55  GLU n 
1 56  ASN n 
1 57  PRO n 
1 58  TYR n 
1 59  ASN n 
1 60  THR n 
1 61  PRO n 
1 62  VAL n 
1 63  PHE n 
1 64  ALA n 
1 65  CYS n 
1 66  LYS n 
1 67  LYS n 
1 68  LYS n 
1 69  ASP n 
1 70  SER n 
1 71  THR n 
1 72  LYS n 
1 73  TRP n 
1 74  ARG n 
1 75  LYS n 
1 76  LEU n 
1 77  VAL n 
1 78  ASP n 
1 79  PHE n 
1 80  ARG n 
1 81  GLU n 
1 82  LEU n 
1 83  ASN n 
1 84  LYS n 
1 85  ARG n 
1 86  THR n 
1 87  GLN n 
1 88  ASP n 
1 89  PHE n 
1 90  TRP n 
1 91  GLU n 
1 92  VAL n 
1 93  GLN n 
1 94  LEU n 
1 95  GLY n 
1 96  ILE n 
1 97  PRO n 
1 98  HIS n 
1 99  PRO n 
1 100 ALA n 
1 101 GLY n 
1 102 LEU n 
1 103 LYS n 
1 104 LYS n 
1 105 LYS n 
1 106 LYS n 
1 107 SER n 
1 108 VAL n 
1 109 THR n 
1 110 VAL n 
1 111 LEU n 
1 112 ASP n 
1 113 VAL n 
1 114 GLY n 
1 115 ASP n 
1 116 ALA n 
1 117 TYR n 
1 118 PHE n 
1 119 SER n 
1 120 VAL n 
1 121 PRO n 
1 122 LEU n 
1 123 ASP n 
1 124 GLU n 
1 125 ASP n 
1 126 PHE n 
1 127 ARG n 
1 128 LYS n 
1 129 TYR n 
1 130 THR n 
1 131 ALA n 
1 132 PHE n 
1 133 THR n 
1 134 ILE n 
1 135 PRO n 
1 136 SER n 
1 137 ILE n 
1 138 ASN n 
1 139 ASN n 
1 140 GLU n 
1 141 THR n 
1 142 PRO n 
1 143 GLY n 
1 144 ILE n 
1 145 ARG n 
1 146 TYR n 
1 147 GLN n 
1 148 TYR n 
1 149 ASN n 
1 150 VAL n 
1 151 LEU n 
1 152 PRO n 
1 153 GLN n 
1 154 GLY n 
1 155 TRP n 
1 156 LYS n 
1 157 GLY n 
1 158 SER n 
1 159 PRO n 
1 160 ALA n 
1 161 ILE n 
1 162 PHE n 
1 163 GLN n 
1 164 SER n 
1 165 SER n 
1 166 MET n 
1 167 THR n 
1 168 LYS n 
1 169 ILE n 
1 170 LEU n 
1 171 GLU n 
1 172 PRO n 
1 173 PHE n 
1 174 LYS n 
1 175 LYS n 
1 176 GLN n 
1 177 ASN n 
1 178 PRO n 
1 179 ASP n 
1 180 ILE n 
1 181 VAL n 
1 182 ILE n 
1 183 TYR n 
1 184 GLN n 
1 185 TYR n 
1 186 MET n 
1 187 ASP n 
1 188 ASP n 
1 189 LEU n 
1 190 TYR n 
1 191 VAL n 
1 192 GLY n 
1 193 SER n 
1 194 ASP n 
1 195 LEU n 
1 196 GLU n 
1 197 ILE n 
1 198 GLY n 
1 199 GLN n 
1 200 HIS n 
1 201 ARG n 
1 202 THR n 
1 203 LYS n 
1 204 ILE n 
1 205 GLU n 
1 206 GLU n 
1 207 LEU n 
1 208 ARG n 
1 209 GLN n 
1 210 HIS n 
1 211 LEU n 
1 212 LEU n 
1 213 ARG n 
1 214 TRP n 
1 215 GLY n 
1 216 LEU n 
1 217 THR n 
1 218 THR n 
1 219 PRO n 
1 220 ASP n 
1 221 LYS n 
1 222 LYS n 
1 223 HIS n 
1 224 GLN n 
1 225 LYS n 
1 226 GLU n 
1 227 PRO n 
1 228 PRO n 
1 229 PHE n 
1 230 LEU n 
1 231 TRP n 
1 232 MET n 
1 233 GLY n 
1 234 TYR n 
1 235 GLU n 
1 236 LEU n 
1 237 HIS n 
1 238 PRO n 
1 239 ASP n 
1 240 LYS n 
1 241 TRP n 
1 242 THR n 
1 243 VAL n 
1 244 GLN n 
1 245 PRO n 
1 246 ILE n 
1 247 VAL n 
1 248 LEU n 
1 249 PRO n 
1 250 GLU n 
1 251 LYS n 
1 252 ASP n 
1 253 SER n 
1 254 TRP n 
1 255 THR n 
1 256 VAL n 
1 257 ASN n 
1 258 ASP n 
1 259 ILE n 
1 260 GLN n 
1 261 LYS n 
1 262 LEU n 
1 263 VAL n 
1 264 GLY n 
1 265 LYS n 
1 266 LEU n 
1 267 ASN n 
1 268 TRP n 
1 269 ALA n 
1 270 SER n 
1 271 GLN n 
1 272 ILE n 
1 273 TYR n 
1 274 PRO n 
1 275 GLY n 
1 276 ILE n 
1 277 LYS n 
1 278 VAL n 
1 279 ARG n 
1 280 GLN n 
1 281 LEU n 
1 282 SER n 
1 283 LYS n 
1 284 LEU n 
1 285 LEU n 
1 286 ARG n 
1 287 GLY n 
1 288 THR n 
1 289 LYS n 
1 290 ALA n 
1 291 LEU n 
1 292 THR n 
1 293 GLU n 
1 294 VAL n 
1 295 ILE n 
1 296 PRO n 
1 297 LEU n 
1 298 THR n 
1 299 GLU n 
1 300 GLU n 
1 301 ALA n 
1 302 GLU n 
1 303 LEU n 
1 304 GLU n 
1 305 LEU n 
1 306 ALA n 
1 307 GLU n 
1 308 ASN n 
1 309 ARG n 
1 310 GLU n 
1 311 ILE n 
1 312 LEU n 
1 313 LYS n 
1 314 GLU n 
1 315 PRO n 
1 316 VAL n 
1 317 HIS n 
1 318 GLY n 
1 319 VAL n 
1 320 TYR n 
1 321 TYR n 
1 322 ASP n 
1 323 PRO n 
1 324 SER n 
1 325 LYS n 
1 326 ASP n 
1 327 LEU n 
1 328 ILE n 
1 329 ALA n 
1 330 GLU n 
1 331 ILE n 
1 332 GLN n 
1 333 LYS n 
1 334 GLN n 
1 335 GLY n 
1 336 GLN n 
1 337 GLY n 
1 338 GLN n 
1 339 TRP n 
1 340 THR n 
1 341 TYR n 
1 342 GLN n 
1 343 ILE n 
1 344 TYR n 
1 345 GLN n 
1 346 GLU n 
1 347 PRO n 
1 348 PHE n 
1 349 LYS n 
1 350 ASN n 
1 351 LEU n 
1 352 LYS n 
1 353 THR n 
1 354 GLY n 
1 355 LYS n 
1 356 TYR n 
1 357 ALA n 
1 358 ARG n 
1 359 MET n 
1 360 ARG n 
1 361 GLY n 
1 362 ALA n 
1 363 HIS n 
1 364 THR n 
1 365 ASN n 
1 366 ASP n 
1 367 VAL n 
1 368 LYS n 
1 369 GLN n 
1 370 LEU n 
1 371 THR n 
1 372 GLU n 
1 373 ALA n 
1 374 VAL n 
1 375 GLN n 
1 376 LYS n 
1 377 ILE n 
1 378 THR n 
1 379 THR n 
1 380 GLU n 
1 381 SER n 
1 382 ILE n 
1 383 VAL n 
1 384 ILE n 
1 385 TRP n 
1 386 GLY n 
1 387 LYS n 
1 388 THR n 
1 389 PRO n 
1 390 LYS n 
1 391 PHE n 
1 392 LYS n 
1 393 LEU n 
1 394 PRO n 
1 395 ILE n 
1 396 GLN n 
1 397 LYS n 
1 398 GLU n 
1 399 THR n 
1 400 TRP n 
1 401 GLU n 
1 402 THR n 
1 403 TRP n 
1 404 TRP n 
1 405 THR n 
1 406 GLU n 
1 407 TYR n 
1 408 TRP n 
1 409 GLN n 
1 410 ALA n 
1 411 THR n 
1 412 TRP n 
1 413 ILE n 
1 414 PRO n 
1 415 GLU n 
1 416 TRP n 
1 417 GLU n 
1 418 PHE n 
1 419 VAL n 
1 420 ASN n 
1 421 THR n 
1 422 PRO n 
1 423 PRO n 
1 424 LEU n 
1 425 VAL n 
1 426 LYS n 
1 427 LEU n 
1 428 TRP n 
1 429 TYR n 
1 430 GLN n 
1 431 LEU n 
1 432 GLU n 
1 433 LYS n 
1 434 GLU n 
1 435 PRO n 
1 436 ILE n 
1 437 VAL n 
1 438 GLY n 
1 439 ALA n 
1 440 GLU n 
1 441 THR n 
1 442 PHE n 
1 443 TYR n 
1 444 VAL n 
1 445 ASP n 
1 446 GLY n 
1 447 ALA n 
1 448 ALA n 
1 449 ASN n 
1 450 ARG n 
1 451 GLU n 
1 452 THR n 
1 453 LYS n 
1 454 LEU n 
1 455 GLY n 
1 456 LYS n 
1 457 ALA n 
1 458 GLY n 
1 459 TYR n 
1 460 VAL n 
1 461 THR n 
1 462 ASN n 
1 463 LYS n 
1 464 GLY n 
1 465 ARG n 
1 466 GLN n 
1 467 LYS n 
1 468 VAL n 
1 469 VAL n 
1 470 PRO n 
1 471 LEU n 
1 472 THR n 
1 473 ASN n 
1 474 THR n 
1 475 THR n 
1 476 ASN n 
1 477 GLN n 
1 478 LYS n 
1 479 THR n 
1 480 GLU n 
1 481 LEU n 
1 482 GLN n 
1 483 ALA n 
1 484 ILE n 
1 485 TYR n 
1 486 LEU n 
1 487 ALA n 
1 488 LEU n 
1 489 GLN n 
1 490 ASP n 
1 491 SER n 
1 492 GLY n 
1 493 LEU n 
1 494 GLU n 
1 495 VAL n 
1 496 ASN n 
1 497 ILE n 
1 498 VAL n 
1 499 THR n 
1 500 ASP n 
1 501 SER n 
1 502 GLN n 
1 503 TYR n 
1 504 ALA n 
1 505 LEU n 
1 506 GLY n 
1 507 ILE n 
1 508 ILE n 
1 509 GLN n 
1 510 ALA n 
1 511 GLN n 
1 512 PRO n 
1 513 ASP n 
1 514 LYS n 
1 515 SER n 
1 516 GLU n 
1 517 SER n 
1 518 GLU n 
1 519 LEU n 
1 520 VAL n 
1 521 ASN n 
1 522 GLN n 
1 523 ILE n 
1 524 ILE n 
1 525 GLU n 
1 526 GLN n 
1 527 LEU n 
1 528 ILE n 
1 529 LYS n 
1 530 LYS n 
1 531 GLU n 
1 532 LYS n 
1 533 VAL n 
1 534 TYR n 
1 535 LEU n 
1 536 ALA n 
1 537 TRP n 
1 538 VAL n 
1 539 PRO n 
1 540 ALA n 
1 541 HIS n 
1 542 LYS n 
1 543 GLY n 
1 544 ILE n 
1 545 GLY n 
1 546 GLY n 
1 547 ASN n 
1 548 GLU n 
1 549 GLN n 
1 550 VAL n 
1 551 ASP n 
1 552 LYS n 
1 553 LEU n 
1 554 VAL n 
1 555 SER n 
1 556 ALA n 
2 1   MET n 
2 2   ALA n 
2 3   HIS n 
2 4   HIS n 
2 5   HIS n 
2 6   HIS n 
2 7   HIS n 
2 8   HIS n 
2 9   ALA n 
2 10  LEU n 
2 11  GLU n 
2 12  VAL n 
2 13  LEU n 
2 14  PHE n 
2 15  GLN n 
2 16  GLY n 
2 17  PRO n 
2 18  ILE n 
2 19  SER n 
2 20  PRO n 
2 21  ILE n 
2 22  GLU n 
2 23  THR n 
2 24  VAL n 
2 25  PRO n 
2 26  VAL n 
2 27  LYS n 
2 28  LEU n 
2 29  LYS n 
2 30  PRO n 
2 31  GLY n 
2 32  MET n 
2 33  ASP n 
2 34  GLY n 
2 35  PRO n 
2 36  LYS n 
2 37  VAL n 
2 38  LYS n 
2 39  GLN n 
2 40  TRP n 
2 41  PRO n 
2 42  LEU n 
2 43  THR n 
2 44  GLU n 
2 45  GLU n 
2 46  LYS n 
2 47  ILE n 
2 48  LYS n 
2 49  ALA n 
2 50  LEU n 
2 51  VAL n 
2 52  GLU n 
2 53  ILE n 
2 54  CYS n 
2 55  THR n 
2 56  GLU n 
2 57  MET n 
2 58  GLU n 
2 59  LYS n 
2 60  GLU n 
2 61  GLY n 
2 62  LYS n 
2 63  ILE n 
2 64  SER n 
2 65  LYS n 
2 66  ILE n 
2 67  GLY n 
2 68  PRO n 
2 69  GLU n 
2 70  ASN n 
2 71  PRO n 
2 72  TYR n 
2 73  ASN n 
2 74  THR n 
2 75  PRO n 
2 76  VAL n 
2 77  PHE n 
2 78  ALA n 
2 79  ILE n 
2 80  LYS n 
2 81  LYS n 
2 82  LYS n 
2 83  ASP n 
2 84  SER n 
2 85  THR n 
2 86  LYS n 
2 87  TRP n 
2 88  ARG n 
2 89  LYS n 
2 90  LEU n 
2 91  VAL n 
2 92  ASP n 
2 93  PHE n 
2 94  ARG n 
2 95  GLU n 
2 96  LEU n 
2 97  ASN n 
2 98  LYS n 
2 99  ARG n 
2 100 THR n 
2 101 GLN n 
2 102 ASP n 
2 103 PHE n 
2 104 TRP n 
2 105 GLU n 
2 106 VAL n 
2 107 GLN n 
2 108 LEU n 
2 109 GLY n 
2 110 ILE n 
2 111 PRO n 
2 112 HIS n 
2 113 PRO n 
2 114 ALA n 
2 115 GLY n 
2 116 LEU n 
2 117 LYS n 
2 118 LYS n 
2 119 LYS n 
2 120 LYS n 
2 121 SER n 
2 122 VAL n 
2 123 THR n 
2 124 VAL n 
2 125 LEU n 
2 126 ASP n 
2 127 VAL n 
2 128 GLY n 
2 129 ASP n 
2 130 ALA n 
2 131 TYR n 
2 132 PHE n 
2 133 SER n 
2 134 VAL n 
2 135 PRO n 
2 136 LEU n 
2 137 ASP n 
2 138 GLU n 
2 139 ASP n 
2 140 PHE n 
2 141 ARG n 
2 142 LYS n 
2 143 TYR n 
2 144 THR n 
2 145 ALA n 
2 146 PHE n 
2 147 THR n 
2 148 ILE n 
2 149 PRO n 
2 150 SER n 
2 151 ILE n 
2 152 ASN n 
2 153 ASN n 
2 154 GLU n 
2 155 THR n 
2 156 PRO n 
2 157 GLY n 
2 158 ILE n 
2 159 ARG n 
2 160 TYR n 
2 161 GLN n 
2 162 TYR n 
2 163 ASN n 
2 164 VAL n 
2 165 LEU n 
2 166 PRO n 
2 167 GLN n 
2 168 GLY n 
2 169 TRP n 
2 170 LYS n 
2 171 GLY n 
2 172 SER n 
2 173 PRO n 
2 174 ALA n 
2 175 ILE n 
2 176 PHE n 
2 177 GLN n 
2 178 SER n 
2 179 SER n 
2 180 MET n 
2 181 THR n 
2 182 LYS n 
2 183 ILE n 
2 184 LEU n 
2 185 GLU n 
2 186 PRO n 
2 187 PHE n 
2 188 LYS n 
2 189 LYS n 
2 190 GLN n 
2 191 ASN n 
2 192 PRO n 
2 193 ASP n 
2 194 ILE n 
2 195 VAL n 
2 196 ILE n 
2 197 TYR n 
2 198 GLN n 
2 199 TYR n 
2 200 MET n 
2 201 ASP n 
2 202 ASP n 
2 203 LEU n 
2 204 TYR n 
2 205 VAL n 
2 206 GLY n 
2 207 SER n 
2 208 ASP n 
2 209 LEU n 
2 210 GLU n 
2 211 ILE n 
2 212 GLY n 
2 213 GLN n 
2 214 HIS n 
2 215 ARG n 
2 216 THR n 
2 217 LYS n 
2 218 ILE n 
2 219 GLU n 
2 220 GLU n 
2 221 LEU n 
2 222 ARG n 
2 223 GLN n 
2 224 HIS n 
2 225 LEU n 
2 226 LEU n 
2 227 ARG n 
2 228 TRP n 
2 229 GLY n 
2 230 LEU n 
2 231 THR n 
2 232 THR n 
2 233 PRO n 
2 234 ASP n 
2 235 LYS n 
2 236 LYS n 
2 237 HIS n 
2 238 GLN n 
2 239 LYS n 
2 240 GLU n 
2 241 PRO n 
2 242 PRO n 
2 243 PHE n 
2 244 LEU n 
2 245 TRP n 
2 246 MET n 
2 247 GLY n 
2 248 TYR n 
2 249 GLU n 
2 250 LEU n 
2 251 HIS n 
2 252 PRO n 
2 253 ASP n 
2 254 LYS n 
2 255 TRP n 
2 256 THR n 
2 257 VAL n 
2 258 GLN n 
2 259 PRO n 
2 260 ILE n 
2 261 VAL n 
2 262 LEU n 
2 263 PRO n 
2 264 GLU n 
2 265 LYS n 
2 266 ASP n 
2 267 SER n 
2 268 TRP n 
2 269 THR n 
2 270 VAL n 
2 271 ASN n 
2 272 ASP n 
2 273 ILE n 
2 274 GLN n 
2 275 LYS n 
2 276 LEU n 
2 277 VAL n 
2 278 GLY n 
2 279 LYS n 
2 280 LEU n 
2 281 ASN n 
2 282 TRP n 
2 283 ALA n 
2 284 SER n 
2 285 GLN n 
2 286 ILE n 
2 287 TYR n 
2 288 PRO n 
2 289 GLY n 
2 290 ILE n 
2 291 LYS n 
2 292 VAL n 
2 293 ARG n 
2 294 GLN n 
2 295 LEU n 
2 296 SER n 
2 297 LYS n 
2 298 LEU n 
2 299 LEU n 
2 300 ARG n 
2 301 GLY n 
2 302 THR n 
2 303 LYS n 
2 304 ALA n 
2 305 LEU n 
2 306 THR n 
2 307 GLU n 
2 308 VAL n 
2 309 ILE n 
2 310 PRO n 
2 311 LEU n 
2 312 THR n 
2 313 GLU n 
2 314 GLU n 
2 315 ALA n 
2 316 GLU n 
2 317 LEU n 
2 318 GLU n 
2 319 LEU n 
2 320 ALA n 
2 321 GLU n 
2 322 ASN n 
2 323 ARG n 
2 324 GLU n 
2 325 ILE n 
2 326 LEU n 
2 327 LYS n 
2 328 GLU n 
2 329 PRO n 
2 330 VAL n 
2 331 HIS n 
2 332 GLY n 
2 333 VAL n 
2 334 TYR n 
2 335 TYR n 
2 336 ASP n 
2 337 PRO n 
2 338 SER n 
2 339 LYS n 
2 340 ASP n 
2 341 LEU n 
2 342 ILE n 
2 343 ALA n 
2 344 GLU n 
2 345 ILE n 
2 346 GLN n 
2 347 LYS n 
2 348 GLN n 
2 349 GLY n 
2 350 GLN n 
2 351 GLY n 
2 352 GLN n 
2 353 TRP n 
2 354 THR n 
2 355 TYR n 
2 356 GLN n 
2 357 ILE n 
2 358 TYR n 
2 359 GLN n 
2 360 GLU n 
2 361 PRO n 
2 362 PHE n 
2 363 LYS n 
2 364 ASN n 
2 365 LEU n 
2 366 LYS n 
2 367 THR n 
2 368 GLY n 
2 369 LYS n 
2 370 TYR n 
2 371 ALA n 
2 372 ARG n 
2 373 MET n 
2 374 ARG n 
2 375 GLY n 
2 376 ALA n 
2 377 HIS n 
2 378 THR n 
2 379 ASN n 
2 380 ASP n 
2 381 VAL n 
2 382 LYS n 
2 383 GLN n 
2 384 LEU n 
2 385 THR n 
2 386 GLU n 
2 387 ALA n 
2 388 VAL n 
2 389 GLN n 
2 390 LYS n 
2 391 ILE n 
2 392 THR n 
2 393 THR n 
2 394 GLU n 
2 395 SER n 
2 396 ILE n 
2 397 VAL n 
2 398 ILE n 
2 399 TRP n 
2 400 GLY n 
2 401 LYS n 
2 402 THR n 
2 403 PRO n 
2 404 LYS n 
2 405 PHE n 
2 406 LYS n 
2 407 LEU n 
2 408 PRO n 
2 409 ILE n 
2 410 GLN n 
2 411 LYS n 
2 412 GLU n 
2 413 THR n 
2 414 TRP n 
2 415 GLU n 
2 416 THR n 
2 417 TRP n 
2 418 TRP n 
2 419 THR n 
2 420 GLU n 
2 421 TYR n 
2 422 TRP n 
2 423 GLN n 
2 424 ALA n 
2 425 THR n 
2 426 TRP n 
2 427 ILE n 
2 428 PRO n 
2 429 GLU n 
2 430 TRP n 
2 431 GLU n 
2 432 PHE n 
2 433 VAL n 
2 434 ASN n 
2 435 THR n 
2 436 PRO n 
2 437 PRO n 
2 438 LEU n 
2 439 VAL n 
2 440 LYS n 
2 441 LEU n 
2 442 TRP n 
2 443 TYR n 
2 444 GLN n 
3 1   DA  n 
3 2   DT  n 
3 3   DG  n 
3 4   DA  n 
3 5   DA  n 
3 6   DC  n 
3 7   DG  n 
3 8   DG  n 
3 9   DC  n 
3 10  DG  n 
3 11  DC  n 
3 12  DC  n 
3 13  DC  n 
3 14  DG  n 
3 15  DA  n 
3 16  DA  n 
3 17  DC  n 
3 18  DA  n 
3 19  DG  n 
3 20  DG  n 
3 21  DG  n 
3 22  DA  n 
3 23  DC  n 
3 24  DT  n 
3 25  DG  n 
3 26  DT  n 
3 27  DG  n 
4 1   DA  n 
4 2   DC  n 
4 3   DA  n 
4 4   DG  n 
4 5   DT  n 
4 6   DC  n 
4 7   DC  n 
4 8   DC  n 
4 9   DT  n 
4 10  DG  n 
4 11  DT  n 
4 12  DT  n 
4 13  DC  n 
4 14  DG  n 
4 15  DG  n 
4 16  DG  n 
4 17  DC  n 
4 18  DG  n 
4 19  DC  n 
4 20  DC  n 
4 21  DDG n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 556 HIV-1 ? gag-pol ? 'isolate BH10' ? ? ? ? 
'Human immunodeficiency virus type 1 group M subtype B (isolate BH10)' 11678 ? ? ? ? ? ? ? ? 'Escherichia coli' 469008 ? ? ? ? ? ? 
'BL21(DE3)' 'BL21 CodonPlus RIL' ? ? ? ? ? ? PLASMID ? ? ? 'pCDF-2 Ek/LIC' ? ? 
2 1 sample 'Biological sequence' 1 444 HIV-1 ? gag-pol ? 'isolate BH10' ? ? ? ? 
'Human immunodeficiency virus type 1 group M subtype B (isolate BH10)' 11678 ? ? ? ? ? ? ? ? 'Escherichia coli' 469008 ? ? ? ? ? ? 
'BL21(DE3)' 'BL21 CodonPlus RIL' ? ? ? ? ? ? PLASMID ? ? ? 'pCDF-2 Ek/LIC' ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
3 1 sample 1 27 'synthetic construct' ? 32630 ? 
4 1 sample 1 21 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP POL_HV1B1 P03366 ? 1 
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
;
600 
2 UNP POL_HV1B1 P03366 ? 2 
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQ
;
600 
3 PDB 6AN8      6AN8   ? 3 ? 1   
4 PDB 6AN8      6AN8   ? 4 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6AN8 A 3  ? 556 ? P03366 600 ? 1153 ? 1   554 
2 2 6AN8 B 17 ? 444 ? P03366 600 ? 1027 ? 1   428 
3 3 6AN8 T 1  ? 27  ? 6AN8   701 ? 727  ? 701 727 
4 4 6AN8 P 1  ? 21  ? 6AN8   802 ? 822  ? 802 822 
5 1 6AN8 C 3  ? 556 ? P03366 600 ? 1153 ? 1   554 
6 2 6AN8 D 17 ? 444 ? P03366 600 ? 1027 ? 1   428 
7 3 6AN8 E 1  ? 27  ? 6AN8   701 ? 727  ? 701 727 
8 4 6AN8 F 1  ? 21  ? 6AN8   802 ? 822  ? 802 822 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6AN8 MET A 1   ? UNP P03366 ?   ?   'initiating methionine' -1  1  
1 6AN8 VAL A 2   ? UNP P03366 ?   ?   'expression tag'        0   2  
1 6AN8 CYS A 65  ? UNP P03366 ILE 662 'engineered mutation'   63  3  
1 6AN8 SER A 282 ? UNP P03366 CYS 879 'engineered mutation'   280 4  
2 6AN8 MET B 1   ? UNP P03366 ?   ?   'initiating methionine' -15 5  
2 6AN8 ALA B 2   ? UNP P03366 ?   ?   'expression tag'        -14 6  
2 6AN8 HIS B 3   ? UNP P03366 ?   ?   'expression tag'        -13 7  
2 6AN8 HIS B 4   ? UNP P03366 ?   ?   'expression tag'        -12 8  
2 6AN8 HIS B 5   ? UNP P03366 ?   ?   'expression tag'        -11 9  
2 6AN8 HIS B 6   ? UNP P03366 ?   ?   'expression tag'        -10 10 
2 6AN8 HIS B 7   ? UNP P03366 ?   ?   'expression tag'        -9  11 
2 6AN8 HIS B 8   ? UNP P03366 ?   ?   'expression tag'        -8  12 
2 6AN8 ALA B 9   ? UNP P03366 ?   ?   'expression tag'        -7  13 
2 6AN8 LEU B 10  ? UNP P03366 ?   ?   'expression tag'        -6  14 
2 6AN8 GLU B 11  ? UNP P03366 ?   ?   'expression tag'        -5  15 
2 6AN8 VAL B 12  ? UNP P03366 ?   ?   'expression tag'        -4  16 
2 6AN8 LEU B 13  ? UNP P03366 ?   ?   'expression tag'        -3  17 
2 6AN8 PHE B 14  ? UNP P03366 ?   ?   'expression tag'        -2  18 
2 6AN8 GLN B 15  ? UNP P03366 ?   ?   'expression tag'        -1  19 
2 6AN8 GLY B 16  ? UNP P03366 ?   ?   'expression tag'        0   20 
2 6AN8 SER B 296 ? UNP P03366 CYS 879 'engineered mutation'   280 21 
5 6AN8 MET C 1   ? UNP P03366 ?   ?   'initiating methionine' -1  22 
5 6AN8 VAL C 2   ? UNP P03366 ?   ?   'expression tag'        0   23 
5 6AN8 CYS C 65  ? UNP P03366 ILE 662 'engineered mutation'   63  24 
5 6AN8 SER C 282 ? UNP P03366 CYS 879 'engineered mutation'   280 25 
6 6AN8 MET D 1   ? UNP P03366 ?   ?   'initiating methionine' -15 26 
6 6AN8 ALA D 2   ? UNP P03366 ?   ?   'expression tag'        -14 27 
6 6AN8 HIS D 3   ? UNP P03366 ?   ?   'expression tag'        -13 28 
6 6AN8 HIS D 4   ? UNP P03366 ?   ?   'expression tag'        -12 29 
6 6AN8 HIS D 5   ? UNP P03366 ?   ?   'expression tag'        -11 30 
6 6AN8 HIS D 6   ? UNP P03366 ?   ?   'expression tag'        -10 31 
6 6AN8 HIS D 7   ? UNP P03366 ?   ?   'expression tag'        -9  32 
6 6AN8 HIS D 8   ? UNP P03366 ?   ?   'expression tag'        -8  33 
6 6AN8 ALA D 9   ? UNP P03366 ?   ?   'expression tag'        -7  34 
6 6AN8 LEU D 10  ? UNP P03366 ?   ?   'expression tag'        -6  35 
6 6AN8 GLU D 11  ? UNP P03366 ?   ?   'expression tag'        -5  36 
6 6AN8 VAL D 12  ? UNP P03366 ?   ?   'expression tag'        -4  37 
6 6AN8 LEU D 13  ? UNP P03366 ?   ?   'expression tag'        -3  38 
6 6AN8 PHE D 14  ? UNP P03366 ?   ?   'expression tag'        -2  39 
6 6AN8 GLN D 15  ? UNP P03366 ?   ?   'expression tag'        -1  40 
6 6AN8 GLY D 16  ? UNP P03366 ?   ?   'expression tag'        0   41 
6 6AN8 SER D 296 ? UNP P03366 CYS 879 'engineered mutation'   280 42 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                               ?                               'C3 H7 N O2' 
89.093  
ARG 'L-peptide linking' y ARGININE                                              ?                               'C6 H15 N4 O2 1' 
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                            ?                               'C4 H8 N2 O3' 
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                       ?                               'C4 H7 N O4' 
133.103 
CYS 'L-peptide linking' y CYSTEINE                                              ?                               'C3 H7 N O2 S' 
121.158 
D4T non-polymer         . 
;2',3'-DEHYDRO-2',3'-DEOXY-THYMIDINE 5'-TRIPHOSPHATE
;
?                               'C10 H15 N2 O13 P3' 464.153 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                  ?                               'C10 H14 N5 O6 P' 
331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                   ?                               'C9 H14 N3 O7 P' 
307.197 
DDG 'DNA linking'       n "2',3'-DIDEOXY-GUANOSINE-5'-MONOPHOSPHATE"            ?                               'C10 H14 N5 O6 P' 
331.222 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                  ?                               'C10 H14 N5 O7 P' 
347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                          ?                               'C10 H15 N2 O8 P' 
322.208 
GLN 'L-peptide linking' y GLUTAMINE                                             ?                               'C5 H10 N2 O3' 
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                       ?                               'C5 H9 N O4' 
147.129 
GLY 'peptide linking'   y GLYCINE                                               ?                               'C2 H5 N O2' 
75.067  
GOL non-polymer         . GLYCEROL                                              'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094  
HIS 'L-peptide linking' y HISTIDINE                                             ?                               'C6 H10 N3 O2 1' 
156.162 
HOH non-polymer         . WATER                                                 ?                               'H2 O' 18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                            ?                               'C6 H13 N O2' 
131.173 
LEU 'L-peptide linking' y LEUCINE                                               ?                               'C6 H13 N O2' 
131.173 
LYS 'L-peptide linking' y LYSINE                                                ?                               'C6 H15 N2 O2 1' 
147.195 
MET 'L-peptide linking' y METHIONINE                                            ?                               'C5 H11 N O2 S' 
149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                       ?                               'Mg 2' 24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                         ?                               'C9 H11 N O2' 
165.189 
PRO 'L-peptide linking' y PROLINE                                               ?                               'C5 H9 N O2' 
115.130 
SER 'L-peptide linking' y SERINE                                                ?                               'C3 H7 N O3' 
105.093 
THR 'L-peptide linking' y THREONINE                                             ?                               'C4 H9 N O3' 
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                            ?                               'C11 H12 N2 O2' 
204.225 
TYR 'L-peptide linking' y TYROSINE                                              ?                               'C9 H11 N O3' 
181.189 
VAL 'L-peptide linking' y VALINE                                                ?                               'C5 H11 N O2' 
117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6AN8 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.14 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         60.88 
_exptl_crystal.description                 PARALLELOGRAMS 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              9.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'PEG 8000, NaCl, CHES (N-Cyclohexyl-2-aminoethanesulfonic acid), TRIS, MgCl2, d4T triphosphate' 
_exptl_crystal_grow.pdbx_pH_range   '9.5 - 10.5' 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      
;White beam collimating mirror, horizontally focusing monochromator using single bent triangular Si(111) crystal, vertically focusing Rh-coated Si mirror
;
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 270' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2010-07-10 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9177 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'CHESS BEAMLINE F1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9177 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   F1 
_diffrn_source.pdbx_synchrotron_site       CHESS 
# 
_reflns.B_iso_Wilson_estimate            56.630 
_reflns.entry_id                         6AN8 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.5960 
_reflns.d_resolution_low                 50.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       97706 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       -1 
_reflns.percent_possible_obs             97.900 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.400 
_reflns.pdbx_Rmerge_I_obs                0.079 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            21.5 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 1.067 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.600 2.690  ? 2.1  ? ? ? ? 9516 96.100 ? ? ? ? 0.662 ? ? ? ? ? ? ? ? 5.200 ? 0.945 ? ? ? ? ? 1  1 ? ? 
2.690 2.800  ? 2.7  ? ? ? ? 9596 96.200 ? ? ? ? 0.541 ? ? ? ? ? ? ? ? 5.400 ? 0.988 ? ? ? ? ? 2  1 ? ? 
2.800 2.930  ? 3.7  ? ? ? ? 9602 96.500 ? ? ? ? 0.417 ? ? ? ? ? ? ? ? 5.700 ? 1.023 ? ? ? ? ? 3  1 ? ? 
2.930 3.080  ? 5.4  ? ? ? ? 9643 96.900 ? ? ? ? 0.305 ? ? ? ? ? ? ? ? 5.900 ? 1.075 ? ? ? ? ? 4  1 ? ? 
3.080 3.280  ? 8.8  ? ? ? ? 9710 97.700 ? ? ? ? 0.203 ? ? ? ? ? ? ? ? 6.300 ? 1.140 ? ? ? ? ? 5  1 ? ? 
3.280 3.530  ? 15.1 ? ? ? ? 9817 98.500 ? ? ? ? 0.128 ? ? ? ? ? ? ? ? 6.700 ? 1.188 ? ? ? ? ? 6  1 ? ? 
3.530 3.880  ? 23.4 ? ? ? ? 9905 99.300 ? ? ? ? 0.086 ? ? ? ? ? ? ? ? 7.000 ? 1.150 ? ? ? ? ? 7  1 ? ? 
3.880 4.450  ? 30.7 ? ? ? ? 9985 99.700 ? ? ? ? 0.061 ? ? ? ? ? ? ? ? 7.300 ? 0.989 ? ? ? ? ? 8  1 ? ? 
4.450 5.600  ? 35.5 ? ? ? ? 9998 99.800 ? ? ? ? 0.050 ? ? ? ? ? ? ? ? 7.400 ? 0.923 ? ? ? ? ? 9  1 ? ? 
5.600 50.000 ? 49.8 ? ? ? ? 9934 97.900 ? ? ? ? 0.039 ? ? ? ? ? ? ? ? 7.300 ? 1.204 ? ? ? ? ? 10 1 ? ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                281.250 
_refine.B_iso_mean                               89.8485 
_refine.B_iso_min                                22.320 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6AN8 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.5960 
_refine.ls_d_res_low                             43.3590 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     97681 
_refine.ls_number_reflns_R_free                  1728 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    97.7800 
_refine.ls_percent_reflns_R_free                 1.7700 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1783 
_refine.ls_R_factor_R_free                       0.2166 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1777 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.380 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDBID 6AMO' 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 22.8600 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.3400 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.5960 
_refine_hist.d_res_low                        43.3590 
_refine_hist.pdbx_number_atoms_ligand         138 
_refine_hist.number_atoms_solvent             695 
_refine_hist.number_atoms_total               18327 
_refine_hist.pdbx_number_residues_total       2008 
_refine_hist.pdbx_B_iso_mean_ligand           92.38 
_refine_hist.pdbx_B_iso_mean_solvent          66.48 
_refine_hist.pdbx_number_atoms_protein        15778 
_refine_hist.pdbx_number_atoms_nucleic_acid   1716 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.006  ? 18275 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.419  ? 25134 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.039  ? 2722  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.003  ? 2859  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 13.139 ? 10629 ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.5957 2.6721  7900 . 138 7762 95.0000  . . . 0.3144 0.0000 0.2874 . . . . . . 12 . . . 
'X-RAY DIFFRACTION' 2.6721 2.7583  7964 . 139 7825 96.0000  . . . 0.2973 0.0000 0.2647 . . . . . . 12 . . . 
'X-RAY DIFFRACTION' 2.7583 2.8569  7962 . 147 7815 96.0000  . . . 0.2965 0.0000 0.2407 . . . . . . 12 . . . 
'X-RAY DIFFRACTION' 2.8569 2.9713  8029 . 140 7889 97.0000  . . . 0.2799 0.0000 0.2309 . . . . . . 12 . . . 
'X-RAY DIFFRACTION' 2.9713 3.1064  8079 . 134 7945 97.0000  . . . 0.2877 0.0000 0.2262 . . . . . . 12 . . . 
'X-RAY DIFFRACTION' 3.1064 3.2702  8091 . 146 7945 98.0000  . . . 0.2634 0.0000 0.2082 . . . . . . 12 . . . 
'X-RAY DIFFRACTION' 3.2702 3.4750  8180 . 144 8036 98.0000  . . . 0.2525 0.0000 0.1918 . . . . . . 12 . . . 
'X-RAY DIFFRACTION' 3.4750 3.7431  8260 . 147 8113 99.0000  . . . 0.2020 0.0000 0.1736 . . . . . . 12 . . . 
'X-RAY DIFFRACTION' 3.7431 4.1196  8277 . 148 8129 100.0000 . . . 0.2048 0.0000 0.1564 . . . . . . 12 . . . 
'X-RAY DIFFRACTION' 4.1196 4.7151  8331 . 147 8184 100.0000 . . . 0.1538 0.0000 0.1423 . . . . . . 12 . . . 
'X-RAY DIFFRACTION' 4.7151 5.9381  8346 . 150 8196 100.0000 . . . 0.2055 0.0000 0.1546 . . . . . . 12 . . . 
'X-RAY DIFFRACTION' 5.9381 43.3647 8262 . 148 8114 98.0000  . . . 0.1898 0.0000 0.1577 . . . . . . 12 . . . 
# 
_struct.entry_id                     6AN8 
_struct.title                        
'STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE (RT) TERNARY COMPLEX WITH A DOUBLE STRANDED DNA AND AN INCOMING D4TTP AT PH 8.0' 
_struct.pdbx_descriptor              'Gag-Pol polyprotein/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6AN8 
_struct_keywords.text            'RT, DNA, CROSSLINK, N SITE COMPLEX, PYROPHOSPHOROLYSIS, P51, P66, TRANSFERASE-DNA COMPLEX' 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 3 ? 
D  N N 4 ? 
E  N N 1 ? 
F  N N 2 ? 
G  N N 3 ? 
H  N N 4 ? 
I  N N 5 ? 
J  N N 5 ? 
K  N N 6 ? 
L  N N 7 ? 
M  N N 7 ? 
N  N N 7 ? 
O  N N 7 ? 
P  N N 7 ? 
Q  N N 7 ? 
R  N N 7 ? 
S  N N 5 ? 
T  N N 5 ? 
U  N N 6 ? 
V  N N 7 ? 
W  N N 7 ? 
X  N N 7 ? 
Y  N N 7 ? 
Z  N N 7 ? 
AA N N 7 ? 
BA N N 8 ? 
CA N N 8 ? 
DA N N 8 ? 
EA N N 8 ? 
FA N N 8 ? 
GA N N 8 ? 
HA N N 8 ? 
IA N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 THR A 29  ? LYS A 34  ? THR A 27  LYS A 32  1 ? 6  
HELX_P HELX_P2  AA2 LEU A 36  ? GLU A 46  ? LEU A 34  GLU A 44  1 ? 11 
HELX_P HELX_P3  AA3 PHE A 79  ? THR A 86  ? PHE A 77  THR A 84  1 ? 8  
HELX_P HELX_P4  AA4 HIS A 98  ? LEU A 102 ? HIS A 96  LEU A 100 5 ? 5  
HELX_P HELX_P5  AA5 ALA A 116 ? VAL A 120 ? ALA A 114 VAL A 118 5 ? 5  
HELX_P HELX_P6  AA6 ASP A 123 ? TYR A 129 ? ASP A 121 TYR A 127 5 ? 7  
HELX_P HELX_P7  AA7 GLY A 157 ? ASN A 177 ? GLY A 155 ASN A 175 1 ? 21 
HELX_P HELX_P8  AA8 GLU A 196 ? ARG A 213 ? GLU A 194 ARG A 211 1 ? 18 
HELX_P HELX_P9  AA9 THR A 255 ? SER A 270 ? THR A 253 SER A 268 1 ? 16 
HELX_P HELX_P10 AB1 VAL A 278 ? LYS A 283 ? VAL A 276 LYS A 281 1 ? 6  
HELX_P HELX_P11 AB2 LEU A 284 ? ARG A 286 ? LEU A 282 ARG A 284 5 ? 3  
HELX_P HELX_P12 AB3 THR A 298 ? LEU A 312 ? THR A 296 LEU A 310 1 ? 15 
HELX_P HELX_P13 AB4 ASN A 365 ? TRP A 385 ? ASN A 363 TRP A 383 1 ? 21 
HELX_P HELX_P14 AB5 GLN A 396 ? TYR A 407 ? GLN A 394 TYR A 405 1 ? 12 
HELX_P HELX_P15 AB6 THR A 475 ? ASP A 490 ? THR A 473 ASP A 488 1 ? 16 
HELX_P HELX_P16 AB7 SER A 501 ? ALA A 510 ? SER A 499 ALA A 508 1 ? 10 
HELX_P HELX_P17 AB8 SER A 517 ? LYS A 530 ? SER A 515 LYS A 528 1 ? 14 
HELX_P HELX_P18 AB9 GLY A 546 ? SER A 555 ? GLY A 544 SER A 553 1 ? 10 
HELX_P HELX_P19 AC1 THR B 43  ? GLU B 60  ? THR B 27  GLU B 44  1 ? 18 
HELX_P HELX_P20 AC2 PHE B 93  ? LYS B 98  ? PHE B 77  LYS B 82  1 ? 6  
HELX_P HELX_P21 AC3 GLY B 115 ? LYS B 119 ? GLY B 99  LYS B 103 5 ? 5  
HELX_P HELX_P22 AC4 GLY B 128 ? VAL B 134 ? GLY B 112 VAL B 118 5 ? 7  
HELX_P HELX_P23 AC5 ASP B 137 ? ALA B 145 ? ASP B 121 ALA B 129 5 ? 9  
HELX_P HELX_P24 AC6 SER B 150 ? GLU B 154 ? SER B 134 GLU B 138 5 ? 5  
HELX_P HELX_P25 AC7 LYS B 170 ? ASN B 191 ? LYS B 154 ASN B 175 1 ? 22 
HELX_P HELX_P26 AC8 GLU B 210 ? ARG B 227 ? GLU B 194 ARG B 211 1 ? 18 
HELX_P HELX_P27 AC9 HIS B 251 ? TRP B 255 ? HIS B 235 TRP B 239 5 ? 5  
HELX_P HELX_P28 AD1 THR B 269 ? SER B 284 ? THR B 253 SER B 268 1 ? 16 
HELX_P HELX_P29 AD2 VAL B 292 ? LEU B 298 ? VAL B 276 LEU B 282 1 ? 7  
HELX_P HELX_P30 AD3 THR B 312 ? GLU B 328 ? THR B 296 GLU B 312 1 ? 17 
HELX_P HELX_P31 AD4 ASN B 379 ? TRP B 399 ? ASN B 363 TRP B 383 1 ? 21 
HELX_P HELX_P32 AD5 GLN B 410 ? TRP B 422 ? GLN B 394 TRP B 406 1 ? 13 
HELX_P HELX_P33 AD6 THR E 29  ? GLU E 46  ? THR C 27  GLU C 44  1 ? 18 
HELX_P HELX_P34 AD7 PHE E 79  ? THR E 86  ? PHE C 77  THR C 84  1 ? 8  
HELX_P HELX_P35 AD8 HIS E 98  ? LEU E 102 ? HIS C 96  LEU C 100 5 ? 5  
HELX_P HELX_P36 AD9 ALA E 116 ? VAL E 120 ? ALA C 114 VAL C 118 5 ? 5  
HELX_P HELX_P37 AE1 ASP E 123 ? TYR E 129 ? ASP C 121 TYR C 127 5 ? 7  
HELX_P HELX_P38 AE2 GLY E 157 ? ASN E 177 ? GLY C 155 ASN C 175 1 ? 21 
HELX_P HELX_P39 AE3 GLU E 196 ? ARG E 213 ? GLU C 194 ARG C 211 1 ? 18 
HELX_P HELX_P40 AE4 VAL E 256 ? SER E 270 ? VAL C 254 SER C 268 1 ? 15 
HELX_P HELX_P41 AE5 VAL E 278 ? LEU E 284 ? VAL C 276 LEU C 282 1 ? 7  
HELX_P HELX_P42 AE6 THR E 298 ? LEU E 312 ? THR C 296 LEU C 310 1 ? 15 
HELX_P HELX_P43 AE7 ASN E 365 ? TRP E 385 ? ASN C 363 TRP C 383 1 ? 21 
HELX_P HELX_P44 AE8 GLN E 396 ? TYR E 407 ? GLN C 394 TYR C 405 1 ? 12 
HELX_P HELX_P45 AE9 THR E 475 ? ASP E 490 ? THR C 473 ASP C 488 1 ? 16 
HELX_P HELX_P46 AF1 SER E 501 ? ALA E 510 ? SER C 499 ALA C 508 1 ? 10 
HELX_P HELX_P47 AF2 SER E 517 ? LYS E 530 ? SER C 515 LYS C 528 1 ? 14 
HELX_P HELX_P48 AF3 GLY E 545 ? SER E 555 ? GLY C 543 SER C 553 1 ? 11 
HELX_P HELX_P49 AF4 THR F 43  ? GLU F 60  ? THR D 27  GLU D 44  1 ? 18 
HELX_P HELX_P50 AF5 PHE F 93  ? LYS F 98  ? PHE D 77  LYS D 82  1 ? 6  
HELX_P HELX_P51 AF6 THR F 100 ? GLU F 105 ? THR D 84  GLU D 89  1 ? 6  
HELX_P HELX_P52 AF7 GLY F 115 ? LYS F 119 ? GLY D 99  LYS D 103 5 ? 5  
HELX_P HELX_P53 AF8 GLY F 128 ? VAL F 134 ? GLY D 112 VAL D 118 5 ? 7  
HELX_P HELX_P54 AF9 ASP F 137 ? ALA F 145 ? ASP D 121 ALA D 129 5 ? 9  
HELX_P HELX_P55 AG1 SER F 150 ? GLU F 154 ? SER D 134 GLU D 138 5 ? 5  
HELX_P HELX_P56 AG2 LYS F 170 ? PHE F 176 ? LYS D 154 PHE D 160 1 ? 7  
HELX_P HELX_P57 AG3 PHE F 176 ? LEU F 184 ? PHE D 160 LEU D 168 1 ? 9  
HELX_P HELX_P58 AG4 LEU F 184 ? ASN F 191 ? LEU D 168 ASN D 175 1 ? 8  
HELX_P HELX_P59 AG5 GLU F 210 ? ARG F 227 ? GLU D 194 ARG D 211 1 ? 18 
HELX_P HELX_P60 AG6 HIS F 251 ? TRP F 255 ? HIS D 235 TRP D 239 5 ? 5  
HELX_P HELX_P61 AG7 VAL F 270 ? SER F 284 ? VAL D 254 SER D 268 1 ? 15 
HELX_P HELX_P62 AG8 VAL F 292 ? LEU F 298 ? VAL D 276 LEU D 282 1 ? 7  
HELX_P HELX_P63 AG9 THR F 312 ? GLU F 328 ? THR D 296 GLU D 312 1 ? 17 
HELX_P HELX_P64 AH1 ASN F 379 ? TRP F 399 ? ASN D 363 TRP D 383 1 ? 21 
HELX_P HELX_P65 AH2 GLN F 410 ? TRP F 422 ? GLN D 394 TRP D 406 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ?    ? A ASP 112 OD1   ? ? ? 1_555 I  MG  .  MG  ? ? A ASP 110 A MG  601 1_555 ? ? ? ? ? ? ?            2.087 ? 
metalc2   metalc ?    ? A VAL 113 O     ? ? ? 1_555 I  MG  .  MG  ? ? A VAL 111 A MG  601 1_555 ? ? ? ? ? ? ?            2.264 ? 
metalc3   metalc ?    ? A ASP 187 OD2   ? ? ? 1_555 I  MG  .  MG  ? ? A ASP 185 A MG  601 1_555 ? ? ? ? ? ? ?            2.041 ? 
metalc4   metalc ?    ? A ASP 445 OD1   ? ? ? 1_555 J  MG  .  MG  ? ? A ASP 443 A MG  602 1_555 ? ? ? ? ? ? ?            2.145 ? 
metalc5   metalc ?    ? A GLU 480 OE2   ? ? ? 1_555 J  MG  .  MG  ? ? A GLU 478 A MG  602 1_555 ? ? ? ? ? ? ?            2.363 ? 
metalc6   metalc ?    ? A ASP 500 OD1   ? ? ? 1_555 J  MG  .  MG  ? ? A ASP 498 A MG  602 1_555 ? ? ? ? ? ? ?            2.170 ? 
metalc7   metalc ?    ? A ASP 500 OD2   ? ? ? 1_555 J  MG  .  MG  ? ? A ASP 498 A MG  602 1_555 ? ? ? ? ? ? ?            2.320 ? 
covale1   covale both ? D DC  20  "O3'" ? ? ? 1_555 D  DDG 21 P   ? ? P DC  821 P DDG 822 1_555 ? ? ? ? ? ? ?            1.610 ? 
metalc8   metalc ?    ? E ASP 112 OD1   ? ? ? 1_555 S  MG  .  MG  ? ? C ASP 110 C MG  601 1_555 ? ? ? ? ? ? ?            2.099 ? 
metalc9   metalc ?    ? E VAL 113 O     ? ? ? 1_555 S  MG  .  MG  ? ? C VAL 111 C MG  601 1_555 ? ? ? ? ? ? ?            2.093 ? 
metalc10  metalc ?    ? E ASP 187 OD2   ? ? ? 1_555 S  MG  .  MG  ? ? C ASP 185 C MG  601 1_555 ? ? ? ? ? ? ?            2.061 ? 
metalc11  metalc ?    ? E ASP 445 OD1   ? ? ? 1_555 T  MG  .  MG  ? ? C ASP 443 C MG  602 1_555 ? ? ? ? ? ? ?            2.140 ? 
metalc12  metalc ?    ? E GLU 480 OE2   ? ? ? 1_555 T  MG  .  MG  ? ? C GLU 478 C MG  602 1_555 ? ? ? ? ? ? ?            2.258 ? 
metalc13  metalc ?    ? E ASP 500 OD1   ? ? ? 1_555 T  MG  .  MG  ? ? C ASP 498 C MG  602 1_555 ? ? ? ? ? ? ?            2.158 ? 
metalc14  metalc ?    ? E ASP 500 OD2   ? ? ? 1_555 T  MG  .  MG  ? ? C ASP 498 C MG  602 1_555 ? ? ? ? ? ? ?            2.423 ? 
covale2   covale both ? H DC  20  "O3'" ? ? ? 1_555 H  DDG 21 P   ? ? F DC  821 F DDG 822 1_555 ? ? ? ? ? ? ?            1.610 ? 
metalc15  metalc ?    ? I MG  .   MG    ? ? ? 1_555 K  D4T .  O2C ? ? A MG  601 A D4T 603 1_555 ? ? ? ? ? ? ?            2.107 ? 
metalc16  metalc ?    ? I MG  .   MG    ? ? ? 1_555 K  D4T .  O2B ? ? A MG  601 A D4T 603 1_555 ? ? ? ? ? ? ?            2.092 ? 
metalc17  metalc ?    ? I MG  .   MG    ? ? ? 1_555 K  D4T .  O1A ? ? A MG  601 A D4T 603 1_555 ? ? ? ? ? ? ?            2.400 ? 
metalc18  metalc ?    ? J MG  .   MG    ? ? ? 1_555 BA HOH .  O   ? ? A MG  602 A HOH 746 1_555 ? ? ? ? ? ? ?            2.957 ? 
metalc19  metalc ?    ? J MG  .   MG    ? ? ? 1_555 BA HOH .  O   ? ? A MG  602 A HOH 788 1_555 ? ? ? ? ? ? ?            2.484 ? 
metalc20  metalc ?    ? S MG  .   MG    ? ? ? 1_555 U  D4T .  O2C ? ? C MG  601 C D4T 603 1_555 ? ? ? ? ? ? ?            2.144 ? 
metalc21  metalc ?    ? S MG  .   MG    ? ? ? 1_555 U  D4T .  O2B ? ? C MG  601 C D4T 603 1_555 ? ? ? ? ? ? ?            2.211 ? 
metalc22  metalc ?    ? S MG  .   MG    ? ? ? 1_555 U  D4T .  O1A ? ? C MG  601 C D4T 603 1_555 ? ? ? ? ? ? ?            2.265 ? 
metalc23  metalc ?    ? T MG  .   MG    ? ? ? 1_555 FA HOH .  O   ? ? C MG  602 C HOH 732 1_555 ? ? ? ? ? ? ?            2.549 ? 
metalc24  metalc ?    ? T MG  .   MG    ? ? ? 1_555 FA HOH .  O   ? ? C MG  602 C HOH 758 1_555 ? ? ? ? ? ? ?            2.242 ? 
hydrog1   hydrog ?    ? G DC  6   N3    ? ? ? 1_555 H  DDG 21 N1  ? ? E DC  706 F DDG 822 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2   hydrog ?    ? G DC  6   N4    ? ? ? 1_555 H  DDG 21 O6  ? ? E DC  706 F DDG 822 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3   hydrog ?    ? G DC  6   O2    ? ? ? 1_555 H  DDG 21 N2  ? ? E DC  706 F DDG 822 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4   hydrog ?    ? G DG  7   N1    ? ? ? 1_555 H  DC  20 N3  ? ? E DG  707 F DC  821 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5   hydrog ?    ? G DG  7   N2    ? ? ? 1_555 H  DC  20 O2  ? ? E DG  707 F DC  821 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6   hydrog ?    ? G DG  7   O6    ? ? ? 1_555 H  DC  20 N4  ? ? E DG  707 F DC  821 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7   hydrog ?    ? G DG  8   N1    ? ? ? 1_555 H  DC  19 N3  ? ? E DG  708 F DC  820 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8   hydrog ?    ? G DG  8   N2    ? ? ? 1_555 H  DC  19 O2  ? ? E DG  708 F DC  820 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9   hydrog ?    ? G DG  8   O6    ? ? ? 1_555 H  DC  19 N4  ? ? E DG  708 F DC  820 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10  hydrog ?    ? G DC  9   N3    ? ? ? 1_555 H  DG  18 N1  ? ? E DC  709 F DG  819 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11  hydrog ?    ? G DC  9   N4    ? ? ? 1_555 H  DG  18 O6  ? ? E DC  709 F DG  819 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12  hydrog ?    ? G DC  9   O2    ? ? ? 1_555 H  DG  18 N2  ? ? E DC  709 F DG  819 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13  hydrog ?    ? G DG  10  N1    ? ? ? 1_555 H  DC  17 N3  ? ? E DG  710 F DC  818 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14  hydrog ?    ? G DG  10  N2    ? ? ? 1_555 H  DC  17 O2  ? ? E DG  710 F DC  818 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15  hydrog ?    ? G DG  10  O6    ? ? ? 1_555 H  DC  17 N4  ? ? E DG  710 F DC  818 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16  hydrog ?    ? G DC  11  N3    ? ? ? 1_555 H  DG  16 N1  ? ? E DC  711 F DG  817 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17  hydrog ?    ? G DC  11  N4    ? ? ? 1_555 H  DG  16 O6  ? ? E DC  711 F DG  817 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18  hydrog ?    ? G DC  11  O2    ? ? ? 1_555 H  DG  16 N2  ? ? E DC  711 F DG  817 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19  hydrog ?    ? G DC  12  N3    ? ? ? 1_555 H  DG  15 N1  ? ? E DC  712 F DG  816 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20  hydrog ?    ? G DC  12  N4    ? ? ? 1_555 H  DG  15 O6  ? ? E DC  712 F DG  816 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21  hydrog ?    ? G DC  12  O2    ? ? ? 1_555 H  DG  15 N2  ? ? E DC  712 F DG  816 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22  hydrog ?    ? G DC  13  N3    ? ? ? 1_555 H  DG  14 N1  ? ? E DC  713 F DG  815 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23  hydrog ?    ? G DC  13  N4    ? ? ? 1_555 H  DG  14 O6  ? ? E DC  713 F DG  815 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24  hydrog ?    ? G DC  13  O2    ? ? ? 1_555 H  DG  14 N2  ? ? E DC  713 F DG  815 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25  hydrog ?    ? G DG  14  N1    ? ? ? 1_555 H  DC  13 N3  ? ? E DG  714 F DC  814 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26  hydrog ?    ? G DG  14  N2    ? ? ? 1_555 H  DC  13 O2  ? ? E DG  714 F DC  814 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27  hydrog ?    ? G DG  14  O6    ? ? ? 1_555 H  DC  13 N4  ? ? E DG  714 F DC  814 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28  hydrog ?    ? G DA  15  N1    ? ? ? 1_555 H  DT  12 N3  ? ? E DA  715 F DT  813 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29  hydrog ?    ? G DA  15  N6    ? ? ? 1_555 H  DT  12 O4  ? ? E DA  715 F DT  813 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30  hydrog ?    ? G DA  16  N1    ? ? ? 1_555 H  DT  11 N3  ? ? E DA  716 F DT  812 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31  hydrog ?    ? G DA  16  N6    ? ? ? 1_555 H  DT  11 O4  ? ? E DA  716 F DT  812 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32  hydrog ?    ? G DC  17  N3    ? ? ? 1_555 H  DG  10 N1  ? ? E DC  717 F DG  811 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33  hydrog ?    ? G DC  17  N4    ? ? ? 1_555 H  DG  10 O6  ? ? E DC  717 F DG  811 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34  hydrog ?    ? G DC  17  O2    ? ? ? 1_555 H  DG  10 N2  ? ? E DC  717 F DG  811 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35  hydrog ?    ? G DA  18  N1    ? ? ? 1_555 H  DT  9  N3  ? ? E DA  718 F DT  810 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36  hydrog ?    ? G DA  18  N6    ? ? ? 1_555 H  DT  9  O4  ? ? E DA  718 F DT  810 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37  hydrog ?    ? G DG  19  N1    ? ? ? 1_555 H  DC  8  N3  ? ? E DG  719 F DC  809 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38  hydrog ?    ? G DG  19  N2    ? ? ? 1_555 H  DC  8  O2  ? ? E DG  719 F DC  809 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39  hydrog ?    ? G DG  19  O6    ? ? ? 1_555 H  DC  8  N4  ? ? E DG  719 F DC  809 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40  hydrog ?    ? G DG  20  N1    ? ? ? 1_555 H  DC  7  N3  ? ? E DG  720 F DC  808 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41  hydrog ?    ? G DG  20  N2    ? ? ? 1_555 H  DC  7  O2  ? ? E DG  720 F DC  808 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42  hydrog ?    ? G DG  20  O6    ? ? ? 1_555 H  DC  7  N4  ? ? E DG  720 F DC  808 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43  hydrog ?    ? G DG  21  N1    ? ? ? 1_555 H  DC  6  N3  ? ? E DG  721 F DC  807 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44  hydrog ?    ? G DG  21  N2    ? ? ? 1_555 H  DC  6  O2  ? ? E DG  721 F DC  807 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45  hydrog ?    ? G DG  21  O6    ? ? ? 1_555 H  DC  6  N4  ? ? E DG  721 F DC  807 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46  hydrog ?    ? G DA  22  N1    ? ? ? 1_555 H  DT  5  N3  ? ? E DA  722 F DT  806 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47  hydrog ?    ? G DA  22  N6    ? ? ? 1_555 H  DT  5  O4  ? ? E DA  722 F DT  806 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48  hydrog ?    ? G DC  23  N3    ? ? ? 1_555 H  DG  4  N1  ? ? E DC  723 F DG  805 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49  hydrog ?    ? G DC  23  N4    ? ? ? 1_555 H  DG  4  O6  ? ? E DC  723 F DG  805 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50  hydrog ?    ? G DC  23  O2    ? ? ? 1_555 H  DG  4  N2  ? ? E DC  723 F DG  805 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51  hydrog ?    ? G DT  24  N3    ? ? ? 1_555 H  DA  3  N1  ? ? E DT  724 F DA  804 1_555 ? ? ? ? ? ? 'DT-DA PAIR' ?     ? 
hydrog52  hydrog ?    ? G DG  25  N2    ? ? ? 1_555 H  DC  2  O2  ? ? E DG  725 F DC  803 1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? 
hydrog53  hydrog ?    ? C DC  6   N3    ? ? ? 1_555 D  DDG 21 N1  ? ? T DC  706 P DDG 822 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54  hydrog ?    ? C DC  6   N4    ? ? ? 1_555 D  DDG 21 O6  ? ? T DC  706 P DDG 822 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55  hydrog ?    ? C DC  6   O2    ? ? ? 1_555 D  DDG 21 N2  ? ? T DC  706 P DDG 822 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56  hydrog ?    ? C DG  7   N1    ? ? ? 1_555 D  DC  20 N3  ? ? T DG  707 P DC  821 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57  hydrog ?    ? C DG  7   N2    ? ? ? 1_555 D  DC  20 O2  ? ? T DG  707 P DC  821 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58  hydrog ?    ? C DG  7   O6    ? ? ? 1_555 D  DC  20 N4  ? ? T DG  707 P DC  821 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59  hydrog ?    ? C DG  8   N2    ? ? ? 1_555 D  DC  19 O2  ? ? T DG  708 P DC  820 1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? 
hydrog60  hydrog ?    ? C DC  9   N3    ? ? ? 1_555 D  DG  18 N1  ? ? T DC  709 P DG  819 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61  hydrog ?    ? C DC  9   N4    ? ? ? 1_555 D  DG  18 O6  ? ? T DC  709 P DG  819 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62  hydrog ?    ? C DC  9   O2    ? ? ? 1_555 D  DG  18 N2  ? ? T DC  709 P DG  819 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63  hydrog ?    ? C DG  10  N1    ? ? ? 1_555 D  DC  17 N3  ? ? T DG  710 P DC  818 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64  hydrog ?    ? C DG  10  N2    ? ? ? 1_555 D  DC  17 O2  ? ? T DG  710 P DC  818 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog65  hydrog ?    ? C DG  10  O6    ? ? ? 1_555 D  DC  17 N4  ? ? T DG  710 P DC  818 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog66  hydrog ?    ? C DC  11  N3    ? ? ? 1_555 D  DG  16 N1  ? ? T DC  711 P DG  817 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog67  hydrog ?    ? C DC  11  N4    ? ? ? 1_555 D  DG  16 O6  ? ? T DC  711 P DG  817 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog68  hydrog ?    ? C DC  11  O2    ? ? ? 1_555 D  DG  16 N2  ? ? T DC  711 P DG  817 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog69  hydrog ?    ? C DC  12  N3    ? ? ? 1_555 D  DG  15 N1  ? ? T DC  712 P DG  816 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog70  hydrog ?    ? C DC  12  N4    ? ? ? 1_555 D  DG  15 O6  ? ? T DC  712 P DG  816 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog71  hydrog ?    ? C DC  12  O2    ? ? ? 1_555 D  DG  15 N2  ? ? T DC  712 P DG  816 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog72  hydrog ?    ? C DC  13  N3    ? ? ? 1_555 D  DG  14 N1  ? ? T DC  713 P DG  815 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog73  hydrog ?    ? C DC  13  N4    ? ? ? 1_555 D  DG  14 O6  ? ? T DC  713 P DG  815 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog74  hydrog ?    ? C DC  13  O2    ? ? ? 1_555 D  DG  14 N2  ? ? T DC  713 P DG  815 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog75  hydrog ?    ? C DG  14  N1    ? ? ? 1_555 D  DC  13 N3  ? ? T DG  714 P DC  814 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog76  hydrog ?    ? C DG  14  N2    ? ? ? 1_555 D  DC  13 O2  ? ? T DG  714 P DC  814 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog77  hydrog ?    ? C DG  14  O6    ? ? ? 1_555 D  DC  13 N4  ? ? T DG  714 P DC  814 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog78  hydrog ?    ? C DA  15  N1    ? ? ? 1_555 D  DT  12 N3  ? ? T DA  715 P DT  813 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog79  hydrog ?    ? C DA  15  N6    ? ? ? 1_555 D  DT  12 O4  ? ? T DA  715 P DT  813 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog80  hydrog ?    ? C DA  16  N1    ? ? ? 1_555 D  DT  11 N3  ? ? T DA  716 P DT  812 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog81  hydrog ?    ? C DA  16  N6    ? ? ? 1_555 D  DT  11 O4  ? ? T DA  716 P DT  812 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog82  hydrog ?    ? C DC  17  O2    ? ? ? 1_555 D  DG  10 N2  ? ? T DC  717 P DG  811 1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog83  hydrog ?    ? C DA  18  N1    ? ? ? 1_555 D  DT  9  N3  ? ? T DA  718 P DT  810 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog84  hydrog ?    ? C DA  18  N6    ? ? ? 1_555 D  DT  9  O4  ? ? T DA  718 P DT  810 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog85  hydrog ?    ? C DG  19  N1    ? ? ? 1_555 D  DC  8  N3  ? ? T DG  719 P DC  809 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog86  hydrog ?    ? C DG  19  N2    ? ? ? 1_555 D  DC  8  O2  ? ? T DG  719 P DC  809 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog87  hydrog ?    ? C DG  19  O6    ? ? ? 1_555 D  DC  8  N4  ? ? T DG  719 P DC  809 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog88  hydrog ?    ? C DG  20  N1    ? ? ? 1_555 D  DC  7  N3  ? ? T DG  720 P DC  808 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog89  hydrog ?    ? C DG  20  N2    ? ? ? 1_555 D  DC  7  O2  ? ? T DG  720 P DC  808 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog90  hydrog ?    ? C DG  20  O6    ? ? ? 1_555 D  DC  7  N4  ? ? T DG  720 P DC  808 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog91  hydrog ?    ? C DG  21  N1    ? ? ? 1_555 D  DC  6  N3  ? ? T DG  721 P DC  807 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog92  hydrog ?    ? C DG  21  N2    ? ? ? 1_555 D  DC  6  O2  ? ? T DG  721 P DC  807 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog93  hydrog ?    ? C DG  21  O6    ? ? ? 1_555 D  DC  6  N4  ? ? T DG  721 P DC  807 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog94  hydrog ?    ? C DA  22  N1    ? ? ? 1_555 D  DT  5  N3  ? ? T DA  722 P DT  806 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog95  hydrog ?    ? C DA  22  N6    ? ? ? 1_555 D  DT  5  O4  ? ? T DA  722 P DT  806 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog96  hydrog ?    ? C DC  23  N3    ? ? ? 1_555 D  DG  4  N1  ? ? T DC  723 P DG  805 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog97  hydrog ?    ? C DC  23  N4    ? ? ? 1_555 D  DG  4  O6  ? ? T DC  723 P DG  805 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog98  hydrog ?    ? C DC  23  O2    ? ? ? 1_555 D  DG  4  N2  ? ? T DC  723 P DG  805 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog99  hydrog ?    ? C DT  24  N3    ? ? ? 1_555 D  DA  3  N1  ? ? T DT  724 P DA  804 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog100 hydrog ?    ? C DT  24  O4    ? ? ? 1_555 D  DA  3  N6  ? ? T DT  724 P DA  804 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog101 hydrog ?    ? C DG  25  N1    ? ? ? 1_555 D  DC  2  N3  ? ? T DG  725 P DC  803 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog102 hydrog ?    ? C DG  25  N2    ? ? ? 1_555 D  DC  2  O2  ? ? T DG  725 P DC  803 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog103 hydrog ?    ? C DG  25  O6    ? ? ? 1_555 D  DC  2  N4  ? ? T DG  725 P DC  803 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 227 A . ? PRO 225 A PRO 228 A ? PRO 226 A 1 2.81  
2 PRO 422 A . ? PRO 420 A PRO 423 A ? PRO 421 A 1 -0.71 
3 PRO 227 E . ? PRO 225 C PRO 228 E ? PRO 226 C 1 -0.67 
4 PRO 422 E . ? PRO 420 C PRO 423 E ? PRO 421 C 1 0.07  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 2 ? 
AA3 ? 3 ? 
AA4 ? 3 ? 
AA5 ? 5 ? 
AA6 ? 2 ? 
AA7 ? 5 ? 
AA8 ? 3 ? 
AA9 ? 2 ? 
AB1 ? 4 ? 
AB2 ? 5 ? 
AB3 ? 3 ? 
AB4 ? 2 ? 
AB5 ? 3 ? 
AB6 ? 3 ? 
AB7 ? 5 ? 
AB8 ? 2 ? 
AB9 ? 5 ? 
AC1 ? 3 ? 
AC2 ? 2 ? 
AC3 ? 4 ? 
AC4 ? 2 ? 
AC5 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? parallel      
AA5 4 5 ? parallel      
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? parallel      
AA7 4 5 ? parallel      
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? parallel      
AB2 4 5 ? parallel      
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB7 3 4 ? parallel      
AB7 4 5 ? parallel      
AB8 1 2 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? parallel      
AB9 4 5 ? parallel      
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC5 2 3 ? anti-parallel 
AC5 3 4 ? parallel      
AC5 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 49  ? LYS A 51  ? ILE A 47  LYS A 49  
AA1 2 ARG A 145 ? TYR A 148 ? ARG A 143 TYR A 146 
AA1 3 ALA A 131 ? THR A 133 ? ALA A 129 THR A 131 
AA2 1 VAL A 62  ? LYS A 66  ? VAL A 60  LYS A 64  
AA2 2 TRP A 73  ? VAL A 77  ? TRP A 71  VAL A 75  
AA3 1 SER A 107 ? ASP A 112 ? SER A 105 ASP A 110 
AA3 2 ASP A 188 ? SER A 193 ? ASP A 186 SER A 191 
AA3 3 VAL A 181 ? TYR A 185 ? VAL A 179 TYR A 183 
AA4 1 PHE A 229 ? TRP A 231 ? PHE A 227 TRP A 229 
AA4 2 TYR A 234 ? LEU A 236 ? TYR A 232 LEU A 234 
AA4 3 TRP A 241 ? VAL A 243 ? TRP A 239 VAL A 241 
AA5 1 LYS A 349 ? TYR A 356 ? LYS A 347 TYR A 354 
AA5 2 GLN A 338 ? GLU A 346 ? GLN A 336 GLU A 344 
AA5 3 ILE A 328 ? GLY A 335 ? ILE A 326 GLY A 333 
AA5 4 LYS A 390 ? LEU A 393 ? LYS A 388 LEU A 391 
AA5 5 TRP A 416 ? PHE A 418 ? TRP A 414 PHE A 416 
AA6 1 HIS A 363 ? THR A 364 ? HIS A 361 THR A 362 
AA6 2 LYS A 514 ? SER A 515 ? LYS A 512 SER A 513 
AA7 1 GLN A 466 ? LEU A 471 ? GLN A 464 LEU A 469 
AA7 2 GLY A 455 ? THR A 461 ? GLY A 453 THR A 459 
AA7 3 GLU A 440 ? ALA A 448 ? GLU A 438 ALA A 446 
AA7 4 GLU A 494 ? THR A 499 ? GLU A 492 THR A 497 
AA7 5 LYS A 532 ? TRP A 537 ? LYS A 530 TRP A 535 
AA8 1 ILE B 63  ? LYS B 65  ? ILE B 47  LYS B 49  
AA8 2 ILE B 158 ? TYR B 162 ? ILE B 142 TYR B 146 
AA8 3 PHE B 146 ? ILE B 148 ? PHE B 130 ILE B 132 
AA9 1 VAL B 76  ? ILE B 79  ? VAL B 60  ILE B 63  
AA9 2 ARG B 88  ? VAL B 91  ? ARG B 72  VAL B 75  
AB1 1 VAL B 195 ? TYR B 199 ? VAL B 179 TYR B 183 
AB1 2 ASP B 202 ? SER B 207 ? ASP B 186 SER B 191 
AB1 3 SER B 121 ? ASP B 126 ? SER B 105 ASP B 110 
AB1 4 TYR B 248 ? LEU B 250 ? TYR B 232 LEU B 234 
AB2 1 LYS B 363 ? ALA B 371 ? LYS B 347 ALA B 355 
AB2 2 GLN B 352 ? GLU B 360 ? GLN B 336 GLU B 344 
AB2 3 ILE B 342 ? GLY B 349 ? ILE B 326 GLY B 333 
AB2 4 LYS B 404 ? LEU B 407 ? LYS B 388 LEU B 391 
AB2 5 TRP B 430 ? PHE B 432 ? TRP B 414 PHE B 416 
AB3 1 ILE E 49  ? LYS E 51  ? ILE C 47  LYS C 49  
AB3 2 ARG E 145 ? TYR E 148 ? ARG C 143 TYR C 146 
AB3 3 ALA E 131 ? THR E 133 ? ALA C 129 THR C 131 
AB4 1 VAL E 62  ? LYS E 66  ? VAL C 60  LYS C 64  
AB4 2 TRP E 73  ? VAL E 77  ? TRP C 71  VAL C 75  
AB5 1 SER E 107 ? ASP E 112 ? SER C 105 ASP C 110 
AB5 2 ASP E 188 ? SER E 193 ? ASP C 186 SER C 191 
AB5 3 VAL E 181 ? TYR E 185 ? VAL C 179 TYR C 183 
AB6 1 PHE E 229 ? TRP E 231 ? PHE C 227 TRP C 229 
AB6 2 TYR E 234 ? LEU E 236 ? TYR C 232 LEU C 234 
AB6 3 TRP E 241 ? VAL E 243 ? TRP C 239 VAL C 241 
AB7 1 LYS E 349 ? TYR E 356 ? LYS C 347 TYR C 354 
AB7 2 GLN E 338 ? GLU E 346 ? GLN C 336 GLU C 344 
AB7 3 ILE E 328 ? GLY E 335 ? ILE C 326 GLY C 333 
AB7 4 LYS E 390 ? LEU E 393 ? LYS C 388 LEU C 391 
AB7 5 TRP E 416 ? PHE E 418 ? TRP C 414 PHE C 416 
AB8 1 HIS E 363 ? THR E 364 ? HIS C 361 THR C 362 
AB8 2 LYS E 514 ? SER E 515 ? LYS C 512 SER C 513 
AB9 1 GLN E 466 ? LEU E 471 ? GLN C 464 LEU C 469 
AB9 2 GLY E 455 ? THR E 461 ? GLY C 453 THR C 459 
AB9 3 THR E 441 ? ALA E 448 ? THR C 439 ALA C 446 
AB9 4 GLU E 494 ? THR E 499 ? GLU C 492 THR C 497 
AB9 5 LYS E 532 ? TRP E 537 ? LYS C 530 TRP C 535 
AC1 1 ILE F 63  ? LYS F 65  ? ILE D 47  LYS D 49  
AC1 2 ILE F 158 ? TYR F 162 ? ILE D 142 TYR D 146 
AC1 3 PHE F 146 ? ILE F 148 ? PHE D 130 ILE D 132 
AC2 1 VAL F 76  ? ILE F 79  ? VAL D 60  ILE D 63  
AC2 2 ARG F 88  ? VAL F 91  ? ARG D 72  VAL D 75  
AC3 1 VAL F 195 ? TYR F 199 ? VAL D 179 TYR D 183 
AC3 2 ASP F 202 ? SER F 207 ? ASP D 186 SER D 191 
AC3 3 SER F 121 ? ASP F 126 ? SER D 105 ASP D 110 
AC3 4 TYR F 248 ? LEU F 250 ? TYR D 232 LEU D 234 
AC4 1 TRP F 268 ? THR F 269 ? TRP D 252 THR D 253 
AC4 2 VAL F 308 ? ILE F 309 ? VAL D 292 ILE D 293 
AC5 1 ASN F 364 ? ALA F 371 ? ASN D 348 ALA D 355 
AC5 2 GLN F 352 ? TYR F 358 ? GLN D 336 TYR D 342 
AC5 3 ILE F 342 ? GLY F 349 ? ILE D 326 GLY D 333 
AC5 4 LYS F 404 ? LEU F 407 ? LYS D 388 LEU D 391 
AC5 5 TRP F 430 ? PHE F 432 ? TRP D 414 PHE D 416 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N SER A 50  ? N SER A 48  O GLN A 147 ? O GLN A 145 
AA1 2 3 O TYR A 146 ? O TYR A 144 N PHE A 132 ? N PHE A 130 
AA2 1 2 N PHE A 63  ? N PHE A 61  O LEU A 76  ? O LEU A 74  
AA3 1 2 N THR A 109 ? N THR A 107 O VAL A 191 ? O VAL A 189 
AA3 2 3 O TYR A 190 ? O TYR A 188 N TYR A 183 ? N TYR A 181 
AA4 1 2 N PHE A 229 ? N PHE A 227 O LEU A 236 ? O LEU A 234 
AA4 2 3 N GLU A 235 ? N GLU A 233 O THR A 242 ? O THR A 240 
AA5 1 2 O LEU A 351 ? O LEU A 349 N ILE A 343 ? N ILE A 341 
AA5 2 3 O GLN A 338 ? O GLN A 336 N GLN A 334 ? N GLN A 332 
AA5 3 4 N ALA A 329 ? N ALA A 327 O LYS A 392 ? O LYS A 390 
AA5 4 5 N LEU A 393 ? N LEU A 391 O GLU A 417 ? O GLU A 415 
AA6 1 2 N THR A 364 ? N THR A 362 O LYS A 514 ? O LYS A 512 
AA7 1 2 O LEU A 471 ? O LEU A 469 N GLY A 455 ? N GLY A 453 
AA7 2 3 O VAL A 460 ? O VAL A 458 N TYR A 443 ? N TYR A 441 
AA7 3 4 N PHE A 442 ? N PHE A 440 O ASN A 496 ? O ASN A 494 
AA7 4 5 N ILE A 497 ? N ILE A 495 O TYR A 534 ? O TYR A 532 
AA8 1 2 N SER B 64  ? N SER B 48  O GLN B 161 ? O GLN B 145 
AA8 2 3 O ILE B 158 ? O ILE B 142 N ILE B 148 ? N ILE B 132 
AA9 1 2 N PHE B 77  ? N PHE B 61  O LEU B 90  ? O LEU B 74  
AB1 1 2 N TYR B 197 ? N TYR B 181 O TYR B 204 ? O TYR B 188 
AB1 2 3 O VAL B 205 ? O VAL B 189 N THR B 123 ? N THR B 107 
AB1 3 4 N VAL B 122 ? N VAL B 106 O LEU B 250 ? O LEU B 234 
AB2 1 2 O TYR B 370 ? O TYR B 354 N TRP B 353 ? N TRP B 337 
AB2 2 3 O TYR B 358 ? O TYR B 342 N ILE B 342 ? N ILE B 326 
AB2 3 4 N ALA B 343 ? N ALA B 327 O LYS B 406 ? O LYS B 390 
AB2 4 5 N LEU B 407 ? N LEU B 391 O GLU B 431 ? O GLU B 415 
AB3 1 2 N SER E 50  ? N SER C 48  O GLN E 147 ? O GLN C 145 
AB3 2 3 O TYR E 146 ? O TYR C 144 N PHE E 132 ? N PHE C 130 
AB4 1 2 N CYS E 65  ? N CYS C 63  O ARG E 74  ? O ARG C 72  
AB5 1 2 N THR E 109 ? N THR C 107 O VAL E 191 ? O VAL C 189 
AB5 2 3 O TYR E 190 ? O TYR C 188 N TYR E 183 ? N TYR C 181 
AB6 1 2 N PHE E 229 ? N PHE C 227 O LEU E 236 ? O LEU C 234 
AB6 2 3 N GLU E 235 ? N GLU C 233 O THR E 242 ? O THR C 240 
AB7 1 2 O LEU E 351 ? O LEU C 349 N ILE E 343 ? N ILE C 341 
AB7 2 3 O GLN E 338 ? O GLN C 336 N GLN E 334 ? N GLN C 332 
AB7 3 4 N ALA E 329 ? N ALA C 327 O LYS E 390 ? O LYS C 388 
AB7 4 5 N PHE E 391 ? N PHE C 389 O GLU E 417 ? O GLU C 415 
AB8 1 2 N THR E 364 ? N THR C 362 O LYS E 514 ? O LYS C 512 
AB9 1 2 O LEU E 471 ? O LEU C 469 N GLY E 455 ? N GLY C 453 
AB9 2 3 O VAL E 460 ? O VAL C 458 N TYR E 443 ? N TYR C 441 
AB9 3 4 N PHE E 442 ? N PHE C 440 O ASN E 496 ? O ASN C 494 
AB9 4 5 N ILE E 497 ? N ILE C 495 O TYR E 534 ? O TYR C 532 
AC1 1 2 N SER F 64  ? N SER D 48  O GLN F 161 ? O GLN D 145 
AC1 2 3 O ILE F 158 ? O ILE D 142 N ILE F 148 ? N ILE D 132 
AC2 1 2 N PHE F 77  ? N PHE D 61  O LEU F 90  ? O LEU D 74  
AC3 1 2 N TYR F 197 ? N TYR D 181 O TYR F 204 ? O TYR D 188 
AC3 2 3 O VAL F 205 ? O VAL D 189 N THR F 123 ? N THR D 107 
AC3 3 4 N VAL F 124 ? N VAL D 108 O TYR F 248 ? O TYR D 232 
AC4 1 2 N TRP F 268 ? N TRP D 252 O ILE F 309 ? O ILE D 293 
AC5 1 2 O LYS F 366 ? O LYS D 350 N ILE F 357 ? N ILE D 341 
AC5 2 3 O TYR F 358 ? O TYR D 342 N ILE F 342 ? N ILE D 326 
AC5 3 4 N ALA F 343 ? N ALA D 327 O LYS F 406 ? O LYS D 390 
AC5 4 5 N LEU F 407 ? N LEU D 391 O GLU F 431 ? O GLU D 415 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MG  601 ? 4  'binding site for residue MG A 601'                     
AC2 Software A MG  602 ? 5  'binding site for residue MG A 602'                     
AC3 Software A D4T 603 ? 15 'binding site for residue D4T A 603'                    
AC4 Software B GOL 501 ? 7  'binding site for residue GOL B 501'                    
AC5 Software B GOL 502 ? 8  'binding site for residue GOL B 502'                    
AC6 Software B GOL 503 ? 5  'binding site for residue GOL B 503'                    
AC7 Software B GOL 504 ? 7  'binding site for residue GOL B 504'                    
AC8 Software B GOL 505 ? 6  'binding site for residue GOL B 505'                    
AC9 Software B GOL 506 ? 10 'binding site for residue GOL B 506'                    
AD1 Software B GOL 507 ? 6  'binding site for residue GOL B 507'                    
AD2 Software C MG  601 ? 4  'binding site for residue MG C 601'                     
AD3 Software C MG  602 ? 5  'binding site for residue MG C 602'                     
AD4 Software C D4T 603 ? 14 'binding site for residue D4T C 603'                    
AD5 Software C GOL 604 ? 4  'binding site for residue GOL C 604'                    
AD6 Software C GOL 605 ? 8  'binding site for residue GOL C 605'                    
AD7 Software C GOL 606 ? 6  'binding site for residue GOL C 606'                    
AD8 Software D GOL 501 ? 6  'binding site for residue GOL D 501'                    
AD9 Software D GOL 502 ? 7  'binding site for residue GOL D 502'                    
AE1 Software D GOL 503 ? 4  'binding site for residue GOL D 503'                    
AE2 Software F DC  821 ? 15 'binding site for Di-nucleotide DC F 821 and DDG F 822' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 4  ASP A  112 ? ASP A 110 . ? 1_555 ? 
2   AC1 4  VAL A  113 ? VAL A 111 . ? 1_555 ? 
3   AC1 4  ASP A  187 ? ASP A 185 . ? 1_555 ? 
4   AC1 4  D4T K  .   ? D4T A 603 . ? 1_555 ? 
5   AC2 5  ASP A  445 ? ASP A 443 . ? 1_555 ? 
6   AC2 5  GLU A  480 ? GLU A 478 . ? 1_555 ? 
7   AC2 5  ASP A  500 ? ASP A 498 . ? 1_555 ? 
8   AC2 5  HOH BA .   ? HOH A 746 . ? 1_555 ? 
9   AC2 5  HOH BA .   ? HOH A 788 . ? 1_555 ? 
10  AC3 15 LYS A  67  ? LYS A 65  . ? 1_555 ? 
11  AC3 15 ARG A  74  ? ARG A 72  . ? 1_555 ? 
12  AC3 15 ASP A  112 ? ASP A 110 . ? 1_555 ? 
13  AC3 15 VAL A  113 ? VAL A 111 . ? 1_555 ? 
14  AC3 15 GLY A  114 ? GLY A 112 . ? 1_555 ? 
15  AC3 15 ASP A  115 ? ASP A 113 . ? 1_555 ? 
16  AC3 15 ALA A  116 ? ALA A 114 . ? 1_555 ? 
17  AC3 15 TYR A  117 ? TYR A 115 . ? 1_555 ? 
18  AC3 15 MET A  186 ? MET A 184 . ? 1_555 ? 
19  AC3 15 ASP A  187 ? ASP A 185 . ? 1_555 ? 
20  AC3 15 LYS A  222 ? LYS A 220 . ? 1_555 ? 
21  AC3 15 MG  I  .   ? MG  A 601 . ? 1_555 ? 
22  AC3 15 HOH BA .   ? HOH A 779 . ? 1_555 ? 
23  AC3 15 DDG D  21  ? DDG P 822 . ? 1_555 ? 
24  AC3 15 DA  C  5   ? DA  T 705 . ? 1_555 ? 
25  AC4 7  THR A  379 ? THR A 377 . ? 1_555 ? 
26  AC4 7  ILE A  382 ? ILE A 380 . ? 1_555 ? 
27  AC4 7  PRO B  41  ? PRO B 25  . ? 1_555 ? 
28  AC4 7  THR B  416 ? THR B 400 . ? 1_555 ? 
29  AC4 7  GOL P  .   ? GOL B 505 . ? 1_555 ? 
30  AC4 7  HOH CA .   ? HOH B 606 . ? 1_555 ? 
31  AC4 7  HOH CA .   ? HOH B 707 . ? 1_555 ? 
32  AC5 8  LEU A  94  ? LEU A 92  . ? 1_555 ? 
33  AC5 8  GLN B  39  ? GLN B 23  . ? 1_555 ? 
34  AC5 8  TRP B  40  ? TRP B 24  . ? 1_555 ? 
35  AC5 8  PRO B  41  ? PRO B 25  . ? 1_555 ? 
36  AC5 8  PRO B  149 ? PRO B 133 . ? 1_555 ? 
37  AC5 8  ASN B  153 ? ASN B 137 . ? 1_555 ? 
38  AC5 8  HOH CA .   ? HOH B 655 . ? 1_555 ? 
39  AC5 8  HOH CA .   ? HOH B 708 . ? 1_555 ? 
40  AC6 5  GLY B  332 ? GLY B 316 . ? 1_555 ? 
41  AC6 5  VAL B  333 ? VAL B 317 . ? 1_555 ? 
42  AC6 5  TYR B  334 ? TYR B 318 . ? 1_555 ? 
43  AC6 5  LYS B  339 ? LYS B 323 . ? 1_555 ? 
44  AC6 5  HOH CA .   ? HOH B 607 . ? 1_555 ? 
45  AC7 7  GLU B  344 ? GLU B 328 . ? 1_555 ? 
46  AC7 7  TYR B  358 ? TYR B 342 . ? 1_555 ? 
47  AC7 7  PRO B  361 ? PRO B 345 . ? 1_555 ? 
48  AC7 7  PHE B  362 ? PHE B 346 . ? 1_555 ? 
49  AC7 7  ASN B  364 ? ASN B 348 . ? 1_555 ? 
50  AC7 7  TRP B  442 ? TRP B 426 . ? 1_555 ? 
51  AC7 7  HOH CA .   ? HOH B 628 . ? 1_555 ? 
52  AC8 6  TRP B  40  ? TRP B 24  . ? 1_555 ? 
53  AC8 6  GLU B  415 ? GLU B 399 . ? 1_555 ? 
54  AC8 6  TRP B  418 ? TRP B 402 . ? 1_555 ? 
55  AC8 6  GOL L  .   ? GOL B 501 . ? 1_555 ? 
56  AC8 6  HOH CA .   ? HOH B 683 . ? 1_555 ? 
57  AC8 6  HOH CA .   ? HOH B 707 . ? 1_555 ? 
58  AC9 10 TRP A  404 ? TRP A 402 . ? 1_555 ? 
59  AC9 10 LYS B  347 ? LYS B 331 . ? 1_555 ? 
60  AC9 10 GLY B  349 ? GLY B 333 . ? 1_555 ? 
61  AC9 10 GLN B  350 ? GLN B 334 . ? 1_555 ? 
62  AC9 10 GLY B  351 ? GLY B 335 . ? 1_555 ? 
63  AC9 10 GLN B  352 ? GLN B 336 . ? 1_555 ? 
64  AC9 10 TRP B  353 ? TRP B 337 . ? 1_555 ? 
65  AC9 10 HIS B  377 ? HIS B 361 . ? 1_555 ? 
66  AC9 10 ASP B  380 ? ASP B 364 . ? 1_555 ? 
67  AC9 10 GLN B  383 ? GLN B 367 . ? 1_555 ? 
68  AD1 6  TYR B  248 ? TYR B 232 . ? 1_555 ? 
69  AD1 6  LEU B  250 ? LEU B 234 . ? 1_555 ? 
70  AD1 6  TRP B  255 ? TRP B 239 . ? 1_555 ? 
71  AD1 6  LYS B  390 ? LYS B 374 . ? 1_555 ? 
72  AD1 6  GLU B  394 ? GLU B 378 . ? 1_555 ? 
73  AD1 6  HOH CA .   ? HOH B 616 . ? 1_555 ? 
74  AD2 4  ASP E  112 ? ASP C 110 . ? 1_555 ? 
75  AD2 4  VAL E  113 ? VAL C 111 . ? 1_555 ? 
76  AD2 4  ASP E  187 ? ASP C 185 . ? 1_555 ? 
77  AD2 4  D4T U  .   ? D4T C 603 . ? 1_555 ? 
78  AD3 5  ASP E  445 ? ASP C 443 . ? 1_555 ? 
79  AD3 5  GLU E  480 ? GLU C 478 . ? 1_555 ? 
80  AD3 5  ASP E  500 ? ASP C 498 . ? 1_555 ? 
81  AD3 5  HOH FA .   ? HOH C 732 . ? 1_555 ? 
82  AD3 5  HOH FA .   ? HOH C 758 . ? 1_555 ? 
83  AD4 14 LYS E  67  ? LYS C 65  . ? 1_555 ? 
84  AD4 14 ARG E  74  ? ARG C 72  . ? 1_555 ? 
85  AD4 14 ASP E  112 ? ASP C 110 . ? 1_555 ? 
86  AD4 14 VAL E  113 ? VAL C 111 . ? 1_555 ? 
87  AD4 14 GLY E  114 ? GLY C 112 . ? 1_555 ? 
88  AD4 14 ASP E  115 ? ASP C 113 . ? 1_555 ? 
89  AD4 14 ALA E  116 ? ALA C 114 . ? 1_555 ? 
90  AD4 14 TYR E  117 ? TYR C 115 . ? 1_555 ? 
91  AD4 14 GLN E  153 ? GLN C 151 . ? 1_555 ? 
92  AD4 14 ASP E  187 ? ASP C 185 . ? 1_555 ? 
93  AD4 14 MG  S  .   ? MG  C 601 . ? 1_555 ? 
94  AD4 14 DA  G  5   ? DA  E 705 . ? 1_555 ? 
95  AD4 14 HOH HA .   ? HOH E 802 . ? 1_555 ? 
96  AD4 14 DDG H  21  ? DDG F 822 . ? 1_555 ? 
97  AD5 4  LYS E  333 ? LYS C 331 . ? 1_555 ? 
98  AD5 4  ASP E  366 ? ASP C 364 . ? 1_555 ? 
99  AD5 4  TRP E  428 ? TRP C 426 . ? 1_555 ? 
100 AD5 4  ASP E  513 ? ASP C 511 . ? 1_555 ? 
101 AD6 8  THR E  405 ? THR C 403 . ? 1_555 ? 
102 AD6 8  GLU E  406 ? GLU C 404 . ? 1_555 ? 
103 AD6 8  TYR E  407 ? TYR C 405 . ? 1_555 ? 
104 AD6 8  TRP E  408 ? TRP C 406 . ? 1_555 ? 
105 AD6 8  LYS F  347 ? LYS D 331 . ? 1_555 ? 
106 AD6 8  GLN F  348 ? GLN D 332 . ? 1_555 ? 
107 AD6 8  GLY F  349 ? GLY D 333 . ? 1_555 ? 
108 AD6 8  LYS F  440 ? LYS D 424 . ? 1_555 ? 
109 AD7 6  TYR E  459 ? TYR C 457 . ? 1_555 ? 
110 AD7 6  ARG E  465 ? ARG C 463 . ? 1_555 ? 
111 AD7 6  GLN E  466 ? GLN C 464 . ? 1_555 ? 
112 AD7 6  LYS E  467 ? LYS C 465 . ? 1_555 ? 
113 AD7 6  ASP E  490 ? ASP C 488 . ? 1_555 ? 
114 AD7 6  HOH FA .   ? HOH C 745 . ? 1_555 ? 
115 AD8 6  TRP F  282 ? TRP D 266 . ? 1_555 ? 
116 AD8 6  GLU F  344 ? GLU D 328 . ? 1_555 ? 
117 AD8 6  TYR F  358 ? TYR D 342 . ? 1_555 ? 
118 AD8 6  PHE F  362 ? PHE D 346 . ? 1_555 ? 
119 AD8 6  ASN F  364 ? ASN D 348 . ? 1_555 ? 
120 AD8 6  TRP F  442 ? TRP D 426 . ? 1_555 ? 
121 AD9 7  LEU E  94  ? LEU C 92  . ? 1_555 ? 
122 AD9 7  VAL E  383 ? VAL C 381 . ? 1_555 ? 
123 AD9 7  GLN F  39  ? GLN D 23  . ? 1_555 ? 
124 AD9 7  TRP F  40  ? TRP D 24  . ? 1_555 ? 
125 AD9 7  PRO F  41  ? PRO D 25  . ? 1_555 ? 
126 AD9 7  ASN F  153 ? ASN D 137 . ? 1_555 ? 
127 AD9 7  HOH GA .   ? HOH D 674 . ? 1_555 ? 
128 AE1 4  TRP F  40  ? TRP D 24  . ? 1_555 ? 
129 AE1 4  GLU F  415 ? GLU D 399 . ? 1_555 ? 
130 AE1 4  TRP F  418 ? TRP D 402 . ? 1_555 ? 
131 AE1 4  HOH GA .   ? HOH D 611 . ? 1_555 ? 
132 AE2 15 TYR E  117 ? TYR C 115 . ? 1_555 ? 
133 AE2 15 TYR E  185 ? TYR C 183 . ? 1_555 ? 
134 AE2 15 MET E  186 ? MET C 184 . ? 1_555 ? 
135 AE2 15 ASP E  187 ? ASP C 185 . ? 1_555 ? 
136 AE2 15 ASP E  188 ? ASP C 186 . ? 1_555 ? 
137 AE2 15 MET E  232 ? MET C 230 . ? 1_555 ? 
138 AE2 15 GLY E  233 ? GLY C 231 . ? 1_555 ? 
139 AE2 15 D4T U  .   ? D4T C 603 . ? 1_555 ? 
140 AE2 15 HOH FA .   ? HOH C 790 . ? 1_555 ? 
141 AE2 15 DC  G  6   ? DC  E 706 . ? 1_555 ? 
142 AE2 15 DG  G  7   ? DG  E 707 . ? 1_555 ? 
143 AE2 15 DG  G  8   ? DG  E 708 . ? 1_555 ? 
144 AE2 15 HOH HA .   ? HOH E 802 . ? 1_555 ? 
145 AE2 15 DC  H  19  ? DC  F 820 . ? 1_555 ? 
146 AE2 15 HOH IA .   ? HOH F 910 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6AN8 
_atom_sites.fract_transf_matrix[1][1]   0.011116 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001529 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007529 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007267 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . MET A  1 1   ? 45.345  20.065  8.134   1.00 120.01 ? -1  MET A N     1 
ATOM   2     C  CA    . MET A  1 1   ? 46.609  19.688  8.757   1.00 119.85 ? -1  MET A CA    1 
ATOM   3     C  C     . MET A  1 1   ? 46.796  20.412  10.086  1.00 125.43 ? -1  MET A C     1 
ATOM   4     O  O     . MET A  1 1   ? 47.290  21.539  10.127  1.00 127.63 ? -1  MET A O     1 
ATOM   5     C  CB    . MET A  1 1   ? 47.779  19.990  7.818   1.00 119.96 ? -1  MET A CB    1 
ATOM   6     C  CG    . MET A  1 1   ? 49.140  19.578  8.359   1.00 121.26 ? -1  MET A CG    1 
ATOM   7     S  SD    . MET A  1 1   ? 49.260  17.811  8.694   1.00 124.52 ? -1  MET A SD    1 
ATOM   8     C  CE    . MET A  1 1   ? 50.979  17.676  9.178   1.00 121.37 ? -1  MET A CE    1 
ATOM   9     N  N     . VAL A  1 2   ? 46.395  19.759  11.172  1.00 127.90 ? 0   VAL A N     1 
ATOM   10    C  CA    . VAL A  1 2   ? 46.525  20.330  12.510  1.00 130.12 ? 0   VAL A CA    1 
ATOM   11    C  C     . VAL A  1 2   ? 47.594  19.559  13.276  1.00 118.88 ? 0   VAL A C     1 
ATOM   12    O  O     . VAL A  1 2   ? 47.696  18.332  13.134  1.00 124.10 ? 0   VAL A O     1 
ATOM   13    C  CB    . VAL A  1 2   ? 45.181  20.319  13.256  1.00 133.45 ? 0   VAL A CB    1 
ATOM   14    C  CG1   . VAL A  1 2   ? 44.204  21.279  12.595  1.00 139.46 ? 0   VAL A CG1   1 
ATOM   15    C  CG2   . VAL A  1 2   ? 44.600  18.913  13.297  1.00 129.25 ? 0   VAL A CG2   1 
ATOM   16    N  N     . PRO A  1 3   ? 48.417  20.229  14.080  1.00 105.03 ? 1   PRO A N     1 
ATOM   17    C  CA    . PRO A  1 3   ? 49.431  19.510  14.856  1.00 90.69  ? 1   PRO A CA    1 
ATOM   18    C  C     . PRO A  1 3   ? 48.792  18.663  15.943  1.00 98.66  ? 1   PRO A C     1 
ATOM   19    O  O     . PRO A  1 3   ? 47.774  19.030  16.533  1.00 103.42 ? 1   PRO A O     1 
ATOM   20    C  CB    . PRO A  1 3   ? 50.287  20.631  15.460  1.00 85.32  ? 1   PRO A CB    1 
ATOM   21    C  CG    . PRO A  1 3   ? 49.933  21.869  14.688  1.00 89.39  ? 1   PRO A CG    1 
ATOM   22    C  CD    . PRO A  1 3   ? 48.513  21.686  14.260  1.00 97.66  ? 1   PRO A CD    1 
ATOM   23    N  N     . ILE A  1 4   ? 49.406  17.515  16.203  1.00 102.82 ? 2   ILE A N     1 
ATOM   24    C  CA    . ILE A  1 4   ? 48.941  16.608  17.245  1.00 109.34 ? 2   ILE A CA    1 
ATOM   25    C  C     . ILE A  1 4   ? 49.602  16.995  18.561  1.00 109.77 ? 2   ILE A C     1 
ATOM   26    O  O     . ILE A  1 4   ? 50.832  17.102  18.646  1.00 105.67 ? 2   ILE A O     1 
ATOM   27    C  CB    . ILE A  1 4   ? 49.235  15.144  16.875  1.00 110.93 ? 2   ILE A CB    1 
ATOM   28    C  CG1   . ILE A  1 4   ? 50.667  14.988  16.360  1.00 110.03 ? 2   ILE A CG1   1 
ATOM   29    C  CG2   . ILE A  1 4   ? 48.244  14.652  15.832  1.00 111.64 ? 2   ILE A CG2   1 
ATOM   30    C  CD1   . ILE A  1 4   ? 50.999  13.589  15.888  1.00 107.42 ? 2   ILE A CD1   1 
ATOM   31    N  N     . SER A  1 5   ? 48.783  17.220  19.586  1.00 109.25 ? 3   SER A N     1 
ATOM   32    C  CA    . SER A  1 5   ? 49.291  17.654  20.875  1.00 106.37 ? 3   SER A CA    1 
ATOM   33    C  C     . SER A  1 5   ? 50.052  16.518  21.557  1.00 94.91  ? 3   SER A C     1 
ATOM   34    O  O     . SER A  1 5   ? 49.870  15.345  21.221  1.00 82.35  ? 3   SER A O     1 
ATOM   35    C  CB    . SER A  1 5   ? 48.142  18.128  21.761  1.00 108.05 ? 3   SER A CB    1 
ATOM   36    O  OG    . SER A  1 5   ? 47.311  17.045  22.134  1.00 105.74 ? 3   SER A OG    1 
ATOM   37    N  N     . PRO A  1 6   ? 50.925  16.845  22.515  1.00 91.08  ? 4   PRO A N     1 
ATOM   38    C  CA    . PRO A  1 6   ? 51.670  15.786  23.215  1.00 87.99  ? 4   PRO A CA    1 
ATOM   39    C  C     . PRO A  1 6   ? 50.797  14.891  24.075  1.00 87.97  ? 4   PRO A C     1 
ATOM   40    O  O     . PRO A  1 6   ? 51.233  13.788  24.428  1.00 91.41  ? 4   PRO A O     1 
ATOM   41    C  CB    . PRO A  1 6   ? 52.674  16.567  24.074  1.00 85.76  ? 4   PRO A CB    1 
ATOM   42    C  CG    . PRO A  1 6   ? 52.757  17.920  23.446  1.00 87.13  ? 4   PRO A CG    1 
ATOM   43    C  CD    . PRO A  1 6   ? 51.393  18.188  22.899  1.00 86.51  ? 4   PRO A CD    1 
ATOM   44    N  N     . ILE A  1 7   ? 49.586  15.324  24.425  1.00 95.34  ? 5   ILE A N     1 
ATOM   45    C  CA    . ILE A  1 7   ? 48.724  14.527  25.290  1.00 102.55 ? 5   ILE A CA    1 
ATOM   46    C  C     . ILE A  1 7   ? 48.179  13.340  24.508  1.00 106.03 ? 5   ILE A C     1 
ATOM   47    O  O     . ILE A  1 7   ? 47.677  13.489  23.386  1.00 100.33 ? 5   ILE A O     1 
ATOM   48    C  CB    . ILE A  1 7   ? 47.590  15.391  25.860  1.00 90.79  ? 5   ILE A CB    1 
ATOM   49    C  CG1   . ILE A  1 7   ? 48.165  16.586  26.622  1.00 82.83  ? 5   ILE A CG1   1 
ATOM   50    C  CG2   . ILE A  1 7   ? 46.688  14.563  26.764  1.00 92.00  ? 5   ILE A CG2   1 
ATOM   51    C  CD1   . ILE A  1 7   ? 47.112  17.506  27.199  1.00 87.81  ? 5   ILE A CD1   1 
ATOM   52    N  N     . GLU A  1 8   ? 48.282  12.151  25.098  1.00 109.73 ? 6   GLU A N     1 
ATOM   53    C  CA    . GLU A  1 8   ? 47.767  10.946  24.463  1.00 110.88 ? 6   GLU A CA    1 
ATOM   54    C  C     . GLU A  1 8   ? 46.250  11.023  24.349  1.00 99.35  ? 6   GLU A C     1 
ATOM   55    O  O     . GLU A  1 8   ? 45.560  11.376  25.310  1.00 98.49  ? 6   GLU A O     1 
ATOM   56    C  CB    . GLU A  1 8   ? 48.177  9.711   25.261  1.00 127.44 ? 6   GLU A CB    1 
ATOM   57    C  CG    . GLU A  1 8   ? 49.676  9.576   25.469  1.00 139.69 ? 6   GLU A CG    1 
ATOM   58    C  CD    . GLU A  1 8   ? 50.039  8.379   26.324  1.00 143.53 ? 6   GLU A CD    1 
ATOM   59    O  OE1   . GLU A  1 8   ? 49.123  7.616   26.700  1.00 146.20 ? 6   GLU A OE1   1 
ATOM   60    O  OE2   . GLU A  1 8   ? 51.239  8.200   26.621  1.00 142.85 ? 6   GLU A OE2   1 
ATOM   61    N  N     . THR A  1 9   ? 45.731  10.695  23.169  1.00 94.99  ? 7   THR A N     1 
ATOM   62    C  CA    . THR A  1 9   ? 44.298  10.750  22.938  1.00 97.02  ? 7   THR A CA    1 
ATOM   63    C  C     . THR A  1 9   ? 43.597  9.574   23.614  1.00 94.71  ? 7   THR A C     1 
ATOM   64    O  O     . THR A  1 9   ? 44.196  8.532   23.893  1.00 93.36  ? 7   THR A O     1 
ATOM   65    C  CB    . THR A  1 9   ? 43.992  10.749  21.439  1.00 100.50 ? 7   THR A CB    1 
ATOM   66    O  OG1   . THR A  1 9   ? 42.575  10.802  21.240  1.00 106.79 ? 7   THR A OG1   1 
ATOM   67    C  CG2   . THR A  1 9   ? 44.543  9.492   20.782  1.00 97.63  ? 7   THR A CG2   1 
ATOM   68    N  N     . VAL A  1 10  ? 42.311  9.756   23.879  1.00 94.40  ? 8   VAL A N     1 
ATOM   69    C  CA    . VAL A  1 10  ? 41.465  8.744   24.504  1.00 90.86  ? 8   VAL A CA    1 
ATOM   70    C  C     . VAL A  1 10  ? 40.490  8.232   23.450  1.00 90.34  ? 8   VAL A C     1 
ATOM   71    O  O     . VAL A  1 10  ? 39.667  9.009   22.949  1.00 92.63  ? 8   VAL A O     1 
ATOM   72    C  CB    . VAL A  1 10  ? 40.715  9.303   25.724  1.00 94.91  ? 8   VAL A CB    1 
ATOM   73    C  CG1   . VAL A  1 10  ? 39.727  8.276   26.256  1.00 92.66  ? 8   VAL A CG1   1 
ATOM   74    C  CG2   . VAL A  1 10  ? 41.699  9.712   26.809  1.00 93.49  ? 8   VAL A CG2   1 
ATOM   75    N  N     . PRO A  1 11  ? 40.543  6.948   23.081  1.00 89.50  ? 9   PRO A N     1 
ATOM   76    C  CA    . PRO A  1 11  ? 39.628  6.438   22.050  1.00 88.03  ? 9   PRO A CA    1 
ATOM   77    C  C     . PRO A  1 11  ? 38.182  6.410   22.519  1.00 92.07  ? 9   PRO A C     1 
ATOM   78    O  O     . PRO A  1 11  ? 37.821  5.631   23.407  1.00 81.29  ? 9   PRO A O     1 
ATOM   79    C  CB    . PRO A  1 11  ? 40.162  5.026   21.776  1.00 80.56  ? 9   PRO A CB    1 
ATOM   80    C  CG    . PRO A  1 11  ? 40.863  4.639   23.037  1.00 81.17  ? 9   PRO A CG    1 
ATOM   81    C  CD    . PRO A  1 11  ? 41.454  5.907   23.586  1.00 80.81  ? 9   PRO A CD    1 
ATOM   82    N  N     . VAL A  1 12  ? 37.347  7.257   21.925  1.00 96.78  ? 10  VAL A N     1 
ATOM   83    C  CA    . VAL A  1 12  ? 35.944  7.389   22.302  1.00 103.52 ? 10  VAL A CA    1 
ATOM   84    C  C     . VAL A  1 12  ? 35.090  6.861   21.159  1.00 107.76 ? 10  VAL A C     1 
ATOM   85    O  O     . VAL A  1 12  ? 35.209  7.324   20.018  1.00 114.32 ? 10  VAL A O     1 
ATOM   86    C  CB    . VAL A  1 12  ? 35.580  8.844   22.633  1.00 106.55 ? 10  VAL A CB    1 
ATOM   87    C  CG1   . VAL A  1 12  ? 34.091  8.966   22.912  1.00 110.60 ? 10  VAL A CG1   1 
ATOM   88    C  CG2   . VAL A  1 12  ? 36.394  9.336   23.820  1.00 106.60 ? 10  VAL A CG2   1 
ATOM   89    N  N     . LYS A  1 13  ? 34.229  5.896   21.465  1.00 110.30 ? 11  LYS A N     1 
ATOM   90    C  CA    . LYS A  1 13  ? 33.290  5.330   20.511  1.00 114.65 ? 11  LYS A CA    1 
ATOM   91    C  C     . LYS A  1 13  ? 31.881  5.825   20.828  1.00 113.85 ? 11  LYS A C     1 
ATOM   92    O  O     . LYS A  1 13  ? 31.677  6.680   21.698  1.00 114.59 ? 11  LYS A O     1 
ATOM   93    C  CB    . LYS A  1 13  ? 33.371  3.800   20.529  1.00 117.00 ? 11  LYS A CB    1 
ATOM   94    C  CG    . LYS A  1 13  ? 34.366  3.203   19.542  1.00 126.71 ? 11  LYS A CG    1 
ATOM   95    C  CD    . LYS A  1 13  ? 35.803  3.550   19.897  1.00 133.54 ? 11  LYS A CD    1 
ATOM   96    C  CE    . LYS A  1 13  ? 36.774  2.978   18.878  1.00 135.64 ? 11  LYS A CE    1 
ATOM   97    N  NZ    . LYS A  1 13  ? 38.186  3.317   19.202  1.00 134.64 ? 11  LYS A NZ    1 
ATOM   98    N  N     . LEU A  1 14  ? 30.900  5.283   20.112  1.00 114.27 ? 12  LEU A N     1 
ATOM   99    C  CA    . LEU A  1 14  ? 29.496  5.583   20.346  1.00 116.87 ? 12  LEU A CA    1 
ATOM   100   C  C     . LEU A  1 14  ? 28.741  4.280   20.557  1.00 126.15 ? 12  LEU A C     1 
ATOM   101   O  O     . LEU A  1 14  ? 29.259  3.187   20.312  1.00 132.80 ? 12  LEU A O     1 
ATOM   102   C  CB    . LEU A  1 14  ? 28.878  6.372   19.181  1.00 119.74 ? 12  LEU A CB    1 
ATOM   103   C  CG    . LEU A  1 14  ? 29.477  7.736   18.827  1.00 125.74 ? 12  LEU A CG    1 
ATOM   104   C  CD1   . LEU A  1 14  ? 30.614  7.590   17.826  1.00 130.39 ? 12  LEU A CD1   1 
ATOM   105   C  CD2   . LEU A  1 14  ? 28.402  8.672   18.293  1.00 125.71 ? 12  LEU A CD2   1 
ATOM   106   N  N     . LYS A  1 15  ? 27.506  4.404   21.020  1.00 125.51 ? 13  LYS A N     1 
ATOM   107   C  CA    . LYS A  1 15  ? 26.662  3.230   21.193  1.00 129.43 ? 13  LYS A CA    1 
ATOM   108   C  C     . LYS A  1 15  ? 26.308  2.657   19.825  1.00 141.01 ? 13  LYS A C     1 
ATOM   109   O  O     . LYS A  1 15  ? 25.941  3.414   18.918  1.00 143.78 ? 13  LYS A O     1 
ATOM   110   C  CB    . LYS A  1 15  ? 25.400  3.591   21.972  1.00 132.52 ? 13  LYS A CB    1 
ATOM   111   C  CG    . LYS A  1 15  ? 25.684  4.151   23.359  1.00 131.65 ? 13  LYS A CG    1 
ATOM   112   C  CD    . LYS A  1 15  ? 24.405  4.504   24.099  1.00 133.25 ? 13  LYS A CD    1 
ATOM   113   C  CE    . LYS A  1 15  ? 24.710  5.056   25.483  1.00 131.59 ? 13  LYS A CE    1 
ATOM   114   N  NZ    . LYS A  1 15  ? 23.473  5.425   26.224  1.00 133.30 ? 13  LYS A NZ    1 
ATOM   115   N  N     . PRO A  1 16  ? 26.412  1.342   19.633  1.00 140.83 ? 14  PRO A N     1 
ATOM   116   C  CA    . PRO A  1 16  ? 26.190  0.773   18.298  1.00 139.21 ? 14  PRO A CA    1 
ATOM   117   C  C     . PRO A  1 16  ? 24.757  0.972   17.830  1.00 132.79 ? 14  PRO A C     1 
ATOM   118   O  O     . PRO A  1 16  ? 23.820  1.043   18.627  1.00 136.96 ? 14  PRO A O     1 
ATOM   119   C  CB    . PRO A  1 16  ? 26.518  -0.713  18.487  1.00 138.56 ? 14  PRO A CB    1 
ATOM   120   C  CG    . PRO A  1 16  ? 26.316  -0.961  19.946  1.00 136.98 ? 14  PRO A CG    1 
ATOM   121   C  CD    . PRO A  1 16  ? 26.726  0.308   20.633  1.00 135.89 ? 14  PRO A CD    1 
ATOM   122   N  N     . GLY A  1 17  ? 24.598  1.065   16.511  1.00 126.24 ? 15  GLY A N     1 
ATOM   123   C  CA    . GLY A  1 17  ? 23.307  1.312   15.910  1.00 124.96 ? 15  GLY A CA    1 
ATOM   124   C  C     . GLY A  1 17  ? 22.849  2.753   15.939  1.00 124.47 ? 15  GLY A C     1 
ATOM   125   O  O     . GLY A  1 17  ? 21.750  3.044   15.450  1.00 119.94 ? 15  GLY A O     1 
ATOM   126   N  N     . MET A  1 18  ? 23.648  3.662   16.491  1.00 122.28 ? 16  MET A N     1 
ATOM   127   C  CA    . MET A  1 18  ? 23.296  5.069   16.587  1.00 124.34 ? 16  MET A CA    1 
ATOM   128   C  C     . MET A  1 18  ? 24.347  5.917   15.882  1.00 122.24 ? 16  MET A C     1 
ATOM   129   O  O     . MET A  1 18  ? 25.517  5.535   15.789  1.00 114.95 ? 16  MET A O     1 
ATOM   130   C  CB    . MET A  1 18  ? 23.163  5.509   18.050  1.00 129.59 ? 16  MET A CB    1 
ATOM   131   C  CG    . MET A  1 18  ? 22.107  4.742   18.829  1.00 134.37 ? 16  MET A CG    1 
ATOM   132   S  SD    . MET A  1 18  ? 22.016  5.237   20.560  1.00 143.08 ? 16  MET A SD    1 
ATOM   133   C  CE    . MET A  1 18  ? 20.703  4.169   21.147  1.00 140.64 ? 16  MET A CE    1 
ATOM   134   N  N     . ASP A  1 19  ? 23.915  7.076   15.388  1.00 131.09 ? 17  ASP A N     1 
ATOM   135   C  CA    . ASP A  1 19  ? 24.759  7.988   14.639  1.00 138.13 ? 17  ASP A CA    1 
ATOM   136   C  C     . ASP A  1 19  ? 25.118  9.192   15.516  1.00 138.39 ? 17  ASP A C     1 
ATOM   137   O  O     . ASP A  1 19  ? 25.100  9.104   16.752  1.00 145.68 ? 17  ASP A O     1 
ATOM   138   C  CB    . ASP A  1 19  ? 24.039  8.380   13.345  1.00 143.97 ? 17  ASP A CB    1 
ATOM   139   C  CG    . ASP A  1 19  ? 24.995  8.811   12.250  1.00 148.05 ? 17  ASP A CG    1 
ATOM   140   O  OD1   . ASP A  1 19  ? 26.223  8.728   12.464  1.00 146.39 ? 17  ASP A OD1   1 
ATOM   141   O  OD2   . ASP A  1 19  ? 24.518  9.236   11.177  1.00 152.72 ? 17  ASP A OD2   1 
ATOM   142   N  N     . GLY A  1 20  ? 25.442  10.314  14.878  1.00 136.19 ? 18  GLY A N     1 
ATOM   143   C  CA    . GLY A  1 20  ? 25.807  11.517  15.586  1.00 127.17 ? 18  GLY A CA    1 
ATOM   144   C  C     . GLY A  1 20  ? 24.635  12.459  15.770  1.00 138.09 ? 18  GLY A C     1 
ATOM   145   O  O     . GLY A  1 20  ? 23.503  12.166  15.372  1.00 140.38 ? 18  GLY A O     1 
ATOM   146   N  N     . PRO A  1 21  ? 24.887  13.617  16.377  1.00 146.04 ? 19  PRO A N     1 
ATOM   147   C  CA    . PRO A  1 21  ? 23.797  14.558  16.658  1.00 155.50 ? 19  PRO A CA    1 
ATOM   148   C  C     . PRO A  1 21  ? 23.375  15.332  15.419  1.00 161.79 ? 19  PRO A C     1 
ATOM   149   O  O     . PRO A  1 21  ? 24.198  15.703  14.578  1.00 165.52 ? 19  PRO A O     1 
ATOM   150   C  CB    . PRO A  1 21  ? 24.405  15.490  17.712  1.00 154.99 ? 19  PRO A CB    1 
ATOM   151   C  CG    . PRO A  1 21  ? 25.865  15.481  17.400  1.00 152.90 ? 19  PRO A CG    1 
ATOM   152   C  CD    . PRO A  1 21  ? 26.181  14.093  16.899  1.00 149.18 ? 19  PRO A CD    1 
ATOM   153   N  N     . LYS A  1 22  ? 22.058  15.578  15.315  1.00 162.11 ? 20  LYS A N     1 
ATOM   154   C  CA    . LYS A  1 22  ? 21.467  16.347  14.221  1.00 159.44 ? 20  LYS A CA    1 
ATOM   155   C  C     . LYS A  1 22  ? 20.358  17.229  14.807  1.00 159.77 ? 20  LYS A C     1 
ATOM   156   O  O     . LYS A  1 22  ? 19.166  16.996  14.616  1.00 162.17 ? 20  LYS A O     1 
ATOM   157   C  CB    . LYS A  1 22  ? 20.930  15.436  13.114  1.00 157.32 ? 20  LYS A CB    1 
ATOM   158   C  CG    . LYS A  1 22  ? 21.989  14.596  12.416  1.00 153.57 ? 20  LYS A CG    1 
ATOM   159   C  CD    . LYS A  1 22  ? 21.361  13.625  11.430  1.00 154.65 ? 20  LYS A CD    1 
ATOM   160   C  CE    . LYS A  1 22  ? 22.408  12.718  10.804  1.00 153.10 ? 20  LYS A CE    1 
ATOM   161   N  NZ    . LYS A  1 22  ? 21.797  11.715  9.889   1.00 151.95 ? 20  LYS A NZ    1 
ATOM   162   N  N     . VAL A  1 23  ? 20.760  18.266  15.538  1.00 157.56 ? 21  VAL A N     1 
ATOM   163   C  CA    . VAL A  1 23  ? 19.836  19.172  16.209  1.00 156.61 ? 21  VAL A CA    1 
ATOM   164   C  C     . VAL A  1 23  ? 20.023  20.572  15.642  1.00 156.55 ? 21  VAL A C     1 
ATOM   165   O  O     . VAL A  1 23  ? 21.155  21.018  15.425  1.00 158.53 ? 21  VAL A O     1 
ATOM   166   C  CB    . VAL A  1 23  ? 20.049  19.167  17.738  1.00 155.69 ? 21  VAL A CB    1 
ATOM   167   C  CG1   . VAL A  1 23  ? 19.022  20.055  18.426  1.00 156.39 ? 21  VAL A CG1   1 
ATOM   168   C  CG2   . VAL A  1 23  ? 19.980  17.747  18.278  1.00 153.22 ? 21  VAL A CG2   1 
ATOM   169   N  N     . LYS A  1 24  ? 18.910  21.260  15.402  1.00 155.87 ? 22  LYS A N     1 
ATOM   170   C  CA    . LYS A  1 24  ? 18.959  22.612  14.869  1.00 151.07 ? 22  LYS A CA    1 
ATOM   171   C  C     . LYS A  1 24  ? 19.406  23.598  15.947  1.00 159.31 ? 22  LYS A C     1 
ATOM   172   O  O     . LYS A  1 24  ? 19.260  23.359  17.149  1.00 158.23 ? 22  LYS A O     1 
ATOM   173   C  CB    . LYS A  1 24  ? 17.591  23.014  14.313  1.00 142.35 ? 22  LYS A CB    1 
ATOM   174   C  CG    . LYS A  1 24  ? 17.624  24.179  13.335  1.00 137.81 ? 22  LYS A CG    1 
ATOM   175   C  CD    . LYS A  1 24  ? 18.461  23.846  12.111  1.00 134.54 ? 22  LYS A CD    1 
ATOM   176   C  CE    . LYS A  1 24  ? 18.465  24.993  11.114  1.00 137.44 ? 22  LYS A CE    1 
ATOM   177   N  NZ    . LYS A  1 24  ? 19.263  24.670  9.899   1.00 138.48 ? 22  LYS A NZ    1 
ATOM   178   N  N     . GLN A  1 25  ? 19.959  24.722  15.496  1.00 166.04 ? 23  GLN A N     1 
ATOM   179   C  CA    . GLN A  1 25  ? 20.468  25.740  16.401  1.00 171.67 ? 23  GLN A CA    1 
ATOM   180   C  C     . GLN A  1 25  ? 19.323  26.420  17.154  1.00 179.70 ? 23  GLN A C     1 
ATOM   181   O  O     . GLN A  1 25  ? 18.144  26.286  16.813  1.00 183.90 ? 23  GLN A O     1 
ATOM   182   C  CB    . GLN A  1 25  ? 21.283  26.779  15.630  1.00 173.23 ? 23  GLN A CB    1 
ATOM   183   C  CG    . GLN A  1 25  ? 22.557  26.234  15.004  1.00 172.20 ? 23  GLN A CG    1 
ATOM   184   C  CD    . GLN A  1 25  ? 23.645  25.975  16.027  1.00 168.97 ? 23  GLN A CD    1 
ATOM   185   O  OE1   . GLN A  1 25  ? 23.674  26.597  17.089  1.00 163.82 ? 23  GLN A OE1   1 
ATOM   186   N  NE2   . GLN A  1 25  ? 24.547  25.052  15.712  1.00 169.37 ? 23  GLN A NE2   1 
ATOM   187   N  N     . TRP A  1 26  ? 19.692  27.163  18.197  1.00 182.76 ? 24  TRP A N     1 
ATOM   188   C  CA    . TRP A  1 26  ? 18.741  27.903  19.012  1.00 188.25 ? 24  TRP A CA    1 
ATOM   189   C  C     . TRP A  1 26  ? 18.897  29.396  18.772  1.00 189.19 ? 24  TRP A C     1 
ATOM   190   O  O     . TRP A  1 26  ? 20.009  29.925  18.905  1.00 186.90 ? 24  TRP A O     1 
ATOM   191   C  CB    . TRP A  1 26  ? 18.945  27.595  20.499  1.00 192.05 ? 24  TRP A CB    1 
ATOM   192   C  CG    . TRP A  1 26  ? 18.242  26.356  20.960  1.00 196.97 ? 24  TRP A CG    1 
ATOM   193   C  CD1   . TRP A  1 26  ? 18.721  25.080  20.929  1.00 196.30 ? 24  TRP A CD1   1 
ATOM   194   C  CD2   . TRP A  1 26  ? 16.929  26.278  21.527  1.00 200.55 ? 24  TRP A CD2   1 
ATOM   195   N  NE1   . TRP A  1 26  ? 17.787  24.211  21.440  1.00 197.18 ? 24  TRP A NE1   1 
ATOM   196   C  CE2   . TRP A  1 26  ? 16.678  24.922  21.815  1.00 199.35 ? 24  TRP A CE2   1 
ATOM   197   C  CE3   . TRP A  1 26  ? 15.941  27.224  21.819  1.00 202.10 ? 24  TRP A CE3   1 
ATOM   198   C  CZ2   . TRP A  1 26  ? 15.480  24.488  22.379  1.00 199.07 ? 24  TRP A CZ2   1 
ATOM   199   C  CZ3   . TRP A  1 26  ? 14.753  26.792  22.379  1.00 201.72 ? 24  TRP A CZ3   1 
ATOM   200   C  CH2   . TRP A  1 26  ? 14.533  25.436  22.654  1.00 200.50 ? 24  TRP A CH2   1 
ATOM   201   N  N     . PRO A  1 27  ? 17.825  30.102  18.416  1.00 194.80 ? 25  PRO A N     1 
ATOM   202   C  CA    . PRO A  1 27  ? 17.924  31.559  18.230  1.00 199.62 ? 25  PRO A CA    1 
ATOM   203   C  C     . PRO A  1 27  ? 18.268  32.253  19.539  1.00 203.63 ? 25  PRO A C     1 
ATOM   204   O  O     . PRO A  1 27  ? 17.508  32.203  20.509  1.00 204.77 ? 25  PRO A O     1 
ATOM   205   C  CB    . PRO A  1 27  ? 16.527  31.947  17.728  1.00 199.98 ? 25  PRO A CB    1 
ATOM   206   C  CG    . PRO A  1 27  ? 15.940  30.677  17.194  1.00 198.48 ? 25  PRO A CG    1 
ATOM   207   C  CD    . PRO A  1 27  ? 16.492  29.589  18.059  1.00 196.35 ? 25  PRO A CD    1 
ATOM   208   N  N     . LEU A  1 28  ? 19.426  32.905  19.560  1.00 206.31 ? 26  LEU A N     1 
ATOM   209   C  CA    . LEU A  1 28  ? 19.921  33.601  20.737  1.00 208.61 ? 26  LEU A CA    1 
ATOM   210   C  C     . LEU A  1 28  ? 20.015  35.096  20.459  1.00 217.33 ? 26  LEU A C     1 
ATOM   211   O  O     . LEU A  1 28  ? 19.811  35.561  19.335  1.00 217.41 ? 26  LEU A O     1 
ATOM   212   C  CB    . LEU A  1 28  ? 21.287  33.051  21.169  1.00 202.59 ? 26  LEU A CB    1 
ATOM   213   C  CG    . LEU A  1 28  ? 21.336  31.567  21.540  1.00 198.19 ? 26  LEU A CG    1 
ATOM   214   C  CD1   . LEU A  1 28  ? 22.749  31.153  21.920  1.00 194.10 ? 26  LEU A CD1   1 
ATOM   215   C  CD2   . LEU A  1 28  ? 20.362  31.260  22.667  1.00 197.17 ? 26  LEU A CD2   1 
ATOM   216   N  N     . THR A  1 29  ? 20.332  35.849  21.509  1.00 223.74 ? 27  THR A N     1 
ATOM   217   C  CA    . THR A  1 29  ? 20.454  37.293  21.395  1.00 231.60 ? 27  THR A CA    1 
ATOM   218   C  C     . THR A  1 29  ? 21.741  37.662  20.658  1.00 232.90 ? 27  THR A C     1 
ATOM   219   O  O     . THR A  1 29  ? 22.688  36.876  20.572  1.00 232.80 ? 27  THR A O     1 
ATOM   220   C  CB    . THR A  1 29  ? 20.433  37.941  22.781  1.00 233.50 ? 27  THR A CB    1 
ATOM   221   O  OG1   . THR A  1 29  ? 19.549  37.207  23.637  1.00 234.27 ? 27  THR A OG1   1 
ATOM   222   C  CG2   . THR A  1 29  ? 19.945  39.382  22.696  1.00 235.81 ? 27  THR A CG2   1 
ATOM   223   N  N     . GLU A  1 30  ? 21.763  38.883  20.118  1.00 232.74 ? 28  GLU A N     1 
ATOM   224   C  CA    . GLU A  1 30  ? 22.939  39.374  19.409  1.00 228.89 ? 28  GLU A CA    1 
ATOM   225   C  C     . GLU A  1 30  ? 24.139  39.581  20.325  1.00 217.73 ? 28  GLU A C     1 
ATOM   226   O  O     . GLU A  1 30  ? 25.259  39.723  19.823  1.00 221.83 ? 28  GLU A O     1 
ATOM   227   C  CB    . GLU A  1 30  ? 22.615  40.684  18.684  1.00 233.40 ? 28  GLU A CB    1 
ATOM   228   C  CG    . GLU A  1 30  ? 22.264  41.850  19.599  1.00 236.84 ? 28  GLU A CG    1 
ATOM   229   C  CD    . GLU A  1 30  ? 20.830  41.803  20.092  1.00 240.95 ? 28  GLU A CD    1 
ATOM   230   O  OE1   . GLU A  1 30  ? 20.048  40.978  19.576  1.00 241.96 ? 28  GLU A OE1   1 
ATOM   231   O  OE2   . GLU A  1 30  ? 20.486  42.593  20.996  1.00 243.16 ? 28  GLU A OE2   1 
ATOM   232   N  N     . GLU A  1 31  ? 23.937  39.607  21.646  1.00 205.90 ? 29  GLU A N     1 
ATOM   233   C  CA    . GLU A  1 31  ? 25.068  39.721  22.560  1.00 190.99 ? 29  GLU A CA    1 
ATOM   234   C  C     . GLU A  1 31  ? 25.917  38.456  22.544  1.00 186.85 ? 29  GLU A C     1 
ATOM   235   O  O     . GLU A  1 31  ? 27.152  38.529  22.555  1.00 179.74 ? 29  GLU A O     1 
ATOM   236   C  CB    . GLU A  1 31  ? 24.574  40.016  23.976  1.00 184.79 ? 29  GLU A CB    1 
ATOM   237   C  CG    . GLU A  1 31  ? 25.685  40.098  25.013  1.00 177.53 ? 29  GLU A CG    1 
ATOM   238   C  CD    . GLU A  1 31  ? 25.158  40.260  26.425  1.00 171.64 ? 29  GLU A CD    1 
ATOM   239   O  OE1   . GLU A  1 31  ? 23.922  40.273  26.603  1.00 171.89 ? 29  GLU A OE1   1 
ATOM   240   O  OE2   . GLU A  1 31  ? 25.981  40.373  27.357  1.00 168.48 ? 29  GLU A OE2   1 
ATOM   241   N  N     . LYS A  1 32  ? 25.273  37.287  22.518  1.00 189.18 ? 30  LYS A N     1 
ATOM   242   C  CA    . LYS A  1 32  ? 26.008  36.030  22.447  1.00 192.07 ? 30  LYS A CA    1 
ATOM   243   C  C     . LYS A  1 32  ? 26.664  35.824  21.090  1.00 201.90 ? 30  LYS A C     1 
ATOM   244   O  O     . LYS A  1 32  ? 27.638  35.069  20.993  1.00 204.93 ? 30  LYS A O     1 
ATOM   245   C  CB    . LYS A  1 32  ? 25.076  34.857  22.753  1.00 184.83 ? 30  LYS A CB    1 
ATOM   246   C  CG    . LYS A  1 32  ? 24.272  35.019  24.031  1.00 180.78 ? 30  LYS A CG    1 
ATOM   247   C  CD    . LYS A  1 32  ? 25.179  35.200  25.234  1.00 175.16 ? 30  LYS A CD    1 
ATOM   248   C  CE    . LYS A  1 32  ? 24.374  35.393  26.509  1.00 170.76 ? 30  LYS A CE    1 
ATOM   249   N  NZ    . LYS A  1 32  ? 23.500  34.222  26.797  1.00 167.52 ? 30  LYS A NZ    1 
ATOM   250   N  N     . ILE A  1 33  ? 26.154  36.477  20.043  1.00 204.30 ? 31  ILE A N     1 
ATOM   251   C  CA    . ILE A  1 33  ? 26.728  36.314  18.712  1.00 200.04 ? 31  ILE A CA    1 
ATOM   252   C  C     . ILE A  1 33  ? 28.107  36.956  18.641  1.00 190.92 ? 31  ILE A C     1 
ATOM   253   O  O     . ILE A  1 33  ? 29.047  36.381  18.080  1.00 187.29 ? 31  ILE A O     1 
ATOM   254   C  CB    . ILE A  1 33  ? 25.776  36.891  17.650  1.00 203.99 ? 31  ILE A CB    1 
ATOM   255   C  CG1   . ILE A  1 33  ? 24.409  36.211  17.738  1.00 204.96 ? 31  ILE A CG1   1 
ATOM   256   C  CG2   . ILE A  1 33  ? 26.365  36.723  16.262  1.00 203.85 ? 31  ILE A CG2   1 
ATOM   257   C  CD1   . ILE A  1 33  ? 23.414  36.716  16.721  1.00 206.66 ? 31  ILE A CD1   1 
ATOM   258   N  N     . LYS A  1 34  ? 28.255  38.150  19.210  1.00 186.31 ? 32  LYS A N     1 
ATOM   259   C  CA    . LYS A  1 34  ? 29.532  38.851  19.222  1.00 178.34 ? 32  LYS A CA    1 
ATOM   260   C  C     . LYS A  1 34  ? 30.483  38.329  20.293  1.00 177.30 ? 32  LYS A C     1 
ATOM   261   O  O     . LYS A  1 34  ? 31.542  38.930  20.508  1.00 175.80 ? 32  LYS A O     1 
ATOM   262   C  CB    . LYS A  1 34  ? 29.305  40.353  19.413  1.00 172.56 ? 32  LYS A CB    1 
ATOM   263   C  CG    . LYS A  1 34  ? 28.361  40.968  18.391  1.00 168.18 ? 32  LYS A CG    1 
ATOM   264   C  CD    . LYS A  1 34  ? 28.201  42.464  18.609  1.00 165.98 ? 32  LYS A CD    1 
ATOM   265   C  CE    . LYS A  1 34  ? 29.506  43.203  18.356  1.00 163.32 ? 32  LYS A CE    1 
ATOM   266   N  NZ    . LYS A  1 34  ? 29.972  43.039  16.951  1.00 162.76 ? 32  LYS A NZ    1 
ATOM   267   N  N     . ALA A  1 35  ? 30.132  37.233  20.967  1.00 177.17 ? 33  ALA A N     1 
ATOM   268   C  CA    . ALA A  1 35  ? 30.980  36.637  21.992  1.00 175.00 ? 33  ALA A CA    1 
ATOM   269   C  C     . ALA A  1 35  ? 31.345  35.192  21.678  1.00 179.10 ? 33  ALA A C     1 
ATOM   270   O  O     . ALA A  1 35  ? 31.886  34.498  22.548  1.00 178.93 ? 33  ALA A O     1 
ATOM   271   C  CB    . ALA A  1 35  ? 30.298  36.719  23.361  1.00 170.48 ? 33  ALA A CB    1 
ATOM   272   N  N     . LEU A  1 36  ? 31.065  34.718  20.464  1.00 180.56 ? 34  LEU A N     1 
ATOM   273   C  CA    . LEU A  1 36  ? 31.401  33.352  20.080  1.00 178.09 ? 34  LEU A CA    1 
ATOM   274   C  C     . LEU A  1 36  ? 32.111  33.325  18.733  1.00 169.38 ? 34  LEU A C     1 
ATOM   275   O  O     . LEU A  1 36  ? 32.911  32.422  18.466  1.00 169.56 ? 34  LEU A O     1 
ATOM   276   C  CB    . LEU A  1 36  ? 30.145  32.478  20.039  1.00 183.02 ? 34  LEU A CB    1 
ATOM   277   C  CG    . LEU A  1 36  ? 29.507  32.144  21.389  1.00 184.13 ? 34  LEU A CG    1 
ATOM   278   C  CD1   . LEU A  1 36  ? 28.276  31.271  21.199  1.00 184.82 ? 34  LEU A CD1   1 
ATOM   279   C  CD2   . LEU A  1 36  ? 30.514  31.463  22.304  1.00 181.63 ? 34  LEU A CD2   1 
ATOM   280   N  N     . VAL A  1 37  ? 31.820  34.305  17.874  1.00 164.63 ? 35  VAL A N     1 
ATOM   281   C  CA    . VAL A  1 37  ? 32.527  34.401  16.601  1.00 154.24 ? 35  VAL A CA    1 
ATOM   282   C  C     . VAL A  1 37  ? 34.000  34.713  16.831  1.00 163.56 ? 35  VAL A C     1 
ATOM   283   O  O     . VAL A  1 37  ? 34.867  34.249  16.080  1.00 159.92 ? 35  VAL A O     1 
ATOM   284   C  CB    . VAL A  1 37  ? 31.856  35.452  15.695  1.00 140.79 ? 35  VAL A CB    1 
ATOM   285   C  CG1   . VAL A  1 37  ? 32.595  35.573  14.369  1.00 134.61 ? 35  VAL A CG1   1 
ATOM   286   C  CG2   . VAL A  1 37  ? 30.398  35.093  15.459  1.00 137.25 ? 35  VAL A CG2   1 
ATOM   287   N  N     . GLU A  1 38  ? 34.311  35.485  17.875  1.00 170.68 ? 36  GLU A N     1 
ATOM   288   C  CA    . GLU A  1 38  ? 35.705  35.775  18.190  1.00 179.67 ? 36  GLU A CA    1 
ATOM   289   C  C     . GLU A  1 38  ? 36.406  34.569  18.801  1.00 178.72 ? 36  GLU A C     1 
ATOM   290   O  O     . GLU A  1 38  ? 37.630  34.442  18.684  1.00 181.09 ? 36  GLU A O     1 
ATOM   291   C  CB    . GLU A  1 38  ? 35.791  36.974  19.135  1.00 184.99 ? 36  GLU A CB    1 
ATOM   292   C  CG    . GLU A  1 38  ? 35.170  38.248  18.585  1.00 191.93 ? 36  GLU A CG    1 
ATOM   293   C  CD    . GLU A  1 38  ? 35.940  38.815  17.407  1.00 195.54 ? 36  GLU A CD    1 
ATOM   294   O  OE1   . GLU A  1 38  ? 37.148  38.520  17.284  1.00 195.25 ? 36  GLU A OE1   1 
ATOM   295   O  OE2   . GLU A  1 38  ? 35.336  39.555  16.602  1.00 197.97 ? 36  GLU A OE2   1 
ATOM   296   N  N     . ILE A  1 39  ? 35.657  33.679  19.451  1.00 177.41 ? 37  ILE A N     1 
ATOM   297   C  CA    . ILE A  1 39  ? 36.263  32.504  20.069  1.00 173.24 ? 37  ILE A CA    1 
ATOM   298   C  C     . ILE A  1 39  ? 36.602  31.457  19.016  1.00 181.39 ? 37  ILE A C     1 
ATOM   299   O  O     . ILE A  1 39  ? 37.713  30.915  18.995  1.00 178.93 ? 37  ILE A O     1 
ATOM   300   C  CB    . ILE A  1 39  ? 35.334  31.932  21.155  1.00 167.15 ? 37  ILE A CB    1 
ATOM   301   C  CG1   . ILE A  1 39  ? 35.116  32.959  22.268  1.00 163.68 ? 37  ILE A CG1   1 
ATOM   302   C  CG2   . ILE A  1 39  ? 35.907  30.643  21.723  1.00 163.33 ? 37  ILE A CG2   1 
ATOM   303   C  CD1   . ILE A  1 39  ? 34.279  32.443  23.419  1.00 159.01 ? 37  ILE A CD1   1 
ATOM   304   N  N     . CYS A  1 40  ? 35.652  31.158  18.126  1.00 188.23 ? 38  CYS A N     1 
ATOM   305   C  CA    . CYS A  1 40  ? 35.885  30.157  17.091  1.00 194.51 ? 38  CYS A CA    1 
ATOM   306   C  C     . CYS A  1 40  ? 36.968  30.578  16.107  1.00 186.87 ? 38  CYS A C     1 
ATOM   307   O  O     . CYS A  1 40  ? 37.565  29.714  15.455  1.00 188.05 ? 38  CYS A O     1 
ATOM   308   C  CB    . CYS A  1 40  ? 34.585  29.863  16.341  1.00 204.80 ? 38  CYS A CB    1 
ATOM   309   S  SG    . CYS A  1 40  ? 33.277  29.162  17.374  1.00 208.55 ? 38  CYS A SG    1 
ATOM   310   N  N     . THR A  1 41  ? 37.234  31.879  15.981  1.00 179.57 ? 39  THR A N     1 
ATOM   311   C  CA    . THR A  1 41  ? 38.326  32.333  15.128  1.00 167.60 ? 39  THR A CA    1 
ATOM   312   C  C     . THR A  1 41  ? 39.670  32.202  15.835  1.00 167.84 ? 39  THR A C     1 
ATOM   313   O  O     . THR A  1 41  ? 40.667  31.815  15.215  1.00 162.87 ? 39  THR A O     1 
ATOM   314   C  CB    . THR A  1 41  ? 38.090  33.780  14.692  1.00 155.76 ? 39  THR A CB    1 
ATOM   315   O  OG1   . THR A  1 41  ? 36.796  33.891  14.084  1.00 150.95 ? 39  THR A OG1   1 
ATOM   316   C  CG2   . THR A  1 41  ? 39.149  34.217  13.690  1.00 152.27 ? 39  THR A CG2   1 
ATOM   317   N  N     . GLU A  1 42  ? 39.714  32.515  17.133  1.00 169.54 ? 40  GLU A N     1 
ATOM   318   C  CA    . GLU A  1 42  ? 40.952  32.359  17.890  1.00 175.07 ? 40  GLU A CA    1 
ATOM   319   C  C     . GLU A  1 42  ? 41.322  30.890  18.048  1.00 176.17 ? 40  GLU A C     1 
ATOM   320   O  O     . GLU A  1 42  ? 42.491  30.519  17.892  1.00 176.77 ? 40  GLU A O     1 
ATOM   321   C  CB    . GLU A  1 42  ? 40.821  33.030  19.258  1.00 178.95 ? 40  GLU A CB    1 
ATOM   322   C  CG    . GLU A  1 42  ? 40.835  34.550  19.213  1.00 186.78 ? 40  GLU A CG    1 
ATOM   323   C  CD    . GLU A  1 42  ? 42.200  35.113  18.865  1.00 191.71 ? 40  GLU A CD    1 
ATOM   324   O  OE1   . GLU A  1 42  ? 43.206  34.393  19.039  1.00 191.88 ? 40  GLU A OE1   1 
ATOM   325   O  OE2   . GLU A  1 42  ? 42.267  36.277  18.417  1.00 194.03 ? 40  GLU A OE2   1 
ATOM   326   N  N     . MET A  1 43  ? 40.341  30.038  18.358  1.00 175.86 ? 41  MET A N     1 
ATOM   327   C  CA    . MET A  1 43  ? 40.611  28.611  18.487  1.00 175.77 ? 41  MET A CA    1 
ATOM   328   C  C     . MET A  1 43  ? 40.966  27.968  17.154  1.00 167.33 ? 41  MET A C     1 
ATOM   329   O  O     . MET A  1 43  ? 41.623  26.921  17.141  1.00 167.86 ? 41  MET A O     1 
ATOM   330   C  CB    . MET A  1 43  ? 39.407  27.900  19.108  1.00 183.54 ? 41  MET A CB    1 
ATOM   331   C  CG    . MET A  1 43  ? 39.060  28.382  20.509  1.00 191.13 ? 41  MET A CG    1 
ATOM   332   S  SD    . MET A  1 43  ? 37.653  27.512  21.226  1.00 196.89 ? 41  MET A SD    1 
ATOM   333   C  CE    . MET A  1 43  ? 38.307  25.850  21.356  1.00 198.12 ? 41  MET A CE    1 
ATOM   334   N  N     . GLU A  1 44  ? 40.548  28.566  16.036  1.00 160.78 ? 42  GLU A N     1 
ATOM   335   C  CA    . GLU A  1 44  ? 40.920  28.029  14.731  1.00 150.17 ? 42  GLU A CA    1 
ATOM   336   C  C     . GLU A  1 44  ? 42.396  28.266  14.439  1.00 147.94 ? 42  GLU A C     1 
ATOM   337   O  O     . GLU A  1 44  ? 43.072  27.393  13.881  1.00 144.45 ? 42  GLU A O     1 
ATOM   338   C  CB    . GLU A  1 44  ? 40.046  28.647  13.640  1.00 149.82 ? 42  GLU A CB    1 
ATOM   339   C  CG    . GLU A  1 44  ? 40.392  28.187  12.233  1.00 151.77 ? 42  GLU A CG    1 
ATOM   340   C  CD    . GLU A  1 44  ? 39.475  28.781  11.184  1.00 157.87 ? 42  GLU A CD    1 
ATOM   341   O  OE1   . GLU A  1 44  ? 39.282  28.141  10.130  1.00 160.00 ? 42  GLU A OE1   1 
ATOM   342   O  OE2   . GLU A  1 44  ? 38.941  29.887  11.417  1.00 161.07 ? 42  GLU A OE2   1 
ATOM   343   N  N     . LYS A  1 45  ? 42.913  29.439  14.810  1.00 148.85 ? 43  LYS A N     1 
ATOM   344   C  CA    . LYS A  1 45  ? 44.330  29.718  14.605  1.00 151.09 ? 43  LYS A CA    1 
ATOM   345   C  C     . LYS A  1 45  ? 45.202  28.925  15.572  1.00 145.04 ? 43  LYS A C     1 
ATOM   346   O  O     . LYS A  1 45  ? 46.327  28.549  15.224  1.00 144.28 ? 43  LYS A O     1 
ATOM   347   C  CB    . LYS A  1 45  ? 44.594  31.217  14.751  1.00 155.19 ? 43  LYS A CB    1 
ATOM   348   C  CG    . LYS A  1 45  ? 46.026  31.636  14.449  1.00 156.22 ? 43  LYS A CG    1 
ATOM   349   C  CD    . LYS A  1 45  ? 46.217  33.147  14.548  1.00 157.88 ? 43  LYS A CD    1 
ATOM   350   C  CE    . LYS A  1 45  ? 46.338  33.623  15.993  1.00 158.47 ? 43  LYS A CE    1 
ATOM   351   N  NZ    . LYS A  1 45  ? 45.029  33.706  16.702  1.00 160.08 ? 43  LYS A NZ    1 
ATOM   352   N  N     . GLU A  1 46  ? 44.702  28.656  16.776  1.00 142.71 ? 44  GLU A N     1 
ATOM   353   C  CA    . GLU A  1 46  ? 45.445  27.909  17.783  1.00 136.83 ? 44  GLU A CA    1 
ATOM   354   C  C     . GLU A  1 46  ? 45.341  26.399  17.603  1.00 135.35 ? 44  GLU A C     1 
ATOM   355   O  O     . GLU A  1 46  ? 45.846  25.654  18.450  1.00 131.63 ? 44  GLU A O     1 
ATOM   356   C  CB    . GLU A  1 46  ? 44.963  28.298  19.184  1.00 133.37 ? 44  GLU A CB    1 
ATOM   357   C  CG    . GLU A  1 46  ? 45.174  29.763  19.527  1.00 134.61 ? 44  GLU A CG    1 
ATOM   358   C  CD    . GLU A  1 46  ? 44.569  30.143  20.863  1.00 136.83 ? 44  GLU A CD    1 
ATOM   359   O  OE1   . GLU A  1 46  ? 43.969  29.264  21.517  1.00 135.68 ? 44  GLU A OE1   1 
ATOM   360   O  OE2   . GLU A  1 46  ? 44.692  31.321  21.260  1.00 140.09 ? 44  GLU A OE2   1 
ATOM   361   N  N     . GLY A  1 47  ? 44.704  25.933  16.531  1.00 135.88 ? 45  GLY A N     1 
ATOM   362   C  CA    . GLY A  1 47  ? 44.566  24.515  16.276  1.00 130.26 ? 45  GLY A CA    1 
ATOM   363   C  C     . GLY A  1 47  ? 43.539  23.801  17.127  1.00 123.03 ? 45  GLY A C     1 
ATOM   364   O  O     . GLY A  1 47  ? 43.390  22.580  16.989  1.00 118.76 ? 45  GLY A O     1 
ATOM   365   N  N     . LYS A  1 48  ? 42.826  24.515  17.999  1.00 122.48 ? 46  LYS A N     1 
ATOM   366   C  CA    . LYS A  1 48  ? 41.833  23.884  18.858  1.00 126.03 ? 46  LYS A CA    1 
ATOM   367   C  C     . LYS A  1 48  ? 40.517  23.618  18.140  1.00 130.66 ? 46  LYS A C     1 
ATOM   368   O  O     . LYS A  1 48  ? 39.703  22.832  18.638  1.00 129.74 ? 46  LYS A O     1 
ATOM   369   C  CB    . LYS A  1 48  ? 41.579  24.754  20.091  1.00 121.92 ? 46  LYS A CB    1 
ATOM   370   C  CG    . LYS A  1 48  ? 42.832  25.071  20.892  1.00 118.94 ? 46  LYS A CG    1 
ATOM   371   C  CD    . LYS A  1 48  ? 42.526  25.995  22.058  1.00 119.29 ? 46  LYS A CD    1 
ATOM   372   C  CE    . LYS A  1 48  ? 43.778  26.284  22.871  1.00 123.27 ? 46  LYS A CE    1 
ATOM   373   N  NZ    . LYS A  1 48  ? 43.499  27.191  24.019  1.00 124.62 ? 46  LYS A NZ    1 
ATOM   374   N  N     . ILE A  1 49  ? 40.292  24.247  16.989  1.00 135.29 ? 47  ILE A N     1 
ATOM   375   C  CA    . ILE A  1 49  ? 39.045  24.115  16.243  1.00 141.48 ? 47  ILE A CA    1 
ATOM   376   C  C     . ILE A  1 49  ? 39.367  24.134  14.756  1.00 144.62 ? 47  ILE A C     1 
ATOM   377   O  O     . ILE A  1 49  ? 40.098  25.012  14.285  1.00 146.64 ? 47  ILE A O     1 
ATOM   378   C  CB    . ILE A  1 49  ? 38.047  25.235  16.601  1.00 146.80 ? 47  ILE A CB    1 
ATOM   379   C  CG1   . ILE A  1 49  ? 37.306  24.903  17.899  1.00 147.58 ? 47  ILE A CG1   1 
ATOM   380   C  CG2   . ILE A  1 49  ? 37.069  25.474  15.466  1.00 148.80 ? 47  ILE A CG2   1 
ATOM   381   C  CD1   . ILE A  1 49  ? 36.231  25.906  18.263  1.00 151.35 ? 47  ILE A CD1   1 
ATOM   382   N  N     . SER A  1 50  ? 38.832  23.166  14.019  1.00 142.63 ? 48  SER A N     1 
ATOM   383   C  CA    . SER A  1 50  ? 38.995  23.094  12.576  1.00 139.65 ? 48  SER A CA    1 
ATOM   384   C  C     . SER A  1 50  ? 37.659  23.344  11.888  1.00 143.41 ? 48  SER A C     1 
ATOM   385   O  O     . SER A  1 50  ? 36.593  23.065  12.444  1.00 136.39 ? 48  SER A O     1 
ATOM   386   C  CB    . SER A  1 50  ? 39.556  21.734  12.148  1.00 132.88 ? 48  SER A CB    1 
ATOM   387   O  OG    . SER A  1 50  ? 40.852  21.526  12.681  1.00 128.59 ? 48  SER A OG    1 
ATOM   388   N  N     . LYS A  1 51  ? 37.726  23.877  10.671  1.00 148.64 ? 49  LYS A N     1 
ATOM   389   C  CA    . LYS A  1 51  ? 36.532  24.179  9.896   1.00 153.46 ? 49  LYS A CA    1 
ATOM   390   C  C     . LYS A  1 51  ? 36.159  22.996  9.013   1.00 154.47 ? 49  LYS A C     1 
ATOM   391   O  O     . LYS A  1 51  ? 37.030  22.317  8.459   1.00 155.58 ? 49  LYS A O     1 
ATOM   392   C  CB    . LYS A  1 51  ? 36.742  25.431  9.042   1.00 155.03 ? 49  LYS A CB    1 
ATOM   393   C  CG    . LYS A  1 51  ? 37.972  25.386  8.150   1.00 156.29 ? 49  LYS A CG    1 
ATOM   394   C  CD    . LYS A  1 51  ? 38.127  26.680  7.366   1.00 153.75 ? 49  LYS A CD    1 
ATOM   395   C  CE    . LYS A  1 51  ? 39.385  26.666  6.515   1.00 146.93 ? 49  LYS A CE    1 
ATOM   396   N  NZ    . LYS A  1 51  ? 39.568  27.946  5.777   1.00 147.38 ? 49  LYS A NZ    1 
ATOM   397   N  N     . ILE A  1 52  ? 34.856  22.752  8.888   1.00 155.08 ? 50  ILE A N     1 
ATOM   398   C  CA    . ILE A  1 52  ? 34.348  21.638  8.096   1.00 152.85 ? 50  ILE A CA    1 
ATOM   399   C  C     . ILE A  1 52  ? 33.465  22.173  6.977   1.00 154.83 ? 50  ILE A C     1 
ATOM   400   O  O     . ILE A  1 52  ? 33.251  23.385  6.864   1.00 151.09 ? 50  ILE A O     1 
ATOM   401   C  CB    . ILE A  1 52  ? 33.576  20.636  8.975   1.00 147.63 ? 50  ILE A CB    1 
ATOM   402   C  CG1   . ILE A  1 52  ? 32.465  21.352  9.746   1.00 147.55 ? 50  ILE A CG1   1 
ATOM   403   C  CG2   . ILE A  1 52  ? 34.523  19.922  9.927   1.00 145.49 ? 50  ILE A CG2   1 
ATOM   404   C  CD1   . ILE A  1 52  ? 31.681  20.449  10.670  1.00 147.89 ? 50  ILE A CD1   1 
ATOM   405   N  N     . GLY A  1 53  ? 32.949  21.273  6.145   1.00 156.59 ? 51  GLY A N     1 
ATOM   406   C  CA    . GLY A  1 53  ? 32.093  21.651  5.046   1.00 159.53 ? 51  GLY A CA    1 
ATOM   407   C  C     . GLY A  1 53  ? 30.832  20.815  4.985   1.00 162.72 ? 51  GLY A C     1 
ATOM   408   O  O     . GLY A  1 53  ? 30.301  20.372  6.009   1.00 156.78 ? 51  GLY A O     1 
ATOM   409   N  N     . PRO A  1 54  ? 30.324  20.581  3.771   1.00 169.07 ? 52  PRO A N     1 
ATOM   410   C  CA    . PRO A  1 54  ? 29.093  19.788  3.627   1.00 174.08 ? 52  PRO A CA    1 
ATOM   411   C  C     . PRO A  1 54  ? 29.288  18.298  3.853   1.00 174.57 ? 52  PRO A C     1 
ATOM   412   O  O     . PRO A  1 54  ? 28.291  17.566  3.905   1.00 172.25 ? 52  PRO A O     1 
ATOM   413   C  CB    . PRO A  1 54  ? 28.662  20.076  2.184   1.00 176.28 ? 52  PRO A CB    1 
ATOM   414   C  CG    . PRO A  1 54  ? 29.940  20.379  1.475   1.00 173.88 ? 52  PRO A CG    1 
ATOM   415   C  CD    . PRO A  1 54  ? 30.815  21.087  2.477   1.00 171.08 ? 52  PRO A CD    1 
ATOM   416   N  N     . GLU A  1 55  ? 30.526  17.824  3.990   1.00 177.61 ? 53  GLU A N     1 
ATOM   417   C  CA    . GLU A  1 55  ? 30.786  16.407  4.213   1.00 177.92 ? 53  GLU A CA    1 
ATOM   418   C  C     . GLU A  1 55  ? 30.528  15.973  5.650   1.00 181.89 ? 53  GLU A C     1 
ATOM   419   O  O     . GLU A  1 55  ? 30.782  14.810  5.983   1.00 178.43 ? 53  GLU A O     1 
ATOM   420   C  CB    . GLU A  1 55  ? 32.229  16.065  3.826   1.00 175.64 ? 53  GLU A CB    1 
ATOM   421   C  CG    . GLU A  1 55  ? 33.286  16.567  4.804   1.00 174.10 ? 53  GLU A CG    1 
ATOM   422   C  CD    . GLU A  1 55  ? 33.519  18.063  4.711   1.00 175.53 ? 53  GLU A CD    1 
ATOM   423   O  OE1   . GLU A  1 55  ? 33.078  18.677  3.716   1.00 176.58 ? 53  GLU A OE1   1 
ATOM   424   O  OE2   . GLU A  1 55  ? 34.143  18.627  5.635   1.00 174.20 ? 53  GLU A OE2   1 
ATOM   425   N  N     . ASN A  1 56  ? 30.032  16.869  6.504   1.00 186.77 ? 54  ASN A N     1 
ATOM   426   C  CA    . ASN A  1 56  ? 29.762  16.580  7.912   1.00 191.42 ? 54  ASN A CA    1 
ATOM   427   C  C     . ASN A  1 56  ? 28.273  16.791  8.157   1.00 184.55 ? 54  ASN A C     1 
ATOM   428   O  O     . ASN A  1 56  ? 27.841  17.903  8.500   1.00 190.66 ? 54  ASN A O     1 
ATOM   429   C  CB    . ASN A  1 56  ? 30.612  17.466  8.822   1.00 199.01 ? 54  ASN A CB    1 
ATOM   430   C  CG    . ASN A  1 56  ? 30.604  17.006  10.268  1.00 204.19 ? 54  ASN A CG    1 
ATOM   431   O  OD1   . ASN A  1 56  ? 29.569  16.615  10.806  1.00 208.94 ? 54  ASN A OD1   1 
ATOM   432   N  ND2   . ASN A  1 56  ? 31.767  17.053  10.907  1.00 202.98 ? 54  ASN A ND2   1 
ATOM   433   N  N     . PRO A  1 57  ? 27.444  15.746  7.994   1.00 172.27 ? 55  PRO A N     1 
ATOM   434   C  CA    . PRO A  1 57  ? 25.989  15.873  8.149   1.00 164.38 ? 55  PRO A CA    1 
ATOM   435   C  C     . PRO A  1 57  ? 25.519  15.859  9.604   1.00 162.76 ? 55  PRO A C     1 
ATOM   436   O  O     . PRO A  1 57  ? 24.635  15.089  9.983   1.00 160.07 ? 55  PRO A O     1 
ATOM   437   C  CB    . PRO A  1 57  ? 25.463  14.661  7.375   1.00 161.51 ? 55  PRO A CB    1 
ATOM   438   C  CG    . PRO A  1 57  ? 26.529  13.636  7.557   1.00 158.34 ? 55  PRO A CG    1 
ATOM   439   C  CD    . PRO A  1 57  ? 27.837  14.389  7.574   1.00 162.16 ? 55  PRO A CD    1 
ATOM   440   N  N     . TYR A  1 58  ? 26.113  16.724  10.424  1.00 162.01 ? 56  TYR A N     1 
ATOM   441   C  CA    . TYR A  1 58  ? 25.753  16.826  11.830  1.00 160.51 ? 56  TYR A CA    1 
ATOM   442   C  C     . TYR A  1 58  ? 25.671  18.294  12.223  1.00 169.77 ? 56  TYR A C     1 
ATOM   443   O  O     . TYR A  1 58  ? 26.170  19.177  11.520  1.00 164.45 ? 56  TYR A O     1 
ATOM   444   C  CB    . TYR A  1 58  ? 26.756  16.089  12.729  1.00 147.83 ? 56  TYR A CB    1 
ATOM   445   C  CG    . TYR A  1 58  ? 26.915  14.621  12.400  1.00 136.00 ? 56  TYR A CG    1 
ATOM   446   C  CD1   . TYR A  1 58  ? 25.853  13.737  12.546  1.00 132.96 ? 56  TYR A CD1   1 
ATOM   447   C  CD2   . TYR A  1 58  ? 28.129  14.117  11.953  1.00 127.54 ? 56  TYR A CD2   1 
ATOM   448   C  CE1   . TYR A  1 58  ? 25.995  12.395  12.246  1.00 130.80 ? 56  TYR A CE1   1 
ATOM   449   C  CE2   . TYR A  1 58  ? 28.281  12.777  11.654  1.00 124.76 ? 56  TYR A CE2   1 
ATOM   450   C  CZ    . TYR A  1 58  ? 27.212  11.920  11.803  1.00 127.00 ? 56  TYR A CZ    1 
ATOM   451   O  OH    . TYR A  1 58  ? 27.361  10.586  11.505  1.00 122.80 ? 56  TYR A OH    1 
ATOM   452   N  N     . ASN A  1 59  ? 25.028  18.546  13.363  1.00 180.74 ? 57  ASN A N     1 
ATOM   453   C  CA    . ASN A  1 59  ? 24.865  19.899  13.875  1.00 194.74 ? 57  ASN A CA    1 
ATOM   454   C  C     . ASN A  1 59  ? 24.460  19.823  15.340  1.00 189.95 ? 57  ASN A C     1 
ATOM   455   O  O     . ASN A  1 59  ? 23.772  18.888  15.758  1.00 192.32 ? 57  ASN A O     1 
ATOM   456   C  CB    . ASN A  1 59  ? 23.823  20.685  13.070  1.00 210.31 ? 57  ASN A CB    1 
ATOM   457   C  CG    . ASN A  1 59  ? 23.731  22.138  13.496  1.00 220.92 ? 57  ASN A CG    1 
ATOM   458   O  OD1   . ASN A  1 59  ? 24.499  22.982  13.034  1.00 223.89 ? 57  ASN A OD1   1 
ATOM   459   N  ND2   . ASN A  1 59  ? 22.786  22.437  14.380  1.00 225.29 ? 57  ASN A ND2   1 
ATOM   460   N  N     . THR A  1 60  ? 24.895  20.821  16.115  1.00 184.20 ? 58  THR A N     1 
ATOM   461   C  CA    . THR A  1 60  ? 24.602  20.874  17.541  1.00 176.89 ? 58  THR A CA    1 
ATOM   462   C  C     . THR A  1 60  ? 24.540  22.329  17.988  1.00 185.56 ? 58  THR A C     1 
ATOM   463   O  O     . THR A  1 60  ? 25.466  23.098  17.682  1.00 183.84 ? 58  THR A O     1 
ATOM   464   C  CB    . THR A  1 60  ? 25.651  20.125  18.365  1.00 164.83 ? 58  THR A CB    1 
ATOM   465   O  OG1   . THR A  1 60  ? 25.719  18.760  17.933  1.00 159.43 ? 58  THR A OG1   1 
ATOM   466   C  CG2   . THR A  1 60  ? 25.295  20.166  19.843  1.00 159.14 ? 58  THR A CG2   1 
ATOM   467   N  N     . PRO A  1 61  ? 23.486  22.734  18.695  1.00 190.06 ? 59  PRO A N     1 
ATOM   468   C  CA    . PRO A  1 61  ? 23.405  24.120  19.167  1.00 194.17 ? 59  PRO A CA    1 
ATOM   469   C  C     . PRO A  1 61  ? 24.340  24.375  20.338  1.00 187.07 ? 59  PRO A C     1 
ATOM   470   O  O     . PRO A  1 61  ? 24.692  23.467  21.097  1.00 187.29 ? 59  PRO A O     1 
ATOM   471   C  CB    . PRO A  1 61  ? 21.938  24.263  19.587  1.00 197.16 ? 59  PRO A CB    1 
ATOM   472   C  CG    . PRO A  1 61  ? 21.527  22.877  19.956  1.00 194.34 ? 59  PRO A CG    1 
ATOM   473   C  CD    . PRO A  1 61  ? 22.275  21.962  19.024  1.00 192.46 ? 59  PRO A CD    1 
ATOM   474   N  N     . VAL A  1 62  ? 24.743  25.640  20.479  1.00 182.41 ? 60  VAL A N     1 
ATOM   475   C  CA    . VAL A  1 62  ? 25.665  26.064  21.525  1.00 171.36 ? 60  VAL A CA    1 
ATOM   476   C  C     . VAL A  1 62  ? 25.160  27.358  22.152  1.00 175.13 ? 60  VAL A C     1 
ATOM   477   O  O     . VAL A  1 62  ? 24.392  28.112  21.551  1.00 177.25 ? 60  VAL A O     1 
ATOM   478   C  CB    . VAL A  1 62  ? 27.103  26.262  20.994  1.00 162.36 ? 60  VAL A CB    1 
ATOM   479   C  CG1   . VAL A  1 62  ? 27.697  24.935  20.549  1.00 159.72 ? 60  VAL A CG1   1 
ATOM   480   C  CG2   . VAL A  1 62  ? 27.115  27.267  19.852  1.00 160.39 ? 60  VAL A CG2   1 
ATOM   481   N  N     . PHE A  1 63  ? 25.609  27.607  23.381  1.00 176.20 ? 61  PHE A N     1 
ATOM   482   C  CA    . PHE A  1 63  ? 25.266  28.823  24.102  1.00 178.39 ? 61  PHE A CA    1 
ATOM   483   C  C     . PHE A  1 63  ? 26.451  29.220  24.972  1.00 179.88 ? 61  PHE A C     1 
ATOM   484   O  O     . PHE A  1 63  ? 27.371  28.430  25.200  1.00 178.07 ? 61  PHE A O     1 
ATOM   485   C  CB    . PHE A  1 63  ? 23.996  28.639  24.945  1.00 179.17 ? 61  PHE A CB    1 
ATOM   486   C  CG    . PHE A  1 63  ? 24.208  27.837  26.198  1.00 179.85 ? 61  PHE A CG    1 
ATOM   487   C  CD1   . PHE A  1 63  ? 24.377  26.463  26.141  1.00 177.27 ? 61  PHE A CD1   1 
ATOM   488   C  CD2   . PHE A  1 63  ? 24.229  28.459  27.435  1.00 180.58 ? 61  PHE A CD2   1 
ATOM   489   C  CE1   . PHE A  1 63  ? 24.571  25.726  27.295  1.00 173.09 ? 61  PHE A CE1   1 
ATOM   490   C  CE2   . PHE A  1 63  ? 24.420  27.728  28.592  1.00 176.57 ? 61  PHE A CE2   1 
ATOM   491   C  CZ    . PHE A  1 63  ? 24.592  26.360  28.522  1.00 172.82 ? 61  PHE A CZ    1 
ATOM   492   N  N     . ALA A  1 64  ? 26.423  30.459  25.457  1.00 184.07 ? 62  ALA A N     1 
ATOM   493   C  CA    . ALA A  1 64  ? 27.524  31.000  26.242  1.00 188.61 ? 62  ALA A CA    1 
ATOM   494   C  C     . ALA A  1 64  ? 26.987  31.761  27.444  1.00 190.56 ? 62  ALA A C     1 
ATOM   495   O  O     . ALA A  1 64  ? 25.948  32.422  27.360  1.00 194.25 ? 62  ALA A O     1 
ATOM   496   C  CB    . ALA A  1 64  ? 28.413  31.924  25.398  1.00 191.12 ? 62  ALA A CB    1 
ATOM   497   N  N     . CYS A  1 65  ? 27.707  31.663  28.561  1.00 187.48 ? 63  CYS A N     1 
ATOM   498   C  CA    . CYS A  1 65  ? 27.365  32.374  29.784  1.00 183.69 ? 63  CYS A CA    1 
ATOM   499   C  C     . CYS A  1 65  ? 28.629  32.981  30.374  1.00 179.09 ? 63  CYS A C     1 
ATOM   500   O  O     . CYS A  1 65  ? 29.731  32.456  30.192  1.00 179.12 ? 63  CYS A O     1 
ATOM   501   C  CB    . CYS A  1 65  ? 26.692  31.448  30.809  1.00 181.14 ? 63  CYS A CB    1 
ATOM   502   S  SG    . CYS A  1 65  ? 26.110  32.284  32.304  1.00 179.83 ? 63  CYS A SG    1 
ATOM   503   N  N     . LYS A  1 66  ? 28.458  34.095  31.082  1.00 174.58 ? 64  LYS A N     1 
ATOM   504   C  CA    . LYS A  1 66  ? 29.594  34.814  31.645  1.00 166.76 ? 64  LYS A CA    1 
ATOM   505   C  C     . LYS A  1 66  ? 30.266  34.004  32.747  1.00 169.30 ? 64  LYS A C     1 
ATOM   506   O  O     . LYS A  1 66  ? 29.601  33.366  33.568  1.00 173.02 ? 64  LYS A O     1 
ATOM   507   C  CB    . LYS A  1 66  ? 29.141  36.165  32.197  1.00 157.54 ? 64  LYS A CB    1 
ATOM   508   C  CG    . LYS A  1 66  ? 29.504  37.360  31.330  1.00 151.12 ? 64  LYS A CG    1 
ATOM   509   C  CD    . LYS A  1 66  ? 31.007  37.579  31.295  1.00 144.63 ? 64  LYS A CD    1 
ATOM   510   C  CE    . LYS A  1 66  ? 31.348  38.972  30.792  1.00 145.51 ? 64  LYS A CE    1 
ATOM   511   N  NZ    . LYS A  1 66  ? 30.811  40.028  31.695  1.00 144.50 ? 64  LYS A NZ    1 
ATOM   512   N  N     . LYS A  1 67  ? 31.597  34.035  32.761  1.00 167.35 ? 65  LYS A N     1 
ATOM   513   C  CA    . LYS A  1 67  ? 32.348  33.398  33.833  1.00 162.59 ? 65  LYS A CA    1 
ATOM   514   C  C     . LYS A  1 67  ? 32.190  34.178  35.132  1.00 171.70 ? 65  LYS A C     1 
ATOM   515   O  O     . LYS A  1 67  ? 32.016  35.400  35.134  1.00 170.84 ? 65  LYS A O     1 
ATOM   516   C  CB    . LYS A  1 67  ? 33.830  33.294  33.472  1.00 149.60 ? 65  LYS A CB    1 
ATOM   517   C  CG    . LYS A  1 67  ? 34.175  32.170  32.511  1.00 138.98 ? 65  LYS A CG    1 
ATOM   518   C  CD    . LYS A  1 67  ? 35.681  32.050  32.337  1.00 130.03 ? 65  LYS A CD    1 
ATOM   519   C  CE    . LYS A  1 67  ? 36.047  30.893  31.422  1.00 123.32 ? 65  LYS A CE    1 
ATOM   520   N  NZ    . LYS A  1 67  ? 37.520  30.764  31.253  1.00 119.47 ? 65  LYS A NZ    1 
ATOM   521   N  N     . LYS A  1 68  ? 32.256  33.457  36.247  1.00 178.54 ? 66  LYS A N     1 
ATOM   522   C  CA    . LYS A  1 68  ? 32.139  34.081  37.556  1.00 187.51 ? 66  LYS A CA    1 
ATOM   523   C  C     . LYS A  1 68  ? 33.442  34.787  37.912  1.00 194.55 ? 66  LYS A C     1 
ATOM   524   O  O     . LYS A  1 68  ? 34.518  34.182  37.863  1.00 193.54 ? 66  LYS A O     1 
ATOM   525   C  CB    . LYS A  1 68  ? 31.793  33.036  38.616  1.00 183.96 ? 66  LYS A CB    1 
ATOM   526   C  CG    . LYS A  1 68  ? 31.515  33.620  39.992  1.00 181.24 ? 66  LYS A CG    1 
ATOM   527   C  CD    . LYS A  1 68  ? 30.336  34.578  39.948  1.00 181.91 ? 66  LYS A CD    1 
ATOM   528   C  CE    . LYS A  1 68  ? 30.056  35.175  41.317  1.00 180.95 ? 66  LYS A CE    1 
ATOM   529   N  NZ    . LYS A  1 68  ? 28.906  36.119  41.284  1.00 182.04 ? 66  LYS A NZ    1 
ATOM   530   N  N     . ASP A  1 69  ? 33.339  36.072  38.258  1.00 200.66 ? 67  ASP A N     1 
ATOM   531   C  CA    . ASP A  1 69  ? 34.483  36.873  38.701  1.00 204.35 ? 67  ASP A CA    1 
ATOM   532   C  C     . ASP A  1 69  ? 35.561  36.949  37.618  1.00 201.09 ? 67  ASP A C     1 
ATOM   533   O  O     . ASP A  1 69  ? 36.753  36.771  37.879  1.00 202.61 ? 67  ASP A O     1 
ATOM   534   C  CB    . ASP A  1 69  ? 35.053  36.327  40.015  1.00 207.86 ? 67  ASP A CB    1 
ATOM   535   C  CG    . ASP A  1 69  ? 36.035  37.280  40.672  1.00 211.66 ? 67  ASP A CG    1 
ATOM   536   O  OD1   . ASP A  1 69  ? 36.083  38.460  40.266  1.00 214.90 ? 67  ASP A OD1   1 
ATOM   537   O  OD2   . ASP A  1 69  ? 36.766  36.845  41.588  1.00 211.15 ? 67  ASP A OD2   1 
ATOM   538   N  N     . SER A  1 70  ? 35.133  37.223  36.387  1.00 195.72 ? 68  SER A N     1 
ATOM   539   C  CA    . SER A  1 70  ? 36.070  37.334  35.278  1.00 188.50 ? 68  SER A CA    1 
ATOM   540   C  C     . SER A  1 70  ? 35.398  38.053  34.118  1.00 181.99 ? 68  SER A C     1 
ATOM   541   O  O     . SER A  1 70  ? 34.191  37.919  33.902  1.00 184.30 ? 68  SER A O     1 
ATOM   542   C  CB    . SER A  1 70  ? 36.576  35.959  34.827  1.00 185.87 ? 68  SER A CB    1 
ATOM   543   O  OG    . SER A  1 70  ? 37.593  36.085  33.849  1.00 184.50 ? 68  SER A OG    1 
ATOM   544   N  N     . THR A  1 71  ? 36.201  38.816  33.374  1.00 174.02 ? 69  THR A N     1 
ATOM   545   C  CA    . THR A  1 71  ? 35.689  39.494  32.189  1.00 165.05 ? 69  THR A CA    1 
ATOM   546   C  C     . THR A  1 71  ? 35.475  38.523  31.036  1.00 167.97 ? 69  THR A C     1 
ATOM   547   O  O     . THR A  1 71  ? 34.644  38.780  30.158  1.00 168.67 ? 69  THR A O     1 
ATOM   548   C  CB    . THR A  1 71  ? 36.644  40.610  31.764  1.00 156.77 ? 69  THR A CB    1 
ATOM   549   O  OG1   . THR A  1 71  ? 37.967  40.077  31.614  1.00 152.40 ? 69  THR A OG1   1 
ATOM   550   C  CG2   . THR A  1 71  ? 36.664  41.722  32.800  1.00 153.75 ? 69  THR A CG2   1 
ATOM   551   N  N     . LYS A  1 72  ? 36.207  37.412  31.021  1.00 167.44 ? 70  LYS A N     1 
ATOM   552   C  CA    . LYS A  1 72  ? 36.113  36.463  29.922  1.00 168.33 ? 70  LYS A CA    1 
ATOM   553   C  C     . LYS A  1 72  ? 34.797  35.694  29.974  1.00 171.33 ? 70  LYS A C     1 
ATOM   554   O  O     . LYS A  1 72  ? 34.230  35.451  31.043  1.00 171.35 ? 70  LYS A O     1 
ATOM   555   C  CB    . LYS A  1 72  ? 37.288  35.484  29.959  1.00 161.61 ? 70  LYS A CB    1 
ATOM   556   C  CG    . LYS A  1 72  ? 38.648  36.136  29.769  1.00 158.06 ? 70  LYS A CG    1 
ATOM   557   C  CD    . LYS A  1 72  ? 39.754  35.094  29.704  1.00 154.00 ? 70  LYS A CD    1 
ATOM   558   C  CE    . LYS A  1 72  ? 41.101  35.735  29.411  1.00 152.77 ? 70  LYS A CE    1 
ATOM   559   N  NZ    . LYS A  1 72  ? 42.182  34.719  29.268  1.00 148.62 ? 70  LYS A NZ    1 
ATOM   560   N  N     . TRP A  1 73  ? 34.312  35.314  28.796  1.00 172.59 ? 71  TRP A N     1 
ATOM   561   C  CA    . TRP A  1 73  ? 33.101  34.522  28.666  1.00 169.16 ? 71  TRP A CA    1 
ATOM   562   C  C     . TRP A  1 73  ? 33.428  33.032  28.700  1.00 161.57 ? 71  TRP A C     1 
ATOM   563   O  O     . TRP A  1 73  ? 34.574  32.615  28.514  1.00 157.58 ? 71  TRP A O     1 
ATOM   564   C  CB    . TRP A  1 73  ? 32.369  34.864  27.366  1.00 172.24 ? 71  TRP A CB    1 
ATOM   565   C  CG    . TRP A  1 73  ? 31.610  36.158  27.407  1.00 175.53 ? 71  TRP A CG    1 
ATOM   566   C  CD1   . TRP A  1 73  ? 32.134  37.418  27.435  1.00 176.96 ? 71  TRP A CD1   1 
ATOM   567   C  CD2   . TRP A  1 73  ? 30.186  36.316  27.407  1.00 175.44 ? 71  TRP A CD2   1 
ATOM   568   N  NE1   . TRP A  1 73  ? 31.124  38.350  27.461  1.00 178.18 ? 71  TRP A NE1   1 
ATOM   569   C  CE2   . TRP A  1 73  ? 29.918  37.699  27.444  1.00 176.24 ? 71  TRP A CE2   1 
ATOM   570   C  CE3   . TRP A  1 73  ? 29.111  35.422  27.383  1.00 173.24 ? 71  TRP A CE3   1 
ATOM   571   C  CZ2   . TRP A  1 73  ? 28.621  38.208  27.457  1.00 174.65 ? 71  TRP A CZ2   1 
ATOM   572   C  CZ3   . TRP A  1 73  ? 27.825  35.929  27.397  1.00 172.03 ? 71  TRP A CZ3   1 
ATOM   573   C  CH2   . TRP A  1 73  ? 27.591  37.309  27.433  1.00 172.52 ? 71  TRP A CH2   1 
ATOM   574   N  N     . ARG A  1 74  ? 32.396  32.227  28.942  1.00 160.98 ? 72  ARG A N     1 
ATOM   575   C  CA    . ARG A  1 74  ? 32.507  30.775  28.959  1.00 157.67 ? 72  ARG A CA    1 
ATOM   576   C  C     . ARG A  1 74  ? 31.638  30.196  27.853  1.00 160.45 ? 72  ARG A C     1 
ATOM   577   O  O     . ARG A  1 74  ? 30.466  30.563  27.725  1.00 162.47 ? 72  ARG A O     1 
ATOM   578   C  CB    . ARG A  1 74  ? 32.088  30.200  30.315  1.00 151.91 ? 72  ARG A CB    1 
ATOM   579   C  CG    . ARG A  1 74  ? 31.941  28.686  30.326  1.00 141.03 ? 72  ARG A CG    1 
ATOM   580   C  CD    . ARG A  1 74  ? 31.568  28.170  31.706  1.00 130.28 ? 72  ARG A CD    1 
ATOM   581   N  NE    . ARG A  1 74  ? 32.618  28.425  32.687  1.00 124.06 ? 72  ARG A NE    1 
ATOM   582   C  CZ    . ARG A  1 74  ? 33.667  27.632  32.880  1.00 114.89 ? 72  ARG A CZ    1 
ATOM   583   N  NH1   . ARG A  1 74  ? 33.811  26.531  32.154  1.00 106.02 ? 72  ARG A NH1   1 
ATOM   584   N  NH2   . ARG A  1 74  ? 34.575  27.941  33.796  1.00 109.43 ? 72  ARG A NH2   1 
ATOM   585   N  N     . LYS A  1 75  ? 32.212  29.297  27.059  1.00 162.13 ? 73  LYS A N     1 
ATOM   586   C  CA    . LYS A  1 75  ? 31.497  28.644  25.972  1.00 166.53 ? 73  LYS A CA    1 
ATOM   587   C  C     . LYS A  1 75  ? 31.108  27.231  26.387  1.00 166.83 ? 73  LYS A C     1 
ATOM   588   O  O     . LYS A  1 75  ? 31.943  26.474  26.893  1.00 164.28 ? 73  LYS A O     1 
ATOM   589   C  CB    . LYS A  1 75  ? 32.343  28.605  24.699  1.00 165.70 ? 73  LYS A CB    1 
ATOM   590   C  CG    . LYS A  1 75  ? 31.710  27.798  23.577  1.00 165.85 ? 73  LYS A CG    1 
ATOM   591   C  CD    . LYS A  1 75  ? 32.475  27.941  22.275  1.00 167.82 ? 73  LYS A CD    1 
ATOM   592   C  CE    . LYS A  1 75  ? 31.898  27.027  21.207  1.00 167.20 ? 73  LYS A CE    1 
ATOM   593   N  NZ    . LYS A  1 75  ? 30.425  27.204  21.070  1.00 167.82 ? 73  LYS A NZ    1 
ATOM   594   N  N     . LEU A  1 76  ? 29.842  26.885  26.170  1.00 167.80 ? 74  LEU A N     1 
ATOM   595   C  CA    . LEU A  1 76  ? 29.315  25.570  26.497  1.00 165.42 ? 74  LEU A CA    1 
ATOM   596   C  C     . LEU A  1 76  ? 28.560  25.018  25.297  1.00 164.34 ? 74  LEU A C     1 
ATOM   597   O  O     . LEU A  1 76  ? 27.976  25.769  24.512  1.00 170.54 ? 74  LEU A O     1 
ATOM   598   C  CB    . LEU A  1 76  ? 28.388  25.627  27.721  1.00 163.49 ? 74  LEU A CB    1 
ATOM   599   C  CG    . LEU A  1 76  ? 28.974  26.255  28.988  1.00 157.93 ? 74  LEU A CG    1 
ATOM   600   C  CD1   . LEU A  1 76  ? 27.886  26.497  30.022  1.00 155.20 ? 74  LEU A CD1   1 
ATOM   601   C  CD2   . LEU A  1 76  ? 30.077  25.380  29.563  1.00 154.66 ? 74  LEU A CD2   1 
ATOM   602   N  N     . VAL A  1 77  ? 28.580  23.695  25.156  1.00 158.42 ? 75  VAL A N     1 
ATOM   603   C  CA    . VAL A  1 77  ? 27.909  23.007  24.060  1.00 151.32 ? 75  VAL A CA    1 
ATOM   604   C  C     . VAL A  1 77  ? 26.822  22.118  24.643  1.00 153.81 ? 75  VAL A C     1 
ATOM   605   O  O     . VAL A  1 77  ? 27.089  21.308  25.538  1.00 148.87 ? 75  VAL A O     1 
ATOM   606   C  CB    . VAL A  1 77  ? 28.894  22.180  23.214  1.00 145.25 ? 75  VAL A CB    1 
ATOM   607   C  CG1   . VAL A  1 77  ? 28.173  21.558  22.031  1.00 141.44 ? 75  VAL A CG1   1 
ATOM   608   C  CG2   . VAL A  1 77  ? 30.053  23.047  22.746  1.00 147.99 ? 75  VAL A CG2   1 
ATOM   609   N  N     . ASP A  1 78  ? 25.599  22.269  24.134  1.00 156.91 ? 76  ASP A N     1 
ATOM   610   C  CA    . ASP A  1 78  ? 24.461  21.471  24.590  1.00 156.34 ? 76  ASP A CA    1 
ATOM   611   C  C     . ASP A  1 78  ? 24.498  20.127  23.866  1.00 153.59 ? 76  ASP A C     1 
ATOM   612   O  O     . ASP A  1 78  ? 23.780  19.878  22.894  1.00 156.03 ? 76  ASP A O     1 
ATOM   613   C  CB    . ASP A  1 78  ? 23.152  22.215  24.351  1.00 158.13 ? 76  ASP A CB    1 
ATOM   614   C  CG    . ASP A  1 78  ? 21.996  21.640  25.150  1.00 157.57 ? 76  ASP A CG    1 
ATOM   615   O  OD1   . ASP A  1 78  ? 21.830  20.402  25.165  1.00 156.18 ? 76  ASP A OD1   1 
ATOM   616   O  OD2   . ASP A  1 78  ? 21.254  22.430  25.771  1.00 158.33 ? 76  ASP A OD2   1 
ATOM   617   N  N     . PHE A  1 79  ? 25.367  19.242  24.361  1.00 149.06 ? 77  PHE A N     1 
ATOM   618   C  CA    . PHE A  1 79  ? 25.533  17.901  23.813  1.00 146.25 ? 77  PHE A CA    1 
ATOM   619   C  C     . PHE A  1 79  ? 24.578  16.888  24.434  1.00 146.63 ? 77  PHE A C     1 
ATOM   620   O  O     . PHE A  1 79  ? 24.916  15.701  24.522  1.00 145.42 ? 77  PHE A O     1 
ATOM   621   C  CB    . PHE A  1 79  ? 26.980  17.438  23.991  1.00 141.56 ? 77  PHE A CB    1 
ATOM   622   C  CG    . PHE A  1 79  ? 27.892  17.841  22.868  1.00 136.75 ? 77  PHE A CG    1 
ATOM   623   C  CD1   . PHE A  1 79  ? 27.416  17.937  21.571  1.00 134.92 ? 77  PHE A CD1   1 
ATOM   624   C  CD2   . PHE A  1 79  ? 29.227  18.118  23.108  1.00 133.43 ? 77  PHE A CD2   1 
ATOM   625   C  CE1   . PHE A  1 79  ? 28.255  18.303  20.535  1.00 133.72 ? 77  PHE A CE1   1 
ATOM   626   C  CE2   . PHE A  1 79  ? 30.071  18.487  22.077  1.00 131.35 ? 77  PHE A CE2   1 
ATOM   627   C  CZ    . PHE A  1 79  ? 29.584  18.579  20.788  1.00 131.72 ? 77  PHE A CZ    1 
ATOM   628   N  N     . ARG A  1 80  ? 23.389  17.323  24.863  1.00 146.33 ? 78  ARG A N     1 
ATOM   629   C  CA    . ARG A  1 80  ? 22.461  16.408  25.522  1.00 144.36 ? 78  ARG A CA    1 
ATOM   630   C  C     . ARG A  1 80  ? 22.006  15.293  24.589  1.00 142.17 ? 78  ARG A C     1 
ATOM   631   O  O     . ARG A  1 80  ? 21.730  14.178  25.047  1.00 137.95 ? 78  ARG A O     1 
ATOM   632   C  CB    . ARG A  1 80  ? 21.257  17.178  26.066  1.00 143.57 ? 78  ARG A CB    1 
ATOM   633   C  CG    . ARG A  1 80  ? 21.565  17.992  27.313  1.00 141.60 ? 78  ARG A CG    1 
ATOM   634   C  CD    . ARG A  1 80  ? 20.326  18.691  27.848  1.00 143.39 ? 78  ARG A CD    1 
ATOM   635   N  NE    . ARG A  1 80  ? 19.825  19.705  26.926  1.00 151.24 ? 78  ARG A NE    1 
ATOM   636   C  CZ    . ARG A  1 80  ? 18.781  20.489  27.175  1.00 156.75 ? 78  ARG A CZ    1 
ATOM   637   N  NH1   . ARG A  1 80  ? 18.124  20.377  28.321  1.00 158.06 ? 78  ARG A NH1   1 
ATOM   638   N  NH2   . ARG A  1 80  ? 18.395  21.386  26.278  1.00 158.83 ? 78  ARG A NH2   1 
ATOM   639   N  N     . GLU A  1 81  ? 21.924  15.564  23.285  1.00 143.81 ? 79  GLU A N     1 
ATOM   640   C  CA    . GLU A  1 81  ? 21.607  14.503  22.337  1.00 144.79 ? 79  GLU A CA    1 
ATOM   641   C  C     . GLU A  1 81  ? 22.831  13.666  21.989  1.00 141.09 ? 79  GLU A C     1 
ATOM   642   O  O     . GLU A  1 81  ? 22.696  12.472  21.699  1.00 147.30 ? 79  GLU A O     1 
ATOM   643   C  CB    . GLU A  1 81  ? 20.989  15.090  21.067  1.00 146.33 ? 79  GLU A CB    1 
ATOM   644   C  CG    . GLU A  1 81  ? 19.507  15.411  21.192  1.00 144.36 ? 79  GLU A CG    1 
ATOM   645   C  CD    . GLU A  1 81  ? 18.651  14.168  21.367  1.00 136.64 ? 79  GLU A CD    1 
ATOM   646   O  OE1   . GLU A  1 81  ? 19.085  13.077  20.940  1.00 131.43 ? 79  GLU A OE1   1 
ATOM   647   O  OE2   . GLU A  1 81  ? 17.544  14.282  21.934  1.00 134.08 ? 79  GLU A OE2   1 
ATOM   648   N  N     . LEU A  1 82  ? 24.024  14.266  22.012  1.00 132.87 ? 80  LEU A N     1 
ATOM   649   C  CA    . LEU A  1 82  ? 25.237  13.492  21.774  1.00 126.02 ? 80  LEU A CA    1 
ATOM   650   C  C     . LEU A  1 82  ? 25.537  12.566  22.946  1.00 125.87 ? 80  LEU A C     1 
ATOM   651   O  O     . LEU A  1 82  ? 26.037  11.452  22.753  1.00 123.09 ? 80  LEU A O     1 
ATOM   652   C  CB    . LEU A  1 82  ? 26.419  14.427  21.511  1.00 118.66 ? 80  LEU A CB    1 
ATOM   653   C  CG    . LEU A  1 82  ? 27.769  13.745  21.272  1.00 110.94 ? 80  LEU A CG    1 
ATOM   654   C  CD1   . LEU A  1 82  ? 27.696  12.817  20.070  1.00 112.43 ? 80  LEU A CD1   1 
ATOM   655   C  CD2   . LEU A  1 82  ? 28.880  14.768  21.095  1.00 103.52 ? 80  LEU A CD2   1 
ATOM   656   N  N     . ASN A  1 83  ? 25.232  13.008  24.169  1.00 127.93 ? 81  ASN A N     1 
ATOM   657   C  CA    . ASN A  1 83  ? 25.473  12.172  25.341  1.00 126.71 ? 81  ASN A CA    1 
ATOM   658   C  C     . ASN A  1 83  ? 24.594  10.928  25.337  1.00 128.46 ? 81  ASN A C     1 
ATOM   659   O  O     . ASN A  1 83  ? 25.010  9.877   25.836  1.00 130.63 ? 81  ASN A O     1 
ATOM   660   C  CB    . ASN A  1 83  ? 25.244  12.978  26.619  1.00 123.28 ? 81  ASN A CB    1 
ATOM   661   C  CG    . ASN A  1 83  ? 26.187  14.159  26.740  1.00 120.44 ? 81  ASN A CG    1 
ATOM   662   O  OD1   . ASN A  1 83  ? 27.301  14.136  26.217  1.00 121.00 ? 81  ASN A OD1   1 
ATOM   663   N  ND2   . ASN A  1 83  ? 25.743  15.202  27.431  1.00 114.92 ? 81  ASN A ND2   1 
ATOM   664   N  N     . LYS A  1 84  ? 23.383  11.024  24.782  1.00 127.52 ? 82  LYS A N     1 
ATOM   665   C  CA    . LYS A  1 84  ? 22.501  9.866   24.715  1.00 125.14 ? 82  LYS A CA    1 
ATOM   666   C  C     . LYS A  1 84  ? 23.019  8.797   23.762  1.00 130.08 ? 82  LYS A C     1 
ATOM   667   O  O     . LYS A  1 84  ? 22.630  7.631   23.889  1.00 132.22 ? 82  LYS A O     1 
ATOM   668   C  CB    . LYS A  1 84  ? 21.095  10.295  24.290  1.00 124.43 ? 82  LYS A CB    1 
ATOM   669   C  CG    . LYS A  1 84  ? 20.403  11.234  25.263  1.00 118.20 ? 82  LYS A CG    1 
ATOM   670   C  CD    . LYS A  1 84  ? 19.040  11.659  24.737  1.00 117.26 ? 82  LYS A CD    1 
ATOM   671   C  CE    . LYS A  1 84  ? 18.350  12.619  25.691  1.00 114.87 ? 82  LYS A CE    1 
ATOM   672   N  NZ    . LYS A  1 84  ? 17.031  13.068  25.166  1.00 116.38 ? 82  LYS A NZ    1 
ATOM   673   N  N     . ARG A  1 85  ? 23.884  9.163   22.818  1.00 131.15 ? 83  ARG A N     1 
ATOM   674   C  CA    . ARG A  1 85  ? 24.404  8.231   21.829  1.00 134.73 ? 83  ARG A CA    1 
ATOM   675   C  C     . ARG A  1 85  ? 25.891  7.952   21.996  1.00 132.32 ? 83  ARG A C     1 
ATOM   676   O  O     . ARG A  1 85  ? 26.437  7.120   21.264  1.00 130.66 ? 83  ARG A O     1 
ATOM   677   C  CB    . ARG A  1 85  ? 24.127  8.759   20.417  1.00 138.47 ? 83  ARG A CB    1 
ATOM   678   C  CG    . ARG A  1 85  ? 22.669  9.120   20.178  1.00 143.68 ? 83  ARG A CG    1 
ATOM   679   C  CD    . ARG A  1 85  ? 22.452  9.704   18.792  1.00 148.08 ? 83  ARG A CD    1 
ATOM   680   N  NE    . ARG A  1 85  ? 21.075  10.152  18.605  1.00 146.96 ? 83  ARG A NE    1 
ATOM   681   C  CZ    . ARG A  1 85  ? 20.611  10.698  17.486  1.00 148.05 ? 83  ARG A CZ    1 
ATOM   682   N  NH1   . ARG A  1 85  ? 21.414  10.865  16.445  1.00 148.79 ? 83  ARG A NH1   1 
ATOM   683   N  NH2   . ARG A  1 85  ? 19.343  11.076  17.408  1.00 152.32 ? 83  ARG A NH2   1 
ATOM   684   N  N     . THR A  1 86  ? 26.557  8.619   22.933  1.00 130.98 ? 84  THR A N     1 
ATOM   685   C  CA    . THR A  1 86  ? 27.969  8.387   23.196  1.00 122.29 ? 84  THR A CA    1 
ATOM   686   C  C     . THR A  1 86  ? 28.131  7.284   24.236  1.00 110.79 ? 84  THR A C     1 
ATOM   687   O  O     . THR A  1 86  ? 27.273  7.090   25.101  1.00 106.13 ? 84  THR A O     1 
ATOM   688   C  CB    . THR A  1 86  ? 28.646  9.673   23.680  1.00 124.68 ? 84  THR A CB    1 
ATOM   689   O  OG1   . THR A  1 86  ? 28.237  10.769  22.852  1.00 131.98 ? 84  THR A OG1   1 
ATOM   690   C  CG2   . THR A  1 86  ? 30.162  9.546   23.610  1.00 122.82 ? 84  THR A CG2   1 
ATOM   691   N  N     . GLN A  1 87  ? 29.240  6.553   24.133  1.00 104.30 ? 85  GLN A N     1 
ATOM   692   C  CA    . GLN A  1 87  ? 29.514  5.467   25.065  1.00 100.85 ? 85  GLN A CA    1 
ATOM   693   C  C     . GLN A  1 87  ? 29.577  5.985   26.497  1.00 109.14 ? 85  GLN A C     1 
ATOM   694   O  O     . GLN A  1 87  ? 29.912  7.146   26.750  1.00 115.78 ? 85  GLN A O     1 
ATOM   695   C  CB    . GLN A  1 87  ? 30.831  4.776   24.709  1.00 100.43 ? 85  GLN A CB    1 
ATOM   696   C  CG    . GLN A  1 87  ? 32.050  5.681   24.806  1.00 98.90  ? 85  GLN A CG    1 
ATOM   697   C  CD    . GLN A  1 87  ? 33.353  4.906   24.833  1.00 101.12 ? 85  GLN A CD    1 
ATOM   698   O  OE1   . GLN A  1 87  ? 34.260  5.165   24.042  1.00 101.63 ? 85  GLN A OE1   1 
ATOM   699   N  NE2   . GLN A  1 87  ? 33.456  3.953   25.752  1.00 102.38 ? 85  GLN A NE2   1 
ATOM   700   N  N     . ASP A  1 88  ? 29.246  5.108   27.439  1.00 108.41 ? 86  ASP A N     1 
ATOM   701   C  CA    . ASP A  1 88  ? 29.314  5.455   28.850  1.00 103.42 ? 86  ASP A CA    1 
ATOM   702   C  C     . ASP A  1 88  ? 30.759  5.439   29.328  1.00 94.33  ? 86  ASP A C     1 
ATOM   703   O  O     . ASP A  1 88  ? 31.561  4.600   28.909  1.00 96.02  ? 86  ASP A O     1 
ATOM   704   C  CB    . ASP A  1 88  ? 28.476  4.485   29.684  1.00 103.93 ? 86  ASP A CB    1 
ATOM   705   C  CG    . ASP A  1 88  ? 26.995  4.585   29.380  1.00 110.67 ? 86  ASP A CG    1 
ATOM   706   O  OD1   . ASP A  1 88  ? 26.559  5.647   28.888  1.00 116.78 ? 86  ASP A OD1   1 
ATOM   707   O  OD2   . ASP A  1 88  ? 26.266  3.604   29.637  1.00 112.13 ? 86  ASP A OD2   1 
ATOM   708   N  N     . PHE A  1 89  ? 31.090  6.381   30.205  1.00 85.56  ? 87  PHE A N     1 
ATOM   709   C  CA    . PHE A  1 89  ? 32.411  6.472   30.805  1.00 83.00  ? 87  PHE A CA    1 
ATOM   710   C  C     . PHE A  1 89  ? 32.312  6.199   32.299  1.00 86.32  ? 87  PHE A C     1 
ATOM   711   O  O     . PHE A  1 89  ? 31.338  6.593   32.948  1.00 92.51  ? 87  PHE A O     1 
ATOM   712   C  CB    . PHE A  1 89  ? 33.036  7.851   30.574  1.00 85.04  ? 87  PHE A CB    1 
ATOM   713   C  CG    . PHE A  1 89  ? 33.237  8.194   29.126  1.00 87.15  ? 87  PHE A CG    1 
ATOM   714   C  CD1   . PHE A  1 89  ? 34.376  7.780   28.454  1.00 88.55  ? 87  PHE A CD1   1 
ATOM   715   C  CD2   . PHE A  1 89  ? 32.294  8.939   28.439  1.00 82.06  ? 87  PHE A CD2   1 
ATOM   716   C  CE1   . PHE A  1 89  ? 34.566  8.096   27.124  1.00 89.39  ? 87  PHE A CE1   1 
ATOM   717   C  CE2   . PHE A  1 89  ? 32.479  9.259   27.108  1.00 91.77  ? 87  PHE A CE2   1 
ATOM   718   C  CZ    . PHE A  1 89  ? 33.617  8.836   26.450  1.00 94.85  ? 87  PHE A CZ    1 
ATOM   719   N  N     . TRP A  1 90  ? 33.319  5.520   32.841  1.00 83.07  ? 88  TRP A N     1 
ATOM   720   C  CA    . TRP A  1 90  ? 33.424  5.331   34.280  1.00 82.28  ? 88  TRP A CA    1 
ATOM   721   C  C     . TRP A  1 90  ? 34.145  6.533   34.874  1.00 78.37  ? 88  TRP A C     1 
ATOM   722   O  O     . TRP A  1 90  ? 35.289  6.822   34.507  1.00 80.43  ? 88  TRP A O     1 
ATOM   723   C  CB    . TRP A  1 90  ? 34.163  4.040   34.627  1.00 83.29  ? 88  TRP A CB    1 
ATOM   724   C  CG    . TRP A  1 90  ? 34.138  3.765   36.094  1.00 81.97  ? 88  TRP A CG    1 
ATOM   725   C  CD1   . TRP A  1 90  ? 35.076  4.131   37.015  1.00 78.02  ? 88  TRP A CD1   1 
ATOM   726   C  CD2   . TRP A  1 90  ? 33.103  3.092   36.819  1.00 74.34  ? 88  TRP A CD2   1 
ATOM   727   N  NE1   . TRP A  1 90  ? 34.696  3.714   38.268  1.00 75.19  ? 88  TRP A NE1   1 
ATOM   728   C  CE2   . TRP A  1 90  ? 33.487  3.075   38.175  1.00 67.46  ? 88  TRP A CE2   1 
ATOM   729   C  CE3   . TRP A  1 90  ? 31.893  2.497   36.453  1.00 67.10  ? 88  TRP A CE3   1 
ATOM   730   C  CZ2   . TRP A  1 90  ? 32.704  2.486   39.164  1.00 69.61  ? 88  TRP A CZ2   1 
ATOM   731   C  CZ3   . TRP A  1 90  ? 31.117  1.912   37.436  1.00 66.61  ? 88  TRP A CZ3   1 
ATOM   732   C  CH2   . TRP A  1 90  ? 31.526  1.910   38.775  1.00 70.53  ? 88  TRP A CH2   1 
ATOM   733   N  N     . GLU A  1 91  ? 33.475  7.231   35.785  1.00 75.10  ? 89  GLU A N     1 
ATOM   734   C  CA    . GLU A  1 91  ? 34.043  8.436   36.369  1.00 79.49  ? 89  GLU A CA    1 
ATOM   735   C  C     . GLU A  1 91  ? 35.179  8.081   37.319  1.00 72.18  ? 89  GLU A C     1 
ATOM   736   O  O     . GLU A  1 91  ? 35.035  7.206   38.179  1.00 77.58  ? 89  GLU A O     1 
ATOM   737   C  CB    . GLU A  1 91  ? 32.960  9.225   37.101  1.00 79.17  ? 89  GLU A CB    1 
ATOM   738   C  CG    . GLU A  1 91  ? 31.696  9.444   36.282  1.00 79.07  ? 89  GLU A CG    1 
ATOM   739   C  CD    . GLU A  1 91  ? 31.923  10.321  35.063  1.00 89.09  ? 89  GLU A CD    1 
ATOM   740   O  OE1   . GLU A  1 91  ? 32.909  11.088  35.050  1.00 88.26  ? 89  GLU A OE1   1 
ATOM   741   O  OE2   . GLU A  1 91  ? 31.111  10.244  34.117  1.00 91.80  ? 89  GLU A OE2   1 
ATOM   742   N  N     . VAL A  1 92  ? 36.321  8.759   37.153  1.00 73.71  ? 90  VAL A N     1 
ATOM   743   C  CA    . VAL A  1 92  ? 37.462  8.558   38.039  1.00 74.40  ? 90  VAL A CA    1 
ATOM   744   C  C     . VAL A  1 92  ? 37.456  9.519   39.219  1.00 75.06  ? 90  VAL A C     1 
ATOM   745   O  O     . VAL A  1 92  ? 38.318  9.409   40.102  1.00 78.98  ? 90  VAL A O     1 
ATOM   746   C  CB    . VAL A  1 92  ? 38.791  8.687   37.265  1.00 73.47  ? 90  VAL A CB    1 
ATOM   747   C  CG1   . VAL A  1 92  ? 38.881  7.619   36.187  1.00 65.99  ? 90  VAL A CG1   1 
ATOM   748   C  CG2   . VAL A  1 92  ? 38.925  10.077  36.660  1.00 80.67  ? 90  VAL A CG2   1 
ATOM   749   N  N     . GLN A  1 93  ? 36.514  10.460  39.261  1.00 69.86  ? 91  GLN A N     1 
ATOM   750   C  CA    . GLN A  1 93  ? 36.355  11.358  40.403  1.00 77.55  ? 91  GLN A CA    1 
ATOM   751   C  C     . GLN A  1 93  ? 35.451  10.661  41.411  1.00 82.04  ? 91  GLN A C     1 
ATOM   752   O  O     . GLN A  1 93  ? 34.231  10.615  41.242  1.00 85.44  ? 91  GLN A O     1 
ATOM   753   C  CB    . GLN A  1 93  ? 35.780  12.699  39.962  1.00 83.75  ? 91  GLN A CB    1 
ATOM   754   C  CG    . GLN A  1 93  ? 35.776  13.754  41.053  1.00 87.67  ? 91  GLN A CG    1 
ATOM   755   C  CD    . GLN A  1 93  ? 37.175  14.135  41.493  1.00 89.16  ? 91  GLN A CD    1 
ATOM   756   O  OE1   . GLN A  1 93  ? 38.076  14.292  40.670  1.00 92.66  ? 91  GLN A OE1   1 
ATOM   757   N  NE2   . GLN A  1 93  ? 37.366  14.278  42.799  1.00 92.88  ? 91  GLN A NE2   1 
ATOM   758   N  N     . LEU A  1 94  ? 36.051  10.111  42.465  1.00 79.13  ? 92  LEU A N     1 
ATOM   759   C  CA    . LEU A  1 94  ? 35.318  9.306   43.432  1.00 78.37  ? 92  LEU A CA    1 
ATOM   760   C  C     . LEU A  1 94  ? 34.771  10.116  44.600  1.00 81.91  ? 92  LEU A C     1 
ATOM   761   O  O     . LEU A  1 94  ? 34.020  9.568   45.414  1.00 84.38  ? 92  LEU A O     1 
ATOM   762   C  CB    . LEU A  1 94  ? 36.213  8.184   43.967  1.00 77.61  ? 92  LEU A CB    1 
ATOM   763   C  CG    . LEU A  1 94  ? 36.929  7.336   42.912  1.00 75.13  ? 92  LEU A CG    1 
ATOM   764   C  CD1   . LEU A  1 94  ? 37.678  6.184   43.565  1.00 72.44  ? 92  LEU A CD1   1 
ATOM   765   C  CD2   . LEU A  1 94  ? 35.950  6.824   41.865  1.00 75.95  ? 92  LEU A CD2   1 
ATOM   766   N  N     . GLY A  1 95  ? 35.120  11.392  44.702  1.00 78.26  ? 93  GLY A N     1 
ATOM   767   C  CA    . GLY A  1 95  ? 34.646  12.197  45.810  1.00 72.45  ? 93  GLY A CA    1 
ATOM   768   C  C     . GLY A  1 95  ? 35.229  13.591  45.748  1.00 73.76  ? 93  GLY A C     1 
ATOM   769   O  O     . GLY A  1 95  ? 35.883  13.970  44.775  1.00 82.36  ? 93  GLY A O     1 
ATOM   770   N  N     . ILE A  1 96  ? 34.984  14.348  46.806  1.00 73.99  ? 94  ILE A N     1 
ATOM   771   C  CA    . ILE A  1 96  ? 35.392  15.747  46.904  1.00 74.88  ? 94  ILE A CA    1 
ATOM   772   C  C     . ILE A  1 96  ? 36.424  15.865  48.018  1.00 76.06  ? 94  ILE A C     1 
ATOM   773   O  O     . ILE A  1 96  ? 36.156  15.424  49.142  1.00 66.48  ? 94  ILE A O     1 
ATOM   774   C  CB    . ILE A  1 96  ? 34.192  16.674  47.178  1.00 73.40  ? 94  ILE A CB    1 
ATOM   775   C  CG1   . ILE A  1 96  ? 33.071  16.404  46.171  1.00 71.03  ? 94  ILE A CG1   1 
ATOM   776   C  CG2   . ILE A  1 96  ? 34.620  18.129  47.125  1.00 70.98  ? 94  ILE A CG2   1 
ATOM   777   C  CD1   . ILE A  1 96  ? 33.499  16.547  44.727  1.00 84.26  ? 94  ILE A CD1   1 
ATOM   778   N  N     . PRO A  1 97  ? 37.598  16.437  47.757  1.00 75.61  ? 95  PRO A N     1 
ATOM   779   C  CA    . PRO A  1 97  ? 38.586  16.610  48.829  1.00 69.38  ? 95  PRO A CA    1 
ATOM   780   C  C     . PRO A  1 97  ? 38.083  17.573  49.891  1.00 66.78  ? 95  PRO A C     1 
ATOM   781   O  O     . PRO A  1 97  ? 37.457  18.591  49.587  1.00 68.28  ? 95  PRO A O     1 
ATOM   782   C  CB    . PRO A  1 97  ? 39.812  17.174  48.100  1.00 66.13  ? 95  PRO A CB    1 
ATOM   783   C  CG    . PRO A  1 97  ? 39.598  16.839  46.657  1.00 66.65  ? 95  PRO A CG    1 
ATOM   784   C  CD    . PRO A  1 97  ? 38.117  16.879  46.453  1.00 72.31  ? 95  PRO A CD    1 
ATOM   785   N  N     . HIS A  1 98  ? 38.361  17.238  51.149  1.00 67.19  ? 96  HIS A N     1 
ATOM   786   C  CA    . HIS A  1 98  ? 37.956  18.077  52.260  1.00 66.32  ? 96  HIS A CA    1 
ATOM   787   C  C     . HIS A  1 98  ? 39.181  18.631  52.978  1.00 65.76  ? 96  HIS A C     1 
ATOM   788   O  O     . HIS A  1 98  ? 40.145  17.893  53.215  1.00 64.35  ? 96  HIS A O     1 
ATOM   789   C  CB    . HIS A  1 98  ? 37.085  17.296  53.255  1.00 65.77  ? 96  HIS A CB    1 
ATOM   790   C  CG    . HIS A  1 98  ? 36.347  18.168  54.221  1.00 66.74  ? 96  HIS A CG    1 
ATOM   791   N  ND1   . HIS A  1 98  ? 36.942  18.703  55.343  1.00 66.42  ? 96  HIS A ND1   1 
ATOM   792   C  CD2   . HIS A  1 98  ? 35.067  18.609  54.227  1.00 68.08  ? 96  HIS A CD2   1 
ATOM   793   C  CE1   . HIS A  1 98  ? 36.059  19.431  56.002  1.00 67.53  ? 96  HIS A CE1   1 
ATOM   794   N  NE2   . HIS A  1 98  ? 34.914  19.391  55.345  1.00 71.65  ? 96  HIS A NE2   1 
ATOM   795   N  N     . PRO A  1 99  ? 39.176  19.917  53.336  1.00 65.37  ? 97  PRO A N     1 
ATOM   796   C  CA    . PRO A  1 99  ? 40.373  20.513  53.954  1.00 65.56  ? 97  PRO A CA    1 
ATOM   797   C  C     . PRO A  1 99  ? 40.749  19.899  55.291  1.00 63.98  ? 97  PRO A C     1 
ATOM   798   O  O     . PRO A  1 99  ? 41.916  19.996  55.688  1.00 61.94  ? 97  PRO A O     1 
ATOM   799   C  CB    . PRO A  1 99  ? 39.990  21.993  54.104  1.00 64.53  ? 97  PRO A CB    1 
ATOM   800   C  CG    . PRO A  1 99  ? 38.497  22.003  54.099  1.00 64.20  ? 97  PRO A CG    1 
ATOM   801   C  CD    . PRO A  1 99  ? 38.093  20.900  53.169  1.00 64.49  ? 97  PRO A CD    1 
ATOM   802   N  N     . ALA A  1 100 ? 39.806  19.271  55.998  1.00 60.21  ? 98  ALA A N     1 
ATOM   803   C  CA    . ALA A  1 100 ? 40.139  18.618  57.258  1.00 59.16  ? 98  ALA A CA    1 
ATOM   804   C  C     . ALA A  1 100 ? 41.066  17.426  57.062  1.00 58.00  ? 98  ALA A C     1 
ATOM   805   O  O     . ALA A  1 100 ? 41.710  16.992  58.023  1.00 57.51  ? 98  ALA A O     1 
ATOM   806   C  CB    . ALA A  1 100 ? 38.866  18.175  57.980  1.00 64.62  ? 98  ALA A CB    1 
ATOM   807   N  N     . GLY A  1 101 ? 41.143  16.886  55.846  1.00 57.66  ? 99  GLY A N     1 
ATOM   808   C  CA    . GLY A  1 101 ? 42.066  15.812  55.542  1.00 67.94  ? 99  GLY A CA    1 
ATOM   809   C  C     . GLY A  1 101 ? 43.443  16.254  55.111  1.00 75.34  ? 99  GLY A C     1 
ATOM   810   O  O     . GLY A  1 101 ? 44.329  15.413  54.936  1.00 79.09  ? 99  GLY A O     1 
ATOM   811   N  N     . LEU A  1 102 ? 43.648  17.556  54.932  1.00 69.71  ? 100 LEU A N     1 
ATOM   812   C  CA    . LEU A  1 102 ? 44.953  18.077  54.557  1.00 68.63  ? 100 LEU A CA    1 
ATOM   813   C  C     . LEU A  1 102 ? 45.887  18.074  55.759  1.00 69.94  ? 100 LEU A C     1 
ATOM   814   O  O     . LEU A  1 102 ? 45.478  18.377  56.883  1.00 67.26  ? 100 LEU A O     1 
ATOM   815   C  CB    . LEU A  1 102 ? 44.826  19.495  54.001  1.00 65.78  ? 100 LEU A CB    1 
ATOM   816   C  CG    . LEU A  1 102 ? 43.863  19.695  52.830  1.00 64.62  ? 100 LEU A CG    1 
ATOM   817   C  CD1   . LEU A  1 102 ? 43.792  21.161  52.441  1.00 65.28  ? 100 LEU A CD1   1 
ATOM   818   C  CD2   . LEU A  1 102 ? 44.279  18.844  51.643  1.00 62.71  ? 100 LEU A CD2   1 
ATOM   819   N  N     . LYS A  1 103 ? 47.146  17.730  55.516  1.00 70.66  ? 101 LYS A N     1 
ATOM   820   C  CA    . LYS A  1 103 ? 48.154  17.733  56.561  1.00 72.03  ? 101 LYS A CA    1 
ATOM   821   C  C     . LYS A  1 103 ? 48.875  19.078  56.596  1.00 79.26  ? 101 LYS A C     1 
ATOM   822   O  O     . LYS A  1 103 ? 48.788  19.886  55.668  1.00 79.81  ? 101 LYS A O     1 
ATOM   823   C  CB    . LYS A  1 103 ? 49.145  16.588  56.348  1.00 72.07  ? 101 LYS A CB    1 
ATOM   824   C  CG    . LYS A  1 103 ? 48.482  15.225  56.235  1.00 85.41  ? 101 LYS A CG    1 
ATOM   825   C  CD    . LYS A  1 103 ? 49.491  14.128  55.939  1.00 95.06  ? 101 LYS A CD    1 
ATOM   826   C  CE    . LYS A  1 103 ? 48.796  12.792  55.724  1.00 93.63  ? 101 LYS A CE    1 
ATOM   827   N  NZ    . LYS A  1 103 ? 49.761  11.694  55.438  1.00 99.36  ? 101 LYS A NZ    1 
ATOM   828   N  N     . LYS A  1 104 ? 49.589  19.317  57.692  1.00 87.35  ? 102 LYS A N     1 
ATOM   829   C  CA    . LYS A  1 104 ? 50.320  20.568  57.855  1.00 95.73  ? 102 LYS A CA    1 
ATOM   830   C  C     . LYS A  1 104 ? 51.501  20.611  56.893  1.00 85.02  ? 102 LYS A C     1 
ATOM   831   O  O     . LYS A  1 104 ? 52.384  19.747  56.940  1.00 89.45  ? 102 LYS A O     1 
ATOM   832   C  CB    . LYS A  1 104 ? 50.796  20.719  59.298  1.00 108.10 ? 102 LYS A CB    1 
ATOM   833   C  CG    . LYS A  1 104 ? 51.766  21.872  59.518  1.00 116.50 ? 102 LYS A CG    1 
ATOM   834   C  CD    . LYS A  1 104 ? 51.159  23.206  59.110  1.00 120.14 ? 102 LYS A CD    1 
ATOM   835   C  CE    . LYS A  1 104 ? 52.175  24.331  59.229  1.00 119.76 ? 102 LYS A CE    1 
ATOM   836   N  NZ    . LYS A  1 104 ? 51.633  25.628  58.740  1.00 118.98 ? 102 LYS A NZ    1 
ATOM   837   N  N     . LYS A  1 105 ? 51.515  21.614  56.019  1.00 75.33  ? 103 LYS A N     1 
ATOM   838   C  CA    . LYS A  1 105 ? 52.607  21.833  55.082  1.00 82.22  ? 103 LYS A CA    1 
ATOM   839   C  C     . LYS A  1 105 ? 53.186  23.223  55.293  1.00 84.57  ? 103 LYS A C     1 
ATOM   840   O  O     . LYS A  1 105 ? 52.449  24.185  55.532  1.00 92.30  ? 103 LYS A O     1 
ATOM   841   C  CB    . LYS A  1 105 ? 52.141  21.671  53.632  1.00 75.19  ? 103 LYS A CB    1 
ATOM   842   C  CG    . LYS A  1 105 ? 51.782  20.244  53.259  1.00 70.87  ? 103 LYS A CG    1 
ATOM   843   C  CD    . LYS A  1 105 ? 52.928  19.297  53.571  1.00 74.38  ? 103 LYS A CD    1 
ATOM   844   C  CE    . LYS A  1 105 ? 52.552  17.855  53.277  1.00 82.31  ? 103 LYS A CE    1 
ATOM   845   N  NZ    . LYS A  1 105 ? 53.645  16.913  53.649  1.00 90.44  ? 103 LYS A NZ    1 
ATOM   846   N  N     . LYS A  1 106 ? 54.514  23.321  55.205  1.00 82.67  ? 104 LYS A N     1 
ATOM   847   C  CA    . LYS A  1 106 ? 55.174  24.605  55.414  1.00 91.35  ? 104 LYS A CA    1 
ATOM   848   C  C     . LYS A  1 106 ? 54.847  25.584  54.294  1.00 87.76  ? 104 LYS A C     1 
ATOM   849   O  O     . LYS A  1 106 ? 54.616  26.772  54.549  1.00 84.23  ? 104 LYS A O     1 
ATOM   850   C  CB    . LYS A  1 106 ? 56.685  24.402  55.527  1.00 97.33  ? 104 LYS A CB    1 
ATOM   851   C  CG    . LYS A  1 106 ? 57.456  25.650  55.924  1.00 106.43 ? 104 LYS A CG    1 
ATOM   852   C  CD    . LYS A  1 106 ? 58.946  25.365  56.024  1.00 112.42 ? 104 LYS A CD    1 
ATOM   853   C  CE    . LYS A  1 106 ? 59.229  24.248  57.017  1.00 112.16 ? 104 LYS A CE    1 
ATOM   854   N  NZ    . LYS A  1 106 ? 60.682  23.934  57.102  1.00 114.69 ? 104 LYS A NZ    1 
ATOM   855   N  N     . SER A  1 107 ? 54.815  25.107  53.052  1.00 91.52  ? 105 SER A N     1 
ATOM   856   C  CA    . SER A  1 107 ? 54.552  25.950  51.895  1.00 95.07  ? 105 SER A CA    1 
ATOM   857   C  C     . SER A  1 107 ? 53.424  25.351  51.068  1.00 91.59  ? 105 SER A C     1 
ATOM   858   O  O     . SER A  1 107 ? 53.377  24.136  50.853  1.00 84.00  ? 105 SER A O     1 
ATOM   859   C  CB    . SER A  1 107 ? 55.809  26.115  51.036  1.00 96.53  ? 105 SER A CB    1 
ATOM   860   O  OG    . SER A  1 107 ? 56.859  26.711  51.778  1.00 97.71  ? 105 SER A OG    1 
ATOM   861   N  N     . VAL A  1 108 ? 52.522  26.212  50.603  1.00 93.55  ? 106 VAL A N     1 
ATOM   862   C  CA    . VAL A  1 108 ? 51.328  25.803  49.874  1.00 84.27  ? 106 VAL A CA    1 
ATOM   863   C  C     . VAL A  1 108 ? 51.177  26.683  48.640  1.00 84.29  ? 106 VAL A C     1 
ATOM   864   O  O     . VAL A  1 108 ? 51.339  27.906  48.715  1.00 94.62  ? 106 VAL A O     1 
ATOM   865   C  CB    . VAL A  1 108 ? 50.069  25.887  50.763  1.00 85.86  ? 106 VAL A CB    1 
ATOM   866   C  CG1   . VAL A  1 108 ? 48.807  25.761  49.926  1.00 83.70  ? 106 VAL A CG1   1 
ATOM   867   C  CG2   . VAL A  1 108 ? 50.105  24.811  51.841  1.00 90.33  ? 106 VAL A CG2   1 
ATOM   868   N  N     . THR A  1 109 ? 50.870  26.058  47.504  1.00 83.77  ? 107 THR A N     1 
ATOM   869   C  CA    . THR A  1 109 ? 50.632  26.774  46.257  1.00 86.91  ? 107 THR A CA    1 
ATOM   870   C  C     . THR A  1 109 ? 49.444  26.149  45.545  1.00 92.52  ? 107 THR A C     1 
ATOM   871   O  O     . THR A  1 109 ? 49.396  24.928  45.369  1.00 94.47  ? 107 THR A O     1 
ATOM   872   C  CB    . THR A  1 109 ? 51.867  26.741  45.350  1.00 86.86  ? 107 THR A CB    1 
ATOM   873   O  OG1   . THR A  1 109 ? 52.988  27.304  46.042  1.00 93.74  ? 107 THR A OG1   1 
ATOM   874   C  CG2   . THR A  1 109 ? 51.615  27.532  44.074  1.00 83.85  ? 107 THR A CG2   1 
ATOM   875   N  N     . VAL A  1 110 ? 48.489  26.983  45.142  1.00 95.24  ? 108 VAL A N     1 
ATOM   876   C  CA    . VAL A  1 110 ? 47.294  26.539  44.432  1.00 103.60 ? 108 VAL A CA    1 
ATOM   877   C  C     . VAL A  1 110 ? 47.384  27.044  42.999  1.00 110.29 ? 108 VAL A C     1 
ATOM   878   O  O     . VAL A  1 110 ? 47.434  28.258  42.761  1.00 116.23 ? 108 VAL A O     1 
ATOM   879   C  CB    . VAL A  1 110 ? 46.009  27.034  45.112  1.00 107.77 ? 108 VAL A CB    1 
ATOM   880   C  CG1   . VAL A  1 110 ? 44.783  26.516  44.372  1.00 106.18 ? 108 VAL A CG1   1 
ATOM   881   C  CG2   . VAL A  1 110 ? 45.981  26.601  46.569  1.00 106.90 ? 108 VAL A CG2   1 
ATOM   882   N  N     . LEU A  1 111 ? 47.407  26.117  42.048  1.00 110.13 ? 109 LEU A N     1 
ATOM   883   C  CA    . LEU A  1 111 ? 47.462  26.444  40.632  1.00 107.82 ? 109 LEU A CA    1 
ATOM   884   C  C     . LEU A  1 111 ? 46.078  26.314  40.003  1.00 103.99 ? 109 LEU A C     1 
ATOM   885   O  O     . LEU A  1 111 ? 45.113  25.880  40.634  1.00 114.18 ? 109 LEU A O     1 
ATOM   886   C  CB    . LEU A  1 111 ? 48.465  25.541  39.908  1.00 104.08 ? 109 LEU A CB    1 
ATOM   887   C  CG    . LEU A  1 111 ? 49.929  25.656  40.337  1.00 103.92 ? 109 LEU A CG    1 
ATOM   888   C  CD1   . LEU A  1 111 ? 50.793  24.683  39.552  1.00 105.15 ? 109 LEU A CD1   1 
ATOM   889   C  CD2   . LEU A  1 111 ? 50.428  27.080  40.162  1.00 101.13 ? 109 LEU A CD2   1 
ATOM   890   N  N     . ASP A  1 112 ? 45.996  26.701  38.731  1.00 93.76  ? 110 ASP A N     1 
ATOM   891   C  CA    . ASP A  1 112 ? 44.741  26.618  37.986  1.00 92.11  ? 110 ASP A CA    1 
ATOM   892   C  C     . ASP A  1 112 ? 45.090  26.564  36.505  1.00 95.63  ? 110 ASP A C     1 
ATOM   893   O  O     . ASP A  1 112 ? 45.617  27.539  35.959  1.00 98.41  ? 110 ASP A O     1 
ATOM   894   C  CB    . ASP A  1 112 ? 43.840  27.806  38.303  1.00 98.66  ? 110 ASP A CB    1 
ATOM   895   C  CG    . ASP A  1 112 ? 42.399  27.580  37.881  1.00 115.80 ? 110 ASP A CG    1 
ATOM   896   O  OD1   . ASP A  1 112 ? 42.166  27.075  36.761  1.00 134.94 ? 110 ASP A OD1   1 
ATOM   897   O  OD2   . ASP A  1 112 ? 41.494  27.905  38.676  1.00 120.87 ? 110 ASP A OD2   1 
ATOM   898   N  N     . VAL A  1 113 ? 44.799  25.433  35.865  1.00 88.23  ? 111 VAL A N     1 
ATOM   899   C  CA    . VAL A  1 113 ? 45.128  25.260  34.455  1.00 89.60  ? 111 VAL A CA    1 
ATOM   900   C  C     . VAL A  1 113 ? 44.192  26.119  33.615  1.00 93.69  ? 111 VAL A C     1 
ATOM   901   O  O     . VAL A  1 113 ? 42.964  26.005  33.714  1.00 92.25  ? 111 VAL A O     1 
ATOM   902   C  CB    . VAL A  1 113 ? 45.042  23.783  34.050  1.00 84.67  ? 111 VAL A CB    1 
ATOM   903   C  CG1   . VAL A  1 113 ? 45.350  23.620  32.569  1.00 86.67  ? 111 VAL A CG1   1 
ATOM   904   C  CG2   . VAL A  1 113 ? 45.992  22.947  34.893  1.00 80.29  ? 111 VAL A CG2   1 
ATOM   905   N  N     . GLY A  1 114 ? 44.770  26.987  32.787  1.00 95.45  ? 112 GLY A N     1 
ATOM   906   C  CA    . GLY A  1 114 ? 43.971  27.800  31.887  1.00 89.57  ? 112 GLY A CA    1 
ATOM   907   C  C     . GLY A  1 114 ? 43.586  27.022  30.638  1.00 98.23  ? 112 GLY A C     1 
ATOM   908   O  O     . GLY A  1 114 ? 44.403  26.327  30.035  1.00 96.92  ? 112 GLY A O     1 
ATOM   909   N  N     . ASP A  1 115 ? 42.318  27.154  30.253  1.00 102.57 ? 113 ASP A N     1 
ATOM   910   C  CA    . ASP A  1 115 ? 41.738  26.404  29.139  1.00 111.46 ? 113 ASP A CA    1 
ATOM   911   C  C     . ASP A  1 115 ? 41.956  24.904  29.334  1.00 105.88 ? 113 ASP A C     1 
ATOM   912   O  O     . ASP A  1 115 ? 42.655  24.238  28.569  1.00 112.09 ? 113 ASP A O     1 
ATOM   913   C  CB    . ASP A  1 115 ? 42.304  26.879  27.798  1.00 121.60 ? 113 ASP A CB    1 
ATOM   914   C  CG    . ASP A  1 115 ? 41.905  28.303  27.469  1.00 129.52 ? 113 ASP A CG    1 
ATOM   915   O  OD1   . ASP A  1 115 ? 40.796  28.717  27.868  1.00 129.30 ? 113 ASP A OD1   1 
ATOM   916   O  OD2   . ASP A  1 115 ? 42.700  29.008  26.812  1.00 134.28 ? 113 ASP A OD2   1 
ATOM   917   N  N     . ALA A  1 116 ? 41.341  24.384  30.396  1.00 101.40 ? 114 ALA A N     1 
ATOM   918   C  CA    . ALA A  1 116 ? 41.497  22.988  30.784  1.00 104.26 ? 114 ALA A CA    1 
ATOM   919   C  C     . ALA A  1 116 ? 41.043  22.046  29.677  1.00 99.57  ? 114 ALA A C     1 
ATOM   920   O  O     . ALA A  1 116 ? 41.864  21.344  29.077  1.00 93.77  ? 114 ALA A O     1 
ATOM   921   C  CB    . ALA A  1 116 ? 40.720  22.706  32.071  1.00 103.17 ? 114 ALA A CB    1 
ATOM   922   N  N     . TYR A  1 117 ? 39.737  22.026  29.398  1.00 99.69  ? 115 TYR A N     1 
ATOM   923   C  CA    . TYR A  1 117 ? 39.213  21.125  28.377  1.00 98.32  ? 115 TYR A CA    1 
ATOM   924   C  C     . TYR A  1 117 ? 39.751  21.469  26.994  1.00 101.15 ? 115 TYR A C     1 
ATOM   925   O  O     . TYR A  1 117 ? 39.888  20.582  26.143  1.00 100.50 ? 115 TYR A O     1 
ATOM   926   C  CB    . TYR A  1 117 ? 37.684  21.161  28.367  1.00 95.34  ? 115 TYR A CB    1 
ATOM   927   C  CG    . TYR A  1 117 ? 37.023  20.568  29.594  1.00 100.13 ? 115 TYR A CG    1 
ATOM   928   C  CD1   . TYR A  1 117 ? 37.774  19.971  30.599  1.00 93.37  ? 115 TYR A CD1   1 
ATOM   929   C  CD2   . TYR A  1 117 ? 35.642  20.596  29.738  1.00 101.33 ? 115 TYR A CD2   1 
ATOM   930   C  CE1   . TYR A  1 117 ? 37.169  19.429  31.716  1.00 94.82  ? 115 TYR A CE1   1 
ATOM   931   C  CE2   . TYR A  1 117 ? 35.027  20.054  30.850  1.00 102.47 ? 115 TYR A CE2   1 
ATOM   932   C  CZ    . TYR A  1 117 ? 35.796  19.472  31.836  1.00 99.90  ? 115 TYR A CZ    1 
ATOM   933   O  OH    . TYR A  1 117 ? 35.188  18.933  32.947  1.00 88.68  ? 115 TYR A OH    1 
ATOM   934   N  N     . PHE A  1 118 ? 40.065  22.739  26.752  1.00 103.35 ? 116 PHE A N     1 
ATOM   935   C  CA    . PHE A  1 118 ? 40.556  23.189  25.456  1.00 109.34 ? 116 PHE A CA    1 
ATOM   936   C  C     . PHE A  1 118 ? 42.038  22.898  25.245  1.00 110.89 ? 116 PHE A C     1 
ATOM   937   O  O     . PHE A  1 118 ? 42.597  23.321  24.227  1.00 111.67 ? 116 PHE A O     1 
ATOM   938   C  CB    . PHE A  1 118 ? 40.286  24.687  25.288  1.00 117.03 ? 116 PHE A CB    1 
ATOM   939   C  CG    . PHE A  1 118 ? 38.828  25.046  25.332  1.00 121.21 ? 116 PHE A CG    1 
ATOM   940   C  CD1   . PHE A  1 118 ? 37.872  24.176  24.833  1.00 125.01 ? 116 PHE A CD1   1 
ATOM   941   C  CD2   . PHE A  1 118 ? 38.411  26.249  25.879  1.00 122.48 ? 116 PHE A CD2   1 
ATOM   942   C  CE1   . PHE A  1 118 ? 36.530  24.500  24.873  1.00 128.88 ? 116 PHE A CE1   1 
ATOM   943   C  CE2   . PHE A  1 118 ? 37.069  26.579  25.922  1.00 124.56 ? 116 PHE A CE2   1 
ATOM   944   C  CZ    . PHE A  1 118 ? 36.127  25.703  25.419  1.00 127.34 ? 116 PHE A CZ    1 
ATOM   945   N  N     . SER A  1 119 ? 42.682  22.192  26.175  1.00 107.48 ? 117 SER A N     1 
ATOM   946   C  CA    . SER A  1 119 ? 44.081  21.815  26.036  1.00 106.26 ? 117 SER A CA    1 
ATOM   947   C  C     . SER A  1 119 ? 44.289  20.315  25.880  1.00 102.84 ? 117 SER A C     1 
ATOM   948   O  O     . SER A  1 119 ? 45.421  19.888  25.630  1.00 111.40 ? 117 SER A O     1 
ATOM   949   C  CB    . SER A  1 119 ? 44.891  22.311  27.245  1.00 97.48  ? 117 SER A CB    1 
ATOM   950   O  OG    . SER A  1 119 ? 44.814  23.720  27.368  1.00 91.06  ? 117 SER A OG    1 
ATOM   951   N  N     . VAL A  1 120 ? 43.243  19.516  26.017  1.00 97.43  ? 118 VAL A N     1 
ATOM   952   C  CA    . VAL A  1 120 ? 43.315  18.062  25.890  1.00 94.00  ? 118 VAL A CA    1 
ATOM   953   C  C     . VAL A  1 120 ? 42.643  17.670  24.581  1.00 101.84 ? 118 VAL A C     1 
ATOM   954   O  O     . VAL A  1 120 ? 41.492  18.058  24.352  1.00 101.60 ? 118 VAL A O     1 
ATOM   955   C  CB    . VAL A  1 120 ? 42.644  17.350  27.080  1.00 86.06  ? 118 VAL A CB    1 
ATOM   956   C  CG1   . VAL A  1 120 ? 42.683  15.841  26.892  1.00 88.14  ? 118 VAL A CG1   1 
ATOM   957   C  CG2   . VAL A  1 120 ? 43.320  17.749  28.380  1.00 80.08  ? 118 VAL A CG2   1 
ATOM   958   N  N     . PRO A  1 121 ? 43.305  16.911  23.713  1.00 104.42 ? 119 PRO A N     1 
ATOM   959   C  CA    . PRO A  1 121 ? 42.734  16.620  22.394  1.00 105.92 ? 119 PRO A CA    1 
ATOM   960   C  C     . PRO A  1 121 ? 41.578  15.634  22.481  1.00 112.29 ? 119 PRO A C     1 
ATOM   961   O  O     . PRO A  1 121 ? 41.348  14.969  23.493  1.00 114.58 ? 119 PRO A O     1 
ATOM   962   C  CB    . PRO A  1 121 ? 43.915  16.022  21.629  1.00 105.59 ? 119 PRO A CB    1 
ATOM   963   C  CG    . PRO A  1 121 ? 44.727  15.364  22.694  1.00 105.23 ? 119 PRO A CG    1 
ATOM   964   C  CD    . PRO A  1 121 ? 44.621  16.274  23.893  1.00 105.02 ? 119 PRO A CD    1 
ATOM   965   N  N     . LEU A  1 122 ? 40.845  15.549  21.378  1.00 115.49 ? 120 LEU A N     1 
ATOM   966   C  CA    . LEU A  1 122 ? 39.762  14.594  21.210  1.00 113.65 ? 120 LEU A CA    1 
ATOM   967   C  C     . LEU A  1 122 ? 40.233  13.431  20.345  1.00 121.44 ? 120 LEU A C     1 
ATOM   968   O  O     . LEU A  1 122 ? 41.231  13.528  19.626  1.00 121.72 ? 120 LEU A O     1 
ATOM   969   C  CB    . LEU A  1 122 ? 38.540  15.270  20.578  1.00 106.46 ? 120 LEU A CB    1 
ATOM   970   C  CG    . LEU A  1 122 ? 37.203  14.527  20.610  1.00 99.60  ? 120 LEU A CG    1 
ATOM   971   C  CD1   . LEU A  1 122 ? 36.759  14.287  22.045  1.00 101.62 ? 120 LEU A CD1   1 
ATOM   972   C  CD2   . LEU A  1 122 ? 36.141  15.293  19.835  1.00 93.96  ? 120 LEU A CD2   1 
ATOM   973   N  N     . ASP A  1 123 ? 39.509  12.316  20.435  1.00 126.01 ? 121 ASP A N     1 
ATOM   974   C  CA    . ASP A  1 123 ? 39.823  11.157  19.611  1.00 131.13 ? 121 ASP A CA    1 
ATOM   975   C  C     . ASP A  1 123 ? 39.758  11.530  18.135  1.00 131.13 ? 121 ASP A C     1 
ATOM   976   O  O     . ASP A  1 123 ? 38.891  12.297  17.709  1.00 134.12 ? 121 ASP A O     1 
ATOM   977   C  CB    . ASP A  1 123 ? 38.855  10.012  19.911  1.00 134.82 ? 121 ASP A CB    1 
ATOM   978   C  CG    . ASP A  1 123 ? 39.263  8.712   19.242  1.00 138.29 ? 121 ASP A CG    1 
ATOM   979   O  OD1   . ASP A  1 123 ? 40.406  8.628   18.745  1.00 140.96 ? 121 ASP A OD1   1 
ATOM   980   O  OD2   . ASP A  1 123 ? 38.438  7.775   19.211  1.00 139.29 ? 121 ASP A OD2   1 
ATOM   981   N  N     . GLU A  1 124 ? 40.694  10.984  17.355  1.00 129.12 ? 122 GLU A N     1 
ATOM   982   C  CA    . GLU A  1 124 ? 40.782  11.335  15.941  1.00 128.01 ? 122 GLU A CA    1 
ATOM   983   C  C     . GLU A  1 124 ? 39.511  10.946  15.196  1.00 126.92 ? 122 GLU A C     1 
ATOM   984   O  O     . GLU A  1 124 ? 38.920  11.765  14.482  1.00 117.71 ? 122 GLU A O     1 
ATOM   985   C  CB    . GLU A  1 124 ? 42.005  10.665  15.313  1.00 130.53 ? 122 GLU A CB    1 
ATOM   986   C  CG    . GLU A  1 124 ? 42.261  11.059  13.865  1.00 132.61 ? 122 GLU A CG    1 
ATOM   987   C  CD    . GLU A  1 124 ? 42.723  12.497  13.719  1.00 136.25 ? 122 GLU A CD    1 
ATOM   988   O  OE1   . GLU A  1 124 ? 43.164  13.091  14.726  1.00 134.96 ? 122 GLU A OE1   1 
ATOM   989   O  OE2   . GLU A  1 124 ? 42.646  13.035  12.594  1.00 140.08 ? 122 GLU A OE2   1 
ATOM   990   N  N     . ASP A  1 125 ? 39.069  9.699   15.359  1.00 130.95 ? 123 ASP A N     1 
ATOM   991   C  CA    . ASP A  1 125 ? 37.871  9.219   14.681  1.00 136.55 ? 123 ASP A CA    1 
ATOM   992   C  C     . ASP A  1 125 ? 36.583  9.765   15.283  1.00 131.06 ? 123 ASP A C     1 
ATOM   993   O  O     . ASP A  1 125 ? 35.503  9.451   14.768  1.00 134.14 ? 123 ASP A O     1 
ATOM   994   C  CB    . ASP A  1 125 ? 37.841  7.689   14.699  1.00 141.11 ? 123 ASP A CB    1 
ATOM   995   C  CG    . ASP A  1 125 ? 39.063  7.074   14.045  1.00 145.59 ? 123 ASP A CG    1 
ATOM   996   O  OD1   . ASP A  1 125 ? 39.594  7.677   13.089  1.00 146.13 ? 123 ASP A OD1   1 
ATOM   997   O  OD2   . ASP A  1 125 ? 39.493  5.988   14.489  1.00 142.64 ? 123 ASP A OD2   1 
ATOM   998   N  N     . PHE A  1 126 ? 36.660  10.568  16.345  1.00 127.14 ? 124 PHE A N     1 
ATOM   999   C  CA    . PHE A  1 126 ? 35.478  11.099  17.006  1.00 121.89 ? 124 PHE A CA    1 
ATOM   1000  C  C     . PHE A  1 126 ? 35.261  12.586  16.759  1.00 116.58 ? 124 PHE A C     1 
ATOM   1001  O  O     . PHE A  1 126 ? 34.174  13.092  17.061  1.00 114.45 ? 124 PHE A O     1 
ATOM   1002  C  CB    . PHE A  1 126 ? 35.560  10.840  18.520  1.00 120.52 ? 124 PHE A CB    1 
ATOM   1003  C  CG    . PHE A  1 126 ? 34.246  10.983  19.236  1.00 118.32 ? 124 PHE A CG    1 
ATOM   1004  C  CD1   . PHE A  1 126 ? 33.310  9.963   19.204  1.00 117.32 ? 124 PHE A CD1   1 
ATOM   1005  C  CD2   . PHE A  1 126 ? 33.951  12.132  19.952  1.00 113.87 ? 124 PHE A CD2   1 
ATOM   1006  C  CE1   . PHE A  1 126 ? 32.102  10.089  19.864  1.00 113.70 ? 124 PHE A CE1   1 
ATOM   1007  C  CE2   . PHE A  1 126 ? 32.744  12.265  20.613  1.00 109.84 ? 124 PHE A CE2   1 
ATOM   1008  C  CZ    . PHE A  1 126 ? 31.819  11.241  20.569  1.00 109.97 ? 124 PHE A CZ    1 
ATOM   1009  N  N     . ARG A  1 127 ? 36.253  13.295  16.213  1.00 117.99 ? 125 ARG A N     1 
ATOM   1010  C  CA    . ARG A  1 127 ? 36.093  14.725  15.966  1.00 120.50 ? 125 ARG A CA    1 
ATOM   1011  C  C     . ARG A  1 127 ? 34.985  15.006  14.959  1.00 127.99 ? 125 ARG A C     1 
ATOM   1012  O  O     . ARG A  1 127 ? 34.386  16.087  14.982  1.00 129.68 ? 125 ARG A O     1 
ATOM   1013  C  CB    . ARG A  1 127 ? 37.413  15.326  15.478  1.00 115.38 ? 125 ARG A CB    1 
ATOM   1014  C  CG    . ARG A  1 127 ? 38.547  15.225  16.482  1.00 109.46 ? 125 ARG A CG    1 
ATOM   1015  C  CD    . ARG A  1 127 ? 39.854  15.751  15.910  1.00 100.66 ? 125 ARG A CD    1 
ATOM   1016  N  NE    . ARG A  1 127 ? 40.962  15.566  16.842  1.00 104.43 ? 125 ARG A NE    1 
ATOM   1017  C  CZ    . ARG A  1 127 ? 42.217  15.930  16.597  1.00 105.26 ? 125 ARG A CZ    1 
ATOM   1018  N  NH1   . ARG A  1 127 ? 42.530  16.504  15.443  1.00 108.05 ? 125 ARG A NH1   1 
ATOM   1019  N  NH2   . ARG A  1 127 ? 43.159  15.721  17.506  1.00 103.86 ? 125 ARG A NH2   1 
ATOM   1020  N  N     . LYS A  1 128 ? 34.696  14.049  14.075  1.00 132.73 ? 126 LYS A N     1 
ATOM   1021  C  CA    . LYS A  1 128 ? 33.656  14.243  13.072  1.00 133.58 ? 126 LYS A CA    1 
ATOM   1022  C  C     . LYS A  1 128 ? 32.260  14.295  13.680  1.00 132.80 ? 126 LYS A C     1 
ATOM   1023  O  O     . LYS A  1 128 ? 31.346  14.840  13.052  1.00 133.65 ? 126 LYS A O     1 
ATOM   1024  C  CB    . LYS A  1 128 ? 33.727  13.131  12.025  1.00 132.67 ? 126 LYS A CB    1 
ATOM   1025  C  CG    . LYS A  1 128 ? 33.665  11.727  12.606  1.00 129.68 ? 126 LYS A CG    1 
ATOM   1026  C  CD    . LYS A  1 128 ? 33.780  10.672  11.517  1.00 129.45 ? 126 LYS A CD    1 
ATOM   1027  C  CE    . LYS A  1 128 ? 35.110  10.769  10.787  1.00 132.42 ? 126 LYS A CE    1 
ATOM   1028  N  NZ    . LYS A  1 128 ? 36.267  10.539  11.697  1.00 129.73 ? 126 LYS A NZ    1 
ATOM   1029  N  N     . TYR A  1 129 ? 32.075  13.749  14.880  1.00 129.97 ? 127 TYR A N     1 
ATOM   1030  C  CA    . TYR A  1 129 ? 30.773  13.733  15.534  1.00 125.93 ? 127 TYR A CA    1 
ATOM   1031  C  C     . TYR A  1 129 ? 30.480  15.013  16.308  1.00 117.68 ? 127 TYR A C     1 
ATOM   1032  O  O     . TYR A  1 129 ? 29.480  15.066  17.032  1.00 113.79 ? 127 TYR A O     1 
ATOM   1033  C  CB    . TYR A  1 129 ? 30.670  12.527  16.470  1.00 129.74 ? 127 TYR A CB    1 
ATOM   1034  C  CG    . TYR A  1 129 ? 30.794  11.197  15.763  1.00 142.16 ? 127 TYR A CG    1 
ATOM   1035  C  CD1   . TYR A  1 129 ? 29.678  10.565  15.230  1.00 146.86 ? 127 TYR A CD1   1 
ATOM   1036  C  CD2   . TYR A  1 129 ? 32.028  10.574  15.626  1.00 145.76 ? 127 TYR A CD2   1 
ATOM   1037  C  CE1   . TYR A  1 129 ? 29.787  9.350   14.581  1.00 148.45 ? 127 TYR A CE1   1 
ATOM   1038  C  CE2   . TYR A  1 129 ? 32.147  9.358   14.978  1.00 147.22 ? 127 TYR A CE2   1 
ATOM   1039  C  CZ    . TYR A  1 129 ? 31.023  8.751   14.458  1.00 149.30 ? 127 TYR A CZ    1 
ATOM   1040  O  OH    . TYR A  1 129 ? 31.137  7.541   13.813  1.00 153.84 ? 127 TYR A OH    1 
ATOM   1041  N  N     . THR A  1 130 ? 31.321  16.037  16.176  1.00 118.31 ? 128 THR A N     1 
ATOM   1042  C  CA    . THR A  1 130 ? 31.150  17.313  16.870  1.00 123.30 ? 128 THR A CA    1 
ATOM   1043  C  C     . THR A  1 130 ? 31.080  18.414  15.816  1.00 147.61 ? 128 THR A C     1 
ATOM   1044  O  O     . THR A  1 130 ? 32.082  19.060  15.503  1.00 154.12 ? 128 THR A O     1 
ATOM   1045  C  CB    . THR A  1 130 ? 32.292  17.558  17.868  1.00 114.48 ? 128 THR A CB    1 
ATOM   1046  O  OG1   . THR A  1 130 ? 33.545  17.562  17.172  1.00 107.65 ? 128 THR A OG1   1 
ATOM   1047  C  CG2   . THR A  1 130 ? 32.311  16.472  18.933  1.00 114.87 ? 128 THR A CG2   1 
ATOM   1048  N  N     . ALA A  1 131 ? 29.887  18.624  15.269  1.00 156.26 ? 129 ALA A N     1 
ATOM   1049  C  CA    . ALA A  1 131 ? 29.651  19.644  14.258  1.00 164.93 ? 129 ALA A CA    1 
ATOM   1050  C  C     . ALA A  1 131 ? 28.712  20.709  14.806  1.00 166.78 ? 129 ALA A C     1 
ATOM   1051  O  O     . ALA A  1 131 ? 27.747  20.397  15.510  1.00 163.31 ? 129 ALA A O     1 
ATOM   1052  C  CB    . ALA A  1 131 ? 29.064  19.031  12.985  1.00 168.22 ? 129 ALA A CB    1 
ATOM   1053  N  N     . PHE A  1 132 ? 29.000  21.967  14.477  1.00 174.38 ? 130 PHE A N     1 
ATOM   1054  C  CA    . PHE A  1 132 ? 28.210  23.086  14.972  1.00 178.87 ? 130 PHE A CA    1 
ATOM   1055  C  C     . PHE A  1 132 ? 28.493  24.310  14.113  1.00 199.78 ? 130 PHE A C     1 
ATOM   1056  O  O     . PHE A  1 132 ? 29.639  24.552  13.726  1.00 197.42 ? 130 PHE A O     1 
ATOM   1057  C  CB    . PHE A  1 132 ? 28.514  23.377  16.449  1.00 165.90 ? 130 PHE A CB    1 
ATOM   1058  C  CG    . PHE A  1 132 ? 29.952  23.732  16.723  1.00 156.10 ? 130 PHE A CG    1 
ATOM   1059  C  CD1   . PHE A  1 132 ? 30.935  22.756  16.731  1.00 152.44 ? 130 PHE A CD1   1 
ATOM   1060  C  CD2   . PHE A  1 132 ? 30.315  25.040  16.996  1.00 149.69 ? 130 PHE A CD2   1 
ATOM   1061  C  CE1   . PHE A  1 132 ? 32.254  23.080  16.986  1.00 147.07 ? 130 PHE A CE1   1 
ATOM   1062  C  CE2   . PHE A  1 132 ? 31.633  25.369  17.256  1.00 144.96 ? 130 PHE A CE2   1 
ATOM   1063  C  CZ    . PHE A  1 132 ? 32.603  24.388  17.250  1.00 143.59 ? 130 PHE A CZ    1 
ATOM   1064  N  N     . THR A  1 133 ? 27.442  25.071  13.820  1.00 218.71 ? 131 THR A N     1 
ATOM   1065  C  CA    . THR A  1 133 ? 27.533  26.264  12.992  1.00 238.40 ? 131 THR A CA    1 
ATOM   1066  C  C     . THR A  1 133 ? 27.553  27.515  13.862  1.00 247.22 ? 131 THR A C     1 
ATOM   1067  O  O     . THR A  1 133 ? 26.992  27.540  14.960  1.00 251.75 ? 131 THR A O     1 
ATOM   1068  C  CB    . THR A  1 133 ? 26.361  26.340  12.010  1.00 243.41 ? 131 THR A CB    1 
ATOM   1069  O  OG1   . THR A  1 133 ? 25.136  26.492  12.737  1.00 244.59 ? 131 THR A OG1   1 
ATOM   1070  C  CG2   . THR A  1 133 ? 26.285  25.076  11.169  1.00 243.06 ? 131 THR A CG2   1 
ATOM   1071  N  N     . ILE A  1 134 ? 28.209  28.557  13.358  1.00 249.77 ? 132 ILE A N     1 
ATOM   1072  C  CA    . ILE A  1 134 ? 28.310  29.828  14.073  1.00 246.33 ? 132 ILE A CA    1 
ATOM   1073  C  C     . ILE A  1 134 ? 27.905  30.959  13.135  1.00 248.75 ? 132 ILE A C     1 
ATOM   1074  O  O     . ILE A  1 134 ? 28.708  31.380  12.290  1.00 249.69 ? 132 ILE A O     1 
ATOM   1075  C  CB    . ILE A  1 134 ? 29.726  30.061  14.625  1.00 242.54 ? 132 ILE A CB    1 
ATOM   1076  C  CG1   . ILE A  1 134 ? 30.140  28.931  15.570  1.00 240.28 ? 132 ILE A CG1   1 
ATOM   1077  C  CG2   . ILE A  1 134 ? 29.803  31.401  15.342  1.00 240.28 ? 132 ILE A CG2   1 
ATOM   1078  C  CD1   . ILE A  1 134 ? 30.914  27.824  14.895  1.00 240.87 ? 132 ILE A CD1   1 
ATOM   1079  N  N     . PRO A  1 135 ? 26.679  31.478  13.239  1.00 247.93 ? 133 PRO A N     1 
ATOM   1080  C  CA    . PRO A  1 135 ? 26.268  32.604  12.388  1.00 249.43 ? 133 PRO A CA    1 
ATOM   1081  C  C     . PRO A  1 135 ? 26.835  33.914  12.918  1.00 245.78 ? 133 PRO A C     1 
ATOM   1082  O  O     . PRO A  1 135 ? 26.622  34.272  14.078  1.00 244.32 ? 133 PRO A O     1 
ATOM   1083  C  CB    . PRO A  1 135 ? 24.738  32.573  12.478  1.00 250.52 ? 133 PRO A CB    1 
ATOM   1084  C  CG    . PRO A  1 135 ? 24.463  31.966  13.815  1.00 247.13 ? 133 PRO A CG    1 
ATOM   1085  C  CD    . PRO A  1 135 ? 25.572  30.976  14.072  1.00 244.98 ? 133 PRO A CD    1 
ATOM   1086  N  N     . SER A  1 136 ? 27.569  34.629  12.061  1.00 244.56 ? 134 SER A N     1 
ATOM   1087  C  CA    . SER A  1 136 ? 28.111  35.923  12.462  1.00 241.43 ? 134 SER A CA    1 
ATOM   1088  C  C     . SER A  1 136 ? 27.011  36.966  12.615  1.00 243.14 ? 134 SER A C     1 
ATOM   1089  O  O     . SER A  1 136 ? 27.166  37.919  13.387  1.00 241.45 ? 134 SER A O     1 
ATOM   1090  C  CB    . SER A  1 136 ? 29.155  36.395  11.450  1.00 242.20 ? 134 SER A CB    1 
ATOM   1091  O  OG    . SER A  1 136 ? 30.249  35.496  11.390  1.00 240.06 ? 134 SER A OG    1 
ATOM   1092  N  N     . ILE A  1 137 ? 25.907  36.808  11.890  1.00 244.70 ? 135 ILE A N     1 
ATOM   1093  C  CA    . ILE A  1 137 ? 24.745  37.678  12.009  1.00 248.23 ? 135 ILE A CA    1 
ATOM   1094  C  C     . ILE A  1 137 ? 23.548  36.813  12.376  1.00 242.10 ? 135 ILE A C     1 
ATOM   1095  O  O     . ILE A  1 137 ? 23.499  35.620  12.057  1.00 243.57 ? 135 ILE A O     1 
ATOM   1096  C  CB    . ILE A  1 137 ? 24.479  38.472  10.710  1.00 254.57 ? 135 ILE A CB    1 
ATOM   1097  C  CG1   . ILE A  1 137 ? 25.788  39.011  10.131  1.00 256.59 ? 135 ILE A CG1   1 
ATOM   1098  C  CG2   . ILE A  1 137 ? 23.522  39.627  10.969  1.00 257.42 ? 135 ILE A CG2   1 
ATOM   1099  C  CD1   . ILE A  1 137 ? 26.455  40.060  10.995  1.00 256.89 ? 135 ILE A CD1   1 
ATOM   1100  N  N     . ASN A  1 138 ? 22.575  37.422  13.059  1.00 237.79 ? 136 ASN A N     1 
ATOM   1101  C  CA    . ASN A  1 138 ? 21.419  36.665  13.528  1.00 226.96 ? 136 ASN A CA    1 
ATOM   1102  C  C     . ASN A  1 138 ? 20.540  36.188  12.378  1.00 235.15 ? 136 ASN A C     1 
ATOM   1103  O  O     . ASN A  1 138 ? 19.834  35.183  12.521  1.00 228.54 ? 136 ASN A O     1 
ATOM   1104  C  CB    . ASN A  1 138 ? 20.602  37.508  14.508  1.00 219.51 ? 136 ASN A CB    1 
ATOM   1105  C  CG    . ASN A  1 138 ? 20.220  38.858  13.937  1.00 220.31 ? 136 ASN A CG    1 
ATOM   1106  O  OD1   . ASN A  1 138 ? 20.951  39.433  13.131  1.00 222.11 ? 136 ASN A OD1   1 
ATOM   1107  N  ND2   . ASN A  1 138 ? 19.068  39.371  14.353  1.00 218.61 ? 136 ASN A ND2   1 
ATOM   1108  N  N     . ASN A  1 139 ? 20.564  36.881  11.239  1.00 245.49 ? 137 ASN A N     1 
ATOM   1109  C  CA    . ASN A  1 139 ? 19.727  36.488  10.111  1.00 254.04 ? 137 ASN A CA    1 
ATOM   1110  C  C     . ASN A  1 139 ? 20.279  36.996  8.784   1.00 249.54 ? 137 ASN A C     1 
ATOM   1111  O  O     . ASN A  1 139 ? 19.519  37.462  7.929   1.00 256.18 ? 137 ASN A O     1 
ATOM   1112  C  CB    . ASN A  1 139 ? 18.295  36.990  10.312  1.00 265.68 ? 137 ASN A CB    1 
ATOM   1113  C  CG    . ASN A  1 139 ? 18.219  38.497  10.468  1.00 275.39 ? 137 ASN A CG    1 
ATOM   1114  O  OD1   . ASN A  1 139 ? 18.287  39.022  11.579  1.00 276.45 ? 137 ASN A OD1   1 
ATOM   1115  N  ND2   . ASN A  1 139 ? 18.075  39.201  9.351   1.00 281.25 ? 137 ASN A ND2   1 
ATOM   1116  N  N     . GLU A  1 140 ? 21.595  36.907  8.595   1.00 238.96 ? 138 GLU A N     1 
ATOM   1117  C  CA    . GLU A  1 140 ? 22.205  37.312  7.334   1.00 230.44 ? 138 GLU A CA    1 
ATOM   1118  C  C     . GLU A  1 140 ? 23.229  36.285  6.868   1.00 227.95 ? 138 GLU A C     1 
ATOM   1119  O  O     . GLU A  1 140 ? 22.950  35.481  5.973   1.00 227.54 ? 138 GLU A O     1 
ATOM   1120  C  CB    . GLU A  1 140 ? 22.862  38.688  7.465   1.00 224.44 ? 138 GLU A CB    1 
ATOM   1121  C  CG    . GLU A  1 140 ? 21.887  39.836  7.668   1.00 220.57 ? 138 GLU A CG    1 
ATOM   1122  C  CD    . GLU A  1 140 ? 22.587  41.175  7.800   1.00 217.59 ? 138 GLU A CD    1 
ATOM   1123  O  OE1   . GLU A  1 140 ? 23.835  41.192  7.854   1.00 214.81 ? 138 GLU A OE1   1 
ATOM   1124  O  OE2   . GLU A  1 140 ? 21.890  42.210  7.849   1.00 218.87 ? 138 GLU A OE2   1 
ATOM   1125  N  N     . THR A  1 141 ? 24.413  36.308  7.466   1.00 222.99 ? 139 THR A N     1 
ATOM   1126  C  CA    . THR A  1 141 ? 25.466  35.380  7.075   1.00 219.19 ? 139 THR A CA    1 
ATOM   1127  C  C     . THR A  1 141 ? 25.122  33.973  7.550   1.00 208.79 ? 139 THR A C     1 
ATOM   1128  O  O     . THR A  1 141 ? 24.788  33.787  8.726   1.00 210.14 ? 139 THR A O     1 
ATOM   1129  C  CB    . THR A  1 141 ? 26.809  35.821  7.658   1.00 219.15 ? 139 THR A CB    1 
ATOM   1130  O  OG1   . THR A  1 141 ? 27.124  37.140  7.193   1.00 223.43 ? 139 THR A OG1   1 
ATOM   1131  C  CG2   . THR A  1 141 ? 27.916  34.864  7.240   1.00 216.29 ? 139 THR A CG2   1 
ATOM   1132  N  N     . PRO A  1 142 ? 25.184  32.962  6.677   1.00 203.14 ? 140 PRO A N     1 
ATOM   1133  C  CA    . PRO A  1 142 ? 24.901  31.590  7.127   1.00 200.75 ? 140 PRO A CA    1 
ATOM   1134  C  C     . PRO A  1 142 ? 25.916  31.059  8.124   1.00 212.29 ? 140 PRO A C     1 
ATOM   1135  O  O     . PRO A  1 142 ? 25.578  30.159  8.903   1.00 203.53 ? 140 PRO A O     1 
ATOM   1136  C  CB    . PRO A  1 142 ? 24.921  30.780  5.823   1.00 193.17 ? 140 PRO A CB    1 
ATOM   1137  C  CG    . PRO A  1 142 ? 25.769  31.586  4.893   1.00 192.63 ? 140 PRO A CG    1 
ATOM   1138  C  CD    . PRO A  1 142 ? 25.499  33.022  5.240   1.00 196.95 ? 140 PRO A CD    1 
ATOM   1139  N  N     . GLY A  1 143 ? 27.139  31.581  8.126   1.00 225.19 ? 141 GLY A N     1 
ATOM   1140  C  CA    . GLY A  1 143 ? 28.140  31.168  9.089   1.00 232.93 ? 141 GLY A CA    1 
ATOM   1141  C  C     . GLY A  1 143 ? 28.818  29.860  8.744   1.00 235.56 ? 141 GLY A C     1 
ATOM   1142  O  O     . GLY A  1 143 ? 28.153  28.836  8.556   1.00 238.40 ? 141 GLY A O     1 
ATOM   1143  N  N     . ILE A  1 144 ? 30.149  29.881  8.656   1.00 234.02 ? 142 ILE A N     1 
ATOM   1144  C  CA    . ILE A  1 144 ? 30.899  28.665  8.373   1.00 226.79 ? 142 ILE A CA    1 
ATOM   1145  C  C     . ILE A  1 144 ? 30.887  27.762  9.599   1.00 219.45 ? 142 ILE A C     1 
ATOM   1146  O  O     . ILE A  1 144 ? 31.069  28.218  10.737  1.00 218.54 ? 142 ILE A O     1 
ATOM   1147  C  CB    . ILE A  1 144 ? 32.333  29.007  7.934   1.00 226.16 ? 142 ILE A CB    1 
ATOM   1148  C  CG1   . ILE A  1 144 ? 33.159  27.733  7.740   1.00 223.29 ? 142 ILE A CG1   1 
ATOM   1149  C  CG2   . ILE A  1 144 ? 32.998  29.946  8.934   1.00 225.12 ? 142 ILE A CG2   1 
ATOM   1150  C  CD1   . ILE A  1 144 ? 34.576  27.987  7.278   1.00 223.73 ? 142 ILE A CD1   1 
ATOM   1151  N  N     . ARG A  1 145 ? 30.656  26.472  9.374   1.00 213.16 ? 143 ARG A N     1 
ATOM   1152  C  CA    . ARG A  1 145 ? 30.571  25.501  10.453  1.00 202.98 ? 143 ARG A CA    1 
ATOM   1153  C  C     . ARG A  1 145 ? 31.951  24.950  10.789  1.00 204.15 ? 143 ARG A C     1 
ATOM   1154  O  O     . ARG A  1 145 ? 32.759  24.674  9.899   1.00 205.47 ? 143 ARG A O     1 
ATOM   1155  C  CB    . ARG A  1 145 ? 29.624  24.362  10.073  1.00 195.77 ? 143 ARG A CB    1 
ATOM   1156  C  CG    . ARG A  1 145 ? 29.847  23.804  8.679   1.00 193.18 ? 143 ARG A CG    1 
ATOM   1157  C  CD    . ARG A  1 145 ? 28.587  23.138  8.154   1.00 189.60 ? 143 ARG A CD    1 
ATOM   1158  N  NE    . ARG A  1 145 ? 28.047  22.172  9.105   1.00 183.93 ? 143 ARG A NE    1 
ATOM   1159  C  CZ    . ARG A  1 145 ? 28.370  20.884  9.123   1.00 180.43 ? 143 ARG A CZ    1 
ATOM   1160  N  NH1   . ARG A  1 145 ? 29.231  20.404  8.236   1.00 180.78 ? 143 ARG A NH1   1 
ATOM   1161  N  NH2   . ARG A  1 145 ? 27.831  20.075  10.024  1.00 177.48 ? 143 ARG A NH2   1 
ATOM   1162  N  N     . TYR A  1 146 ? 32.212  24.797  12.083  1.00 201.47 ? 144 TYR A N     1 
ATOM   1163  C  CA    . TYR A  1 146 ? 33.486  24.319  12.597  1.00 197.40 ? 144 TYR A CA    1 
ATOM   1164  C  C     . TYR A  1 146 ? 33.299  22.973  13.291  1.00 180.73 ? 144 TYR A C     1 
ATOM   1165  O  O     . TYR A  1 146 ? 32.202  22.407  13.326  1.00 180.40 ? 144 TYR A O     1 
ATOM   1166  C  CB    . TYR A  1 146 ? 34.095  25.342  13.558  1.00 205.41 ? 144 TYR A CB    1 
ATOM   1167  C  CG    . TYR A  1 146 ? 34.561  26.624  12.905  1.00 216.85 ? 144 TYR A CG    1 
ATOM   1168  C  CD1   . TYR A  1 146 ? 35.833  26.724  12.360  1.00 222.37 ? 144 TYR A CD1   1 
ATOM   1169  C  CD2   . TYR A  1 146 ? 33.735  27.738  12.847  1.00 221.85 ? 144 TYR A CD2   1 
ATOM   1170  C  CE1   . TYR A  1 146 ? 36.266  27.894  11.768  1.00 228.21 ? 144 TYR A CE1   1 
ATOM   1171  C  CE2   . TYR A  1 146 ? 34.159  28.913  12.258  1.00 227.93 ? 144 TYR A CE2   1 
ATOM   1172  C  CZ    . TYR A  1 146 ? 35.426  28.985  11.720  1.00 231.91 ? 144 TYR A CZ    1 
ATOM   1173  O  OH    . TYR A  1 146 ? 35.854  30.153  11.131  1.00 237.92 ? 144 TYR A OH    1 
ATOM   1174  N  N     . GLN A  1 147 ? 34.393  22.462  13.851  1.00 167.66 ? 145 GLN A N     1 
ATOM   1175  C  CA    . GLN A  1 147 ? 34.373  21.231  14.626  1.00 150.22 ? 145 GLN A CA    1 
ATOM   1176  C  C     . GLN A  1 147 ? 35.330  21.387  15.802  1.00 145.34 ? 145 GLN A C     1 
ATOM   1177  O  O     . GLN A  1 147 ? 36.038  22.392  15.925  1.00 145.86 ? 145 GLN A O     1 
ATOM   1178  C  CB    . GLN A  1 147 ? 34.737  20.019  13.761  1.00 139.57 ? 145 GLN A CB    1 
ATOM   1179  C  CG    . GLN A  1 147 ? 36.210  19.924  13.414  1.00 133.49 ? 145 GLN A CG    1 
ATOM   1180  C  CD    . GLN A  1 147 ? 36.559  18.627  12.714  1.00 125.61 ? 145 GLN A CD    1 
ATOM   1181  O  OE1   . GLN A  1 147 ? 35.690  17.793  12.455  1.00 118.28 ? 145 GLN A OE1   1 
ATOM   1182  N  NE2   . GLN A  1 147 ? 37.837  18.448  12.404  1.00 126.77 ? 145 GLN A NE2   1 
ATOM   1183  N  N     . TYR A  1 148 ? 35.349  20.385  16.676  1.00 134.17 ? 146 TYR A N     1 
ATOM   1184  C  CA    . TYR A  1 148 ? 36.183  20.391  17.870  1.00 123.79 ? 146 TYR A CA    1 
ATOM   1185  C  C     . TYR A  1 148 ? 37.359  19.442  17.690  1.00 118.89 ? 146 TYR A C     1 
ATOM   1186  O  O     . TYR A  1 148 ? 37.179  18.296  17.266  1.00 116.64 ? 146 TYR A O     1 
ATOM   1187  C  CB    . TYR A  1 148 ? 35.377  19.990  19.108  1.00 127.53 ? 146 TYR A CB    1 
ATOM   1188  C  CG    . TYR A  1 148 ? 34.936  21.157  19.961  1.00 133.57 ? 146 TYR A CG    1 
ATOM   1189  C  CD1   . TYR A  1 148 ? 33.691  21.743  19.780  1.00 135.02 ? 146 TYR A CD1   1 
ATOM   1190  C  CD2   . TYR A  1 148 ? 35.765  21.671  20.949  1.00 137.10 ? 146 TYR A CD2   1 
ATOM   1191  C  CE1   . TYR A  1 148 ? 33.285  22.811  20.558  1.00 135.75 ? 146 TYR A CE1   1 
ATOM   1192  C  CE2   . TYR A  1 148 ? 35.369  22.737  21.731  1.00 137.70 ? 146 TYR A CE2   1 
ATOM   1193  C  CZ    . TYR A  1 148 ? 34.128  23.303  21.532  1.00 136.57 ? 146 TYR A CZ    1 
ATOM   1194  O  OH    . TYR A  1 148 ? 33.731  24.365  22.311  1.00 135.90 ? 146 TYR A OH    1 
ATOM   1195  N  N     . ASN A  1 149 ? 38.560  19.926  18.007  1.00 118.78 ? 147 ASN A N     1 
ATOM   1196  C  CA    . ASN A  1 149 ? 39.745  19.083  18.086  1.00 119.92 ? 147 ASN A CA    1 
ATOM   1197  C  C     . ASN A  1 149 ? 40.161  18.794  19.521  1.00 119.26 ? 147 ASN A C     1 
ATOM   1198  O  O     . ASN A  1 149 ? 41.089  18.006  19.735  1.00 116.30 ? 147 ASN A O     1 
ATOM   1199  C  CB    . ASN A  1 149 ? 40.917  19.734  17.339  1.00 124.15 ? 147 ASN A CB    1 
ATOM   1200  C  CG    . ASN A  1 149 ? 40.628  19.934  15.866  1.00 128.92 ? 147 ASN A CG    1 
ATOM   1201  O  OD1   . ASN A  1 149 ? 39.473  19.939  15.444  1.00 132.25 ? 147 ASN A OD1   1 
ATOM   1202  N  ND2   . ASN A  1 149 ? 41.681  20.102  15.074  1.00 131.87 ? 147 ASN A ND2   1 
ATOM   1203  N  N     . VAL A  1 150 ? 39.498  19.409  20.499  1.00 119.87 ? 148 VAL A N     1 
ATOM   1204  C  CA    . VAL A  1 150 ? 39.808  19.214  21.910  1.00 112.74 ? 148 VAL A CA    1 
ATOM   1205  C  C     . VAL A  1 150 ? 38.558  18.727  22.631  1.00 107.66 ? 148 VAL A C     1 
ATOM   1206  O  O     . VAL A  1 150 ? 37.637  18.191  22.006  1.00 106.13 ? 148 VAL A O     1 
ATOM   1207  C  CB    . VAL A  1 150 ? 40.345  20.510  22.544  1.00 116.76 ? 148 VAL A CB    1 
ATOM   1208  C  CG1   . VAL A  1 150 ? 41.710  20.855  21.971  1.00 119.07 ? 148 VAL A CG1   1 
ATOM   1209  C  CG2   . VAL A  1 150 ? 39.366  21.652  22.317  1.00 121.68 ? 148 VAL A CG2   1 
ATOM   1210  N  N     . LEU A  1 151 ? 38.517  18.912  23.950  1.00 107.18 ? 149 LEU A N     1 
ATOM   1211  C  CA    . LEU A  1 151 ? 37.365  18.499  24.741  1.00 105.05 ? 149 LEU A CA    1 
ATOM   1212  C  C     . LEU A  1 151 ? 36.357  19.637  24.813  1.00 109.28 ? 149 LEU A C     1 
ATOM   1213  O  O     . LEU A  1 151 ? 36.686  20.706  25.344  1.00 109.09 ? 149 LEU A O     1 
ATOM   1214  C  CB    . LEU A  1 151 ? 37.789  18.097  26.143  1.00 95.24  ? 149 LEU A CB    1 
ATOM   1215  C  CG    . LEU A  1 151 ? 38.785  16.944  26.268  1.00 89.83  ? 149 LEU A CG    1 
ATOM   1216  C  CD1   . LEU A  1 151 ? 39.077  16.653  27.732  1.00 91.58  ? 149 LEU A CD1   1 
ATOM   1217  C  CD2   . LEU A  1 151 ? 38.263  15.702  25.565  1.00 93.97  ? 149 LEU A CD2   1 
ATOM   1218  N  N     . PRO A  1 152 ? 35.143  19.466  24.296  1.00 115.13 ? 150 PRO A N     1 
ATOM   1219  C  CA    . PRO A  1 152 ? 34.129  20.513  24.448  1.00 118.32 ? 150 PRO A CA    1 
ATOM   1220  C  C     . PRO A  1 152 ? 33.574  20.536  25.863  1.00 110.33 ? 150 PRO A C     1 
ATOM   1221  O  O     . PRO A  1 152 ? 33.534  19.518  26.558  1.00 107.55 ? 150 PRO A O     1 
ATOM   1222  C  CB    . PRO A  1 152 ? 33.046  20.115  23.435  1.00 123.54 ? 150 PRO A CB    1 
ATOM   1223  C  CG    . PRO A  1 152 ? 33.677  19.062  22.561  1.00 125.59 ? 150 PRO A CG    1 
ATOM   1224  C  CD    . PRO A  1 152 ? 34.681  18.376  23.425  1.00 119.05 ? 150 PRO A CD    1 
ATOM   1225  N  N     . GLN A  1 153 ? 33.143  21.720  26.286  1.00 112.56 ? 151 GLN A N     1 
ATOM   1226  C  CA    . GLN A  1 153 ? 32.536  21.897  27.598  1.00 115.73 ? 151 GLN A CA    1 
ATOM   1227  C  C     . GLN A  1 153 ? 31.035  21.660  27.485  1.00 117.13 ? 151 GLN A C     1 
ATOM   1228  O  O     . GLN A  1 153 ? 30.333  22.407  26.795  1.00 120.28 ? 151 GLN A O     1 
ATOM   1229  C  CB    . GLN A  1 153 ? 32.829  23.293  28.148  1.00 122.12 ? 151 GLN A CB    1 
ATOM   1230  C  CG    . GLN A  1 153 ? 34.311  23.604  28.279  1.00 128.26 ? 151 GLN A CG    1 
ATOM   1231  C  CD    . GLN A  1 153 ? 34.573  24.920  28.984  1.00 132.16 ? 151 GLN A CD    1 
ATOM   1232  O  OE1   . GLN A  1 153 ? 33.670  25.509  29.578  1.00 136.27 ? 151 GLN A OE1   1 
ATOM   1233  N  NE2   . GLN A  1 153 ? 35.814  25.388  28.923  1.00 130.08 ? 151 GLN A NE2   1 
ATOM   1234  N  N     . GLY A  1 154 ? 30.548  20.621  28.157  1.00 117.82 ? 152 GLY A N     1 
ATOM   1235  C  CA    . GLY A  1 154 ? 29.151  20.246  28.068  1.00 117.38 ? 152 GLY A CA    1 
ATOM   1236  C  C     . GLY A  1 154 ? 28.979  18.798  27.661  1.00 112.99 ? 152 GLY A C     1 
ATOM   1237  O  O     . GLY A  1 154 ? 27.892  18.227  27.790  1.00 106.51 ? 152 GLY A O     1 
ATOM   1238  N  N     . TRP A  1 155 ? 30.055  18.197  27.162  1.00 114.00 ? 153 TRP A N     1 
ATOM   1239  C  CA    . TRP A  1 155 ? 30.045  16.791  26.787  1.00 113.97 ? 153 TRP A CA    1 
ATOM   1240  C  C     . TRP A  1 155 ? 30.268  15.925  28.021  1.00 120.63 ? 153 TRP A C     1 
ATOM   1241  O  O     . TRP A  1 155 ? 31.066  16.265  28.899  1.00 128.25 ? 153 TRP A O     1 
ATOM   1242  C  CB    . TRP A  1 155 ? 31.123  16.523  25.736  1.00 108.84 ? 153 TRP A CB    1 
ATOM   1243  C  CG    . TRP A  1 155 ? 31.133  15.129  25.195  1.00 108.56 ? 153 TRP A CG    1 
ATOM   1244  C  CD1   . TRP A  1 155 ? 30.058  14.405  24.770  1.00 111.69 ? 153 TRP A CD1   1 
ATOM   1245  C  CD2   . TRP A  1 155 ? 32.282  14.298  24.991  1.00 105.71 ? 153 TRP A CD2   1 
ATOM   1246  N  NE1   . TRP A  1 155 ? 30.464  13.168  24.329  1.00 111.03 ? 153 TRP A NE1   1 
ATOM   1247  C  CE2   . TRP A  1 155 ? 31.826  13.079  24.452  1.00 106.34 ? 153 TRP A CE2   1 
ATOM   1248  C  CE3   . TRP A  1 155 ? 33.652  14.465  25.218  1.00 101.56 ? 153 TRP A CE3   1 
ATOM   1249  C  CZ2   . TRP A  1 155 ? 32.690  12.032  24.138  1.00 99.96  ? 153 TRP A CZ2   1 
ATOM   1250  C  CZ3   . TRP A  1 155 ? 34.508  13.424  24.905  1.00 102.28 ? 153 TRP A CZ3   1 
ATOM   1251  C  CH2   . TRP A  1 155 ? 34.024  12.224  24.370  1.00 100.50 ? 153 TRP A CH2   1 
ATOM   1252  N  N     . LYS A  1 156 ? 29.550  14.802  28.089  1.00 114.32 ? 154 LYS A N     1 
ATOM   1253  C  CA    . LYS A  1 156 ? 29.593  13.969  29.286  1.00 111.21 ? 154 LYS A CA    1 
ATOM   1254  C  C     . LYS A  1 156 ? 30.899  13.198  29.431  1.00 112.17 ? 154 LYS A C     1 
ATOM   1255  O  O     . LYS A  1 156 ? 31.109  12.566  30.471  1.00 113.76 ? 154 LYS A O     1 
ATOM   1256  C  CB    . LYS A  1 156 ? 28.415  12.991  29.298  1.00 104.27 ? 154 LYS A CB    1 
ATOM   1257  C  CG    . LYS A  1 156 ? 28.571  11.792  28.378  1.00 99.61  ? 154 LYS A CG    1 
ATOM   1258  C  CD    . LYS A  1 156 ? 27.423  10.811  28.572  1.00 99.88  ? 154 LYS A CD    1 
ATOM   1259  C  CE    . LYS A  1 156 ? 27.603  9.561   27.728  1.00 105.18 ? 154 LYS A CE    1 
ATOM   1260  N  NZ    . LYS A  1 156 ? 28.815  8.793   28.120  1.00 105.51 ? 154 LYS A NZ    1 
ATOM   1261  N  N     . GLY A  1 157 ? 31.775  13.235  28.430  1.00 108.81 ? 155 GLY A N     1 
ATOM   1262  C  CA    . GLY A  1 157 ? 33.046  12.546  28.519  1.00 109.10 ? 155 GLY A CA    1 
ATOM   1263  C  C     . GLY A  1 157 ? 34.211  13.477  28.785  1.00 109.76 ? 155 GLY A C     1 
ATOM   1264  O  O     . GLY A  1 157 ? 35.334  13.024  29.026  1.00 111.14 ? 155 GLY A O     1 
ATOM   1265  N  N     . SER A  1 158 ? 33.951  14.784  28.751  1.00 105.83 ? 156 SER A N     1 
ATOM   1266  C  CA    . SER A  1 158 ? 35.022  15.760  28.945  1.00 104.81 ? 156 SER A CA    1 
ATOM   1267  C  C     . SER A  1 158 ? 35.641  15.708  30.338  1.00 100.27 ? 156 SER A C     1 
ATOM   1268  O  O     . SER A  1 158 ? 36.880  15.740  30.434  1.00 95.80  ? 156 SER A O     1 
ATOM   1269  C  CB    . SER A  1 158 ? 34.501  17.164  28.618  1.00 112.26 ? 156 SER A CB    1 
ATOM   1270  O  OG    . SER A  1 158 ? 34.078  17.250  27.268  1.00 120.57 ? 156 SER A OG    1 
ATOM   1271  N  N     . PRO A  1 159 ? 34.878  15.646  31.440  1.00 96.24  ? 157 PRO A N     1 
ATOM   1272  C  CA    . PRO A  1 159 ? 35.540  15.615  32.759  1.00 94.41  ? 157 PRO A CA    1 
ATOM   1273  C  C     . PRO A  1 159 ? 36.414  14.390  32.976  1.00 93.55  ? 157 PRO A C     1 
ATOM   1274  O  O     . PRO A  1 159 ? 37.564  14.525  33.415  1.00 95.44  ? 157 PRO A O     1 
ATOM   1275  C  CB    . PRO A  1 159 ? 34.358  15.657  33.740  1.00 92.10  ? 157 PRO A CB    1 
ATOM   1276  C  CG    . PRO A  1 159 ? 33.255  16.287  32.975  1.00 92.23  ? 157 PRO A CG    1 
ATOM   1277  C  CD    . PRO A  1 159 ? 33.416  15.778  31.578  1.00 93.98  ? 157 PRO A CD    1 
ATOM   1278  N  N     . ALA A  1 160 ? 35.902  13.194  32.676  1.00 89.66  ? 158 ALA A N     1 
ATOM   1279  C  CA    . ALA A  1 160 ? 36.660  11.976  32.948  1.00 85.99  ? 158 ALA A CA    1 
ATOM   1280  C  C     . ALA A  1 160 ? 37.932  11.911  32.110  1.00 88.46  ? 158 ALA A C     1 
ATOM   1281  O  O     . ALA A  1 160 ? 38.970  11.432  32.582  1.00 88.41  ? 158 ALA A O     1 
ATOM   1282  C  CB    . ALA A  1 160 ? 35.788  10.747  32.696  1.00 80.24  ? 158 ALA A CB    1 
ATOM   1283  N  N     . ILE A  1 161 ? 37.872  12.387  30.865  1.00 85.89  ? 159 ILE A N     1 
ATOM   1284  C  CA    . ILE A  1 161 ? 39.054  12.362  30.008  1.00 90.61  ? 159 ILE A CA    1 
ATOM   1285  C  C     . ILE A  1 161 ? 40.108  13.337  30.519  1.00 95.49  ? 159 ILE A C     1 
ATOM   1286  O  O     . ILE A  1 161 ? 41.302  13.016  30.554  1.00 103.68 ? 159 ILE A O     1 
ATOM   1287  C  CB    . ILE A  1 161 ? 38.662  12.655  28.548  1.00 89.11  ? 159 ILE A CB    1 
ATOM   1288  C  CG1   . ILE A  1 161 ? 37.901  11.468  27.953  1.00 85.97  ? 159 ILE A CG1   1 
ATOM   1289  C  CG2   . ILE A  1 161 ? 39.893  12.969  27.711  1.00 92.52  ? 159 ILE A CG2   1 
ATOM   1290  C  CD1   . ILE A  1 161 ? 37.466  11.677  26.519  1.00 88.47  ? 159 ILE A CD1   1 
ATOM   1291  N  N     . PHE A  1 162 ? 39.688  14.535  30.932  1.00 88.42  ? 160 PHE A N     1 
ATOM   1292  C  CA    . PHE A  1 162 ? 40.643  15.514  31.443  1.00 87.20  ? 160 PHE A CA    1 
ATOM   1293  C  C     . PHE A  1 162 ? 41.280  15.035  32.741  1.00 89.82  ? 160 PHE A C     1 
ATOM   1294  O  O     . PHE A  1 162 ? 42.500  15.130  32.918  1.00 92.91  ? 160 PHE A O     1 
ATOM   1295  C  CB    . PHE A  1 162 ? 39.960  16.866  31.649  1.00 82.92  ? 160 PHE A CB    1 
ATOM   1296  C  CG    . PHE A  1 162 ? 40.873  17.923  32.206  1.00 81.43  ? 160 PHE A CG    1 
ATOM   1297  C  CD1   . PHE A  1 162 ? 41.660  18.689  31.364  1.00 77.09  ? 160 PHE A CD1   1 
ATOM   1298  C  CD2   . PHE A  1 162 ? 40.950  18.146  33.572  1.00 77.65  ? 160 PHE A CD2   1 
ATOM   1299  C  CE1   . PHE A  1 162 ? 42.505  19.657  31.872  1.00 77.84  ? 160 PHE A CE1   1 
ATOM   1300  C  CE2   . PHE A  1 162 ? 41.793  19.113  34.085  1.00 74.82  ? 160 PHE A CE2   1 
ATOM   1301  C  CZ    . PHE A  1 162 ? 42.571  19.870  33.234  1.00 76.63  ? 160 PHE A CZ    1 
ATOM   1302  N  N     . GLN A  1 163 ? 40.464  14.526  33.669  1.00 93.36  ? 161 GLN A N     1 
ATOM   1303  C  CA    . GLN A  1 163 ? 40.992  14.056  34.946  1.00 89.11  ? 161 GLN A CA    1 
ATOM   1304  C  C     . GLN A  1 163 ? 41.967  12.901  34.761  1.00 89.43  ? 161 GLN A C     1 
ATOM   1305  O  O     . GLN A  1 163 ? 42.941  12.787  35.513  1.00 88.47  ? 161 GLN A O     1 
ATOM   1306  C  CB    . GLN A  1 163 ? 39.844  13.641  35.865  1.00 94.18  ? 161 GLN A CB    1 
ATOM   1307  C  CG    . GLN A  1 163 ? 38.942  14.788  36.288  1.00 97.63  ? 161 GLN A CG    1 
ATOM   1308  C  CD    . GLN A  1 163 ? 37.640  14.310  36.900  1.00 97.18  ? 161 GLN A CD    1 
ATOM   1309  O  OE1   . GLN A  1 163 ? 37.325  13.121  36.864  1.00 88.08  ? 161 GLN A OE1   1 
ATOM   1310  N  NE2   . GLN A  1 163 ? 36.874  15.238  37.464  1.00 100.77 ? 161 GLN A NE2   1 
ATOM   1311  N  N     . SER A  1 164 ? 41.727  12.042  33.770  1.00 93.18  ? 162 SER A N     1 
ATOM   1312  C  CA    . SER A  1 164 ? 42.640  10.934  33.514  1.00 88.80  ? 162 SER A CA    1 
ATOM   1313  C  C     . SER A  1 164 ? 43.884  11.396  32.765  1.00 83.97  ? 162 SER A C     1 
ATOM   1314  O  O     . SER A  1 164 ? 44.981  10.875  32.998  1.00 88.75  ? 162 SER A O     1 
ATOM   1315  C  CB    . SER A  1 164 ? 41.923  9.833   32.732  1.00 96.79  ? 162 SER A CB    1 
ATOM   1316  O  OG    . SER A  1 164 ? 42.772  8.717   32.530  1.00 108.74 ? 162 SER A OG    1 
ATOM   1317  N  N     . SER A  1 165 ? 43.735  12.370  31.864  1.00 84.00  ? 163 SER A N     1 
ATOM   1318  C  CA    . SER A  1 165 ? 44.893  12.896  31.148  1.00 82.23  ? 163 SER A CA    1 
ATOM   1319  C  C     . SER A  1 165 ? 45.804  13.685  32.080  1.00 84.07  ? 163 SER A C     1 
ATOM   1320  O  O     . SER A  1 165 ? 47.033  13.599  31.976  1.00 81.75  ? 163 SER A O     1 
ATOM   1321  C  CB    . SER A  1 165 ? 44.436  13.769  29.979  1.00 79.18  ? 163 SER A CB    1 
ATOM   1322  O  OG    . SER A  1 165 ? 43.647  13.029  29.064  1.00 81.46  ? 163 SER A OG    1 
ATOM   1323  N  N     . MET A  1 166 ? 45.217  14.458  32.998  1.00 89.78  ? 164 MET A N     1 
ATOM   1324  C  CA    . MET A  1 166 ? 46.016  15.227  33.947  1.00 87.36  ? 164 MET A CA    1 
ATOM   1325  C  C     . MET A  1 166 ? 46.821  14.319  34.867  1.00 90.77  ? 164 MET A C     1 
ATOM   1326  O  O     . MET A  1 166 ? 47.944  14.665  35.254  1.00 100.90 ? 164 MET A O     1 
ATOM   1327  C  CB    . MET A  1 166 ? 45.106  16.147  34.763  1.00 86.98  ? 164 MET A CB    1 
ATOM   1328  C  CG    . MET A  1 166 ? 45.801  16.949  35.860  1.00 90.06  ? 164 MET A CG    1 
ATOM   1329  S  SD    . MET A  1 166 ? 46.575  18.478  35.296  1.00 89.52  ? 164 MET A SD    1 
ATOM   1330  C  CE    . MET A  1 166 ? 48.195  17.899  34.804  1.00 96.66  ? 164 MET A CE    1 
ATOM   1331  N  N     . THR A  1 167 ? 46.274  13.154  35.222  1.00 76.64  ? 165 THR A N     1 
ATOM   1332  C  CA    . THR A  1 167 ? 46.992  12.239  36.103  1.00 71.36  ? 165 THR A CA    1 
ATOM   1333  C  C     . THR A  1 167 ? 48.209  11.640  35.407  1.00 79.64  ? 165 THR A C     1 
ATOM   1334  O  O     . THR A  1 167 ? 49.282  11.526  36.012  1.00 83.44  ? 165 THR A O     1 
ATOM   1335  C  CB    . THR A  1 167 ? 46.054  11.133  36.590  1.00 67.51  ? 165 THR A CB    1 
ATOM   1336  O  OG1   . THR A  1 167 ? 44.958  11.716  37.308  1.00 65.30  ? 165 THR A OG1   1 
ATOM   1337  C  CG2   . THR A  1 167 ? 46.793  10.168  37.505  1.00 64.82  ? 165 THR A CG2   1 
ATOM   1338  N  N     . LYS A  1 168 ? 48.066  11.258  34.135  1.00 74.08  ? 166 LYS A N     1 
ATOM   1339  C  CA    . LYS A  1 168 ? 49.188  10.670  33.410  1.00 84.36  ? 166 LYS A CA    1 
ATOM   1340  C  C     . LYS A  1 168 ? 50.324  11.667  33.225  1.00 87.81  ? 166 LYS A C     1 
ATOM   1341  O  O     . LYS A  1 168 ? 51.491  11.267  33.136  1.00 96.81  ? 166 LYS A O     1 
ATOM   1342  C  CB    . LYS A  1 168 ? 48.723  10.140  32.052  1.00 97.43  ? 166 LYS A CB    1 
ATOM   1343  C  CG    . LYS A  1 168 ? 47.736  8.986   32.134  1.00 104.54 ? 166 LYS A CG    1 
ATOM   1344  C  CD    . LYS A  1 168 ? 47.477  8.381   30.762  1.00 106.53 ? 166 LYS A CD    1 
ATOM   1345  C  CE    . LYS A  1 168 ? 46.887  9.403   29.805  1.00 112.37 ? 166 LYS A CE    1 
ATOM   1346  N  NZ    . LYS A  1 168 ? 46.630  8.817   28.460  1.00 114.17 ? 166 LYS A NZ    1 
ATOM   1347  N  N     . ILE A  1 169 ? 50.009  12.961  33.164  1.00 83.12  ? 167 ILE A N     1 
ATOM   1348  C  CA    . ILE A  1 169 ? 51.048  13.973  33.011  1.00 78.65  ? 167 ILE A CA    1 
ATOM   1349  C  C     . ILE A  1 169 ? 51.740  14.243  34.342  1.00 83.78  ? 167 ILE A C     1 
ATOM   1350  O  O     . ILE A  1 169 ? 52.951  14.483  34.388  1.00 87.87  ? 167 ILE A O     1 
ATOM   1351  C  CB    . ILE A  1 169 ? 50.448  15.256  32.406  1.00 76.42  ? 167 ILE A CB    1 
ATOM   1352  C  CG1   . ILE A  1 169 ? 49.818  14.954  31.045  1.00 77.23  ? 167 ILE A CG1   1 
ATOM   1353  C  CG2   . ILE A  1 169 ? 51.510  16.339  32.270  1.00 83.13  ? 167 ILE A CG2   1 
ATOM   1354  C  CD1   . ILE A  1 169 ? 49.151  16.149  30.401  1.00 78.68  ? 167 ILE A CD1   1 
ATOM   1355  N  N     . LEU A  1 170 ? 50.990  14.198  35.445  1.00 78.44  ? 168 LEU A N     1 
ATOM   1356  C  CA    . LEU A  1 170 ? 51.570  14.422  36.763  1.00 74.39  ? 168 LEU A CA    1 
ATOM   1357  C  C     . LEU A  1 170 ? 52.317  13.207  37.296  1.00 88.25  ? 168 LEU A C     1 
ATOM   1358  O  O     . LEU A  1 170 ? 53.155  13.360  38.191  1.00 91.67  ? 168 LEU A O     1 
ATOM   1359  C  CB    . LEU A  1 170 ? 50.482  14.822  37.761  1.00 72.88  ? 168 LEU A CB    1 
ATOM   1360  C  CG    . LEU A  1 170 ? 49.824  16.186  37.559  1.00 76.52  ? 168 LEU A CG    1 
ATOM   1361  C  CD1   . LEU A  1 170 ? 48.744  16.421  38.605  1.00 72.80  ? 168 LEU A CD1   1 
ATOM   1362  C  CD2   . LEU A  1 170 ? 50.866  17.290  37.604  1.00 73.72  ? 168 LEU A CD2   1 
ATOM   1363  N  N     . GLU A  1 171 ? 52.031  12.014  36.772  1.00 96.80  ? 169 GLU A N     1 
ATOM   1364  C  CA    . GLU A  1 171 ? 52.676  10.803  37.276  1.00 101.92 ? 169 GLU A CA    1 
ATOM   1365  C  C     . GLU A  1 171 ? 54.198  10.860  37.203  1.00 97.88  ? 169 GLU A C     1 
ATOM   1366  O  O     . GLU A  1 171 ? 54.852  10.511  38.202  1.00 97.12  ? 169 GLU A O     1 
ATOM   1367  C  CB    . GLU A  1 171 ? 52.128  9.579   36.533  1.00 109.15 ? 169 GLU A CB    1 
ATOM   1368  C  CG    . GLU A  1 171 ? 52.562  8.248   37.125  1.00 113.81 ? 169 GLU A CG    1 
ATOM   1369  C  CD    . GLU A  1 171 ? 52.182  7.069   36.249  1.00 118.29 ? 169 GLU A CD    1 
ATOM   1370  O  OE1   . GLU A  1 171 ? 53.077  6.266   35.910  1.00 119.23 ? 169 GLU A OE1   1 
ATOM   1371  O  OE2   . GLU A  1 171 ? 50.991  6.948   35.894  1.00 117.39 ? 169 GLU A OE2   1 
ATOM   1372  N  N     . PRO A  1 172 ? 54.828  11.272  36.094  1.00 93.13  ? 170 PRO A N     1 
ATOM   1373  C  CA    . PRO A  1 172 ? 56.297  11.353  36.103  1.00 93.46  ? 170 PRO A CA    1 
ATOM   1374  C  C     . PRO A  1 172 ? 56.840  12.422  37.036  1.00 101.35 ? 170 PRO A C     1 
ATOM   1375  O  O     . PRO A  1 172 ? 57.921  12.232  37.606  1.00 107.07 ? 170 PRO A O     1 
ATOM   1376  C  CB    . PRO A  1 172 ? 56.643  11.654  34.637  1.00 86.72  ? 170 PRO A CB    1 
ATOM   1377  C  CG    . PRO A  1 172 ? 55.420  12.285  34.086  1.00 87.52  ? 170 PRO A CG    1 
ATOM   1378  C  CD    . PRO A  1 172 ? 54.283  11.584  34.760  1.00 86.99  ? 170 PRO A CD    1 
ATOM   1379  N  N     . PHE A  1 173 ? 56.129  13.538  37.214  1.00 95.65  ? 171 PHE A N     1 
ATOM   1380  C  CA    . PHE A  1 173 ? 56.620  14.578  38.113  1.00 85.66  ? 171 PHE A CA    1 
ATOM   1381  C  C     . PHE A  1 173 ? 56.512  14.146  39.570  1.00 86.62  ? 171 PHE A C     1 
ATOM   1382  O  O     . PHE A  1 173 ? 57.409  14.429  40.373  1.00 82.46  ? 171 PHE A O     1 
ATOM   1383  C  CB    . PHE A  1 173 ? 55.860  15.885  37.885  1.00 77.88  ? 171 PHE A CB    1 
ATOM   1384  C  CG    . PHE A  1 173 ? 56.392  17.039  38.688  1.00 80.02  ? 171 PHE A CG    1 
ATOM   1385  C  CD1   . PHE A  1 173 ? 57.437  17.810  38.206  1.00 82.68  ? 171 PHE A CD1   1 
ATOM   1386  C  CD2   . PHE A  1 173 ? 55.855  17.348  39.927  1.00 76.23  ? 171 PHE A CD2   1 
ATOM   1387  C  CE1   . PHE A  1 173 ? 57.933  18.871  38.943  1.00 83.25  ? 171 PHE A CE1   1 
ATOM   1388  C  CE2   . PHE A  1 173 ? 56.347  18.406  40.668  1.00 81.72  ? 171 PHE A CE2   1 
ATOM   1389  C  CZ    . PHE A  1 173 ? 57.388  19.168  40.175  1.00 79.77  ? 171 PHE A CZ    1 
ATOM   1390  N  N     . LYS A  1 174 ? 55.420  13.467  39.932  1.00 85.84  ? 172 LYS A N     1 
ATOM   1391  C  CA    . LYS A  1 174 ? 55.279  12.979  41.300  1.00 75.57  ? 172 LYS A CA    1 
ATOM   1392  C  C     . LYS A  1 174 ? 56.312  11.908  41.621  1.00 84.53  ? 172 LYS A C     1 
ATOM   1393  O  O     . LYS A  1 174 ? 56.751  11.798  42.772  1.00 86.02  ? 172 LYS A O     1 
ATOM   1394  C  CB    . LYS A  1 174 ? 53.866  12.439  41.528  1.00 69.84  ? 172 LYS A CB    1 
ATOM   1395  C  CG    . LYS A  1 174 ? 52.773  13.489  41.421  1.00 75.24  ? 172 LYS A CG    1 
ATOM   1396  C  CD    . LYS A  1 174 ? 51.409  12.904  41.755  1.00 85.38  ? 172 LYS A CD    1 
ATOM   1397  C  CE    . LYS A  1 174 ? 50.316  13.951  41.624  1.00 87.54  ? 172 LYS A CE    1 
ATOM   1398  N  NZ    . LYS A  1 174 ? 48.979  13.410  41.990  1.00 69.28  ? 172 LYS A NZ    1 
ATOM   1399  N  N     . LYS A  1 175 ? 56.713  11.116  40.624  1.00 100.20 ? 173 LYS A N     1 
ATOM   1400  C  CA    . LYS A  1 175 ? 57.748  10.113  40.850  1.00 112.40 ? 173 LYS A CA    1 
ATOM   1401  C  C     . LYS A  1 175 ? 59.104  10.758  41.106  1.00 113.11 ? 173 LYS A C     1 
ATOM   1402  O  O     . LYS A  1 175 ? 59.925  10.200  41.842  1.00 111.10 ? 173 LYS A O     1 
ATOM   1403  C  CB    . LYS A  1 175 ? 57.824  9.160   39.656  1.00 121.24 ? 173 LYS A CB    1 
ATOM   1404  C  CG    . LYS A  1 175 ? 58.733  7.961   39.870  1.00 127.89 ? 173 LYS A CG    1 
ATOM   1405  C  CD    . LYS A  1 175 ? 58.693  7.015   38.681  1.00 129.91 ? 173 LYS A CD    1 
ATOM   1406  C  CE    . LYS A  1 175 ? 59.578  5.802   38.912  1.00 131.68 ? 173 LYS A CE    1 
ATOM   1407  N  NZ    . LYS A  1 175 ? 59.537  4.856   37.763  1.00 133.41 ? 173 LYS A NZ    1 
ATOM   1408  N  N     . GLN A  1 176 ? 59.353  11.930  40.518  1.00 116.03 ? 174 GLN A N     1 
ATOM   1409  C  CA    . GLN A  1 176 ? 60.605  12.639  40.744  1.00 117.68 ? 174 GLN A CA    1 
ATOM   1410  C  C     . GLN A  1 176 ? 60.586  13.475  42.017  1.00 115.71 ? 174 GLN A C     1 
ATOM   1411  O  O     . GLN A  1 176 ? 61.654  13.850  42.511  1.00 122.26 ? 174 GLN A O     1 
ATOM   1412  C  CB    . GLN A  1 176 ? 60.929  13.538  39.548  1.00 117.54 ? 174 GLN A CB    1 
ATOM   1413  C  CG    . GLN A  1 176 ? 61.103  12.793  38.235  1.00 122.11 ? 174 GLN A CG    1 
ATOM   1414  C  CD    . GLN A  1 176 ? 61.421  13.720  37.078  1.00 130.33 ? 174 GLN A CD    1 
ATOM   1415  O  OE1   . GLN A  1 176 ? 61.635  14.917  37.268  1.00 134.36 ? 174 GLN A OE1   1 
ATOM   1416  N  NE2   . GLN A  1 176 ? 61.452  13.170  35.870  1.00 131.15 ? 174 GLN A NE2   1 
ATOM   1417  N  N     . ASN A  1 177 ? 59.404  13.776  42.554  1.00 105.87 ? 175 ASN A N     1 
ATOM   1418  C  CA    . ASN A  1 177 ? 59.258  14.569  43.774  1.00 97.32  ? 175 ASN A CA    1 
ATOM   1419  C  C     . ASN A  1 177 ? 58.278  13.857  44.697  1.00 93.01  ? 175 ASN A C     1 
ATOM   1420  O  O     . ASN A  1 177 ? 57.109  14.250  44.806  1.00 88.87  ? 175 ASN A O     1 
ATOM   1421  C  CB    . ASN A  1 177 ? 58.792  15.991  43.457  1.00 94.11  ? 175 ASN A CB    1 
ATOM   1422  C  CG    . ASN A  1 177 ? 59.762  16.736  42.561  1.00 97.18  ? 175 ASN A CG    1 
ATOM   1423  O  OD1   . ASN A  1 177 ? 60.737  17.320  43.035  1.00 96.70  ? 175 ASN A OD1   1 
ATOM   1424  N  ND2   . ASN A  1 177 ? 59.500  16.720  41.259  1.00 78.58  ? 175 ASN A ND2   1 
ATOM   1425  N  N     . PRO A  1 178 ? 58.725  12.800  45.382  1.00 96.24  ? 176 PRO A N     1 
ATOM   1426  C  CA    . PRO A  1 178 ? 57.791  12.031  46.221  1.00 97.25  ? 176 PRO A CA    1 
ATOM   1427  C  C     . PRO A  1 178 ? 57.290  12.798  47.432  1.00 99.40  ? 176 PRO A C     1 
ATOM   1428  O  O     . PRO A  1 178 ? 56.139  12.601  47.838  1.00 98.80  ? 176 PRO A O     1 
ATOM   1429  C  CB    . PRO A  1 178 ? 58.618  10.804  46.637  1.00 94.97  ? 176 PRO A CB    1 
ATOM   1430  C  CG    . PRO A  1 178 ? 59.788  10.771  45.694  1.00 99.31  ? 176 PRO A CG    1 
ATOM   1431  C  CD    . PRO A  1 178 ? 60.067  12.198  45.355  1.00 98.92  ? 176 PRO A CD    1 
ATOM   1432  N  N     . ASP A  1 179 ? 58.114  13.663  48.020  1.00 100.23 ? 177 ASP A N     1 
ATOM   1433  C  CA    . ASP A  1 179 ? 57.739  14.379  49.233  1.00 97.74  ? 177 ASP A CA    1 
ATOM   1434  C  C     . ASP A  1 179 ? 56.792  15.544  48.976  1.00 96.51  ? 177 ASP A C     1 
ATOM   1435  O  O     . ASP A  1 179 ? 56.373  16.200  49.936  1.00 106.73 ? 177 ASP A O     1 
ATOM   1436  C  CB    . ASP A  1 179 ? 58.993  14.888  49.950  1.00 109.08 ? 177 ASP A CB    1 
ATOM   1437  C  CG    . ASP A  1 179 ? 59.941  13.768  50.328  1.00 116.99 ? 177 ASP A CG    1 
ATOM   1438  O  OD1   . ASP A  1 179 ? 59.478  12.616  50.467  1.00 113.98 ? 177 ASP A OD1   1 
ATOM   1439  O  OD2   . ASP A  1 179 ? 61.150  14.041  50.489  1.00 121.49 ? 177 ASP A OD2   1 
ATOM   1440  N  N     . ILE A  1 180 ? 56.445  15.818  47.723  1.00 90.97  ? 178 ILE A N     1 
ATOM   1441  C  CA    . ILE A  1 180 ? 55.562  16.925  47.374  1.00 88.28  ? 178 ILE A CA    1 
ATOM   1442  C  C     . ILE A  1 180 ? 54.156  16.375  47.176  1.00 86.29  ? 178 ILE A C     1 
ATOM   1443  O  O     . ILE A  1 180 ? 53.944  15.463  46.367  1.00 94.31  ? 178 ILE A O     1 
ATOM   1444  C  CB    . ILE A  1 180 ? 56.052  17.660  46.117  1.00 83.52  ? 178 ILE A CB    1 
ATOM   1445  C  CG1   . ILE A  1 180 ? 57.409  18.311  46.383  1.00 88.77  ? 178 ILE A CG1   1 
ATOM   1446  C  CG2   . ILE A  1 180 ? 55.033  18.700  45.678  1.00 82.11  ? 178 ILE A CG2   1 
ATOM   1447  C  CD1   . ILE A  1 180 ? 57.934  19.108  45.218  1.00 93.56  ? 178 ILE A CD1   1 
ATOM   1448  N  N     . VAL A  1 181 ? 53.200  16.929  47.912  1.00 75.33  ? 179 VAL A N     1 
ATOM   1449  C  CA    . VAL A  1 181 ? 51.803  16.524  47.817  1.00 76.46  ? 179 VAL A CA    1 
ATOM   1450  C  C     . VAL A  1 181 ? 51.122  17.369  46.749  1.00 76.07  ? 179 VAL A C     1 
ATOM   1451  O  O     . VAL A  1 181 ? 51.266  18.597  46.730  1.00 78.97  ? 179 VAL A O     1 
ATOM   1452  C  CB    . VAL A  1 181 ? 51.095  16.672  49.173  1.00 65.53  ? 179 VAL A CB    1 
ATOM   1453  C  CG1   . VAL A  1 181 ? 49.629  16.296  49.052  1.00 66.81  ? 179 VAL A CG1   1 
ATOM   1454  C  CG2   . VAL A  1 181 ? 51.784  15.819  50.226  1.00 69.32  ? 179 VAL A CG2   1 
ATOM   1455  N  N     . ILE A  1 182 ? 50.384  16.714  45.856  1.00 76.63  ? 180 ILE A N     1 
ATOM   1456  C  CA    . ILE A  1 182 ? 49.666  17.383  44.776  1.00 73.42  ? 180 ILE A CA    1 
ATOM   1457  C  C     . ILE A  1 182 ? 48.224  16.891  44.820  1.00 74.56  ? 180 ILE A C     1 
ATOM   1458  O  O     . ILE A  1 182 ? 47.924  15.784  44.360  1.00 75.82  ? 180 ILE A O     1 
ATOM   1459  C  CB    . ILE A  1 182 ? 50.294  17.124  43.402  1.00 72.01  ? 180 ILE A CB    1 
ATOM   1460  C  CG1   . ILE A  1 182 ? 51.758  17.567  43.387  1.00 77.42  ? 180 ILE A CG1   1 
ATOM   1461  C  CG2   . ILE A  1 182 ? 49.512  17.848  42.316  1.00 69.66  ? 180 ILE A CG2   1 
ATOM   1462  C  CD1   . ILE A  1 182 ? 52.453  17.328  42.063  1.00 73.15  ? 180 ILE A CD1   1 
ATOM   1463  N  N     . TYR A  1 183 ? 47.330  17.706  45.377  1.00 78.61  ? 181 TYR A N     1 
ATOM   1464  C  CA    . TYR A  1 183 ? 45.900  17.417  45.345  1.00 75.95  ? 181 TYR A CA    1 
ATOM   1465  C  C     . TYR A  1 183 ? 45.352  17.853  43.993  1.00 72.99  ? 181 TYR A C     1 
ATOM   1466  O  O     . TYR A  1 183 ? 45.304  19.049  43.689  1.00 79.26  ? 181 TYR A O     1 
ATOM   1467  C  CB    . TYR A  1 183 ? 45.179  18.124  46.489  1.00 76.20  ? 181 TYR A CB    1 
ATOM   1468  C  CG    . TYR A  1 183 ? 45.089  17.311  47.760  1.00 70.73  ? 181 TYR A CG    1 
ATOM   1469  C  CD1   . TYR A  1 183 ? 46.204  17.117  48.565  1.00 68.82  ? 181 TYR A CD1   1 
ATOM   1470  C  CD2   . TYR A  1 183 ? 43.885  16.747  48.161  1.00 81.60  ? 181 TYR A CD2   1 
ATOM   1471  C  CE1   . TYR A  1 183 ? 46.124  16.375  49.729  1.00 78.62  ? 181 TYR A CE1   1 
ATOM   1472  C  CE2   . TYR A  1 183 ? 43.794  16.003  49.323  1.00 82.95  ? 181 TYR A CE2   1 
ATOM   1473  C  CZ    . TYR A  1 183 ? 44.916  15.820  50.103  1.00 81.92  ? 181 TYR A CZ    1 
ATOM   1474  O  OH    . TYR A  1 183 ? 44.832  15.083  51.261  1.00 66.53  ? 181 TYR A OH    1 
ATOM   1475  N  N     . GLN A  1 184 ? 44.941  16.884  43.181  1.00 69.85  ? 182 GLN A N     1 
ATOM   1476  C  CA    . GLN A  1 184 ? 44.487  17.122  41.815  1.00 71.88  ? 182 GLN A CA    1 
ATOM   1477  C  C     . GLN A  1 184 ? 42.971  16.979  41.769  1.00 71.57  ? 182 GLN A C     1 
ATOM   1478  O  O     . GLN A  1 184 ? 42.444  15.865  41.855  1.00 75.61  ? 182 GLN A O     1 
ATOM   1479  C  CB    . GLN A  1 184 ? 45.163  16.149  40.852  1.00 74.17  ? 182 GLN A CB    1 
ATOM   1480  C  CG    . GLN A  1 184 ? 44.573  16.132  39.453  1.00 67.24  ? 182 GLN A CG    1 
ATOM   1481  C  CD    . GLN A  1 184 ? 44.944  14.875  38.692  1.00 72.28  ? 182 GLN A CD    1 
ATOM   1482  O  OE1   . GLN A  1 184 ? 45.854  14.145  39.084  1.00 75.92  ? 182 GLN A OE1   1 
ATOM   1483  N  NE2   . GLN A  1 184 ? 44.231  14.610  37.603  1.00 74.78  ? 182 GLN A NE2   1 
ATOM   1484  N  N     . TYR A  1 185 ? 42.274  18.106  41.635  1.00 66.79  ? 183 TYR A N     1 
ATOM   1485  C  CA    . TYR A  1 185 ? 40.821  18.120  41.483  1.00 66.52  ? 183 TYR A CA    1 
ATOM   1486  C  C     . TYR A  1 185 ? 40.480  18.956  40.258  1.00 68.40  ? 183 TYR A C     1 
ATOM   1487  O  O     . TYR A  1 185 ? 40.629  20.183  40.281  1.00 70.52  ? 183 TYR A O     1 
ATOM   1488  C  CB    . TYR A  1 185 ? 40.130  18.672  42.730  1.00 69.16  ? 183 TYR A CB    1 
ATOM   1489  C  CG    . TYR A  1 185 ? 38.622  18.633  42.636  1.00 77.52  ? 183 TYR A CG    1 
ATOM   1490  C  CD1   . TYR A  1 185 ? 37.915  17.493  42.997  1.00 64.14  ? 183 TYR A CD1   1 
ATOM   1491  C  CD2   . TYR A  1 185 ? 37.906  19.731  42.177  1.00 72.03  ? 183 TYR A CD2   1 
ATOM   1492  C  CE1   . TYR A  1 185 ? 36.539  17.450  42.909  1.00 66.87  ? 183 TYR A CE1   1 
ATOM   1493  C  CE2   . TYR A  1 185 ? 36.530  19.697  42.084  1.00 69.57  ? 183 TYR A CE2   1 
ATOM   1494  C  CZ    . TYR A  1 185 ? 35.851  18.554  42.452  1.00 78.44  ? 183 TYR A CZ    1 
ATOM   1495  O  OH    . TYR A  1 185 ? 34.479  18.517  42.361  1.00 93.66  ? 183 TYR A OH    1 
ATOM   1496  N  N     . MET A  1 186 ? 40.013  18.292  39.202  1.00 83.83  ? 184 MET A N     1 
ATOM   1497  C  CA    . MET A  1 186 ? 39.689  18.921  37.917  1.00 81.23  ? 184 MET A CA    1 
ATOM   1498  C  C     . MET A  1 186 ? 40.945  19.638  37.432  1.00 84.84  ? 184 MET A C     1 
ATOM   1499  O  O     . MET A  1 186 ? 41.996  18.985  37.320  1.00 83.70  ? 184 MET A O     1 
ATOM   1500  C  CB    . MET A  1 186 ? 38.440  19.789  38.087  1.00 84.50  ? 184 MET A CB    1 
ATOM   1501  C  CG    . MET A  1 186 ? 37.745  20.178  36.786  1.00 97.79  ? 184 MET A CG    1 
ATOM   1502  S  SD    . MET A  1 186 ? 36.645  18.904  36.132  1.00 102.97 ? 184 MET A SD    1 
ATOM   1503  C  CE    . MET A  1 186 ? 37.744  18.012  35.036  1.00 90.67  ? 184 MET A CE    1 
ATOM   1504  N  N     . ASP A  1 187 ? 40.904  20.940  37.148  1.00 96.50  ? 185 ASP A N     1 
ATOM   1505  C  CA    . ASP A  1 187 ? 42.090  21.659  36.694  1.00 98.56  ? 185 ASP A CA    1 
ATOM   1506  C  C     . ASP A  1 187 ? 42.886  22.270  37.838  1.00 108.61 ? 185 ASP A C     1 
ATOM   1507  O  O     . ASP A  1 187 ? 44.099  22.463  37.701  1.00 111.92 ? 185 ASP A O     1 
ATOM   1508  C  CB    . ASP A  1 187 ? 41.693  22.764  35.715  1.00 102.74 ? 185 ASP A CB    1 
ATOM   1509  C  CG    . ASP A  1 187 ? 40.811  23.814  36.356  1.00 115.75 ? 185 ASP A CG    1 
ATOM   1510  O  OD1   . ASP A  1 187 ? 39.967  23.445  37.198  1.00 123.70 ? 185 ASP A OD1   1 
ATOM   1511  O  OD2   . ASP A  1 187 ? 40.963  25.007  36.022  1.00 134.95 ? 185 ASP A OD2   1 
ATOM   1512  N  N     . ASP A  1 188 ? 42.233  22.585  38.955  1.00 109.77 ? 186 ASP A N     1 
ATOM   1513  C  CA    . ASP A  1 188 ? 42.926  23.198  40.079  1.00 108.37 ? 186 ASP A CA    1 
ATOM   1514  C  C     . ASP A  1 188 ? 43.865  22.193  40.734  1.00 95.00  ? 186 ASP A C     1 
ATOM   1515  O  O     . ASP A  1 188 ? 43.481  21.052  41.009  1.00 89.04  ? 186 ASP A O     1 
ATOM   1516  C  CB    . ASP A  1 188 ? 41.920  23.729  41.099  1.00 106.86 ? 186 ASP A CB    1 
ATOM   1517  C  CG    . ASP A  1 188 ? 41.184  24.959  40.603  1.00 119.70 ? 186 ASP A CG    1 
ATOM   1518  O  OD1   . ASP A  1 188 ? 40.288  24.813  39.745  1.00 125.66 ? 186 ASP A OD1   1 
ATOM   1519  O  OD2   . ASP A  1 188 ? 41.505  26.072  41.068  1.00 125.02 ? 186 ASP A OD2   1 
ATOM   1520  N  N     . LEU A  1 189 ? 45.099  22.622  40.984  1.00 88.04  ? 187 LEU A N     1 
ATOM   1521  C  CA    . LEU A  1 189 ? 46.131  21.774  41.566  1.00 78.52  ? 187 LEU A CA    1 
ATOM   1522  C  C     . LEU A  1 189 ? 46.599  22.386  42.877  1.00 80.52  ? 187 LEU A C     1 
ATOM   1523  O  O     . LEU A  1 189 ? 47.155  23.490  42.888  1.00 83.81  ? 187 LEU A O     1 
ATOM   1524  C  CB    . LEU A  1 189 ? 47.307  21.600  40.603  1.00 80.33  ? 187 LEU A CB    1 
ATOM   1525  C  CG    . LEU A  1 189 ? 46.997  20.917  39.270  1.00 91.83  ? 187 LEU A CG    1 
ATOM   1526  C  CD1   . LEU A  1 189 ? 48.245  20.844  38.406  1.00 90.68  ? 187 LEU A CD1   1 
ATOM   1527  C  CD2   . LEU A  1 189 ? 46.419  19.529  39.500  1.00 95.90  ? 187 LEU A CD2   1 
ATOM   1528  N  N     . TYR A  1 190 ? 46.369  21.673  43.976  1.00 71.42  ? 188 TYR A N     1 
ATOM   1529  C  CA    . TYR A  1 190 ? 46.886  22.056  45.283  1.00 74.33  ? 188 TYR A CA    1 
ATOM   1530  C  C     . TYR A  1 190 ? 48.259  21.420  45.462  1.00 71.31  ? 188 TYR A C     1 
ATOM   1531  O  O     . TYR A  1 190 ? 48.376  20.191  45.497  1.00 69.73  ? 188 TYR A O     1 
ATOM   1532  C  CB    . TYR A  1 190 ? 45.926  21.613  46.389  1.00 77.29  ? 188 TYR A CB    1 
ATOM   1533  C  CG    . TYR A  1 190 ? 46.457  21.765  47.801  1.00 69.44  ? 188 TYR A CG    1 
ATOM   1534  C  CD1   . TYR A  1 190 ? 47.235  20.770  48.385  1.00 68.78  ? 188 TYR A CD1   1 
ATOM   1535  C  CD2   . TYR A  1 190 ? 46.162  22.891  48.557  1.00 70.52  ? 188 TYR A CD2   1 
ATOM   1536  C  CE1   . TYR A  1 190 ? 47.719  20.901  49.672  1.00 68.15  ? 188 TYR A CE1   1 
ATOM   1537  C  CE2   . TYR A  1 190 ? 46.638  23.029  49.848  1.00 71.62  ? 188 TYR A CE2   1 
ATOM   1538  C  CZ    . TYR A  1 190 ? 47.417  22.031  50.399  1.00 71.85  ? 188 TYR A CZ    1 
ATOM   1539  O  OH    . TYR A  1 190 ? 47.895  22.161  51.683  1.00 82.96  ? 188 TYR A OH    1 
ATOM   1540  N  N     . VAL A  1 191 ? 49.292  22.250  45.572  1.00 73.09  ? 189 VAL A N     1 
ATOM   1541  C  CA    . VAL A  1 191 ? 50.665  21.779  45.716  1.00 79.66  ? 189 VAL A CA    1 
ATOM   1542  C  C     . VAL A  1 191 ? 51.178  22.220  47.079  1.00 80.44  ? 189 VAL A C     1 
ATOM   1543  O  O     . VAL A  1 191 ? 51.164  23.416  47.398  1.00 81.97  ? 189 VAL A O     1 
ATOM   1544  C  CB    . VAL A  1 191 ? 51.574  22.303  44.593  1.00 75.46  ? 189 VAL A CB    1 
ATOM   1545  C  CG1   . VAL A  1 191 ? 52.931  21.618  44.656  1.00 75.62  ? 189 VAL A CG1   1 
ATOM   1546  C  CG2   . VAL A  1 191 ? 50.922  22.084  43.236  1.00 75.46  ? 189 VAL A CG2   1 
ATOM   1547  N  N     . GLY A  1 192 ? 51.628  21.261  47.875  1.00 74.11  ? 190 GLY A N     1 
ATOM   1548  C  CA    . GLY A  1 192 ? 52.153  21.557  49.194  1.00 75.42  ? 190 GLY A CA    1 
ATOM   1549  C  C     . GLY A  1 192 ? 53.427  20.783  49.451  1.00 73.52  ? 190 GLY A C     1 
ATOM   1550  O  O     . GLY A  1 192 ? 53.641  19.696  48.909  1.00 71.57  ? 190 GLY A O     1 
ATOM   1551  N  N     . SER A  1 193 ? 54.279  21.362  50.293  1.00 73.89  ? 191 SER A N     1 
ATOM   1552  C  CA    . SER A  1 193 ? 55.547  20.740  50.644  1.00 74.19  ? 191 SER A CA    1 
ATOM   1553  C  C     . SER A  1 193 ? 56.041  21.344  51.948  1.00 83.85  ? 191 SER A C     1 
ATOM   1554  O  O     . SER A  1 193 ? 55.598  22.418  52.364  1.00 89.63  ? 191 SER A O     1 
ATOM   1555  C  CB    . SER A  1 193 ? 56.592  20.923  49.537  1.00 78.26  ? 191 SER A CB    1 
ATOM   1556  O  OG    . SER A  1 193 ? 56.993  22.278  49.432  1.00 78.36  ? 191 SER A OG    1 
ATOM   1557  N  N     . ASP A  1 194 ? 56.966  20.635  52.590  1.00 82.73  ? 192 ASP A N     1 
ATOM   1558  C  CA    . ASP A  1 194 ? 57.626  21.126  53.790  1.00 93.75  ? 192 ASP A CA    1 
ATOM   1559  C  C     . ASP A  1 194 ? 58.936  21.840  53.484  1.00 103.86 ? 192 ASP A C     1 
ATOM   1560  O  O     . ASP A  1 194 ? 59.723  22.091  54.403  1.00 109.62 ? 192 ASP A O     1 
ATOM   1561  C  CB    . ASP A  1 194 ? 57.870  19.974  54.768  1.00 96.72  ? 192 ASP A CB    1 
ATOM   1562  C  CG    . ASP A  1 194 ? 56.585  19.447  55.377  1.00 104.16 ? 192 ASP A CG    1 
ATOM   1563  O  OD1   . ASP A  1 194 ? 55.672  20.260  55.634  1.00 101.23 ? 192 ASP A OD1   1 
ATOM   1564  O  OD2   . ASP A  1 194 ? 56.485  18.221  55.595  1.00 107.58 ? 192 ASP A OD2   1 
ATOM   1565  N  N     . LEU A  1 195 ? 59.185  22.169  52.218  1.00 98.36  ? 193 LEU A N     1 
ATOM   1566  C  CA    . LEU A  1 195 ? 60.391  22.887  51.842  1.00 97.31  ? 193 LEU A CA    1 
ATOM   1567  C  C     . LEU A  1 195 ? 60.290  24.354  52.254  1.00 109.85 ? 193 LEU A C     1 
ATOM   1568  O  O     . LEU A  1 195 ? 59.225  24.858  52.624  1.00 107.89 ? 193 LEU A O     1 
ATOM   1569  C  CB    . LEU A  1 195 ? 60.631  22.784  50.336  1.00 92.62  ? 193 LEU A CB    1 
ATOM   1570  C  CG    . LEU A  1 195 ? 60.864  21.395  49.741  1.00 95.94  ? 193 LEU A CG    1 
ATOM   1571  C  CD1   . LEU A  1 195 ? 60.985  21.481  48.227  1.00 82.56  ? 193 LEU A CD1   1 
ATOM   1572  C  CD2   . LEU A  1 195 ? 62.105  20.760  50.344  1.00 96.08  ? 193 LEU A CD2   1 
ATOM   1573  N  N     . GLU A  1 196 ? 61.424  25.045  52.182  1.00 116.73 ? 194 GLU A N     1 
ATOM   1574  C  CA    . GLU A  1 196 ? 61.438  26.475  52.438  1.00 118.66 ? 194 GLU A CA    1 
ATOM   1575  C  C     . GLU A  1 196 ? 60.703  27.214  51.323  1.00 112.15 ? 194 GLU A C     1 
ATOM   1576  O  O     . GLU A  1 196 ? 60.512  26.696  50.219  1.00 117.62 ? 194 GLU A O     1 
ATOM   1577  C  CB    . GLU A  1 196 ? 62.874  26.987  52.556  1.00 129.40 ? 194 GLU A CB    1 
ATOM   1578  C  CG    . GLU A  1 196 ? 63.740  26.208  53.537  1.00 133.46 ? 194 GLU A CG    1 
ATOM   1579  C  CD    . GLU A  1 196 ? 63.295  26.366  54.981  1.00 133.26 ? 194 GLU A CD    1 
ATOM   1580  O  OE1   . GLU A  1 196 ? 62.540  27.315  55.279  1.00 132.57 ? 194 GLU A OE1   1 
ATOM   1581  O  OE2   . GLU A  1 196 ? 63.705  25.536  55.821  1.00 130.37 ? 194 GLU A OE2   1 
ATOM   1582  N  N     . ILE A  1 197 ? 60.285  28.445  51.629  1.00 109.10 ? 195 ILE A N     1 
ATOM   1583  C  CA    . ILE A  1 197 ? 59.531  29.239  50.661  1.00 105.69 ? 195 ILE A CA    1 
ATOM   1584  C  C     . ILE A  1 197 ? 60.335  29.428  49.382  1.00 112.49 ? 195 ILE A C     1 
ATOM   1585  O  O     . ILE A  1 197 ? 59.787  29.383  48.274  1.00 107.34 ? 195 ILE A O     1 
ATOM   1586  C  CB    . ILE A  1 197 ? 59.125  30.590  51.279  1.00 115.04 ? 195 ILE A CB    1 
ATOM   1587  C  CG1   . ILE A  1 197 ? 58.430  30.377  52.624  1.00 117.56 ? 195 ILE A CG1   1 
ATOM   1588  C  CG2   . ILE A  1 197 ? 58.216  31.358  50.331  1.00 113.43 ? 195 ILE A CG2   1 
ATOM   1589  C  CD1   . ILE A  1 197 ? 58.064  31.664  53.330  1.00 110.70 ? 195 ILE A CD1   1 
ATOM   1590  N  N     . GLY A  1 198 ? 61.647  29.633  49.512  1.00 116.78 ? 196 GLY A N     1 
ATOM   1591  C  CA    . GLY A  1 198 ? 62.479  29.792  48.330  1.00 117.27 ? 196 GLY A CA    1 
ATOM   1592  C  C     . GLY A  1 198 ? 62.563  28.522  47.504  1.00 115.68 ? 196 GLY A C     1 
ATOM   1593  O  O     . GLY A  1 198 ? 62.352  28.542  46.288  1.00 116.47 ? 196 GLY A O     1 
ATOM   1594  N  N     . GLN A  1 199 ? 62.873  27.397  48.154  1.00 113.97 ? 197 GLN A N     1 
ATOM   1595  C  CA    . GLN A  1 199 ? 62.963  26.127  47.445  1.00 114.20 ? 197 GLN A CA    1 
ATOM   1596  C  C     . GLN A  1 199 ? 61.606  25.637  46.957  1.00 111.16 ? 197 GLN A C     1 
ATOM   1597  O  O     . GLN A  1 199 ? 61.551  24.864  45.995  1.00 107.66 ? 197 GLN A O     1 
ATOM   1598  C  CB    . GLN A  1 199 ? 63.604  25.067  48.342  1.00 117.61 ? 197 GLN A CB    1 
ATOM   1599  C  CG    . GLN A  1 199 ? 65.021  25.397  48.781  1.00 125.71 ? 197 GLN A CG    1 
ATOM   1600  C  CD    . GLN A  1 199 ? 65.607  24.342  49.700  1.00 130.54 ? 197 GLN A CD    1 
ATOM   1601  O  OE1   . GLN A  1 199 ? 64.935  23.377  50.063  1.00 134.58 ? 197 GLN A OE1   1 
ATOM   1602  N  NE2   . GLN A  1 199 ? 66.867  24.522  50.080  1.00 128.41 ? 197 GLN A NE2   1 
ATOM   1603  N  N     . HIS A  1 200 ? 60.515  26.067  47.597  1.00 110.48 ? 198 HIS A N     1 
ATOM   1604  C  CA    . HIS A  1 200 ? 59.186  25.640  47.170  1.00 100.78 ? 198 HIS A CA    1 
ATOM   1605  C  C     . HIS A  1 200 ? 58.830  26.229  45.811  1.00 97.82  ? 198 HIS A C     1 
ATOM   1606  O  O     . HIS A  1 200 ? 58.317  25.525  44.934  1.00 89.00  ? 198 HIS A O     1 
ATOM   1607  C  CB    . HIS A  1 200 ? 58.148  26.037  48.218  1.00 85.93  ? 198 HIS A CB    1 
ATOM   1608  C  CG    . HIS A  1 200 ? 56.738  25.733  47.818  1.00 84.00  ? 198 HIS A CG    1 
ATOM   1609  N  ND1   . HIS A  1 200 ? 56.134  24.523  48.081  1.00 81.31  ? 198 HIS A ND1   1 
ATOM   1610  C  CD2   . HIS A  1 200 ? 55.812  26.484  47.177  1.00 84.51  ? 198 HIS A CD2   1 
ATOM   1611  C  CE1   . HIS A  1 200 ? 54.896  24.541  47.620  1.00 80.26  ? 198 HIS A CE1   1 
ATOM   1612  N  NE2   . HIS A  1 200 ? 54.676  25.720  47.065  1.00 82.14  ? 198 HIS A NE2   1 
ATOM   1613  N  N     . ARG A  1 201 ? 59.090  27.526  45.621  1.00 102.96 ? 199 ARG A N     1 
ATOM   1614  C  CA    . ARG A  1 201 ? 58.818  28.154  44.332  1.00 101.96 ? 199 ARG A CA    1 
ATOM   1615  C  C     . ARG A  1 201 ? 59.648  27.530  43.219  1.00 104.34 ? 199 ARG A C     1 
ATOM   1616  O  O     . ARG A  1 201 ? 59.214  27.504  42.062  1.00 92.63  ? 199 ARG A O     1 
ATOM   1617  C  CB    . ARG A  1 201 ? 59.085  29.658  44.406  1.00 106.46 ? 199 ARG A CB    1 
ATOM   1618  C  CG    . ARG A  1 201 ? 57.877  30.504  44.789  1.00 107.35 ? 199 ARG A CG    1 
ATOM   1619  C  CD    . ARG A  1 201 ? 57.470  30.296  46.237  1.00 108.66 ? 199 ARG A CD    1 
ATOM   1620  N  NE    . ARG A  1 201 ? 56.374  31.179  46.626  1.00 113.21 ? 199 ARG A NE    1 
ATOM   1621  C  CZ    . ARG A  1 201 ? 56.540  32.407  47.107  1.00 121.36 ? 199 ARG A CZ    1 
ATOM   1622  N  NH1   . ARG A  1 201 ? 57.761  32.903  47.260  1.00 128.40 ? 199 ARG A NH1   1 
ATOM   1623  N  NH2   . ARG A  1 201 ? 55.486  33.141  47.436  1.00 123.59 ? 199 ARG A NH2   1 
ATOM   1624  N  N     . THR A  1 202 ? 60.839  27.023  43.547  1.00 115.24 ? 200 THR A N     1 
ATOM   1625  C  CA    . THR A  1 202 ? 61.681  26.386  42.540  1.00 126.11 ? 200 THR A CA    1 
ATOM   1626  C  C     . THR A  1 202 ? 61.001  25.152  41.960  1.00 115.00 ? 200 THR A C     1 
ATOM   1627  O  O     . THR A  1 202 ? 60.955  24.970  40.738  1.00 112.26 ? 200 THR A O     1 
ATOM   1628  C  CB    . THR A  1 202 ? 63.037  26.020  43.146  1.00 133.37 ? 200 THR A CB    1 
ATOM   1629  O  OG1   . THR A  1 202 ? 63.693  27.209  43.607  1.00 136.56 ? 200 THR A OG1   1 
ATOM   1630  C  CG2   . THR A  1 202 ? 63.914  25.332  42.111  1.00 132.48 ? 200 THR A CG2   1 
ATOM   1631  N  N     . LYS A  1 203 ? 60.460  24.292  42.826  1.00 108.43 ? 201 LYS A N     1 
ATOM   1632  C  CA    . LYS A  1 203 ? 59.761  23.107  42.342  1.00 100.42 ? 201 LYS A CA    1 
ATOM   1633  C  C     . LYS A  1 203 ? 58.429  23.463  41.696  1.00 93.61  ? 201 LYS A C     1 
ATOM   1634  O  O     . LYS A  1 203 ? 57.978  22.759  40.785  1.00 94.77  ? 201 LYS A O     1 
ATOM   1635  C  CB    . LYS A  1 203 ? 59.553  22.113  43.484  1.00 92.42  ? 201 LYS A CB    1 
ATOM   1636  C  CG    . LYS A  1 203 ? 60.391  20.852  43.358  1.00 98.78  ? 201 LYS A CG    1 
ATOM   1637  C  CD    . LYS A  1 203 ? 61.875  21.166  43.313  1.00 115.93 ? 201 LYS A CD    1 
ATOM   1638  C  CE    . LYS A  1 203 ? 62.694  19.906  43.088  1.00 119.16 ? 201 LYS A CE    1 
ATOM   1639  N  NZ    . LYS A  1 203 ? 64.154  20.192  43.031  1.00 126.83 ? 201 LYS A NZ    1 
ATOM   1640  N  N     . ILE A  1 204 ? 57.787  24.543  42.149  1.00 86.21  ? 202 ILE A N     1 
ATOM   1641  C  CA    . ILE A  1 204 ? 56.554  24.998  41.511  1.00 85.96  ? 202 ILE A CA    1 
ATOM   1642  C  C     . ILE A  1 204 ? 56.817  25.359  40.056  1.00 89.12  ? 202 ILE A C     1 
ATOM   1643  O  O     . ILE A  1 204 ? 56.080  24.949  39.151  1.00 87.03  ? 202 ILE A O     1 
ATOM   1644  C  CB    . ILE A  1 204 ? 55.951  26.184  42.285  1.00 86.70  ? 202 ILE A CB    1 
ATOM   1645  C  CG1   . ILE A  1 204 ? 55.389  25.715  43.626  1.00 88.90  ? 202 ILE A CG1   1 
ATOM   1646  C  CG2   . ILE A  1 204 ? 54.865  26.861  41.463  1.00 87.22  ? 202 ILE A CG2   1 
ATOM   1647  C  CD1   . ILE A  1 204 ? 54.264  24.724  43.486  1.00 82.03  ? 202 ILE A CD1   1 
ATOM   1648  N  N     . GLU A  1 205 ? 57.882  26.127  39.808  1.00 94.17  ? 203 GLU A N     1 
ATOM   1649  C  CA    . GLU A  1 205 ? 58.230  26.480  38.438  1.00 101.71 ? 203 GLU A CA    1 
ATOM   1650  C  C     . GLU A  1 205 ? 58.655  25.260  37.631  1.00 101.75 ? 203 GLU A C     1 
ATOM   1651  O  O     . GLU A  1 205 ? 58.380  25.192  36.428  1.00 108.97 ? 203 GLU A O     1 
ATOM   1652  C  CB    . GLU A  1 205 ? 59.332  27.539  38.433  1.00 118.99 ? 203 GLU A CB    1 
ATOM   1653  C  CG    . GLU A  1 205 ? 58.940  28.822  39.143  1.00 125.23 ? 203 GLU A CG    1 
ATOM   1654  C  CD    . GLU A  1 205 ? 57.625  29.387  38.639  1.00 126.08 ? 203 GLU A CD    1 
ATOM   1655  O  OE1   . GLU A  1 205 ? 57.409  29.398  37.407  1.00 128.96 ? 203 GLU A OE1   1 
ATOM   1656  O  OE2   . GLU A  1 205 ? 56.804  29.817  39.476  1.00 124.50 ? 203 GLU A OE2   1 
ATOM   1657  N  N     . GLU A  1 206 ? 59.324  24.292  38.266  1.00 96.07  ? 204 GLU A N     1 
ATOM   1658  C  CA    . GLU A  1 206 ? 59.601  23.028  37.592  1.00 92.96  ? 204 GLU A CA    1 
ATOM   1659  C  C     . GLU A  1 206 ? 58.309  22.343  37.167  1.00 92.56  ? 204 GLU A C     1 
ATOM   1660  O  O     . GLU A  1 206 ? 58.216  21.810  36.055  1.00 95.40  ? 204 GLU A O     1 
ATOM   1661  C  CB    . GLU A  1 206 ? 60.416  22.110  38.504  1.00 91.93  ? 204 GLU A CB    1 
ATOM   1662  C  CG    . GLU A  1 206 ? 61.862  22.532  38.689  1.00 96.22  ? 204 GLU A CG    1 
ATOM   1663  C  CD    . GLU A  1 206 ? 62.585  21.689  39.721  1.00 105.25 ? 204 GLU A CD    1 
ATOM   1664  O  OE1   . GLU A  1 206 ? 63.287  22.268  40.577  1.00 111.92 ? 204 GLU A OE1   1 
ATOM   1665  O  OE2   . GLU A  1 206 ? 62.445  20.449  39.682  1.00 107.35 ? 204 GLU A OE2   1 
ATOM   1666  N  N     . LEU A  1 207 ? 57.298  22.353  38.039  1.00 90.85  ? 205 LEU A N     1 
ATOM   1667  C  CA    . LEU A  1 207 ? 56.012  21.759  37.691  1.00 83.54  ? 205 LEU A CA    1 
ATOM   1668  C  C     . LEU A  1 207 ? 55.299  22.574  36.618  1.00 87.75  ? 205 LEU A C     1 
ATOM   1669  O  O     . LEU A  1 207 ? 54.668  22.007  35.718  1.00 87.98  ? 205 LEU A O     1 
ATOM   1670  C  CB    . LEU A  1 207 ? 55.137  21.634  38.938  1.00 81.53  ? 205 LEU A CB    1 
ATOM   1671  C  CG    . LEU A  1 207 ? 53.729  21.079  38.722  1.00 83.01  ? 205 LEU A CG    1 
ATOM   1672  C  CD1   . LEU A  1 207 ? 53.787  19.671  38.151  1.00 78.39  ? 205 LEU A CD1   1 
ATOM   1673  C  CD2   . LEU A  1 207 ? 52.935  21.106  40.019  1.00 78.00  ? 205 LEU A CD2   1 
ATOM   1674  N  N     . ARG A  1 208 ? 55.384  23.905  36.699  1.00 90.83  ? 206 ARG A N     1 
ATOM   1675  C  CA    . ARG A  1 208 ? 54.745  24.747  35.692  1.00 93.15  ? 206 ARG A CA    1 
ATOM   1676  C  C     . ARG A  1 208 ? 55.362  24.527  34.317  1.00 101.51 ? 206 ARG A C     1 
ATOM   1677  O  O     . ARG A  1 208 ? 54.657  24.549  33.301  1.00 106.62 ? 206 ARG A O     1 
ATOM   1678  C  CB    . ARG A  1 208 ? 54.841  26.219  36.098  1.00 93.15  ? 206 ARG A CB    1 
ATOM   1679  C  CG    . ARG A  1 208 ? 54.014  26.578  37.324  1.00 88.96  ? 206 ARG A CG    1 
ATOM   1680  C  CD    . ARG A  1 208 ? 54.170  28.045  37.706  1.00 97.53  ? 206 ARG A CD    1 
ATOM   1681  N  NE    . ARG A  1 208 ? 53.614  28.946  36.700  1.00 97.58  ? 206 ARG A NE    1 
ATOM   1682  C  CZ    . ARG A  1 208 ? 54.340  29.609  35.806  1.00 99.32  ? 206 ARG A CZ    1 
ATOM   1683  N  NH1   . ARG A  1 208 ? 55.660  29.478  35.789  1.00 106.88 ? 206 ARG A NH1   1 
ATOM   1684  N  NH2   . ARG A  1 208 ? 53.747  30.407  34.928  1.00 104.23 ? 206 ARG A NH2   1 
ATOM   1685  N  N     . GLN A  1 209 ? 56.678  24.311  34.262  1.00 103.69 ? 207 GLN A N     1 
ATOM   1686  C  CA    . GLN A  1 209 ? 57.320  24.003  32.991  1.00 110.53 ? 207 GLN A CA    1 
ATOM   1687  C  C     . GLN A  1 209 ? 57.088  22.556  32.575  1.00 103.13 ? 207 GLN A C     1 
ATOM   1688  O  O     . GLN A  1 209 ? 57.072  22.256  31.376  1.00 105.65 ? 207 GLN A O     1 
ATOM   1689  C  CB    . GLN A  1 209 ? 58.820  24.294  33.069  1.00 117.96 ? 207 GLN A CB    1 
ATOM   1690  C  CG    . GLN A  1 209 ? 59.158  25.736  33.418  1.00 120.56 ? 207 GLN A CG    1 
ATOM   1691  C  CD    . GLN A  1 209 ? 58.565  26.733  32.442  1.00 128.31 ? 207 GLN A CD    1 
ATOM   1692  O  OE1   . GLN A  1 209 ? 58.431  26.451  31.251  1.00 133.47 ? 207 GLN A OE1   1 
ATOM   1693  N  NE2   . GLN A  1 209 ? 58.204  27.908  32.944  1.00 130.89 ? 207 GLN A NE2   1 
ATOM   1694  N  N     . HIS A  1 210 ? 56.909  21.653  33.542  1.00 98.49  ? 208 HIS A N     1 
ATOM   1695  C  CA    . HIS A  1 210 ? 56.600  20.265  33.215  1.00 96.65  ? 208 HIS A CA    1 
ATOM   1696  C  C     . HIS A  1 210 ? 55.248  20.157  32.524  1.00 97.27  ? 208 HIS A C     1 
ATOM   1697  O  O     . HIS A  1 210 ? 55.115  19.492  31.490  1.00 99.29  ? 208 HIS A O     1 
ATOM   1698  C  CB    . HIS A  1 210 ? 56.628  19.411  34.484  1.00 91.78  ? 208 HIS A CB    1 
ATOM   1699  C  CG    . HIS A  1 210 ? 56.333  17.962  34.245  1.00 89.11  ? 208 HIS A CG    1 
ATOM   1700  N  ND1   . HIS A  1 210 ? 57.295  17.063  33.840  1.00 91.94  ? 208 HIS A ND1   1 
ATOM   1701  C  CD2   . HIS A  1 210 ? 55.182  17.257  34.355  1.00 86.79  ? 208 HIS A CD2   1 
ATOM   1702  C  CE1   . HIS A  1 210 ? 56.751  15.866  33.711  1.00 91.69  ? 208 HIS A CE1   1 
ATOM   1703  N  NE2   . HIS A  1 210 ? 55.469  15.956  34.017  1.00 84.39  ? 208 HIS A NE2   1 
ATOM   1704  N  N     . LEU A  1 211 ? 54.227  20.813  33.083  1.00 93.40  ? 209 LEU A N     1 
ATOM   1705  C  CA    . LEU A  1 211 ? 52.907  20.799  32.462  1.00 91.56  ? 209 LEU A CA    1 
ATOM   1706  C  C     . LEU A  1 211 ? 52.905  21.539  31.132  1.00 87.17  ? 209 LEU A C     1 
ATOM   1707  O  O     . LEU A  1 211 ? 52.103  21.219  30.248  1.00 86.53  ? 209 LEU A O     1 
ATOM   1708  C  CB    . LEU A  1 211 ? 51.876  21.414  33.407  1.00 90.63  ? 209 LEU A CB    1 
ATOM   1709  C  CG    . LEU A  1 211 ? 51.761  20.758  34.781  1.00 89.76  ? 209 LEU A CG    1 
ATOM   1710  C  CD1   . LEU A  1 211 ? 50.641  21.392  35.590  1.00 91.27  ? 209 LEU A CD1   1 
ATOM   1711  C  CD2   . LEU A  1 211 ? 51.546  19.264  34.629  1.00 84.99  ? 209 LEU A CD2   1 
ATOM   1712  N  N     . LEU A  1 212 ? 53.789  22.526  30.973  1.00 92.21  ? 210 LEU A N     1 
ATOM   1713  C  CA    . LEU A  1 212 ? 53.852  23.284  29.731  1.00 91.20  ? 210 LEU A CA    1 
ATOM   1714  C  C     . LEU A  1 212 ? 54.322  22.431  28.560  1.00 99.14  ? 210 LEU A C     1 
ATOM   1715  O  O     . LEU A  1 212 ? 54.042  22.776  27.407  1.00 99.92  ? 210 LEU A O     1 
ATOM   1716  C  CB    . LEU A  1 212 ? 54.775  24.491  29.905  1.00 93.50  ? 210 LEU A CB    1 
ATOM   1717  C  CG    . LEU A  1 212 ? 54.574  25.669  28.951  1.00 97.90  ? 210 LEU A CG    1 
ATOM   1718  C  CD1   . LEU A  1 212 ? 53.156  26.205  29.064  1.00 95.54  ? 210 LEU A CD1   1 
ATOM   1719  C  CD2   . LEU A  1 212 ? 55.587  26.764  29.241  1.00 100.24 ? 210 LEU A CD2   1 
ATOM   1720  N  N     . ARG A  1 213 ? 55.025  21.328  28.830  1.00 98.33  ? 211 ARG A N     1 
ATOM   1721  C  CA    . ARG A  1 213 ? 55.475  20.451  27.755  1.00 97.48  ? 211 ARG A CA    1 
ATOM   1722  C  C     . ARG A  1 213 ? 54.304  19.785  27.044  1.00 102.44 ? 211 ARG A C     1 
ATOM   1723  O  O     . ARG A  1 213 ? 54.417  19.431  25.866  1.00 111.09 ? 211 ARG A O     1 
ATOM   1724  C  CB    . ARG A  1 213 ? 56.433  19.395  28.305  1.00 94.27  ? 211 ARG A CB    1 
ATOM   1725  C  CG    . ARG A  1 213 ? 57.650  19.968  29.012  1.00 100.15 ? 211 ARG A CG    1 
ATOM   1726  C  CD    . ARG A  1 213 ? 58.502  18.866  29.620  1.00 111.13 ? 211 ARG A CD    1 
ATOM   1727  N  NE    . ARG A  1 213 ? 59.010  17.944  28.609  1.00 119.36 ? 211 ARG A NE    1 
ATOM   1728  C  CZ    . ARG A  1 213 ? 59.742  16.869  28.880  1.00 127.48 ? 211 ARG A CZ    1 
ATOM   1729  N  NH1   . ARG A  1 213 ? 60.053  16.576  30.136  1.00 131.85 ? 211 ARG A NH1   1 
ATOM   1730  N  NH2   . ARG A  1 213 ? 60.163  16.085  27.897  1.00 130.69 ? 211 ARG A NH2   1 
ATOM   1731  N  N     . TRP A  1 214 ? 53.182  19.605  27.737  1.00 97.97  ? 212 TRP A N     1 
ATOM   1732  C  CA    . TRP A  1 214 ? 51.973  19.051  27.145  1.00 98.80  ? 212 TRP A CA    1 
ATOM   1733  C  C     . TRP A  1 214 ? 50.957  20.125  26.777  1.00 93.60  ? 212 TRP A C     1 
ATOM   1734  O  O     . TRP A  1 214 ? 49.798  19.800  26.499  1.00 87.68  ? 212 TRP A O     1 
ATOM   1735  C  CB    . TRP A  1 214 ? 51.339  18.031  28.092  1.00 95.87  ? 212 TRP A CB    1 
ATOM   1736  C  CG    . TRP A  1 214 ? 52.040  16.705  28.103  1.00 95.26  ? 212 TRP A CG    1 
ATOM   1737  C  CD1   . TRP A  1 214 ? 51.693  15.589  27.398  1.00 93.27  ? 212 TRP A CD1   1 
ATOM   1738  C  CD2   . TRP A  1 214 ? 53.210  16.357  28.853  1.00 98.39  ? 212 TRP A CD2   1 
ATOM   1739  N  NE1   . TRP A  1 214 ? 52.572  14.568  27.665  1.00 91.22  ? 212 TRP A NE1   1 
ATOM   1740  C  CE2   . TRP A  1 214 ? 53.513  15.014  28.555  1.00 91.47  ? 212 TRP A CE2   1 
ATOM   1741  C  CE3   . TRP A  1 214 ? 54.029  17.051  29.749  1.00 102.21 ? 212 TRP A CE3   1 
ATOM   1742  C  CZ2   . TRP A  1 214 ? 54.601  14.351  29.119  1.00 88.94  ? 212 TRP A CZ2   1 
ATOM   1743  C  CZ3   . TRP A  1 214 ? 55.109  16.391  30.309  1.00 99.52  ? 212 TRP A CZ3   1 
ATOM   1744  C  CH2   . TRP A  1 214 ? 55.385  15.055  29.992  1.00 94.19  ? 212 TRP A CH2   1 
ATOM   1745  N  N     . GLY A  1 215 ? 51.361  21.394  26.770  1.00 91.32  ? 213 GLY A N     1 
ATOM   1746  C  CA    . GLY A  1 215 ? 50.461  22.465  26.397  1.00 91.48  ? 213 GLY A CA    1 
ATOM   1747  C  C     . GLY A  1 215 ? 49.545  22.948  27.495  1.00 98.76  ? 213 GLY A C     1 
ATOM   1748  O  O     . GLY A  1 215 ? 48.558  23.632  27.205  1.00 99.66  ? 213 GLY A O     1 
ATOM   1749  N  N     . LEU A  1 216 ? 49.837  22.617  28.750  1.00 96.94  ? 214 LEU A N     1 
ATOM   1750  C  CA    . LEU A  1 216 ? 49.021  23.049  29.878  1.00 99.51  ? 214 LEU A CA    1 
ATOM   1751  C  C     . LEU A  1 216 ? 49.612  24.326  30.464  1.00 104.70 ? 214 LEU A C     1 
ATOM   1752  O  O     . LEU A  1 216 ? 50.750  24.325  30.946  1.00 105.28 ? 214 LEU A O     1 
ATOM   1753  C  CB    . LEU A  1 216 ? 48.942  21.952  30.938  1.00 92.58  ? 214 LEU A CB    1 
ATOM   1754  C  CG    . LEU A  1 216 ? 48.311  20.634  30.487  1.00 89.66  ? 214 LEU A CG    1 
ATOM   1755  C  CD1   . LEU A  1 216 ? 48.350  19.613  31.609  1.00 80.58  ? 214 LEU A CD1   1 
ATOM   1756  C  CD2   . LEU A  1 216 ? 46.884  20.857  30.014  1.00 83.07  ? 214 LEU A CD2   1 
ATOM   1757  N  N     . THR A  1 217 ? 48.840  25.407  30.423  1.00 108.04 ? 215 THR A N     1 
ATOM   1758  C  CA    . THR A  1 217 ? 49.287  26.708  30.899  1.00 114.78 ? 215 THR A CA    1 
ATOM   1759  C  C     . THR A  1 217 ? 48.774  26.963  32.309  1.00 112.21 ? 215 THR A C     1 
ATOM   1760  O  O     . THR A  1 217 ? 47.629  26.634  32.636  1.00 115.18 ? 215 THR A O     1 
ATOM   1761  C  CB    . THR A  1 217 ? 48.812  27.825  29.967  1.00 119.63 ? 215 THR A CB    1 
ATOM   1762  O  OG1   . THR A  1 217 ? 47.381  27.813  29.892  1.00 120.53 ? 215 THR A OG1   1 
ATOM   1763  C  CG2   . THR A  1 217 ? 49.390  27.638  28.572  1.00 121.11 ? 215 THR A CG2   1 
ATOM   1764  N  N     . THR A  1 218 ? 49.633  27.553  33.143  1.00 106.86 ? 216 THR A N     1 
ATOM   1765  C  CA    . THR A  1 218 ? 49.297  27.942  34.511  1.00 100.47 ? 216 THR A CA    1 
ATOM   1766  C  C     . THR A  1 218 ? 49.515  29.447  34.628  1.00 102.05 ? 216 THR A C     1 
ATOM   1767  O  O     . THR A  1 218 ? 50.576  29.898  35.087  1.00 93.57  ? 216 THR A O     1 
ATOM   1768  C  CB    . THR A  1 218 ? 50.135  27.179  35.536  1.00 100.94 ? 216 THR A CB    1 
ATOM   1769  O  OG1   . THR A  1 218 ? 51.524  27.293  35.201  1.00 103.67 ? 216 THR A OG1   1 
ATOM   1770  C  CG2   . THR A  1 218 ? 49.740  25.709  35.558  1.00 93.83  ? 216 THR A CG2   1 
ATOM   1771  N  N     . PRO A  1 219 ? 48.536  30.251  34.223  1.00 107.58 ? 217 PRO A N     1 
ATOM   1772  C  CA    . PRO A  1 219 ? 48.733  31.704  34.200  1.00 113.40 ? 217 PRO A CA    1 
ATOM   1773  C  C     . PRO A  1 219 ? 48.849  32.288  35.599  1.00 123.41 ? 217 PRO A C     1 
ATOM   1774  O  O     . PRO A  1 219 ? 48.419  31.702  36.595  1.00 121.09 ? 217 PRO A O     1 
ATOM   1775  C  CB    . PRO A  1 219 ? 47.479  32.220  33.486  1.00 107.56 ? 217 PRO A CB    1 
ATOM   1776  C  CG    . PRO A  1 219 ? 46.451  31.167  33.733  1.00 106.80 ? 217 PRO A CG    1 
ATOM   1777  C  CD    . PRO A  1 219 ? 47.197  29.863  33.747  1.00 106.11 ? 217 PRO A CD    1 
ATOM   1778  N  N     . ASP A  1 220 ? 49.449  33.480  35.657  1.00 139.03 ? 218 ASP A N     1 
ATOM   1779  C  CA    . ASP A  1 220 ? 49.649  34.178  36.921  1.00 150.63 ? 218 ASP A CA    1 
ATOM   1780  C  C     . ASP A  1 220 ? 48.364  34.774  37.478  1.00 158.38 ? 218 ASP A C     1 
ATOM   1781  O  O     . ASP A  1 220 ? 48.379  35.286  38.603  1.00 159.61 ? 218 ASP A O     1 
ATOM   1782  C  CB    . ASP A  1 220 ? 50.690  35.286  36.746  1.00 153.67 ? 218 ASP A CB    1 
ATOM   1783  C  CG    . ASP A  1 220 ? 51.968  34.790  36.097  1.00 155.24 ? 218 ASP A CG    1 
ATOM   1784  O  OD1   . ASP A  1 220 ? 52.318  33.608  36.294  1.00 155.34 ? 218 ASP A OD1   1 
ATOM   1785  O  OD2   . ASP A  1 220 ? 52.622  35.584  35.388  1.00 158.88 ? 218 ASP A OD2   1 
ATOM   1786  N  N     . LYS A  1 221 ? 47.263  34.725  36.726  1.00 161.80 ? 219 LYS A N     1 
ATOM   1787  C  CA    . LYS A  1 221 ? 46.011  35.309  37.197  1.00 160.18 ? 219 LYS A CA    1 
ATOM   1788  C  C     . LYS A  1 221 ? 45.459  34.532  38.387  1.00 155.14 ? 219 LYS A C     1 
ATOM   1789  O  O     . LYS A  1 221 ? 45.080  35.123  39.405  1.00 161.36 ? 219 LYS A O     1 
ATOM   1790  C  CB    . LYS A  1 221 ? 44.995  35.351  36.055  1.00 158.69 ? 219 LYS A CB    1 
ATOM   1791  C  CG    . LYS A  1 221 ? 44.118  36.598  36.025  1.00 159.00 ? 219 LYS A CG    1 
ATOM   1792  C  CD    . LYS A  1 221 ? 43.083  36.597  37.138  1.00 158.18 ? 219 LYS A CD    1 
ATOM   1793  C  CE    . LYS A  1 221 ? 42.187  37.823  37.056  1.00 159.18 ? 219 LYS A CE    1 
ATOM   1794  N  NZ    . LYS A  1 221 ? 41.142  37.822  38.116  1.00 156.26 ? 219 LYS A NZ    1 
ATOM   1795  N  N     . LYS A  1 222 ? 45.409  33.205  38.279  1.00 144.87 ? 220 LYS A N     1 
ATOM   1796  C  CA    . LYS A  1 222 ? 44.914  32.345  39.347  1.00 131.99 ? 220 LYS A CA    1 
ATOM   1797  C  C     . LYS A  1 222 ? 46.043  31.577  40.029  1.00 123.21 ? 220 LYS A C     1 
ATOM   1798  O  O     . LYS A  1 222 ? 45.861  30.429  40.442  1.00 117.65 ? 220 LYS A O     1 
ATOM   1799  C  CB    . LYS A  1 222 ? 43.858  31.381  38.811  1.00 132.20 ? 220 LYS A CB    1 
ATOM   1800  C  CG    . LYS A  1 222 ? 42.604  32.063  38.286  1.00 136.64 ? 220 LYS A CG    1 
ATOM   1801  C  CD    . LYS A  1 222 ? 41.592  31.044  37.790  1.00 139.90 ? 220 LYS A CD    1 
ATOM   1802  C  CE    . LYS A  1 222 ? 40.329  31.719  37.280  1.00 143.00 ? 220 LYS A CE    1 
ATOM   1803  N  NZ    . LYS A  1 222 ? 39.334  30.726  36.787  1.00 142.86 ? 220 LYS A NZ    1 
ATOM   1804  N  N     . HIS A  1 223 ? 47.212  32.199  40.149  1.00 121.17 ? 221 HIS A N     1 
ATOM   1805  C  CA    . HIS A  1 223 ? 48.349  31.622  40.855  1.00 114.95 ? 221 HIS A CA    1 
ATOM   1806  C  C     . HIS A  1 223 ? 48.367  32.180  42.272  1.00 110.96 ? 221 HIS A C     1 
ATOM   1807  O  O     . HIS A  1 223 ? 48.504  33.394  42.462  1.00 125.39 ? 221 HIS A O     1 
ATOM   1808  C  CB    . HIS A  1 223 ? 49.658  31.937  40.130  1.00 119.59 ? 221 HIS A CB    1 
ATOM   1809  C  CG    . HIS A  1 223 ? 50.823  31.118  40.593  1.00 115.12 ? 221 HIS A CG    1 
ATOM   1810  N  ND1   . HIS A  1 223 ? 51.236  31.084  41.907  1.00 113.81 ? 221 HIS A ND1   1 
ATOM   1811  C  CD2   . HIS A  1 223 ? 51.670  30.310  39.912  1.00 113.14 ? 221 HIS A CD2   1 
ATOM   1812  C  CE1   . HIS A  1 223 ? 52.283  30.286  42.017  1.00 111.34 ? 221 HIS A CE1   1 
ATOM   1813  N  NE2   . HIS A  1 223 ? 52.567  29.803  40.821  1.00 111.66 ? 221 HIS A NE2   1 
ATOM   1814  N  N     . GLN A  1 224 ? 48.225  31.301  43.260  1.00 96.50  ? 222 GLN A N     1 
ATOM   1815  C  CA    . GLN A  1 224 ? 48.125  31.692  44.662  1.00 94.87  ? 222 GLN A CA    1 
ATOM   1816  C  C     . GLN A  1 224 ? 49.441  31.360  45.356  1.00 103.84 ? 222 GLN A C     1 
ATOM   1817  O  O     . GLN A  1 224 ? 49.807  30.186  45.477  1.00 106.57 ? 222 GLN A O     1 
ATOM   1818  C  CB    . GLN A  1 224 ? 46.948  30.990  45.334  1.00 89.30  ? 222 GLN A CB    1 
ATOM   1819  C  CG    . GLN A  1 224 ? 45.618  31.232  44.638  1.00 97.69  ? 222 GLN A CG    1 
ATOM   1820  C  CD    . GLN A  1 224 ? 44.478  30.454  45.264  1.00 108.98 ? 222 GLN A CD    1 
ATOM   1821  O  OE1   . GLN A  1 224 ? 44.621  29.885  46.346  1.00 114.49 ? 222 GLN A OE1   1 
ATOM   1822  N  NE2   . GLN A  1 224 ? 43.338  30.422  44.583  1.00 111.97 ? 222 GLN A NE2   1 
ATOM   1823  N  N     . LYS A  1 225 ? 50.144  32.396  45.818  1.00 104.01 ? 223 LYS A N     1 
ATOM   1824  C  CA    . LYS A  1 225 ? 51.449  32.234  46.441  1.00 103.02 ? 223 LYS A CA    1 
ATOM   1825  C  C     . LYS A  1 225 ? 51.458  32.521  47.936  1.00 112.23 ? 223 LYS A C     1 
ATOM   1826  O  O     . LYS A  1 225 ? 52.490  32.307  48.580  1.00 112.99 ? 223 LYS A O     1 
ATOM   1827  C  CB    . LYS A  1 225 ? 52.482  33.141  45.755  1.00 107.18 ? 223 LYS A CB    1 
ATOM   1828  C  CG    . LYS A  1 225 ? 52.657  32.875  44.270  1.00 108.21 ? 223 LYS A CG    1 
ATOM   1829  C  CD    . LYS A  1 225 ? 53.744  33.751  43.667  1.00 105.83 ? 223 LYS A CD    1 
ATOM   1830  C  CE    . LYS A  1 225 ? 53.927  33.463  42.184  1.00 103.44 ? 223 LYS A CE    1 
ATOM   1831  N  NZ    . LYS A  1 225 ? 55.007  34.293  41.580  1.00 100.86 ? 223 LYS A NZ    1 
ATOM   1832  N  N     . GLU A  1 226 ? 50.352  32.994  48.506  1.00 120.29 ? 224 GLU A N     1 
ATOM   1833  C  CA    . GLU A  1 226 ? 50.324  33.368  49.912  1.00 124.75 ? 224 GLU A CA    1 
ATOM   1834  C  C     . GLU A  1 226 ? 48.920  33.173  50.460  1.00 121.66 ? 224 GLU A C     1 
ATOM   1835  O  O     . GLU A  1 226 ? 47.940  33.346  49.725  1.00 115.86 ? 224 GLU A O     1 
ATOM   1836  C  CB    . GLU A  1 226 ? 50.776  34.822  50.111  1.00 131.52 ? 224 GLU A CB    1 
ATOM   1837  C  CG    . GLU A  1 226 ? 50.128  35.811  49.158  1.00 134.50 ? 224 GLU A CG    1 
ATOM   1838  C  CD    . GLU A  1 226 ? 50.751  37.190  49.241  1.00 139.95 ? 224 GLU A CD    1 
ATOM   1839  O  OE1   . GLU A  1 226 ? 51.371  37.502  50.279  1.00 142.76 ? 224 GLU A OE1   1 
ATOM   1840  O  OE2   . GLU A  1 226 ? 50.627  37.959  48.265  1.00 145.43 ? 224 GLU A OE2   1 
ATOM   1841  N  N     . PRO A  1 227 ? 48.789  32.810  51.733  1.00 120.02 ? 225 PRO A N     1 
ATOM   1842  C  CA    . PRO A  1 227 ? 47.461  32.635  52.331  1.00 111.46 ? 225 PRO A CA    1 
ATOM   1843  C  C     . PRO A  1 227 ? 46.757  33.970  52.489  1.00 109.94 ? 225 PRO A C     1 
ATOM   1844  O  O     . PRO A  1 227 ? 47.412  35.022  52.545  1.00 122.29 ? 225 PRO A O     1 
ATOM   1845  C  CB    . PRO A  1 227 ? 47.773  31.999  53.695  1.00 113.61 ? 225 PRO A CB    1 
ATOM   1846  C  CG    . PRO A  1 227 ? 49.156  32.451  54.006  1.00 118.66 ? 225 PRO A CG    1 
ATOM   1847  C  CD    . PRO A  1 227 ? 49.870  32.504  52.686  1.00 120.54 ? 225 PRO A CD    1 
ATOM   1848  N  N     . PRO A  1 228 ? 45.415  33.977  52.567  1.00 100.38 ? 226 PRO A N     1 
ATOM   1849  C  CA    . PRO A  1 228 ? 44.555  32.789  52.571  1.00 91.66  ? 226 PRO A CA    1 
ATOM   1850  C  C     . PRO A  1 228 ? 44.238  32.271  51.173  1.00 96.87  ? 226 PRO A C     1 
ATOM   1851  O  O     . PRO A  1 228 ? 43.796  33.029  50.310  1.00 100.99 ? 226 PRO A O     1 
ATOM   1852  C  CB    . PRO A  1 228 ? 43.286  33.282  53.272  1.00 87.80  ? 226 PRO A CB    1 
ATOM   1853  C  CG    . PRO A  1 228 ? 43.287  34.786  53.100  1.00 93.08  ? 226 PRO A CG    1 
ATOM   1854  C  CD    . PRO A  1 228 ? 44.621  35.217  52.547  1.00 96.55  ? 226 PRO A CD    1 
ATOM   1855  N  N     . PHE A  1 229 ? 44.468  30.978  50.962  1.00 99.90  ? 227 PHE A N     1 
ATOM   1856  C  CA    . PHE A  1 229 ? 44.212  30.359  49.670  1.00 102.69 ? 227 PHE A CA    1 
ATOM   1857  C  C     . PHE A  1 229 ? 42.740  29.993  49.549  1.00 105.45 ? 227 PHE A C     1 
ATOM   1858  O  O     . PHE A  1 229 ? 42.156  29.414  50.471  1.00 108.74 ? 227 PHE A O     1 
ATOM   1859  C  CB    . PHE A  1 229 ? 45.080  29.114  49.493  1.00 102.21 ? 227 PHE A CB    1 
ATOM   1860  C  CG    . PHE A  1 229 ? 46.547  29.359  49.706  1.00 105.60 ? 227 PHE A CG    1 
ATOM   1861  C  CD1   . PHE A  1 229 ? 47.128  29.134  50.943  1.00 100.67 ? 227 PHE A CD1   1 
ATOM   1862  C  CD2   . PHE A  1 229 ? 47.345  29.811  48.668  1.00 107.08 ? 227 PHE A CD2   1 
ATOM   1863  C  CE1   . PHE A  1 229 ? 48.477  29.357  51.141  1.00 101.74 ? 227 PHE A CE1   1 
ATOM   1864  C  CE2   . PHE A  1 229 ? 48.694  30.036  48.860  1.00 107.38 ? 227 PHE A CE2   1 
ATOM   1865  C  CZ    . PHE A  1 229 ? 49.261  29.809  50.099  1.00 107.99 ? 227 PHE A CZ    1 
ATOM   1866  N  N     . LEU A  1 230 ? 42.140  30.333  48.411  1.00 104.31 ? 228 LEU A N     1 
ATOM   1867  C  CA    . LEU A  1 230 ? 40.763  29.947  48.110  1.00 97.57  ? 228 LEU A CA    1 
ATOM   1868  C  C     . LEU A  1 230 ? 40.811  28.636  47.336  1.00 100.03 ? 228 LEU A C     1 
ATOM   1869  O  O     . LEU A  1 230 ? 41.106  28.616  46.139  1.00 101.64 ? 228 LEU A O     1 
ATOM   1870  C  CB    . LEU A  1 230 ? 40.050  31.045  47.330  1.00 93.64  ? 228 LEU A CB    1 
ATOM   1871  C  CG    . LEU A  1 230 ? 39.850  32.360  48.086  1.00 95.68  ? 228 LEU A CG    1 
ATOM   1872  C  CD1   . LEU A  1 230 ? 39.115  33.377  47.225  1.00 100.72 ? 228 LEU A CD1   1 
ATOM   1873  C  CD2   . LEU A  1 230 ? 39.106  32.121  49.392  1.00 83.16  ? 228 LEU A CD2   1 
ATOM   1874  N  N     . TRP A  1 231 ? 40.523  27.534  48.027  1.00 98.83  ? 229 TRP A N     1 
ATOM   1875  C  CA    . TRP A  1 231 ? 40.635  26.194  47.464  1.00 97.45  ? 229 TRP A CA    1 
ATOM   1876  C  C     . TRP A  1 231 ? 39.388  25.404  47.826  1.00 96.47  ? 229 TRP A C     1 
ATOM   1877  O  O     . TRP A  1 231 ? 39.079  25.242  49.011  1.00 100.36 ? 229 TRP A O     1 
ATOM   1878  C  CB    . TRP A  1 231 ? 41.895  25.492  47.980  1.00 99.75  ? 229 TRP A CB    1 
ATOM   1879  C  CG    . TRP A  1 231 ? 42.072  24.083  47.495  1.00 100.04 ? 229 TRP A CG    1 
ATOM   1880  C  CD1   . TRP A  1 231 ? 42.523  23.688  46.269  1.00 95.90  ? 229 TRP A CD1   1 
ATOM   1881  C  CD2   . TRP A  1 231 ? 41.822  22.883  48.237  1.00 90.28  ? 229 TRP A CD2   1 
ATOM   1882  N  NE1   . TRP A  1 231 ? 42.559  22.316  46.198  1.00 85.79  ? 229 TRP A NE1   1 
ATOM   1883  C  CE2   . TRP A  1 231 ? 42.136  21.798  47.394  1.00 83.12  ? 229 TRP A CE2   1 
ATOM   1884  C  CE3   . TRP A  1 231 ? 41.359  22.620  49.530  1.00 88.55  ? 229 TRP A CE3   1 
ATOM   1885  C  CZ2   . TRP A  1 231 ? 41.999  20.473  47.801  1.00 81.54  ? 229 TRP A CZ2   1 
ATOM   1886  C  CZ3   . TRP A  1 231 ? 41.225  21.303  49.932  1.00 83.71  ? 229 TRP A CZ3   1 
ATOM   1887  C  CH2   . TRP A  1 231 ? 41.545  20.247  49.071  1.00 83.86  ? 229 TRP A CH2   1 
ATOM   1888  N  N     . MET A  1 232 ? 38.673  24.925  46.805  1.00 94.11  ? 230 MET A N     1 
ATOM   1889  C  CA    . MET A  1 232 ? 37.475  24.101  46.981  1.00 87.57  ? 230 MET A CA    1 
ATOM   1890  C  C     . MET A  1 232 ? 36.401  24.814  47.797  1.00 86.91  ? 230 MET A C     1 
ATOM   1891  O  O     . MET A  1 232 ? 35.608  24.174  48.491  1.00 86.22  ? 230 MET A O     1 
ATOM   1892  C  CB    . MET A  1 232 ? 37.816  22.751  47.620  1.00 83.03  ? 230 MET A CB    1 
ATOM   1893  C  CG    . MET A  1 232 ? 38.812  21.925  46.829  1.00 87.15  ? 230 MET A CG    1 
ATOM   1894  S  SD    . MET A  1 232 ? 38.235  21.526  45.171  1.00 92.20  ? 230 MET A SD    1 
ATOM   1895  C  CE    . MET A  1 232 ? 36.748  20.604  45.550  1.00 92.66  ? 230 MET A CE    1 
ATOM   1896  N  N     . GLY A  1 233 ? 36.353  26.141  47.713  1.00 88.15  ? 231 GLY A N     1 
ATOM   1897  C  CA    . GLY A  1 233 ? 35.362  26.894  48.454  1.00 92.70  ? 231 GLY A CA    1 
ATOM   1898  C  C     . GLY A  1 233 ? 35.688  27.116  49.911  1.00 92.70  ? 231 GLY A C     1 
ATOM   1899  O  O     . GLY A  1 233 ? 34.782  27.398  50.701  1.00 83.05  ? 231 GLY A O     1 
ATOM   1900  N  N     . TYR A  1 234 ? 36.955  26.996  50.294  1.00 92.54  ? 232 TYR A N     1 
ATOM   1901  C  CA    . TYR A  1 234 ? 37.394  27.218  51.662  1.00 88.33  ? 232 TYR A CA    1 
ATOM   1902  C  C     . TYR A  1 234 ? 38.497  28.269  51.682  1.00 93.57  ? 232 TYR A C     1 
ATOM   1903  O  O     . TYR A  1 234 ? 39.057  28.640  50.648  1.00 98.27  ? 232 TYR A O     1 
ATOM   1904  C  CB    . TYR A  1 234 ? 37.894  25.918  52.304  1.00 85.18  ? 232 TYR A CB    1 
ATOM   1905  C  CG    . TYR A  1 234 ? 36.890  24.790  52.281  1.00 85.19  ? 232 TYR A CG    1 
ATOM   1906  C  CD1   . TYR A  1 234 ? 35.932  24.666  53.278  1.00 83.80  ? 232 TYR A CD1   1 
ATOM   1907  C  CD2   . TYR A  1 234 ? 36.903  23.844  51.266  1.00 85.61  ? 232 TYR A CD2   1 
ATOM   1908  C  CE1   . TYR A  1 234 ? 35.013  23.636  53.262  1.00 80.47  ? 232 TYR A CE1   1 
ATOM   1909  C  CE2   . TYR A  1 234 ? 35.987  22.810  51.239  1.00 85.07  ? 232 TYR A CE2   1 
ATOM   1910  C  CZ    . TYR A  1 234 ? 35.045  22.710  52.240  1.00 84.52  ? 232 TYR A CZ    1 
ATOM   1911  O  OH    . TYR A  1 234 ? 34.132  21.682  52.220  1.00 82.22  ? 232 TYR A OH    1 
ATOM   1912  N  N     . GLU A  1 235 ? 38.804  28.746  52.883  1.00 93.67  ? 233 GLU A N     1 
ATOM   1913  C  CA    . GLU A  1 235 ? 39.892  29.691  53.111  1.00 100.86 ? 233 GLU A CA    1 
ATOM   1914  C  C     . GLU A  1 235 ? 40.992  28.956  53.865  1.00 94.08  ? 233 GLU A C     1 
ATOM   1915  O  O     . GLU A  1 235 ? 40.841  28.651  55.052  1.00 97.29  ? 233 GLU A O     1 
ATOM   1916  C  CB    . GLU A  1 235 ? 39.404  30.910  53.891  1.00 108.09 ? 233 GLU A CB    1 
ATOM   1917  C  CG    . GLU A  1 235 ? 38.253  31.648  53.228  1.00 110.48 ? 233 GLU A CG    1 
ATOM   1918  C  CD    . GLU A  1 235 ? 37.718  32.780  54.081  1.00 115.56 ? 233 GLU A CD    1 
ATOM   1919  O  OE1   . GLU A  1 235 ? 38.201  32.948  55.220  1.00 114.87 ? 233 GLU A OE1   1 
ATOM   1920  O  OE2   . GLU A  1 235 ? 36.813  33.502  53.613  1.00 117.80 ? 233 GLU A OE2   1 
ATOM   1921  N  N     . LEU A  1 236 ? 42.094  28.669  53.178  1.00 82.69  ? 234 LEU A N     1 
ATOM   1922  C  CA    . LEU A  1 236 ? 43.183  27.893  53.758  1.00 80.36  ? 234 LEU A CA    1 
ATOM   1923  C  C     . LEU A  1 236 ? 44.239  28.829  54.333  1.00 83.46  ? 234 LEU A C     1 
ATOM   1924  O  O     . LEU A  1 236 ? 44.815  29.645  53.606  1.00 96.99  ? 234 LEU A O     1 
ATOM   1925  C  CB    . LEU A  1 236 ? 43.800  26.961  52.716  1.00 79.91  ? 234 LEU A CB    1 
ATOM   1926  C  CG    . LEU A  1 236 ? 42.874  25.906  52.112  1.00 76.48  ? 234 LEU A CG    1 
ATOM   1927  C  CD1   . LEU A  1 236 ? 43.656  24.963  51.211  1.00 79.68  ? 234 LEU A CD1   1 
ATOM   1928  C  CD2   . LEU A  1 236 ? 42.151  25.132  53.203  1.00 82.65  ? 234 LEU A CD2   1 
ATOM   1929  N  N     . HIS A  1 237 ? 44.487  28.707  55.629  1.00 76.92  ? 235 HIS A N     1 
ATOM   1930  C  CA    . HIS A  1 237 ? 45.526  29.440  56.332  1.00 89.05  ? 235 HIS A CA    1 
ATOM   1931  C  C     . HIS A  1 237 ? 46.634  28.486  56.768  1.00 89.62  ? 235 HIS A C     1 
ATOM   1932  O  O     . HIS A  1 237 ? 46.441  27.265  56.777  1.00 83.89  ? 235 HIS A O     1 
ATOM   1933  C  CB    . HIS A  1 237 ? 44.936  30.166  57.551  1.00 90.81  ? 235 HIS A CB    1 
ATOM   1934  C  CG    . HIS A  1 237 ? 43.940  31.226  57.196  1.00 93.35  ? 235 HIS A CG    1 
ATOM   1935  N  ND1   . HIS A  1 237 ? 42.705  30.936  56.655  1.00 90.99  ? 235 HIS A ND1   1 
ATOM   1936  C  CD2   . HIS A  1 237 ? 43.998  32.575  57.298  1.00 96.34  ? 235 HIS A CD2   1 
ATOM   1937  C  CE1   . HIS A  1 237 ? 42.045  32.060  56.443  1.00 92.65  ? 235 HIS A CE1   1 
ATOM   1938  N  NE2   . HIS A  1 237 ? 42.807  33.069  56.824  1.00 96.30  ? 235 HIS A NE2   1 
ATOM   1939  N  N     . PRO A  1 238 ? 47.820  29.003  57.111  1.00 92.23  ? 236 PRO A N     1 
ATOM   1940  C  CA    . PRO A  1 238 ? 48.931  28.101  57.467  1.00 96.87  ? 236 PRO A CA    1 
ATOM   1941  C  C     . PRO A  1 238 ? 48.615  27.129  58.592  1.00 101.84 ? 236 PRO A C     1 
ATOM   1942  O  O     . PRO A  1 238 ? 49.182  26.028  58.617  1.00 107.93 ? 236 PRO A O     1 
ATOM   1943  C  CB    . PRO A  1 238 ? 50.050  29.073  57.863  1.00 90.32  ? 236 PRO A CB    1 
ATOM   1944  C  CG    . PRO A  1 238 ? 49.767  30.295  57.072  1.00 93.95  ? 236 PRO A CG    1 
ATOM   1945  C  CD    . PRO A  1 238 ? 48.268  30.405  57.011  1.00 89.74  ? 236 PRO A CD    1 
ATOM   1946  N  N     . ASP A  1 239 ? 47.728  27.488  59.521  1.00 96.23  ? 237 ASP A N     1 
ATOM   1947  C  CA    . ASP A  1 239 ? 47.427  26.624  60.653  1.00 94.66  ? 237 ASP A CA    1 
ATOM   1948  C  C     . ASP A  1 239 ? 45.941  26.374  60.865  1.00 87.26  ? 237 ASP A C     1 
ATOM   1949  O  O     . ASP A  1 239 ? 45.582  25.671  61.816  1.00 92.42  ? 237 ASP A O     1 
ATOM   1950  C  CB    . ASP A  1 239 ? 48.028  27.206  61.942  1.00 104.48 ? 237 ASP A CB    1 
ATOM   1951  C  CG    . ASP A  1 239 ? 49.542  27.198  61.932  1.00 116.31 ? 237 ASP A CG    1 
ATOM   1952  O  OD1   . ASP A  1 239 ? 50.128  26.237  61.389  1.00 117.78 ? 237 ASP A OD1   1 
ATOM   1953  O  OD2   . ASP A  1 239 ? 50.148  28.152  62.464  1.00 123.02 ? 237 ASP A OD2   1 
ATOM   1954  N  N     . LYS A  1 240 ? 45.070  26.915  60.017  1.00 76.49  ? 238 LYS A N     1 
ATOM   1955  C  CA    . LYS A  1 240 ? 43.640  26.686  60.157  1.00 72.45  ? 238 LYS A CA    1 
ATOM   1956  C  C     . LYS A  1 240 ? 42.977  26.830  58.796  1.00 79.82  ? 238 LYS A C     1 
ATOM   1957  O  O     . LYS A  1 240 ? 43.571  27.330  57.838  1.00 81.50  ? 238 LYS A O     1 
ATOM   1958  C  CB    . LYS A  1 240 ? 43.010  27.649  61.170  1.00 73.85  ? 238 LYS A CB    1 
ATOM   1959  C  CG    . LYS A  1 240 ? 42.934  29.091  60.698  1.00 79.14  ? 238 LYS A CG    1 
ATOM   1960  C  CD    . LYS A  1 240 ? 42.244  29.973  61.727  1.00 87.44  ? 238 LYS A CD    1 
ATOM   1961  C  CE    . LYS A  1 240 ? 42.246  31.431  61.295  1.00 93.79  ? 238 LYS A CE    1 
ATOM   1962  N  NZ    . LYS A  1 240 ? 41.634  32.317  62.324  1.00 93.97  ? 238 LYS A NZ    1 
ATOM   1963  N  N     . TRP A  1 241 ? 41.730  26.376  58.722  1.00 78.63  ? 239 TRP A N     1 
ATOM   1964  C  CA    . TRP A  1 241 ? 40.918  26.525  57.526  1.00 79.09  ? 239 TRP A CA    1 
ATOM   1965  C  C     . TRP A  1 241 ? 39.501  26.882  57.944  1.00 77.72  ? 239 TRP A C     1 
ATOM   1966  O  O     . TRP A  1 241 ? 39.062  26.569  59.053  1.00 70.58  ? 239 TRP A O     1 
ATOM   1967  C  CB    . TRP A  1 241 ? 40.912  25.249  56.670  1.00 69.23  ? 239 TRP A CB    1 
ATOM   1968  C  CG    . TRP A  1 241 ? 40.171  24.110  57.302  1.00 67.05  ? 239 TRP A CG    1 
ATOM   1969  C  CD1   . TRP A  1 241 ? 40.696  23.128  58.089  1.00 65.57  ? 239 TRP A CD1   1 
ATOM   1970  C  CD2   . TRP A  1 241 ? 38.767  23.837  57.202  1.00 66.27  ? 239 TRP A CD2   1 
ATOM   1971  N  NE1   . TRP A  1 241 ? 39.707  22.260  58.484  1.00 63.90  ? 239 TRP A NE1   1 
ATOM   1972  C  CE2   . TRP A  1 241 ? 38.514  22.674  57.953  1.00 64.29  ? 239 TRP A CE2   1 
ATOM   1973  C  CE3   . TRP A  1 241 ? 37.701  24.464  56.550  1.00 68.14  ? 239 TRP A CE3   1 
ATOM   1974  C  CZ2   . TRP A  1 241 ? 37.239  22.125  58.071  1.00 67.81  ? 239 TRP A CZ2   1 
ATOM   1975  C  CZ3   . TRP A  1 241 ? 36.436  23.918  56.669  1.00 66.10  ? 239 TRP A CZ3   1 
ATOM   1976  C  CH2   . TRP A  1 241 ? 36.216  22.760  57.423  1.00 64.15  ? 239 TRP A CH2   1 
ATOM   1977  N  N     . THR A  1 242 ? 38.786  27.544  57.039  1.00 85.13  ? 240 THR A N     1 
ATOM   1978  C  CA    . THR A  1 242 ? 37.395  27.886  57.285  1.00 91.34  ? 240 THR A CA    1 
ATOM   1979  C  C     . THR A  1 242 ? 36.652  27.910  55.960  1.00 82.96  ? 240 THR A C     1 
ATOM   1980  O  O     . THR A  1 242 ? 37.243  28.064  54.892  1.00 87.63  ? 240 THR A O     1 
ATOM   1981  C  CB    . THR A  1 242 ? 37.253  29.234  58.001  1.00 100.61 ? 240 THR A CB    1 
ATOM   1982  O  OG1   . THR A  1 242 ? 35.864  29.534  58.186  1.00 104.32 ? 240 THR A OG1   1 
ATOM   1983  C  CG2   . THR A  1 242 ? 37.899  30.342  57.187  1.00 104.54 ? 240 THR A CG2   1 
ATOM   1984  N  N     . VAL A  1 243 ? 35.336  27.747  56.047  1.00 74.39  ? 241 VAL A N     1 
ATOM   1985  C  CA    . VAL A  1 243 ? 34.491  27.829  54.866  1.00 72.91  ? 241 VAL A CA    1 
ATOM   1986  C  C     . VAL A  1 243 ? 34.357  29.289  54.443  1.00 83.68  ? 241 VAL A C     1 
ATOM   1987  O  O     . VAL A  1 243 ? 34.358  30.209  55.275  1.00 90.61  ? 241 VAL A O     1 
ATOM   1988  C  CB    . VAL A  1 243 ? 33.117  27.188  55.142  1.00 79.30  ? 241 VAL A CB    1 
ATOM   1989  C  CG1   . VAL A  1 243 ? 32.388  27.930  56.254  1.00 72.86  ? 241 VAL A CG1   1 
ATOM   1990  C  CG2   . VAL A  1 243 ? 32.283  27.145  53.880  1.00 88.43  ? 241 VAL A CG2   1 
ATOM   1991  N  N     . GLN A  1 244 ? 34.273  29.511  53.133  1.00 86.48  ? 242 GLN A N     1 
ATOM   1992  C  CA    . GLN A  1 244 ? 34.054  30.852  52.620  1.00 93.76  ? 242 GLN A CA    1 
ATOM   1993  C  C     . GLN A  1 244 ? 32.728  31.398  53.151  1.00 92.26  ? 242 GLN A C     1 
ATOM   1994  O  O     . GLN A  1 244 ? 31.810  30.627  53.450  1.00 96.00  ? 242 GLN A O     1 
ATOM   1995  C  CB    . GLN A  1 244 ? 34.061  30.843  51.091  1.00 100.41 ? 242 GLN A CB    1 
ATOM   1996  C  CG    . GLN A  1 244 ? 35.428  30.547  50.494  1.00 103.34 ? 242 GLN A CG    1 
ATOM   1997  C  CD    . GLN A  1 244 ? 35.405  30.480  48.980  1.00 107.71 ? 242 GLN A CD    1 
ATOM   1998  O  OE1   . GLN A  1 244 ? 34.395  30.788  48.349  1.00 112.97 ? 242 GLN A OE1   1 
ATOM   1999  N  NE2   . GLN A  1 244 ? 36.523  30.073  48.390  1.00 104.28 ? 242 GLN A NE2   1 
ATOM   2000  N  N     . PRO A  1 245 ? 32.609  32.731  53.295  1.00 93.94  ? 243 PRO A N     1 
ATOM   2001  C  CA    . PRO A  1 245 ? 31.416  33.313  53.931  1.00 93.81  ? 243 PRO A CA    1 
ATOM   2002  C  C     . PRO A  1 245 ? 30.099  32.821  53.351  1.00 98.33  ? 243 PRO A C     1 
ATOM   2003  O  O     . PRO A  1 245 ? 29.843  32.952  52.149  1.00 99.79  ? 243 PRO A O     1 
ATOM   2004  C  CB    . PRO A  1 245 ? 31.599  34.817  53.693  1.00 99.43  ? 243 PRO A CB    1 
ATOM   2005  C  CG    . PRO A  1 245 ? 33.074  34.996  53.620  1.00 101.87 ? 243 PRO A CG    1 
ATOM   2006  C  CD    . PRO A  1 245 ? 33.603  33.761  52.945  1.00 98.22  ? 243 PRO A CD    1 
ATOM   2007  N  N     . ILE A  1 246 ? 29.261  32.246  54.208  1.00 98.35  ? 244 ILE A N     1 
ATOM   2008  C  CA    . ILE A  1 246 ? 27.969  31.697  53.815  1.00 104.20 ? 244 ILE A CA    1 
ATOM   2009  C  C     . ILE A  1 246 ? 26.896  32.721  54.156  1.00 107.14 ? 244 ILE A C     1 
ATOM   2010  O  O     . ILE A  1 246 ? 26.762  33.129  55.316  1.00 103.85 ? 244 ILE A O     1 
ATOM   2011  C  CB    . ILE A  1 246 ? 27.697  30.356  54.512  1.00 102.56 ? 244 ILE A CB    1 
ATOM   2012  C  CG1   . ILE A  1 246 ? 28.845  29.380  54.247  1.00 102.43 ? 244 ILE A CG1   1 
ATOM   2013  C  CG2   . ILE A  1 246 ? 26.373  29.770  54.044  1.00 105.53 ? 244 ILE A CG2   1 
ATOM   2014  C  CD1   . ILE A  1 246 ? 28.746  28.095  55.031  1.00 97.02  ? 244 ILE A CD1   1 
ATOM   2015  N  N     . VAL A  1 247 ? 26.133  33.136  53.150  1.00 108.24 ? 245 VAL A N     1 
ATOM   2016  C  CA    . VAL A  1 247 ? 25.084  34.136  53.308  1.00 106.16 ? 245 VAL A CA    1 
ATOM   2017  C  C     . VAL A  1 247 ? 23.740  33.422  53.267  1.00 109.40 ? 245 VAL A C     1 
ATOM   2018  O  O     . VAL A  1 247 ? 23.440  32.702  52.306  1.00 105.90 ? 245 VAL A O     1 
ATOM   2019  C  CB    . VAL A  1 247 ? 25.164  35.220  52.222  1.00 101.10 ? 245 VAL A CB    1 
ATOM   2020  C  CG1   . VAL A  1 247 ? 24.108  36.288  52.461  1.00 98.07  ? 245 VAL A CG1   1 
ATOM   2021  C  CG2   . VAL A  1 247 ? 26.556  35.832  52.186  1.00 100.51 ? 245 VAL A CG2   1 
ATOM   2022  N  N     . LEU A  1 248 ? 22.935  33.619  54.310  1.00 112.57 ? 246 LEU A N     1 
ATOM   2023  C  CA    . LEU A  1 248 ? 21.593  33.053  54.349  1.00 118.02 ? 246 LEU A CA    1 
ATOM   2024  C  C     . LEU A  1 248 ? 20.577  34.111  53.956  1.00 123.91 ? 246 LEU A C     1 
ATOM   2025  O  O     . LEU A  1 248 ? 20.637  35.237  54.471  1.00 124.88 ? 246 LEU A O     1 
ATOM   2026  C  CB    . LEU A  1 248 ? 21.270  32.521  55.742  1.00 115.78 ? 246 LEU A CB    1 
ATOM   2027  C  CG    . LEU A  1 248 ? 22.119  31.356  56.254  1.00 111.04 ? 246 LEU A CG    1 
ATOM   2028  C  CD1   . LEU A  1 248 ? 21.652  30.924  57.635  1.00 103.36 ? 246 LEU A CD1   1 
ATOM   2029  C  CD2   . LEU A  1 248 ? 22.073  30.189  55.280  1.00 109.97 ? 246 LEU A CD2   1 
ATOM   2030  N  N     . PRO A  1 249 ? 19.644  33.804  53.059  1.00 126.57 ? 247 PRO A N     1 
ATOM   2031  C  CA    . PRO A  1 249 ? 18.629  34.795  52.689  1.00 129.92 ? 247 PRO A CA    1 
ATOM   2032  C  C     . PRO A  1 249 ? 17.687  35.079  53.847  1.00 131.05 ? 247 PRO A C     1 
ATOM   2033  O  O     . PRO A  1 249 ? 17.397  34.211  54.674  1.00 125.38 ? 247 PRO A O     1 
ATOM   2034  C  CB    . PRO A  1 249 ? 17.893  34.131  51.520  1.00 130.58 ? 247 PRO A CB    1 
ATOM   2035  C  CG    . PRO A  1 249 ? 18.090  32.668  51.743  1.00 126.73 ? 247 PRO A CG    1 
ATOM   2036  C  CD    . PRO A  1 249 ? 19.461  32.529  52.345  1.00 125.21 ? 247 PRO A CD    1 
ATOM   2037  N  N     . GLU A  1 250 ? 17.210  36.322  53.901  1.00 138.41 ? 248 GLU A N     1 
ATOM   2038  C  CA    . GLU A  1 250 ? 16.299  36.781  54.950  1.00 144.72 ? 248 GLU A CA    1 
ATOM   2039  C  C     . GLU A  1 250 ? 15.107  37.444  54.268  1.00 144.54 ? 248 GLU A C     1 
ATOM   2040  O  O     . GLU A  1 250 ? 15.095  38.660  54.056  1.00 148.94 ? 248 GLU A O     1 
ATOM   2041  C  CB    . GLU A  1 250 ? 17.006  37.729  55.915  1.00 150.17 ? 248 GLU A CB    1 
ATOM   2042  C  CG    . GLU A  1 250 ? 16.186  38.090  57.142  1.00 156.07 ? 248 GLU A CG    1 
ATOM   2043  C  CD    . GLU A  1 250 ? 16.970  38.918  58.141  1.00 161.94 ? 248 GLU A CD    1 
ATOM   2044  O  OE1   . GLU A  1 250 ? 18.163  39.185  57.886  1.00 161.85 ? 248 GLU A OE1   1 
ATOM   2045  O  OE2   . GLU A  1 250 ? 16.393  39.302  59.180  1.00 164.74 ? 248 GLU A OE2   1 
ATOM   2046  N  N     . LYS A  1 251 ? 14.107  36.640  53.925  1.00 140.48 ? 249 LYS A N     1 
ATOM   2047  C  CA    . LYS A  1 251 ? 12.906  37.118  53.257  1.00 138.03 ? 249 LYS A CA    1 
ATOM   2048  C  C     . LYS A  1 251 ? 11.766  37.261  54.257  1.00 137.04 ? 249 LYS A C     1 
ATOM   2049  O  O     . LYS A  1 251 ? 11.696  36.541  55.256  1.00 130.72 ? 249 LYS A O     1 
ATOM   2050  C  CB    . LYS A  1 251 ? 12.491  36.164  52.135  1.00 133.84 ? 249 LYS A CB    1 
ATOM   2051  C  CG    . LYS A  1 251 ? 13.603  35.832  51.154  1.00 128.90 ? 249 LYS A CG    1 
ATOM   2052  C  CD    . LYS A  1 251 ? 13.106  34.906  50.056  1.00 130.56 ? 249 LYS A CD    1 
ATOM   2053  C  CE    . LYS A  1 251 ? 11.971  35.546  49.272  1.00 137.71 ? 249 LYS A CE    1 
ATOM   2054  N  NZ    . LYS A  1 251 ? 11.460  34.651  48.197  1.00 138.80 ? 249 LYS A NZ    1 
ATOM   2055  N  N     . ASP A  1 252 ? 10.869  38.208  53.978  1.00 143.44 ? 250 ASP A N     1 
ATOM   2056  C  CA    . ASP A  1 252 ? 9.689   38.377  54.818  1.00 150.46 ? 250 ASP A CA    1 
ATOM   2057  C  C     . ASP A  1 252 ? 8.646   37.300  54.550  1.00 157.87 ? 250 ASP A C     1 
ATOM   2058  O  O     . ASP A  1 252 ? 7.951   36.872  55.478  1.00 153.74 ? 250 ASP A O     1 
ATOM   2059  C  CB    . ASP A  1 252 ? 9.085   39.766  54.606  1.00 150.56 ? 250 ASP A CB    1 
ATOM   2060  C  CG    . ASP A  1 252 ? 8.731   40.034  53.157  1.00 149.31 ? 250 ASP A CG    1 
ATOM   2061  O  OD1   . ASP A  1 252 ? 9.409   39.481  52.265  1.00 148.01 ? 250 ASP A OD1   1 
ATOM   2062  O  OD2   . ASP A  1 252 ? 7.775   40.799  52.909  1.00 149.19 ? 250 ASP A OD2   1 
ATOM   2063  N  N     . SER A  1 253 ? 8.526   36.853  53.302  1.00 161.80 ? 251 SER A N     1 
ATOM   2064  C  CA    . SER A  1 253 ? 7.624   35.773  52.922  1.00 162.49 ? 251 SER A CA    1 
ATOM   2065  C  C     . SER A  1 253 ? 8.453   34.646  52.325  1.00 152.27 ? 251 SER A C     1 
ATOM   2066  O  O     . SER A  1 253 ? 9.198   34.863  51.363  1.00 153.29 ? 251 SER A O     1 
ATOM   2067  C  CB    . SER A  1 253 ? 6.570   36.258  51.925  1.00 171.21 ? 251 SER A CB    1 
ATOM   2068  O  OG    . SER A  1 253 ? 7.174   36.720  50.729  1.00 176.41 ? 251 SER A OG    1 
ATOM   2069  N  N     . TRP A  1 254 ? 8.325   33.452  52.893  1.00 143.52 ? 252 TRP A N     1 
ATOM   2070  C  CA    . TRP A  1 254 ? 9.117   32.302  52.482  1.00 133.45 ? 252 TRP A CA    1 
ATOM   2071  C  C     . TRP A  1 254 ? 8.291   31.363  51.614  1.00 125.39 ? 252 TRP A C     1 
ATOM   2072  O  O     . TRP A  1 254 ? 7.133   31.067  51.924  1.00 120.60 ? 252 TRP A O     1 
ATOM   2073  C  CB    . TRP A  1 254 ? 9.654   31.550  53.701  1.00 132.29 ? 252 TRP A CB    1 
ATOM   2074  C  CG    . TRP A  1 254 ? 10.770  32.266  54.392  1.00 130.81 ? 252 TRP A CG    1 
ATOM   2075  C  CD1   . TRP A  1 254 ? 10.659  33.202  55.378  1.00 130.21 ? 252 TRP A CD1   1 
ATOM   2076  C  CD2   . TRP A  1 254 ? 12.172  32.107  54.145  1.00 129.27 ? 252 TRP A CD2   1 
ATOM   2077  N  NE1   . TRP A  1 254 ? 11.906  33.635  55.762  1.00 128.53 ? 252 TRP A NE1   1 
ATOM   2078  C  CE2   . TRP A  1 254 ? 12.851  32.978  55.019  1.00 128.75 ? 252 TRP A CE2   1 
ATOM   2079  C  CE3   . TRP A  1 254 ? 12.918  31.312  53.269  1.00 125.69 ? 252 TRP A CE3   1 
ATOM   2080  C  CZ2   . TRP A  1 254 ? 14.241  33.076  55.043  1.00 127.89 ? 252 TRP A CZ2   1 
ATOM   2081  C  CZ3   . TRP A  1 254 ? 14.297  31.411  53.295  1.00 122.76 ? 252 TRP A CZ3   1 
ATOM   2082  C  CH2   . TRP A  1 254 ? 14.944  32.286  54.175  1.00 122.97 ? 252 TRP A CH2   1 
ATOM   2083  N  N     . THR A  1 255 ? 8.896   30.897  50.525  1.00 125.69 ? 253 THR A N     1 
ATOM   2084  C  CA    . THR A  1 255 ? 8.280   29.952  49.609  1.00 131.21 ? 253 THR A CA    1 
ATOM   2085  C  C     . THR A  1 255 ? 8.994   28.604  49.713  1.00 136.21 ? 253 THR A C     1 
ATOM   2086  O  O     . THR A  1 255 ? 9.818   28.378  50.606  1.00 136.46 ? 253 THR A O     1 
ATOM   2087  C  CB    . THR A  1 255 ? 8.309   30.500  48.180  1.00 130.61 ? 253 THR A CB    1 
ATOM   2088  O  OG1   . THR A  1 255 ? 9.657   30.503  47.693  1.00 127.63 ? 253 THR A OG1   1 
ATOM   2089  C  CG2   . THR A  1 255 ? 7.762   31.920  48.145  1.00 135.40 ? 253 THR A CG2   1 
ATOM   2090  N  N     . VAL A  1 256 ? 8.678   27.701  48.784  1.00 138.25 ? 254 VAL A N     1 
ATOM   2091  C  CA    . VAL A  1 256 ? 9.249   26.359  48.826  1.00 139.05 ? 254 VAL A CA    1 
ATOM   2092  C  C     . VAL A  1 256 ? 10.691  26.366  48.334  1.00 139.57 ? 254 VAL A C     1 
ATOM   2093  O  O     . VAL A  1 256 ? 11.584  25.808  48.981  1.00 135.95 ? 254 VAL A O     1 
ATOM   2094  C  CB    . VAL A  1 256 ? 8.379   25.384  48.012  1.00 138.98 ? 254 VAL A CB    1 
ATOM   2095  C  CG1   . VAL A  1 256 ? 9.032   24.011  47.956  1.00 133.35 ? 254 VAL A CG1   1 
ATOM   2096  C  CG2   . VAL A  1 256 ? 6.991   25.291  48.616  1.00 144.13 ? 254 VAL A CG2   1 
ATOM   2097  N  N     . ASN A  1 257 ? 10.941  26.996  47.183  1.00 140.94 ? 255 ASN A N     1 
ATOM   2098  C  CA    . ASN A  1 257 ? 12.290  27.022  46.630  1.00 138.35 ? 255 ASN A CA    1 
ATOM   2099  C  C     . ASN A  1 257 ? 13.259  27.810  47.501  1.00 136.00 ? 255 ASN A C     1 
ATOM   2100  O  O     . ASN A  1 257 ? 14.469  27.571  47.433  1.00 137.42 ? 255 ASN A O     1 
ATOM   2101  C  CB    . ASN A  1 257 ? 12.268  27.601  45.214  1.00 144.59 ? 255 ASN A CB    1 
ATOM   2102  C  CG    . ASN A  1 257 ? 13.590  27.425  44.491  1.00 147.67 ? 255 ASN A CG    1 
ATOM   2103  O  OD1   . ASN A  1 257 ? 14.440  28.315  44.498  1.00 152.19 ? 255 ASN A OD1   1 
ATOM   2104  N  ND2   . ASN A  1 257 ? 13.771  26.268  43.865  1.00 144.75 ? 255 ASN A ND2   1 
ATOM   2105  N  N     . ASP A  1 258 ? 12.757  28.739  48.318  1.00 132.42 ? 256 ASP A N     1 
ATOM   2106  C  CA    . ASP A  1 258 ? 13.635  29.482  49.216  1.00 125.43 ? 256 ASP A CA    1 
ATOM   2107  C  C     . ASP A  1 258 ? 14.113  28.607  50.368  1.00 116.86 ? 256 ASP A C     1 
ATOM   2108  O  O     . ASP A  1 258 ? 15.274  28.697  50.784  1.00 115.80 ? 256 ASP A O     1 
ATOM   2109  C  CB    . ASP A  1 258 ? 12.916  30.722  49.747  1.00 128.80 ? 256 ASP A CB    1 
ATOM   2110  C  CG    . ASP A  1 258 ? 12.412  31.622  48.637  1.00 132.96 ? 256 ASP A CG    1 
ATOM   2111  O  OD1   . ASP A  1 258 ? 13.053  31.666  47.566  1.00 131.94 ? 256 ASP A OD1   1 
ATOM   2112  O  OD2   . ASP A  1 258 ? 11.372  32.286  48.836  1.00 136.89 ? 256 ASP A OD2   1 
ATOM   2113  N  N     . ILE A  1 259 ? 13.232  27.754  50.896  1.00 111.84 ? 257 ILE A N     1 
ATOM   2114  C  CA    . ILE A  1 259 ? 13.621  26.864  51.986  1.00 104.30 ? 257 ILE A CA    1 
ATOM   2115  C  C     . ILE A  1 259 ? 14.591  25.801  51.485  1.00 98.91  ? 257 ILE A C     1 
ATOM   2116  O  O     . ILE A  1 259 ? 15.513  25.395  52.203  1.00 96.84  ? 257 ILE A O     1 
ATOM   2117  C  CB    . ILE A  1 259 ? 12.372  26.239  52.633  1.00 103.35 ? 257 ILE A CB    1 
ATOM   2118  C  CG1   . ILE A  1 259 ? 11.437  27.333  53.152  1.00 106.91 ? 257 ILE A CG1   1 
ATOM   2119  C  CG2   . ILE A  1 259 ? 12.762  25.300  53.764  1.00 99.20  ? 257 ILE A CG2   1 
ATOM   2120  C  CD1   . ILE A  1 259 ? 10.145  26.806  53.739  1.00 111.45 ? 257 ILE A CD1   1 
ATOM   2121  N  N     . GLN A  1 260 ? 14.405  25.338  50.246  1.00 101.02 ? 258 GLN A N     1 
ATOM   2122  C  CA    . GLN A  1 260 ? 15.317  24.350  49.679  1.00 104.13 ? 258 GLN A CA    1 
ATOM   2123  C  C     . GLN A  1 260 ? 16.734  24.899  49.582  1.00 106.15 ? 258 GLN A C     1 
ATOM   2124  O  O     . GLN A  1 260 ? 17.706  24.185  49.858  1.00 102.20 ? 258 GLN A O     1 
ATOM   2125  C  CB    . GLN A  1 260 ? 14.817  23.903  48.305  1.00 107.32 ? 258 GLN A CB    1 
ATOM   2126  C  CG    . GLN A  1 260 ? 13.482  23.176  48.336  1.00 105.92 ? 258 GLN A CG    1 
ATOM   2127  C  CD    . GLN A  1 260 ? 12.998  22.792  46.952  1.00 101.40 ? 258 GLN A CD    1 
ATOM   2128  O  OE1   . GLN A  1 260 ? 13.521  23.269  45.944  1.00 105.11 ? 258 GLN A OE1   1 
ATOM   2129  N  NE2   . GLN A  1 260 ? 11.996  21.924  46.896  1.00 98.06  ? 258 GLN A NE2   1 
ATOM   2130  N  N     . LYS A  1 261 ? 16.873  26.168  49.189  1.00 109.93 ? 259 LYS A N     1 
ATOM   2131  C  CA    . LYS A  1 261 ? 18.186  26.802  49.199  1.00 113.03 ? 259 LYS A CA    1 
ATOM   2132  C  C     . LYS A  1 261 ? 18.657  27.081  50.620  1.00 112.06 ? 259 LYS A C     1 
ATOM   2133  O  O     . LYS A  1 261 ? 19.863  27.043  50.892  1.00 109.80 ? 259 LYS A O     1 
ATOM   2134  C  CB    . LYS A  1 261 ? 18.152  28.098  48.389  1.00 114.85 ? 259 LYS A CB    1 
ATOM   2135  C  CG    . LYS A  1 261 ? 17.739  27.917  46.938  1.00 112.20 ? 259 LYS A CG    1 
ATOM   2136  C  CD    . LYS A  1 261 ? 17.600  29.256  46.231  1.00 120.51 ? 259 LYS A CD    1 
ATOM   2137  C  CE    . LYS A  1 261 ? 18.892  30.054  46.292  1.00 125.36 ? 259 LYS A CE    1 
ATOM   2138  N  NZ    . LYS A  1 261 ? 18.770  31.362  45.590  1.00 130.59 ? 259 LYS A NZ    1 
ATOM   2139  N  N     . LEU A  1 262 ? 17.725  27.358  51.535  1.00 108.97 ? 260 LEU A N     1 
ATOM   2140  C  CA    . LEU A  1 262 ? 18.094  27.639  52.918  1.00 100.83 ? 260 LEU A CA    1 
ATOM   2141  C  C     . LEU A  1 262 ? 18.612  26.388  53.616  1.00 97.66  ? 260 LEU A C     1 
ATOM   2142  O  O     . LEU A  1 262 ? 19.657  26.421  54.277  1.00 97.27  ? 260 LEU A O     1 
ATOM   2143  C  CB    . LEU A  1 262 ? 16.895  28.219  53.669  1.00 97.82  ? 260 LEU A CB    1 
ATOM   2144  C  CG    . LEU A  1 262 ? 17.092  28.491  55.160  1.00 101.66 ? 260 LEU A CG    1 
ATOM   2145  C  CD1   . LEU A  1 262 ? 18.212  29.496  55.380  1.00 104.47 ? 260 LEU A CD1   1 
ATOM   2146  C  CD2   . LEU A  1 262 ? 15.796  28.978  55.788  1.00 104.99 ? 260 LEU A CD2   1 
ATOM   2147  N  N     . VAL A  1 263 ? 17.889  25.272  53.484  1.00 94.17  ? 261 VAL A N     1 
ATOM   2148  C  CA    . VAL A  1 263 ? 18.328  24.020  54.093  1.00 87.62  ? 261 VAL A CA    1 
ATOM   2149  C  C     . VAL A  1 263 ? 19.631  23.545  53.465  1.00 91.66  ? 261 VAL A C     1 
ATOM   2150  O  O     . VAL A  1 263 ? 20.486  22.965  54.147  1.00 92.79  ? 261 VAL A O     1 
ATOM   2151  C  CB    . VAL A  1 263 ? 17.218  22.955  53.975  1.00 74.49  ? 261 VAL A CB    1 
ATOM   2152  C  CG1   . VAL A  1 263 ? 17.705  21.603  54.476  1.00 63.86  ? 261 VAL A CG1   1 
ATOM   2153  C  CG2   . VAL A  1 263 ? 15.981  23.395  54.744  1.00 77.00  ? 261 VAL A CG2   1 
ATOM   2154  N  N     . GLY A  1 264 ? 19.814  23.793  52.167  1.00 92.87  ? 262 GLY A N     1 
ATOM   2155  C  CA    . GLY A  1 264 ? 21.035  23.363  51.507  1.00 93.16  ? 262 GLY A CA    1 
ATOM   2156  C  C     . GLY A  1 264 ? 22.272  24.053  52.048  1.00 91.48  ? 262 GLY A C     1 
ATOM   2157  O  O     . GLY A  1 264 ? 23.302  23.413  52.274  1.00 90.85  ? 262 GLY A O     1 
ATOM   2158  N  N     . LYS A  1 265 ? 22.192  25.370  52.258  1.00 89.69  ? 263 LYS A N     1 
ATOM   2159  C  CA    . LYS A  1 265 ? 23.336  26.096  52.799  1.00 85.05  ? 263 LYS A CA    1 
ATOM   2160  C  C     . LYS A  1 265 ? 23.618  25.706  54.243  1.00 86.16  ? 263 LYS A C     1 
ATOM   2161  O  O     . LYS A  1 265 ? 24.779  25.708  54.668  1.00 82.83  ? 263 LYS A O     1 
ATOM   2162  C  CB    . LYS A  1 265 ? 23.107  27.604  52.690  1.00 85.76  ? 263 LYS A CB    1 
ATOM   2163  C  CG    . LYS A  1 265 ? 23.145  28.135  51.267  1.00 88.22  ? 263 LYS A CG    1 
ATOM   2164  C  CD    . LYS A  1 265 ? 22.963  29.643  51.237  1.00 91.73  ? 263 LYS A CD    1 
ATOM   2165  C  CE    . LYS A  1 265 ? 23.061  30.185  49.820  1.00 86.74  ? 263 LYS A CE    1 
ATOM   2166  N  NZ    . LYS A  1 265 ? 22.833  31.656  49.772  1.00 90.70  ? 263 LYS A NZ    1 
ATOM   2167  N  N     . LEU A  1 266 ? 22.577  25.372  55.010  1.00 84.92  ? 264 LEU A N     1 
ATOM   2168  C  CA    . LEU A  1 266 ? 22.790  24.927  56.383  1.00 79.07  ? 264 LEU A CA    1 
ATOM   2169  C  C     . LEU A  1 266 ? 23.453  23.556  56.431  1.00 80.81  ? 264 LEU A C     1 
ATOM   2170  O  O     . LEU A  1 266 ? 24.247  23.287  57.339  1.00 87.30  ? 264 LEU A O     1 
ATOM   2171  C  CB    . LEU A  1 266 ? 21.463  24.909  57.141  1.00 73.65  ? 264 LEU A CB    1 
ATOM   2172  C  CG    . LEU A  1 266 ? 20.805  26.273  57.357  1.00 75.12  ? 264 LEU A CG    1 
ATOM   2173  C  CD1   . LEU A  1 266 ? 19.435  26.114  57.990  1.00 75.18  ? 264 LEU A CD1   1 
ATOM   2174  C  CD2   . LEU A  1 266 ? 21.690  27.166  58.212  1.00 76.16  ? 264 LEU A CD2   1 
ATOM   2175  N  N     . ASN A  1 267 ? 23.139  22.679  55.473  1.00 79.87  ? 265 ASN A N     1 
ATOM   2176  C  CA    . ASN A  1 267 ? 23.856  21.412  55.373  1.00 75.66  ? 265 ASN A CA    1 
ATOM   2177  C  C     . ASN A  1 267 ? 25.322  21.644  55.034  1.00 68.16  ? 265 ASN A C     1 
ATOM   2178  O  O     . ASN A  1 267 ? 26.211  21.004  55.608  1.00 67.95  ? 265 ASN A O     1 
ATOM   2179  C  CB    . ASN A  1 267 ? 23.202  20.514  54.322  1.00 75.26  ? 265 ASN A CB    1 
ATOM   2180  C  CG    . ASN A  1 267 ? 21.865  19.964  54.775  1.00 77.12  ? 265 ASN A CG    1 
ATOM   2181  O  OD1   . ASN A  1 267 ? 21.630  19.779  55.968  1.00 65.11  ? 265 ASN A OD1   1 
ATOM   2182  N  ND2   . ASN A  1 267 ? 20.981  19.695  53.821  1.00 85.62  ? 265 ASN A ND2   1 
ATOM   2183  N  N     . TRP A  1 268 ? 25.592  22.559  54.101  1.00 67.40  ? 266 TRP A N     1 
ATOM   2184  C  CA    . TRP A  1 268 ? 26.970  22.896  53.765  1.00 64.42  ? 266 TRP A CA    1 
ATOM   2185  C  C     . TRP A  1 268 ? 27.676  23.590  54.923  1.00 67.41  ? 266 TRP A C     1 
ATOM   2186  O  O     . TRP A  1 268 ? 28.893  23.448  55.078  1.00 74.86  ? 266 TRP A O     1 
ATOM   2187  C  CB    . TRP A  1 268 ? 26.993  23.772  52.512  1.00 68.21  ? 266 TRP A CB    1 
ATOM   2188  C  CG    . TRP A  1 268 ? 28.304  24.437  52.247  1.00 64.88  ? 266 TRP A CG    1 
ATOM   2189  C  CD1   . TRP A  1 268 ? 28.636  25.729  52.528  1.00 63.29  ? 266 TRP A CD1   1 
ATOM   2190  C  CD2   . TRP A  1 268 ? 29.462  23.848  51.642  1.00 63.40  ? 266 TRP A CD2   1 
ATOM   2191  N  NE1   . TRP A  1 268 ? 29.926  25.982  52.137  1.00 63.59  ? 266 TRP A NE1   1 
ATOM   2192  C  CE2   . TRP A  1 268 ? 30.457  24.843  51.592  1.00 67.17  ? 266 TRP A CE2   1 
ATOM   2193  C  CE3   . TRP A  1 268 ? 29.753  22.576  51.139  1.00 65.45  ? 266 TRP A CE3   1 
ATOM   2194  C  CZ2   . TRP A  1 268 ? 31.723  24.607  51.059  1.00 69.43  ? 266 TRP A CZ2   1 
ATOM   2195  C  CZ3   . TRP A  1 268 ? 31.010  22.343  50.610  1.00 67.15  ? 266 TRP A CZ3   1 
ATOM   2196  C  CH2   . TRP A  1 268 ? 31.980  23.354  50.575  1.00 66.35  ? 266 TRP A CH2   1 
ATOM   2197  N  N     . ALA A  1 269 ? 26.934  24.332  55.747  1.00 65.59  ? 267 ALA A N     1 
ATOM   2198  C  CA    . ALA A  1 269 ? 27.528  25.014  56.890  1.00 66.17  ? 267 ALA A CA    1 
ATOM   2199  C  C     . ALA A  1 269 ? 27.744  24.092  58.082  1.00 70.81  ? 267 ALA A C     1 
ATOM   2200  O  O     . ALA A  1 269 ? 28.588  24.392  58.934  1.00 66.64  ? 267 ALA A O     1 
ATOM   2201  C  CB    . ALA A  1 269 ? 26.653  26.196  57.311  1.00 61.86  ? 267 ALA A CB    1 
ATOM   2202  N  N     . SER A  1 270 ? 27.012  22.979  58.162  1.00 64.64  ? 268 SER A N     1 
ATOM   2203  C  CA    . SER A  1 270 ? 27.111  22.077  59.304  1.00 55.32  ? 268 SER A CA    1 
ATOM   2204  C  C     . SER A  1 270 ? 28.415  21.292  59.337  1.00 58.77  ? 268 SER A C     1 
ATOM   2205  O  O     . SER A  1 270 ? 28.629  20.534  60.290  1.00 62.39  ? 268 SER A O     1 
ATOM   2206  C  CB    . SER A  1 270 ? 25.928  21.107  59.308  1.00 55.19  ? 268 SER A CB    1 
ATOM   2207  O  OG    . SER A  1 270 ? 25.944  20.276  58.161  1.00 50.78  ? 268 SER A OG    1 
ATOM   2208  N  N     . GLN A  1 271 ? 29.283  21.446  58.338  1.00 67.21  ? 269 GLN A N     1 
ATOM   2209  C  CA    . GLN A  1 271 ? 30.556  20.739  58.322  1.00 64.05  ? 269 GLN A CA    1 
ATOM   2210  C  C     . GLN A  1 271 ? 31.598  21.365  59.238  1.00 66.38  ? 269 GLN A C     1 
ATOM   2211  O  O     . GLN A  1 271 ? 32.658  20.763  59.441  1.00 67.69  ? 269 GLN A O     1 
ATOM   2212  C  CB    . GLN A  1 271 ? 31.110  20.680  56.896  1.00 61.17  ? 269 GLN A CB    1 
ATOM   2213  C  CG    . GLN A  1 271 ? 31.448  22.042  56.314  1.00 63.35  ? 269 GLN A CG    1 
ATOM   2214  C  CD    . GLN A  1 271 ? 32.080  21.949  54.939  1.00 67.09  ? 269 GLN A CD    1 
ATOM   2215  O  OE1   . GLN A  1 271 ? 33.099  21.284  54.755  1.00 67.61  ? 269 GLN A OE1   1 
ATOM   2216  N  NE2   . GLN A  1 271 ? 31.473  22.616  53.963  1.00 58.21  ? 269 GLN A NE2   1 
ATOM   2217  N  N     . ILE A  1 272 ? 31.334  22.548  59.791  1.00 62.18  ? 270 ILE A N     1 
ATOM   2218  C  CA    . ILE A  1 272 ? 32.309  23.214  60.646  1.00 65.46  ? 270 ILE A CA    1 
ATOM   2219  C  C     . ILE A  1 272 ? 31.593  24.001  61.738  1.00 63.81  ? 270 ILE A C     1 
ATOM   2220  O  O     . ILE A  1 272 ? 32.185  24.324  62.774  1.00 62.95  ? 270 ILE A O     1 
ATOM   2221  C  CB    . ILE A  1 272 ? 33.241  24.119  59.818  1.00 64.89  ? 270 ILE A CB    1 
ATOM   2222  C  CG1   . ILE A  1 272 ? 34.498  24.463  60.620  1.00 65.10  ? 270 ILE A CG1   1 
ATOM   2223  C  CG2   . ILE A  1 272 ? 32.516  25.382  59.373  1.00 57.55  ? 270 ILE A CG2   1 
ATOM   2224  C  CD1   . ILE A  1 272 ? 35.214  23.248  61.171  1.00 63.02  ? 270 ILE A CD1   1 
ATOM   2225  N  N     . TYR A  1 273 ? 30.313  24.310  61.522  1.00 69.01  ? 271 TYR A N     1 
ATOM   2226  C  CA    . TYR A  1 273 ? 29.514  24.995  62.530  1.00 74.60  ? 271 TYR A CA    1 
ATOM   2227  C  C     . TYR A  1 273 ? 28.774  23.959  63.364  1.00 75.43  ? 271 TYR A C     1 
ATOM   2228  O  O     . TYR A  1 273 ? 27.896  23.263  62.830  1.00 73.08  ? 271 TYR A O     1 
ATOM   2229  C  CB    . TYR A  1 273 ? 28.531  25.959  61.881  1.00 66.15  ? 271 TYR A CB    1 
ATOM   2230  C  CG    . TYR A  1 273 ? 29.143  27.277  61.463  1.00 66.06  ? 271 TYR A CG    1 
ATOM   2231  C  CD1   . TYR A  1 273 ? 29.212  28.343  62.350  1.00 74.02  ? 271 TYR A CD1   1 
ATOM   2232  C  CD2   . TYR A  1 273 ? 29.646  27.458  60.182  1.00 72.11  ? 271 TYR A CD2   1 
ATOM   2233  C  CE1   . TYR A  1 273 ? 29.768  29.552  61.975  1.00 77.50  ? 271 TYR A CE1   1 
ATOM   2234  C  CE2   . TYR A  1 273 ? 30.205  28.662  59.797  1.00 74.86  ? 271 TYR A CE2   1 
ATOM   2235  C  CZ    . TYR A  1 273 ? 30.263  29.706  60.697  1.00 78.97  ? 271 TYR A CZ    1 
ATOM   2236  O  OH    . TYR A  1 273 ? 30.818  30.907  60.319  1.00 85.65  ? 271 TYR A OH    1 
ATOM   2237  N  N     . PRO A  1 274 ? 29.081  23.815  64.652  1.00 68.40  ? 272 PRO A N     1 
ATOM   2238  C  CA    . PRO A  1 274 ? 28.438  22.767  65.452  1.00 57.35  ? 272 PRO A CA    1 
ATOM   2239  C  C     . PRO A  1 274 ? 27.019  23.142  65.850  1.00 63.59  ? 272 PRO A C     1 
ATOM   2240  O  O     . PRO A  1 274 ? 26.733  24.285  66.215  1.00 65.43  ? 272 PRO A O     1 
ATOM   2241  C  CB    . PRO A  1 274 ? 29.343  22.658  66.689  1.00 55.27  ? 272 PRO A CB    1 
ATOM   2242  C  CG    . PRO A  1 274 ? 30.568  23.491  66.381  1.00 59.68  ? 272 PRO A CG    1 
ATOM   2243  C  CD    . PRO A  1 274 ? 30.117  24.529  65.412  1.00 56.07  ? 272 PRO A CD    1 
ATOM   2244  N  N     . GLY A  1 275 ? 26.127  22.158  65.775  1.00 60.05  ? 273 GLY A N     1 
ATOM   2245  C  CA    . GLY A  1 275 ? 24.783  22.311  66.297  1.00 65.72  ? 273 GLY A CA    1 
ATOM   2246  C  C     . GLY A  1 275 ? 23.743  22.825  65.328  1.00 71.67  ? 273 GLY A C     1 
ATOM   2247  O  O     . GLY A  1 275 ? 22.732  23.380  65.772  1.00 81.58  ? 273 GLY A O     1 
ATOM   2248  N  N     . ILE A  1 276 ? 23.946  22.656  64.026  1.00 72.18  ? 274 ILE A N     1 
ATOM   2249  C  CA    . ILE A  1 276 ? 22.985  23.133  63.037  1.00 79.13  ? 274 ILE A CA    1 
ATOM   2250  C  C     . ILE A  1 276 ? 21.890  22.089  62.859  1.00 76.16  ? 274 ILE A C     1 
ATOM   2251  O  O     . ILE A  1 276 ? 22.168  20.889  62.749  1.00 72.08  ? 274 ILE A O     1 
ATOM   2252  C  CB    . ILE A  1 276 ? 23.685  23.446  61.704  1.00 80.19  ? 274 ILE A CB    1 
ATOM   2253  C  CG1   . ILE A  1 276 ? 24.607  24.657  61.862  1.00 79.43  ? 274 ILE A CG1   1 
ATOM   2254  C  CG2   . ILE A  1 276 ? 22.664  23.691  60.601  1.00 84.93  ? 274 ILE A CG2   1 
ATOM   2255  C  CD1   . ILE A  1 276 ? 25.228  25.127  60.565  1.00 90.87  ? 274 ILE A CD1   1 
ATOM   2256  N  N     . LYS A  1 277 ? 20.638  22.545  62.836  1.00 79.86  ? 275 LYS A N     1 
ATOM   2257  C  CA    . LYS A  1 277 ? 19.477  21.683  62.669  1.00 81.22  ? 275 LYS A CA    1 
ATOM   2258  C  C     . LYS A  1 277 ? 18.663  22.141  61.467  1.00 82.57  ? 275 LYS A C     1 
ATOM   2259  O  O     . LYS A  1 277 ? 18.534  23.343  61.215  1.00 84.20  ? 275 LYS A O     1 
ATOM   2260  C  CB    . LYS A  1 277 ? 18.593  21.695  63.921  1.00 77.44  ? 275 LYS A CB    1 
ATOM   2261  C  CG    . LYS A  1 277 ? 19.329  21.433  65.224  1.00 78.18  ? 275 LYS A CG    1 
ATOM   2262  C  CD    . LYS A  1 277 ? 18.363  21.436  66.400  1.00 85.71  ? 275 LYS A CD    1 
ATOM   2263  C  CE    . LYS A  1 277 ? 19.093  21.334  67.730  1.00 89.05  ? 275 LYS A CE    1 
ATOM   2264  N  NZ    . LYS A  1 277 ? 19.918  22.541  68.012  1.00 99.41  ? 275 LYS A NZ    1 
ATOM   2265  N  N     . VAL A  1 278 ? 18.111  21.178  60.727  1.00 83.68  ? 276 VAL A N     1 
ATOM   2266  C  CA    . VAL A  1 278 ? 17.237  21.477  59.596  1.00 83.18  ? 276 VAL A CA    1 
ATOM   2267  C  C     . VAL A  1 278 ? 16.022  20.559  59.637  1.00 82.91  ? 276 VAL A C     1 
ATOM   2268  O  O     . VAL A  1 278 ? 15.389  20.305  58.606  1.00 88.55  ? 276 VAL A O     1 
ATOM   2269  C  CB    . VAL A  1 278 ? 17.978  21.343  58.252  1.00 77.83  ? 276 VAL A CB    1 
ATOM   2270  C  CG1   . VAL A  1 278 ? 19.023  22.435  58.101  1.00 82.39  ? 276 VAL A CG1   1 
ATOM   2271  C  CG2   . VAL A  1 278 ? 18.616  19.971  58.127  1.00 65.83  ? 276 VAL A CG2   1 
ATOM   2272  N  N     . ARG A  1 279 ? 15.684  20.058  60.827  1.00 84.53  ? 277 ARG A N     1 
ATOM   2273  C  CA    . ARG A  1 279 ? 14.535  19.166  60.957  1.00 85.17  ? 277 ARG A CA    1 
ATOM   2274  C  C     . ARG A  1 279 ? 13.228  19.910  60.714  1.00 94.91  ? 277 ARG A C     1 
ATOM   2275  O  O     . ARG A  1 279 ? 12.405  19.490  59.893  1.00 102.85 ? 277 ARG A O     1 
ATOM   2276  C  CB    . ARG A  1 279 ? 14.531  18.512  62.339  1.00 75.32  ? 277 ARG A CB    1 
ATOM   2277  C  CG    . ARG A  1 279 ? 13.178  17.957  62.766  1.00 76.31  ? 277 ARG A CG    1 
ATOM   2278  C  CD    . ARG A  1 279 ? 12.817  16.679  62.024  1.00 78.22  ? 277 ARG A CD    1 
ATOM   2279  N  NE    . ARG A  1 279 ? 13.574  15.529  62.510  1.00 82.60  ? 277 ARG A NE    1 
ATOM   2280  C  CZ    . ARG A  1 279 ? 14.621  15.002  61.884  1.00 80.81  ? 277 ARG A CZ    1 
ATOM   2281  N  NH1   . ARG A  1 279 ? 15.038  15.516  60.736  1.00 88.18  ? 277 ARG A NH1   1 
ATOM   2282  N  NH2   . ARG A  1 279 ? 15.248  13.955  62.404  1.00 66.32  ? 277 ARG A NH2   1 
ATOM   2283  N  N     . GLN A  1 280 ? 13.021  21.023  61.421  1.00 91.29  ? 278 GLN A N     1 
ATOM   2284  C  CA    . GLN A  1 280 ? 11.760  21.748  61.305  1.00 89.89  ? 278 GLN A CA    1 
ATOM   2285  C  C     . GLN A  1 280 ? 11.665  22.520  59.995  1.00 93.03  ? 278 GLN A C     1 
ATOM   2286  O  O     . GLN A  1 280 ? 10.557  22.763  59.503  1.00 100.13 ? 278 GLN A O     1 
ATOM   2287  C  CB    . GLN A  1 280 ? 11.587  22.691  62.496  1.00 91.43  ? 278 GLN A CB    1 
ATOM   2288  C  CG    . GLN A  1 280 ? 11.650  22.003  63.853  1.00 91.79  ? 278 GLN A CG    1 
ATOM   2289  C  CD    . GLN A  1 280 ? 10.531  20.998  64.057  1.00 97.36  ? 278 GLN A CD    1 
ATOM   2290  O  OE1   . GLN A  1 280 ? 9.478   21.084  63.424  1.00 101.30 ? 278 GLN A OE1   1 
ATOM   2291  N  NE2   . GLN A  1 280 ? 10.755  20.037  64.945  1.00 95.94  ? 278 GLN A NE2   1 
ATOM   2292  N  N     . LEU A  1 281 ? 12.801  22.913  59.417  1.00 90.63  ? 279 LEU A N     1 
ATOM   2293  C  CA    . LEU A  1 281 ? 12.771  23.599  58.129  1.00 90.57  ? 279 LEU A CA    1 
ATOM   2294  C  C     . LEU A  1 281 ? 12.437  22.629  57.002  1.00 93.53  ? 279 LEU A C     1 
ATOM   2295  O  O     . LEU A  1 281 ? 11.615  22.934  56.129  1.00 92.56  ? 279 LEU A O     1 
ATOM   2296  C  CB    . LEU A  1 281 ? 14.109  24.291  57.866  1.00 88.37  ? 279 LEU A CB    1 
ATOM   2297  C  CG    . LEU A  1 281 ? 14.492  25.417  58.827  1.00 88.82  ? 279 LEU A CG    1 
ATOM   2298  C  CD1   . LEU A  1 281 ? 15.821  26.034  58.428  1.00 87.89  ? 279 LEU A CD1   1 
ATOM   2299  C  CD2   . LEU A  1 281 ? 13.401  26.474  58.874  1.00 95.57  ? 279 LEU A CD2   1 
ATOM   2300  N  N     . SER A  1 282 ? 13.069  21.452  57.003  1.00 94.32  ? 280 SER A N     1 
ATOM   2301  C  CA    . SER A  1 282 ? 12.769  20.454  55.981  1.00 100.03 ? 280 SER A CA    1 
ATOM   2302  C  C     . SER A  1 282 ? 11.365  19.889  56.145  1.00 106.03 ? 280 SER A C     1 
ATOM   2303  O  O     . SER A  1 282 ? 10.768  19.427  55.166  1.00 111.88 ? 280 SER A O     1 
ATOM   2304  C  CB    . SER A  1 282 ? 13.800  19.326  56.023  1.00 99.37  ? 280 SER A CB    1 
ATOM   2305  O  OG    . SER A  1 282 ? 15.111  19.821  55.817  1.00 101.57 ? 280 SER A OG    1 
ATOM   2306  N  N     . LYS A  1 283 ? 10.824  19.917  57.366  1.00 101.95 ? 281 LYS A N     1 
ATOM   2307  C  CA    . LYS A  1 283 ? 9.463   19.443  57.591  1.00 100.50 ? 281 LYS A CA    1 
ATOM   2308  C  C     . LYS A  1 283 ? 8.437   20.280  56.838  1.00 100.61 ? 281 LYS A C     1 
ATOM   2309  O  O     . LYS A  1 283 ? 7.336   19.792  56.560  1.00 102.65 ? 281 LYS A O     1 
ATOM   2310  C  CB    . LYS A  1 283 ? 9.151   19.442  59.090  1.00 96.54  ? 281 LYS A CB    1 
ATOM   2311  C  CG    . LYS A  1 283 ? 7.908   18.652  59.473  1.00 97.31  ? 281 LYS A CG    1 
ATOM   2312  C  CD    . LYS A  1 283 ? 7.695   18.644  60.978  1.00 101.13 ? 281 LYS A CD    1 
ATOM   2313  C  CE    . LYS A  1 283 ? 6.462   17.838  61.355  1.00 101.99 ? 281 LYS A CE    1 
ATOM   2314  N  NZ    . LYS A  1 283 ? 6.224   17.829  62.825  1.00 98.43  ? 281 LYS A NZ    1 
ATOM   2315  N  N     . LEU A  1 284 ? 8.775   21.525  56.497  1.00 96.38  ? 282 LEU A N     1 
ATOM   2316  C  CA    . LEU A  1 284 ? 7.877   22.372  55.724  1.00 97.27  ? 282 LEU A CA    1 
ATOM   2317  C  C     . LEU A  1 284 ? 7.841   21.995  54.250  1.00 104.48 ? 282 LEU A C     1 
ATOM   2318  O  O     . LEU A  1 284 ? 6.905   22.390  53.546  1.00 111.59 ? 282 LEU A O     1 
ATOM   2319  C  CB    . LEU A  1 284 ? 8.287   23.839  55.866  1.00 97.72  ? 282 LEU A CB    1 
ATOM   2320  C  CG    . LEU A  1 284 ? 8.585   24.333  57.283  1.00 96.41  ? 282 LEU A CG    1 
ATOM   2321  C  CD1   . LEU A  1 284 ? 8.956   25.808  57.269  1.00 101.57 ? 282 LEU A CD1   1 
ATOM   2322  C  CD2   . LEU A  1 284 ? 7.403   24.079  58.205  1.00 95.91  ? 282 LEU A CD2   1 
ATOM   2323  N  N     . LEU A  1 285 ? 8.831   21.244  53.768  1.00 100.03 ? 283 LEU A N     1 
ATOM   2324  C  CA    . LEU A  1 285 ? 8.915   20.848  52.370  1.00 105.83 ? 283 LEU A CA    1 
ATOM   2325  C  C     . LEU A  1 285 ? 8.163   19.554  52.077  1.00 110.51 ? 283 LEU A C     1 
ATOM   2326  O  O     . LEU A  1 285 ? 8.423   18.915  51.050  1.00 111.45 ? 283 LEU A O     1 
ATOM   2327  C  CB    . LEU A  1 285 ? 10.380  20.706  51.951  1.00 100.85 ? 283 LEU A CB    1 
ATOM   2328  C  CG    . LEU A  1 285 ? 11.261  21.944  52.123  1.00 105.29 ? 283 LEU A CG    1 
ATOM   2329  C  CD1   . LEU A  1 285 ? 12.692  21.647  51.702  1.00 97.83  ? 283 LEU A CD1   1 
ATOM   2330  C  CD2   . LEU A  1 285 ? 10.698  23.114  51.334  1.00 114.42 ? 283 LEU A CD2   1 
ATOM   2331  N  N     . ARG A  1 286 ? 7.240   19.158  52.947  1.00 113.84 ? 284 ARG A N     1 
ATOM   2332  C  CA    . ARG A  1 286 ? 6.498   17.915  52.797  1.00 113.15 ? 284 ARG A CA    1 
ATOM   2333  C  C     . ARG A  1 286 ? 5.098   18.196  52.267  1.00 119.72 ? 284 ARG A C     1 
ATOM   2334  O  O     . ARG A  1 286 ? 4.482   19.207  52.615  1.00 123.10 ? 284 ARG A O     1 
ATOM   2335  C  CB    . ARG A  1 286 ? 6.413   17.173  54.132  1.00 106.57 ? 284 ARG A CB    1 
ATOM   2336  C  CG    . ARG A  1 286 ? 7.764   16.774  54.703  1.00 101.21 ? 284 ARG A CG    1 
ATOM   2337  C  CD    . ARG A  1 286 ? 7.624   16.196  56.101  1.00 103.63 ? 284 ARG A CD    1 
ATOM   2338  N  NE    . ARG A  1 286 ? 8.917   15.826  56.671  1.00 103.70 ? 284 ARG A NE    1 
ATOM   2339  C  CZ    . ARG A  1 286 ? 9.087   15.387  57.913  1.00 100.56 ? 284 ARG A CZ    1 
ATOM   2340  N  NH1   . ARG A  1 286 ? 8.045   15.265  58.724  1.00 101.84 ? 284 ARG A NH1   1 
ATOM   2341  N  NH2   . ARG A  1 286 ? 10.300  15.074  58.348  1.00 94.26  ? 284 ARG A NH2   1 
ATOM   2342  N  N     . GLY A  1 287 ? 4.603   17.295  51.421  1.00 127.28 ? 285 GLY A N     1 
ATOM   2343  C  CA    . GLY A  1 287 ? 3.262   17.415  50.883  1.00 142.34 ? 285 GLY A CA    1 
ATOM   2344  C  C     . GLY A  1 287 ? 3.142   18.403  49.742  1.00 162.39 ? 285 GLY A C     1 
ATOM   2345  O  O     . GLY A  1 287 ? 2.755   18.031  48.629  1.00 163.59 ? 285 GLY A O     1 
ATOM   2346  N  N     . THR A  1 288 ? 3.466   19.666  50.008  1.00 173.47 ? 286 THR A N     1 
ATOM   2347  C  CA    . THR A  1 288 ? 3.370   20.699  48.985  1.00 185.13 ? 286 THR A CA    1 
ATOM   2348  C  C     . THR A  1 288 ? 4.358   20.431  47.857  1.00 183.11 ? 286 THR A C     1 
ATOM   2349  O  O     . THR A  1 288 ? 5.553   20.230  48.094  1.00 185.65 ? 286 THR A O     1 
ATOM   2350  C  CB    . THR A  1 288 ? 3.631   22.076  49.597  1.00 188.92 ? 286 THR A CB    1 
ATOM   2351  O  OG1   . THR A  1 288 ? 2.575   22.405  50.508  1.00 190.96 ? 286 THR A OG1   1 
ATOM   2352  C  CG2   . THR A  1 288 ? 3.712   23.136  48.510  1.00 191.66 ? 286 THR A CG2   1 
ATOM   2353  N  N     . LYS A  1 289 ? 3.853   20.427  46.624  1.00 178.15 ? 287 LYS A N     1 
ATOM   2354  C  CA    . LYS A  1 289 ? 4.696   20.198  45.457  1.00 169.13 ? 287 LYS A CA    1 
ATOM   2355  C  C     . LYS A  1 289 ? 4.604   21.364  44.481  1.00 165.91 ? 287 LYS A C     1 
ATOM   2356  O  O     . LYS A  1 289 ? 4.439   21.161  43.274  1.00 170.76 ? 287 LYS A O     1 
ATOM   2357  C  CB    . LYS A  1 289 ? 4.309   18.891  44.765  1.00 170.23 ? 287 LYS A CB    1 
ATOM   2358  C  CG    . LYS A  1 289 ? 4.534   17.657  45.618  1.00 171.05 ? 287 LYS A CG    1 
ATOM   2359  C  CD    . LYS A  1 289 ? 4.313   16.389  44.816  1.00 174.70 ? 287 LYS A CD    1 
ATOM   2360  C  CE    . LYS A  1 289 ? 4.662   15.159  45.631  1.00 171.72 ? 287 LYS A CE    1 
ATOM   2361  N  NZ    . LYS A  1 289 ? 4.558   13.921  44.815  1.00 173.16 ? 287 LYS A NZ    1 
ATOM   2362  N  N     . ALA A  1 290 ? 4.709   22.586  44.997  1.00 155.76 ? 288 ALA A N     1 
ATOM   2363  C  CA    . ALA A  1 290 ? 4.693   23.801  44.184  1.00 147.54 ? 288 ALA A CA    1 
ATOM   2364  C  C     . ALA A  1 290 ? 5.855   24.675  44.643  1.00 140.36 ? 288 ALA A C     1 
ATOM   2365  O  O     . ALA A  1 290 ? 5.783   25.303  45.703  1.00 142.21 ? 288 ALA A O     1 
ATOM   2366  C  CB    . ALA A  1 290 ? 3.360   24.533  44.305  1.00 146.45 ? 288 ALA A CB    1 
ATOM   2367  N  N     . LEU A  1 291 ? 6.922   24.716  43.841  1.00 129.73 ? 289 LEU A N     1 
ATOM   2368  C  CA    . LEU A  1 291 ? 8.127   25.443  44.227  1.00 120.34 ? 289 LEU A CA    1 
ATOM   2369  C  C     . LEU A  1 291 ? 7.881   26.936  44.407  1.00 125.66 ? 289 LEU A C     1 
ATOM   2370  O  O     . LEU A  1 291 ? 8.656   27.599  45.104  1.00 128.57 ? 289 LEU A O     1 
ATOM   2371  C  CB    . LEU A  1 291 ? 9.229   25.222  43.188  1.00 114.98 ? 289 LEU A CB    1 
ATOM   2372  C  CG    . LEU A  1 291 ? 9.732   23.787  43.021  1.00 111.97 ? 289 LEU A CG    1 
ATOM   2373  C  CD1   . LEU A  1 291 ? 10.834  23.726  41.974  1.00 110.26 ? 289 LEU A CD1   1 
ATOM   2374  C  CD2   . LEU A  1 291 ? 10.220  23.230  44.348  1.00 101.95 ? 289 LEU A CD2   1 
ATOM   2375  N  N     . THR A  1 292 ? 6.827   27.478  43.801  1.00 125.67 ? 290 THR A N     1 
ATOM   2376  C  CA    . THR A  1 292 ? 6.499   28.896  43.897  1.00 130.18 ? 290 THR A CA    1 
ATOM   2377  C  C     . THR A  1 292 ? 5.282   29.129  44.788  1.00 129.93 ? 290 THR A C     1 
ATOM   2378  O  O     . THR A  1 292 ? 4.458   30.006  44.524  1.00 137.98 ? 290 THR A O     1 
ATOM   2379  C  CB    . THR A  1 292 ? 6.262   29.490  42.511  1.00 135.66 ? 290 THR A CB    1 
ATOM   2380  O  OG1   . THR A  1 292 ? 5.150   28.834  41.891  1.00 141.71 ? 290 THR A OG1   1 
ATOM   2381  C  CG2   . THR A  1 292 ? 7.497   29.314  41.639  1.00 129.34 ? 290 THR A CG2   1 
ATOM   2382  N  N     . GLU A  1 293 ? 5.158   28.345  45.855  1.00 121.82 ? 291 GLU A N     1 
ATOM   2383  C  CA    . GLU A  1 293 ? 4.054   28.464  46.798  1.00 123.40 ? 291 GLU A CA    1 
ATOM   2384  C  C     . GLU A  1 293 ? 4.579   28.984  48.128  1.00 120.79 ? 291 GLU A C     1 
ATOM   2385  O  O     . GLU A  1 293 ? 5.538   28.433  48.679  1.00 112.24 ? 291 GLU A O     1 
ATOM   2386  C  CB    . GLU A  1 293 ? 3.349   27.121  46.999  1.00 125.61 ? 291 GLU A CB    1 
ATOM   2387  C  CG    . GLU A  1 293 ? 1.992   27.237  47.675  1.00 134.54 ? 291 GLU A CG    1 
ATOM   2388  C  CD    . GLU A  1 293 ? 1.421   25.893  48.081  1.00 135.56 ? 291 GLU A CD    1 
ATOM   2389  O  OE1   . GLU A  1 293 ? 1.668   25.464  49.228  1.00 132.70 ? 291 GLU A OE1   1 
ATOM   2390  O  OE2   . GLU A  1 293 ? 0.731   25.262  47.253  1.00 140.24 ? 291 GLU A OE2   1 
ATOM   2391  N  N     . VAL A  1 294 ? 3.948   30.040  48.640  1.00 128.05 ? 292 VAL A N     1 
ATOM   2392  C  CA    . VAL A  1 294 ? 4.369   30.623  49.907  1.00 129.73 ? 292 VAL A CA    1 
ATOM   2393  C  C     . VAL A  1 294 ? 3.993   29.686  51.047  1.00 128.24 ? 292 VAL A C     1 
ATOM   2394  O  O     . VAL A  1 294 ? 2.865   29.179  51.114  1.00 127.76 ? 292 VAL A O     1 
ATOM   2395  C  CB    . VAL A  1 294 ? 3.749   32.018  50.089  1.00 128.49 ? 292 VAL A CB    1 
ATOM   2396  C  CG1   . VAL A  1 294 ? 2.244   31.975  49.851  1.00 130.74 ? 292 VAL A CG1   1 
ATOM   2397  C  CG2   . VAL A  1 294 ? 4.063   32.569  51.473  1.00 123.73 ? 292 VAL A CG2   1 
ATOM   2398  N  N     . ILE A  1 295 ? 4.943   29.439  51.942  1.00 129.48 ? 293 ILE A N     1 
ATOM   2399  C  CA    . ILE A  1 295 ? 4.742   28.588  53.106  1.00 129.94 ? 293 ILE A CA    1 
ATOM   2400  C  C     . ILE A  1 295 ? 5.072   29.403  54.351  1.00 129.13 ? 293 ILE A C     1 
ATOM   2401  O  O     . ILE A  1 295 ? 6.188   29.917  54.474  1.00 127.99 ? 293 ILE A O     1 
ATOM   2402  C  CB    . ILE A  1 295 ? 5.602   27.313  53.052  1.00 127.76 ? 293 ILE A CB    1 
ATOM   2403  C  CG1   . ILE A  1 295 ? 5.098   26.373  51.956  1.00 126.81 ? 293 ILE A CG1   1 
ATOM   2404  C  CG2   . ILE A  1 295 ? 5.603   26.614  54.404  1.00 128.66 ? 293 ILE A CG2   1 
ATOM   2405  C  CD1   . ILE A  1 295 ? 5.748   25.009  51.981  1.00 120.50 ? 293 ILE A CD1   1 
ATOM   2406  N  N     . PRO A  1 296 ? 4.145   29.554  55.295  1.00 132.92 ? 294 PRO A N     1 
ATOM   2407  C  CA    . PRO A  1 296 ? 4.468   30.282  56.527  1.00 131.48 ? 294 PRO A CA    1 
ATOM   2408  C  C     . PRO A  1 296 ? 5.364   29.453  57.433  1.00 127.84 ? 294 PRO A C     1 
ATOM   2409  O  O     . PRO A  1 296 ? 5.222   28.232  57.532  1.00 116.20 ? 294 PRO A O     1 
ATOM   2410  C  CB    . PRO A  1 296 ? 3.096   30.525  57.163  1.00 130.14 ? 294 PRO A CB    1 
ATOM   2411  C  CG    . PRO A  1 296 ? 2.258   29.395  56.663  1.00 130.77 ? 294 PRO A CG    1 
ATOM   2412  C  CD    . PRO A  1 296 ? 2.743   29.103  55.266  1.00 133.09 ? 294 PRO A CD    1 
ATOM   2413  N  N     . LEU A  1 297 ? 6.296   30.132  58.096  1.00 134.59 ? 295 LEU A N     1 
ATOM   2414  C  CA    . LEU A  1 297 ? 7.244   29.464  58.978  1.00 137.35 ? 295 LEU A CA    1 
ATOM   2415  C  C     . LEU A  1 297 ? 6.562   29.117  60.295  1.00 142.10 ? 295 LEU A C     1 
ATOM   2416  O  O     . LEU A  1 297 ? 6.005   29.995  60.963  1.00 149.20 ? 295 LEU A O     1 
ATOM   2417  C  CB    . LEU A  1 297 ? 8.465   30.348  59.221  1.00 135.29 ? 295 LEU A CB    1 
ATOM   2418  C  CG    . LEU A  1 297 ? 9.266   30.770  57.988  1.00 136.30 ? 295 LEU A CG    1 
ATOM   2419  C  CD1   . LEU A  1 297 ? 10.524  31.516  58.404  1.00 141.89 ? 295 LEU A CD1   1 
ATOM   2420  C  CD2   . LEU A  1 297 ? 9.608   29.566  57.125  1.00 127.41 ? 295 LEU A CD2   1 
ATOM   2421  N  N     . THR A  1 298 ? 6.604   27.841  60.665  1.00 137.84 ? 296 THR A N     1 
ATOM   2422  C  CA    . THR A  1 298 ? 6.054   27.412  61.940  1.00 136.98 ? 296 THR A CA    1 
ATOM   2423  C  C     . THR A  1 298 ? 6.913   27.942  63.087  1.00 136.21 ? 296 THR A C     1 
ATOM   2424  O  O     . THR A  1 298 ? 8.075   28.316  62.907  1.00 137.79 ? 296 THR A O     1 
ATOM   2425  C  CB    . THR A  1 298 ? 5.972   25.885  61.999  1.00 134.87 ? 296 THR A CB    1 
ATOM   2426  O  OG1   . THR A  1 298 ? 5.658   25.374  60.698  1.00 134.86 ? 296 THR A OG1   1 
ATOM   2427  C  CG2   . THR A  1 298 ? 4.889   25.440  62.972  1.00 137.08 ? 296 THR A CG2   1 
ATOM   2428  N  N     . GLU A  1 299 ? 6.317   27.981  64.283  1.00 133.79 ? 297 GLU A N     1 
ATOM   2429  C  CA    . GLU A  1 299 ? 7.056   28.422  65.462  1.00 130.89 ? 297 GLU A CA    1 
ATOM   2430  C  C     . GLU A  1 299 ? 8.272   27.544  65.727  1.00 120.94 ? 297 GLU A C     1 
ATOM   2431  O  O     . GLU A  1 299 ? 9.307   28.042  66.183  1.00 119.50 ? 297 GLU A O     1 
ATOM   2432  C  CB    . GLU A  1 299 ? 6.135   28.439  66.684  1.00 136.06 ? 297 GLU A CB    1 
ATOM   2433  C  CG    . GLU A  1 299 ? 6.765   29.039  67.931  1.00 143.00 ? 297 GLU A CG    1 
ATOM   2434  C  CD    . GLU A  1 299 ? 5.785   29.147  69.082  1.00 153.81 ? 297 GLU A CD    1 
ATOM   2435  O  OE1   . GLU A  1 299 ? 4.624   28.723  68.914  1.00 157.25 ? 297 GLU A OE1   1 
ATOM   2436  O  OE2   . GLU A  1 299 ? 6.175   29.659  70.153  1.00 157.41 ? 297 GLU A OE2   1 
ATOM   2437  N  N     . GLU A  1 300 ? 8.172   26.242  65.445  1.00 113.36 ? 298 GLU A N     1 
ATOM   2438  C  CA    . GLU A  1 300 ? 9.331   25.368  65.595  1.00 107.70 ? 298 GLU A CA    1 
ATOM   2439  C  C     . GLU A  1 300 ? 10.345  25.607  64.484  1.00 100.52 ? 298 GLU A C     1 
ATOM   2440  O  O     . GLU A  1 300 ? 11.558  25.566  64.723  1.00 97.65  ? 298 GLU A O     1 
ATOM   2441  C  CB    . GLU A  1 300 ? 8.891   23.902  65.616  1.00 109.03 ? 298 GLU A CB    1 
ATOM   2442  C  CG    . GLU A  1 300 ? 8.151   23.472  66.880  1.00 111.33 ? 298 GLU A CG    1 
ATOM   2443  C  CD    . GLU A  1 300 ? 6.726   23.993  66.944  1.00 117.58 ? 298 GLU A CD    1 
ATOM   2444  O  OE1   . GLU A  1 300 ? 6.212   24.462  65.906  1.00 121.27 ? 298 GLU A OE1   1 
ATOM   2445  O  OE2   . GLU A  1 300 ? 6.121   23.935  68.035  1.00 119.12 ? 298 GLU A OE2   1 
ATOM   2446  N  N     . ALA A  1 301 ? 9.870   25.856  63.261  1.00 101.75 ? 299 ALA A N     1 
ATOM   2447  C  CA    . ALA A  1 301 ? 10.774  26.167  62.161  1.00 99.78  ? 299 ALA A CA    1 
ATOM   2448  C  C     . ALA A  1 301 ? 11.380  27.557  62.290  1.00 110.79 ? 299 ALA A C     1 
ATOM   2449  O  O     . ALA A  1 301 ? 12.462  27.800  61.746  1.00 100.17 ? 299 ALA A O     1 
ATOM   2450  C  CB    . ALA A  1 301 ? 10.044  26.038  60.824  1.00 98.27  ? 299 ALA A CB    1 
ATOM   2451  N  N     . GLU A  1 302 ? 10.710  28.470  62.996  1.00 123.41 ? 300 GLU A N     1 
ATOM   2452  C  CA    . GLU A  1 302 ? 11.252  29.811  63.181  1.00 130.07 ? 300 GLU A CA    1 
ATOM   2453  C  C     . GLU A  1 302 ? 12.322  29.834  64.266  1.00 117.00 ? 300 GLU A C     1 
ATOM   2454  O  O     . GLU A  1 302 ? 13.368  30.472  64.095  1.00 121.17 ? 300 GLU A O     1 
ATOM   2455  C  CB    . GLU A  1 302 ? 10.127  30.790  63.516  1.00 143.01 ? 300 GLU A CB    1 
ATOM   2456  C  CG    . GLU A  1 302 ? 10.553  32.250  63.560  1.00 155.35 ? 300 GLU A CG    1 
ATOM   2457  C  CD    . GLU A  1 302 ? 11.075  32.750  62.225  1.00 165.22 ? 300 GLU A CD    1 
ATOM   2458  O  OE1   . GLU A  1 302 ? 12.279  32.568  61.944  1.00 164.76 ? 300 GLU A OE1   1 
ATOM   2459  O  OE2   . GLU A  1 302 ? 10.277  33.321  61.452  1.00 170.39 ? 300 GLU A OE2   1 
ATOM   2460  N  N     . LEU A  1 303 ? 12.079  29.148  65.386  1.00 104.97 ? 301 LEU A N     1 
ATOM   2461  C  CA    . LEU A  1 303 ? 13.093  29.064  66.433  1.00 106.95 ? 301 LEU A CA    1 
ATOM   2462  C  C     . LEU A  1 303 ? 14.316  28.295  65.952  1.00 107.00 ? 301 LEU A C     1 
ATOM   2463  O  O     . LEU A  1 303 ? 15.450  28.627  66.316  1.00 105.81 ? 301 LEU A O     1 
ATOM   2464  C  CB    . LEU A  1 303 ? 12.504  28.413  67.685  1.00 106.03 ? 301 LEU A CB    1 
ATOM   2465  C  CG    . LEU A  1 303 ? 13.465  28.202  68.858  1.00 110.50 ? 301 LEU A CG    1 
ATOM   2466  C  CD1   . LEU A  1 303 ? 14.061  29.526  69.311  1.00 111.94 ? 301 LEU A CD1   1 
ATOM   2467  C  CD2   . LEU A  1 303 ? 12.763  27.504  70.012  1.00 112.40 ? 301 LEU A CD2   1 
ATOM   2468  N  N     . GLU A  1 304 ? 14.104  27.263  65.131  1.00 100.57 ? 302 GLU A N     1 
ATOM   2469  C  CA    . GLU A  1 304 ? 15.227  26.533  64.552  1.00 95.18  ? 302 GLU A CA    1 
ATOM   2470  C  C     . GLU A  1 304 ? 16.050  27.432  63.638  1.00 98.87  ? 302 GLU A C     1 
ATOM   2471  O  O     . GLU A  1 304 ? 17.285  27.378  63.646  1.00 94.81  ? 302 GLU A O     1 
ATOM   2472  C  CB    . GLU A  1 304 ? 14.715  25.312  63.788  1.00 91.83  ? 302 GLU A CB    1 
ATOM   2473  C  CG    . GLU A  1 304 ? 15.796  24.338  63.354  1.00 90.48  ? 302 GLU A CG    1 
ATOM   2474  C  CD    . GLU A  1 304 ? 15.250  23.213  62.495  1.00 95.86  ? 302 GLU A CD    1 
ATOM   2475  O  OE1   . GLU A  1 304 ? 14.614  23.508  61.461  1.00 96.89  ? 302 GLU A OE1   1 
ATOM   2476  O  OE2   . GLU A  1 304 ? 15.445  22.034  62.858  1.00 88.95  ? 302 GLU A OE2   1 
ATOM   2477  N  N     . LEU A  1 305 ? 15.379  28.274  62.847  1.00 102.52 ? 303 LEU A N     1 
ATOM   2478  C  CA    . LEU A  1 305 ? 16.090  29.186  61.958  1.00 101.69 ? 303 LEU A CA    1 
ATOM   2479  C  C     . LEU A  1 305 ? 16.799  30.289  62.733  1.00 105.19 ? 303 LEU A C     1 
ATOM   2480  O  O     . LEU A  1 305 ? 17.864  30.755  62.311  1.00 103.71 ? 303 LEU A O     1 
ATOM   2481  C  CB    . LEU A  1 305 ? 15.117  29.786  60.942  1.00 99.74  ? 303 LEU A CB    1 
ATOM   2482  C  CG    . LEU A  1 305 ? 15.683  30.787  59.933  1.00 105.00 ? 303 LEU A CG    1 
ATOM   2483  C  CD1   . LEU A  1 305 ? 16.821  30.165  59.140  1.00 99.72  ? 303 LEU A CD1   1 
ATOM   2484  C  CD2   . LEU A  1 305 ? 14.587  31.286  59.003  1.00 111.80 ? 303 LEU A CD2   1 
ATOM   2485  N  N     . ALA A  1 306 ? 16.233  30.716  63.864  1.00 106.53 ? 304 ALA A N     1 
ATOM   2486  C  CA    . ALA A  1 306 ? 16.876  31.756  64.662  1.00 110.34 ? 304 ALA A CA    1 
ATOM   2487  C  C     . ALA A  1 306 ? 18.130  31.230  65.349  1.00 104.30 ? 304 ALA A C     1 
ATOM   2488  O  O     . ALA A  1 306 ? 19.139  31.939  65.439  1.00 100.40 ? 304 ALA A O     1 
ATOM   2489  C  CB    . ALA A  1 306 ? 15.892  32.313  65.690  1.00 112.67 ? 304 ALA A CB    1 
ATOM   2490  N  N     . GLU A  1 307 ? 18.087  29.989  65.840  1.00 100.57 ? 305 GLU A N     1 
ATOM   2491  C  CA    . GLU A  1 307 ? 19.255  29.418  66.502  1.00 99.74  ? 305 GLU A CA    1 
ATOM   2492  C  C     . GLU A  1 307 ? 20.384  29.144  65.518  1.00 99.49  ? 305 GLU A C     1 
ATOM   2493  O  O     . GLU A  1 307 ? 21.559  29.196  65.898  1.00 103.99 ? 305 GLU A O     1 
ATOM   2494  C  CB    . GLU A  1 307 ? 18.869  28.136  67.240  1.00 99.93  ? 305 GLU A CB    1 
ATOM   2495  C  CG    . GLU A  1 307 ? 17.920  28.352  68.408  1.00 111.67 ? 305 GLU A CG    1 
ATOM   2496  C  CD    . GLU A  1 307 ? 17.544  27.058  69.103  1.00 112.85 ? 305 GLU A CD    1 
ATOM   2497  O  OE1   . GLU A  1 307 ? 16.790  27.112  70.098  1.00 112.42 ? 305 GLU A OE1   1 
ATOM   2498  O  OE2   . GLU A  1 307 ? 18.003  25.986  68.654  1.00 107.74 ? 305 GLU A OE2   1 
ATOM   2499  N  N     . ASN A  1 308 ? 20.054  28.854  64.257  1.00 94.66  ? 306 ASN A N     1 
ATOM   2500  C  CA    . ASN A  1 308 ? 21.095  28.612  63.262  1.00 90.77  ? 306 ASN A CA    1 
ATOM   2501  C  C     . ASN A  1 308 ? 21.807  29.903  62.878  1.00 95.22  ? 306 ASN A C     1 
ATOM   2502  O  O     . ASN A  1 308 ? 23.018  29.898  62.626  1.00 89.04  ? 306 ASN A O     1 
ATOM   2503  C  CB    . ASN A  1 308 ? 20.500  27.940  62.025  1.00 90.47  ? 306 ASN A CB    1 
ATOM   2504  C  CG    . ASN A  1 308 ? 20.280  26.453  62.219  1.00 91.03  ? 306 ASN A CG    1 
ATOM   2505  O  OD1   . ASN A  1 308 ? 20.999  25.801  62.975  1.00 96.68  ? 306 ASN A OD1   1 
ATOM   2506  N  ND2   . ASN A  1 308 ? 19.285  25.907  61.529  1.00 90.47  ? 306 ASN A ND2   1 
ATOM   2507  N  N     . ARG A  1 309 ? 21.076  31.019  62.825  1.00 100.66 ? 307 ARG A N     1 
ATOM   2508  C  CA    . ARG A  1 309 ? 21.707  32.289  62.482  1.00 106.49 ? 307 ARG A CA    1 
ATOM   2509  C  C     . ARG A  1 309 ? 22.664  32.755  63.571  1.00 106.03 ? 307 ARG A C     1 
ATOM   2510  O  O     . ARG A  1 309 ? 23.702  33.352  63.264  1.00 105.67 ? 307 ARG A O     1 
ATOM   2511  C  CB    . ARG A  1 309 ? 20.647  33.357  62.216  1.00 112.80 ? 307 ARG A CB    1 
ATOM   2512  C  CG    . ARG A  1 309 ? 20.149  33.387  60.780  1.00 116.62 ? 307 ARG A CG    1 
ATOM   2513  C  CD    . ARG A  1 309 ? 19.429  34.690  60.474  1.00 120.17 ? 307 ARG A CD    1 
ATOM   2514  N  NE    . ARG A  1 309 ? 19.135  34.832  59.051  1.00 123.32 ? 307 ARG A NE    1 
ATOM   2515  C  CZ    . ARG A  1 309 ? 17.982  34.487  58.488  1.00 126.81 ? 307 ARG A CZ    1 
ATOM   2516  N  NH1   . ARG A  1 309 ? 17.006  33.980  59.227  1.00 123.89 ? 307 ARG A NH1   1 
ATOM   2517  N  NH2   . ARG A  1 309 ? 17.803  34.653  57.184  1.00 128.58 ? 307 ARG A NH2   1 
ATOM   2518  N  N     . GLU A  1 310 ? 22.342  32.494  64.841  1.00 105.50 ? 308 GLU A N     1 
ATOM   2519  C  CA    . GLU A  1 310 ? 23.249  32.882  65.915  1.00 115.56 ? 308 GLU A CA    1 
ATOM   2520  C  C     . GLU A  1 310 ? 24.489  31.998  65.943  1.00 102.50 ? 308 GLU A C     1 
ATOM   2521  O  O     . GLU A  1 310 ? 25.559  32.445  66.374  1.00 104.71 ? 308 GLU A O     1 
ATOM   2522  C  CB    . GLU A  1 310 ? 22.525  32.835  67.261  1.00 127.37 ? 308 GLU A CB    1 
ATOM   2523  C  CG    . GLU A  1 310 ? 23.274  33.532  68.388  1.00 136.06 ? 308 GLU A CG    1 
ATOM   2524  C  CD    . GLU A  1 310 ? 22.461  33.620  69.664  1.00 140.86 ? 308 GLU A CD    1 
ATOM   2525  O  OE1   . GLU A  1 310 ? 21.323  33.106  69.684  1.00 143.35 ? 308 GLU A OE1   1 
ATOM   2526  O  OE2   . GLU A  1 310 ? 22.961  34.205  70.648  1.00 142.36 ? 308 GLU A OE2   1 
ATOM   2527  N  N     . ILE A  1 311 ? 24.369  30.747  65.491  1.00 88.42  ? 309 ILE A N     1 
ATOM   2528  C  CA    . ILE A  1 311 ? 25.538  29.881  65.384  1.00 79.00  ? 309 ILE A CA    1 
ATOM   2529  C  C     . ILE A  1 311 ? 26.477  30.391  64.299  1.00 80.50  ? 309 ILE A C     1 
ATOM   2530  O  O     . ILE A  1 311 ? 27.706  30.312  64.430  1.00 75.34  ? 309 ILE A O     1 
ATOM   2531  C  CB    . ILE A  1 311 ? 25.097  28.426  65.127  1.00 72.74  ? 309 ILE A CB    1 
ATOM   2532  C  CG1   . ILE A  1 311 ? 24.434  27.842  66.376  1.00 77.54  ? 309 ILE A CG1   1 
ATOM   2533  C  CG2   . ILE A  1 311 ? 26.272  27.563  64.696  1.00 61.64  ? 309 ILE A CG2   1 
ATOM   2534  C  CD1   . ILE A  1 311 ? 23.972  26.408  66.209  1.00 59.98  ? 309 ILE A CD1   1 
ATOM   2535  N  N     . LEU A  1 312 ? 25.919  30.942  63.222  1.00 82.67  ? 310 LEU A N     1 
ATOM   2536  C  CA    . LEU A  1 312 ? 26.724  31.467  62.127  1.00 87.83  ? 310 LEU A CA    1 
ATOM   2537  C  C     . LEU A  1 312 ? 27.287  32.854  62.409  1.00 99.30  ? 310 LEU A C     1 
ATOM   2538  O  O     . LEU A  1 312 ? 28.090  33.349  61.609  1.00 103.37 ? 310 LEU A O     1 
ATOM   2539  C  CB    . LEU A  1 312 ? 25.899  31.502  60.837  1.00 85.50  ? 310 LEU A CB    1 
ATOM   2540  C  CG    . LEU A  1 312 ? 25.972  30.274  59.925  1.00 88.31  ? 310 LEU A CG    1 
ATOM   2541  C  CD1   . LEU A  1 312 ? 25.463  29.024  60.625  1.00 86.88  ? 310 LEU A CD1   1 
ATOM   2542  C  CD2   . LEU A  1 312 ? 25.202  30.520  58.635  1.00 93.91  ? 310 LEU A CD2   1 
ATOM   2543  N  N     . LYS A  1 313 ? 26.893  33.491  63.513  1.00 109.62 ? 311 LYS A N     1 
ATOM   2544  C  CA    . LYS A  1 313 ? 27.426  34.811  63.840  1.00 121.79 ? 311 LYS A CA    1 
ATOM   2545  C  C     . LYS A  1 313 ? 28.902  34.728  64.212  1.00 127.69 ? 311 LYS A C     1 
ATOM   2546  O  O     . LYS A  1 313 ? 29.753  35.363  63.577  1.00 122.48 ? 311 LYS A O     1 
ATOM   2547  C  CB    . LYS A  1 313 ? 26.619  35.440  64.978  1.00 122.89 ? 311 LYS A CB    1 
ATOM   2548  C  CG    . LYS A  1 313 ? 25.198  35.821  64.604  1.00 126.38 ? 311 LYS A CG    1 
ATOM   2549  C  CD    . LYS A  1 313 ? 24.463  36.423  65.790  1.00 128.78 ? 311 LYS A CD    1 
ATOM   2550  C  CE    . LYS A  1 313 ? 23.034  36.788  65.425  1.00 132.18 ? 311 LYS A CE    1 
ATOM   2551  N  NZ    . LYS A  1 313 ? 22.300  37.381  66.577  1.00 135.86 ? 311 LYS A NZ    1 
ATOM   2552  N  N     . GLU A  1 314 ? 29.222  33.953  65.239  1.00 135.97 ? 312 GLU A N     1 
ATOM   2553  C  CA    . GLU A  1 314 ? 30.604  33.837  65.684  1.00 144.37 ? 312 GLU A CA    1 
ATOM   2554  C  C     . GLU A  1 314 ? 31.424  33.080  64.645  1.00 128.77 ? 312 GLU A C     1 
ATOM   2555  O  O     . GLU A  1 314 ? 31.003  32.009  64.192  1.00 124.54 ? 312 GLU A O     1 
ATOM   2556  C  CB    . GLU A  1 314 ? 30.671  33.126  67.034  1.00 160.75 ? 312 GLU A CB    1 
ATOM   2557  C  CG    . GLU A  1 314 ? 29.908  33.832  68.142  1.00 175.49 ? 312 GLU A CG    1 
ATOM   2558  C  CD    . GLU A  1 314 ? 29.978  33.090  69.462  1.00 185.11 ? 312 GLU A CD    1 
ATOM   2559  O  OE1   . GLU A  1 314 ? 30.627  32.025  69.514  1.00 186.64 ? 312 GLU A OE1   1 
ATOM   2560  O  OE2   . GLU A  1 314 ? 29.382  33.574  70.447  1.00 190.34 ? 312 GLU A OE2   1 
ATOM   2561  N  N     . PRO A  1 315 ? 32.584  33.595  64.241  1.00 121.74 ? 313 PRO A N     1 
ATOM   2562  C  CA    . PRO A  1 315 ? 33.393  32.891  63.237  1.00 112.44 ? 313 PRO A CA    1 
ATOM   2563  C  C     . PRO A  1 315 ? 34.021  31.636  63.826  1.00 99.66  ? 313 PRO A C     1 
ATOM   2564  O  O     . PRO A  1 315 ? 34.624  31.670  64.901  1.00 102.76 ? 313 PRO A O     1 
ATOM   2565  C  CB    . PRO A  1 315 ? 34.454  33.926  62.848  1.00 117.62 ? 313 PRO A CB    1 
ATOM   2566  C  CG    . PRO A  1 315 ? 34.581  34.795  64.062  1.00 121.87 ? 313 PRO A CG    1 
ATOM   2567  C  CD    . PRO A  1 315 ? 33.203  34.863  64.667  1.00 123.75 ? 313 PRO A CD    1 
ATOM   2568  N  N     . VAL A  1 316 ? 33.868  30.521  63.113  1.00 85.48  ? 314 VAL A N     1 
ATOM   2569  C  CA    . VAL A  1 316 ? 34.455  29.251  63.511  1.00 76.43  ? 314 VAL A CA    1 
ATOM   2570  C  C     . VAL A  1 316 ? 35.449  28.823  62.440  1.00 77.83  ? 314 VAL A C     1 
ATOM   2571  O  O     . VAL A  1 316 ? 35.412  29.286  61.297  1.00 77.53  ? 314 VAL A O     1 
ATOM   2572  C  CB    . VAL A  1 316 ? 33.392  28.156  63.738  1.00 78.59  ? 314 VAL A CB    1 
ATOM   2573  C  CG1   . VAL A  1 316 ? 32.314  28.648  64.697  1.00 84.91  ? 314 VAL A CG1   1 
ATOM   2574  C  CG2   . VAL A  1 316 ? 32.786  27.721  62.415  1.00 76.69  ? 314 VAL A CG2   1 
ATOM   2575  N  N     . HIS A  1 317 ? 36.354  27.931  62.831  1.00 79.82  ? 315 HIS A N     1 
ATOM   2576  C  CA    . HIS A  1 317 ? 37.368  27.436  61.915  1.00 74.23  ? 315 HIS A CA    1 
ATOM   2577  C  C     . HIS A  1 317 ? 37.725  26.005  62.287  1.00 71.00  ? 315 HIS A C     1 
ATOM   2578  O  O     . HIS A  1 317 ? 37.510  25.559  63.419  1.00 72.45  ? 315 HIS A O     1 
ATOM   2579  C  CB    . HIS A  1 317 ? 38.624  28.318  61.922  1.00 81.67  ? 315 HIS A CB    1 
ATOM   2580  C  CG    . HIS A  1 317 ? 39.444  28.192  63.167  1.00 96.08  ? 315 HIS A CG    1 
ATOM   2581  N  ND1   . HIS A  1 317 ? 39.230  28.976  64.279  1.00 102.32 ? 315 HIS A ND1   1 
ATOM   2582  C  CD2   . HIS A  1 317 ? 40.470  27.365  63.480  1.00 97.98  ? 315 HIS A CD2   1 
ATOM   2583  C  CE1   . HIS A  1 317 ? 40.091  28.641  65.223  1.00 99.78  ? 315 HIS A CE1   1 
ATOM   2584  N  NE2   . HIS A  1 317 ? 40.855  27.666  64.764  1.00 97.61  ? 315 HIS A NE2   1 
ATOM   2585  N  N     . GLY A  1 318 ? 38.265  25.283  61.306  1.00 67.25  ? 316 GLY A N     1 
ATOM   2586  C  CA    . GLY A  1 318 ? 38.770  23.946  61.512  1.00 59.77  ? 316 GLY A CA    1 
ATOM   2587  C  C     . GLY A  1 318 ? 40.290  23.914  61.441  1.00 65.08  ? 316 GLY A C     1 
ATOM   2588  O  O     . GLY A  1 318 ? 40.940  24.844  60.963  1.00 77.28  ? 316 GLY A O     1 
ATOM   2589  N  N     . VAL A  1 319 ? 40.856  22.812  61.927  1.00 63.00  ? 317 VAL A N     1 
ATOM   2590  C  CA    . VAL A  1 319 ? 42.304  22.627  61.890  1.00 65.79  ? 317 VAL A CA    1 
ATOM   2591  C  C     . VAL A  1 319 ? 42.645  21.567  60.854  1.00 65.09  ? 317 VAL A C     1 
ATOM   2592  O  O     . VAL A  1 319 ? 41.761  21.051  60.160  1.00 64.45  ? 317 VAL A O     1 
ATOM   2593  C  CB    . VAL A  1 319 ? 42.859  22.248  63.275  1.00 62.82  ? 317 VAL A CB    1 
ATOM   2594  C  CG1   . VAL A  1 319 ? 42.691  23.406  64.249  1.00 55.27  ? 317 VAL A CG1   1 
ATOM   2595  C  CG2   . VAL A  1 319 ? 42.165  21.004  63.799  1.00 59.21  ? 317 VAL A CG2   1 
ATOM   2596  N  N     . TYR A  1 320 ? 43.926  21.233  60.743  1.00 53.17  ? 318 TYR A N     1 
ATOM   2597  C  CA    . TYR A  1 320 ? 44.402  20.255  59.777  1.00 56.12  ? 318 TYR A CA    1 
ATOM   2598  C  C     . TYR A  1 320 ? 44.728  18.933  60.465  1.00 56.73  ? 318 TYR A C     1 
ATOM   2599  O  O     . TYR A  1 320 ? 44.832  18.843  61.691  1.00 58.84  ? 318 TYR A O     1 
ATOM   2600  C  CB    . TYR A  1 320 ? 45.623  20.796  59.029  1.00 60.22  ? 318 TYR A CB    1 
ATOM   2601  C  CG    . TYR A  1 320 ? 45.297  21.968  58.133  1.00 67.34  ? 318 TYR A CG    1 
ATOM   2602  C  CD1   . TYR A  1 320 ? 44.186  21.939  57.298  1.00 60.32  ? 318 TYR A CD1   1 
ATOM   2603  C  CD2   . TYR A  1 320 ? 46.088  23.110  58.134  1.00 64.92  ? 318 TYR A CD2   1 
ATOM   2604  C  CE1   . TYR A  1 320 ? 43.880  23.009  56.480  1.00 60.10  ? 318 TYR A CE1   1 
ATOM   2605  C  CE2   . TYR A  1 320 ? 45.788  24.185  57.322  1.00 63.29  ? 318 TYR A CE2   1 
ATOM   2606  C  CZ    . TYR A  1 320 ? 44.683  24.130  56.498  1.00 61.63  ? 318 TYR A CZ    1 
ATOM   2607  O  OH    . TYR A  1 320 ? 44.382  25.199  55.687  1.00 68.39  ? 318 TYR A OH    1 
ATOM   2608  N  N     . TYR A  1 321 ? 44.888  17.897  59.648  1.00 50.06  ? 319 TYR A N     1 
ATOM   2609  C  CA    . TYR A  1 321 ? 45.059  16.540  60.145  1.00 62.23  ? 319 TYR A CA    1 
ATOM   2610  C  C     . TYR A  1 321 ? 46.520  16.270  60.483  1.00 66.31  ? 319 TYR A C     1 
ATOM   2611  O  O     . TYR A  1 321 ? 47.411  16.499  59.658  1.00 65.23  ? 319 TYR A O     1 
ATOM   2612  C  CB    . TYR A  1 321 ? 44.557  15.528  59.114  1.00 52.51  ? 319 TYR A CB    1 
ATOM   2613  C  CG    . TYR A  1 321 ? 44.813  14.085  59.486  1.00 58.25  ? 319 TYR A CG    1 
ATOM   2614  C  CD1   . TYR A  1 321 ? 44.297  13.546  60.658  1.00 57.89  ? 319 TYR A CD1   1 
ATOM   2615  C  CD2   . TYR A  1 321 ? 45.559  13.257  58.658  1.00 68.15  ? 319 TYR A CD2   1 
ATOM   2616  C  CE1   . TYR A  1 321 ? 44.527  12.227  61.000  1.00 62.50  ? 319 TYR A CE1   1 
ATOM   2617  C  CE2   . TYR A  1 321 ? 45.793  11.937  58.991  1.00 69.95  ? 319 TYR A CE2   1 
ATOM   2618  C  CZ    . TYR A  1 321 ? 45.274  11.428  60.162  1.00 64.95  ? 319 TYR A CZ    1 
ATOM   2619  O  OH    . TYR A  1 321 ? 45.504  10.114  60.497  1.00 67.37  ? 319 TYR A OH    1 
ATOM   2620  N  N     . ASP A  1 322 ? 46.758  15.784  61.698  1.00 60.55  ? 320 ASP A N     1 
ATOM   2621  C  CA    . ASP A  1 322 ? 48.083  15.350  62.123  1.00 59.35  ? 320 ASP A CA    1 
ATOM   2622  C  C     . ASP A  1 322 ? 48.073  13.837  62.277  1.00 69.88  ? 320 ASP A C     1 
ATOM   2623  O  O     . ASP A  1 322 ? 47.453  13.321  63.221  1.00 59.89  ? 320 ASP A O     1 
ATOM   2624  C  CB    . ASP A  1 322 ? 48.481  16.021  63.440  1.00 68.52  ? 320 ASP A CB    1 
ATOM   2625  C  CG    . ASP A  1 322 ? 49.893  15.668  63.876  1.00 76.86  ? 320 ASP A CG    1 
ATOM   2626  O  OD1   . ASP A  1 322 ? 50.630  15.034  63.091  1.00 78.62  ? 320 ASP A OD1   1 
ATOM   2627  O  OD2   . ASP A  1 322 ? 50.269  16.027  65.012  1.00 86.84  ? 320 ASP A OD2   1 
ATOM   2628  N  N     . PRO A  1 323 ? 48.730  13.088  61.388  1.00 74.94  ? 321 PRO A N     1 
ATOM   2629  C  CA    . PRO A  1 323 ? 48.683  11.619  61.487  1.00 62.42  ? 321 PRO A CA    1 
ATOM   2630  C  C     . PRO A  1 323 ? 49.308  11.069  62.756  1.00 61.05  ? 321 PRO A C     1 
ATOM   2631  O  O     . PRO A  1 323 ? 49.041  9.913   63.107  1.00 60.02  ? 321 PRO A O     1 
ATOM   2632  C  CB    . PRO A  1 323 ? 49.452  11.157  60.240  1.00 65.25  ? 321 PRO A CB    1 
ATOM   2633  C  CG    . PRO A  1 323 ? 49.432  12.333  59.311  1.00 66.77  ? 321 PRO A CG    1 
ATOM   2634  C  CD    . PRO A  1 323 ? 49.458  13.542  60.192  1.00 70.02  ? 321 PRO A CD    1 
ATOM   2635  N  N     . SER A  1 324 ? 50.128  11.854  63.458  1.00 68.75  ? 322 SER A N     1 
ATOM   2636  C  CA    . SER A  1 324 ? 50.767  11.379  64.678  1.00 68.60  ? 322 SER A CA    1 
ATOM   2637  C  C     . SER A  1 324 ? 49.808  11.315  65.860  1.00 78.63  ? 322 SER A C     1 
ATOM   2638  O  O     . SER A  1 324 ? 50.106  10.631  66.844  1.00 86.24  ? 322 SER A O     1 
ATOM   2639  C  CB    . SER A  1 324 ? 51.956  12.273  65.035  1.00 71.46  ? 322 SER A CB    1 
ATOM   2640  O  OG    . SER A  1 324 ? 51.531  13.581  65.373  1.00 78.54  ? 322 SER A OG    1 
ATOM   2641  N  N     . LYS A  1 325 ? 48.675  12.007  65.788  1.00 82.33  ? 323 LYS A N     1 
ATOM   2642  C  CA    . LYS A  1 325 ? 47.690  12.018  66.857  1.00 85.14  ? 323 LYS A CA    1 
ATOM   2643  C  C     . LYS A  1 325 ? 46.472  11.193  66.459  1.00 79.21  ? 323 LYS A C     1 
ATOM   2644  O  O     . LYS A  1 325 ? 46.201  10.971  65.276  1.00 71.52  ? 323 LYS A O     1 
ATOM   2645  C  CB    . LYS A  1 325 ? 47.264  13.451  67.198  1.00 85.51  ? 323 LYS A CB    1 
ATOM   2646  C  CG    . LYS A  1 325 ? 48.414  14.364  67.595  1.00 74.65  ? 323 LYS A CG    1 
ATOM   2647  C  CD    . LYS A  1 325 ? 47.915  15.759  67.937  1.00 76.30  ? 323 LYS A CD    1 
ATOM   2648  C  CE    . LYS A  1 325 ? 49.064  16.697  68.278  1.00 83.43  ? 323 LYS A CE    1 
ATOM   2649  N  NZ    . LYS A  1 325 ? 49.969  16.931  67.119  1.00 88.38  ? 323 LYS A NZ    1 
ATOM   2650  N  N     . ASP A  1 326 ? 45.738  10.738  67.470  1.00 79.04  ? 324 ASP A N     1 
ATOM   2651  C  CA    . ASP A  1 326 ? 44.558  9.925   67.227  1.00 83.68  ? 324 ASP A CA    1 
ATOM   2652  C  C     . ASP A  1 326 ? 43.408  10.778  66.696  1.00 62.60  ? 324 ASP A C     1 
ATOM   2653  O  O     . ASP A  1 326 ? 43.404  12.007  66.799  1.00 60.07  ? 324 ASP A O     1 
ATOM   2654  C  CB    . ASP A  1 326 ? 44.118  9.210   68.505  1.00 97.82  ? 324 ASP A CB    1 
ATOM   2655  C  CG    . ASP A  1 326 ? 45.105  8.153   68.953  1.00 111.53 ? 324 ASP A CG    1 
ATOM   2656  O  OD1   . ASP A  1 326 ? 45.856  7.637   68.098  1.00 118.43 ? 324 ASP A OD1   1 
ATOM   2657  O  OD2   . ASP A  1 326 ? 45.125  7.833   70.160  1.00 115.54 ? 324 ASP A OD2   1 
ATOM   2658  N  N     . LEU A  1 327 ? 42.424  10.098  66.116  1.00 55.74  ? 325 LEU A N     1 
ATOM   2659  C  CA    . LEU A  1 327 ? 41.187  10.721  65.668  1.00 53.08  ? 325 LEU A CA    1 
ATOM   2660  C  C     . LEU A  1 327 ? 40.101  10.477  66.708  1.00 49.30  ? 325 LEU A C     1 
ATOM   2661  O  O     . LEU A  1 327 ? 39.866  9.332   67.108  1.00 60.63  ? 325 LEU A O     1 
ATOM   2662  C  CB    . LEU A  1 327 ? 40.756  10.167  64.310  1.00 59.94  ? 325 LEU A CB    1 
ATOM   2663  C  CG    . LEU A  1 327 ? 41.212  10.921  63.062  1.00 63.13  ? 325 LEU A CG    1 
ATOM   2664  C  CD1   . LEU A  1 327 ? 40.789  10.179  61.807  1.00 67.73  ? 325 LEU A CD1   1 
ATOM   2665  C  CD2   . LEU A  1 327 ? 40.635  12.320  63.069  1.00 58.72  ? 325 LEU A CD2   1 
ATOM   2666  N  N     . ILE A  1 328 ? 39.450  11.551  67.147  1.00 45.21  ? 326 ILE A N     1 
ATOM   2667  C  CA    . ILE A  1 328 ? 38.408  11.489  68.165  1.00 45.57  ? 326 ILE A CA    1 
ATOM   2668  C  C     . ILE A  1 328 ? 37.114  12.009  67.556  1.00 44.95  ? 326 ILE A C     1 
ATOM   2669  O  O     . ILE A  1 328 ? 37.109  13.058  66.902  1.00 51.75  ? 326 ILE A O     1 
ATOM   2670  C  CB    . ILE A  1 328 ? 38.783  12.301  69.417  1.00 56.73  ? 326 ILE A CB    1 
ATOM   2671  C  CG1   . ILE A  1 328 ? 40.194  11.946  69.895  1.00 52.87  ? 326 ILE A CG1   1 
ATOM   2672  C  CG2   . ILE A  1 328 ? 37.770  12.062  70.526  1.00 48.50  ? 326 ILE A CG2   1 
ATOM   2673  C  CD1   . ILE A  1 328 ? 40.293  10.601  70.578  1.00 62.47  ? 326 ILE A CD1   1 
ATOM   2674  N  N     . ALA A  1 329 ? 36.023  11.276  67.772  1.00 41.77  ? 327 ALA A N     1 
ATOM   2675  C  CA    . ALA A  1 329 ? 34.700  11.673  67.309  1.00 39.78  ? 327 ALA A CA    1 
ATOM   2676  C  C     . ALA A  1 329 ? 33.743  11.613  68.489  1.00 45.98  ? 327 ALA A C     1 
ATOM   2677  O  O     . ALA A  1 329 ? 33.624  10.572  69.142  1.00 48.54  ? 327 ALA A O     1 
ATOM   2678  C  CB    . ALA A  1 329 ? 34.215  10.771  66.169  1.00 36.03  ? 327 ALA A CB    1 
ATOM   2679  N  N     . GLU A  1 330 ? 33.071  12.727  68.767  1.00 44.30  ? 328 GLU A N     1 
ATOM   2680  C  CA    . GLU A  1 330 ? 32.142  12.832  69.884  1.00 47.52  ? 328 GLU A CA    1 
ATOM   2681  C  C     . GLU A  1 330 ? 30.774  13.229  69.351  1.00 48.35  ? 328 GLU A C     1 
ATOM   2682  O  O     . GLU A  1 330 ? 30.669  14.134  68.519  1.00 47.58  ? 328 GLU A O     1 
ATOM   2683  C  CB    . GLU A  1 330 ? 32.637  13.852  70.912  1.00 45.58  ? 328 GLU A CB    1 
ATOM   2684  C  CG    . GLU A  1 330 ? 31.775  13.953  72.157  1.00 66.65  ? 328 GLU A CG    1 
ATOM   2685  C  CD    . GLU A  1 330 ? 32.401  14.828  73.225  1.00 75.48  ? 328 GLU A CD    1 
ATOM   2686  O  OE1   . GLU A  1 330 ? 33.599  15.163  73.092  1.00 68.72  ? 328 GLU A OE1   1 
ATOM   2687  O  OE2   . GLU A  1 330 ? 31.697  15.182  74.194  1.00 74.17  ? 328 GLU A OE2   1 
ATOM   2688  N  N     . ILE A  1 331 ? 29.730  12.553  69.829  1.00 44.17  ? 329 ILE A N     1 
ATOM   2689  C  CA    . ILE A  1 331 ? 28.364  12.768  69.368  1.00 47.67  ? 329 ILE A CA    1 
ATOM   2690  C  C     . ILE A  1 331 ? 27.529  13.299  70.525  1.00 49.89  ? 329 ILE A C     1 
ATOM   2691  O  O     . ILE A  1 331 ? 27.743  12.922  71.682  1.00 51.60  ? 329 ILE A O     1 
ATOM   2692  C  CB    . ILE A  1 331 ? 27.741  11.472  68.807  1.00 33.81  ? 329 ILE A CB    1 
ATOM   2693  C  CG1   . ILE A  1 331 ? 28.723  10.757  67.878  1.00 42.83  ? 329 ILE A CG1   1 
ATOM   2694  C  CG2   . ILE A  1 331 ? 26.443  11.770  68.069  1.00 35.83  ? 329 ILE A CG2   1 
ATOM   2695  C  CD1   . ILE A  1 331 ? 28.193  9.446   67.332  1.00 36.39  ? 329 ILE A CD1   1 
ATOM   2696  N  N     . GLN A  1 332 ? 26.577  14.177  70.209  1.00 50.69  ? 330 GLN A N     1 
ATOM   2697  C  CA    . GLN A  1 332 ? 25.579  14.633  71.165  1.00 46.18  ? 330 GLN A CA    1 
ATOM   2698  C  C     . GLN A  1 332 ? 24.195  14.446  70.566  1.00 50.36  ? 330 GLN A C     1 
ATOM   2699  O  O     . GLN A  1 332 ? 24.005  14.605  69.357  1.00 47.85  ? 330 GLN A O     1 
ATOM   2700  C  CB    . GLN A  1 332 ? 25.774  16.106  71.550  1.00 53.23  ? 330 GLN A CB    1 
ATOM   2701  C  CG    . GLN A  1 332 ? 27.111  16.422  72.191  1.00 58.01  ? 330 GLN A CG    1 
ATOM   2702  C  CD    . GLN A  1 332 ? 28.187  16.722  71.170  1.00 60.61  ? 330 GLN A CD    1 
ATOM   2703  O  OE1   . GLN A  1 332 ? 27.908  17.260  70.099  1.00 59.22  ? 330 GLN A OE1   1 
ATOM   2704  N  NE2   . GLN A  1 332 ? 29.427  16.374  71.496  1.00 59.81  ? 330 GLN A NE2   1 
ATOM   2705  N  N     . LYS A  1 333 ? 23.233  14.103  71.417  1.00 54.40  ? 331 LYS A N     1 
ATOM   2706  C  CA    . LYS A  1 333 ? 21.842  14.020  70.996  1.00 50.78  ? 331 LYS A CA    1 
ATOM   2707  C  C     . LYS A  1 333 ? 21.208  15.402  71.058  1.00 43.21  ? 331 LYS A C     1 
ATOM   2708  O  O     . LYS A  1 333 ? 21.309  16.096  72.074  1.00 45.18  ? 331 LYS A O     1 
ATOM   2709  C  CB    . LYS A  1 333 ? 21.070  13.040  71.879  1.00 52.11  ? 331 LYS A CB    1 
ATOM   2710  C  CG    . LYS A  1 333 ? 19.580  12.992  71.594  1.00 58.69  ? 331 LYS A CG    1 
ATOM   2711  C  CD    . LYS A  1 333 ? 18.855  12.130  72.613  1.00 58.58  ? 331 LYS A CD    1 
ATOM   2712  C  CE    . LYS A  1 333 ? 17.354  12.130  72.371  1.00 56.67  ? 331 LYS A CE    1 
ATOM   2713  N  NZ    . LYS A  1 333 ? 16.623  11.366  73.421  1.00 57.86  ? 331 LYS A NZ    1 
ATOM   2714  N  N     . GLN A  1 334 ? 20.566  15.807  69.966  1.00 53.98  ? 332 GLN A N     1 
ATOM   2715  C  CA    . GLN A  1 334 ? 19.883  17.089  69.893  1.00 63.90  ? 332 GLN A CA    1 
ATOM   2716  C  C     . GLN A  1 334 ? 18.376  16.966  70.057  1.00 75.43  ? 332 GLN A C     1 
ATOM   2717  O  O     . GLN A  1 334 ? 17.679  17.986  70.030  1.00 84.35  ? 332 GLN A O     1 
ATOM   2718  C  CB    . GLN A  1 334 ? 20.200  17.784  68.565  1.00 66.91  ? 332 GLN A CB    1 
ATOM   2719  C  CG    . GLN A  1 334 ? 21.637  18.253  68.428  1.00 65.68  ? 332 GLN A CG    1 
ATOM   2720  C  CD    . GLN A  1 334 ? 21.932  18.826  67.053  1.00 74.35  ? 332 GLN A CD    1 
ATOM   2721  O  OE1   . GLN A  1 334 ? 21.510  18.276  66.034  1.00 73.77  ? 332 GLN A OE1   1 
ATOM   2722  N  NE2   . GLN A  1 334 ? 22.654  19.938  67.018  1.00 77.90  ? 332 GLN A NE2   1 
ATOM   2723  N  N     . GLY A  1 335 ? 17.860  15.752  70.226  1.00 80.08  ? 333 GLY A N     1 
ATOM   2724  C  CA    . GLY A  1 335 ? 16.434  15.555  70.377  1.00 80.36  ? 333 GLY A CA    1 
ATOM   2725  C  C     . GLY A  1 335 ? 15.702  15.471  69.054  1.00 87.31  ? 333 GLY A C     1 
ATOM   2726  O  O     . GLY A  1 335 ? 16.164  16.011  68.045  1.00 90.95  ? 333 GLY A O     1 
ATOM   2727  N  N     . GLN A  1 336 ? 14.556  14.790  69.057  1.00 89.64  ? 334 GLN A N     1 
ATOM   2728  C  CA    . GLN A  1 336 ? 13.730  14.617  67.860  1.00 92.30  ? 334 GLN A CA    1 
ATOM   2729  C  C     . GLN A  1 336 ? 14.511  13.936  66.738  1.00 80.90  ? 334 GLN A C     1 
ATOM   2730  O  O     . GLN A  1 336 ? 14.428  14.326  65.572  1.00 78.77  ? 334 GLN A O     1 
ATOM   2731  C  CB    . GLN A  1 336 ? 13.145  15.949  67.382  1.00 102.21 ? 334 GLN A CB    1 
ATOM   2732  C  CG    . GLN A  1 336 ? 12.063  16.528  68.284  1.00 115.91 ? 334 GLN A CG    1 
ATOM   2733  C  CD    . GLN A  1 336 ? 12.619  17.159  69.548  1.00 126.51 ? 334 GLN A CD    1 
ATOM   2734  O  OE1   . GLN A  1 336 ? 13.688  17.769  69.533  1.00 126.75 ? 334 GLN A OE1   1 
ATOM   2735  N  NE2   . GLN A  1 336 ? 11.892  17.014  70.650  1.00 133.24 ? 334 GLN A NE2   1 
ATOM   2736  N  N     . GLY A  1 337 ? 15.274  12.905  67.094  1.00 67.24  ? 335 GLY A N     1 
ATOM   2737  C  CA    . GLY A  1 337 ? 16.042  12.177  66.104  1.00 71.79  ? 335 GLY A CA    1 
ATOM   2738  C  C     . GLY A  1 337 ? 17.184  12.950  65.490  1.00 70.57  ? 335 GLY A C     1 
ATOM   2739  O  O     . GLY A  1 337 ? 17.655  12.584  64.411  1.00 67.56  ? 335 GLY A O     1 
ATOM   2740  N  N     . GLN A  1 338 ? 17.649  14.009  66.146  1.00 64.98  ? 336 GLN A N     1 
ATOM   2741  C  CA    . GLN A  1 338 ? 18.724  14.848  65.637  1.00 61.66  ? 336 GLN A CA    1 
ATOM   2742  C  C     . GLN A  1 338 ? 20.000  14.571  66.417  1.00 57.38  ? 336 GLN A C     1 
ATOM   2743  O  O     . GLN A  1 338 ? 19.986  14.550  67.652  1.00 56.82  ? 336 GLN A O     1 
ATOM   2744  C  CB    . GLN A  1 338 ? 18.358  16.328  65.737  1.00 67.40  ? 336 GLN A CB    1 
ATOM   2745  C  CG    . GLN A  1 338 ? 17.128  16.718  64.943  1.00 69.96  ? 336 GLN A CG    1 
ATOM   2746  C  CD    . GLN A  1 338 ? 16.700  18.145  65.211  1.00 76.15  ? 336 GLN A CD    1 
ATOM   2747  O  OE1   . GLN A  1 338 ? 16.894  19.029  64.379  1.00 78.14  ? 336 GLN A OE1   1 
ATOM   2748  N  NE2   . GLN A  1 338 ? 16.116  18.377  66.381  1.00 82.23  ? 336 GLN A NE2   1 
ATOM   2749  N  N     . TRP A  1 339 ? 21.096  14.365  65.695  1.00 62.16  ? 337 TRP A N     1 
ATOM   2750  C  CA    . TRP A  1 339 ? 22.395  14.108  66.293  1.00 54.73  ? 337 TRP A CA    1 
ATOM   2751  C  C     . TRP A  1 339 ? 23.423  15.036  65.668  1.00 54.90  ? 337 TRP A C     1 
ATOM   2752  O  O     . TRP A  1 339 ? 23.386  15.293  64.462  1.00 58.45  ? 337 TRP A O     1 
ATOM   2753  C  CB    . TRP A  1 339 ? 22.817  12.646  66.102  1.00 40.40  ? 337 TRP A CB    1 
ATOM   2754  C  CG    . TRP A  1 339 ? 21.777  11.671  66.553  1.00 46.35  ? 337 TRP A CG    1 
ATOM   2755  C  CD1   . TRP A  1 339 ? 20.678  11.262  65.854  1.00 42.74  ? 337 TRP A CD1   1 
ATOM   2756  C  CD2   . TRP A  1 339 ? 21.734  10.981  67.807  1.00 53.31  ? 337 TRP A CD2   1 
ATOM   2757  N  NE1   . TRP A  1 339 ? 19.953  10.361  66.595  1.00 43.61  ? 337 TRP A NE1   1 
ATOM   2758  C  CE2   . TRP A  1 339 ? 20.581  10.170  67.798  1.00 55.16  ? 337 TRP A CE2   1 
ATOM   2759  C  CE3   . TRP A  1 339 ? 22.558  10.969  68.937  1.00 48.93  ? 337 TRP A CE3   1 
ATOM   2760  C  CZ2   . TRP A  1 339 ? 20.232  9.357   68.874  1.00 53.25  ? 337 TRP A CZ2   1 
ATOM   2761  C  CZ3   . TRP A  1 339 ? 22.210  10.161  70.004  1.00 48.75  ? 337 TRP A CZ3   1 
ATOM   2762  C  CH2   . TRP A  1 339 ? 21.058  9.366   69.964  1.00 48.10  ? 337 TRP A CH2   1 
ATOM   2763  N  N     . THR A  1 340 ? 24.326  15.548  66.497  1.00 46.09  ? 338 THR A N     1 
ATOM   2764  C  CA    . THR A  1 340 ? 25.428  16.378  66.043  1.00 44.49  ? 338 THR A CA    1 
ATOM   2765  C  C     . THR A  1 340 ? 26.730  15.772  66.543  1.00 48.13  ? 338 THR A C     1 
ATOM   2766  O  O     . THR A  1 340 ? 26.759  15.095  67.575  1.00 48.24  ? 338 THR A O     1 
ATOM   2767  C  CB    . THR A  1 340 ? 25.289  17.830  66.533  1.00 44.89  ? 338 THR A CB    1 
ATOM   2768  O  OG1   . THR A  1 340 ? 26.362  18.622  66.011  1.00 66.47  ? 338 THR A OG1   1 
ATOM   2769  C  CG2   . THR A  1 340 ? 25.312  17.891  68.054  1.00 43.52  ? 338 THR A CG2   1 
ATOM   2770  N  N     . TYR A  1 341 ? 27.809  16.004  65.799  1.00 44.85  ? 339 TYR A N     1 
ATOM   2771  C  CA    . TYR A  1 341 ? 29.086  15.415  66.169  1.00 50.90  ? 339 TYR A CA    1 
ATOM   2772  C  C     . TYR A  1 341 ? 30.225  16.349  65.793  1.00 53.83  ? 339 TYR A C     1 
ATOM   2773  O  O     . TYR A  1 341 ? 30.092  17.217  64.926  1.00 56.23  ? 339 TYR A O     1 
ATOM   2774  C  CB    . TYR A  1 341 ? 29.286  14.039  65.518  1.00 45.67  ? 339 TYR A CB    1 
ATOM   2775  C  CG    . TYR A  1 341 ? 29.328  14.049  64.004  1.00 49.54  ? 339 TYR A CG    1 
ATOM   2776  C  CD1   . TYR A  1 341 ? 28.174  13.854  63.257  1.00 50.75  ? 339 TYR A CD1   1 
ATOM   2777  C  CD2   . TYR A  1 341 ? 30.526  14.233  63.323  1.00 48.10  ? 339 TYR A CD2   1 
ATOM   2778  C  CE1   . TYR A  1 341 ? 28.209  13.851  61.875  1.00 56.67  ? 339 TYR A CE1   1 
ATOM   2779  C  CE2   . TYR A  1 341 ? 30.569  14.236  61.942  1.00 54.68  ? 339 TYR A CE2   1 
ATOM   2780  C  CZ    . TYR A  1 341 ? 29.409  14.044  61.224  1.00 58.11  ? 339 TYR A CZ    1 
ATOM   2781  O  OH    . TYR A  1 341 ? 29.449  14.045  59.849  1.00 64.47  ? 339 TYR A OH    1 
ATOM   2782  N  N     . GLN A  1 342 ? 31.354  16.152  66.470  1.00 44.36  ? 340 GLN A N     1 
ATOM   2783  C  CA    . GLN A  1 342 ? 32.593  16.859  66.189  1.00 44.53  ? 340 GLN A CA    1 
ATOM   2784  C  C     . GLN A  1 342 ? 33.723  15.847  66.092  1.00 49.89  ? 340 GLN A C     1 
ATOM   2785  O  O     . GLN A  1 342 ? 33.796  14.908  66.891  1.00 49.44  ? 340 GLN A O     1 
ATOM   2786  C  CB    . GLN A  1 342 ? 32.920  17.897  67.275  1.00 48.46  ? 340 GLN A CB    1 
ATOM   2787  C  CG    . GLN A  1 342 ? 31.828  18.925  67.525  1.00 61.75  ? 340 GLN A CG    1 
ATOM   2788  C  CD    . GLN A  1 342 ? 30.732  18.406  68.439  1.00 61.22  ? 340 GLN A CD    1 
ATOM   2789  O  OE1   . GLN A  1 342 ? 30.930  17.442  69.179  1.00 46.42  ? 340 GLN A OE1   1 
ATOM   2790  N  NE2   . GLN A  1 342 ? 29.568  19.042  68.386  1.00 62.90  ? 340 GLN A NE2   1 
ATOM   2791  N  N     . ILE A  1 343 ? 34.596  16.037  65.108  1.00 44.84  ? 341 ILE A N     1 
ATOM   2792  C  CA    . ILE A  1 343 ? 35.784  15.214  64.929  1.00 39.89  ? 341 ILE A CA    1 
ATOM   2793  C  C     . ILE A  1 343 ? 37.003  16.093  65.162  1.00 54.58  ? 341 ILE A C     1 
ATOM   2794  O  O     . ILE A  1 343 ? 37.129  17.163  64.555  1.00 67.14  ? 341 ILE A O     1 
ATOM   2795  C  CB    . ILE A  1 343 ? 35.821  14.566  63.534  1.00 39.32  ? 341 ILE A CB    1 
ATOM   2796  C  CG1   . ILE A  1 343 ? 34.541  13.766  63.292  1.00 38.04  ? 341 ILE A CG1   1 
ATOM   2797  C  CG2   . ILE A  1 343 ? 37.040  13.666  63.400  1.00 38.61  ? 341 ILE A CG2   1 
ATOM   2798  C  CD1   . ILE A  1 343 ? 34.476  13.117  61.927  1.00 40.67  ? 341 ILE A CD1   1 
ATOM   2799  N  N     . TYR A  1 344 ? 37.894  15.647  66.044  1.00 45.93  ? 342 TYR A N     1 
ATOM   2800  C  CA    . TYR A  1 344 ? 39.036  16.453  66.445  1.00 43.94  ? 342 TYR A CA    1 
ATOM   2801  C  C     . TYR A  1 344 ? 40.172  15.537  66.876  1.00 54.66  ? 342 TYR A C     1 
ATOM   2802  O  O     . TYR A  1 344 ? 39.991  14.333  67.075  1.00 56.52  ? 342 TYR A O     1 
ATOM   2803  C  CB    . TYR A  1 344 ? 38.664  17.417  67.577  1.00 43.74  ? 342 TYR A CB    1 
ATOM   2804  C  CG    . TYR A  1 344 ? 38.178  16.723  68.832  1.00 50.47  ? 342 TYR A CG    1 
ATOM   2805  C  CD1   . TYR A  1 344 ? 39.068  16.342  69.830  1.00 54.58  ? 342 TYR A CD1   1 
ATOM   2806  C  CD2   . TYR A  1 344 ? 36.830  16.445  69.018  1.00 44.22  ? 342 TYR A CD2   1 
ATOM   2807  C  CE1   . TYR A  1 344 ? 38.631  15.705  70.975  1.00 46.49  ? 342 TYR A CE1   1 
ATOM   2808  C  CE2   . TYR A  1 344 ? 36.383  15.808  70.161  1.00 47.26  ? 342 TYR A CE2   1 
ATOM   2809  C  CZ    . TYR A  1 344 ? 37.288  15.442  71.136  1.00 48.69  ? 342 TYR A CZ    1 
ATOM   2810  O  OH    . TYR A  1 344 ? 36.849  14.808  72.276  1.00 51.38  ? 342 TYR A OH    1 
ATOM   2811  N  N     . GLN A  1 345 ? 41.352  16.128  67.024  1.00 61.21  ? 343 GLN A N     1 
ATOM   2812  C  CA    . GLN A  1 345 ? 42.516  15.447  67.575  1.00 64.77  ? 343 GLN A CA    1 
ATOM   2813  C  C     . GLN A  1 345 ? 42.989  16.062  68.880  1.00 71.25  ? 343 GLN A C     1 
ATOM   2814  O  O     . GLN A  1 345 ? 43.346  15.333  69.809  1.00 73.14  ? 343 GLN A O     1 
ATOM   2815  C  CB    . GLN A  1 345 ? 43.662  15.452  66.554  1.00 52.83  ? 343 GLN A CB    1 
ATOM   2816  C  CG    . GLN A  1 345 ? 43.274  14.879  65.203  1.00 50.87  ? 343 GLN A CG    1 
ATOM   2817  C  CD    . GLN A  1 345 ? 44.449  14.771  64.255  1.00 65.08  ? 343 GLN A CD    1 
ATOM   2818  O  OE1   . GLN A  1 345 ? 44.761  15.711  63.524  1.00 77.62  ? 343 GLN A OE1   1 
ATOM   2819  N  NE2   . GLN A  1 345 ? 45.107  13.617  64.259  1.00 61.03  ? 343 GLN A NE2   1 
ATOM   2820  N  N     . GLU A  1 346 ? 42.998  17.388  68.974  1.00 67.22  ? 344 GLU A N     1 
ATOM   2821  C  CA    . GLU A  1 346 ? 43.220  18.129  70.201  1.00 74.91  ? 344 GLU A CA    1 
ATOM   2822  C  C     . GLU A  1 346 ? 41.902  18.702  70.708  1.00 78.66  ? 344 GLU A C     1 
ATOM   2823  O  O     . GLU A  1 346 ? 41.028  19.061  69.912  1.00 73.57  ? 344 GLU A O     1 
ATOM   2824  C  CB    . GLU A  1 346 ? 44.223  19.266  69.982  1.00 87.76  ? 344 GLU A CB    1 
ATOM   2825  C  CG    . GLU A  1 346 ? 45.650  18.795  69.744  1.00 100.70 ? 344 GLU A CG    1 
ATOM   2826  C  CD    . GLU A  1 346 ? 46.248  18.106  70.957  1.00 112.79 ? 344 GLU A CD    1 
ATOM   2827  O  OE1   . GLU A  1 346 ? 45.825  18.413  72.091  1.00 120.16 ? 344 GLU A OE1   1 
ATOM   2828  O  OE2   . GLU A  1 346 ? 47.142  17.253  70.777  1.00 116.12 ? 344 GLU A OE2   1 
ATOM   2829  N  N     . PRO A  1 347 ? 41.725  18.782  72.026  1.00 87.53  ? 345 PRO A N     1 
ATOM   2830  C  CA    . PRO A  1 347 ? 40.446  19.256  72.575  1.00 83.30  ? 345 PRO A CA    1 
ATOM   2831  C  C     . PRO A  1 347 ? 40.112  20.662  72.095  1.00 80.80  ? 345 PRO A C     1 
ATOM   2832  O  O     . PRO A  1 347 ? 40.951  21.565  72.124  1.00 78.64  ? 345 PRO A O     1 
ATOM   2833  C  CB    . PRO A  1 347 ? 40.676  19.213  74.090  1.00 92.37  ? 345 PRO A CB    1 
ATOM   2834  C  CG    . PRO A  1 347 ? 41.745  18.182  74.276  1.00 90.97  ? 345 PRO A CG    1 
ATOM   2835  C  CD    . PRO A  1 347 ? 42.643  18.316  73.081  1.00 92.77  ? 345 PRO A CD    1 
ATOM   2836  N  N     . PHE A  1 348 ? 38.870  20.831  71.635  1.00 85.22  ? 346 PHE A N     1 
ATOM   2837  C  CA    . PHE A  1 348 ? 38.330  22.103  71.153  1.00 95.16  ? 346 PHE A CA    1 
ATOM   2838  C  C     . PHE A  1 348 ? 39.029  22.597  69.889  1.00 89.73  ? 346 PHE A C     1 
ATOM   2839  O  O     . PHE A  1 348 ? 38.913  23.773  69.531  1.00 90.34  ? 346 PHE A O     1 
ATOM   2840  C  CB    . PHE A  1 348 ? 38.378  23.181  72.243  1.00 107.70 ? 346 PHE A CB    1 
ATOM   2841  C  CG    . PHE A  1 348 ? 37.551  22.852  73.454  1.00 120.51 ? 346 PHE A CG    1 
ATOM   2842  C  CD1   . PHE A  1 348 ? 36.198  23.149  73.487  1.00 126.76 ? 346 PHE A CD1   1 
ATOM   2843  C  CD2   . PHE A  1 348 ? 38.126  22.242  74.557  1.00 120.10 ? 346 PHE A CD2   1 
ATOM   2844  C  CE1   . PHE A  1 348 ? 35.434  22.846  74.599  1.00 126.92 ? 346 PHE A CE1   1 
ATOM   2845  C  CE2   . PHE A  1 348 ? 37.367  21.937  75.671  1.00 122.57 ? 346 PHE A CE2   1 
ATOM   2846  C  CZ    . PHE A  1 348 ? 36.020  22.239  75.692  1.00 127.16 ? 346 PHE A CZ    1 
ATOM   2847  N  N     . LYS A  1 349 ? 39.750  21.717  69.198  1.00 83.04  ? 347 LYS A N     1 
ATOM   2848  C  CA    . LYS A  1 349 ? 40.357  22.015  67.902  1.00 79.59  ? 347 LYS A CA    1 
ATOM   2849  C  C     . LYS A  1 349 ? 39.710  21.084  66.883  1.00 68.41  ? 347 LYS A C     1 
ATOM   2850  O  O     . LYS A  1 349 ? 40.290  20.071  66.486  1.00 72.30  ? 347 LYS A O     1 
ATOM   2851  C  CB    . LYS A  1 349 ? 41.879  21.847  67.941  1.00 87.82  ? 347 LYS A CB    1 
ATOM   2852  C  CG    . LYS A  1 349 ? 42.604  22.873  68.797  1.00 90.12  ? 347 LYS A CG    1 
ATOM   2853  C  CD    . LYS A  1 349 ? 44.111  22.719  68.663  1.00 98.62  ? 347 LYS A CD    1 
ATOM   2854  C  CE    . LYS A  1 349 ? 44.855  23.764  69.476  1.00 101.70 ? 347 LYS A CE    1 
ATOM   2855  N  NZ    . LYS A  1 349 ? 46.330  23.634  69.318  1.00 100.93 ? 347 LYS A NZ    1 
ATOM   2856  N  N     . ASN A  1 350 ? 38.498  21.435  66.459  1.00 60.59  ? 348 ASN A N     1 
ATOM   2857  C  CA    . ASN A  1 350 ? 37.722  20.560  65.593  1.00 54.30  ? 348 ASN A CA    1 
ATOM   2858  C  C     . ASN A  1 350 ? 38.313  20.511  64.191  1.00 58.47  ? 348 ASN A C     1 
ATOM   2859  O  O     . ASN A  1 350 ? 38.600  21.548  63.586  1.00 67.24  ? 348 ASN A O     1 
ATOM   2860  C  CB    . ASN A  1 350 ? 36.269  21.028  65.530  1.00 48.50  ? 348 ASN A CB    1 
ATOM   2861  C  CG    . ASN A  1 350 ? 35.487  20.673  66.777  1.00 50.38  ? 348 ASN A CG    1 
ATOM   2862  O  OD1   . ASN A  1 350 ? 35.801  19.700  67.462  1.00 46.09  ? 348 ASN A OD1   1 
ATOM   2863  N  ND2   . ASN A  1 350 ? 34.458  21.457  67.074  1.00 51.88  ? 348 ASN A ND2   1 
ATOM   2864  N  N     . LEU A  1 351 ? 38.501  19.294  63.678  1.00 52.50  ? 349 LEU A N     1 
ATOM   2865  C  CA    . LEU A  1 351 ? 38.803  19.128  62.261  1.00 52.38  ? 349 LEU A CA    1 
ATOM   2866  C  C     . LEU A  1 351 ? 37.582  19.456  61.415  1.00 52.88  ? 349 LEU A C     1 
ATOM   2867  O  O     . LEU A  1 351 ? 37.676  20.187  60.422  1.00 55.93  ? 349 LEU A O     1 
ATOM   2868  C  CB    . LEU A  1 351 ? 39.278  17.702  61.991  1.00 46.51  ? 349 LEU A CB    1 
ATOM   2869  C  CG    . LEU A  1 351 ? 40.636  17.332  62.579  1.00 54.53  ? 349 LEU A CG    1 
ATOM   2870  C  CD1   . LEU A  1 351 ? 40.810  15.830  62.594  1.00 60.33  ? 349 LEU A CD1   1 
ATOM   2871  C  CD2   . LEU A  1 351 ? 41.731  17.980  61.765  1.00 53.28  ? 349 LEU A CD2   1 
ATOM   2872  N  N     . LYS A  1 352 ? 36.425  18.923  61.800  1.00 58.37  ? 350 LYS A N     1 
ATOM   2873  C  CA    . LYS A  1 352 ? 35.164  19.218  61.138  1.00 61.66  ? 350 LYS A CA    1 
ATOM   2874  C  C     . LYS A  1 352 ? 34.033  18.761  62.043  1.00 63.31  ? 350 LYS A C     1 
ATOM   2875  O  O     . LYS A  1 352 ? 34.236  17.994  62.987  1.00 62.43  ? 350 LYS A O     1 
ATOM   2876  C  CB    . LYS A  1 352 ? 35.065  18.537  59.771  1.00 51.70  ? 350 LYS A CB    1 
ATOM   2877  C  CG    . LYS A  1 352 ? 34.972  17.023  59.838  1.00 44.30  ? 350 LYS A CG    1 
ATOM   2878  C  CD    . LYS A  1 352 ? 34.992  16.414  58.447  1.00 44.27  ? 350 LYS A CD    1 
ATOM   2879  C  CE    . LYS A  1 352 ? 33.881  16.982  57.579  1.00 44.44  ? 350 LYS A CE    1 
ATOM   2880  N  NZ    . LYS A  1 352 ? 32.533  16.667  58.129  1.00 48.09  ? 350 LYS A NZ    1 
ATOM   2881  N  N     . THR A  1 353 ? 32.836  19.246  61.742  1.00 53.95  ? 351 THR A N     1 
ATOM   2882  C  CA    . THR A  1 353 ? 31.632  18.848  62.454  1.00 52.59  ? 351 THR A CA    1 
ATOM   2883  C  C     . THR A  1 353 ? 30.650  18.230  61.461  1.00 58.66  ? 351 THR A C     1 
ATOM   2884  O  O     . THR A  1 353 ? 30.974  17.998  60.293  1.00 70.93  ? 351 THR A O     1 
ATOM   2885  C  CB    . THR A  1 353 ? 31.019  20.040  63.195  1.00 55.31  ? 351 THR A CB    1 
ATOM   2886  O  OG1   . THR A  1 353 ? 30.575  21.019  62.249  1.00 56.46  ? 351 THR A OG1   1 
ATOM   2887  C  CG2   . THR A  1 353 ? 32.041  20.671  64.131  1.00 47.66  ? 351 THR A CG2   1 
ATOM   2888  N  N     . GLY A  1 354 ? 29.444  17.963  61.937  1.00 55.31  ? 352 GLY A N     1 
ATOM   2889  C  CA    . GLY A  1 354 ? 28.429  17.368  61.095  1.00 47.47  ? 352 GLY A CA    1 
ATOM   2890  C  C     . GLY A  1 354 ? 27.230  16.964  61.920  1.00 54.81  ? 352 GLY A C     1 
ATOM   2891  O  O     . GLY A  1 354 ? 27.215  17.090  63.149  1.00 53.05  ? 352 GLY A O     1 
ATOM   2892  N  N     . LYS A  1 355 ? 26.220  16.462  61.216  1.00 46.66  ? 353 LYS A N     1 
ATOM   2893  C  CA    . LYS A  1 355 ? 24.980  16.057  61.856  1.00 53.98  ? 353 LYS A CA    1 
ATOM   2894  C  C     . LYS A  1 355 ? 24.430  14.808  61.186  1.00 55.97  ? 353 LYS A C     1 
ATOM   2895  O  O     . LYS A  1 355 ? 24.652  14.566  59.996  1.00 60.40  ? 353 LYS A O     1 
ATOM   2896  C  CB    . LYS A  1 355 ? 23.930  17.175  61.811  1.00 53.24  ? 353 LYS A CB    1 
ATOM   2897  C  CG    . LYS A  1 355 ? 23.526  17.590  60.407  1.00 52.86  ? 353 LYS A CG    1 
ATOM   2898  C  CD    . LYS A  1 355 ? 22.459  18.668  60.441  1.00 60.11  ? 353 LYS A CD    1 
ATOM   2899  C  CE    . LYS A  1 355 ? 22.094  19.129  59.043  1.00 64.90  ? 353 LYS A CE    1 
ATOM   2900  N  NZ    . LYS A  1 355 ? 21.559  18.016  58.211  1.00 68.33  ? 353 LYS A NZ    1 
ATOM   2901  N  N     . TYR A  1 356 ? 23.713  14.013  61.977  1.00 54.32  ? 354 TYR A N     1 
ATOM   2902  C  CA    . TYR A  1 356 ? 22.938  12.881  61.487  1.00 49.31  ? 354 TYR A CA    1 
ATOM   2903  C  C     . TYR A  1 356 ? 21.531  13.001  62.048  1.00 53.84  ? 354 TYR A C     1 
ATOM   2904  O  O     . TYR A  1 356 ? 21.339  12.928  63.266  1.00 58.14  ? 354 TYR A O     1 
ATOM   2905  C  CB    . TYR A  1 356 ? 23.567  11.545  61.892  1.00 52.73  ? 354 TYR A CB    1 
ATOM   2906  C  CG    . TYR A  1 356 ? 22.744  10.349  61.470  1.00 50.91  ? 354 TYR A CG    1 
ATOM   2907  C  CD1   . TYR A  1 356 ? 22.761  9.903   60.156  1.00 44.23  ? 354 TYR A CD1   1 
ATOM   2908  C  CD2   . TYR A  1 356 ? 21.945  9.669   62.383  1.00 44.48  ? 354 TYR A CD2   1 
ATOM   2909  C  CE1   . TYR A  1 356 ? 22.011  8.816   59.761  1.00 54.17  ? 354 TYR A CE1   1 
ATOM   2910  C  CE2   . TYR A  1 356 ? 21.190  8.577   61.996  1.00 49.76  ? 354 TYR A CE2   1 
ATOM   2911  C  CZ    . TYR A  1 356 ? 21.228  8.156   60.683  1.00 57.64  ? 354 TYR A CZ    1 
ATOM   2912  O  OH    . TYR A  1 356 ? 20.481  7.072   60.283  1.00 61.70  ? 354 TYR A OH    1 
ATOM   2913  N  N     . ALA A  1 357 ? 20.551  13.188  61.161  1.00 54.63  ? 355 ALA A N     1 
ATOM   2914  C  CA    . ALA A  1 357 ? 19.159  13.347  61.565  1.00 60.32  ? 355 ALA A CA    1 
ATOM   2915  C  C     . ALA A  1 357 ? 18.222  12.503  60.708  1.00 63.87  ? 355 ALA A C     1 
ATOM   2916  O  O     . ALA A  1 357 ? 17.018  12.777  60.660  1.00 72.25  ? 355 ALA A O     1 
ATOM   2917  C  CB    . ALA A  1 357 ? 18.746  14.819  61.511  1.00 53.07  ? 355 ALA A CB    1 
ATOM   2918  N  N     . ARG A  1 358 ? 18.746  11.483  60.035  1.00 59.09  ? 356 ARG A N     1 
ATOM   2919  C  CA    . ARG A  1 358 ? 17.908  10.622  59.212  1.00 62.61  ? 356 ARG A CA    1 
ATOM   2920  C  C     . ARG A  1 358 ? 17.011  9.762   60.094  1.00 64.45  ? 356 ARG A C     1 
ATOM   2921  O  O     . ARG A  1 358 ? 17.476  9.138   61.053  1.00 63.49  ? 356 ARG A O     1 
ATOM   2922  C  CB    . ARG A  1 358 ? 18.772  9.740   58.314  1.00 58.75  ? 356 ARG A CB    1 
ATOM   2923  C  CG    . ARG A  1 358 ? 17.976  8.867   57.357  1.00 67.13  ? 356 ARG A CG    1 
ATOM   2924  C  CD    . ARG A  1 358 ? 18.898  8.031   56.488  1.00 82.59  ? 356 ARG A CD    1 
ATOM   2925  N  NE    . ARG A  1 358 ? 18.170  7.264   55.483  1.00 96.19  ? 356 ARG A NE    1 
ATOM   2926  C  CZ    . ARG A  1 358 ? 18.751  6.476   54.584  1.00 105.13 ? 356 ARG A CZ    1 
ATOM   2927  N  NH1   . ARG A  1 358 ? 20.071  6.351   54.567  1.00 106.78 ? 356 ARG A NH1   1 
ATOM   2928  N  NH2   . ARG A  1 358 ? 18.013  5.813   53.704  1.00 105.49 ? 356 ARG A NH2   1 
ATOM   2929  N  N     . MET A  1 359 ? 15.723  9.737   59.769  1.00 62.76  ? 357 MET A N     1 
ATOM   2930  C  CA    . MET A  1 359 ? 14.735  8.925   60.474  1.00 67.88  ? 357 MET A CA    1 
ATOM   2931  C  C     . MET A  1 359 ? 14.381  7.744   59.576  1.00 65.47  ? 357 MET A C     1 
ATOM   2932  O  O     . MET A  1 359 ? 13.538  7.863   58.681  1.00 76.57  ? 357 MET A O     1 
ATOM   2933  C  CB    . MET A  1 359 ? 13.503  9.754   60.833  1.00 89.29  ? 357 MET A CB    1 
ATOM   2934  C  CG    . MET A  1 359 ? 12.332  8.950   61.392  1.00 104.81 ? 357 MET A CG    1 
ATOM   2935  S  SD    . MET A  1 359 ? 12.753  7.940   62.825  1.00 104.16 ? 357 MET A SD    1 
ATOM   2936  C  CE    . MET A  1 359 ? 11.127  7.374   63.322  1.00 93.15  ? 357 MET A CE    1 
ATOM   2937  N  N     . ARG A  1 360 ? 15.036  6.610   59.806  1.00 55.49  ? 358 ARG A N     1 
ATOM   2938  C  CA    . ARG A  1 360 ? 14.764  5.384   59.070  1.00 68.55  ? 358 ARG A CA    1 
ATOM   2939  C  C     . ARG A  1 360 ? 13.982  4.428   59.960  1.00 67.27  ? 358 ARG A C     1 
ATOM   2940  O  O     . ARG A  1 360 ? 14.361  4.190   61.112  1.00 53.83  ? 358 ARG A O     1 
ATOM   2941  C  CB    . ARG A  1 360 ? 16.058  4.725   58.577  1.00 67.71  ? 358 ARG A CB    1 
ATOM   2942  C  CG    . ARG A  1 360 ? 17.092  4.439   59.653  1.00 72.38  ? 358 ARG A CG    1 
ATOM   2943  C  CD    . ARG A  1 360 ? 18.063  3.346   59.215  1.00 79.60  ? 358 ARG A CD    1 
ATOM   2944  N  NE    . ARG A  1 360 ? 18.827  3.711   58.024  1.00 91.11  ? 358 ARG A NE    1 
ATOM   2945  C  CZ    . ARG A  1 360 ? 18.589  3.237   56.805  1.00 87.60  ? 358 ARG A CZ    1 
ATOM   2946  N  NH1   . ARG A  1 360 ? 19.340  3.626   55.784  1.00 82.90  ? 358 ARG A NH1   1 
ATOM   2947  N  NH2   . ARG A  1 360 ? 17.605  2.371   56.605  1.00 90.14  ? 358 ARG A NH2   1 
ATOM   2948  N  N     . GLY A  1 361 ? 12.887  3.893   59.426  1.00 65.79  ? 359 GLY A N     1 
ATOM   2949  C  CA    . GLY A  1 361 ? 12.040  2.992   60.180  1.00 58.85  ? 359 GLY A CA    1 
ATOM   2950  C  C     . GLY A  1 361 ? 10.859  3.691   60.820  1.00 51.67  ? 359 GLY A C     1 
ATOM   2951  O  O     . GLY A  1 361 ? 10.994  4.803   61.339  1.00 60.43  ? 359 GLY A O     1 
ATOM   2952  N  N     . ALA A  1 362 ? 9.688   3.051   60.779  1.00 45.24  ? 360 ALA A N     1 
ATOM   2953  C  CA    . ALA A  1 362 ? 8.518   3.620   61.437  1.00 43.94  ? 360 ALA A CA    1 
ATOM   2954  C  C     . ALA A  1 362 ? 8.684   3.639   62.950  1.00 42.18  ? 360 ALA A C     1 
ATOM   2955  O  O     . ALA A  1 362 ? 8.146   4.527   63.621  1.00 47.24  ? 360 ALA A O     1 
ATOM   2956  C  CB    . ALA A  1 362 ? 7.262   2.839   61.050  1.00 41.52  ? 360 ALA A CB    1 
ATOM   2957  N  N     . HIS A  1 363 ? 9.424   2.678   63.499  1.00 37.18  ? 361 HIS A N     1 
ATOM   2958  C  CA    . HIS A  1 363 ? 9.664   2.579   64.931  1.00 46.75  ? 361 HIS A CA    1 
ATOM   2959  C  C     . HIS A  1 363 ? 11.152  2.376   65.169  1.00 41.40  ? 361 HIS A C     1 
ATOM   2960  O  O     . HIS A  1 363 ? 11.796  1.585   64.473  1.00 57.60  ? 361 HIS A O     1 
ATOM   2961  C  CB    . HIS A  1 363 ? 8.866   1.424   65.544  1.00 40.27  ? 361 HIS A CB    1 
ATOM   2962  C  CG    . HIS A  1 363 ? 7.564   1.161   64.854  1.00 41.87  ? 361 HIS A CG    1 
ATOM   2963  N  ND1   . HIS A  1 363 ? 6.461   1.973   65.009  1.00 39.86  ? 361 HIS A ND1   1 
ATOM   2964  C  CD2   . HIS A  1 363 ? 7.191   0.181   63.998  1.00 37.20  ? 361 HIS A CD2   1 
ATOM   2965  C  CE1   . HIS A  1 363 ? 5.464   1.503   64.282  1.00 50.83  ? 361 HIS A CE1   1 
ATOM   2966  N  NE2   . HIS A  1 363 ? 5.881   0.415   63.658  1.00 39.30  ? 361 HIS A NE2   1 
ATOM   2967  N  N     . THR A  1 364 ? 11.695  3.090   66.151  1.00 34.96  ? 362 THR A N     1 
ATOM   2968  C  CA    . THR A  1 364 ? 13.124  3.036   66.435  1.00 41.95  ? 362 THR A CA    1 
ATOM   2969  C  C     . THR A  1 364 ? 13.361  3.550   67.850  1.00 46.08  ? 362 THR A C     1 
ATOM   2970  O  O     . THR A  1 364 ? 12.428  3.946   68.554  1.00 48.60  ? 362 THR A O     1 
ATOM   2971  C  CB    . THR A  1 364 ? 13.921  3.849   65.410  1.00 37.36  ? 362 THR A CB    1 
ATOM   2972  O  OG1   . THR A  1 364 ? 15.320  3.740   65.694  1.00 53.84  ? 362 THR A OG1   1 
ATOM   2973  C  CG2   . THR A  1 364 ? 13.513  5.312   65.458  1.00 34.75  ? 362 THR A CG2   1 
ATOM   2974  N  N     . ASN A  1 365 ? 14.628  3.537   68.262  1.00 32.73  ? 363 ASN A N     1 
ATOM   2975  C  CA    . ASN A  1 365 ? 15.028  4.063   69.558  1.00 40.37  ? 363 ASN A CA    1 
ATOM   2976  C  C     . ASN A  1 365 ? 16.336  4.830   69.407  1.00 46.04  ? 363 ASN A C     1 
ATOM   2977  O  O     . ASN A  1 365 ? 16.997  4.778   68.366  1.00 41.05  ? 363 ASN A O     1 
ATOM   2978  C  CB    . ASN A  1 365 ? 15.152  2.949   70.612  1.00 38.23  ? 363 ASN A CB    1 
ATOM   2979  C  CG    . ASN A  1 365 ? 16.134  1.858   70.212  1.00 41.69  ? 363 ASN A CG    1 
ATOM   2980  O  OD1   . ASN A  1 365 ? 17.236  2.131   69.736  1.00 43.28  ? 363 ASN A OD1   1 
ATOM   2981  N  ND2   . ASN A  1 365 ? 15.734  0.608   70.414  1.00 38.46  ? 363 ASN A ND2   1 
ATOM   2982  N  N     . ASP A  1 366 ? 16.707  5.548   70.472  1.00 43.38  ? 364 ASP A N     1 
ATOM   2983  C  CA    . ASP A  1 366 ? 17.914  6.368   70.433  1.00 37.10  ? 364 ASP A CA    1 
ATOM   2984  C  C     . ASP A  1 366 ? 19.169  5.526   70.245  1.00 41.75  ? 364 ASP A C     1 
ATOM   2985  O  O     . ASP A  1 366 ? 20.155  6.006   69.675  1.00 49.13  ? 364 ASP A O     1 
ATOM   2986  C  CB    . ASP A  1 366 ? 18.029  7.202   71.710  1.00 31.81  ? 364 ASP A CB    1 
ATOM   2987  C  CG    . ASP A  1 366 ? 17.075  8.378   71.728  1.00 43.58  ? 364 ASP A CG    1 
ATOM   2988  O  OD1   . ASP A  1 366 ? 16.708  8.866   70.639  1.00 46.48  ? 364 ASP A OD1   1 
ATOM   2989  O  OD2   . ASP A  1 366 ? 16.695  8.819   72.833  1.00 53.00  ? 364 ASP A OD2   1 
ATOM   2990  N  N     . VAL A  1 367 ? 19.158  4.278   70.717  1.00 42.81  ? 365 VAL A N     1 
ATOM   2991  C  CA    . VAL A  1 367 ? 20.339  3.432   70.576  1.00 37.20  ? 365 VAL A CA    1 
ATOM   2992  C  C     . VAL A  1 367 ? 20.549  3.045   69.117  1.00 38.49  ? 365 VAL A C     1 
ATOM   2993  O  O     . VAL A  1 367 ? 21.681  3.046   68.619  1.00 43.18  ? 365 VAL A O     1 
ATOM   2994  C  CB    . VAL A  1 367 ? 20.222  2.193   71.482  1.00 34.18  ? 365 VAL A CB    1 
ATOM   2995  C  CG1   . VAL A  1 367 ? 21.507  1.383   71.438  1.00 27.72  ? 365 VAL A CG1   1 
ATOM   2996  C  CG2   . VAL A  1 367 ? 19.899  2.611   72.908  1.00 31.46  ? 365 VAL A CG2   1 
ATOM   2997  N  N     . LYS A  1 368 ? 19.466  2.710   68.410  1.00 38.55  ? 366 LYS A N     1 
ATOM   2998  C  CA    . LYS A  1 368 ? 19.574  2.422   66.983  1.00 42.68  ? 366 LYS A CA    1 
ATOM   2999  C  C     . LYS A  1 368 ? 20.106  3.626   66.216  1.00 44.95  ? 366 LYS A C     1 
ATOM   3000  O  O     . LYS A  1 368 ? 20.976  3.486   65.349  1.00 38.91  ? 366 LYS A O     1 
ATOM   3001  C  CB    . LYS A  1 368 ? 18.214  2.007   66.422  1.00 37.42  ? 366 LYS A CB    1 
ATOM   3002  C  CG    . LYS A  1 368 ? 17.725  0.634   66.840  1.00 43.43  ? 366 LYS A CG    1 
ATOM   3003  C  CD    . LYS A  1 368 ? 16.360  0.367   66.224  1.00 46.90  ? 366 LYS A CD    1 
ATOM   3004  C  CE    . LYS A  1 368 ? 15.865  -1.036  66.513  1.00 47.09  ? 366 LYS A CE    1 
ATOM   3005  N  NZ    . LYS A  1 368 ? 14.586  -1.303  65.797  1.00 49.24  ? 366 LYS A NZ    1 
ATOM   3006  N  N     . GLN A  1 369 ? 19.590  4.818   66.522  1.00 35.31  ? 367 GLN A N     1 
ATOM   3007  C  CA    . GLN A  1 369 ? 19.993  6.010   65.784  1.00 37.02  ? 367 GLN A CA    1 
ATOM   3008  C  C     . GLN A  1 369 ? 21.428  6.404   66.107  1.00 43.15  ? 367 GLN A C     1 
ATOM   3009  O  O     . GLN A  1 369 ? 22.159  6.876   65.229  1.00 50.68  ? 367 GLN A O     1 
ATOM   3010  C  CB    . GLN A  1 369 ? 19.031  7.158   66.084  1.00 37.03  ? 367 GLN A CB    1 
ATOM   3011  C  CG    . GLN A  1 369 ? 17.606  6.889   65.626  1.00 43.57  ? 367 GLN A CG    1 
ATOM   3012  C  CD    . GLN A  1 369 ? 16.677  8.057   65.885  1.00 50.42  ? 367 GLN A CD    1 
ATOM   3013  O  OE1   . GLN A  1 369 ? 16.997  8.963   66.655  1.00 48.77  ? 367 GLN A OE1   1 
ATOM   3014  N  NE2   . GLN A  1 369 ? 15.520  8.045   65.235  1.00 64.50  ? 367 GLN A NE2   1 
ATOM   3015  N  N     . LEU A  1 370 ? 21.849  6.224   67.361  1.00 37.61  ? 368 LEU A N     1 
ATOM   3016  C  CA    . LEU A  1 370 ? 23.248  6.458   67.704  1.00 40.15  ? 368 LEU A CA    1 
ATOM   3017  C  C     . LEU A  1 370 ? 24.160  5.502   66.947  1.00 43.58  ? 368 LEU A C     1 
ATOM   3018  O  O     . LEU A  1 370 ? 25.242  5.891   66.493  1.00 40.95  ? 368 LEU A O     1 
ATOM   3019  C  CB    . LEU A  1 370 ? 23.453  6.315   69.212  1.00 35.43  ? 368 LEU A CB    1 
ATOM   3020  C  CG    . LEU A  1 370 ? 24.892  6.476   69.703  1.00 36.87  ? 368 LEU A CG    1 
ATOM   3021  C  CD1   . LEU A  1 370 ? 25.420  7.861   69.362  1.00 39.85  ? 368 LEU A CD1   1 
ATOM   3022  C  CD2   . LEU A  1 370 ? 24.982  6.216   71.196  1.00 36.17  ? 368 LEU A CD2   1 
ATOM   3023  N  N     . THR A  1 371 ? 23.734  4.245   66.800  1.00 38.39  ? 369 THR A N     1 
ATOM   3024  C  CA    . THR A  1 371 ? 24.500  3.283   66.015  1.00 39.78  ? 369 THR A CA    1 
ATOM   3025  C  C     . THR A  1 371 ? 24.612  3.727   64.562  1.00 40.17  ? 369 THR A C     1 
ATOM   3026  O  O     . THR A  1 371 ? 25.684  3.627   63.954  1.00 41.90  ? 369 THR A O     1 
ATOM   3027  C  CB    . THR A  1 371 ? 23.851  1.901   66.107  1.00 34.38  ? 369 THR A CB    1 
ATOM   3028  O  OG1   . THR A  1 371 ? 23.841  1.466   67.472  1.00 37.26  ? 369 THR A OG1   1 
ATOM   3029  C  CG2   . THR A  1 371 ? 24.611  0.891   65.263  1.00 41.25  ? 369 THR A CG2   1 
ATOM   3030  N  N     . GLU A  1 372 ? 23.516  4.232   63.993  1.00 36.74  ? 370 GLU A N     1 
ATOM   3031  C  CA    . GLU A  1 372 ? 23.548  4.705   62.613  1.00 45.48  ? 370 GLU A CA    1 
ATOM   3032  C  C     . GLU A  1 372 ? 24.431  5.938   62.472  1.00 43.43  ? 370 GLU A C     1 
ATOM   3033  O  O     . GLU A  1 372 ? 25.122  6.100   61.460  1.00 52.56  ? 370 GLU A O     1 
ATOM   3034  C  CB    . GLU A  1 372 ? 22.127  4.997   62.132  1.00 34.06  ? 370 GLU A CB    1 
ATOM   3035  C  CG    . GLU A  1 372 ? 21.228  3.772   62.115  1.00 39.79  ? 370 GLU A CG    1 
ATOM   3036  C  CD    . GLU A  1 372 ? 19.753  4.125   62.129  1.00 51.30  ? 370 GLU A CD    1 
ATOM   3037  O  OE1   . GLU A  1 372 ? 19.418  5.310   61.917  1.00 51.40  ? 370 GLU A OE1   1 
ATOM   3038  O  OE2   . GLU A  1 372 ? 18.928  3.214   62.357  1.00 51.50  ? 370 GLU A OE2   1 
ATOM   3039  N  N     . ALA A  1 373 ? 24.426  6.817   63.478  1.00 45.23  ? 371 ALA A N     1 
ATOM   3040  C  CA    . ALA A  1 373 ? 25.298  7.987   63.439  1.00 39.38  ? 371 ALA A CA    1 
ATOM   3041  C  C     . ALA A  1 373 ? 26.766  7.579   63.475  1.00 41.69  ? 371 ALA A C     1 
ATOM   3042  O  O     . ALA A  1 373 ? 27.597  8.164   62.771  1.00 42.66  ? 371 ALA A O     1 
ATOM   3043  C  CB    . ALA A  1 373 ? 24.972  8.925   64.601  1.00 32.21  ? 371 ALA A CB    1 
ATOM   3044  N  N     . VAL A  1 374 ? 27.101  6.573   64.286  1.00 32.81  ? 372 VAL A N     1 
ATOM   3045  C  CA    . VAL A  1 374 ? 28.479  6.093   64.356  1.00 32.00  ? 372 VAL A CA    1 
ATOM   3046  C  C     . VAL A  1 374 ? 28.919  5.534   63.009  1.00 29.91  ? 372 VAL A C     1 
ATOM   3047  O  O     . VAL A  1 374 ? 30.049  5.769   62.560  1.00 38.71  ? 372 VAL A O     1 
ATOM   3048  C  CB    . VAL A  1 374 ? 28.620  5.049   65.480  1.00 34.54  ? 372 VAL A CB    1 
ATOM   3049  C  CG1   . VAL A  1 374 ? 29.875  4.211   65.284  1.00 26.86  ? 372 VAL A CG1   1 
ATOM   3050  C  CG2   . VAL A  1 374 ? 28.644  5.734   66.837  1.00 30.13  ? 372 VAL A CG2   1 
ATOM   3051  N  N     . GLN A  1 375 ? 28.033  4.796   62.339  1.00 34.58  ? 373 GLN A N     1 
ATOM   3052  C  CA    . GLN A  1 375 ? 28.380  4.218   61.045  1.00 32.91  ? 373 GLN A CA    1 
ATOM   3053  C  C     . GLN A  1 375 ? 28.599  5.299   59.993  1.00 39.05  ? 373 GLN A C     1 
ATOM   3054  O  O     . GLN A  1 375 ? 29.514  5.191   59.168  1.00 44.01  ? 373 GLN A O     1 
ATOM   3055  C  CB    . GLN A  1 375 ? 27.291  3.242   60.605  1.00 29.61  ? 373 GLN A CB    1 
ATOM   3056  C  CG    . GLN A  1 375 ? 27.118  2.064   61.551  1.00 44.53  ? 373 GLN A CG    1 
ATOM   3057  C  CD    . GLN A  1 375 ? 25.830  1.305   61.314  1.00 43.38  ? 373 GLN A CD    1 
ATOM   3058  O  OE1   . GLN A  1 375 ? 25.032  1.666   60.449  1.00 54.04  ? 373 GLN A OE1   1 
ATOM   3059  N  NE2   . GLN A  1 375 ? 25.617  0.247   62.086  1.00 43.58  ? 373 GLN A NE2   1 
ATOM   3060  N  N     . LYS A  1 376 ? 27.774  6.350   60.008  1.00 36.71  ? 374 LYS A N     1 
ATOM   3061  C  CA    . LYS A  1 376 ? 27.968  7.454   59.073  1.00 37.70  ? 374 LYS A CA    1 
ATOM   3062  C  C     . LYS A  1 376 ? 29.295  8.160   59.320  1.00 42.65  ? 374 LYS A C     1 
ATOM   3063  O  O     . LYS A  1 376 ? 30.024  8.480   58.374  1.00 50.55  ? 374 LYS A O     1 
ATOM   3064  C  CB    . LYS A  1 376 ? 26.811  8.447   59.180  1.00 41.54  ? 374 LYS A CB    1 
ATOM   3065  C  CG    . LYS A  1 376 ? 27.099  9.794   58.531  1.00 61.58  ? 374 LYS A CG    1 
ATOM   3066  C  CD    . LYS A  1 376 ? 25.935  10.757  58.690  1.00 75.60  ? 374 LYS A CD    1 
ATOM   3067  C  CE    . LYS A  1 376 ? 26.326  12.161  58.256  1.00 88.38  ? 374 LYS A CE    1 
ATOM   3068  N  NZ    . LYS A  1 376 ? 26.857  12.184  56.865  1.00 91.90  ? 374 LYS A NZ    1 
ATOM   3069  N  N     . ILE A  1 377 ? 29.624  8.410   60.588  1.00 38.43  ? 375 ILE A N     1 
ATOM   3070  C  CA    . ILE A  1 377 ? 30.880  9.073   60.918  1.00 38.37  ? 375 ILE A CA    1 
ATOM   3071  C  C     . ILE A  1 377 ? 32.067  8.200   60.529  1.00 40.64  ? 375 ILE A C     1 
ATOM   3072  O  O     . ILE A  1 377 ? 33.099  8.702   60.068  1.00 37.65  ? 375 ILE A O     1 
ATOM   3073  C  CB    . ILE A  1 377 ? 30.906  9.437   62.414  1.00 40.48  ? 375 ILE A CB    1 
ATOM   3074  C  CG1   . ILE A  1 377 ? 29.797  10.439  62.737  1.00 38.91  ? 375 ILE A CG1   1 
ATOM   3075  C  CG2   . ILE A  1 377 ? 32.263  9.997   62.811  1.00 33.35  ? 375 ILE A CG2   1 
ATOM   3076  C  CD1   . ILE A  1 377 ? 29.565  10.623  64.212  1.00 33.54  ? 375 ILE A CD1   1 
ATOM   3077  N  N     . THR A  1 378 ? 31.937  6.881   60.697  1.00 33.44  ? 376 THR A N     1 
ATOM   3078  C  CA    . THR A  1 378 ? 33.032  5.977   60.356  1.00 34.11  ? 376 THR A CA    1 
ATOM   3079  C  C     . THR A  1 378 ? 33.351  6.032   58.867  1.00 44.25  ? 376 THR A C     1 
ATOM   3080  O  O     . THR A  1 378 ? 34.508  6.224   58.475  1.00 50.38  ? 376 THR A O     1 
ATOM   3081  C  CB    . THR A  1 378 ? 32.687  4.548   60.771  1.00 37.05  ? 376 THR A CB    1 
ATOM   3082  O  OG1   . THR A  1 378 ? 32.588  4.471   62.199  1.00 32.44  ? 376 THR A OG1   1 
ATOM   3083  C  CG2   . THR A  1 378 ? 33.759  3.587   60.282  1.00 28.60  ? 376 THR A CG2   1 
ATOM   3084  N  N     . THR A  1 379 ? 32.333  5.859   58.020  1.00 31.22  ? 377 THR A N     1 
ATOM   3085  C  CA    . THR A  1 379 ? 32.553  5.911   56.578  1.00 32.07  ? 377 THR A CA    1 
ATOM   3086  C  C     . THR A  1 379 ? 33.071  7.278   56.148  1.00 49.22  ? 377 THR A C     1 
ATOM   3087  O  O     . THR A  1 379 ? 33.947  7.374   55.280  1.00 54.23  ? 377 THR A O     1 
ATOM   3088  C  CB    . THR A  1 379 ? 31.261  5.568   55.836  1.00 33.87  ? 377 THR A CB    1 
ATOM   3089  O  OG1   . THR A  1 379 ? 30.764  4.306   56.300  1.00 47.93  ? 377 THR A OG1   1 
ATOM   3090  C  CG2   . THR A  1 379 ? 31.512  5.484   54.339  1.00 43.37  ? 377 THR A CG2   1 
ATOM   3091  N  N     . GLU A  1 380 ? 32.545  8.346   56.751  1.00 39.65  ? 378 GLU A N     1 
ATOM   3092  C  CA    . GLU A  1 380 ? 33.041  9.685   56.452  1.00 46.40  ? 378 GLU A CA    1 
ATOM   3093  C  C     . GLU A  1 380 ? 34.514  9.822   56.819  1.00 49.68  ? 378 GLU A C     1 
ATOM   3094  O  O     . GLU A  1 380 ? 35.294  10.427  56.075  1.00 47.10  ? 378 GLU A O     1 
ATOM   3095  C  CB    . GLU A  1 380 ? 32.203  10.727  57.194  1.00 42.48  ? 378 GLU A CB    1 
ATOM   3096  C  CG    . GLU A  1 380 ? 32.646  12.163  56.974  1.00 50.87  ? 378 GLU A CG    1 
ATOM   3097  C  CD    . GLU A  1 380 ? 31.835  13.150  57.790  1.00 73.27  ? 378 GLU A CD    1 
ATOM   3098  O  OE1   . GLU A  1 380 ? 31.050  12.707  58.654  1.00 81.75  ? 378 GLU A OE1   1 
ATOM   3099  O  OE2   . GLU A  1 380 ? 31.981  14.370  57.568  1.00 77.27  ? 378 GLU A OE2   1 
ATOM   3100  N  N     . SER A  1 381 ? 34.914  9.253   57.959  1.00 34.92  ? 379 SER A N     1 
ATOM   3101  C  CA    . SER A  1 381 ? 36.303  9.360   58.389  1.00 37.46  ? 379 SER A CA    1 
ATOM   3102  C  C     . SER A  1 381 ? 37.229  8.511   57.529  1.00 46.51  ? 379 SER A C     1 
ATOM   3103  O  O     . SER A  1 381 ? 38.389  8.882   57.320  1.00 55.46  ? 379 SER A O     1 
ATOM   3104  C  CB    . SER A  1 381 ? 36.431  8.957   59.856  1.00 37.05  ? 379 SER A CB    1 
ATOM   3105  O  OG    . SER A  1 381 ? 35.670  9.813   60.690  1.00 44.49  ? 379 SER A OG    1 
ATOM   3106  N  N     . ILE A  1 382 ? 36.742  7.373   57.031  1.00 35.04  ? 380 ILE A N     1 
ATOM   3107  C  CA    . ILE A  1 382 ? 37.560  6.545   56.151  1.00 40.91  ? 380 ILE A CA    1 
ATOM   3108  C  C     . ILE A  1 382 ? 37.769  7.236   54.808  1.00 51.87  ? 380 ILE A C     1 
ATOM   3109  O  O     . ILE A  1 382 ? 38.833  7.103   54.190  1.00 54.51  ? 380 ILE A O     1 
ATOM   3110  C  CB    . ILE A  1 382 ? 36.917  5.153   55.998  1.00 37.89  ? 380 ILE A CB    1 
ATOM   3111  C  CG1   . ILE A  1 382 ? 36.948  4.416   57.340  1.00 32.29  ? 380 ILE A CG1   1 
ATOM   3112  C  CG2   . ILE A  1 382 ? 37.619  4.337   54.920  1.00 33.07  ? 380 ILE A CG2   1 
ATOM   3113  C  CD1   . ILE A  1 382 ? 36.171  3.119   57.353  1.00 34.38  ? 380 ILE A CD1   1 
ATOM   3114  N  N     . VAL A  1 383 ? 36.779  8.000   54.345  1.00 47.20  ? 381 VAL A N     1 
ATOM   3115  C  CA    . VAL A  1 383 ? 36.941  8.749   53.103  1.00 47.10  ? 381 VAL A CA    1 
ATOM   3116  C  C     . VAL A  1 383 ? 37.969  9.861   53.278  1.00 53.03  ? 381 VAL A C     1 
ATOM   3117  O  O     . VAL A  1 383 ? 38.834  10.068  52.419  1.00 63.45  ? 381 VAL A O     1 
ATOM   3118  C  CB    . VAL A  1 383 ? 35.586  9.309   52.634  1.00 42.94  ? 381 VAL A CB    1 
ATOM   3119  C  CG1   . VAL A  1 383 ? 35.780  10.258  51.466  1.00 51.74  ? 381 VAL A CG1   1 
ATOM   3120  C  CG2   . VAL A  1 383 ? 34.646  8.184   52.247  1.00 39.57  ? 381 VAL A CG2   1 
ATOM   3121  N  N     . ILE A  1 384 ? 37.900  10.587  54.393  1.00 51.08  ? 382 ILE A N     1 
ATOM   3122  C  CA    . ILE A  1 384 ? 38.710  11.791  54.557  1.00 51.74  ? 382 ILE A CA    1 
ATOM   3123  C  C     . ILE A  1 384 ? 40.106  11.450  55.063  1.00 49.33  ? 382 ILE A C     1 
ATOM   3124  O  O     . ILE A  1 384 ? 41.107  11.962  54.550  1.00 54.83  ? 382 ILE A O     1 
ATOM   3125  C  CB    . ILE A  1 384 ? 37.995  12.788  55.490  1.00 47.08  ? 382 ILE A CB    1 
ATOM   3126  C  CG1   . ILE A  1 384 ? 36.663  13.222  54.869  1.00 47.00  ? 382 ILE A CG1   1 
ATOM   3127  C  CG2   . ILE A  1 384 ? 38.879  13.993  55.770  1.00 50.72  ? 382 ILE A CG2   1 
ATOM   3128  C  CD1   . ILE A  1 384 ? 35.924  14.270  55.672  1.00 42.62  ? 382 ILE A CD1   1 
ATOM   3129  N  N     . TRP A  1 385 ? 40.203  10.586  56.074  1.00 46.90  ? 383 TRP A N     1 
ATOM   3130  C  CA    . TRP A  1 385 ? 41.485  10.268  56.687  1.00 47.16  ? 383 TRP A CA    1 
ATOM   3131  C  C     . TRP A  1 385 ? 41.922  8.822   56.509  1.00 54.80  ? 383 TRP A C     1 
ATOM   3132  O  O     . TRP A  1 385 ? 43.087  8.513   56.784  1.00 52.46  ? 383 TRP A O     1 
ATOM   3133  C  CB    . TRP A  1 385 ? 41.460  10.595  58.190  1.00 46.66  ? 383 TRP A CB    1 
ATOM   3134  C  CG    . TRP A  1 385 ? 41.065  12.009  58.488  1.00 48.14  ? 383 TRP A CG    1 
ATOM   3135  C  CD1   . TRP A  1 385 ? 41.841  13.123  58.356  1.00 49.72  ? 383 TRP A CD1   1 
ATOM   3136  C  CD2   . TRP A  1 385 ? 39.795  12.460  58.975  1.00 49.71  ? 383 TRP A CD2   1 
ATOM   3137  N  NE1   . TRP A  1 385 ? 41.133  14.241  58.727  1.00 54.80  ? 383 TRP A NE1   1 
ATOM   3138  C  CE2   . TRP A  1 385 ? 39.874  13.860  59.112  1.00 53.00  ? 383 TRP A CE2   1 
ATOM   3139  C  CE3   . TRP A  1 385 ? 38.600  11.815  59.307  1.00 49.30  ? 383 TRP A CE3   1 
ATOM   3140  C  CZ2   . TRP A  1 385 ? 38.802  14.627  59.566  1.00 53.58  ? 383 TRP A CZ2   1 
ATOM   3141  C  CZ3   . TRP A  1 385 ? 37.537  12.578  59.759  1.00 45.28  ? 383 TRP A CZ3   1 
ATOM   3142  C  CH2   . TRP A  1 385 ? 37.645  13.968  59.883  1.00 46.68  ? 383 TRP A CH2   1 
ATOM   3143  N  N     . GLY A  1 386 ? 41.037  7.932   56.069  1.00 49.47  ? 384 GLY A N     1 
ATOM   3144  C  CA    . GLY A  1 386 ? 41.414  6.547   55.877  1.00 45.53  ? 384 GLY A CA    1 
ATOM   3145  C  C     . GLY A  1 386 ? 41.522  5.730   57.141  1.00 49.15  ? 384 GLY A C     1 
ATOM   3146  O  O     . GLY A  1 386 ? 42.219  4.710   57.148  1.00 48.59  ? 384 GLY A O     1 
ATOM   3147  N  N     . LYS A  1 387 ? 40.859  6.146   58.217  1.00 48.20  ? 385 LYS A N     1 
ATOM   3148  C  CA    . LYS A  1 387 ? 40.880  5.389   59.460  1.00 48.63  ? 385 LYS A CA    1 
ATOM   3149  C  C     . LYS A  1 387 ? 39.648  5.749   60.277  1.00 53.01  ? 385 LYS A C     1 
ATOM   3150  O  O     . LYS A  1 387 ? 39.009  6.781   60.053  1.00 49.16  ? 385 LYS A O     1 
ATOM   3151  C  CB    . LYS A  1 387 ? 42.159  5.652   60.261  1.00 52.43  ? 385 LYS A CB    1 
ATOM   3152  C  CG    . LYS A  1 387 ? 42.378  7.110   60.626  1.00 57.89  ? 385 LYS A CG    1 
ATOM   3153  C  CD    . LYS A  1 387 ? 43.625  7.285   61.477  1.00 61.72  ? 385 LYS A CD    1 
ATOM   3154  C  CE    . LYS A  1 387 ? 43.510  6.526   62.789  1.00 72.68  ? 385 LYS A CE    1 
ATOM   3155  N  NZ    . LYS A  1 387 ? 44.712  6.717   63.647  1.00 87.97  ? 385 LYS A NZ    1 
ATOM   3156  N  N     . THR A  1 388 ? 39.324  4.877   61.228  1.00 48.81  ? 386 THR A N     1 
ATOM   3157  C  CA    . THR A  1 388 ? 38.171  5.075   62.098  1.00 40.05  ? 386 THR A CA    1 
ATOM   3158  C  C     . THR A  1 388 ? 38.586  5.846   63.344  1.00 40.44  ? 386 THR A C     1 
ATOM   3159  O  O     . THR A  1 388 ? 39.578  5.483   63.986  1.00 57.69  ? 386 THR A O     1 
ATOM   3160  C  CB    . THR A  1 388 ? 37.562  3.740   62.505  1.00 40.75  ? 386 THR A CB    1 
ATOM   3161  O  OG1   . THR A  1 388 ? 37.145  3.026   61.335  1.00 53.08  ? 386 THR A OG1   1 
ATOM   3162  C  CG2   . THR A  1 388 ? 36.360  3.952   63.416  1.00 38.16  ? 386 THR A CG2   1 
ATOM   3163  N  N     . PRO A  1 389 ? 37.869  6.903   63.715  1.00 40.38  ? 387 PRO A N     1 
ATOM   3164  C  CA    . PRO A  1 389 ? 38.203  7.622   64.944  1.00 52.45  ? 387 PRO A CA    1 
ATOM   3165  C  C     . PRO A  1 389 ? 37.717  6.877   66.173  1.00 40.21  ? 387 PRO A C     1 
ATOM   3166  O  O     . PRO A  1 389 ? 36.765  6.095   66.126  1.00 42.02  ? 387 PRO A O     1 
ATOM   3167  C  CB    . PRO A  1 389 ? 37.459  8.953   64.780  1.00 41.27  ? 387 PRO A CB    1 
ATOM   3168  C  CG    . PRO A  1 389 ? 36.266  8.592   63.972  1.00 40.32  ? 387 PRO A CG    1 
ATOM   3169  C  CD    . PRO A  1 389 ? 36.711  7.500   63.026  1.00 43.16  ? 387 PRO A CD    1 
ATOM   3170  N  N     . LYS A  1 390 ? 38.402  7.119   67.287  1.00 40.98  ? 388 LYS A N     1 
ATOM   3171  C  CA    . LYS A  1 390 ? 37.900  6.660   68.573  1.00 40.59  ? 388 LYS A CA    1 
ATOM   3172  C  C     . LYS A  1 390 ? 36.690  7.501   68.956  1.00 40.24  ? 388 LYS A C     1 
ATOM   3173  O  O     . LYS A  1 390 ? 36.712  8.729   68.835  1.00 43.93  ? 388 LYS A O     1 
ATOM   3174  C  CB    . LYS A  1 390 ? 38.987  6.755   69.641  1.00 43.35  ? 388 LYS A CB    1 
ATOM   3175  C  CG    . LYS A  1 390 ? 40.160  5.818   69.410  1.00 62.44  ? 388 LYS A CG    1 
ATOM   3176  C  CD    . LYS A  1 390 ? 41.216  5.982   70.489  1.00 81.34  ? 388 LYS A CD    1 
ATOM   3177  C  CE    . LYS A  1 390 ? 42.395  5.055   70.246  1.00 91.24  ? 388 LYS A CE    1 
ATOM   3178  N  NZ    . LYS A  1 390 ? 43.463  5.237   71.268  1.00 100.64 ? 388 LYS A NZ    1 
ATOM   3179  N  N     . PHE A  1 391 ? 35.625  6.841   69.400  1.00 39.21  ? 389 PHE A N     1 
ATOM   3180  C  CA    . PHE A  1 391 ? 34.355  7.507   69.644  1.00 38.83  ? 389 PHE A CA    1 
ATOM   3181  C  C     . PHE A  1 391 ? 34.181  7.839   71.120  1.00 43.83  ? 389 PHE A C     1 
ATOM   3182  O  O     . PHE A  1 391 ? 34.598  7.079   71.997  1.00 39.52  ? 389 PHE A O     1 
ATOM   3183  C  CB    . PHE A  1 391 ? 33.186  6.643   69.169  1.00 37.47  ? 389 PHE A CB    1 
ATOM   3184  C  CG    . PHE A  1 391 ? 32.981  6.668   67.683  1.00 37.15  ? 389 PHE A CG    1 
ATOM   3185  C  CD1   . PHE A  1 391 ? 32.184  7.638   67.099  1.00 37.32  ? 389 PHE A CD1   1 
ATOM   3186  C  CD2   . PHE A  1 391 ? 33.582  5.721   66.870  1.00 36.92  ? 389 PHE A CD2   1 
ATOM   3187  C  CE1   . PHE A  1 391 ? 31.991  7.666   65.732  1.00 40.38  ? 389 PHE A CE1   1 
ATOM   3188  C  CE2   . PHE A  1 391 ? 33.392  5.743   65.501  1.00 36.84  ? 389 PHE A CE2   1 
ATOM   3189  C  CZ    . PHE A  1 391 ? 32.595  6.717   64.931  1.00 39.14  ? 389 PHE A CZ    1 
ATOM   3190  N  N     . LYS A  1 392 ? 33.571  8.991   71.381  1.00 39.94  ? 390 LYS A N     1 
ATOM   3191  C  CA    . LYS A  1 392 ? 33.114  9.374   72.712  1.00 42.72  ? 390 LYS A CA    1 
ATOM   3192  C  C     . LYS A  1 392 ? 31.602  9.526   72.626  1.00 39.74  ? 390 LYS A C     1 
ATOM   3193  O  O     . LYS A  1 392 ? 31.102  10.468  72.002  1.00 49.60  ? 390 LYS A O     1 
ATOM   3194  C  CB    . LYS A  1 392 ? 33.789  10.662  73.185  1.00 42.28  ? 390 LYS A CB    1 
ATOM   3195  C  CG    . LYS A  1 392 ? 35.292  10.523  73.394  1.00 44.17  ? 390 LYS A CG    1 
ATOM   3196  C  CD    . LYS A  1 392 ? 35.948  11.857  73.718  1.00 56.00  ? 390 LYS A CD    1 
ATOM   3197  C  CE    . LYS A  1 392 ? 35.440  12.432  75.030  1.00 72.13  ? 390 LYS A CE    1 
ATOM   3198  N  NZ    . LYS A  1 392 ? 36.107  13.724  75.353  1.00 79.10  ? 390 LYS A NZ    1 
ATOM   3199  N  N     . LEU A  1 393 ? 30.876  8.587   73.232  1.00 38.85  ? 391 LEU A N     1 
ATOM   3200  C  CA    . LEU A  1 393 ? 29.439  8.496   73.051  1.00 42.30  ? 391 LEU A CA    1 
ATOM   3201  C  C     . LEU A  1 393 ? 28.704  8.776   74.356  1.00 38.92  ? 391 LEU A C     1 
ATOM   3202  O  O     . LEU A  1 393 ? 29.153  8.349   75.425  1.00 46.47  ? 391 LEU A O     1 
ATOM   3203  C  CB    . LEU A  1 393 ? 29.045  7.104   72.537  1.00 36.55  ? 391 LEU A CB    1 
ATOM   3204  C  CG    . LEU A  1 393 ? 29.786  6.617   71.291  1.00 36.30  ? 391 LEU A CG    1 
ATOM   3205  C  CD1   . LEU A  1 393 ? 29.307  5.230   70.887  1.00 34.98  ? 391 LEU A CD1   1 
ATOM   3206  C  CD2   . LEU A  1 393 ? 29.616  7.603   70.147  1.00 36.47  ? 391 LEU A CD2   1 
ATOM   3207  N  N     . PRO A  1 394 ? 27.569  9.488   74.301  1.00 43.36  ? 392 PRO A N     1 
ATOM   3208  C  CA    . PRO A  1 394 ? 26.749  9.742   75.492  1.00 43.96  ? 392 PRO A CA    1 
ATOM   3209  C  C     . PRO A  1 394 ? 25.835  8.573   75.856  1.00 48.01  ? 392 PRO A C     1 
ATOM   3210  O  O     . PRO A  1 394 ? 24.627  8.735   76.033  1.00 48.97  ? 392 PRO A O     1 
ATOM   3211  C  CB    . PRO A  1 394 ? 25.948  10.983  75.089  1.00 40.05  ? 392 PRO A CB    1 
ATOM   3212  C  CG    . PRO A  1 394 ? 25.773  10.829  73.617  1.00 43.15  ? 392 PRO A CG    1 
ATOM   3213  C  CD    . PRO A  1 394 ? 27.033  10.168  73.108  1.00 44.83  ? 392 PRO A CD    1 
ATOM   3214  N  N     . ILE A  1 395 ? 26.418  7.381   75.962  1.00 37.22  ? 393 ILE A N     1 
ATOM   3215  C  CA    . ILE A  1 395 ? 25.688  6.183   76.360  1.00 43.18  ? 393 ILE A CA    1 
ATOM   3216  C  C     . ILE A  1 395 ? 26.572  5.365   77.293  1.00 46.62  ? 393 ILE A C     1 
ATOM   3217  O  O     . ILE A  1 395 ? 27.771  5.197   77.044  1.00 46.50  ? 393 ILE A O     1 
ATOM   3218  C  CB    . ILE A  1 395 ? 25.240  5.350   75.138  1.00 38.51  ? 393 ILE A CB    1 
ATOM   3219  C  CG1   . ILE A  1 395 ? 24.454  4.118   75.590  1.00 35.75  ? 393 ILE A CG1   1 
ATOM   3220  C  CG2   . ILE A  1 395 ? 26.433  4.948   74.278  1.00 34.71  ? 393 ILE A CG2   1 
ATOM   3221  C  CD1   . ILE A  1 395 ? 23.907  3.286   74.448  1.00 32.95  ? 393 ILE A CD1   1 
ATOM   3222  N  N     . GLN A  1 396 ? 25.982  4.872   78.379  1.00 40.99  ? 394 GLN A N     1 
ATOM   3223  C  CA    . GLN A  1 396 ? 26.734  4.062   79.328  1.00 41.42  ? 394 GLN A CA    1 
ATOM   3224  C  C     . GLN A  1 396 ? 27.172  2.751   78.682  1.00 45.29  ? 394 GLN A C     1 
ATOM   3225  O  O     . GLN A  1 396 ? 26.482  2.195   77.824  1.00 46.12  ? 394 GLN A O     1 
ATOM   3226  C  CB    . GLN A  1 396 ? 25.889  3.773   80.571  1.00 49.17  ? 394 GLN A CB    1 
ATOM   3227  C  CG    . GLN A  1 396 ? 25.437  5.008   81.335  1.00 54.57  ? 394 GLN A CG    1 
ATOM   3228  C  CD    . GLN A  1 396 ? 26.523  5.580   82.227  1.00 67.29  ? 394 GLN A CD    1 
ATOM   3229  O  OE1   . GLN A  1 396 ? 27.650  5.086   82.249  1.00 72.42  ? 394 GLN A OE1   1 
ATOM   3230  N  NE2   . GLN A  1 396 ? 26.185  6.625   82.972  1.00 69.05  ? 394 GLN A NE2   1 
ATOM   3231  N  N     . LYS A  1 397 ? 28.341  2.262   79.103  1.00 37.37  ? 395 LYS A N     1 
ATOM   3232  C  CA    . LYS A  1 397 ? 28.798  0.952   78.648  1.00 40.96  ? 395 LYS A CA    1 
ATOM   3233  C  C     . LYS A  1 397 ? 27.791  -0.133  79.004  1.00 46.13  ? 395 LYS A C     1 
ATOM   3234  O  O     . LYS A  1 397 ? 27.558  -1.058  78.217  1.00 52.30  ? 395 LYS A O     1 
ATOM   3235  C  CB    . LYS A  1 397 ? 30.164  0.630   79.256  1.00 38.24  ? 395 LYS A CB    1 
ATOM   3236  C  CG    . LYS A  1 397 ? 31.331  1.362   78.612  1.00 38.74  ? 395 LYS A CG    1 
ATOM   3237  C  CD    . LYS A  1 397 ? 31.728  0.713   77.297  1.00 41.17  ? 395 LYS A CD    1 
ATOM   3238  C  CE    . LYS A  1 397 ? 32.827  1.496   76.601  1.00 42.32  ? 395 LYS A CE    1 
ATOM   3239  N  NZ    . LYS A  1 397 ? 33.260  0.832   75.342  1.00 37.79  ? 395 LYS A NZ    1 
ATOM   3240  N  N     . GLU A  1 398 ? 27.182  -0.034  80.188  1.00 52.96  ? 396 GLU A N     1 
ATOM   3241  C  CA    . GLU A  1 398 ? 26.187  -1.019  80.597  1.00 54.37  ? 396 GLU A CA    1 
ATOM   3242  C  C     . GLU A  1 398 ? 24.949  -0.956  79.710  1.00 55.12  ? 396 GLU A C     1 
ATOM   3243  O  O     . GLU A  1 398 ? 24.373  -1.995  79.366  1.00 53.12  ? 396 GLU A O     1 
ATOM   3244  C  CB    . GLU A  1 398 ? 25.809  -0.802  82.062  1.00 69.33  ? 396 GLU A CB    1 
ATOM   3245  C  CG    . GLU A  1 398 ? 24.728  -1.740  82.572  1.00 89.80  ? 396 GLU A CG    1 
ATOM   3246  C  CD    . GLU A  1 398 ? 24.260  -1.383  83.968  1.00 112.72 ? 396 GLU A CD    1 
ATOM   3247  O  OE1   . GLU A  1 398 ? 24.764  -0.385  84.526  1.00 120.38 ? 396 GLU A OE1   1 
ATOM   3248  O  OE2   . GLU A  1 398 ? 23.388  -2.098  84.505  1.00 119.45 ? 396 GLU A OE2   1 
ATOM   3249  N  N     . THR A  1 399 ? 24.522  0.253   79.335  1.00 34.79  ? 397 THR A N     1 
ATOM   3250  C  CA    . THR A  1 399 ? 23.365  0.388   78.456  1.00 33.70  ? 397 THR A CA    1 
ATOM   3251  C  C     . THR A  1 399 ? 23.639  -0.240  77.097  1.00 40.10  ? 397 THR A C     1 
ATOM   3252  O  O     . THR A  1 399 ? 22.828  -1.019  76.584  1.00 32.26  ? 397 THR A O     1 
ATOM   3253  C  CB    . THR A  1 399 ? 22.990  1.861   78.297  1.00 36.32  ? 397 THR A CB    1 
ATOM   3254  O  OG1   . THR A  1 399 ? 22.631  2.408   79.572  1.00 46.96  ? 397 THR A OG1   1 
ATOM   3255  C  CG2   . THR A  1 399 ? 21.817  2.009   77.338  1.00 33.07  ? 397 THR A CG2   1 
ATOM   3256  N  N     . TRP A  1 400 ? 24.787  0.088   76.500  1.00 40.51  ? 398 TRP A N     1 
ATOM   3257  C  CA    . TRP A  1 400 ? 25.142  -0.502  75.214  1.00 37.24  ? 398 TRP A CA    1 
ATOM   3258  C  C     . TRP A  1 400 ? 25.269  -2.016  75.318  1.00 32.34  ? 398 TRP A C     1 
ATOM   3259  O  O     . TRP A  1 400 ? 24.815  -2.745  74.429  1.00 36.97  ? 398 TRP A O     1 
ATOM   3260  C  CB    . TRP A  1 400 ? 26.443  0.106   74.693  1.00 34.09  ? 398 TRP A CB    1 
ATOM   3261  C  CG    . TRP A  1 400 ? 26.942  -0.589  73.473  1.00 32.56  ? 398 TRP A CG    1 
ATOM   3262  C  CD1   . TRP A  1 400 ? 28.059  -1.362  73.370  1.00 33.03  ? 398 TRP A CD1   1 
ATOM   3263  C  CD2   . TRP A  1 400 ? 26.322  -0.603  72.184  1.00 31.86  ? 398 TRP A CD2   1 
ATOM   3264  N  NE1   . TRP A  1 400 ? 28.182  -1.846  72.090  1.00 45.50  ? 398 TRP A NE1   1 
ATOM   3265  C  CE2   . TRP A  1 400 ? 27.126  -1.394  71.342  1.00 31.95  ? 398 TRP A CE2   1 
ATOM   3266  C  CE3   . TRP A  1 400 ? 25.167  -0.016  71.657  1.00 31.37  ? 398 TRP A CE3   1 
ATOM   3267  C  CZ2   . TRP A  1 400 ? 26.814  -1.614  70.002  1.00 35.86  ? 398 TRP A CZ2   1 
ATOM   3268  C  CZ3   . TRP A  1 400 ? 24.858  -0.235  70.330  1.00 35.30  ? 398 TRP A CZ3   1 
ATOM   3269  C  CH2   . TRP A  1 400 ? 25.678  -1.028  69.516  1.00 34.91  ? 398 TRP A CH2   1 
ATOM   3270  N  N     . GLU A  1 401 ? 25.878  -2.505  76.402  1.00 33.17  ? 399 GLU A N     1 
ATOM   3271  C  CA    . GLU A  1 401 ? 26.031  -3.944  76.593  1.00 33.39  ? 399 GLU A CA    1 
ATOM   3272  C  C     . GLU A  1 401 ? 24.678  -4.643  76.636  1.00 47.26  ? 399 GLU A C     1 
ATOM   3273  O  O     . GLU A  1 401 ? 24.496  -5.701  76.022  1.00 43.56  ? 399 GLU A O     1 
ATOM   3274  C  CB    . GLU A  1 401 ? 26.814  -4.219  77.877  1.00 35.80  ? 399 GLU A CB    1 
ATOM   3275  C  CG    . GLU A  1 401 ? 27.003  -5.693  78.202  1.00 60.59  ? 399 GLU A CG    1 
ATOM   3276  C  CD    . GLU A  1 401 ? 28.213  -6.297  77.515  1.00 83.42  ? 399 GLU A CD    1 
ATOM   3277  O  OE1   . GLU A  1 401 ? 28.948  -5.548  76.835  1.00 87.88  ? 399 GLU A OE1   1 
ATOM   3278  O  OE2   . GLU A  1 401 ? 28.433  -7.518  77.660  1.00 90.84  ? 399 GLU A OE2   1 
ATOM   3279  N  N     . THR A  1 402 ? 23.715  -4.064  77.357  1.00 38.82  ? 400 THR A N     1 
ATOM   3280  C  CA    . THR A  1 402 ? 22.389  -4.668  77.444  1.00 32.09  ? 400 THR A CA    1 
ATOM   3281  C  C     . THR A  1 402 ? 21.719  -4.726  76.076  1.00 43.40  ? 400 THR A C     1 
ATOM   3282  O  O     . THR A  1 402 ? 21.045  -5.710  75.747  1.00 38.83  ? 400 THR A O     1 
ATOM   3283  C  CB    . THR A  1 402 ? 21.525  -3.887  78.437  1.00 40.14  ? 400 THR A CB    1 
ATOM   3284  O  OG1   . THR A  1 402 ? 22.087  -3.993  79.750  1.00 39.70  ? 400 THR A OG1   1 
ATOM   3285  C  CG2   . THR A  1 402 ? 20.100  -4.421  78.460  1.00 31.76  ? 400 THR A CG2   1 
ATOM   3286  N  N     . TRP A  1 403 ? 21.910  -3.692  75.256  1.00 36.44  ? 401 TRP A N     1 
ATOM   3287  C  CA    . TRP A  1 403 ? 21.211  -3.621  73.978  1.00 30.17  ? 401 TRP A CA    1 
ATOM   3288  C  C     . TRP A  1 403 ? 21.754  -4.641  72.983  1.00 42.06  ? 401 TRP A C     1 
ATOM   3289  O  O     . TRP A  1 403 ? 21.002  -5.465  72.451  1.00 43.82  ? 401 TRP A O     1 
ATOM   3290  C  CB    . TRP A  1 403 ? 21.304  -2.209  73.400  1.00 30.41  ? 401 TRP A CB    1 
ATOM   3291  C  CG    . TRP A  1 403 ? 20.926  -2.158  71.952  1.00 37.17  ? 401 TRP A CG    1 
ATOM   3292  C  CD1   . TRP A  1 403 ? 21.771  -2.031  70.887  1.00 37.40  ? 401 TRP A CD1   1 
ATOM   3293  C  CD2   . TRP A  1 403 ? 19.606  -2.259  71.406  1.00 40.89  ? 401 TRP A CD2   1 
ATOM   3294  N  NE1   . TRP A  1 403 ? 21.057  -2.033  69.713  1.00 43.48  ? 401 TRP A NE1   1 
ATOM   3295  C  CE2   . TRP A  1 403 ? 19.726  -2.174  70.004  1.00 46.93  ? 401 TRP A CE2   1 
ATOM   3296  C  CE3   . TRP A  1 403 ? 18.333  -2.409  71.967  1.00 35.70  ? 401 TRP A CE3   1 
ATOM   3297  C  CZ2   . TRP A  1 403 ? 18.622  -2.233  69.156  1.00 40.30  ? 401 TRP A CZ2   1 
ATOM   3298  C  CZ3   . TRP A  1 403 ? 17.238  -2.467  71.121  1.00 35.83  ? 401 TRP A CZ3   1 
ATOM   3299  C  CH2   . TRP A  1 403 ? 17.390  -2.379  69.732  1.00 39.56  ? 401 TRP A CH2   1 
ATOM   3300  N  N     . TRP A  1 404 ? 23.062  -4.601  72.711  1.00 34.74  ? 402 TRP A N     1 
ATOM   3301  C  CA    . TRP A  1 404 ? 23.586  -5.409  71.613  1.00 40.20  ? 402 TRP A CA    1 
ATOM   3302  C  C     . TRP A  1 404 ? 23.630  -6.893  71.963  1.00 35.21  ? 402 TRP A C     1 
ATOM   3303  O  O     . TRP A  1 404 ? 23.484  -7.737  71.072  1.00 34.58  ? 402 TRP A O     1 
ATOM   3304  C  CB    . TRP A  1 404 ? 24.968  -4.902  71.180  1.00 37.97  ? 402 TRP A CB    1 
ATOM   3305  C  CG    . TRP A  1 404 ? 26.138  -5.299  72.040  1.00 31.85  ? 402 TRP A CG    1 
ATOM   3306  C  CD1   . TRP A  1 404 ? 26.734  -4.547  73.010  1.00 34.32  ? 402 TRP A CD1   1 
ATOM   3307  C  CD2   . TRP A  1 404 ? 26.882  -6.524  71.973  1.00 38.18  ? 402 TRP A CD2   1 
ATOM   3308  N  NE1   . TRP A  1 404 ? 27.787  -5.233  73.566  1.00 36.00  ? 402 TRP A NE1   1 
ATOM   3309  C  CE2   . TRP A  1 404 ? 27.900  -6.449  72.946  1.00 33.40  ? 402 TRP A CE2   1 
ATOM   3310  C  CE3   . TRP A  1 404 ? 26.779  -7.681  71.193  1.00 32.74  ? 402 TRP A CE3   1 
ATOM   3311  C  CZ2   . TRP A  1 404 ? 28.810  -7.484  73.158  1.00 34.44  ? 402 TRP A CZ2   1 
ATOM   3312  C  CZ3   . TRP A  1 404 ? 27.683  -8.706  71.404  1.00 33.78  ? 402 TRP A CZ3   1 
ATOM   3313  C  CH2   . TRP A  1 404 ? 28.685  -8.601  72.380  1.00 43.48  ? 402 TRP A CH2   1 
ATOM   3314  N  N     . THR A  1 405 ? 23.809  -7.236  73.241  1.00 34.70  ? 403 THR A N     1 
ATOM   3315  C  CA    . THR A  1 405 ? 23.810  -8.647  73.619  1.00 37.79  ? 403 THR A CA    1 
ATOM   3316  C  C     . THR A  1 405 ? 22.426  -9.270  73.486  1.00 31.71  ? 403 THR A C     1 
ATOM   3317  O  O     . THR A  1 405 ? 22.313  -10.459 73.167  1.00 45.31  ? 403 THR A O     1 
ATOM   3318  C  CB    . THR A  1 405 ? 24.325  -8.821  75.049  1.00 32.95  ? 403 THR A CB    1 
ATOM   3319  O  OG1   . THR A  1 405 ? 23.579  -7.980  75.939  1.00 37.63  ? 403 THR A OG1   1 
ATOM   3320  C  CG2   . THR A  1 405 ? 25.806  -8.472  75.136  1.00 34.89  ? 403 THR A CG2   1 
ATOM   3321  N  N     . GLU A  1 406 ? 21.367  -8.494  73.717  1.00 38.73  ? 404 GLU A N     1 
ATOM   3322  C  CA    . GLU A  1 406 ? 20.007  -9.016  73.696  1.00 38.11  ? 404 GLU A CA    1 
ATOM   3323  C  C     . GLU A  1 406 ? 19.294  -8.804  72.367  1.00 32.40  ? 404 GLU A C     1 
ATOM   3324  O  O     . GLU A  1 406 ? 18.252  -9.427  72.138  1.00 42.71  ? 404 GLU A O     1 
ATOM   3325  C  CB    . GLU A  1 406 ? 19.180  -8.381  74.822  1.00 37.79  ? 404 GLU A CB    1 
ATOM   3326  C  CG    . GLU A  1 406 ? 19.681  -8.704  76.224  1.00 46.66  ? 404 GLU A CG    1 
ATOM   3327  C  CD    . GLU A  1 406 ? 19.585  -10.182 76.563  1.00 66.38  ? 404 GLU A CD    1 
ATOM   3328  O  OE1   . GLU A  1 406 ? 18.776  -10.894 75.930  1.00 72.76  ? 404 GLU A OE1   1 
ATOM   3329  O  OE2   . GLU A  1 406 ? 20.321  -10.633 77.466  1.00 73.93  ? 404 GLU A OE2   1 
ATOM   3330  N  N     . TYR A  1 407 ? 19.819  -7.950  71.494  1.00 36.91  ? 405 TYR A N     1 
ATOM   3331  C  CA    . TYR A  1 407 ? 19.197  -7.724  70.198  1.00 29.74  ? 405 TYR A CA    1 
ATOM   3332  C  C     . TYR A  1 407 ? 19.361  -8.957  69.318  1.00 36.65  ? 405 TYR A C     1 
ATOM   3333  O  O     . TYR A  1 407 ? 20.381  -9.650  69.377  1.00 41.99  ? 405 TYR A O     1 
ATOM   3334  C  CB    . TYR A  1 407 ? 19.822  -6.505  69.520  1.00 36.05  ? 405 TYR A CB    1 
ATOM   3335  C  CG    . TYR A  1 407 ? 18.968  -5.870  68.448  1.00 36.05  ? 405 TYR A CG    1 
ATOM   3336  C  CD1   . TYR A  1 407 ? 17.584  -5.980  68.475  1.00 37.61  ? 405 TYR A CD1   1 
ATOM   3337  C  CD2   . TYR A  1 407 ? 19.548  -5.160  67.405  1.00 41.81  ? 405 TYR A CD2   1 
ATOM   3338  C  CE1   . TYR A  1 407 ? 16.802  -5.396  67.495  1.00 50.11  ? 405 TYR A CE1   1 
ATOM   3339  C  CE2   . TYR A  1 407 ? 18.776  -4.575  66.420  1.00 43.01  ? 405 TYR A CE2   1 
ATOM   3340  C  CZ    . TYR A  1 407 ? 17.404  -4.695  66.469  1.00 52.48  ? 405 TYR A CZ    1 
ATOM   3341  O  OH    . TYR A  1 407 ? 16.633  -4.113  65.487  1.00 51.50  ? 405 TYR A OH    1 
ATOM   3342  N  N     . TRP A  1 408 ? 18.346  -9.239  68.499  1.00 40.97  ? 406 TRP A N     1 
ATOM   3343  C  CA    . TRP A  1 408 ? 18.410  -10.406 67.626  1.00 43.08  ? 406 TRP A CA    1 
ATOM   3344  C  C     . TRP A  1 408 ? 19.251  -10.168 66.380  1.00 41.56  ? 406 TRP A C     1 
ATOM   3345  O  O     . TRP A  1 408 ? 19.694  -11.138 65.757  1.00 47.25  ? 406 TRP A O     1 
ATOM   3346  C  CB    . TRP A  1 408 ? 17.004  -10.850 67.215  1.00 44.25  ? 406 TRP A CB    1 
ATOM   3347  C  CG    . TRP A  1 408 ? 16.199  -9.794  66.524  1.00 46.79  ? 406 TRP A CG    1 
ATOM   3348  C  CD1   . TRP A  1 408 ? 16.237  -9.468  65.199  1.00 41.22  ? 406 TRP A CD1   1 
ATOM   3349  C  CD2   . TRP A  1 408 ? 15.221  -8.935  67.121  1.00 57.38  ? 406 TRP A CD2   1 
ATOM   3350  N  NE1   . TRP A  1 408 ? 15.350  -8.452  64.937  1.00 41.75  ? 406 TRP A NE1   1 
ATOM   3351  C  CE2   . TRP A  1 408 ? 14.713  -8.108  66.100  1.00 58.08  ? 406 TRP A CE2   1 
ATOM   3352  C  CE3   . TRP A  1 408 ? 14.728  -8.784  68.421  1.00 58.97  ? 406 TRP A CE3   1 
ATOM   3353  C  CZ2   . TRP A  1 408 ? 13.735  -7.144  66.338  1.00 70.68  ? 406 TRP A CZ2   1 
ATOM   3354  C  CZ3   . TRP A  1 408 ? 13.758  -7.827  68.655  1.00 59.72  ? 406 TRP A CZ3   1 
ATOM   3355  C  CH2   . TRP A  1 408 ? 13.271  -7.020  67.619  1.00 61.39  ? 406 TRP A CH2   1 
ATOM   3356  N  N     . GLN A  1 409 ? 19.479  -8.916  65.999  1.00 32.71  ? 407 GLN A N     1 
ATOM   3357  C  CA    . GLN A  1 409 ? 20.316  -8.602  64.853  1.00 36.13  ? 407 GLN A CA    1 
ATOM   3358  C  C     . GLN A  1 409 ? 21.730  -8.256  65.301  1.00 42.56  ? 407 GLN A C     1 
ATOM   3359  O  O     . GLN A  1 409 ? 21.944  -7.710  66.387  1.00 43.29  ? 407 GLN A O     1 
ATOM   3360  C  CB    . GLN A  1 409 ? 19.736  -7.442  64.043  1.00 43.34  ? 407 GLN A CB    1 
ATOM   3361  C  CG    . GLN A  1 409 ? 18.648  -7.855  63.073  1.00 49.37  ? 407 GLN A CG    1 
ATOM   3362  C  CD    . GLN A  1 409 ? 18.488  -6.871  61.934  1.00 70.16  ? 407 GLN A CD    1 
ATOM   3363  O  OE1   . GLN A  1 409 ? 18.665  -5.665  62.108  1.00 81.04  ? 407 GLN A OE1   1 
ATOM   3364  N  NE2   . GLN A  1 409 ? 18.164  -7.384  60.754  1.00 70.99  ? 407 GLN A NE2   1 
ATOM   3365  N  N     . ALA A  1 410 ? 22.695  -8.588  64.448  1.00 37.55  ? 408 ALA A N     1 
ATOM   3366  C  CA    . ALA A  1 410 ? 24.084  -8.250  64.720  1.00 35.93  ? 408 ALA A CA    1 
ATOM   3367  C  C     . ALA A  1 410 ? 24.266  -6.739  64.689  1.00 38.69  ? 408 ALA A C     1 
ATOM   3368  O  O     . ALA A  1 410 ? 23.834  -6.068  63.746  1.00 36.36  ? 408 ALA A O     1 
ATOM   3369  C  CB    . ALA A  1 410 ? 25.002  -8.918  63.698  1.00 33.32  ? 408 ALA A CB    1 
ATOM   3370  N  N     . THR A  1 411 ? 24.896  -6.201  65.728  1.00 35.89  ? 409 THR A N     1 
ATOM   3371  C  CA    . THR A  1 411 ? 25.154  -4.772  65.796  1.00 42.40  ? 409 THR A CA    1 
ATOM   3372  C  C     . THR A  1 411 ? 26.421  -4.547  66.609  1.00 36.09  ? 409 THR A C     1 
ATOM   3373  O  O     . THR A  1 411 ? 26.717  -5.296  67.545  1.00 36.61  ? 409 THR A O     1 
ATOM   3374  C  CB    . THR A  1 411 ? 23.962  -4.011  66.397  1.00 31.48  ? 409 THR A CB    1 
ATOM   3375  O  OG1   . THR A  1 411 ? 24.208  -2.600  66.339  1.00 41.11  ? 409 THR A OG1   1 
ATOM   3376  C  CG2   . THR A  1 411 ? 23.718  -4.426  67.839  1.00 30.45  ? 409 THR A CG2   1 
ATOM   3377  N  N     . TRP A  1 412 ? 27.176  -3.519  66.234  1.00 38.99  ? 410 TRP A N     1 
ATOM   3378  C  CA    . TRP A  1 412 ? 28.484  -3.305  66.834  1.00 46.02  ? 410 TRP A CA    1 
ATOM   3379  C  C     . TRP A  1 412 ? 28.878  -1.843  66.696  1.00 36.30  ? 410 TRP A C     1 
ATOM   3380  O  O     . TRP A  1 412 ? 28.469  -1.160  65.755  1.00 53.99  ? 410 TRP A O     1 
ATOM   3381  C  CB    . TRP A  1 412 ? 29.538  -4.211  66.185  1.00 41.41  ? 410 TRP A CB    1 
ATOM   3382  C  CG    . TRP A  1 412 ? 30.901  -4.114  66.802  1.00 33.84  ? 410 TRP A CG    1 
ATOM   3383  C  CD1   . TRP A  1 412 ? 31.281  -4.577  68.028  1.00 34.18  ? 410 TRP A CD1   1 
ATOM   3384  C  CD2   . TRP A  1 412 ? 32.070  -3.534  66.212  1.00 36.35  ? 410 TRP A CD2   1 
ATOM   3385  N  NE1   . TRP A  1 412 ? 32.612  -4.312  68.243  1.00 37.30  ? 410 TRP A NE1   1 
ATOM   3386  C  CE2   . TRP A  1 412 ? 33.120  -3.673  67.142  1.00 35.22  ? 410 TRP A CE2   1 
ATOM   3387  C  CE3   . TRP A  1 412 ? 32.330  -2.907  64.989  1.00 34.71  ? 410 TRP A CE3   1 
ATOM   3388  C  CZ2   . TRP A  1 412 ? 34.409  -3.210  66.888  1.00 40.04  ? 410 TRP A CZ2   1 
ATOM   3389  C  CZ3   . TRP A  1 412 ? 33.611  -2.448  64.738  1.00 37.09  ? 410 TRP A CZ3   1 
ATOM   3390  C  CH2   . TRP A  1 412 ? 34.635  -2.604  65.682  1.00 44.26  ? 410 TRP A CH2   1 
ATOM   3391  N  N     . ILE A  1 413 ? 29.676  -1.379  67.652  1.00 33.71  ? 411 ILE A N     1 
ATOM   3392  C  CA    . ILE A  1 413 ? 30.242  -0.033  67.640  1.00 39.52  ? 411 ILE A CA    1 
ATOM   3393  C  C     . ILE A  1 413 ? 31.750  -0.166  67.810  1.00 43.68  ? 411 ILE A C     1 
ATOM   3394  O  O     . ILE A  1 413 ? 32.206  -0.919  68.683  1.00 37.38  ? 411 ILE A O     1 
ATOM   3395  C  CB    . ILE A  1 413 ? 29.623  0.844   68.741  1.00 36.05  ? 411 ILE A CB    1 
ATOM   3396  C  CG1   . ILE A  1 413 ? 28.176  1.193   68.397  1.00 48.96  ? 411 ILE A CG1   1 
ATOM   3397  C  CG2   . ILE A  1 413 ? 30.438  2.112   68.953  1.00 46.37  ? 411 ILE A CG2   1 
ATOM   3398  C  CD1   . ILE A  1 413 ? 27.492  2.046   69.445  1.00 40.38  ? 411 ILE A CD1   1 
ATOM   3399  N  N     . PRO A  1 414 ? 32.561  0.528   67.006  1.00 39.71  ? 412 PRO A N     1 
ATOM   3400  C  CA    . PRO A  1 414 ? 34.018  0.424   67.165  1.00 35.62  ? 412 PRO A CA    1 
ATOM   3401  C  C     . PRO A  1 414 ? 34.494  0.987   68.494  1.00 38.91  ? 412 PRO A C     1 
ATOM   3402  O  O     . PRO A  1 414 ? 33.687  1.490   69.281  1.00 41.93  ? 412 PRO A O     1 
ATOM   3403  C  CB    . PRO A  1 414 ? 34.557  1.234   65.980  1.00 36.07  ? 412 PRO A CB    1 
ATOM   3404  C  CG    . PRO A  1 414 ? 33.475  2.212   65.685  1.00 48.62  ? 412 PRO A CG    1 
ATOM   3405  C  CD    . PRO A  1 414 ? 32.191  1.469   65.936  1.00 38.01  ? 412 PRO A CD    1 
ATOM   3406  N  N     . GLU A  1 415 ? 35.801  0.904   68.742  1.00 44.24  ? 413 GLU A N     1 
ATOM   3407  C  CA    . GLU A  1 415 ? 36.382  1.296   70.022  1.00 46.79  ? 413 GLU A CA    1 
ATOM   3408  C  C     . GLU A  1 415 ? 35.896  2.674   70.447  1.00 37.99  ? 413 GLU A C     1 
ATOM   3409  O  O     . GLU A  1 415 ? 36.054  3.656   69.715  1.00 43.76  ? 413 GLU A O     1 
ATOM   3410  C  CB    . GLU A  1 415 ? 37.908  1.272   69.922  1.00 39.27  ? 413 GLU A CB    1 
ATOM   3411  C  CG    . GLU A  1 415 ? 38.624  1.454   71.247  1.00 53.28  ? 413 GLU A CG    1 
ATOM   3412  C  CD    . GLU A  1 415 ? 40.104  1.143   71.148  1.00 54.85  ? 413 GLU A CD    1 
ATOM   3413  O  OE1   . GLU A  1 415 ? 40.500  0.443   70.192  1.00 49.11  ? 413 GLU A OE1   1 
ATOM   3414  O  OE2   . GLU A  1 415 ? 40.870  1.599   72.024  1.00 62.55  ? 413 GLU A OE2   1 
ATOM   3415  N  N     . TRP A  1 416 ? 35.288  2.737   71.629  1.00 37.95  ? 414 TRP A N     1 
ATOM   3416  C  CA    . TRP A  1 416 ? 34.621  3.947   72.083  1.00 38.01  ? 414 TRP A CA    1 
ATOM   3417  C  C     . TRP A  1 416 ? 34.693  4.026   73.601  1.00 38.81  ? 414 TRP A C     1 
ATOM   3418  O  O     . TRP A  1 416 ? 35.011  3.048   74.283  1.00 58.99  ? 414 TRP A O     1 
ATOM   3419  C  CB    . TRP A  1 416 ? 33.164  3.985   71.612  1.00 36.81  ? 414 TRP A CB    1 
ATOM   3420  C  CG    . TRP A  1 416 ? 32.302  2.938   72.250  1.00 36.09  ? 414 TRP A CG    1 
ATOM   3421  C  CD1   . TRP A  1 416 ? 32.239  1.615   71.923  1.00 35.55  ? 414 TRP A CD1   1 
ATOM   3422  C  CD2   . TRP A  1 416 ? 31.376  3.129   73.325  1.00 37.80  ? 414 TRP A CD2   1 
ATOM   3423  N  NE1   . TRP A  1 416 ? 31.333  0.970   72.729  1.00 35.10  ? 414 TRP A NE1   1 
ATOM   3424  C  CE2   . TRP A  1 416 ? 30.789  1.878   73.599  1.00 35.34  ? 414 TRP A CE2   1 
ATOM   3425  C  CE3   . TRP A  1 416 ? 30.987  4.237   74.084  1.00 36.58  ? 414 TRP A CE3   1 
ATOM   3426  C  CZ2   . TRP A  1 416 ? 29.831  1.704   74.596  1.00 35.17  ? 414 TRP A CZ2   1 
ATOM   3427  C  CZ3   . TRP A  1 416 ? 30.039  4.063   75.075  1.00 41.87  ? 414 TRP A CZ3   1 
ATOM   3428  C  CH2   . TRP A  1 416 ? 29.472  2.806   75.323  1.00 35.71  ? 414 TRP A CH2   1 
ATOM   3429  N  N     . GLU A  1 417 ? 34.383  5.211   74.123  1.00 39.38  ? 415 GLU A N     1 
ATOM   3430  C  CA    . GLU A  1 417 ? 34.357  5.451   75.557  1.00 40.66  ? 415 GLU A CA    1 
ATOM   3431  C  C     . GLU A  1 417 ? 33.136  6.287   75.905  1.00 51.09  ? 415 GLU A C     1 
ATOM   3432  O  O     . GLU A  1 417 ? 32.625  7.046   75.078  1.00 48.38  ? 415 GLU A O     1 
ATOM   3433  C  CB    . GLU A  1 417 ? 35.630  6.160   76.044  1.00 44.67  ? 415 GLU A CB    1 
ATOM   3434  C  CG    . GLU A  1 417 ? 35.860  7.525   75.418  1.00 70.20  ? 415 GLU A CG    1 
ATOM   3435  C  CD    . GLU A  1 417 ? 37.054  8.245   76.015  1.00 90.36  ? 415 GLU A CD    1 
ATOM   3436  O  OE1   . GLU A  1 417 ? 37.370  7.995   77.197  1.00 89.15  ? 415 GLU A OE1   1 
ATOM   3437  O  OE2   . GLU A  1 417 ? 37.679  9.059   75.300  1.00 94.40  ? 415 GLU A OE2   1 
ATOM   3438  N  N     . PHE A  1 418 ? 32.674  6.136   77.143  1.00 40.61  ? 416 PHE A N     1 
ATOM   3439  C  CA    . PHE A  1 418 ? 31.508  6.869   77.617  1.00 40.64  ? 416 PHE A CA    1 
ATOM   3440  C  C     . PHE A  1 418 ? 31.904  8.288   78.006  1.00 58.91  ? 416 PHE A C     1 
ATOM   3441  O  O     . PHE A  1 418 ? 32.923  8.499   78.671  1.00 59.26  ? 416 PHE A O     1 
ATOM   3442  C  CB    . PHE A  1 418 ? 30.879  6.143   78.807  1.00 49.37  ? 416 PHE A CB    1 
ATOM   3443  C  CG    . PHE A  1 418 ? 29.896  6.975   79.583  1.00 45.67  ? 416 PHE A CG    1 
ATOM   3444  C  CD1   . PHE A  1 418 ? 28.702  7.376   79.009  1.00 45.60  ? 416 PHE A CD1   1 
ATOM   3445  C  CD2   . PHE A  1 418 ? 30.161  7.342   80.893  1.00 48.30  ? 416 PHE A CD2   1 
ATOM   3446  C  CE1   . PHE A  1 418 ? 27.794  8.137   79.721  1.00 52.87  ? 416 PHE A CE1   1 
ATOM   3447  C  CE2   . PHE A  1 418 ? 29.255  8.102   81.612  1.00 50.69  ? 416 PHE A CE2   1 
ATOM   3448  C  CZ    . PHE A  1 418 ? 28.070  8.499   81.025  1.00 56.37  ? 416 PHE A CZ    1 
ATOM   3449  N  N     . VAL A  1 419 ? 31.105  9.260   77.576  1.00 52.99  ? 417 VAL A N     1 
ATOM   3450  C  CA    . VAL A  1 419 ? 31.259  10.655  77.977  1.00 58.01  ? 417 VAL A CA    1 
ATOM   3451  C  C     . VAL A  1 419 ? 29.963  11.095  78.648  1.00 61.87  ? 417 VAL A C     1 
ATOM   3452  O  O     . VAL A  1 419 ? 28.878  10.955  78.070  1.00 61.84  ? 417 VAL A O     1 
ATOM   3453  C  CB    . VAL A  1 419 ? 31.618  11.563  76.784  1.00 49.67  ? 417 VAL A CB    1 
ATOM   3454  C  CG1   . VAL A  1 419 ? 30.668  11.344  75.614  1.00 42.54  ? 417 VAL A CG1   1 
ATOM   3455  C  CG2   . VAL A  1 419 ? 31.631  13.027  77.206  1.00 45.99  ? 417 VAL A CG2   1 
ATOM   3456  N  N     . ASN A  1 420 ? 30.075  11.607  79.873  1.00 62.80  ? 418 ASN A N     1 
ATOM   3457  C  CA    . ASN A  1 420 ? 28.902  11.923  80.687  1.00 69.30  ? 418 ASN A CA    1 
ATOM   3458  C  C     . ASN A  1 420 ? 28.442  13.353  80.398  1.00 67.09  ? 418 ASN A C     1 
ATOM   3459  O  O     . ASN A  1 420 ? 28.623  14.283  81.188  1.00 76.87  ? 418 ASN A O     1 
ATOM   3460  C  CB    . ASN A  1 420 ? 29.209  11.715  82.164  1.00 74.39  ? 418 ASN A CB    1 
ATOM   3461  C  CG    . ASN A  1 420 ? 27.955  11.589  83.010  1.00 80.66  ? 418 ASN A CG    1 
ATOM   3462  O  OD1   . ASN A  1 420 ? 26.913  12.160  82.689  1.00 84.05  ? 418 ASN A OD1   1 
ATOM   3463  N  ND2   . ASN A  1 420 ? 28.051  10.834  84.099  1.00 81.62  ? 418 ASN A ND2   1 
ATOM   3464  N  N     . THR A  1 421 ? 27.832  13.512  79.230  1.00 59.55  ? 419 THR A N     1 
ATOM   3465  C  CA    . THR A  1 421 ? 27.219  14.779  78.832  1.00 65.41  ? 419 THR A CA    1 
ATOM   3466  C  C     . THR A  1 421 ? 25.752  14.537  78.508  1.00 68.02  ? 419 THR A C     1 
ATOM   3467  O  O     . THR A  1 421 ? 25.443  13.937  77.460  1.00 66.01  ? 419 THR A O     1 
ATOM   3468  C  CB    . THR A  1 421 ? 27.939  15.393  77.630  1.00 64.62  ? 419 THR A CB    1 
ATOM   3469  O  OG1   . THR A  1 421 ? 27.954  14.457  76.545  1.00 85.13  ? 419 THR A OG1   1 
ATOM   3470  C  CG2   . THR A  1 421 ? 29.368  15.764  77.997  1.00 59.67  ? 419 THR A CG2   1 
ATOM   3471  N  N     . PRO A  1 422 ? 24.825  14.960  79.363  1.00 65.94  ? 420 PRO A N     1 
ATOM   3472  C  CA    . PRO A  1 422 ? 23.398  14.770  79.080  1.00 59.08  ? 420 PRO A CA    1 
ATOM   3473  C  C     . PRO A  1 422 ? 22.982  15.535  77.837  1.00 54.04  ? 420 PRO A C     1 
ATOM   3474  O  O     . PRO A  1 422 ? 23.637  16.517  77.456  1.00 66.92  ? 420 PRO A O     1 
ATOM   3475  C  CB    . PRO A  1 422 ? 22.714  15.329  80.337  1.00 55.15  ? 420 PRO A CB    1 
ATOM   3476  C  CG    . PRO A  1 422 ? 23.760  15.249  81.404  1.00 49.26  ? 420 PRO A CG    1 
ATOM   3477  C  CD    . PRO A  1 422 ? 25.052  15.534  80.700  1.00 57.89  ? 420 PRO A CD    1 
ATOM   3478  N  N     . PRO A  1 423 ? 21.893  15.120  77.167  1.00 51.29  ? 421 PRO A N     1 
ATOM   3479  C  CA    . PRO A  1 423 ? 21.054  13.966  77.516  1.00 57.17  ? 421 PRO A CA    1 
ATOM   3480  C  C     . PRO A  1 423 ? 21.705  12.624  77.192  1.00 52.26  ? 421 PRO A C     1 
ATOM   3481  O  O     . PRO A  1 423 ? 22.135  12.398  76.062  1.00 45.23  ? 421 PRO A O     1 
ATOM   3482  C  CB    . PRO A  1 423 ? 19.798  14.178  76.664  1.00 43.74  ? 421 PRO A CB    1 
ATOM   3483  C  CG    . PRO A  1 423 ? 20.268  14.964  75.497  1.00 44.30  ? 421 PRO A CG    1 
ATOM   3484  C  CD    . PRO A  1 423 ? 21.349  15.867  76.019  1.00 45.92  ? 421 PRO A CD    1 
ATOM   3485  N  N     . LEU A  1 424 ? 21.781  11.747  78.189  1.00 49.30  ? 422 LEU A N     1 
ATOM   3486  C  CA    . LEU A  1 424 ? 22.338  10.423  77.972  1.00 48.70  ? 422 LEU A CA    1 
ATOM   3487  C  C     . LEU A  1 424 ? 21.356  9.549   77.202  1.00 50.07  ? 422 LEU A C     1 
ATOM   3488  O  O     . LEU A  1 424 ? 20.136  9.671   77.342  1.00 53.76  ? 422 LEU A O     1 
ATOM   3489  C  CB    . LEU A  1 424 ? 22.692  9.760   79.303  1.00 41.62  ? 422 LEU A CB    1 
ATOM   3490  C  CG    . LEU A  1 424 ? 23.786  10.429  80.137  1.00 50.92  ? 422 LEU A CG    1 
ATOM   3491  C  CD1   . LEU A  1 424 ? 24.197  9.533   81.297  1.00 43.53  ? 422 LEU A CD1   1 
ATOM   3492  C  CD2   . LEU A  1 424 ? 24.987  10.777  79.270  1.00 50.35  ? 422 LEU A CD2   1 
ATOM   3493  N  N     . VAL A  1 425 ? 21.903  8.664   76.378  1.00 51.45  ? 423 VAL A N     1 
ATOM   3494  C  CA    . VAL A  1 425 ? 21.109  7.706   75.619  1.00 35.87  ? 423 VAL A CA    1 
ATOM   3495  C  C     . VAL A  1 425 ? 20.906  6.463   76.474  1.00 44.27  ? 423 VAL A C     1 
ATOM   3496  O  O     . VAL A  1 425 ? 21.874  5.876   76.973  1.00 49.57  ? 423 VAL A O     1 
ATOM   3497  C  CB    . VAL A  1 425 ? 21.794  7.356   74.288  1.00 35.88  ? 423 VAL A CB    1 
ATOM   3498  C  CG1   . VAL A  1 425 ? 21.014  6.273   73.559  1.00 40.14  ? 423 VAL A CG1   1 
ATOM   3499  C  CG2   . VAL A  1 425 ? 21.932  8.599   73.424  1.00 43.12  ? 423 VAL A CG2   1 
ATOM   3500  N  N     . LYS A  1 426 ? 19.650  6.062   76.648  1.00 42.34  ? 424 LYS A N     1 
ATOM   3501  C  CA    . LYS A  1 426 ? 19.335  4.905   77.472  1.00 53.81  ? 424 LYS A CA    1 
ATOM   3502  C  C     . LYS A  1 426 ? 18.125  4.187   76.894  1.00 50.00  ? 424 LYS A C     1 
ATOM   3503  O  O     . LYS A  1 426 ? 17.401  4.717   76.048  1.00 50.17  ? 424 LYS A O     1 
ATOM   3504  C  CB    . LYS A  1 426 ? 19.074  5.305   78.928  1.00 52.41  ? 424 LYS A CB    1 
ATOM   3505  C  CG    . LYS A  1 426 ? 17.836  6.162   79.126  1.00 62.90  ? 424 LYS A CG    1 
ATOM   3506  C  CD    . LYS A  1 426 ? 17.533  6.348   80.603  1.00 72.38  ? 424 LYS A CD    1 
ATOM   3507  C  CE    . LYS A  1 426 ? 16.177  7.000   80.807  1.00 69.12  ? 424 LYS A CE    1 
ATOM   3508  N  NZ    . LYS A  1 426 ? 15.811  7.081   82.247  1.00 82.00  ? 424 LYS A NZ    1 
ATOM   3509  N  N     . LEU A  1 427 ? 17.923  2.959   77.364  1.00 50.19  ? 425 LEU A N     1 
ATOM   3510  C  CA    . LEU A  1 427 ? 16.729  2.190   77.049  1.00 43.35  ? 425 LEU A CA    1 
ATOM   3511  C  C     . LEU A  1 427 ? 15.655  2.506   78.083  1.00 44.50  ? 425 LEU A C     1 
ATOM   3512  O  O     . LEU A  1 427 ? 15.897  2.407   79.290  1.00 40.17  ? 425 LEU A O     1 
ATOM   3513  C  CB    . LEU A  1 427 ? 17.044  0.694   77.030  1.00 46.75  ? 425 LEU A CB    1 
ATOM   3514  C  CG    . LEU A  1 427 ? 18.044  0.265   75.953  1.00 49.86  ? 425 LEU A CG    1 
ATOM   3515  C  CD1   . LEU A  1 427 ? 18.526  -1.157  76.187  1.00 42.93  ? 425 LEU A CD1   1 
ATOM   3516  C  CD2   . LEU A  1 427 ? 17.423  0.400   74.569  1.00 37.08  ? 425 LEU A CD2   1 
ATOM   3517  N  N     . TRP A  1 428 ? 14.476  2.896   77.605  1.00 50.36  ? 426 TRP A N     1 
ATOM   3518  C  CA    . TRP A  1 428 ? 13.436  3.418   78.482  1.00 53.27  ? 426 TRP A CA    1 
ATOM   3519  C  C     . TRP A  1 428 ? 12.607  2.331   79.152  1.00 46.53  ? 426 TRP A C     1 
ATOM   3520  O  O     . TRP A  1 428 ? 11.852  2.639   80.080  1.00 51.59  ? 426 TRP A O     1 
ATOM   3521  C  CB    . TRP A  1 428 ? 12.531  4.361   77.691  1.00 52.17  ? 426 TRP A CB    1 
ATOM   3522  C  CG    . TRP A  1 428 ? 13.276  5.547   77.173  1.00 55.14  ? 426 TRP A CG    1 
ATOM   3523  C  CD1   . TRP A  1 428 ? 13.941  5.646   75.986  1.00 51.15  ? 426 TRP A CD1   1 
ATOM   3524  C  CD2   . TRP A  1 428 ? 13.456  6.801   77.840  1.00 59.47  ? 426 TRP A CD2   1 
ATOM   3525  N  NE1   . TRP A  1 428 ? 14.514  6.889   75.868  1.00 61.08  ? 426 TRP A NE1   1 
ATOM   3526  C  CE2   . TRP A  1 428 ? 14.231  7.617   76.993  1.00 61.78  ? 426 TRP A CE2   1 
ATOM   3527  C  CE3   . TRP A  1 428 ? 13.030  7.314   79.068  1.00 54.13  ? 426 TRP A CE3   1 
ATOM   3528  C  CZ2   . TRP A  1 428 ? 14.590  8.918   77.336  1.00 63.39  ? 426 TRP A CZ2   1 
ATOM   3529  C  CZ3   . TRP A  1 428 ? 13.386  8.605   79.406  1.00 59.14  ? 426 TRP A CZ3   1 
ATOM   3530  C  CH2   . TRP A  1 428 ? 14.159  9.393   78.544  1.00 64.28  ? 426 TRP A CH2   1 
ATOM   3531  N  N     . TYR A  1 429 ? 12.731  1.081   78.715  1.00 40.16  ? 427 TYR A N     1 
ATOM   3532  C  CA    . TYR A  1 429 ? 12.044  -0.028  79.361  1.00 41.86  ? 427 TYR A CA    1 
ATOM   3533  C  C     . TYR A  1 429 ? 12.699  -1.326  78.915  1.00 44.23  ? 427 TYR A C     1 
ATOM   3534  O  O     . TYR A  1 429 ? 13.334  -1.393  77.860  1.00 39.59  ? 427 TYR A O     1 
ATOM   3535  C  CB    . TYR A  1 429 ? 10.545  -0.032  79.041  1.00 32.08  ? 427 TYR A CB    1 
ATOM   3536  C  CG    . TYR A  1 429 ? 10.231  -0.117  77.566  1.00 41.54  ? 427 TYR A CG    1 
ATOM   3537  C  CD1   . TYR A  1 429 ? 10.159  1.030   76.785  1.00 40.82  ? 427 TYR A CD1   1 
ATOM   3538  C  CD2   . TYR A  1 429 ? 10.002  -1.344  76.954  1.00 38.76  ? 427 TYR A CD2   1 
ATOM   3539  C  CE1   . TYR A  1 429 ? 9.871   0.957   75.438  1.00 31.48  ? 427 TYR A CE1   1 
ATOM   3540  C  CE2   . TYR A  1 429 ? 9.714   -1.426  75.607  1.00 30.46  ? 427 TYR A CE2   1 
ATOM   3541  C  CZ    . TYR A  1 429 ? 9.651   -0.272  74.856  1.00 33.34  ? 427 TYR A CZ    1 
ATOM   3542  O  OH    . TYR A  1 429 ? 9.362   -0.347  73.517  1.00 31.56  ? 427 TYR A OH    1 
ATOM   3543  N  N     . GLN A  1 430 ? 12.531  -2.359  79.737  1.00 51.68  ? 428 GLN A N     1 
ATOM   3544  C  CA    . GLN A  1 430 ? 13.141  -3.661  79.499  1.00 45.79  ? 428 GLN A CA    1 
ATOM   3545  C  C     . GLN A  1 430 ? 12.071  -4.734  79.627  1.00 46.85  ? 428 GLN A C     1 
ATOM   3546  O  O     . GLN A  1 430 ? 11.444  -4.864  80.683  1.00 63.30  ? 428 GLN A O     1 
ATOM   3547  C  CB    . GLN A  1 430 ? 14.281  -3.920  80.489  1.00 57.17  ? 428 GLN A CB    1 
ATOM   3548  C  CG    . GLN A  1 430 ? 15.156  -5.111  80.141  1.00 76.54  ? 428 GLN A CG    1 
ATOM   3549  C  CD    . GLN A  1 430 ? 16.188  -4.785  79.078  1.00 85.21  ? 428 GLN A CD    1 
ATOM   3550  O  OE1   . GLN A  1 430 ? 16.404  -3.620  78.743  1.00 87.01  ? 428 GLN A OE1   1 
ATOM   3551  N  NE2   . GLN A  1 430 ? 16.836  -5.816  78.545  1.00 82.76  ? 428 GLN A NE2   1 
ATOM   3552  N  N     . LEU A  1 431 ? 11.862  -5.494  78.556  1.00 35.37  ? 429 LEU A N     1 
ATOM   3553  C  CA    . LEU A  1 431 ? 10.937  -6.618  78.612  1.00 34.76  ? 429 LEU A CA    1 
ATOM   3554  C  C     . LEU A  1 431 ? 11.552  -7.753  79.420  1.00 36.22  ? 429 LEU A C     1 
ATOM   3555  O  O     . LEU A  1 431 ? 12.726  -8.091  79.240  1.00 53.28  ? 429 LEU A O     1 
ATOM   3556  C  CB    . LEU A  1 431 ? 10.592  -7.096  77.203  1.00 29.94  ? 429 LEU A CB    1 
ATOM   3557  C  CG    . LEU A  1 431 ? 9.984   -6.075  76.239  1.00 37.48  ? 429 LEU A CG    1 
ATOM   3558  C  CD1   . LEU A  1 431 ? 9.721   -6.719  74.888  1.00 29.48  ? 429 LEU A CD1   1 
ATOM   3559  C  CD2   . LEU A  1 431 ? 8.705   -5.479  76.809  1.00 42.44  ? 429 LEU A CD2   1 
ATOM   3560  N  N     . GLU A  1 432 ? 10.760  -8.337  80.316  1.00 39.92  ? 430 GLU A N     1 
ATOM   3561  C  CA    . GLU A  1 432 ? 11.241  -9.451  81.119  1.00 39.78  ? 430 GLU A CA    1 
ATOM   3562  C  C     . GLU A  1 432 ? 11.568  -10.646 80.232  1.00 40.40  ? 430 GLU A C     1 
ATOM   3563  O  O     . GLU A  1 432 ? 11.001  -10.822 79.151  1.00 43.17  ? 430 GLU A O     1 
ATOM   3564  C  CB    . GLU A  1 432 ? 10.197  -9.850  82.163  1.00 41.55  ? 430 GLU A CB    1 
ATOM   3565  C  CG    . GLU A  1 432 ? 9.887   -8.779  83.198  1.00 44.77  ? 430 GLU A CG    1 
ATOM   3566  C  CD    . GLU A  1 432 ? 11.088  -8.427  84.054  1.00 48.26  ? 430 GLU A CD    1 
ATOM   3567  O  OE1   . GLU A  1 432 ? 11.734  -7.394  83.779  1.00 53.19  ? 430 GLU A OE1   1 
ATOM   3568  O  OE2   . GLU A  1 432 ? 11.391  -9.188  84.997  1.00 56.47  ? 430 GLU A OE2   1 
ATOM   3569  N  N     . LYS A  1 433 ? 12.499  -11.476 80.702  1.00 38.35  ? 431 LYS A N     1 
ATOM   3570  C  CA    . LYS A  1 433 ? 12.866  -12.691 79.988  1.00 36.74  ? 431 LYS A CA    1 
ATOM   3571  C  C     . LYS A  1 433 ? 12.042  -13.898 80.410  1.00 38.17  ? 431 LYS A C     1 
ATOM   3572  O  O     . LYS A  1 433 ? 11.967  -14.874 79.655  1.00 45.01  ? 431 LYS A O     1 
ATOM   3573  C  CB    . LYS A  1 433 ? 14.354  -12.995 80.191  1.00 45.11  ? 431 LYS A CB    1 
ATOM   3574  C  CG    . LYS A  1 433 ? 15.288  -11.959 79.588  1.00 49.86  ? 431 LYS A CG    1 
ATOM   3575  C  CD    . LYS A  1 433 ? 16.741  -12.279 79.896  1.00 67.25  ? 431 LYS A CD    1 
ATOM   3576  C  CE    . LYS A  1 433 ? 17.673  -11.251 79.278  1.00 81.82  ? 431 LYS A CE    1 
ATOM   3577  N  NZ    . LYS A  1 433 ? 17.370  -9.871  79.748  1.00 91.67  ? 431 LYS A NZ    1 
ATOM   3578  N  N     . GLU A  1 434 ? 11.429  -13.857 81.584  1.00 42.91  ? 432 GLU A N     1 
ATOM   3579  C  CA    . GLU A  1 434 ? 10.604  -14.931 82.111  1.00 44.95  ? 432 GLU A CA    1 
ATOM   3580  C  C     . GLU A  1 434 ? 9.280   -14.358 82.588  1.00 44.00  ? 432 GLU A C     1 
ATOM   3581  O  O     . GLU A  1 434 ? 9.186   -13.164 82.892  1.00 45.73  ? 432 GLU A O     1 
ATOM   3582  C  CB    . GLU A  1 434 ? 11.312  -15.654 83.268  1.00 51.91  ? 432 GLU A CB    1 
ATOM   3583  C  CG    . GLU A  1 434 ? 12.602  -16.354 82.870  1.00 60.19  ? 432 GLU A CG    1 
ATOM   3584  C  CD    . GLU A  1 434 ? 12.376  -17.503 81.904  1.00 76.25  ? 432 GLU A CD    1 
ATOM   3585  O  OE1   . GLU A  1 434 ? 11.262  -18.069 81.894  1.00 78.32  ? 432 GLU A OE1   1 
ATOM   3586  O  OE2   . GLU A  1 434 ? 13.314  -17.840 81.151  1.00 84.66  ? 432 GLU A OE2   1 
ATOM   3587  N  N     . PRO A  1 435 ? 8.230   -15.180 82.652  1.00 40.63  ? 433 PRO A N     1 
ATOM   3588  C  CA    . PRO A  1 435 ? 6.945   -14.684 83.158  1.00 35.38  ? 433 PRO A CA    1 
ATOM   3589  C  C     . PRO A  1 435 ? 7.051   -14.252 84.612  1.00 36.16  ? 433 PRO A C     1 
ATOM   3590  O  O     . PRO A  1 435 ? 7.842   -14.790 85.391  1.00 44.16  ? 433 PRO A O     1 
ATOM   3591  C  CB    . PRO A  1 435 ? 6.008   -15.887 82.994  1.00 40.86  ? 433 PRO A CB    1 
ATOM   3592  C  CG    . PRO A  1 435 ? 6.915   -17.072 82.918  1.00 47.43  ? 433 PRO A CG    1 
ATOM   3593  C  CD    . PRO A  1 435 ? 8.144   -16.585 82.218  1.00 42.88  ? 433 PRO A CD    1 
ATOM   3594  N  N     . ILE A  1 436 ? 6.239   -13.264 84.971  1.00 36.71  ? 434 ILE A N     1 
ATOM   3595  C  CA    . ILE A  1 436 ? 6.305   -12.634 86.284  1.00 36.74  ? 434 ILE A CA    1 
ATOM   3596  C  C     . ILE A  1 436 ? 5.347   -13.352 87.224  1.00 53.23  ? 434 ILE A C     1 
ATOM   3597  O  O     . ILE A  1 436 ? 4.138   -13.405 86.973  1.00 47.27  ? 434 ILE A O     1 
ATOM   3598  C  CB    . ILE A  1 436 ? 5.970   -11.139 86.192  1.00 42.86  ? 434 ILE A CB    1 
ATOM   3599  C  CG1   . ILE A  1 436 ? 6.772   -10.491 85.062  1.00 35.03  ? 434 ILE A CG1   1 
ATOM   3600  C  CG2   . ILE A  1 436 ? 6.253   -10.448 87.517  1.00 37.18  ? 434 ILE A CG2   1 
ATOM   3601  C  CD1   . ILE A  1 436 ? 6.094   -9.291  84.446  1.00 47.00  ? 434 ILE A CD1   1 
ATOM   3602  N  N     . VAL A  1 437 ? 5.887   -13.905 88.310  1.00 50.02  ? 435 VAL A N     1 
ATOM   3603  C  CA    . VAL A  1 437 ? 5.060   -14.586 89.297  1.00 51.31  ? 435 VAL A CA    1 
ATOM   3604  C  C     . VAL A  1 437 ? 4.240   -13.557 90.063  1.00 49.03  ? 435 VAL A C     1 
ATOM   3605  O  O     . VAL A  1 437 ? 4.771   -12.548 90.545  1.00 46.46  ? 435 VAL A O     1 
ATOM   3606  C  CB    . VAL A  1 437 ? 5.931   -15.423 90.246  1.00 48.25  ? 435 VAL A CB    1 
ATOM   3607  C  CG1   . VAL A  1 437 ? 5.068   -16.116 91.290  1.00 43.60  ? 435 VAL A CG1   1 
ATOM   3608  C  CG2   . VAL A  1 437 ? 6.743   -16.440 89.461  1.00 44.36  ? 435 VAL A CG2   1 
ATOM   3609  N  N     . GLY A  1 438 ? 2.937   -13.806 90.175  1.00 45.86  ? 436 GLY A N     1 
ATOM   3610  C  CA    . GLY A  1 438 ? 2.049   -12.910 90.883  1.00 50.02  ? 436 GLY A CA    1 
ATOM   3611  C  C     . GLY A  1 438 ? 1.502   -11.761 90.066  1.00 55.42  ? 436 GLY A C     1 
ATOM   3612  O  O     . GLY A  1 438 ? 0.712   -10.969 90.596  1.00 60.76  ? 436 GLY A O     1 
ATOM   3613  N  N     . ALA A  1 439 ? 1.899   -11.637 88.803  1.00 46.03  ? 437 ALA A N     1 
ATOM   3614  C  CA    . ALA A  1 439 ? 1.392   -10.604 87.912  1.00 39.62  ? 437 ALA A CA    1 
ATOM   3615  C  C     . ALA A  1 439 ? 0.234   -11.154 87.092  1.00 46.32  ? 437 ALA A C     1 
ATOM   3616  O  O     . ALA A  1 439 ? 0.287   -12.286 86.604  1.00 47.77  ? 437 ALA A O     1 
ATOM   3617  C  CB    . ALA A  1 439 ? 2.494   -10.090 86.984  1.00 42.35  ? 437 ALA A CB    1 
ATOM   3618  N  N     . GLU A  1 440 ? -0.813  -10.344 86.946  1.00 48.24  ? 438 GLU A N     1 
ATOM   3619  C  CA    . GLU A  1 440 ? -1.996  -10.764 86.206  1.00 45.48  ? 438 GLU A CA    1 
ATOM   3620  C  C     . GLU A  1 440 ? -1.643  -11.027 84.747  1.00 45.59  ? 438 GLU A C     1 
ATOM   3621  O  O     . GLU A  1 440 ? -0.936  -10.239 84.113  1.00 51.95  ? 438 GLU A O     1 
ATOM   3622  C  CB    . GLU A  1 440 ? -3.079  -9.691  86.312  1.00 45.87  ? 438 GLU A CB    1 
ATOM   3623  C  CG    . GLU A  1 440 ? -4.441  -10.106 85.787  1.00 53.28  ? 438 GLU A CG    1 
ATOM   3624  C  CD    . GLU A  1 440 ? -5.497  -9.043  86.028  1.00 51.87  ? 438 GLU A CD    1 
ATOM   3625  O  OE1   . GLU A  1 440 ? -5.168  -8.008  86.647  1.00 52.84  ? 438 GLU A OE1   1 
ATOM   3626  O  OE2   . GLU A  1 440 ? -6.654  -9.240  85.602  1.00 43.66  ? 438 GLU A OE2   1 
ATOM   3627  N  N     . THR A  1 441 ? -2.135  -12.144 84.216  1.00 36.86  ? 439 THR A N     1 
ATOM   3628  C  CA    . THR A  1 441 ? -1.839  -12.568 82.852  1.00 37.77  ? 439 THR A CA    1 
ATOM   3629  C  C     . THR A  1 441 ? -2.970  -12.131 81.928  1.00 42.89  ? 439 THR A C     1 
ATOM   3630  O  O     . THR A  1 441 ? -4.115  -12.560 82.099  1.00 44.67  ? 439 THR A O     1 
ATOM   3631  C  CB    . THR A  1 441 ? -1.651  -14.083 82.780  1.00 36.53  ? 439 THR A CB    1 
ATOM   3632  O  OG1   . THR A  1 441 ? -0.502  -14.462 83.549  1.00 42.91  ? 439 THR A OG1   1 
ATOM   3633  C  CG2   . THR A  1 441 ? -1.458  -14.524 81.339  1.00 37.63  ? 439 THR A CG2   1 
ATOM   3634  N  N     . PHE A  1 442 ? -2.644  -11.293 80.946  1.00 41.49  ? 440 PHE A N     1 
ATOM   3635  C  CA    . PHE A  1 442 ? -3.621  -10.761 80.002  1.00 35.62  ? 440 PHE A CA    1 
ATOM   3636  C  C     . PHE A  1 442 ? -3.483  -11.478 78.664  1.00 37.04  ? 440 PHE A C     1 
ATOM   3637  O  O     . PHE A  1 442 ? -2.408  -11.464 78.055  1.00 44.64  ? 440 PHE A O     1 
ATOM   3638  C  CB    . PHE A  1 442 ? -3.432  -9.255  79.816  1.00 39.81  ? 440 PHE A CB    1 
ATOM   3639  C  CG    . PHE A  1 442 ? -3.945  -8.427  80.959  1.00 36.01  ? 440 PHE A CG    1 
ATOM   3640  C  CD1   . PHE A  1 442 ? -3.331  -8.475  82.199  1.00 36.11  ? 440 PHE A CD1   1 
ATOM   3641  C  CD2   . PHE A  1 442 ? -5.028  -7.582  80.786  1.00 41.71  ? 440 PHE A CD2   1 
ATOM   3642  C  CE1   . PHE A  1 442 ? -3.797  -7.707  83.250  1.00 41.19  ? 440 PHE A CE1   1 
ATOM   3643  C  CE2   . PHE A  1 442 ? -5.500  -6.810  81.834  1.00 42.55  ? 440 PHE A CE2   1 
ATOM   3644  C  CZ    . PHE A  1 442 ? -4.882  -6.873  83.068  1.00 37.64  ? 440 PHE A CZ    1 
ATOM   3645  N  N     . TYR A  1 443 ? -4.569  -12.100 78.208  1.00 36.10  ? 441 TYR A N     1 
ATOM   3646  C  CA    . TYR A  1 443 ? -4.633  -12.719 76.887  1.00 41.79  ? 441 TYR A CA    1 
ATOM   3647  C  C     . TYR A  1 443 ? -5.346  -11.753 75.948  1.00 49.22  ? 441 TYR A C     1 
ATOM   3648  O  O     . TYR A  1 443 ? -6.571  -11.611 76.009  1.00 45.23  ? 441 TYR A O     1 
ATOM   3649  C  CB    . TYR A  1 443 ? -5.354  -14.063 76.943  1.00 37.57  ? 441 TYR A CB    1 
ATOM   3650  C  CG    . TYR A  1 443 ? -4.618  -15.123 77.726  1.00 45.84  ? 441 TYR A CG    1 
ATOM   3651  C  CD1   . TYR A  1 443 ? -4.775  -15.231 79.101  1.00 37.39  ? 441 TYR A CD1   1 
ATOM   3652  C  CD2   . TYR A  1 443 ? -3.768  -16.020 77.089  1.00 37.05  ? 441 TYR A CD2   1 
ATOM   3653  C  CE1   . TYR A  1 443 ? -4.108  -16.201 79.822  1.00 37.64  ? 441 TYR A CE1   1 
ATOM   3654  C  CE2   . TYR A  1 443 ? -3.095  -16.993 77.802  1.00 41.88  ? 441 TYR A CE2   1 
ATOM   3655  C  CZ    . TYR A  1 443 ? -3.267  -17.078 79.169  1.00 45.83  ? 441 TYR A CZ    1 
ATOM   3656  O  OH    . TYR A  1 443 ? -2.598  -18.045 79.884  1.00 38.09  ? 441 TYR A OH    1 
ATOM   3657  N  N     . VAL A  1 444 ? -4.582  -11.098 75.079  1.00 35.94  ? 442 VAL A N     1 
ATOM   3658  C  CA    . VAL A  1 444 ? -5.106  -10.045 74.227  1.00 36.33  ? 442 VAL A CA    1 
ATOM   3659  C  C     . VAL A  1 444 ? -5.323  -10.587 72.821  1.00 39.37  ? 442 VAL A C     1 
ATOM   3660  O  O     . VAL A  1 444 ? -4.712  -11.573 72.400  1.00 40.58  ? 442 VAL A O     1 
ATOM   3661  C  CB    . VAL A  1 444 ? -4.169  -8.816  74.205  1.00 37.03  ? 442 VAL A CB    1 
ATOM   3662  C  CG1   . VAL A  1 444 ? -3.862  -8.372  75.618  1.00 36.80  ? 442 VAL A CG1   1 
ATOM   3663  C  CG2   . VAL A  1 444 ? -2.887  -9.135  73.450  1.00 39.66  ? 442 VAL A CG2   1 
ATOM   3664  N  N     . ASP A  1 445 ? -6.211  -9.926  72.082  1.00 40.39  ? 443 ASP A N     1 
ATOM   3665  C  CA    . ASP A  1 445 ? -6.474  -10.277 70.693  1.00 48.19  ? 443 ASP A CA    1 
ATOM   3666  C  C     . ASP A  1 445 ? -7.275  -9.157  70.048  1.00 51.73  ? 443 ASP A C     1 
ATOM   3667  O  O     . ASP A  1 445 ? -7.943  -8.372  70.728  1.00 44.25  ? 443 ASP A O     1 
ATOM   3668  C  CB    . ASP A  1 445 ? -7.228  -11.606 70.571  1.00 52.70  ? 443 ASP A CB    1 
ATOM   3669  C  CG    . ASP A  1 445 ? -7.121  -12.208 69.184  1.00 60.09  ? 443 ASP A CG    1 
ATOM   3670  O  OD1   . ASP A  1 445 ? -6.381  -11.648 68.347  1.00 59.16  ? 443 ASP A OD1   1 
ATOM   3671  O  OD2   . ASP A  1 445 ? -7.775  -13.241 68.930  1.00 65.53  ? 443 ASP A OD2   1 
ATOM   3672  N  N     . GLY A  1 446 ? -7.196  -9.097  68.723  1.00 50.31  ? 444 GLY A N     1 
ATOM   3673  C  CA    . GLY A  1 446 ? -7.954  -8.133  67.955  1.00 42.00  ? 444 GLY A CA    1 
ATOM   3674  C  C     . GLY A  1 446 ? -8.259  -8.638  66.561  1.00 49.30  ? 444 GLY A C     1 
ATOM   3675  O  O     . GLY A  1 446 ? -7.427  -9.306  65.940  1.00 57.28  ? 444 GLY A O     1 
ATOM   3676  N  N     . ALA A  1 447 ? -9.455  -8.338  66.063  1.00 47.80  ? 445 ALA A N     1 
ATOM   3677  C  CA    . ALA A  1 447 ? -9.846  -8.712  64.715  1.00 46.16  ? 445 ALA A CA    1 
ATOM   3678  C  C     . ALA A  1 447 ? -10.556 -7.537  64.065  1.00 56.56  ? 445 ALA A C     1 
ATOM   3679  O  O     . ALA A  1 447 ? -11.202 -6.733  64.741  1.00 48.07  ? 445 ALA A O     1 
ATOM   3680  C  CB    . ALA A  1 447 ? -10.751 -9.951  64.705  1.00 47.19  ? 445 ALA A CB    1 
ATOM   3681  N  N     . ALA A  1 448 ? -10.424 -7.439  62.744  1.00 58.52  ? 446 ALA A N     1 
ATOM   3682  C  CA    . ALA A  1 448 ? -11.053 -6.373  61.982  1.00 53.80  ? 446 ALA A CA    1 
ATOM   3683  C  C     . ALA A  1 448 ? -11.553 -6.929  60.659  1.00 62.77  ? 446 ALA A C     1 
ATOM   3684  O  O     . ALA A  1 448 ? -10.942 -7.826  60.074  1.00 61.35  ? 446 ALA A O     1 
ATOM   3685  C  CB    . ALA A  1 448 ? -10.089 -5.206  61.732  1.00 54.42  ? 446 ALA A CB    1 
ATOM   3686  N  N     . ASN A  1 449 ? -12.676 -6.389  60.195  1.00 72.78  ? 447 ASN A N     1 
ATOM   3687  C  CA    . ASN A  1 449 ? -13.246 -6.800  58.921  1.00 69.96  ? 447 ASN A CA    1 
ATOM   3688  C  C     . ASN A  1 449 ? -12.565 -6.047  57.786  1.00 69.74  ? 447 ASN A C     1 
ATOM   3689  O  O     . ASN A  1 449 ? -12.402 -4.825  57.850  1.00 72.10  ? 447 ASN A O     1 
ATOM   3690  C  CB    . ASN A  1 449 ? -14.753 -6.548  58.905  1.00 77.35  ? 447 ASN A CB    1 
ATOM   3691  C  CG    . ASN A  1 449 ? -15.417 -7.072  57.648  1.00 82.25  ? 447 ASN A CG    1 
ATOM   3692  O  OD1   . ASN A  1 449 ? -15.483 -6.380  56.634  1.00 83.66  ? 447 ASN A OD1   1 
ATOM   3693  N  ND2   . ASN A  1 449 ? -15.919 -8.301  57.711  1.00 85.21  ? 447 ASN A ND2   1 
ATOM   3694  N  N     . ARG A  1 450 ? -12.161 -6.783  56.748  1.00 79.67  ? 448 ARG A N     1 
ATOM   3695  C  CA    . ARG A  1 450 ? -11.464 -6.164  55.626  1.00 92.62  ? 448 ARG A CA    1 
ATOM   3696  C  C     . ARG A  1 450 ? -12.364 -5.200  54.862  1.00 91.93  ? 448 ARG A C     1 
ATOM   3697  O  O     . ARG A  1 450 ? -11.886 -4.182  54.349  1.00 93.16  ? 448 ARG A O     1 
ATOM   3698  C  CB    . ARG A  1 450 ? -10.925 -7.242  54.685  1.00 104.74 ? 448 ARG A CB    1 
ATOM   3699  C  CG    . ARG A  1 450 ? -10.122 -6.709  53.509  1.00 114.90 ? 448 ARG A CG    1 
ATOM   3700  C  CD    . ARG A  1 450 ? -9.996  -7.754  52.412  1.00 127.14 ? 448 ARG A CD    1 
ATOM   3701  N  NE    . ARG A  1 450 ? -9.270  -8.940  52.857  1.00 128.50 ? 448 ARG A NE    1 
ATOM   3702  C  CZ    . ARG A  1 450 ? -7.995  -9.184  52.571  1.00 125.42 ? 448 ARG A CZ    1 
ATOM   3703  N  NH1   . ARG A  1 450 ? -7.304  -8.327  51.834  1.00 124.19 ? 448 ARG A NH1   1 
ATOM   3704  N  NH2   . ARG A  1 450 ? -7.413  -10.289 53.017  1.00 123.13 ? 448 ARG A NH2   1 
ATOM   3705  N  N     . GLU A  1 451 ? -13.663 -5.494  54.782  1.00 91.58  ? 449 GLU A N     1 
ATOM   3706  C  CA    . GLU A  1 451 ? -14.570 -4.670  53.990  1.00 99.27  ? 449 GLU A CA    1 
ATOM   3707  C  C     . GLU A  1 451 ? -15.066 -3.463  54.782  1.00 88.72  ? 449 GLU A C     1 
ATOM   3708  O  O     . GLU A  1 451 ? -14.771 -2.315  54.435  1.00 92.33  ? 449 GLU A O     1 
ATOM   3709  C  CB    . GLU A  1 451 ? -15.750 -5.514  53.500  1.00 115.97 ? 449 GLU A CB    1 
ATOM   3710  C  CG    . GLU A  1 451 ? -15.340 -6.763  52.737  1.00 125.49 ? 449 GLU A CG    1 
ATOM   3711  C  CD    . GLU A  1 451 ? -14.588 -6.448  51.459  1.00 138.17 ? 449 GLU A CD    1 
ATOM   3712  O  OE1   . GLU A  1 451 ? -14.877 -5.403  50.838  1.00 143.41 ? 449 GLU A OE1   1 
ATOM   3713  O  OE2   . GLU A  1 451 ? -13.703 -7.243  51.079  1.00 141.25 ? 449 GLU A OE2   1 
ATOM   3714  N  N     . THR A  1 452 ? -15.824 -3.708  55.852  1.00 81.29  ? 450 THR A N     1 
ATOM   3715  C  CA    . THR A  1 452 ? -16.425 -2.622  56.618  1.00 77.87  ? 450 THR A CA    1 
ATOM   3716  C  C     . THR A  1 452 ? -15.411 -1.827  57.429  1.00 74.14  ? 450 THR A C     1 
ATOM   3717  O  O     . THR A  1 452 ? -15.774 -0.782  57.979  1.00 77.31  ? 450 THR A O     1 
ATOM   3718  C  CB    . THR A  1 452 ? -17.501 -3.171  57.559  1.00 68.95  ? 450 THR A CB    1 
ATOM   3719  O  OG1   . THR A  1 452 ? -16.900 -4.065  58.505  1.00 64.91  ? 450 THR A OG1   1 
ATOM   3720  C  CG2   . THR A  1 452 ? -18.567 -3.917  56.772  1.00 70.49  ? 450 THR A CG2   1 
ATOM   3721  N  N     . LYS A  1 453 ? -14.166 -2.293  57.523  1.00 68.76  ? 451 LYS A N     1 
ATOM   3722  C  CA    . LYS A  1 453 ? -13.105 -1.684  58.322  1.00 72.56  ? 451 LYS A CA    1 
ATOM   3723  C  C     . LYS A  1 453 ? -13.448 -1.623  59.807  1.00 70.98  ? 451 LYS A C     1 
ATOM   3724  O  O     . LYS A  1 453 ? -12.770 -0.920  60.567  1.00 68.08  ? 451 LYS A O     1 
ATOM   3725  C  CB    . LYS A  1 453 ? -12.746 -0.281  57.813  1.00 77.16  ? 451 LYS A CB    1 
ATOM   3726  C  CG    . LYS A  1 453 ? -12.413 -0.219  56.331  1.00 83.00  ? 451 LYS A CG    1 
ATOM   3727  C  CD    . LYS A  1 453 ? -11.216 -1.088  55.986  1.00 78.19  ? 451 LYS A CD    1 
ATOM   3728  C  CE    . LYS A  1 453 ? -10.888 -1.002  54.502  1.00 82.41  ? 451 LYS A CE    1 
ATOM   3729  N  NZ    . LYS A  1 453 ? -9.772  -1.911  54.119  1.00 81.60  ? 451 LYS A NZ    1 
ATOM   3730  N  N     . LEU A  1 454 ? -14.482 -2.337  60.240  1.00 68.63  ? 452 LEU A N     1 
ATOM   3731  C  CA    . LEU A  1 454 ? -14.856 -2.399  61.643  1.00 66.37  ? 452 LEU A CA    1 
ATOM   3732  C  C     . LEU A  1 454 ? -14.070 -3.499  62.342  1.00 71.16  ? 452 LEU A C     1 
ATOM   3733  O  O     . LEU A  1 454 ? -13.683 -4.497  61.730  1.00 72.97  ? 452 LEU A O     1 
ATOM   3734  C  CB    . LEU A  1 454 ? -16.356 -2.656  61.793  1.00 62.28  ? 452 LEU A CB    1 
ATOM   3735  C  CG    . LEU A  1 454 ? -17.292 -1.633  61.147  1.00 64.94  ? 452 LEU A CG    1 
ATOM   3736  C  CD1   . LEU A  1 454 ? -18.723 -2.143  61.147  1.00 65.42  ? 452 LEU A CD1   1 
ATOM   3737  C  CD2   . LEU A  1 454 ? -17.198 -0.299  61.868  1.00 63.33  ? 452 LEU A CD2   1 
ATOM   3738  N  N     . GLY A  1 455 ? -13.840 -3.309  63.638  1.00 69.06  ? 453 GLY A N     1 
ATOM   3739  C  CA    . GLY A  1 455 ? -13.064 -4.284  64.381  1.00 57.39  ? 453 GLY A CA    1 
ATOM   3740  C  C     . GLY A  1 455 ? -13.336 -4.215  65.865  1.00 58.29  ? 453 GLY A C     1 
ATOM   3741  O  O     . GLY A  1 455 ? -14.038 -3.329  66.358  1.00 57.54  ? 453 GLY A O     1 
ATOM   3742  N  N     . LYS A  1 456 ? -12.761 -5.185  66.575  1.00 59.71  ? 454 LYS A N     1 
ATOM   3743  C  CA    . LYS A  1 456 ? -12.837 -5.268  68.024  1.00 51.68  ? 454 LYS A CA    1 
ATOM   3744  C  C     . LYS A  1 456 ? -11.460 -5.585  68.586  1.00 46.07  ? 454 LYS A C     1 
ATOM   3745  O  O     . LYS A  1 456 ? -10.628 -6.211  67.923  1.00 47.99  ? 454 LYS A O     1 
ATOM   3746  C  CB    . LYS A  1 456 ? -13.836 -6.341  68.483  1.00 48.40  ? 454 LYS A CB    1 
ATOM   3747  C  CG    . LYS A  1 456 ? -15.275 -6.093  68.063  1.00 62.05  ? 454 LYS A CG    1 
ATOM   3748  C  CD    . LYS A  1 456 ? -16.185 -7.204  68.565  1.00 55.86  ? 454 LYS A CD    1 
ATOM   3749  C  CE    . LYS A  1 456 ? -17.633 -6.962  68.174  1.00 63.87  ? 454 LYS A CE    1 
ATOM   3750  N  NZ    . LYS A  1 456 ? -18.532 -8.023  68.710  1.00 67.17  ? 454 LYS A NZ    1 
ATOM   3751  N  N     . ALA A  1 457 ? -11.229 -5.147  69.820  1.00 46.60  ? 455 ALA A N     1 
ATOM   3752  C  CA    . ALA A  1 457 ? -10.002 -5.442  70.544  1.00 44.13  ? 455 ALA A CA    1 
ATOM   3753  C  C     . ALA A  1 457 ? -10.337 -5.612  72.016  1.00 48.37  ? 455 ALA A C     1 
ATOM   3754  O  O     . ALA A  1 457 ? -11.211 -4.917  72.543  1.00 46.00  ? 455 ALA A O     1 
ATOM   3755  C  CB    . ALA A  1 457 ? -8.956  -4.336  70.362  1.00 42.18  ? 455 ALA A CB    1 
ATOM   3756  N  N     . GLY A  1 458 ? -9.651  -6.537  72.675  1.00 41.18  ? 456 GLY A N     1 
ATOM   3757  C  CA    . GLY A  1 458 ? -9.919  -6.766  74.079  1.00 41.26  ? 456 GLY A CA    1 
ATOM   3758  C  C     . GLY A  1 458 ? -9.000  -7.817  74.658  1.00 42.51  ? 456 GLY A C     1 
ATOM   3759  O  O     . GLY A  1 458 ? -7.989  -8.186  74.058  1.00 44.74  ? 456 GLY A O     1 
ATOM   3760  N  N     . TYR A  1 459 ? -9.377  -8.298  75.842  1.00 39.77  ? 457 TYR A N     1 
ATOM   3761  C  CA    . TYR A  1 459 ? -8.545  -9.240  76.575  1.00 38.85  ? 457 TYR A CA    1 
ATOM   3762  C  C     . TYR A  1 459 ? -9.401  -10.041 77.546  1.00 44.73  ? 457 TYR A C     1 
ATOM   3763  O  O     . TYR A  1 459 ? -10.523 -9.655  77.883  1.00 42.05  ? 457 TYR A O     1 
ATOM   3764  C  CB    . TYR A  1 459 ? -7.420  -8.520  77.335  1.00 40.40  ? 457 TYR A CB    1 
ATOM   3765  C  CG    . TYR A  1 459 ? -7.906  -7.461  78.308  1.00 40.64  ? 457 TYR A CG    1 
ATOM   3766  C  CD1   . TYR A  1 459 ? -8.454  -7.814  79.538  1.00 39.05  ? 457 TYR A CD1   1 
ATOM   3767  C  CD2   . TYR A  1 459 ? -7.805  -6.110  78.002  1.00 38.73  ? 457 TYR A CD2   1 
ATOM   3768  C  CE1   . TYR A  1 459 ? -8.900  -6.856  80.424  1.00 39.79  ? 457 TYR A CE1   1 
ATOM   3769  C  CE2   . TYR A  1 459 ? -8.245  -5.143  78.886  1.00 42.42  ? 457 TYR A CE2   1 
ATOM   3770  C  CZ    . TYR A  1 459 ? -8.792  -5.523  80.095  1.00 54.57  ? 457 TYR A CZ    1 
ATOM   3771  O  OH    . TYR A  1 459 ? -9.236  -4.568  80.980  1.00 50.54  ? 457 TYR A OH    1 
ATOM   3772  N  N     . VAL A  1 460 ? -8.843  -11.167 77.990  1.00 41.79  ? 458 VAL A N     1 
ATOM   3773  C  CA    . VAL A  1 460 ? -9.317  -11.900 79.157  1.00 40.27  ? 458 VAL A CA    1 
ATOM   3774  C  C     . VAL A  1 460 ? -8.102  -12.219 80.016  1.00 45.80  ? 458 VAL A C     1 
ATOM   3775  O  O     . VAL A  1 460 ? -6.997  -12.425 79.505  1.00 46.27  ? 458 VAL A O     1 
ATOM   3776  C  CB    . VAL A  1 460 ? -10.078 -13.196 78.793  1.00 41.83  ? 458 VAL A CB    1 
ATOM   3777  C  CG1   . VAL A  1 460 ? -11.355 -12.875 78.043  1.00 41.52  ? 458 VAL A CG1   1 
ATOM   3778  C  CG2   . VAL A  1 460 ? -9.193  -14.135 77.984  1.00 39.95  ? 458 VAL A CG2   1 
ATOM   3779  N  N     . THR A  1 461 ? -8.305  -12.245 81.329  1.00 39.25  ? 459 THR A N     1 
ATOM   3780  C  CA    . THR A  1 461 ? -7.219  -12.494 82.264  1.00 43.40  ? 459 THR A CA    1 
ATOM   3781  C  C     . THR A  1 461 ? -7.537  -13.700 83.138  1.00 50.38  ? 459 THR A C     1 
ATOM   3782  O  O     . THR A  1 461 ? -8.666  -14.197 83.174  1.00 48.06  ? 459 THR A O     1 
ATOM   3783  C  CB    . THR A  1 461 ? -6.943  -11.270 83.148  1.00 38.79  ? 459 THR A CB    1 
ATOM   3784  O  OG1   . THR A  1 461 ? -7.876  -11.240 84.235  1.00 39.90  ? 459 THR A OG1   1 
ATOM   3785  C  CG2   . THR A  1 461 ? -7.069  -9.988  82.344  1.00 38.50  ? 459 THR A CG2   1 
ATOM   3786  N  N     . ASN A  1 462 ? -6.508  -14.166 83.850  1.00 45.88  ? 460 ASN A N     1 
ATOM   3787  C  CA    . ASN A  1 462 ? -6.665  -15.306 84.744  1.00 48.94  ? 460 ASN A CA    1 
ATOM   3788  C  C     . ASN A  1 462 ? -7.514  -14.973 85.963  1.00 46.39  ? 460 ASN A C     1 
ATOM   3789  O  O     . ASN A  1 462 ? -8.088  -15.884 86.569  1.00 50.62  ? 460 ASN A O     1 
ATOM   3790  C  CB    . ASN A  1 462 ? -5.292  -15.816 85.185  1.00 40.13  ? 460 ASN A CB    1 
ATOM   3791  C  CG    . ASN A  1 462 ? -4.518  -14.787 85.986  1.00 49.77  ? 460 ASN A CG    1 
ATOM   3792  O  OD1   . ASN A  1 462 ? -4.068  -13.776 85.447  1.00 50.14  ? 460 ASN A OD1   1 
ATOM   3793  N  ND2   . ASN A  1 462 ? -4.352  -15.043 87.279  1.00 40.74  ? 460 ASN A ND2   1 
ATOM   3794  N  N     . LYS A  1 463 ? -7.606  -13.699 86.334  1.00 47.08  ? 461 LYS A N     1 
ATOM   3795  C  CA    . LYS A  1 463 ? -8.431  -13.272 87.455  1.00 44.44  ? 461 LYS A CA    1 
ATOM   3796  C  C     . LYS A  1 463 ? -9.878  -13.013 87.061  1.00 45.01  ? 461 LYS A C     1 
ATOM   3797  O  O     . LYS A  1 463 ? -10.682 -12.641 87.922  1.00 52.03  ? 461 LYS A O     1 
ATOM   3798  C  CB    . LYS A  1 463 ? -7.839  -12.011 88.096  1.00 42.31  ? 461 LYS A CB    1 
ATOM   3799  C  CG    . LYS A  1 463 ? -6.501  -12.237 88.779  1.00 60.56  ? 461 LYS A CG    1 
ATOM   3800  C  CD    . LYS A  1 463 ? -5.852  -10.923 89.185  1.00 75.84  ? 461 LYS A CD    1 
ATOM   3801  C  CE    . LYS A  1 463 ? -6.698  -10.164 90.193  1.00 88.95  ? 461 LYS A CE    1 
ATOM   3802  N  NZ    . LYS A  1 463 ? -6.064  -8.872  90.580  1.00 95.25  ? 461 LYS A NZ    1 
ATOM   3803  N  N     . GLY A  1 464 ? -10.230 -13.199 85.791  1.00 44.73  ? 462 GLY A N     1 
ATOM   3804  C  CA    . GLY A  1 464 ? -11.576 -12.963 85.317  1.00 43.37  ? 462 GLY A CA    1 
ATOM   3805  C  C     . GLY A  1 464 ? -11.801 -11.608 84.683  1.00 46.78  ? 462 GLY A C     1 
ATOM   3806  O  O     . GLY A  1 464 ? -12.898 -11.360 84.168  1.00 45.28  ? 462 GLY A O     1 
ATOM   3807  N  N     . ARG A  1 465 ? -10.805 -10.725 84.708  1.00 44.81  ? 463 ARG A N     1 
ATOM   3808  C  CA    . ARG A  1 465 ? -10.953 -9.419  84.082  1.00 42.25  ? 463 ARG A CA    1 
ATOM   3809  C  C     . ARG A  1 465 ? -11.114 -9.578  82.576  1.00 45.23  ? 463 ARG A C     1 
ATOM   3810  O  O     . ARG A  1 465 ? -10.489 -10.441 81.954  1.00 47.11  ? 463 ARG A O     1 
ATOM   3811  C  CB    . ARG A  1 465 ? -9.744  -8.537  84.395  1.00 42.88  ? 463 ARG A CB    1 
ATOM   3812  C  CG    . ARG A  1 465 ? -9.931  -7.074  84.038  1.00 54.67  ? 463 ARG A CG    1 
ATOM   3813  C  CD    . ARG A  1 465 ? -8.627  -6.311  84.184  1.00 50.37  ? 463 ARG A CD    1 
ATOM   3814  N  NE    . ARG A  1 465 ? -7.926  -6.668  85.413  1.00 52.18  ? 463 ARG A NE    1 
ATOM   3815  C  CZ    . ARG A  1 465 ? -8.111  -6.066  86.583  1.00 51.22  ? 463 ARG A CZ    1 
ATOM   3816  N  NH1   . ARG A  1 465 ? -8.979  -5.069  86.688  1.00 55.90  ? 463 ARG A NH1   1 
ATOM   3817  N  NH2   . ARG A  1 465 ? -7.427  -6.460  87.648  1.00 43.11  ? 463 ARG A NH2   1 
ATOM   3818  N  N     . GLN A  1 466 ? -11.961 -8.736  81.990  1.00 43.11  ? 464 GLN A N     1 
ATOM   3819  C  CA    . GLN A  1 466 ? -12.319 -8.880  80.589  1.00 42.56  ? 464 GLN A CA    1 
ATOM   3820  C  C     . GLN A  1 466 ? -12.727 -7.525  80.031  1.00 43.19  ? 464 GLN A C     1 
ATOM   3821  O  O     . GLN A  1 466 ? -13.268 -6.678  80.748  1.00 44.11  ? 464 GLN A O     1 
ATOM   3822  C  CB    . GLN A  1 466 ? -13.450 -9.903  80.421  1.00 53.44  ? 464 GLN A CB    1 
ATOM   3823  C  CG    . GLN A  1 466 ? -13.870 -10.176 78.990  1.00 75.53  ? 464 GLN A CG    1 
ATOM   3824  C  CD    . GLN A  1 466 ? -14.860 -11.319 78.894  1.00 94.60  ? 464 GLN A CD    1 
ATOM   3825  O  OE1   . GLN A  1 466 ? -14.704 -12.345 79.556  1.00 96.81  ? 464 GLN A OE1   1 
ATOM   3826  N  NE2   . GLN A  1 466 ? -15.891 -11.144 78.074  1.00 94.35  ? 464 GLN A NE2   1 
ATOM   3827  N  N     . LYS A  1 467 ? -12.451 -7.326  78.745  1.00 42.87  ? 465 LYS A N     1 
ATOM   3828  C  CA    . LYS A  1 467 ? -12.859 -6.117  78.048  1.00 47.69  ? 465 LYS A CA    1 
ATOM   3829  C  C     . LYS A  1 467 ? -12.941 -6.423  76.560  1.00 47.31  ? 465 LYS A C     1 
ATOM   3830  O  O     . LYS A  1 467 ? -12.145 -7.207  76.043  1.00 47.52  ? 465 LYS A O     1 
ATOM   3831  C  CB    . LYS A  1 467 ? -11.883 -4.960  78.305  1.00 43.11  ? 465 LYS A CB    1 
ATOM   3832  C  CG    . LYS A  1 467 ? -12.161 -3.714  77.474  1.00 44.05  ? 465 LYS A CG    1 
ATOM   3833  C  CD    . LYS A  1 467 ? -11.299 -2.538  77.896  1.00 43.77  ? 465 LYS A CD    1 
ATOM   3834  C  CE    . LYS A  1 467 ? -11.714 -2.013  79.259  1.00 50.87  ? 465 LYS A CE    1 
ATOM   3835  N  NZ    . LYS A  1 467 ? -11.003 -0.752  79.613  1.00 51.27  ? 465 LYS A NZ    1 
ATOM   3836  N  N     . VAL A  1 468 ? -13.930 -5.831  75.894  1.00 45.28  ? 466 VAL A N     1 
ATOM   3837  C  CA    . VAL A  1 468 ? -14.024 -5.829  74.437  1.00 49.59  ? 466 VAL A CA    1 
ATOM   3838  C  C     . VAL A  1 468 ? -14.432 -4.429  74.009  1.00 52.42  ? 466 VAL A C     1 
ATOM   3839  O  O     . VAL A  1 468 ? -15.445 -3.902  74.481  1.00 57.18  ? 466 VAL A O     1 
ATOM   3840  C  CB    . VAL A  1 468 ? -15.030 -6.869  73.903  1.00 46.80  ? 466 VAL A CB    1 
ATOM   3841  C  CG1   . VAL A  1 468 ? -15.158 -6.749  72.392  1.00 47.63  ? 466 VAL A CG1   1 
ATOM   3842  C  CG2   . VAL A  1 468 ? -14.611 -8.279  74.288  1.00 45.77  ? 466 VAL A CG2   1 
ATOM   3843  N  N     . VAL A  1 469 ? -13.647 -3.822  73.126  1.00 50.54  ? 467 VAL A N     1 
ATOM   3844  C  CA    . VAL A  1 469 ? -13.867 -2.455  72.677  1.00 50.00  ? 467 VAL A CA    1 
ATOM   3845  C  C     . VAL A  1 469 ? -14.114 -2.476  71.173  1.00 59.04  ? 467 VAL A C     1 
ATOM   3846  O  O     . VAL A  1 469 ? -13.243 -2.905  70.410  1.00 67.94  ? 467 VAL A O     1 
ATOM   3847  C  CB    . VAL A  1 469 ? -12.681 -1.537  73.015  1.00 47.55  ? 467 VAL A CB    1 
ATOM   3848  C  CG1   . VAL A  1 469 ? -12.952 -0.122  72.529  1.00 49.38  ? 467 VAL A CG1   1 
ATOM   3849  C  CG2   . VAL A  1 469 ? -12.413 -1.549  74.509  1.00 49.46  ? 467 VAL A CG2   1 
ATOM   3850  N  N     . PRO A  1 470 ? -15.275 -2.031  70.697  1.00 63.23  ? 468 PRO A N     1 
ATOM   3851  C  CA    . PRO A  1 470 ? -15.484 -1.935  69.248  1.00 68.78  ? 468 PRO A CA    1 
ATOM   3852  C  C     . PRO A  1 470 ? -14.719 -0.758  68.662  1.00 66.38  ? 468 PRO A C     1 
ATOM   3853  O  O     . PRO A  1 470 ? -14.654 0.323   69.252  1.00 60.14  ? 468 PRO A O     1 
ATOM   3854  C  CB    . PRO A  1 470 ? -16.999 -1.741  69.121  1.00 54.83  ? 468 PRO A CB    1 
ATOM   3855  C  CG    . PRO A  1 470 ? -17.396 -1.100  70.409  1.00 55.05  ? 468 PRO A CG    1 
ATOM   3856  C  CD    . PRO A  1 470 ? -16.483 -1.671  71.460  1.00 52.65  ? 468 PRO A CD    1 
ATOM   3857  N  N     . LEU A  1 471 ? -14.136 -0.981  67.486  1.00 64.90  ? 469 LEU A N     1 
ATOM   3858  C  CA    . LEU A  1 471 ? -13.326 0.018   66.804  1.00 58.06  ? 469 LEU A CA    1 
ATOM   3859  C  C     . LEU A  1 471 ? -13.846 0.212   65.388  1.00 56.78  ? 469 LEU A C     1 
ATOM   3860  O  O     . LEU A  1 471 ? -14.293 -0.743  64.747  1.00 64.60  ? 469 LEU A O     1 
ATOM   3861  C  CB    . LEU A  1 471 ? -11.849 -0.397  66.771  1.00 54.21  ? 469 LEU A CB    1 
ATOM   3862  C  CG    . LEU A  1 471 ? -11.186 -0.668  68.124  1.00 49.02  ? 469 LEU A CG    1 
ATOM   3863  C  CD1   . LEU A  1 471 ? -9.850  -1.365  67.935  1.00 46.21  ? 469 LEU A CD1   1 
ATOM   3864  C  CD2   . LEU A  1 471 ? -11.008 0.628   68.899  1.00 52.50  ? 469 LEU A CD2   1 
ATOM   3865  N  N     . THR A  1 472 ? -13.786 1.450   64.905  1.00 56.17  ? 470 THR A N     1 
ATOM   3866  C  CA    . THR A  1 472 ? -14.218 1.792   63.558  1.00 58.49  ? 470 THR A CA    1 
ATOM   3867  C  C     . THR A  1 472 ? -13.030 2.305   62.756  1.00 73.64  ? 470 THR A C     1 
ATOM   3868  O  O     . THR A  1 472 ? -12.150 2.980   63.299  1.00 70.96  ? 470 THR A O     1 
ATOM   3869  C  CB    . THR A  1 472 ? -15.324 2.854   63.575  1.00 61.75  ? 470 THR A CB    1 
ATOM   3870  O  OG1   . THR A  1 472 ? -14.827 4.054   64.180  1.00 63.01  ? 470 THR A OG1   1 
ATOM   3871  C  CG2   . THR A  1 472 ? -16.528 2.359   64.361  1.00 61.86  ? 470 THR A CG2   1 
ATOM   3872  N  N     . ASN A  1 473 ? -13.015 1.979   61.463  1.00 73.22  ? 471 ASN A N     1 
ATOM   3873  C  CA    . ASN A  1 473 ? -11.961 2.393   60.538  1.00 75.39  ? 471 ASN A CA    1 
ATOM   3874  C  C     . ASN A  1 473 ? -10.583 1.987   61.070  1.00 77.99  ? 471 ASN A C     1 
ATOM   3875  O  O     . ASN A  1 473 ? -9.738  2.812   61.422  1.00 76.96  ? 471 ASN A O     1 
ATOM   3876  C  CB    . ASN A  1 473 ? -12.040 3.900   60.268  1.00 86.18  ? 471 ASN A CB    1 
ATOM   3877  C  CG    . ASN A  1 473 ? -11.102 4.347   59.162  1.00 104.38 ? 471 ASN A CG    1 
ATOM   3878  O  OD1   . ASN A  1 473 ? -11.358 4.109   57.982  1.00 111.32 ? 471 ASN A OD1   1 
ATOM   3879  N  ND2   . ASN A  1 473 ? -10.014 5.008   59.540  1.00 109.54 ? 471 ASN A ND2   1 
ATOM   3880  N  N     . THR A  1 474 ? -10.384 0.672   61.116  1.00 69.40  ? 472 THR A N     1 
ATOM   3881  C  CA    . THR A  1 474 ? -9.181  0.084   61.684  1.00 58.12  ? 472 THR A CA    1 
ATOM   3882  C  C     . THR A  1 474 ? -8.724  -1.067  60.797  1.00 57.95  ? 472 THR A C     1 
ATOM   3883  O  O     . THR A  1 474 ? -9.336  -1.370  59.768  1.00 65.80  ? 472 THR A O     1 
ATOM   3884  C  CB    . THR A  1 474 ? -9.428  -0.397  63.119  1.00 61.71  ? 472 THR A CB    1 
ATOM   3885  O  OG1   . THR A  1 474 ? -8.193  -0.831  63.701  1.00 60.10  ? 472 THR A OG1   1 
ATOM   3886  C  CG2   . THR A  1 474 ? -10.421 -1.552  63.128  1.00 50.90  ? 472 THR A CG2   1 
ATOM   3887  N  N     . THR A  1 475 ? -7.628  -1.706  61.201  1.00 49.32  ? 473 THR A N     1 
ATOM   3888  C  CA    . THR A  1 475 ? -7.084  -2.869  60.516  1.00 54.90  ? 473 THR A CA    1 
ATOM   3889  C  C     . THR A  1 475 ? -6.814  -3.965  61.538  1.00 57.25  ? 473 THR A C     1 
ATOM   3890  O  O     . THR A  1 475 ? -6.829  -3.731  62.750  1.00 56.74  ? 473 THR A O     1 
ATOM   3891  C  CB    . THR A  1 475 ? -5.789  -2.533  59.760  1.00 55.53  ? 473 THR A CB    1 
ATOM   3892  O  OG1   . THR A  1 475 ? -4.752  -2.226  60.701  1.00 49.40  ? 473 THR A OG1   1 
ATOM   3893  C  CG2   . THR A  1 475 ? -5.995  -1.342  58.832  1.00 55.15  ? 473 THR A CG2   1 
ATOM   3894  N  N     . ASN A  1 476 ? -6.564  -5.176  61.033  1.00 57.76  ? 474 ASN A N     1 
ATOM   3895  C  CA    . ASN A  1 476 ? -6.208  -6.284  61.916  1.00 50.33  ? 474 ASN A CA    1 
ATOM   3896  C  C     . ASN A  1 476 ? -4.958  -5.962  62.725  1.00 54.77  ? 474 ASN A C     1 
ATOM   3897  O  O     . ASN A  1 476 ? -4.876  -6.293  63.913  1.00 58.35  ? 474 ASN A O     1 
ATOM   3898  C  CB    . ASN A  1 476 ? -6.001  -7.563  61.104  1.00 54.92  ? 474 ASN A CB    1 
ATOM   3899  C  CG    . ASN A  1 476 ? -7.307  -8.219  60.703  1.00 79.85  ? 474 ASN A CG    1 
ATOM   3900  O  OD1   . ASN A  1 476 ? -8.250  -8.284  61.490  1.00 87.05  ? 474 ASN A OD1   1 
ATOM   3901  N  ND2   . ASN A  1 476 ? -7.367  -8.712  59.471  1.00 88.74  ? 474 ASN A ND2   1 
ATOM   3902  N  N     . GLN A  1 477 ? -3.977  -5.310  62.097  1.00 59.40  ? 475 GLN A N     1 
ATOM   3903  C  CA    . GLN A  1 477 ? -2.749  -4.962  62.804  1.00 53.69  ? 475 GLN A CA    1 
ATOM   3904  C  C     . GLN A  1 477 ? -3.009  -3.920  63.885  1.00 43.71  ? 475 GLN A C     1 
ATOM   3905  O  O     . GLN A  1 477 ? -2.436  -3.999  64.978  1.00 42.96  ? 475 GLN A O     1 
ATOM   3906  C  CB    . GLN A  1 477 ? -1.696  -4.458  61.816  1.00 60.77  ? 475 GLN A CB    1 
ATOM   3907  C  CG    . GLN A  1 477 ? -1.225  -5.495  60.805  1.00 69.92  ? 475 GLN A CG    1 
ATOM   3908  C  CD    . GLN A  1 477 ? -2.141  -5.604  59.600  1.00 83.25  ? 475 GLN A CD    1 
ATOM   3909  O  OE1   . GLN A  1 477 ? -3.234  -5.036  59.580  1.00 90.57  ? 475 GLN A OE1   1 
ATOM   3910  N  NE2   . GLN A  1 477 ? -1.695  -6.332  58.583  1.00 84.33  ? 475 GLN A NE2   1 
ATOM   3911  N  N     . LYS A  1 478 ? -3.869  -2.939  63.601  1.00 46.63  ? 476 LYS A N     1 
ATOM   3912  C  CA    . LYS A  1 478 ? -4.159  -1.904  64.589  1.00 44.27  ? 476 LYS A CA    1 
ATOM   3913  C  C     . LYS A  1 478 ? -4.894  -2.475  65.795  1.00 45.96  ? 476 LYS A C     1 
ATOM   3914  O  O     . LYS A  1 478 ? -4.613  -2.092  66.937  1.00 57.47  ? 476 LYS A O     1 
ATOM   3915  C  CB    . LYS A  1 478 ? -4.973  -0.777  63.953  1.00 44.07  ? 476 LYS A CB    1 
ATOM   3916  C  CG    . LYS A  1 478 ? -4.180  0.127   63.022  1.00 52.74  ? 476 LYS A CG    1 
ATOM   3917  C  CD    . LYS A  1 478 ? -5.037  1.276   62.516  1.00 59.65  ? 476 LYS A CD    1 
ATOM   3918  C  CE    . LYS A  1 478 ? -4.222  2.262   61.693  1.00 62.58  ? 476 LYS A CE    1 
ATOM   3919  N  NZ    . LYS A  1 478 ? -3.636  1.632   60.479  1.00 75.78  ? 476 LYS A NZ    1 
ATOM   3920  N  N     . THR A  1 479 ? -5.841  -3.390  65.565  1.00 42.33  ? 477 THR A N     1 
ATOM   3921  C  CA    . THR A  1 479 ? -6.584  -3.970  66.680  1.00 52.11  ? 477 THR A CA    1 
ATOM   3922  C  C     . THR A  1 479 ? -5.689  -4.825  67.567  1.00 47.76  ? 477 THR A C     1 
ATOM   3923  O  O     . THR A  1 479 ? -5.911  -4.895  68.781  1.00 49.93  ? 477 THR A O     1 
ATOM   3924  C  CB    . THR A  1 479 ? -7.762  -4.796  66.165  1.00 54.44  ? 477 THR A CB    1 
ATOM   3925  O  OG1   . THR A  1 479 ? -7.279  -5.857  65.332  1.00 60.78  ? 477 THR A OG1   1 
ATOM   3926  C  CG2   . THR A  1 479 ? -8.719  -3.922  65.367  1.00 45.45  ? 477 THR A CG2   1 
ATOM   3927  N  N     . GLU A  1 480 ? -4.680  -5.480  66.988  1.00 43.93  ? 478 GLU A N     1 
ATOM   3928  C  CA    . GLU A  1 480 ? -3.731  -6.228  67.806  1.00 48.29  ? 478 GLU A CA    1 
ATOM   3929  C  C     . GLU A  1 480 ? -2.905  -5.291  68.678  1.00 46.42  ? 478 GLU A C     1 
ATOM   3930  O  O     . GLU A  1 480 ? -2.685  -5.568  69.863  1.00 49.18  ? 478 GLU A O     1 
ATOM   3931  C  CB    . GLU A  1 480 ? -2.825  -7.083  66.918  1.00 48.92  ? 478 GLU A CB    1 
ATOM   3932  C  CG    . GLU A  1 480 ? -3.534  -8.231  66.204  1.00 59.17  ? 478 GLU A CG    1 
ATOM   3933  C  CD    . GLU A  1 480 ? -3.911  -9.373  67.136  1.00 76.06  ? 478 GLU A CD    1 
ATOM   3934  O  OE1   . GLU A  1 480 ? -3.521  -9.335  68.323  1.00 73.10  ? 478 GLU A OE1   1 
ATOM   3935  O  OE2   . GLU A  1 480 ? -4.597  -10.315 66.681  1.00 84.56  ? 478 GLU A OE2   1 
ATOM   3936  N  N     . LEU A  1 481 ? -2.441  -4.176  68.110  1.00 37.15  ? 479 LEU A N     1 
ATOM   3937  C  CA    . LEU A  1 481 ? -1.762  -3.165  68.913  1.00 36.54  ? 479 LEU A CA    1 
ATOM   3938  C  C     . LEU A  1 481 ? -2.708  -2.558  69.940  1.00 42.31  ? 479 LEU A C     1 
ATOM   3939  O  O     . LEU A  1 481 ? -2.318  -2.314  71.088  1.00 39.57  ? 479 LEU A O     1 
ATOM   3940  C  CB    . LEU A  1 481 ? -1.184  -2.076  68.010  1.00 46.60  ? 479 LEU A CB    1 
ATOM   3941  C  CG    . LEU A  1 481 ? 0.071   -2.414  67.207  1.00 47.45  ? 479 LEU A CG    1 
ATOM   3942  C  CD1   . LEU A  1 481 ? 0.391   -1.283  66.242  1.00 37.09  ? 479 LEU A CD1   1 
ATOM   3943  C  CD2   . LEU A  1 481 ? 1.244   -2.671  68.139  1.00 34.83  ? 479 LEU A CD2   1 
ATOM   3944  N  N     . GLN A  1 482 ? -3.960  -2.308  69.545  1.00 42.33  ? 480 GLN A N     1 
ATOM   3945  C  CA    . GLN A  1 482 ? -4.933  -1.741  70.472  1.00 46.61  ? 480 GLN A CA    1 
ATOM   3946  C  C     . GLN A  1 482 ? -5.196  -2.685  71.638  1.00 44.74  ? 480 GLN A C     1 
ATOM   3947  O  O     . GLN A  1 482 ? -5.344  -2.244  72.784  1.00 38.64  ? 480 GLN A O     1 
ATOM   3948  C  CB    . GLN A  1 482 ? -6.235  -1.422  69.736  1.00 41.09  ? 480 GLN A CB    1 
ATOM   3949  C  CG    . GLN A  1 482 ? -7.149  -0.464  70.481  1.00 63.95  ? 480 GLN A CG    1 
ATOM   3950  C  CD    . GLN A  1 482 ? -6.617  0.956   70.489  1.00 61.61  ? 480 GLN A CD    1 
ATOM   3951  O  OE1   . GLN A  1 482 ? -6.232  1.492   69.449  1.00 58.33  ? 480 GLN A OE1   1 
ATOM   3952  N  NE2   . GLN A  1 482 ? -6.588  1.572   71.666  1.00 57.69  ? 480 GLN A NE2   1 
ATOM   3953  N  N     . ALA A  1 483 ? -5.251  -3.991  71.364  1.00 38.19  ? 481 ALA A N     1 
ATOM   3954  C  CA    . ALA A  1 483 ? -5.466  -4.966  72.429  1.00 47.72  ? 481 ALA A CA    1 
ATOM   3955  C  C     . ALA A  1 483 ? -4.342  -4.917  73.457  1.00 47.24  ? 481 ALA A C     1 
ATOM   3956  O  O     . ALA A  1 483 ? -4.594  -4.979  74.667  1.00 47.06  ? 481 ALA A O     1 
ATOM   3957  C  CB    . ALA A  1 483 ? -5.592  -6.369  71.837  1.00 37.62  ? 481 ALA A CB    1 
ATOM   3958  N  N     . ILE A  1 484 ? -3.095  -4.805  72.995  1.00 35.63  ? 482 ILE A N     1 
ATOM   3959  C  CA    . ILE A  1 484 ? -1.968  -4.697  73.916  1.00 34.68  ? 482 ILE A CA    1 
ATOM   3960  C  C     . ILE A  1 484 ? -2.039  -3.389  74.694  1.00 45.70  ? 482 ILE A C     1 
ATOM   3961  O  O     . ILE A  1 484 ? -1.752  -3.348  75.897  1.00 39.72  ? 482 ILE A O     1 
ATOM   3962  C  CB    . ILE A  1 484 ? -0.641  -4.835  73.148  1.00 33.84  ? 482 ILE A CB    1 
ATOM   3963  C  CG1   . ILE A  1 484 ? -0.494  -6.254  72.595  1.00 33.56  ? 482 ILE A CG1   1 
ATOM   3964  C  CG2   . ILE A  1 484 ? 0.538   -4.479  74.040  1.00 33.09  ? 482 ILE A CG2   1 
ATOM   3965  C  CD1   . ILE A  1 484 ? 0.756   -6.462  71.778  1.00 36.40  ? 482 ILE A CD1   1 
ATOM   3966  N  N     . TYR A  1 485 ? -2.430  -2.301  74.024  1.00 37.88  ? 483 TYR A N     1 
ATOM   3967  C  CA    . TYR A  1 485 ? -2.589  -1.024  74.711  1.00 38.67  ? 483 TYR A CA    1 
ATOM   3968  C  C     . TYR A  1 485 ? -3.649  -1.114  75.802  1.00 45.55  ? 483 TYR A C     1 
ATOM   3969  O  O     . TYR A  1 485 ? -3.483  -0.546  76.888  1.00 42.92  ? 483 TYR A O     1 
ATOM   3970  C  CB    . TYR A  1 485 ? -2.938  0.070   73.701  1.00 38.87  ? 483 TYR A CB    1 
ATOM   3971  C  CG    . TYR A  1 485 ? -3.137  1.441   74.307  1.00 41.26  ? 483 TYR A CG    1 
ATOM   3972  C  CD1   . TYR A  1 485 ? -2.155  2.021   75.099  1.00 41.66  ? 483 TYR A CD1   1 
ATOM   3973  C  CD2   . TYR A  1 485 ? -4.299  2.164   74.071  1.00 42.12  ? 483 TYR A CD2   1 
ATOM   3974  C  CE1   . TYR A  1 485 ? -2.331  3.276   75.651  1.00 47.36  ? 483 TYR A CE1   1 
ATOM   3975  C  CE2   . TYR A  1 485 ? -4.482  3.421   74.616  1.00 49.23  ? 483 TYR A CE2   1 
ATOM   3976  C  CZ    . TYR A  1 485 ? -3.496  3.971   75.406  1.00 52.92  ? 483 TYR A CZ    1 
ATOM   3977  O  OH    . TYR A  1 485 ? -3.673  5.222   75.952  1.00 65.03  ? 483 TYR A OH    1 
ATOM   3978  N  N     . LEU A  1 486 ? -4.742  -1.836  75.536  1.00 44.80  ? 484 LEU A N     1 
ATOM   3979  C  CA    . LEU A  1 486 ? -5.772  -2.028  76.553  1.00 38.67  ? 484 LEU A CA    1 
ATOM   3980  C  C     . LEU A  1 486 ? -5.229  -2.794  77.752  1.00 56.68  ? 484 LEU A C     1 
ATOM   3981  O  O     . LEU A  1 486 ? -5.503  -2.436  78.903  1.00 44.42  ? 484 LEU A O     1 
ATOM   3982  C  CB    . LEU A  1 486 ? -6.973  -2.763  75.958  1.00 39.36  ? 484 LEU A CB    1 
ATOM   3983  C  CG    . LEU A  1 486 ? -7.803  -2.060  74.883  1.00 40.66  ? 484 LEU A CG    1 
ATOM   3984  C  CD1   . LEU A  1 486 ? -8.872  -3.001  74.354  1.00 41.31  ? 484 LEU A CD1   1 
ATOM   3985  C  CD2   . LEU A  1 486 ? -8.427  -0.788  75.430  1.00 42.04  ? 484 LEU A CD2   1 
ATOM   3986  N  N     . ALA A  1 487 ? -4.461  -3.858  77.500  1.00 36.74  ? 485 ALA A N     1 
ATOM   3987  C  CA    . ALA A  1 487 ? -3.916  -4.653  78.596  1.00 36.18  ? 485 ALA A CA    1 
ATOM   3988  C  C     . ALA A  1 487 ? -2.958  -3.834  79.449  1.00 43.85  ? 485 ALA A C     1 
ATOM   3989  O  O     . ALA A  1 487 ? -2.920  -3.990  80.674  1.00 47.42  ? 485 ALA A O     1 
ATOM   3990  C  CB    . ALA A  1 487 ? -3.213  -5.893  78.048  1.00 35.25  ? 485 ALA A CB    1 
ATOM   3991  N  N     . LEU A  1 488 ? -2.175  -2.957  78.819  1.00 44.95  ? 486 LEU A N     1 
ATOM   3992  C  CA    . LEU A  1 488 ? -1.273  -2.099  79.579  1.00 41.78  ? 486 LEU A CA    1 
ATOM   3993  C  C     . LEU A  1 488 ? -2.047  -1.054  80.373  1.00 39.23  ? 486 LEU A C     1 
ATOM   3994  O  O     . LEU A  1 488 ? -1.674  -0.724  81.505  1.00 42.14  ? 486 LEU A O     1 
ATOM   3995  C  CB    . LEU A  1 488 ? -0.270  -1.434  78.637  1.00 39.05  ? 486 LEU A CB    1 
ATOM   3996  C  CG    . LEU A  1 488 ? 0.698   -2.374  77.914  1.00 38.76  ? 486 LEU A CG    1 
ATOM   3997  C  CD1   . LEU A  1 488 ? 1.350   -1.671  76.735  1.00 33.78  ? 486 LEU A CD1   1 
ATOM   3998  C  CD2   . LEU A  1 488 ? 1.755   -2.898  78.874  1.00 33.50  ? 486 LEU A CD2   1 
ATOM   3999  N  N     . GLN A  1 489 ? -3.135  -0.530  79.802  1.00 42.34  ? 487 GLN A N     1 
ATOM   4000  C  CA    . GLN A  1 489 ? -3.914  0.492   80.493  1.00 39.47  ? 487 GLN A CA    1 
ATOM   4001  C  C     . GLN A  1 489 ? -4.576  -0.061  81.750  1.00 41.16  ? 487 GLN A C     1 
ATOM   4002  O  O     . GLN A  1 489 ? -4.628  0.617   82.782  1.00 41.03  ? 487 GLN A O     1 
ATOM   4003  C  CB    . GLN A  1 489 ? -4.974  1.071   79.557  1.00 40.49  ? 487 GLN A CB    1 
ATOM   4004  C  CG    . GLN A  1 489 ? -4.453  2.065   78.540  1.00 53.83  ? 487 GLN A CG    1 
ATOM   4005  C  CD    . GLN A  1 489 ? -5.572  2.763   77.792  1.00 67.16  ? 487 GLN A CD    1 
ATOM   4006  O  OE1   . GLN A  1 489 ? -6.428  2.118   77.186  1.00 70.62  ? 487 GLN A OE1   1 
ATOM   4007  N  NE2   . GLN A  1 489 ? -5.576  4.090   77.839  1.00 73.44  ? 487 GLN A NE2   1 
ATOM   4008  N  N     . ASP A  1 490 ? -5.087  -1.290  81.683  1.00 39.55  ? 488 ASP A N     1 
ATOM   4009  C  CA    . ASP A  1 490 ? -5.935  -1.839  82.731  1.00 42.78  ? 488 ASP A CA    1 
ATOM   4010  C  C     . ASP A  1 490 ? -5.196  -2.801  83.654  1.00 45.47  ? 488 ASP A C     1 
ATOM   4011  O  O     . ASP A  1 490 ? -5.840  -3.555  84.392  1.00 61.10  ? 488 ASP A O     1 
ATOM   4012  C  CB    . ASP A  1 490 ? -7.145  -2.538  82.113  1.00 45.33  ? 488 ASP A CB    1 
ATOM   4013  C  CG    . ASP A  1 490 ? -7.916  -1.640  81.169  1.00 50.02  ? 488 ASP A CG    1 
ATOM   4014  O  OD1   . ASP A  1 490 ? -7.791  -0.403  81.288  1.00 53.36  ? 488 ASP A OD1   1 
ATOM   4015  O  OD2   . ASP A  1 490 ? -8.649  -2.175  80.310  1.00 45.15  ? 488 ASP A OD2   1 
ATOM   4016  N  N     . SER A  1 491 ? -3.869  -2.793  83.635  1.00 47.30  ? 489 SER A N     1 
ATOM   4017  C  CA    . SER A  1 491 ? -3.081  -3.674  84.481  1.00 39.13  ? 489 SER A CA    1 
ATOM   4018  C  C     . SER A  1 491 ? -2.293  -2.873  85.510  1.00 38.91  ? 489 SER A C     1 
ATOM   4019  O  O     . SER A  1 491 ? -2.132  -1.654  85.399  1.00 44.58  ? 489 SER A O     1 
ATOM   4020  C  CB    . SER A  1 491 ? -2.122  -4.527  83.644  1.00 36.95  ? 489 SER A CB    1 
ATOM   4021  O  OG    . SER A  1 491 ? -1.290  -3.712  82.838  1.00 43.08  ? 489 SER A OG    1 
ATOM   4022  N  N     . GLY A  1 492 ? -1.807  -3.588  86.523  1.00 39.08  ? 490 GLY A N     1 
ATOM   4023  C  CA    . GLY A  1 492 ? -0.925  -3.016  87.517  1.00 39.73  ? 490 GLY A CA    1 
ATOM   4024  C  C     . GLY A  1 492 ? 0.470   -2.776  86.970  1.00 49.13  ? 490 GLY A C     1 
ATOM   4025  O  O     . GLY A  1 492 ? 0.729   -2.858  85.769  1.00 40.85  ? 490 GLY A O     1 
ATOM   4026  N  N     . LEU A  1 493 ? 1.392   -2.470  87.888  1.00 40.60  ? 491 LEU A N     1 
ATOM   4027  C  CA    . LEU A  1 493 ? 2.763   -2.161  87.492  1.00 44.50  ? 491 LEU A CA    1 
ATOM   4028  C  C     . LEU A  1 493 ? 3.485   -3.360  86.891  1.00 42.50  ? 491 LEU A C     1 
ATOM   4029  O  O     . LEU A  1 493 ? 4.447   -3.173  86.138  1.00 43.80  ? 491 LEU A O     1 
ATOM   4030  C  CB    . LEU A  1 493 ? 3.549   -1.627  88.690  1.00 45.25  ? 491 LEU A CB    1 
ATOM   4031  C  CG    . LEU A  1 493 ? 3.001   -0.334  89.295  1.00 51.76  ? 491 LEU A CG    1 
ATOM   4032  C  CD1   . LEU A  1 493 ? 3.852   0.116   90.470  1.00 53.88  ? 491 LEU A CD1   1 
ATOM   4033  C  CD2   . LEU A  1 493 ? 2.921   0.754   88.235  1.00 47.43  ? 491 LEU A CD2   1 
ATOM   4034  N  N     . GLU A  1 494 ? 3.050   -4.577  87.203  1.00 37.47  ? 492 GLU A N     1 
ATOM   4035  C  CA    . GLU A  1 494 ? 3.629   -5.793  86.651  1.00 36.57  ? 492 GLU A CA    1 
ATOM   4036  C  C     . GLU A  1 494 ? 2.537   -6.573  85.933  1.00 36.13  ? 492 GLU A C     1 
ATOM   4037  O  O     . GLU A  1 494 ? 1.439   -6.746  86.474  1.00 50.26  ? 492 GLU A O     1 
ATOM   4038  C  CB    . GLU A  1 494 ? 4.268   -6.641  87.751  1.00 41.40  ? 492 GLU A CB    1 
ATOM   4039  C  CG    . GLU A  1 494 ? 5.317   -5.894  88.556  1.00 43.36  ? 492 GLU A CG    1 
ATOM   4040  C  CD    . GLU A  1 494 ? 5.902   -6.731  89.675  1.00 57.32  ? 492 GLU A CD    1 
ATOM   4041  O  OE1   . GLU A  1 494 ? 5.386   -7.841  89.924  1.00 60.66  ? 492 GLU A OE1   1 
ATOM   4042  O  OE2   . GLU A  1 494 ? 6.880   -6.277  90.306  1.00 66.34  ? 492 GLU A OE2   1 
ATOM   4043  N  N     . VAL A  1 495 ? 2.835   -7.039  84.722  1.00 35.08  ? 493 VAL A N     1 
ATOM   4044  C  CA    . VAL A  1 495 ? 1.818   -7.655  83.876  1.00 35.65  ? 493 VAL A CA    1 
ATOM   4045  C  C     . VAL A  1 495 ? 2.484   -8.621  82.905  1.00 35.02  ? 493 VAL A C     1 
ATOM   4046  O  O     . VAL A  1 495 ? 3.554   -8.339  82.358  1.00 37.40  ? 493 VAL A O     1 
ATOM   4047  C  CB    . VAL A  1 495 ? 0.998   -6.581  83.128  1.00 34.71  ? 493 VAL A CB    1 
ATOM   4048  C  CG1   . VAL A  1 495 ? 1.913   -5.667  82.319  1.00 37.83  ? 493 VAL A CG1   1 
ATOM   4049  C  CG2   . VAL A  1 495 ? -0.052  -7.223  82.238  1.00 34.59  ? 493 VAL A CG2   1 
ATOM   4050  N  N     . ASN A  1 496 ? 1.847   -9.772  82.705  1.00 35.76  ? 494 ASN A N     1 
ATOM   4051  C  CA    . ASN A  1 496 ? 2.192   -10.699 81.636  1.00 33.66  ? 494 ASN A CA    1 
ATOM   4052  C  C     . ASN A  1 496 ? 1.139   -10.584 80.542  1.00 43.97  ? 494 ASN A C     1 
ATOM   4053  O  O     . ASN A  1 496 ? -0.062  -10.621 80.827  1.00 45.35  ? 494 ASN A O     1 
ATOM   4054  C  CB    . ASN A  1 496 ? 2.261   -12.140 82.147  1.00 41.05  ? 494 ASN A CB    1 
ATOM   4055  C  CG    . ASN A  1 496 ? 3.126   -12.284 83.382  1.00 45.98  ? 494 ASN A CG    1 
ATOM   4056  O  OD1   . ASN A  1 496 ? 4.354   -12.246 83.305  1.00 49.08  ? 494 ASN A OD1   1 
ATOM   4057  N  ND2   . ASN A  1 496 ? 2.486   -12.464 84.532  1.00 50.68  ? 494 ASN A ND2   1 
ATOM   4058  N  N     . ILE A  1 497 ? 1.586   -10.439 79.298  1.00 34.82  ? 495 ILE A N     1 
ATOM   4059  C  CA    . ILE A  1 497 ? 0.695   -10.238 78.162  1.00 32.95  ? 495 ILE A CA    1 
ATOM   4060  C  C     . ILE A  1 497 ? 0.966   -11.323 77.131  1.00 33.59  ? 495 ILE A C     1 
ATOM   4061  O  O     . ILE A  1 497 ? 2.112   -11.511 76.706  1.00 36.85  ? 495 ILE A O     1 
ATOM   4062  C  CB    . ILE A  1 497 ? 0.866   -8.838  77.546  1.00 32.61  ? 495 ILE A CB    1 
ATOM   4063  C  CG1   . ILE A  1 497 ? 0.567   -7.758  78.588  1.00 32.95  ? 495 ILE A CG1   1 
ATOM   4064  C  CG2   . ILE A  1 497 ? -0.038  -8.676  76.332  1.00 32.91  ? 495 ILE A CG2   1 
ATOM   4065  C  CD1   . ILE A  1 497 ? 0.743   -6.349  78.075  1.00 42.30  ? 495 ILE A CD1   1 
ATOM   4066  N  N     . VAL A  1 498 ? -0.088  -12.031 76.732  1.00 33.51  ? 496 VAL A N     1 
ATOM   4067  C  CA    . VAL A  1 498 ? -0.009  -13.099 75.742  1.00 33.79  ? 496 VAL A CA    1 
ATOM   4068  C  C     . VAL A  1 498 ? -0.734  -12.635 74.487  1.00 38.05  ? 496 VAL A C     1 
ATOM   4069  O  O     . VAL A  1 498 ? -1.918  -12.279 74.540  1.00 36.06  ? 496 VAL A O     1 
ATOM   4070  C  CB    . VAL A  1 498 ? -0.613  -14.409 76.272  1.00 34.63  ? 496 VAL A CB    1 
ATOM   4071  C  CG1   . VAL A  1 498 ? -0.626  -15.468 75.179  1.00 37.53  ? 496 VAL A CG1   1 
ATOM   4072  C  CG2   . VAL A  1 498 ? 0.160   -14.896 77.486  1.00 34.63  ? 496 VAL A CG2   1 
ATOM   4073  N  N     . THR A  1 499 ? -0.025  -12.640 73.361  1.00 33.82  ? 497 THR A N     1 
ATOM   4074  C  CA    . THR A  1 499 ? -0.587  -12.257 72.077  1.00 34.27  ? 497 THR A CA    1 
ATOM   4075  C  C     . THR A  1 499 ? -0.194  -13.284 71.025  1.00 41.37  ? 497 THR A C     1 
ATOM   4076  O  O     . THR A  1 499 ? 0.789   -14.014 71.178  1.00 37.57  ? 497 THR A O     1 
ATOM   4077  C  CB    . THR A  1 499 ? -0.114  -10.862 71.639  1.00 33.74  ? 497 THR A CB    1 
ATOM   4078  O  OG1   . THR A  1 499 ? -0.552  -10.604 70.300  1.00 37.89  ? 497 THR A OG1   1 
ATOM   4079  C  CG2   . THR A  1 499 ? 1.402   -10.771 71.695  1.00 32.90  ? 497 THR A CG2   1 
ATOM   4080  N  N     . ASP A  1 500 ? -0.983  -13.340 69.954  1.00 35.62  ? 498 ASP A N     1 
ATOM   4081  C  CA    . ASP A  1 500 ? -0.652  -14.147 68.788  1.00 40.54  ? 498 ASP A CA    1 
ATOM   4082  C  C     . ASP A  1 500 ? -0.152  -13.300 67.627  1.00 49.77  ? 498 ASP A C     1 
ATOM   4083  O  O     . ASP A  1 500 ? 0.093   -13.834 66.541  1.00 62.63  ? 498 ASP A O     1 
ATOM   4084  C  CB    . ASP A  1 500 ? -1.861  -14.983 68.350  1.00 47.03  ? 498 ASP A CB    1 
ATOM   4085  C  CG    . ASP A  1 500 ? -3.044  -14.133 67.907  1.00 51.02  ? 498 ASP A CG    1 
ATOM   4086  O  OD1   . ASP A  1 500 ? -2.944  -13.443 66.871  1.00 62.24  ? 498 ASP A OD1   1 
ATOM   4087  O  OD2   . ASP A  1 500 ? -4.090  -14.172 68.587  1.00 68.53  ? 498 ASP A OD2   1 
ATOM   4088  N  N     . SER A  1 501 ? 0.009   -11.997 67.835  1.00 51.12  ? 499 SER A N     1 
ATOM   4089  C  CA    . SER A  1 501 ? 0.364   -11.067 66.769  1.00 44.94  ? 499 SER A CA    1 
ATOM   4090  C  C     . SER A  1 501 ? 1.880   -11.020 66.620  1.00 43.06  ? 499 SER A C     1 
ATOM   4091  O  O     . SER A  1 501 ? 2.575   -10.430 67.452  1.00 48.83  ? 499 SER A O     1 
ATOM   4092  C  CB    . SER A  1 501 ? -0.194  -9.678  67.066  1.00 38.39  ? 499 SER A CB    1 
ATOM   4093  O  OG    . SER A  1 501 ? 0.295   -8.727  66.138  1.00 42.49  ? 499 SER A OG    1 
ATOM   4094  N  N     . GLN A  1 502 ? 2.392   -11.642 65.554  1.00 57.77  ? 500 GLN A N     1 
ATOM   4095  C  CA    . GLN A  1 502 ? 3.803   -11.479 65.222  1.00 52.59  ? 500 GLN A CA    1 
ATOM   4096  C  C     . GLN A  1 502 ? 4.125   -10.028 64.896  1.00 40.78  ? 500 GLN A C     1 
ATOM   4097  O  O     . GLN A  1 502 ? 5.238   -9.561  65.166  1.00 41.76  ? 500 GLN A O     1 
ATOM   4098  C  CB    . GLN A  1 502 ? 4.180   -12.377 64.042  1.00 45.65  ? 500 GLN A CB    1 
ATOM   4099  C  CG    . GLN A  1 502 ? 3.766   -13.831 64.193  1.00 66.35  ? 500 GLN A CG    1 
ATOM   4100  C  CD    . GLN A  1 502 ? 4.262   -14.693 63.046  1.00 78.20  ? 500 GLN A CD    1 
ATOM   4101  O  OE1   . GLN A  1 502 ? 5.162   -14.299 62.303  1.00 76.16  ? 500 GLN A OE1   1 
ATOM   4102  N  NE2   . GLN A  1 502 ? 3.676   -15.876 62.896  1.00 84.51  ? 500 GLN A NE2   1 
ATOM   4103  N  N     . TYR A  1 503 ? 3.162   -9.302  64.323  1.00 41.09  ? 501 TYR A N     1 
ATOM   4104  C  CA    . TYR A  1 503 ? 3.372   -7.903  63.970  1.00 36.79  ? 501 TYR A CA    1 
ATOM   4105  C  C     . TYR A  1 503 ? 3.606   -7.050  65.212  1.00 47.63  ? 501 TYR A C     1 
ATOM   4106  O  O     . TYR A  1 503 ? 4.616   -6.346  65.320  1.00 54.67  ? 501 TYR A O     1 
ATOM   4107  C  CB    . TYR A  1 503 ? 2.173   -7.386  63.175  1.00 36.59  ? 501 TYR A CB    1 
ATOM   4108  C  CG    . TYR A  1 503 ? 2.113   -5.881  63.062  1.00 41.09  ? 501 TYR A CG    1 
ATOM   4109  C  CD1   . TYR A  1 503 ? 2.956   -5.198  62.197  1.00 37.70  ? 501 TYR A CD1   1 
ATOM   4110  C  CD2   . TYR A  1 503 ? 1.210   -5.142  63.816  1.00 36.91  ? 501 TYR A CD2   1 
ATOM   4111  C  CE1   . TYR A  1 503 ? 2.906   -3.821  62.089  1.00 42.60  ? 501 TYR A CE1   1 
ATOM   4112  C  CE2   . TYR A  1 503 ? 1.151   -3.765  63.715  1.00 37.34  ? 501 TYR A CE2   1 
ATOM   4113  C  CZ    . TYR A  1 503 ? 2.001   -3.110  62.849  1.00 49.02  ? 501 TYR A CZ    1 
ATOM   4114  O  OH    . TYR A  1 503 ? 1.949   -1.739  62.743  1.00 47.38  ? 501 TYR A OH    1 
ATOM   4115  N  N     . ALA A  1 504 ? 2.673   -7.105  66.166  1.00 43.50  ? 502 ALA A N     1 
ATOM   4116  C  CA    . ALA A  1 504 ? 2.788   -6.280  67.364  1.00 44.80  ? 502 ALA A CA    1 
ATOM   4117  C  C     . ALA A  1 504 ? 3.992   -6.683  68.207  1.00 45.91  ? 502 ALA A C     1 
ATOM   4118  O  O     . ALA A  1 504 ? 4.718   -5.819  68.712  1.00 41.53  ? 502 ALA A O     1 
ATOM   4119  C  CB    . ALA A  1 504 ? 1.503   -6.368  68.186  1.00 47.47  ? 502 ALA A CB    1 
ATOM   4120  N  N     . LEU A  1 505 ? 4.222   -7.990  68.368  1.00 39.86  ? 503 LEU A N     1 
ATOM   4121  C  CA    . LEU A  1 505 ? 5.353   -8.447  69.169  1.00 40.84  ? 503 LEU A CA    1 
ATOM   4122  C  C     . LEU A  1 505 ? 6.677   -8.007  68.559  1.00 49.12  ? 503 LEU A C     1 
ATOM   4123  O  O     . LEU A  1 505 ? 7.604   -7.620  69.281  1.00 54.12  ? 503 LEU A O     1 
ATOM   4124  C  CB    . LEU A  1 505 ? 5.314   -9.968  69.315  1.00 44.06  ? 503 LEU A CB    1 
ATOM   4125  C  CG    . LEU A  1 505 ? 6.395   -10.571 70.213  1.00 60.16  ? 503 LEU A CG    1 
ATOM   4126  C  CD1   . LEU A  1 505 ? 6.073   -10.321 71.676  1.00 53.67  ? 503 LEU A CD1   1 
ATOM   4127  C  CD2   . LEU A  1 505 ? 6.560   -12.055 69.938  1.00 67.08  ? 503 LEU A CD2   1 
ATOM   4128  N  N     . GLY A  1 506 ? 6.787   -8.062  67.230  1.00 41.99  ? 504 GLY A N     1 
ATOM   4129  C  CA    . GLY A  1 506 ? 8.020   -7.653  66.581  1.00 48.76  ? 504 GLY A CA    1 
ATOM   4130  C  C     . GLY A  1 506 ? 8.346   -6.188  66.789  1.00 50.22  ? 504 GLY A C     1 
ATOM   4131  O  O     . GLY A  1 506 ? 9.519   -5.816  66.882  1.00 56.52  ? 504 GLY A O     1 
ATOM   4132  N  N     . ILE A  1 507 ? 7.322   -5.337  66.866  1.00 44.19  ? 505 ILE A N     1 
ATOM   4133  C  CA    . ILE A  1 507 ? 7.554   -3.918  67.112  1.00 40.26  ? 505 ILE A CA    1 
ATOM   4134  C  C     . ILE A  1 507 ? 8.038   -3.697  68.540  1.00 42.63  ? 505 ILE A C     1 
ATOM   4135  O  O     . ILE A  1 507 ? 9.045   -3.020  68.775  1.00 47.18  ? 505 ILE A O     1 
ATOM   4136  C  CB    . ILE A  1 507 ? 6.279   -3.106  66.825  1.00 38.49  ? 505 ILE A CB    1 
ATOM   4137  C  CG1   . ILE A  1 507 ? 5.900   -3.197  65.347  1.00 46.23  ? 505 ILE A CG1   1 
ATOM   4138  C  CG2   . ILE A  1 507 ? 6.467   -1.654  67.242  1.00 40.29  ? 505 ILE A CG2   1 
ATOM   4139  C  CD1   . ILE A  1 507 ? 4.631   -2.445  65.003  1.00 45.34  ? 505 ILE A CD1   1 
ATOM   4140  N  N     . ILE A  1 508 ? 7.335   -4.278  69.514  1.00 37.10  ? 506 ILE A N     1 
ATOM   4141  C  CA    . ILE A  1 508 ? 7.602   -3.967  70.914  1.00 39.26  ? 506 ILE A CA    1 
ATOM   4142  C  C     . ILE A  1 508 ? 8.917   -4.587  71.371  1.00 39.20  ? 506 ILE A C     1 
ATOM   4143  O  O     . ILE A  1 508 ? 9.648   -3.995  72.176  1.00 40.27  ? 506 ILE A O     1 
ATOM   4144  C  CB    . ILE A  1 508 ? 6.420   -4.422  71.789  1.00 34.48  ? 506 ILE A CB    1 
ATOM   4145  C  CG1   . ILE A  1 508 ? 5.132   -3.739  71.326  1.00 35.61  ? 506 ILE A CG1   1 
ATOM   4146  C  CG2   . ILE A  1 508 ? 6.688   -4.108  73.251  1.00 36.15  ? 506 ILE A CG2   1 
ATOM   4147  C  CD1   . ILE A  1 508 ? 3.888   -4.230  72.032  1.00 31.57  ? 506 ILE A CD1   1 
ATOM   4148  N  N     . GLN A  1 509 ? 9.248   -5.780  70.865  1.00 36.96  ? 507 GLN A N     1 
ATOM   4149  C  CA    . GLN A  1 509 ? 10.470  -6.452  71.300  1.00 34.22  ? 507 GLN A CA    1 
ATOM   4150  C  C     . GLN A  1 509 ? 11.717  -5.641  70.969  1.00 38.15  ? 507 GLN A C     1 
ATOM   4151  O  O     . GLN A  1 509 ? 12.725  -5.744  71.677  1.00 40.31  ? 507 GLN A O     1 
ATOM   4152  C  CB    . GLN A  1 509 ? 10.565  -7.845  70.675  1.00 36.74  ? 507 GLN A CB    1 
ATOM   4153  C  CG    . GLN A  1 509 ? 9.724   -8.900  71.375  1.00 55.58  ? 507 GLN A CG    1 
ATOM   4154  C  CD    . GLN A  1 509 ? 9.956   -10.293 70.821  1.00 60.52  ? 507 GLN A CD    1 
ATOM   4155  O  OE1   . GLN A  1 509 ? 10.484  -10.457 69.721  1.00 68.80  ? 507 GLN A OE1   1 
ATOM   4156  N  NE2   . GLN A  1 509 ? 9.567   -11.306 71.587  1.00 48.97  ? 507 GLN A NE2   1 
ATOM   4157  N  N     . ALA A  1 510 ? 11.668  -4.826  69.918  1.00 32.74  ? 508 ALA A N     1 
ATOM   4158  C  CA    . ALA A  1 510 ? 12.798  -3.991  69.532  1.00 36.83  ? 508 ALA A CA    1 
ATOM   4159  C  C     . ALA A  1 510 ? 12.948  -2.749  70.411  1.00 40.52  ? 508 ALA A C     1 
ATOM   4160  O  O     . ALA A  1 510 ? 13.757  -1.878  70.085  1.00 38.32  ? 508 ALA A O     1 
ATOM   4161  C  CB    . ALA A  1 510 ? 12.672  -3.574  68.065  1.00 31.11  ? 508 ALA A CB    1 
ATOM   4162  N  N     . GLN A  1 511 ? 12.193  -2.661  71.503  1.00 29.30  ? 509 GLN A N     1 
ATOM   4163  C  CA    . GLN A  1 511 ? 12.250  -1.583  72.487  1.00 34.15  ? 509 GLN A CA    1 
ATOM   4164  C  C     . GLN A  1 511 ? 12.265  -0.185  71.841  1.00 39.78  ? 509 GLN A C     1 
ATOM   4165  O  O     . GLN A  1 511 ? 13.168  0.613   72.105  1.00 42.20  ? 509 GLN A O     1 
ATOM   4166  C  CB    . GLN A  1 511 ? 13.448  -1.764  73.414  1.00 32.64  ? 509 GLN A CB    1 
ATOM   4167  C  CG    . GLN A  1 511 ? 13.486  -3.065  74.197  1.00 35.91  ? 509 GLN A CG    1 
ATOM   4168  C  CD    . GLN A  1 511 ? 14.804  -3.237  74.932  1.00 43.21  ? 509 GLN A CD    1 
ATOM   4169  O  OE1   . GLN A  1 511 ? 15.637  -4.064  74.556  1.00 47.04  ? 509 GLN A OE1   1 
ATOM   4170  N  NE2   . GLN A  1 511 ? 15.013  -2.431  75.965  1.00 37.56  ? 509 GLN A NE2   1 
ATOM   4171  N  N     . PRO A  1 512 ? 11.280  0.132   70.997  1.00 33.85  ? 510 PRO A N     1 
ATOM   4172  C  CA    . PRO A  1 512 ? 11.223  1.481   70.430  1.00 32.07  ? 510 PRO A CA    1 
ATOM   4173  C  C     . PRO A  1 512 ? 10.843  2.498   71.492  1.00 34.81  ? 510 PRO A C     1 
ATOM   4174  O  O     . PRO A  1 512 ? 10.099  2.204   72.431  1.00 44.32  ? 510 PRO A O     1 
ATOM   4175  C  CB    . PRO A  1 512 ? 10.141  1.369   69.351  1.00 32.93  ? 510 PRO A CB    1 
ATOM   4176  C  CG    . PRO A  1 512 ? 9.247   0.303   69.852  1.00 31.44  ? 510 PRO A CG    1 
ATOM   4177  C  CD    . PRO A  1 512 ? 10.135  -0.687  70.554  1.00 32.81  ? 510 PRO A CD    1 
ATOM   4178  N  N     . ASP A  1 513 ? 11.387  3.706   71.346  1.00 32.47  ? 511 ASP A N     1 
ATOM   4179  C  CA    . ASP A  1 513 ? 11.024  4.827   72.198  1.00 37.00  ? 511 ASP A CA    1 
ATOM   4180  C  C     . ASP A  1 513 ? 10.354  5.949   71.422  1.00 38.13  ? 511 ASP A C     1 
ATOM   4181  O  O     . ASP A  1 513 ? 9.946   6.947   72.027  1.00 38.71  ? 511 ASP A O     1 
ATOM   4182  C  CB    . ASP A  1 513 ? 12.259  5.364   72.942  1.00 38.02  ? 511 ASP A CB    1 
ATOM   4183  C  CG    . ASP A  1 513 ? 13.380  5.797   72.005  1.00 45.74  ? 511 ASP A CG    1 
ATOM   4184  O  OD1   . ASP A  1 513 ? 13.105  6.170   70.844  1.00 41.88  ? 511 ASP A OD1   1 
ATOM   4185  O  OD2   . ASP A  1 513 ? 14.551  5.759   72.439  1.00 39.80  ? 511 ASP A OD2   1 
ATOM   4186  N  N     . LYS A  1 514 ? 10.241  5.816   70.103  1.00 35.97  ? 512 LYS A N     1 
ATOM   4187  C  CA    . LYS A  1 514 ? 9.594   6.804   69.256  1.00 40.77  ? 512 LYS A CA    1 
ATOM   4188  C  C     . LYS A  1 514 ? 8.979   6.075   68.072  1.00 41.68  ? 512 LYS A C     1 
ATOM   4189  O  O     . LYS A  1 514 ? 9.466   5.019   67.657  1.00 42.24  ? 512 LYS A O     1 
ATOM   4190  C  CB    . LYS A  1 514 ? 10.583  7.875   68.779  1.00 37.02  ? 512 LYS A CB    1 
ATOM   4191  C  CG    . LYS A  1 514 ? 11.731  7.325   67.943  1.00 54.18  ? 512 LYS A CG    1 
ATOM   4192  C  CD    . LYS A  1 514 ? 12.678  8.427   67.488  1.00 65.85  ? 512 LYS A CD    1 
ATOM   4193  C  CE    . LYS A  1 514 ? 13.446  9.026   68.659  1.00 63.53  ? 512 LYS A CE    1 
ATOM   4194  N  NZ    . LYS A  1 514 ? 14.361  8.038   69.300  1.00 49.73  ? 512 LYS A NZ    1 
ATOM   4195  N  N     . SER A  1 515 ? 7.901   6.638   67.533  1.00 37.22  ? 513 SER A N     1 
ATOM   4196  C  CA    . SER A  1 515 ? 7.199   5.978   66.444  1.00 37.43  ? 513 SER A CA    1 
ATOM   4197  C  C     . SER A  1 515 ? 6.424   7.006   65.637  1.00 46.78  ? 513 SER A C     1 
ATOM   4198  O  O     . SER A  1 515 ? 5.993   8.035   66.164  1.00 57.21  ? 513 SER A O     1 
ATOM   4199  C  CB    . SER A  1 515 ? 6.248   4.895   66.967  1.00 37.86  ? 513 SER A CB    1 
ATOM   4200  O  OG    . SER A  1 515 ? 5.525   4.293   65.906  1.00 39.48  ? 513 SER A OG    1 
ATOM   4201  N  N     . GLU A  1 516 ? 6.255   6.712   64.348  1.00 39.87  ? 514 GLU A N     1 
ATOM   4202  C  CA    . GLU A  1 516 ? 5.353   7.495   63.515  1.00 55.25  ? 514 GLU A CA    1 
ATOM   4203  C  C     . GLU A  1 516 ? 3.892   7.173   63.792  1.00 51.89  ? 514 GLU A C     1 
ATOM   4204  O  O     . GLU A  1 516 ? 3.012   7.890   63.305  1.00 56.80  ? 514 GLU A O     1 
ATOM   4205  C  CB    . GLU A  1 516 ? 5.671   7.260   62.037  1.00 55.39  ? 514 GLU A CB    1 
ATOM   4206  C  CG    . GLU A  1 516 ? 7.091   7.636   61.644  1.00 73.96  ? 514 GLU A CG    1 
ATOM   4207  C  CD    . GLU A  1 516 ? 7.454   7.170   60.247  1.00 83.83  ? 514 GLU A CD    1 
ATOM   4208  O  OE1   . GLU A  1 516 ? 6.604   6.529   59.593  1.00 82.52  ? 514 GLU A OE1   1 
ATOM   4209  O  OE2   . GLU A  1 516 ? 8.591   7.441   59.806  1.00 82.46  ? 514 GLU A OE2   1 
ATOM   4210  N  N     . SER A  1 517 ? 3.620   6.121   64.559  1.00 44.14  ? 515 SER A N     1 
ATOM   4211  C  CA    . SER A  1 517 ? 2.266   5.727   64.921  1.00 51.93  ? 515 SER A CA    1 
ATOM   4212  C  C     . SER A  1 517 ? 1.943   6.269   66.308  1.00 56.73  ? 515 SER A C     1 
ATOM   4213  O  O     . SER A  1 517 ? 2.660   5.980   67.274  1.00 60.34  ? 515 SER A O     1 
ATOM   4214  C  CB    . SER A  1 517 ? 2.119   4.206   64.891  1.00 44.17  ? 515 SER A CB    1 
ATOM   4215  O  OG    . SER A  1 517 ? 0.906   3.796   65.497  1.00 45.40  ? 515 SER A OG    1 
ATOM   4216  N  N     . GLU A  1 518 ? 0.871   7.060   66.400  1.00 56.80  ? 516 GLU A N     1 
ATOM   4217  C  CA    . GLU A  1 518 ? 0.435   7.569   67.697  1.00 60.82  ? 516 GLU A CA    1 
ATOM   4218  C  C     . GLU A  1 518 ? 0.093   6.428   68.646  1.00 55.42  ? 516 GLU A C     1 
ATOM   4219  O  O     . GLU A  1 518 ? 0.351   6.514   69.853  1.00 61.02  ? 516 GLU A O     1 
ATOM   4220  C  CB    . GLU A  1 518 ? -0.767  8.497   67.515  1.00 71.02  ? 516 GLU A CB    1 
ATOM   4221  C  CG    . GLU A  1 518 ? -1.386  8.984   68.816  1.00 83.96  ? 516 GLU A CG    1 
ATOM   4222  C  CD    . GLU A  1 518 ? -2.654  9.786   68.594  1.00 106.38 ? 516 GLU A CD    1 
ATOM   4223  O  OE1   . GLU A  1 518 ? -3.014  10.024  67.421  1.00 112.02 ? 516 GLU A OE1   1 
ATOM   4224  O  OE2   . GLU A  1 518 ? -3.294  10.177  69.594  1.00 108.88 ? 516 GLU A OE2   1 
ATOM   4225  N  N     . LEU A  1 519 ? -0.480  5.344   68.116  1.00 45.55  ? 517 LEU A N     1 
ATOM   4226  C  CA    . LEU A  1 519 ? -0.845  4.211   68.959  1.00 40.63  ? 517 LEU A CA    1 
ATOM   4227  C  C     . LEU A  1 519 ? 0.387   3.553   69.568  1.00 48.64  ? 517 LEU A C     1 
ATOM   4228  O  O     . LEU A  1 519 ? 0.384   3.189   70.750  1.00 50.67  ? 517 LEU A O     1 
ATOM   4229  C  CB    . LEU A  1 519 ? -1.655  3.198   68.149  1.00 40.82  ? 517 LEU A CB    1 
ATOM   4230  C  CG    . LEU A  1 519 ? -2.172  1.969   68.898  1.00 41.39  ? 517 LEU A CG    1 
ATOM   4231  C  CD1   . LEU A  1 519 ? -2.890  2.381   70.173  1.00 41.84  ? 517 LEU A CD1   1 
ATOM   4232  C  CD2   . LEU A  1 519 ? -3.094  1.158   68.004  1.00 40.60  ? 517 LEU A CD2   1 
ATOM   4233  N  N     . VAL A  1 520 ? 1.451   3.392   68.778  1.00 48.67  ? 518 VAL A N     1 
ATOM   4234  C  CA    . VAL A  1 520 ? 2.679   2.802   69.306  1.00 48.57  ? 518 VAL A CA    1 
ATOM   4235  C  C     . VAL A  1 520 ? 3.293   3.712   70.363  1.00 47.30  ? 518 VAL A C     1 
ATOM   4236  O  O     . VAL A  1 520 ? 3.808   3.241   71.384  1.00 41.95  ? 518 VAL A O     1 
ATOM   4237  C  CB    . VAL A  1 520 ? 3.668   2.505   68.163  1.00 39.71  ? 518 VAL A CB    1 
ATOM   4238  C  CG1   . VAL A  1 520 ? 4.982   1.974   68.718  1.00 34.61  ? 518 VAL A CG1   1 
ATOM   4239  C  CG2   . VAL A  1 520 ? 3.064   1.507   67.187  1.00 36.18  ? 518 VAL A CG2   1 
ATOM   4240  N  N     . ASN A  1 521 ? 3.236   5.028   70.142  1.00 43.34  ? 519 ASN A N     1 
ATOM   4241  C  CA    . ASN A  1 521 ? 3.758   5.967   71.132  1.00 45.12  ? 519 ASN A CA    1 
ATOM   4242  C  C     . ASN A  1 521 ? 2.989   5.870   72.444  1.00 44.95  ? 519 ASN A C     1 
ATOM   4243  O  O     . ASN A  1 521 ? 3.578   5.972   73.526  1.00 43.64  ? 519 ASN A O     1 
ATOM   4244  C  CB    . ASN A  1 521 ? 3.709   7.394   70.586  1.00 39.78  ? 519 ASN A CB    1 
ATOM   4245  C  CG    . ASN A  1 521 ? 4.764   7.651   69.530  1.00 44.07  ? 519 ASN A CG    1 
ATOM   4246  O  OD1   . ASN A  1 521 ? 5.843   7.058   69.556  1.00 51.36  ? 519 ASN A OD1   1 
ATOM   4247  N  ND2   . ASN A  1 521 ? 4.458   8.541   68.594  1.00 44.44  ? 519 ASN A ND2   1 
ATOM   4248  N  N     . GLN A  1 522 ? 1.670   5.673   72.368  1.00 46.08  ? 520 GLN A N     1 
ATOM   4249  C  CA    . GLN A  1 522 ? 0.889   5.460   73.582  1.00 46.36  ? 520 GLN A CA    1 
ATOM   4250  C  C     . GLN A  1 522 ? 1.285   4.157   74.264  1.00 43.87  ? 520 GLN A C     1 
ATOM   4251  O  O     . GLN A  1 522 ? 1.368   4.094   75.496  1.00 48.08  ? 520 GLN A O     1 
ATOM   4252  C  CB    . GLN A  1 522 ? -0.603  5.465   73.255  1.00 44.48  ? 520 GLN A CB    1 
ATOM   4253  C  CG    . GLN A  1 522 ? -1.117  6.798   72.741  1.00 56.48  ? 520 GLN A CG    1 
ATOM   4254  C  CD    . GLN A  1 522 ? -2.567  6.734   72.308  1.00 61.54  ? 520 GLN A CD    1 
ATOM   4255  O  OE1   . GLN A  1 522 ? -3.080  5.667   71.969  1.00 70.07  ? 520 GLN A OE1   1 
ATOM   4256  N  NE2   . GLN A  1 522 ? -3.239  7.879   72.323  1.00 65.40  ? 520 GLN A NE2   1 
ATOM   4257  N  N     . ILE A  1 523 ? 1.536   3.107   73.478  1.00 37.10  ? 521 ILE A N     1 
ATOM   4258  C  CA    . ILE A  1 523 ? 2.009   1.846   74.042  1.00 42.53  ? 521 ILE A CA    1 
ATOM   4259  C  C     . ILE A  1 523 ? 3.373   2.035   74.691  1.00 51.64  ? 521 ILE A C     1 
ATOM   4260  O  O     . ILE A  1 523 ? 3.630   1.525   75.788  1.00 51.70  ? 521 ILE A O     1 
ATOM   4261  C  CB    . ILE A  1 523 ? 2.038   0.756   72.954  1.00 40.08  ? 521 ILE A CB    1 
ATOM   4262  C  CG1   . ILE A  1 523 ? 0.613   0.378   72.544  1.00 35.42  ? 521 ILE A CG1   1 
ATOM   4263  C  CG2   . ILE A  1 523 ? 2.815   -0.466  73.429  1.00 33.43  ? 521 ILE A CG2   1 
ATOM   4264  C  CD1   . ILE A  1 523 ? 0.542   -0.718  71.511  1.00 35.02  ? 521 ILE A CD1   1 
ATOM   4265  N  N     . ILE A  1 524 ? 4.264   2.776   74.029  1.00 44.02  ? 522 ILE A N     1 
ATOM   4266  C  CA    . ILE A  1 524 ? 5.582   3.047   74.599  1.00 39.60  ? 522 ILE A CA    1 
ATOM   4267  C  C     . ILE A  1 524 ? 5.447   3.786   75.924  1.00 35.13  ? 522 ILE A C     1 
ATOM   4268  O  O     . ILE A  1 524 ? 6.140   3.472   76.900  1.00 39.21  ? 522 ILE A O     1 
ATOM   4269  C  CB    . ILE A  1 524 ? 6.446   3.833   73.595  1.00 41.58  ? 522 ILE A CB    1 
ATOM   4270  C  CG1   . ILE A  1 524 ? 6.781   2.965   72.380  1.00 42.43  ? 522 ILE A CG1   1 
ATOM   4271  C  CG2   . ILE A  1 524 ? 7.718   4.335   74.261  1.00 34.34  ? 522 ILE A CG2   1 
ATOM   4272  C  CD1   . ILE A  1 524 ? 7.468   3.717   71.261  1.00 33.97  ? 522 ILE A CD1   1 
ATOM   4273  N  N     . GLU A  1 525 ? 4.547   4.772   75.983  1.00 47.15  ? 523 GLU A N     1 
ATOM   4274  C  CA    . GLU A  1 525 ? 4.346   5.522   77.220  1.00 37.56  ? 523 GLU A CA    1 
ATOM   4275  C  C     . GLU A  1 525 ? 3.886   4.611   78.351  1.00 40.89  ? 523 GLU A C     1 
ATOM   4276  O  O     . GLU A  1 525 ? 4.318   4.768   79.500  1.00 47.02  ? 523 GLU A O     1 
ATOM   4277  C  CB    . GLU A  1 525 ? 3.336   6.647   76.994  1.00 42.93  ? 523 GLU A CB    1 
ATOM   4278  C  CG    . GLU A  1 525 ? 3.069   7.498   78.226  1.00 79.29  ? 523 GLU A CG    1 
ATOM   4279  C  CD    . GLU A  1 525 ? 2.073   8.612   77.965  1.00 101.69 ? 523 GLU A CD    1 
ATOM   4280  O  OE1   . GLU A  1 525 ? 1.524   8.669   76.844  1.00 110.62 ? 523 GLU A OE1   1 
ATOM   4281  O  OE2   . GLU A  1 525 ? 1.841   9.432   78.879  1.00 108.90 ? 523 GLU A OE2   1 
ATOM   4282  N  N     . GLN A  1 526 ? 3.011   3.649   78.046  1.00 42.28  ? 524 GLN A N     1 
ATOM   4283  C  CA    . GLN A  1 526 ? 2.560   2.706   79.064  1.00 38.14  ? 524 GLN A CA    1 
ATOM   4284  C  C     . GLN A  1 526 ? 3.684   1.770   79.489  1.00 39.93  ? 524 GLN A C     1 
ATOM   4285  O  O     . GLN A  1 526 ? 3.830   1.468   80.679  1.00 40.86  ? 524 GLN A O     1 
ATOM   4286  C  CB    . GLN A  1 526 ? 1.366   1.904   78.547  1.00 37.69  ? 524 GLN A CB    1 
ATOM   4287  C  CG    . GLN A  1 526 ? 0.126   2.734   78.276  1.00 41.89  ? 524 GLN A CG    1 
ATOM   4288  C  CD    . GLN A  1 526 ? -0.526  3.239   79.547  1.00 52.98  ? 524 GLN A CD    1 
ATOM   4289  O  OE1   . GLN A  1 526 ? -0.442  2.602   80.597  1.00 50.77  ? 524 GLN A OE1   1 
ATOM   4290  N  NE2   . GLN A  1 526 ? -1.178  4.392   79.459  1.00 56.80  ? 524 GLN A NE2   1 
ATOM   4291  N  N     . LEU A  1 527 ? 4.485   1.297   78.529  1.00 47.71  ? 525 LEU A N     1 
ATOM   4292  C  CA    . LEU A  1 527 ? 5.589   0.401   78.856  1.00 43.11  ? 525 LEU A CA    1 
ATOM   4293  C  C     . LEU A  1 527 ? 6.599   1.059   79.787  1.00 49.57  ? 525 LEU A C     1 
ATOM   4294  O  O     . LEU A  1 527 ? 7.187   0.383   80.638  1.00 50.43  ? 525 LEU A O     1 
ATOM   4295  C  CB    . LEU A  1 527 ? 6.278   -0.068  77.574  1.00 33.36  ? 525 LEU A CB    1 
ATOM   4296  C  CG    . LEU A  1 527 ? 5.480   -1.048  76.714  1.00 40.53  ? 525 LEU A CG    1 
ATOM   4297  C  CD1   . LEU A  1 527 ? 6.119   -1.201  75.344  1.00 31.57  ? 525 LEU A CD1   1 
ATOM   4298  C  CD2   . LEU A  1 527 ? 5.369   -2.397  77.411  1.00 31.76  ? 525 LEU A CD2   1 
ATOM   4299  N  N     . ILE A  1 528 ? 6.813   2.369   79.643  1.00 46.09  ? 526 ILE A N     1 
ATOM   4300  C  CA    . ILE A  1 528 ? 7.741   3.072   80.523  1.00 45.92  ? 526 ILE A CA    1 
ATOM   4301  C  C     . ILE A  1 528 ? 7.192   3.127   81.944  1.00 46.08  ? 526 ILE A C     1 
ATOM   4302  O  O     . ILE A  1 528 ? 7.938   2.976   82.918  1.00 58.75  ? 526 ILE A O     1 
ATOM   4303  C  CB    . ILE A  1 528 ? 8.033   4.478   79.966  1.00 36.12  ? 526 ILE A CB    1 
ATOM   4304  C  CG1   . ILE A  1 528 ? 8.744   4.376   78.613  1.00 35.18  ? 526 ILE A CG1   1 
ATOM   4305  C  CG2   . ILE A  1 528 ? 8.861   5.292   80.954  1.00 37.79  ? 526 ILE A CG2   1 
ATOM   4306  C  CD1   . ILE A  1 528 ? 9.021   5.711   77.957  1.00 44.70  ? 526 ILE A CD1   1 
ATOM   4307  N  N     . LYS A  1 529 ? 5.880   3.334   82.086  1.00 45.95  ? 527 LYS A N     1 
ATOM   4308  C  CA    . LYS A  1 529 ? 5.283   3.437   83.414  1.00 39.21  ? 527 LYS A CA    1 
ATOM   4309  C  C     . LYS A  1 529 ? 5.324   2.112   84.163  1.00 39.11  ? 527 LYS A C     1 
ATOM   4310  O  O     . LYS A  1 529 ? 5.362   2.102   85.399  1.00 50.01  ? 527 LYS A O     1 
ATOM   4311  C  CB    . LYS A  1 529 ? 3.841   3.931   83.306  1.00 43.40  ? 527 LYS A CB    1 
ATOM   4312  C  CG    . LYS A  1 529 ? 3.702   5.345   82.774  1.00 62.43  ? 527 LYS A CG    1 
ATOM   4313  C  CD    . LYS A  1 529 ? 2.241   5.765   82.726  1.00 70.57  ? 527 LYS A CD    1 
ATOM   4314  C  CE    . LYS A  1 529 ? 2.086   7.178   82.188  1.00 78.37  ? 527 LYS A CE    1 
ATOM   4315  N  NZ    . LYS A  1 529 ? 0.658   7.593   82.120  1.00 77.93  ? 527 LYS A NZ    1 
ATOM   4316  N  N     . LYS A  1 530 ? 5.316   0.993   83.445  1.00 36.41  ? 528 LYS A N     1 
ATOM   4317  C  CA    . LYS A  1 530 ? 5.306   -0.308  84.093  1.00 43.77  ? 528 LYS A CA    1 
ATOM   4318  C  C     . LYS A  1 530 ? 6.631   -0.573  84.803  1.00 37.60  ? 528 LYS A C     1 
ATOM   4319  O  O     . LYS A  1 530 ? 7.661   0.040   84.513  1.00 50.72  ? 528 LYS A O     1 
ATOM   4320  C  CB    . LYS A  1 530 ? 5.042   -1.415  83.075  1.00 34.89  ? 528 LYS A CB    1 
ATOM   4321  C  CG    . LYS A  1 530 ? 3.698   -1.330  82.380  1.00 40.65  ? 528 LYS A CG    1 
ATOM   4322  C  CD    . LYS A  1 530 ? 2.557   -1.512  83.362  1.00 43.36  ? 528 LYS A CD    1 
ATOM   4323  C  CE    . LYS A  1 530 ? 1.216   -1.454  82.654  1.00 38.95  ? 528 LYS A CE    1 
ATOM   4324  N  NZ    . LYS A  1 530 ? 0.079   -1.475  83.615  1.00 41.44  ? 528 LYS A NZ    1 
ATOM   4325  N  N     . GLU A  1 531 ? 6.589   -1.506  85.752  1.00 40.17  ? 529 GLU A N     1 
ATOM   4326  C  CA    . GLU A  1 531 ? 7.791   -1.989  86.419  1.00 43.24  ? 529 GLU A CA    1 
ATOM   4327  C  C     . GLU A  1 531 ? 8.297   -3.298  85.832  1.00 46.09  ? 529 GLU A C     1 
ATOM   4328  O  O     . GLU A  1 531 ? 9.511   -3.502  85.740  1.00 52.04  ? 529 GLU A O     1 
ATOM   4329  C  CB    . GLU A  1 531 ? 7.538   -2.163  87.920  1.00 43.10  ? 529 GLU A CB    1 
ATOM   4330  C  CG    . GLU A  1 531 ? 7.245   -0.862  88.653  1.00 61.06  ? 529 GLU A CG    1 
ATOM   4331  C  CD    . GLU A  1 531 ? 7.200   -1.037  90.160  1.00 79.36  ? 529 GLU A CD    1 
ATOM   4332  O  OE1   . GLU A  1 531 ? 7.614   -0.105  90.881  1.00 89.65  ? 529 GLU A OE1   1 
ATOM   4333  O  OE2   . GLU A  1 531 ? 6.755   -2.109  90.622  1.00 85.87  ? 529 GLU A OE2   1 
ATOM   4334  N  N     . LYS A  1 532 ? 7.392   -4.186  85.424  1.00 40.59  ? 530 LYS A N     1 
ATOM   4335  C  CA    . LYS A  1 532 ? 7.765   -5.449  84.799  1.00 38.66  ? 530 LYS A CA    1 
ATOM   4336  C  C     . LYS A  1 532 ? 6.720   -5.812  83.755  1.00 49.50  ? 530 LYS A C     1 
ATOM   4337  O  O     . LYS A  1 532 ? 5.524   -5.842  84.058  1.00 63.78  ? 530 LYS A O     1 
ATOM   4338  C  CB    . LYS A  1 532 ? 7.889   -6.570  85.839  1.00 38.31  ? 530 LYS A CB    1 
ATOM   4339  C  CG    . LYS A  1 532 ? 9.100   -6.460  86.750  1.00 45.16  ? 530 LYS A CG    1 
ATOM   4340  C  CD    . LYS A  1 532 ? 9.173   -7.628  87.717  1.00 57.26  ? 530 LYS A CD    1 
ATOM   4341  C  CE    . LYS A  1 532 ? 10.421  -7.550  88.580  1.00 58.19  ? 530 LYS A CE    1 
ATOM   4342  N  NZ    . LYS A  1 532 ? 10.535  -8.718  89.496  1.00 69.68  ? 530 LYS A NZ    1 
ATOM   4343  N  N     . VAL A  1 533 ? 7.171   -6.076  82.530  1.00 36.22  ? 531 VAL A N     1 
ATOM   4344  C  CA    . VAL A  1 533 ? 6.302   -6.511  81.442  1.00 32.77  ? 531 VAL A CA    1 
ATOM   4345  C  C     . VAL A  1 533 ? 6.918   -7.745  80.802  1.00 41.68  ? 531 VAL A C     1 
ATOM   4346  O  O     . VAL A  1 533 ? 8.103   -7.740  80.450  1.00 37.74  ? 531 VAL A O     1 
ATOM   4347  C  CB    . VAL A  1 533 ? 6.096   -5.414  80.381  1.00 34.11  ? 531 VAL A CB    1 
ATOM   4348  C  CG1   . VAL A  1 533 ? 5.185   -5.918  79.269  1.00 31.57  ? 531 VAL A CG1   1 
ATOM   4349  C  CG2   . VAL A  1 533 ? 5.519   -4.171  81.006  1.00 32.56  ? 531 VAL A CG2   1 
ATOM   4350  N  N     . TYR A  1 534 ? 6.117   -8.794  80.647  1.00 33.34  ? 532 TYR A N     1 
ATOM   4351  C  CA    . TYR A  1 534 ? 6.534   -10.003 79.950  1.00 31.80  ? 532 TYR A CA    1 
ATOM   4352  C  C     . TYR A  1 534 ? 5.589   -10.241 78.782  1.00 35.24  ? 532 TYR A C     1 
ATOM   4353  O  O     . TYR A  1 534 ? 4.391   -10.468 78.985  1.00 41.85  ? 532 TYR A O     1 
ATOM   4354  C  CB    . TYR A  1 534 ? 6.547   -11.211 80.888  1.00 32.56  ? 532 TYR A CB    1 
ATOM   4355  C  CG    . TYR A  1 534 ? 6.876   -12.512 80.190  1.00 41.49  ? 532 TYR A CG    1 
ATOM   4356  C  CD1   . TYR A  1 534 ? 8.177   -12.803 79.796  1.00 42.77  ? 532 TYR A CD1   1 
ATOM   4357  C  CD2   . TYR A  1 534 ? 5.885   -13.449 79.924  1.00 36.95  ? 532 TYR A CD2   1 
ATOM   4358  C  CE1   . TYR A  1 534 ? 8.483   -13.991 79.158  1.00 37.29  ? 532 TYR A CE1   1 
ATOM   4359  C  CE2   . TYR A  1 534 ? 6.180   -14.639 79.286  1.00 45.68  ? 532 TYR A CE2   1 
ATOM   4360  C  CZ    . TYR A  1 534 ? 7.480   -14.905 78.906  1.00 45.55  ? 532 TYR A CZ    1 
ATOM   4361  O  OH    . TYR A  1 534 ? 7.773   -16.090 78.271  1.00 46.54  ? 532 TYR A OH    1 
ATOM   4362  N  N     . LEU A  1 535 ? 6.126   -10.181 77.566  1.00 36.50  ? 533 LEU A N     1 
ATOM   4363  C  CA    . LEU A  1 535 ? 5.370   -10.473 76.357  1.00 33.80  ? 533 LEU A CA    1 
ATOM   4364  C  C     . LEU A  1 535 ? 5.657   -11.897 75.908  1.00 44.41  ? 533 LEU A C     1 
ATOM   4365  O  O     . LEU A  1 535 ? 6.818   -12.272 75.716  1.00 59.27  ? 533 LEU A O     1 
ATOM   4366  C  CB    . LEU A  1 535 ? 5.723   -9.501  75.231  1.00 42.92  ? 533 LEU A CB    1 
ATOM   4367  C  CG    . LEU A  1 535 ? 5.260   -8.050  75.330  1.00 56.81  ? 533 LEU A CG    1 
ATOM   4368  C  CD1   . LEU A  1 535 ? 5.509   -7.359  74.005  1.00 64.20  ? 533 LEU A CD1   1 
ATOM   4369  C  CD2   . LEU A  1 535 ? 3.795   -7.967  75.706  1.00 64.68  ? 533 LEU A CD2   1 
ATOM   4370  N  N     . ALA A  1 536 ? 4.600   -12.682 75.734  1.00 41.32  ? 534 ALA A N     1 
ATOM   4371  C  CA    . ALA A  1 536 ? 4.705   -14.038 75.224  1.00 32.90  ? 534 ALA A CA    1 
ATOM   4372  C  C     . ALA A  1 536 ? 3.873   -14.168 73.957  1.00 35.35  ? 534 ALA A C     1 
ATOM   4373  O  O     . ALA A  1 536 ? 2.855   -13.489 73.790  1.00 35.65  ? 534 ALA A O     1 
ATOM   4374  C  CB    . ALA A  1 536 ? 4.244   -15.065 76.262  1.00 45.49  ? 534 ALA A CB    1 
ATOM   4375  N  N     . TRP A  1 537 ? 4.315   -15.047 73.063  1.00 39.74  ? 535 TRP A N     1 
ATOM   4376  C  CA    . TRP A  1 537 ? 3.639   -15.280 71.797  1.00 33.88  ? 535 TRP A CA    1 
ATOM   4377  C  C     . TRP A  1 537 ? 3.167   -16.724 71.717  1.00 35.02  ? 535 TRP A C     1 
ATOM   4378  O  O     . TRP A  1 537 ? 3.867   -17.644 72.152  1.00 50.19  ? 535 TRP A O     1 
ATOM   4379  C  CB    . TRP A  1 537 ? 4.555   -14.967 70.611  1.00 33.76  ? 535 TRP A CB    1 
ATOM   4380  C  CG    . TRP A  1 537 ? 3.897   -15.170 69.276  1.00 43.62  ? 535 TRP A CG    1 
ATOM   4381  C  CD1   . TRP A  1 537 ? 3.163   -14.256 68.576  1.00 39.34  ? 535 TRP A CD1   1 
ATOM   4382  C  CD2   . TRP A  1 537 ? 3.915   -16.362 68.481  1.00 40.05  ? 535 TRP A CD2   1 
ATOM   4383  N  NE1   . TRP A  1 537 ? 2.722   -14.806 67.396  1.00 43.69  ? 535 TRP A NE1   1 
ATOM   4384  C  CE2   . TRP A  1 537 ? 3.171   -16.098 67.313  1.00 42.97  ? 535 TRP A CE2   1 
ATOM   4385  C  CE3   . TRP A  1 537 ? 4.488   -17.627 68.643  1.00 37.34  ? 535 TRP A CE3   1 
ATOM   4386  C  CZ2   . TRP A  1 537 ? 2.986   -17.050 66.313  1.00 46.53  ? 535 TRP A CZ2   1 
ATOM   4387  C  CZ3   . TRP A  1 537 ? 4.302   -18.572 67.650  1.00 42.65  ? 535 TRP A CZ3   1 
ATOM   4388  C  CH2   . TRP A  1 537 ? 3.558   -18.279 66.500  1.00 42.80  ? 535 TRP A CH2   1 
ATOM   4389  N  N     . VAL A  1 538 ? 1.973   -16.911 71.165  1.00 35.74  ? 536 VAL A N     1 
ATOM   4390  C  CA    . VAL A  1 538 ? 1.434   -18.238 70.883  1.00 49.29  ? 536 VAL A CA    1 
ATOM   4391  C  C     . VAL A  1 538 ? 0.879   -18.222 69.463  1.00 44.86  ? 536 VAL A C     1 
ATOM   4392  O  O     . VAL A  1 538 ? 0.467   -17.160 68.975  1.00 46.14  ? 536 VAL A O     1 
ATOM   4393  C  CB    . VAL A  1 538 ? 0.356   -18.643 71.902  1.00 48.70  ? 536 VAL A CB    1 
ATOM   4394  C  CG1   . VAL A  1 538 ? 0.971   -18.849 73.279  1.00 37.13  ? 536 VAL A CG1   1 
ATOM   4395  C  CG2   . VAL A  1 538 ? -0.749  -17.599 71.956  1.00 37.19  ? 536 VAL A CG2   1 
ATOM   4396  N  N     . PRO A  1 539 ? 0.863   -19.351 68.759  1.00 44.59  ? 537 PRO A N     1 
ATOM   4397  C  CA    . PRO A  1 539 ? 0.241   -19.370 67.431  1.00 51.79  ? 537 PRO A CA    1 
ATOM   4398  C  C     . PRO A  1 539 ? -1.270  -19.238 67.537  1.00 55.08  ? 537 PRO A C     1 
ATOM   4399  O  O     . PRO A  1 539 ? -1.905  -19.819 68.420  1.00 46.65  ? 537 PRO A O     1 
ATOM   4400  C  CB    . PRO A  1 539 ? 0.651   -20.734 66.864  1.00 49.52  ? 537 PRO A CB    1 
ATOM   4401  C  CG    . PRO A  1 539 ? 0.903   -21.576 68.065  1.00 49.44  ? 537 PRO A CG    1 
ATOM   4402  C  CD    . PRO A  1 539 ? 1.470   -20.648 69.104  1.00 47.58  ? 537 PRO A CD    1 
ATOM   4403  N  N     . ALA A  1 540 ? -1.841  -18.455 66.627  1.00 56.04  ? 538 ALA A N     1 
ATOM   4404  C  CA    . ALA A  1 540 ? -3.277  -18.235 66.634  1.00 55.35  ? 538 ALA A CA    1 
ATOM   4405  C  C     . ALA A  1 540 ? -4.014  -19.472 66.128  1.00 60.17  ? 538 ALA A C     1 
ATOM   4406  O  O     . ALA A  1 540 ? -3.454  -20.324 65.431  1.00 69.44  ? 538 ALA A O     1 
ATOM   4407  C  CB    . ALA A  1 540 ? -3.637  -17.020 65.779  1.00 56.66  ? 538 ALA A CB    1 
ATOM   4408  N  N     . HIS A  1 541 ? -5.290  -19.567 66.509  1.00 61.92  ? 539 HIS A N     1 
ATOM   4409  C  CA    . HIS A  1 541 ? -6.195  -20.612 66.023  1.00 63.59  ? 539 HIS A CA    1 
ATOM   4410  C  C     . HIS A  1 541 ? -5.656  -22.010 66.329  1.00 63.39  ? 539 HIS A C     1 
ATOM   4411  O  O     . HIS A  1 541 ? -5.612  -22.889 65.466  1.00 69.31  ? 539 HIS A O     1 
ATOM   4412  C  CB    . HIS A  1 541 ? -6.467  -20.441 64.526  1.00 61.24  ? 539 HIS A CB    1 
ATOM   4413  C  CG    . HIS A  1 541 ? -6.795  -19.035 64.130  1.00 79.75  ? 539 HIS A CG    1 
ATOM   4414  N  ND1   . HIS A  1 541 ? -7.931  -18.385 64.563  1.00 86.91  ? 539 HIS A ND1   1 
ATOM   4415  C  CD2   . HIS A  1 541 ? -6.135  -18.153 63.343  1.00 80.64  ? 539 HIS A CD2   1 
ATOM   4416  C  CE1   . HIS A  1 541 ? -7.956  -17.164 64.060  1.00 88.95  ? 539 HIS A CE1   1 
ATOM   4417  N  NE2   . HIS A  1 541 ? -6.878  -16.998 63.315  1.00 86.07  ? 539 HIS A NE2   1 
ATOM   4418  N  N     . LYS A  1 542 ? -5.244  -22.214 67.582  1.00 64.44  ? 540 LYS A N     1 
ATOM   4419  C  CA    . LYS A  1 542 ? -4.723  -23.501 68.025  1.00 61.37  ? 540 LYS A CA    1 
ATOM   4420  C  C     . LYS A  1 542 ? -5.334  -23.958 69.344  1.00 67.86  ? 540 LYS A C     1 
ATOM   4421  O  O     . LYS A  1 542 ? -4.918  -24.993 69.878  1.00 78.94  ? 540 LYS A O     1 
ATOM   4422  C  CB    . LYS A  1 542 ? -3.194  -23.449 68.150  1.00 66.41  ? 540 LYS A CB    1 
ATOM   4423  C  CG    . LYS A  1 542 ? -2.466  -23.317 66.821  1.00 71.17  ? 540 LYS A CG    1 
ATOM   4424  C  CD    . LYS A  1 542 ? -2.705  -24.533 65.940  1.00 74.07  ? 540 LYS A CD    1 
ATOM   4425  C  CE    . LYS A  1 542 ? -2.056  -24.363 64.578  1.00 78.46  ? 540 LYS A CE    1 
ATOM   4426  N  NZ    . LYS A  1 542 ? -2.244  -25.563 63.718  1.00 88.30  ? 540 LYS A NZ    1 
ATOM   4427  N  N     . GLY A  1 543 ? -6.309  -23.223 69.876  1.00 61.45  ? 541 GLY A N     1 
ATOM   4428  C  CA    . GLY A  1 543 ? -6.898  -23.577 71.155  1.00 60.44  ? 541 GLY A CA    1 
ATOM   4429  C  C     . GLY A  1 543 ? -5.927  -23.513 72.311  1.00 66.75  ? 541 GLY A C     1 
ATOM   4430  O  O     . GLY A  1 543 ? -6.031  -24.312 73.248  1.00 74.05  ? 541 GLY A O     1 
ATOM   4431  N  N     . ILE A  1 544 ? -4.980  -22.582 72.269  1.00 70.69  ? 542 ILE A N     1 
ATOM   4432  C  CA    . ILE A  1 544 ? -3.949  -22.466 73.294  1.00 78.81  ? 542 ILE A CA    1 
ATOM   4433  C  C     . ILE A  1 544 ? -4.408  -21.459 74.337  1.00 90.68  ? 542 ILE A C     1 
ATOM   4434  O  O     . ILE A  1 544 ? -4.728  -20.313 74.003  1.00 96.30  ? 542 ILE A O     1 
ATOM   4435  C  CB    . ILE A  1 544 ? -2.604  -22.041 72.686  1.00 68.86  ? 542 ILE A CB    1 
ATOM   4436  C  CG1   . ILE A  1 544 ? -2.089  -23.101 71.712  1.00 66.37  ? 542 ILE A CG1   1 
ATOM   4437  C  CG2   . ILE A  1 544 ? -1.587  -21.768 73.784  1.00 69.24  ? 542 ILE A CG2   1 
ATOM   4438  C  CD1   . ILE A  1 544 ? -0.739  -22.765 71.128  1.00 68.57  ? 542 ILE A CD1   1 
ATOM   4439  N  N     . GLY A  1 545 ? -4.431  -21.884 75.597  1.00 93.23  ? 543 GLY A N     1 
ATOM   4440  C  CA    . GLY A  1 545 ? -4.692  -21.055 76.757  1.00 84.49  ? 543 GLY A CA    1 
ATOM   4441  C  C     . GLY A  1 545 ? -5.904  -20.165 76.583  1.00 70.19  ? 543 GLY A C     1 
ATOM   4442  O  O     . GLY A  1 545 ? -6.891  -20.519 75.930  1.00 76.88  ? 543 GLY A O     1 
ATOM   4443  N  N     . GLY A  1 546 ? -5.828  -18.982 77.191  1.00 66.26  ? 544 GLY A N     1 
ATOM   4444  C  CA    . GLY A  1 546 ? -6.873  -17.989 77.042  1.00 65.15  ? 544 GLY A CA    1 
ATOM   4445  C  C     . GLY A  1 546 ? -6.900  -17.310 75.690  1.00 68.16  ? 544 GLY A C     1 
ATOM   4446  O  O     . GLY A  1 546 ? -7.864  -16.595 75.398  1.00 65.06  ? 544 GLY A O     1 
ATOM   4447  N  N     . ASN A  1 547 ? -5.866  -17.513 74.867  1.00 61.71  ? 545 ASN A N     1 
ATOM   4448  C  CA    . ASN A  1 547 ? -5.870  -16.962 73.515  1.00 54.74  ? 545 ASN A CA    1 
ATOM   4449  C  C     . ASN A  1 547 ? -7.063  -17.464 72.714  1.00 60.18  ? 545 ASN A C     1 
ATOM   4450  O  O     . ASN A  1 547 ? -7.612  -16.727 71.887  1.00 61.95  ? 545 ASN A O     1 
ATOM   4451  C  CB    . ASN A  1 547 ? -4.561  -17.312 72.806  1.00 57.70  ? 545 ASN A CB    1 
ATOM   4452  C  CG    . ASN A  1 547 ? -4.574  -16.938 71.336  1.00 56.74  ? 545 ASN A CG    1 
ATOM   4453  O  OD1   . ASN A  1 547 ? -4.914  -17.755 70.479  1.00 48.35  ? 545 ASN A OD1   1 
ATOM   4454  N  ND2   . ASN A  1 547 ? -4.203  -15.698 71.037  1.00 55.76  ? 545 ASN A ND2   1 
ATOM   4455  N  N     . GLU A  1 548 ? -7.479  -18.711 72.947  1.00 56.28  ? 546 GLU A N     1 
ATOM   4456  C  CA    . GLU A  1 548 ? -8.689  -19.221 72.310  1.00 66.72  ? 546 GLU A CA    1 
ATOM   4457  C  C     . GLU A  1 548 ? -9.926  -18.492 72.820  1.00 68.42  ? 546 GLU A C     1 
ATOM   4458  O  O     . GLU A  1 548 ? -10.871 -18.251 72.059  1.00 63.53  ? 546 GLU A O     1 
ATOM   4459  C  CB    . GLU A  1 548 ? -8.811  -20.724 72.557  1.00 74.46  ? 546 GLU A CB    1 
ATOM   4460  C  CG    . GLU A  1 548 ? -10.069 -21.356 71.987  1.00 82.17  ? 546 GLU A CG    1 
ATOM   4461  C  CD    . GLU A  1 548 ? -10.219 -22.811 72.383  1.00 92.51  ? 546 GLU A CD    1 
ATOM   4462  O  OE1   . GLU A  1 548 ? -9.471  -23.267 73.274  1.00 90.08  ? 546 GLU A OE1   1 
ATOM   4463  O  OE2   . GLU A  1 548 ? -11.084 -23.499 71.802  1.00 100.23 ? 546 GLU A OE2   1 
ATOM   4464  N  N     . GLN A  1 549 ? -9.934  -18.125 74.103  1.00 65.27  ? 547 GLN A N     1 
ATOM   4465  C  CA    . GLN A  1 549 ? -11.110 -17.490 74.690  1.00 64.35  ? 547 GLN A CA    1 
ATOM   4466  C  C     . GLN A  1 549 ? -11.273 -16.060 74.189  1.00 62.28  ? 547 GLN A C     1 
ATOM   4467  O  O     . GLN A  1 549 ? -12.373 -15.648 73.803  1.00 64.15  ? 547 GLN A O     1 
ATOM   4468  C  CB    . GLN A  1 549 ? -11.011 -17.520 76.215  1.00 67.36  ? 547 GLN A CB    1 
ATOM   4469  C  CG    . GLN A  1 549 ? -10.583 -18.866 76.784  1.00 76.44  ? 547 GLN A CG    1 
ATOM   4470  C  CD    . GLN A  1 549 ? -11.542 -19.987 76.431  1.00 90.25  ? 547 GLN A CD    1 
ATOM   4471  O  OE1   . GLN A  1 549 ? -12.744 -19.769 76.275  1.00 98.11  ? 547 GLN A OE1   1 
ATOM   4472  N  NE2   . GLN A  1 549 ? -11.011 -21.197 76.300  1.00 93.91  ? 547 GLN A NE2   1 
ATOM   4473  N  N     . VAL A  1 550 ? -10.186 -15.284 74.189  1.00 60.10  ? 548 VAL A N     1 
ATOM   4474  C  CA    . VAL A  1 550 ? -10.270 -13.904 73.726  1.00 55.21  ? 548 VAL A CA    1 
ATOM   4475  C  C     . VAL A  1 550 ? -10.513 -13.854 72.222  1.00 56.89  ? 548 VAL A C     1 
ATOM   4476  O  O     . VAL A  1 550 ? -11.070 -12.875 71.708  1.00 58.06  ? 548 VAL A O     1 
ATOM   4477  C  CB    . VAL A  1 550 ? -8.998  -13.132 74.131  1.00 55.54  ? 548 VAL A CB    1 
ATOM   4478  C  CG1   . VAL A  1 550 ? -7.771  -13.724 73.454  1.00 51.49  ? 548 VAL A CG1   1 
ATOM   4479  C  CG2   . VAL A  1 550 ? -9.139  -11.647 73.815  1.00 39.97  ? 548 VAL A CG2   1 
ATOM   4480  N  N     . ASP A  1 551 ? -10.121 -14.903 71.495  1.00 56.24  ? 549 ASP A N     1 
ATOM   4481  C  CA    . ASP A  1 551 ? -10.364 -14.937 70.056  1.00 59.50  ? 549 ASP A CA    1 
ATOM   4482  C  C     . ASP A  1 551 ? -11.856 -14.973 69.750  1.00 57.29  ? 549 ASP A C     1 
ATOM   4483  O  O     . ASP A  1 551 ? -12.311 -14.371 68.770  1.00 62.89  ? 549 ASP A O     1 
ATOM   4484  C  CB    . ASP A  1 551 ? -9.660  -16.141 69.433  1.00 62.51  ? 549 ASP A CB    1 
ATOM   4485  C  CG    . ASP A  1 551 ? -9.906  -16.252 67.942  1.00 63.72  ? 549 ASP A CG    1 
ATOM   4486  O  OD1   . ASP A  1 551 ? -9.326  -15.450 67.180  1.00 66.22  ? 549 ASP A OD1   1 
ATOM   4487  O  OD2   . ASP A  1 551 ? -10.684 -17.139 67.531  1.00 73.32  ? 549 ASP A OD2   1 
ATOM   4488  N  N     . LYS A  1 552 ? -12.635 -15.675 70.577  1.00 53.55  ? 550 LYS A N     1 
ATOM   4489  C  CA    . LYS A  1 552 ? -14.080 -15.718 70.377  1.00 61.43  ? 550 LYS A CA    1 
ATOM   4490  C  C     . LYS A  1 552 ? -14.709 -14.349 70.604  1.00 62.56  ? 550 LYS A C     1 
ATOM   4491  O  O     . LYS A  1 552 ? -15.670 -13.979 69.919  1.00 71.15  ? 550 LYS A O     1 
ATOM   4492  C  CB    . LYS A  1 552 ? -14.711 -16.751 71.310  1.00 67.44  ? 550 LYS A CB    1 
ATOM   4493  C  CG    . LYS A  1 552 ? -14.095 -18.136 71.232  1.00 84.60  ? 550 LYS A CG    1 
ATOM   4494  C  CD    . LYS A  1 552 ? -14.664 -19.039 72.316  1.00 97.92  ? 550 LYS A CD    1 
ATOM   4495  C  CE    . LYS A  1 552 ? -13.990 -20.402 72.319  1.00 105.90 ? 550 LYS A CE    1 
ATOM   4496  N  NZ    . LYS A  1 552 ? -14.490 -21.264 73.426  1.00 108.61 ? 550 LYS A NZ    1 
ATOM   4497  N  N     . LEU A  1 553 ? -14.178 -13.583 71.559  1.00 48.38  ? 551 LEU A N     1 
ATOM   4498  C  CA    . LEU A  1 553 ? -14.774 -12.296 71.904  1.00 52.68  ? 551 LEU A CA    1 
ATOM   4499  C  C     . LEU A  1 553 ? -14.615 -11.288 70.774  1.00 59.69  ? 551 LEU A C     1 
ATOM   4500  O  O     . LEU A  1 553 ? -15.568 -10.586 70.415  1.00 61.00  ? 551 LEU A O     1 
ATOM   4501  C  CB    . LEU A  1 553 ? -14.146 -11.756 73.187  1.00 59.82  ? 551 LEU A CB    1 
ATOM   4502  C  CG    . LEU A  1 553 ? -14.385 -12.546 74.470  1.00 61.57  ? 551 LEU A CG    1 
ATOM   4503  C  CD1   . LEU A  1 553 ? -13.712 -11.838 75.625  1.00 50.45  ? 551 LEU A CD1   1 
ATOM   4504  C  CD2   . LEU A  1 553 ? -15.873 -12.706 74.729  1.00 54.76  ? 551 LEU A CD2   1 
ATOM   4505  N  N     . VAL A  1 554 ? -13.409 -11.195 70.202  1.00 56.51  ? 552 VAL A N     1 
ATOM   4506  C  CA    . VAL A  1 554 ? -13.117 -10.162 69.215  1.00 64.79  ? 552 VAL A CA    1 
ATOM   4507  C  C     . VAL A  1 554 ? -13.405 -10.607 67.788  1.00 68.39  ? 552 VAL A C     1 
ATOM   4508  O  O     . VAL A  1 554 ? -13.184 -9.827  66.852  1.00 73.97  ? 552 VAL A O     1 
ATOM   4509  C  CB    . VAL A  1 554 ? -11.650 -9.700  69.336  1.00 60.75  ? 552 VAL A CB    1 
ATOM   4510  C  CG1   . VAL A  1 554 ? -11.350 -9.265  70.764  1.00 48.19  ? 552 VAL A CG1   1 
ATOM   4511  C  CG2   . VAL A  1 554 ? -10.705 -10.808 68.895  1.00 43.79  ? 552 VAL A CG2   1 
ATOM   4512  N  N     . SER A  1 555 ? -13.896 -11.827 67.590  1.00 73.28  ? 553 SER A N     1 
ATOM   4513  C  CA    . SER A  1 555 ? -14.225 -12.306 66.251  1.00 88.34  ? 553 SER A CA    1 
ATOM   4514  C  C     . SER A  1 555 ? -15.589 -12.989 66.228  1.00 90.64  ? 553 SER A C     1 
ATOM   4515  O  O     . SER A  1 555 ? -16.468 -12.616 65.451  1.00 98.61  ? 553 SER A O     1 
ATOM   4516  C  CB    . SER A  1 555 ? -13.148 -13.267 65.742  1.00 99.14  ? 553 SER A CB    1 
ATOM   4517  O  OG    . SER A  1 555 ? -13.027 -14.397 66.589  1.00 107.05 ? 553 SER A OG    1 
ATOM   4518  N  N     . PRO B  2 20  ? 53.015  -17.761 24.710  1.00 194.19 ? 4   PRO B N     1 
ATOM   4519  C  CA    . PRO B  2 20  ? 53.007  -18.974 23.884  1.00 195.56 ? 4   PRO B CA    1 
ATOM   4520  C  C     . PRO B  2 20  ? 51.756  -19.817 24.105  1.00 183.88 ? 4   PRO B C     1 
ATOM   4521  O  O     . PRO B  2 20  ? 51.716  -20.981 23.705  1.00 188.96 ? 4   PRO B O     1 
ATOM   4522  C  CB    . PRO B  2 20  ? 54.259  -19.722 24.350  1.00 200.85 ? 4   PRO B CB    1 
ATOM   4523  C  CG    . PRO B  2 20  ? 55.160  -18.654 24.864  1.00 201.27 ? 4   PRO B CG    1 
ATOM   4524  C  CD    . PRO B  2 20  ? 54.256  -17.635 25.493  1.00 195.62 ? 4   PRO B CD    1 
ATOM   4525  N  N     . ILE B  2 21  ? 50.746  -19.227 24.738  1.00 168.55 ? 5   ILE B N     1 
ATOM   4526  C  CA    . ILE B  2 21  ? 49.488  -19.900 25.038  1.00 154.01 ? 5   ILE B CA    1 
ATOM   4527  C  C     . ILE B  2 21  ? 48.362  -19.128 24.367  1.00 145.84 ? 5   ILE B C     1 
ATOM   4528  O  O     . ILE B  2 21  ? 48.236  -17.913 24.562  1.00 144.55 ? 5   ILE B O     1 
ATOM   4529  C  CB    . ILE B  2 21  ? 49.248  -20.006 26.555  1.00 146.02 ? 5   ILE B CB    1 
ATOM   4530  C  CG1   . ILE B  2 21  ? 50.427  -20.703 27.238  1.00 137.60 ? 5   ILE B CG1   1 
ATOM   4531  C  CG2   . ILE B  2 21  ? 47.949  -20.746 26.839  1.00 147.02 ? 5   ILE B CG2   1 
ATOM   4532  C  CD1   . ILE B  2 21  ? 50.292  -20.795 28.742  1.00 121.09 ? 5   ILE B CD1   1 
ATOM   4533  N  N     . GLU B  2 22  ? 47.551  -19.828 23.578  1.00 137.92 ? 6   GLU B N     1 
ATOM   4534  C  CA    . GLU B  2 22  ? 46.397  -19.199 22.951  1.00 132.48 ? 6   GLU B CA    1 
ATOM   4535  C  C     . GLU B  2 22  ? 45.359  -18.845 24.007  1.00 121.95 ? 6   GLU B C     1 
ATOM   4536  O  O     . GLU B  2 22  ? 45.006  -19.674 24.851  1.00 119.47 ? 6   GLU B O     1 
ATOM   4537  C  CB    . GLU B  2 22  ? 45.786  -20.123 21.897  1.00 138.21 ? 6   GLU B CB    1 
ATOM   4538  C  CG    . GLU B  2 22  ? 46.547  -20.172 20.580  1.00 148.39 ? 6   GLU B CG    1 
ATOM   4539  C  CD    . GLU B  2 22  ? 47.815  -20.999 20.661  1.00 160.17 ? 6   GLU B CD    1 
ATOM   4540  O  OE1   . GLU B  2 22  ? 47.984  -21.739 21.653  1.00 163.56 ? 6   GLU B OE1   1 
ATOM   4541  O  OE2   . GLU B  2 22  ? 48.644  -20.909 19.731  1.00 164.86 ? 6   GLU B OE2   1 
ATOM   4542  N  N     . THR B  2 23  ? 44.871  -17.608 23.960  1.00 113.09 ? 7   THR B N     1 
ATOM   4543  C  CA    . THR B  2 23  ? 43.889  -17.148 24.932  1.00 104.81 ? 7   THR B CA    1 
ATOM   4544  C  C     . THR B  2 23  ? 42.548  -17.826 24.678  1.00 111.58 ? 7   THR B C     1 
ATOM   4545  O  O     . THR B  2 23  ? 41.990  -17.722 23.581  1.00 111.35 ? 7   THR B O     1 
ATOM   4546  C  CB    . THR B  2 23  ? 43.743  -15.630 24.860  1.00 97.07  ? 7   THR B CB    1 
ATOM   4547  O  OG1   . THR B  2 23  ? 43.255  -15.256 23.565  1.00 101.74 ? 7   THR B OG1   1 
ATOM   4548  C  CG2   . THR B  2 23  ? 45.083  -14.954 25.106  1.00 90.48  ? 7   THR B CG2   1 
ATOM   4549  N  N     . VAL B  2 24  ? 42.037  -18.523 25.688  1.00 111.48 ? 8   VAL B N     1 
ATOM   4550  C  CA    . VAL B  2 24  ? 40.735  -19.178 25.599  1.00 111.46 ? 8   VAL B CA    1 
ATOM   4551  C  C     . VAL B  2 24  ? 39.659  -18.104 25.491  1.00 111.14 ? 8   VAL B C     1 
ATOM   4552  O  O     . VAL B  2 24  ? 39.574  -17.224 26.362  1.00 110.76 ? 8   VAL B O     1 
ATOM   4553  C  CB    . VAL B  2 24  ? 40.488  -20.099 26.804  1.00 106.26 ? 8   VAL B CB    1 
ATOM   4554  C  CG1   . VAL B  2 24  ? 39.087  -20.684 26.747  1.00 110.04 ? 8   VAL B CG1   1 
ATOM   4555  C  CG2   . VAL B  2 24  ? 41.531  -21.206 26.848  1.00 107.65 ? 8   VAL B CG2   1 
ATOM   4556  N  N     . PRO B  2 25  ? 38.826  -18.128 24.450  1.00 115.23 ? 9   PRO B N     1 
ATOM   4557  C  CA    . PRO B  2 25  ? 37.799  -17.087 24.300  1.00 106.61 ? 9   PRO B CA    1 
ATOM   4558  C  C     . PRO B  2 25  ? 36.770  -17.169 25.418  1.00 97.06  ? 9   PRO B C     1 
ATOM   4559  O  O     . PRO B  2 25  ? 36.278  -18.248 25.755  1.00 100.38 ? 9   PRO B O     1 
ATOM   4560  C  CB    . PRO B  2 25  ? 37.178  -17.396 22.933  1.00 91.82  ? 9   PRO B CB    1 
ATOM   4561  C  CG    . PRO B  2 25  ? 37.436  -18.854 22.727  1.00 94.13  ? 9   PRO B CG    1 
ATOM   4562  C  CD    . PRO B  2 25  ? 38.768  -19.126 23.368  1.00 92.69  ? 9   PRO B CD    1 
ATOM   4563  N  N     . VAL B  2 26  ? 36.452  -16.013 25.997  1.00 88.10  ? 10  VAL B N     1 
ATOM   4564  C  CA    . VAL B  2 26  ? 35.481  -15.902 27.077  1.00 95.51  ? 10  VAL B CA    1 
ATOM   4565  C  C     . VAL B  2 26  ? 34.421  -14.895 26.658  1.00 90.98  ? 10  VAL B C     1 
ATOM   4566  O  O     . VAL B  2 26  ? 34.748  -13.791 26.207  1.00 90.21  ? 10  VAL B O     1 
ATOM   4567  C  CB    . VAL B  2 26  ? 36.145  -15.479 28.401  1.00 101.94 ? 10  VAL B CB    1 
ATOM   4568  C  CG1   . VAL B  2 26  ? 35.119  -15.440 29.524  1.00 108.20 ? 10  VAL B CG1   1 
ATOM   4569  C  CG2   . VAL B  2 26  ? 37.288  -16.420 28.749  1.00 102.31 ? 10  VAL B CG2   1 
ATOM   4570  N  N     . LYS B  2 27  ? 33.155  -15.276 26.805  1.00 90.90  ? 11  LYS B N     1 
ATOM   4571  C  CA    . LYS B  2 27  ? 32.030  -14.424 26.448  1.00 101.77 ? 11  LYS B CA    1 
ATOM   4572  C  C     . LYS B  2 27  ? 31.078  -14.323 27.630  1.00 109.69 ? 11  LYS B C     1 
ATOM   4573  O  O     . LYS B  2 27  ? 30.898  -15.289 28.376  1.00 114.35 ? 11  LYS B O     1 
ATOM   4574  C  CB    . LYS B  2 27  ? 31.287  -14.968 25.221  1.00 111.79 ? 11  LYS B CB    1 
ATOM   4575  C  CG    . LYS B  2 27  ? 32.149  -15.085 23.974  1.00 122.49 ? 11  LYS B CG    1 
ATOM   4576  C  CD    . LYS B  2 27  ? 32.654  -13.725 23.522  1.00 125.45 ? 11  LYS B CD    1 
ATOM   4577  C  CE    . LYS B  2 27  ? 33.581  -13.851 22.323  1.00 127.77 ? 11  LYS B CE    1 
ATOM   4578  N  NZ    . LYS B  2 27  ? 34.819  -14.610 22.653  1.00 125.01 ? 11  LYS B NZ    1 
ATOM   4579  N  N     . LEU B  2 28  ? 30.477  -13.147 27.801  1.00 107.98 ? 12  LEU B N     1 
ATOM   4580  C  CA    . LEU B  2 28  ? 29.463  -12.967 28.826  1.00 99.79  ? 12  LEU B CA    1 
ATOM   4581  C  C     . LEU B  2 28  ? 28.211  -13.770 28.478  1.00 99.58  ? 12  LEU B C     1 
ATOM   4582  O  O     . LEU B  2 28  ? 28.044  -14.264 27.359  1.00 99.98  ? 12  LEU B O     1 
ATOM   4583  C  CB    . LEU B  2 28  ? 29.102  -11.488 28.977  1.00 92.48  ? 12  LEU B CB    1 
ATOM   4584  C  CG    . LEU B  2 28  ? 30.202  -10.500 29.367  1.00 87.51  ? 12  LEU B CG    1 
ATOM   4585  C  CD1   . LEU B  2 28  ? 29.654  -9.084  29.351  1.00 87.63  ? 12  LEU B CD1   1 
ATOM   4586  C  CD2   . LEU B  2 28  ? 30.770  -10.836 30.732  1.00 68.80  ? 12  LEU B CD2   1 
ATOM   4587  N  N     . LYS B  2 29  ? 27.322  -13.898 29.457  1.00 98.83  ? 13  LYS B N     1 
ATOM   4588  C  CA    . LYS B  2 29  ? 26.043  -14.538 29.195  1.00 107.89 ? 13  LYS B CA    1 
ATOM   4589  C  C     . LYS B  2 29  ? 25.219  -13.668 28.247  1.00 113.94 ? 13  LYS B C     1 
ATOM   4590  O  O     . LYS B  2 29  ? 25.289  -12.437 28.317  1.00 117.42 ? 13  LYS B O     1 
ATOM   4591  C  CB    . LYS B  2 29  ? 25.278  -14.778 30.497  1.00 105.12 ? 13  LYS B CB    1 
ATOM   4592  C  CG    . LYS B  2 29  ? 26.003  -15.691 31.474  1.00 103.29 ? 13  LYS B CG    1 
ATOM   4593  C  CD    . LYS B  2 29  ? 25.031  -16.392 32.409  1.00 111.44 ? 13  LYS B CD    1 
ATOM   4594  C  CE    . LYS B  2 29  ? 24.215  -15.398 33.215  1.00 119.91 ? 13  LYS B CE    1 
ATOM   4595  N  NZ    . LYS B  2 29  ? 23.231  -16.080 34.101  1.00 126.97 ? 13  LYS B NZ    1 
ATOM   4596  N  N     . PRO B  2 30  ? 24.450  -14.274 27.344  1.00 115.01 ? 14  PRO B N     1 
ATOM   4597  C  CA    . PRO B  2 30  ? 23.715  -13.483 26.347  1.00 119.91 ? 14  PRO B CA    1 
ATOM   4598  C  C     . PRO B  2 30  ? 22.731  -12.523 27.002  1.00 121.48 ? 14  PRO B C     1 
ATOM   4599  O  O     . PRO B  2 30  ? 21.931  -12.911 27.856  1.00 123.10 ? 14  PRO B O     1 
ATOM   4600  C  CB    . PRO B  2 30  ? 22.995  -14.549 25.512  1.00 122.63 ? 14  PRO B CB    1 
ATOM   4601  C  CG    . PRO B  2 30  ? 23.799  -15.793 25.710  1.00 121.94 ? 14  PRO B CG    1 
ATOM   4602  C  CD    . PRO B  2 30  ? 24.301  -15.722 27.121  1.00 115.96 ? 14  PRO B CD    1 
ATOM   4603  N  N     . GLY B  2 31  ? 22.803  -11.259 26.596  1.00 118.07 ? 15  GLY B N     1 
ATOM   4604  C  CA    . GLY B  2 31  ? 21.916  -10.239 27.111  1.00 118.65 ? 15  GLY B CA    1 
ATOM   4605  C  C     . GLY B  2 31  ? 22.385  -9.542  28.367  1.00 114.50 ? 15  GLY B C     1 
ATOM   4606  O  O     . GLY B  2 31  ? 21.578  -8.863  29.014  1.00 118.16 ? 15  GLY B O     1 
ATOM   4607  N  N     . MET B  2 32  ? 23.656  -9.682  28.735  1.00 105.96 ? 16  MET B N     1 
ATOM   4608  C  CA    . MET B  2 32  ? 24.198  -9.057  29.933  1.00 106.18 ? 16  MET B CA    1 
ATOM   4609  C  C     . MET B  2 32  ? 25.462  -8.285  29.588  1.00 105.68 ? 16  MET B C     1 
ATOM   4610  O  O     . MET B  2 32  ? 26.324  -8.781  28.856  1.00 105.11 ? 16  MET B O     1 
ATOM   4611  C  CB    . MET B  2 32  ? 24.508  -10.093 31.020  1.00 104.32 ? 16  MET B CB    1 
ATOM   4612  C  CG    . MET B  2 32  ? 23.282  -10.720 31.658  1.00 104.79 ? 16  MET B CG    1 
ATOM   4613  S  SD    . MET B  2 32  ? 23.717  -11.836 33.005  1.00 106.28 ? 16  MET B SD    1 
ATOM   4614  C  CE    . MET B  2 32  ? 22.094  -12.346 33.565  1.00 112.92 ? 16  MET B CE    1 
ATOM   4615  N  N     . ASP B  2 33  ? 25.566  -7.071  30.122  1.00 101.49 ? 17  ASP B N     1 
ATOM   4616  C  CA    . ASP B  2 33  ? 26.759  -6.259  29.964  1.00 103.90 ? 17  ASP B CA    1 
ATOM   4617  C  C     . ASP B  2 33  ? 27.730  -6.553  31.108  1.00 95.28  ? 17  ASP B C     1 
ATOM   4618  O  O     . ASP B  2 33  ? 27.429  -7.309  32.034  1.00 90.63  ? 17  ASP B O     1 
ATOM   4619  C  CB    . ASP B  2 33  ? 26.389  -4.777  29.909  1.00 108.63 ? 17  ASP B CB    1 
ATOM   4620  C  CG    . ASP B  2 33  ? 27.478  -3.925  29.285  1.00 108.27 ? 17  ASP B CG    1 
ATOM   4621  O  OD1   . ASP B  2 33  ? 28.404  -4.498  28.674  1.00 105.59 ? 17  ASP B OD1   1 
ATOM   4622  O  OD2   . ASP B  2 33  ? 27.410  -2.684  29.411  1.00 107.42 ? 17  ASP B OD2   1 
ATOM   4623  N  N     . GLY B  2 34  ? 28.914  -5.950  31.045  1.00 87.47  ? 18  GLY B N     1 
ATOM   4624  C  CA    . GLY B  2 34  ? 29.918  -6.141  32.063  1.00 78.00  ? 18  GLY B CA    1 
ATOM   4625  C  C     . GLY B  2 34  ? 29.532  -5.511  33.386  1.00 75.08  ? 18  GLY B C     1 
ATOM   4626  O  O     . GLY B  2 34  ? 28.548  -4.771  33.487  1.00 76.00  ? 18  GLY B O     1 
ATOM   4627  N  N     . PRO B  2 35  ? 30.305  -5.797  34.433  1.00 71.19  ? 19  PRO B N     1 
ATOM   4628  C  CA    . PRO B  2 35  ? 29.986  -5.241  35.753  1.00 68.42  ? 19  PRO B CA    1 
ATOM   4629  C  C     . PRO B  2 35  ? 30.320  -3.760  35.831  1.00 62.72  ? 19  PRO B C     1 
ATOM   4630  O  O     . PRO B  2 35  ? 31.331  -3.301  35.294  1.00 59.16  ? 19  PRO B O     1 
ATOM   4631  C  CB    . PRO B  2 35  ? 30.864  -6.064  36.701  1.00 64.77  ? 19  PRO B CB    1 
ATOM   4632  C  CG    . PRO B  2 35  ? 32.033  -6.461  35.861  1.00 62.53  ? 19  PRO B CG    1 
ATOM   4633  C  CD    . PRO B  2 35  ? 31.492  -6.669  34.469  1.00 69.10  ? 19  PRO B CD    1 
ATOM   4634  N  N     . LYS B  2 36  ? 29.449  -3.008  36.509  1.00 57.71  ? 20  LYS B N     1 
ATOM   4635  C  CA    . LYS B  2 36  ? 29.637  -1.576  36.737  1.00 63.17  ? 20  LYS B CA    1 
ATOM   4636  C  C     . LYS B  2 36  ? 29.340  -1.289  38.212  1.00 68.78  ? 20  LYS B C     1 
ATOM   4637  O  O     . LYS B  2 36  ? 28.338  -0.658  38.555  1.00 65.59  ? 20  LYS B O     1 
ATOM   4638  C  CB    . LYS B  2 36  ? 28.749  -0.744  35.810  1.00 59.99  ? 20  LYS B CB    1 
ATOM   4639  C  CG    . LYS B  2 36  ? 29.011  -0.962  34.329  1.00 62.22  ? 20  LYS B CG    1 
ATOM   4640  C  CD    . LYS B  2 36  ? 28.077  -0.121  33.473  1.00 64.74  ? 20  LYS B CD    1 
ATOM   4641  C  CE    . LYS B  2 36  ? 28.313  -0.370  31.991  1.00 73.09  ? 20  LYS B CE    1 
ATOM   4642  N  NZ    . LYS B  2 36  ? 27.390  0.431   31.141  1.00 79.95  ? 20  LYS B NZ    1 
ATOM   4643  N  N     . VAL B  2 37  ? 30.224  -1.763  39.087  1.00 53.91  ? 21  VAL B N     1 
ATOM   4644  C  CA    . VAL B  2 37  ? 30.054  -1.651  40.531  1.00 53.64  ? 21  VAL B CA    1 
ATOM   4645  C  C     . VAL B  2 37  ? 31.031  -0.607  41.054  1.00 51.62  ? 21  VAL B C     1 
ATOM   4646  O  O     . VAL B  2 37  ? 32.228  -0.657  40.743  1.00 57.55  ? 21  VAL B O     1 
ATOM   4647  C  CB    . VAL B  2 37  ? 30.267  -3.005  41.227  1.00 50.84  ? 21  VAL B CB    1 
ATOM   4648  C  CG1   . VAL B  2 37  ? 29.817  -2.930  42.676  1.00 49.50  ? 21  VAL B CG1   1 
ATOM   4649  C  CG2   . VAL B  2 37  ? 29.525  -4.105  40.484  1.00 51.85  ? 21  VAL B CG2   1 
ATOM   4650  N  N     . LYS B  2 38  ? 30.523  0.331   41.848  1.00 51.46  ? 22  LYS B N     1 
ATOM   4651  C  CA    . LYS B  2 38  ? 31.352  1.415   42.357  1.00 52.50  ? 22  LYS B CA    1 
ATOM   4652  C  C     . LYS B  2 38  ? 32.332  0.912   43.409  1.00 50.55  ? 22  LYS B C     1 
ATOM   4653  O  O     . LYS B  2 38  ? 32.002  0.058   44.237  1.00 48.52  ? 22  LYS B O     1 
ATOM   4654  C  CB    . LYS B  2 38  ? 30.481  2.521   42.952  1.00 53.17  ? 22  LYS B CB    1 
ATOM   4655  C  CG    . LYS B  2 38  ? 29.842  3.439   41.926  1.00 70.61  ? 22  LYS B CG    1 
ATOM   4656  C  CD    . LYS B  2 38  ? 29.087  4.572   42.606  1.00 84.97  ? 22  LYS B CD    1 
ATOM   4657  C  CE    . LYS B  2 38  ? 28.494  5.533   41.588  1.00 95.66  ? 22  LYS B CE    1 
ATOM   4658  N  NZ    . LYS B  2 38  ? 27.732  6.634   42.240  1.00 98.33  ? 22  LYS B NZ    1 
ATOM   4659  N  N     . GLN B  2 39  ? 33.547  1.451   43.368  1.00 49.82  ? 23  GLN B N     1 
ATOM   4660  C  CA    . GLN B  2 39  ? 34.531  1.169   44.402  1.00 53.77  ? 23  GLN B CA    1 
ATOM   4661  C  C     . GLN B  2 39  ? 34.124  1.842   45.707  1.00 57.57  ? 23  GLN B C     1 
ATOM   4662  O  O     . GLN B  2 39  ? 33.683  2.994   45.718  1.00 64.08  ? 23  GLN B O     1 
ATOM   4663  C  CB    . GLN B  2 39  ? 35.912  1.659   43.965  1.00 49.43  ? 23  GLN B CB    1 
ATOM   4664  C  CG    . GLN B  2 39  ? 36.986  1.546   45.034  1.00 48.72  ? 23  GLN B CG    1 
ATOM   4665  C  CD    . GLN B  2 39  ? 37.305  0.109   45.389  1.00 47.59  ? 23  GLN B CD    1 
ATOM   4666  O  OE1   . GLN B  2 39  ? 37.336  -0.763  44.521  1.00 47.73  ? 23  GLN B OE1   1 
ATOM   4667  N  NE2   . GLN B  2 39  ? 37.540  -0.146  46.671  1.00 52.25  ? 23  GLN B NE2   1 
ATOM   4668  N  N     . TRP B  2 40  ? 34.264  1.116   46.808  1.00 47.05  ? 24  TRP B N     1 
ATOM   4669  C  CA    . TRP B  2 40  ? 33.922  1.674   48.104  1.00 53.39  ? 24  TRP B CA    1 
ATOM   4670  C  C     . TRP B  2 40  ? 35.166  2.201   48.806  1.00 56.79  ? 24  TRP B C     1 
ATOM   4671  O  O     . TRP B  2 40  ? 36.292  1.845   48.444  1.00 46.95  ? 24  TRP B O     1 
ATOM   4672  C  CB    . TRP B  2 40  ? 33.218  0.622   48.974  1.00 46.37  ? 24  TRP B CB    1 
ATOM   4673  C  CG    . TRP B  2 40  ? 33.998  -0.627  49.253  1.00 53.15  ? 24  TRP B CG    1 
ATOM   4674  C  CD1   . TRP B  2 40  ? 35.094  -0.751  50.058  1.00 46.81  ? 24  TRP B CD1   1 
ATOM   4675  C  CD2   . TRP B  2 40  ? 33.708  -1.942  48.765  1.00 44.30  ? 24  TRP B CD2   1 
ATOM   4676  N  NE1   . TRP B  2 40  ? 35.516  -2.058  50.083  1.00 51.54  ? 24  TRP B NE1   1 
ATOM   4677  C  CE2   . TRP B  2 40  ? 34.681  -2.810  49.298  1.00 43.67  ? 24  TRP B CE2   1 
ATOM   4678  C  CE3   . TRP B  2 40  ? 32.728  -2.467  47.916  1.00 44.60  ? 24  TRP B CE3   1 
ATOM   4679  C  CZ2   . TRP B  2 40  ? 34.700  -4.174  49.016  1.00 44.71  ? 24  TRP B CZ2   1 
ATOM   4680  C  CZ3   . TRP B  2 40  ? 32.743  -3.823  47.644  1.00 44.26  ? 24  TRP B CZ3   1 
ATOM   4681  C  CH2   . TRP B  2 40  ? 33.726  -4.659  48.187  1.00 44.37  ? 24  TRP B CH2   1 
ATOM   4682  N  N     . PRO B  2 41  ? 35.003  3.076   49.802  1.00 51.14  ? 25  PRO B N     1 
ATOM   4683  C  CA    . PRO B  2 41  ? 36.175  3.646   50.477  1.00 52.83  ? 25  PRO B CA    1 
ATOM   4684  C  C     . PRO B  2 41  ? 37.037  2.574   51.122  1.00 50.73  ? 25  PRO B C     1 
ATOM   4685  O  O     . PRO B  2 41  ? 36.543  1.559   51.617  1.00 48.77  ? 25  PRO B O     1 
ATOM   4686  C  CB    . PRO B  2 41  ? 35.562  4.576   51.531  1.00 48.57  ? 25  PRO B CB    1 
ATOM   4687  C  CG    . PRO B  2 41  ? 34.213  4.902   51.004  1.00 49.18  ? 25  PRO B CG    1 
ATOM   4688  C  CD    . PRO B  2 41  ? 33.747  3.680   50.284  1.00 47.79  ? 25  PRO B CD    1 
ATOM   4689  N  N     . LEU B  2 42  ? 38.345  2.810   51.106  1.00 47.67  ? 26  LEU B N     1 
ATOM   4690  C  CA    . LEU B  2 42  ? 39.315  1.892   51.678  1.00 47.25  ? 26  LEU B CA    1 
ATOM   4691  C  C     . LEU B  2 42  ? 40.124  2.598   52.756  1.00 48.28  ? 26  LEU B C     1 
ATOM   4692  O  O     . LEU B  2 42  ? 40.377  3.804   52.678  1.00 49.59  ? 26  LEU B O     1 
ATOM   4693  C  CB    . LEU B  2 42  ? 40.259  1.335   50.605  1.00 47.45  ? 26  LEU B CB    1 
ATOM   4694  C  CG    . LEU B  2 42  ? 39.617  0.537   49.469  1.00 46.77  ? 26  LEU B CG    1 
ATOM   4695  C  CD1   . LEU B  2 42  ? 40.678  0.028   48.507  1.00 47.33  ? 26  LEU B CD1   1 
ATOM   4696  C  CD2   . LEU B  2 42  ? 38.797  -0.615  50.026  1.00 45.49  ? 26  LEU B CD2   1 
ATOM   4697  N  N     . THR B  2 43  ? 40.525  1.832   53.766  1.00 47.93  ? 27  THR B N     1 
ATOM   4698  C  CA    . THR B  2 43  ? 41.383  2.360   54.813  1.00 49.16  ? 27  THR B CA    1 
ATOM   4699  C  C     . THR B  2 43  ? 42.765  2.687   54.248  1.00 53.52  ? 27  THR B C     1 
ATOM   4700  O  O     . THR B  2 43  ? 43.122  2.297   53.132  1.00 66.08  ? 27  THR B O     1 
ATOM   4701  C  CB    . THR B  2 43  ? 41.503  1.362   55.965  1.00 50.54  ? 27  THR B CB    1 
ATOM   4702  O  OG1   . THR B  2 43  ? 41.980  0.107   55.465  1.00 60.76  ? 27  THR B OG1   1 
ATOM   4703  C  CG2   . THR B  2 43  ? 40.154  1.157   56.636  1.00 47.80  ? 27  THR B CG2   1 
ATOM   4704  N  N     . GLU B  2 44  ? 43.550  3.419   55.041  1.00 52.05  ? 28  GLU B N     1 
ATOM   4705  C  CA    . GLU B  2 44  ? 44.879  3.824   54.595  1.00 53.68  ? 28  GLU B CA    1 
ATOM   4706  C  C     . GLU B  2 44  ? 45.772  2.615   54.352  1.00 56.33  ? 28  GLU B C     1 
ATOM   4707  O  O     . GLU B  2 44  ? 46.437  2.518   53.314  1.00 65.85  ? 28  GLU B O     1 
ATOM   4708  C  CB    . GLU B  2 44  ? 45.518  4.762   55.620  1.00 57.75  ? 28  GLU B CB    1 
ATOM   4709  C  CG    . GLU B  2 44  ? 46.957  5.133   55.289  1.00 65.45  ? 28  GLU B CG    1 
ATOM   4710  C  CD    . GLU B  2 44  ? 47.472  6.286   56.126  1.00 84.49  ? 28  GLU B CD    1 
ATOM   4711  O  OE1   . GLU B  2 44  ? 46.716  6.783   56.985  1.00 94.50  ? 28  GLU B OE1   1 
ATOM   4712  O  OE2   . GLU B  2 44  ? 48.633  6.697   55.921  1.00 95.63  ? 28  GLU B OE2   1 
ATOM   4713  N  N     . GLU B  2 45  ? 45.797  1.677   55.303  1.00 52.85  ? 29  GLU B N     1 
ATOM   4714  C  CA    . GLU B  2 45  ? 46.684  0.525   55.180  1.00 56.20  ? 29  GLU B CA    1 
ATOM   4715  C  C     . GLU B  2 45  ? 46.307  -0.353  53.993  1.00 60.51  ? 29  GLU B C     1 
ATOM   4716  O  O     . GLU B  2 45  ? 47.176  -1.011  53.411  1.00 68.78  ? 29  GLU B O     1 
ATOM   4717  C  CB    . GLU B  2 45  ? 46.673  -0.290  56.474  1.00 53.70  ? 29  GLU B CB    1 
ATOM   4718  C  CG    . GLU B  2 45  ? 45.325  -0.898  56.827  1.00 73.37  ? 29  GLU B CG    1 
ATOM   4719  C  CD    . GLU B  2 45  ? 45.375  -1.722  58.100  1.00 83.97  ? 29  GLU B CD    1 
ATOM   4720  O  OE1   . GLU B  2 45  ? 44.304  -1.969  58.694  1.00 88.20  ? 29  GLU B OE1   1 
ATOM   4721  O  OE2   . GLU B  2 45  ? 46.487  -2.119  58.508  1.00 87.39  ? 29  GLU B OE2   1 
ATOM   4722  N  N     . LYS B  2 46  ? 45.028  -0.370  53.613  1.00 54.23  ? 30  LYS B N     1 
ATOM   4723  C  CA    . LYS B  2 46  ? 44.614  -1.164  52.462  1.00 50.53  ? 30  LYS B CA    1 
ATOM   4724  C  C     . LYS B  2 46  ? 45.013  -0.501  51.150  1.00 55.53  ? 30  LYS B C     1 
ATOM   4725  O  O     . LYS B  2 46  ? 45.455  -1.183  50.218  1.00 52.88  ? 30  LYS B O     1 
ATOM   4726  C  CB    . LYS B  2 46  ? 43.105  -1.405  52.504  1.00 48.54  ? 30  LYS B CB    1 
ATOM   4727  C  CG    . LYS B  2 46  ? 42.678  -2.472  53.498  1.00 46.56  ? 30  LYS B CG    1 
ATOM   4728  C  CD    . LYS B  2 46  ? 41.166  -2.611  53.541  1.00 58.97  ? 30  LYS B CD    1 
ATOM   4729  C  CE    . LYS B  2 46  ? 40.749  -3.863  54.293  1.00 64.98  ? 30  LYS B CE    1 
ATOM   4730  N  NZ    . LYS B  2 46  ? 41.306  -3.906  55.674  1.00 60.83  ? 30  LYS B NZ    1 
ATOM   4731  N  N     . ILE B  2 47  ? 44.863  0.822   51.056  1.00 50.68  ? 31  ILE B N     1 
ATOM   4732  C  CA    . ILE B  2 47  ? 45.271  1.532   49.846  1.00 52.41  ? 31  ILE B CA    1 
ATOM   4733  C  C     . ILE B  2 47  ? 46.776  1.410   49.646  1.00 59.14  ? 31  ILE B C     1 
ATOM   4734  O  O     . ILE B  2 47  ? 47.252  1.109   48.545  1.00 57.48  ? 31  ILE B O     1 
ATOM   4735  C  CB    . ILE B  2 47  ? 44.829  3.006   49.908  1.00 60.21  ? 31  ILE B CB    1 
ATOM   4736  C  CG1   . ILE B  2 47  ? 43.303  3.110   49.916  1.00 51.27  ? 31  ILE B CG1   1 
ATOM   4737  C  CG2   . ILE B  2 47  ? 45.408  3.784   48.738  1.00 56.39  ? 31  ILE B CG2   1 
ATOM   4738  C  CD1   . ILE B  2 47  ? 42.788  4.535   49.961  1.00 52.23  ? 31  ILE B CD1   1 
ATOM   4739  N  N     . LYS B  2 48  ? 47.548  1.635   50.713  1.00 54.43  ? 32  LYS B N     1 
ATOM   4740  C  CA    . LYS B  2 48  ? 48.997  1.492   50.622  1.00 56.26  ? 32  LYS B CA    1 
ATOM   4741  C  C     . LYS B  2 48  ? 49.399  0.068   50.263  1.00 65.57  ? 32  LYS B C     1 
ATOM   4742  O  O     . LYS B  2 48  ? 50.416  -0.138  49.591  1.00 73.98  ? 32  LYS B O     1 
ATOM   4743  C  CB    . LYS B  2 48  ? 49.655  1.911   51.938  1.00 57.55  ? 32  LYS B CB    1 
ATOM   4744  C  CG    . LYS B  2 48  ? 49.675  3.412   52.175  1.00 58.98  ? 32  LYS B CG    1 
ATOM   4745  C  CD    . LYS B  2 48  ? 50.427  3.750   53.451  1.00 75.10  ? 32  LYS B CD    1 
ATOM   4746  C  CE    . LYS B  2 48  ? 50.505  5.252   53.668  1.00 87.07  ? 32  LYS B CE    1 
ATOM   4747  N  NZ    . LYS B  2 48  ? 51.227  5.935   52.559  1.00 100.41 ? 32  LYS B NZ    1 
ATOM   4748  N  N     . ALA B  2 49  ? 48.619  -0.923  50.696  1.00 60.16  ? 33  ALA B N     1 
ATOM   4749  C  CA    . ALA B  2 49  ? 48.909  -2.302  50.322  1.00 57.38  ? 33  ALA B CA    1 
ATOM   4750  C  C     . ALA B  2 49  ? 48.584  -2.554  48.855  1.00 61.72  ? 33  ALA B C     1 
ATOM   4751  O  O     . ALA B  2 49  ? 49.363  -3.200  48.143  1.00 62.91  ? 33  ALA B O     1 
ATOM   4752  C  CB    . ALA B  2 49  ? 48.131  -3.264  51.218  1.00 52.11  ? 33  ALA B CB    1 
ATOM   4753  N  N     . LEU B  2 50  ? 47.442  -2.047  48.383  1.00 59.37  ? 34  LEU B N     1 
ATOM   4754  C  CA    . LEU B  2 50  ? 47.047  -2.277  46.997  1.00 59.35  ? 34  LEU B CA    1 
ATOM   4755  C  C     . LEU B  2 50  ? 47.934  -1.519  46.018  1.00 57.20  ? 34  LEU B C     1 
ATOM   4756  O  O     . LEU B  2 50  ? 48.197  -2.015  44.916  1.00 55.01  ? 34  LEU B O     1 
ATOM   4757  C  CB    . LEU B  2 50  ? 45.583  -1.889  46.795  1.00 51.00  ? 34  LEU B CB    1 
ATOM   4758  C  CG    . LEU B  2 50  ? 44.556  -2.885  47.334  1.00 49.86  ? 34  LEU B CG    1 
ATOM   4759  C  CD1   . LEU B  2 50  ? 43.144  -2.379  47.099  1.00 52.89  ? 34  LEU B CD1   1 
ATOM   4760  C  CD2   . LEU B  2 50  ? 44.755  -4.246  46.688  1.00 49.34  ? 34  LEU B CD2   1 
ATOM   4761  N  N     . VAL B  2 51  ? 48.398  -0.324  46.389  1.00 55.34  ? 35  VAL B N     1 
ATOM   4762  C  CA    . VAL B  2 51  ? 49.302  0.419   45.517  1.00 64.93  ? 35  VAL B CA    1 
ATOM   4763  C  C     . VAL B  2 51  ? 50.623  -0.324  45.362  1.00 71.38  ? 35  VAL B C     1 
ATOM   4764  O  O     . VAL B  2 51  ? 51.175  -0.416  44.258  1.00 60.44  ? 35  VAL B O     1 
ATOM   4765  C  CB    . VAL B  2 51  ? 49.508  1.849   46.052  1.00 58.52  ? 35  VAL B CB    1 
ATOM   4766  C  CG1   . VAL B  2 51  ? 50.697  2.511   45.371  1.00 61.13  ? 35  VAL B CG1   1 
ATOM   4767  C  CG2   . VAL B  2 51  ? 48.249  2.677   45.841  1.00 57.59  ? 35  VAL B CG2   1 
ATOM   4768  N  N     . GLU B  2 52  ? 51.142  -0.881  46.458  1.00 58.93  ? 36  GLU B N     1 
ATOM   4769  C  CA    . GLU B  2 52  ? 52.388  -1.637  46.387  1.00 60.58  ? 36  GLU B CA    1 
ATOM   4770  C  C     . GLU B  2 52  ? 52.209  -2.931  45.603  1.00 60.10  ? 36  GLU B C     1 
ATOM   4771  O  O     . GLU B  2 52  ? 53.096  -3.328  44.838  1.00 76.93  ? 36  GLU B O     1 
ATOM   4772  C  CB    . GLU B  2 52  ? 52.903  -1.927  47.797  1.00 64.98  ? 36  GLU B CB    1 
ATOM   4773  C  CG    . GLU B  2 52  ? 54.177  -2.750  47.841  1.00 80.58  ? 36  GLU B CG    1 
ATOM   4774  C  CD    . GLU B  2 52  ? 54.674  -2.973  49.255  1.00 105.41 ? 36  GLU B CD    1 
ATOM   4775  O  OE1   . GLU B  2 52  ? 54.079  -2.402  50.193  1.00 110.77 ? 36  GLU B OE1   1 
ATOM   4776  O  OE2   . GLU B  2 52  ? 55.660  -3.719  49.429  1.00 118.46 ? 36  GLU B OE2   1 
ATOM   4777  N  N     . ILE B  2 53  ? 51.068  -3.602  45.777  1.00 70.40  ? 37  ILE B N     1 
ATOM   4778  C  CA    . ILE B  2 53  ? 50.827  -4.854  45.067  1.00 67.60  ? 37  ILE B CA    1 
ATOM   4779  C  C     . ILE B  2 53  ? 50.630  -4.600  43.577  1.00 62.82  ? 37  ILE B C     1 
ATOM   4780  O  O     . ILE B  2 53  ? 51.198  -5.304  42.734  1.00 63.03  ? 37  ILE B O     1 
ATOM   4781  C  CB    . ILE B  2 53  ? 49.623  -5.592  45.681  1.00 55.37  ? 37  ILE B CB    1 
ATOM   4782  C  CG1   . ILE B  2 53  ? 49.992  -6.170  47.048  1.00 55.08  ? 37  ILE B CG1   1 
ATOM   4783  C  CG2   . ILE B  2 53  ? 49.127  -6.687  44.746  1.00 55.16  ? 37  ILE B CG2   1 
ATOM   4784  C  CD1   . ILE B  2 53  ? 48.832  -6.822  47.768  1.00 57.59  ? 37  ILE B CD1   1 
ATOM   4785  N  N     . CYS B  2 54  ? 49.832  -3.589  43.228  1.00 62.50  ? 38  CYS B N     1 
ATOM   4786  C  CA    . CYS B  2 54  ? 49.535  -3.339  41.822  1.00 64.90  ? 38  CYS B CA    1 
ATOM   4787  C  C     . CYS B  2 54  ? 50.749  -2.814  41.067  1.00 71.44  ? 38  CYS B C     1 
ATOM   4788  O  O     . CYS B  2 54  ? 50.874  -3.054  39.860  1.00 71.73  ? 38  CYS B O     1 
ATOM   4789  C  CB    . CYS B  2 54  ? 48.362  -2.367  41.698  1.00 58.77  ? 38  CYS B CB    1 
ATOM   4790  S  SG    . CYS B  2 54  ? 46.775  -3.075  42.198  1.00 61.71  ? 38  CYS B SG    1 
ATOM   4791  N  N     . THR B  2 55  ? 51.649  -2.101  41.747  1.00 74.13  ? 39  THR B N     1 
ATOM   4792  C  CA    . THR B  2 55  ? 52.874  -1.653  41.092  1.00 70.20  ? 39  THR B CA    1 
ATOM   4793  C  C     . THR B  2 55  ? 53.748  -2.838  40.696  1.00 72.15  ? 39  THR B C     1 
ATOM   4794  O  O     . THR B  2 55  ? 54.310  -2.862  39.595  1.00 70.92  ? 39  THR B O     1 
ATOM   4795  C  CB    . THR B  2 55  ? 53.643  -0.695  42.004  1.00 73.54  ? 39  THR B CB    1 
ATOM   4796  O  OG1   . THR B  2 55  ? 52.848  0.472   42.251  1.00 71.22  ? 39  THR B OG1   1 
ATOM   4797  C  CG2   . THR B  2 55  ? 54.958  -0.275  41.359  1.00 69.17  ? 39  THR B CG2   1 
ATOM   4798  N  N     . GLU B  2 56  ? 53.863  -3.837  41.575  1.00 70.34  ? 40  GLU B N     1 
ATOM   4799  C  CA    . GLU B  2 56  ? 54.627  -5.033  41.238  1.00 66.94  ? 40  GLU B CA    1 
ATOM   4800  C  C     . GLU B  2 56  ? 53.942  -5.833  40.136  1.00 69.61  ? 40  GLU B C     1 
ATOM   4801  O  O     . GLU B  2 56  ? 54.605  -6.316  39.211  1.00 82.92  ? 40  GLU B O     1 
ATOM   4802  C  CB    . GLU B  2 56  ? 54.833  -5.895  42.484  1.00 66.12  ? 40  GLU B CB    1 
ATOM   4803  C  CG    . GLU B  2 56  ? 55.731  -5.259  43.537  1.00 95.64  ? 40  GLU B CG    1 
ATOM   4804  C  CD    . GLU B  2 56  ? 57.157  -5.071  43.052  1.00 110.00 ? 40  GLU B CD    1 
ATOM   4805  O  OE1   . GLU B  2 56  ? 57.600  -5.851  42.182  1.00 107.99 ? 40  GLU B OE1   1 
ATOM   4806  O  OE2   . GLU B  2 56  ? 57.835  -4.141  43.538  1.00 114.33 ? 40  GLU B OE2   1 
ATOM   4807  N  N     . MET B  2 57  ? 52.617  -5.979  40.214  1.00 72.63  ? 41  MET B N     1 
ATOM   4808  C  CA    . MET B  2 57  ? 51.893  -6.713  39.181  1.00 73.95  ? 41  MET B CA    1 
ATOM   4809  C  C     . MET B  2 57  ? 51.991  -6.014  37.832  1.00 70.74  ? 41  MET B C     1 
ATOM   4810  O  O     . MET B  2 57  ? 52.074  -6.672  36.788  1.00 75.08  ? 41  MET B O     1 
ATOM   4811  C  CB    . MET B  2 57  ? 50.429  -6.889  39.587  1.00 76.33  ? 41  MET B CB    1 
ATOM   4812  C  CG    . MET B  2 57  ? 50.226  -7.757  40.816  1.00 71.70  ? 41  MET B CG    1 
ATOM   4813  S  SD    . MET B  2 57  ? 48.485  -7.932  41.247  1.00 72.07  ? 41  MET B SD    1 
ATOM   4814  C  CE    . MET B  2 57  ? 47.850  -8.709  39.765  1.00 78.26  ? 41  MET B CE    1 
ATOM   4815  N  N     . GLU B  2 58  ? 51.979  -4.679  37.832  1.00 68.64  ? 42  GLU B N     1 
ATOM   4816  C  CA    . GLU B  2 58  ? 52.122  -3.946  36.578  1.00 72.50  ? 42  GLU B CA    1 
ATOM   4817  C  C     . GLU B  2 58  ? 53.525  -4.105  36.007  1.00 78.21  ? 42  GLU B C     1 
ATOM   4818  O  O     . GLU B  2 58  ? 53.696  -4.223  34.787  1.00 73.23  ? 42  GLU B O     1 
ATOM   4819  C  CB    . GLU B  2 58  ? 51.794  -2.468  36.789  1.00 71.20  ? 42  GLU B CB    1 
ATOM   4820  C  CG    . GLU B  2 58  ? 51.844  -1.639  35.516  1.00 73.72  ? 42  GLU B CG    1 
ATOM   4821  C  CD    . GLU B  2 58  ? 51.528  -0.177  35.760  1.00 80.25  ? 42  GLU B CD    1 
ATOM   4822  O  OE1   . GLU B  2 58  ? 51.699  0.284   36.908  1.00 83.56  ? 42  GLU B OE1   1 
ATOM   4823  O  OE2   . GLU B  2 58  ? 51.104  0.509   34.805  1.00 79.41  ? 42  GLU B OE2   1 
ATOM   4824  N  N     . LYS B  2 59  ? 54.541  -4.109  36.873  1.00 75.60  ? 43  LYS B N     1 
ATOM   4825  C  CA    . LYS B  2 59  ? 55.904  -4.350  36.412  1.00 74.88  ? 43  LYS B CA    1 
ATOM   4826  C  C     . LYS B  2 59  ? 56.042  -5.750  35.827  1.00 85.34  ? 43  LYS B C     1 
ATOM   4827  O  O     . LYS B  2 59  ? 56.786  -5.959  34.862  1.00 85.89  ? 43  LYS B O     1 
ATOM   4828  C  CB    . LYS B  2 59  ? 56.891  -4.147  37.562  1.00 76.28  ? 43  LYS B CB    1 
ATOM   4829  C  CG    . LYS B  2 59  ? 58.351  -4.278  37.162  1.00 100.57 ? 43  LYS B CG    1 
ATOM   4830  C  CD    . LYS B  2 59  ? 59.266  -4.216  38.374  1.00 116.07 ? 43  LYS B CD    1 
ATOM   4831  C  CE    . LYS B  2 59  ? 59.022  -5.390  39.307  1.00 120.80 ? 43  LYS B CE    1 
ATOM   4832  N  NZ    . LYS B  2 59  ? 59.918  -5.354  40.496  1.00 131.23 ? 43  LYS B NZ    1 
ATOM   4833  N  N     . GLU B  2 60  ? 55.327  -6.720  36.396  1.00 73.66  ? 44  GLU B N     1 
ATOM   4834  C  CA    . GLU B  2 60  ? 55.332  -8.086  35.892  1.00 74.51  ? 44  GLU B CA    1 
ATOM   4835  C  C     . GLU B  2 60  ? 54.372  -8.293  34.728  1.00 74.55  ? 44  GLU B C     1 
ATOM   4836  O  O     . GLU B  2 60  ? 54.277  -9.414  34.217  1.00 75.45  ? 44  GLU B O     1 
ATOM   4837  C  CB    . GLU B  2 60  ? 54.991  -9.065  37.020  1.00 74.45  ? 44  GLU B CB    1 
ATOM   4838  C  CG    . GLU B  2 60  ? 55.919  -8.978  38.220  1.00 80.32  ? 44  GLU B CG    1 
ATOM   4839  C  CD    . GLU B  2 60  ? 55.458  -9.844  39.378  1.00 93.76  ? 44  GLU B CD    1 
ATOM   4840  O  OE1   . GLU B  2 60  ? 56.066  -10.911 39.605  1.00 102.47 ? 44  GLU B OE1   1 
ATOM   4841  O  OE2   . GLU B  2 60  ? 54.482  -9.461  40.058  1.00 92.69  ? 44  GLU B OE2   1 
ATOM   4842  N  N     . GLY B  2 61  ? 53.663  -7.252  34.298  1.00 73.86  ? 45  GLY B N     1 
ATOM   4843  C  CA    . GLY B  2 61  ? 52.764  -7.366  33.170  1.00 74.25  ? 45  GLY B CA    1 
ATOM   4844  C  C     . GLY B  2 61  ? 51.436  -8.022  33.467  1.00 84.53  ? 45  GLY B C     1 
ATOM   4845  O  O     . GLY B  2 61  ? 50.645  -8.227  32.538  1.00 72.38  ? 45  GLY B O     1 
ATOM   4846  N  N     . LYS B  2 62  ? 51.159  -8.355  34.729  1.00 74.19  ? 46  LYS B N     1 
ATOM   4847  C  CA    . LYS B  2 62  ? 49.897  -9.007  35.061  1.00 72.53  ? 46  LYS B CA    1 
ATOM   4848  C  C     . LYS B  2 62  ? 48.713  -8.065  34.888  1.00 74.47  ? 46  LYS B C     1 
ATOM   4849  O  O     . LYS B  2 62  ? 47.621  -8.507  34.515  1.00 69.38  ? 46  LYS B O     1 
ATOM   4850  C  CB    . LYS B  2 62  ? 49.948  -9.547  36.490  1.00 66.64  ? 46  LYS B CB    1 
ATOM   4851  C  CG    . LYS B  2 62  ? 51.070  -10.546 36.729  1.00 73.30  ? 46  LYS B CG    1 
ATOM   4852  C  CD    . LYS B  2 62  ? 51.173  -10.928 38.196  1.00 75.84  ? 46  LYS B CD    1 
ATOM   4853  C  CE    . LYS B  2 62  ? 52.334  -11.881 38.435  1.00 81.70  ? 46  LYS B CE    1 
ATOM   4854  N  NZ    . LYS B  2 62  ? 52.490  -12.224 39.876  1.00 83.46  ? 46  LYS B NZ    1 
ATOM   4855  N  N     . ILE B  2 63  ? 48.906  -6.771  35.151  1.00 72.44  ? 47  ILE B N     1 
ATOM   4856  C  CA    . ILE B  2 63  ? 47.861  -5.772  34.986  1.00 67.29  ? 47  ILE B CA    1 
ATOM   4857  C  C     . ILE B  2 63  ? 48.429  -4.586  34.219  1.00 69.71  ? 47  ILE B C     1 
ATOM   4858  O  O     . ILE B  2 63  ? 49.643  -4.384  34.146  1.00 74.40  ? 47  ILE B O     1 
ATOM   4859  C  CB    . ILE B  2 63  ? 47.271  -5.303  36.335  1.00 61.94  ? 47  ILE B CB    1 
ATOM   4860  C  CG1   . ILE B  2 63  ? 48.366  -4.708  37.221  1.00 62.03  ? 47  ILE B CG1   1 
ATOM   4861  C  CG2   . ILE B  2 63  ? 46.562  -6.450  37.042  1.00 60.17  ? 47  ILE B CG2   1 
ATOM   4862  C  CD1   . ILE B  2 63  ? 47.865  -4.203  38.551  1.00 59.81  ? 47  ILE B CD1   1 
ATOM   4863  N  N     . SER B  2 64  ? 47.525  -3.796  33.644  1.00 70.80  ? 48  SER B N     1 
ATOM   4864  C  CA    . SER B  2 64  ? 47.892  -2.598  32.905  1.00 71.94  ? 48  SER B CA    1 
ATOM   4865  C  C     . SER B  2 64  ? 46.921  -1.480  33.250  1.00 70.80  ? 48  SER B C     1 
ATOM   4866  O  O     . SER B  2 64  ? 45.732  -1.719  33.476  1.00 70.64  ? 48  SER B O     1 
ATOM   4867  C  CB    . SER B  2 64  ? 47.888  -2.839  31.388  1.00 71.05  ? 48  SER B CB    1 
ATOM   4868  O  OG    . SER B  2 64  ? 48.822  -3.838  31.024  1.00 72.62  ? 48  SER B OG    1 
ATOM   4869  N  N     . LYS B  2 65  ? 47.439  -0.256  33.288  1.00 69.25  ? 49  LYS B N     1 
ATOM   4870  C  CA    . LYS B  2 65  ? 46.593  0.899   33.541  1.00 67.39  ? 49  LYS B CA    1 
ATOM   4871  C  C     . LYS B  2 65  ? 45.677  1.160   32.351  1.00 68.65  ? 49  LYS B C     1 
ATOM   4872  O  O     . LYS B  2 65  ? 46.043  0.937   31.195  1.00 84.53  ? 49  LYS B O     1 
ATOM   4873  C  CB    . LYS B  2 65  ? 47.444  2.134   33.834  1.00 68.56  ? 49  LYS B CB    1 
ATOM   4874  C  CG    . LYS B  2 65  ? 48.230  2.042   35.130  1.00 80.17  ? 49  LYS B CG    1 
ATOM   4875  C  CD    . LYS B  2 65  ? 48.948  3.343   35.451  1.00 79.50  ? 49  LYS B CD    1 
ATOM   4876  C  CE    . LYS B  2 65  ? 49.648  3.260   36.799  1.00 73.08  ? 49  LYS B CE    1 
ATOM   4877  N  NZ    . LYS B  2 65  ? 50.333  4.530   37.161  1.00 87.57  ? 49  LYS B NZ    1 
ATOM   4878  N  N     . ILE B  2 66  ? 44.465  1.629   32.648  1.00 67.37  ? 50  ILE B N     1 
ATOM   4879  C  CA    . ILE B  2 66  ? 43.465  1.925   31.633  1.00 70.14  ? 50  ILE B CA    1 
ATOM   4880  C  C     . ILE B  2 66  ? 42.905  3.318   31.888  1.00 68.68  ? 50  ILE B C     1 
ATOM   4881  O  O     . ILE B  2 66  ? 43.185  3.951   32.906  1.00 68.15  ? 50  ILE B O     1 
ATOM   4882  C  CB    . ILE B  2 66  ? 42.328  0.882   31.607  1.00 72.04  ? 50  ILE B CB    1 
ATOM   4883  C  CG1   . ILE B  2 66  ? 41.612  0.844   32.956  1.00 71.73  ? 50  ILE B CG1   1 
ATOM   4884  C  CG2   . ILE B  2 66  ? 42.870  -0.492  31.248  1.00 69.54  ? 50  ILE B CG2   1 
ATOM   4885  C  CD1   . ILE B  2 66  ? 40.447  -0.111  32.993  1.00 65.16  ? 50  ILE B CD1   1 
ATOM   4886  N  N     . GLY B  2 67  ? 42.098  3.788   30.941  1.00 70.25  ? 51  GLY B N     1 
ATOM   4887  C  CA    . GLY B  2 67  ? 41.506  5.100   31.028  1.00 76.60  ? 51  GLY B CA    1 
ATOM   4888  C  C     . GLY B  2 67  ? 40.024  5.053   31.336  1.00 85.85  ? 51  GLY B C     1 
ATOM   4889  O  O     . GLY B  2 67  ? 39.470  4.009   31.695  1.00 92.33  ? 51  GLY B O     1 
ATOM   4890  N  N     . PRO B  2 68  ? 39.349  6.197   31.200  1.00 91.83  ? 52  PRO B N     1 
ATOM   4891  C  CA    . PRO B  2 68  ? 37.911  6.254   31.477  1.00 87.75  ? 52  PRO B CA    1 
ATOM   4892  C  C     . PRO B  2 68  ? 37.031  5.788   30.329  1.00 95.91  ? 52  PRO B C     1 
ATOM   4893  O  O     . PRO B  2 68  ? 35.804  5.893   30.438  1.00 112.23 ? 52  PRO B O     1 
ATOM   4894  C  CB    . PRO B  2 68  ? 37.687  7.744   31.767  1.00 88.83  ? 52  PRO B CB    1 
ATOM   4895  C  CG    . PRO B  2 68  ? 38.693  8.428   30.906  1.00 86.56  ? 52  PRO B CG    1 
ATOM   4896  C  CD    . PRO B  2 68  ? 39.901  7.520   30.861  1.00 90.05  ? 52  PRO B CD    1 
ATOM   4897  N  N     . GLU B  2 69  ? 37.604  5.286   29.235  1.00 90.49  ? 53  GLU B N     1 
ATOM   4898  C  CA    . GLU B  2 69  ? 36.790  4.757   28.148  1.00 83.56  ? 53  GLU B CA    1 
ATOM   4899  C  C     . GLU B  2 69  ? 36.301  3.340   28.415  1.00 73.96  ? 53  GLU B C     1 
ATOM   4900  O  O     . GLU B  2 69  ? 35.460  2.841   27.660  1.00 76.00  ? 53  GLU B O     1 
ATOM   4901  C  CB    . GLU B  2 69  ? 37.568  4.793   26.827  1.00 90.31  ? 53  GLU B CB    1 
ATOM   4902  C  CG    . GLU B  2 69  ? 38.723  3.807   26.737  1.00 93.48  ? 53  GLU B CG    1 
ATOM   4903  C  CD    . GLU B  2 69  ? 39.998  4.328   27.373  1.00 101.23 ? 53  GLU B CD    1 
ATOM   4904  O  OE1   . GLU B  2 69  ? 39.967  5.425   27.969  1.00 104.05 ? 53  GLU B OE1   1 
ATOM   4905  O  OE2   . GLU B  2 69  ? 41.035  3.639   27.272  1.00 103.83 ? 53  GLU B OE2   1 
ATOM   4906  N  N     . ASN B  2 70  ? 36.809  2.686   29.460  1.00 70.82  ? 54  ASN B N     1 
ATOM   4907  C  CA    . ASN B  2 70  ? 36.354  1.369   29.889  1.00 72.44  ? 54  ASN B CA    1 
ATOM   4908  C  C     . ASN B  2 70  ? 35.221  1.551   30.891  1.00 76.10  ? 54  ASN B C     1 
ATOM   4909  O  O     . ASN B  2 70  ? 35.476  1.824   32.071  1.00 82.41  ? 54  ASN B O     1 
ATOM   4910  C  CB    . ASN B  2 70  ? 37.512  0.577   30.502  1.00 67.63  ? 54  ASN B CB    1 
ATOM   4911  C  CG    . ASN B  2 70  ? 37.155  -0.875  30.788  1.00 72.31  ? 54  ASN B CG    1 
ATOM   4912  O  OD1   . ASN B  2 70  ? 36.000  -1.211  31.047  1.00 71.71  ? 54  ASN B OD1   1 
ATOM   4913  N  ND2   . ASN B  2 70  ? 38.159  -1.743  30.749  1.00 75.96  ? 54  ASN B ND2   1 
ATOM   4914  N  N     . PRO B  2 71  ? 33.960  1.409   30.470  1.00 72.91  ? 55  PRO B N     1 
ATOM   4915  C  CA    . PRO B  2 71  ? 32.839  1.719   31.369  1.00 73.77  ? 55  PRO B CA    1 
ATOM   4916  C  C     . PRO B  2 71  ? 32.626  0.701   32.477  1.00 73.37  ? 55  PRO B C     1 
ATOM   4917  O  O     . PRO B  2 71  ? 31.707  0.879   33.285  1.00 69.62  ? 55  PRO B O     1 
ATOM   4918  C  CB    . PRO B  2 71  ? 31.637  1.747   30.416  1.00 70.64  ? 55  PRO B CB    1 
ATOM   4919  C  CG    . PRO B  2 71  ? 32.003  0.768   29.356  1.00 74.16  ? 55  PRO B CG    1 
ATOM   4920  C  CD    . PRO B  2 71  ? 33.497  0.889   29.171  1.00 73.55  ? 55  PRO B CD    1 
ATOM   4921  N  N     . TYR B  2 72  ? 33.433  -0.350  32.547  1.00 69.01  ? 56  TYR B N     1 
ATOM   4922  C  CA    . TYR B  2 72  ? 33.245  -1.412  33.522  1.00 65.62  ? 56  TYR B CA    1 
ATOM   4923  C  C     . TYR B  2 72  ? 34.148  -1.196  34.730  1.00 66.77  ? 56  TYR B C     1 
ATOM   4924  O  O     . TYR B  2 72  ? 35.198  -0.553  34.637  1.00 69.62  ? 56  TYR B O     1 
ATOM   4925  C  CB    . TYR B  2 72  ? 33.526  -2.775  32.889  1.00 62.22  ? 56  TYR B CB    1 
ATOM   4926  C  CG    . TYR B  2 72  ? 32.834  -2.956  31.559  1.00 76.34  ? 56  TYR B CG    1 
ATOM   4927  C  CD1   . TYR B  2 72  ? 31.451  -3.024  31.481  1.00 77.88  ? 56  TYR B CD1   1 
ATOM   4928  C  CD2   . TYR B  2 72  ? 33.563  -3.049  30.380  1.00 86.71  ? 56  TYR B CD2   1 
ATOM   4929  C  CE1   . TYR B  2 72  ? 30.811  -3.184  30.269  1.00 85.25  ? 56  TYR B CE1   1 
ATOM   4930  C  CE2   . TYR B  2 72  ? 32.932  -3.210  29.162  1.00 89.48  ? 56  TYR B CE2   1 
ATOM   4931  C  CZ    . TYR B  2 72  ? 31.556  -3.277  29.113  1.00 86.91  ? 56  TYR B CZ    1 
ATOM   4932  O  OH    . TYR B  2 72  ? 30.920  -3.438  27.904  1.00 88.08  ? 56  TYR B OH    1 
ATOM   4933  N  N     . ASN B  2 73  ? 33.727  -1.737  35.871  1.00 60.67  ? 57  ASN B N     1 
ATOM   4934  C  CA    . ASN B  2 73  ? 34.488  -1.578  37.101  1.00 59.56  ? 57  ASN B CA    1 
ATOM   4935  C  C     . ASN B  2 73  ? 34.032  -2.615  38.118  1.00 61.15  ? 57  ASN B C     1 
ATOM   4936  O  O     . ASN B  2 73  ? 32.858  -2.991  38.162  1.00 57.17  ? 57  ASN B O     1 
ATOM   4937  C  CB    . ASN B  2 73  ? 34.332  -0.166  37.673  1.00 60.07  ? 57  ASN B CB    1 
ATOM   4938  C  CG    . ASN B  2 73  ? 35.240  0.085   38.858  1.00 67.56  ? 57  ASN B CG    1 
ATOM   4939  O  OD1   . ASN B  2 73  ? 36.420  0.395   38.695  1.00 66.70  ? 57  ASN B OD1   1 
ATOM   4940  N  ND2   . ASN B  2 73  ? 34.692  -0.043  40.062  1.00 65.37  ? 57  ASN B ND2   1 
ATOM   4941  N  N     . THR B  2 74  ? 34.979  -3.066  38.943  1.00 59.55  ? 58  THR B N     1 
ATOM   4942  C  CA    . THR B  2 74  ? 34.730  -4.078  39.954  1.00 50.89  ? 58  THR B CA    1 
ATOM   4943  C  C     . THR B  2 74  ? 35.450  -3.637  41.225  1.00 49.87  ? 58  THR B C     1 
ATOM   4944  O  O     . THR B  2 74  ? 36.602  -3.179  41.149  1.00 54.52  ? 58  THR B O     1 
ATOM   4945  C  CB    . THR B  2 74  ? 35.223  -5.457  39.487  1.00 51.27  ? 58  THR B CB    1 
ATOM   4946  O  OG1   . THR B  2 74  ? 34.348  -5.960  38.468  1.00 59.93  ? 58  THR B OG1   1 
ATOM   4947  C  CG2   . THR B  2 74  ? 35.266  -6.437  40.633  1.00 52.12  ? 58  THR B CG2   1 
ATOM   4948  N  N     . PRO B  2 75  ? 34.807  -3.729  42.393  1.00 55.95  ? 59  PRO B N     1 
ATOM   4949  C  CA    . PRO B  2 75  ? 35.466  -3.281  43.625  1.00 51.70  ? 59  PRO B CA    1 
ATOM   4950  C  C     . PRO B  2 75  ? 36.699  -4.115  43.942  1.00 47.33  ? 59  PRO B C     1 
ATOM   4951  O  O     . PRO B  2 75  ? 36.794  -5.290  43.581  1.00 46.91  ? 59  PRO B O     1 
ATOM   4952  C  CB    . PRO B  2 75  ? 34.387  -3.462  44.698  1.00 46.22  ? 59  PRO B CB    1 
ATOM   4953  C  CG    . PRO B  2 75  ? 33.103  -3.545  43.958  1.00 48.06  ? 59  PRO B CG    1 
ATOM   4954  C  CD    . PRO B  2 75  ? 33.428  -4.178  42.641  1.00 52.62  ? 59  PRO B CD    1 
ATOM   4955  N  N     . VAL B  2 76  ? 37.646  -3.489  44.637  1.00 46.60  ? 60  VAL B N     1 
ATOM   4956  C  CA    . VAL B  2 76  ? 38.879  -4.146  45.057  1.00 49.85  ? 60  VAL B CA    1 
ATOM   4957  C  C     . VAL B  2 76  ? 39.205  -3.702  46.476  1.00 55.82  ? 60  VAL B C     1 
ATOM   4958  O  O     . VAL B  2 76  ? 38.953  -2.553  46.856  1.00 45.87  ? 60  VAL B O     1 
ATOM   4959  C  CB    . VAL B  2 76  ? 40.047  -3.835  44.093  1.00 47.82  ? 60  VAL B CB    1 
ATOM   4960  C  CG1   . VAL B  2 76  ? 40.358  -2.343  44.077  1.00 48.48  ? 60  VAL B CG1   1 
ATOM   4961  C  CG2   . VAL B  2 76  ? 41.288  -4.645  44.458  1.00 48.01  ? 60  VAL B CG2   1 
ATOM   4962  N  N     . PHE B  2 77  ? 39.740  -4.626  47.268  1.00 48.65  ? 61  PHE B N     1 
ATOM   4963  C  CA    . PHE B  2 77  ? 40.277  -4.311  48.585  1.00 46.94  ? 61  PHE B CA    1 
ATOM   4964  C  C     . PHE B  2 77  ? 41.340  -5.354  48.911  1.00 45.30  ? 61  PHE B C     1 
ATOM   4965  O  O     . PHE B  2 77  ? 41.750  -6.137  48.049  1.00 45.82  ? 61  PHE B O     1 
ATOM   4966  C  CB    . PHE B  2 77  ? 39.160  -4.222  49.638  1.00 52.89  ? 61  PHE B CB    1 
ATOM   4967  C  CG    . PHE B  2 77  ? 38.443  -5.521  49.903  1.00 49.27  ? 61  PHE B CG    1 
ATOM   4968  C  CD1   . PHE B  2 77  ? 37.608  -6.083  48.950  1.00 57.55  ? 61  PHE B CD1   1 
ATOM   4969  C  CD2   . PHE B  2 77  ? 38.570  -6.154  51.129  1.00 44.69  ? 61  PHE B CD2   1 
ATOM   4970  C  CE1   . PHE B  2 77  ? 36.940  -7.268  49.202  1.00 47.01  ? 61  PHE B CE1   1 
ATOM   4971  C  CE2   . PHE B  2 77  ? 37.901  -7.336  51.388  1.00 45.45  ? 61  PHE B CE2   1 
ATOM   4972  C  CZ    . PHE B  2 77  ? 37.086  -7.894  50.424  1.00 45.53  ? 61  PHE B CZ    1 
ATOM   4973  N  N     . ALA B  2 78  ? 41.806  -5.355  50.155  1.00 45.21  ? 62  ALA B N     1 
ATOM   4974  C  CA    . ALA B  2 78  ? 42.869  -6.252  50.576  1.00 45.83  ? 62  ALA B CA    1 
ATOM   4975  C  C     . ALA B  2 78  ? 42.472  -6.942  51.871  1.00 45.09  ? 62  ALA B C     1 
ATOM   4976  O  O     . ALA B  2 78  ? 41.722  -6.394  52.681  1.00 51.85  ? 62  ALA B O     1 
ATOM   4977  C  CB    . ALA B  2 78  ? 44.198  -5.504  50.759  1.00 47.00  ? 62  ALA B CB    1 
ATOM   4978  N  N     . ILE B  2 79  ? 42.977  -8.163  52.051  1.00 45.40  ? 63  ILE B N     1 
ATOM   4979  C  CA    . ILE B  2 79  ? 42.690  -8.971  53.228  1.00 52.72  ? 63  ILE B CA    1 
ATOM   4980  C  C     . ILE B  2 79  ? 43.987  -9.591  53.730  1.00 54.08  ? 63  ILE B C     1 
ATOM   4981  O  O     . ILE B  2 79  ? 45.005  -9.616  53.037  1.00 58.30  ? 63  ILE B O     1 
ATOM   4982  C  CB    . ILE B  2 79  ? 41.661  -10.087 52.949  1.00 50.41  ? 63  ILE B CB    1 
ATOM   4983  C  CG1   . ILE B  2 79  ? 42.240  -11.097 51.956  1.00 45.71  ? 63  ILE B CG1   1 
ATOM   4984  C  CG2   . ILE B  2 79  ? 40.355  -9.510  52.439  1.00 43.54  ? 63  ILE B CG2   1 
ATOM   4985  C  CD1   . ILE B  2 79  ? 41.592  -12.455 52.028  1.00 47.26  ? 63  ILE B CD1   1 
ATOM   4986  N  N     . LYS B  2 80  ? 43.929  -10.099 54.957  1.00 53.31  ? 64  LYS B N     1 
ATOM   4987  C  CA    . LYS B  2 80  ? 44.960  -10.961 55.513  1.00 51.21  ? 64  LYS B CA    1 
ATOM   4988  C  C     . LYS B  2 80  ? 44.303  -12.261 55.946  1.00 52.64  ? 64  LYS B C     1 
ATOM   4989  O  O     . LYS B  2 80  ? 43.313  -12.242 56.686  1.00 53.04  ? 64  LYS B O     1 
ATOM   4990  C  CB    . LYS B  2 80  ? 45.671  -10.301 56.699  1.00 48.49  ? 64  LYS B CB    1 
ATOM   4991  C  CG    . LYS B  2 80  ? 46.492  -9.079  56.333  1.00 49.29  ? 64  LYS B CG    1 
ATOM   4992  C  CD    . LYS B  2 80  ? 47.292  -8.582  57.524  1.00 50.70  ? 64  LYS B CD    1 
ATOM   4993  C  CE    . LYS B  2 80  ? 48.154  -7.390  57.151  1.00 52.61  ? 64  LYS B CE    1 
ATOM   4994  N  NZ    . LYS B  2 80  ? 48.939  -6.880  58.309  1.00 67.67  ? 64  LYS B NZ    1 
ATOM   4995  N  N     . LYS B  2 81  ? 44.839  -13.382 55.474  1.00 52.04  ? 65  LYS B N     1 
ATOM   4996  C  CA    . LYS B  2 81  ? 44.303  -14.674 55.864  1.00 52.65  ? 65  LYS B CA    1 
ATOM   4997  C  C     . LYS B  2 81  ? 44.621  -14.948 57.334  1.00 48.88  ? 65  LYS B C     1 
ATOM   4998  O  O     . LYS B  2 81  ? 45.376  -14.216 57.981  1.00 55.58  ? 65  LYS B O     1 
ATOM   4999  C  CB    . LYS B  2 81  ? 44.862  -15.775 54.963  1.00 55.41  ? 65  LYS B CB    1 
ATOM   5000  C  CG    . LYS B  2 81  ? 44.757  -15.451 53.479  1.00 55.98  ? 65  LYS B CG    1 
ATOM   5001  C  CD    . LYS B  2 81  ? 45.126  -16.642 52.610  1.00 70.30  ? 65  LYS B CD    1 
ATOM   5002  C  CE    . LYS B  2 81  ? 44.115  -17.767 52.758  1.00 84.81  ? 65  LYS B CE    1 
ATOM   5003  N  NZ    . LYS B  2 81  ? 44.399  -18.890 51.824  1.00 89.25  ? 65  LYS B NZ    1 
ATOM   5004  N  N     . LYS B  2 82  ? 44.023  -16.014 57.864  1.00 58.09  ? 66  LYS B N     1 
ATOM   5005  C  CA    . LYS B  2 82  ? 44.212  -16.353 59.270  1.00 55.63  ? 66  LYS B CA    1 
ATOM   5006  C  C     . LYS B  2 82  ? 45.688  -16.563 59.581  1.00 54.04  ? 66  LYS B C     1 
ATOM   5007  O  O     . LYS B  2 82  ? 46.383  -17.307 58.883  1.00 56.36  ? 66  LYS B O     1 
ATOM   5008  C  CB    . LYS B  2 82  ? 43.418  -17.609 59.632  1.00 52.04  ? 66  LYS B CB    1 
ATOM   5009  C  CG    . LYS B  2 82  ? 41.934  -17.379 59.860  1.00 49.26  ? 66  LYS B CG    1 
ATOM   5010  C  CD    . LYS B  2 82  ? 41.324  -18.533 60.646  1.00 49.39  ? 66  LYS B CD    1 
ATOM   5011  C  CE    . LYS B  2 82  ? 39.805  -18.452 60.672  1.00 50.80  ? 66  LYS B CE    1 
ATOM   5012  N  NZ    . LYS B  2 82  ? 39.320  -17.147 61.199  1.00 47.41  ? 66  LYS B NZ    1 
ATOM   5013  N  N     . ASP B  2 83  ? 46.162  -15.884 60.628  1.00 55.92  ? 67  ASP B N     1 
ATOM   5014  C  CA    . ASP B  2 83  ? 47.540  -16.005 61.108  1.00 58.38  ? 67  ASP B CA    1 
ATOM   5015  C  C     . ASP B  2 83  ? 48.556  -15.606 60.040  1.00 60.70  ? 67  ASP B C     1 
ATOM   5016  O  O     . ASP B  2 83  ? 49.693  -16.084 60.041  1.00 70.84  ? 67  ASP B O     1 
ATOM   5017  C  CB    . ASP B  2 83  ? 47.827  -17.420 61.619  1.00 56.07  ? 67  ASP B CB    1 
ATOM   5018  C  CG    . ASP B  2 83  ? 46.941  -17.805 62.786  1.00 60.62  ? 67  ASP B CG    1 
ATOM   5019  O  OD1   . ASP B  2 83  ? 46.616  -16.918 63.603  1.00 65.41  ? 67  ASP B OD1   1 
ATOM   5020  O  OD2   . ASP B  2 83  ? 46.568  -18.992 62.886  1.00 72.69  ? 67  ASP B OD2   1 
ATOM   5021  N  N     . SER B  2 84  ? 48.160  -14.724 59.127  1.00 63.86  ? 68  SER B N     1 
ATOM   5022  C  CA    . SER B  2 84  ? 49.035  -14.229 58.073  1.00 64.94  ? 68  SER B CA    1 
ATOM   5023  C  C     . SER B  2 84  ? 49.181  -12.722 58.211  1.00 64.07  ? 68  SER B C     1 
ATOM   5024  O  O     . SER B  2 84  ? 48.184  -12.008 58.364  1.00 69.51  ? 68  SER B O     1 
ATOM   5025  C  CB    . SER B  2 84  ? 48.491  -14.585 56.687  1.00 63.83  ? 68  SER B CB    1 
ATOM   5026  O  OG    . SER B  2 84  ? 49.302  -14.028 55.665  1.00 66.07  ? 68  SER B OG    1 
ATOM   5027  N  N     . THR B  2 85  ? 50.422  -12.244 58.159  1.00 65.90  ? 69  THR B N     1 
ATOM   5028  C  CA    . THR B  2 85  ? 50.719  -10.821 58.238  1.00 67.31  ? 69  THR B CA    1 
ATOM   5029  C  C     . THR B  2 85  ? 50.901  -10.179 56.871  1.00 63.40  ? 69  THR B C     1 
ATOM   5030  O  O     . THR B  2 85  ? 51.204  -8.984  56.798  1.00 61.61  ? 69  THR B O     1 
ATOM   5031  C  CB    . THR B  2 85  ? 51.976  -10.589 59.085  1.00 63.46  ? 69  THR B CB    1 
ATOM   5032  O  OG1   . THR B  2 85  ? 53.080  -11.302 58.511  1.00 66.66  ? 69  THR B OG1   1 
ATOM   5033  C  CG2   . THR B  2 85  ? 51.755  -11.071 60.511  1.00 62.66  ? 69  THR B CG2   1 
ATOM   5034  N  N     . LYS B  2 86  ? 50.717  -10.934 55.792  1.00 55.24  ? 70  LYS B N     1 
ATOM   5035  C  CA    . LYS B  2 86  ? 50.928  -10.440 54.439  1.00 63.66  ? 70  LYS B CA    1 
ATOM   5036  C  C     . LYS B  2 86  ? 49.595  -10.051 53.814  1.00 61.55  ? 70  LYS B C     1 
ATOM   5037  O  O     . LYS B  2 86  ? 48.623  -10.809 53.891  1.00 59.67  ? 70  LYS B O     1 
ATOM   5038  C  CB    . LYS B  2 86  ? 51.625  -11.497 53.580  1.00 70.10  ? 70  LYS B CB    1 
ATOM   5039  C  CG    . LYS B  2 86  ? 51.873  -11.068 52.146  1.00 82.37  ? 70  LYS B CG    1 
ATOM   5040  C  CD    . LYS B  2 86  ? 52.547  -12.172 51.348  1.00 87.54  ? 70  LYS B CD    1 
ATOM   5041  C  CE    . LYS B  2 86  ? 52.792  -11.741 49.912  1.00 85.62  ? 70  LYS B CE    1 
ATOM   5042  N  NZ    . LYS B  2 86  ? 53.664  -10.536 49.838  1.00 88.46  ? 70  LYS B NZ    1 
ATOM   5043  N  N     . TRP B  2 87  ? 49.556  -8.872  53.199  1.00 57.79  ? 71  TRP B N     1 
ATOM   5044  C  CA    . TRP B  2 87  ? 48.355  -8.431  52.507  1.00 51.23  ? 71  TRP B CA    1 
ATOM   5045  C  C     . TRP B  2 87  ? 48.126  -9.258  51.248  1.00 63.55  ? 71  TRP B C     1 
ATOM   5046  O  O     . TRP B  2 87  ? 49.068  -9.705  50.588  1.00 73.54  ? 71  TRP B O     1 
ATOM   5047  C  CB    . TRP B  2 87  ? 48.458  -6.951  52.136  1.00 51.48  ? 71  TRP B CB    1 
ATOM   5048  C  CG    . TRP B  2 87  ? 48.324  -6.020  53.296  1.00 56.05  ? 71  TRP B CG    1 
ATOM   5049  C  CD1   . TRP B  2 87  ? 49.311  -5.267  53.862  1.00 65.19  ? 71  TRP B CD1   1 
ATOM   5050  C  CD2   . TRP B  2 87  ? 47.130  -5.737  54.033  1.00 54.27  ? 71  TRP B CD2   1 
ATOM   5051  N  NE1   . TRP B  2 87  ? 48.805  -4.533  54.907  1.00 70.84  ? 71  TRP B NE1   1 
ATOM   5052  C  CE2   . TRP B  2 87  ? 47.467  -4.803  55.033  1.00 58.93  ? 71  TRP B CE2   1 
ATOM   5053  C  CE3   . TRP B  2 87  ? 45.807  -6.184  53.945  1.00 53.38  ? 71  TRP B CE3   1 
ATOM   5054  C  CZ2   . TRP B  2 87  ? 46.532  -4.309  55.939  1.00 58.64  ? 71  TRP B CZ2   1 
ATOM   5055  C  CZ3   . TRP B  2 87  ? 44.880  -5.691  54.846  1.00 60.74  ? 71  TRP B CZ3   1 
ATOM   5056  C  CH2   . TRP B  2 87  ? 45.247  -4.764  55.829  1.00 58.25  ? 71  TRP B CH2   1 
ATOM   5057  N  N     . ARG B  2 88  ? 46.853  -9.460  50.917  1.00 52.17  ? 72  ARG B N     1 
ATOM   5058  C  CA    . ARG B  2 88  ? 46.466  -10.152 49.697  1.00 52.23  ? 72  ARG B CA    1 
ATOM   5059  C  C     . ARG B  2 88  ? 45.433  -9.317  48.960  1.00 53.54  ? 72  ARG B C     1 
ATOM   5060  O  O     . ARG B  2 88  ? 44.437  -8.891  49.553  1.00 55.44  ? 72  ARG B O     1 
ATOM   5061  C  CB    . ARG B  2 88  ? 45.902  -11.546 49.992  1.00 54.36  ? 72  ARG B CB    1 
ATOM   5062  C  CG    . ARG B  2 88  ? 45.712  -12.405 48.750  1.00 57.71  ? 72  ARG B CG    1 
ATOM   5063  C  CD    . ARG B  2 88  ? 44.970  -13.687 49.074  1.00 62.30  ? 72  ARG B CD    1 
ATOM   5064  N  NE    . ARG B  2 88  ? 44.997  -14.637 47.966  1.00 61.74  ? 72  ARG B NE    1 
ATOM   5065  C  CZ    . ARG B  2 88  ? 44.188  -14.586 46.914  1.00 57.82  ? 72  ARG B CZ    1 
ATOM   5066  N  NH1   . ARG B  2 88  ? 43.284  -13.621 46.814  1.00 56.19  ? 72  ARG B NH1   1 
ATOM   5067  N  NH2   . ARG B  2 88  ? 44.281  -15.500 45.959  1.00 56.75  ? 72  ARG B NH2   1 
ATOM   5068  N  N     . LYS B  2 89  ? 45.676  -9.083  47.674  1.00 53.53  ? 73  LYS B N     1 
ATOM   5069  C  CA    . LYS B  2 89  ? 44.717  -8.369  46.845  1.00 49.46  ? 73  LYS B CA    1 
ATOM   5070  C  C     . LYS B  2 89  ? 43.475  -9.226  46.635  1.00 47.85  ? 73  LYS B C     1 
ATOM   5071  O  O     . LYS B  2 89  ? 43.570  -10.376 46.196  1.00 61.67  ? 73  LYS B O     1 
ATOM   5072  C  CB    . LYS B  2 89  ? 45.355  -8.011  45.504  1.00 50.88  ? 73  LYS B CB    1 
ATOM   5073  C  CG    . LYS B  2 89  ? 44.468  -7.223  44.558  1.00 50.15  ? 73  LYS B CG    1 
ATOM   5074  C  CD    . LYS B  2 89  ? 45.267  -6.770  43.344  1.00 51.99  ? 73  LYS B CD    1 
ATOM   5075  C  CE    . LYS B  2 89  ? 44.435  -5.927  42.393  1.00 63.70  ? 73  LYS B CE    1 
ATOM   5076  N  NZ    . LYS B  2 89  ? 43.441  -6.734  41.638  1.00 66.33  ? 73  LYS B NZ    1 
ATOM   5077  N  N     . LEU B  2 90  ? 42.311  -8.671  46.961  1.00 46.32  ? 74  LEU B N     1 
ATOM   5078  C  CA    . LEU B  2 90  ? 41.045  -9.373  46.799  1.00 44.94  ? 74  LEU B CA    1 
ATOM   5079  C  C     . LEU B  2 90  ? 40.107  -8.531  45.951  1.00 44.36  ? 74  LEU B C     1 
ATOM   5080  O  O     . LEU B  2 90  ? 39.845  -7.367  46.272  1.00 51.06  ? 74  LEU B O     1 
ATOM   5081  C  CB    . LEU B  2 90  ? 40.397  -9.689  48.150  1.00 43.89  ? 74  LEU B CB    1 
ATOM   5082  C  CG    . LEU B  2 90  ? 39.076  -10.459 48.066  1.00 57.44  ? 74  LEU B CG    1 
ATOM   5083  C  CD1   . LEU B  2 90  ? 39.219  -11.665 47.152  1.00 43.07  ? 74  LEU B CD1   1 
ATOM   5084  C  CD2   . LEU B  2 90  ? 38.615  -10.892 49.447  1.00 42.01  ? 74  LEU B CD2   1 
ATOM   5085  N  N     . VAL B  2 91  ? 39.598  -9.126  44.876  1.00 46.34  ? 75  VAL B N     1 
ATOM   5086  C  CA    . VAL B  2 91  ? 38.701  -8.459  43.942  1.00 46.96  ? 75  VAL B CA    1 
ATOM   5087  C  C     . VAL B  2 91  ? 37.308  -9.043  44.121  1.00 50.97  ? 75  VAL B C     1 
ATOM   5088  O  O     . VAL B  2 91  ? 37.138  -10.268 44.138  1.00 55.27  ? 75  VAL B O     1 
ATOM   5089  C  CB    . VAL B  2 91  ? 39.188  -8.619  42.492  1.00 53.00  ? 75  VAL B CB    1 
ATOM   5090  C  CG1   . VAL B  2 91  ? 38.416  -7.702  41.573  1.00 48.02  ? 75  VAL B CG1   1 
ATOM   5091  C  CG2   . VAL B  2 91  ? 40.678  -8.338  42.400  1.00 55.30  ? 75  VAL B CG2   1 
ATOM   5092  N  N     . ASP B  2 92  ? 36.311  -8.166  44.257  1.00 49.00  ? 76  ASP B N     1 
ATOM   5093  C  CA    . ASP B  2 92  ? 34.923  -8.589  44.441  1.00 48.03  ? 76  ASP B CA    1 
ATOM   5094  C  C     . ASP B  2 92  ? 34.294  -8.863  43.073  1.00 49.02  ? 76  ASP B C     1 
ATOM   5095  O  O     . ASP B  2 92  ? 33.455  -8.117  42.566  1.00 54.14  ? 76  ASP B O     1 
ATOM   5096  C  CB    . ASP B  2 92  ? 34.145  -7.537  45.223  1.00 44.60  ? 76  ASP B CB    1 
ATOM   5097  C  CG    . ASP B  2 92  ? 32.727  -7.974  45.546  1.00 47.79  ? 76  ASP B CG    1 
ATOM   5098  O  OD1   . ASP B  2 92  ? 32.380  -9.143  45.271  1.00 46.67  ? 76  ASP B OD1   1 
ATOM   5099  O  OD2   . ASP B  2 92  ? 31.957  -7.143  46.074  1.00 48.93  ? 76  ASP B OD2   1 
ATOM   5100  N  N     . PHE B  2 93  ? 34.713  -9.981  42.480  1.00 43.62  ? 77  PHE B N     1 
ATOM   5101  C  CA    . PHE B  2 93  ? 34.239  -10.410 41.170  1.00 43.29  ? 77  PHE B CA    1 
ATOM   5102  C  C     . PHE B  2 93  ? 32.858  -11.058 41.210  1.00 53.97  ? 77  PHE B C     1 
ATOM   5103  O  O     . PHE B  2 93  ? 32.503  -11.760 40.256  1.00 66.07  ? 77  PHE B O     1 
ATOM   5104  C  CB    . PHE B  2 93  ? 35.241  -11.382 40.540  1.00 53.85  ? 77  PHE B CB    1 
ATOM   5105  C  CG    . PHE B  2 93  ? 36.380  -10.708 39.827  1.00 55.51  ? 77  PHE B CG    1 
ATOM   5106  C  CD1   . PHE B  2 93  ? 36.166  -9.571  39.065  1.00 57.25  ? 77  PHE B CD1   1 
ATOM   5107  C  CD2   . PHE B  2 93  ? 37.666  -11.216 39.917  1.00 52.88  ? 77  PHE B CD2   1 
ATOM   5108  C  CE1   . PHE B  2 93  ? 37.214  -8.953  38.406  1.00 52.86  ? 77  PHE B CE1   1 
ATOM   5109  C  CE2   . PHE B  2 93  ? 38.719  -10.603 39.261  1.00 51.82  ? 77  PHE B CE2   1 
ATOM   5110  C  CZ    . PHE B  2 93  ? 38.492  -9.470  38.504  1.00 48.39  ? 77  PHE B CZ    1 
ATOM   5111  N  N     . ARG B  2 94  ? 32.077  -10.842 42.273  1.00 49.36  ? 78  ARG B N     1 
ATOM   5112  C  CA    . ARG B  2 94  ? 30.769  -11.486 42.377  1.00 42.94  ? 78  ARG B CA    1 
ATOM   5113  C  C     . ARG B  2 94  ? 29.862  -11.103 41.214  1.00 51.42  ? 78  ARG B C     1 
ATOM   5114  O  O     . ARG B  2 94  ? 29.081  -11.929 40.730  1.00 56.48  ? 78  ARG B O     1 
ATOM   5115  C  CB    . ARG B  2 94  ? 30.107  -11.130 43.708  1.00 40.48  ? 78  ARG B CB    1 
ATOM   5116  C  CG    . ARG B  2 94  ? 30.565  -11.981 44.881  1.00 47.93  ? 78  ARG B CG    1 
ATOM   5117  C  CD    . ARG B  2 94  ? 29.892  -11.544 46.172  1.00 42.84  ? 78  ARG B CD    1 
ATOM   5118  N  NE    . ARG B  2 94  ? 30.291  -10.195 46.562  1.00 39.10  ? 78  ARG B NE    1 
ATOM   5119  C  CZ    . ARG B  2 94  ? 29.796  -9.542  47.609  1.00 49.93  ? 78  ARG B CZ    1 
ATOM   5120  N  NH1   . ARG B  2 94  ? 28.878  -10.115 48.376  1.00 47.61  ? 78  ARG B NH1   1 
ATOM   5121  N  NH2   . ARG B  2 94  ? 30.220  -8.318  47.890  1.00 42.60  ? 78  ARG B NH2   1 
ATOM   5122  N  N     . GLU B  2 95  ? 29.952  -9.855  40.748  1.00 54.37  ? 79  GLU B N     1 
ATOM   5123  C  CA    . GLU B  2 95  ? 29.105  -9.425  39.641  1.00 56.27  ? 79  GLU B CA    1 
ATOM   5124  C  C     . GLU B  2 95  ? 29.587  -10.006 38.318  1.00 60.04  ? 79  GLU B C     1 
ATOM   5125  O  O     . GLU B  2 95  ? 28.778  -10.470 37.507  1.00 65.76  ? 79  GLU B O     1 
ATOM   5126  C  CB    . GLU B  2 95  ? 29.059  -7.897  39.576  1.00 66.47  ? 79  GLU B CB    1 
ATOM   5127  C  CG    . GLU B  2 95  ? 27.988  -7.344  38.649  1.00 82.42  ? 79  GLU B CG    1 
ATOM   5128  C  CD    . GLU B  2 95  ? 26.581  -7.639  39.137  1.00 89.00  ? 79  GLU B CD    1 
ATOM   5129  O  OE1   . GLU B  2 95  ? 26.396  -7.806  40.361  1.00 80.92  ? 79  GLU B OE1   1 
ATOM   5130  O  OE2   . GLU B  2 95  ? 25.661  -7.705  38.295  1.00 94.16  ? 79  GLU B OE2   1 
ATOM   5131  N  N     . LEU B  2 96  ? 30.902  -9.994  38.084  1.00 56.71  ? 80  LEU B N     1 
ATOM   5132  C  CA    . LEU B  2 96  ? 31.436  -10.565 36.852  1.00 51.58  ? 80  LEU B CA    1 
ATOM   5133  C  C     . LEU B  2 96  ? 31.237  -12.075 36.800  1.00 56.22  ? 80  LEU B C     1 
ATOM   5134  O  O     . LEU B  2 96  ? 31.051  -12.636 35.713  1.00 66.84  ? 80  LEU B O     1 
ATOM   5135  C  CB    . LEU B  2 96  ? 32.920  -10.221 36.711  1.00 53.17  ? 80  LEU B CB    1 
ATOM   5136  C  CG    . LEU B  2 96  ? 33.639  -10.784 35.480  1.00 57.22  ? 80  LEU B CG    1 
ATOM   5137  C  CD1   . LEU B  2 96  ? 33.089  -10.171 34.199  1.00 50.98  ? 80  LEU B CD1   1 
ATOM   5138  C  CD2   . LEU B  2 96  ? 35.144  -10.578 35.576  1.00 53.42  ? 80  LEU B CD2   1 
ATOM   5139  N  N     . ASN B  2 97  ? 31.261  -12.745 37.954  1.00 60.25  ? 81  ASN B N     1 
ATOM   5140  C  CA    . ASN B  2 97  ? 31.142  -14.200 37.972  1.00 59.80  ? 81  ASN B CA    1 
ATOM   5141  C  C     . ASN B  2 97  ? 29.766  -14.651 37.495  1.00 65.69  ? 81  ASN B C     1 
ATOM   5142  O  O     . ASN B  2 97  ? 29.658  -15.532 36.634  1.00 77.97  ? 81  ASN B O     1 
ATOM   5143  C  CB    . ASN B  2 97  ? 31.431  -14.736 39.373  1.00 54.71  ? 81  ASN B CB    1 
ATOM   5144  C  CG    . ASN B  2 97  ? 32.904  -14.676 39.726  1.00 60.82  ? 81  ASN B CG    1 
ATOM   5145  O  OD1   . ASN B  2 97  ? 33.761  -14.609 38.845  1.00 66.05  ? 81  ASN B OD1   1 
ATOM   5146  N  ND2   . ASN B  2 97  ? 33.206  -14.709 41.018  1.00 66.80  ? 81  ASN B ND2   1 
ATOM   5147  N  N     . LYS B  2 98  ? 28.702  -14.063 38.039  1.00 62.84  ? 82  LYS B N     1 
ATOM   5148  C  CA    . LYS B  2 98  ? 27.357  -14.451 37.631  1.00 74.21  ? 82  LYS B CA    1 
ATOM   5149  C  C     . LYS B  2 98  ? 26.966  -13.896 36.267  1.00 78.49  ? 82  LYS B C     1 
ATOM   5150  O  O     . LYS B  2 98  ? 25.870  -14.200 35.785  1.00 87.56  ? 82  LYS B O     1 
ATOM   5151  C  CB    . LYS B  2 98  ? 26.331  -14.024 38.686  1.00 80.54  ? 82  LYS B CB    1 
ATOM   5152  C  CG    . LYS B  2 98  ? 26.359  -12.558 39.071  1.00 83.20  ? 82  LYS B CG    1 
ATOM   5153  C  CD    . LYS B  2 98  ? 25.354  -12.289 40.184  1.00 87.13  ? 82  LYS B CD    1 
ATOM   5154  C  CE    . LYS B  2 98  ? 25.416  -10.852 40.671  1.00 94.40  ? 82  LYS B CE    1 
ATOM   5155  N  NZ    . LYS B  2 98  ? 24.433  -10.596 41.759  1.00 97.29  ? 82  LYS B NZ    1 
ATOM   5156  N  N     . ARG B  2 99  ? 27.826  -13.101 35.635  1.00 70.24  ? 83  ARG B N     1 
ATOM   5157  C  CA    . ARG B  2 99  ? 27.627  -12.676 34.257  1.00 66.74  ? 83  ARG B CA    1 
ATOM   5158  C  C     . ARG B  2 99  ? 28.405  -13.533 33.266  1.00 78.08  ? 83  ARG B C     1 
ATOM   5159  O  O     . ARG B  2 99  ? 28.344  -13.275 32.060  1.00 82.96  ? 83  ARG B O     1 
ATOM   5160  C  CB    . ARG B  2 99  ? 28.015  -11.203 34.096  1.00 61.18  ? 83  ARG B CB    1 
ATOM   5161  C  CG    . ARG B  2 99  ? 27.085  -10.248 34.825  1.00 66.53  ? 83  ARG B CG    1 
ATOM   5162  C  CD    . ARG B  2 99  ? 27.634  -8.833  34.837  1.00 79.58  ? 83  ARG B CD    1 
ATOM   5163  N  NE    . ARG B  2 99  ? 26.813  -7.938  35.646  1.00 81.94  ? 83  ARG B NE    1 
ATOM   5164  C  CZ    . ARG B  2 99  ? 25.793  -7.227  35.176  1.00 86.88  ? 83  ARG B CZ    1 
ATOM   5165  N  NH1   . ARG B  2 99  ? 25.463  -7.304  33.894  1.00 95.88  ? 83  ARG B NH1   1 
ATOM   5166  N  NH2   . ARG B  2 99  ? 25.101  -6.440  35.988  1.00 85.53  ? 83  ARG B NH2   1 
ATOM   5167  N  N     . THR B  2 100 ? 29.136  -14.535 33.748  1.00 81.26  ? 84  THR B N     1 
ATOM   5168  C  CA    . THR B  2 100 ? 29.823  -15.523 32.922  1.00 86.18  ? 84  THR B CA    1 
ATOM   5169  C  C     . THR B  2 100 ? 29.504  -16.926 33.416  1.00 104.02 ? 84  THR B C     1 
ATOM   5170  O  O     . THR B  2 100 ? 30.357  -17.819 33.408  1.00 102.45 ? 84  THR B O     1 
ATOM   5171  C  CB    . THR B  2 100 ? 31.333  -15.293 32.917  1.00 82.33  ? 84  THR B CB    1 
ATOM   5172  O  OG1   . THR B  2 100 ? 31.844  -15.427 34.249  1.00 86.14  ? 84  THR B OG1   1 
ATOM   5173  C  CG2   . THR B  2 100 ? 31.670  -13.908 32.390  1.00 78.17  ? 84  THR B CG2   1 
ATOM   5174  N  N     . GLN B  2 101 ? 28.260  -17.140 33.851  1.00 121.78 ? 85  GLN B N     1 
ATOM   5175  C  CA    . GLN B  2 101 ? 27.909  -18.381 34.536  1.00 136.51 ? 85  GLN B CA    1 
ATOM   5176  C  C     . GLN B  2 101 ? 27.888  -19.576 33.590  1.00 141.38 ? 85  GLN B C     1 
ATOM   5177  O  O     . GLN B  2 101 ? 28.183  -20.701 34.012  1.00 135.42 ? 85  GLN B O     1 
ATOM   5178  C  CB    . GLN B  2 101 ? 26.556  -18.225 35.232  1.00 140.16 ? 85  GLN B CB    1 
ATOM   5179  C  CG    . GLN B  2 101 ? 26.154  -19.410 36.094  1.00 142.83 ? 85  GLN B CG    1 
ATOM   5180  C  CD    . GLN B  2 101 ? 24.844  -19.183 36.823  1.00 146.98 ? 85  GLN B CD    1 
ATOM   5181  O  OE1   . GLN B  2 101 ? 24.333  -18.064 36.872  1.00 148.26 ? 85  GLN B OE1   1 
ATOM   5182  N  NE2   . GLN B  2 101 ? 24.292  -20.248 37.393  1.00 148.36 ? 85  GLN B NE2   1 
ATOM   5183  N  N     . ASP B  2 102 ? 27.552  -19.364 32.317  1.00 147.14 ? 86  ASP B N     1 
ATOM   5184  C  CA    . ASP B  2 102 ? 27.516  -20.474 31.370  1.00 145.50 ? 86  ASP B CA    1 
ATOM   5185  C  C     . ASP B  2 102 ? 28.903  -20.942 30.949  1.00 135.81 ? 86  ASP B C     1 
ATOM   5186  O  O     . ASP B  2 102 ? 29.003  -21.812 30.077  1.00 144.12 ? 86  ASP B O     1 
ATOM   5187  C  CB    . ASP B  2 102 ? 26.703  -20.086 30.133  1.00 156.18 ? 86  ASP B CB    1 
ATOM   5188  C  CG    . ASP B  2 102 ? 27.312  -18.923 29.377  1.00 164.54 ? 86  ASP B CG    1 
ATOM   5189  O  OD1   . ASP B  2 102 ? 27.954  -18.066 30.019  1.00 168.22 ? 86  ASP B OD1   1 
ATOM   5190  O  OD2   . ASP B  2 102 ? 27.147  -18.864 28.140  1.00 167.00 ? 86  ASP B OD2   1 
ATOM   5191  N  N     . PHE B  2 103 ? 29.967  -20.396 31.540  1.00 126.38 ? 87  PHE B N     1 
ATOM   5192  C  CA    . PHE B  2 103 ? 31.334  -20.795 31.222  1.00 126.13 ? 87  PHE B CA    1 
ATOM   5193  C  C     . PHE B  2 103 ? 31.893  -21.771 32.252  1.00 133.28 ? 87  PHE B C     1 
ATOM   5194  O  O     . PHE B  2 103 ? 32.194  -22.923 31.924  1.00 132.71 ? 87  PHE B O     1 
ATOM   5195  C  CB    . PHE B  2 103 ? 32.229  -19.553 31.118  1.00 119.73 ? 87  PHE B CB    1 
ATOM   5196  C  CG    . PHE B  2 103 ? 33.653  -19.860 30.757  1.00 119.28 ? 87  PHE B CG    1 
ATOM   5197  C  CD1   . PHE B  2 103 ? 34.018  -20.059 29.436  1.00 125.74 ? 87  PHE B CD1   1 
ATOM   5198  C  CD2   . PHE B  2 103 ? 34.628  -19.944 31.737  1.00 112.84 ? 87  PHE B CD2   1 
ATOM   5199  C  CE1   . PHE B  2 103 ? 35.327  -20.342 29.100  1.00 129.52 ? 87  PHE B CE1   1 
ATOM   5200  C  CE2   . PHE B  2 103 ? 35.939  -20.226 31.407  1.00 117.73 ? 87  PHE B CE2   1 
ATOM   5201  C  CZ    . PHE B  2 103 ? 36.288  -20.425 30.086  1.00 126.11 ? 87  PHE B CZ    1 
ATOM   5202  N  N     . TRP B  2 104 ? 32.036  -21.327 33.501  1.00 137.93 ? 88  TRP B N     1 
ATOM   5203  C  CA    . TRP B  2 104 ? 32.587  -22.147 34.574  1.00 143.86 ? 88  TRP B CA    1 
ATOM   5204  C  C     . TRP B  2 104 ? 31.596  -23.171 35.114  1.00 148.36 ? 88  TRP B C     1 
ATOM   5205  O  O     . TRP B  2 104 ? 31.877  -23.800 36.140  1.00 148.30 ? 88  TRP B O     1 
ATOM   5206  C  CB    . TRP B  2 104 ? 33.082  -21.255 35.717  1.00 141.09 ? 88  TRP B CB    1 
ATOM   5207  C  CG    . TRP B  2 104 ? 32.099  -20.200 36.126  1.00 138.35 ? 88  TRP B CG    1 
ATOM   5208  C  CD1   . TRP B  2 104 ? 32.048  -18.914 35.676  1.00 134.36 ? 88  TRP B CD1   1 
ATOM   5209  C  CD2   . TRP B  2 104 ? 31.023  -20.340 37.064  1.00 138.49 ? 88  TRP B CD2   1 
ATOM   5210  N  NE1   . TRP B  2 104 ? 31.009  -18.243 36.273  1.00 134.15 ? 88  TRP B NE1   1 
ATOM   5211  C  CE2   . TRP B  2 104 ? 30.363  -19.096 37.130  1.00 136.70 ? 88  TRP B CE2   1 
ATOM   5212  C  CE3   . TRP B  2 104 ? 30.553  -21.394 37.853  1.00 136.09 ? 88  TRP B CE3   1 
ATOM   5213  C  CZ2   . TRP B  2 104 ? 29.260  -18.877 37.953  1.00 133.59 ? 88  TRP B CZ2   1 
ATOM   5214  C  CZ3   . TRP B  2 104 ? 29.457  -21.175 38.671  1.00 133.29 ? 88  TRP B CZ3   1 
ATOM   5215  C  CH2   . TRP B  2 104 ? 28.824  -19.926 38.715  1.00 132.53 ? 88  TRP B CH2   1 
ATOM   5216  N  N     . GLU B  2 105 ? 30.451  -23.348 34.455  1.00 150.67 ? 89  GLU B N     1 
ATOM   5217  C  CA    . GLU B  2 105 ? 29.458  -24.334 34.864  1.00 149.63 ? 89  GLU B CA    1 
ATOM   5218  C  C     . GLU B  2 105 ? 28.950  -25.210 33.727  1.00 143.42 ? 89  GLU B C     1 
ATOM   5219  O  O     . GLU B  2 105 ? 28.502  -26.330 33.995  1.00 144.02 ? 89  GLU B O     1 
ATOM   5220  C  CB    . GLU B  2 105 ? 28.259  -23.641 35.529  1.00 155.31 ? 89  GLU B CB    1 
ATOM   5221  C  CG    . GLU B  2 105 ? 27.348  -24.568 36.322  1.00 162.33 ? 89  GLU B CG    1 
ATOM   5222  C  CD    . GLU B  2 105 ? 26.201  -23.830 36.985  1.00 166.04 ? 89  GLU B CD    1 
ATOM   5223  O  OE1   . GLU B  2 105 ? 26.023  -22.631 36.694  1.00 167.48 ? 89  GLU B OE1   1 
ATOM   5224  O  OE2   . GLU B  2 105 ? 25.481  -24.447 37.799  1.00 166.63 ? 89  GLU B OE2   1 
ATOM   5225  N  N     . VAL B  2 106 ? 29.011  -24.754 32.478  1.00 140.43 ? 90  VAL B N     1 
ATOM   5226  C  CA    . VAL B  2 106 ? 28.504  -25.500 31.332  1.00 132.00 ? 90  VAL B CA    1 
ATOM   5227  C  C     . VAL B  2 106 ? 29.637  -25.939 30.410  1.00 140.94 ? 90  VAL B C     1 
ATOM   5228  O  O     . VAL B  2 106 ? 29.771  -27.123 30.097  1.00 144.80 ? 90  VAL B O     1 
ATOM   5229  C  CB    . VAL B  2 106 ? 27.448  -24.678 30.559  1.00 116.19 ? 90  VAL B CB    1 
ATOM   5230  C  CG1   . VAL B  2 106 ? 27.040  -25.400 29.283  1.00 111.98 ? 90  VAL B CG1   1 
ATOM   5231  C  CG2   . VAL B  2 106 ? 26.241  -24.408 31.440  1.00 107.76 ? 90  VAL B CG2   1 
ATOM   5232  N  N     . GLN B  2 107 ? 30.460  -24.991 29.959  1.00 143.69 ? 91  GLN B N     1 
ATOM   5233  C  CA    . GLN B  2 107 ? 31.509  -25.310 28.995  1.00 147.19 ? 91  GLN B CA    1 
ATOM   5234  C  C     . GLN B  2 107 ? 32.650  -26.081 29.651  1.00 142.86 ? 91  GLN B C     1 
ATOM   5235  O  O     . GLN B  2 107 ? 32.921  -27.234 29.296  1.00 144.23 ? 91  GLN B O     1 
ATOM   5236  C  CB    . GLN B  2 107 ? 32.027  -24.027 28.340  1.00 147.34 ? 91  GLN B CB    1 
ATOM   5237  C  CG    . GLN B  2 107 ? 33.124  -24.266 27.313  1.00 150.19 ? 91  GLN B CG    1 
ATOM   5238  C  CD    . GLN B  2 107 ? 33.557  -22.997 26.604  1.00 150.54 ? 91  GLN B CD    1 
ATOM   5239  O  OE1   . GLN B  2 107 ? 32.924  -21.950 26.735  1.00 152.33 ? 91  GLN B OE1   1 
ATOM   5240  N  NE2   . GLN B  2 107 ? 34.644  -23.086 25.845  1.00 149.13 ? 91  GLN B NE2   1 
ATOM   5241  N  N     . LEU B  2 108 ? 33.336  -25.459 30.607  1.00 136.21 ? 92  LEU B N     1 
ATOM   5242  C  CA    . LEU B  2 108 ? 34.492  -26.053 31.282  1.00 133.36 ? 92  LEU B CA    1 
ATOM   5243  C  C     . LEU B  2 108 ? 34.221  -26.065 32.783  1.00 137.22 ? 92  LEU B C     1 
ATOM   5244  O  O     . LEU B  2 108 ? 34.654  -25.174 33.517  1.00 138.99 ? 92  LEU B O     1 
ATOM   5245  C  CB    . LEU B  2 108 ? 35.780  -25.288 30.941  1.00 127.57 ? 92  LEU B CB    1 
ATOM   5246  C  CG    . LEU B  2 108 ? 36.200  -25.252 29.472  1.00 128.27 ? 92  LEU B CG    1 
ATOM   5247  C  CD1   . LEU B  2 108 ? 37.460  -24.418 29.298  1.00 126.06 ? 92  LEU B CD1   1 
ATOM   5248  C  CD2   . LEU B  2 108 ? 36.411  -26.661 28.940  1.00 131.19 ? 92  LEU B CD2   1 
ATOM   5249  N  N     . GLY B  2 109 ? 33.499  -27.091 33.233  1.00 136.28 ? 93  GLY B N     1 
ATOM   5250  C  CA    . GLY B  2 109 ? 33.173  -27.248 34.632  1.00 135.28 ? 93  GLY B CA    1 
ATOM   5251  C  C     . GLY B  2 109 ? 34.147  -28.165 35.349  1.00 132.98 ? 93  GLY B C     1 
ATOM   5252  O  O     . GLY B  2 109 ? 34.831  -28.983 34.736  1.00 143.64 ? 93  GLY B O     1 
ATOM   5253  N  N     . ILE B  2 110 ? 34.210  -28.009 36.664  1.00 117.98 ? 94  ILE B N     1 
ATOM   5254  C  CA    . ILE B  2 110 ? 35.071  -28.807 37.531  1.00 100.08 ? 94  ILE B CA    1 
ATOM   5255  C  C     . ILE B  2 110 ? 34.181  -29.761 38.320  1.00 95.85  ? 94  ILE B C     1 
ATOM   5256  O  O     . ILE B  2 110 ? 33.292  -29.304 39.051  1.00 84.67  ? 94  ILE B O     1 
ATOM   5257  C  CB    . ILE B  2 110 ? 35.905  -27.925 38.473  1.00 86.80  ? 94  ILE B CB    1 
ATOM   5258  C  CG1   . ILE B  2 110 ? 36.805  -26.985 37.668  1.00 89.15  ? 94  ILE B CG1   1 
ATOM   5259  C  CG2   . ILE B  2 110 ? 36.733  -28.788 39.416  1.00 69.97  ? 94  ILE B CG2   1 
ATOM   5260  C  CD1   . ILE B  2 110 ? 37.614  -26.033 38.523  1.00 89.43  ? 94  ILE B CD1   1 
ATOM   5261  N  N     . PRO B  2 111 ? 34.373  -31.074 38.207  1.00 96.83  ? 95  PRO B N     1 
ATOM   5262  C  CA    . PRO B  2 111 ? 33.516  -32.007 38.949  1.00 95.10  ? 95  PRO B CA    1 
ATOM   5263  C  C     . PRO B  2 111 ? 33.816  -31.970 40.439  1.00 94.69  ? 95  PRO B C     1 
ATOM   5264  O  O     . PRO B  2 111 ? 34.965  -31.809 40.857  1.00 102.37 ? 95  PRO B O     1 
ATOM   5265  C  CB    . PRO B  2 111 ? 33.866  -33.368 38.339  1.00 89.07  ? 95  PRO B CB    1 
ATOM   5266  C  CG    . PRO B  2 111 ? 35.269  -33.201 37.854  1.00 91.98  ? 95  PRO B CG    1 
ATOM   5267  C  CD    . PRO B  2 111 ? 35.376  -31.773 37.385  1.00 91.70  ? 95  PRO B CD    1 
ATOM   5268  N  N     . HIS B  2 112 ? 32.763  -32.122 41.243  1.00 84.96  ? 96  HIS B N     1 
ATOM   5269  C  CA    . HIS B  2 112 ? 32.900  -32.086 42.692  1.00 74.09  ? 96  HIS B CA    1 
ATOM   5270  C  C     . HIS B  2 112 ? 32.934  -33.501 43.241  1.00 61.46  ? 96  HIS B C     1 
ATOM   5271  O  O     . HIS B  2 112 ? 31.980  -34.264 43.019  1.00 60.29  ? 96  HIS B O     1 
ATOM   5272  C  CB    . HIS B  2 112 ? 31.754  -31.308 43.324  1.00 64.10  ? 96  HIS B CB    1 
ATOM   5273  C  CG    . HIS B  2 112 ? 31.763  -31.341 44.820  1.00 53.77  ? 96  HIS B CG    1 
ATOM   5274  N  ND1   . HIS B  2 112 ? 32.652  -30.605 45.574  1.00 58.13  ? 96  HIS B ND1   1 
ATOM   5275  C  CD2   . HIS B  2 112 ? 31.003  -32.032 45.701  1.00 56.22  ? 96  HIS B CD2   1 
ATOM   5276  C  CE1   . HIS B  2 112 ? 32.433  -30.836 46.856  1.00 55.68  ? 96  HIS B CE1   1 
ATOM   5277  N  NE2   . HIS B  2 112 ? 31.439  -31.699 46.961  1.00 49.10  ? 96  HIS B NE2   1 
ATOM   5278  N  N     . PRO B  2 113 ? 33.987  -33.895 43.959  1.00 60.87  ? 97  PRO B N     1 
ATOM   5279  C  CA    . PRO B  2 113 ? 34.054  -35.260 44.501  1.00 61.99  ? 97  PRO B CA    1 
ATOM   5280  C  C     . PRO B  2 113 ? 33.231  -35.387 45.776  1.00 54.85  ? 97  PRO B C     1 
ATOM   5281  O  O     . PRO B  2 113 ? 33.369  -34.587 46.705  1.00 53.59  ? 97  PRO B O     1 
ATOM   5282  C  CB    . PRO B  2 113 ? 35.548  -35.456 44.778  1.00 57.19  ? 97  PRO B CB    1 
ATOM   5283  C  CG    . PRO B  2 113 ? 36.045  -34.073 45.066  1.00 56.35  ? 97  PRO B CG    1 
ATOM   5284  C  CD    . PRO B  2 113 ? 35.216  -33.128 44.230  1.00 54.28  ? 97  PRO B CD    1 
ATOM   5285  N  N     . ALA B  2 114 ? 32.374  -36.410 45.819  1.00 55.62  ? 98  ALA B N     1 
ATOM   5286  C  CA    . ALA B  2 114 ? 31.547  -36.645 46.996  1.00 55.04  ? 98  ALA B CA    1 
ATOM   5287  C  C     . ALA B  2 114 ? 32.349  -37.176 48.176  1.00 67.86  ? 98  ALA B C     1 
ATOM   5288  O  O     . ALA B  2 114 ? 31.872  -37.108 49.315  1.00 72.90  ? 98  ALA B O     1 
ATOM   5289  C  CB    . ALA B  2 114 ? 30.415  -37.617 46.658  1.00 55.91  ? 98  ALA B CB    1 
ATOM   5290  N  N     . GLY B  2 115 ? 33.552  -37.698 47.934  1.00 57.52  ? 99  GLY B N     1 
ATOM   5291  C  CA    . GLY B  2 115 ? 34.374  -38.242 48.999  1.00 63.32  ? 99  GLY B CA    1 
ATOM   5292  C  C     . GLY B  2 115 ? 35.203  -37.236 49.764  1.00 66.86  ? 99  GLY B C     1 
ATOM   5293  O  O     . GLY B  2 115 ? 35.797  -37.596 50.784  1.00 77.91  ? 99  GLY B O     1 
ATOM   5294  N  N     . LEU B  2 116 ? 35.258  -35.985 49.298  1.00 56.55  ? 100 LEU B N     1 
ATOM   5295  C  CA    . LEU B  2 116 ? 36.050  -34.969 49.988  1.00 58.74  ? 100 LEU B CA    1 
ATOM   5296  C  C     . LEU B  2 116 ? 35.529  -34.728 51.400  1.00 66.79  ? 100 LEU B C     1 
ATOM   5297  O  O     . LEU B  2 116 ? 36.316  -34.575 52.342  1.00 68.49  ? 100 LEU B O     1 
ATOM   5298  C  CB    . LEU B  2 116 ? 36.051  -33.667 49.185  1.00 58.01  ? 100 LEU B CB    1 
ATOM   5299  C  CG    . LEU B  2 116 ? 36.835  -32.495 49.775  1.00 57.73  ? 100 LEU B CG    1 
ATOM   5300  C  CD1   . LEU B  2 116 ? 38.304  -32.855 49.933  1.00 55.65  ? 100 LEU B CD1   1 
ATOM   5301  C  CD2   . LEU B  2 116 ? 36.675  -31.255 48.910  1.00 56.43  ? 100 LEU B CD2   1 
ATOM   5302  N  N     . LYS B  2 117 ? 34.205  -34.695 51.568  1.00 63.73  ? 101 LYS B N     1 
ATOM   5303  C  CA    . LYS B  2 117 ? 33.615  -34.485 52.884  1.00 59.26  ? 101 LYS B CA    1 
ATOM   5304  C  C     . LYS B  2 117 ? 33.769  -35.690 53.804  1.00 57.52  ? 101 LYS B C     1 
ATOM   5305  O  O     . LYS B  2 117 ? 33.562  -35.549 55.014  1.00 57.01  ? 101 LYS B O     1 
ATOM   5306  C  CB    . LYS B  2 117 ? 32.132  -34.134 52.746  1.00 63.31  ? 101 LYS B CB    1 
ATOM   5307  C  CG    . LYS B  2 117 ? 31.281  -35.246 52.156  1.00 60.26  ? 101 LYS B CG    1 
ATOM   5308  C  CD    . LYS B  2 117 ? 29.823  -34.830 52.067  1.00 51.47  ? 101 LYS B CD    1 
ATOM   5309  C  CE    . LYS B  2 117 ? 28.972  -35.925 51.448  1.00 55.36  ? 101 LYS B CE    1 
ATOM   5310  N  NZ    . LYS B  2 117 ? 29.415  -36.255 50.065  1.00 53.39  ? 101 LYS B NZ    1 
ATOM   5311  N  N     . LYS B  2 118 ? 34.116  -36.861 53.271  1.00 61.77  ? 102 LYS B N     1 
ATOM   5312  C  CA    . LYS B  2 118 ? 34.296  -38.053 54.090  1.00 70.45  ? 102 LYS B CA    1 
ATOM   5313  C  C     . LYS B  2 118 ? 35.725  -38.227 54.588  1.00 71.64  ? 102 LYS B C     1 
ATOM   5314  O  O     . LYS B  2 118 ? 35.962  -39.075 55.455  1.00 78.66  ? 102 LYS B O     1 
ATOM   5315  C  CB    . LYS B  2 118 ? 33.875  -39.302 53.307  1.00 60.22  ? 102 LYS B CB    1 
ATOM   5316  C  CG    . LYS B  2 118 ? 32.423  -39.289 52.860  1.00 59.01  ? 102 LYS B CG    1 
ATOM   5317  C  CD    . LYS B  2 118 ? 32.054  -40.567 52.125  1.00 69.02  ? 102 LYS B CD    1 
ATOM   5318  C  CE    . LYS B  2 118 ? 30.589  -40.564 51.717  1.00 71.12  ? 102 LYS B CE    1 
ATOM   5319  N  NZ    . LYS B  2 118 ? 30.200  -41.823 51.024  1.00 78.44  ? 102 LYS B NZ    1 
ATOM   5320  N  N     . LYS B  2 119 ? 36.672  -37.448 54.073  1.00 65.85  ? 103 LYS B N     1 
ATOM   5321  C  CA    . LYS B  2 119 ? 38.062  -37.586 54.483  1.00 71.47  ? 103 LYS B CA    1 
ATOM   5322  C  C     . LYS B  2 119 ? 38.264  -37.081 55.907  1.00 73.87  ? 103 LYS B C     1 
ATOM   5323  O  O     . LYS B  2 119 ? 37.524  -36.226 56.402  1.00 78.90  ? 103 LYS B O     1 
ATOM   5324  C  CB    . LYS B  2 119 ? 38.977  -36.830 53.521  1.00 71.91  ? 103 LYS B CB    1 
ATOM   5325  C  CG    . LYS B  2 119 ? 39.030  -37.430 52.126  1.00 81.05  ? 103 LYS B CG    1 
ATOM   5326  C  CD    . LYS B  2 119 ? 39.530  -38.866 52.169  1.00 83.12  ? 103 LYS B CD    1 
ATOM   5327  C  CE    . LYS B  2 119 ? 39.501  -39.505 50.792  1.00 85.40  ? 103 LYS B CE    1 
ATOM   5328  N  NZ    . LYS B  2 119 ? 40.033  -40.896 50.812  1.00 92.47  ? 103 LYS B NZ    1 
ATOM   5329  N  N     . LYS B  2 120 ? 39.287  -37.626 56.567  1.00 74.30  ? 104 LYS B N     1 
ATOM   5330  C  CA    . LYS B  2 120 ? 39.568  -37.245 57.948  1.00 76.39  ? 104 LYS B CA    1 
ATOM   5331  C  C     . LYS B  2 120 ? 40.194  -35.858 58.026  1.00 77.50  ? 104 LYS B C     1 
ATOM   5332  O  O     . LYS B  2 120 ? 39.881  -35.080 58.934  1.00 79.57  ? 104 LYS B O     1 
ATOM   5333  C  CB    . LYS B  2 120 ? 40.475  -38.287 58.603  1.00 83.30  ? 104 LYS B CB    1 
ATOM   5334  C  CG    . LYS B  2 120 ? 40.823  -37.988 60.053  1.00 98.22  ? 104 LYS B CG    1 
ATOM   5335  C  CD    . LYS B  2 120 ? 41.656  -39.103 60.667  1.00 106.20 ? 104 LYS B CD    1 
ATOM   5336  C  CE    . LYS B  2 120 ? 40.871  -40.403 60.744  1.00 104.54 ? 104 LYS B CE    1 
ATOM   5337  N  NZ    . LYS B  2 120 ? 41.652  -41.486 61.402  1.00 108.66 ? 104 LYS B NZ    1 
ATOM   5338  N  N     . SER B  2 121 ? 41.078  -35.530 57.086  1.00 74.43  ? 105 SER B N     1 
ATOM   5339  C  CA    . SER B  2 121 ? 41.747  -34.238 57.058  1.00 71.56  ? 105 SER B CA    1 
ATOM   5340  C  C     . SER B  2 121 ? 41.713  -33.673 55.646  1.00 71.56  ? 105 SER B C     1 
ATOM   5341  O  O     . SER B  2 121 ? 41.933  -34.400 54.673  1.00 63.09  ? 105 SER B O     1 
ATOM   5342  C  CB    . SER B  2 121 ? 43.199  -34.349 57.542  1.00 76.39  ? 105 SER B CB    1 
ATOM   5343  O  OG    . SER B  2 121 ? 43.255  -34.809 58.881  1.00 88.08  ? 105 SER B OG    1 
ATOM   5344  N  N     . VAL B  2 122 ? 41.430  -32.377 55.541  1.00 70.11  ? 106 VAL B N     1 
ATOM   5345  C  CA    . VAL B  2 122 ? 41.386  -31.670 54.266  1.00 60.87  ? 106 VAL B CA    1 
ATOM   5346  C  C     . VAL B  2 122 ? 42.146  -30.361 54.425  1.00 58.23  ? 106 VAL B C     1 
ATOM   5347  O  O     . VAL B  2 122 ? 41.783  -29.527 55.262  1.00 57.09  ? 106 VAL B O     1 
ATOM   5348  C  CB    . VAL B  2 122 ? 39.946  -31.403 53.796  1.00 57.01  ? 106 VAL B CB    1 
ATOM   5349  C  CG1   . VAL B  2 122 ? 39.949  -30.519 52.558  1.00 54.83  ? 106 VAL B CG1   1 
ATOM   5350  C  CG2   . VAL B  2 122 ? 39.222  -32.712 53.516  1.00 56.73  ? 106 VAL B CG2   1 
ATOM   5351  N  N     . THR B  2 123 ? 43.194  -30.181 53.628  1.00 61.72  ? 107 THR B N     1 
ATOM   5352  C  CA    . THR B  2 123 ? 43.994  -28.964 53.642  1.00 59.31  ? 107 THR B CA    1 
ATOM   5353  C  C     . THR B  2 123 ? 43.634  -28.099 52.441  1.00 57.49  ? 107 THR B C     1 
ATOM   5354  O  O     . THR B  2 123 ? 43.450  -28.604 51.330  1.00 60.95  ? 107 THR B O     1 
ATOM   5355  C  CB    . THR B  2 123 ? 45.491  -29.289 53.627  1.00 63.35  ? 107 THR B CB    1 
ATOM   5356  O  OG1   . THR B  2 123 ? 45.807  -30.140 54.736  1.00 69.76  ? 107 THR B OG1   1 
ATOM   5357  C  CG2   . THR B  2 123 ? 46.320  -28.016 53.727  1.00 65.18  ? 107 THR B CG2   1 
ATOM   5358  N  N     . VAL B  2 124 ? 43.523  -26.794 52.675  1.00 60.58  ? 108 VAL B N     1 
ATOM   5359  C  CA    . VAL B  2 124 ? 43.170  -25.825 51.644  1.00 59.73  ? 108 VAL B CA    1 
ATOM   5360  C  C     . VAL B  2 124 ? 44.424  -25.039 51.290  1.00 64.38  ? 108 VAL B C     1 
ATOM   5361  O  O     . VAL B  2 124 ? 45.014  -24.376 52.153  1.00 74.15  ? 108 VAL B O     1 
ATOM   5362  C  CB    . VAL B  2 124 ? 42.043  -24.891 52.109  1.00 52.02  ? 108 VAL B CB    1 
ATOM   5363  C  CG1   . VAL B  2 124 ? 41.564  -24.020 50.957  1.00 50.53  ? 108 VAL B CG1   1 
ATOM   5364  C  CG2   . VAL B  2 124 ? 40.895  -25.699 52.693  1.00 51.26  ? 108 VAL B CG2   1 
ATOM   5365  N  N     . LEU B  2 125 ? 44.828  -25.111 50.025  1.00 58.74  ? 109 LEU B N     1 
ATOM   5366  C  CA    . LEU B  2 125 ? 46.026  -24.443 49.536  1.00 63.60  ? 109 LEU B CA    1 
ATOM   5367  C  C     . LEU B  2 125 ? 45.646  -23.320 48.582  1.00 75.06  ? 109 LEU B C     1 
ATOM   5368  O  O     . LEU B  2 125 ? 44.788  -23.498 47.711  1.00 87.06  ? 109 LEU B O     1 
ATOM   5369  C  CB    . LEU B  2 125 ? 46.954  -25.432 48.824  1.00 61.40  ? 109 LEU B CB    1 
ATOM   5370  C  CG    . LEU B  2 125 ? 47.484  -26.608 49.643  1.00 68.28  ? 109 LEU B CG    1 
ATOM   5371  C  CD1   . LEU B  2 125 ? 48.367  -27.498 48.782  1.00 76.74  ? 109 LEU B CD1   1 
ATOM   5372  C  CD2   . LEU B  2 125 ? 48.245  -26.110 50.859  1.00 74.25  ? 109 LEU B CD2   1 
ATOM   5373  N  N     . ASP B  2 126 ? 46.290  -22.167 48.748  1.00 76.22  ? 110 ASP B N     1 
ATOM   5374  C  CA    . ASP B  2 126 ? 46.081  -21.036 47.850  1.00 75.09  ? 110 ASP B CA    1 
ATOM   5375  C  C     . ASP B  2 126 ? 46.953  -21.236 46.616  1.00 80.47  ? 110 ASP B C     1 
ATOM   5376  O  O     . ASP B  2 126 ? 48.180  -21.113 46.685  1.00 78.85  ? 110 ASP B O     1 
ATOM   5377  C  CB    . ASP B  2 126 ? 46.406  -19.722 48.554  1.00 67.79  ? 110 ASP B CB    1 
ATOM   5378  C  CG    . ASP B  2 126 ? 45.888  -18.506 47.801  1.00 72.83  ? 110 ASP B CG    1 
ATOM   5379  O  OD1   . ASP B  2 126 ? 45.627  -18.615 46.585  1.00 70.95  ? 110 ASP B OD1   1 
ATOM   5380  O  OD2   . ASP B  2 126 ? 45.746  -17.436 48.429  1.00 77.91  ? 110 ASP B OD2   1 
ATOM   5381  N  N     . VAL B  2 127 ? 46.322  -21.554 45.491  1.00 71.59  ? 111 VAL B N     1 
ATOM   5382  C  CA    . VAL B  2 127 ? 47.021  -21.766 44.231  1.00 65.02  ? 111 VAL B CA    1 
ATOM   5383  C  C     . VAL B  2 127 ? 46.665  -20.682 43.217  1.00 70.50  ? 111 VAL B C     1 
ATOM   5384  O  O     . VAL B  2 127 ? 46.924  -20.836 42.024  1.00 81.33  ? 111 VAL B O     1 
ATOM   5385  C  CB    . VAL B  2 127 ? 46.744  -23.173 43.674  1.00 68.48  ? 111 VAL B CB    1 
ATOM   5386  C  CG1   . VAL B  2 127 ? 47.242  -24.241 44.644  1.00 65.97  ? 111 VAL B CG1   1 
ATOM   5387  C  CG2   . VAL B  2 127 ? 45.260  -23.349 43.397  1.00 65.62  ? 111 VAL B CG2   1 
ATOM   5388  N  N     . GLY B  2 128 ? 46.077  -19.574 43.682  1.00 69.92  ? 112 GLY B N     1 
ATOM   5389  C  CA    . GLY B  2 128 ? 45.648  -18.527 42.773  1.00 71.75  ? 112 GLY B CA    1 
ATOM   5390  C  C     . GLY B  2 128 ? 46.789  -17.869 42.026  1.00 73.54  ? 112 GLY B C     1 
ATOM   5391  O  O     . GLY B  2 128 ? 46.593  -17.345 40.925  1.00 70.58  ? 112 GLY B O     1 
ATOM   5392  N  N     . ASP B  2 129 ? 47.993  -17.886 42.603  1.00 71.76  ? 113 ASP B N     1 
ATOM   5393  C  CA    . ASP B  2 129 ? 49.138  -17.261 41.951  1.00 79.14  ? 113 ASP B CA    1 
ATOM   5394  C  C     . ASP B  2 129 ? 49.517  -17.962 40.653  1.00 84.54  ? 113 ASP B C     1 
ATOM   5395  O  O     . ASP B  2 129 ? 50.139  -17.340 39.784  1.00 85.11  ? 113 ASP B O     1 
ATOM   5396  C  CB    . ASP B  2 129 ? 50.336  -17.237 42.903  1.00 84.36  ? 113 ASP B CB    1 
ATOM   5397  C  CG    . ASP B  2 129 ? 51.461  -16.352 42.404  1.00 95.21  ? 113 ASP B CG    1 
ATOM   5398  O  OD1   . ASP B  2 129 ? 51.261  -15.121 42.333  1.00 98.69  ? 113 ASP B OD1   1 
ATOM   5399  O  OD2   . ASP B  2 129 ? 52.545  -16.885 42.085  1.00 99.64  ? 113 ASP B OD2   1 
ATOM   5400  N  N     . ALA B  2 130 ? 49.157  -19.238 40.501  1.00 82.00  ? 114 ALA B N     1 
ATOM   5401  C  CA    . ALA B  2 130 ? 49.438  -19.952 39.262  1.00 82.34  ? 114 ALA B CA    1 
ATOM   5402  C  C     . ALA B  2 130 ? 48.628  -19.417 38.089  1.00 85.34  ? 114 ALA B C     1 
ATOM   5403  O  O     . ALA B  2 130 ? 49.038  -19.596 36.937  1.00 87.10  ? 114 ALA B O     1 
ATOM   5404  C  CB    . ALA B  2 130 ? 49.166  -21.446 39.442  1.00 77.78  ? 114 ALA B CB    1 
ATOM   5405  N  N     . TYR B  2 131 ? 47.494  -18.764 38.353  1.00 86.09  ? 115 TYR B N     1 
ATOM   5406  C  CA    . TYR B  2 131 ? 46.663  -18.238 37.276  1.00 82.73  ? 115 TYR B CA    1 
ATOM   5407  C  C     . TYR B  2 131 ? 47.325  -17.073 36.553  1.00 78.02  ? 115 TYR B C     1 
ATOM   5408  O  O     . TYR B  2 131 ? 46.959  -16.781 35.410  1.00 86.08  ? 115 TYR B O     1 
ATOM   5409  C  CB    . TYR B  2 131 ? 45.302  -17.796 37.820  1.00 80.92  ? 115 TYR B CB    1 
ATOM   5410  C  CG    . TYR B  2 131 ? 44.555  -18.860 38.596  1.00 79.83  ? 115 TYR B CG    1 
ATOM   5411  C  CD1   . TYR B  2 131 ? 44.773  -20.211 38.357  1.00 85.67  ? 115 TYR B CD1   1 
ATOM   5412  C  CD2   . TYR B  2 131 ? 43.630  -18.509 39.570  1.00 75.87  ? 115 TYR B CD2   1 
ATOM   5413  C  CE1   . TYR B  2 131 ? 44.093  -21.180 39.067  1.00 85.98  ? 115 TYR B CE1   1 
ATOM   5414  C  CE2   . TYR B  2 131 ? 42.945  -19.471 40.283  1.00 77.74  ? 115 TYR B CE2   1 
ATOM   5415  C  CZ    . TYR B  2 131 ? 43.179  -20.805 40.028  1.00 83.08  ? 115 TYR B CZ    1 
ATOM   5416  O  OH    . TYR B  2 131 ? 42.498  -21.766 40.738  1.00 83.34  ? 115 TYR B OH    1 
ATOM   5417  N  N     . PHE B  2 132 ? 48.290  -16.406 37.188  1.00 68.06  ? 116 PHE B N     1 
ATOM   5418  C  CA    . PHE B  2 132 ? 48.974  -15.268 36.585  1.00 67.66  ? 116 PHE B CA    1 
ATOM   5419  C  C     . PHE B  2 132 ? 49.892  -15.659 35.432  1.00 74.70  ? 116 PHE B C     1 
ATOM   5420  O  O     . PHE B  2 132 ? 50.450  -14.765 34.787  1.00 78.06  ? 116 PHE B O     1 
ATOM   5421  C  CB    . PHE B  2 132 ? 49.776  -14.519 37.651  1.00 73.87  ? 116 PHE B CB    1 
ATOM   5422  C  CG    . PHE B  2 132 ? 48.929  -13.911 38.731  1.00 80.94  ? 116 PHE B CG    1 
ATOM   5423  C  CD1   . PHE B  2 132 ? 47.655  -13.446 38.450  1.00 75.55  ? 116 PHE B CD1   1 
ATOM   5424  C  CD2   . PHE B  2 132 ? 49.403  -13.810 40.028  1.00 82.09  ? 116 PHE B CD2   1 
ATOM   5425  C  CE1   . PHE B  2 132 ? 46.872  -12.887 39.442  1.00 69.15  ? 116 PHE B CE1   1 
ATOM   5426  C  CE2   . PHE B  2 132 ? 48.624  -13.253 41.025  1.00 74.04  ? 116 PHE B CE2   1 
ATOM   5427  C  CZ    . PHE B  2 132 ? 47.357  -12.791 40.730  1.00 70.47  ? 116 PHE B CZ    1 
ATOM   5428  N  N     . SER B  2 133 ? 50.067  -16.951 35.157  1.00 70.68  ? 117 SER B N     1 
ATOM   5429  C  CA    . SER B  2 133 ? 50.923  -17.391 34.063  1.00 75.88  ? 117 SER B CA    1 
ATOM   5430  C  C     . SER B  2 133 ? 50.172  -17.580 32.752  1.00 86.10  ? 117 SER B C     1 
ATOM   5431  O  O     . SER B  2 133 ? 50.807  -17.623 31.692  1.00 96.10  ? 117 SER B O     1 
ATOM   5432  C  CB    . SER B  2 133 ? 51.621  -18.704 34.431  1.00 74.94  ? 117 SER B CB    1 
ATOM   5433  O  OG    . SER B  2 133 ? 50.675  -19.734 34.658  1.00 73.29  ? 117 SER B OG    1 
ATOM   5434  N  N     . VAL B  2 134 ? 48.853  -17.698 32.795  1.00 77.58  ? 118 VAL B N     1 
ATOM   5435  C  CA    . VAL B  2 134 ? 48.032  -17.899 31.603  1.00 77.33  ? 118 VAL B CA    1 
ATOM   5436  C  C     . VAL B  2 134 ? 47.471  -16.548 31.174  1.00 77.59  ? 118 VAL B C     1 
ATOM   5437  O  O     . VAL B  2 134 ? 46.885  -15.845 32.009  1.00 78.29  ? 118 VAL B O     1 
ATOM   5438  C  CB    . VAL B  2 134 ? 46.895  -18.904 31.860  1.00 69.73  ? 118 VAL B CB    1 
ATOM   5439  C  CG1   . VAL B  2 134 ? 46.024  -19.047 30.620  1.00 75.45  ? 118 VAL B CG1   1 
ATOM   5440  C  CG2   . VAL B  2 134 ? 47.463  -20.248 32.278  1.00 74.37  ? 118 VAL B CG2   1 
ATOM   5441  N  N     . PRO B  2 135 ? 47.628  -16.152 29.915  1.00 85.36  ? 119 PRO B N     1 
ATOM   5442  C  CA    . PRO B  2 135 ? 47.066  -14.873 29.468  1.00 87.67  ? 119 PRO B CA    1 
ATOM   5443  C  C     . PRO B  2 135 ? 45.548  -14.925 29.396  1.00 84.24  ? 119 PRO B C     1 
ATOM   5444  O  O     . PRO B  2 135 ? 44.934  -15.985 29.251  1.00 82.26  ? 119 PRO B O     1 
ATOM   5445  C  CB    . PRO B  2 135 ? 47.678  -14.678 28.075  1.00 75.82  ? 119 PRO B CB    1 
ATOM   5446  C  CG    . PRO B  2 135 ? 48.841  -15.629 28.018  1.00 84.26  ? 119 PRO B CG    1 
ATOM   5447  C  CD    . PRO B  2 135 ? 48.446  -16.789 28.872  1.00 76.47  ? 119 PRO B CD    1 
ATOM   5448  N  N     . LEU B  2 136 ? 44.943  -13.747 29.502  1.00 78.91  ? 120 LEU B N     1 
ATOM   5449  C  CA    . LEU B  2 136 ? 43.501  -13.594 29.403  1.00 76.22  ? 120 LEU B CA    1 
ATOM   5450  C  C     . LEU B  2 136 ? 43.121  -13.145 27.998  1.00 88.10  ? 120 LEU B C     1 
ATOM   5451  O  O     . LEU B  2 136 ? 43.883  -12.445 27.325  1.00 90.28  ? 120 LEU B O     1 
ATOM   5452  C  CB    . LEU B  2 136 ? 42.989  -12.584 30.435  1.00 64.23  ? 120 LEU B CB    1 
ATOM   5453  C  CG    . LEU B  2 136 ? 41.474  -12.427 30.587  1.00 71.17  ? 120 LEU B CG    1 
ATOM   5454  C  CD1   . LEU B  2 136 ? 40.846  -13.718 31.088  1.00 60.89  ? 120 LEU B CD1   1 
ATOM   5455  C  CD2   . LEU B  2 136 ? 41.145  -11.270 31.518  1.00 61.44  ? 120 LEU B CD2   1 
ATOM   5456  N  N     . ASP B  2 137 ? 41.937  -13.568 27.556  1.00 85.56  ? 121 ASP B N     1 
ATOM   5457  C  CA    . ASP B  2 137 ? 41.425  -13.162 26.254  1.00 87.69  ? 121 ASP B CA    1 
ATOM   5458  C  C     . ASP B  2 137 ? 41.394  -11.643 26.144  1.00 89.70  ? 121 ASP B C     1 
ATOM   5459  O  O     . ASP B  2 137 ? 40.859  -10.957 27.019  1.00 92.56  ? 121 ASP B O     1 
ATOM   5460  C  CB    . ASP B  2 137 ? 40.024  -13.737 26.039  1.00 95.67  ? 121 ASP B CB    1 
ATOM   5461  C  CG    . ASP B  2 137 ? 39.441  -13.371 24.685  1.00 105.99 ? 121 ASP B CG    1 
ATOM   5462  O  OD1   . ASP B  2 137 ? 40.218  -13.035 23.766  1.00 111.15 ? 121 ASP B OD1   1 
ATOM   5463  O  OD2   . ASP B  2 137 ? 38.201  -13.414 24.544  1.00 110.18 ? 121 ASP B OD2   1 
ATOM   5464  N  N     . GLU B  2 138 ? 41.982  -11.125 25.062  1.00 94.49  ? 122 GLU B N     1 
ATOM   5465  C  CA    . GLU B  2 138 ? 42.076  -9.679  24.884  1.00 97.99  ? 122 GLU B CA    1 
ATOM   5466  C  C     . GLU B  2 138 ? 40.698  -9.028  24.886  1.00 95.17  ? 122 GLU B C     1 
ATOM   5467  O  O     . GLU B  2 138 ? 40.509  -7.959  25.477  1.00 101.24 ? 122 GLU B O     1 
ATOM   5468  C  CB    . GLU B  2 138 ? 42.819  -9.360  23.587  1.00 107.08 ? 122 GLU B CB    1 
ATOM   5469  C  CG    . GLU B  2 138 ? 43.064  -7.877  23.355  1.00 117.93 ? 122 GLU B CG    1 
ATOM   5470  C  CD    . GLU B  2 138 ? 44.096  -7.297  24.304  1.00 131.28 ? 122 GLU B CD    1 
ATOM   5471  O  OE1   . GLU B  2 138 ? 44.902  -8.075  24.857  1.00 138.23 ? 122 GLU B OE1   1 
ATOM   5472  O  OE2   . GLU B  2 138 ? 44.102  -6.063  24.497  1.00 134.53 ? 122 GLU B OE2   1 
ATOM   5473  N  N     . ASP B  2 139 ? 39.720  -9.665  24.240  1.00 94.15  ? 123 ASP B N     1 
ATOM   5474  C  CA    . ASP B  2 139 ? 38.372  -9.115  24.181  1.00 93.19  ? 123 ASP B CA    1 
ATOM   5475  C  C     . ASP B  2 139 ? 37.643  -9.182  25.517  1.00 90.79  ? 123 ASP B C     1 
ATOM   5476  O  O     . ASP B  2 139 ? 36.554  -8.610  25.636  1.00 87.42  ? 123 ASP B O     1 
ATOM   5477  C  CB    . ASP B  2 139 ? 37.557  -9.848  23.114  1.00 99.13  ? 123 ASP B CB    1 
ATOM   5478  C  CG    . ASP B  2 139 ? 38.184  -9.754  21.737  1.00 122.77 ? 123 ASP B CG    1 
ATOM   5479  O  OD1   . ASP B  2 139 ? 39.229  -9.084  21.603  1.00 129.71 ? 123 ASP B OD1   1 
ATOM   5480  O  OD2   . ASP B  2 139 ? 37.632  -10.351 20.788  1.00 127.97 ? 123 ASP B OD2   1 
ATOM   5481  N  N     . PHE B  2 140 ? 38.210  -9.858  26.517  1.00 81.87  ? 124 PHE B N     1 
ATOM   5482  C  CA    . PHE B  2 140 ? 37.576  -9.995  27.820  1.00 75.12  ? 124 PHE B CA    1 
ATOM   5483  C  C     . PHE B  2 140 ? 38.274  -9.204  28.918  1.00 80.70  ? 124 PHE B C     1 
ATOM   5484  O  O     . PHE B  2 140 ? 37.701  -9.044  30.002  1.00 81.23  ? 124 PHE B O     1 
ATOM   5485  C  CB    . PHE B  2 140 ? 37.512  -11.478 28.222  1.00 74.46  ? 124 PHE B CB    1 
ATOM   5486  C  CG    . PHE B  2 140 ? 36.633  -11.748 29.410  1.00 74.15  ? 124 PHE B CG    1 
ATOM   5487  C  CD1   . PHE B  2 140 ? 35.256  -11.792 29.272  1.00 73.81  ? 124 PHE B CD1   1 
ATOM   5488  C  CD2   . PHE B  2 140 ? 37.183  -11.961 30.663  1.00 68.85  ? 124 PHE B CD2   1 
ATOM   5489  C  CE1   . PHE B  2 140 ? 34.443  -12.038 30.362  1.00 77.40  ? 124 PHE B CE1   1 
ATOM   5490  C  CE2   . PHE B  2 140 ? 36.376  -12.204 31.757  1.00 66.79  ? 124 PHE B CE2   1 
ATOM   5491  C  CZ    . PHE B  2 140 ? 35.004  -12.246 31.606  1.00 75.89  ? 124 PHE B CZ    1 
ATOM   5492  N  N     . ARG B  2 141 ? 39.482  -8.690  28.665  1.00 81.06  ? 125 ARG B N     1 
ATOM   5493  C  CA    . ARG B  2 141 ? 40.231  -7.995  29.707  1.00 76.29  ? 125 ARG B CA    1 
ATOM   5494  C  C     . ARG B  2 141 ? 39.517  -6.737  30.183  1.00 80.46  ? 125 ARG B C     1 
ATOM   5495  O  O     . ARG B  2 141 ? 39.713  -6.309  31.327  1.00 84.28  ? 125 ARG B O     1 
ATOM   5496  C  CB    . ARG B  2 141 ? 41.630  -7.646  29.200  1.00 77.31  ? 125 ARG B CB    1 
ATOM   5497  C  CG    . ARG B  2 141 ? 42.463  -8.852  28.807  1.00 82.18  ? 125 ARG B CG    1 
ATOM   5498  C  CD    . ARG B  2 141 ? 43.822  -8.434  28.274  1.00 88.16  ? 125 ARG B CD    1 
ATOM   5499  N  NE    . ARG B  2 141 ? 44.659  -9.587  27.959  1.00 90.71  ? 125 ARG B NE    1 
ATOM   5500  C  CZ    . ARG B  2 141 ? 45.901  -9.502  27.495  1.00 90.76  ? 125 ARG B CZ    1 
ATOM   5501  N  NH1   . ARG B  2 141 ? 46.454  -8.315  27.288  1.00 89.40  ? 125 ARG B NH1   1 
ATOM   5502  N  NH2   . ARG B  2 141 ? 46.591  -10.605 27.237  1.00 91.65  ? 125 ARG B NH2   1 
ATOM   5503  N  N     . LYS B  2 142 ? 38.685  -6.133  29.331  1.00 84.24  ? 126 LYS B N     1 
ATOM   5504  C  CA    . LYS B  2 142 ? 37.995  -4.907  29.714  1.00 86.94  ? 126 LYS B CA    1 
ATOM   5505  C  C     . LYS B  2 142 ? 36.973  -5.133  30.822  1.00 81.10  ? 126 LYS B C     1 
ATOM   5506  O  O     . LYS B  2 142 ? 36.575  -4.168  31.483  1.00 80.19  ? 126 LYS B O     1 
ATOM   5507  C  CB    . LYS B  2 142 ? 37.315  -4.280  28.495  1.00 93.57  ? 126 LYS B CB    1 
ATOM   5508  C  CG    . LYS B  2 142 ? 36.341  -5.195  27.770  1.00 98.27  ? 126 LYS B CG    1 
ATOM   5509  C  CD    . LYS B  2 142 ? 35.657  -4.461  26.626  1.00 107.42 ? 126 LYS B CD    1 
ATOM   5510  C  CE    . LYS B  2 142 ? 34.743  -5.382  25.833  1.00 112.86 ? 126 LYS B CE    1 
ATOM   5511  N  NZ    . LYS B  2 142 ? 35.502  -6.455  25.135  1.00 116.69 ? 126 LYS B NZ    1 
ATOM   5512  N  N     . TYR B  2 143 ? 36.545  -6.374  31.044  1.00 69.17  ? 127 TYR B N     1 
ATOM   5513  C  CA    . TYR B  2 143 ? 35.584  -6.685  32.094  1.00 71.06  ? 127 TYR B CA    1 
ATOM   5514  C  C     . TYR B  2 143 ? 36.236  -6.928  33.449  1.00 71.54  ? 127 TYR B C     1 
ATOM   5515  O  O     . TYR B  2 143 ? 35.520  -7.114  34.439  1.00 71.52  ? 127 TYR B O     1 
ATOM   5516  C  CB    . TYR B  2 143 ? 34.748  -7.909  31.703  1.00 72.83  ? 127 TYR B CB    1 
ATOM   5517  C  CG    . TYR B  2 143 ? 33.956  -7.732  30.428  1.00 77.97  ? 127 TYR B CG    1 
ATOM   5518  C  CD1   . TYR B  2 143 ? 32.932  -6.799  30.348  1.00 76.73  ? 127 TYR B CD1   1 
ATOM   5519  C  CD2   . TYR B  2 143 ? 34.226  -8.506  29.306  1.00 83.25  ? 127 TYR B CD2   1 
ATOM   5520  C  CE1   . TYR B  2 143 ? 32.204  -6.634  29.185  1.00 82.28  ? 127 TYR B CE1   1 
ATOM   5521  C  CE2   . TYR B  2 143 ? 33.503  -8.351  28.139  1.00 81.69  ? 127 TYR B CE2   1 
ATOM   5522  C  CZ    . TYR B  2 143 ? 32.493  -7.413  28.084  1.00 85.71  ? 127 TYR B CZ    1 
ATOM   5523  O  OH    . TYR B  2 143 ? 31.768  -7.254  26.924  1.00 84.19  ? 127 TYR B OH    1 
ATOM   5524  N  N     . THR B  2 144 ? 37.567  -6.936  33.521  1.00 70.21  ? 128 THR B N     1 
ATOM   5525  C  CA    . THR B  2 144 ? 38.286  -7.115  34.775  1.00 57.72  ? 128 THR B CA    1 
ATOM   5526  C  C     . THR B  2 144 ? 38.767  -5.792  35.359  1.00 53.03  ? 128 THR B C     1 
ATOM   5527  O  O     . THR B  2 144 ? 39.674  -5.783  36.198  1.00 64.38  ? 128 THR B O     1 
ATOM   5528  C  CB    . THR B  2 144 ? 39.472  -8.062  34.578  1.00 58.12  ? 128 THR B CB    1 
ATOM   5529  O  OG1   . THR B  2 144 ? 40.386  -7.496  33.630  1.00 57.92  ? 128 THR B OG1   1 
ATOM   5530  C  CG2   . THR B  2 144 ? 38.995  -9.414  34.071  1.00 58.59  ? 128 THR B CG2   1 
ATOM   5531  N  N     . ALA B  2 145 ? 38.175  -4.679  34.935  1.00 53.54  ? 129 ALA B N     1 
ATOM   5532  C  CA    . ALA B  2 145 ? 38.638  -3.369  35.365  1.00 56.98  ? 129 ALA B CA    1 
ATOM   5533  C  C     . ALA B  2 145 ? 38.328  -3.131  36.838  1.00 61.18  ? 129 ALA B C     1 
ATOM   5534  O  O     . ALA B  2 145 ? 37.261  -3.501  37.335  1.00 65.63  ? 129 ALA B O     1 
ATOM   5535  C  CB    . ALA B  2 145 ? 37.993  -2.276  34.515  1.00 57.53  ? 129 ALA B CB    1 
ATOM   5536  N  N     . PHE B  2 146 ? 39.276  -2.510  37.536  1.00 58.91  ? 130 PHE B N     1 
ATOM   5537  C  CA    . PHE B  2 146 ? 39.086  -2.095  38.918  1.00 58.25  ? 130 PHE B CA    1 
ATOM   5538  C  C     . PHE B  2 146 ? 39.742  -0.735  39.112  1.00 64.53  ? 130 PHE B C     1 
ATOM   5539  O  O     . PHE B  2 146 ? 40.535  -0.279  38.284  1.00 65.47  ? 130 PHE B O     1 
ATOM   5540  C  CB    . PHE B  2 146 ? 39.645  -3.128  39.908  1.00 51.99  ? 130 PHE B CB    1 
ATOM   5541  C  CG    . PHE B  2 146 ? 41.116  -3.398  39.751  1.00 56.66  ? 130 PHE B CG    1 
ATOM   5542  C  CD1   . PHE B  2 146 ? 41.570  -4.343  38.846  1.00 61.89  ? 130 PHE B CD1   1 
ATOM   5543  C  CD2   . PHE B  2 146 ? 42.045  -2.720  40.525  1.00 51.21  ? 130 PHE B CD2   1 
ATOM   5544  C  CE1   . PHE B  2 146 ? 42.922  -4.598  38.705  1.00 61.32  ? 130 PHE B CE1   1 
ATOM   5545  C  CE2   . PHE B  2 146 ? 43.397  -2.971  40.389  1.00 63.02  ? 130 PHE B CE2   1 
ATOM   5546  C  CZ    . PHE B  2 146 ? 43.835  -3.913  39.480  1.00 60.67  ? 130 PHE B CZ    1 
ATOM   5547  N  N     . THR B  2 147 ? 39.399  -0.083  40.220  1.00 61.53  ? 131 THR B N     1 
ATOM   5548  C  CA    . THR B  2 147 ? 39.848  1.274   40.500  1.00 55.84  ? 131 THR B CA    1 
ATOM   5549  C  C     . THR B  2 147 ? 40.387  1.351   41.919  1.00 53.39  ? 131 THR B C     1 
ATOM   5550  O  O     . THR B  2 147 ? 39.696  0.974   42.870  1.00 60.97  ? 131 THR B O     1 
ATOM   5551  C  CB    . THR B  2 147 ? 38.705  2.279   40.316  1.00 57.38  ? 131 THR B CB    1 
ATOM   5552  O  OG1   . THR B  2 147 ? 38.198  2.193   38.979  1.00 65.61  ? 131 THR B OG1   1 
ATOM   5553  C  CG2   . THR B  2 147 ? 39.192  3.692   40.575  1.00 67.40  ? 131 THR B CG2   1 
ATOM   5554  N  N     . ILE B  2 148 ? 41.614  1.840   42.058  1.00 56.08  ? 132 ILE B N     1 
ATOM   5555  C  CA    . ILE B  2 148 ? 42.230  2.056   43.363  1.00 57.16  ? 132 ILE B CA    1 
ATOM   5556  C  C     . ILE B  2 148 ? 41.878  3.468   43.820  1.00 55.47  ? 132 ILE B C     1 
ATOM   5557  O  O     . ILE B  2 148 ? 42.279  4.437   43.154  1.00 58.83  ? 132 ILE B O     1 
ATOM   5558  C  CB    . ILE B  2 148 ? 43.750  1.865   43.310  1.00 59.67  ? 132 ILE B CB    1 
ATOM   5559  C  CG1   . ILE B  2 148 ? 44.096  0.421   42.947  1.00 60.01  ? 132 ILE B CG1   1 
ATOM   5560  C  CG2   . ILE B  2 148 ? 44.381  2.249   44.640  1.00 53.43  ? 132 ILE B CG2   1 
ATOM   5561  C  CD1   . ILE B  2 148 ? 45.581  0.165   42.866  1.00 54.86  ? 132 ILE B CD1   1 
ATOM   5562  N  N     . PRO B  2 149 ? 41.153  3.632   44.917  1.00 51.38  ? 133 PRO B N     1 
ATOM   5563  C  CA    . PRO B  2 149 ? 40.797  4.970   45.393  1.00 51.39  ? 133 PRO B CA    1 
ATOM   5564  C  C     . PRO B  2 149 ? 41.996  5.642   46.055  1.00 56.78  ? 133 PRO B C     1 
ATOM   5565  O  O     . PRO B  2 149 ? 43.069  5.061   46.198  1.00 61.05  ? 133 PRO B O     1 
ATOM   5566  C  CB    . PRO B  2 149 ? 39.681  4.692   46.400  1.00 49.85  ? 133 PRO B CB    1 
ATOM   5567  C  CG    . PRO B  2 149 ? 40.017  3.347   46.941  1.00 48.85  ? 133 PRO B CG    1 
ATOM   5568  C  CD    . PRO B  2 149 ? 40.614  2.575   45.790  1.00 57.45  ? 133 PRO B CD    1 
ATOM   5569  N  N     . SER B  2 150 ? 41.788  6.890   46.463  1.00 54.08  ? 134 SER B N     1 
ATOM   5570  C  CA    . SER B  2 150 ? 42.803  7.664   47.159  1.00 61.23  ? 134 SER B CA    1 
ATOM   5571  C  C     . SER B  2 150 ? 42.209  8.250   48.431  1.00 61.34  ? 134 SER B C     1 
ATOM   5572  O  O     . SER B  2 150 ? 41.006  8.514   48.509  1.00 61.41  ? 134 SER B O     1 
ATOM   5573  C  CB    . SER B  2 150 ? 43.364  8.787   46.274  1.00 58.76  ? 134 SER B CB    1 
ATOM   5574  O  OG    . SER B  2 150 ? 42.344  9.691   45.886  1.00 64.50  ? 134 SER B OG    1 
ATOM   5575  N  N     . ILE B  2 151 ? 43.067  8.442   49.432  1.00 58.01  ? 135 ILE B N     1 
ATOM   5576  C  CA    . ILE B  2 151 ? 42.638  9.055   50.682  1.00 55.41  ? 135 ILE B CA    1 
ATOM   5577  C  C     . ILE B  2 151 ? 42.287  10.513  50.432  1.00 63.96  ? 135 ILE B C     1 
ATOM   5578  O  O     . ILE B  2 151 ? 43.035  11.242  49.767  1.00 69.20  ? 135 ILE B O     1 
ATOM   5579  C  CB    . ILE B  2 151 ? 43.734  8.924   51.749  1.00 59.87  ? 135 ILE B CB    1 
ATOM   5580  C  CG1   . ILE B  2 151 ? 43.969  7.454   52.095  1.00 58.61  ? 135 ILE B CG1   1 
ATOM   5581  C  CG2   . ILE B  2 151 ? 43.370  9.718   52.995  1.00 56.98  ? 135 ILE B CG2   1 
ATOM   5582  C  CD1   . ILE B  2 151 ? 45.069  7.252   53.099  1.00 63.32  ? 135 ILE B CD1   1 
ATOM   5583  N  N     . ASN B  2 152 ? 41.136  10.941  50.953  1.00 59.57  ? 136 ASN B N     1 
ATOM   5584  C  CA    . ASN B  2 152 ? 40.662  12.320  50.852  1.00 59.48  ? 136 ASN B CA    1 
ATOM   5585  C  C     . ASN B  2 152 ? 40.503  12.772  49.404  1.00 57.94  ? 136 ASN B C     1 
ATOM   5586  O  O     . ASN B  2 152 ? 40.423  13.975  49.131  1.00 74.89  ? 136 ASN B O     1 
ATOM   5587  C  CB    . ASN B  2 152 ? 41.590  13.276  51.614  1.00 62.85  ? 136 ASN B CB    1 
ATOM   5588  C  CG    . ASN B  2 152 ? 40.926  14.599  51.945  1.00 68.49  ? 136 ASN B CG    1 
ATOM   5589  O  OD1   . ASN B  2 152 ? 39.700  14.707  51.948  1.00 75.18  ? 136 ASN B OD1   1 
ATOM   5590  N  ND2   . ASN B  2 152 ? 41.736  15.613  52.224  1.00 65.20  ? 136 ASN B ND2   1 
ATOM   5591  N  N     . ASN B  2 153 ? 40.451  11.821  48.469  1.00 64.26  ? 137 ASN B N     1 
ATOM   5592  C  CA    . ASN B  2 153 ? 40.337  12.114  47.040  1.00 67.47  ? 137 ASN B CA    1 
ATOM   5593  C  C     . ASN B  2 153 ? 41.456  13.041  46.572  1.00 71.13  ? 137 ASN B C     1 
ATOM   5594  O  O     . ASN B  2 153 ? 41.235  13.964  45.786  1.00 68.31  ? 137 ASN B O     1 
ATOM   5595  C  CB    . ASN B  2 153 ? 38.964  12.697  46.703  1.00 73.14  ? 137 ASN B CB    1 
ATOM   5596  C  CG    . ASN B  2 153 ? 37.837  11.736  47.013  1.00 76.14  ? 137 ASN B CG    1 
ATOM   5597  O  OD1   . ASN B  2 153 ? 37.163  11.857  48.036  1.00 77.58  ? 137 ASN B OD1   1 
ATOM   5598  N  ND2   . ASN B  2 153 ? 37.634  10.764  46.132  1.00 70.66  ? 137 ASN B ND2   1 
ATOM   5599  N  N     . GLU B  2 154 ? 42.671  12.793  47.069  1.00 70.69  ? 138 GLU B N     1 
ATOM   5600  C  CA    . GLU B  2 154 ? 43.823  13.586  46.651  1.00 74.44  ? 138 GLU B CA    1 
ATOM   5601  C  C     . GLU B  2 154 ? 44.044  13.489  45.148  1.00 77.27  ? 138 GLU B C     1 
ATOM   5602  O  O     . GLU B  2 154 ? 44.281  14.500  44.478  1.00 77.19  ? 138 GLU B O     1 
ATOM   5603  C  CB    . GLU B  2 154 ? 45.072  13.131  47.406  1.00 85.04  ? 138 GLU B CB    1 
ATOM   5604  C  CG    . GLU B  2 154 ? 46.360  13.779  46.924  1.00 100.70 ? 138 GLU B CG    1 
ATOM   5605  C  CD    . GLU B  2 154 ? 47.589  13.198  47.593  1.00 111.62 ? 138 GLU B CD    1 
ATOM   5606  O  OE1   . GLU B  2 154 ? 47.430  12.345  48.489  1.00 113.99 ? 138 GLU B OE1   1 
ATOM   5607  O  OE2   . GLU B  2 154 ? 48.714  13.593  47.220  1.00 121.80 ? 138 GLU B OE2   1 
ATOM   5608  N  N     . THR B  2 155 ? 43.969  12.282  44.602  1.00 70.18  ? 139 THR B N     1 
ATOM   5609  C  CA    . THR B  2 155 ? 44.088  12.027  43.179  1.00 75.79  ? 139 THR B CA    1 
ATOM   5610  C  C     . THR B  2 155 ? 42.843  11.300  42.691  1.00 73.78  ? 139 THR B C     1 
ATOM   5611  O  O     . THR B  2 155 ? 42.131  10.672  43.484  1.00 85.95  ? 139 THR B O     1 
ATOM   5612  C  CB    . THR B  2 155 ? 45.331  11.179  42.869  1.00 71.74  ? 139 THR B CB    1 
ATOM   5613  O  OG1   . THR B  2 155 ? 45.130  9.841   43.341  1.00 78.42  ? 139 THR B OG1   1 
ATOM   5614  C  CG2   . THR B  2 155 ? 46.559  11.765  43.545  1.00 65.03  ? 139 THR B CG2   1 
ATOM   5615  N  N     . PRO B  2 156 ? 42.538  11.373  41.391  1.00 74.64  ? 140 PRO B N     1 
ATOM   5616  C  CA    . PRO B  2 156 ? 41.453  10.545  40.848  1.00 68.39  ? 140 PRO B CA    1 
ATOM   5617  C  C     . PRO B  2 156 ? 41.735  9.060   41.013  1.00 67.00  ? 140 PRO B C     1 
ATOM   5618  O  O     . PRO B  2 156 ? 42.816  8.672   41.466  1.00 67.20  ? 140 PRO B O     1 
ATOM   5619  C  CB    . PRO B  2 156 ? 41.407  10.950  39.369  1.00 67.94  ? 140 PRO B CB    1 
ATOM   5620  C  CG    . PRO B  2 156 ? 41.994  12.320  39.336  1.00 74.73  ? 140 PRO B CG    1 
ATOM   5621  C  CD    . PRO B  2 156 ? 43.059  12.326  40.394  1.00 75.37  ? 140 PRO B CD    1 
ATOM   5622  N  N     . GLY B  2 157 ? 40.771  8.219   40.649  1.00 66.22  ? 141 GLY B N     1 
ATOM   5623  C  CA    . GLY B  2 157 ? 40.968  6.787   40.775  1.00 65.66  ? 141 GLY B CA    1 
ATOM   5624  C  C     . GLY B  2 157 ? 42.008  6.276   39.792  1.00 69.28  ? 141 GLY B C     1 
ATOM   5625  O  O     . GLY B  2 157 ? 42.089  6.726   38.648  1.00 78.49  ? 141 GLY B O     1 
ATOM   5626  N  N     . ILE B  2 158 ? 42.816  5.327   40.253  1.00 70.61  ? 142 ILE B N     1 
ATOM   5627  C  CA    . ILE B  2 158 ? 43.840  4.690   39.434  1.00 72.47  ? 142 ILE B CA    1 
ATOM   5628  C  C     . ILE B  2 158 ? 43.259  3.380   38.919  1.00 69.76  ? 142 ILE B C     1 
ATOM   5629  O  O     . ILE B  2 158 ? 43.109  2.414   39.676  1.00 81.97  ? 142 ILE B O     1 
ATOM   5630  C  CB    . ILE B  2 158 ? 45.134  4.456   40.225  1.00 75.51  ? 142 ILE B CB    1 
ATOM   5631  C  CG1   . ILE B  2 158 ? 45.537  5.727   40.975  1.00 75.45  ? 142 ILE B CG1   1 
ATOM   5632  C  CG2   . ILE B  2 158 ? 46.252  4.019   39.292  1.00 63.11  ? 142 ILE B CG2   1 
ATOM   5633  C  CD1   . ILE B  2 158 ? 46.728  5.541   41.889  1.00 76.97  ? 142 ILE B CD1   1 
ATOM   5634  N  N     . ARG B  2 159 ? 42.933  3.341   37.631  1.00 60.08  ? 143 ARG B N     1 
ATOM   5635  C  CA    . ARG B  2 159 ? 42.238  2.212   37.032  1.00 59.13  ? 143 ARG B CA    1 
ATOM   5636  C  C     . ARG B  2 159 ? 43.222  1.255   36.372  1.00 65.17  ? 143 ARG B C     1 
ATOM   5637  O  O     . ARG B  2 159 ? 44.192  1.680   35.739  1.00 68.22  ? 143 ARG B O     1 
ATOM   5638  C  CB    . ARG B  2 159 ? 41.211  2.695   36.005  1.00 58.32  ? 143 ARG B CB    1 
ATOM   5639  C  CG    . ARG B  2 159 ? 40.071  3.500   36.605  1.00 61.94  ? 143 ARG B CG    1 
ATOM   5640  C  CD    . ARG B  2 159 ? 39.094  3.966   35.537  1.00 63.98  ? 143 ARG B CD    1 
ATOM   5641  N  NE    . ARG B  2 159 ? 38.689  2.881   34.648  1.00 69.45  ? 143 ARG B NE    1 
ATOM   5642  C  CZ    . ARG B  2 159 ? 37.762  1.976   34.945  1.00 66.91  ? 143 ARG B CZ    1 
ATOM   5643  N  NH1   . ARG B  2 159 ? 37.145  2.014   36.117  1.00 64.36  ? 143 ARG B NH1   1 
ATOM   5644  N  NH2   . ARG B  2 159 ? 37.456  1.027   34.072  1.00 76.11  ? 143 ARG B NH2   1 
ATOM   5645  N  N     . TYR B  2 160 ? 42.962  -0.041  36.528  1.00 62.84  ? 144 TYR B N     1 
ATOM   5646  C  CA    . TYR B  2 160 ? 43.741  -1.097  35.900  1.00 59.98  ? 144 TYR B CA    1 
ATOM   5647  C  C     . TYR B  2 160 ? 42.801  -2.098  35.243  1.00 62.60  ? 144 TYR B C     1 
ATOM   5648  O  O     . TYR B  2 160 ? 41.582  -2.063  35.431  1.00 69.62  ? 144 TYR B O     1 
ATOM   5649  C  CB    . TYR B  2 160 ? 44.631  -1.837  36.909  1.00 58.26  ? 144 TYR B CB    1 
ATOM   5650  C  CG    . TYR B  2 160 ? 45.712  -1.013  37.569  1.00 69.58  ? 144 TYR B CG    1 
ATOM   5651  C  CD1   . TYR B  2 160 ? 45.438  -0.245  38.693  1.00 71.84  ? 144 TYR B CD1   1 
ATOM   5652  C  CD2   . TYR B  2 160 ? 47.016  -1.033  37.090  1.00 74.36  ? 144 TYR B CD2   1 
ATOM   5653  C  CE1   . TYR B  2 160 ? 46.428  0.497   39.309  1.00 72.96  ? 144 TYR B CE1   1 
ATOM   5654  C  CE2   . TYR B  2 160 ? 48.012  -0.295  37.700  1.00 76.45  ? 144 TYR B CE2   1 
ATOM   5655  C  CZ    . TYR B  2 160 ? 47.712  0.469   38.808  1.00 76.14  ? 144 TYR B CZ    1 
ATOM   5656  O  OH    . TYR B  2 160 ? 48.700  1.206   39.418  1.00 85.96  ? 144 TYR B OH    1 
ATOM   5657  N  N     . GLN B  2 161 ? 43.391  -3.002  34.465  1.00 61.04  ? 145 GLN B N     1 
ATOM   5658  C  CA    . GLN B  2 161 ? 42.702  -4.181  33.964  1.00 63.95  ? 145 GLN B CA    1 
ATOM   5659  C  C     . GLN B  2 161 ? 43.700  -5.328  33.930  1.00 68.34  ? 145 GLN B C     1 
ATOM   5660  O  O     . GLN B  2 161 ? 44.913  -5.118  33.866  1.00 67.64  ? 145 GLN B O     1 
ATOM   5661  C  CB    . GLN B  2 161 ? 42.093  -3.955  32.573  1.00 63.76  ? 145 GLN B CB    1 
ATOM   5662  C  CG    . GLN B  2 161 ? 43.081  -4.088  31.426  1.00 81.01  ? 145 GLN B CG    1 
ATOM   5663  C  CD    . GLN B  2 161 ? 42.428  -3.893  30.071  1.00 78.16  ? 145 GLN B CD    1 
ATOM   5664  O  OE1   . GLN B  2 161 ? 41.275  -3.470  29.978  1.00 75.15  ? 145 GLN B OE1   1 
ATOM   5665  N  NE2   . GLN B  2 161 ? 43.163  -4.205  29.010  1.00 81.12  ? 145 GLN B NE2   1 
ATOM   5666  N  N     . TYR B  2 162 ? 43.180  -6.549  33.981  1.00 62.42  ? 146 TYR B N     1 
ATOM   5667  C  CA    . TYR B  2 162 ? 44.026  -7.730  34.059  1.00 69.07  ? 146 TYR B CA    1 
ATOM   5668  C  C     . TYR B  2 162 ? 44.446  -8.197  32.672  1.00 71.04  ? 146 TYR B C     1 
ATOM   5669  O  O     . TYR B  2 162 ? 43.631  -8.262  31.748  1.00 73.94  ? 146 TYR B O     1 
ATOM   5670  C  CB    . TYR B  2 162 ? 43.307  -8.859  34.798  1.00 57.70  ? 146 TYR B CB    1 
ATOM   5671  C  CG    . TYR B  2 162 ? 43.513  -8.819  36.294  1.00 64.81  ? 146 TYR B CG    1 
ATOM   5672  C  CD1   . TYR B  2 162 ? 42.685  -8.060  37.111  1.00 60.68  ? 146 TYR B CD1   1 
ATOM   5673  C  CD2   . TYR B  2 162 ? 44.543  -9.535  36.889  1.00 64.77  ? 146 TYR B CD2   1 
ATOM   5674  C  CE1   . TYR B  2 162 ? 42.876  -8.020  38.480  1.00 53.11  ? 146 TYR B CE1   1 
ATOM   5675  C  CE2   . TYR B  2 162 ? 44.741  -9.502  38.254  1.00 55.37  ? 146 TYR B CE2   1 
ATOM   5676  C  CZ    . TYR B  2 162 ? 43.906  -8.743  39.045  1.00 53.80  ? 146 TYR B CZ    1 
ATOM   5677  O  OH    . TYR B  2 162 ? 44.103  -8.708  40.406  1.00 58.18  ? 146 TYR B OH    1 
ATOM   5678  N  N     . ASN B  2 163 ? 45.734  -8.515  32.536  1.00 72.67  ? 147 ASN B N     1 
ATOM   5679  C  CA    . ASN B  2 163 ? 46.265  -9.120  31.322  1.00 66.92  ? 147 ASN B CA    1 
ATOM   5680  C  C     . ASN B  2 163 ? 46.336  -10.637 31.401  1.00 69.54  ? 147 ASN B C     1 
ATOM   5681  O  O     . ASN B  2 163 ? 46.444  -11.293 30.360  1.00 77.33  ? 147 ASN B O     1 
ATOM   5682  C  CB    . ASN B  2 163 ? 47.665  -8.571  31.021  1.00 69.59  ? 147 ASN B CB    1 
ATOM   5683  C  CG    . ASN B  2 163 ? 47.663  -7.078  30.764  1.00 73.30  ? 147 ASN B CG    1 
ATOM   5684  O  OD1   . ASN B  2 163 ? 46.736  -6.541  30.158  1.00 72.98  ? 147 ASN B OD1   1 
ATOM   5685  N  ND2   . ASN B  2 163 ? 48.704  -6.397  31.228  1.00 72.82  ? 147 ASN B ND2   1 
ATOM   5686  N  N     . VAL B  2 164 ? 46.281  -11.200 32.606  1.00 77.04  ? 148 VAL B N     1 
ATOM   5687  C  CA    . VAL B  2 164 ? 46.323  -12.643 32.810  1.00 74.94  ? 148 VAL B CA    1 
ATOM   5688  C  C     . VAL B  2 164 ? 45.059  -13.065 33.545  1.00 73.12  ? 148 VAL B C     1 
ATOM   5689  O  O     . VAL B  2 164 ? 44.196  -12.231 33.842  1.00 79.25  ? 148 VAL B O     1 
ATOM   5690  C  CB    . VAL B  2 164 ? 47.583  -13.055 33.591  1.00 74.21  ? 148 VAL B CB    1 
ATOM   5691  C  CG1   . VAL B  2 164 ? 48.835  -12.691 32.810  1.00 69.21  ? 148 VAL B CG1   1 
ATOM   5692  C  CG2   . VAL B  2 164 ? 47.591  -12.385 34.955  1.00 72.11  ? 148 VAL B CG2   1 
ATOM   5693  N  N     . LEU B  2 165 ? 44.938  -14.354 33.841  1.00 66.81  ? 149 LEU B N     1 
ATOM   5694  C  CA    . LEU B  2 165 ? 43.791  -14.855 34.585  1.00 63.26  ? 149 LEU B CA    1 
ATOM   5695  C  C     . LEU B  2 165 ? 43.774  -14.231 35.974  1.00 67.25  ? 149 LEU B C     1 
ATOM   5696  O  O     . LEU B  2 165 ? 44.755  -14.377 36.719  1.00 68.70  ? 149 LEU B O     1 
ATOM   5697  C  CB    . LEU B  2 165 ? 43.834  -16.376 34.692  1.00 61.31  ? 149 LEU B CB    1 
ATOM   5698  C  CG    . LEU B  2 165 ? 43.773  -17.171 33.389  1.00 65.27  ? 149 LEU B CG    1 
ATOM   5699  C  CD1   . LEU B  2 165 ? 43.700  -18.660 33.684  1.00 63.23  ? 149 LEU B CD1   1 
ATOM   5700  C  CD2   . LEU B  2 165 ? 42.592  -16.730 32.535  1.00 69.72  ? 149 LEU B CD2   1 
ATOM   5701  N  N     . PRO B  2 166 ? 42.713  -13.530 36.360  1.00 71.67  ? 150 PRO B N     1 
ATOM   5702  C  CA    . PRO B  2 166 ? 42.710  -12.861 37.662  1.00 63.91  ? 150 PRO B CA    1 
ATOM   5703  C  C     . PRO B  2 166 ? 42.249  -13.785 38.776  1.00 56.24  ? 150 PRO B C     1 
ATOM   5704  O  O     . PRO B  2 166 ? 41.429  -14.685 38.580  1.00 59.42  ? 150 PRO B O     1 
ATOM   5705  C  CB    . PRO B  2 166 ? 41.723  -11.700 37.464  1.00 55.79  ? 150 PRO B CB    1 
ATOM   5706  C  CG    . PRO B  2 166 ? 41.090  -11.908 36.089  1.00 54.78  ? 150 PRO B CG    1 
ATOM   5707  C  CD    . PRO B  2 166 ? 41.470  -13.275 35.616  1.00 63.37  ? 150 PRO B CD    1 
ATOM   5708  N  N     . GLN B  2 167 ? 42.809  -13.556 39.961  1.00 65.21  ? 151 GLN B N     1 
ATOM   5709  C  CA    . GLN B  2 167 ? 42.347  -14.255 41.150  1.00 61.79  ? 151 GLN B CA    1 
ATOM   5710  C  C     . GLN B  2 167 ? 40.931  -13.814 41.499  1.00 59.08  ? 151 GLN B C     1 
ATOM   5711  O  O     . GLN B  2 167 ? 40.559  -12.653 41.306  1.00 47.73  ? 151 GLN B O     1 
ATOM   5712  C  CB    . GLN B  2 167 ? 43.284  -13.985 42.328  1.00 53.40  ? 151 GLN B CB    1 
ATOM   5713  C  CG    . GLN B  2 167 ? 44.616  -14.711 42.259  1.00 61.31  ? 151 GLN B CG    1 
ATOM   5714  C  CD    . GLN B  2 167 ? 45.555  -14.303 43.381  1.00 69.25  ? 151 GLN B CD    1 
ATOM   5715  O  OE1   . GLN B  2 167 ? 46.446  -15.060 43.767  1.00 67.07  ? 151 GLN B OE1   1 
ATOM   5716  N  NE2   . GLN B  2 167 ? 45.357  -13.100 43.911  1.00 67.01  ? 151 GLN B NE2   1 
ATOM   5717  N  N     . GLY B  2 168 ? 40.136  -14.752 42.008  1.00 58.92  ? 152 GLY B N     1 
ATOM   5718  C  CA    . GLY B  2 168 ? 38.774  -14.461 42.402  1.00 60.04  ? 152 GLY B CA    1 
ATOM   5719  C  C     . GLY B  2 168 ? 37.752  -14.508 41.288  1.00 53.54  ? 152 GLY B C     1 
ATOM   5720  O  O     . GLY B  2 168 ? 36.566  -14.271 41.551  1.00 60.70  ? 152 GLY B O     1 
ATOM   5721  N  N     . TRP B  2 169 ? 38.164  -14.795 40.058  1.00 55.71  ? 153 TRP B N     1 
ATOM   5722  C  CA    . TRP B  2 169 ? 37.250  -14.932 38.932  1.00 58.58  ? 153 TRP B CA    1 
ATOM   5723  C  C     . TRP B  2 169 ? 37.024  -16.412 38.654  1.00 69.82  ? 153 TRP B C     1 
ATOM   5724  O  O     . TRP B  2 169 ? 37.986  -17.170 38.491  1.00 75.97  ? 153 TRP B O     1 
ATOM   5725  C  CB    . TRP B  2 169 ? 37.805  -14.227 37.693  1.00 63.88  ? 153 TRP B CB    1 
ATOM   5726  C  CG    . TRP B  2 169 ? 36.967  -14.401 36.461  1.00 71.52  ? 153 TRP B CG    1 
ATOM   5727  C  CD1   . TRP B  2 169 ? 35.642  -14.105 36.321  1.00 71.59  ? 153 TRP B CD1   1 
ATOM   5728  C  CD2   . TRP B  2 169 ? 37.404  -14.896 35.188  1.00 72.26  ? 153 TRP B CD2   1 
ATOM   5729  N  NE1   . TRP B  2 169 ? 35.225  -14.394 35.044  1.00 62.51  ? 153 TRP B NE1   1 
ATOM   5730  C  CE2   . TRP B  2 169 ? 36.288  -14.879 34.329  1.00 68.95  ? 153 TRP B CE2   1 
ATOM   5731  C  CE3   . TRP B  2 169 ? 38.629  -15.353 34.694  1.00 69.87  ? 153 TRP B CE3   1 
ATOM   5732  C  CZ2   . TRP B  2 169 ? 36.359  -15.306 33.004  1.00 72.63  ? 153 TRP B CZ2   1 
ATOM   5733  C  CZ3   . TRP B  2 169 ? 38.699  -15.775 33.378  1.00 72.29  ? 153 TRP B CZ3   1 
ATOM   5734  C  CH2   . TRP B  2 169 ? 37.571  -15.747 32.548  1.00 71.57  ? 153 TRP B CH2   1 
ATOM   5735  N  N     . LYS B  2 170 ? 35.752  -16.819 38.606  1.00 66.42  ? 154 LYS B N     1 
ATOM   5736  C  CA    . LYS B  2 170 ? 35.425  -18.231 38.441  1.00 73.08  ? 154 LYS B CA    1 
ATOM   5737  C  C     . LYS B  2 170 ? 35.917  -18.792 37.113  1.00 69.71  ? 154 LYS B C     1 
ATOM   5738  O  O     . LYS B  2 170 ? 36.068  -20.013 36.987  1.00 73.05  ? 154 LYS B O     1 
ATOM   5739  C  CB    . LYS B  2 170 ? 33.915  -18.443 38.573  1.00 84.12  ? 154 LYS B CB    1 
ATOM   5740  C  CG    . LYS B  2 170 ? 33.358  -18.030 39.925  1.00 87.69  ? 154 LYS B CG    1 
ATOM   5741  C  CD    . LYS B  2 170 ? 31.939  -18.521 40.138  1.00 81.44  ? 154 LYS B CD    1 
ATOM   5742  C  CE    . LYS B  2 170 ? 31.406  -18.087 41.494  1.00 71.20  ? 154 LYS B CE    1 
ATOM   5743  N  NZ    . LYS B  2 170 ? 29.974  -18.451 41.676  1.00 71.30  ? 154 LYS B NZ    1 
ATOM   5744  N  N     . GLY B  2 171 ? 36.171  -17.936 36.122  1.00 62.37  ? 155 GLY B N     1 
ATOM   5745  C  CA    . GLY B  2 171 ? 36.733  -18.406 34.870  1.00 61.71  ? 155 GLY B CA    1 
ATOM   5746  C  C     . GLY B  2 171 ? 38.196  -18.785 34.957  1.00 66.29  ? 155 GLY B C     1 
ATOM   5747  O  O     . GLY B  2 171 ? 38.688  -19.512 34.087  1.00 66.98  ? 155 GLY B O     1 
ATOM   5748  N  N     . SER B  2 172 ? 38.904  -18.312 35.990  1.00 63.39  ? 156 SER B N     1 
ATOM   5749  C  CA    . SER B  2 172 ? 40.330  -18.620 36.101  1.00 61.25  ? 156 SER B CA    1 
ATOM   5750  C  C     . SER B  2 172 ? 40.585  -20.098 36.374  1.00 69.67  ? 156 SER B C     1 
ATOM   5751  O  O     . SER B  2 172 ? 41.375  -20.710 35.633  1.00 80.58  ? 156 SER B O     1 
ATOM   5752  C  CB    . SER B  2 172 ? 40.979  -17.720 37.158  1.00 59.88  ? 156 SER B CB    1 
ATOM   5753  O  OG    . SER B  2 172 ? 40.898  -16.355 36.786  1.00 62.37  ? 156 SER B OG    1 
ATOM   5754  N  N     . PRO B  2 173 ? 39.979  -20.736 37.387  1.00 71.54  ? 157 PRO B N     1 
ATOM   5755  C  CA    . PRO B  2 173 ? 40.211  -22.179 37.566  1.00 69.91  ? 157 PRO B CA    1 
ATOM   5756  C  C     . PRO B  2 173 ? 39.675  -23.027 36.426  1.00 68.63  ? 157 PRO B C     1 
ATOM   5757  O  O     . PRO B  2 173 ? 40.182  -24.135 36.212  1.00 68.01  ? 157 PRO B O     1 
ATOM   5758  C  CB    . PRO B  2 173 ? 39.486  -22.493 38.881  1.00 63.04  ? 157 PRO B CB    1 
ATOM   5759  C  CG    . PRO B  2 173 ? 38.439  -21.457 38.982  1.00 64.10  ? 157 PRO B CG    1 
ATOM   5760  C  CD    . PRO B  2 173 ? 39.052  -20.214 38.408  1.00 62.29  ? 157 PRO B CD    1 
ATOM   5761  N  N     . ALA B  2 174 ? 38.666  -22.547 35.694  1.00 64.43  ? 158 ALA B N     1 
ATOM   5762  C  CA    . ALA B  2 174 ? 38.132  -23.313 34.574  1.00 67.97  ? 158 ALA B CA    1 
ATOM   5763  C  C     . ALA B  2 174 ? 39.129  -23.373 33.424  1.00 75.59  ? 158 ALA B C     1 
ATOM   5764  O  O     . ALA B  2 174 ? 39.349  -24.438 32.834  1.00 84.45  ? 158 ALA B O     1 
ATOM   5765  C  CB    . ALA B  2 174 ? 36.806  -22.708 34.109  1.00 71.92  ? 158 ALA B CB    1 
ATOM   5766  N  N     . ILE B  2 175 ? 39.742  -22.237 33.089  1.00 78.16  ? 159 ILE B N     1 
ATOM   5767  C  CA    . ILE B  2 175 ? 40.705  -22.208 31.992  1.00 75.34  ? 159 ILE B CA    1 
ATOM   5768  C  C     . ILE B  2 175 ? 42.001  -22.899 32.398  1.00 76.44  ? 159 ILE B C     1 
ATOM   5769  O  O     . ILE B  2 175 ? 42.615  -23.619 31.602  1.00 89.73  ? 159 ILE B O     1 
ATOM   5770  C  CB    . ILE B  2 175 ? 40.949  -20.757 31.538  1.00 80.00  ? 159 ILE B CB    1 
ATOM   5771  C  CG1   . ILE B  2 175 ? 39.645  -20.136 31.034  1.00 69.73  ? 159 ILE B CG1   1 
ATOM   5772  C  CG2   . ILE B  2 175 ? 42.020  -20.701 30.460  1.00 86.18  ? 159 ILE B CG2   1 
ATOM   5773  C  CD1   . ILE B  2 175 ? 39.782  -18.697 30.595  1.00 67.42  ? 159 ILE B CD1   1 
ATOM   5774  N  N     . PHE B  2 176 ? 42.434  -22.700 33.644  1.00 72.97  ? 160 PHE B N     1 
ATOM   5775  C  CA    . PHE B  2 176 ? 43.652  -23.321 34.147  1.00 82.04  ? 160 PHE B CA    1 
ATOM   5776  C  C     . PHE B  2 176 ? 43.480  -24.805 34.450  1.00 92.71  ? 160 PHE B C     1 
ATOM   5777  O  O     . PHE B  2 176 ? 44.477  -25.482 34.725  1.00 94.80  ? 160 PHE B O     1 
ATOM   5778  C  CB    . PHE B  2 176 ? 44.126  -22.587 35.407  1.00 79.05  ? 160 PHE B CB    1 
ATOM   5779  C  CG    . PHE B  2 176 ? 45.564  -22.847 35.759  1.00 81.56  ? 160 PHE B CG    1 
ATOM   5780  C  CD1   . PHE B  2 176 ? 46.581  -22.207 35.074  1.00 87.28  ? 160 PHE B CD1   1 
ATOM   5781  C  CD2   . PHE B  2 176 ? 45.898  -23.721 36.781  1.00 83.60  ? 160 PHE B CD2   1 
ATOM   5782  C  CE1   . PHE B  2 176 ? 47.905  -22.439 35.392  1.00 89.70  ? 160 PHE B CE1   1 
ATOM   5783  C  CE2   . PHE B  2 176 ? 47.220  -23.959 37.104  1.00 82.78  ? 160 PHE B CE2   1 
ATOM   5784  C  CZ    . PHE B  2 176 ? 48.225  -23.316 36.409  1.00 88.61  ? 160 PHE B CZ    1 
ATOM   5785  N  N     . GLN B  2 177 ? 42.249  -25.322 34.394  1.00 92.91  ? 161 GLN B N     1 
ATOM   5786  C  CA    . GLN B  2 177 ? 41.998  -26.713 34.765  1.00 93.74  ? 161 GLN B CA    1 
ATOM   5787  C  C     . GLN B  2 177 ? 42.806  -27.678 33.906  1.00 101.08 ? 161 GLN B C     1 
ATOM   5788  O  O     . GLN B  2 177 ? 43.306  -28.694 34.404  1.00 105.78 ? 161 GLN B O     1 
ATOM   5789  C  CB    . GLN B  2 177 ? 40.504  -27.018 34.656  1.00 85.61  ? 161 GLN B CB    1 
ATOM   5790  C  CG    . GLN B  2 177 ? 40.112  -28.407 35.128  1.00 88.50  ? 161 GLN B CG    1 
ATOM   5791  C  CD    . GLN B  2 177 ? 38.622  -28.661 35.008  1.00 92.88  ? 161 GLN B CD    1 
ATOM   5792  O  OE1   . GLN B  2 177 ? 37.882  -27.837 34.469  1.00 91.08  ? 161 GLN B OE1   1 
ATOM   5793  N  NE2   . GLN B  2 177 ? 38.174  -29.806 35.511  1.00 91.68  ? 161 GLN B NE2   1 
ATOM   5794  N  N     . SER B  2 178 ? 42.942  -27.382 32.611  1.00 105.35 ? 162 SER B N     1 
ATOM   5795  C  CA    . SER B  2 178 ? 43.757  -28.229 31.745  1.00 104.54 ? 162 SER B CA    1 
ATOM   5796  C  C     . SER B  2 178 ? 45.216  -28.218 32.184  1.00 97.43  ? 162 SER B C     1 
ATOM   5797  O  O     . SER B  2 178 ? 45.879  -29.262 32.189  1.00 98.53  ? 162 SER B O     1 
ATOM   5798  C  CB    . SER B  2 178 ? 43.628  -27.774 30.292  1.00 107.43 ? 162 SER B CB    1 
ATOM   5799  O  OG    . SER B  2 178 ? 43.986  -26.411 30.151  1.00 110.89 ? 162 SER B OG    1 
ATOM   5800  N  N     . SER B  2 179 ? 45.730  -27.046 32.563  1.00 91.03  ? 163 SER B N     1 
ATOM   5801  C  CA    . SER B  2 179 ? 47.098  -26.969 33.065  1.00 88.11  ? 163 SER B CA    1 
ATOM   5802  C  C     . SER B  2 179 ? 47.217  -27.615 34.440  1.00 90.70  ? 163 SER B C     1 
ATOM   5803  O  O     . SER B  2 179 ? 48.211  -28.289 34.731  1.00 82.27  ? 163 SER B O     1 
ATOM   5804  C  CB    . SER B  2 179 ? 47.556  -25.512 33.117  1.00 89.91  ? 163 SER B CB    1 
ATOM   5805  O  OG    . SER B  2 179 ? 47.425  -24.887 31.852  1.00 96.26  ? 163 SER B OG    1 
ATOM   5806  N  N     . MET B  2 180 ? 46.208  -27.424 35.295  1.00 86.88  ? 164 MET B N     1 
ATOM   5807  C  CA    . MET B  2 180 ? 46.266  -27.964 36.650  1.00 75.81  ? 164 MET B CA    1 
ATOM   5808  C  C     . MET B  2 180 ? 46.271  -29.488 36.644  1.00 80.72  ? 164 MET B C     1 
ATOM   5809  O  O     . MET B  2 180 ? 46.981  -30.116 37.439  1.00 75.55  ? 164 MET B O     1 
ATOM   5810  C  CB    . MET B  2 180 ? 45.090  -27.435 37.472  1.00 73.84  ? 164 MET B CB    1 
ATOM   5811  C  CG    . MET B  2 180 ? 44.993  -28.022 38.870  1.00 77.92  ? 164 MET B CG    1 
ATOM   5812  S  SD    . MET B  2 180 ? 46.362  -27.530 39.935  1.00 82.16  ? 164 MET B SD    1 
ATOM   5813  C  CE    . MET B  2 180 ? 46.032  -25.779 40.114  1.00 69.95  ? 164 MET B CE    1 
ATOM   5814  N  N     . THR B  2 181 ? 45.485  -30.101 35.753  1.00 83.46  ? 165 THR B N     1 
ATOM   5815  C  CA    . THR B  2 181 ? 45.410  -31.559 35.710  1.00 84.89  ? 165 THR B CA    1 
ATOM   5816  C  C     . THR B  2 181 ? 46.764  -32.174 35.375  1.00 93.60  ? 165 THR B C     1 
ATOM   5817  O  O     . THR B  2 181 ? 47.161  -33.182 35.970  1.00 93.83  ? 165 THR B O     1 
ATOM   5818  C  CB    . THR B  2 181 ? 44.354  -32.002 34.695  1.00 81.61  ? 165 THR B CB    1 
ATOM   5819  O  OG1   . THR B  2 181 ? 43.076  -31.473 35.070  1.00 83.98  ? 165 THR B OG1   1 
ATOM   5820  C  CG2   . THR B  2 181 ? 44.267  -33.521 34.640  1.00 77.69  ? 165 THR B CG2   1 
ATOM   5821  N  N     . LYS B  2 182 ? 47.493  -31.572 34.431  1.00 98.41  ? 166 LYS B N     1 
ATOM   5822  C  CA    . LYS B  2 182 ? 48.805  -32.096 34.065  1.00 101.77 ? 166 LYS B CA    1 
ATOM   5823  C  C     . LYS B  2 182 ? 49.802  -31.969 35.211  1.00 103.88 ? 166 LYS B C     1 
ATOM   5824  O  O     . LYS B  2 182 ? 50.678  -32.828 35.365  1.00 113.30 ? 166 LYS B O     1 
ATOM   5825  C  CB    . LYS B  2 182 ? 49.327  -31.375 32.821  1.00 103.58 ? 166 LYS B CB    1 
ATOM   5826  C  CG    . LYS B  2 182 ? 50.620  -31.945 32.263  1.00 118.34 ? 166 LYS B CG    1 
ATOM   5827  C  CD    . LYS B  2 182 ? 51.045  -31.214 31.000  1.00 128.64 ? 166 LYS B CD    1 
ATOM   5828  C  CE    . LYS B  2 182 ? 52.309  -31.821 30.412  1.00 132.00 ? 166 LYS B CE    1 
ATOM   5829  N  NZ    . LYS B  2 182 ? 52.726  -31.134 29.159  1.00 128.90 ? 166 LYS B NZ    1 
ATOM   5830  N  N     . ILE B  2 183 ? 49.683  -30.918 36.024  1.00 94.73  ? 167 ILE B N     1 
ATOM   5831  C  CA    . ILE B  2 183 ? 50.592  -30.748 37.153  1.00 89.64  ? 167 ILE B CA    1 
ATOM   5832  C  C     . ILE B  2 183 ? 50.268  -31.748 38.256  1.00 90.07  ? 167 ILE B C     1 
ATOM   5833  O  O     . ILE B  2 183 ? 51.170  -32.351 38.850  1.00 84.78  ? 167 ILE B O     1 
ATOM   5834  C  CB    . ILE B  2 183 ? 50.536  -29.299 37.669  1.00 86.90  ? 167 ILE B CB    1 
ATOM   5835  C  CG1   . ILE B  2 183 ? 50.847  -28.316 36.539  1.00 81.51  ? 167 ILE B CG1   1 
ATOM   5836  C  CG2   . ILE B  2 183 ? 51.510  -29.105 38.821  1.00 90.78  ? 167 ILE B CG2   1 
ATOM   5837  C  CD1   . ILE B  2 183 ? 50.631  -26.867 36.920  1.00 79.21  ? 167 ILE B CD1   1 
ATOM   5838  N  N     . LEU B  2 184 ? 48.982  -31.941 38.547  1.00 92.30  ? 168 LEU B N     1 
ATOM   5839  C  CA    . LEU B  2 184 ? 48.565  -32.862 39.596  1.00 91.16  ? 168 LEU B CA    1 
ATOM   5840  C  C     . LEU B  2 184 ? 48.546  -34.315 39.144  1.00 99.87  ? 168 LEU B C     1 
ATOM   5841  O  O     . LEU B  2 184 ? 48.324  -35.200 39.978  1.00 103.72 ? 168 LEU B O     1 
ATOM   5842  C  CB    . LEU B  2 184 ? 47.176  -32.479 40.113  1.00 81.65  ? 168 LEU B CB    1 
ATOM   5843  C  CG    . LEU B  2 184 ? 47.011  -31.069 40.679  1.00 78.60  ? 168 LEU B CG    1 
ATOM   5844  C  CD1   . LEU B  2 184 ? 45.588  -30.859 41.171  1.00 73.92  ? 168 LEU B CD1   1 
ATOM   5845  C  CD2   . LEU B  2 184 ? 48.011  -30.818 41.794  1.00 75.48  ? 168 LEU B CD2   1 
ATOM   5846  N  N     . GLU B  2 185 ? 48.770  -34.583 37.858  1.00 109.58 ? 169 GLU B N     1 
ATOM   5847  C  CA    . GLU B  2 185 ? 48.695  -35.956 37.363  1.00 118.36 ? 169 GLU B CA    1 
ATOM   5848  C  C     . GLU B  2 185 ? 49.732  -36.879 37.994  1.00 109.15 ? 169 GLU B C     1 
ATOM   5849  O  O     . GLU B  2 185 ? 49.361  -37.995 38.398  1.00 105.76 ? 169 GLU B O     1 
ATOM   5850  C  CB    . GLU B  2 185 ? 48.799  -35.958 35.833  1.00 131.31 ? 169 GLU B CB    1 
ATOM   5851  C  CG    . GLU B  2 185 ? 48.467  -37.294 35.183  1.00 147.53 ? 169 GLU B CG    1 
ATOM   5852  C  CD    . GLU B  2 185 ? 47.049  -37.755 35.475  1.00 156.18 ? 169 GLU B CD    1 
ATOM   5853  O  OE1   . GLU B  2 185 ? 46.823  -38.367 36.542  1.00 156.70 ? 169 GLU B OE1   1 
ATOM   5854  O  OE2   . GLU B  2 185 ? 46.156  -37.501 34.639  1.00 158.69 ? 169 GLU B OE2   1 
ATOM   5855  N  N     . PRO B  2 186 ? 51.015  -36.512 38.108  1.00 108.99 ? 170 PRO B N     1 
ATOM   5856  C  CA    . PRO B  2 186 ? 51.962  -37.434 38.759  1.00 108.79 ? 170 PRO B CA    1 
ATOM   5857  C  C     . PRO B  2 186 ? 51.664  -37.666 40.228  1.00 101.96 ? 170 PRO B C     1 
ATOM   5858  O  O     . PRO B  2 186 ? 51.882  -38.777 40.728  1.00 101.29 ? 170 PRO B O     1 
ATOM   5859  C  CB    . PRO B  2 186 ? 53.320  -36.744 38.563  1.00 114.39 ? 170 PRO B CB    1 
ATOM   5860  C  CG    . PRO B  2 186 ? 53.118  -35.803 37.429  1.00 114.69 ? 170 PRO B CG    1 
ATOM   5861  C  CD    . PRO B  2 186 ? 51.709  -35.330 37.565  1.00 110.32 ? 170 PRO B CD    1 
ATOM   5862  N  N     . PHE B  2 187 ? 51.166  -36.650 40.938  1.00 102.16 ? 171 PHE B N     1 
ATOM   5863  C  CA    . PHE B  2 187 ? 50.890  -36.810 42.362  1.00 100.86 ? 171 PHE B CA    1 
ATOM   5864  C  C     . PHE B  2 187 ? 49.680  -37.706 42.596  1.00 93.46  ? 171 PHE B C     1 
ATOM   5865  O  O     . PHE B  2 187 ? 49.671  -38.511 43.535  1.00 85.65  ? 171 PHE B O     1 
ATOM   5866  C  CB    . PHE B  2 187 ? 50.684  -35.443 43.013  1.00 103.79 ? 171 PHE B CB    1 
ATOM   5867  C  CG    . PHE B  2 187 ? 50.533  -35.498 44.506  1.00 111.63 ? 171 PHE B CG    1 
ATOM   5868  C  CD1   . PHE B  2 187 ? 51.648  -35.551 45.326  1.00 118.15 ? 171 PHE B CD1   1 
ATOM   5869  C  CD2   . PHE B  2 187 ? 49.277  -35.495 45.091  1.00 105.51 ? 171 PHE B CD2   1 
ATOM   5870  C  CE1   . PHE B  2 187 ? 51.514  -35.602 46.701  1.00 120.35 ? 171 PHE B CE1   1 
ATOM   5871  C  CE2   . PHE B  2 187 ? 49.136  -35.546 46.465  1.00 105.57 ? 171 PHE B CE2   1 
ATOM   5872  C  CZ    . PHE B  2 187 ? 50.256  -35.599 47.271  1.00 112.85 ? 171 PHE B CZ    1 
ATOM   5873  N  N     . LYS B  2 188 ? 48.648  -37.581 41.757  1.00 89.37  ? 172 LYS B N     1 
ATOM   5874  C  CA    . LYS B  2 188 ? 47.468  -38.427 41.910  1.00 88.39  ? 172 LYS B CA    1 
ATOM   5875  C  C     . LYS B  2 188 ? 47.796  -39.889 41.636  1.00 93.14  ? 172 LYS B C     1 
ATOM   5876  O  O     . LYS B  2 188 ? 47.266  -40.785 42.303  1.00 86.36  ? 172 LYS B O     1 
ATOM   5877  C  CB    . LYS B  2 188 ? 46.347  -37.943 40.990  1.00 87.13  ? 172 LYS B CB    1 
ATOM   5878  C  CG    . LYS B  2 188 ? 45.753  -36.601 41.389  1.00 81.01  ? 172 LYS B CG    1 
ATOM   5879  C  CD    . LYS B  2 188 ? 44.598  -36.215 40.481  1.00 79.35  ? 172 LYS B CD    1 
ATOM   5880  C  CE    . LYS B  2 188 ? 44.033  -34.856 40.859  1.00 94.56  ? 172 LYS B CE    1 
ATOM   5881  N  NZ    . LYS B  2 188 ? 42.891  -34.466 39.986  1.00 103.78 ? 172 LYS B NZ    1 
ATOM   5882  N  N     . LYS B  2 189 ? 48.664  -40.151 40.655  1.00 103.77 ? 173 LYS B N     1 
ATOM   5883  C  CA    . LYS B  2 189 ? 49.109  -41.519 40.416  1.00 115.09 ? 173 LYS B CA    1 
ATOM   5884  C  C     . LYS B  2 189 ? 49.936  -42.038 41.585  1.00 114.56 ? 173 LYS B C     1 
ATOM   5885  O  O     . LYS B  2 189 ? 49.866  -43.224 41.925  1.00 116.96 ? 173 LYS B O     1 
ATOM   5886  C  CB    . LYS B  2 189 ? 49.911  -41.594 39.117  1.00 132.53 ? 173 LYS B CB    1 
ATOM   5887  C  CG    . LYS B  2 189 ? 49.096  -41.337 37.861  1.00 141.83 ? 173 LYS B CG    1 
ATOM   5888  C  CD    . LYS B  2 189 ? 47.987  -42.364 37.707  1.00 149.15 ? 173 LYS B CD    1 
ATOM   5889  C  CE    . LYS B  2 189 ? 47.270  -42.211 36.376  1.00 151.72 ? 173 LYS B CE    1 
ATOM   5890  N  NZ    . LYS B  2 189 ? 48.185  -42.440 35.224  1.00 157.53 ? 173 LYS B NZ    1 
ATOM   5891  N  N     . GLN B  2 190 ? 50.722  -41.160 42.212  1.00 115.98 ? 174 GLN B N     1 
ATOM   5892  C  CA    . GLN B  2 190 ? 51.522  -41.568 43.362  1.00 120.73 ? 174 GLN B CA    1 
ATOM   5893  C  C     . GLN B  2 190 ? 50.641  -41.899 44.560  1.00 119.55 ? 174 GLN B C     1 
ATOM   5894  O  O     . GLN B  2 190 ? 50.940  -42.828 45.320  1.00 118.16 ? 174 GLN B O     1 
ATOM   5895  C  CB    . GLN B  2 190 ? 52.522  -40.466 43.716  1.00 130.25 ? 174 GLN B CB    1 
ATOM   5896  C  CG    . GLN B  2 190 ? 53.415  -40.781 44.908  1.00 138.56 ? 174 GLN B CG    1 
ATOM   5897  C  CD    . GLN B  2 190 ? 54.474  -41.820 44.593  1.00 148.79 ? 174 GLN B CD    1 
ATOM   5898  O  OE1   . GLN B  2 190 ? 54.694  -42.170 43.434  1.00 152.87 ? 174 GLN B OE1   1 
ATOM   5899  N  NE2   . GLN B  2 190 ? 55.139  -42.318 45.629  1.00 152.80 ? 174 GLN B NE2   1 
ATOM   5900  N  N     . ASN B  2 191 ? 49.550  -41.157 44.744  1.00 113.26 ? 175 ASN B N     1 
ATOM   5901  C  CA    . ASN B  2 191 ? 48.646  -41.341 45.878  1.00 101.93 ? 175 ASN B CA    1 
ATOM   5902  C  C     . ASN B  2 191 ? 47.220  -41.449 45.356  1.00 97.11  ? 175 ASN B C     1 
ATOM   5903  O  O     . ASN B  2 191 ? 46.526  -40.435 45.195  1.00 98.07  ? 175 ASN B O     1 
ATOM   5904  C  CB    . ASN B  2 191 ? 48.782  -40.197 46.880  1.00 98.71  ? 175 ASN B CB    1 
ATOM   5905  C  CG    . ASN B  2 191 ? 50.209  -40.007 47.356  1.00 99.70  ? 175 ASN B CG    1 
ATOM   5906  O  OD1   . ASN B  2 191 ? 50.626  -40.594 48.354  1.00 105.50 ? 175 ASN B OD1   1 
ATOM   5907  N  ND2   . ASN B  2 191 ? 50.966  -39.182 46.642  1.00 92.76  ? 175 ASN B ND2   1 
ATOM   5908  N  N     . PRO B  2 192 ? 46.744  -42.667 45.084  1.00 96.67  ? 176 PRO B N     1 
ATOM   5909  C  CA    . PRO B  2 192 ? 45.384  -42.818 44.543  1.00 98.74  ? 176 PRO B CA    1 
ATOM   5910  C  C     . PRO B  2 192 ? 44.286  -42.577 45.566  1.00 98.42  ? 176 PRO B C     1 
ATOM   5911  O  O     . PRO B  2 192 ? 43.136  -42.361 45.169  1.00 102.86 ? 176 PRO B O     1 
ATOM   5912  C  CB    . PRO B  2 192 ? 45.368  -44.267 44.043  1.00 85.88  ? 176 PRO B CB    1 
ATOM   5913  C  CG    . PRO B  2 192 ? 46.348  -44.964 44.928  1.00 88.82  ? 176 PRO B CG    1 
ATOM   5914  C  CD    . PRO B  2 192 ? 47.439  -43.961 45.205  1.00 89.61  ? 176 PRO B CD    1 
ATOM   5915  N  N     . ASP B  2 193 ? 44.599  -42.606 46.862  1.00 94.91  ? 177 ASP B N     1 
ATOM   5916  C  CA    . ASP B  2 193 ? 43.594  -42.409 47.898  1.00 90.87  ? 177 ASP B CA    1 
ATOM   5917  C  C     . ASP B  2 193 ? 43.328  -40.942 48.208  1.00 84.10  ? 177 ASP B C     1 
ATOM   5918  O  O     . ASP B  2 193 ? 42.312  -40.633 48.842  1.00 87.68  ? 177 ASP B O     1 
ATOM   5919  C  CB    . ASP B  2 193 ? 44.015  -43.125 49.186  1.00 96.92  ? 177 ASP B CB    1 
ATOM   5920  C  CG    . ASP B  2 193 ? 44.118  -44.627 49.009  1.00 109.71 ? 177 ASP B CG    1 
ATOM   5921  O  OD1   . ASP B  2 193 ? 45.034  -45.080 48.292  1.00 116.78 ? 177 ASP B OD1   1 
ATOM   5922  O  OD2   . ASP B  2 193 ? 43.282  -45.353 49.587  1.00 114.15 ? 177 ASP B OD2   1 
ATOM   5923  N  N     . ILE B  2 194 ? 44.202  -40.038 47.778  1.00 77.84  ? 178 ILE B N     1 
ATOM   5924  C  CA    . ILE B  2 194 ? 44.046  -38.618 48.075  1.00 74.51  ? 178 ILE B CA    1 
ATOM   5925  C  C     . ILE B  2 194 ? 43.022  -38.013 47.122  1.00 71.68  ? 178 ILE B C     1 
ATOM   5926  O  O     . ILE B  2 194 ? 43.088  -38.221 45.905  1.00 75.24  ? 178 ILE B O     1 
ATOM   5927  C  CB    . ILE B  2 194 ? 45.397  -37.891 47.976  1.00 75.25  ? 178 ILE B CB    1 
ATOM   5928  C  CG1   . ILE B  2 194 ? 46.322  -38.335 49.112  1.00 81.16  ? 178 ILE B CG1   1 
ATOM   5929  C  CG2   . ILE B  2 194 ? 45.200  -36.382 47.997  1.00 70.95  ? 178 ILE B CG2   1 
ATOM   5930  C  CD1   . ILE B  2 194 ? 47.635  -37.584 49.161  1.00 85.55  ? 178 ILE B CD1   1 
ATOM   5931  N  N     . VAL B  2 195 ? 42.073  -37.264 47.676  1.00 70.57  ? 179 VAL B N     1 
ATOM   5932  C  CA    . VAL B  2 195 ? 41.058  -36.567 46.896  1.00 65.34  ? 179 VAL B CA    1 
ATOM   5933  C  C     . VAL B  2 195 ? 41.459  -35.102 46.800  1.00 71.16  ? 179 VAL B C     1 
ATOM   5934  O  O     . VAL B  2 195 ? 41.681  -34.442 47.822  1.00 71.27  ? 179 VAL B O     1 
ATOM   5935  C  CB    . VAL B  2 195 ? 39.663  -36.721 47.523  1.00 65.85  ? 179 VAL B CB    1 
ATOM   5936  C  CG1   . VAL B  2 195 ? 38.675  -35.790 46.846  1.00 62.60  ? 179 VAL B CG1   1 
ATOM   5937  C  CG2   . VAL B  2 195 ? 39.193  -38.162 47.423  1.00 70.06  ? 179 VAL B CG2   1 
ATOM   5938  N  N     . ILE B  2 196 ? 41.557  -34.593 45.575  1.00 76.33  ? 180 ILE B N     1 
ATOM   5939  C  CA    . ILE B  2 196 ? 41.940  -33.210 45.318  1.00 69.89  ? 180 ILE B CA    1 
ATOM   5940  C  C     . ILE B  2 196 ? 40.783  -32.512 44.618  1.00 66.93  ? 180 ILE B C     1 
ATOM   5941  O  O     . ILE B  2 196 ? 40.274  -33.007 43.606  1.00 71.93  ? 180 ILE B O     1 
ATOM   5942  C  CB    . ILE B  2 196 ? 43.225  -33.121 44.475  1.00 78.08  ? 180 ILE B CB    1 
ATOM   5943  C  CG1   . ILE B  2 196 ? 44.394  -33.776 45.213  1.00 72.33  ? 180 ILE B CG1   1 
ATOM   5944  C  CG2   . ILE B  2 196 ? 43.544  -31.670 44.145  1.00 84.68  ? 180 ILE B CG2   1 
ATOM   5945  C  CD1   . ILE B  2 196 ? 45.721  -33.645 44.498  1.00 72.81  ? 180 ILE B CD1   1 
ATOM   5946  N  N     . TYR B  2 197 ? 40.370  -31.368 45.159  1.00 64.17  ? 181 TYR B N     1 
ATOM   5947  C  CA    . TYR B  2 197 ? 39.295  -30.570 44.587  1.00 55.26  ? 181 TYR B CA    1 
ATOM   5948  C  C     . TYR B  2 197 ? 39.741  -29.121 44.475  1.00 62.80  ? 181 TYR B C     1 
ATOM   5949  O  O     . TYR B  2 197 ? 40.384  -28.586 45.383  1.00 68.66  ? 181 TYR B O     1 
ATOM   5950  C  CB    . TYR B  2 197 ? 38.017  -30.662 45.428  1.00 57.55  ? 181 TYR B CB    1 
ATOM   5951  C  CG    . TYR B  2 197 ? 36.901  -29.763 44.944  1.00 57.09  ? 181 TYR B CG    1 
ATOM   5952  C  CD1   . TYR B  2 197 ? 36.360  -29.919 43.674  1.00 52.03  ? 181 TYR B CD1   1 
ATOM   5953  C  CD2   . TYR B  2 197 ? 36.384  -28.764 45.758  1.00 49.86  ? 181 TYR B CD2   1 
ATOM   5954  C  CE1   . TYR B  2 197 ? 35.339  -29.103 43.227  1.00 57.83  ? 181 TYR B CE1   1 
ATOM   5955  C  CE2   . TYR B  2 197 ? 35.362  -27.943 45.320  1.00 48.44  ? 181 TYR B CE2   1 
ATOM   5956  C  CZ    . TYR B  2 197 ? 34.844  -28.117 44.054  1.00 60.52  ? 181 TYR B CZ    1 
ATOM   5957  O  OH    . TYR B  2 197 ? 33.826  -27.301 43.615  1.00 60.03  ? 181 TYR B OH    1 
ATOM   5958  N  N     . GLN B  2 198 ? 39.393  -28.490 43.358  1.00 59.75  ? 182 GLN B N     1 
ATOM   5959  C  CA    . GLN B  2 198 ? 39.765  -27.111 43.078  1.00 61.26  ? 182 GLN B CA    1 
ATOM   5960  C  C     . GLN B  2 198 ? 38.517  -26.240 43.075  1.00 61.65  ? 182 GLN B C     1 
ATOM   5961  O  O     . GLN B  2 198 ? 37.538  -26.552 42.388  1.00 59.19  ? 182 GLN B O     1 
ATOM   5962  C  CB    . GLN B  2 198 ? 40.490  -27.006 41.735  1.00 63.36  ? 182 GLN B CB    1 
ATOM   5963  C  CG    . GLN B  2 198 ? 40.999  -25.614 41.401  1.00 76.68  ? 182 GLN B CG    1 
ATOM   5964  C  CD    . GLN B  2 198 ? 41.718  -25.566 40.066  1.00 87.59  ? 182 GLN B CD    1 
ATOM   5965  O  OE1   . GLN B  2 198 ? 41.742  -26.550 39.326  1.00 86.64  ? 182 GLN B OE1   1 
ATOM   5966  N  NE2   . GLN B  2 198 ? 42.309  -24.419 39.752  1.00 88.91  ? 182 GLN B NE2   1 
ATOM   5967  N  N     . TYR B  2 199 ? 38.550  -25.157 43.848  1.00 52.03  ? 183 TYR B N     1 
ATOM   5968  C  CA    . TYR B  2 199 ? 37.460  -24.189 43.873  1.00 52.72  ? 183 TYR B CA    1 
ATOM   5969  C  C     . TYR B  2 199 ? 38.052  -22.793 43.974  1.00 49.84  ? 183 TYR B C     1 
ATOM   5970  O  O     . TYR B  2 199 ? 38.755  -22.487 44.942  1.00 53.03  ? 183 TYR B O     1 
ATOM   5971  C  CB    . TYR B  2 199 ? 36.498  -24.449 45.036  1.00 46.63  ? 183 TYR B CB    1 
ATOM   5972  C  CG    . TYR B  2 199 ? 35.227  -23.637 44.940  1.00 53.38  ? 183 TYR B CG    1 
ATOM   5973  C  CD1   . TYR B  2 199 ? 34.203  -24.022 44.086  1.00 51.41  ? 183 TYR B CD1   1 
ATOM   5974  C  CD2   . TYR B  2 199 ? 35.054  -22.482 45.692  1.00 45.70  ? 183 TYR B CD2   1 
ATOM   5975  C  CE1   . TYR B  2 199 ? 33.041  -23.285 43.984  1.00 47.66  ? 183 TYR B CE1   1 
ATOM   5976  C  CE2   . TYR B  2 199 ? 33.891  -21.736 45.596  1.00 44.39  ? 183 TYR B CE2   1 
ATOM   5977  C  CZ    . TYR B  2 199 ? 32.890  -22.144 44.739  1.00 53.74  ? 183 TYR B CZ    1 
ATOM   5978  O  OH    . TYR B  2 199 ? 31.730  -21.415 44.631  1.00 70.43  ? 183 TYR B OH    1 
ATOM   5979  N  N     . MET B  2 200 ? 37.769  -21.959 42.974  1.00 50.32  ? 184 MET B N     1 
ATOM   5980  C  CA    . MET B  2 200 ? 38.228  -20.565 42.921  1.00 63.96  ? 184 MET B CA    1 
ATOM   5981  C  C     . MET B  2 200 ? 39.755  -20.574 42.964  1.00 62.05  ? 184 MET B C     1 
ATOM   5982  O  O     . MET B  2 200 ? 40.379  -21.260 42.139  1.00 63.10  ? 184 MET B O     1 
ATOM   5983  C  CB    . MET B  2 200 ? 37.542  -19.769 44.023  1.00 73.85  ? 184 MET B CB    1 
ATOM   5984  C  CG    . MET B  2 200 ? 36.041  -19.680 43.867  1.00 95.04  ? 184 MET B CG    1 
ATOM   5985  S  SD    . MET B  2 200 ? 35.572  -18.734 42.415  1.00 106.03 ? 184 MET B SD    1 
ATOM   5986  C  CE    . MET B  2 200 ? 35.962  -17.076 42.963  1.00 110.50 ? 184 MET B CE    1 
ATOM   5987  N  N     . ASP B  2 201 ? 40.388  -19.850 43.882  1.00 48.15  ? 185 ASP B N     1 
ATOM   5988  C  CA    . ASP B  2 201 ? 41.838  -19.815 44.003  1.00 56.65  ? 185 ASP B CA    1 
ATOM   5989  C  C     . ASP B  2 201 ? 42.386  -20.927 44.885  1.00 61.41  ? 185 ASP B C     1 
ATOM   5990  O  O     . ASP B  2 201 ? 43.603  -20.990 45.091  1.00 63.13  ? 185 ASP B O     1 
ATOM   5991  C  CB    . ASP B  2 201 ? 42.286  -18.462 44.565  1.00 50.70  ? 185 ASP B CB    1 
ATOM   5992  C  CG    . ASP B  2 201 ? 41.714  -17.291 43.796  1.00 54.18  ? 185 ASP B CG    1 
ATOM   5993  O  OD1   . ASP B  2 201 ? 41.091  -17.520 42.737  1.00 60.18  ? 185 ASP B OD1   1 
ATOM   5994  O  OD2   . ASP B  2 201 ? 41.881  -16.143 44.253  1.00 63.43  ? 185 ASP B OD2   1 
ATOM   5995  N  N     . ASP B  2 202 ? 41.531  -21.800 45.406  1.00 52.61  ? 186 ASP B N     1 
ATOM   5996  C  CA    . ASP B  2 202 ? 41.926  -22.763 46.419  1.00 56.17  ? 186 ASP B CA    1 
ATOM   5997  C  C     . ASP B  2 202 ? 42.000  -24.172 45.847  1.00 62.56  ? 186 ASP B C     1 
ATOM   5998  O  O     . ASP B  2 202 ? 41.381  -24.497 44.830  1.00 64.39  ? 186 ASP B O     1 
ATOM   5999  C  CB    . ASP B  2 202 ? 40.954  -22.737 47.602  1.00 68.45  ? 186 ASP B CB    1 
ATOM   6000  C  CG    . ASP B  2 202 ? 40.899  -21.384 48.278  1.00 75.50  ? 186 ASP B CG    1 
ATOM   6001  O  OD1   . ASP B  2 202 ? 41.939  -20.694 48.309  1.00 80.14  ? 186 ASP B OD1   1 
ATOM   6002  O  OD2   . ASP B  2 202 ? 39.815  -21.010 48.774  1.00 76.26  ? 186 ASP B OD2   1 
ATOM   6003  N  N     . LEU B  2 203 ? 42.775  -25.009 46.533  1.00 71.75  ? 187 LEU B N     1 
ATOM   6004  C  CA    . LEU B  2 203 ? 42.935  -26.417 46.195  1.00 73.52  ? 187 LEU B CA    1 
ATOM   6005  C  C     . LEU B  2 203 ? 42.674  -27.229 47.454  1.00 66.77  ? 187 LEU B C     1 
ATOM   6006  O  O     . LEU B  2 203 ? 43.417  -27.111 48.435  1.00 73.92  ? 187 LEU B O     1 
ATOM   6007  C  CB    . LEU B  2 203 ? 44.338  -26.696 45.647  1.00 65.85  ? 187 LEU B CB    1 
ATOM   6008  C  CG    . LEU B  2 203 ? 44.544  -27.978 44.841  1.00 67.26  ? 187 LEU B CG    1 
ATOM   6009  C  CD1   . LEU B  2 203 ? 43.697  -27.951 43.579  1.00 61.12  ? 187 LEU B CD1   1 
ATOM   6010  C  CD2   . LEU B  2 203 ? 46.015  -28.155 44.499  1.00 69.59  ? 187 LEU B CD2   1 
ATOM   6011  N  N     . TYR B  2 204 ? 41.618  -28.036 47.433  1.00 55.20  ? 188 TYR B N     1 
ATOM   6012  C  CA    . TYR B  2 204 ? 41.210  -28.827 48.587  1.00 58.04  ? 188 TYR B CA    1 
ATOM   6013  C  C     . TYR B  2 204 ? 41.801  -30.225 48.465  1.00 62.27  ? 188 TYR B C     1 
ATOM   6014  O  O     . TYR B  2 204 ? 41.463  -30.967 47.537  1.00 61.17  ? 188 TYR B O     1 
ATOM   6015  C  CB    . TYR B  2 204 ? 39.686  -28.883 48.694  1.00 55.76  ? 188 TYR B CB    1 
ATOM   6016  C  CG    . TYR B  2 204 ? 39.055  -27.542 48.998  1.00 53.27  ? 188 TYR B CG    1 
ATOM   6017  C  CD1   . TYR B  2 204 ? 38.877  -26.595 47.998  1.00 58.85  ? 188 TYR B CD1   1 
ATOM   6018  C  CD2   . TYR B  2 204 ? 38.642  -27.222 50.284  1.00 50.05  ? 188 TYR B CD2   1 
ATOM   6019  C  CE1   . TYR B  2 204 ? 38.307  -25.367 48.269  1.00 50.94  ? 188 TYR B CE1   1 
ATOM   6020  C  CE2   . TYR B  2 204 ? 38.067  -25.996 50.564  1.00 52.35  ? 188 TYR B CE2   1 
ATOM   6021  C  CZ    . TYR B  2 204 ? 37.903  -25.073 49.553  1.00 54.58  ? 188 TYR B CZ    1 
ATOM   6022  O  OH    . TYR B  2 204 ? 37.332  -23.851 49.827  1.00 57.14  ? 188 TYR B OH    1 
ATOM   6023  N  N     . VAL B  2 205 ? 42.681  -30.577 49.398  1.00 64.71  ? 189 VAL B N     1 
ATOM   6024  C  CA    . VAL B  2 205 ? 43.408  -31.841 49.374  1.00 68.21  ? 189 VAL B CA    1 
ATOM   6025  C  C     . VAL B  2 205 ? 43.001  -32.630 50.610  1.00 66.52  ? 189 VAL B C     1 
ATOM   6026  O  O     . VAL B  2 205 ? 43.347  -32.253 51.737  1.00 63.14  ? 189 VAL B O     1 
ATOM   6027  C  CB    . VAL B  2 205 ? 44.926  -31.626 49.333  1.00 70.69  ? 189 VAL B CB    1 
ATOM   6028  C  CG1   . VAL B  2 205 ? 45.643  -32.938 49.067  1.00 72.19  ? 189 VAL B CG1   1 
ATOM   6029  C  CG2   . VAL B  2 205 ? 45.282  -30.587 48.282  1.00 73.76  ? 189 VAL B CG2   1 
ATOM   6030  N  N     . GLY B  2 206 ? 42.276  -33.720 50.404  1.00 61.79  ? 190 GLY B N     1 
ATOM   6031  C  CA    . GLY B  2 206 ? 41.762  -34.530 51.499  1.00 66.16  ? 190 GLY B CA    1 
ATOM   6032  C  C     . GLY B  2 206 ? 42.336  -35.933 51.475  1.00 72.65  ? 190 GLY B C     1 
ATOM   6033  O  O     . GLY B  2 206 ? 42.498  -36.528 50.408  1.00 66.09  ? 190 GLY B O     1 
ATOM   6034  N  N     . SER B  2 207 ? 42.638  -36.456 52.662  1.00 67.87  ? 191 SER B N     1 
ATOM   6035  C  CA    . SER B  2 207 ? 43.166  -37.805 52.796  1.00 74.85  ? 191 SER B CA    1 
ATOM   6036  C  C     . SER B  2 207 ? 42.747  -38.370 54.145  1.00 76.78  ? 191 SER B C     1 
ATOM   6037  O  O     . SER B  2 207 ? 42.374  -37.633 55.062  1.00 75.61  ? 191 SER B O     1 
ATOM   6038  C  CB    . SER B  2 207 ? 44.693  -37.834 52.659  1.00 82.83  ? 191 SER B CB    1 
ATOM   6039  O  OG    . SER B  2 207 ? 45.316  -37.167 53.743  1.00 82.17  ? 191 SER B OG    1 
ATOM   6040  N  N     . ASP B  2 208 ? 42.812  -39.695 54.253  1.00 86.45  ? 192 ASP B N     1 
ATOM   6041  C  CA    . ASP B  2 208 ? 42.537  -40.398 55.498  1.00 84.39  ? 192 ASP B CA    1 
ATOM   6042  C  C     . ASP B  2 208 ? 43.807  -40.735 56.266  1.00 87.98  ? 192 ASP B C     1 
ATOM   6043  O  O     . ASP B  2 208 ? 43.742  -41.446 57.274  1.00 93.81  ? 192 ASP B O     1 
ATOM   6044  C  CB    . ASP B  2 208 ? 41.739  -41.673 55.219  1.00 83.69  ? 192 ASP B CB    1 
ATOM   6045  C  CG    . ASP B  2 208 ? 40.361  -41.384 54.659  1.00 83.64  ? 192 ASP B CG    1 
ATOM   6046  O  OD1   . ASP B  2 208 ? 39.724  -40.416 55.122  1.00 77.22  ? 192 ASP B OD1   1 
ATOM   6047  O  OD2   . ASP B  2 208 ? 39.919  -42.122 53.752  1.00 85.27  ? 192 ASP B OD2   1 
ATOM   6048  N  N     . LEU B  2 209 ? 44.957  -40.243 55.812  1.00 88.60  ? 193 LEU B N     1 
ATOM   6049  C  CA    . LEU B  2 209 ? 46.212  -40.491 56.500  1.00 91.68  ? 193 LEU B CA    1 
ATOM   6050  C  C     . LEU B  2 209 ? 46.220  -39.791 57.858  1.00 100.95 ? 193 LEU B C     1 
ATOM   6051  O  O     . LEU B  2 209 ? 45.388  -38.929 58.153  1.00 101.54 ? 193 LEU B O     1 
ATOM   6052  C  CB    . LEU B  2 209 ? 47.389  -40.014 55.650  1.00 87.39  ? 193 LEU B CB    1 
ATOM   6053  C  CG    . LEU B  2 209 ? 47.494  -40.602 54.242  1.00 89.51  ? 193 LEU B CG    1 
ATOM   6054  C  CD1   . LEU B  2 209 ? 48.672  -40.000 53.494  1.00 88.97  ? 193 LEU B CD1   1 
ATOM   6055  C  CD2   . LEU B  2 209 ? 47.612  -42.116 54.305  1.00 86.03  ? 193 LEU B CD2   1 
ATOM   6056  N  N     . GLU B  2 210 ? 47.180  -40.175 58.695  1.00 112.03 ? 194 GLU B N     1 
ATOM   6057  C  CA    . GLU B  2 210 ? 47.321  -39.530 59.988  1.00 119.82 ? 194 GLU B CA    1 
ATOM   6058  C  C     . GLU B  2 210 ? 47.844  -38.105 59.813  1.00 110.38 ? 194 GLU B C     1 
ATOM   6059  O  O     . GLU B  2 210 ? 48.315  -37.712 58.741  1.00 110.30 ? 194 GLU B O     1 
ATOM   6060  C  CB    . GLU B  2 210 ? 48.244  -40.341 60.898  1.00 130.63 ? 194 GLU B CB    1 
ATOM   6061  C  CG    . GLU B  2 210 ? 47.647  -41.666 61.343  1.00 141.80 ? 194 GLU B CG    1 
ATOM   6062  C  CD    . GLU B  2 210 ? 46.324  -41.496 62.070  1.00 149.03 ? 194 GLU B CD    1 
ATOM   6063  O  OE1   . GLU B  2 210 ? 46.159  -40.485 62.786  1.00 150.32 ? 194 GLU B OE1   1 
ATOM   6064  O  OE2   . GLU B  2 210 ? 45.446  -42.371 61.919  1.00 151.84 ? 194 GLU B OE2   1 
ATOM   6065  N  N     . ILE B  2 211 ? 47.749  -37.326 60.894  1.00 104.10 ? 195 ILE B N     1 
ATOM   6066  C  CA    . ILE B  2 211 ? 48.107  -35.910 60.835  1.00 102.25 ? 195 ILE B CA    1 
ATOM   6067  C  C     . ILE B  2 211 ? 49.551  -35.739 60.379  1.00 99.75  ? 195 ILE B C     1 
ATOM   6068  O  O     . ILE B  2 211 ? 49.862  -34.852 59.575  1.00 99.07  ? 195 ILE B O     1 
ATOM   6069  C  CB    . ILE B  2 211 ? 47.856  -35.241 62.198  1.00 111.11 ? 195 ILE B CB    1 
ATOM   6070  C  CG1   . ILE B  2 211 ? 46.413  -35.478 62.645  1.00 118.28 ? 195 ILE B CG1   1 
ATOM   6071  C  CG2   . ILE B  2 211 ? 48.148  -33.752 62.124  1.00 111.35 ? 195 ILE B CG2   1 
ATOM   6072  C  CD1   . ILE B  2 211 ? 46.086  -34.883 63.996  1.00 125.39 ? 195 ILE B CD1   1 
ATOM   6073  N  N     . GLY B  2 212 ? 50.452  -36.587 60.875  1.00 101.32 ? 196 GLY B N     1 
ATOM   6074  C  CA    . GLY B  2 212 ? 51.826  -36.539 60.403  1.00 90.32  ? 196 GLY B CA    1 
ATOM   6075  C  C     . GLY B  2 212 ? 51.947  -36.934 58.943  1.00 100.54 ? 196 GLY B C     1 
ATOM   6076  O  O     . GLY B  2 212 ? 52.604  -36.250 58.154  1.00 89.95  ? 196 GLY B O     1 
ATOM   6077  N  N     . GLN B  2 213 ? 51.303  -38.041 58.563  1.00 103.29 ? 197 GLN B N     1 
ATOM   6078  C  CA    . GLN B  2 213 ? 51.362  -38.497 57.178  1.00 111.64 ? 197 GLN B CA    1 
ATOM   6079  C  C     . GLN B  2 213 ? 50.673  -37.517 56.237  1.00 108.95 ? 197 GLN B C     1 
ATOM   6080  O  O     . GLN B  2 213 ? 51.135  -37.302 55.111  1.00 105.58 ? 197 GLN B O     1 
ATOM   6081  C  CB    . GLN B  2 213 ? 50.732  -39.885 57.057  1.00 121.49 ? 197 GLN B CB    1 
ATOM   6082  C  CG    . GLN B  2 213 ? 51.456  -40.972 57.833  1.00 128.82 ? 197 GLN B CG    1 
ATOM   6083  C  CD    . GLN B  2 213 ? 52.785  -41.348 57.209  1.00 136.75 ? 197 GLN B CD    1 
ATOM   6084  O  OE1   . GLN B  2 213 ? 53.070  -40.995 56.064  1.00 135.02 ? 197 GLN B OE1   1 
ATOM   6085  N  NE2   . GLN B  2 213 ? 53.607  -42.070 57.961  1.00 150.12 ? 197 GLN B NE2   1 
ATOM   6086  N  N     . HIS B  2 214 ? 49.568  -36.913 56.679  1.00 105.77 ? 198 HIS B N     1 
ATOM   6087  C  CA    . HIS B  2 214 ? 48.839  -35.981 55.825  1.00 91.16  ? 198 HIS B CA    1 
ATOM   6088  C  C     . HIS B  2 214 ? 49.676  -34.745 55.522  1.00 90.68  ? 198 HIS B C     1 
ATOM   6089  O  O     . HIS B  2 214 ? 49.882  -34.392 54.356  1.00 92.28  ? 198 HIS B O     1 
ATOM   6090  C  CB    . HIS B  2 214 ? 47.517  -35.588 56.484  1.00 82.51  ? 198 HIS B CB    1 
ATOM   6091  C  CG    . HIS B  2 214 ? 46.722  -34.593 55.696  1.00 78.02  ? 198 HIS B CG    1 
ATOM   6092  N  ND1   . HIS B  2 214 ? 45.980  -34.943 54.588  1.00 76.20  ? 198 HIS B ND1   1 
ATOM   6093  C  CD2   . HIS B  2 214 ? 46.558  -33.259 55.852  1.00 75.97  ? 198 HIS B CD2   1 
ATOM   6094  C  CE1   . HIS B  2 214 ? 45.390  -33.867 54.098  1.00 74.33  ? 198 HIS B CE1   1 
ATOM   6095  N  NE2   . HIS B  2 214 ? 45.724  -32.832 54.847  1.00 74.54  ? 198 HIS B NE2   1 
ATOM   6096  N  N     . ARG B  2 215 ? 50.168  -34.073 56.567  1.00 88.85  ? 199 ARG B N     1 
ATOM   6097  C  CA    . ARG B  2 215 ? 50.965  -32.866 56.367  1.00 92.05  ? 199 ARG B CA    1 
ATOM   6098  C  C     . ARG B  2 215 ? 52.232  -33.151 55.573  1.00 98.43  ? 199 ARG B C     1 
ATOM   6099  O  O     . ARG B  2 215 ? 52.706  -32.284 54.831  1.00 103.47 ? 199 ARG B O     1 
ATOM   6100  C  CB    . ARG B  2 215 ? 51.311  -32.238 57.718  1.00 90.31  ? 199 ARG B CB    1 
ATOM   6101  C  CG    . ARG B  2 215 ? 50.097  -31.831 58.536  1.00 81.10  ? 199 ARG B CG    1 
ATOM   6102  C  CD    . ARG B  2 215 ? 50.503  -31.257 59.882  1.00 84.61  ? 199 ARG B CD    1 
ATOM   6103  N  NE    . ARG B  2 215 ? 49.344  -30.947 60.713  1.00 90.66  ? 199 ARG B NE    1 
ATOM   6104  C  CZ    . ARG B  2 215 ? 49.418  -30.414 61.928  1.00 99.92  ? 199 ARG B CZ    1 
ATOM   6105  N  NH1   . ARG B  2 215 ? 50.599  -30.127 62.459  1.00 112.24 ? 199 ARG B NH1   1 
ATOM   6106  N  NH2   . ARG B  2 215 ? 48.310  -30.167 62.614  1.00 98.40  ? 199 ARG B NH2   1 
ATOM   6107  N  N     . THR B  2 216 ? 52.793  -34.355 55.713  1.00 94.04  ? 200 THR B N     1 
ATOM   6108  C  CA    . THR B  2 216 ? 53.935  -34.735 54.888  1.00 103.86 ? 200 THR B CA    1 
ATOM   6109  C  C     . THR B  2 216 ? 53.546  -34.804 53.416  1.00 105.29 ? 200 THR B C     1 
ATOM   6110  O  O     . THR B  2 216 ? 54.271  -34.301 52.550  1.00 112.98 ? 200 THR B O     1 
ATOM   6111  C  CB    . THR B  2 216 ? 54.502  -36.076 55.357  1.00 107.13 ? 200 THR B CB    1 
ATOM   6112  O  OG1   . THR B  2 216 ? 55.054  -35.932 56.672  1.00 108.21 ? 200 THR B OG1   1 
ATOM   6113  C  CG2   . THR B  2 216 ? 55.588  -36.561 54.408  1.00 102.66 ? 200 THR B CG2   1 
ATOM   6114  N  N     . LYS B  2 217 ? 52.397  -35.415 53.114  1.00 95.01  ? 201 LYS B N     1 
ATOM   6115  C  CA    . LYS B  2 217 ? 51.955  -35.512 51.727  1.00 90.28  ? 201 LYS B CA    1 
ATOM   6116  C  C     . LYS B  2 217 ? 51.524  -34.159 51.175  1.00 85.30  ? 201 LYS B C     1 
ATOM   6117  O  O     . LYS B  2 217 ? 51.580  -33.944 49.959  1.00 87.87  ? 201 LYS B O     1 
ATOM   6118  C  CB    . LYS B  2 217 ? 50.816  -36.525 51.604  1.00 91.19  ? 201 LYS B CB    1 
ATOM   6119  C  CG    . LYS B  2 217 ? 51.259  -37.926 51.193  1.00 102.02 ? 201 LYS B CG    1 
ATOM   6120  C  CD    . LYS B  2 217 ? 52.220  -38.538 52.201  1.00 115.09 ? 201 LYS B CD    1 
ATOM   6121  C  CE    . LYS B  2 217 ? 52.647  -39.936 51.780  1.00 118.25 ? 201 LYS B CE    1 
ATOM   6122  N  NZ    . LYS B  2 217 ? 53.364  -39.934 50.475  1.00 120.01 ? 201 LYS B NZ    1 
ATOM   6123  N  N     . ILE B  2 218 ? 51.089  -33.241 52.041  1.00 81.20  ? 202 ILE B N     1 
ATOM   6124  C  CA    . ILE B  2 218 ? 50.760  -31.896 51.580  1.00 84.74  ? 202 ILE B CA    1 
ATOM   6125  C  C     . ILE B  2 218 ? 52.021  -31.165 51.138  1.00 96.87  ? 202 ILE B C     1 
ATOM   6126  O  O     . ILE B  2 218 ? 52.018  -30.445 50.132  1.00 92.44  ? 202 ILE B O     1 
ATOM   6127  C  CB    . ILE B  2 218 ? 50.008  -31.119 52.677  1.00 85.65  ? 202 ILE B CB    1 
ATOM   6128  C  CG1   . ILE B  2 218 ? 48.683  -31.807 53.011  1.00 80.00  ? 202 ILE B CG1   1 
ATOM   6129  C  CG2   . ILE B  2 218 ? 49.749  -29.687 52.238  1.00 70.89  ? 202 ILE B CG2   1 
ATOM   6130  C  CD1   . ILE B  2 218 ? 47.709  -31.839 51.859  1.00 71.84  ? 202 ILE B CD1   1 
ATOM   6131  N  N     . GLU B  2 219 ? 53.120  -31.343 51.875  1.00 108.15 ? 203 GLU B N     1 
ATOM   6132  C  CA    . GLU B  2 219 ? 54.375  -30.703 51.495  1.00 116.54 ? 203 GLU B CA    1 
ATOM   6133  C  C     . GLU B  2 219 ? 54.911  -31.274 50.188  1.00 114.59 ? 203 GLU B C     1 
ATOM   6134  O  O     . GLU B  2 219 ? 55.488  -30.541 49.376  1.00 116.67 ? 203 GLU B O     1 
ATOM   6135  C  CB    . GLU B  2 219 ? 55.404  -30.856 52.615  1.00 126.25 ? 203 GLU B CB    1 
ATOM   6136  C  CG    . GLU B  2 219 ? 56.712  -30.117 52.364  1.00 134.47 ? 203 GLU B CG    1 
ATOM   6137  C  CD    . GLU B  2 219 ? 56.530  -28.613 52.271  1.00 134.92 ? 203 GLU B CD    1 
ATOM   6138  O  OE1   . GLU B  2 219 ? 55.562  -28.088 52.861  1.00 131.08 ? 203 GLU B OE1   1 
ATOM   6139  O  OE2   . GLU B  2 219 ? 57.355  -27.954 51.605  1.00 137.66 ? 203 GLU B OE2   1 
ATOM   6140  N  N     . GLU B  2 220 ? 54.732  -32.579 49.968  1.00 113.41 ? 204 GLU B N     1 
ATOM   6141  C  CA    . GLU B  2 220 ? 55.124  -33.172 48.693  1.00 106.83 ? 204 GLU B CA    1 
ATOM   6142  C  C     . GLU B  2 220 ? 54.347  -32.549 47.541  1.00 103.38 ? 204 GLU B C     1 
ATOM   6143  O  O     . GLU B  2 220 ? 54.900  -32.325 46.458  1.00 106.69 ? 204 GLU B O     1 
ATOM   6144  C  CB    . GLU B  2 220 ? 54.909  -34.685 48.725  1.00 103.94 ? 204 GLU B CB    1 
ATOM   6145  C  CG    . GLU B  2 220 ? 55.703  -35.410 49.797  1.00 112.28 ? 204 GLU B CG    1 
ATOM   6146  C  CD    . GLU B  2 220 ? 55.459  -36.906 49.785  1.00 122.63 ? 204 GLU B CD    1 
ATOM   6147  O  OE1   . GLU B  2 220 ? 54.776  -37.390 48.858  1.00 125.30 ? 204 GLU B OE1   1 
ATOM   6148  O  OE2   . GLU B  2 220 ? 55.948  -37.598 50.703  1.00 129.86 ? 204 GLU B OE2   1 
ATOM   6149  N  N     . LEU B  2 221 ? 53.062  -32.262 47.758  1.00 101.67 ? 205 LEU B N     1 
ATOM   6150  C  CA    . LEU B  2 221 ? 52.276  -31.584 46.734  1.00 95.26  ? 205 LEU B CA    1 
ATOM   6151  C  C     . LEU B  2 221 ? 52.722  -30.140 46.554  1.00 95.36  ? 205 LEU B C     1 
ATOM   6152  O  O     . LEU B  2 221 ? 52.676  -29.614 45.435  1.00 88.19  ? 205 LEU B O     1 
ATOM   6153  C  CB    . LEU B  2 221 ? 50.790  -31.645 47.087  1.00 88.82  ? 205 LEU B CB    1 
ATOM   6154  C  CG    . LEU B  2 221 ? 49.830  -31.081 46.038  1.00 83.49  ? 205 LEU B CG    1 
ATOM   6155  C  CD1   . LEU B  2 221 ? 49.966  -31.844 44.731  1.00 83.74  ? 205 LEU B CD1   1 
ATOM   6156  C  CD2   . LEU B  2 221 ? 48.401  -31.127 46.542  1.00 75.89  ? 205 LEU B CD2   1 
ATOM   6157  N  N     . ARG B  2 222 ? 53.153  -29.484 47.635  1.00 102.91 ? 206 ARG B N     1 
ATOM   6158  C  CA    . ARG B  2 222 ? 53.696  -28.135 47.513  1.00 113.01 ? 206 ARG B CA    1 
ATOM   6159  C  C     . ARG B  2 222 ? 54.956  -28.133 46.658  1.00 117.59 ? 206 ARG B C     1 
ATOM   6160  O  O     . ARG B  2 222 ? 55.110  -27.299 45.758  1.00 122.48 ? 206 ARG B O     1 
ATOM   6161  C  CB    . ARG B  2 222 ? 53.986  -27.552 48.897  1.00 119.45 ? 206 ARG B CB    1 
ATOM   6162  C  CG    . ARG B  2 222 ? 52.753  -27.269 49.738  1.00 123.59 ? 206 ARG B CG    1 
ATOM   6163  C  CD    . ARG B  2 222 ? 53.113  -26.439 50.962  1.00 132.47 ? 206 ARG B CD    1 
ATOM   6164  N  NE    . ARG B  2 222 ? 51.953  -26.151 51.800  1.00 133.52 ? 206 ARG B NE    1 
ATOM   6165  C  CZ    . ARG B  2 222 ? 51.641  -26.825 52.903  1.00 137.13 ? 206 ARG B CZ    1 
ATOM   6166  N  NH1   . ARG B  2 222 ? 52.407  -27.830 53.306  1.00 140.51 ? 206 ARG B NH1   1 
ATOM   6167  N  NH2   . ARG B  2 222 ? 50.565  -26.493 53.603  1.00 132.74 ? 206 ARG B NH2   1 
ATOM   6168  N  N     . GLN B  2 223 ? 55.873  -29.068 46.925  1.00 115.19 ? 207 GLN B N     1 
ATOM   6169  C  CA    . GLN B  2 223 ? 57.068  -29.185 46.097  1.00 113.62 ? 207 GLN B CA    1 
ATOM   6170  C  C     . GLN B  2 223 ? 56.716  -29.574 44.667  1.00 116.28 ? 207 GLN B C     1 
ATOM   6171  O  O     . GLN B  2 223 ? 57.447  -29.228 43.732  1.00 117.93 ? 207 GLN B O     1 
ATOM   6172  C  CB    . GLN B  2 223 ? 58.032  -30.207 46.702  1.00 115.01 ? 207 GLN B CB    1 
ATOM   6173  C  CG    . GLN B  2 223 ? 58.415  -29.928 48.148  1.00 114.70 ? 207 GLN B CG    1 
ATOM   6174  C  CD    . GLN B  2 223 ? 59.221  -28.653 48.311  1.00 123.16 ? 207 GLN B CD    1 
ATOM   6175  O  OE1   . GLN B  2 223 ? 59.807  -28.145 47.354  1.00 133.03 ? 207 GLN B OE1   1 
ATOM   6176  N  NE2   . GLN B  2 223 ? 59.254  -28.128 49.530  1.00 124.10 ? 207 GLN B NE2   1 
ATOM   6177  N  N     . HIS B  2 224 ? 55.603  -30.288 44.478  1.00 116.16 ? 208 HIS B N     1 
ATOM   6178  C  CA    . HIS B  2 224 ? 55.162  -30.629 43.132  1.00 116.64 ? 208 HIS B CA    1 
ATOM   6179  C  C     . HIS B  2 224 ? 54.695  -29.395 42.370  1.00 117.86 ? 208 HIS B C     1 
ATOM   6180  O  O     . HIS B  2 224 ? 54.814  -29.345 41.141  1.00 119.15 ? 208 HIS B O     1 
ATOM   6181  C  CB    . HIS B  2 224 ? 54.044  -31.668 43.192  1.00 113.33 ? 208 HIS B CB    1 
ATOM   6182  C  CG    . HIS B  2 224 ? 54.164  -32.744 42.160  1.00 115.20 ? 208 HIS B CG    1 
ATOM   6183  N  ND1   . HIS B  2 224 ? 54.950  -33.861 42.340  1.00 123.64 ? 208 HIS B ND1   1 
ATOM   6184  C  CD2   . HIS B  2 224 ? 53.603  -32.872 40.934  1.00 120.18 ? 208 HIS B CD2   1 
ATOM   6185  C  CE1   . HIS B  2 224 ? 54.867  -34.633 41.272  1.00 130.17 ? 208 HIS B CE1   1 
ATOM   6186  N  NE2   . HIS B  2 224 ? 54.056  -34.056 40.403  1.00 126.27 ? 208 HIS B NE2   1 
ATOM   6187  N  N     . LEU B  2 225 ? 54.162  -28.399 43.078  1.00 120.46 ? 209 LEU B N     1 
ATOM   6188  C  CA    . LEU B  2 225 ? 53.747  -27.146 42.461  1.00 122.80 ? 209 LEU B CA    1 
ATOM   6189  C  C     . LEU B  2 225 ? 54.895  -26.161 42.302  1.00 121.38 ? 209 LEU B C     1 
ATOM   6190  O  O     . LEU B  2 225 ? 54.873  -25.346 41.372  1.00 122.38 ? 209 LEU B O     1 
ATOM   6191  C  CB    . LEU B  2 225 ? 52.634  -26.494 43.286  1.00 116.76 ? 209 LEU B CB    1 
ATOM   6192  C  CG    . LEU B  2 225 ? 51.369  -27.333 43.482  1.00 116.65 ? 209 LEU B CG    1 
ATOM   6193  C  CD1   . LEU B  2 225 ? 50.392  -26.631 44.409  1.00 116.32 ? 209 LEU B CD1   1 
ATOM   6194  C  CD2   . LEU B  2 225 ? 50.715  -27.648 42.145  1.00 119.32 ? 209 LEU B CD2   1 
ATOM   6195  N  N     . LEU B  2 226 ? 55.892  -26.210 43.190  1.00 120.04 ? 210 LEU B N     1 
ATOM   6196  C  CA    . LEU B  2 226 ? 57.024  -25.295 43.081  1.00 121.47 ? 210 LEU B CA    1 
ATOM   6197  C  C     . LEU B  2 226 ? 57.826  -25.553 41.812  1.00 132.58 ? 210 LEU B C     1 
ATOM   6198  O  O     . LEU B  2 226 ? 58.363  -24.617 41.210  1.00 133.62 ? 210 LEU B O     1 
ATOM   6199  C  CB    . LEU B  2 226 ? 57.923  -25.415 44.312  1.00 118.23 ? 210 LEU B CB    1 
ATOM   6200  C  CG    . LEU B  2 226 ? 57.334  -24.921 45.636  1.00 118.07 ? 210 LEU B CG    1 
ATOM   6201  C  CD1   . LEU B  2 226 ? 58.309  -25.124 46.788  1.00 117.67 ? 210 LEU B CD1   1 
ATOM   6202  C  CD2   . LEU B  2 226 ? 56.928  -23.459 45.527  1.00 116.17 ? 210 LEU B CD2   1 
ATOM   6203  N  N     . ARG B  2 227 ? 57.917  -26.813 41.384  1.00 133.52 ? 211 ARG B N     1 
ATOM   6204  C  CA    . ARG B  2 227 ? 58.703  -27.153 40.203  1.00 142.38 ? 211 ARG B CA    1 
ATOM   6205  C  C     . ARG B  2 227 ? 57.907  -26.892 38.936  1.00 140.18 ? 211 ARG B C     1 
ATOM   6206  O  O     . ARG B  2 227 ? 58.020  -27.635 37.956  1.00 146.51 ? 211 ARG B O     1 
ATOM   6207  C  CB    . ARG B  2 227 ? 59.166  -28.611 40.258  1.00 143.03 ? 211 ARG B CB    1 
ATOM   6208  C  CG    . ARG B  2 227 ? 58.046  -29.612 40.494  1.00 140.43 ? 211 ARG B CG    1 
ATOM   6209  C  CD    . ARG B  2 227 ? 58.569  -31.039 40.521  1.00 135.20 ? 211 ARG B CD    1 
ATOM   6210  N  NE    . ARG B  2 227 ? 59.622  -31.211 41.517  1.00 137.08 ? 211 ARG B NE    1 
ATOM   6211  C  CZ    . ARG B  2 227 ? 59.424  -31.673 42.748  1.00 140.23 ? 211 ARG B CZ    1 
ATOM   6212  N  NH1   . ARG B  2 227 ? 58.207  -32.021 43.143  1.00 141.08 ? 211 ARG B NH1   1 
ATOM   6213  N  NH2   . ARG B  2 227 ? 60.445  -31.790 43.585  1.00 145.87 ? 211 ARG B NH2   1 
ATOM   6214  N  N     . TRP B  2 228 ? 57.090  -25.843 38.949  1.00 128.52 ? 212 TRP B N     1 
ATOM   6215  C  CA    . TRP B  2 228 ? 56.322  -25.458 37.775  1.00 120.10 ? 212 TRP B CA    1 
ATOM   6216  C  C     . TRP B  2 228 ? 56.292  -23.945 37.630  1.00 122.60 ? 212 TRP B C     1 
ATOM   6217  O  O     . TRP B  2 228 ? 56.343  -23.423 36.518  1.00 127.77 ? 212 TRP B O     1 
ATOM   6218  C  CB    . TRP B  2 228 ? 54.899  -26.010 37.853  1.00 118.41 ? 212 TRP B CB    1 
ATOM   6219  C  CG    . TRP B  2 228 ? 54.082  -25.731 36.621  1.00 121.03 ? 212 TRP B CG    1 
ATOM   6220  C  CD1   . TRP B  2 228 ? 53.944  -26.538 35.528  1.00 125.74 ? 212 TRP B CD1   1 
ATOM   6221  C  CD2   . TRP B  2 228 ? 53.292  -24.564 36.358  1.00 119.54 ? 212 TRP B CD2   1 
ATOM   6222  N  NE1   . TRP B  2 228 ? 53.117  -25.946 34.603  1.00 124.76 ? 212 TRP B NE1   1 
ATOM   6223  C  CE2   . TRP B  2 228 ? 52.704  -24.733 35.088  1.00 120.34 ? 212 TRP B CE2   1 
ATOM   6224  C  CE3   . TRP B  2 228 ? 53.025  -23.392 37.074  1.00 118.86 ? 212 TRP B CE3   1 
ATOM   6225  C  CZ2   . TRP B  2 228 ? 51.866  -23.776 34.520  1.00 118.58 ? 212 TRP B CZ2   1 
ATOM   6226  C  CZ3   . TRP B  2 228 ? 52.192  -22.444 36.508  1.00 117.34 ? 212 TRP B CZ3   1 
ATOM   6227  C  CH2   . TRP B  2 228 ? 51.623  -22.642 35.243  1.00 117.89 ? 212 TRP B CH2   1 
ATOM   6228  N  N     . PRO B  2 242 ? 52.100  -16.244 46.221  1.00 153.57 ? 226 PRO B N     1 
ATOM   6229  C  CA    . PRO B  2 242 ? 52.962  -16.016 47.382  1.00 154.74 ? 226 PRO B CA    1 
ATOM   6230  C  C     . PRO B  2 242 ? 52.366  -16.564 48.675  1.00 154.95 ? 226 PRO B C     1 
ATOM   6231  O  O     . PRO B  2 242 ? 52.886  -16.291 49.758  1.00 157.24 ? 226 PRO B O     1 
ATOM   6232  C  CB    . PRO B  2 242 ? 53.069  -14.490 47.434  1.00 153.18 ? 226 PRO B CB    1 
ATOM   6233  C  CG    . PRO B  2 242 ? 51.821  -13.979 46.725  1.00 151.35 ? 226 PRO B CG    1 
ATOM   6234  C  CD    . PRO B  2 242 ? 51.141  -15.142 46.039  1.00 150.80 ? 226 PRO B CD    1 
ATOM   6235  N  N     . PHE B  2 243 ? 51.284  -17.335 48.558  1.00 147.55 ? 227 PHE B N     1 
ATOM   6236  C  CA    . PHE B  2 243 ? 50.606  -17.912 49.713  1.00 137.29 ? 227 PHE B CA    1 
ATOM   6237  C  C     . PHE B  2 243 ? 50.581  -19.436 49.662  1.00 133.59 ? 227 PHE B C     1 
ATOM   6238  O  O     . PHE B  2 243 ? 49.705  -20.058 50.270  1.00 137.08 ? 227 PHE B O     1 
ATOM   6239  C  CB    . PHE B  2 243 ? 49.184  -17.361 49.829  1.00 131.50 ? 227 PHE B CB    1 
ATOM   6240  C  CG    . PHE B  2 243 ? 49.128  -15.874 50.022  1.00 133.75 ? 227 PHE B CG    1 
ATOM   6241  C  CD1   . PHE B  2 243 ? 49.169  -15.325 51.293  1.00 131.88 ? 227 PHE B CD1   1 
ATOM   6242  C  CD2   . PHE B  2 243 ? 49.037  -15.024 48.932  1.00 133.94 ? 227 PHE B CD2   1 
ATOM   6243  C  CE1   . PHE B  2 243 ? 49.120  -13.957 51.473  1.00 130.82 ? 227 PHE B CE1   1 
ATOM   6244  C  CE2   . PHE B  2 243 ? 48.989  -13.656 49.106  1.00 134.02 ? 227 PHE B CE2   1 
ATOM   6245  C  CZ    . PHE B  2 243 ? 49.030  -13.121 50.378  1.00 132.63 ? 227 PHE B CZ    1 
ATOM   6246  N  N     . LEU B  2 244 ? 51.526  -20.051 48.949  1.00 128.75 ? 228 LEU B N     1 
ATOM   6247  C  CA    . LEU B  2 244 ? 51.578  -21.506 48.879  1.00 118.87 ? 228 LEU B CA    1 
ATOM   6248  C  C     . LEU B  2 244 ? 52.098  -22.126 50.169  1.00 134.60 ? 228 LEU B C     1 
ATOM   6249  O  O     . LEU B  2 244 ? 51.850  -23.311 50.417  1.00 133.15 ? 228 LEU B O     1 
ATOM   6250  C  CB    . LEU B  2 244 ? 52.447  -21.941 47.696  1.00 106.76 ? 228 LEU B CB    1 
ATOM   6251  C  CG    . LEU B  2 244 ? 52.386  -23.410 47.273  1.00 94.19  ? 228 LEU B CG    1 
ATOM   6252  C  CD1   . LEU B  2 244 ? 50.957  -23.813 46.951  1.00 77.80  ? 228 LEU B CD1   1 
ATOM   6253  C  CD2   . LEU B  2 244 ? 53.295  -23.661 46.080  1.00 97.96  ? 228 LEU B CD2   1 
ATOM   6254  N  N     . TRP B  2 245 ? 52.801  -21.352 51.000  1.00 144.32 ? 229 TRP B N     1 
ATOM   6255  C  CA    . TRP B  2 245 ? 53.338  -21.886 52.245  1.00 151.43 ? 229 TRP B CA    1 
ATOM   6256  C  C     . TRP B  2 245 ? 52.260  -22.113 53.296  1.00 151.81 ? 229 TRP B C     1 
ATOM   6257  O  O     . TRP B  2 245 ? 52.496  -22.856 54.255  1.00 159.18 ? 229 TRP B O     1 
ATOM   6258  C  CB    . TRP B  2 245 ? 54.414  -20.950 52.802  1.00 154.69 ? 229 TRP B CB    1 
ATOM   6259  C  CG    . TRP B  2 245 ? 53.903  -19.594 53.195  1.00 155.22 ? 229 TRP B CG    1 
ATOM   6260  C  CD1   . TRP B  2 245 ? 53.804  -18.492 52.396  1.00 154.51 ? 229 TRP B CD1   1 
ATOM   6261  C  CD2   . TRP B  2 245 ? 53.429  -19.194 54.489  1.00 154.48 ? 229 TRP B CD2   1 
ATOM   6262  N  NE1   . TRP B  2 245 ? 53.297  -17.433 53.109  1.00 153.26 ? 229 TRP B NE1   1 
ATOM   6263  C  CE2   . TRP B  2 245 ? 53.058  -17.837 54.397  1.00 154.47 ? 229 TRP B CE2   1 
ATOM   6264  C  CE3   . TRP B  2 245 ? 53.282  -19.851 55.714  1.00 154.15 ? 229 TRP B CE3   1 
ATOM   6265  C  CZ2   . TRP B  2 245 ? 52.549  -17.126 55.483  1.00 155.49 ? 229 TRP B CZ2   1 
ATOM   6266  C  CZ3   . TRP B  2 245 ? 52.776  -19.144 56.791  1.00 155.84 ? 229 TRP B CZ3   1 
ATOM   6267  C  CH2   . TRP B  2 245 ? 52.416  -17.796 56.668  1.00 155.70 ? 229 TRP B CH2   1 
ATOM   6268  N  N     . MET B  2 246 ? 51.093  -21.498 53.143  1.00 143.89 ? 230 MET B N     1 
ATOM   6269  C  CA    . MET B  2 246 ? 50.016  -21.643 54.108  1.00 139.29 ? 230 MET B CA    1 
ATOM   6270  C  C     . MET B  2 246 ? 49.183  -22.882 53.803  1.00 131.87 ? 230 MET B C     1 
ATOM   6271  O  O     . MET B  2 246 ? 49.094  -23.331 52.657  1.00 132.20 ? 230 MET B O     1 
ATOM   6272  C  CB    . MET B  2 246 ? 49.121  -20.403 54.114  1.00 137.22 ? 230 MET B CB    1 
ATOM   6273  C  CG    . MET B  2 246 ? 49.835  -19.129 54.526  1.00 136.24 ? 230 MET B CG    1 
ATOM   6274  S  SD    . MET B  2 246 ? 48.748  -17.691 54.561  1.00 128.02 ? 230 MET B SD    1 
ATOM   6275  C  CE    . MET B  2 246 ? 47.547  -18.205 55.786  1.00 131.50 ? 230 MET B CE    1 
ATOM   6276  N  N     . GLY B  2 247 ? 48.571  -23.430 54.849  1.00 124.56 ? 231 GLY B N     1 
ATOM   6277  C  CA    . GLY B  2 247 ? 47.731  -24.602 54.710  1.00 107.43 ? 231 GLY B CA    1 
ATOM   6278  C  C     . GLY B  2 247 ? 46.657  -24.683 55.773  1.00 100.53 ? 231 GLY B C     1 
ATOM   6279  O  O     . GLY B  2 247 ? 46.902  -25.179 56.877  1.00 99.21  ? 231 GLY B O     1 
ATOM   6280  N  N     . TYR B  2 248 ? 45.462  -24.194 55.454  1.00 97.80  ? 232 TYR B N     1 
ATOM   6281  C  CA    . TYR B  2 248 ? 44.344  -24.229 56.388  1.00 96.63  ? 232 TYR B CA    1 
ATOM   6282  C  C     . TYR B  2 248 ? 43.778  -25.644 56.440  1.00 90.67  ? 232 TYR B C     1 
ATOM   6283  O  O     . TYR B  2 248 ? 43.368  -26.193 55.411  1.00 96.47  ? 232 TYR B O     1 
ATOM   6284  C  CB    . TYR B  2 248 ? 43.274  -23.224 55.970  1.00 101.68 ? 232 TYR B CB    1 
ATOM   6285  C  CG    . TYR B  2 248 ? 42.209  -22.982 57.013  1.00 117.45 ? 232 TYR B CG    1 
ATOM   6286  C  CD1   . TYR B  2 248 ? 42.487  -22.248 58.159  1.00 126.01 ? 232 TYR B CD1   1 
ATOM   6287  C  CD2   . TYR B  2 248 ? 40.922  -23.474 56.846  1.00 121.43 ? 232 TYR B CD2   1 
ATOM   6288  C  CE1   . TYR B  2 248 ? 41.515  -22.020 59.115  1.00 126.09 ? 232 TYR B CE1   1 
ATOM   6289  C  CE2   . TYR B  2 248 ? 39.944  -23.250 57.795  1.00 126.81 ? 232 TYR B CE2   1 
ATOM   6290  C  CZ    . TYR B  2 248 ? 40.245  -22.523 58.927  1.00 129.65 ? 232 TYR B CZ    1 
ATOM   6291  O  OH    . TYR B  2 248 ? 39.271  -22.300 59.873  1.00 130.56 ? 232 TYR B OH    1 
ATOM   6292  N  N     . GLU B  2 249 ? 43.755  -26.232 57.632  1.00 80.19  ? 233 GLU B N     1 
ATOM   6293  C  CA    . GLU B  2 249 ? 43.374  -27.626 57.809  1.00 76.38  ? 233 GLU B CA    1 
ATOM   6294  C  C     . GLU B  2 249 ? 41.911  -27.743 58.213  1.00 73.09  ? 233 GLU B C     1 
ATOM   6295  O  O     . GLU B  2 249 ? 41.427  -26.998 59.071  1.00 73.98  ? 233 GLU B O     1 
ATOM   6296  C  CB    . GLU B  2 249 ? 44.260  -28.302 58.857  1.00 74.70  ? 233 GLU B CB    1 
ATOM   6297  C  CG    . GLU B  2 249 ? 45.709  -28.463 58.427  1.00 83.68  ? 233 GLU B CG    1 
ATOM   6298  C  CD    . GLU B  2 249 ? 46.547  -29.190 59.459  1.00 85.62  ? 233 GLU B CD    1 
ATOM   6299  O  OE1   . GLU B  2 249 ? 46.041  -29.427 60.576  1.00 89.01  ? 233 GLU B OE1   1 
ATOM   6300  O  OE2   . GLU B  2 249 ? 47.710  -29.525 59.152  1.00 85.89  ? 233 GLU B OE2   1 
ATOM   6301  N  N     . LEU B  2 250 ? 41.215  -28.688 57.588  1.00 71.21  ? 234 LEU B N     1 
ATOM   6302  C  CA    . LEU B  2 250 ? 39.820  -28.979 57.874  1.00 62.64  ? 234 LEU B CA    1 
ATOM   6303  C  C     . LEU B  2 250 ? 39.676  -30.435 58.290  1.00 63.75  ? 234 LEU B C     1 
ATOM   6304  O  O     . LEU B  2 250 ? 40.517  -31.282 57.973  1.00 80.65  ? 234 LEU B O     1 
ATOM   6305  C  CB    . LEU B  2 250 ? 38.929  -28.702 56.658  1.00 60.29  ? 234 LEU B CB    1 
ATOM   6306  C  CG    . LEU B  2 250 ? 38.942  -27.289 56.081  1.00 59.32  ? 234 LEU B CG    1 
ATOM   6307  C  CD1   . LEU B  2 250 ? 38.175  -27.258 54.771  1.00 57.33  ? 234 LEU B CD1   1 
ATOM   6308  C  CD2   . LEU B  2 250 ? 38.349  -26.308 57.074  1.00 58.42  ? 234 LEU B CD2   1 
ATOM   6309  N  N     . HIS B  2 251 ? 38.592  -30.722 59.005  1.00 62.89  ? 235 HIS B N     1 
ATOM   6310  C  CA    . HIS B  2 251 ? 38.269  -32.082 59.437  1.00 73.30  ? 235 HIS B CA    1 
ATOM   6311  C  C     . HIS B  2 251 ? 36.774  -32.294 59.262  1.00 70.68  ? 235 HIS B C     1 
ATOM   6312  O  O     . HIS B  2 251 ? 35.996  -32.205 60.220  1.00 68.94  ? 235 HIS B O     1 
ATOM   6313  C  CB    . HIS B  2 251 ? 38.710  -32.321 60.883  1.00 66.01  ? 235 HIS B CB    1 
ATOM   6314  C  CG    . HIS B  2 251 ? 40.172  -32.089 61.108  1.00 75.96  ? 235 HIS B CG    1 
ATOM   6315  N  ND1   . HIS B  2 251 ? 41.141  -32.967 60.672  1.00 76.96  ? 235 HIS B ND1   1 
ATOM   6316  C  CD2   . HIS B  2 251 ? 40.832  -31.073 61.713  1.00 72.80  ? 235 HIS B CD2   1 
ATOM   6317  C  CE1   . HIS B  2 251 ? 42.334  -32.505 61.003  1.00 74.55  ? 235 HIS B CE1   1 
ATOM   6318  N  NE2   . HIS B  2 251 ? 42.174  -31.357 61.636  1.00 80.97  ? 235 HIS B NE2   1 
ATOM   6319  N  N     . PRO B  2 252 ? 36.332  -32.574 58.033  1.00 68.99  ? 236 PRO B N     1 
ATOM   6320  C  CA    . PRO B  2 252 ? 34.889  -32.730 57.791  1.00 69.75  ? 236 PRO B CA    1 
ATOM   6321  C  C     . PRO B  2 252 ? 34.275  -33.906 58.528  1.00 79.45  ? 236 PRO B C     1 
ATOM   6322  O  O     . PRO B  2 252 ? 33.074  -33.877 58.826  1.00 79.82  ? 236 PRO B O     1 
ATOM   6323  C  CB    . PRO B  2 252 ? 34.807  -32.912 56.268  1.00 67.21  ? 236 PRO B CB    1 
ATOM   6324  C  CG    . PRO B  2 252 ? 36.101  -32.372 55.738  1.00 64.73  ? 236 PRO B CG    1 
ATOM   6325  C  CD    . PRO B  2 252 ? 37.117  -32.671 56.792  1.00 68.75  ? 236 PRO B CD    1 
ATOM   6326  N  N     . ASP B  2 253 ? 35.060  -34.942 58.833  1.00 86.81  ? 237 ASP B N     1 
ATOM   6327  C  CA    . ASP B  2 253 ? 34.538  -36.064 59.603  1.00 88.52  ? 237 ASP B CA    1 
ATOM   6328  C  C     . ASP B  2 253 ? 34.146  -35.658 61.017  1.00 84.98  ? 237 ASP B C     1 
ATOM   6329  O  O     . ASP B  2 253 ? 33.335  -36.348 61.644  1.00 86.23  ? 237 ASP B O     1 
ATOM   6330  C  CB    . ASP B  2 253 ? 35.564  -37.197 59.652  1.00 95.76  ? 237 ASP B CB    1 
ATOM   6331  C  CG    . ASP B  2 253 ? 36.832  -36.805 60.384  1.00 103.34 ? 237 ASP B CG    1 
ATOM   6332  O  OD1   . ASP B  2 253 ? 37.210  -35.616 60.328  1.00 106.38 ? 237 ASP B OD1   1 
ATOM   6333  O  OD2   . ASP B  2 253 ? 37.451  -37.687 61.017  1.00 110.34 ? 237 ASP B OD2   1 
ATOM   6334  N  N     . LYS B  2 254 ? 34.697  -34.559 61.529  1.00 89.11  ? 238 LYS B N     1 
ATOM   6335  C  CA    . LYS B  2 254 ? 34.351  -34.046 62.847  1.00 88.61  ? 238 LYS B CA    1 
ATOM   6336  C  C     . LYS B  2 254 ? 33.239  -33.005 62.805  1.00 90.38  ? 238 LYS B C     1 
ATOM   6337  O  O     . LYS B  2 254 ? 32.830  -32.516 63.863  1.00 93.17  ? 238 LYS B O     1 
ATOM   6338  C  CB    . LYS B  2 254 ? 35.589  -33.444 63.522  1.00 86.60  ? 238 LYS B CB    1 
ATOM   6339  C  CG    . LYS B  2 254 ? 36.781  -34.387 63.605  1.00 95.17  ? 238 LYS B CG    1 
ATOM   6340  C  CD    . LYS B  2 254 ? 36.477  -35.604 64.465  1.00 94.33  ? 238 LYS B CD    1 
ATOM   6341  C  CE    . LYS B  2 254 ? 37.678  -36.535 64.539  1.00 101.09 ? 238 LYS B CE    1 
ATOM   6342  N  NZ    . LYS B  2 254 ? 37.396  -37.757 65.342  1.00 106.15 ? 238 LYS B NZ    1 
ATOM   6343  N  N     . TRP B  2 255 ? 32.750  -32.649 61.619  1.00 94.29  ? 239 TRP B N     1 
ATOM   6344  C  CA    . TRP B  2 255 ? 31.672  -31.674 61.515  1.00 87.04  ? 239 TRP B CA    1 
ATOM   6345  C  C     . TRP B  2 255 ? 30.381  -32.264 62.067  1.00 94.15  ? 239 TRP B C     1 
ATOM   6346  O  O     . TRP B  2 255 ? 30.028  -33.408 61.767  1.00 98.12  ? 239 TRP B O     1 
ATOM   6347  C  CB    . TRP B  2 255 ? 31.484  -31.242 60.061  1.00 69.18  ? 239 TRP B CB    1 
ATOM   6348  C  CG    . TRP B  2 255 ? 32.615  -30.414 59.536  1.00 66.42  ? 239 TRP B CG    1 
ATOM   6349  C  CD1   . TRP B  2 255 ? 33.657  -29.904 60.253  1.00 67.03  ? 239 TRP B CD1   1 
ATOM   6350  C  CD2   . TRP B  2 255 ? 32.818  -29.997 58.180  1.00 67.24  ? 239 TRP B CD2   1 
ATOM   6351  N  NE1   . TRP B  2 255 ? 34.498  -29.197 59.428  1.00 63.08  ? 239 TRP B NE1   1 
ATOM   6352  C  CE2   . TRP B  2 255 ? 34.006  -29.239 58.150  1.00 68.55  ? 239 TRP B CE2   1 
ATOM   6353  C  CE3   . TRP B  2 255 ? 32.114  -30.195 56.988  1.00 54.16  ? 239 TRP B CE3   1 
ATOM   6354  C  CZ2   . TRP B  2 255 ? 34.503  -28.677 56.977  1.00 64.76  ? 239 TRP B CZ2   1 
ATOM   6355  C  CZ3   . TRP B  2 255 ? 32.609  -29.635 55.825  1.00 52.75  ? 239 TRP B CZ3   1 
ATOM   6356  C  CH2   . TRP B  2 255 ? 33.793  -28.885 55.828  1.00 62.63  ? 239 TRP B CH2   1 
ATOM   6357  N  N     . THR B  2 256 ? 29.676  -31.480 62.878  1.00 95.55  ? 240 THR B N     1 
ATOM   6358  C  CA    . THR B  2 256 ? 28.484  -31.930 63.577  1.00 102.25 ? 240 THR B CA    1 
ATOM   6359  C  C     . THR B  2 256 ? 27.251  -31.192 63.071  1.00 97.19  ? 240 THR B C     1 
ATOM   6360  O  O     . THR B  2 256 ? 27.343  -30.151 62.415  1.00 96.33  ? 240 THR B O     1 
ATOM   6361  C  CB    . THR B  2 256 ? 28.628  -31.724 65.090  1.00 104.91 ? 240 THR B CB    1 
ATOM   6362  O  OG1   . THR B  2 256 ? 27.398  -32.063 65.743  1.00 116.48 ? 240 THR B OG1   1 
ATOM   6363  C  CG2   . THR B  2 256 ? 28.980  -30.276 65.395  1.00 96.88  ? 240 THR B CG2   1 
ATOM   6364  N  N     . VAL B  2 257 ? 26.086  -31.752 63.389  1.00 93.51  ? 241 VAL B N     1 
ATOM   6365  C  CA    . VAL B  2 257 ? 24.804  -31.154 63.044  1.00 84.78  ? 241 VAL B CA    1 
ATOM   6366  C  C     . VAL B  2 257 ? 24.070  -30.797 64.328  1.00 72.53  ? 241 VAL B C     1 
ATOM   6367  O  O     . VAL B  2 257 ? 24.232  -31.449 65.365  1.00 72.62  ? 241 VAL B O     1 
ATOM   6368  C  CB    . VAL B  2 257 ? 23.946  -32.088 62.163  1.00 77.82  ? 241 VAL B CB    1 
ATOM   6369  C  CG1   . VAL B  2 257 ? 24.615  -32.308 60.814  1.00 70.30  ? 241 VAL B CG1   1 
ATOM   6370  C  CG2   . VAL B  2 257 ? 23.708  -33.414 62.866  1.00 76.00  ? 241 VAL B CG2   1 
ATOM   6371  N  N     . GLN B  2 258 ? 23.261  -29.741 64.253  1.00 63.08  ? 242 GLN B N     1 
ATOM   6372  C  CA    . GLN B  2 258 ? 22.488  -29.259 65.395  1.00 67.50  ? 242 GLN B CA    1 
ATOM   6373  C  C     . GLN B  2 258 ? 21.011  -29.540 65.158  1.00 71.51  ? 242 GLN B C     1 
ATOM   6374  O  O     . GLN B  2 258 ? 20.326  -28.748 64.493  1.00 65.17  ? 242 GLN B O     1 
ATOM   6375  C  CB    . GLN B  2 258 ? 22.724  -27.762 65.616  1.00 66.28  ? 242 GLN B CB    1 
ATOM   6376  C  CG    . GLN B  2 258 ? 21.933  -27.154 66.771  1.00 70.15  ? 242 GLN B CG    1 
ATOM   6377  C  CD    . GLN B  2 258 ? 22.475  -27.539 68.136  1.00 78.08  ? 242 GLN B CD    1 
ATOM   6378  O  OE1   . GLN B  2 258 ? 23.450  -28.281 68.247  1.00 75.47  ? 242 GLN B OE1   1 
ATOM   6379  N  NE2   . GLN B  2 258 ? 21.843  -27.026 69.187  1.00 80.29  ? 242 GLN B NE2   1 
ATOM   6380  N  N     . PRO B  2 259 ? 20.476  -30.645 65.664  1.00 75.48  ? 243 PRO B N     1 
ATOM   6381  C  CA    . PRO B  2 259 ? 19.057  -30.946 65.465  1.00 70.35  ? 243 PRO B CA    1 
ATOM   6382  C  C     . PRO B  2 259 ? 18.179  -30.104 66.383  1.00 67.08  ? 243 PRO B C     1 
ATOM   6383  O  O     . PRO B  2 259 ? 18.646  -29.436 67.306  1.00 62.52  ? 243 PRO B O     1 
ATOM   6384  C  CB    . PRO B  2 259 ? 18.964  -32.432 65.819  1.00 66.72  ? 243 PRO B CB    1 
ATOM   6385  C  CG    . PRO B  2 259 ? 20.041  -32.622 66.836  1.00 70.75  ? 243 PRO B CG    1 
ATOM   6386  C  CD    . PRO B  2 259 ? 21.163  -31.699 66.431  1.00 76.33  ? 243 PRO B CD    1 
ATOM   6387  N  N     . ILE B  2 260 ? 16.881  -30.150 66.106  1.00 70.49  ? 244 ILE B N     1 
ATOM   6388  C  CA    . ILE B  2 260 ? 15.898  -29.471 66.940  1.00 65.91  ? 244 ILE B CA    1 
ATOM   6389  C  C     . ILE B  2 260 ? 15.695  -30.280 68.213  1.00 65.66  ? 244 ILE B C     1 
ATOM   6390  O  O     . ILE B  2 260 ? 15.390  -31.478 68.161  1.00 61.84  ? 244 ILE B O     1 
ATOM   6391  C  CB    . ILE B  2 260 ? 14.576  -29.282 66.181  1.00 64.97  ? 244 ILE B CB    1 
ATOM   6392  C  CG1   . ILE B  2 260 ? 14.813  -28.504 64.886  1.00 63.89  ? 244 ILE B CG1   1 
ATOM   6393  C  CG2   . ILE B  2 260 ? 13.558  -28.569 67.057  1.00 68.85  ? 244 ILE B CG2   1 
ATOM   6394  C  CD1   . ILE B  2 260 ? 13.563  -28.294 64.063  1.00 67.78  ? 244 ILE B CD1   1 
ATOM   6395  N  N     . VAL B  2 261 ? 15.869  -29.631 69.361  1.00 64.33  ? 245 VAL B N     1 
ATOM   6396  C  CA    . VAL B  2 261 ? 15.773  -30.296 70.652  1.00 74.62  ? 245 VAL B CA    1 
ATOM   6397  C  C     . VAL B  2 261 ? 14.673  -29.640 71.473  1.00 76.79  ? 245 VAL B C     1 
ATOM   6398  O  O     . VAL B  2 261 ? 14.416  -28.436 71.362  1.00 75.98  ? 245 VAL B O     1 
ATOM   6399  C  CB    . VAL B  2 261 ? 17.118  -30.267 71.413  1.00 70.48  ? 245 VAL B CB    1 
ATOM   6400  C  CG1   . VAL B  2 261 ? 18.164  -31.078 70.666  1.00 62.35  ? 245 VAL B CG1   1 
ATOM   6401  C  CG2   . VAL B  2 261 ? 17.589  -28.834 71.608  1.00 82.33  ? 245 VAL B CG2   1 
ATOM   6402  N  N     . LEU B  2 262 ? 14.017  -30.449 72.300  1.00 71.07  ? 246 LEU B N     1 
ATOM   6403  C  CA    . LEU B  2 262 ? 12.958  -29.985 73.176  1.00 69.31  ? 246 LEU B CA    1 
ATOM   6404  C  C     . LEU B  2 262 ? 13.447  -29.930 74.617  1.00 77.66  ? 246 LEU B C     1 
ATOM   6405  O  O     . LEU B  2 262 ? 14.247  -30.776 75.032  1.00 77.76  ? 246 LEU B O     1 
ATOM   6406  C  CB    . LEU B  2 262 ? 11.731  -30.901 73.092  1.00 58.98  ? 246 LEU B CB    1 
ATOM   6407  C  CG    . LEU B  2 262 ? 11.101  -31.028 71.703  1.00 53.33  ? 246 LEU B CG    1 
ATOM   6408  C  CD1   . LEU B  2 262 ? 9.916   -31.979 71.728  1.00 51.72  ? 246 LEU B CD1   1 
ATOM   6409  C  CD2   . LEU B  2 262 ? 10.689  -29.662 71.173  1.00 52.91  ? 246 LEU B CD2   1 
ATOM   6410  N  N     . PRO B  2 263 ? 12.997  -28.950 75.396  1.00 80.80  ? 247 PRO B N     1 
ATOM   6411  C  CA    . PRO B  2 263 ? 13.433  -28.866 76.793  1.00 82.16  ? 247 PRO B CA    1 
ATOM   6412  C  C     . PRO B  2 263 ? 12.933  -30.043 77.613  1.00 85.36  ? 247 PRO B C     1 
ATOM   6413  O  O     . PRO B  2 263 ? 11.890  -30.637 77.328  1.00 88.12  ? 247 PRO B O     1 
ATOM   6414  C  CB    . PRO B  2 263 ? 12.815  -27.549 77.280  1.00 70.58  ? 247 PRO B CB    1 
ATOM   6415  C  CG    . PRO B  2 263 ? 11.658  -27.316 76.370  1.00 60.10  ? 247 PRO B CG    1 
ATOM   6416  C  CD    . PRO B  2 263 ? 12.078  -27.858 75.035  1.00 67.83  ? 247 PRO B CD    1 
ATOM   6417  N  N     . GLU B  2 264 ? 13.703  -30.377 78.644  1.00 90.76  ? 248 GLU B N     1 
ATOM   6418  C  CA    . GLU B  2 264 ? 13.366  -31.440 79.588  1.00 102.41 ? 248 GLU B CA    1 
ATOM   6419  C  C     . GLU B  2 264 ? 13.385  -30.836 80.988  1.00 102.63 ? 248 GLU B C     1 
ATOM   6420  O  O     . GLU B  2 264 ? 14.454  -30.656 81.580  1.00 114.60 ? 248 GLU B O     1 
ATOM   6421  C  CB    . GLU B  2 264 ? 14.335  -32.613 79.468  1.00 112.22 ? 248 GLU B CB    1 
ATOM   6422  C  CG    . GLU B  2 264 ? 14.300  -33.311 78.119  1.00 118.24 ? 248 GLU B CG    1 
ATOM   6423  C  CD    . GLU B  2 264 ? 15.087  -34.607 78.113  1.00 120.26 ? 248 GLU B CD    1 
ATOM   6424  O  OE1   . GLU B  2 264 ? 15.660  -34.959 79.164  1.00 123.50 ? 248 GLU B OE1   1 
ATOM   6425  O  OE2   . GLU B  2 264 ? 15.129  -35.274 77.058  1.00 124.04 ? 248 GLU B OE2   1 
ATOM   6426  N  N     . LYS B  2 265 ? 12.206  -30.519 81.511  1.00 94.98  ? 249 LYS B N     1 
ATOM   6427  C  CA    . LYS B  2 265 ? 12.061  -29.919 82.827  1.00 91.37  ? 249 LYS B CA    1 
ATOM   6428  C  C     . LYS B  2 265 ? 11.414  -30.907 83.788  1.00 96.07  ? 249 LYS B C     1 
ATOM   6429  O  O     . LYS B  2 265 ? 10.675  -31.806 83.378  1.00 91.84  ? 249 LYS B O     1 
ATOM   6430  C  CB    . LYS B  2 265 ? 11.220  -28.640 82.760  1.00 87.55  ? 249 LYS B CB    1 
ATOM   6431  C  CG    . LYS B  2 265 ? 11.798  -27.550 81.871  1.00 81.50  ? 249 LYS B CG    1 
ATOM   6432  C  CD    . LYS B  2 265 ? 10.954  -26.287 81.943  1.00 71.88  ? 249 LYS B CD    1 
ATOM   6433  C  CE    . LYS B  2 265 ? 11.591  -25.140 81.172  1.00 74.71  ? 249 LYS B CE    1 
ATOM   6434  N  NZ    . LYS B  2 265 ? 11.680  -25.418 79.713  1.00 78.31  ? 249 LYS B NZ    1 
ATOM   6435  N  N     . ASP B  2 266 ? 11.703  -30.731 85.079  1.00 104.44 ? 250 ASP B N     1 
ATOM   6436  C  CA    . ASP B  2 266 ? 11.044  -31.534 86.101  1.00 112.76 ? 250 ASP B CA    1 
ATOM   6437  C  C     . ASP B  2 266 ? 9.607   -31.083 86.329  1.00 98.40  ? 250 ASP B C     1 
ATOM   6438  O  O     . ASP B  2 266 ? 8.737   -31.914 86.610  1.00 95.90  ? 250 ASP B O     1 
ATOM   6439  C  CB    . ASP B  2 266 ? 11.834  -31.474 87.410  1.00 129.97 ? 250 ASP B CB    1 
ATOM   6440  C  CG    . ASP B  2 266 ? 12.058  -30.055 87.894  1.00 141.32 ? 250 ASP B CG    1 
ATOM   6441  O  OD1   . ASP B  2 266 ? 12.196  -29.150 87.044  1.00 143.26 ? 250 ASP B OD1   1 
ATOM   6442  O  OD2   . ASP B  2 266 ? 12.095  -29.845 89.125  1.00 145.92 ? 250 ASP B OD2   1 
ATOM   6443  N  N     . SER B  2 267 ? 9.344   -29.783 86.211  1.00 93.11  ? 251 SER B N     1 
ATOM   6444  C  CA    . SER B  2 267 ? 7.998   -29.238 86.274  1.00 89.16  ? 251 SER B CA    1 
ATOM   6445  C  C     . SER B  2 267 ? 7.780   -28.315 85.085  1.00 82.78  ? 251 SER B C     1 
ATOM   6446  O  O     . SER B  2 267 ? 8.717   -27.686 84.587  1.00 86.31  ? 251 SER B O     1 
ATOM   6447  C  CB    . SER B  2 267 ? 7.753   -28.475 87.584  1.00 90.24  ? 251 SER B CB    1 
ATOM   6448  O  OG    . SER B  2 267 ? 8.633   -27.372 87.705  1.00 96.50  ? 251 SER B OG    1 
ATOM   6449  N  N     . TRP B  2 268 ? 6.532   -28.243 84.630  1.00 75.21  ? 252 TRP B N     1 
ATOM   6450  C  CA    . TRP B  2 268 ? 6.158   -27.430 83.481  1.00 60.89  ? 252 TRP B CA    1 
ATOM   6451  C  C     . TRP B  2 268 ? 5.121   -26.401 83.902  1.00 59.47  ? 252 TRP B C     1 
ATOM   6452  O  O     . TRP B  2 268 ? 4.148   -26.738 84.587  1.00 66.99  ? 252 TRP B O     1 
ATOM   6453  C  CB    . TRP B  2 268 ? 5.608   -28.298 82.346  1.00 56.20  ? 252 TRP B CB    1 
ATOM   6454  C  CG    . TRP B  2 268 ? 6.613   -29.240 81.763  1.00 63.94  ? 252 TRP B CG    1 
ATOM   6455  C  CD1   . TRP B  2 268 ? 6.992   -30.449 82.267  1.00 72.44  ? 252 TRP B CD1   1 
ATOM   6456  C  CD2   . TRP B  2 268 ? 7.363   -29.056 80.556  1.00 70.11  ? 252 TRP B CD2   1 
ATOM   6457  N  NE1   . TRP B  2 268 ? 7.935   -31.027 81.452  1.00 74.51  ? 252 TRP B NE1   1 
ATOM   6458  C  CE2   . TRP B  2 268 ? 8.180   -30.192 80.394  1.00 69.72  ? 252 TRP B CE2   1 
ATOM   6459  C  CE3   . TRP B  2 268 ? 7.425   -28.039 79.598  1.00 66.54  ? 252 TRP B CE3   1 
ATOM   6460  C  CZ2   . TRP B  2 268 ? 9.048   -30.340 79.315  1.00 72.11  ? 252 TRP B CZ2   1 
ATOM   6461  C  CZ3   . TRP B  2 268 ? 8.287   -28.188 78.527  1.00 58.34  ? 252 TRP B CZ3   1 
ATOM   6462  C  CH2   . TRP B  2 268 ? 9.087   -29.329 78.394  1.00 67.62  ? 252 TRP B CH2   1 
ATOM   6463  N  N     . THR B  2 269 ? 5.330   -25.154 83.497  1.00 52.70  ? 253 THR B N     1 
ATOM   6464  C  CA    . THR B  2 269 ? 4.364   -24.091 83.720  1.00 49.83  ? 253 THR B CA    1 
ATOM   6465  C  C     . THR B  2 269 ? 3.535   -23.868 82.460  1.00 52.69  ? 253 THR B C     1 
ATOM   6466  O  O     . THR B  2 269 ? 3.811   -24.423 81.394  1.00 54.79  ? 253 THR B O     1 
ATOM   6467  C  CB    . THR B  2 269 ? 5.065   -22.792 84.133  1.00 47.12  ? 253 THR B CB    1 
ATOM   6468  O  OG1   . THR B  2 269 ? 5.876   -22.317 83.051  1.00 53.27  ? 253 THR B OG1   1 
ATOM   6469  C  CG2   . THR B  2 269 ? 5.940   -23.020 85.356  1.00 48.38  ? 253 THR B CG2   1 
ATOM   6470  N  N     . VAL B  2 270 ? 2.492   -23.045 82.601  1.00 49.28  ? 254 VAL B N     1 
ATOM   6471  C  CA    . VAL B  2 270 ? 1.686   -22.663 81.444  1.00 46.10  ? 254 VAL B CA    1 
ATOM   6472  C  C     . VAL B  2 270 ? 2.560   -21.998 80.390  1.00 44.45  ? 254 VAL B C     1 
ATOM   6473  O  O     . VAL B  2 270 ? 2.439   -22.279 79.191  1.00 47.96  ? 254 VAL B O     1 
ATOM   6474  C  CB    . VAL B  2 270 ? 0.526   -21.748 81.880  1.00 47.98  ? 254 VAL B CB    1 
ATOM   6475  C  CG1   . VAL B  2 270 ? -0.225  -21.221 80.666  1.00 48.69  ? 254 VAL B CG1   1 
ATOM   6476  C  CG2   . VAL B  2 270 ? -0.416  -22.493 82.811  1.00 46.57  ? 254 VAL B CG2   1 
ATOM   6477  N  N     . ASN B  2 271 ? 3.467   -21.119 80.823  1.00 49.23  ? 255 ASN B N     1 
ATOM   6478  C  CA    . ASN B  2 271 ? 4.365   -20.449 79.889  1.00 42.71  ? 255 ASN B CA    1 
ATOM   6479  C  C     . ASN B  2 271 ? 5.289   -21.443 79.196  1.00 49.95  ? 255 ASN B C     1 
ATOM   6480  O  O     . ASN B  2 271 ? 5.543   -21.329 77.991  1.00 48.59  ? 255 ASN B O     1 
ATOM   6481  C  CB    . ASN B  2 271 ? 5.171   -19.378 80.623  1.00 41.94  ? 255 ASN B CB    1 
ATOM   6482  C  CG    . ASN B  2 271 ? 6.243   -18.753 79.753  1.00 44.74  ? 255 ASN B CG    1 
ATOM   6483  O  OD1   . ASN B  2 271 ? 5.947   -17.992 78.832  1.00 43.35  ? 255 ASN B OD1   1 
ATOM   6484  N  ND2   . ASN B  2 271 ? 7.500   -19.063 80.050  1.00 43.25  ? 255 ASN B ND2   1 
ATOM   6485  N  N     . ASP B  2 272 ? 5.802   -22.427 79.942  1.00 47.09  ? 256 ASP B N     1 
ATOM   6486  C  CA    . ASP B  2 272 ? 6.663   -23.444 79.344  1.00 45.04  ? 256 ASP B CA    1 
ATOM   6487  C  C     . ASP B  2 272 ? 5.932   -24.207 78.246  1.00 45.27  ? 256 ASP B C     1 
ATOM   6488  O  O     . ASP B  2 272 ? 6.476   -24.432 77.159  1.00 50.69  ? 256 ASP B O     1 
ATOM   6489  C  CB    . ASP B  2 272 ? 7.164   -24.412 80.418  1.00 50.37  ? 256 ASP B CB    1 
ATOM   6490  C  CG    . ASP B  2 272 ? 8.128   -23.762 81.390  1.00 62.47  ? 256 ASP B CG    1 
ATOM   6491  O  OD1   . ASP B  2 272 ? 8.834   -22.814 80.987  1.00 63.79  ? 256 ASP B OD1   1 
ATOM   6492  O  OD2   . ASP B  2 272 ? 8.183   -24.205 82.557  1.00 59.10  ? 256 ASP B OD2   1 
ATOM   6493  N  N     . ILE B  2 273 ? 4.689   -24.611 78.515  1.00 49.73  ? 257 ILE B N     1 
ATOM   6494  C  CA    . ILE B  2 273 ? 3.947   -25.417 77.552  1.00 52.56  ? 257 ILE B CA    1 
ATOM   6495  C  C     . ILE B  2 273 ? 3.510   -24.567 76.364  1.00 51.82  ? 257 ILE B C     1 
ATOM   6496  O  O     . ILE B  2 273 ? 3.497   -25.038 75.220  1.00 47.70  ? 257 ILE B O     1 
ATOM   6497  C  CB    . ILE B  2 273 ? 2.756   -26.102 78.246  1.00 54.23  ? 257 ILE B CB    1 
ATOM   6498  C  CG1   . ILE B  2 273 ? 3.262   -27.028 79.355  1.00 49.45  ? 257 ILE B CG1   1 
ATOM   6499  C  CG2   . ILE B  2 273 ? 1.919   -26.880 77.244  1.00 48.77  ? 257 ILE B CG2   1 
ATOM   6500  C  CD1   . ILE B  2 273 ? 2.165   -27.700 80.148  1.00 54.21  ? 257 ILE B CD1   1 
ATOM   6501  N  N     . GLN B  2 274 ? 3.157   -23.302 76.609  1.00 44.12  ? 258 GLN B N     1 
ATOM   6502  C  CA    . GLN B  2 274 ? 2.816   -22.407 75.508  1.00 44.66  ? 258 GLN B CA    1 
ATOM   6503  C  C     . GLN B  2 274 ? 3.995   -22.227 74.559  1.00 47.47  ? 258 GLN B C     1 
ATOM   6504  O  O     . GLN B  2 274 ? 3.817   -22.173 73.337  1.00 42.13  ? 258 GLN B O     1 
ATOM   6505  C  CB    . GLN B  2 274 ? 2.353   -21.055 76.050  1.00 42.12  ? 258 GLN B CB    1 
ATOM   6506  C  CG    . GLN B  2 274 ? 0.957   -21.068 76.651  1.00 49.84  ? 258 GLN B CG    1 
ATOM   6507  C  CD    . GLN B  2 274 ? 0.561   -19.727 77.230  1.00 52.59  ? 258 GLN B CD    1 
ATOM   6508  O  OE1   . GLN B  2 274 ? 1.361   -18.792 77.262  1.00 51.55  ? 258 GLN B OE1   1 
ATOM   6509  N  NE2   . GLN B  2 274 ? -0.680  -19.624 77.693  1.00 64.73  ? 258 GLN B NE2   1 
ATOM   6510  N  N     . LYS B  2 275 ? 5.210   -22.135 75.105  1.00 46.46  ? 259 LYS B N     1 
ATOM   6511  C  CA    . LYS B  2 275 ? 6.396   -22.057 74.257  1.00 46.86  ? 259 LYS B CA    1 
ATOM   6512  C  C     . LYS B  2 275 ? 6.656   -23.382 73.553  1.00 46.52  ? 259 LYS B C     1 
ATOM   6513  O  O     . LYS B  2 275 ? 7.102   -23.402 72.400  1.00 46.72  ? 259 LYS B O     1 
ATOM   6514  C  CB    . LYS B  2 275 ? 7.609   -21.642 75.089  1.00 41.56  ? 259 LYS B CB    1 
ATOM   6515  C  CG    . LYS B  2 275 ? 7.646   -20.162 75.433  1.00 40.54  ? 259 LYS B CG    1 
ATOM   6516  C  CD    . LYS B  2 275 ? 8.549   -19.889 76.625  1.00 60.02  ? 259 LYS B CD    1 
ATOM   6517  C  CE    . LYS B  2 275 ? 9.951   -20.428 76.404  1.00 79.24  ? 259 LYS B CE    1 
ATOM   6518  N  NZ    . LYS B  2 275 ? 10.795  -20.257 77.620  1.00 88.17  ? 259 LYS B NZ    1 
ATOM   6519  N  N     . LEU B  2 276 ? 6.378   -24.498 74.230  1.00 46.91  ? 260 LEU B N     1 
ATOM   6520  C  CA    . LEU B  2 276 ? 6.609   -25.810 73.635  1.00 45.09  ? 260 LEU B CA    1 
ATOM   6521  C  C     . LEU B  2 276 ? 5.666   -26.057 72.463  1.00 54.06  ? 260 LEU B C     1 
ATOM   6522  O  O     . LEU B  2 276 ? 6.089   -26.532 71.402  1.00 55.31  ? 260 LEU B O     1 
ATOM   6523  C  CB    . LEU B  2 276 ? 6.451   -26.897 74.698  1.00 46.71  ? 260 LEU B CB    1 
ATOM   6524  C  CG    . LEU B  2 276 ? 6.606   -28.349 74.244  1.00 48.28  ? 260 LEU B CG    1 
ATOM   6525  C  CD1   . LEU B  2 276 ? 7.993   -28.589 73.673  1.00 56.52  ? 260 LEU B CD1   1 
ATOM   6526  C  CD2   . LEU B  2 276 ? 6.328   -29.296 75.400  1.00 53.15  ? 260 LEU B CD2   1 
ATOM   6527  N  N     . VAL B  2 277 ? 4.381   -25.740 72.636  1.00 51.44  ? 261 VAL B N     1 
ATOM   6528  C  CA    . VAL B  2 277 ? 3.416   -25.944 71.559  1.00 50.16  ? 261 VAL B CA    1 
ATOM   6529  C  C     . VAL B  2 277 ? 3.720   -25.019 70.388  1.00 44.48  ? 261 VAL B C     1 
ATOM   6530  O  O     . VAL B  2 277 ? 3.569   -25.402 69.221  1.00 46.57  ? 261 VAL B O     1 
ATOM   6531  C  CB    . VAL B  2 277 ? 1.980   -25.752 72.082  1.00 51.57  ? 261 VAL B CB    1 
ATOM   6532  C  CG1   . VAL B  2 277 ? 0.974   -25.935 70.958  1.00 53.69  ? 261 VAL B CG1   1 
ATOM   6533  C  CG2   . VAL B  2 277 ? 1.691   -26.729 73.210  1.00 58.95  ? 261 VAL B CG2   1 
ATOM   6534  N  N     . GLY B  2 278 ? 4.158   -23.792 70.673  1.00 43.14  ? 262 GLY B N     1 
ATOM   6535  C  CA    . GLY B  2 278 ? 4.550   -22.894 69.599  1.00 55.34  ? 262 GLY B CA    1 
ATOM   6536  C  C     . GLY B  2 278 ? 5.759   -23.398 68.836  1.00 51.57  ? 262 GLY B C     1 
ATOM   6537  O  O     . GLY B  2 278 ? 5.835   -23.264 67.612  1.00 49.64  ? 262 GLY B O     1 
ATOM   6538  N  N     . LYS B  2 279 ? 6.719   -23.993 69.548  1.00 42.39  ? 263 LYS B N     1 
ATOM   6539  C  CA    . LYS B  2 279 ? 7.897   -24.550 68.892  1.00 46.48  ? 263 LYS B CA    1 
ATOM   6540  C  C     . LYS B  2 279 ? 7.543   -25.796 68.089  1.00 55.08  ? 263 LYS B C     1 
ATOM   6541  O  O     . LYS B  2 279 ? 8.015   -25.969 66.959  1.00 57.47  ? 263 LYS B O     1 
ATOM   6542  C  CB    . LYS B  2 279 ? 8.970   -24.864 69.935  1.00 47.27  ? 263 LYS B CB    1 
ATOM   6543  C  CG    . LYS B  2 279 ? 10.264  -25.422 69.371  1.00 43.14  ? 263 LYS B CG    1 
ATOM   6544  C  CD    . LYS B  2 279 ? 11.323  -25.520 70.458  1.00 53.91  ? 263 LYS B CD    1 
ATOM   6545  C  CE    . LYS B  2 279 ? 12.633  -26.071 69.921  1.00 66.83  ? 263 LYS B CE    1 
ATOM   6546  N  NZ    . LYS B  2 279 ? 13.688  -26.090 70.973  1.00 78.90  ? 263 LYS B NZ    1 
ATOM   6547  N  N     . LEU B  2 280 ? 6.711   -26.673 68.656  1.00 55.75  ? 264 LEU B N     1 
ATOM   6548  C  CA    . LEU B  2 280 ? 6.309   -27.883 67.945  1.00 46.26  ? 264 LEU B CA    1 
ATOM   6549  C  C     . LEU B  2 280 ? 5.447   -27.554 66.733  1.00 49.65  ? 264 LEU B C     1 
ATOM   6550  O  O     . LEU B  2 280 ? 5.537   -28.227 65.700  1.00 56.20  ? 264 LEU B O     1 
ATOM   6551  C  CB    . LEU B  2 280 ? 5.564   -28.824 68.890  1.00 51.88  ? 264 LEU B CB    1 
ATOM   6552  C  CG    . LEU B  2 280 ? 6.389   -29.528 69.966  1.00 58.73  ? 264 LEU B CG    1 
ATOM   6553  C  CD1   . LEU B  2 280 ? 5.473   -30.194 70.974  1.00 60.48  ? 264 LEU B CD1   1 
ATOM   6554  C  CD2   . LEU B  2 280 ? 7.322   -30.548 69.335  1.00 60.50  ? 264 LEU B CD2   1 
ATOM   6555  N  N     . ASN B  2 281 ? 4.599   -26.527 66.843  1.00 51.42  ? 265 ASN B N     1 
ATOM   6556  C  CA    . ASN B  2 281 ? 3.752   -26.151 65.715  1.00 52.38  ? 265 ASN B CA    1 
ATOM   6557  C  C     . ASN B  2 281 ? 4.585   -25.648 64.544  1.00 54.89  ? 265 ASN B C     1 
ATOM   6558  O  O     . ASN B  2 281 ? 4.301   -25.978 63.387  1.00 58.30  ? 265 ASN B O     1 
ATOM   6559  C  CB    . ASN B  2 281 ? 2.736   -25.095 66.147  1.00 53.14  ? 265 ASN B CB    1 
ATOM   6560  C  CG    . ASN B  2 281 ? 1.876   -24.612 64.998  1.00 55.39  ? 265 ASN B CG    1 
ATOM   6561  O  OD1   . ASN B  2 281 ? 1.010   -25.337 64.511  1.00 70.31  ? 265 ASN B OD1   1 
ATOM   6562  N  ND2   . ASN B  2 281 ? 2.110   -23.380 64.559  1.00 45.86  ? 265 ASN B ND2   1 
ATOM   6563  N  N     . TRP B  2 282 ? 5.615   -24.846 64.822  1.00 49.16  ? 266 TRP B N     1 
ATOM   6564  C  CA    . TRP B  2 282 ? 6.515   -24.419 63.757  1.00 54.41  ? 266 TRP B CA    1 
ATOM   6565  C  C     . TRP B  2 282 ? 7.306   -25.599 63.209  1.00 57.83  ? 266 TRP B C     1 
ATOM   6566  O  O     . TRP B  2 282 ? 7.562   -25.676 62.002  1.00 56.77  ? 266 TRP B O     1 
ATOM   6567  C  CB    . TRP B  2 282 ? 7.458   -23.330 64.269  1.00 65.08  ? 266 TRP B CB    1 
ATOM   6568  C  CG    . TRP B  2 282 ? 8.139   -22.565 63.174  1.00 87.89  ? 266 TRP B CG    1 
ATOM   6569  C  CD1   . TRP B  2 282 ? 7.714   -21.401 62.604  1.00 99.67  ? 266 TRP B CD1   1 
ATOM   6570  C  CD2   . TRP B  2 282 ? 9.363   -22.911 62.514  1.00 87.73  ? 266 TRP B CD2   1 
ATOM   6571  N  NE1   . TRP B  2 282 ? 8.597   -20.999 61.632  1.00 102.17 ? 266 TRP B NE1   1 
ATOM   6572  C  CE2   . TRP B  2 282 ? 9.618   -21.909 61.557  1.00 95.16  ? 266 TRP B CE2   1 
ATOM   6573  C  CE3   . TRP B  2 282 ? 10.269  -23.969 62.640  1.00 88.75  ? 266 TRP B CE3   1 
ATOM   6574  C  CZ2   . TRP B  2 282 ? 10.740  -21.933 60.730  1.00 99.64  ? 266 TRP B CZ2   1 
ATOM   6575  C  CZ3   . TRP B  2 282 ? 11.382  -23.991 61.819  1.00 98.60  ? 266 TRP B CZ3   1 
ATOM   6576  C  CH2   . TRP B  2 282 ? 11.608  -22.980 60.876  1.00 103.59 ? 266 TRP B CH2   1 
ATOM   6577  N  N     . ALA B  2 283 ? 7.692   -26.532 64.082  1.00 47.56  ? 267 ALA B N     1 
ATOM   6578  C  CA    . ALA B  2 283 ? 8.404   -27.726 63.643  1.00 47.70  ? 267 ALA B CA    1 
ATOM   6579  C  C     . ALA B  2 283 ? 7.539   -28.632 62.777  1.00 60.60  ? 267 ALA B C     1 
ATOM   6580  O  O     . ALA B  2 283 ? 8.083   -29.445 62.021  1.00 68.45  ? 267 ALA B O     1 
ATOM   6581  C  CB    . ALA B  2 283 ? 8.922   -28.503 64.854  1.00 45.81  ? 267 ALA B CB    1 
ATOM   6582  N  N     . SER B  2 284 ? 6.211   -28.515 62.868  1.00 58.57  ? 268 SER B N     1 
ATOM   6583  C  CA    . SER B  2 284 ? 5.333   -29.321 62.028  1.00 61.79  ? 268 SER B CA    1 
ATOM   6584  C  C     . SER B  2 284 ? 5.497   -28.995 60.550  1.00 63.30  ? 268 SER B C     1 
ATOM   6585  O  O     . SER B  2 284 ? 5.138   -29.819 59.701  1.00 69.73  ? 268 SER B O     1 
ATOM   6586  C  CB    . SER B  2 284 ? 3.874   -29.127 62.446  1.00 66.07  ? 268 SER B CB    1 
ATOM   6587  O  OG    . SER B  2 284 ? 3.456   -27.789 62.239  1.00 76.25  ? 268 SER B OG    1 
ATOM   6588  N  N     . GLN B  2 285 ? 6.027   -27.814 60.223  1.00 47.77  ? 269 GLN B N     1 
ATOM   6589  C  CA    . GLN B  2 285 ? 6.314   -27.479 58.834  1.00 57.55  ? 269 GLN B CA    1 
ATOM   6590  C  C     . GLN B  2 285 ? 7.462   -28.306 58.270  1.00 62.93  ? 269 GLN B C     1 
ATOM   6591  O  O     . GLN B  2 285 ? 7.625   -28.368 57.046  1.00 55.96  ? 269 GLN B O     1 
ATOM   6592  C  CB    . GLN B  2 285 ? 6.637   -25.990 58.711  1.00 52.44  ? 269 GLN B CB    1 
ATOM   6593  C  CG    . GLN B  2 285 ? 5.577   -25.077 59.303  1.00 47.06  ? 269 GLN B CG    1 
ATOM   6594  C  CD    . GLN B  2 285 ? 5.953   -23.612 59.208  1.00 54.27  ? 269 GLN B CD    1 
ATOM   6595  O  OE1   . GLN B  2 285 ? 6.687   -23.091 60.048  1.00 53.41  ? 269 GLN B OE1   1 
ATOM   6596  N  NE2   . GLN B  2 285 ? 5.451   -22.938 58.179  1.00 52.69  ? 269 GLN B NE2   1 
ATOM   6597  N  N     . ILE B  2 286 ? 8.255   -28.935 59.131  1.00 58.39  ? 270 ILE B N     1 
ATOM   6598  C  CA    . ILE B  2 286 ? 9.373   -29.774 58.723  1.00 58.12  ? 270 ILE B CA    1 
ATOM   6599  C  C     . ILE B  2 286 ? 9.058   -31.251 58.934  1.00 60.62  ? 270 ILE B C     1 
ATOM   6600  O  O     . ILE B  2 286 ? 9.258   -32.072 58.039  1.00 69.89  ? 270 ILE B O     1 
ATOM   6601  C  CB    . ILE B  2 286 ? 10.663  -29.370 59.472  1.00 61.67  ? 270 ILE B CB    1 
ATOM   6602  C  CG1   . ILE B  2 286 ? 10.961  -27.885 59.250  1.00 52.02  ? 270 ILE B CG1   1 
ATOM   6603  C  CG2   . ILE B  2 286 ? 11.833  -30.231 59.026  1.00 66.53  ? 270 ILE B CG2   1 
ATOM   6604  C  CD1   . ILE B  2 286 ? 12.028  -27.330 60.168  1.00 51.26  ? 270 ILE B CD1   1 
ATOM   6605  N  N     . TYR B  2 287 ? 8.561   -31.602 60.117  1.00 62.12  ? 271 TYR B N     1 
ATOM   6606  C  CA    . TYR B  2 287 ? 8.160   -32.969 60.428  1.00 66.36  ? 271 TYR B CA    1 
ATOM   6607  C  C     . TYR B  2 287 ? 6.641   -33.030 60.497  1.00 78.56  ? 271 TYR B C     1 
ATOM   6608  O  O     . TYR B  2 287 ? 6.051   -32.509 61.457  1.00 74.85  ? 271 TYR B O     1 
ATOM   6609  C  CB    . TYR B  2 287 ? 8.776   -33.428 61.752  1.00 65.33  ? 271 TYR B CB    1 
ATOM   6610  C  CG    . TYR B  2 287 ? 10.282  -33.288 61.823  1.00 62.65  ? 271 TYR B CG    1 
ATOM   6611  C  CD1   . TYR B  2 287 ? 10.872  -32.073 62.150  1.00 60.60  ? 271 TYR B CD1   1 
ATOM   6612  C  CD2   . TYR B  2 287 ? 11.113  -34.373 61.576  1.00 71.34  ? 271 TYR B CD2   1 
ATOM   6613  C  CE1   . TYR B  2 287 ? 12.245  -31.940 62.219  1.00 63.36  ? 271 TYR B CE1   1 
ATOM   6614  C  CE2   . TYR B  2 287 ? 12.489  -34.250 61.645  1.00 70.96  ? 271 TYR B CE2   1 
ATOM   6615  C  CZ    . TYR B  2 287 ? 13.049  -33.031 61.967  1.00 73.36  ? 271 TYR B CZ    1 
ATOM   6616  O  OH    . TYR B  2 287 ? 14.417  -32.901 62.036  1.00 81.48  ? 271 TYR B OH    1 
ATOM   6617  N  N     . PRO B  2 288 ? 5.965   -33.640 59.519  1.00 89.21  ? 272 PRO B N     1 
ATOM   6618  C  CA    . PRO B  2 288 ? 4.493   -33.593 59.508  1.00 97.07  ? 272 PRO B CA    1 
ATOM   6619  C  C     . PRO B  2 288 ? 3.834   -34.451 60.575  1.00 90.08  ? 272 PRO B C     1 
ATOM   6620  O  O     . PRO B  2 288 ? 2.642   -34.258 60.844  1.00 90.59  ? 272 PRO B O     1 
ATOM   6621  C  CB    . PRO B  2 288 ? 4.139   -34.090 58.100  1.00 105.14 ? 272 PRO B CB    1 
ATOM   6622  C  CG    . PRO B  2 288 ? 5.294   -34.954 57.712  1.00 106.63 ? 272 PRO B CG    1 
ATOM   6623  C  CD    . PRO B  2 288 ? 6.510   -34.322 58.333  1.00 95.98  ? 272 PRO B CD    1 
ATOM   6624  N  N     . GLY B  2 289 ? 4.557   -35.384 61.190  1.00 86.42  ? 273 GLY B N     1 
ATOM   6625  C  CA    . GLY B  2 289 ? 3.968   -36.248 62.192  1.00 86.93  ? 273 GLY B CA    1 
ATOM   6626  C  C     . GLY B  2 289 ? 3.904   -35.688 63.592  1.00 88.28  ? 273 GLY B C     1 
ATOM   6627  O  O     . GLY B  2 289 ? 3.406   -36.365 64.496  1.00 85.34  ? 273 GLY B O     1 
ATOM   6628  N  N     . ILE B  2 290 ? 4.391   -34.466 63.804  1.00 81.60  ? 274 ILE B N     1 
ATOM   6629  C  CA    . ILE B  2 290 ? 4.389   -33.874 65.136  1.00 75.55  ? 274 ILE B CA    1 
ATOM   6630  C  C     . ILE B  2 290 ? 2.971   -33.458 65.506  1.00 73.18  ? 274 ILE B C     1 
ATOM   6631  O  O     . ILE B  2 290 ? 2.281   -32.782 64.731  1.00 73.03  ? 274 ILE B O     1 
ATOM   6632  C  CB    . ILE B  2 290 ? 5.356   -32.682 65.196  1.00 68.41  ? 274 ILE B CB    1 
ATOM   6633  C  CG1   . ILE B  2 290 ? 6.796   -33.155 64.976  1.00 61.63  ? 274 ILE B CG1   1 
ATOM   6634  C  CG2   . ILE B  2 290 ? 5.223   -31.949 66.522  1.00 81.11  ? 274 ILE B CG2   1 
ATOM   6635  C  CD1   . ILE B  2 290 ? 7.825   -32.046 65.041  1.00 68.83  ? 274 ILE B CD1   1 
ATOM   6636  N  N     . LYS B  2 291 ? 2.530   -33.864 66.695  1.00 70.36  ? 275 LYS B N     1 
ATOM   6637  C  CA    . LYS B  2 291 ? 1.197   -33.556 67.191  1.00 73.59  ? 275 LYS B CA    1 
ATOM   6638  C  C     . LYS B  2 291 ? 1.296   -32.714 68.456  1.00 73.24  ? 275 LYS B C     1 
ATOM   6639  O  O     . LYS B  2 291 ? 2.282   -32.788 69.195  1.00 75.12  ? 275 LYS B O     1 
ATOM   6640  C  CB    . LYS B  2 291 ? 0.401   -34.836 67.477  1.00 76.57  ? 275 LYS B CB    1 
ATOM   6641  C  CG    . LYS B  2 291 ? 0.298   -35.776 66.287  1.00 91.58  ? 275 LYS B CG    1 
ATOM   6642  C  CD    . LYS B  2 291 ? -0.301  -35.071 65.081  1.00 104.03 ? 275 LYS B CD    1 
ATOM   6643  C  CE    . LYS B  2 291 ? -0.293  -35.969 63.855  1.00 113.52 ? 275 LYS B CE    1 
ATOM   6644  N  NZ    . LYS B  2 291 ? -0.799  -35.262 62.645  1.00 120.42 ? 275 LYS B NZ    1 
ATOM   6645  N  N     . VAL B  2 292 ? 0.264   -31.906 68.696  1.00 74.75  ? 276 VAL B N     1 
ATOM   6646  C  CA    . VAL B  2 292 ? 0.225   -31.023 69.858  1.00 75.40  ? 276 VAL B CA    1 
ATOM   6647  C  C     . VAL B  2 292 ? -1.141  -31.112 70.525  1.00 74.80  ? 276 VAL B C     1 
ATOM   6648  O  O     . VAL B  2 292 ? -1.526  -30.223 71.293  1.00 64.75  ? 276 VAL B O     1 
ATOM   6649  C  CB    . VAL B  2 292 ? 0.546   -29.568 69.469  1.00 73.11  ? 276 VAL B CB    1 
ATOM   6650  C  CG1   . VAL B  2 292 ? 1.986   -29.441 69.001  1.00 74.86  ? 276 VAL B CG1   1 
ATOM   6651  C  CG2   . VAL B  2 292 ? -0.414  -29.083 68.392  1.00 66.22  ? 276 VAL B CG2   1 
ATOM   6652  N  N     . ARG B  2 293 ? -1.881  -32.185 70.240  1.00 83.64  ? 277 ARG B N     1 
ATOM   6653  C  CA    . ARG B  2 293 ? -3.233  -32.325 70.776  1.00 85.86  ? 277 ARG B CA    1 
ATOM   6654  C  C     . ARG B  2 293 ? -3.213  -32.475 72.292  1.00 74.71  ? 277 ARG B C     1 
ATOM   6655  O  O     . ARG B  2 293 ? -3.846  -31.698 73.015  1.00 65.13  ? 277 ARG B O     1 
ATOM   6656  C  CB    . ARG B  2 293 ? -3.933  -33.519 70.126  1.00 105.02 ? 277 ARG B CB    1 
ATOM   6657  C  CG    . ARG B  2 293 ? -3.993  -33.459 68.610  1.00 125.46 ? 277 ARG B CG    1 
ATOM   6658  C  CD    . ARG B  2 293 ? -4.622  -34.717 68.036  1.00 140.23 ? 277 ARG B CD    1 
ATOM   6659  N  NE    . ARG B  2 293 ? -4.602  -34.721 66.576  1.00 145.42 ? 277 ARG B NE    1 
ATOM   6660  C  CZ    . ARG B  2 293 ? -5.096  -35.700 65.825  1.00 150.71 ? 277 ARG B CZ    1 
ATOM   6661  N  NH1   . ARG B  2 293 ? -5.652  -36.761 66.395  1.00 152.10 ? 277 ARG B NH1   1 
ATOM   6662  N  NH2   . ARG B  2 293 ? -5.034  -35.620 64.503  1.00 151.54 ? 277 ARG B NH2   1 
ATOM   6663  N  N     . GLN B  2 294 ? -2.484  -33.476 72.794  1.00 78.38  ? 278 GLN B N     1 
ATOM   6664  C  CA    . GLN B  2 294 ? -2.477  -33.738 74.230  1.00 77.88  ? 278 GLN B CA    1 
ATOM   6665  C  C     . GLN B  2 294 ? -1.790  -32.623 75.008  1.00 74.17  ? 278 GLN B C     1 
ATOM   6666  O  O     . GLN B  2 294 ? -2.097  -32.415 76.187  1.00 79.02  ? 278 GLN B O     1 
ATOM   6667  C  CB    . GLN B  2 294 ? -1.801  -35.079 74.516  1.00 80.73  ? 278 GLN B CB    1 
ATOM   6668  C  CG    . GLN B  2 294 ? -2.474  -36.267 73.849  1.00 89.14  ? 278 GLN B CG    1 
ATOM   6669  C  CD    . GLN B  2 294 ? -3.900  -36.476 74.323  1.00 94.20  ? 278 GLN B CD    1 
ATOM   6670  O  OE1   . GLN B  2 294 ? -4.253  -36.125 75.449  1.00 96.71  ? 278 GLN B OE1   1 
ATOM   6671  N  NE2   . GLN B  2 294 ? -4.730  -37.051 73.461  1.00 100.62 ? 278 GLN B NE2   1 
ATOM   6672  N  N     . LEU B  2 295 ? -0.866  -31.900 74.375  1.00 72.99  ? 279 LEU B N     1 
ATOM   6673  C  CA    . LEU B  2 295 ? -0.182  -30.815 75.067  1.00 67.20  ? 279 LEU B CA    1 
ATOM   6674  C  C     . LEU B  2 295 ? -1.037  -29.555 75.118  1.00 74.67  ? 279 LEU B C     1 
ATOM   6675  O  O     . LEU B  2 295 ? -0.991  -28.812 76.104  1.00 86.27  ? 279 LEU B O     1 
ATOM   6676  C  CB    . LEU B  2 295 ? 1.163   -30.533 74.396  1.00 65.92  ? 279 LEU B CB    1 
ATOM   6677  C  CG    . LEU B  2 295 ? 2.195   -31.649 74.562  1.00 74.27  ? 279 LEU B CG    1 
ATOM   6678  C  CD1   . LEU B  2 295 ? 3.461   -31.340 73.785  1.00 71.53  ? 279 LEU B CD1   1 
ATOM   6679  C  CD2   . LEU B  2 295 ? 2.506   -31.867 76.036  1.00 70.50  ? 279 LEU B CD2   1 
ATOM   6680  N  N     . SER B  2 296 ? -1.824  -29.299 74.070  1.00 68.22  ? 280 SER B N     1 
ATOM   6681  C  CA    . SER B  2 296 ? -2.718  -28.147 74.090  1.00 66.13  ? 280 SER B CA    1 
ATOM   6682  C  C     . SER B  2 296 ? -3.868  -28.346 75.070  1.00 73.23  ? 280 SER B C     1 
ATOM   6683  O  O     . SER B  2 296 ? -4.394  -27.367 75.611  1.00 68.30  ? 280 SER B O     1 
ATOM   6684  C  CB    . SER B  2 296 ? -3.256  -27.870 72.686  1.00 67.69  ? 280 SER B CB    1 
ATOM   6685  O  OG    . SER B  2 296 ? -2.206  -27.543 71.793  1.00 71.73  ? 280 SER B OG    1 
ATOM   6686  N  N     . LYS B  2 297 ? -4.269  -29.598 75.310  1.00 77.24  ? 281 LYS B N     1 
ATOM   6687  C  CA    . LYS B  2 297 ? -5.318  -29.865 76.288  1.00 87.97  ? 281 LYS B CA    1 
ATOM   6688  C  C     . LYS B  2 297 ? -4.903  -29.432 77.687  1.00 83.07  ? 281 LYS B C     1 
ATOM   6689  O  O     . LYS B  2 297 ? -5.760  -29.102 78.515  1.00 92.75  ? 281 LYS B O     1 
ATOM   6690  C  CB    . LYS B  2 297 ? -5.683  -31.350 76.284  1.00 97.40  ? 281 LYS B CB    1 
ATOM   6691  C  CG    . LYS B  2 297 ? -6.414  -31.816 75.037  1.00 110.03 ? 281 LYS B CG    1 
ATOM   6692  C  CD    . LYS B  2 297 ? -6.858  -33.264 75.174  1.00 117.68 ? 281 LYS B CD    1 
ATOM   6693  C  CE    . LYS B  2 297 ? -7.661  -33.715 73.965  1.00 123.31 ? 281 LYS B CE    1 
ATOM   6694  N  NZ    . LYS B  2 297 ? -8.166  -35.106 74.125  1.00 129.07 ? 281 LYS B NZ    1 
ATOM   6695  N  N     . LEU B  2 298 ? -3.599  -29.428 77.972  1.00 70.40  ? 282 LEU B N     1 
ATOM   6696  C  CA    . LEU B  2 298 ? -3.121  -28.982 79.274  1.00 73.31  ? 282 LEU B CA    1 
ATOM   6697  C  C     . LEU B  2 298 ? -3.376  -27.500 79.507  1.00 78.62  ? 282 LEU B C     1 
ATOM   6698  O  O     . LEU B  2 298 ? -3.424  -27.064 80.662  1.00 83.19  ? 282 LEU B O     1 
ATOM   6699  C  CB    . LEU B  2 298 ? -1.627  -29.277 79.413  1.00 70.81  ? 282 LEU B CB    1 
ATOM   6700  C  CG    . LEU B  2 298 ? -1.200  -30.719 79.142  1.00 70.13  ? 282 LEU B CG    1 
ATOM   6701  C  CD1   . LEU B  2 298 ? 0.304   -30.869 79.285  1.00 68.30  ? 282 LEU B CD1   1 
ATOM   6702  C  CD2   . LEU B  2 298 ? -1.928  -31.673 80.072  1.00 74.06  ? 282 LEU B CD2   1 
ATOM   6703  N  N     . LEU B  2 299 ? -3.546  -26.719 78.440  1.00 79.15  ? 283 LEU B N     1 
ATOM   6704  C  CA    . LEU B  2 299 ? -3.723  -25.278 78.538  1.00 78.82  ? 283 LEU B CA    1 
ATOM   6705  C  C     . LEU B  2 299 ? -5.185  -24.856 78.431  1.00 82.88  ? 283 LEU B C     1 
ATOM   6706  O  O     . LEU B  2 299 ? -5.464  -23.684 78.162  1.00 84.10  ? 283 LEU B O     1 
ATOM   6707  C  CB    . LEU B  2 299 ? -2.890  -24.576 77.465  1.00 78.34  ? 283 LEU B CB    1 
ATOM   6708  C  CG    . LEU B  2 299 ? -1.394  -24.896 77.493  1.00 69.64  ? 283 LEU B CG    1 
ATOM   6709  C  CD1   . LEU B  2 299 ? -0.687  -24.272 76.302  1.00 66.55  ? 283 LEU B CD1   1 
ATOM   6710  C  CD2   . LEU B  2 299 ? -0.770  -24.427 78.797  1.00 66.53  ? 283 LEU B CD2   1 
ATOM   6711  N  N     . ARG B  2 300 ? -6.121  -25.781 78.634  1.00 87.29  ? 284 ARG B N     1 
ATOM   6712  C  CA    . ARG B  2 300 ? -7.534  -25.425 78.611  1.00 82.28  ? 284 ARG B CA    1 
ATOM   6713  C  C     . ARG B  2 300 ? -7.852  -24.443 79.731  1.00 71.23  ? 284 ARG B C     1 
ATOM   6714  O  O     . ARG B  2 300 ? -7.563  -24.702 80.903  1.00 82.17  ? 284 ARG B O     1 
ATOM   6715  C  CB    . ARG B  2 300 ? -8.401  -26.677 78.747  1.00 95.19  ? 284 ARG B CB    1 
ATOM   6716  C  CG    . ARG B  2 300 ? -8.388  -27.595 77.537  1.00 102.25 ? 284 ARG B CG    1 
ATOM   6717  C  CD    . ARG B  2 300 ? -9.207  -28.847 77.811  1.00 116.83 ? 284 ARG B CD    1 
ATOM   6718  N  NE    . ARG B  2 300 ? -9.243  -29.754 76.668  1.00 129.02 ? 284 ARG B NE    1 
ATOM   6719  C  CZ    . ARG B  2 300 ? -9.888  -30.917 76.661  1.00 139.52 ? 284 ARG B CZ    1 
ATOM   6720  N  NH1   . ARG B  2 300 ? -10.551 -31.315 77.739  1.00 143.57 ? 284 ARG B NH1   1 
ATOM   6721  N  NH2   . ARG B  2 300 ? -9.871  -31.682 75.578  1.00 142.29 ? 284 ARG B NH2   1 
ATOM   6722  N  N     . GLY B  2 301 ? -8.445  -23.315 79.367  1.00 58.62  ? 285 GLY B N     1 
ATOM   6723  C  CA    . GLY B  2 301 ? -8.811  -22.279 80.312  1.00 55.63  ? 285 GLY B CA    1 
ATOM   6724  C  C     . GLY B  2 301 ? -8.008  -21.010 80.093  1.00 54.66  ? 285 GLY B C     1 
ATOM   6725  O  O     . GLY B  2 301 ? -7.353  -20.815 79.067  1.00 65.61  ? 285 GLY B O     1 
ATOM   6726  N  N     . THR B  2 302 ? -8.073  -20.132 81.091  1.00 48.01  ? 286 THR B N     1 
ATOM   6727  C  CA    . THR B  2 302 ? -7.359  -18.855 81.094  1.00 51.04  ? 286 THR B CA    1 
ATOM   6728  C  C     . THR B  2 302 ? -6.490  -18.829 82.348  1.00 53.66  ? 286 THR B C     1 
ATOM   6729  O  O     . THR B  2 302 ? -6.832  -18.198 83.350  1.00 62.20  ? 286 THR B O     1 
ATOM   6730  C  CB    . THR B  2 302 ? -8.346  -17.672 81.046  1.00 51.66  ? 286 THR B CB    1 
ATOM   6731  O  OG1   . THR B  2 302 ? -9.265  -17.859 79.963  1.00 61.47  ? 286 THR B OG1   1 
ATOM   6732  C  CG2   . THR B  2 302 ? -7.606  -16.360 80.846  1.00 51.81  ? 286 THR B CG2   1 
ATOM   6733  N  N     . LYS B  2 303 ? -5.360  -19.524 82.286  1.00 50.68  ? 287 LYS B N     1 
ATOM   6734  C  CA    . LYS B  2 303 ? -4.505  -19.742 83.443  1.00 53.31  ? 287 LYS B CA    1 
ATOM   6735  C  C     . LYS B  2 303 ? -3.366  -18.730 83.492  1.00 56.29  ? 287 LYS B C     1 
ATOM   6736  O  O     . LYS B  2 303 ? -2.990  -18.125 82.485  1.00 52.80  ? 287 LYS B O     1 
ATOM   6737  C  CB    . LYS B  2 303 ? -3.933  -21.163 83.427  1.00 51.78  ? 287 LYS B CB    1 
ATOM   6738  C  CG    . LYS B  2 303 ? -4.981  -22.262 83.461  1.00 48.57  ? 287 LYS B CG    1 
ATOM   6739  C  CD    . LYS B  2 303 ? -4.339  -23.627 83.268  1.00 65.71  ? 287 LYS B CD    1 
ATOM   6740  C  CE    . LYS B  2 303 ? -5.366  -24.745 83.334  1.00 72.16  ? 287 LYS B CE    1 
ATOM   6741  N  NZ    . LYS B  2 303 ? -6.008  -24.835 84.675  1.00 80.13  ? 287 LYS B NZ    1 
ATOM   6742  N  N     . ALA B  2 304 ? -2.819  -18.556 84.693  1.00 52.92  ? 288 ALA B N     1 
ATOM   6743  C  CA    . ALA B  2 304 ? -1.651  -17.709 84.877  1.00 51.22  ? 288 ALA B CA    1 
ATOM   6744  C  C     . ALA B  2 304 ? -0.413  -18.384 84.297  1.00 49.33  ? 288 ALA B C     1 
ATOM   6745  O  O     . ALA B  2 304 ? -0.275  -19.610 84.332  1.00 52.17  ? 288 ALA B O     1 
ATOM   6746  C  CB    . ALA B  2 304 ? -1.444  -17.402 86.359  1.00 43.58  ? 288 ALA B CB    1 
ATOM   6747  N  N     . LEU B  2 305 ? 0.499   -17.565 83.764  1.00 45.03  ? 289 LEU B N     1 
ATOM   6748  C  CA    . LEU B  2 305 ? 1.639   -18.106 83.027  1.00 48.51  ? 289 LEU B CA    1 
ATOM   6749  C  C     . LEU B  2 305 ? 2.547   -18.942 83.921  1.00 47.75  ? 289 LEU B C     1 
ATOM   6750  O  O     . LEU B  2 305 ? 3.104   -19.953 83.476  1.00 52.54  ? 289 LEU B O     1 
ATOM   6751  C  CB    . LEU B  2 305 ? 2.433   -16.975 82.374  1.00 44.66  ? 289 LEU B CB    1 
ATOM   6752  C  CG    . LEU B  2 305 ? 1.784   -16.284 81.175  1.00 43.72  ? 289 LEU B CG    1 
ATOM   6753  C  CD1   . LEU B  2 305 ? 2.778   -15.360 80.487  1.00 39.28  ? 289 LEU B CD1   1 
ATOM   6754  C  CD2   . LEU B  2 305 ? 1.235   -17.309 80.198  1.00 46.47  ? 289 LEU B CD2   1 
ATOM   6755  N  N     . THR B  2 306 ? 2.712   -18.543 85.179  1.00 43.61  ? 290 THR B N     1 
ATOM   6756  C  CA    . THR B  2 306 ? 3.621   -19.228 86.086  1.00 44.78  ? 290 THR B CA    1 
ATOM   6757  C  C     . THR B  2 306 ? 2.958   -20.374 86.843  1.00 50.27  ? 290 THR B C     1 
ATOM   6758  O  O     . THR B  2 306 ? 3.590   -20.959 87.729  1.00 55.96  ? 290 THR B O     1 
ATOM   6759  C  CB    . THR B  2 306 ? 4.228   -18.234 87.080  1.00 44.70  ? 290 THR B CB    1 
ATOM   6760  O  OG1   . THR B  2 306 ? 3.193   -17.679 87.900  1.00 50.62  ? 290 THR B OG1   1 
ATOM   6761  C  CG2   . THR B  2 306 ? 4.938   -17.111 86.337  1.00 43.47  ? 290 THR B CG2   1 
ATOM   6762  N  N     . GLU B  2 307 ? 1.711   -20.707 86.519  1.00 55.33  ? 291 GLU B N     1 
ATOM   6763  C  CA    . GLU B  2 307 ? 1.051   -21.835 87.163  1.00 51.42  ? 291 GLU B CA    1 
ATOM   6764  C  C     . GLU B  2 307 ? 1.659   -23.146 86.680  1.00 53.50  ? 291 GLU B C     1 
ATOM   6765  O  O     . GLU B  2 307 ? 1.756   -23.391 85.473  1.00 56.15  ? 291 GLU B O     1 
ATOM   6766  C  CB    . GLU B  2 307 ? -0.450  -21.811 86.878  1.00 47.96  ? 291 GLU B CB    1 
ATOM   6767  C  CG    . GLU B  2 307 ? -1.175  -23.080 87.304  1.00 69.30  ? 291 GLU B CG    1 
ATOM   6768  C  CD    . GLU B  2 307 ? -2.684  -22.962 87.192  1.00 74.20  ? 291 GLU B CD    1 
ATOM   6769  O  OE1   . GLU B  2 307 ? -3.197  -21.823 87.228  1.00 66.87  ? 291 GLU B OE1   1 
ATOM   6770  O  OE2   . GLU B  2 307 ? -3.356  -24.008 87.066  1.00 73.74  ? 291 GLU B OE2   1 
ATOM   6771  N  N     . VAL B  2 308 ? 2.069   -23.988 87.625  1.00 56.19  ? 292 VAL B N     1 
ATOM   6772  C  CA    . VAL B  2 308 ? 2.691   -25.264 87.293  1.00 57.45  ? 292 VAL B CA    1 
ATOM   6773  C  C     . VAL B  2 308 ? 1.619   -26.239 86.825  1.00 62.38  ? 292 VAL B C     1 
ATOM   6774  O  O     . VAL B  2 308 ? 0.607   -26.444 87.506  1.00 66.19  ? 292 VAL B O     1 
ATOM   6775  C  CB    . VAL B  2 308 ? 3.462   -25.821 88.498  1.00 55.10  ? 292 VAL B CB    1 
ATOM   6776  C  CG1   . VAL B  2 308 ? 3.954   -27.232 88.209  1.00 55.82  ? 292 VAL B CG1   1 
ATOM   6777  C  CG2   . VAL B  2 308 ? 4.631   -24.911 88.845  1.00 53.30  ? 292 VAL B CG2   1 
ATOM   6778  N  N     . ILE B  2 309 ? 1.840   -26.842 85.661  1.00 60.73  ? 293 ILE B N     1 
ATOM   6779  C  CA    . ILE B  2 309 ? 0.904   -27.806 85.090  1.00 56.52  ? 293 ILE B CA    1 
ATOM   6780  C  C     . ILE B  2 309 ? 1.574   -29.173 85.026  1.00 64.45  ? 293 ILE B C     1 
ATOM   6781  O  O     . ILE B  2 309 ? 2.554   -29.347 84.287  1.00 64.21  ? 293 ILE B O     1 
ATOM   6782  C  CB    . ILE B  2 309 ? 0.426   -27.365 83.697  1.00 54.51  ? 293 ILE B CB    1 
ATOM   6783  C  CG1   . ILE B  2 309 ? -0.201  -25.972 83.761  1.00 54.85  ? 293 ILE B CG1   1 
ATOM   6784  C  CG2   . ILE B  2 309 ? -0.558  -28.378 83.125  1.00 54.39  ? 293 ILE B CG2   1 
ATOM   6785  C  CD1   . ILE B  2 309 ? -1.383  -25.873 84.698  1.00 60.43  ? 293 ILE B CD1   1 
ATOM   6786  N  N     . PRO B  2 310 ? 1.094   -30.162 85.777  1.00 69.09  ? 294 PRO B N     1 
ATOM   6787  C  CA    . PRO B  2 310 ? 1.660   -31.510 85.656  1.00 65.62  ? 294 PRO B CA    1 
ATOM   6788  C  C     . PRO B  2 310 ? 1.265   -32.148 84.334  1.00 67.36  ? 294 PRO B C     1 
ATOM   6789  O  O     . PRO B  2 310 ? 0.138   -31.991 83.859  1.00 73.01  ? 294 PRO B O     1 
ATOM   6790  C  CB    . PRO B  2 310 ? 1.052   -32.258 86.847  1.00 65.08  ? 294 PRO B CB    1 
ATOM   6791  C  CG    . PRO B  2 310 ? -0.227  -31.538 87.121  1.00 62.15  ? 294 PRO B CG    1 
ATOM   6792  C  CD    . PRO B  2 310 ? 0.035   -30.091 86.797  1.00 60.44  ? 294 PRO B CD    1 
ATOM   6793  N  N     . LEU B  2 311 ? 2.210   -32.869 83.737  1.00 69.94  ? 295 LEU B N     1 
ATOM   6794  C  CA    . LEU B  2 311 ? 1.975   -33.508 82.451  1.00 75.37  ? 295 LEU B CA    1 
ATOM   6795  C  C     . LEU B  2 311 ? 1.152   -34.776 82.636  1.00 89.84  ? 295 LEU B C     1 
ATOM   6796  O  O     . LEU B  2 311 ? 1.491   -35.633 83.458  1.00 96.92  ? 295 LEU B O     1 
ATOM   6797  C  CB    . LEU B  2 311 ? 3.301   -33.835 81.764  1.00 74.82  ? 295 LEU B CB    1 
ATOM   6798  C  CG    . LEU B  2 311 ? 4.256   -32.667 81.511  1.00 73.54  ? 295 LEU B CG    1 
ATOM   6799  C  CD1   . LEU B  2 311 ? 5.411   -33.109 80.625  1.00 75.70  ? 295 LEU B CD1   1 
ATOM   6800  C  CD2   . LEU B  2 311 ? 3.525   -31.484 80.897  1.00 59.91  ? 295 LEU B CD2   1 
ATOM   6801  N  N     . THR B  2 312 ? 0.070   -34.892 81.871  1.00 91.88  ? 296 THR B N     1 
ATOM   6802  C  CA    . THR B  2 312 ? -0.768  -36.078 81.937  1.00 94.89  ? 296 THR B CA    1 
ATOM   6803  C  C     . THR B  2 312 ? -0.055  -37.271 81.302  1.00 100.71 ? 296 THR B C     1 
ATOM   6804  O  O     . THR B  2 312 ? 1.017   -37.148 80.703  1.00 98.73  ? 296 THR B O     1 
ATOM   6805  C  CB    . THR B  2 312 ? -2.107  -35.834 81.240  1.00 88.51  ? 296 THR B CB    1 
ATOM   6806  O  OG1   . THR B  2 312 ? -1.879  -35.507 79.863  1.00 80.97  ? 296 THR B OG1   1 
ATOM   6807  C  CG2   . THR B  2 312 ? -2.857  -34.694 81.911  1.00 85.13  ? 296 THR B CG2   1 
ATOM   6808  N  N     . GLU B  2 313 ? -0.672  -38.446 81.444  1.00 108.04 ? 297 GLU B N     1 
ATOM   6809  C  CA    . GLU B  2 313 ? -0.102  -39.655 80.859  1.00 114.36 ? 297 GLU B CA    1 
ATOM   6810  C  C     . GLU B  2 313 ? -0.058  -39.561 79.339  1.00 105.81 ? 297 GLU B C     1 
ATOM   6811  O  O     . GLU B  2 313 ? 0.920   -39.982 78.709  1.00 96.78  ? 297 GLU B O     1 
ATOM   6812  C  CB    . GLU B  2 313 ? -0.905  -40.878 81.303  1.00 131.21 ? 297 GLU B CB    1 
ATOM   6813  C  CG    . GLU B  2 313 ? -0.309  -42.210 80.878  1.00 142.30 ? 297 GLU B CG    1 
ATOM   6814  C  CD    . GLU B  2 313 ? -1.104  -43.393 81.396  1.00 151.33 ? 297 GLU B CD    1 
ATOM   6815  O  OE1   . GLU B  2 313 ? -2.156  -43.171 82.032  1.00 151.49 ? 297 GLU B OE1   1 
ATOM   6816  O  OE2   . GLU B  2 313 ? -0.676  -44.545 81.170  1.00 154.95 ? 297 GLU B OE2   1 
ATOM   6817  N  N     . GLU B  2 314 ? -1.108  -39.003 78.731  1.00 104.99 ? 298 GLU B N     1 
ATOM   6818  C  CA    . GLU B  2 314 ? -1.122  -38.839 77.282  1.00 102.88 ? 298 GLU B CA    1 
ATOM   6819  C  C     . GLU B  2 314 ? -0.164  -37.744 76.833  1.00 102.66 ? 298 GLU B C     1 
ATOM   6820  O  O     . GLU B  2 314 ? 0.420   -37.841 75.747  1.00 102.77 ? 298 GLU B O     1 
ATOM   6821  C  CB    . GLU B  2 314 ? -2.540  -38.532 76.796  1.00 105.96 ? 298 GLU B CB    1 
ATOM   6822  C  CG    . GLU B  2 314 ? -3.572  -39.611 77.106  1.00 119.51 ? 298 GLU B CG    1 
ATOM   6823  C  CD    . GLU B  2 314 ? -4.096  -39.537 78.529  1.00 129.68 ? 298 GLU B CD    1 
ATOM   6824  O  OE1   . GLU B  2 314 ? -3.741  -38.578 79.247  1.00 126.77 ? 298 GLU B OE1   1 
ATOM   6825  O  OE2   . GLU B  2 314 ? -4.863  -40.439 78.929  1.00 135.45 ? 298 GLU B OE2   1 
ATOM   6826  N  N     . ALA B  2 315 ? 0.010   -36.699 77.647  1.00 99.24  ? 299 ALA B N     1 
ATOM   6827  C  CA    . ALA B  2 315 ? 0.939   -35.632 77.292  1.00 87.13  ? 299 ALA B CA    1 
ATOM   6828  C  C     . ALA B  2 315 ? 2.379   -36.129 77.304  1.00 86.43  ? 299 ALA B C     1 
ATOM   6829  O  O     . ALA B  2 315 ? 3.176   -35.759 76.434  1.00 87.40  ? 299 ALA B O     1 
ATOM   6830  C  CB    . ALA B  2 315 ? 0.771   -34.448 78.243  1.00 87.48  ? 299 ALA B CB    1 
ATOM   6831  N  N     . GLU B  2 316 ? 2.732   -36.962 78.287  1.00 87.00  ? 300 GLU B N     1 
ATOM   6832  C  CA    . GLU B  2 316 ? 4.055   -37.579 78.292  1.00 86.91  ? 300 GLU B CA    1 
ATOM   6833  C  C     . GLU B  2 316 ? 4.261   -38.434 77.049  1.00 88.91  ? 300 GLU B C     1 
ATOM   6834  O  O     . GLU B  2 316 ? 5.350   -38.442 76.463  1.00 82.49  ? 300 GLU B O     1 
ATOM   6835  C  CB    . GLU B  2 316 ? 4.238   -38.425 79.553  1.00 97.40  ? 300 GLU B CB    1 
ATOM   6836  C  CG    . GLU B  2 316 ? 4.171   -37.649 80.860  1.00 100.28 ? 300 GLU B CG    1 
ATOM   6837  C  CD    . GLU B  2 316 ? 5.465   -36.928 81.188  1.00 103.64 ? 300 GLU B CD    1 
ATOM   6838  O  OE1   . GLU B  2 316 ? 5.535   -36.297 82.263  1.00 109.12 ? 300 GLU B OE1   1 
ATOM   6839  O  OE2   . GLU B  2 316 ? 6.413   -36.996 80.377  1.00 101.74 ? 300 GLU B OE2   1 
ATOM   6840  N  N     . LEU B  2 317 ? 3.220   -39.155 76.629  1.00 101.86 ? 301 LEU B N     1 
ATOM   6841  C  CA    . LEU B  2 317 ? 3.323   -40.004 75.447  1.00 110.96 ? 301 LEU B CA    1 
ATOM   6842  C  C     . LEU B  2 317 ? 3.499   -39.170 74.183  1.00 103.56 ? 301 LEU B C     1 
ATOM   6843  O  O     . LEU B  2 317 ? 4.344   -39.479 73.336  1.00 97.13  ? 301 LEU B O     1 
ATOM   6844  C  CB    . LEU B  2 317 ? 2.085   -40.895 75.341  1.00 117.39 ? 301 LEU B CB    1 
ATOM   6845  C  CG    . LEU B  2 317 ? 1.971   -41.788 74.106  1.00 123.06 ? 301 LEU B CG    1 
ATOM   6846  C  CD1   . LEU B  2 317 ? 3.135   -42.763 74.037  1.00 122.30 ? 301 LEU B CD1   1 
ATOM   6847  C  CD2   . LEU B  2 317 ? 0.643   -42.531 74.105  1.00 126.55 ? 301 LEU B CD2   1 
ATOM   6848  N  N     . GLU B  2 318 ? 2.707   -38.104 74.041  1.00 97.35  ? 302 GLU B N     1 
ATOM   6849  C  CA    . GLU B  2 318 ? 2.802   -37.266 72.850  1.00 87.12  ? 302 GLU B CA    1 
ATOM   6850  C  C     . GLU B  2 318 ? 4.134   -36.527 72.798  1.00 77.92  ? 302 GLU B C     1 
ATOM   6851  O  O     . GLU B  2 318 ? 4.711   -36.350 71.718  1.00 75.19  ? 302 GLU B O     1 
ATOM   6852  C  CB    . GLU B  2 318 ? 1.638   -36.277 72.811  1.00 90.86  ? 302 GLU B CB    1 
ATOM   6853  C  CG    . GLU B  2 318 ? 1.524   -35.502 71.508  1.00 87.17  ? 302 GLU B CG    1 
ATOM   6854  C  CD    . GLU B  2 318 ? 0.488   -34.398 71.577  1.00 89.42  ? 302 GLU B CD    1 
ATOM   6855  O  OE1   . GLU B  2 318 ? 0.482   -33.648 72.575  1.00 90.85  ? 302 GLU B OE1   1 
ATOM   6856  O  OE2   . GLU B  2 318 ? -0.325  -34.283 70.636  1.00 92.55  ? 302 GLU B OE2   1 
ATOM   6857  N  N     . LEU B  2 319 ? 4.636   -36.085 73.953  1.00 73.13  ? 303 LEU B N     1 
ATOM   6858  C  CA    . LEU B  2 319 ? 5.924   -35.400 73.983  1.00 68.19  ? 303 LEU B CA    1 
ATOM   6859  C  C     . LEU B  2 319 ? 7.067   -36.363 73.691  1.00 79.91  ? 303 LEU B C     1 
ATOM   6860  O  O     . LEU B  2 319 ? 8.039   -35.997 73.020  1.00 78.70  ? 303 LEU B O     1 
ATOM   6861  C  CB    . LEU B  2 319 ? 6.124   -34.718 75.336  1.00 67.95  ? 303 LEU B CB    1 
ATOM   6862  C  CG    . LEU B  2 319 ? 7.448   -33.980 75.547  1.00 65.93  ? 303 LEU B CG    1 
ATOM   6863  C  CD1   . LEU B  2 319 ? 7.653   -32.923 74.476  1.00 68.30  ? 303 LEU B CD1   1 
ATOM   6864  C  CD2   . LEU B  2 319 ? 7.498   -33.357 76.933  1.00 64.90  ? 303 LEU B CD2   1 
ATOM   6865  N  N     . ALA B  2 320 ? 6.970   -37.600 74.186  1.00 87.24  ? 304 ALA B N     1 
ATOM   6866  C  CA    . ALA B  2 320 ? 8.008   -38.587 73.911  1.00 85.26  ? 304 ALA B CA    1 
ATOM   6867  C  C     . ALA B  2 320 ? 8.011   -38.989 72.442  1.00 88.45  ? 304 ALA B C     1 
ATOM   6868  O  O     . ALA B  2 320 ? 9.074   -39.245 71.865  1.00 86.64  ? 304 ALA B O     1 
ATOM   6869  C  CB    . ALA B  2 320 ? 7.820   -39.813 74.805  1.00 90.70  ? 304 ALA B CB    1 
ATOM   6870  N  N     . GLU B  2 321 ? 6.831   -39.052 71.821  1.00 87.11  ? 305 GLU B N     1 
ATOM   6871  C  CA    . GLU B  2 321 ? 6.761   -39.379 70.401  1.00 85.93  ? 305 GLU B CA    1 
ATOM   6872  C  C     . GLU B  2 321 ? 7.341   -38.258 69.547  1.00 85.83  ? 305 GLU B C     1 
ATOM   6873  O  O     . GLU B  2 321 ? 8.035   -38.521 68.558  1.00 91.92  ? 305 GLU B O     1 
ATOM   6874  C  CB    . GLU B  2 321 ? 5.316   -39.669 69.997  1.00 96.61  ? 305 GLU B CB    1 
ATOM   6875  C  CG    . GLU B  2 321 ? 4.793   -41.014 70.475  1.00 118.07 ? 305 GLU B CG    1 
ATOM   6876  C  CD    . GLU B  2 321 ? 3.356   -41.257 70.058  1.00 129.81 ? 305 GLU B CD    1 
ATOM   6877  O  OE1   . GLU B  2 321 ? 2.545   -41.663 70.916  1.00 131.80 ? 305 GLU B OE1   1 
ATOM   6878  O  OE2   . GLU B  2 321 ? 3.036   -41.033 68.872  1.00 133.29 ? 305 GLU B OE2   1 
ATOM   6879  N  N     . ASN B  2 322 ? 7.071   -37.003 69.915  1.00 84.74  ? 306 ASN B N     1 
ATOM   6880  C  CA    . ASN B  2 322 ? 7.623   -35.880 69.164  1.00 76.87  ? 306 ASN B CA    1 
ATOM   6881  C  C     . ASN B  2 322 ? 9.140   -35.820 69.275  1.00 73.77  ? 306 ASN B C     1 
ATOM   6882  O  O     . ASN B  2 322 ? 9.807   -35.338 68.352  1.00 77.56  ? 306 ASN B O     1 
ATOM   6883  C  CB    . ASN B  2 322 ? 7.004   -34.567 69.644  1.00 71.43  ? 306 ASN B CB    1 
ATOM   6884  C  CG    . ASN B  2 322 ? 5.563   -34.407 69.204  1.00 67.74  ? 306 ASN B CG    1 
ATOM   6885  O  OD1   . ASN B  2 322 ? 5.151   -34.951 68.179  1.00 69.38  ? 306 ASN B OD1   1 
ATOM   6886  N  ND2   . ASN B  2 322 ? 4.789   -33.652 69.975  1.00 70.83  ? 306 ASN B ND2   1 
ATOM   6887  N  N     . ARG B  2 323 ? 9.704   -36.299 70.386  1.00 76.48  ? 307 ARG B N     1 
ATOM   6888  C  CA    . ARG B  2 323 ? 11.156  -36.321 70.519  1.00 85.41  ? 307 ARG B CA    1 
ATOM   6889  C  C     . ARG B  2 323 ? 11.792  -37.329 69.572  1.00 96.49  ? 307 ARG B C     1 
ATOM   6890  O  O     . ARG B  2 323 ? 12.907  -37.104 69.089  1.00 96.14  ? 307 ARG B O     1 
ATOM   6891  C  CB    . ARG B  2 323 ? 11.552  -36.625 71.963  1.00 80.52  ? 307 ARG B CB    1 
ATOM   6892  C  CG    . ARG B  2 323 ? 11.245  -35.500 72.933  1.00 77.26  ? 307 ARG B CG    1 
ATOM   6893  C  CD    . ARG B  2 323 ? 12.130  -35.578 74.165  1.00 79.13  ? 307 ARG B CD    1 
ATOM   6894  N  NE    . ARG B  2 323 ? 12.056  -34.357 74.961  1.00 83.02  ? 307 ARG B NE    1 
ATOM   6895  C  CZ    . ARG B  2 323 ? 11.285  -34.208 76.033  1.00 91.52  ? 307 ARG B CZ    1 
ATOM   6896  N  NH1   . ARG B  2 323 ? 10.522  -35.210 76.447  1.00 94.98  ? 307 ARG B NH1   1 
ATOM   6897  N  NH2   . ARG B  2 323 ? 11.281  -33.058 76.694  1.00 89.51  ? 307 ARG B NH2   1 
ATOM   6898  N  N     . GLU B  2 324 ? 11.104  -38.438 69.291  1.00 102.82 ? 308 GLU B N     1 
ATOM   6899  C  CA    . GLU B  2 324 ? 11.647  -39.424 68.363  1.00 112.55 ? 308 GLU B CA    1 
ATOM   6900  C  C     . GLU B  2 324 ? 11.552  -38.940 66.922  1.00 107.31 ? 308 GLU B C     1 
ATOM   6901  O  O     . GLU B  2 324 ? 12.452  -39.198 66.115  1.00 110.18 ? 308 GLU B O     1 
ATOM   6902  C  CB    . GLU B  2 324 ? 10.923  -40.760 68.531  1.00 124.92 ? 308 GLU B CB    1 
ATOM   6903  C  CG    . GLU B  2 324 ? 11.156  -41.430 69.876  1.00 137.73 ? 308 GLU B CG    1 
ATOM   6904  C  CD    . GLU B  2 324 ? 12.587  -41.900 70.058  1.00 147.56 ? 308 GLU B CD    1 
ATOM   6905  O  OE1   . GLU B  2 324 ? 13.276  -42.129 69.041  1.00 151.30 ? 308 GLU B OE1   1 
ATOM   6906  O  OE2   . GLU B  2 324 ? 13.025  -42.040 71.219  1.00 152.52 ? 308 GLU B OE2   1 
ATOM   6907  N  N     . ILE B  2 325 ? 10.469  -38.235 66.581  1.00 95.15  ? 309 ILE B N     1 
ATOM   6908  C  CA    . ILE B  2 325 ? 10.310  -37.727 65.221  1.00 84.54  ? 309 ILE B CA    1 
ATOM   6909  C  C     . ILE B  2 325 ? 11.398  -36.708 64.903  1.00 92.30  ? 309 ILE B C     1 
ATOM   6910  O  O     . ILE B  2 325 ? 11.922  -36.665 63.783  1.00 93.07  ? 309 ILE B O     1 
ATOM   6911  C  CB    . ILE B  2 325 ? 8.902   -37.132 65.032  1.00 70.03  ? 309 ILE B CB    1 
ATOM   6912  C  CG1   . ILE B  2 325 ? 7.832   -38.182 65.338  1.00 76.78  ? 309 ILE B CG1   1 
ATOM   6913  C  CG2   . ILE B  2 325 ? 8.731   -36.605 63.616  1.00 73.56  ? 309 ILE B CG2   1 
ATOM   6914  C  CD1   . ILE B  2 325 ? 6.415   -37.683 65.143  1.00 78.40  ? 309 ILE B CD1   1 
ATOM   6915  N  N     . LEU B  2 326 ? 11.762  -35.878 65.885  1.00 91.21  ? 310 LEU B N     1 
ATOM   6916  C  CA    . LEU B  2 326 ? 12.830  -34.906 65.683  1.00 92.65  ? 310 LEU B CA    1 
ATOM   6917  C  C     . LEU B  2 326 ? 14.184  -35.570 65.467  1.00 97.42  ? 310 LEU B C     1 
ATOM   6918  O  O     . LEU B  2 326 ? 15.089  -34.936 64.915  1.00 96.06  ? 310 LEU B O     1 
ATOM   6919  C  CB    . LEU B  2 326 ? 12.904  -33.948 66.872  1.00 85.73  ? 310 LEU B CB    1 
ATOM   6920  C  CG    . LEU B  2 326 ? 11.706  -33.012 67.040  1.00 76.40  ? 310 LEU B CG    1 
ATOM   6921  C  CD1   . LEU B  2 326 ? 11.879  -32.139 68.270  1.00 76.77  ? 310 LEU B CD1   1 
ATOM   6922  C  CD2   . LEU B  2 326 ? 11.514  -32.160 65.796  1.00 66.27  ? 310 LEU B CD2   1 
ATOM   6923  N  N     . LYS B  2 327 ? 14.344  -36.824 65.893  1.00 100.43 ? 311 LYS B N     1 
ATOM   6924  C  CA    . LYS B  2 327 ? 15.554  -37.584 65.609  1.00 103.38 ? 311 LYS B CA    1 
ATOM   6925  C  C     . LYS B  2 327 ? 15.513  -38.251 64.241  1.00 99.62  ? 311 LYS B C     1 
ATOM   6926  O  O     . LYS B  2 327 ? 16.570  -38.472 63.637  1.00 99.91  ? 311 LYS B O     1 
ATOM   6927  C  CB    . LYS B  2 327 ? 15.774  -38.647 66.689  1.00 104.38 ? 311 LYS B CB    1 
ATOM   6928  C  CG    . LYS B  2 327 ? 15.885  -38.079 68.094  1.00 103.85 ? 311 LYS B CG    1 
ATOM   6929  C  CD    . LYS B  2 327 ? 15.989  -39.179 69.137  1.00 112.97 ? 311 LYS B CD    1 
ATOM   6930  C  CE    . LYS B  2 327 ? 16.033  -38.602 70.545  1.00 119.24 ? 311 LYS B CE    1 
ATOM   6931  N  NZ    . LYS B  2 327 ? 16.076  -39.671 71.582  1.00 125.36 ? 311 LYS B NZ    1 
ATOM   6932  N  N     . GLU B  2 328 ? 14.321  -38.575 63.743  1.00 100.87 ? 312 GLU B N     1 
ATOM   6933  C  CA    . GLU B  2 328 ? 14.194  -39.176 62.426  1.00 102.59 ? 312 GLU B CA    1 
ATOM   6934  C  C     . GLU B  2 328 ? 14.564  -38.165 61.342  1.00 110.16 ? 312 GLU B C     1 
ATOM   6935  O  O     . GLU B  2 328 ? 14.323  -36.964 61.493  1.00 106.23 ? 312 GLU B O     1 
ATOM   6936  C  CB    . GLU B  2 328 ? 12.770  -39.675 62.203  1.00 106.82 ? 312 GLU B CB    1 
ATOM   6937  C  CG    . GLU B  2 328 ? 12.302  -40.704 63.218  1.00 119.65 ? 312 GLU B CG    1 
ATOM   6938  C  CD    . GLU B  2 328 ? 10.828  -41.033 63.080  1.00 128.88 ? 312 GLU B CD    1 
ATOM   6939  O  OE1   . GLU B  2 328 ? 10.179  -40.489 62.162  1.00 129.74 ? 312 GLU B OE1   1 
ATOM   6940  O  OE2   . GLU B  2 328 ? 10.317  -41.833 63.893  1.00 130.96 ? 312 GLU B OE2   1 
ATOM   6941  N  N     . PRO B  2 329 ? 15.149  -38.624 60.238  1.00 115.59 ? 313 PRO B N     1 
ATOM   6942  C  CA    . PRO B  2 329 ? 15.489  -37.701 59.152  1.00 109.82 ? 313 PRO B CA    1 
ATOM   6943  C  C     . PRO B  2 329 ? 14.250  -37.265 58.388  1.00 102.74 ? 313 PRO B C     1 
ATOM   6944  O  O     . PRO B  2 329 ? 13.265  -37.999 58.281  1.00 113.30 ? 313 PRO B O     1 
ATOM   6945  C  CB    . PRO B  2 329 ? 16.427  -38.527 58.266  1.00 112.09 ? 313 PRO B CB    1 
ATOM   6946  C  CG    . PRO B  2 329 ? 15.991  -39.934 58.494  1.00 119.73 ? 313 PRO B CG    1 
ATOM   6947  C  CD    . PRO B  2 329 ? 15.557  -40.008 59.936  1.00 120.62 ? 313 PRO B CD    1 
ATOM   6948  N  N     . VAL B  2 330 ? 14.310  -36.045 57.854  1.00 80.54  ? 314 VAL B N     1 
ATOM   6949  C  CA    . VAL B  2 330 ? 13.182  -35.501 57.109  1.00 70.39  ? 314 VAL B CA    1 
ATOM   6950  C  C     . VAL B  2 330 ? 13.044  -36.233 55.780  1.00 79.62  ? 314 VAL B C     1 
ATOM   6951  O  O     . VAL B  2 330 ? 14.037  -36.512 55.093  1.00 85.44  ? 314 VAL B O     1 
ATOM   6952  C  CB    . VAL B  2 330 ? 13.354  -33.986 56.906  1.00 65.35  ? 314 VAL B CB    1 
ATOM   6953  C  CG1   . VAL B  2 330 ? 12.089  -33.379 56.316  1.00 62.26  ? 314 VAL B CG1   1 
ATOM   6954  C  CG2   . VAL B  2 330 ? 13.709  -33.314 58.224  1.00 55.03  ? 314 VAL B CG2   1 
ATOM   6955  N  N     . HIS B  2 331 ? 11.803  -36.550 55.417  1.00 88.25  ? 315 HIS B N     1 
ATOM   6956  C  CA    . HIS B  2 331 ? 11.522  -37.300 54.200  1.00 94.00  ? 315 HIS B CA    1 
ATOM   6957  C  C     . HIS B  2 331 ? 11.707  -36.433 52.962  1.00 83.16  ? 315 HIS B C     1 
ATOM   6958  O  O     . HIS B  2 331 ? 11.363  -35.247 52.955  1.00 78.21  ? 315 HIS B O     1 
ATOM   6959  C  CB    . HIS B  2 331 ? 10.095  -37.850 54.232  1.00 106.59 ? 315 HIS B CB    1 
ATOM   6960  C  CG    . HIS B  2 331 ? 9.628   -38.394 52.917  1.00 114.73 ? 315 HIS B CG    1 
ATOM   6961  N  ND1   . HIS B  2 331 ? 10.285  -39.412 52.259  1.00 116.82 ? 315 HIS B ND1   1 
ATOM   6962  C  CD2   . HIS B  2 331 ? 8.578   -38.056 52.133  1.00 114.79 ? 315 HIS B CD2   1 
ATOM   6963  C  CE1   . HIS B  2 331 ? 9.657   -39.680 51.128  1.00 118.72 ? 315 HIS B CE1   1 
ATOM   6964  N  NE2   . HIS B  2 331 ? 8.617   -38.871 51.028  1.00 116.79 ? 315 HIS B NE2   1 
ATOM   6965  N  N     . GLY B  2 332 ? 12.249  -37.039 51.910  1.00 81.17  ? 316 GLY B N     1 
ATOM   6966  C  CA    . GLY B  2 332 ? 12.406  -36.363 50.631  1.00 74.22  ? 316 GLY B CA    1 
ATOM   6967  C  C     . GLY B  2 332 ? 13.322  -35.161 50.661  1.00 62.36  ? 316 GLY B C     1 
ATOM   6968  O  O     . GLY B  2 332 ? 13.038  -34.153 50.003  1.00 59.88  ? 316 GLY B O     1 
ATOM   6969  N  N     . VAL B  2 333 ? 14.418  -35.241 51.409  1.00 58.58  ? 317 VAL B N     1 
ATOM   6970  C  CA    . VAL B  2 333 ? 15.389  -34.157 51.511  1.00 56.73  ? 317 VAL B CA    1 
ATOM   6971  C  C     . VAL B  2 333 ? 16.693  -34.643 50.895  1.00 51.45  ? 317 VAL B C     1 
ATOM   6972  O  O     . VAL B  2 333 ? 17.388  -35.490 51.470  1.00 62.23  ? 317 VAL B O     1 
ATOM   6973  C  CB    . VAL B  2 333 ? 15.596  -33.703 52.963  1.00 52.04  ? 317 VAL B CB    1 
ATOM   6974  C  CG1   . VAL B  2 333 ? 16.757  -32.724 53.054  1.00 54.18  ? 317 VAL B CG1   1 
ATOM   6975  C  CG2   . VAL B  2 333 ? 14.328  -33.070 53.492  1.00 49.86  ? 317 VAL B CG2   1 
ATOM   6976  N  N     . TYR B  2 334 ? 17.023  -34.114 49.720  1.00 50.99  ? 318 TYR B N     1 
ATOM   6977  C  CA    . TYR B  2 334 ? 18.273  -34.447 49.055  1.00 51.18  ? 318 TYR B CA    1 
ATOM   6978  C  C     . TYR B  2 334 ? 18.762  -33.222 48.298  1.00 49.96  ? 318 TYR B C     1 
ATOM   6979  O  O     . TYR B  2 334 ? 18.030  -32.248 48.106  1.00 49.25  ? 318 TYR B O     1 
ATOM   6980  C  CB    . TYR B  2 334 ? 18.112  -35.653 48.121  1.00 52.83  ? 318 TYR B CB    1 
ATOM   6981  C  CG    . TYR B  2 334 ? 17.023  -35.500 47.083  1.00 57.31  ? 318 TYR B CG    1 
ATOM   6982  C  CD1   . TYR B  2 334 ? 17.286  -34.910 45.853  1.00 56.41  ? 318 TYR B CD1   1 
ATOM   6983  C  CD2   . TYR B  2 334 ? 15.734  -35.953 47.329  1.00 54.37  ? 318 TYR B CD2   1 
ATOM   6984  C  CE1   . TYR B  2 334 ? 16.295  -34.770 44.901  1.00 55.02  ? 318 TYR B CE1   1 
ATOM   6985  C  CE2   . TYR B  2 334 ? 14.737  -35.819 46.381  1.00 55.12  ? 318 TYR B CE2   1 
ATOM   6986  C  CZ    . TYR B  2 334 ? 15.023  -35.226 45.170  1.00 59.18  ? 318 TYR B CZ    1 
ATOM   6987  O  OH    . TYR B  2 334 ? 14.032  -35.090 44.225  1.00 55.82  ? 318 TYR B OH    1 
ATOM   6988  N  N     . TYR B  2 335 ? 20.019  -33.282 47.871  1.00 49.90  ? 319 TYR B N     1 
ATOM   6989  C  CA    . TYR B  2 335 ? 20.648  -32.159 47.193  1.00 48.94  ? 319 TYR B CA    1 
ATOM   6990  C  C     . TYR B  2 335 ? 20.308  -32.176 45.708  1.00 54.37  ? 319 TYR B C     1 
ATOM   6991  O  O     . TYR B  2 335 ? 20.405  -33.216 45.049  1.00 51.50  ? 319 TYR B O     1 
ATOM   6992  C  CB    . TYR B  2 335 ? 22.162  -32.207 47.398  1.00 48.84  ? 319 TYR B CB    1 
ATOM   6993  C  CG    . TYR B  2 335 ? 22.937  -31.202 46.578  1.00 48.20  ? 319 TYR B CG    1 
ATOM   6994  C  CD1   . TYR B  2 335 ? 22.861  -29.845 46.855  1.00 47.10  ? 319 TYR B CD1   1 
ATOM   6995  C  CD2   . TYR B  2 335 ? 23.756  -31.614 45.536  1.00 48.82  ? 319 TYR B CD2   1 
ATOM   6996  C  CE1   . TYR B  2 335 ? 23.574  -28.924 46.111  1.00 46.74  ? 319 TYR B CE1   1 
ATOM   6997  C  CE2   . TYR B  2 335 ? 24.473  -30.702 44.787  1.00 48.39  ? 319 TYR B CE2   1 
ATOM   6998  C  CZ    . TYR B  2 335 ? 24.378  -29.358 45.078  1.00 58.28  ? 319 TYR B CZ    1 
ATOM   6999  O  OH    . TYR B  2 335 ? 25.090  -28.447 44.334  1.00 49.74  ? 319 TYR B OH    1 
ATOM   7000  N  N     . ASP B  2 336 ? 19.897  -31.022 45.187  1.00 48.80  ? 320 ASP B N     1 
ATOM   7001  C  CA    . ASP B  2 336 ? 19.653  -30.848 43.760  1.00 49.37  ? 320 ASP B CA    1 
ATOM   7002  C  C     . ASP B  2 336 ? 20.767  -29.988 43.183  1.00 59.89  ? 320 ASP B C     1 
ATOM   7003  O  O     . ASP B  2 336 ? 20.848  -28.792 43.506  1.00 47.82  ? 320 ASP B O     1 
ATOM   7004  C  CB    . ASP B  2 336 ? 18.288  -30.199 43.515  1.00 49.45  ? 320 ASP B CB    1 
ATOM   7005  C  CG    . ASP B  2 336 ? 17.882  -30.206 42.046  1.00 54.65  ? 320 ASP B CG    1 
ATOM   7006  O  OD1   . ASP B  2 336 ? 18.760  -30.326 41.165  1.00 50.75  ? 320 ASP B OD1   1 
ATOM   7007  O  OD2   . ASP B  2 336 ? 16.670  -30.085 41.769  1.00 53.95  ? 320 ASP B OD2   1 
ATOM   7008  N  N     . PRO B  2 337 ? 21.640  -30.537 42.334  1.00 49.38  ? 321 PRO B N     1 
ATOM   7009  C  CA    . PRO B  2 337 ? 22.768  -29.742 41.819  1.00 51.54  ? 321 PRO B CA    1 
ATOM   7010  C  C     . PRO B  2 337 ? 22.358  -28.567 40.943  1.00 55.16  ? 321 PRO B C     1 
ATOM   7011  O  O     . PRO B  2 337 ? 23.210  -27.717 40.654  1.00 49.96  ? 321 PRO B O     1 
ATOM   7012  C  CB    . PRO B  2 337 ? 23.589  -30.768 41.025  1.00 49.89  ? 321 PRO B CB    1 
ATOM   7013  C  CG    . PRO B  2 337 ? 22.623  -31.864 40.697  1.00 55.29  ? 321 PRO B CG    1 
ATOM   7014  C  CD    . PRO B  2 337 ? 21.672  -31.929 41.855  1.00 50.63  ? 321 PRO B CD    1 
ATOM   7015  N  N     . SER B  2 338 ? 21.098  -28.480 40.519  1.00 56.48  ? 322 SER B N     1 
ATOM   7016  C  CA    . SER B  2 338 ? 20.660  -27.378 39.672  1.00 49.39  ? 322 SER B CA    1 
ATOM   7017  C  C     . SER B  2 338 ? 20.069  -26.214 40.457  1.00 48.54  ? 322 SER B C     1 
ATOM   7018  O  O     . SER B  2 338 ? 19.739  -25.187 39.854  1.00 58.91  ? 322 SER B O     1 
ATOM   7019  C  CB    . SER B  2 338 ? 19.627  -27.867 38.651  1.00 52.81  ? 322 SER B CB    1 
ATOM   7020  O  OG    . SER B  2 338 ? 18.377  -28.118 39.270  1.00 56.96  ? 322 SER B OG    1 
ATOM   7021  N  N     . LYS B  2 339 ? 19.921  -26.346 41.771  1.00 61.31  ? 323 LYS B N     1 
ATOM   7022  C  CA    . LYS B  2 339 ? 19.338  -25.306 42.605  1.00 48.57  ? 323 LYS B CA    1 
ATOM   7023  C  C     . LYS B  2 339 ? 20.418  -24.619 43.428  1.00 45.99  ? 323 LYS B C     1 
ATOM   7024  O  O     . LYS B  2 339 ? 21.423  -25.230 43.802  1.00 47.52  ? 323 LYS B O     1 
ATOM   7025  C  CB    . LYS B  2 339 ? 18.270  -25.880 43.540  1.00 46.93  ? 323 LYS B CB    1 
ATOM   7026  C  CG    . LYS B  2 339 ? 17.058  -26.458 42.832  1.00 48.11  ? 323 LYS B CG    1 
ATOM   7027  C  CD    . LYS B  2 339 ? 16.088  -27.053 43.838  1.00 48.17  ? 323 LYS B CD    1 
ATOM   7028  C  CE    . LYS B  2 339 ? 14.886  -27.675 43.156  1.00 49.63  ? 323 LYS B CE    1 
ATOM   7029  N  NZ    . LYS B  2 339 ? 14.018  -28.392 44.130  1.00 49.91  ? 323 LYS B NZ    1 
ATOM   7030  N  N     . ASP B  2 340 ? 20.197  -23.339 43.711  1.00 45.50  ? 324 ASP B N     1 
ATOM   7031  C  CA    . ASP B  2 340 ? 21.130  -22.585 44.534  1.00 49.62  ? 324 ASP B CA    1 
ATOM   7032  C  C     . ASP B  2 340 ? 21.002  -22.987 45.998  1.00 52.18  ? 324 ASP B C     1 
ATOM   7033  O  O     . ASP B  2 340 ? 19.940  -23.411 46.462  1.00 54.38  ? 324 ASP B O     1 
ATOM   7034  C  CB    . ASP B  2 340 ? 20.885  -21.083 44.389  1.00 44.63  ? 324 ASP B CB    1 
ATOM   7035  C  CG    . ASP B  2 340 ? 21.201  -20.570 43.000  1.00 69.37  ? 324 ASP B CG    1 
ATOM   7036  O  OD1   . ASP B  2 340 ? 22.009  -21.212 42.296  1.00 74.90  ? 324 ASP B OD1   1 
ATOM   7037  O  OD2   . ASP B  2 340 ? 20.643  -19.522 42.614  1.00 70.31  ? 324 ASP B OD2   1 
ATOM   7038  N  N     . LEU B  2 341 ? 22.105  -22.851 46.727  1.00 54.52  ? 325 LEU B N     1 
ATOM   7039  C  CA    . LEU B  2 341 ? 22.110  -23.072 48.164  1.00 51.30  ? 325 LEU B CA    1 
ATOM   7040  C  C     . LEU B  2 341 ? 21.755  -21.781 48.888  1.00 44.50  ? 325 LEU B C     1 
ATOM   7041  O  O     . LEU B  2 341 ? 22.205  -20.697 48.507  1.00 51.93  ? 325 LEU B O     1 
ATOM   7042  C  CB    . LEU B  2 341 ? 23.476  -23.575 48.632  1.00 45.40  ? 325 LEU B CB    1 
ATOM   7043  C  CG    . LEU B  2 341 ? 23.890  -24.980 48.201  1.00 44.22  ? 325 LEU B CG    1 
ATOM   7044  C  CD1   . LEU B  2 341 ? 25.285  -25.291 48.712  1.00 53.73  ? 325 LEU B CD1   1 
ATOM   7045  C  CD2   . LEU B  2 341 ? 22.891  -26.009 48.703  1.00 44.35  ? 325 LEU B CD2   1 
ATOM   7046  N  N     . ILE B  2 342 ? 20.939  -21.906 49.930  1.00 40.04  ? 326 ILE B N     1 
ATOM   7047  C  CA    . ILE B  2 342 ? 20.524  -20.781 50.757  1.00 36.58  ? 326 ILE B CA    1 
ATOM   7048  C  C     . ILE B  2 342 ? 20.938  -21.068 52.192  1.00 34.79  ? 326 ILE B C     1 
ATOM   7049  O  O     . ILE B  2 342 ? 20.748  -22.182 52.691  1.00 43.74  ? 326 ILE B O     1 
ATOM   7050  C  CB    . ILE B  2 342 ? 19.004  -20.534 50.664  1.00 39.89  ? 326 ILE B CB    1 
ATOM   7051  C  CG1   . ILE B  2 342 ? 18.579  -20.344 49.206  1.00 41.76  ? 326 ILE B CG1   1 
ATOM   7052  C  CG2   . ILE B  2 342 ? 18.605  -19.326 51.497  1.00 34.61  ? 326 ILE B CG2   1 
ATOM   7053  C  CD1   . ILE B  2 342 ? 17.086  -20.158 49.024  1.00 49.60  ? 326 ILE B CD1   1 
ATOM   7054  N  N     . ALA B  2 343 ? 21.512  -20.064 52.851  1.00 36.81  ? 327 ALA B N     1 
ATOM   7055  C  CA    . ALA B  2 343 ? 21.982  -20.194 54.224  1.00 41.31  ? 327 ALA B CA    1 
ATOM   7056  C  C     . ALA B  2 343 ? 21.355  -19.093 55.065  1.00 41.64  ? 327 ALA B C     1 
ATOM   7057  O  O     . ALA B  2 343 ? 21.485  -17.909 54.738  1.00 46.09  ? 327 ALA B O     1 
ATOM   7058  C  CB    . ALA B  2 343 ? 23.510  -20.123 54.294  1.00 32.49  ? 327 ALA B CB    1 
ATOM   7059  N  N     . GLU B  2 344 ? 20.670  -19.484 56.135  1.00 40.96  ? 328 GLU B N     1 
ATOM   7060  C  CA    . GLU B  2 344 ? 20.124  -18.556 57.114  1.00 36.35  ? 328 GLU B CA    1 
ATOM   7061  C  C     . GLU B  2 344 ? 20.914  -18.675 58.409  1.00 37.60  ? 328 GLU B C     1 
ATOM   7062  O  O     . GLU B  2 344 ? 21.335  -19.771 58.789  1.00 39.17  ? 328 GLU B O     1 
ATOM   7063  C  CB    . GLU B  2 344 ? 18.643  -18.833 57.381  1.00 37.47  ? 328 GLU B CB    1 
ATOM   7064  C  CG    . GLU B  2 344 ? 17.736  -18.558 56.197  1.00 52.48  ? 328 GLU B CG    1 
ATOM   7065  C  CD    . GLU B  2 344 ? 16.285  -18.884 56.489  1.00 62.59  ? 328 GLU B CD    1 
ATOM   7066  O  OE1   . GLU B  2 344 ? 15.459  -18.806 55.556  1.00 67.89  ? 328 GLU B OE1   1 
ATOM   7067  O  OE2   . GLU B  2 344 ? 15.972  -19.219 57.651  1.00 62.48  ? 328 GLU B OE2   1 
ATOM   7068  N  N     . ILE B  2 345 ? 21.120  -17.545 59.079  1.00 37.81  ? 329 ILE B N     1 
ATOM   7069  C  CA    . ILE B  2 345 ? 21.873  -17.492 60.325  1.00 31.65  ? 329 ILE B CA    1 
ATOM   7070  C  C     . ILE B  2 345 ? 21.023  -16.790 61.373  1.00 42.34  ? 329 ILE B C     1 
ATOM   7071  O  O     . ILE B  2 345 ? 20.346  -15.800 61.074  1.00 49.29  ? 329 ILE B O     1 
ATOM   7072  C  CB    . ILE B  2 345 ? 23.225  -16.766 60.141  1.00 30.80  ? 329 ILE B CB    1 
ATOM   7073  C  CG1   . ILE B  2 345 ? 24.067  -17.460 59.068  1.00 30.66  ? 329 ILE B CG1   1 
ATOM   7074  C  CG2   . ILE B  2 345 ? 23.992  -16.701 61.455  1.00 30.71  ? 329 ILE B CG2   1 
ATOM   7075  C  CD1   . ILE B  2 345 ? 25.386  -16.773 58.796  1.00 30.10  ? 329 ILE B CD1   1 
ATOM   7076  N  N     . GLN B  2 346 ? 21.046  -17.307 62.600  1.00 36.45  ? 330 GLN B N     1 
ATOM   7077  C  CA    . GLN B  2 346 ? 20.367  -16.684 63.728  1.00 42.47  ? 330 GLN B CA    1 
ATOM   7078  C  C     . GLN B  2 346 ? 21.383  -16.353 64.810  1.00 39.15  ? 330 GLN B C     1 
ATOM   7079  O  O     . GLN B  2 346 ? 22.233  -17.184 65.147  1.00 43.12  ? 330 GLN B O     1 
ATOM   7080  C  CB    . GLN B  2 346 ? 19.273  -17.589 64.306  1.00 37.74  ? 330 GLN B CB    1 
ATOM   7081  C  CG    . GLN B  2 346 ? 18.144  -17.905 63.346  1.00 40.53  ? 330 GLN B CG    1 
ATOM   7082  C  CD    . GLN B  2 346 ? 18.452  -19.097 62.464  1.00 40.63  ? 330 GLN B CD    1 
ATOM   7083  O  OE1   . GLN B  2 346 ? 19.046  -20.079 62.913  1.00 39.05  ? 330 GLN B OE1   1 
ATOM   7084  N  NE2   . GLN B  2 346 ? 18.053  -19.016 61.201  1.00 34.79  ? 330 GLN B NE2   1 
ATOM   7085  N  N     . LYS B  2 347 ? 21.292  -15.140 65.345  1.00 41.02  ? 331 LYS B N     1 
ATOM   7086  C  CA    . LYS B  2 347 ? 22.092  -14.732 66.494  1.00 35.98  ? 331 LYS B CA    1 
ATOM   7087  C  C     . LYS B  2 347 ? 21.383  -15.193 67.761  1.00 36.38  ? 331 LYS B C     1 
ATOM   7088  O  O     . LYS B  2 347 ? 20.311  -14.683 68.102  1.00 49.66  ? 331 LYS B O     1 
ATOM   7089  C  CB    . LYS B  2 347 ? 22.293  -13.219 66.485  1.00 32.22  ? 331 LYS B CB    1 
ATOM   7090  C  CG    . LYS B  2 347 ? 22.911  -12.651 67.750  1.00 32.40  ? 331 LYS B CG    1 
ATOM   7091  C  CD    . LYS B  2 347 ? 22.889  -11.133 67.712  1.00 32.13  ? 331 LYS B CD    1 
ATOM   7092  C  CE    . LYS B  2 347 ? 23.399  -10.531 69.008  1.00 32.65  ? 331 LYS B CE    1 
ATOM   7093  N  NZ    . LYS B  2 347 ? 23.183  -9.056  69.040  1.00 32.54  ? 331 LYS B NZ    1 
ATOM   7094  N  N     . GLN B  2 348 ? 21.972  -16.165 68.457  1.00 34.60  ? 332 GLN B N     1 
ATOM   7095  C  CA    . GLN B  2 348 ? 21.361  -16.740 69.647  1.00 39.26  ? 332 GLN B CA    1 
ATOM   7096  C  C     . GLN B  2 348 ? 21.848  -16.105 70.942  1.00 40.02  ? 332 GLN B C     1 
ATOM   7097  O  O     . GLN B  2 348 ? 21.302  -16.414 72.007  1.00 60.75  ? 332 GLN B O     1 
ATOM   7098  C  CB    . GLN B  2 348 ? 21.617  -18.252 69.698  1.00 44.65  ? 332 GLN B CB    1 
ATOM   7099  C  CG    . GLN B  2 348 ? 21.038  -19.027 68.519  1.00 51.50  ? 332 GLN B CG    1 
ATOM   7100  C  CD    . GLN B  2 348 ? 19.520  -19.106 68.548  1.00 49.54  ? 332 GLN B CD    1 
ATOM   7101  O  OE1   . GLN B  2 348 ? 18.883  -18.695 69.518  1.00 50.12  ? 332 GLN B OE1   1 
ATOM   7102  N  NE2   . GLN B  2 348 ? 18.936  -19.641 67.482  1.00 37.91  ? 332 GLN B NE2   1 
ATOM   7103  N  N     . GLY B  2 349 ? 22.844  -15.236 70.882  1.00 35.51  ? 333 GLY B N     1 
ATOM   7104  C  CA    . GLY B  2 349 ? 23.344  -14.597 72.089  1.00 35.96  ? 333 GLY B CA    1 
ATOM   7105  C  C     . GLY B  2 349 ? 24.426  -15.409 72.771  1.00 37.60  ? 333 GLY B C     1 
ATOM   7106  O  O     . GLY B  2 349 ? 24.504  -16.632 72.646  1.00 36.95  ? 333 GLY B O     1 
ATOM   7107  N  N     . GLN B  2 350 ? 25.285  -14.700 73.507  1.00 36.29  ? 334 GLN B N     1 
ATOM   7108  C  CA    . GLN B  2 350 ? 26.355  -15.312 74.299  1.00 36.95  ? 334 GLN B CA    1 
ATOM   7109  C  C     . GLN B  2 350 ? 27.294  -16.145 73.428  1.00 47.09  ? 334 GLN B C     1 
ATOM   7110  O  O     . GLN B  2 350 ? 27.702  -17.248 73.799  1.00 44.74  ? 334 GLN B O     1 
ATOM   7111  C  CB    . GLN B  2 350 ? 25.782  -16.153 75.444  1.00 38.95  ? 334 GLN B CB    1 
ATOM   7112  C  CG    . GLN B  2 350 ? 24.788  -15.405 76.316  1.00 50.58  ? 334 GLN B CG    1 
ATOM   7113  C  CD    . GLN B  2 350 ? 25.375  -14.140 76.913  1.00 72.70  ? 334 GLN B CD    1 
ATOM   7114  O  OE1   . GLN B  2 350 ? 26.487  -14.148 77.444  1.00 77.73  ? 334 GLN B OE1   1 
ATOM   7115  N  NE2   . GLN B  2 350 ? 24.631  -13.043 76.823  1.00 74.97  ? 334 GLN B NE2   1 
ATOM   7116  N  N     . GLY B  2 351 ? 27.641  -15.612 72.259  1.00 43.05  ? 335 GLY B N     1 
ATOM   7117  C  CA    . GLY B  2 351 ? 28.548  -16.284 71.353  1.00 34.21  ? 335 GLY B CA    1 
ATOM   7118  C  C     . GLY B  2 351 ? 27.948  -17.419 70.554  1.00 42.74  ? 335 GLY B C     1 
ATOM   7119  O  O     . GLY B  2 351 ? 28.685  -18.102 69.835  1.00 43.53  ? 335 GLY B O     1 
ATOM   7120  N  N     . GLN B  2 352 ? 26.639  -17.640 70.648  1.00 43.69  ? 336 GLN B N     1 
ATOM   7121  C  CA    . GLN B  2 352 ? 25.977  -18.750 69.977  1.00 39.30  ? 336 GLN B CA    1 
ATOM   7122  C  C     . GLN B  2 352 ? 25.366  -18.276 68.664  1.00 42.51  ? 336 GLN B C     1 
ATOM   7123  O  O     . GLN B  2 352 ? 24.660  -17.263 68.632  1.00 42.22  ? 336 GLN B O     1 
ATOM   7124  C  CB    . GLN B  2 352 ? 24.895  -19.356 70.872  1.00 47.02  ? 336 GLN B CB    1 
ATOM   7125  C  CG    . GLN B  2 352 ? 25.388  -19.814 72.236  1.00 62.30  ? 336 GLN B CG    1 
ATOM   7126  C  CD    . GLN B  2 352 ? 26.159  -21.118 72.174  1.00 81.69  ? 336 GLN B CD    1 
ATOM   7127  O  OE1   . GLN B  2 352 ? 26.178  -21.794 71.145  1.00 89.17  ? 336 GLN B OE1   1 
ATOM   7128  N  NE2   . GLN B  2 352 ? 26.797  -21.481 73.280  1.00 86.62  ? 336 GLN B NE2   1 
ATOM   7129  N  N     . TRP B  2 353 ? 25.638  -19.012 67.588  1.00 33.97  ? 337 TRP B N     1 
ATOM   7130  C  CA    . TRP B  2 353 ? 25.091  -18.709 66.269  1.00 36.57  ? 337 TRP B CA    1 
ATOM   7131  C  C     . TRP B  2 353 ? 24.657  -20.013 65.618  1.00 41.23  ? 337 TRP B C     1 
ATOM   7132  O  O     . TRP B  2 353 ? 25.465  -20.935 65.481  1.00 43.10  ? 337 TRP B O     1 
ATOM   7133  C  CB    . TRP B  2 353 ? 26.117  -17.986 65.389  1.00 31.97  ? 337 TRP B CB    1 
ATOM   7134  C  CG    . TRP B  2 353 ? 26.603  -16.686 65.961  1.00 35.08  ? 337 TRP B CG    1 
ATOM   7135  C  CD1   . TRP B  2 353 ? 27.512  -16.523 66.967  1.00 31.65  ? 337 TRP B CD1   1 
ATOM   7136  C  CD2   . TRP B  2 353 ? 26.214  -15.367 65.555  1.00 37.91  ? 337 TRP B CD2   1 
ATOM   7137  N  NE1   . TRP B  2 353 ? 27.708  -15.187 67.215  1.00 38.78  ? 337 TRP B NE1   1 
ATOM   7138  C  CE2   . TRP B  2 353 ? 26.925  -14.456 66.362  1.00 35.78  ? 337 TRP B CE2   1 
ATOM   7139  C  CE3   . TRP B  2 353 ? 25.335  -14.869 64.588  1.00 33.44  ? 337 TRP B CE3   1 
ATOM   7140  C  CZ2   . TRP B  2 353 ? 26.783  -13.076 66.232  1.00 30.14  ? 337 TRP B CZ2   1 
ATOM   7141  C  CZ3   . TRP B  2 353 ? 25.196  -13.497 64.462  1.00 30.11  ? 337 TRP B CZ3   1 
ATOM   7142  C  CH2   . TRP B  2 353 ? 25.916  -12.617 65.280  1.00 29.95  ? 337 TRP B CH2   1 
ATOM   7143  N  N     . THR B  2 354 ? 23.390  -20.090 65.226  1.00 40.45  ? 338 THR B N     1 
ATOM   7144  C  CA    . THR B  2 354 ? 22.848  -21.248 64.535  1.00 41.39  ? 338 THR B CA    1 
ATOM   7145  C  C     . THR B  2 354 ? 22.667  -20.931 63.056  1.00 46.89  ? 338 THR B C     1 
ATOM   7146  O  O     . THR B  2 354 ? 22.597  -19.767 62.653  1.00 33.02  ? 338 THR B O     1 
ATOM   7147  C  CB    . THR B  2 354 ? 21.509  -21.682 65.144  1.00 36.05  ? 338 THR B CB    1 
ATOM   7148  O  OG1   . THR B  2 354 ? 20.586  -20.586 65.105  1.00 35.77  ? 338 THR B OG1   1 
ATOM   7149  C  CG2   . THR B  2 354 ? 21.700  -22.129 66.583  1.00 37.25  ? 338 THR B CG2   1 
ATOM   7150  N  N     . TYR B  2 355 ? 22.593  -21.985 62.245  1.00 34.30  ? 339 TYR B N     1 
ATOM   7151  C  CA    . TYR B  2 355 ? 22.462  -21.800 60.808  1.00 37.15  ? 339 TYR B CA    1 
ATOM   7152  C  C     . TYR B  2 355 ? 21.826  -23.033 60.186  1.00 39.60  ? 339 TYR B C     1 
ATOM   7153  O  O     . TYR B  2 355 ? 21.906  -24.141 60.726  1.00 35.66  ? 339 TYR B O     1 
ATOM   7154  C  CB    . TYR B  2 355 ? 23.817  -21.507 60.150  1.00 34.65  ? 339 TYR B CB    1 
ATOM   7155  C  CG    . TYR B  2 355 ? 24.769  -22.682 60.144  1.00 43.10  ? 339 TYR B CG    1 
ATOM   7156  C  CD1   . TYR B  2 355 ? 25.626  -22.911 61.212  1.00 36.99  ? 339 TYR B CD1   1 
ATOM   7157  C  CD2   . TYR B  2 355 ? 24.814  -23.559 59.066  1.00 41.90  ? 339 TYR B CD2   1 
ATOM   7158  C  CE1   . TYR B  2 355 ? 26.499  -23.982 61.209  1.00 44.64  ? 339 TYR B CE1   1 
ATOM   7159  C  CE2   . TYR B  2 355 ? 25.681  -24.632 59.055  1.00 47.92  ? 339 TYR B CE2   1 
ATOM   7160  C  CZ    . TYR B  2 355 ? 26.521  -24.839 60.128  1.00 48.11  ? 339 TYR B CZ    1 
ATOM   7161  O  OH    . TYR B  2 355 ? 27.387  -25.908 60.120  1.00 46.31  ? 339 TYR B OH    1 
ATOM   7162  N  N     . GLN B  2 356 ? 21.193  -22.820 59.035  1.00 36.37  ? 340 GLN B N     1 
ATOM   7163  C  CA    . GLN B  2 356 ? 20.570  -23.890 58.267  1.00 35.51  ? 340 GLN B CA    1 
ATOM   7164  C  C     . GLN B  2 356 ? 20.883  -23.667 56.796  1.00 41.82  ? 340 GLN B C     1 
ATOM   7165  O  O     . GLN B  2 356 ? 20.778  -22.541 56.303  1.00 43.53  ? 340 GLN B O     1 
ATOM   7166  C  CB    . GLN B  2 356 ? 19.049  -23.932 58.478  1.00 41.72  ? 340 GLN B CB    1 
ATOM   7167  C  CG    . GLN B  2 356 ? 18.608  -24.087 59.927  1.00 42.04  ? 340 GLN B CG    1 
ATOM   7168  C  CD    . GLN B  2 356 ? 18.661  -22.781 60.697  1.00 41.51  ? 340 GLN B CD    1 
ATOM   7169  O  OE1   . GLN B  2 356 ? 18.311  -21.723 60.172  1.00 37.09  ? 340 GLN B OE1   1 
ATOM   7170  N  NE2   . GLN B  2 356 ? 19.115  -22.846 61.943  1.00 36.58  ? 340 GLN B NE2   1 
ATOM   7171  N  N     . ILE B  2 357 ? 21.275  -24.734 56.105  1.00 44.28  ? 341 ILE B N     1 
ATOM   7172  C  CA    . ILE B  2 357 ? 21.535  -24.703 54.670  1.00 44.38  ? 341 ILE B CA    1 
ATOM   7173  C  C     . ILE B  2 357 ? 20.441  -25.501 53.977  1.00 43.04  ? 341 ILE B C     1 
ATOM   7174  O  O     . ILE B  2 357 ? 20.196  -26.662 54.326  1.00 41.44  ? 341 ILE B O     1 
ATOM   7175  C  CB    . ILE B  2 357 ? 22.925  -25.266 54.330  1.00 41.07  ? 341 ILE B CB    1 
ATOM   7176  C  CG1   . ILE B  2 357 ? 24.006  -24.532 55.125  1.00 38.49  ? 341 ILE B CG1   1 
ATOM   7177  C  CG2   . ILE B  2 357 ? 23.194  -25.153 52.836  1.00 35.42  ? 341 ILE B CG2   1 
ATOM   7178  C  CD1   . ILE B  2 357 ? 25.398  -25.076 54.906  1.00 40.09  ? 341 ILE B CD1   1 
ATOM   7179  N  N     . TYR B  2 358 ? 19.785  -24.881 52.998  1.00 41.17  ? 342 TYR B N     1 
ATOM   7180  C  CA    . TYR B  2 358 ? 18.680  -25.525 52.308  1.00 37.19  ? 342 TYR B CA    1 
ATOM   7181  C  C     . TYR B  2 358 ? 18.587  -24.987 50.889  1.00 49.28  ? 342 TYR B C     1 
ATOM   7182  O  O     . TYR B  2 358 ? 19.174  -23.956 50.551  1.00 45.33  ? 342 TYR B O     1 
ATOM   7183  C  CB    . TYR B  2 358 ? 17.352  -25.306 53.046  1.00 37.66  ? 342 TYR B CB    1 
ATOM   7184  C  CG    . TYR B  2 358 ? 16.915  -23.857 53.106  1.00 41.10  ? 342 TYR B CG    1 
ATOM   7185  C  CD1   . TYR B  2 358 ? 17.368  -23.016 54.114  1.00 37.69  ? 342 TYR B CD1   1 
ATOM   7186  C  CD2   . TYR B  2 358 ? 16.049  -23.331 52.154  1.00 39.98  ? 342 TYR B CD2   1 
ATOM   7187  C  CE1   . TYR B  2 358 ? 16.973  -21.692 54.172  1.00 36.30  ? 342 TYR B CE1   1 
ATOM   7188  C  CE2   . TYR B  2 358 ? 15.650  -22.009 52.204  1.00 40.19  ? 342 TYR B CE2   1 
ATOM   7189  C  CZ    . TYR B  2 358 ? 16.114  -21.195 53.215  1.00 42.77  ? 342 TYR B CZ    1 
ATOM   7190  O  OH    . TYR B  2 358 ? 15.719  -19.879 53.269  1.00 42.43  ? 342 TYR B OH    1 
ATOM   7191  N  N     . GLN B  2 359 ? 17.841  -25.710 50.058  1.00 48.28  ? 343 GLN B N     1 
ATOM   7192  C  CA    . GLN B  2 359 ? 17.479  -25.267 48.718  1.00 46.06  ? 343 GLN B CA    1 
ATOM   7193  C  C     . GLN B  2 359 ? 15.993  -24.986 48.578  1.00 49.36  ? 343 GLN B C     1 
ATOM   7194  O  O     . GLN B  2 359 ? 15.608  -24.062 47.859  1.00 56.23  ? 343 GLN B O     1 
ATOM   7195  C  CB    . GLN B  2 359 ? 17.902  -26.313 47.682  1.00 41.87  ? 343 GLN B CB    1 
ATOM   7196  C  CG    . GLN B  2 359 ? 19.401  -26.544 47.636  1.00 38.97  ? 343 GLN B CG    1 
ATOM   7197  C  CD    . GLN B  2 359 ? 19.797  -27.643 46.670  1.00 42.17  ? 343 GLN B CD    1 
ATOM   7198  O  OE1   . GLN B  2 359 ? 19.195  -28.716 46.650  1.00 41.01  ? 343 GLN B OE1   1 
ATOM   7199  N  NE2   . GLN B  2 359 ? 20.812  -27.376 45.856  1.00 40.07  ? 343 GLN B NE2   1 
ATOM   7200  N  N     . GLU B  2 360 ? 15.153  -25.764 49.257  1.00 55.43  ? 344 GLU B N     1 
ATOM   7201  C  CA    . GLU B  2 360 ? 13.729  -25.522 49.383  1.00 56.79  ? 344 GLU B CA    1 
ATOM   7202  C  C     . GLU B  2 360 ? 13.385  -25.260 50.844  1.00 55.19  ? 344 GLU B C     1 
ATOM   7203  O  O     . GLU B  2 360 ? 14.018  -25.827 51.742  1.00 49.00  ? 344 GLU B O     1 
ATOM   7204  C  CB    . GLU B  2 360 ? 12.908  -26.713 48.870  1.00 55.58  ? 344 GLU B CB    1 
ATOM   7205  C  CG    . GLU B  2 360 ? 13.108  -27.023 47.394  1.00 67.33  ? 344 GLU B CG    1 
ATOM   7206  C  CD    . GLU B  2 360 ? 12.507  -25.967 46.483  1.00 82.52  ? 344 GLU B CD    1 
ATOM   7207  O  OE1   . GLU B  2 360 ? 11.674  -25.166 46.959  1.00 88.24  ? 344 GLU B OE1   1 
ATOM   7208  O  OE2   . GLU B  2 360 ? 12.869  -25.939 45.287  1.00 81.08  ? 344 GLU B OE2   1 
ATOM   7209  N  N     . PRO B  2 361 ? 12.404  -24.399 51.117  1.00 58.10  ? 345 PRO B N     1 
ATOM   7210  C  CA    . PRO B  2 361 ? 12.057  -24.096 52.511  1.00 51.30  ? 345 PRO B CA    1 
ATOM   7211  C  C     . PRO B  2 361 ? 11.642  -25.348 53.269  1.00 54.88  ? 345 PRO B C     1 
ATOM   7212  O  O     . PRO B  2 361 ? 10.965  -26.228 52.733  1.00 55.34  ? 345 PRO B O     1 
ATOM   7213  C  CB    . PRO B  2 361 ? 10.895  -23.105 52.380  1.00 56.42  ? 345 PRO B CB    1 
ATOM   7214  C  CG    . PRO B  2 361 ? 11.072  -22.495 51.030  1.00 52.52  ? 345 PRO B CG    1 
ATOM   7215  C  CD    . PRO B  2 361 ? 11.627  -23.587 50.165  1.00 56.66  ? 345 PRO B CD    1 
ATOM   7216  N  N     . PHE B  2 362 ? 12.074  -25.423 54.527  1.00 56.84  ? 346 PHE B N     1 
ATOM   7217  C  CA    . PHE B  2 362 ? 11.820  -26.542 55.431  1.00 55.17  ? 346 PHE B CA    1 
ATOM   7218  C  C     . PHE B  2 362 ? 12.397  -27.856 54.918  1.00 52.52  ? 346 PHE B C     1 
ATOM   7219  O  O     . PHE B  2 362 ? 12.034  -28.927 55.419  1.00 58.54  ? 346 PHE B O     1 
ATOM   7220  C  CB    . PHE B  2 362 ? 10.322  -26.693 55.719  1.00 60.70  ? 346 PHE B CB    1 
ATOM   7221  C  CG    . PHE B  2 362 ? 9.644   -25.394 56.047  1.00 67.03  ? 346 PHE B CG    1 
ATOM   7222  C  CD1   . PHE B  2 362 ? 9.841   -24.787 57.277  1.00 70.21  ? 346 PHE B CD1   1 
ATOM   7223  C  CD2   . PHE B  2 362 ? 8.823   -24.772 55.122  1.00 61.41  ? 346 PHE B CD2   1 
ATOM   7224  C  CE1   . PHE B  2 362 ? 9.225   -23.587 57.580  1.00 65.82  ? 346 PHE B CE1   1 
ATOM   7225  C  CE2   . PHE B  2 362 ? 8.205   -23.572 55.419  1.00 63.68  ? 346 PHE B CE2   1 
ATOM   7226  C  CZ    . PHE B  2 362 ? 8.406   -22.979 56.650  1.00 60.92  ? 346 PHE B CZ    1 
ATOM   7227  N  N     . LYS B  2 363 ? 13.287  -27.799 53.934  1.00 53.22  ? 347 LYS B N     1 
ATOM   7228  C  CA    . LYS B  2 363 ? 14.026  -28.958 53.442  1.00 49.70  ? 347 LYS B CA    1 
ATOM   7229  C  C     . LYS B  2 363 ? 15.512  -28.695 53.666  1.00 47.59  ? 347 LYS B C     1 
ATOM   7230  O  O     . LYS B  2 363 ? 16.283  -28.551 52.714  1.00 61.41  ? 347 LYS B O     1 
ATOM   7231  C  CB    . LYS B  2 363 ? 13.712  -29.224 51.963  1.00 59.41  ? 347 LYS B CB    1 
ATOM   7232  C  CG    . LYS B  2 363 ? 12.251  -29.526 51.680  1.00 64.18  ? 347 LYS B CG    1 
ATOM   7233  C  CD    . LYS B  2 363 ? 11.775  -30.723 52.485  1.00 78.31  ? 347 LYS B CD    1 
ATOM   7234  C  CE    . LYS B  2 363 ? 10.325  -31.060 52.181  1.00 82.62  ? 347 LYS B CE    1 
ATOM   7235  N  NZ    . LYS B  2 363 ? 9.836   -32.193 53.015  1.00 85.44  ? 347 LYS B NZ    1 
ATOM   7236  N  N     . ASN B  2 364 ? 15.908  -28.624 54.935  1.00 41.75  ? 348 ASN B N     1 
ATOM   7237  C  CA    . ASN B  2 364 ? 17.281  -28.283 55.283  1.00 40.13  ? 348 ASN B CA    1 
ATOM   7238  C  C     . ASN B  2 364 ? 18.216  -29.434 54.937  1.00 44.02  ? 348 ASN B C     1 
ATOM   7239  O  O     . ASN B  2 364 ? 18.018  -30.566 55.391  1.00 51.74  ? 348 ASN B O     1 
ATOM   7240  C  CB    . ASN B  2 364 ? 17.382  -27.944 56.768  1.00 40.06  ? 348 ASN B CB    1 
ATOM   7241  C  CG    . ASN B  2 364 ? 16.608  -26.697 57.134  1.00 46.01  ? 348 ASN B CG    1 
ATOM   7242  O  OD1   . ASN B  2 364 ? 16.517  -25.756 56.346  1.00 47.74  ? 348 ASN B OD1   1 
ATOM   7243  N  ND2   . ASN B  2 364 ? 16.043  -26.683 58.335  1.00 51.31  ? 348 ASN B ND2   1 
ATOM   7244  N  N     . LEU B  2 365 ? 19.237  -29.143 54.131  1.00 39.84  ? 349 LEU B N     1 
ATOM   7245  C  CA    . LEU B  2 365 ? 20.277  -30.122 53.850  1.00 40.42  ? 349 LEU B CA    1 
ATOM   7246  C  C     . LEU B  2 365 ? 21.277  -30.239 54.992  1.00 41.64  ? 349 LEU B C     1 
ATOM   7247  O  O     . LEU B  2 365 ? 21.938  -31.276 55.116  1.00 44.76  ? 349 LEU B O     1 
ATOM   7248  C  CB    . LEU B  2 365 ? 21.008  -29.756 52.556  1.00 39.85  ? 349 LEU B CB    1 
ATOM   7249  C  CG    . LEU B  2 365 ? 20.123  -29.537 51.327  1.00 48.49  ? 349 LEU B CG    1 
ATOM   7250  C  CD1   . LEU B  2 365 ? 20.952  -29.067 50.144  1.00 44.15  ? 349 LEU B CD1   1 
ATOM   7251  C  CD2   . LEU B  2 365 ? 19.356  -30.805 50.978  1.00 41.53  ? 349 LEU B CD2   1 
ATOM   7252  N  N     . LYS B  2 366 ? 21.395  -29.206 55.825  1.00 39.78  ? 350 LYS B N     1 
ATOM   7253  C  CA    . LYS B  2 366 ? 22.305  -29.221 56.960  1.00 45.73  ? 350 LYS B CA    1 
ATOM   7254  C  C     . LYS B  2 366 ? 21.907  -28.118 57.931  1.00 46.59  ? 350 LYS B C     1 
ATOM   7255  O  O     . LYS B  2 366 ? 21.547  -27.015 57.513  1.00 45.71  ? 350 LYS B O     1 
ATOM   7256  C  CB    . LYS B  2 366 ? 23.760  -29.037 56.511  1.00 45.71  ? 350 LYS B CB    1 
ATOM   7257  C  CG    . LYS B  2 366 ? 24.752  -28.939 57.658  1.00 52.24  ? 350 LYS B CG    1 
ATOM   7258  C  CD    . LYS B  2 366 ? 26.184  -28.927 57.159  1.00 57.12  ? 350 LYS B CD    1 
ATOM   7259  C  CE    . LYS B  2 366 ? 27.151  -28.678 58.302  1.00 61.73  ? 350 LYS B CE    1 
ATOM   7260  N  NZ    . LYS B  2 366 ? 26.935  -29.626 59.430  1.00 69.34  ? 350 LYS B NZ    1 
ATOM   7261  N  N     . THR B  2 367 ? 21.959  -28.433 59.225  1.00 41.11  ? 351 THR B N     1 
ATOM   7262  C  CA    . THR B  2 367 ? 21.761  -27.463 60.293  1.00 44.52  ? 351 THR B CA    1 
ATOM   7263  C  C     . THR B  2 367 ? 22.896  -27.607 61.294  1.00 50.11  ? 351 THR B C     1 
ATOM   7264  O  O     . THR B  2 367 ? 23.265  -28.726 61.663  1.00 54.37  ? 351 THR B O     1 
ATOM   7265  C  CB    . THR B  2 367 ? 20.417  -27.656 61.013  1.00 43.53  ? 351 THR B CB    1 
ATOM   7266  O  OG1   . THR B  2 367 ? 20.452  -28.867 61.778  1.00 45.03  ? 351 THR B OG1   1 
ATOM   7267  C  CG2   . THR B  2 367 ? 19.270  -27.727 60.014  1.00 39.88  ? 351 THR B CG2   1 
ATOM   7268  N  N     . GLY B  2 368 ? 23.446  -26.478 61.735  1.00 37.70  ? 352 GLY B N     1 
ATOM   7269  C  CA    . GLY B  2 368 ? 24.562  -26.505 62.655  1.00 45.55  ? 352 GLY B CA    1 
ATOM   7270  C  C     . GLY B  2 368 ? 24.539  -25.322 63.598  1.00 45.96  ? 352 GLY B C     1 
ATOM   7271  O  O     . GLY B  2 368 ? 23.659  -24.461 63.533  1.00 44.20  ? 352 GLY B O     1 
ATOM   7272  N  N     . LYS B  2 369 ? 25.529  -25.289 64.485  1.00 40.84  ? 353 LYS B N     1 
ATOM   7273  C  CA    . LYS B  2 369 ? 25.657  -24.205 65.446  1.00 41.89  ? 353 LYS B CA    1 
ATOM   7274  C  C     . LYS B  2 369 ? 27.131  -23.931 65.698  1.00 37.42  ? 353 LYS B C     1 
ATOM   7275  O  O     . LYS B  2 369 ? 27.927  -24.862 65.842  1.00 44.62  ? 353 LYS B O     1 
ATOM   7276  C  CB    . LYS B  2 369 ? 24.946  -24.534 66.764  1.00 38.30  ? 353 LYS B CB    1 
ATOM   7277  C  CG    . LYS B  2 369 ? 24.996  -23.411 67.789  1.00 48.97  ? 353 LYS B CG    1 
ATOM   7278  C  CD    . LYS B  2 369 ? 24.127  -23.722 68.996  1.00 52.63  ? 353 LYS B CD    1 
ATOM   7279  C  CE    . LYS B  2 369 ? 24.672  -24.895 69.792  1.00 51.21  ? 353 LYS B CE    1 
ATOM   7280  N  NZ    . LYS B  2 369 ? 25.971  -24.569 70.441  1.00 61.27  ? 353 LYS B NZ    1 
ATOM   7281  N  N     . TYR B  2 370 ? 27.482  -22.651 65.743  1.00 37.15  ? 354 TYR B N     1 
ATOM   7282  C  CA    . TYR B  2 370 ? 28.820  -22.201 66.085  1.00 38.91  ? 354 TYR B CA    1 
ATOM   7283  C  C     . TYR B  2 370 ? 28.800  -21.508 67.440  1.00 41.07  ? 354 TYR B C     1 
ATOM   7284  O  O     . TYR B  2 370 ? 27.827  -20.836 67.798  1.00 48.34  ? 354 TYR B O     1 
ATOM   7285  C  CB    . TYR B  2 370 ? 29.371  -21.245 65.024  1.00 33.71  ? 354 TYR B CB    1 
ATOM   7286  C  CG    . TYR B  2 370 ? 29.505  -21.851 63.646  1.00 39.35  ? 354 TYR B CG    1 
ATOM   7287  C  CD1   . TYR B  2 370 ? 29.900  -23.173 63.479  1.00 34.76  ? 354 TYR B CD1   1 
ATOM   7288  C  CD2   . TYR B  2 370 ? 29.235  -21.099 62.508  1.00 32.65  ? 354 TYR B CD2   1 
ATOM   7289  C  CE1   . TYR B  2 370 ? 30.022  -23.730 62.219  1.00 42.77  ? 354 TYR B CE1   1 
ATOM   7290  C  CE2   . TYR B  2 370 ? 29.354  -21.646 61.245  1.00 47.07  ? 354 TYR B CE2   1 
ATOM   7291  C  CZ    . TYR B  2 370 ? 29.748  -22.961 61.105  1.00 53.88  ? 354 TYR B CZ    1 
ATOM   7292  O  OH    . TYR B  2 370 ? 29.868  -23.509 59.848  1.00 56.91  ? 354 TYR B OH    1 
ATOM   7293  N  N     . ALA B  2 371 ? 29.885  -21.671 68.192  1.00 39.55  ? 355 ALA B N     1 
ATOM   7294  C  CA    . ALA B  2 371 ? 29.984  -21.064 69.510  1.00 41.56  ? 355 ALA B CA    1 
ATOM   7295  C  C     . ALA B  2 371 ? 31.431  -20.693 69.795  1.00 45.22  ? 355 ALA B C     1 
ATOM   7296  O  O     . ALA B  2 371 ? 32.361  -21.393 69.385  1.00 52.01  ? 355 ALA B O     1 
ATOM   7297  C  CB    . ALA B  2 371 ? 29.458  -21.998 70.604  1.00 38.11  ? 355 ALA B CB    1 
ATOM   7298  N  N     . ARG B  2 372 ? 31.600  -19.576 70.504  1.00 50.25  ? 356 ARG B N     1 
ATOM   7299  C  CA    . ARG B  2 372 ? 32.902  -19.126 70.998  1.00 35.98  ? 356 ARG B CA    1 
ATOM   7300  C  C     . ARG B  2 372 ? 33.897  -18.937 69.854  1.00 48.20  ? 356 ARG B C     1 
ATOM   7301  O  O     . ARG B  2 372 ? 35.048  -19.374 69.917  1.00 42.76  ? 356 ARG B O     1 
ATOM   7302  C  CB    . ARG B  2 372 ? 33.445  -20.092 72.054  1.00 37.81  ? 356 ARG B CB    1 
ATOM   7303  C  CG    . ARG B  2 372 ? 34.292  -19.427 73.125  1.00 53.63  ? 356 ARG B CG    1 
ATOM   7304  C  CD    . ARG B  2 372 ? 34.430  -20.321 74.347  1.00 58.95  ? 356 ARG B CD    1 
ATOM   7305  N  NE    . ARG B  2 372 ? 35.259  -21.493 74.086  1.00 56.00  ? 356 ARG B NE    1 
ATOM   7306  C  CZ    . ARG B  2 372 ? 35.378  -22.522 74.918  1.00 68.26  ? 356 ARG B CZ    1 
ATOM   7307  N  NH1   . ARG B  2 372 ? 34.711  -22.530 76.065  1.00 62.26  ? 356 ARG B NH1   1 
ATOM   7308  N  NH2   . ARG B  2 372 ? 36.157  -23.546 74.602  1.00 83.23  ? 356 ARG B NH2   1 
ATOM   7309  N  N     . MET B  2 373 ? 33.438  -18.278 68.793  1.00 48.56  ? 357 MET B N     1 
ATOM   7310  C  CA    . MET B  2 373 ? 34.311  -17.907 67.693  1.00 33.28  ? 357 MET B CA    1 
ATOM   7311  C  C     . MET B  2 373 ? 35.079  -16.637 68.052  1.00 45.43  ? 357 MET B C     1 
ATOM   7312  O  O     . MET B  2 373 ? 34.909  -16.059 69.129  1.00 53.59  ? 357 MET B O     1 
ATOM   7313  C  CB    . MET B  2 373 ? 33.502  -17.713 66.414  1.00 32.34  ? 357 MET B CB    1 
ATOM   7314  C  CG    . MET B  2 373 ? 32.705  -18.930 65.985  1.00 40.64  ? 357 MET B CG    1 
ATOM   7315  S  SD    . MET B  2 373 ? 31.701  -18.588 64.529  1.00 54.55  ? 357 MET B SD    1 
ATOM   7316  C  CE    . MET B  2 373 ? 30.644  -17.280 65.141  1.00 66.31  ? 357 MET B CE    1 
ATOM   7317  N  N     . ARG B  2 374 ? 35.937  -16.190 67.138  1.00 40.80  ? 358 ARG B N     1 
ATOM   7318  C  CA    . ARG B  2 374 ? 36.662  -14.948 67.363  1.00 33.92  ? 358 ARG B CA    1 
ATOM   7319  C  C     . ARG B  2 374 ? 35.686  -13.780 67.429  1.00 43.68  ? 358 ARG B C     1 
ATOM   7320  O  O     . ARG B  2 374 ? 34.720  -13.707 66.664  1.00 44.33  ? 358 ARG B O     1 
ATOM   7321  C  CB    . ARG B  2 374 ? 37.703  -14.726 66.262  1.00 33.31  ? 358 ARG B CB    1 
ATOM   7322  C  CG    . ARG B  2 374 ? 37.136  -14.512 64.866  1.00 31.55  ? 358 ARG B CG    1 
ATOM   7323  C  CD    . ARG B  2 374 ? 38.239  -14.566 63.818  1.00 51.23  ? 358 ARG B CD    1 
ATOM   7324  N  NE    . ARG B  2 374 ? 37.815  -14.016 62.534  1.00 58.26  ? 358 ARG B NE    1 
ATOM   7325  C  CZ    . ARG B  2 374 ? 38.221  -12.845 62.054  1.00 64.29  ? 358 ARG B CZ    1 
ATOM   7326  N  NH1   . ARG B  2 374 ? 39.070  -12.099 62.748  1.00 50.60  ? 358 ARG B NH1   1 
ATOM   7327  N  NH2   . ARG B  2 374 ? 37.783  -12.422 60.876  1.00 66.81  ? 358 ARG B NH2   1 
ATOM   7328  N  N     . GLY B  2 375 ? 35.930  -12.871 68.369  1.00 48.85  ? 359 GLY B N     1 
ATOM   7329  C  CA    . GLY B  2 375 ? 35.014  -11.777 68.605  1.00 43.88  ? 359 GLY B CA    1 
ATOM   7330  C  C     . GLY B  2 375 ? 33.848  -12.109 69.506  1.00 45.00  ? 359 GLY B C     1 
ATOM   7331  O  O     . GLY B  2 375 ? 32.949  -11.272 69.661  1.00 40.93  ? 359 GLY B O     1 
ATOM   7332  N  N     . ALA B  2 376 ? 33.829  -13.300 70.100  1.00 43.74  ? 360 ALA B N     1 
ATOM   7333  C  CA    . ALA B  2 376 ? 32.738  -13.677 70.987  1.00 39.24  ? 360 ALA B CA    1 
ATOM   7334  C  C     . ALA B  2 376 ? 32.677  -12.738 72.185  1.00 44.31  ? 360 ALA B C     1 
ATOM   7335  O  O     . ALA B  2 376 ? 33.705  -12.362 72.754  1.00 46.54  ? 360 ALA B O     1 
ATOM   7336  C  CB    . ALA B  2 376 ? 32.906  -15.123 71.453  1.00 36.26  ? 360 ALA B CB    1 
ATOM   7337  N  N     . HIS B  2 377 ? 31.454  -12.347 72.548  1.00 45.65  ? 361 HIS B N     1 
ATOM   7338  C  CA    . HIS B  2 377 ? 31.161  -11.473 73.681  1.00 40.46  ? 361 HIS B CA    1 
ATOM   7339  C  C     . HIS B  2 377 ? 31.705  -10.060 73.504  1.00 44.92  ? 361 HIS B C     1 
ATOM   7340  O  O     . HIS B  2 377 ? 31.828  -9.324  74.489  1.00 41.99  ? 361 HIS B O     1 
ATOM   7341  C  CB    . HIS B  2 377 ? 31.684  -12.061 74.998  1.00 34.62  ? 361 HIS B CB    1 
ATOM   7342  C  CG    . HIS B  2 377 ? 31.341  -13.505 75.192  1.00 42.04  ? 361 HIS B CG    1 
ATOM   7343  N  ND1   . HIS B  2 377 ? 30.090  -13.927 75.586  1.00 40.97  ? 361 HIS B ND1   1 
ATOM   7344  C  CD2   . HIS B  2 377 ? 32.088  -14.625 75.045  1.00 44.42  ? 361 HIS B CD2   1 
ATOM   7345  C  CE1   . HIS B  2 377 ? 30.080  -15.245 75.674  1.00 51.45  ? 361 HIS B CE1   1 
ATOM   7346  N  NE2   . HIS B  2 377 ? 31.280  -15.693 75.351  1.00 44.43  ? 361 HIS B NE2   1 
ATOM   7347  N  N     . THR B  2 378 ? 32.031  -9.647  72.277  1.00 39.87  ? 362 THR B N     1 
ATOM   7348  C  CA    . THR B  2 378 ? 32.514  -8.284  72.078  1.00 35.26  ? 362 THR B CA    1 
ATOM   7349  C  C     . THR B  2 378 ? 32.161  -7.709  70.708  1.00 32.98  ? 362 THR B C     1 
ATOM   7350  O  O     . THR B  2 378 ? 31.899  -6.507  70.597  1.00 42.48  ? 362 THR B O     1 
ATOM   7351  C  CB    . THR B  2 378 ? 34.031  -8.212  72.298  1.00 40.91  ? 362 THR B CB    1 
ATOM   7352  O  OG1   . THR B  2 378 ? 34.491  -6.881  72.029  1.00 38.90  ? 362 THR B OG1   1 
ATOM   7353  C  CG2   . THR B  2 378 ? 34.768  -9.193  71.396  1.00 46.86  ? 362 THR B CG2   1 
ATOM   7354  N  N     . ASN B  2 379 ? 32.146  -8.534  69.660  1.00 32.20  ? 363 ASN B N     1 
ATOM   7355  C  CA    . ASN B  2 379 ? 31.955  -8.032  68.300  1.00 33.47  ? 363 ASN B CA    1 
ATOM   7356  C  C     . ASN B  2 379 ? 31.014  -8.962  67.545  1.00 37.82  ? 363 ASN B C     1 
ATOM   7357  O  O     . ASN B  2 379 ? 31.393  -10.085 67.197  1.00 35.20  ? 363 ASN B O     1 
ATOM   7358  C  CB    . ASN B  2 379 ? 33.295  -7.902  67.571  1.00 30.68  ? 363 ASN B CB    1 
ATOM   7359  C  CG    . ASN B  2 379 ? 33.197  -7.065  66.304  1.00 41.13  ? 363 ASN B CG    1 
ATOM   7360  O  OD1   . ASN B  2 379 ? 32.182  -7.080  65.605  1.00 32.79  ? 363 ASN B OD1   1 
ATOM   7361  N  ND2   . ASN B  2 379 ? 34.260  -6.329  66.003  1.00 29.31  ? 363 ASN B ND2   1 
ATOM   7362  N  N     . ASP B  2 380 ? 29.795  -8.484  67.277  1.00 38.54  ? 364 ASP B N     1 
ATOM   7363  C  CA    . ASP B  2 380 ? 28.838  -9.269  66.504  1.00 38.46  ? 364 ASP B CA    1 
ATOM   7364  C  C     . ASP B  2 380 ? 29.282  -9.425  65.055  1.00 45.38  ? 364 ASP B C     1 
ATOM   7365  O  O     . ASP B  2 380 ? 29.114  -10.497 64.461  1.00 43.70  ? 364 ASP B O     1 
ATOM   7366  C  CB    . ASP B  2 380 ? 27.455  -8.620  66.558  1.00 51.41  ? 364 ASP B CB    1 
ATOM   7367  C  CG    . ASP B  2 380 ? 26.626  -9.102  67.729  1.00 47.93  ? 364 ASP B CG    1 
ATOM   7368  O  OD1   . ASP B  2 380 ? 26.889  -10.217 68.225  1.00 41.70  ? 364 ASP B OD1   1 
ATOM   7369  O  OD2   . ASP B  2 380 ? 25.704  -8.369  68.144  1.00 44.64  ? 364 ASP B OD2   1 
ATOM   7370  N  N     . VAL B  2 381 ? 29.845  -8.367  64.467  1.00 33.44  ? 365 VAL B N     1 
ATOM   7371  C  CA    . VAL B  2 381 ? 30.164  -8.395  63.043  1.00 37.27  ? 365 VAL B CA    1 
ATOM   7372  C  C     . VAL B  2 381 ? 31.320  -9.350  62.767  1.00 38.97  ? 365 VAL B C     1 
ATOM   7373  O  O     . VAL B  2 381 ? 31.322  -10.063 61.756  1.00 43.04  ? 365 VAL B O     1 
ATOM   7374  C  CB    . VAL B  2 381 ? 30.460  -6.973  62.533  1.00 38.54  ? 365 VAL B CB    1 
ATOM   7375  C  CG1   . VAL B  2 381 ? 30.857  -7.008  61.066  1.00 43.42  ? 365 VAL B CG1   1 
ATOM   7376  C  CG2   . VAL B  2 381 ? 29.245  -6.081  62.732  1.00 29.11  ? 365 VAL B CG2   1 
ATOM   7377  N  N     . LYS B  2 382 ? 32.318  -9.387  63.654  1.00 37.87  ? 366 LYS B N     1 
ATOM   7378  C  CA    . LYS B  2 382 ? 33.414  -10.334 63.472  1.00 38.51  ? 366 LYS B CA    1 
ATOM   7379  C  C     . LYS B  2 382 ? 32.923  -11.772 63.583  1.00 37.17  ? 366 LYS B C     1 
ATOM   7380  O  O     . LYS B  2 382 ? 33.333  -12.637 62.800  1.00 34.65  ? 366 LYS B O     1 
ATOM   7381  C  CB    . LYS B  2 382 ? 34.526  -10.071 64.487  1.00 32.43  ? 366 LYS B CB    1 
ATOM   7382  C  CG    . LYS B  2 382 ? 35.698  -11.038 64.356  1.00 41.05  ? 366 LYS B CG    1 
ATOM   7383  C  CD    . LYS B  2 382 ? 36.727  -10.862 65.462  1.00 38.30  ? 366 LYS B CD    1 
ATOM   7384  C  CE    . LYS B  2 382 ? 37.497  -9.563  65.314  1.00 34.17  ? 366 LYS B CE    1 
ATOM   7385  N  NZ    . LYS B  2 382 ? 38.618  -9.472  66.290  1.00 31.01  ? 366 LYS B NZ    1 
ATOM   7386  N  N     . GLN B  2 383 ? 32.043  -12.047 64.549  1.00 35.28  ? 367 GLN B N     1 
ATOM   7387  C  CA    . GLN B  2 383 ? 31.478  -13.387 64.680  1.00 29.36  ? 367 GLN B CA    1 
ATOM   7388  C  C     . GLN B  2 383 ? 30.645  -13.751 63.460  1.00 34.32  ? 367 GLN B C     1 
ATOM   7389  O  O     . GLN B  2 383 ? 30.786  -14.845 62.901  1.00 34.38  ? 367 GLN B O     1 
ATOM   7390  C  CB    . GLN B  2 383 ? 30.628  -13.478 65.945  1.00 29.68  ? 367 GLN B CB    1 
ATOM   7391  C  CG    . GLN B  2 383 ? 31.407  -13.396 67.237  1.00 33.94  ? 367 GLN B CG    1 
ATOM   7392  C  CD    . GLN B  2 383 ? 30.493  -13.256 68.430  1.00 39.18  ? 367 GLN B CD    1 
ATOM   7393  O  OE1   . GLN B  2 383 ? 30.113  -14.244 69.057  1.00 46.30  ? 367 GLN B OE1   1 
ATOM   7394  N  NE2   . GLN B  2 383 ? 30.124  -12.021 68.745  1.00 36.44  ? 367 GLN B NE2   1 
ATOM   7395  N  N     . LEU B  2 384 ? 29.759  -12.845 63.040  1.00 35.93  ? 368 LEU B N     1 
ATOM   7396  C  CA    . LEU B  2 384 ? 28.939  -13.105 61.862  1.00 43.16  ? 368 LEU B CA    1 
ATOM   7397  C  C     . LEU B  2 384 ? 29.805  -13.320 60.628  1.00 37.50  ? 368 LEU B C     1 
ATOM   7398  O  O     . LEU B  2 384 ? 29.526  -14.205 59.811  1.00 35.16  ? 368 LEU B O     1 
ATOM   7399  C  CB    . LEU B  2 384 ? 27.957  -11.955 61.640  1.00 29.73  ? 368 LEU B CB    1 
ATOM   7400  C  CG    . LEU B  2 384 ? 27.002  -12.125 60.458  1.00 28.89  ? 368 LEU B CG    1 
ATOM   7401  C  CD1   . LEU B  2 384 ? 26.216  -13.420 60.591  1.00 29.17  ? 368 LEU B CD1   1 
ATOM   7402  C  CD2   . LEU B  2 384 ? 26.065  -10.932 60.346  1.00 29.08  ? 368 LEU B CD2   1 
ATOM   7403  N  N     . THR B  2 385 ? 30.865  -12.521 60.480  1.00 31.92  ? 369 THR B N     1 
ATOM   7404  C  CA    . THR B  2 385 ? 31.804  -12.725 59.381  1.00 35.04  ? 369 THR B CA    1 
ATOM   7405  C  C     . THR B  2 385 ? 32.429  -14.113 59.450  1.00 40.45  ? 369 THR B C     1 
ATOM   7406  O  O     . THR B  2 385 ? 32.493  -14.830 58.444  1.00 38.45  ? 369 THR B O     1 
ATOM   7407  C  CB    . THR B  2 385 ? 32.887  -11.646 59.410  1.00 37.50  ? 369 THR B CB    1 
ATOM   7408  O  OG1   . THR B  2 385 ? 32.291  -10.360 59.197  1.00 54.27  ? 369 THR B OG1   1 
ATOM   7409  C  CG2   . THR B  2 385 ? 33.929  -11.901 58.331  1.00 49.51  ? 369 THR B CG2   1 
ATOM   7410  N  N     . GLU B  2 386 ? 32.888  -14.512 60.639  1.00 31.63  ? 370 GLU B N     1 
ATOM   7411  C  CA    . GLU B  2 386 ? 33.483  -15.835 60.803  1.00 30.28  ? 370 GLU B CA    1 
ATOM   7412  C  C     . GLU B  2 386 ? 32.481  -16.935 60.480  1.00 42.38  ? 370 GLU B C     1 
ATOM   7413  O  O     . GLU B  2 386 ? 32.825  -17.926 59.826  1.00 47.87  ? 370 GLU B O     1 
ATOM   7414  C  CB    . GLU B  2 386 ? 34.012  -16.000 62.228  1.00 30.56  ? 370 GLU B CB    1 
ATOM   7415  C  CG    . GLU B  2 386 ? 34.653  -17.355 62.504  1.00 38.55  ? 370 GLU B CG    1 
ATOM   7416  C  CD    . GLU B  2 386 ? 36.021  -17.498 61.861  1.00 45.96  ? 370 GLU B CD    1 
ATOM   7417  O  OE1   . GLU B  2 386 ? 36.608  -16.466 61.475  1.00 47.55  ? 370 GLU B OE1   1 
ATOM   7418  O  OE2   . GLU B  2 386 ? 36.510  -18.642 61.743  1.00 57.71  ? 370 GLU B OE2   1 
ATOM   7419  N  N     . ALA B  2 387 ? 31.233  -16.778 60.930  1.00 34.71  ? 371 ALA B N     1 
ATOM   7420  C  CA    . ALA B  2 387 ? 30.218  -17.792 60.667  1.00 33.45  ? 371 ALA B CA    1 
ATOM   7421  C  C     . ALA B  2 387 ? 29.951  -17.932 59.174  1.00 40.52  ? 371 ALA B C     1 
ATOM   7422  O  O     . ALA B  2 387 ? 29.830  -19.051 58.661  1.00 37.37  ? 371 ALA B O     1 
ATOM   7423  C  CB    . ALA B  2 387 ? 28.929  -17.454 61.416  1.00 30.20  ? 371 ALA B CB    1 
ATOM   7424  N  N     . VAL B  2 388 ? 29.860  -16.807 58.459  1.00 29.97  ? 372 VAL B N     1 
ATOM   7425  C  CA    . VAL B  2 388 ? 29.646  -16.855 57.014  1.00 38.23  ? 372 VAL B CA    1 
ATOM   7426  C  C     . VAL B  2 388 ? 30.785  -17.600 56.330  1.00 39.80  ? 372 VAL B C     1 
ATOM   7427  O  O     . VAL B  2 388 ? 30.560  -18.428 55.438  1.00 47.89  ? 372 VAL B O     1 
ATOM   7428  C  CB    . VAL B  2 388 ? 29.482  -15.431 56.451  1.00 38.03  ? 372 VAL B CB    1 
ATOM   7429  C  CG1   . VAL B  2 388 ? 29.526  -15.447 54.930  1.00 37.10  ? 372 VAL B CG1   1 
ATOM   7430  C  CG2   . VAL B  2 388 ? 28.183  -14.815 56.941  1.00 33.54  ? 372 VAL B CG2   1 
ATOM   7431  N  N     . GLN B  2 389 ? 32.025  -17.330 56.746  1.00 36.48  ? 373 GLN B N     1 
ATOM   7432  C  CA    . GLN B  2 389 ? 33.171  -18.000 56.140  1.00 35.65  ? 373 GLN B CA    1 
ATOM   7433  C  C     . GLN B  2 389 ? 33.169  -19.493 56.445  1.00 36.25  ? 373 GLN B C     1 
ATOM   7434  O  O     . GLN B  2 389 ? 33.491  -20.310 55.574  1.00 44.60  ? 373 GLN B O     1 
ATOM   7435  C  CB    . GLN B  2 389 ? 34.470  -17.355 56.623  1.00 31.99  ? 373 GLN B CB    1 
ATOM   7436  C  CG    . GLN B  2 389 ? 34.642  -15.905 56.198  1.00 42.11  ? 373 GLN B CG    1 
ATOM   7437  C  CD    . GLN B  2 389 ? 35.899  -15.280 56.768  1.00 59.51  ? 373 GLN B CD    1 
ATOM   7438  O  OE1   . GLN B  2 389 ? 36.261  -14.157 56.422  1.00 67.06  ? 373 GLN B OE1   1 
ATOM   7439  N  NE2   . GLN B  2 389 ? 36.574  -16.009 57.650  1.00 61.87  ? 373 GLN B NE2   1 
ATOM   7440  N  N     . LYS B  2 390 ? 32.809  -19.869 57.675  1.00 36.12  ? 374 LYS B N     1 
ATOM   7441  C  CA    . LYS B  2 390 ? 32.762  -21.283 58.033  1.00 33.88  ? 374 LYS B CA    1 
ATOM   7442  C  C     . LYS B  2 390 ? 31.698  -22.018 57.227  1.00 35.54  ? 374 LYS B C     1 
ATOM   7443  O  O     . LYS B  2 390 ? 31.939  -23.115 56.712  1.00 36.96  ? 374 LYS B O     1 
ATOM   7444  C  CB    . LYS B  2 390 ? 32.501  -21.439 59.531  1.00 37.46  ? 374 LYS B CB    1 
ATOM   7445  C  CG    . LYS B  2 390 ? 33.644  -20.993 60.424  1.00 47.78  ? 374 LYS B CG    1 
ATOM   7446  C  CD    . LYS B  2 390 ? 33.403  -21.420 61.864  1.00 51.28  ? 374 LYS B CD    1 
ATOM   7447  C  CE    . LYS B  2 390 ? 34.610  -21.126 62.736  1.00 69.81  ? 374 LYS B CE    1 
ATOM   7448  N  NZ    . LYS B  2 390 ? 34.436  -21.655 64.116  1.00 87.42  ? 374 LYS B NZ    1 
ATOM   7449  N  N     . ILE B  2 391 ? 30.508  -21.422 57.109  1.00 36.86  ? 375 ILE B N     1 
ATOM   7450  C  CA    . ILE B  2 391 ? 29.418  -22.061 56.377  1.00 38.85  ? 375 ILE B CA    1 
ATOM   7451  C  C     . ILE B  2 391 ? 29.779  -22.211 54.905  1.00 43.67  ? 375 ILE B C     1 
ATOM   7452  O  O     . ILE B  2 391 ? 29.509  -23.249 54.287  1.00 35.69  ? 375 ILE B O     1 
ATOM   7453  C  CB    . ILE B  2 391 ? 28.115  -21.262 56.563  1.00 38.36  ? 375 ILE B CB    1 
ATOM   7454  C  CG1   . ILE B  2 391 ? 27.683  -21.286 58.030  1.00 40.28  ? 375 ILE B CG1   1 
ATOM   7455  C  CG2   . ILE B  2 391 ? 27.014  -21.809 55.666  1.00 32.50  ? 375 ILE B CG2   1 
ATOM   7456  C  CD1   . ILE B  2 391 ? 26.696  -20.203 58.387  1.00 31.42  ? 375 ILE B CD1   1 
ATOM   7457  N  N     . THR B  2 392 ? 30.396  -21.181 54.322  1.00 32.96  ? 376 THR B N     1 
ATOM   7458  C  CA    . THR B  2 392 ? 30.797  -21.258 52.921  1.00 37.83  ? 376 THR B CA    1 
ATOM   7459  C  C     . THR B  2 392 ? 31.836  -22.350 52.704  1.00 44.27  ? 376 THR B C     1 
ATOM   7460  O  O     . THR B  2 392 ? 31.753  -23.112 51.734  1.00 50.57  ? 376 THR B O     1 
ATOM   7461  C  CB    . THR B  2 392 ? 31.337  -19.908 52.453  1.00 39.23  ? 376 THR B CB    1 
ATOM   7462  O  OG1   . THR B  2 392 ? 30.336  -18.900 52.638  1.00 32.52  ? 376 THR B OG1   1 
ATOM   7463  C  CG2   . THR B  2 392 ? 31.715  -19.972 50.984  1.00 38.20  ? 376 THR B CG2   1 
ATOM   7464  N  N     . THR B  2 393 ? 32.818  -22.444 53.603  1.00 42.61  ? 377 THR B N     1 
ATOM   7465  C  CA    . THR B  2 393 ? 33.828  -23.492 53.496  1.00 41.02  ? 377 THR B CA    1 
ATOM   7466  C  C     . THR B  2 393 ? 33.195  -24.877 53.552  1.00 49.07  ? 377 THR B C     1 
ATOM   7467  O  O     . THR B  2 393 ? 33.579  -25.776 52.793  1.00 60.52  ? 377 THR B O     1 
ATOM   7468  C  CB    . THR B  2 393 ? 34.868  -23.330 54.606  1.00 40.35  ? 377 THR B CB    1 
ATOM   7469  O  OG1   . THR B  2 393 ? 35.569  -22.093 54.430  1.00 45.22  ? 377 THR B OG1   1 
ATOM   7470  C  CG2   . THR B  2 393 ? 35.863  -24.478 54.584  1.00 37.97  ? 377 THR B CG2   1 
ATOM   7471  N  N     . GLU B  2 394 ? 32.217  -25.065 54.441  1.00 51.29  ? 378 GLU B N     1 
ATOM   7472  C  CA    . GLU B  2 394 ? 31.526  -26.348 54.517  1.00 49.44  ? 378 GLU B CA    1 
ATOM   7473  C  C     . GLU B  2 394 ? 30.754  -26.636 53.236  1.00 47.90  ? 378 GLU B C     1 
ATOM   7474  O  O     . GLU B  2 394 ? 30.763  -27.768 52.740  1.00 49.75  ? 378 GLU B O     1 
ATOM   7475  C  CB    . GLU B  2 394 ? 30.589  -26.370 55.724  1.00 43.25  ? 378 GLU B CB    1 
ATOM   7476  C  CG    . GLU B  2 394 ? 31.299  -26.274 57.061  1.00 58.18  ? 378 GLU B CG    1 
ATOM   7477  C  CD    . GLU B  2 394 ? 30.334  -26.175 58.225  1.00 61.15  ? 378 GLU B CD    1 
ATOM   7478  O  OE1   . GLU B  2 394 ? 30.802  -26.071 59.379  1.00 58.92  ? 378 GLU B OE1   1 
ATOM   7479  O  OE2   . GLU B  2 394 ? 29.109  -26.200 57.985  1.00 54.39  ? 378 GLU B OE2   1 
ATOM   7480  N  N     . SER B  2 395 ? 30.088  -25.621 52.681  1.00 41.68  ? 379 SER B N     1 
ATOM   7481  C  CA    . SER B  2 395 ? 29.317  -25.823 51.459  1.00 43.44  ? 379 SER B CA    1 
ATOM   7482  C  C     . SER B  2 395 ? 30.209  -26.154 50.269  1.00 47.47  ? 379 SER B C     1 
ATOM   7483  O  O     . SER B  2 395 ? 29.808  -26.931 49.395  1.00 44.07  ? 379 SER B O     1 
ATOM   7484  C  CB    . SER B  2 395 ? 28.476  -24.583 51.161  1.00 42.06  ? 379 SER B CB    1 
ATOM   7485  O  OG    . SER B  2 395 ? 27.685  -24.223 52.281  1.00 57.41  ? 379 SER B OG    1 
ATOM   7486  N  N     . ILE B  2 396 ? 31.412  -25.576 50.212  1.00 43.31  ? 380 ILE B N     1 
ATOM   7487  C  CA    . ILE B  2 396 ? 32.344  -25.903 49.137  1.00 44.80  ? 380 ILE B CA    1 
ATOM   7488  C  C     . ILE B  2 396 ? 32.807  -27.350 49.258  1.00 53.41  ? 380 ILE B C     1 
ATOM   7489  O  O     . ILE B  2 396 ? 32.979  -28.049 48.252  1.00 50.68  ? 380 ILE B O     1 
ATOM   7490  C  CB    . ILE B  2 396 ? 33.529  -24.920 49.149  1.00 40.96  ? 380 ILE B CB    1 
ATOM   7491  C  CG1   . ILE B  2 396 ? 33.039  -23.494 48.886  1.00 38.13  ? 380 ILE B CG1   1 
ATOM   7492  C  CG2   . ILE B  2 396 ? 34.581  -25.320 48.118  1.00 45.67  ? 380 ILE B CG2   1 
ATOM   7493  C  CD1   . ILE B  2 396 ? 34.075  -22.425 49.171  1.00 39.15  ? 380 ILE B CD1   1 
ATOM   7494  N  N     . VAL B  2 397 ? 33.003  -27.827 50.489  1.00 43.93  ? 381 VAL B N     1 
ATOM   7495  C  CA    . VAL B  2 397 ? 33.478  -29.192 50.694  1.00 45.04  ? 381 VAL B CA    1 
ATOM   7496  C  C     . VAL B  2 397 ? 32.364  -30.199 50.428  1.00 42.74  ? 381 VAL B C     1 
ATOM   7497  O  O     . VAL B  2 397 ? 32.597  -31.260 49.836  1.00 58.18  ? 381 VAL B O     1 
ATOM   7498  C  CB    . VAL B  2 397 ? 34.053  -29.341 52.116  1.00 42.27  ? 381 VAL B CB    1 
ATOM   7499  C  CG1   . VAL B  2 397 ? 34.224  -30.808 52.481  1.00 44.00  ? 381 VAL B CG1   1 
ATOM   7500  C  CG2   . VAL B  2 397 ? 35.382  -28.607 52.230  1.00 42.39  ? 381 VAL B CG2   1 
ATOM   7501  N  N     . ILE B  2 398 ? 31.138  -29.883 50.846  1.00 41.56  ? 382 ILE B N     1 
ATOM   7502  C  CA    . ILE B  2 398 ? 30.051  -30.853 50.766  1.00 47.61  ? 382 ILE B CA    1 
ATOM   7503  C  C     . ILE B  2 398 ? 29.430  -30.870 49.374  1.00 44.86  ? 382 ILE B C     1 
ATOM   7504  O  O     . ILE B  2 398 ? 29.191  -31.937 48.799  1.00 45.06  ? 382 ILE B O     1 
ATOM   7505  C  CB    . ILE B  2 398 ? 28.996  -30.563 51.850  1.00 48.82  ? 382 ILE B CB    1 
ATOM   7506  C  CG1   . ILE B  2 398 ? 29.626  -30.648 53.241  1.00 48.64  ? 382 ILE B CG1   1 
ATOM   7507  C  CG2   . ILE B  2 398 ? 27.842  -31.545 51.745  1.00 41.93  ? 382 ILE B CG2   1 
ATOM   7508  C  CD1   . ILE B  2 398 ? 28.721  -30.159 54.351  1.00 51.20  ? 382 ILE B CD1   1 
ATOM   7509  N  N     . TRP B  2 399 ? 29.157  -29.694 48.807  1.00 41.31  ? 383 TRP B N     1 
ATOM   7510  C  CA    . TRP B  2 399 ? 28.443  -29.605 47.542  1.00 49.47  ? 383 TRP B CA    1 
ATOM   7511  C  C     . TRP B  2 399 ? 29.223  -28.922 46.428  1.00 48.28  ? 383 TRP B C     1 
ATOM   7512  O  O     . TRP B  2 399 ? 28.828  -29.044 45.262  1.00 45.48  ? 383 TRP B O     1 
ATOM   7513  C  CB    . TRP B  2 399 ? 27.107  -28.870 47.733  1.00 40.40  ? 383 TRP B CB    1 
ATOM   7514  C  CG    . TRP B  2 399 ? 26.225  -29.484 48.777  1.00 43.31  ? 383 TRP B CG    1 
ATOM   7515  C  CD1   . TRP B  2 399 ? 25.505  -30.638 48.666  1.00 44.91  ? 383 TRP B CD1   1 
ATOM   7516  C  CD2   . TRP B  2 399 ? 25.960  -28.971 50.089  1.00 49.43  ? 383 TRP B CD2   1 
ATOM   7517  N  NE1   . TRP B  2 399 ? 24.812  -30.878 49.828  1.00 43.53  ? 383 TRP B NE1   1 
ATOM   7518  C  CE2   . TRP B  2 399 ? 25.073  -29.869 50.717  1.00 45.64  ? 383 TRP B CE2   1 
ATOM   7519  C  CE3   . TRP B  2 399 ? 26.390  -27.843 50.795  1.00 51.86  ? 383 TRP B CE3   1 
ATOM   7520  C  CZ2   . TRP B  2 399 ? 24.609  -29.673 52.017  1.00 39.38  ? 383 TRP B CZ2   1 
ATOM   7521  C  CZ3   . TRP B  2 399 ? 25.927  -27.649 52.084  1.00 42.93  ? 383 TRP B CZ3   1 
ATOM   7522  C  CH2   . TRP B  2 399 ? 25.047  -28.561 52.682  1.00 50.44  ? 383 TRP B CH2   1 
ATOM   7523  N  N     . GLY B  2 400 ? 30.305  -28.214 46.740  1.00 49.41  ? 384 GLY B N     1 
ATOM   7524  C  CA    . GLY B  2 400 ? 31.031  -27.481 45.723  1.00 42.08  ? 384 GLY B CA    1 
ATOM   7525  C  C     . GLY B  2 400 ? 30.397  -26.176 45.307  1.00 53.48  ? 384 GLY B C     1 
ATOM   7526  O  O     . GLY B  2 400 ? 30.716  -25.658 44.231  1.00 56.47  ? 384 GLY B O     1 
ATOM   7527  N  N     . LYS B  2 401 ? 29.500  -25.628 46.124  1.00 50.91  ? 385 LYS B N     1 
ATOM   7528  C  CA    . LYS B  2 401 ? 28.832  -24.366 45.843  1.00 52.27  ? 385 LYS B CA    1 
ATOM   7529  C  C     . LYS B  2 401 ? 28.956  -23.449 47.050  1.00 50.80  ? 385 LYS B C     1 
ATOM   7530  O  O     . LYS B  2 401 ? 29.126  -23.907 48.181  1.00 56.56  ? 385 LYS B O     1 
ATOM   7531  C  CB    . LYS B  2 401 ? 27.345  -24.561 45.519  1.00 47.37  ? 385 LYS B CB    1 
ATOM   7532  C  CG    . LYS B  2 401 ? 27.044  -25.131 44.149  1.00 53.23  ? 385 LYS B CG    1 
ATOM   7533  C  CD    . LYS B  2 401 ? 25.539  -25.220 43.944  1.00 58.48  ? 385 LYS B CD    1 
ATOM   7534  C  CE    . LYS B  2 401 ? 25.188  -25.726 42.559  1.00 64.35  ? 385 LYS B CE    1 
ATOM   7535  N  NZ    . LYS B  2 401 ? 23.716  -25.864 42.389  1.00 68.02  ? 385 LYS B NZ    1 
ATOM   7536  N  N     . THR B  2 402 ? 28.872  -22.148 46.797  1.00 46.35  ? 386 THR B N     1 
ATOM   7537  C  CA    . THR B  2 402 ? 28.737  -21.219 47.908  1.00 49.30  ? 386 THR B CA    1 
ATOM   7538  C  C     . THR B  2 402 ? 27.280  -20.819 48.043  1.00 48.64  ? 386 THR B C     1 
ATOM   7539  O  O     . THR B  2 402 ? 26.635  -20.505 47.033  1.00 49.72  ? 386 THR B O     1 
ATOM   7540  C  CB    . THR B  2 402 ? 29.598  -19.977 47.702  1.00 44.41  ? 386 THR B CB    1 
ATOM   7541  O  OG1   . THR B  2 402 ? 29.131  -19.254 46.552  1.00 58.31  ? 386 THR B OG1   1 
ATOM   7542  C  CG2   . THR B  2 402 ? 31.050  -20.362 47.497  1.00 40.79  ? 386 THR B CG2   1 
ATOM   7543  N  N     . PRO B  2 403 ? 26.718  -20.833 49.246  1.00 45.01  ? 387 PRO B N     1 
ATOM   7544  C  CA    . PRO B  2 403 ? 25.310  -20.467 49.407  1.00 43.04  ? 387 PRO B CA    1 
ATOM   7545  C  C     . PRO B  2 403 ? 25.118  -18.958 49.402  1.00 38.49  ? 387 PRO B C     1 
ATOM   7546  O  O     . PRO B  2 403 ? 26.042  -18.181 49.650  1.00 46.01  ? 387 PRO B O     1 
ATOM   7547  C  CB    . PRO B  2 403 ? 24.952  -21.058 50.775  1.00 33.60  ? 387 PRO B CB    1 
ATOM   7548  C  CG    . PRO B  2 403 ? 26.237  -20.996 51.532  1.00 40.47  ? 387 PRO B CG    1 
ATOM   7549  C  CD    . PRO B  2 403 ? 27.337  -21.232 50.522  1.00 39.92  ? 387 PRO B CD    1 
ATOM   7550  N  N     . LYS B  2 404 ? 23.888  -18.553 49.105  1.00 34.45  ? 388 LYS B N     1 
ATOM   7551  C  CA    . LYS B  2 404 ? 23.475  -17.168 49.276  1.00 41.29  ? 388 LYS B CA    1 
ATOM   7552  C  C     . LYS B  2 404 ? 22.975  -16.996 50.705  1.00 41.11  ? 388 LYS B C     1 
ATOM   7553  O  O     . LYS B  2 404 ? 22.055  -17.702 51.135  1.00 45.71  ? 388 LYS B O     1 
ATOM   7554  C  CB    . LYS B  2 404 ? 22.393  -16.776 48.271  1.00 41.68  ? 388 LYS B CB    1 
ATOM   7555  C  CG    . LYS B  2 404 ? 21.995  -15.310 48.359  1.00 62.34  ? 388 LYS B CG    1 
ATOM   7556  C  CD    . LYS B  2 404 ? 21.071  -14.903 47.223  1.00 74.13  ? 388 LYS B CD    1 
ATOM   7557  C  CE    . LYS B  2 404 ? 20.731  -13.422 47.303  1.00 70.78  ? 388 LYS B CE    1 
ATOM   7558  N  NZ    . LYS B  2 404 ? 19.831  -12.988 46.199  1.00 75.32  ? 388 LYS B NZ    1 
ATOM   7559  N  N     . PHE B  2 405 ? 23.584  -16.072 51.438  1.00 33.69  ? 389 PHE B N     1 
ATOM   7560  C  CA    . PHE B  2 405 ? 23.311  -15.919 52.858  1.00 37.68  ? 389 PHE B CA    1 
ATOM   7561  C  C     . PHE B  2 405 ? 22.184  -14.925 53.101  1.00 44.36  ? 389 PHE B C     1 
ATOM   7562  O  O     . PHE B  2 405 ? 22.054  -13.923 52.394  1.00 43.08  ? 389 PHE B O     1 
ATOM   7563  C  CB    . PHE B  2 405 ? 24.569  -15.463 53.599  1.00 31.04  ? 389 PHE B CB    1 
ATOM   7564  C  CG    . PHE B  2 405 ? 25.597  -16.540 53.758  1.00 38.92  ? 389 PHE B CG    1 
ATOM   7565  C  CD1   . PHE B  2 405 ? 26.520  -16.789 52.757  1.00 37.07  ? 389 PHE B CD1   1 
ATOM   7566  C  CD2   . PHE B  2 405 ? 25.640  -17.308 54.909  1.00 36.32  ? 389 PHE B CD2   1 
ATOM   7567  C  CE1   . PHE B  2 405 ? 27.465  -17.782 52.900  1.00 38.26  ? 389 PHE B CE1   1 
ATOM   7568  C  CE2   . PHE B  2 405 ? 26.585  -18.303 55.059  1.00 43.11  ? 389 PHE B CE2   1 
ATOM   7569  C  CZ    . PHE B  2 405 ? 27.499  -18.540 54.053  1.00 40.61  ? 389 PHE B CZ    1 
ATOM   7570  N  N     . LYS B  2 406 ? 21.368  -15.218 54.106  1.00 36.35  ? 390 LYS B N     1 
ATOM   7571  C  CA    . LYS B  2 406 ? 20.387  -14.277 54.637  1.00 36.80  ? 390 LYS B CA    1 
ATOM   7572  C  C     . LYS B  2 406 ? 20.925  -13.817 55.988  1.00 33.48  ? 390 LYS B C     1 
ATOM   7573  O  O     . LYS B  2 406 ? 20.790  -14.518 56.994  1.00 45.74  ? 390 LYS B O     1 
ATOM   7574  C  CB    . LYS B  2 406 ? 19.009  -14.920 54.752  1.00 32.88  ? 390 LYS B CB    1 
ATOM   7575  C  CG    . LYS B  2 406 ? 18.386  -15.267 53.409  1.00 45.54  ? 390 LYS B CG    1 
ATOM   7576  C  CD    . LYS B  2 406 ? 16.991  -15.847 53.570  1.00 49.81  ? 390 LYS B CD    1 
ATOM   7577  C  CE    . LYS B  2 406 ? 16.347  -16.104 52.218  1.00 55.68  ? 390 LYS B CE    1 
ATOM   7578  N  NZ    . LYS B  2 406 ? 14.953  -16.613 52.346  1.00 74.42  ? 390 LYS B NZ    1 
ATOM   7579  N  N     . LEU B  2 407 ? 21.545  -12.641 56.001  1.00 36.56  ? 391 LEU B N     1 
ATOM   7580  C  CA    . LEU B  2 407 ? 22.288  -12.160 57.162  1.00 38.40  ? 391 LEU B CA    1 
ATOM   7581  C  C     . LEU B  2 407 ? 21.361  -11.439 58.132  1.00 37.28  ? 391 LEU B C     1 
ATOM   7582  O  O     . LEU B  2 407 ? 20.628  -10.531 57.720  1.00 47.39  ? 391 LEU B O     1 
ATOM   7583  C  CB    . LEU B  2 407 ? 23.405  -11.222 56.731  1.00 30.44  ? 391 LEU B CB    1 
ATOM   7584  C  CG    . LEU B  2 407 ? 24.420  -11.818 55.757  1.00 30.32  ? 391 LEU B CG    1 
ATOM   7585  C  CD1   . LEU B  2 407 ? 25.497  -10.800 55.421  1.00 44.71  ? 391 LEU B CD1   1 
ATOM   7586  C  CD2   . LEU B  2 407 ? 25.028  -13.081 56.339  1.00 29.93  ? 391 LEU B CD2   1 
ATOM   7587  N  N     . PRO B  2 408 ? 21.365  -11.808 59.415  1.00 35.24  ? 392 PRO B N     1 
ATOM   7588  C  CA    . PRO B  2 408 ? 20.582  -11.070 60.428  1.00 34.76  ? 392 PRO B CA    1 
ATOM   7589  C  C     . PRO B  2 408 ? 21.307  -9.811  60.888  1.00 36.87  ? 392 PRO B C     1 
ATOM   7590  O  O     . PRO B  2 408 ? 21.846  -9.716  61.996  1.00 34.06  ? 392 PRO B O     1 
ATOM   7591  C  CB    . PRO B  2 408 ? 20.431  -12.110 61.543  1.00 37.56  ? 392 PRO B CB    1 
ATOM   7592  C  CG    . PRO B  2 408 ? 21.695  -12.904 61.461  1.00 32.04  ? 392 PRO B CG    1 
ATOM   7593  C  CD    . PRO B  2 408 ? 22.044  -12.983 59.990  1.00 33.33  ? 392 PRO B CD    1 
ATOM   7594  N  N     . ILE B  2 409 ? 21.329  -8.806  60.013  1.00 35.42  ? 393 ILE B N     1 
ATOM   7595  C  CA    . ILE B  2 409 ? 22.066  -7.576  60.273  1.00 35.50  ? 393 ILE B CA    1 
ATOM   7596  C  C     . ILE B  2 409 ? 21.536  -6.506  59.333  1.00 36.97  ? 393 ILE B C     1 
ATOM   7597  O  O     . ILE B  2 409 ? 20.994  -6.810  58.267  1.00 39.08  ? 393 ILE B O     1 
ATOM   7598  C  CB    . ILE B  2 409 ? 23.592  -7.798  60.097  1.00 37.50  ? 393 ILE B CB    1 
ATOM   7599  C  CG1   . ILE B  2 409 ? 24.391  -6.617  60.654  1.00 33.72  ? 393 ILE B CG1   1 
ATOM   7600  C  CG2   . ILE B  2 409 ? 23.933  -8.030  58.634  1.00 34.71  ? 393 ILE B CG2   1 
ATOM   7601  C  CD1   . ILE B  2 409 ? 25.890  -6.793  60.541  1.00 30.66  ? 393 ILE B CD1   1 
ATOM   7602  N  N     . GLN B  2 410 ? 21.683  -5.247  59.736  1.00 38.75  ? 394 GLN B N     1 
ATOM   7603  C  CA    . GLN B  2 410 ? 21.337  -4.140  58.858  1.00 40.55  ? 394 GLN B CA    1 
ATOM   7604  C  C     . GLN B  2 410 ? 22.395  -3.984  57.773  1.00 48.75  ? 394 GLN B C     1 
ATOM   7605  O  O     . GLN B  2 410 ? 23.584  -4.224  58.003  1.00 53.27  ? 394 GLN B O     1 
ATOM   7606  C  CB    . GLN B  2 410 ? 21.199  -2.844  59.656  1.00 38.84  ? 394 GLN B CB    1 
ATOM   7607  C  CG    . GLN B  2 410 ? 19.997  -2.818  60.585  1.00 62.50  ? 394 GLN B CG    1 
ATOM   7608  C  CD    . GLN B  2 410 ? 18.682  -2.945  59.838  1.00 84.86  ? 394 GLN B CD    1 
ATOM   7609  O  OE1   . GLN B  2 410 ? 18.427  -2.215  58.879  1.00 92.20  ? 394 GLN B OE1   1 
ATOM   7610  N  NE2   . GLN B  2 410 ? 17.842  -3.879  60.271  1.00 82.98  ? 394 GLN B NE2   1 
ATOM   7611  N  N     . LYS B  2 411 ? 21.950  -3.584  56.580  1.00 45.68  ? 395 LYS B N     1 
ATOM   7612  C  CA    . LYS B  2 411 ? 22.851  -3.475  55.436  1.00 49.07  ? 395 LYS B CA    1 
ATOM   7613  C  C     . LYS B  2 411 ? 24.008  -2.527  55.729  1.00 43.33  ? 395 LYS B C     1 
ATOM   7614  O  O     . LYS B  2 411 ? 25.171  -2.846  55.455  1.00 45.90  ? 395 LYS B O     1 
ATOM   7615  C  CB    . LYS B  2 411 ? 22.067  -3.015  54.205  1.00 51.79  ? 395 LYS B CB    1 
ATOM   7616  C  CG    . LYS B  2 411 ? 22.905  -2.781  52.960  1.00 51.75  ? 395 LYS B CG    1 
ATOM   7617  C  CD    . LYS B  2 411 ? 22.013  -2.420  51.781  1.00 56.64  ? 395 LYS B CD    1 
ATOM   7618  C  CE    . LYS B  2 411 ? 22.814  -2.193  50.510  1.00 62.95  ? 395 LYS B CE    1 
ATOM   7619  N  NZ    . LYS B  2 411 ? 23.690  -0.992  50.604  1.00 77.39  ? 395 LYS B NZ    1 
ATOM   7620  N  N     . GLU B  2 412 ? 23.709  -1.359  56.303  1.00 35.12  ? 396 GLU B N     1 
ATOM   7621  C  CA    . GLU B  2 412 ? 24.753  -0.370  56.557  1.00 51.61  ? 396 GLU B CA    1 
ATOM   7622  C  C     . GLU B  2 412 ? 25.747  -0.858  57.606  1.00 51.03  ? 396 GLU B C     1 
ATOM   7623  O  O     . GLU B  2 412 ? 26.943  -0.555  57.518  1.00 53.02  ? 396 GLU B O     1 
ATOM   7624  C  CB    . GLU B  2 412 ? 24.129  0.959   56.988  1.00 56.30  ? 396 GLU B CB    1 
ATOM   7625  C  CG    . GLU B  2 412 ? 23.376  1.687   55.882  1.00 70.89  ? 396 GLU B CG    1 
ATOM   7626  C  CD    . GLU B  2 412 ? 21.986  1.127   55.649  1.00 88.08  ? 396 GLU B CD    1 
ATOM   7627  O  OE1   . GLU B  2 412 ? 21.514  0.337   56.494  1.00 95.26  ? 396 GLU B OE1   1 
ATOM   7628  O  OE2   . GLU B  2 412 ? 21.367  1.478   54.622  1.00 100.38 ? 396 GLU B OE2   1 
ATOM   7629  N  N     . THR B  2 413 ? 25.274  -1.611  58.604  1.00 46.33  ? 397 THR B N     1 
ATOM   7630  C  CA    . THR B  2 413 ? 26.179  -2.143  59.620  1.00 43.84  ? 397 THR B CA    1 
ATOM   7631  C  C     . THR B  2 413 ? 27.147  -3.150  59.012  1.00 38.77  ? 397 THR B C     1 
ATOM   7632  O  O     . THR B  2 413 ? 28.354  -3.113  59.278  1.00 50.54  ? 397 THR B O     1 
ATOM   7633  C  CB    . THR B  2 413 ? 25.380  -2.789  60.756  1.00 41.29  ? 397 THR B CB    1 
ATOM   7634  O  OG1   . THR B  2 413 ? 24.478  -1.829  61.319  1.00 51.44  ? 397 THR B OG1   1 
ATOM   7635  C  CG2   . THR B  2 413 ? 26.315  -3.302  61.847  1.00 30.95  ? 397 THR B CG2   1 
ATOM   7636  N  N     . TRP B  2 414 ? 26.628  -4.055  58.180  1.00 38.10  ? 398 TRP B N     1 
ATOM   7637  C  CA    . TRP B  2 414 ? 27.470  -5.066  57.551  1.00 37.99  ? 398 TRP B CA    1 
ATOM   7638  C  C     . TRP B  2 414 ? 28.451  -4.435  56.569  1.00 39.62  ? 398 TRP B C     1 
ATOM   7639  O  O     . TRP B  2 414 ? 29.651  -4.730  56.601  1.00 35.76  ? 398 TRP B O     1 
ATOM   7640  C  CB    . TRP B  2 414 ? 26.588  -6.105  56.855  1.00 30.93  ? 398 TRP B CB    1 
ATOM   7641  C  CG    . TRP B  2 414 ? 27.343  -7.173  56.119  1.00 39.10  ? 398 TRP B CG    1 
ATOM   7642  C  CD1   . TRP B  2 414 ? 27.524  -7.268  54.770  1.00 33.99  ? 398 TRP B CD1   1 
ATOM   7643  C  CD2   . TRP B  2 414 ? 28.013  -8.303  56.693  1.00 31.92  ? 398 TRP B CD2   1 
ATOM   7644  N  NE1   . TRP B  2 414 ? 28.264  -8.385  54.468  1.00 42.96  ? 398 TRP B NE1   1 
ATOM   7645  C  CE2   . TRP B  2 414 ? 28.577  -9.038  55.632  1.00 39.27  ? 398 TRP B CE2   1 
ATOM   7646  C  CE3   . TRP B  2 414 ? 28.190  -8.764  58.001  1.00 38.12  ? 398 TRP B CE3   1 
ATOM   7647  C  CZ2   . TRP B  2 414 ? 29.306  -10.207 55.838  1.00 31.47  ? 398 TRP B CZ2   1 
ATOM   7648  C  CZ3   . TRP B  2 414 ? 28.915  -9.924  58.203  1.00 33.91  ? 398 TRP B CZ3   1 
ATOM   7649  C  CH2   . TRP B  2 414 ? 29.464  -10.632 57.128  1.00 35.63  ? 398 TRP B CH2   1 
ATOM   7650  N  N     . GLU B  2 415 ? 27.962  -3.547  55.700  1.00 41.93  ? 399 GLU B N     1 
ATOM   7651  C  CA    . GLU B  2 415 ? 28.805  -2.944  54.674  1.00 52.63  ? 399 GLU B CA    1 
ATOM   7652  C  C     . GLU B  2 415 ? 29.854  -1.994  55.237  1.00 54.11  ? 399 GLU B C     1 
ATOM   7653  O  O     . GLU B  2 415 ? 30.761  -1.596  54.498  1.00 55.03  ? 399 GLU B O     1 
ATOM   7654  C  CB    . GLU B  2 415 ? 27.940  -2.208  53.649  1.00 47.42  ? 399 GLU B CB    1 
ATOM   7655  C  CG    . GLU B  2 415 ? 27.051  -3.125  52.829  1.00 51.82  ? 399 GLU B CG    1 
ATOM   7656  C  CD    . GLU B  2 415 ? 26.398  -2.416  51.659  1.00 63.22  ? 399 GLU B CD    1 
ATOM   7657  O  OE1   . GLU B  2 415 ? 26.361  -1.168  51.661  1.00 64.30  ? 399 GLU B OE1   1 
ATOM   7658  O  OE2   . GLU B  2 415 ? 25.927  -3.112  50.735  1.00 69.81  ? 399 GLU B OE2   1 
ATOM   7659  N  N     . THR B  2 416 ? 29.759  -1.622  56.512  1.00 46.06  ? 400 THR B N     1 
ATOM   7660  C  CA    . THR B  2 416 ? 30.777  -0.764  57.106  1.00 43.20  ? 400 THR B CA    1 
ATOM   7661  C  C     . THR B  2 416 ? 31.966  -1.563  57.627  1.00 43.30  ? 400 THR B C     1 
ATOM   7662  O  O     . THR B  2 416 ? 33.105  -1.087  57.554  1.00 51.01  ? 400 THR B O     1 
ATOM   7663  C  CB    . THR B  2 416 ? 30.168  0.069   58.241  1.00 46.00  ? 400 THR B CB    1 
ATOM   7664  O  OG1   . THR B  2 416 ? 29.075  0.846   57.736  1.00 51.81  ? 400 THR B OG1   1 
ATOM   7665  C  CG2   . THR B  2 416 ? 31.205  1.008   58.849  1.00 42.09  ? 400 THR B CG2   1 
ATOM   7666  N  N     . TRP B  2 417 ? 31.735  -2.782  58.123  1.00 35.63  ? 401 TRP B N     1 
ATOM   7667  C  CA    . TRP B  2 417 ? 32.741  -3.492  58.898  1.00 35.41  ? 401 TRP B CA    1 
ATOM   7668  C  C     . TRP B  2 417 ? 33.181  -4.835  58.331  1.00 38.27  ? 401 TRP B C     1 
ATOM   7669  O  O     . TRP B  2 417 ? 34.218  -5.346  58.769  1.00 44.73  ? 401 TRP B O     1 
ATOM   7670  C  CB    . TRP B  2 417 ? 32.239  -3.737  60.331  1.00 46.56  ? 401 TRP B CB    1 
ATOM   7671  C  CG    . TRP B  2 417 ? 31.709  -2.522  61.018  1.00 50.04  ? 401 TRP B CG    1 
ATOM   7672  C  CD1   . TRP B  2 417 ? 30.413  -2.279  61.374  1.00 55.70  ? 401 TRP B CD1   1 
ATOM   7673  C  CD2   . TRP B  2 417 ? 32.462  -1.383  61.440  1.00 39.25  ? 401 TRP B CD2   1 
ATOM   7674  N  NE1   . TRP B  2 417 ? 30.314  -1.057  61.992  1.00 47.16  ? 401 TRP B NE1   1 
ATOM   7675  C  CE2   . TRP B  2 417 ? 31.558  -0.486  62.044  1.00 44.86  ? 401 TRP B CE2   1 
ATOM   7676  C  CE3   . TRP B  2 417 ? 33.813  -1.033  61.366  1.00 44.55  ? 401 TRP B CE3   1 
ATOM   7677  C  CZ2   . TRP B  2 417 ? 31.961  0.736   62.567  1.00 57.22  ? 401 TRP B CZ2   1 
ATOM   7678  C  CZ3   . TRP B  2 417 ? 34.211  0.180   61.889  1.00 63.33  ? 401 TRP B CZ3   1 
ATOM   7679  C  CH2   . TRP B  2 417 ? 33.289  1.049   62.483  1.00 68.35  ? 401 TRP B CH2   1 
ATOM   7680  N  N     . TRP B  2 418 ? 32.441  -5.428  57.390  1.00 33.47  ? 402 TRP B N     1 
ATOM   7681  C  CA    . TRP B  2 418 ? 32.685  -6.832  57.063  1.00 38.17  ? 402 TRP B CA    1 
ATOM   7682  C  C     . TRP B  2 418 ? 34.056  -7.038  56.425  1.00 38.27  ? 402 TRP B C     1 
ATOM   7683  O  O     . TRP B  2 418 ? 34.712  -8.056  56.677  1.00 38.85  ? 402 TRP B O     1 
ATOM   7684  C  CB    . TRP B  2 418 ? 31.574  -7.376  56.162  1.00 32.40  ? 402 TRP B CB    1 
ATOM   7685  C  CG    . TRP B  2 418 ? 31.634  -6.954  54.722  1.00 41.38  ? 402 TRP B CG    1 
ATOM   7686  C  CD1   . TRP B  2 418 ? 31.047  -5.856  54.164  1.00 48.05  ? 402 TRP B CD1   1 
ATOM   7687  C  CD2   . TRP B  2 418 ? 32.291  -7.644  53.651  1.00 38.08  ? 402 TRP B CD2   1 
ATOM   7688  N  NE1   . TRP B  2 418 ? 31.308  -5.812  52.817  1.00 45.63  ? 402 TRP B NE1   1 
ATOM   7689  C  CE2   . TRP B  2 418 ? 32.069  -6.898  52.476  1.00 44.08  ? 402 TRP B CE2   1 
ATOM   7690  C  CE3   . TRP B  2 418 ? 33.051  -8.815  53.573  1.00 39.33  ? 402 TRP B CE3   1 
ATOM   7691  C  CZ2   . TRP B  2 418 ? 32.580  -7.285  51.239  1.00 48.10  ? 402 TRP B CZ2   1 
ATOM   7692  C  CZ3   . TRP B  2 418 ? 33.556  -9.197  52.344  1.00 33.22  ? 402 TRP B CZ3   1 
ATOM   7693  C  CH2   . TRP B  2 418 ? 33.319  -8.435  51.194  1.00 43.32  ? 402 TRP B CH2   1 
ATOM   7694  N  N     . THR B  2 419 ? 34.517  -6.084  55.612  1.00 40.79  ? 403 THR B N     1 
ATOM   7695  C  CA    . THR B  2 419 ? 35.830  -6.225  54.990  1.00 42.62  ? 403 THR B CA    1 
ATOM   7696  C  C     . THR B  2 419 ? 36.963  -6.194  56.008  1.00 42.25  ? 403 THR B C     1 
ATOM   7697  O  O     . THR B  2 419 ? 38.045  -6.719  55.727  1.00 57.76  ? 403 THR B O     1 
ATOM   7698  C  CB    . THR B  2 419 ? 36.053  -5.129  53.946  1.00 44.96  ? 403 THR B CB    1 
ATOM   7699  O  OG1   . THR B  2 419 ? 35.872  -3.841  54.548  1.00 45.72  ? 403 THR B OG1   1 
ATOM   7700  C  CG2   . THR B  2 419 ? 35.082  -5.289  52.789  1.00 43.10  ? 403 THR B CG2   1 
ATOM   7701  N  N     . GLU B  2 420 ? 36.740  -5.593  57.181  1.00 43.73  ? 404 GLU B N     1 
ATOM   7702  C  CA    . GLU B  2 420 ? 37.774  -5.559  58.210  1.00 37.95  ? 404 GLU B CA    1 
ATOM   7703  C  C     . GLU B  2 420 ? 38.091  -6.947  58.747  1.00 39.55  ? 404 GLU B C     1 
ATOM   7704  O  O     . GLU B  2 420 ? 39.201  -7.180  59.240  1.00 37.65  ? 404 GLU B O     1 
ATOM   7705  C  CB    . GLU B  2 420 ? 37.347  -4.641  59.356  1.00 37.01  ? 404 GLU B CB    1 
ATOM   7706  C  CG    . GLU B  2 420 ? 37.657  -3.174  59.133  1.00 51.18  ? 404 GLU B CG    1 
ATOM   7707  C  CD    . GLU B  2 420 ? 39.134  -2.926  58.906  1.00 62.96  ? 404 GLU B CD    1 
ATOM   7708  O  OE1   . GLU B  2 420 ? 39.546  -2.807  57.732  1.00 75.57  ? 404 GLU B OE1   1 
ATOM   7709  O  OE2   . GLU B  2 420 ? 39.887  -2.862  59.900  1.00 68.70  ? 404 GLU B OE2   1 
ATOM   7710  N  N     . TYR B  2 421 ? 37.144  -7.876  58.660  1.00 43.58  ? 405 TYR B N     1 
ATOM   7711  C  CA    . TYR B  2 421 ? 37.293  -9.188  59.266  1.00 41.12  ? 405 TYR B CA    1 
ATOM   7712  C  C     . TYR B  2 421 ? 37.312  -10.321 58.252  1.00 36.01  ? 405 TYR B C     1 
ATOM   7713  O  O     . TYR B  2 421 ? 37.468  -11.482 58.649  1.00 45.11  ? 405 TYR B O     1 
ATOM   7714  C  CB    . TYR B  2 421 ? 36.171  -9.418  60.286  1.00 36.01  ? 405 TYR B CB    1 
ATOM   7715  C  CG    . TYR B  2 421 ? 35.989  -8.247  61.222  1.00 35.51  ? 405 TYR B CG    1 
ATOM   7716  C  CD1   . TYR B  2 421 ? 36.954  -7.939  62.172  1.00 32.99  ? 405 TYR B CD1   1 
ATOM   7717  C  CD2   . TYR B  2 421 ? 34.860  -7.441  61.148  1.00 40.52  ? 405 TYR B CD2   1 
ATOM   7718  C  CE1   . TYR B  2 421 ? 36.797  -6.866  63.026  1.00 37.41  ? 405 TYR B CE1   1 
ATOM   7719  C  CE2   . TYR B  2 421 ? 34.696  -6.365  61.998  1.00 29.60  ? 405 TYR B CE2   1 
ATOM   7720  C  CZ    . TYR B  2 421 ? 35.667  -6.083  62.935  1.00 41.37  ? 405 TYR B CZ    1 
ATOM   7721  O  OH    . TYR B  2 421 ? 35.507  -5.013  63.784  1.00 53.73  ? 405 TYR B OH    1 
ATOM   7722  N  N     . TRP B  2 422 ? 37.171  -10.025 56.964  1.00 43.27  ? 406 TRP B N     1 
ATOM   7723  C  CA    . TRP B  2 422 ? 37.149  -11.076 55.956  1.00 33.17  ? 406 TRP B CA    1 
ATOM   7724  C  C     . TRP B  2 422 ? 38.550  -11.640 55.748  1.00 36.34  ? 406 TRP B C     1 
ATOM   7725  O  O     . TRP B  2 422 ? 39.518  -10.889 55.592  1.00 39.26  ? 406 TRP B O     1 
ATOM   7726  C  CB    . TRP B  2 422 ? 36.591  -10.541 54.640  1.00 32.91  ? 406 TRP B CB    1 
ATOM   7727  C  CG    . TRP B  2 422 ? 36.135  -11.628 53.730  1.00 40.93  ? 406 TRP B CG    1 
ATOM   7728  C  CD1   . TRP B  2 422 ? 36.797  -12.126 52.647  1.00 36.15  ? 406 TRP B CD1   1 
ATOM   7729  C  CD2   . TRP B  2 422 ? 34.917  -12.372 53.835  1.00 39.52  ? 406 TRP B CD2   1 
ATOM   7730  N  NE1   . TRP B  2 422 ? 36.062  -13.130 52.065  1.00 37.56  ? 406 TRP B NE1   1 
ATOM   7731  C  CE2   . TRP B  2 422 ? 34.903  -13.300 52.776  1.00 37.62  ? 406 TRP B CE2   1 
ATOM   7732  C  CE3   . TRP B  2 422 ? 33.835  -12.342 54.720  1.00 34.32  ? 406 TRP B CE3   1 
ATOM   7733  C  CZ2   . TRP B  2 422 ? 33.850  -14.188 52.577  1.00 36.70  ? 406 TRP B CZ2   1 
ATOM   7734  C  CZ3   . TRP B  2 422 ? 32.791  -13.224 54.521  1.00 33.52  ? 406 TRP B CZ3   1 
ATOM   7735  C  CH2   . TRP B  2 422 ? 32.805  -14.135 53.459  1.00 32.71  ? 406 TRP B CH2   1 
ATOM   7736  N  N     . GLN B  2 423 ? 38.654  -12.971 55.743  1.00 37.66  ? 407 GLN B N     1 
ATOM   7737  C  CA    . GLN B  2 423 ? 39.939  -13.648 55.621  1.00 37.93  ? 407 GLN B CA    1 
ATOM   7738  C  C     . GLN B  2 423 ? 39.938  -14.705 54.522  1.00 40.34  ? 407 GLN B C     1 
ATOM   7739  O  O     . GLN B  2 423 ? 40.854  -15.536 54.479  1.00 51.61  ? 407 GLN B O     1 
ATOM   7740  C  CB    . GLN B  2 423 ? 40.333  -14.291 56.957  1.00 40.12  ? 407 GLN B CB    1 
ATOM   7741  C  CG    . GLN B  2 423 ? 40.366  -13.322 58.131  1.00 42.76  ? 407 GLN B CG    1 
ATOM   7742  C  CD    . GLN B  2 423 ? 40.420  -14.029 59.472  1.00 45.84  ? 407 GLN B CD    1 
ATOM   7743  O  OE1   . GLN B  2 423 ? 39.663  -14.966 59.724  1.00 48.60  ? 407 GLN B OE1   1 
ATOM   7744  N  NE2   . GLN B  2 423 ? 41.320  -13.581 60.341  1.00 42.49  ? 407 GLN B NE2   1 
ATOM   7745  N  N     . ALA B  2 424 ? 38.943  -14.701 53.639  1.00 38.91  ? 408 ALA B N     1 
ATOM   7746  C  CA    . ALA B  2 424 ? 38.831  -15.677 52.565  1.00 43.08  ? 408 ALA B CA    1 
ATOM   7747  C  C     . ALA B  2 424 ? 39.057  -15.009 51.216  1.00 45.90  ? 408 ALA B C     1 
ATOM   7748  O  O     . ALA B  2 424 ? 38.882  -13.798 51.059  1.00 53.47  ? 408 ALA B O     1 
ATOM   7749  C  CB    . ALA B  2 424 ? 37.461  -16.365 52.586  1.00 35.44  ? 408 ALA B CB    1 
ATOM   7750  N  N     . THR B  2 425 ? 39.447  -15.820 50.236  1.00 43.22  ? 409 THR B N     1 
ATOM   7751  C  CA    . THR B  2 425 ? 39.721  -15.329 48.892  1.00 51.98  ? 409 THR B CA    1 
ATOM   7752  C  C     . THR B  2 425 ? 38.498  -15.376 47.983  1.00 47.69  ? 409 THR B C     1 
ATOM   7753  O  O     . THR B  2 425 ? 38.571  -14.898 46.845  1.00 51.94  ? 409 THR B O     1 
ATOM   7754  C  CB    . THR B  2 425 ? 40.870  -16.123 48.260  1.00 52.10  ? 409 THR B CB    1 
ATOM   7755  O  OG1   . THR B  2 425 ? 40.462  -17.480 48.051  1.00 56.16  ? 409 THR B OG1   1 
ATOM   7756  C  CG2   . THR B  2 425 ? 42.087  -16.101 49.174  1.00 42.58  ? 409 THR B CG2   1 
ATOM   7757  N  N     . TRP B  2 426 ? 37.387  -15.937 48.449  1.00 42.08  ? 410 TRP B N     1 
ATOM   7758  C  CA    . TRP B  2 426 ? 36.110  -15.866 47.756  1.00 43.20  ? 410 TRP B CA    1 
ATOM   7759  C  C     . TRP B  2 426 ? 35.134  -15.018 48.562  1.00 48.15  ? 410 TRP B C     1 
ATOM   7760  O  O     . TRP B  2 426 ? 35.365  -14.699 49.731  1.00 48.47  ? 410 TRP B O     1 
ATOM   7761  C  CB    . TRP B  2 426 ? 35.531  -17.267 47.512  1.00 46.95  ? 410 TRP B CB    1 
ATOM   7762  C  CG    . TRP B  2 426 ? 35.855  -18.275 48.577  1.00 46.25  ? 410 TRP B CG    1 
ATOM   7763  C  CD1   . TRP B  2 426 ? 36.681  -19.352 48.454  1.00 43.89  ? 410 TRP B CD1   1 
ATOM   7764  C  CD2   . TRP B  2 426 ? 35.359  -18.302 49.923  1.00 45.61  ? 410 TRP B CD2   1 
ATOM   7765  N  NE1   . TRP B  2 426 ? 36.732  -20.049 49.636  1.00 42.46  ? 410 TRP B NE1   1 
ATOM   7766  C  CE2   . TRP B  2 426 ? 35.930  -19.425 50.555  1.00 45.73  ? 410 TRP B CE2   1 
ATOM   7767  C  CE3   . TRP B  2 426 ? 34.489  -17.488 50.655  1.00 41.44  ? 410 TRP B CE3   1 
ATOM   7768  C  CZ2   . TRP B  2 426 ? 35.661  -19.753 51.883  1.00 48.19  ? 410 TRP B CZ2   1 
ATOM   7769  C  CZ3   . TRP B  2 426 ? 34.226  -17.813 51.973  1.00 42.26  ? 410 TRP B CZ3   1 
ATOM   7770  C  CH2   . TRP B  2 426 ? 34.809  -18.937 52.573  1.00 39.07  ? 410 TRP B CH2   1 
ATOM   7771  N  N     . ILE B  2 427 ? 34.040  -14.629 47.911  1.00 51.78  ? 411 ILE B N     1 
ATOM   7772  C  CA    . ILE B  2 427 ? 32.983  -13.861 48.565  1.00 46.63  ? 411 ILE B CA    1 
ATOM   7773  C  C     . ILE B  2 427 ? 31.631  -14.428 48.149  1.00 49.36  ? 411 ILE B C     1 
ATOM   7774  O  O     . ILE B  2 427 ? 31.314  -14.455 46.951  1.00 52.68  ? 411 ILE B O     1 
ATOM   7775  C  CB    . ILE B  2 427 ? 33.066  -12.364 48.223  1.00 47.64  ? 411 ILE B CB    1 
ATOM   7776  C  CG1   . ILE B  2 427 ? 34.490  -11.832 48.395  1.00 38.12  ? 411 ILE B CG1   1 
ATOM   7777  C  CG2   . ILE B  2 427 ? 32.115  -11.573 49.109  1.00 40.01  ? 411 ILE B CG2   1 
ATOM   7778  C  CD1   . ILE B  2 427 ? 34.645  -10.380 47.998  1.00 44.05  ? 411 ILE B CD1   1 
ATOM   7779  N  N     . PRO B  2 428 ? 30.807  -14.886 49.085  1.00 45.99  ? 412 PRO B N     1 
ATOM   7780  C  CA    . PRO B  2 428 ? 29.483  -15.394 48.720  1.00 38.51  ? 412 PRO B CA    1 
ATOM   7781  C  C     . PRO B  2 428 ? 28.480  -14.265 48.535  1.00 39.19  ? 412 PRO B C     1 
ATOM   7782  O  O     . PRO B  2 428 ? 28.693  -13.124 48.951  1.00 44.94  ? 412 PRO B O     1 
ATOM   7783  C  CB    . PRO B  2 428 ? 29.104  -16.268 49.919  1.00 33.17  ? 412 PRO B CB    1 
ATOM   7784  C  CG    . PRO B  2 428 ? 29.779  -15.597 51.068  1.00 32.47  ? 412 PRO B CG    1 
ATOM   7785  C  CD    . PRO B  2 428 ? 31.076  -15.036 50.526  1.00 41.55  ? 412 PRO B CD    1 
ATOM   7786  N  N     . GLU B  2 429 ? 27.373  -14.608 47.883  1.00 39.07  ? 413 GLU B N     1 
ATOM   7787  C  CA    . GLU B  2 429 ? 26.244  -13.695 47.805  1.00 39.36  ? 413 GLU B CA    1 
ATOM   7788  C  C     . GLU B  2 429 ? 25.544  -13.623 49.156  1.00 40.46  ? 413 GLU B C     1 
ATOM   7789  O  O     . GLU B  2 429 ? 25.574  -14.570 49.947  1.00 45.19  ? 413 GLU B O     1 
ATOM   7790  C  CB    . GLU B  2 429 ? 25.256  -14.154 46.731  1.00 45.85  ? 413 GLU B CB    1 
ATOM   7791  C  CG    . GLU B  2 429 ? 25.846  -14.283 45.335  1.00 63.14  ? 413 GLU B CG    1 
ATOM   7792  C  CD    . GLU B  2 429 ? 25.970  -12.950 44.623  1.00 90.62  ? 413 GLU B CD    1 
ATOM   7793  O  OE1   . GLU B  2 429 ? 25.574  -11.918 45.205  1.00 104.11 ? 413 GLU B OE1   1 
ATOM   7794  O  OE2   . GLU B  2 429 ? 26.460  -12.935 43.474  1.00 102.38 ? 413 GLU B OE2   1 
ATOM   7795  N  N     . TRP B  2 430 ? 24.911  -12.483 49.425  1.00 34.23  ? 414 TRP B N     1 
ATOM   7796  C  CA    . TRP B  2 430 ? 24.169  -12.336 50.667  1.00 32.81  ? 414 TRP B CA    1 
ATOM   7797  C  C     . TRP B  2 430 ? 23.052  -11.318 50.495  1.00 42.06  ? 414 TRP B C     1 
ATOM   7798  O  O     . TRP B  2 430 ? 23.092  -10.456 49.613  1.00 42.59  ? 414 TRP B O     1 
ATOM   7799  C  CB    . TRP B  2 430 ? 25.079  -11.932 51.836  1.00 35.97  ? 414 TRP B CB    1 
ATOM   7800  C  CG    . TRP B  2 430 ? 25.944  -10.729 51.582  1.00 43.33  ? 414 TRP B CG    1 
ATOM   7801  C  CD1   . TRP B  2 430 ? 25.533  -9.479  51.212  1.00 44.98  ? 414 TRP B CD1   1 
ATOM   7802  C  CD2   . TRP B  2 430 ? 27.368  -10.658 51.712  1.00 34.74  ? 414 TRP B CD2   1 
ATOM   7803  N  NE1   . TRP B  2 430 ? 26.614  -8.641  51.089  1.00 43.78  ? 414 TRP B NE1   1 
ATOM   7804  C  CE2   . TRP B  2 430 ? 27.753  -9.341  51.391  1.00 45.65  ? 414 TRP B CE2   1 
ATOM   7805  C  CE3   . TRP B  2 430 ? 28.357  -11.583 52.062  1.00 39.47  ? 414 TRP B CE3   1 
ATOM   7806  C  CZ2   . TRP B  2 430 ? 29.083  -8.926  51.408  1.00 45.20  ? 414 TRP B CZ2   1 
ATOM   7807  C  CZ3   . TRP B  2 430 ? 29.677  -11.169 52.079  1.00 44.39  ? 414 TRP B CZ3   1 
ATOM   7808  C  CH2   . TRP B  2 430 ? 30.028  -9.852  51.755  1.00 38.08  ? 414 TRP B CH2   1 
ATOM   7809  N  N     . GLU B  2 431 ? 22.044  -11.446 51.355  1.00 48.48  ? 415 GLU B N     1 
ATOM   7810  C  CA    . GLU B  2 431 ? 20.986  -10.461 51.501  1.00 37.35  ? 415 GLU B CA    1 
ATOM   7811  C  C     . GLU B  2 431 ? 20.744  -10.256 52.990  1.00 50.31  ? 415 GLU B C     1 
ATOM   7812  O  O     . GLU B  2 431 ? 21.212  -11.031 53.829  1.00 47.55  ? 415 GLU B O     1 
ATOM   7813  C  CB    . GLU B  2 431 ? 19.702  -10.893 50.783  1.00 35.95  ? 415 GLU B CB    1 
ATOM   7814  C  CG    . GLU B  2 431 ? 19.012  -12.094 51.404  1.00 64.85  ? 415 GLU B CG    1 
ATOM   7815  C  CD    . GLU B  2 431 ? 17.847  -12.587 50.570  1.00 78.73  ? 415 GLU B CD    1 
ATOM   7816  O  OE1   . GLU B  2 431 ? 17.927  -12.498 49.327  1.00 87.02  ? 415 GLU B OE1   1 
ATOM   7817  O  OE2   . GLU B  2 431 ? 16.849  -13.057 51.154  1.00 85.63  ? 415 GLU B OE2   1 
ATOM   7818  N  N     . PHE B  2 432 ? 20.005  -9.202  53.320  1.00 45.66  ? 416 PHE B N     1 
ATOM   7819  C  CA    . PHE B  2 432 ? 19.840  -8.771  54.701  1.00 40.82  ? 416 PHE B CA    1 
ATOM   7820  C  C     . PHE B  2 432 ? 18.385  -8.919  55.120  1.00 43.54  ? 416 PHE B C     1 
ATOM   7821  O  O     . PHE B  2 432 ? 17.481  -8.441  54.427  1.00 46.29  ? 416 PHE B O     1 
ATOM   7822  C  CB    . PHE B  2 432 ? 20.315  -7.328  54.868  1.00 33.79  ? 416 PHE B CB    1 
ATOM   7823  C  CG    . PHE B  2 432 ? 21.692  -7.089  54.319  1.00 48.32  ? 416 PHE B CG    1 
ATOM   7824  C  CD1   . PHE B  2 432 ? 22.814  -7.470  55.036  1.00 44.14  ? 416 PHE B CD1   1 
ATOM   7825  C  CD2   . PHE B  2 432 ? 21.865  -6.500  53.077  1.00 40.10  ? 416 PHE B CD2   1 
ATOM   7826  C  CE1   . PHE B  2 432 ? 24.082  -7.261  54.530  1.00 38.47  ? 416 PHE B CE1   1 
ATOM   7827  C  CE2   . PHE B  2 432 ? 23.130  -6.288  52.566  1.00 37.55  ? 416 PHE B CE2   1 
ATOM   7828  C  CZ    . PHE B  2 432 ? 24.240  -6.668  53.294  1.00 45.43  ? 416 PHE B CZ    1 
ATOM   7829  N  N     . VAL B  2 433 ? 18.168  -9.582  56.256  1.00 45.58  ? 417 VAL B N     1 
ATOM   7830  C  CA    . VAL B  2 433 ? 16.828  -9.873  56.752  1.00 48.49  ? 417 VAL B CA    1 
ATOM   7831  C  C     . VAL B  2 433 ? 16.652  -9.272  58.140  1.00 52.89  ? 417 VAL B C     1 
ATOM   7832  O  O     . VAL B  2 433 ? 17.591  -8.703  58.708  1.00 59.02  ? 417 VAL B O     1 
ATOM   7833  C  CB    . VAL B  2 433 ? 16.563  -11.389 56.778  1.00 46.48  ? 417 VAL B CB    1 
ATOM   7834  C  CG1   . VAL B  2 433 ? 16.756  -11.988 55.393  1.00 57.84  ? 417 VAL B CG1   1 
ATOM   7835  C  CG2   . VAL B  2 433 ? 17.473  -12.069 57.793  1.00 43.75  ? 417 VAL B CG2   1 
ATOM   7836  N  N     . ASN B  2 434 ? 15.445  -9.397  58.694  1.00 66.23  ? 418 ASN B N     1 
ATOM   7837  C  CA    . ASN B  2 434 ? 15.176  -8.932  60.057  1.00 71.42  ? 418 ASN B CA    1 
ATOM   7838  C  C     . ASN B  2 434 ? 13.975  -9.734  60.571  1.00 78.44  ? 418 ASN B C     1 
ATOM   7839  O  O     . ASN B  2 434 ? 12.826  -9.332  60.385  1.00 77.14  ? 418 ASN B O     1 
ATOM   7840  C  CB    . ASN B  2 434 ? 14.912  -7.441  60.108  1.00 70.75  ? 418 ASN B CB    1 
ATOM   7841  C  CG    . ASN B  2 434 ? 15.049  -6.872  61.509  1.00 78.19  ? 418 ASN B CG    1 
ATOM   7842  O  OD1   . ASN B  2 434 ? 15.024  -7.607  62.496  1.00 78.40  ? 418 ASN B OD1   1 
ATOM   7843  N  ND2   . ASN B  2 434 ? 15.194  -5.555  61.601  1.00 77.12  ? 418 ASN B ND2   1 
ATOM   7844  N  N     . THR B  2 435 ? 14.262  -10.864 61.212  1.00 82.44  ? 419 THR B N     1 
ATOM   7845  C  CA    . THR B  2 435 ? 13.229  -11.767 61.721  1.00 76.72  ? 419 THR B CA    1 
ATOM   7846  C  C     . THR B  2 435 ? 13.315  -11.838 63.238  1.00 74.42  ? 419 THR B C     1 
ATOM   7847  O  O     . THR B  2 435 ? 14.188  -12.539 63.781  1.00 72.91  ? 419 THR B O     1 
ATOM   7848  C  CB    . THR B  2 435 ? 13.379  -13.160 61.111  1.00 89.57  ? 419 THR B CB    1 
ATOM   7849  O  OG1   . THR B  2 435 ? 13.456  -13.052 59.684  1.00 104.22 ? 419 THR B OG1   1 
ATOM   7850  C  CG2   . THR B  2 435 ? 12.190  -14.034 61.481  1.00 98.18  ? 419 THR B CG2   1 
ATOM   7851  N  N     . PRO B  2 436 ? 12.450  -11.132 63.963  1.00 82.33  ? 420 PRO B N     1 
ATOM   7852  C  CA    . PRO B  2 436 ? 12.471  -11.199 65.431  1.00 87.98  ? 420 PRO B CA    1 
ATOM   7853  C  C     . PRO B  2 436 ? 12.217  -12.613 65.919  1.00 100.38 ? 420 PRO B C     1 
ATOM   7854  O  O     . PRO B  2 436 ? 11.434  -13.360 65.312  1.00 92.51  ? 420 PRO B O     1 
ATOM   7855  C  CB    . PRO B  2 436 ? 11.332  -10.254 65.843  1.00 88.41  ? 420 PRO B CB    1 
ATOM   7856  C  CG    . PRO B  2 436 ? 11.194  -9.314  64.694  1.00 81.94  ? 420 PRO B CG    1 
ATOM   7857  C  CD    . PRO B  2 436 ? 11.485  -10.135 63.470  1.00 75.20  ? 420 PRO B CD    1 
ATOM   7858  N  N     . PRO B  2 437 ? 12.863  -13.020 67.014  1.00 115.23 ? 421 PRO B N     1 
ATOM   7859  C  CA    . PRO B  2 437 ? 12.709  -14.399 67.492  1.00 125.20 ? 421 PRO B CA    1 
ATOM   7860  C  C     . PRO B  2 437 ? 11.401  -14.622 68.234  1.00 129.23 ? 421 PRO B C     1 
ATOM   7861  O  O     . PRO B  2 437 ? 11.338  -14.494 69.461  1.00 134.05 ? 421 PRO B O     1 
ATOM   7862  C  CB    . PRO B  2 437 ? 13.918  -14.581 68.417  1.00 122.16 ? 421 PRO B CB    1 
ATOM   7863  C  CG    . PRO B  2 437 ? 14.185  -13.209 68.938  1.00 117.71 ? 421 PRO B CG    1 
ATOM   7864  C  CD    . PRO B  2 437 ? 13.805  -12.246 67.841  1.00 114.97 ? 421 PRO B CD    1 
ATOM   7865  N  N     . LEU B  2 438 ? 10.346  -14.958 67.491  1.00 127.57 ? 422 LEU B N     1 
ATOM   7866  C  CA    . LEU B  2 438 ? 9.068   -15.261 68.124  1.00 120.78 ? 422 LEU B CA    1 
ATOM   7867  C  C     . LEU B  2 438 ? 9.141   -16.541 68.945  1.00 113.08 ? 422 LEU B C     1 
ATOM   7868  O  O     . LEU B  2 438 ? 8.408   -16.691 69.928  1.00 105.77 ? 422 LEU B O     1 
ATOM   7869  C  CB    . LEU B  2 438 ? 7.981   -15.368 67.058  1.00 121.27 ? 422 LEU B CB    1 
ATOM   7870  C  CG    . LEU B  2 438 ? 8.033   -14.276 65.987  1.00 126.80 ? 422 LEU B CG    1 
ATOM   7871  C  CD1   . LEU B  2 438 ? 7.234   -14.693 64.770  1.00 129.00 ? 422 LEU B CD1   1 
ATOM   7872  C  CD2   . LEU B  2 438 ? 7.535   -12.940 66.525  1.00 123.20 ? 422 LEU B CD2   1 
ATOM   7873  N  N     . VAL B  2 439 ? 10.010  -17.467 68.557  1.00 112.62 ? 423 VAL B N     1 
ATOM   7874  C  CA    . VAL B  2 439 ? 10.203  -18.730 69.263  1.00 115.04 ? 423 VAL B CA    1 
ATOM   7875  C  C     . VAL B  2 439 ? 11.592  -19.241 68.924  1.00 111.19 ? 423 VAL B C     1 
ATOM   7876  O  O     . VAL B  2 439 ? 11.965  -19.321 67.748  1.00 118.39 ? 423 VAL B O     1 
ATOM   7877  C  CB    . VAL B  2 439 ? 9.125   -19.777 68.903  1.00 117.62 ? 423 VAL B CB    1 
ATOM   7878  C  CG1   . VAL B  2 439 ? 8.844   -19.762 67.408  1.00 117.06 ? 423 VAL B CG1   1 
ATOM   7879  C  CG2   . VAL B  2 439 ? 9.555   -21.171 69.353  1.00 113.91 ? 423 VAL B CG2   1 
ATOM   7880  N  N     . LYS B  2 440 ? 12.370  -19.556 69.955  1.00 103.48 ? 424 LYS B N     1 
ATOM   7881  C  CA    . LYS B  2 440 ? 13.727  -20.064 69.779  1.00 102.39 ? 424 LYS B CA    1 
ATOM   7882  C  C     . LYS B  2 440 ? 13.650  -21.471 69.202  1.00 91.06  ? 424 LYS B C     1 
ATOM   7883  O  O     . LYS B  2 440 ? 13.472  -22.449 69.931  1.00 90.07  ? 424 LYS B O     1 
ATOM   7884  C  CB    . LYS B  2 440 ? 14.477  -20.034 71.106  1.00 112.55 ? 424 LYS B CB    1 
ATOM   7885  C  CG    . LYS B  2 440 ? 14.779  -18.626 71.603  1.00 115.91 ? 424 LYS B CG    1 
ATOM   7886  C  CD    . LYS B  2 440 ? 15.647  -18.645 72.851  1.00 120.99 ? 424 LYS B CD    1 
ATOM   7887  C  CE    . LYS B  2 440 ? 15.971  -17.233 73.315  1.00 120.26 ? 424 LYS B CE    1 
ATOM   7888  N  NZ    . LYS B  2 440 ? 16.705  -16.467 72.269  1.00 114.21 ? 424 LYS B NZ    1 
ATOM   7889  N  N     . LEU B  2 441 ? 13.788  -21.572 67.880  1.00 84.60  ? 425 LEU B N     1 
ATOM   7890  C  CA    . LEU B  2 441 ? 13.573  -22.838 67.189  1.00 86.93  ? 425 LEU B CA    1 
ATOM   7891  C  C     . LEU B  2 441 ? 14.816  -23.718 67.220  1.00 74.72  ? 425 LEU B C     1 
ATOM   7892  O  O     . LEU B  2 441 ? 14.728  -24.920 67.498  1.00 70.62  ? 425 LEU B O     1 
ATOM   7893  C  CB    . LEU B  2 441 ? 13.151  -22.571 65.744  1.00 100.29 ? 425 LEU B CB    1 
ATOM   7894  C  CG    . LEU B  2 441 ? 11.915  -21.692 65.559  1.00 116.28 ? 425 LEU B CG    1 
ATOM   7895  C  CD1   . LEU B  2 441 ? 11.867  -21.128 64.149  1.00 120.14 ? 425 LEU B CD1   1 
ATOM   7896  C  CD2   . LEU B  2 441 ? 10.658  -22.488 65.863  1.00 123.72 ? 425 LEU B CD2   1 
ATOM   7897  N  N     . TRP B  2 442 ? 15.981  -23.140 66.937  1.00 64.21  ? 426 TRP B N     1 
ATOM   7898  C  CA    . TRP B  2 442 ? 17.204  -23.907 66.748  1.00 63.20  ? 426 TRP B CA    1 
ATOM   7899  C  C     . TRP B  2 442 ? 18.109  -23.914 67.971  1.00 66.75  ? 426 TRP B C     1 
ATOM   7900  O  O     . TRP B  2 442 ? 19.146  -24.585 67.951  1.00 69.44  ? 426 TRP B O     1 
ATOM   7901  C  CB    . TRP B  2 442 ? 17.973  -23.367 65.539  1.00 48.84  ? 426 TRP B CB    1 
ATOM   7902  C  CG    . TRP B  2 442 ? 17.115  -23.246 64.322  1.00 52.89  ? 426 TRP B CG    1 
ATOM   7903  C  CD1   . TRP B  2 442 ? 16.543  -22.109 63.831  1.00 51.61  ? 426 TRP B CD1   1 
ATOM   7904  C  CD2   . TRP B  2 442 ? 16.713  -24.307 63.448  1.00 45.42  ? 426 TRP B CD2   1 
ATOM   7905  N  NE1   . TRP B  2 442 ? 15.818  -22.395 62.699  1.00 55.91  ? 426 TRP B NE1   1 
ATOM   7906  C  CE2   . TRP B  2 442 ? 15.906  -23.738 62.444  1.00 54.63  ? 426 TRP B CE2   1 
ATOM   7907  C  CE3   . TRP B  2 442 ? 16.963  -25.683 63.415  1.00 43.19  ? 426 TRP B CE3   1 
ATOM   7908  C  CZ2   . TRP B  2 442 ? 15.345  -24.496 61.418  1.00 62.70  ? 426 TRP B CZ2   1 
ATOM   7909  C  CZ3   . TRP B  2 442 ? 16.405  -26.433 62.397  1.00 57.41  ? 426 TRP B CZ3   1 
ATOM   7910  C  CH2   . TRP B  2 442 ? 15.605  -25.838 61.413  1.00 65.47  ? 426 TRP B CH2   1 
ATOM   7911  N  N     . TYR B  2 443 ? 17.743  -23.196 69.034  1.00 64.88  ? 427 TYR B N     1 
ATOM   7912  C  CA    . TYR B  2 443 ? 18.569  -23.151 70.240  1.00 78.77  ? 427 TYR B CA    1 
ATOM   7913  C  C     . TYR B  2 443 ? 17.682  -22.654 71.381  1.00 99.66  ? 427 TYR B C     1 
ATOM   7914  O  O     . TYR B  2 443 ? 17.389  -21.458 71.461  1.00 100.11 ? 427 TYR B O     1 
ATOM   7915  C  CB    . TYR B  2 443 ? 19.783  -22.258 70.041  1.00 85.03  ? 427 TYR B CB    1 
ATOM   7916  C  CG    . TYR B  2 443 ? 20.797  -22.332 71.160  1.00 90.55  ? 427 TYR B CG    1 
ATOM   7917  C  CD1   . TYR B  2 443 ? 21.578  -23.466 71.341  1.00 95.26  ? 427 TYR B CD1   1 
ATOM   7918  C  CD2   . TYR B  2 443 ? 20.981  -21.264 72.029  1.00 85.94  ? 427 TYR B CD2   1 
ATOM   7919  C  CE1   . TYR B  2 443 ? 22.510  -23.538 72.358  1.00 93.19  ? 427 TYR B CE1   1 
ATOM   7920  C  CE2   . TYR B  2 443 ? 21.911  -21.327 73.049  1.00 91.24  ? 427 TYR B CE2   1 
ATOM   7921  C  CZ    . TYR B  2 443 ? 22.672  -22.465 73.209  1.00 92.59  ? 427 TYR B CZ    1 
ATOM   7922  O  OH    . TYR B  2 443 ? 23.599  -22.531 74.224  1.00 94.74  ? 427 TYR B OH    1 
ATOM   7923  N  N     . GLN B  2 444 ? 17.266  -23.575 72.245  1.00 119.55 ? 428 GLN B N     1 
ATOM   7924  C  CA    . GLN B  2 444 ? 16.397  -23.247 73.370  1.00 141.07 ? 428 GLN B CA    1 
ATOM   7925  C  C     . GLN B  2 444 ? 17.063  -22.259 74.323  1.00 144.20 ? 428 GLN B C     1 
ATOM   7926  O  O     . GLN B  2 444 ? 16.390  -21.519 75.042  1.00 146.48 ? 428 GLN B O     1 
ATOM   7927  C  CB    . GLN B  2 444 ? 16.005  -24.519 74.123  1.00 153.80 ? 428 GLN B CB    1 
ATOM   7928  C  CG    . GLN B  2 444 ? 17.190  -25.327 74.626  1.00 160.52 ? 428 GLN B CG    1 
ATOM   7929  C  CD    . GLN B  2 444 ? 16.776  -26.647 75.242  1.00 167.22 ? 428 GLN B CD    1 
ATOM   7930  O  OE1   . GLN B  2 444 ? 15.633  -27.080 75.099  1.00 166.98 ? 428 GLN B OE1   1 
ATOM   7931  N  NE2   . GLN B  2 444 ? 17.706  -27.295 75.934  1.00 170.62 ? 428 GLN B NE2   1 
ATOM   7932  O  OXT   . GLN B  2 444 ? 18.289  -22.176 74.395  1.00 143.35 ? 428 GLN B OXT   1 
ATOM   7933  P  P     . DA  C  3 4   ? 16.434  27.510  33.352  1.00 240.88 ? 704 DA  T P     1 
ATOM   7934  O  OP1   . DA  C  3 4   ? 16.058  26.450  34.313  1.00 236.74 ? 704 DA  T OP1   1 
ATOM   7935  O  OP2   . DA  C  3 4   ? 17.456  28.515  33.719  1.00 240.77 ? 704 DA  T OP2   1 
ATOM   7936  O  "O5'" . DA  C  3 4   ? 16.882  26.830  31.975  1.00 236.16 ? 704 DA  T "O5'" 1 
ATOM   7937  C  "C5'" . DA  C  3 4   ? 18.013  25.965  31.942  1.00 225.05 ? 704 DA  T "C5'" 1 
ATOM   7938  C  "C4'" . DA  C  3 4   ? 18.233  25.421  30.542  1.00 219.25 ? 704 DA  T "C4'" 1 
ATOM   7939  O  "O4'" . DA  C  3 4   ? 18.149  26.506  29.593  1.00 226.05 ? 704 DA  T "O4'" 1 
ATOM   7940  C  "C3'" . DA  C  3 4   ? 19.594  24.789  30.310  1.00 205.61 ? 704 DA  T "C3'" 1 
ATOM   7941  O  "O3'" . DA  C  3 4   ? 19.548  23.409  30.649  1.00 191.01 ? 704 DA  T "O3'" 1 
ATOM   7942  C  "C2'" . DA  C  3 4   ? 19.810  24.988  28.809  1.00 210.63 ? 704 DA  T "C2'" 1 
ATOM   7943  C  "C1'" . DA  C  3 4   ? 19.036  26.279  28.514  1.00 222.59 ? 704 DA  T "C1'" 1 
ATOM   7944  N  N9    . DA  C  3 4   ? 19.885  27.459  28.352  1.00 227.90 ? 704 DA  T N9    1 
ATOM   7945  C  C8    . DA  C  3 4   ? 20.170  28.110  27.184  1.00 232.14 ? 704 DA  T C8    1 
ATOM   7946  N  N7    . DA  C  3 4   ? 20.959  29.147  27.334  1.00 233.65 ? 704 DA  T N7    1 
ATOM   7947  C  C5    . DA  C  3 4   ? 21.208  29.182  28.696  1.00 230.25 ? 704 DA  T C5    1 
ATOM   7948  C  C6    . DA  C  3 4   ? 21.978  30.048  29.498  1.00 228.74 ? 704 DA  T C6    1 
ATOM   7949  N  N6    . DA  C  3 4   ? 22.664  31.087  29.010  1.00 231.68 ? 704 DA  T N6    1 
ATOM   7950  N  N1    . DA  C  3 4   ? 22.016  29.804  30.824  1.00 223.98 ? 704 DA  T N1    1 
ATOM   7951  C  C2    . DA  C  3 4   ? 21.328  28.763  31.308  1.00 221.98 ? 704 DA  T C2    1 
ATOM   7952  N  N3    . DA  C  3 4   ? 20.572  27.882  30.655  1.00 223.43 ? 704 DA  T N3    1 
ATOM   7953  C  C4    . DA  C  3 4   ? 20.553  28.149  29.340  1.00 227.44 ? 704 DA  T C4    1 
ATOM   7954  P  P     . DA  C  3 5   ? 20.615  22.788  31.677  1.00 176.07 ? 705 DA  T P     1 
ATOM   7955  O  OP1   . DA  C  3 5   ? 20.089  21.481  32.131  1.00 173.01 ? 705 DA  T OP1   1 
ATOM   7956  O  OP2   . DA  C  3 5   ? 20.945  23.833  32.670  1.00 177.15 ? 705 DA  T OP2   1 
ATOM   7957  O  "O5'" . DA  C  3 5   ? 21.915  22.536  30.779  1.00 166.75 ? 705 DA  T "O5'" 1 
ATOM   7958  C  "C5'" . DA  C  3 5   ? 21.800  21.834  29.548  1.00 160.53 ? 705 DA  T "C5'" 1 
ATOM   7959  C  "C4'" . DA  C  3 5   ? 23.156  21.342  29.076  1.00 149.96 ? 705 DA  T "C4'" 1 
ATOM   7960  O  "O4'" . DA  C  3 5   ? 24.058  22.467  28.925  1.00 149.55 ? 705 DA  T "O4'" 1 
ATOM   7961  C  "C3'" . DA  C  3 5   ? 23.870  20.407  30.034  1.00 140.02 ? 705 DA  T "C3'" 1 
ATOM   7962  O  "O3'" . DA  C  3 5   ? 23.423  19.071  29.843  1.00 134.46 ? 705 DA  T "O3'" 1 
ATOM   7963  C  "C2'" . DA  C  3 5   ? 25.319  20.583  29.603  1.00 137.70 ? 705 DA  T "C2'" 1 
ATOM   7964  C  "C1'" . DA  C  3 5   ? 25.368  22.082  29.315  1.00 139.92 ? 705 DA  T "C1'" 1 
ATOM   7965  N  N9    . DA  C  3 5   ? 25.760  22.877  30.474  1.00 136.21 ? 705 DA  T N9    1 
ATOM   7966  C  C8    . DA  C  3 5   ? 24.978  23.748  31.181  1.00 138.41 ? 705 DA  T C8    1 
ATOM   7967  N  N7    . DA  C  3 5   ? 25.600  24.322  32.184  1.00 136.78 ? 705 DA  T N7    1 
ATOM   7968  C  C5    . DA  C  3 5   ? 26.877  23.787  32.134  1.00 133.20 ? 705 DA  T C5    1 
ATOM   7969  C  C6    . DA  C  3 5   ? 28.023  23.988  32.928  1.00 127.16 ? 705 DA  T C6    1 
ATOM   7970  N  N6    . DA  C  3 5   ? 28.058  24.822  33.973  1.00 124.98 ? 705 DA  T N6    1 
ATOM   7971  N  N1    . DA  C  3 5   ? 29.137  23.297  32.606  1.00 124.01 ? 705 DA  T N1    1 
ATOM   7972  C  C2    . DA  C  3 5   ? 29.098  22.463  31.560  1.00 124.59 ? 705 DA  T C2    1 
ATOM   7973  N  N3    . DA  C  3 5   ? 28.083  22.191  30.742  1.00 128.97 ? 705 DA  T N3    1 
ATOM   7974  C  C4    . DA  C  3 5   ? 26.992  22.893  31.087  1.00 133.07 ? 705 DA  T C4    1 
ATOM   7975  P  P     . DC  C  3 6   ? 23.425  18.038  31.075  1.00 123.00 ? 706 DC  T P     1 
ATOM   7976  O  OP1   . DC  C  3 6   ? 22.735  16.806  30.632  1.00 118.78 ? 706 DC  T OP1   1 
ATOM   7977  O  OP2   . DC  C  3 6   ? 22.940  18.762  32.271  1.00 122.39 ? 706 DC  T OP2   1 
ATOM   7978  O  "O5'" . DC  C  3 6   ? 24.974  17.709  31.297  1.00 114.52 ? 706 DC  T "O5'" 1 
ATOM   7979  C  "C5'" . DC  C  3 6   ? 25.723  17.095  30.257  1.00 116.17 ? 706 DC  T "C5'" 1 
ATOM   7980  C  "C4'" . DC  C  3 6   ? 27.152  16.843  30.697  1.00 113.22 ? 706 DC  T "C4'" 1 
ATOM   7981  O  "O4'" . DC  C  3 6   ? 27.852  18.103  30.835  1.00 119.36 ? 706 DC  T "O4'" 1 
ATOM   7982  C  "C3'" . DC  C  3 6   ? 27.298  16.187  32.053  1.00 111.26 ? 706 DC  T "C3'" 1 
ATOM   7983  O  "O3'" . DC  C  3 6   ? 27.137  14.783  31.940  1.00 112.10 ? 706 DC  T "O3'" 1 
ATOM   7984  C  "C2'" . DC  C  3 6   ? 28.727  16.567  32.420  1.00 112.98 ? 706 DC  T "C2'" 1 
ATOM   7985  C  "C1'" . DC  C  3 6   ? 28.822  17.993  31.867  1.00 119.28 ? 706 DC  T "C1'" 1 
ATOM   7986  N  N1    . DC  C  3 6   ? 28.558  19.050  32.891  1.00 117.83 ? 706 DC  T N1    1 
ATOM   7987  C  C2    . DC  C  3 6   ? 29.613  19.532  33.673  1.00 110.96 ? 706 DC  T C2    1 
ATOM   7988  O  O2    . DC  C  3 6   ? 30.750  19.076  33.500  1.00 109.31 ? 706 DC  T O2    1 
ATOM   7989  N  N3    . DC  C  3 6   ? 29.359  20.489  34.599  1.00 108.20 ? 706 DC  T N3    1 
ATOM   7990  C  C4    . DC  C  3 6   ? 28.119  20.956  34.755  1.00 111.05 ? 706 DC  T C4    1 
ATOM   7991  N  N4    . DC  C  3 6   ? 27.919  21.899  35.681  1.00 112.87 ? 706 DC  T N4    1 
ATOM   7992  C  C5    . DC  C  3 6   ? 27.031  20.476  33.969  1.00 113.91 ? 706 DC  T C5    1 
ATOM   7993  C  C6    . DC  C  3 6   ? 27.293  19.534  33.058  1.00 115.25 ? 706 DC  T C6    1 
ATOM   7994  P  P     . DG  C  3 7   ? 26.476  13.954  33.147  1.00 109.25 ? 707 DG  T P     1 
ATOM   7995  O  OP1   . DG  C  3 7   ? 26.114  12.615  32.631  1.00 109.43 ? 707 DG  T OP1   1 
ATOM   7996  O  OP2   . DG  C  3 7   ? 25.441  14.810  33.767  1.00 108.18 ? 707 DG  T OP2   1 
ATOM   7997  O  "O5'" . DG  C  3 7   ? 27.672  13.795  34.195  1.00 112.23 ? 707 DG  T "O5'" 1 
ATOM   7998  C  "C5'" . DG  C  3 7   ? 28.852  13.105  33.815  1.00 108.81 ? 707 DG  T "C5'" 1 
ATOM   7999  C  "C4'" . DG  C  3 7   ? 29.979  13.370  34.797  1.00 103.67 ? 707 DG  T "C4'" 1 
ATOM   8000  O  "O4'" . DG  C  3 7   ? 30.423  14.746  34.680  1.00 102.61 ? 707 DG  T "O4'" 1 
ATOM   8001  C  "C3'" . DG  C  3 7   ? 29.612  13.227  36.259  1.00 101.51 ? 707 DG  T "C3'" 1 
ATOM   8002  O  "O3'" . DG  C  3 7   ? 29.643  11.864  36.651  1.00 98.55  ? 707 DG  T "O3'" 1 
ATOM   8003  C  "C2'" . DG  C  3 7   ? 30.729  14.028  36.912  1.00 102.42 ? 707 DG  T "C2'" 1 
ATOM   8004  C  "C1'" . DG  C  3 7   ? 30.828  15.216  35.959  1.00 103.46 ? 707 DG  T "C1'" 1 
ATOM   8005  N  N9    . DG  C  3 7   ? 29.964  16.325  36.348  1.00 104.83 ? 707 DG  T N9    1 
ATOM   8006  C  C8    . DG  C  3 7   ? 28.707  16.605  35.871  1.00 107.07 ? 707 DG  T C8    1 
ATOM   8007  N  N7    . DG  C  3 7   ? 28.168  17.661  36.416  1.00 111.50 ? 707 DG  T N7    1 
ATOM   8008  C  C5    . DG  C  3 7   ? 29.127  18.104  37.318  1.00 110.65 ? 707 DG  T C5    1 
ATOM   8009  C  C6    . DG  C  3 7   ? 29.108  19.210  38.200  1.00 115.76 ? 707 DG  T C6    1 
ATOM   8010  O  O6    . DG  C  3 7   ? 28.208  20.046  38.364  1.00 121.02 ? 707 DG  T O6    1 
ATOM   8011  N  N1    . DG  C  3 7   ? 30.285  19.300  38.939  1.00 110.11 ? 707 DG  T N1    1 
ATOM   8012  C  C2    . DG  C  3 7   ? 31.346  18.430  38.839  1.00 101.45 ? 707 DG  T C2    1 
ATOM   8013  N  N2    . DG  C  3 7   ? 32.396  18.679  39.635  1.00 99.29  ? 707 DG  T N2    1 
ATOM   8014  N  N3    . DG  C  3 7   ? 31.376  17.390  38.017  1.00 98.77  ? 707 DG  T N3    1 
ATOM   8015  C  C4    . DG  C  3 7   ? 30.237  17.289  37.290  1.00 104.11 ? 707 DG  T C4    1 
ATOM   8016  P  P     . DG  C  3 8   ? 28.785  11.375  37.919  1.00 96.29  ? 708 DG  T P     1 
ATOM   8017  O  OP1   . DG  C  3 8   ? 28.813  9.896   37.941  1.00 95.87  ? 708 DG  T OP1   1 
ATOM   8018  O  OP2   . DG  C  3 8   ? 27.489  12.088  37.884  1.00 98.26  ? 708 DG  T OP2   1 
ATOM   8019  O  "O5'" . DG  C  3 8   ? 29.609  11.926  39.175  1.00 95.26  ? 708 DG  T "O5'" 1 
ATOM   8020  C  "C5'" . DG  C  3 8   ? 30.960  11.524  39.368  1.00 93.92  ? 708 DG  T "C5'" 1 
ATOM   8021  C  "C4'" . DG  C  3 8   ? 31.605  12.313  40.492  1.00 93.60  ? 708 DG  T "C4'" 1 
ATOM   8022  O  "O4'" . DG  C  3 8   ? 31.701  13.711  40.123  1.00 94.34  ? 708 DG  T "O4'" 1 
ATOM   8023  C  "C3'" . DG  C  3 8   ? 30.835  12.316  41.797  1.00 94.09  ? 708 DG  T "C3'" 1 
ATOM   8024  O  "O3'" . DG  C  3 8   ? 31.135  11.147  42.541  1.00 93.54  ? 708 DG  T "O3'" 1 
ATOM   8025  C  "C2'" . DG  C  3 8   ? 31.381  13.570  42.467  1.00 96.03  ? 708 DG  T "C2'" 1 
ATOM   8026  C  "C1'" . DG  C  3 8   ? 31.508  14.520  41.274  1.00 94.99  ? 708 DG  T "C1'" 1 
ATOM   8027  N  N9    . DG  C  3 8   ? 30.325  15.349  41.065  1.00 96.78  ? 708 DG  T N9    1 
ATOM   8028  C  C8    . DG  C  3 8   ? 29.308  15.126  40.169  1.00 99.36  ? 708 DG  T C8    1 
ATOM   8029  N  N7    . DG  C  3 8   ? 28.375  16.036  40.205  1.00 99.97  ? 708 DG  T N7    1 
ATOM   8030  C  C5    . DG  C  3 8   ? 28.798  16.919  41.190  1.00 100.43 ? 708 DG  T C5    1 
ATOM   8031  C  C6    . DG  C  3 8   ? 28.194  18.103  41.673  1.00 103.57 ? 708 DG  T C6    1 
ATOM   8032  O  O6    . DG  C  3 8   ? 27.128  18.623  41.313  1.00 106.22 ? 708 DG  T O6    1 
ATOM   8033  N  N1    . DG  C  3 8   ? 28.955  18.699  42.675  1.00 102.97 ? 708 DG  T N1    1 
ATOM   8034  C  C2    . DG  C  3 8   ? 30.149  18.210  43.151  1.00 100.74 ? 708 DG  T C2    1 
ATOM   8035  N  N2    . DG  C  3 8   ? 30.739  18.923  44.122  1.00 102.04 ? 708 DG  T N2    1 
ATOM   8036  N  N3    . DG  C  3 8   ? 30.727  17.101  42.707  1.00 98.49  ? 708 DG  T N3    1 
ATOM   8037  C  C4    . DG  C  3 8   ? 29.997  16.509  41.730  1.00 98.42  ? 708 DG  T C4    1 
ATOM   8038  P  P     . DC  C  3 9   ? 29.949  10.292  43.208  1.00 83.71  ? 709 DC  T P     1 
ATOM   8039  O  OP1   . DC  C  3 9   ? 30.448  8.915   43.413  1.00 91.12  ? 709 DC  T OP1   1 
ATOM   8040  O  OP2   . DC  C  3 9   ? 28.728  10.520  42.402  1.00 87.73  ? 709 DC  T OP2   1 
ATOM   8041  O  "O5'" . DC  C  3 9   ? 29.735  10.984  44.633  1.00 77.84  ? 709 DC  T "O5'" 1 
ATOM   8042  C  "C5'" . DC  C  3 9   ? 30.790  10.977  45.585  1.00 76.29  ? 709 DC  T "C5'" 1 
ATOM   8043  C  "C4'" . DC  C  3 9   ? 30.641  12.119  46.575  1.00 77.72  ? 709 DC  T "C4'" 1 
ATOM   8044  O  "O4'" . DC  C  3 9   ? 30.651  13.383  45.869  1.00 75.72  ? 709 DC  T "O4'" 1 
ATOM   8045  C  "C3'" . DC  C  3 9   ? 29.339  12.133  47.353  1.00 71.15  ? 709 DC  T "C3'" 1 
ATOM   8046  O  "O3'" . DC  C  3 9   ? 29.427  11.265  48.473  1.00 69.03  ? 709 DC  T "O3'" 1 
ATOM   8047  C  "C2'" . DC  C  3 9   ? 29.260  13.594  47.779  1.00 70.41  ? 709 DC  T "C2'" 1 
ATOM   8048  C  "C1'" . DC  C  3 9   ? 29.815  14.310  46.545  1.00 83.24  ? 709 DC  T "C1'" 1 
ATOM   8049  N  N1    . DC  C  3 9   ? 28.754  14.776  45.603  1.00 80.22  ? 709 DC  T N1    1 
ATOM   8050  C  C2    . DC  C  3 9   ? 28.037  15.943  45.891  1.00 83.15  ? 709 DC  T C2    1 
ATOM   8051  O  O2    . DC  C  3 9   ? 28.297  16.572  46.925  1.00 85.78  ? 709 DC  T O2    1 
ATOM   8052  N  N3    . DC  C  3 9   ? 27.076  16.353  45.027  1.00 86.43  ? 709 DC  T N3    1 
ATOM   8053  C  C4    . DC  C  3 9   ? 26.826  15.647  43.923  1.00 92.94  ? 709 DC  T C4    1 
ATOM   8054  N  N4    . DC  C  3 9   ? 25.869  16.090  43.100  1.00 98.37  ? 709 DC  T N4    1 
ATOM   8055  C  C5    . DC  C  3 9   ? 27.545  14.456  43.613  1.00 90.33  ? 709 DC  T C5    1 
ATOM   8056  C  C6    . DC  C  3 9   ? 28.490  14.061  44.472  1.00 86.31  ? 709 DC  T C6    1 
ATOM   8057  P  P     . DG  C  3 10  ? 28.097  10.601  49.084  1.00 68.06  ? 710 DG  T P     1 
ATOM   8058  O  OP1   . DG  C  3 10  ? 28.518  9.522   50.006  1.00 65.80  ? 710 DG  T OP1   1 
ATOM   8059  O  OP2   . DG  C  3 10  ? 27.191  10.292  47.956  1.00 68.46  ? 710 DG  T OP2   1 
ATOM   8060  O  "O5'" . DG  C  3 10  ? 27.433  11.781  49.936  1.00 64.82  ? 710 DG  T "O5'" 1 
ATOM   8061  C  "C5'" . DG  C  3 10  ? 28.138  12.350  51.033  1.00 63.30  ? 710 DG  T "C5'" 1 
ATOM   8062  C  "C4'" . DG  C  3 10  ? 27.469  13.630  51.498  1.00 70.44  ? 710 DG  T "C4'" 1 
ATOM   8063  O  "O4'" . DG  C  3 10  ? 27.540  14.624  50.447  1.00 70.94  ? 710 DG  T "O4'" 1 
ATOM   8064  C  "C3'" . DG  C  3 10  ? 25.989  13.500  51.815  1.00 65.48  ? 710 DG  T "C3'" 1 
ATOM   8065  O  "O3'" . DG  C  3 10  ? 25.816  13.077  53.161  1.00 71.01  ? 710 DG  T "O3'" 1 
ATOM   8066  C  "C2'" . DG  C  3 10  ? 25.495  14.927  51.610  1.00 65.17  ? 710 DG  T "C2'" 1 
ATOM   8067  C  "C1'" . DG  C  3 10  ? 26.346  15.389  50.427  1.00 72.98  ? 710 DG  T "C1'" 1 
ATOM   8068  N  N9    . DG  C  3 10  ? 25.696  15.202  49.133  1.00 75.16  ? 710 DG  T N9    1 
ATOM   8069  C  C8    . DG  C  3 10  ? 25.926  14.194  48.227  1.00 78.77  ? 710 DG  T C8    1 
ATOM   8070  N  N7    . DG  C  3 10  ? 25.195  14.285  47.152  1.00 85.98  ? 710 DG  T N7    1 
ATOM   8071  C  C5    . DG  C  3 10  ? 24.428  15.425  47.357  1.00 83.78  ? 710 DG  T C5    1 
ATOM   8072  C  C6    . DG  C  3 10  ? 23.449  16.026  46.531  1.00 88.73  ? 710 DG  T C6    1 
ATOM   8073  O  O6    . DG  C  3 10  ? 23.052  15.657  45.416  1.00 92.59  ? 710 DG  T O6    1 
ATOM   8074  N  N1    . DG  C  3 10  ? 22.913  17.170  47.117  1.00 83.76  ? 710 DG  T N1    1 
ATOM   8075  C  C2    . DG  C  3 10  ? 23.278  17.669  48.345  1.00 76.20  ? 710 DG  T C2    1 
ATOM   8076  N  N2    . DG  C  3 10  ? 22.650  18.785  48.745  1.00 79.59  ? 710 DG  T N2    1 
ATOM   8077  N  N3    . DG  C  3 10  ? 24.194  17.115  49.129  1.00 67.99  ? 710 DG  T N3    1 
ATOM   8078  C  C4    . DG  C  3 10  ? 24.725  16.000  48.572  1.00 74.15  ? 710 DG  T C4    1 
ATOM   8079  P  P     . DC  C  3 11  ? 24.522  12.222  53.579  1.00 73.05  ? 711 DC  T P     1 
ATOM   8080  O  OP1   . DC  C  3 11  ? 24.755  11.697  54.942  1.00 74.86  ? 711 DC  T OP1   1 
ATOM   8081  O  OP2   . DC  C  3 11  ? 24.221  11.289  52.471  1.00 69.76  ? 711 DC  T OP2   1 
ATOM   8082  O  "O5'" . DC  C  3 11  ? 23.347  13.305  53.639  1.00 57.90  ? 711 DC  T "O5'" 1 
ATOM   8083  C  "C5'" . DC  C  3 11  ? 23.356  14.307  54.648  1.00 63.08  ? 711 DC  T "C5'" 1 
ATOM   8084  C  "C4'" . DC  C  3 11  ? 22.203  15.273  54.452  1.00 66.80  ? 711 DC  T "C4'" 1 
ATOM   8085  O  "O4'" . DC  C  3 11  ? 22.396  16.003  53.216  1.00 76.74  ? 711 DC  T "O4'" 1 
ATOM   8086  C  "C3'" . DC  C  3 11  ? 20.841  14.618  54.308  1.00 77.88  ? 711 DC  T "C3'" 1 
ATOM   8087  O  "O3'" . DC  C  3 11  ? 20.262  14.353  55.610  1.00 83.50  ? 711 DC  T "O3'" 1 
ATOM   8088  C  "C2'" . DC  C  3 11  ? 20.065  15.657  53.505  1.00 82.55  ? 711 DC  T "C2'" 1 
ATOM   8089  C  "C1'" . DC  C  3 11  ? 21.145  16.222  52.583  1.00 80.45  ? 711 DC  T "C1'" 1 
ATOM   8090  N  N1    . DC  C  3 11  ? 21.170  15.585  51.231  1.00 80.30  ? 711 DC  T N1    1 
ATOM   8091  C  C2    . DC  C  3 11  ? 20.346  16.087  50.218  1.00 71.61  ? 711 DC  T C2    1 
ATOM   8092  O  O2    . DC  C  3 11  ? 19.612  17.051  50.463  1.00 71.05  ? 711 DC  T O2    1 
ATOM   8093  N  N3    . DC  C  3 11  ? 20.375  15.500  48.996  1.00 75.62  ? 711 DC  T N3    1 
ATOM   8094  C  C4    . DC  C  3 11  ? 21.181  14.461  48.773  1.00 81.13  ? 711 DC  T C4    1 
ATOM   8095  N  N4    . DC  C  3 11  ? 21.176  13.916  47.552  1.00 77.69  ? 711 DC  T N4    1 
ATOM   8096  C  C5    . DC  C  3 11  ? 22.028  13.934  49.793  1.00 85.94  ? 711 DC  T C5    1 
ATOM   8097  C  C6    . DC  C  3 11  ? 21.991  14.521  50.994  1.00 83.94  ? 711 DC  T C6    1 
ATOM   8098  P  P     . DC  C  3 12  ? 19.411  15.460  56.415  1.00 76.20  ? 712 DC  T P     1 
ATOM   8099  O  OP1   . DC  C  3 12  ? 20.084  16.775  56.335  1.00 80.43  ? 712 DC  T OP1   1 
ATOM   8100  O  OP2   . DC  C  3 12  ? 19.146  14.881  57.749  1.00 74.35  ? 712 DC  T OP2   1 
ATOM   8101  O  "O5'" . DC  C  3 12  ? 18.004  15.511  55.655  1.00 76.63  ? 712 DC  T "O5'" 1 
ATOM   8102  C  "C5'" . DC  C  3 12  ? 17.279  16.732  55.585  1.00 67.55  ? 712 DC  T "C5'" 1 
ATOM   8103  C  "C4'" . DC  C  3 12  ? 16.153  16.635  54.571  1.00 69.56  ? 712 DC  T "C4'" 1 
ATOM   8104  O  "O4'" . DC  C  3 12  ? 16.696  16.313  53.267  1.00 67.45  ? 712 DC  T "O4'" 1 
ATOM   8105  C  "C3'" . DC  C  3 12  ? 15.098  15.563  54.873  1.00 67.82  ? 712 DC  T "C3'" 1 
ATOM   8106  O  "O3'" . DC  C  3 12  ? 13.810  16.161  54.967  1.00 75.82  ? 712 DC  T "O3'" 1 
ATOM   8107  C  "C2'" . DC  C  3 12  ? 15.189  14.597  53.686  1.00 65.18  ? 712 DC  T "C2'" 1 
ATOM   8108  C  "C1'" . DC  C  3 12  ? 15.793  15.470  52.602  1.00 68.89  ? 712 DC  T "C1'" 1 
ATOM   8109  N  N1    . DC  C  3 12  ? 16.533  14.695  51.569  1.00 83.81  ? 712 DC  T N1    1 
ATOM   8110  C  C2    . DC  C  3 12  ? 16.253  14.902  50.214  1.00 93.26  ? 712 DC  T C2    1 
ATOM   8111  O  O2    . DC  C  3 12  ? 15.398  15.738  49.895  1.00 97.62  ? 712 DC  T O2    1 
ATOM   8112  N  N3    . DC  C  3 12  ? 16.932  14.182  49.286  1.00 92.90  ? 712 DC  T N3    1 
ATOM   8113  C  C4    . DC  C  3 12  ? 17.847  13.291  49.671  1.00 91.70  ? 712 DC  T C4    1 
ATOM   8114  N  N4    . DC  C  3 12  ? 18.491  12.606  48.721  1.00 92.91  ? 712 DC  T N4    1 
ATOM   8115  C  C5    . DC  C  3 12  ? 18.143  13.063  51.047  1.00 86.24  ? 712 DC  T C5    1 
ATOM   8116  C  C6    . DC  C  3 12  ? 17.467  13.778  51.952  1.00 85.55  ? 712 DC  T C6    1 
ATOM   8117  P  P     . DC  C  3 13  ? 12.506  15.254  55.219  1.00 80.23  ? 713 DC  T P     1 
ATOM   8118  O  OP1   . DC  C  3 13  ? 11.557  16.066  56.013  1.00 80.67  ? 713 DC  T OP1   1 
ATOM   8119  O  OP2   . DC  C  3 13  ? 12.940  13.934  55.730  1.00 75.41  ? 713 DC  T OP2   1 
ATOM   8120  O  "O5'" . DC  C  3 13  ? 11.897  15.047  53.754  1.00 77.37  ? 713 DC  T "O5'" 1 
ATOM   8121  C  "C5'" . DC  C  3 13  ? 11.354  16.159  53.053  1.00 78.01  ? 713 DC  T "C5'" 1 
ATOM   8122  C  "C4'" . DC  C  3 13  ? 11.038  15.797  51.614  1.00 88.24  ? 713 DC  T "C4'" 1 
ATOM   8123  O  "O4'" . DC  C  3 13  ? 12.252  15.436  50.927  1.00 95.43  ? 713 DC  T "O4'" 1 
ATOM   8124  C  "C3'" . DC  C  3 13  ? 10.135  14.593  51.436  1.00 92.97  ? 713 DC  T "C3'" 1 
ATOM   8125  O  "O3'" . DC  C  3 13  ? 8.771   14.990  51.546  1.00 99.36  ? 713 DC  T "O3'" 1 
ATOM   8126  C  "C2'" . DC  C  3 13  ? 10.475  14.138  50.015  1.00 98.46  ? 713 DC  T "C2'" 1 
ATOM   8127  C  "C1'" . DC  C  3 13  ? 11.936  14.578  49.845  1.00 95.39  ? 713 DC  T "C1'" 1 
ATOM   8128  N  N1    . DC  C  3 13  ? 12.905  13.445  49.833  1.00 86.97  ? 713 DC  T N1    1 
ATOM   8129  C  C2    . DC  C  3 13  ? 13.243  12.839  48.618  1.00 88.53  ? 713 DC  T C2    1 
ATOM   8130  O  O2    . DC  C  3 13  ? 12.729  13.256  47.573  1.00 88.20  ? 713 DC  T O2    1 
ATOM   8131  N  N3    . DC  C  3 13  ? 14.125  11.809  48.621  1.00 87.34  ? 713 DC  T N3    1 
ATOM   8132  C  C4    . DC  C  3 13  ? 14.657  11.389  49.770  1.00 81.61  ? 713 DC  T C4    1 
ATOM   8133  N  N4    . DC  C  3 13  ? 15.522  10.370  49.723  1.00 80.76  ? 713 DC  T N4    1 
ATOM   8134  C  C5    . DC  C  3 13  ? 14.325  11.994  51.018  1.00 77.09  ? 713 DC  T C5    1 
ATOM   8135  C  C6    . DC  C  3 13  ? 13.453  13.009  51.003  1.00 78.57  ? 713 DC  T C6    1 
ATOM   8136  P  P     . DG  C  3 14  ? 7.626   13.895  51.816  1.00 102.08 ? 714 DG  T P     1 
ATOM   8137  O  OP1   . DG  C  3 14  ? 6.409   14.607  52.259  1.00 104.53 ? 714 DG  T OP1   1 
ATOM   8138  O  OP2   . DG  C  3 14  ? 8.209   12.833  52.665  1.00 103.34 ? 714 DG  T OP2   1 
ATOM   8139  O  "O5'" . DG  C  3 14  ? 7.347   13.270  50.373  1.00 97.30  ? 714 DG  T "O5'" 1 
ATOM   8140  C  "C5'" . DG  C  3 14  ? 6.977   14.116  49.292  1.00 97.49  ? 714 DG  T "C5'" 1 
ATOM   8141  C  "C4'" . DG  C  3 14  ? 6.926   13.332  47.995  1.00 100.66 ? 714 DG  T "C4'" 1 
ATOM   8142  O  "O4'" . DG  C  3 14  ? 8.238   12.773  47.716  1.00 100.69 ? 714 DG  T "O4'" 1 
ATOM   8143  C  "C3'" . DG  C  3 14  ? 5.953   12.155  47.998  1.00 105.88 ? 714 DG  T "C3'" 1 
ATOM   8144  O  "O3'" . DG  C  3 14  ? 5.295   12.064  46.744  1.00 113.13 ? 714 DG  T "O3'" 1 
ATOM   8145  C  "C2'" . DG  C  3 14  ? 6.860   10.954  48.245  1.00 103.61 ? 714 DG  T "C2'" 1 
ATOM   8146  C  "C1'" . DG  C  3 14  ? 8.134   11.377  47.533  1.00 100.84 ? 714 DG  T "C1'" 1 
ATOM   8147  N  N9    . DG  C  3 14  ? 9.334   10.748  48.077  1.00 100.04 ? 714 DG  T N9    1 
ATOM   8148  C  C8    . DG  C  3 14  ? 9.723   10.710  49.394  1.00 95.74  ? 714 DG  T C8    1 
ATOM   8149  N  N7    . DG  C  3 14  ? 10.844  10.073  49.587  1.00 88.96  ? 714 DG  T N7    1 
ATOM   8150  C  C5    . DG  C  3 14  ? 11.225  9.661   48.317  1.00 94.15  ? 714 DG  T C5    1 
ATOM   8151  C  C6    . DG  C  3 14  ? 12.360  8.927   47.900  1.00 96.89  ? 714 DG  T C6    1 
ATOM   8152  O  O6    . DG  C  3 14  ? 13.283  8.481   48.594  1.00 95.81  ? 714 DG  T O6    1 
ATOM   8153  N  N1    . DG  C  3 14  ? 12.363  8.723   46.522  1.00 103.29 ? 714 DG  T N1    1 
ATOM   8154  C  C2    . DG  C  3 14  ? 11.393  9.173   45.657  1.00 104.12 ? 714 DG  T C2    1 
ATOM   8155  N  N2    . DG  C  3 14  ? 11.569  8.879   44.361  1.00 108.50 ? 714 DG  T N2    1 
ATOM   8156  N  N3    . DG  C  3 14  ? 10.324  9.862   46.036  1.00 104.91 ? 714 DG  T N3    1 
ATOM   8157  C  C4    . DG  C  3 14  ? 10.305  10.068  47.375  1.00 101.62 ? 714 DG  T C4    1 
ATOM   8158  P  P     . DA  C  3 15  ? 3.923   11.241  46.607  1.00 117.05 ? 715 DA  T P     1 
ATOM   8159  O  OP1   . DA  C  3 15  ? 2.874   12.191  46.175  1.00 124.84 ? 715 DA  T OP1   1 
ATOM   8160  O  OP2   . DA  C  3 15  ? 3.733   10.450  47.844  1.00 110.64 ? 715 DA  T OP2   1 
ATOM   8161  O  "O5'" . DA  C  3 15  ? 4.214   10.221  45.413  1.00 125.62 ? 715 DA  T "O5'" 1 
ATOM   8162  C  "C5'" . DA  C  3 15  ? 4.660   10.715  44.157  1.00 131.76 ? 715 DA  T "C5'" 1 
ATOM   8163  C  "C4'" . DA  C  3 15  ? 5.335   9.621   43.353  1.00 133.90 ? 715 DA  T "C4'" 1 
ATOM   8164  O  "O4'" . DA  C  3 15  ? 6.582   9.245   43.994  1.00 126.82 ? 715 DA  T "O4'" 1 
ATOM   8165  C  "C3'" . DA  C  3 15  ? 4.523   8.336   43.204  1.00 136.77 ? 715 DA  T "C3'" 1 
ATOM   8166  O  "O3'" . DA  C  3 15  ? 4.627   7.854   41.873  1.00 143.15 ? 715 DA  T "O3'" 1 
ATOM   8167  C  "C2'" . DA  C  3 15  ? 5.176   7.383   44.205  1.00 128.77 ? 715 DA  T "C2'" 1 
ATOM   8168  C  "C1'" . DA  C  3 15  ? 6.624   7.849   44.184  1.00 122.98 ? 715 DA  T "C1'" 1 
ATOM   8169  N  N9    . DA  C  3 15  ? 7.335   7.580   45.430  1.00 115.14 ? 715 DA  T N9    1 
ATOM   8170  C  C8    . DA  C  3 15  ? 6.942   7.927   46.692  1.00 112.49 ? 715 DA  T C8    1 
ATOM   8171  N  N7    . DA  C  3 15  ? 7.784   7.560   47.629  1.00 107.27 ? 715 DA  T N7    1 
ATOM   8172  C  C5    . DA  C  3 15  ? 8.801   6.929   46.933  1.00 106.81 ? 715 DA  T C5    1 
ATOM   8173  C  C6    . DA  C  3 15  ? 9.997   6.314   47.351  1.00 100.67 ? 715 DA  T C6    1 
ATOM   8174  N  N6    . DA  C  3 15  ? 10.376  6.236   48.631  1.00 91.12  ? 715 DA  T N6    1 
ATOM   8175  N  N1    . DA  C  3 15  ? 10.791  5.780   46.400  1.00 103.64 ? 715 DA  T N1    1 
ATOM   8176  C  C2    . DA  C  3 15  ? 10.408  5.860   45.120  1.00 106.27 ? 715 DA  T C2    1 
ATOM   8177  N  N3    . DA  C  3 15  ? 9.310   6.412   44.606  1.00 110.17 ? 715 DA  T N3    1 
ATOM   8178  C  C4    . DA  C  3 15  ? 8.541   6.934   45.575  1.00 111.00 ? 715 DA  T C4    1 
ATOM   8179  P  P     . DA  C  3 16  ? 3.685   6.653   41.371  1.00 156.92 ? 716 DA  T P     1 
ATOM   8180  O  OP1   . DA  C  3 16  ? 3.214   6.991   40.009  1.00 168.75 ? 716 DA  T OP1   1 
ATOM   8181  O  OP2   . DA  C  3 16  ? 2.701   6.366   42.438  1.00 158.56 ? 716 DA  T OP2   1 
ATOM   8182  O  "O5'" . DA  C  3 16  ? 4.684   5.410   41.274  1.00 149.11 ? 716 DA  T "O5'" 1 
ATOM   8183  C  "C5'" . DA  C  3 16  ? 5.882   5.524   40.518  1.00 141.28 ? 716 DA  T "C5'" 1 
ATOM   8184  C  "C4'" . DA  C  3 16  ? 6.790   4.335   40.770  1.00 134.59 ? 716 DA  T "C4'" 1 
ATOM   8185  O  "O4'" . DA  C  3 16  ? 7.393   4.455   42.084  1.00 129.09 ? 716 DA  T "O4'" 1 
ATOM   8186  C  "C3'" . DA  C  3 16  ? 6.089   2.975   40.737  1.00 134.80 ? 716 DA  T "C3'" 1 
ATOM   8187  O  "O3'" . DA  C  3 16  ? 6.814   2.072   39.916  1.00 133.72 ? 716 DA  T "O3'" 1 
ATOM   8188  C  "C2'" . DA  C  3 16  ? 6.080   2.529   42.200  1.00 129.07 ? 716 DA  T "C2'" 1 
ATOM   8189  C  "C1'" . DA  C  3 16  ? 7.320   3.217   42.748  1.00 125.98 ? 716 DA  T "C1'" 1 
ATOM   8190  N  N9    . DA  C  3 16  ? 7.255   3.468   44.185  1.00 123.14 ? 716 DA  T N9    1 
ATOM   8191  C  C8    . DA  C  3 16  ? 6.243   4.083   44.868  1.00 123.43 ? 716 DA  T C8    1 
ATOM   8192  N  N7    . DA  C  3 16  ? 6.454   4.171   46.160  1.00 116.77 ? 716 DA  T N7    1 
ATOM   8193  C  C5    . DA  C  3 16  ? 7.690   3.571   46.337  1.00 114.73 ? 716 DA  T C5    1 
ATOM   8194  C  C6    . DA  C  3 16  ? 8.480   3.343   47.481  1.00 105.89 ? 716 DA  T C6    1 
ATOM   8195  N  N6    . DA  C  3 16  ? 8.115   3.714   48.712  1.00 95.74  ? 716 DA  T N6    1 
ATOM   8196  N  N1    . DA  C  3 16  ? 9.663   2.719   47.309  1.00 108.83 ? 716 DA  T N1    1 
ATOM   8197  C  C2    . DA  C  3 16  ? 10.025  2.349   46.074  1.00 114.70 ? 716 DA  T C2    1 
ATOM   8198  N  N3    . DA  C  3 16  ? 9.369   2.508   44.926  1.00 116.71 ? 716 DA  T N3    1 
ATOM   8199  C  C4    . DA  C  3 16  ? 8.198   3.132   45.129  1.00 118.25 ? 716 DA  T C4    1 
ATOM   8200  P  P     . DC  C  3 17  ? 6.172   0.657   39.510  1.00 140.58 ? 717 DC  T P     1 
ATOM   8201  O  OP1   . DC  C  3 17  ? 6.531   0.385   38.101  1.00 151.08 ? 717 DC  T OP1   1 
ATOM   8202  O  OP2   . DC  C  3 17  ? 4.750   0.670   39.919  1.00 144.88 ? 717 DC  T OP2   1 
ATOM   8203  O  "O5'" . DC  C  3 17  ? 6.938   -0.386  40.446  1.00 136.56 ? 717 DC  T "O5'" 1 
ATOM   8204  C  "C5'" . DC  C  3 17  ? 8.358   -0.425  40.445  1.00 134.92 ? 717 DC  T "C5'" 1 
ATOM   8205  C  "C4'" . DC  C  3 17  ? 8.873   -1.168  41.661  1.00 134.24 ? 717 DC  T "C4'" 1 
ATOM   8206  O  "O4'" . DC  C  3 17  ? 8.590   -0.402  42.847  1.00 130.39 ? 717 DC  T "O4'" 1 
ATOM   8207  C  "C3'" . DC  C  3 17  ? 8.238   -2.542  41.888  1.00 138.61 ? 717 DC  T "C3'" 1 
ATOM   8208  O  "O3'" . DC  C  3 17  ? 9.183   -3.566  41.607  1.00 142.40 ? 717 DC  T "O3'" 1 
ATOM   8209  C  "C2'" . DC  C  3 17  ? 7.818   -2.543  43.369  1.00 134.00 ? 717 DC  T "C2'" 1 
ATOM   8210  C  "C1'" . DC  C  3 17  ? 8.473   -1.285  43.927  1.00 129.23 ? 717 DC  T "C1'" 1 
ATOM   8211  N  N1    . DC  C  3 17  ? 7.669   -0.622  44.993  1.00 126.07 ? 717 DC  T N1    1 
ATOM   8212  C  C2    . DC  C  3 17  ? 8.130   -0.631  46.312  1.00 117.30 ? 717 DC  T C2    1 
ATOM   8213  O  O2    . DC  C  3 17  ? 9.203   -1.189  46.572  1.00 113.26 ? 717 DC  T O2    1 
ATOM   8214  N  N3    . DC  C  3 17  ? 7.387   -0.025  47.272  1.00 114.48 ? 717 DC  T N3    1 
ATOM   8215  C  C4    . DC  C  3 17  ? 6.235   0.565   46.950  1.00 117.70 ? 717 DC  T C4    1 
ATOM   8216  N  N4    . DC  C  3 17  ? 5.537   1.149   47.930  1.00 115.43 ? 717 DC  T N4    1 
ATOM   8217  C  C5    . DC  C  3 17  ? 5.748   0.583   45.610  1.00 121.54 ? 717 DC  T C5    1 
ATOM   8218  C  C6    . DC  C  3 17  ? 6.489   -0.018  44.674  1.00 124.86 ? 717 DC  T C6    1 
ATOM   8219  P  P     . DA  C  3 18  ? 8.757   -5.112  41.699  1.00 146.90 ? 718 DA  T P     1 
ATOM   8220  O  OP1   . DA  C  3 18  ? 9.540   -5.853  40.686  1.00 153.07 ? 718 DA  T OP1   1 
ATOM   8221  O  OP2   . DA  C  3 18  ? 7.279   -5.185  41.680  1.00 147.95 ? 718 DA  T OP2   1 
ATOM   8222  O  "O5'" . DA  C  3 18  ? 9.252   -5.554  43.152  1.00 139.60 ? 718 DA  T "O5'" 1 
ATOM   8223  C  "C5'" . DA  C  3 18  ? 10.602  -5.327  43.539  1.00 135.32 ? 718 DA  T "C5'" 1 
ATOM   8224  C  "C4'" . DA  C  3 18  ? 10.851  -5.825  44.951  1.00 133.17 ? 718 DA  T "C4'" 1 
ATOM   8225  O  "O4'" . DA  C  3 18  ? 10.221  -4.929  45.903  1.00 135.93 ? 718 DA  T "O4'" 1 
ATOM   8226  C  "C3'" . DA  C  3 18  ? 10.304  -7.219  45.248  1.00 134.35 ? 718 DA  T "C3'" 1 
ATOM   8227  O  "O3'" . DA  C  3 18  ? 11.229  -7.941  46.043  1.00 132.19 ? 718 DA  T "O3'" 1 
ATOM   8228  C  "C2'" . DA  C  3 18  ? 9.008   -6.936  46.005  1.00 137.58 ? 718 DA  T "C2'" 1 
ATOM   8229  C  "C1'" . DA  C  3 18  ? 9.352   -5.653  46.748  1.00 135.35 ? 718 DA  T "C1'" 1 
ATOM   8230  N  N9    . DA  C  3 18  ? 8.191   -4.814  47.029  1.00 126.59 ? 718 DA  T N9    1 
ATOM   8231  C  C8    . DA  C  3 18  ? 7.230   -4.416  46.143  1.00 127.49 ? 718 DA  T C8    1 
ATOM   8232  N  N7    . DA  C  3 18  ? 6.301   -3.656  46.673  1.00 127.15 ? 718 DA  T N7    1 
ATOM   8233  C  C5    . DA  C  3 18  ? 6.681   -3.546  48.000  1.00 122.46 ? 718 DA  T C5    1 
ATOM   8234  C  C6    . DA  C  3 18  ? 6.111   -2.870  49.097  1.00 110.81 ? 718 DA  T C6    1 
ATOM   8235  N  N6    . DA  C  3 18  ? 4.988   -2.149  49.014  1.00 114.13 ? 718 DA  T N6    1 
ATOM   8236  N  N1    . DA  C  3 18  ? 6.742   -2.964  50.286  1.00 101.03 ? 718 DA  T N1    1 
ATOM   8237  C  C2    . DA  C  3 18  ? 7.864   -3.689  50.365  1.00 102.27 ? 718 DA  T C2    1 
ATOM   8238  N  N3    . DA  C  3 18  ? 8.494   -4.366  49.406  1.00 110.92 ? 718 DA  T N3    1 
ATOM   8239  C  C4    . DA  C  3 18  ? 7.844   -4.253  48.237  1.00 119.47 ? 718 DA  T C4    1 
ATOM   8240  P  P     . DG  C  3 19  ? 11.170  -9.545  46.096  1.00 141.54 ? 719 DG  T P     1 
ATOM   8241  O  OP1   . DG  C  3 19  ? 12.553  -10.052 45.947  1.00 145.16 ? 719 DG  T OP1   1 
ATOM   8242  O  OP2   . DG  C  3 19  ? 10.117  -9.989  45.156  1.00 142.40 ? 719 DG  T OP2   1 
ATOM   8243  O  "O5'" . DG  C  3 19  ? 10.663  -9.855  47.578  1.00 136.31 ? 719 DG  T "O5'" 1 
ATOM   8244  C  "C5'" . DG  C  3 19  ? 11.352  -9.303  48.690  1.00 126.44 ? 719 DG  T "C5'" 1 
ATOM   8245  C  "C4'" . DG  C  3 19  ? 10.524  -9.435  49.953  1.00 118.56 ? 719 DG  T "C4'" 1 
ATOM   8246  O  "O4'" . DG  C  3 19  ? 9.512   -8.395  49.985  1.00 116.05 ? 719 DG  T "O4'" 1 
ATOM   8247  C  "C3'" . DG  C  3 19  ? 9.776   -10.763 50.097  1.00 118.29 ? 719 DG  T "C3'" 1 
ATOM   8248  O  "O3'" . DG  C  3 19  ? 9.913   -11.249 51.420  1.00 117.68 ? 719 DG  T "O3'" 1 
ATOM   8249  C  "C2'" . DG  C  3 19  ? 8.328   -10.387 49.787  1.00 118.61 ? 719 DG  T "C2'" 1 
ATOM   8250  C  "C1'" . DG  C  3 19  ? 8.272   -8.968  50.321  1.00 115.69 ? 719 DG  T "C1'" 1 
ATOM   8251  N  N9    . DG  C  3 19  ? 7.210   -8.159  49.731  1.00 108.34 ? 719 DG  T N9    1 
ATOM   8252  C  C8    . DG  C  3 19  ? 6.803   -8.154  48.418  1.00 110.61 ? 719 DG  T C8    1 
ATOM   8253  N  N7    . DG  C  3 19  ? 5.827   -7.322  48.181  1.00 108.59 ? 719 DG  T N7    1 
ATOM   8254  C  C5    . DG  C  3 19  ? 5.570   -6.739  49.416  1.00 101.64 ? 719 DG  T C5    1 
ATOM   8255  C  C6    . DG  C  3 19  ? 4.617   -5.759  49.781  1.00 97.66  ? 719 DG  T C6    1 
ATOM   8256  O  O6    . DG  C  3 19  ? 3.782   -5.194  49.061  1.00 104.29 ? 719 DG  T O6    1 
ATOM   8257  N  N1    . DG  C  3 19  ? 4.693   -5.447  51.136  1.00 89.70  ? 719 DG  T N1    1 
ATOM   8258  C  C2    . DG  C  3 19  ? 5.578   -6.010  52.024  1.00 88.94  ? 719 DG  T C2    1 
ATOM   8259  N  N2    . DG  C  3 19  ? 5.501   -5.583  53.293  1.00 86.70  ? 719 DG  T N2    1 
ATOM   8260  N  N3    . DG  C  3 19  ? 6.475   -6.929  51.695  1.00 92.46  ? 719 DG  T N3    1 
ATOM   8261  C  C4    . DG  C  3 19  ? 6.414   -7.244  50.379  1.00 99.31  ? 719 DG  T C4    1 
ATOM   8262  P  P     . DG  C  3 20  ? 9.858   -12.828 51.711  1.00 124.58 ? 720 DG  T P     1 
ATOM   8263  O  OP1   . DG  C  3 20  ? 11.222  -13.264 52.084  1.00 128.20 ? 720 DG  T OP1   1 
ATOM   8264  O  OP2   . DG  C  3 20  ? 9.163   -13.471 50.574  1.00 126.93 ? 720 DG  T OP2   1 
ATOM   8265  O  "O5'" . DG  C  3 20  ? 8.909   -12.943 52.991  1.00 122.36 ? 720 DG  T "O5'" 1 
ATOM   8266  C  "C5'" . DG  C  3 20  ? 9.187   -12.174 54.153  1.00 112.06 ? 720 DG  T "C5'" 1 
ATOM   8267  C  "C4'" . DG  C  3 20  ? 7.934   -11.996 54.989  1.00 106.49 ? 720 DG  T "C4'" 1 
ATOM   8268  O  "O4'" . DG  C  3 20  ? 7.126   -10.923 54.433  1.00 107.38 ? 720 DG  T "O4'" 1 
ATOM   8269  C  "C3'" . DG  C  3 20  ? 7.023   -13.226 55.051  1.00 114.94 ? 720 DG  T "C3'" 1 
ATOM   8270  O  "O3'" . DG  C  3 20  ? 6.558   -13.419 56.380  1.00 125.04 ? 720 DG  T "O3'" 1 
ATOM   8271  C  "C2'" . DG  C  3 20  ? 5.880   -12.858 54.109  1.00 113.74 ? 720 DG  T "C2'" 1 
ATOM   8272  C  "C1'" . DG  C  3 20  ? 5.793   -11.360 54.327  1.00 112.08 ? 720 DG  T "C1'" 1 
ATOM   8273  N  N9    . DG  C  3 20  ? 5.146   -10.646 53.230  1.00 113.33 ? 720 DG  T N9    1 
ATOM   8274  C  C8    . DG  C  3 20  ? 5.351   -10.833 51.884  1.00 115.92 ? 720 DG  T C8    1 
ATOM   8275  N  N7    . DG  C  3 20  ? 4.624   -10.052 51.135  1.00 117.33 ? 720 DG  T N7    1 
ATOM   8276  C  C5    . DG  C  3 20  ? 3.888   -9.299  52.041  1.00 111.40 ? 720 DG  T C5    1 
ATOM   8277  C  C6    . DG  C  3 20  ? 2.928   -8.284  51.817  1.00 105.34 ? 720 DG  T C6    1 
ATOM   8278  O  O6    . DG  C  3 20  ? 2.524   -7.835  50.735  1.00 105.31 ? 720 DG  T O6    1 
ATOM   8279  N  N1    . DG  C  3 20  ? 2.422   -7.780  53.012  1.00 102.06 ? 720 DG  T N1    1 
ATOM   8280  C  C2    . DG  C  3 20  ? 2.797   -8.203  54.265  1.00 96.51  ? 720 DG  T C2    1 
ATOM   8281  N  N2    . DG  C  3 20  ? 2.198   -7.597  55.301  1.00 89.82  ? 720 DG  T N2    1 
ATOM   8282  N  N3    . DG  C  3 20  ? 3.695   -9.153  54.489  1.00 99.02  ? 720 DG  T N3    1 
ATOM   8283  C  C4    . DG  C  3 20  ? 4.197   -9.654  53.335  1.00 108.59 ? 720 DG  T C4    1 
ATOM   8284  P  P     . DG  C  3 21  ? 6.051   -14.867 56.861  1.00 139.58 ? 721 DG  T P     1 
ATOM   8285  O  OP1   . DG  C  3 21  ? 7.116   -15.455 57.702  1.00 145.14 ? 721 DG  T OP1   1 
ATOM   8286  O  OP2   . DG  C  3 21  ? 5.563   -15.605 55.675  1.00 144.37 ? 721 DG  T OP2   1 
ATOM   8287  O  "O5'" . DG  C  3 21  ? 4.790   -14.538 57.786  1.00 136.19 ? 721 DG  T "O5'" 1 
ATOM   8288  C  "C5'" . DG  C  3 21  ? 4.947   -13.695 58.919  1.00 130.79 ? 721 DG  T "C5'" 1 
ATOM   8289  C  "C4'" . DG  C  3 21  ? 3.686   -12.888 59.173  1.00 121.71 ? 721 DG  T "C4'" 1 
ATOM   8290  O  "O4'" . DG  C  3 21  ? 3.386   -12.074 58.009  1.00 119.42 ? 721 DG  T "O4'" 1 
ATOM   8291  C  "C3'" . DG  C  3 21  ? 2.433   -13.717 59.454  1.00 120.58 ? 721 DG  T "C3'" 1 
ATOM   8292  O  "O3'" . DG  C  3 21  ? 1.715   -13.148 60.539  1.00 123.43 ? 721 DG  T "O3'" 1 
ATOM   8293  C  "C2'" . DG  C  3 21  ? 1.647   -13.632 58.146  1.00 119.31 ? 721 DG  T "C2'" 1 
ATOM   8294  C  "C1'" . DG  C  3 21  ? 2.039   -12.254 57.636  1.00 118.88 ? 721 DG  T "C1'" 1 
ATOM   8295  N  N9    . DG  C  3 21  ? 1.945   -12.120 56.184  1.00 115.78 ? 721 DG  T N9    1 
ATOM   8296  C  C8    . DG  C  3 21  ? 2.669   -12.810 55.243  1.00 115.69 ? 721 DG  T C8    1 
ATOM   8297  N  N7    . DG  C  3 21  ? 2.379   -12.478 54.015  1.00 115.74 ? 721 DG  T N7    1 
ATOM   8298  C  C5    . DG  C  3 21  ? 1.400   -11.503 54.149  1.00 112.87 ? 721 DG  T C5    1 
ATOM   8299  C  C6    . DG  C  3 21  ? 0.702   -10.771 53.159  1.00 103.79 ? 721 DG  T C6    1 
ATOM   8300  O  O6    . DG  C  3 21  ? 0.816   -10.845 51.927  1.00 99.30  ? 721 DG  T O6    1 
ATOM   8301  N  N1    . DG  C  3 21  ? -0.207  -9.880  53.722  1.00 98.49  ? 721 DG  T N1    1 
ATOM   8302  C  C2    . DG  C  3 21  ? -0.415  -9.717  55.071  1.00 99.45  ? 721 DG  T C2    1 
ATOM   8303  N  N2    . DG  C  3 21  ? -1.336  -8.807  55.424  1.00 92.65  ? 721 DG  T N2    1 
ATOM   8304  N  N3    . DG  C  3 21  ? 0.232   -10.396 56.010  1.00 103.91 ? 721 DG  T N3    1 
ATOM   8305  C  C4    . DG  C  3 21  ? 1.122   -11.269 55.478  1.00 110.96 ? 721 DG  T C4    1 
ATOM   8306  P  P     . DA  C  3 22  ? 0.597   -14.007 61.309  1.00 125.40 ? 722 DA  T P     1 
ATOM   8307  O  OP1   . DA  C  3 22  ? 0.507   -13.488 62.693  1.00 106.69 ? 722 DA  T OP1   1 
ATOM   8308  O  OP2   . DA  C  3 22  ? 0.884   -15.440 61.075  1.00 134.49 ? 722 DA  T OP2   1 
ATOM   8309  O  "O5'" . DA  C  3 22  ? -0.753  -13.646 60.535  1.00 118.46 ? 722 DA  T "O5'" 1 
ATOM   8310  C  "C5'" . DA  C  3 22  ? -1.142  -12.287 60.392  1.00 106.97 ? 722 DA  T "C5'" 1 
ATOM   8311  C  "C4'" . DA  C  3 22  ? -2.369  -12.169 59.509  1.00 103.45 ? 722 DA  T "C4'" 1 
ATOM   8312  O  "O4'" . DA  C  3 22  ? -1.966  -12.106 58.116  1.00 102.08 ? 722 DA  T "O4'" 1 
ATOM   8313  C  "C3'" . DA  C  3 22  ? -3.358  -13.333 59.621  1.00 102.60 ? 722 DA  T "C3'" 1 
ATOM   8314  O  "O3'" . DA  C  3 22  ? -4.675  -12.830 59.770  1.00 110.19 ? 722 DA  T "O3'" 1 
ATOM   8315  C  "C2'" . DA  C  3 22  ? -3.187  -14.076 58.294  1.00 104.37 ? 722 DA  T "C2'" 1 
ATOM   8316  C  "C1'" . DA  C  3 22  ? -2.805  -12.942 57.359  1.00 106.30 ? 722 DA  T "C1'" 1 
ATOM   8317  N  N9    . DA  C  3 22  ? -2.076  -13.383 56.172  1.00 104.76 ? 722 DA  T N9    1 
ATOM   8318  C  C8    . DA  C  3 22  ? -1.105  -14.343 56.110  1.00 105.81 ? 722 DA  T C8    1 
ATOM   8319  N  N7    . DA  C  3 22  ? -0.623  -14.532 54.904  1.00 104.98 ? 722 DA  T N7    1 
ATOM   8320  C  C5    . DA  C  3 22  ? -1.327  -13.632 54.120  1.00 105.51 ? 722 DA  T C5    1 
ATOM   8321  C  C6    . DA  C  3 22  ? -1.285  -13.337 52.743  1.00 106.00 ? 722 DA  T C6    1 
ATOM   8322  N  N6    . DA  C  3 22  ? -0.464  -13.950 51.883  1.00 106.44 ? 722 DA  T N6    1 
ATOM   8323  N  N1    . DA  C  3 22  ? -2.120  -12.383 52.282  1.00 103.34 ? 722 DA  T N1    1 
ATOM   8324  C  C2    . DA  C  3 22  ? -2.940  -11.771 53.145  1.00 101.76 ? 722 DA  T C2    1 
ATOM   8325  N  N3    . DA  C  3 22  ? -3.070  -11.963 54.457  1.00 101.18 ? 722 DA  T N3    1 
ATOM   8326  C  C4    . DA  C  3 22  ? -2.227  -12.916 54.886  1.00 104.56 ? 722 DA  T C4    1 
ATOM   8327  P  P     . DC  C  3 23  ? -5.823  -13.730 60.444  1.00 118.01 ? 723 DC  T P     1 
ATOM   8328  O  OP1   . DC  C  3 23  ? -6.077  -13.190 61.798  1.00 116.07 ? 723 DC  T OP1   1 
ATOM   8329  O  OP2   . DC  C  3 23  ? -5.456  -15.154 60.279  1.00 118.69 ? 723 DC  T OP2   1 
ATOM   8330  O  "O5'" . DC  C  3 23  ? -7.101  -13.441 59.530  1.00 123.14 ? 723 DC  T "O5'" 1 
ATOM   8331  C  "C5'" . DC  C  3 23  ? -7.444  -12.100 59.209  1.00 120.70 ? 723 DC  T "C5'" 1 
ATOM   8332  C  "C4'" . DC  C  3 23  ? -7.971  -12.000 57.789  1.00 121.99 ? 723 DC  T "C4'" 1 
ATOM   8333  O  "O4'" . DC  C  3 23  ? -6.916  -12.332 56.850  1.00 121.95 ? 723 DC  T "O4'" 1 
ATOM   8334  C  "C3'" . DC  C  3 23  ? -9.145  -12.929 57.466  1.00 126.06 ? 723 DC  T "C3'" 1 
ATOM   8335  O  "O3'" . DC  C  3 23  ? -10.207 -12.184 56.889  1.00 122.15 ? 723 DC  T "O3'" 1 
ATOM   8336  C  "C2'" . DC  C  3 23  ? -8.557  -13.936 56.474  1.00 129.84 ? 723 DC  T "C2'" 1 
ATOM   8337  C  "C1'" . DC  C  3 23  ? -7.453  -13.123 55.821  1.00 124.67 ? 723 DC  T "C1'" 1 
ATOM   8338  N  N1    . DC  C  3 23  ? -6.361  -13.957 55.240  1.00 122.43 ? 723 DC  T N1    1 
ATOM   8339  C  C2    . DC  C  3 23  ? -5.978  -13.767 53.908  1.00 116.54 ? 723 DC  T C2    1 
ATOM   8340  O  O2    . DC  C  3 23  ? -6.552  -12.905 53.232  1.00 108.15 ? 723 DC  T O2    1 
ATOM   8341  N  N3    . DC  C  3 23  ? -4.984  -14.534 53.395  1.00 117.40 ? 723 DC  T N3    1 
ATOM   8342  C  C4    . DC  C  3 23  ? -4.389  -15.454 54.156  1.00 120.17 ? 723 DC  T C4    1 
ATOM   8343  N  N4    . DC  C  3 23  ? -3.415  -16.186 53.606  1.00 118.73 ? 723 DC  T N4    1 
ATOM   8344  C  C5    . DC  C  3 23  ? -4.768  -15.663 55.515  1.00 124.06 ? 723 DC  T C5    1 
ATOM   8345  C  C6    . DC  C  3 23  ? -5.748  -14.901 56.010  1.00 123.87 ? 723 DC  T C6    1 
ATOM   8346  P  P     . DT  C  3 24  ? -11.705 -12.765 56.905  1.00 176.78 ? 724 DT  T P     1 
ATOM   8347  O  OP1   . DT  C  3 24  ? -12.599 -11.688 57.384  1.00 172.69 ? 724 DT  T OP1   1 
ATOM   8348  O  OP2   . DT  C  3 24  ? -11.674 -14.065 57.612  1.00 166.89 ? 724 DT  T OP2   1 
ATOM   8349  O  "O5'" . DT  C  3 24  ? -12.019 -13.054 55.363  1.00 171.54 ? 724 DT  T "O5'" 1 
ATOM   8350  C  "C5'" . DT  C  3 24  ? -11.990 -11.988 54.421  1.00 170.99 ? 724 DT  T "C5'" 1 
ATOM   8351  C  "C4'" . DT  C  3 24  ? -12.007 -12.522 52.999  1.00 172.74 ? 724 DT  T "C4'" 1 
ATOM   8352  O  "O4'" . DT  C  3 24  ? -10.747 -13.185 52.714  1.00 166.75 ? 724 DT  T "O4'" 1 
ATOM   8353  C  "C3'" . DT  C  3 24  ? -13.107 -13.545 52.705  1.00 176.21 ? 724 DT  T "C3'" 1 
ATOM   8354  O  "O3'" . DT  C  3 24  ? -13.710 -13.266 51.447  1.00 184.94 ? 724 DT  T "O3'" 1 
ATOM   8355  C  "C2'" . DT  C  3 24  ? -12.358 -14.876 52.686  1.00 173.17 ? 724 DT  T "C2'" 1 
ATOM   8356  C  "C1'" . DT  C  3 24  ? -10.998 -14.454 52.155  1.00 169.90 ? 724 DT  T "C1'" 1 
ATOM   8357  N  N1    . DT  C  3 24  ? -9.893  -15.372 52.553  1.00 164.96 ? 724 DT  T N1    1 
ATOM   8358  C  C2    . DT  C  3 24  ? -8.870  -15.616 51.667  1.00 164.26 ? 724 DT  T C2    1 
ATOM   8359  O  O2    . DT  C  3 24  ? -8.812  -15.114 50.559  1.00 164.96 ? 724 DT  T O2    1 
ATOM   8360  N  N3    . DT  C  3 24  ? -7.907  -16.473 52.128  1.00 162.95 ? 724 DT  T N3    1 
ATOM   8361  C  C4    . DT  C  3 24  ? -7.867  -17.100 53.361  1.00 162.23 ? 724 DT  T C4    1 
ATOM   8362  O  O4    . DT  C  3 24  ? -6.956  -17.856 53.683  1.00 161.20 ? 724 DT  T O4    1 
ATOM   8363  C  C5    . DT  C  3 24  ? -8.972  -16.802 54.241  1.00 163.05 ? 724 DT  T C5    1 
ATOM   8364  C  C7    . DT  C  3 24  ? -9.038  -17.423 55.605  1.00 162.68 ? 724 DT  T C7    1 
ATOM   8365  C  C6    . DT  C  3 24  ? -9.921  -15.963 53.800  1.00 164.40 ? 724 DT  T C6    1 
ATOM   8366  P  P     . DG  C  3 25  ? -15.211 -13.757 51.147  1.00 190.82 ? 725 DG  T P     1 
ATOM   8367  O  OP1   . DG  C  3 25  ? -16.005 -12.566 50.775  1.00 195.99 ? 725 DG  T OP1   1 
ATOM   8368  O  OP2   . DG  C  3 25  ? -15.641 -14.603 52.283  1.00 190.08 ? 725 DG  T OP2   1 
ATOM   8369  O  "O5'" . DG  C  3 25  ? -15.060 -14.699 49.863  1.00 194.89 ? 725 DG  T "O5'" 1 
ATOM   8370  C  "C5'" . DG  C  3 25  ? -14.894 -14.122 48.572  1.00 196.33 ? 725 DG  T "C5'" 1 
ATOM   8371  C  "C4'" . DG  C  3 25  ? -14.354 -15.144 47.587  1.00 193.95 ? 725 DG  T "C4'" 1 
ATOM   8372  O  "O4'" . DG  C  3 25  ? -12.984 -15.463 47.929  1.00 190.90 ? 725 DG  T "O4'" 1 
ATOM   8373  C  "C3'" . DG  C  3 25  ? -15.085 -16.476 47.580  1.00 188.99 ? 725 DG  T "C3'" 1 
ATOM   8374  O  "O3'" . DG  C  3 25  ? -16.180 -16.425 46.673  1.00 180.47 ? 725 DG  T "O3'" 1 
ATOM   8375  C  "C2'" . DG  C  3 25  ? -14.005 -17.440 47.097  1.00 190.75 ? 725 DG  T "C2'" 1 
ATOM   8376  C  "C1'" . DG  C  3 25  ? -12.734 -16.839 47.703  1.00 190.00 ? 725 DG  T "C1'" 1 
ATOM   8377  N  N9    . DG  C  3 25  ? -12.336 -17.452 48.969  1.00 186.43 ? 725 DG  T N9    1 
ATOM   8378  C  C8    . DG  C  3 25  ? -13.000 -17.381 50.170  1.00 185.41 ? 725 DG  T C8    1 
ATOM   8379  N  N7    . DG  C  3 25  ? -12.403 -18.026 51.133  1.00 183.81 ? 725 DG  T N7    1 
ATOM   8380  C  C5    . DG  C  3 25  ? -11.267 -18.557 50.534  1.00 182.53 ? 725 DG  T C5    1 
ATOM   8381  C  C6    . DG  C  3 25  ? -10.234 -19.352 51.084  1.00 175.93 ? 725 DG  T C6    1 
ATOM   8382  O  O6    . DG  C  3 25  ? -10.115 -19.759 52.248  1.00 169.57 ? 725 DG  T O6    1 
ATOM   8383  N  N1    . DG  C  3 25  ? -9.271  -19.675 50.131  1.00 176.40 ? 725 DG  T N1    1 
ATOM   8384  C  C2    . DG  C  3 25  ? -9.302  -19.279 48.815  1.00 178.38 ? 725 DG  T C2    1 
ATOM   8385  N  N2    . DG  C  3 25  ? -8.283  -19.689 48.046  1.00 176.07 ? 725 DG  T N2    1 
ATOM   8386  N  N3    . DG  C  3 25  ? -10.264 -18.533 48.287  1.00 181.61 ? 725 DG  T N3    1 
ATOM   8387  C  C4    . DG  C  3 25  ? -11.211 -18.210 49.202  1.00 183.99 ? 725 DG  T C4    1 
ATOM   8388  O  "O5'" . DC  D  4 2   ? -2.251  -26.584 48.656  1.00 229.95 ? 803 DC  P "O5'" 1 
ATOM   8389  C  "C5'" . DC  D  4 2   ? -1.713  -25.364 48.159  1.00 227.69 ? 803 DC  P "C5'" 1 
ATOM   8390  C  "C4'" . DC  D  4 2   ? -2.532  -24.851 46.988  1.00 232.78 ? 803 DC  P "C4'" 1 
ATOM   8391  O  "O4'" . DC  D  4 2   ? -3.918  -24.702 47.396  1.00 235.99 ? 803 DC  P "O4'" 1 
ATOM   8392  C  "C3'" . DC  D  4 2   ? -2.107  -23.487 46.455  1.00 228.56 ? 803 DC  P "C3'" 1 
ATOM   8393  O  "O3'" . DC  D  4 2   ? -2.326  -23.422 45.050  1.00 227.21 ? 803 DC  P "O3'" 1 
ATOM   8394  C  "C2'" . DC  D  4 2   ? -3.028  -22.536 47.209  1.00 226.53 ? 803 DC  P "C2'" 1 
ATOM   8395  C  "C1'" . DC  D  4 2   ? -4.313  -23.350 47.268  1.00 233.69 ? 803 DC  P "C1'" 1 
ATOM   8396  N  N1    . DC  D  4 2   ? -5.188  -23.001 48.425  1.00 235.31 ? 803 DC  P N1    1 
ATOM   8397  C  C2    . DC  D  4 2   ? -5.971  -21.843 48.376  1.00 230.40 ? 803 DC  P C2    1 
ATOM   8398  O  O2    . DC  D  4 2   ? -5.924  -21.123 47.371  1.00 228.09 ? 803 DC  P O2    1 
ATOM   8399  N  N3    . DC  D  4 2   ? -6.762  -21.541 49.436  1.00 228.19 ? 803 DC  P N3    1 
ATOM   8400  C  C4    . DC  D  4 2   ? -6.786  -22.342 50.501  1.00 231.41 ? 803 DC  P C4    1 
ATOM   8401  N  N4    . DC  D  4 2   ? -7.581  -22.003 51.521  1.00 228.50 ? 803 DC  P N4    1 
ATOM   8402  C  C5    . DC  D  4 2   ? -5.995  -23.527 50.569  1.00 237.78 ? 803 DC  P C5    1 
ATOM   8403  C  C6    . DC  D  4 2   ? -5.219  -23.815 49.519  1.00 239.79 ? 803 DC  P C6    1 
ATOM   8404  P  P     . DA  D  4 3   ? -1.538  -22.344 44.156  1.00 217.63 ? 804 DA  P P     1 
ATOM   8405  O  OP1   . DA  D  4 3   ? -1.334  -22.935 42.815  1.00 222.90 ? 804 DA  P OP1   1 
ATOM   8406  O  OP2   . DA  D  4 3   ? -0.373  -21.876 44.940  1.00 212.49 ? 804 DA  P OP2   1 
ATOM   8407  O  "O5'" . DA  D  4 3   ? -2.564  -21.123 44.031  1.00 203.63 ? 804 DA  P "O5'" 1 
ATOM   8408  C  "C5'" . DA  D  4 3   ? -2.154  -19.909 43.411  1.00 191.49 ? 804 DA  P "C5'" 1 
ATOM   8409  C  "C4'" . DA  D  4 3   ? -3.357  -19.063 43.037  1.00 182.42 ? 804 DA  P "C4'" 1 
ATOM   8410  O  "O4'" . DA  D  4 3   ? -4.322  -19.093 44.119  1.00 178.16 ? 804 DA  P "O4'" 1 
ATOM   8411  C  "C3'" . DA  D  4 3   ? -3.057  -17.590 42.806  1.00 175.57 ? 804 DA  P "C3'" 1 
ATOM   8412  O  "O3'" . DA  D  4 3   ? -4.007  -17.036 41.904  1.00 174.18 ? 804 DA  P "O3'" 1 
ATOM   8413  C  "C2'" . DA  D  4 3   ? -3.213  -17.010 44.205  1.00 170.46 ? 804 DA  P "C2'" 1 
ATOM   8414  C  "C1'" . DA  D  4 3   ? -4.384  -17.825 44.746  1.00 172.54 ? 804 DA  P "C1'" 1 
ATOM   8415  N  N9    . DA  D  4 3   ? -4.335  -18.025 46.191  1.00 171.75 ? 804 DA  P N9    1 
ATOM   8416  C  C8    . DA  D  4 3   ? -3.357  -18.664 46.901  1.00 172.48 ? 804 DA  P C8    1 
ATOM   8417  N  N7    . DA  D  4 3   ? -3.577  -18.697 48.194  1.00 171.10 ? 804 DA  P N7    1 
ATOM   8418  C  C5    . DA  D  4 3   ? -4.785  -18.035 48.342  1.00 167.61 ? 804 DA  P C5    1 
ATOM   8419  C  C6    . DA  D  4 3   ? -5.568  -17.732 49.473  1.00 160.58 ? 804 DA  P C6    1 
ATOM   8420  N  N6    . DA  D  4 3   ? -5.226  -18.076 50.719  1.00 152.72 ? 804 DA  P N6    1 
ATOM   8421  N  N1    . DA  D  4 3   ? -6.721  -17.059 49.273  1.00 162.18 ? 804 DA  P N1    1 
ATOM   8422  C  C2    . DA  D  4 3   ? -7.060  -16.716 48.024  1.00 164.65 ? 804 DA  P C2    1 
ATOM   8423  N  N3    . DA  D  4 3   ? -6.407  -16.946 46.886  1.00 169.21 ? 804 DA  P N3    1 
ATOM   8424  C  C4    . DA  D  4 3   ? -5.266  -17.615 47.117  1.00 169.84 ? 804 DA  P C4    1 
ATOM   8425  P  P     . DG  D  4 4   ? -3.761  -15.582 41.264  1.00 169.16 ? 805 DG  P P     1 
ATOM   8426  O  OP1   . DG  D  4 4   ? -4.480  -15.534 39.972  1.00 173.82 ? 805 DG  P OP1   1 
ATOM   8427  O  OP2   . DG  D  4 4   ? -2.307  -15.312 41.308  1.00 168.00 ? 805 DG  P OP2   1 
ATOM   8428  O  "O5'" . DG  D  4 4   ? -4.476  -14.584 42.290  1.00 163.17 ? 805 DG  P "O5'" 1 
ATOM   8429  C  "C5'" . DG  D  4 4   ? -5.884  -14.649 42.482  1.00 159.83 ? 805 DG  P "C5'" 1 
ATOM   8430  C  "C4'" . DG  D  4 4   ? -6.337  -13.639 43.522  1.00 150.57 ? 805 DG  P "C4'" 1 
ATOM   8431  O  "O4'" . DG  D  4 4   ? -6.007  -14.124 44.851  1.00 147.38 ? 805 DG  P "O4'" 1 
ATOM   8432  C  "C3'" . DG  D  4 4   ? -5.698  -12.253 43.401  1.00 145.67 ? 805 DG  P "C3'" 1 
ATOM   8433  O  "O3'" . DG  D  4 4   ? -6.684  -11.247 43.583  1.00 144.06 ? 805 DG  P "O3'" 1 
ATOM   8434  C  "C2'" . DG  D  4 4   ? -4.671  -12.241 44.531  1.00 137.27 ? 805 DG  P "C2'" 1 
ATOM   8435  C  "C1'" . DG  D  4 4   ? -5.365  -13.100 45.574  1.00 139.71 ? 805 DG  P "C1'" 1 
ATOM   8436  N  N9    . DG  D  4 4   ? -4.448  -13.713 46.530  1.00 138.88 ? 805 DG  P N9    1 
ATOM   8437  C  C8    . DG  D  4 4   ? -3.208  -14.242 46.267  1.00 141.10 ? 805 DG  P C8    1 
ATOM   8438  N  N7    . DG  D  4 4   ? -2.614  -14.724 47.323  1.00 142.21 ? 805 DG  P N7    1 
ATOM   8439  C  C5    . DG  D  4 4   ? -3.519  -14.503 48.353  1.00 138.68 ? 805 DG  P C5    1 
ATOM   8440  C  C6    . DG  D  4 4   ? -3.426  -14.815 49.731  1.00 134.18 ? 805 DG  P C6    1 
ATOM   8441  O  O6    . DG  D  4 4   ? -2.494  -15.367 50.332  1.00 131.02 ? 805 DG  P O6    1 
ATOM   8442  N  N1    . DG  D  4 4   ? -4.566  -14.419 50.426  1.00 131.26 ? 805 DG  P N1    1 
ATOM   8443  C  C2    . DG  D  4 4   ? -5.657  -13.800 49.861  1.00 129.80 ? 805 DG  P C2    1 
ATOM   8444  N  N2    . DG  D  4 4   ? -6.663  -13.493 50.693  1.00 126.19 ? 805 DG  P N2    1 
ATOM   8445  N  N3    . DG  D  4 4   ? -5.756  -13.502 48.572  1.00 131.51 ? 805 DG  P N3    1 
ATOM   8446  C  C4    . DG  D  4 4   ? -4.654  -13.882 47.881  1.00 136.70 ? 805 DG  P C4    1 
ATOM   8447  P  P     . DT  D  4 5   ? -6.693  -9.944  42.643  1.00 145.94 ? 806 DT  P P     1 
ATOM   8448  O  OP1   . DT  D  4 5   ? -7.919  -9.993  41.817  1.00 155.55 ? 806 DT  P OP1   1 
ATOM   8449  O  OP2   . DT  D  4 5   ? -5.368  -9.853  41.990  1.00 147.89 ? 806 DT  P OP2   1 
ATOM   8450  O  "O5'" . DT  D  4 5   ? -6.811  -8.729  43.674  1.00 137.40 ? 806 DT  P "O5'" 1 
ATOM   8451  C  "C5'" . DT  D  4 5   ? -5.743  -8.454  44.569  1.00 135.93 ? 806 DT  P "C5'" 1 
ATOM   8452  C  "C4'" . DT  D  4 5   ? -6.256  -8.314  45.990  1.00 132.50 ? 806 DT  P "C4'" 1 
ATOM   8453  O  "O4'" . DT  D  4 5   ? -6.171  -9.594  46.662  1.00 132.98 ? 806 DT  P "O4'" 1 
ATOM   8454  C  "C3'" . DT  D  4 5   ? -5.455  -7.368  46.862  1.00 128.97 ? 806 DT  P "C3'" 1 
ATOM   8455  O  "O3'" . DT  D  4 5   ? -5.884  -6.001  46.648  1.00 130.66 ? 806 DT  P "O3'" 1 
ATOM   8456  C  "C2'" . DT  D  4 5   ? -5.761  -7.889  48.263  1.00 125.30 ? 806 DT  P "C2'" 1 
ATOM   8457  C  "C1'" . DT  D  4 5   ? -5.845  -9.399  48.030  1.00 126.41 ? 806 DT  P "C1'" 1 
ATOM   8458  N  N1    . DT  D  4 5   ? -4.571  -10.126 48.330  1.00 123.58 ? 806 DT  P N1    1 
ATOM   8459  C  C2    . DT  D  4 5   ? -4.344  -10.585 49.607  1.00 117.28 ? 806 DT  P C2    1 
ATOM   8460  O  O2    . DT  D  4 5   ? -5.133  -10.430 50.522  1.00 115.71 ? 806 DT  P O2    1 
ATOM   8461  N  N3    . DT  D  4 5   ? -3.152  -11.237 49.778  1.00 118.08 ? 806 DT  P N3    1 
ATOM   8462  C  C4    . DT  D  4 5   ? -2.182  -11.472 48.821  1.00 120.33 ? 806 DT  P C4    1 
ATOM   8463  O  O4    . DT  D  4 5   ? -1.141  -12.069 49.073  1.00 121.37 ? 806 DT  P O4    1 
ATOM   8464  C  C5    . DT  D  4 5   ? -2.482  -10.965 47.502  1.00 121.87 ? 806 DT  P C5    1 
ATOM   8465  C  C7    . DT  D  4 5   ? -1.505  -11.158 46.380  1.00 127.20 ? 806 DT  P C7    1 
ATOM   8466  C  C6    . DT  D  4 5   ? -3.647  -10.325 47.323  1.00 124.59 ? 806 DT  P C6    1 
ATOM   8467  P  P     . DC  D  4 6   ? -7.095  -5.338  47.479  1.00 132.26 ? 807 DC  P P     1 
ATOM   8468  O  OP1   . DC  D  4 6   ? -8.217  -6.296  47.608  1.00 133.46 ? 807 DC  P OP1   1 
ATOM   8469  O  OP2   . DC  D  4 6   ? -7.362  -4.030  46.842  1.00 133.56 ? 807 DC  P OP2   1 
ATOM   8470  O  "O5'" . DC  D  4 6   ? -6.458  -5.028  48.912  1.00 124.30 ? 807 DC  P "O5'" 1 
ATOM   8471  C  "C5'" . DC  D  4 6   ? -7.299  -4.736  50.012  1.00 117.50 ? 807 DC  P "C5'" 1 
ATOM   8472  C  "C4'" . DC  D  4 6   ? -6.566  -4.960  51.321  1.00 109.56 ? 807 DC  P "C4'" 1 
ATOM   8473  O  "O4'" . DC  D  4 6   ? -5.930  -6.258  51.306  1.00 111.23 ? 807 DC  P "O4'" 1 
ATOM   8474  C  "C3'" . DC  D  4 6   ? -5.426  -3.999  51.596  1.00 106.20 ? 807 DC  P "C3'" 1 
ATOM   8475  O  "O3'" . DC  D  4 6   ? -5.917  -2.739  52.123  1.00 107.15 ? 807 DC  P "O3'" 1 
ATOM   8476  C  "C2'" . DC  D  4 6   ? -4.591  -4.782  52.606  1.00 106.77 ? 807 DC  P "C2'" 1 
ATOM   8477  C  "C1'" . DC  D  4 6   ? -4.796  -6.233  52.161  1.00 108.81 ? 807 DC  P "C1'" 1 
ATOM   8478  N  N1    . DC  D  4 6   ? -3.620  -6.809  51.434  1.00 107.95 ? 807 DC  P N1    1 
ATOM   8479  C  C2    . DC  D  4 6   ? -2.805  -7.750  52.074  1.00 105.89 ? 807 DC  P C2    1 
ATOM   8480  O  O2    . DC  D  4 6   ? -3.077  -8.095  53.231  1.00 104.61 ? 807 DC  P O2    1 
ATOM   8481  N  N3    . DC  D  4 6   ? -1.742  -8.261  51.406  1.00 107.76 ? 807 DC  P N3    1 
ATOM   8482  C  C4    . DC  D  4 6   ? -1.483  -7.864  50.159  1.00 112.89 ? 807 DC  P C4    1 
ATOM   8483  N  N4    . DC  D  4 6   ? -0.424  -8.395  49.540  1.00 116.56 ? 807 DC  P N4    1 
ATOM   8484  C  C5    . DC  D  4 6   ? -2.299  -6.904  49.491  1.00 109.08 ? 807 DC  P C5    1 
ATOM   8485  C  C6    . DC  D  4 6   ? -3.344  -6.405  50.161  1.00 107.13 ? 807 DC  P C6    1 
ATOM   8486  P  P     . DC  D  4 7   ? -6.462  -2.585  53.635  1.00 88.53  ? 808 DC  P P     1 
ATOM   8487  O  OP1   . DC  D  4 7   ? -7.343  -3.720  53.986  1.00 93.60  ? 808 DC  P OP1   1 
ATOM   8488  O  OP2   . DC  D  4 7   ? -6.991  -1.209  53.741  1.00 85.28  ? 808 DC  P OP2   1 
ATOM   8489  O  "O5'" . DC  D  4 7   ? -5.153  -2.640  54.551  1.00 78.52  ? 808 DC  P "O5'" 1 
ATOM   8490  C  "C5'" . DC  D  4 7   ? -5.206  -3.309  55.804  1.00 77.23  ? 808 DC  P "C5'" 1 
ATOM   8491  C  "C4'" . DC  D  4 7   ? -3.813  -3.589  56.335  1.00 76.15  ? 808 DC  P "C4'" 1 
ATOM   8492  O  "O4'" . DC  D  4 7   ? -3.066  -4.369  55.376  1.00 77.51  ? 808 DC  P "O4'" 1 
ATOM   8493  C  "C3'" . DC  D  4 7   ? -2.967  -2.346  56.625  1.00 72.49  ? 808 DC  P "C3'" 1 
ATOM   8494  O  "O3'" . DC  D  4 7   ? -2.682  -2.284  58.015  1.00 70.19  ? 808 DC  P "O3'" 1 
ATOM   8495  C  "C2'" . DC  D  4 7   ? -1.691  -2.540  55.785  1.00 72.89  ? 808 DC  P "C2'" 1 
ATOM   8496  C  "C1'" . DC  D  4 7   ? -1.711  -4.033  55.491  1.00 74.87  ? 808 DC  P "C1'" 1 
ATOM   8497  N  N1    . DC  D  4 7   ? -1.020  -4.412  54.220  1.00 77.65  ? 808 DC  P N1    1 
ATOM   8498  C  C2    . DC  D  4 7   ? -0.020  -5.390  54.241  1.00 77.66  ? 808 DC  P C2    1 
ATOM   8499  O  O2    . DC  D  4 7   ? 0.282   -5.920  55.317  1.00 70.92  ? 808 DC  P O2    1 
ATOM   8500  N  N3    . DC  D  4 7   ? 0.593   -5.728  53.080  1.00 82.56  ? 808 DC  P N3    1 
ATOM   8501  C  C4    . DC  D  4 7   ? 0.240   -5.132  51.940  1.00 77.31  ? 808 DC  P C4    1 
ATOM   8502  N  N4    . DC  D  4 7   ? 0.874   -5.497  50.821  1.00 79.03  ? 808 DC  P N4    1 
ATOM   8503  C  C5    . DC  D  4 7   ? -0.777  -4.135  51.897  1.00 78.38  ? 808 DC  P C5    1 
ATOM   8504  C  C6    . DC  D  4 7   ? -1.374  -3.809  53.049  1.00 79.31  ? 808 DC  P C6    1 
ATOM   8505  P  P     . DC  D  4 8   ? -2.016  -0.970  58.653  1.00 69.62  ? 809 DC  P P     1 
ATOM   8506  O  OP1   . DC  D  4 8   ? -2.397  -0.928  60.082  1.00 67.91  ? 809 DC  P OP1   1 
ATOM   8507  O  OP2   . DC  D  4 8   ? -2.324  0.177   57.771  1.00 80.46  ? 809 DC  P OP2   1 
ATOM   8508  O  "O5'" . DC  D  4 8   ? -0.451  -1.266  58.558  1.00 73.98  ? 809 DC  P "O5'" 1 
ATOM   8509  C  "C5'" . DC  D  4 8   ? 0.062   -2.482  59.075  1.00 71.85  ? 809 DC  P "C5'" 1 
ATOM   8510  C  "C4'" . DC  D  4 8   ? 1.494   -2.692  58.632  1.00 66.61  ? 809 DC  P "C4'" 1 
ATOM   8511  O  "O4'" . DC  D  4 8   ? 1.520   -3.116  57.257  1.00 68.46  ? 809 DC  P "O4'" 1 
ATOM   8512  C  "C3'" . DC  D  4 8   ? 2.380   -1.447  58.709  1.00 66.65  ? 809 DC  P "C3'" 1 
ATOM   8513  O  "O3'" . DC  D  4 8   ? 3.350   -1.623  59.728  1.00 67.58  ? 809 DC  P "O3'" 1 
ATOM   8514  C  "C2'" . DC  D  4 8   ? 3.023   -1.339  57.312  1.00 68.46  ? 809 DC  P "C2'" 1 
ATOM   8515  C  "C1'" . DC  D  4 8   ? 2.730   -2.700  56.692  1.00 68.96  ? 809 DC  P "C1'" 1 
ATOM   8516  N  N1    . DC  D  4 8   ? 2.569   -2.668  55.208  1.00 71.46  ? 809 DC  P N1    1 
ATOM   8517  C  C2    . DC  D  4 8   ? 3.338   -3.522  54.411  1.00 72.14  ? 809 DC  P C2    1 
ATOM   8518  O  O2    . DC  D  4 8   ? 4.147   -4.285  54.953  1.00 75.84  ? 809 DC  P O2    1 
ATOM   8519  N  N3    . DC  D  4 8   ? 3.177   -3.487  53.065  1.00 77.52  ? 809 DC  P N3    1 
ATOM   8520  C  C4    . DC  D  4 8   ? 2.294   -2.650  52.520  1.00 76.35  ? 809 DC  P C4    1 
ATOM   8521  N  N4    . DC  D  4 8   ? 2.171   -2.651  51.188  1.00 78.94  ? 809 DC  P N4    1 
ATOM   8522  C  C5    . DC  D  4 8   ? 1.499   -1.773  53.315  1.00 75.71  ? 809 DC  P C5    1 
ATOM   8523  C  C6    . DC  D  4 8   ? 1.666   -1.817  54.641  1.00 75.52  ? 809 DC  P C6    1 
ATOM   8524  P  P     . DT  D  4 9   ? 4.273   -0.398  60.202  1.00 64.13  ? 810 DT  P P     1 
ATOM   8525  O  OP1   . DT  D  4 9   ? 4.414   -0.492  61.672  1.00 62.12  ? 810 DT  P OP1   1 
ATOM   8526  O  OP2   . DT  D  4 9   ? 3.751   0.845   59.593  1.00 70.70  ? 810 DT  P OP2   1 
ATOM   8527  O  "O5'" . DT  D  4 9   ? 5.684   -0.726  59.533  1.00 64.29  ? 810 DT  P "O5'" 1 
ATOM   8528  C  "C5'" . DT  D  4 9   ? 6.157   -2.066  59.522  1.00 68.88  ? 810 DT  P "C5'" 1 
ATOM   8529  C  "C4'" . DT  D  4 9   ? 7.243   -2.240  58.481  1.00 66.08  ? 810 DT  P "C4'" 1 
ATOM   8530  O  "O4'" . DT  D  4 9   ? 6.646   -2.430  57.172  1.00 66.81  ? 810 DT  P "O4'" 1 
ATOM   8531  C  "C3'" . DT  D  4 9   ? 8.196   -1.046  58.346  1.00 65.00  ? 810 DT  P "C3'" 1 
ATOM   8532  O  "O3'" . DT  D  4 9   ? 9.539   -1.472  58.515  1.00 75.17  ? 810 DT  P "O3'" 1 
ATOM   8533  C  "C2'" . DT  D  4 9   ? 7.942   -0.532  56.927  1.00 76.62  ? 810 DT  P "C2'" 1 
ATOM   8534  C  "C1'" . DT  D  4 9   ? 7.453   -1.785  56.226  1.00 72.69  ? 810 DT  P "C1'" 1 
ATOM   8535  N  N1    . DT  D  4 9   ? 6.649   -1.503  55.003  1.00 70.62  ? 810 DT  P N1    1 
ATOM   8536  C  C2    . DT  D  4 9   ? 6.885   -2.230  53.859  1.00 75.00  ? 810 DT  P C2    1 
ATOM   8537  O  O2    . DT  D  4 9   ? 7.717   -3.117  53.792  1.00 77.41  ? 810 DT  P O2    1 
ATOM   8538  N  N3    . DT  D  4 9   ? 6.103   -1.884  52.790  1.00 80.15  ? 810 DT  P N3    1 
ATOM   8539  C  C4    . DT  D  4 9   ? 5.133   -0.900  52.748  1.00 79.68  ? 810 DT  P C4    1 
ATOM   8540  O  O4    . DT  D  4 9   ? 4.481   -0.662  51.736  1.00 87.07  ? 810 DT  P O4    1 
ATOM   8541  C  C5    . DT  D  4 9   ? 4.940   -0.170  53.980  1.00 73.57  ? 810 DT  P C5    1 
ATOM   8542  C  C7    . DT  D  4 9   ? 3.915   0.922   54.057  1.00 74.44  ? 810 DT  P C7    1 
ATOM   8543  C  C6    . DT  D  4 9   ? 5.702   -0.501  55.033  1.00 71.29  ? 810 DT  P C6    1 
ATOM   8544  P  P     . DG  D  4 10  ? 10.717  -0.393  58.692  1.00 67.75  ? 811 DG  P P     1 
ATOM   8545  O  OP1   . DG  D  4 10  ? 11.442  -0.728  59.937  1.00 76.16  ? 811 DG  P OP1   1 
ATOM   8546  O  OP2   . DG  D  4 10  ? 10.143  0.960   58.520  1.00 73.65  ? 811 DG  P OP2   1 
ATOM   8547  O  "O5'" . DG  D  4 10  ? 11.680  -0.679  57.449  1.00 65.61  ? 811 DG  P "O5'" 1 
ATOM   8548  C  "C5'" . DG  D  4 10  ? 12.304  -1.948  57.320  1.00 69.24  ? 811 DG  P "C5'" 1 
ATOM   8549  C  "C4'" . DG  D  4 10  ? 12.511  -2.300  55.860  1.00 76.53  ? 811 DG  P "C4'" 1 
ATOM   8550  O  "O4'" . DG  D  4 10  ? 11.238  -2.300  55.182  1.00 81.11  ? 811 DG  P "O4'" 1 
ATOM   8551  C  "C3'" . DG  D  4 10  ? 13.362  -1.316  55.081  1.00 76.09  ? 811 DG  P "C3'" 1 
ATOM   8552  O  "O3'" . DG  D  4 10  ? 14.737  -1.651  55.227  1.00 77.91  ? 811 DG  P "O3'" 1 
ATOM   8553  C  "C2'" . DG  D  4 10  ? 12.885  -1.532  53.646  1.00 83.39  ? 811 DG  P "C2'" 1 
ATOM   8554  C  "C1'" . DG  D  4 10  ? 11.425  -1.959  53.822  1.00 81.05  ? 811 DG  P "C1'" 1 
ATOM   8555  N  N9    . DG  D  4 10  ? 10.464  -0.919  53.465  1.00 83.84  ? 811 DG  P N9    1 
ATOM   8556  C  C8    . DG  D  4 10  ? 9.891   0.002   54.305  1.00 81.20  ? 811 DG  P C8    1 
ATOM   8557  N  N7    . DG  D  4 10  ? 9.061   0.809   53.705  1.00 78.54  ? 811 DG  P N7    1 
ATOM   8558  C  C5    . DG  D  4 10  ? 9.089   0.398   52.379  1.00 86.71  ? 811 DG  P C5    1 
ATOM   8559  C  C6    . DG  D  4 10  ? 8.394   0.899   51.253  1.00 97.65  ? 811 DG  P C6    1 
ATOM   8560  O  O6    . DG  D  4 10  ? 7.588   1.839   51.204  1.00 96.46  ? 811 DG  P O6    1 
ATOM   8561  N  N1    . DG  D  4 10  ? 8.712   0.193   50.095  1.00 106.38 ? 811 DG  P N1    1 
ATOM   8562  C  C2    . DG  D  4 10  ? 9.591   -0.863  50.035  1.00 100.80 ? 811 DG  P C2    1 
ATOM   8563  N  N2    . DG  D  4 10  ? 9.770   -1.419  48.829  1.00 106.46 ? 811 DG  P N2    1 
ATOM   8564  N  N3    . DG  D  4 10  ? 10.247  -1.343  51.082  1.00 88.03  ? 811 DG  P N3    1 
ATOM   8565  C  C4    . DG  D  4 10  ? 9.948   -0.666  52.216  1.00 85.52  ? 811 DG  P C4    1 
ATOM   8566  P  P     . DT  D  4 11  ? 15.879  -0.596  54.823  1.00 89.09  ? 812 DT  P P     1 
ATOM   8567  O  OP1   . DT  D  4 11  ? 17.153  -1.072  55.408  1.00 92.79  ? 812 DT  P OP1   1 
ATOM   8568  O  OP2   . DT  D  4 11  ? 15.378  0.758   55.144  1.00 90.55  ? 812 DT  P OP2   1 
ATOM   8569  O  "O5'" . DT  D  4 11  ? 15.969  -0.716  53.231  1.00 81.39  ? 812 DT  P "O5'" 1 
ATOM   8570  C  "C5'" . DT  D  4 11  ? 16.202  -1.980  52.623  1.00 75.86  ? 812 DT  P "C5'" 1 
ATOM   8571  C  "C4'" . DT  D  4 11  ? 15.998  -1.895  51.123  1.00 82.45  ? 812 DT  P "C4'" 1 
ATOM   8572  O  "O4'" . DT  D  4 11  ? 14.668  -1.384  50.844  1.00 78.94  ? 812 DT  P "O4'" 1 
ATOM   8573  C  "C3'" . DT  D  4 11  ? 16.978  -0.971  50.397  1.00 85.50  ? 812 DT  P "C3'" 1 
ATOM   8574  O  "O3'" . DT  D  4 11  ? 17.549  -1.638  49.284  1.00 89.14  ? 812 DT  P "O3'" 1 
ATOM   8575  C  "C2'" . DT  D  4 11  ? 16.121  0.221   49.965  1.00 80.88  ? 812 DT  P "C2'" 1 
ATOM   8576  C  "C1'" . DT  D  4 11  ? 14.739  -0.400  49.841  1.00 80.45  ? 812 DT  P "C1'" 1 
ATOM   8577  N  N1    . DT  D  4 11  ? 13.635  0.579   50.062  1.00 83.50  ? 812 DT  P N1    1 
ATOM   8578  C  C2    . DT  D  4 11  ? 12.887  1.005   48.989  1.00 88.54  ? 812 DT  P C2    1 
ATOM   8579  O  O2    . DT  D  4 11  ? 13.072  0.618   47.850  1.00 91.98  ? 812 DT  P O2    1 
ATOM   8580  N  N3    . DT  D  4 11  ? 11.904  1.907   49.300  1.00 87.67  ? 812 DT  P N3    1 
ATOM   8581  C  C4    . DT  D  4 11  ? 11.602  2.417   50.550  1.00 80.84  ? 812 DT  P C4    1 
ATOM   8582  O  O4    . DT  D  4 11  ? 10.696  3.226   50.728  1.00 78.61  ? 812 DT  P O4    1 
ATOM   8583  C  C5    . DT  D  4 11  ? 12.427  1.931   51.631  1.00 82.73  ? 812 DT  P C5    1 
ATOM   8584  C  C7    . DT  D  4 11  ? 12.195  2.411   53.033  1.00 73.57  ? 812 DT  P C7    1 
ATOM   8585  C  C6    . DT  D  4 11  ? 13.394  1.048   51.337  1.00 83.02  ? 812 DT  P C6    1 
ATOM   8586  P  P     . DT  D  4 12  ? 18.795  -0.985  48.510  1.00 98.81  ? 813 DT  P P     1 
ATOM   8587  O  OP1   . DT  D  4 12  ? 19.640  -2.091  48.009  1.00 113.91 ? 813 DT  P OP1   1 
ATOM   8588  O  OP2   . DT  D  4 12  ? 19.381  0.049   49.392  1.00 82.81  ? 813 DT  P OP2   1 
ATOM   8589  O  "O5'" . DT  D  4 12  ? 18.122  -0.241  47.266  1.00 101.17 ? 813 DT  P "O5'" 1 
ATOM   8590  C  "C5'" . DT  D  4 12  ? 17.336  -0.981  46.343  1.00 105.58 ? 813 DT  P "C5'" 1 
ATOM   8591  C  "C4'" . DT  D  4 12  ? 16.694  -0.064  45.319  1.00 108.94 ? 813 DT  P "C4'" 1 
ATOM   8592  O  "O4'" . DT  D  4 12  ? 15.624  0.691   45.939  1.00 110.21 ? 813 DT  P "O4'" 1 
ATOM   8593  C  "C3'" . DT  D  4 12  ? 17.639  0.965   44.687  1.00 111.43 ? 813 DT  P "C3'" 1 
ATOM   8594  O  "O3'" . DT  D  4 12  ? 17.571  0.877   43.270  1.00 116.74 ? 813 DT  P "O3'" 1 
ATOM   8595  C  "C2'" . DT  D  4 12  ? 17.113  2.312   45.198  1.00 109.98 ? 813 DT  P "C2'" 1 
ATOM   8596  C  "C1'" . DT  D  4 12  ? 15.646  2.002   45.440  1.00 110.46 ? 813 DT  P "C1'" 1 
ATOM   8597  N  N1    . DT  D  4 12  ? 14.997  2.903   46.437  1.00 107.53 ? 813 DT  P N1    1 
ATOM   8598  C  C2    . DT  D  4 12  ? 13.907  3.652   46.057  1.00 106.59 ? 813 DT  P C2    1 
ATOM   8599  O  O2    . DT  D  4 12  ? 13.434  3.621   44.935  1.00 109.05 ? 813 DT  P O2    1 
ATOM   8600  N  N3    . DT  D  4 12  ? 13.384  4.445   47.044  1.00 101.84 ? 813 DT  P N3    1 
ATOM   8601  C  C4    . DT  D  4 12  ? 13.833  4.563   48.347  1.00 97.93  ? 813 DT  P C4    1 
ATOM   8602  O  O4    . DT  D  4 12  ? 13.295  5.306   49.162  1.00 91.29  ? 813 DT  P O4    1 
ATOM   8603  C  C5    . DT  D  4 12  ? 14.980  3.752   48.680  1.00 99.45  ? 813 DT  P C5    1 
ATOM   8604  C  C7    . DT  D  4 12  ? 15.557  3.797   50.064  1.00 97.41  ? 813 DT  P C7    1 
ATOM   8605  C  C6    . DT  D  4 12  ? 15.500  2.970   47.721  1.00 102.21 ? 813 DT  P C6    1 
ATOM   8606  P  P     . DC  D  4 13  ? 18.626  1.673   42.355  1.00 117.55 ? 814 DC  P P     1 
ATOM   8607  O  OP1   . DC  D  4 13  ? 18.850  0.871   41.132  1.00 120.17 ? 814 DC  P OP1   1 
ATOM   8608  O  OP2   . DC  D  4 13  ? 19.775  2.045   43.209  1.00 113.45 ? 814 DC  P OP2   1 
ATOM   8609  O  "O5'" . DC  D  4 13  ? 17.852  3.016   41.961  1.00 118.80 ? 814 DC  P "O5'" 1 
ATOM   8610  C  "C5'" . DC  D  4 13  ? 16.594  2.942   41.298  1.00 119.69 ? 814 DC  P "C5'" 1 
ATOM   8611  C  "C4'" . DC  D  4 13  ? 15.981  4.322   41.145  1.00 118.86 ? 814 DC  P "C4'" 1 
ATOM   8612  O  "O4'" . DC  D  4 13  ? 15.425  4.756   42.416  1.00 117.61 ? 814 DC  P "O4'" 1 
ATOM   8613  C  "C3'" . DC  D  4 13  ? 16.957  5.419   40.711  1.00 117.05 ? 814 DC  P "C3'" 1 
ATOM   8614  O  "O3'" . DC  D  4 13  ? 16.359  6.233   39.711  1.00 124.15 ? 814 DC  P "O3'" 1 
ATOM   8615  C  "C2'" . DC  D  4 13  ? 17.194  6.203   41.999  1.00 113.42 ? 814 DC  P "C2'" 1 
ATOM   8616  C  "C1'" . DC  D  4 13  ? 15.839  6.077   42.669  1.00 119.54 ? 814 DC  P "C1'" 1 
ATOM   8617  N  N1    . DC  D  4 13  ? 15.877  6.296   44.142  1.00 120.92 ? 814 DC  P N1    1 
ATOM   8618  C  C2    . DC  D  4 13  ? 14.862  7.035   44.758  1.00 113.39 ? 814 DC  P C2    1 
ATOM   8619  O  O2    . DC  D  4 13  ? 13.942  7.489   44.066  1.00 103.95 ? 814 DC  P O2    1 
ATOM   8620  N  N3    . DC  D  4 13  ? 14.913  7.229   46.099  1.00 115.78 ? 814 DC  P N3    1 
ATOM   8621  C  C4    . DC  D  4 13  ? 15.922  6.722   46.810  1.00 114.67 ? 814 DC  P C4    1 
ATOM   8622  N  N4    . DC  D  4 13  ? 15.929  6.940   48.129  1.00 111.11 ? 814 DC  P N4    1 
ATOM   8623  C  C5    . DC  D  4 13  ? 16.967  5.969   46.199  1.00 120.27 ? 814 DC  P C5    1 
ATOM   8624  C  C6    . DC  D  4 13  ? 16.907  5.785   44.876  1.00 124.28 ? 814 DC  P C6    1 
ATOM   8625  P  P     . DG  D  4 14  ? 17.273  7.137   38.748  1.00 126.14 ? 815 DG  P P     1 
ATOM   8626  O  OP1   . DG  D  4 14  ? 18.127  6.221   37.958  1.00 123.27 ? 815 DG  P OP1   1 
ATOM   8627  O  OP2   . DG  D  4 14  ? 17.898  8.197   39.569  1.00 127.80 ? 815 DG  P OP2   1 
ATOM   8628  O  "O5'" . DG  D  4 14  ? 16.221  7.835   37.766  1.00 124.11 ? 815 DG  P "O5'" 1 
ATOM   8629  C  "C5'" . DG  D  4 14  ? 14.865  8.000   38.171  1.00 120.82 ? 815 DG  P "C5'" 1 
ATOM   8630  C  "C4'" . DG  D  4 14  ? 14.653  9.343   38.850  1.00 121.11 ? 815 DG  P "C4'" 1 
ATOM   8631  O  "O4'" . DG  D  4 14  ? 14.784  9.197   40.277  1.00 120.28 ? 815 DG  P "O4'" 1 
ATOM   8632  C  "C3'" . DG  D  4 14  ? 15.639  10.446  38.449  1.00 119.83 ? 815 DG  P "C3'" 1 
ATOM   8633  O  "O3'" . DG  D  4 14  ? 14.972  11.420  37.651  1.00 132.51 ? 815 DG  P "O3'" 1 
ATOM   8634  C  "C2'" . DG  D  4 14  ? 16.128  11.038  39.787  1.00 112.35 ? 815 DG  P "C2'" 1 
ATOM   8635  C  "C1'" . DG  D  4 14  ? 15.174  10.432  40.809  1.00 117.72 ? 815 DG  P "C1'" 1 
ATOM   8636  N  N9    . DG  D  4 14  ? 15.786  10.197  42.113  1.00 110.28 ? 815 DG  P N9    1 
ATOM   8637  C  C8    . DG  D  4 14  ? 16.979  9.565   42.364  1.00 107.46 ? 815 DG  P C8    1 
ATOM   8638  N  N7    . DG  D  4 14  ? 17.273  9.494   43.632  1.00 102.51 ? 815 DG  P N7    1 
ATOM   8639  C  C5    . DG  D  4 14  ? 16.206  10.118  44.264  1.00 101.17 ? 815 DG  P C5    1 
ATOM   8640  C  C6    . DG  D  4 14  ? 15.966  10.342  45.639  1.00 96.42  ? 815 DG  P C6    1 
ATOM   8641  O  O6    . DG  D  4 14  ? 16.677  10.026  46.604  1.00 90.09  ? 815 DG  P O6    1 
ATOM   8642  N  N1    . DG  D  4 14  ? 14.764  11.013  45.851  1.00 96.51  ? 815 DG  P N1    1 
ATOM   8643  C  C2    . DG  D  4 14  ? 13.901  11.412  44.858  1.00 95.70  ? 815 DG  P C2    1 
ATOM   8644  N  N2    . DG  D  4 14  ? 12.788  12.045  45.257  1.00 95.23  ? 815 DG  P N2    1 
ATOM   8645  N  N3    . DG  D  4 14  ? 14.113  11.207  43.564  1.00 100.70 ? 815 DG  P N3    1 
ATOM   8646  C  C4    . DG  D  4 14  ? 15.280  10.556  43.342  1.00 102.84 ? 815 DG  P C4    1 
ATOM   8647  P  P     . DG  D  4 15  ? 15.721  12.770  37.202  1.00 143.44 ? 816 DG  P P     1 
ATOM   8648  O  OP1   . DG  D  4 15  ? 15.123  13.196  35.918  1.00 151.88 ? 816 DG  P OP1   1 
ATOM   8649  O  OP2   . DG  D  4 15  ? 17.183  12.554  37.287  1.00 143.71 ? 816 DG  P OP2   1 
ATOM   8650  O  "O5'" . DG  D  4 15  ? 15.305  13.826  38.328  1.00 130.98 ? 816 DG  P "O5'" 1 
ATOM   8651  C  "C5'" . DG  D  4 15  ? 13.928  14.083  38.582  1.00 127.17 ? 816 DG  P "C5'" 1 
ATOM   8652  C  "C4'" . DG  D  4 15  ? 13.768  15.091  39.704  1.00 124.46 ? 816 DG  P "C4'" 1 
ATOM   8653  O  "O4'" . DG  D  4 15  ? 14.073  14.457  40.974  1.00 125.28 ? 816 DG  P "O4'" 1 
ATOM   8654  C  "C3'" . DG  D  4 15  ? 14.686  16.315  39.603  1.00 128.87 ? 816 DG  P "C3'" 1 
ATOM   8655  O  "O3'" . DG  D  4 15  ? 13.941  17.510  39.794  1.00 129.95 ? 816 DG  P "O3'" 1 
ATOM   8656  C  "C2'" . DG  D  4 15  ? 15.698  16.100  40.727  1.00 130.43 ? 816 DG  P "C2'" 1 
ATOM   8657  C  "C1'" . DG  D  4 15  ? 14.875  15.322  41.736  1.00 129.84 ? 816 DG  P "C1'" 1 
ATOM   8658  N  N9    . DG  D  4 15  ? 15.690  14.532  42.653  1.00 127.86 ? 816 DG  P N9    1 
ATOM   8659  C  C8    . DG  D  4 15  ? 16.656  13.613  42.320  1.00 128.30 ? 816 DG  P C8    1 
ATOM   8660  N  N7    . DG  D  4 15  ? 17.233  13.068  43.355  1.00 128.94 ? 816 DG  P N7    1 
ATOM   8661  C  C5    . DG  D  4 15  ? 16.612  13.667  44.444  1.00 123.47 ? 816 DG  P C5    1 
ATOM   8662  C  C6    . DG  D  4 15  ? 16.820  13.478  45.831  1.00 112.37 ? 816 DG  P C6    1 
ATOM   8663  O  O6    . DG  D  4 15  ? 17.621  12.716  46.390  1.00 107.73 ? 816 DG  P O6    1 
ATOM   8664  N  N1    . DG  D  4 15  ? 15.980  14.285  46.593  1.00 109.97 ? 816 DG  P N1    1 
ATOM   8665  C  C2    . DG  D  4 15  ? 15.056  15.165  46.080  1.00 113.02 ? 816 DG  P C2    1 
ATOM   8666  N  N2    . DG  D  4 15  ? 14.336  15.858  46.974  1.00 112.26 ? 816 DG  P N2    1 
ATOM   8667  N  N3    . DG  D  4 15  ? 14.852  15.352  44.783  1.00 117.85 ? 816 DG  P N3    1 
ATOM   8668  C  C4    . DG  D  4 15  ? 15.662  14.573  44.027  1.00 123.69 ? 816 DG  P C4    1 
ATOM   8669  P  P     . DG  D  4 16  ? 14.627  18.939  39.527  1.00 133.42 ? 817 DG  P P     1 
ATOM   8670  O  OP1   . DG  D  4 16  ? 13.650  19.765  38.785  1.00 138.94 ? 817 DG  P OP1   1 
ATOM   8671  O  OP2   . DG  D  4 16  ? 15.971  18.705  38.954  1.00 130.38 ? 817 DG  P OP2   1 
ATOM   8672  O  "O5'" . DG  D  4 16  ? 14.816  19.556  40.992  1.00 125.81 ? 817 DG  P "O5'" 1 
ATOM   8673  C  "C5'" . DG  D  4 16  ? 13.699  20.115  41.671  1.00 120.80 ? 817 DG  P "C5'" 1 
ATOM   8674  C  "C4'" . DG  D  4 16  ? 14.039  20.432  43.117  1.00 113.35 ? 817 DG  P "C4'" 1 
ATOM   8675  O  "O4'" . DG  D  4 16  ? 14.170  19.203  43.871  1.00 107.88 ? 817 DG  P "O4'" 1 
ATOM   8676  C  "C3'" . DG  D  4 16  ? 15.361  21.140  43.335  1.00 107.63 ? 817 DG  P "C3'" 1 
ATOM   8677  O  "O3'" . DG  D  4 16  ? 15.222  22.536  43.113  1.00 111.01 ? 817 DG  P "O3'" 1 
ATOM   8678  C  "C2'" . DG  D  4 16  ? 15.621  20.830  44.802  1.00 97.32  ? 817 DG  P "C2'" 1 
ATOM   8679  C  "C1'" . DG  D  4 16  ? 15.133  19.385  44.900  1.00 98.57  ? 817 DG  P "C1'" 1 
ATOM   8680  N  N9    . DG  D  4 16  ? 16.202  18.408  44.725  1.00 98.27  ? 817 DG  P N9    1 
ATOM   8681  C  C8    . DG  D  4 16  ? 16.633  17.851  43.545  1.00 101.30 ? 817 DG  P C8    1 
ATOM   8682  N  N7    . DG  D  4 16  ? 17.619  17.011  43.698  1.00 99.49  ? 817 DG  P N7    1 
ATOM   8683  C  C5    . DG  D  4 16  ? 17.859  17.014  45.066  1.00 98.71  ? 817 DG  P C5    1 
ATOM   8684  C  C6    . DG  D  4 16  ? 18.813  16.297  45.827  1.00 102.51 ? 817 DG  P C6    1 
ATOM   8685  O  O6    . DG  D  4 16  ? 19.664  15.489  45.428  1.00 100.16 ? 817 DG  P O6    1 
ATOM   8686  N  N1    . DG  D  4 16  ? 18.718  16.596  47.185  1.00 102.41 ? 817 DG  P N1    1 
ATOM   8687  C  C2    . DG  D  4 16  ? 17.815  17.475  47.735  1.00 96.15  ? 817 DG  P C2    1 
ATOM   8688  N  N2    . DG  D  4 16  ? 17.872  17.634  49.065  1.00 96.41  ? 817 DG  P N2    1 
ATOM   8689  N  N3    . DG  D  4 16  ? 16.917  18.152  47.033  1.00 89.82  ? 817 DG  P N3    1 
ATOM   8690  C  C4    . DG  D  4 16  ? 16.997  17.873  45.710  1.00 92.58  ? 817 DG  P C4    1 
ATOM   8691  P  P     . DC  D  4 17  ? 16.495  23.403  42.655  1.00 103.54 ? 818 DC  P P     1 
ATOM   8692  O  OP1   . DC  D  4 17  ? 16.027  24.777  42.369  1.00 105.97 ? 818 DC  P OP1   1 
ATOM   8693  O  OP2   . DC  D  4 17  ? 17.203  22.633  41.609  1.00 105.12 ? 818 DC  P OP2   1 
ATOM   8694  O  "O5'" . DC  D  4 17  ? 17.433  23.433  43.954  1.00 108.36 ? 818 DC  P "O5'" 1 
ATOM   8695  C  "C5'" . DC  D  4 17  ? 17.024  24.155  45.110  1.00 107.90 ? 818 DC  P "C5'" 1 
ATOM   8696  C  "C4'" . DC  D  4 17  ? 17.888  23.801  46.310  1.00 101.94 ? 818 DC  P "C4'" 1 
ATOM   8697  O  "O4'" . DC  D  4 17  ? 17.800  22.380  46.572  1.00 96.22  ? 818 DC  P "O4'" 1 
ATOM   8698  C  "C3'" . DC  D  4 17  ? 19.372  24.059  46.138  1.00 105.14 ? 818 DC  P "C3'" 1 
ATOM   8699  O  "O3'" . DC  D  4 17  ? 19.672  25.421  46.411  1.00 107.13 ? 818 DC  P "O3'" 1 
ATOM   8700  C  "C2'" . DC  D  4 17  ? 19.965  23.131  47.192  1.00 99.34  ? 818 DC  P "C2'" 1 
ATOM   8701  C  "C1'" . DC  D  4 17  ? 19.033  21.919  47.104  1.00 97.87  ? 818 DC  P "C1'" 1 
ATOM   8702  N  N1    . DC  D  4 17  ? 19.561  20.827  46.230  1.00 98.26  ? 818 DC  P N1    1 
ATOM   8703  C  C2    . DC  D  4 17  ? 20.378  19.835  46.783  1.00 92.31  ? 818 DC  P C2    1 
ATOM   8704  O  O2    . DC  D  4 17  ? 20.646  19.878  47.989  1.00 86.56  ? 818 DC  P O2    1 
ATOM   8705  N  N3    . DC  D  4 17  ? 20.853  18.852  45.978  1.00 93.28  ? 818 DC  P N3    1 
ATOM   8706  C  C4    . DC  D  4 17  ? 20.542  18.842  44.681  1.00 95.60  ? 818 DC  P C4    1 
ATOM   8707  N  N4    . DC  D  4 17  ? 21.033  17.852  43.928  1.00 96.59  ? 818 DC  P N4    1 
ATOM   8708  C  C5    . DC  D  4 17  ? 19.711  19.844  44.099  1.00 99.62  ? 818 DC  P C5    1 
ATOM   8709  C  C6    . DC  D  4 17  ? 19.248  20.808  44.901  1.00 100.04 ? 818 DC  P C6    1 
ATOM   8710  P  P     . DG  D  4 18  ? 21.008  26.085  45.816  1.00 106.58 ? 819 DG  P P     1 
ATOM   8711  O  OP1   . DG  D  4 18  ? 20.908  27.549  45.996  1.00 115.75 ? 819 DG  P OP1   1 
ATOM   8712  O  OP2   . DG  D  4 18  ? 21.224  25.523  44.464  1.00 97.09  ? 819 DG  P OP2   1 
ATOM   8713  O  "O5'" . DG  D  4 18  ? 22.167  25.533  46.770  1.00 96.04  ? 819 DG  P "O5'" 1 
ATOM   8714  C  "C5'" . DG  D  4 18  ? 22.172  25.882  48.147  1.00 89.52  ? 819 DG  P "C5'" 1 
ATOM   8715  C  "C4'" . DG  D  4 18  ? 23.193  25.060  48.911  1.00 85.80  ? 819 DG  P "C4'" 1 
ATOM   8716  O  "O4'" . DG  D  4 18  ? 22.836  23.658  48.849  1.00 90.36  ? 819 DG  P "O4'" 1 
ATOM   8717  C  "C3'" . DG  D  4 18  ? 24.606  25.119  48.367  1.00 86.18  ? 819 DG  P "C3'" 1 
ATOM   8718  O  "O3'" . DG  D  4 18  ? 25.276  26.260  48.880  1.00 85.31  ? 819 DG  P "O3'" 1 
ATOM   8719  C  "C2'" . DG  D  4 18  ? 25.200  23.826  48.911  1.00 84.17  ? 819 DG  P "C2'" 1 
ATOM   8720  C  "C1'" . DG  D  4 18  ? 24.012  22.867  48.804  1.00 84.54  ? 819 DG  P "C1'" 1 
ATOM   8721  N  N9    . DG  D  4 18  ? 24.001  22.091  47.567  1.00 93.03  ? 819 DG  P N9    1 
ATOM   8722  C  C8    . DG  D  4 18  ? 23.263  22.347  46.437  1.00 94.77  ? 819 DG  P C8    1 
ATOM   8723  N  N7    . DG  D  4 18  ? 23.458  21.480  45.482  1.00 93.74  ? 819 DG  P N7    1 
ATOM   8724  C  C5    . DG  D  4 18  ? 24.386  20.593  46.012  1.00 94.25  ? 819 DG  P C5    1 
ATOM   8725  C  C6    . DG  D  4 18  ? 24.979  19.445  45.438  1.00 98.15  ? 819 DG  P C6    1 
ATOM   8726  O  O6    . DG  D  4 18  ? 24.795  18.968  44.309  1.00 102.20 ? 819 DG  P O6    1 
ATOM   8727  N  N1    . DG  D  4 18  ? 25.869  18.831  46.316  1.00 101.84 ? 819 DG  P N1    1 
ATOM   8728  C  C2    . DG  D  4 18  ? 26.149  19.272  47.588  1.00 98.41  ? 819 DG  P C2    1 
ATOM   8729  N  N2    . DG  D  4 18  ? 27.035  18.547  48.287  1.00 95.17  ? 819 DG  P N2    1 
ATOM   8730  N  N3    . DG  D  4 18  ? 25.600  20.347  48.138  1.00 94.18  ? 819 DG  P N3    1 
ATOM   8731  C  C4    . DG  D  4 18  ? 24.731  20.956  47.295  1.00 93.00  ? 819 DG  P C4    1 
ATOM   8732  P  P     . DC  D  4 19  ? 26.189  27.159  47.911  1.00 91.40  ? 820 DC  P P     1 
ATOM   8733  O  OP1   . DC  D  4 19  ? 26.622  28.349  48.677  1.00 91.74  ? 820 DC  P OP1   1 
ATOM   8734  O  OP2   . DC  D  4 19  ? 25.455  27.330  46.637  1.00 94.64  ? 820 DC  P OP2   1 
ATOM   8735  O  "O5'" . DC  D  4 19  ? 27.462  26.236  47.624  1.00 88.98  ? 820 DC  P "O5'" 1 
ATOM   8736  C  "C5'" . DC  D  4 19  ? 28.299  25.834  48.698  1.00 84.07  ? 820 DC  P "C5'" 1 
ATOM   8737  C  "C4'" . DC  D  4 19  ? 29.198  24.683  48.285  1.00 84.70  ? 820 DC  P "C4'" 1 
ATOM   8738  O  "O4'" . DC  D  4 19  ? 28.400  23.499  48.041  1.00 84.60  ? 820 DC  P "O4'" 1 
ATOM   8739  C  "C3'" . DC  D  4 19  ? 29.959  24.887  46.992  1.00 91.75  ? 820 DC  P "C3'" 1 
ATOM   8740  O  "O3'" . DC  D  4 19  ? 31.126  25.662  47.222  1.00 92.46  ? 820 DC  P "O3'" 1 
ATOM   8741  C  "C2'" . DC  D  4 19  ? 30.299  23.450  46.619  1.00 96.04  ? 820 DC  P "C2'" 1 
ATOM   8742  C  "C1'" . DC  D  4 19  ? 29.027  22.709  47.040  1.00 92.75  ? 820 DC  P "C1'" 1 
ATOM   8743  N  N1    . DC  D  4 19  ? 28.067  22.503  45.918  1.00 101.07 ? 820 DC  P N1    1 
ATOM   8744  C  C2    . DC  D  4 19  ? 28.267  21.443  45.026  1.00 104.22 ? 820 DC  P C2    1 
ATOM   8745  O  O2    . DC  D  4 19  ? 29.236  20.692  45.191  1.00 105.42 ? 820 DC  P O2    1 
ATOM   8746  N  N3    . DC  D  4 19  ? 27.391  21.269  44.007  1.00 105.67 ? 820 DC  P N3    1 
ATOM   8747  C  C4    . DC  D  4 19  ? 26.359  22.102  43.863  1.00 107.27 ? 820 DC  P C4    1 
ATOM   8748  N  N4    . DC  D  4 19  ? 25.522  21.889  42.843  1.00 112.37 ? 820 DC  P N4    1 
ATOM   8749  C  C5    . DC  D  4 19  ? 26.140  23.189  44.759  1.00 105.99 ? 820 DC  P C5    1 
ATOM   8750  C  C6    . DC  D  4 19  ? 27.010  23.351  45.762  1.00 102.68 ? 820 DC  P C6    1 
ATOM   8751  P  P     . DC  D  4 20  ? 31.833  26.429  46.000  1.00 99.61  ? 821 DC  P P     1 
ATOM   8752  O  OP1   . DC  D  4 20  ? 32.789  27.403  46.570  1.00 100.24 ? 821 DC  P OP1   1 
ATOM   8753  O  OP2   . DC  D  4 20  ? 30.769  26.895  45.084  1.00 97.44  ? 821 DC  P OP2   1 
ATOM   8754  O  "O5'" . DC  D  4 20  ? 32.653  25.277  45.251  1.00 100.75 ? 821 DC  P "O5'" 1 
ATOM   8755  C  "C5'" . DC  D  4 20  ? 33.636  24.539  45.960  1.00 94.83  ? 821 DC  P "C5'" 1 
ATOM   8756  C  "C4'" . DC  D  4 20  ? 34.169  23.392  45.121  1.00 99.78  ? 821 DC  P "C4'" 1 
ATOM   8757  O  "O4'" . DC  D  4 20  ? 33.120  22.421  44.909  1.00 102.56 ? 821 DC  P "O4'" 1 
ATOM   8758  C  "C3'" . DC  D  4 20  ? 34.629  23.777  43.729  1.00 114.57 ? 821 DC  P "C3'" 1 
ATOM   8759  O  "O3'" . DC  D  4 20  ? 35.978  24.224  43.772  1.00 143.28 ? 821 DC  P "O3'" 1 
ATOM   8760  C  "C2'" . DC  D  4 20  ? 34.501  22.457  42.973  1.00 104.78 ? 821 DC  P "C2'" 1 
ATOM   8761  C  "C1'" . DC  D  4 20  ? 33.286  21.806  43.643  1.00 108.39 ? 821 DC  P "C1'" 1 
ATOM   8762  N  N1    . DC  D  4 20  ? 32.019  21.960  42.869  1.00 114.79 ? 821 DC  P N1    1 
ATOM   8763  C  C2    . DC  D  4 20  ? 31.672  20.999  41.914  1.00 115.15 ? 821 DC  P C2    1 
ATOM   8764  O  O2    . DC  D  4 20  ? 32.424  20.035  41.727  1.00 118.86 ? 821 DC  P O2    1 
ATOM   8765  N  N3    . DC  D  4 20  ? 30.517  21.152  41.220  1.00 112.61 ? 821 DC  P N3    1 
ATOM   8766  C  C4    . DC  D  4 20  ? 29.733  22.206  41.451  1.00 109.84 ? 821 DC  P C4    1 
ATOM   8767  N  N4    . DC  D  4 20  ? 28.605  22.314  40.742  1.00 109.42 ? 821 DC  P N4    1 
ATOM   8768  C  C5    . DC  D  4 20  ? 30.070  23.196  42.421  1.00 109.80 ? 821 DC  P C5    1 
ATOM   8769  C  C6    . DC  D  4 20  ? 31.210  23.034  43.100  1.00 113.88 ? 821 DC  P C6    1 
HETATM 8770  P  P     . DDG D  4 21  ? 36.215  25.434  42.736  1.00 77.77  ? 822 DDG P P     1 
HETATM 8771  O  OP1   . DDG D  4 21  ? 37.372  26.283  43.206  1.00 83.16  ? 822 DDG P OP1   1 
HETATM 8772  O  OP2   . DDG D  4 21  ? 34.968  26.282  42.653  1.00 76.21  ? 822 DDG P OP2   1 
HETATM 8773  O  "O5'" . DDG D  4 21  ? 36.543  24.837  41.311  1.00 76.57  ? 822 DDG P "O5'" 1 
HETATM 8774  C  "C5'" . DDG D  4 21  ? 37.519  23.827  41.223  1.00 81.03  ? 822 DDG P "C5'" 1 
HETATM 8775  C  "C4'" . DDG D  4 21  ? 37.250  22.981  40.005  1.00 94.70  ? 822 DDG P "C4'" 1 
HETATM 8776  O  "O4'" . DDG D  4 21  ? 36.149  22.335  40.154  1.00 102.57 ? 822 DDG P "O4'" 1 
HETATM 8777  C  "C3'" . DDG D  4 21  ? 37.043  23.934  38.709  1.00 97.79  ? 822 DDG P "C3'" 1 
HETATM 8778  C  "C2'" . DDG D  4 21  ? 36.317  23.272  37.904  1.00 99.13  ? 822 DDG P "C2'" 1 
HETATM 8779  C  "C1'" . DDG D  4 21  ? 35.494  22.302  38.778  1.00 96.15  ? 822 DDG P "C1'" 1 
HETATM 8780  N  N9    . DDG D  4 21  ? 34.253  22.721  38.848  1.00 88.00  ? 822 DDG P N9    1 
HETATM 8781  C  C8    . DDG D  4 21  ? 33.566  23.636  39.577  1.00 86.36  ? 822 DDG P C8    1 
HETATM 8782  N  N7    . DDG D  4 21  ? 32.271  23.609  39.172  1.00 83.76  ? 822 DDG P N7    1 
HETATM 8783  C  C5    . DDG D  4 21  ? 32.158  22.680  38.192  1.00 82.36  ? 822 DDG P C5    1 
HETATM 8784  C  C6    . DDG D  4 21  ? 30.981  22.215  37.373  1.00 74.79  ? 822 DDG P C6    1 
HETATM 8785  O  O6    . DDG D  4 21  ? 29.884  22.706  37.552  1.00 73.09  ? 822 DDG P O6    1 
HETATM 8786  N  N1    . DDG D  4 21  ? 31.152  21.215  36.403  1.00 73.73  ? 822 DDG P N1    1 
HETATM 8787  C  C2    . DDG D  4 21  ? 32.443  20.644  36.198  1.00 74.76  ? 822 DDG P C2    1 
HETATM 8788  N  N2    . DDG D  4 21  ? 32.621  19.632  35.220  1.00 77.48  ? 822 DDG P N2    1 
HETATM 8789  N  N3    . DDG D  4 21  ? 33.566  21.094  36.985  1.00 77.38  ? 822 DDG P N3    1 
HETATM 8790  C  C4    . DDG D  4 21  ? 33.387  22.131  37.990  1.00 84.59  ? 822 DDG P C4    1 
ATOM   8791  N  N     . MET E  1 1   ? 33.437  -57.507 -30.482 1.00 120.15 ? -1  MET C N     1 
ATOM   8792  C  CA    . MET E  1 1   ? 34.378  -56.622 -29.805 1.00 117.58 ? -1  MET C CA    1 
ATOM   8793  C  C     . MET E  1 1   ? 33.631  -55.555 -29.011 1.00 118.18 ? -1  MET C C     1 
ATOM   8794  O  O     . MET E  1 1   ? 33.302  -54.491 -29.536 1.00 118.81 ? -1  MET C O     1 
ATOM   8795  C  CB    . MET E  1 1   ? 35.326  -55.973 -30.815 1.00 122.93 ? -1  MET C CB    1 
ATOM   8796  C  CG    . MET E  1 1   ? 36.468  -55.189 -30.189 1.00 123.07 ? -1  MET C CG    1 
ATOM   8797  S  SD    . MET E  1 1   ? 37.577  -56.216 -29.207 1.00 124.57 ? -1  MET C SD    1 
ATOM   8798  C  CE    . MET E  1 1   ? 38.752  -54.991 -28.635 1.00 122.52 ? -1  MET C CE    1 
ATOM   8799  N  N     . VAL E  1 2   ? 33.366  -55.851 -27.747 1.00 119.78 ? 0   VAL C N     1 
ATOM   8800  C  CA    . VAL E  1 2   ? 32.649  -54.948 -26.849 1.00 112.06 ? 0   VAL C CA    1 
ATOM   8801  C  C     . VAL E  1 2   ? 33.676  -54.162 -26.042 1.00 107.15 ? 0   VAL C C     1 
ATOM   8802  O  O     . VAL E  1 2   ? 34.641  -54.760 -25.548 1.00 108.36 ? 0   VAL C O     1 
ATOM   8803  C  CB    . VAL E  1 2   ? 31.697  -55.721 -25.916 1.00 113.41 ? 0   VAL C CB    1 
ATOM   8804  C  CG1   . VAL E  1 2   ? 30.972  -54.770 -24.974 1.00 117.11 ? 0   VAL C CG1   1 
ATOM   8805  C  CG2   . VAL E  1 2   ? 30.702  -56.534 -26.729 1.00 112.82 ? 0   VAL C CG2   1 
ATOM   8806  N  N     . PRO E  1 3   ? 33.520  -52.846 -25.898 1.00 105.46 ? 1   PRO C N     1 
ATOM   8807  C  CA    . PRO E  1 3   ? 34.467  -52.083 -25.077 1.00 102.14 ? 1   PRO C CA    1 
ATOM   8808  C  C     . PRO E  1 3   ? 34.400  -52.502 -23.615 1.00 99.50  ? 1   PRO C C     1 
ATOM   8809  O  O     . PRO E  1 3   ? 33.324  -52.746 -23.066 1.00 105.85 ? 1   PRO C O     1 
ATOM   8810  C  CB    . PRO E  1 3   ? 34.015  -50.630 -25.272 1.00 102.86 ? 1   PRO C CB    1 
ATOM   8811  C  CG    . PRO E  1 3   ? 32.592  -50.728 -25.720 1.00 107.18 ? 1   PRO C CG    1 
ATOM   8812  C  CD    . PRO E  1 3   ? 32.520  -51.978 -26.539 1.00 105.45 ? 1   PRO C CD    1 
ATOM   8813  N  N     . ILE E  1 4   ? 35.571  -52.587 -22.989 1.00 95.76  ? 2   ILE C N     1 
ATOM   8814  C  CA    . ILE E  1 4   ? 35.677  -53.016 -21.599 1.00 93.63  ? 2   ILE C CA    1 
ATOM   8815  C  C     . ILE E  1 4   ? 35.362  -51.843 -20.682 1.00 97.72  ? 2   ILE C C     1 
ATOM   8816  O  O     . ILE E  1 4   ? 35.806  -50.712 -20.914 1.00 101.84 ? 2   ILE C O     1 
ATOM   8817  C  CB    . ILE E  1 4   ? 37.078  -53.589 -21.322 1.00 92.53  ? 2   ILE C CB    1 
ATOM   8818  C  CG1   . ILE E  1 4   ? 37.364  -54.768 -22.255 1.00 92.32  ? 2   ILE C CG1   1 
ATOM   8819  C  CG2   . ILE E  1 4   ? 37.210  -54.016 -19.867 1.00 89.43  ? 2   ILE C CG2   1 
ATOM   8820  C  CD1   . ILE E  1 4   ? 38.762  -55.333 -22.118 1.00 97.89  ? 2   ILE C CD1   1 
ATOM   8821  N  N     . SER E  1 5   ? 34.587  -52.111 -19.633 1.00 97.33  ? 3   SER C N     1 
ATOM   8822  C  CA    . SER E  1 5   ? 34.213  -51.069 -18.692 1.00 100.06 ? 3   SER C CA    1 
ATOM   8823  C  C     . SER E  1 5   ? 35.413  -50.660 -17.837 1.00 101.23 ? 3   SER C C     1 
ATOM   8824  O  O     . SER E  1 5   ? 36.272  -51.487 -17.521 1.00 100.29 ? 3   SER C O     1 
ATOM   8825  C  CB    . SER E  1 5   ? 33.077  -51.547 -17.791 1.00 102.98 ? 3   SER C CB    1 
ATOM   8826  O  OG    . SER E  1 5   ? 32.736  -50.566 -16.828 1.00 106.41 ? 3   SER C OG    1 
ATOM   8827  N  N     . PRO E  1 6   ? 35.498  -49.381 -17.457 1.00 104.77 ? 4   PRO C N     1 
ATOM   8828  C  CA    . PRO E  1 6   ? 36.602  -48.949 -16.583 1.00 103.13 ? 4   PRO C CA    1 
ATOM   8829  C  C     . PRO E  1 6   ? 36.515  -49.503 -15.172 1.00 102.39 ? 4   PRO C C     1 
ATOM   8830  O  O     . PRO E  1 6   ? 37.524  -49.485 -14.456 1.00 109.47 ? 4   PRO C O     1 
ATOM   8831  C  CB    . PRO E  1 6   ? 36.478  -47.418 -16.585 1.00 102.20 ? 4   PRO C CB    1 
ATOM   8832  C  CG    . PRO E  1 6   ? 35.628  -47.092 -17.777 1.00 109.64 ? 4   PRO C CG    1 
ATOM   8833  C  CD    . PRO E  1 6   ? 34.690  -48.245 -17.927 1.00 110.02 ? 4   PRO C CD    1 
ATOM   8834  N  N     . ILE E  1 7   ? 35.352  -49.987 -14.749 1.00 97.59  ? 5   ILE C N     1 
ATOM   8835  C  CA    . ILE E  1 7   ? 35.169  -50.513 -13.402 1.00 95.15  ? 5   ILE C CA    1 
ATOM   8836  C  C     . ILE E  1 7   ? 35.505  -51.998 -13.404 1.00 99.91  ? 5   ILE C C     1 
ATOM   8837  O  O     . ILE E  1 7   ? 35.052  -52.746 -14.278 1.00 86.58  ? 5   ILE C O     1 
ATOM   8838  C  CB    . ILE E  1 7   ? 33.734  -50.269 -12.908 1.00 93.98  ? 5   ILE C CB    1 
ATOM   8839  C  CG1   . ILE E  1 7   ? 33.429  -48.770 -12.878 1.00 87.73  ? 5   ILE C CG1   1 
ATOM   8840  C  CG2   . ILE E  1 7   ? 33.524  -50.890 -11.534 1.00 86.70  ? 5   ILE C CG2   1 
ATOM   8841  C  CD1   . ILE E  1 7   ? 32.024  -48.440 -12.426 1.00 88.24  ? 5   ILE C CD1   1 
ATOM   8842  N  N     . GLU E  1 8   ? 36.303  -52.423 -12.428 1.00 103.86 ? 6   GLU C N     1 
ATOM   8843  C  CA    . GLU E  1 8   ? 36.682  -53.825 -12.325 1.00 110.36 ? 6   GLU C CA    1 
ATOM   8844  C  C     . GLU E  1 8   ? 35.473  -54.681 -11.966 1.00 109.74 ? 6   GLU C C     1 
ATOM   8845  O  O     . GLU E  1 8   ? 34.645  -54.299 -11.135 1.00 116.64 ? 6   GLU C O     1 
ATOM   8846  C  CB    . GLU E  1 8   ? 37.778  -54.004 -11.276 1.00 125.31 ? 6   GLU C CB    1 
ATOM   8847  C  CG    . GLU E  1 8   ? 39.004  -53.134 -11.500 1.00 142.77 ? 6   GLU C CG    1 
ATOM   8848  C  CD    . GLU E  1 8   ? 40.025  -53.274 -10.388 1.00 155.76 ? 6   GLU C CD    1 
ATOM   8849  O  OE1   . GLU E  1 8   ? 39.856  -54.172 -9.535  1.00 158.25 ? 6   GLU C OE1   1 
ATOM   8850  O  OE2   . GLU E  1 8   ? 40.993  -52.485 -10.363 1.00 159.83 ? 6   GLU C OE2   1 
ATOM   8851  N  N     . THR E  1 9   ? 35.376  -55.845 -12.599 1.00 106.85 ? 7   THR C N     1 
ATOM   8852  C  CA    . THR E  1 9   ? 34.272  -56.755 -12.340 1.00 107.64 ? 7   THR C CA    1 
ATOM   8853  C  C     . THR E  1 9   ? 34.496  -57.516 -11.038 1.00 108.01 ? 7   THR C C     1 
ATOM   8854  O  O     . THR E  1 9   ? 35.631  -57.728 -10.601 1.00 112.43 ? 7   THR C O     1 
ATOM   8855  C  CB    . THR E  1 9   ? 34.101  -57.741 -13.498 1.00 103.93 ? 7   THR C CB    1 
ATOM   8856  O  OG1   . THR E  1 9   ? 33.015  -58.632 -13.216 1.00 97.03  ? 7   THR C OG1   1 
ATOM   8857  C  CG2   . THR E  1 9   ? 35.375  -58.550 -13.708 1.00 107.59 ? 7   THR C CG2   1 
ATOM   8858  N  N     . VAL E  1 10  ? 33.396  -57.920 -10.415 1.00 84.73  ? 8   VAL C N     1 
ATOM   8859  C  CA    . VAL E  1 10  ? 33.422  -58.686 -9.172  1.00 87.10  ? 8   VAL C CA    1 
ATOM   8860  C  C     . VAL E  1 10  ? 33.098  -60.137 -9.510  1.00 90.94  ? 8   VAL C C     1 
ATOM   8861  O  O     . VAL E  1 10  ? 31.983  -60.415 -9.978  1.00 91.93  ? 8   VAL C O     1 
ATOM   8862  C  CB    . VAL E  1 10  ? 32.431  -58.126 -8.141  1.00 90.25  ? 8   VAL C CB    1 
ATOM   8863  C  CG1   . VAL E  1 10  ? 32.337  -59.052 -6.939  1.00 84.06  ? 8   VAL C CG1   1 
ATOM   8864  C  CG2   . VAL E  1 10  ? 32.851  -56.729 -7.710  1.00 88.28  ? 8   VAL C CG2   1 
ATOM   8865  N  N     . PRO E  1 11  ? 34.021  -61.079 -9.298  1.00 92.61  ? 9   PRO C N     1 
ATOM   8866  C  CA    . PRO E  1 11  ? 33.736  -62.482 -9.631  1.00 93.31  ? 9   PRO C CA    1 
ATOM   8867  C  C     . PRO E  1 11  ? 32.632  -63.073 -8.768  1.00 99.71  ? 9   PRO C C     1 
ATOM   8868  O  O     . PRO E  1 11  ? 32.789  -63.217 -7.551  1.00 107.24 ? 9   PRO C O     1 
ATOM   8869  C  CB    . PRO E  1 11  ? 35.080  -63.180 -9.385  1.00 88.64  ? 9   PRO C CB    1 
ATOM   8870  C  CG    . PRO E  1 11  ? 35.796  -62.296 -8.416  1.00 93.50  ? 9   PRO C CG    1 
ATOM   8871  C  CD    . PRO E  1 11  ? 35.378  -60.897 -8.758  1.00 93.94  ? 9   PRO C CD    1 
ATOM   8872  N  N     . VAL E  1 12  ? 31.510  -63.418 -9.393  1.00 104.09 ? 10  VAL C N     1 
ATOM   8873  C  CA    . VAL E  1 12  ? 30.342  -63.950 -8.703  1.00 105.17 ? 10  VAL C CA    1 
ATOM   8874  C  C     . VAL E  1 12  ? 30.059  -65.347 -9.236  1.00 115.63 ? 10  VAL C C     1 
ATOM   8875  O  O     . VAL E  1 12  ? 29.972  -65.546 -10.454 1.00 117.14 ? 10  VAL C O     1 
ATOM   8876  C  CB    . VAL E  1 12  ? 29.113  -63.039 -8.882  1.00 100.54 ? 10  VAL C CB    1 
ATOM   8877  C  CG1   . VAL E  1 12  ? 27.893  -63.652 -8.211  1.00 100.81 ? 10  VAL C CG1   1 
ATOM   8878  C  CG2   . VAL E  1 12  ? 29.395  -61.652 -8.325  1.00 103.73 ? 10  VAL C CG2   1 
ATOM   8879  N  N     . LYS E  1 13  ? 29.919  -66.307 -8.328  1.00 119.08 ? 11  LYS C N     1 
ATOM   8880  C  CA    . LYS E  1 13  ? 29.589  -67.682 -8.663  1.00 118.91 ? 11  LYS C CA    1 
ATOM   8881  C  C     . LYS E  1 13  ? 28.202  -68.020 -8.119  1.00 116.75 ? 11  LYS C C     1 
ATOM   8882  O  O     . LYS E  1 13  ? 27.454  -67.145 -7.668  1.00 116.58 ? 11  LYS C O     1 
ATOM   8883  C  CB    . LYS E  1 13  ? 30.659  -68.634 -8.121  1.00 121.92 ? 11  LYS C CB    1 
ATOM   8884  C  CG    . LYS E  1 13  ? 31.835  -68.873 -9.061  1.00 130.86 ? 11  LYS C CG    1 
ATOM   8885  C  CD    . LYS E  1 13  ? 32.706  -67.637 -9.212  1.00 133.62 ? 11  LYS C CD    1 
ATOM   8886  C  CE    . LYS E  1 13  ? 33.844  -67.881 -10.188 1.00 136.56 ? 11  LYS C CE    1 
ATOM   8887  N  NZ    . LYS E  1 13  ? 34.697  -66.672 -10.356 1.00 138.46 ? 11  LYS C NZ    1 
ATOM   8888  N  N     . LEU E  1 14  ? 27.857  -69.304 -8.162  1.00 117.86 ? 12  LEU C N     1 
ATOM   8889  C  CA    . LEU E  1 14  ? 26.590  -69.796 -7.645  1.00 118.05 ? 12  LEU C CA    1 
ATOM   8890  C  C     . LEU E  1 14  ? 26.855  -70.943 -6.681  1.00 119.93 ? 12  LEU C C     1 
ATOM   8891  O  O     . LEU E  1 14  ? 27.975  -71.452 -6.575  1.00 118.10 ? 12  LEU C O     1 
ATOM   8892  C  CB    . LEU E  1 14  ? 25.654  -70.255 -8.774  1.00 120.86 ? 12  LEU C CB    1 
ATOM   8893  C  CG    . LEU E  1 14  ? 25.187  -69.211 -9.792  1.00 125.96 ? 12  LEU C CG    1 
ATOM   8894  C  CD1   . LEU E  1 14  ? 26.188  -69.063 -10.930 1.00 129.18 ? 12  LEU C CD1   1 
ATOM   8895  C  CD2   . LEU E  1 14  ? 23.807  -69.563 -10.327 1.00 125.54 ? 12  LEU C CD2   1 
ATOM   8896  N  N     . LYS E  1 15  ? 25.809  -71.345 -5.972  1.00 125.44 ? 13  LYS C N     1 
ATOM   8897  C  CA    . LYS E  1 15  ? 25.923  -72.467 -5.050  1.00 132.90 ? 13  LYS C CA    1 
ATOM   8898  C  C     . LYS E  1 15  ? 26.154  -73.753 -5.836  1.00 142.45 ? 13  LYS C C     1 
ATOM   8899  O  O     . LYS E  1 15  ? 25.448  -74.006 -6.820  1.00 145.59 ? 13  LYS C O     1 
ATOM   8900  C  CB    . LYS E  1 15  ? 24.667  -72.579 -4.190  1.00 131.10 ? 13  LYS C CB    1 
ATOM   8901  C  CG    . LYS E  1 15  ? 24.379  -71.336 -3.361  1.00 129.68 ? 13  LYS C CG    1 
ATOM   8902  C  CD    . LYS E  1 15  ? 23.094  -71.479 -2.562  1.00 127.18 ? 13  LYS C CD    1 
ATOM   8903  C  CE    . LYS E  1 15  ? 22.811  -70.225 -1.750  1.00 124.10 ? 13  LYS C CE    1 
ATOM   8904  N  NZ    . LYS E  1 15  ? 21.543  -70.333 -0.979  1.00 123.82 ? 13  LYS C NZ    1 
ATOM   8905  N  N     . PRO E  1 16  ? 27.129  -74.578 -5.450  1.00 144.14 ? 14  PRO C N     1 
ATOM   8906  C  CA    . PRO E  1 16  ? 27.414  -75.797 -6.219  1.00 147.18 ? 14  PRO C CA    1 
ATOM   8907  C  C     . PRO E  1 16  ? 26.245  -76.770 -6.153  1.00 147.90 ? 14  PRO C C     1 
ATOM   8908  O  O     . PRO E  1 16  ? 25.676  -77.010 -5.087  1.00 149.34 ? 14  PRO C O     1 
ATOM   8909  C  CB    . PRO E  1 16  ? 28.665  -76.364 -5.536  1.00 147.22 ? 14  PRO C CB    1 
ATOM   8910  C  CG    . PRO E  1 16  ? 28.620  -75.803 -4.146  1.00 144.66 ? 14  PRO C CG    1 
ATOM   8911  C  CD    . PRO E  1 16  ? 28.011  -74.437 -4.279  1.00 143.42 ? 14  PRO C CD    1 
ATOM   8912  N  N     . GLY E  1 17  ? 25.885  -77.326 -7.308  1.00 146.43 ? 15  GLY C N     1 
ATOM   8913  C  CA    . GLY E  1 17  ? 24.761  -78.234 -7.395  1.00 144.98 ? 15  GLY C CA    1 
ATOM   8914  C  C     . GLY E  1 17  ? 23.446  -77.601 -7.785  1.00 145.44 ? 15  GLY C C     1 
ATOM   8915  O  O     . GLY E  1 17  ? 22.412  -78.277 -7.725  1.00 148.86 ? 15  GLY C O     1 
ATOM   8916  N  N     . MET E  1 18  ? 23.446  -76.329 -8.180  1.00 141.93 ? 16  MET C N     1 
ATOM   8917  C  CA    . MET E  1 18  ? 22.237  -75.634 -8.590  1.00 135.63 ? 16  MET C CA    1 
ATOM   8918  C  C     . MET E  1 18  ? 22.476  -74.936 -9.921  1.00 123.45 ? 16  MET C C     1 
ATOM   8919  O  O     . MET E  1 18  ? 23.596  -74.524 -10.234 1.00 115.49 ? 16  MET C O     1 
ATOM   8920  C  CB    . MET E  1 18  ? 21.786  -74.612 -7.537  1.00 136.04 ? 16  MET C CB    1 
ATOM   8921  C  CG    . MET E  1 18  ? 21.413  -75.222 -6.196  1.00 138.83 ? 16  MET C CG    1 
ATOM   8922  S  SD    . MET E  1 18  ? 20.732  -74.010 -5.047  1.00 152.06 ? 16  MET C SD    1 
ATOM   8923  C  CE    . MET E  1 18  ? 20.465  -75.027 -3.596  1.00 152.62 ? 16  MET C CE    1 
ATOM   8924  N  N     . ASP E  1 19  ? 21.404  -74.807 -10.702 1.00 122.62 ? 17  ASP C N     1 
ATOM   8925  C  CA    . ASP E  1 19  ? 21.485  -74.184 -12.017 1.00 121.93 ? 17  ASP C CA    1 
ATOM   8926  C  C     . ASP E  1 19  ? 21.003  -72.739 -11.949 1.00 116.07 ? 17  ASP C C     1 
ATOM   8927  O  O     . ASP E  1 19  ? 21.228  -72.051 -10.949 1.00 116.67 ? 17  ASP C O     1 
ATOM   8928  C  CB    . ASP E  1 19  ? 20.666  -74.985 -13.034 1.00 124.27 ? 17  ASP C CB    1 
ATOM   8929  C  CG    . ASP E  1 19  ? 21.129  -74.765 -14.463 1.00 124.86 ? 17  ASP C CG    1 
ATOM   8930  O  OD1   . ASP E  1 19  ? 22.115  -74.024 -14.663 1.00 122.77 ? 17  ASP C OD1   1 
ATOM   8931  O  OD2   . ASP E  1 19  ? 20.504  -75.331 -15.384 1.00 125.82 ? 17  ASP C OD2   1 
ATOM   8932  N  N     . GLY E  1 20  ? 20.339  -72.272 -13.004 1.00 117.25 ? 18  GLY C N     1 
ATOM   8933  C  CA    . GLY E  1 20  ? 19.845  -70.919 -13.056 1.00 113.18 ? 18  GLY C CA    1 
ATOM   8934  C  C     . GLY E  1 20  ? 18.333  -70.857 -13.013 1.00 121.92 ? 18  GLY C C     1 
ATOM   8935  O  O     . GLY E  1 20  ? 17.646  -71.883 -12.951 1.00 113.33 ? 18  GLY C O     1 
ATOM   8936  N  N     . PRO E  1 21  ? 17.783  -69.646 -13.044 1.00 135.77 ? 19  PRO C N     1 
ATOM   8937  C  CA    . PRO E  1 21  ? 16.328  -69.500 -12.935 1.00 149.33 ? 19  PRO C CA    1 
ATOM   8938  C  C     . PRO E  1 21  ? 15.622  -69.911 -14.214 1.00 157.10 ? 19  PRO C C     1 
ATOM   8939  O  O     . PRO E  1 21  ? 16.078  -69.626 -15.324 1.00 163.32 ? 19  PRO C O     1 
ATOM   8940  C  CB    . PRO E  1 21  ? 16.141  -68.005 -12.654 1.00 150.48 ? 19  PRO C CB    1 
ATOM   8941  C  CG    . PRO E  1 21  ? 17.335  -67.363 -13.262 1.00 147.98 ? 19  PRO C CG    1 
ATOM   8942  C  CD    . PRO E  1 21  ? 18.468  -68.343 -13.107 1.00 141.90 ? 19  PRO C CD    1 
ATOM   8943  N  N     . LYS E  1 22  ? 14.488  -70.591 -14.047 1.00 157.18 ? 20  LYS C N     1 
ATOM   8944  C  CA    . LYS E  1 22  ? 13.651  -70.995 -15.167 1.00 151.30 ? 20  LYS C CA    1 
ATOM   8945  C  C     . LYS E  1 22  ? 12.190  -70.693 -14.825 1.00 155.14 ? 20  LYS C C     1 
ATOM   8946  O  O     . LYS E  1 22  ? 11.355  -71.581 -14.689 1.00 155.47 ? 20  LYS C O     1 
ATOM   8947  C  CB    . LYS E  1 22  ? 13.853  -72.470 -15.496 1.00 144.47 ? 20  LYS C CB    1 
ATOM   8948  C  CG    . LYS E  1 22  ? 15.261  -72.829 -15.941 1.00 139.35 ? 20  LYS C CG    1 
ATOM   8949  C  CD    . LYS E  1 22  ? 15.384  -74.322 -16.202 1.00 132.81 ? 20  LYS C CD    1 
ATOM   8950  C  CE    . LYS E  1 22  ? 16.798  -74.696 -16.620 1.00 128.58 ? 20  LYS C CE    1 
ATOM   8951  N  NZ    . LYS E  1 22  ? 16.955  -76.158 -16.866 1.00 126.75 ? 20  LYS C NZ    1 
ATOM   8952  N  N     . VAL E  1 23  ? 11.870  -69.408 -14.688 1.00 158.41 ? 21  VAL C N     1 
ATOM   8953  C  CA    . VAL E  1 23  ? 10.545  -68.959 -14.272 1.00 166.33 ? 21  VAL C CA    1 
ATOM   8954  C  C     . VAL E  1 23  ? 9.852   -68.293 -15.453 1.00 172.91 ? 21  VAL C C     1 
ATOM   8955  O  O     . VAL E  1 23  ? 10.474  -67.531 -16.204 1.00 176.84 ? 21  VAL C O     1 
ATOM   8956  C  CB    . VAL E  1 23  ? 10.635  -67.996 -13.072 1.00 167.70 ? 21  VAL C CB    1 
ATOM   8957  C  CG1   . VAL E  1 23  ? 9.245   -67.651 -12.552 1.00 168.09 ? 21  VAL C CG1   1 
ATOM   8958  C  CG2   . VAL E  1 23  ? 11.490  -68.604 -11.971 1.00 168.75 ? 21  VAL C CG2   1 
ATOM   8959  N  N     . LYS E  1 24  ? 8.564   -68.582 -15.615 1.00 174.54 ? 22  LYS C N     1 
ATOM   8960  C  CA    . LYS E  1 24  ? 7.780   -68.000 -16.693 1.00 175.21 ? 22  LYS C CA    1 
ATOM   8961  C  C     . LYS E  1 24  ? 7.407   -66.558 -16.365 1.00 176.71 ? 22  LYS C C     1 
ATOM   8962  O  O     . LYS E  1 24  ? 7.320   -66.165 -15.198 1.00 176.33 ? 22  LYS C O     1 
ATOM   8963  C  CB    . LYS E  1 24  ? 6.519   -68.831 -16.943 1.00 171.51 ? 22  LYS C CB    1 
ATOM   8964  C  CG    . LYS E  1 24  ? 5.778   -68.497 -18.229 1.00 167.44 ? 22  LYS C CG    1 
ATOM   8965  C  CD    . LYS E  1 24  ? 6.654   -68.725 -19.449 1.00 160.81 ? 22  LYS C CD    1 
ATOM   8966  C  CE    . LYS E  1 24  ? 5.908   -68.392 -20.731 1.00 160.05 ? 22  LYS C CE    1 
ATOM   8967  N  NZ    . LYS E  1 24  ? 6.736   -68.649 -21.940 1.00 159.49 ? 22  LYS C NZ    1 
ATOM   8968  N  N     . GLN E  1 25  ? 7.190   -65.767 -17.414 1.00 179.10 ? 23  GLN C N     1 
ATOM   8969  C  CA    . GLN E  1 25  ? 6.843   -64.363 -17.253 1.00 179.41 ? 23  GLN C CA    1 
ATOM   8970  C  C     . GLN E  1 25  ? 5.477   -64.210 -16.588 1.00 180.89 ? 23  GLN C C     1 
ATOM   8971  O  O     . GLN E  1 25  ? 4.675   -65.146 -16.521 1.00 179.72 ? 23  GLN C O     1 
ATOM   8972  C  CB    . GLN E  1 25  ? 6.844   -63.655 -18.609 1.00 181.29 ? 23  GLN C CB    1 
ATOM   8973  C  CG    . GLN E  1 25  ? 8.163   -63.746 -19.358 1.00 181.39 ? 23  GLN C CG    1 
ATOM   8974  C  CD    . GLN E  1 25  ? 9.240   -62.866 -18.756 1.00 178.73 ? 23  GLN C CD    1 
ATOM   8975  O  OE1   . GLN E  1 25  ? 8.947   -61.887 -18.070 1.00 174.55 ? 23  GLN C OE1   1 
ATOM   8976  N  NE2   . GLN E  1 25  ? 10.498  -63.212 -19.009 1.00 177.66 ? 23  GLN C NE2   1 
ATOM   8977  N  N     . TRP E  1 26  ? 5.218   -63.000 -16.092 1.00 183.84 ? 24  TRP C N     1 
ATOM   8978  C  CA    . TRP E  1 26  ? 3.962   -62.668 -15.438 1.00 189.53 ? 24  TRP C CA    1 
ATOM   8979  C  C     . TRP E  1 26  ? 3.125   -61.768 -16.331 1.00 187.62 ? 24  TRP C C     1 
ATOM   8980  O  O     . TRP E  1 26  ? 3.651   -60.791 -16.882 1.00 188.09 ? 24  TRP C O     1 
ATOM   8981  C  CB    . TRP E  1 26  ? 4.217   -61.973 -14.095 1.00 196.41 ? 24  TRP C CB    1 
ATOM   8982  C  CG    . TRP E  1 26  ? 4.483   -62.917 -12.964 1.00 202.99 ? 24  TRP C CG    1 
ATOM   8983  C  CD1   . TRP E  1 26  ? 5.671   -63.512 -12.654 1.00 203.46 ? 24  TRP C CD1   1 
ATOM   8984  C  CD2   . TRP E  1 26  ? 3.540   -63.368 -11.984 1.00 208.37 ? 24  TRP C CD2   1 
ATOM   8985  N  NE1   . TRP E  1 26  ? 5.525   -64.310 -11.544 1.00 205.35 ? 24  TRP C NE1   1 
ATOM   8986  C  CE2   . TRP E  1 26  ? 4.226   -64.238 -11.114 1.00 208.42 ? 24  TRP C CE2   1 
ATOM   8987  C  CE3   . TRP E  1 26  ? 2.182   -63.122 -11.760 1.00 211.21 ? 24  TRP C CE3   1 
ATOM   8988  C  CZ2   . TRP E  1 26  ? 3.600   -64.863 -10.037 1.00 209.33 ? 24  TRP C CZ2   1 
ATOM   8989  C  CZ3   . TRP E  1 26  ? 1.563   -63.743 -10.690 1.00 211.73 ? 24  TRP C CZ3   1 
ATOM   8990  C  CH2   . TRP E  1 26  ? 2.272   -64.603 -9.842  1.00 210.67 ? 24  TRP C CH2   1 
ATOM   8991  N  N     . PRO E  1 27  ? 1.835   -62.059 -16.503 1.00 185.80 ? 25  PRO C N     1 
ATOM   8992  C  CA    . PRO E  1 27  ? 0.971   -61.182 -17.310 1.00 182.87 ? 25  PRO C CA    1 
ATOM   8993  C  C     . PRO E  1 27  ? 0.786   -59.834 -16.627 1.00 179.69 ? 25  PRO C C     1 
ATOM   8994  O  O     . PRO E  1 27  ? 0.255   -59.754 -15.517 1.00 180.10 ? 25  PRO C O     1 
ATOM   8995  C  CB    . PRO E  1 27  ? -0.349  -61.960 -17.394 1.00 183.94 ? 25  PRO C CB    1 
ATOM   8996  C  CG    . PRO E  1 27  ? 0.009   -63.376 -17.051 1.00 184.24 ? 25  PRO C CG    1 
ATOM   8997  C  CD    . PRO E  1 27  ? 1.132   -63.277 -16.068 1.00 184.47 ? 25  PRO C CD    1 
ATOM   8998  N  N     . LEU E  1 28  ? 1.227   -58.776 -17.296 1.00 176.97 ? 26  LEU C N     1 
ATOM   8999  C  CA    . LEU E  1 28  ? 1.141   -57.415 -16.784 1.00 173.35 ? 26  LEU C CA    1 
ATOM   9000  C  C     . LEU E  1 28  ? 0.289   -56.564 -17.723 1.00 176.39 ? 26  LEU C C     1 
ATOM   9001  O  O     . LEU E  1 28  ? -0.212  -57.034 -18.747 1.00 178.90 ? 26  LEU C O     1 
ATOM   9002  C  CB    . LEU E  1 28  ? 2.537   -56.811 -16.609 1.00 166.35 ? 26  LEU C CB    1 
ATOM   9003  C  CG    . LEU E  1 28  ? 3.471   -57.530 -15.633 1.00 160.13 ? 26  LEU C CG    1 
ATOM   9004  C  CD1   . LEU E  1 28  ? 4.821   -56.832 -15.570 1.00 157.28 ? 26  LEU C CD1   1 
ATOM   9005  C  CD2   . LEU E  1 28  ? 2.843   -57.617 -14.250 1.00 158.25 ? 26  LEU C CD2   1 
ATOM   9006  N  N     . THR E  1 29  ? 0.130   -55.295 -17.358 1.00 176.77 ? 27  THR C N     1 
ATOM   9007  C  CA    . THR E  1 29  ? -0.668  -54.369 -18.143 1.00 181.12 ? 27  THR C CA    1 
ATOM   9008  C  C     . THR E  1 29  ? 0.132   -53.854 -19.338 1.00 182.57 ? 27  THR C C     1 
ATOM   9009  O  O     . THR E  1 29  ? 1.366   -53.886 -19.355 1.00 183.03 ? 27  THR C O     1 
ATOM   9010  C  CB    . THR E  1 29  ? -1.135  -53.197 -17.277 1.00 182.03 ? 27  THR C CB    1 
ATOM   9011  O  OG1   . THR E  1 29  ? -1.378  -53.658 -15.942 1.00 182.24 ? 27  THR C OG1   1 
ATOM   9012  C  CG2   . THR E  1 29  ? -2.420  -52.596 -17.830 1.00 184.05 ? 27  THR C CG2   1 
ATOM   9013  N  N     . GLU E  1 30  ? -0.593  -53.375 -20.353 1.00 225.88 ? 28  GLU C N     1 
ATOM   9014  C  CA    . GLU E  1 30  ? 0.058   -52.831 -21.539 1.00 224.21 ? 28  GLU C CA    1 
ATOM   9015  C  C     . GLU E  1 30  ? 0.782   -51.522 -21.253 1.00 217.00 ? 28  GLU C C     1 
ATOM   9016  O  O     . GLU E  1 30  ? 1.623   -51.107 -22.058 1.00 217.73 ? 28  GLU C O     1 
ATOM   9017  C  CB    . GLU E  1 30  ? -0.962  -52.626 -22.663 1.00 230.08 ? 28  GLU C CB    1 
ATOM   9018  C  CG    . GLU E  1 30  ? -2.031  -51.583 -22.371 1.00 233.96 ? 28  GLU C CG    1 
ATOM   9019  C  CD    . GLU E  1 30  ? -3.177  -52.127 -21.540 1.00 237.28 ? 28  GLU C CD    1 
ATOM   9020  O  OE1   . GLU E  1 30  ? -3.178  -53.342 -21.247 1.00 237.48 ? 28  GLU C OE1   1 
ATOM   9021  O  OE2   . GLU E  1 30  ? -4.079  -51.341 -21.183 1.00 239.31 ? 28  GLU C OE2   1 
ATOM   9022  N  N     . GLU E  1 31  ? 0.473   -50.861 -20.135 1.00 210.21 ? 29  GLU C N     1 
ATOM   9023  C  CA    . GLU E  1 31  ? 1.205   -49.653 -19.768 1.00 201.83 ? 29  GLU C CA    1 
ATOM   9024  C  C     . GLU E  1 31  ? 2.660   -49.969 -19.446 1.00 199.02 ? 29  GLU C C     1 
ATOM   9025  O  O     . GLU E  1 31  ? 3.568   -49.242 -19.866 1.00 192.70 ? 29  GLU C O     1 
ATOM   9026  C  CB    . GLU E  1 31  ? 0.529   -48.967 -18.581 1.00 199.01 ? 29  GLU C CB    1 
ATOM   9027  C  CG    . GLU E  1 31  ? 1.261   -47.732 -18.080 1.00 194.84 ? 29  GLU C CG    1 
ATOM   9028  C  CD    . GLU E  1 31  ? 0.635   -47.148 -16.829 1.00 193.14 ? 29  GLU C CD    1 
ATOM   9029  O  OE1   . GLU E  1 31  ? -0.367  -47.713 -16.344 1.00 194.77 ? 29  GLU C OE1   1 
ATOM   9030  O  OE2   . GLU E  1 31  ? 1.146   -46.124 -16.330 1.00 190.40 ? 29  GLU C OE2   1 
ATOM   9031  N  N     . LYS E  1 32  ? 2.900   -51.052 -18.702 1.00 200.12 ? 30  LYS C N     1 
ATOM   9032  C  CA    . LYS E  1 32  ? 4.265   -51.463 -18.396 1.00 199.01 ? 30  LYS C CA    1 
ATOM   9033  C  C     . LYS E  1 32  ? 4.993   -51.996 -19.622 1.00 193.26 ? 30  LYS C C     1 
ATOM   9034  O  O     . LYS E  1 32  ? 6.228   -51.989 -19.647 1.00 197.57 ? 30  LYS C O     1 
ATOM   9035  C  CB    . LYS E  1 32  ? 4.261   -52.525 -17.296 1.00 198.27 ? 30  LYS C CB    1 
ATOM   9036  C  CG    . LYS E  1 32  ? 3.433   -52.155 -16.077 1.00 199.75 ? 30  LYS C CG    1 
ATOM   9037  C  CD    . LYS E  1 32  ? 3.922   -50.864 -15.446 1.00 199.47 ? 30  LYS C CD    1 
ATOM   9038  C  CE    . LYS E  1 32  ? 3.086   -50.494 -14.231 1.00 199.79 ? 30  LYS C CE    1 
ATOM   9039  N  NZ    . LYS E  1 32  ? 3.126   -51.555 -13.187 1.00 198.53 ? 30  LYS C NZ    1 
ATOM   9040  N  N     . ILE E  1 33  ? 4.256   -52.459 -20.633 1.00 185.02 ? 31  ILE C N     1 
ATOM   9041  C  CA    . ILE E  1 33  ? 4.888   -52.978 -21.841 1.00 171.17 ? 31  ILE C CA    1 
ATOM   9042  C  C     . ILE E  1 33  ? 5.511   -51.847 -22.648 1.00 167.98 ? 31  ILE C C     1 
ATOM   9043  O  O     . ILE E  1 33  ? 6.648   -51.960 -23.124 1.00 160.96 ? 31  ILE C O     1 
ATOM   9044  C  CB    . ILE E  1 33  ? 3.864   -53.775 -22.670 1.00 167.82 ? 31  ILE C CB    1 
ATOM   9045  C  CG1   . ILE E  1 33  ? 3.414   -55.021 -21.905 1.00 164.62 ? 31  ILE C CG1   1 
ATOM   9046  C  CG2   . ILE E  1 33  ? 4.442   -54.147 -24.026 1.00 166.48 ? 31  ILE C CG2   1 
ATOM   9047  C  CD1   . ILE E  1 33  ? 2.397   -55.857 -22.646 1.00 169.39 ? 31  ILE C CD1   1 
ATOM   9048  N  N     . LYS E  1 34  ? 4.788   -50.739 -22.810 1.00 169.05 ? 32  LYS C N     1 
ATOM   9049  C  CA    . LYS E  1 34  ? 5.304   -49.617 -23.583 1.00 168.21 ? 32  LYS C CA    1 
ATOM   9050  C  C     . LYS E  1 34  ? 6.372   -48.827 -22.839 1.00 156.82 ? 32  LYS C C     1 
ATOM   9051  O  O     . LYS E  1 34  ? 6.941   -47.894 -23.415 1.00 154.63 ? 32  LYS C O     1 
ATOM   9052  C  CB    . LYS E  1 34  ? 4.158   -48.687 -23.986 1.00 171.13 ? 32  LYS C CB    1 
ATOM   9053  C  CG    . LYS E  1 34  ? 3.057   -49.372 -24.781 1.00 172.82 ? 32  LYS C CG    1 
ATOM   9054  C  CD    . LYS E  1 34  ? 1.942   -48.402 -25.142 1.00 175.41 ? 32  LYS C CD    1 
ATOM   9055  C  CE    . LYS E  1 34  ? 2.438   -47.304 -26.071 1.00 174.82 ? 32  LYS C CE    1 
ATOM   9056  N  NZ    . LYS E  1 34  ? 2.932   -47.850 -27.366 1.00 175.50 ? 32  LYS C NZ    1 
ATOM   9057  N  N     . ALA E  1 35  ? 6.656   -49.173 -21.585 1.00 153.76 ? 33  ALA C N     1 
ATOM   9058  C  CA    . ALA E  1 35  ? 7.681   -48.494 -20.807 1.00 149.79 ? 33  ALA C CA    1 
ATOM   9059  C  C     . ALA E  1 35  ? 8.951   -49.316 -20.646 1.00 154.26 ? 33  ALA C C     1 
ATOM   9060  O  O     . ALA E  1 35  ? 9.956   -48.786 -20.163 1.00 148.54 ? 33  ALA C O     1 
ATOM   9061  C  CB    . ALA E  1 35  ? 7.135   -48.123 -19.422 1.00 144.65 ? 33  ALA C CB    1 
ATOM   9062  N  N     . LEU E  1 36  ? 8.933   -50.589 -21.041 1.00 163.51 ? 34  LEU C N     1 
ATOM   9063  C  CA    . LEU E  1 36  ? 10.095  -51.458 -20.923 1.00 171.00 ? 34  LEU C CA    1 
ATOM   9064  C  C     . LEU E  1 36  ? 10.784  -51.747 -22.247 1.00 177.46 ? 34  LEU C C     1 
ATOM   9065  O  O     . LEU E  1 36  ? 12.002  -51.936 -22.262 1.00 175.87 ? 34  LEU C O     1 
ATOM   9066  C  CB    . LEU E  1 36  ? 9.702   -52.789 -20.268 1.00 170.90 ? 34  LEU C CB    1 
ATOM   9067  C  CG    . LEU E  1 36  ? 9.363   -52.724 -18.777 1.00 166.62 ? 34  LEU C CG    1 
ATOM   9068  C  CD1   . LEU E  1 36  ? 8.927   -54.088 -18.267 1.00 163.97 ? 34  LEU C CD1   1 
ATOM   9069  C  CD2   . LEU E  1 36  ? 10.552  -52.205 -17.981 1.00 162.71 ? 34  LEU C CD2   1 
ATOM   9070  N  N     . VAL E  1 37  ? 10.039  -51.788 -23.355 1.00 182.48 ? 35  VAL C N     1 
ATOM   9071  C  CA    . VAL E  1 37  ? 10.664  -51.992 -24.660 1.00 181.83 ? 35  VAL C CA    1 
ATOM   9072  C  C     . VAL E  1 37  ? 11.568  -50.818 -25.007 1.00 180.22 ? 35  VAL C C     1 
ATOM   9073  O  O     . VAL E  1 37  ? 12.596  -50.989 -25.675 1.00 179.38 ? 35  VAL C O     1 
ATOM   9074  C  CB    . VAL E  1 37  ? 9.585   -52.218 -25.739 1.00 181.81 ? 35  VAL C CB    1 
ATOM   9075  C  CG1   . VAL E  1 37  ? 10.227  -52.529 -27.084 1.00 179.32 ? 35  VAL C CG1   1 
ATOM   9076  C  CG2   . VAL E  1 37  ? 8.646   -53.338 -25.322 1.00 183.11 ? 35  VAL C CG2   1 
ATOM   9077  N  N     . GLU E  1 38  ? 11.212  -49.614 -24.554 1.00 178.70 ? 36  GLU C N     1 
ATOM   9078  C  CA    . GLU E  1 38  ? 12.061  -48.453 -24.798 1.00 173.85 ? 36  GLU C CA    1 
ATOM   9079  C  C     . GLU E  1 38  ? 13.346  -48.527 -23.984 1.00 171.54 ? 36  GLU C C     1 
ATOM   9080  O  O     . GLU E  1 38  ? 14.413  -48.122 -24.459 1.00 166.71 ? 36  GLU C O     1 
ATOM   9081  C  CB    . GLU E  1 38  ? 11.296  -47.168 -24.479 1.00 171.62 ? 36  GLU C CB    1 
ATOM   9082  C  CG    . GLU E  1 38  ? 10.019  -46.988 -25.285 1.00 179.73 ? 36  GLU C CG    1 
ATOM   9083  C  CD    . GLU E  1 38  ? 10.281  -46.807 -26.768 1.00 183.25 ? 36  GLU C CD    1 
ATOM   9084  O  OE1   . GLU E  1 38  ? 11.385  -46.345 -27.129 1.00 181.59 ? 36  GLU C OE1   1 
ATOM   9085  O  OE2   . GLU E  1 38  ? 9.384   -47.129 -27.574 1.00 186.29 ? 36  GLU C OE2   1 
ATOM   9086  N  N     . ILE E  1 39  ? 13.265  -49.043 -22.756 1.00 175.72 ? 37  ILE C N     1 
ATOM   9087  C  CA    . ILE E  1 39  ? 14.451  -49.132 -21.910 1.00 178.22 ? 37  ILE C CA    1 
ATOM   9088  C  C     . ILE E  1 39  ? 15.406  -50.197 -22.434 1.00 193.19 ? 37  ILE C C     1 
ATOM   9089  O  O     . ILE E  1 39  ? 16.624  -49.987 -22.486 1.00 188.58 ? 37  ILE C O     1 
ATOM   9090  C  CB    . ILE E  1 39  ? 14.046  -49.401 -20.449 1.00 171.14 ? 37  ILE C CB    1 
ATOM   9091  C  CG1   . ILE E  1 39  ? 13.175  -48.261 -19.919 1.00 166.70 ? 37  ILE C CG1   1 
ATOM   9092  C  CG2   . ILE E  1 39  ? 15.278  -49.583 -19.576 1.00 167.00 ? 37  ILE C CG2   1 
ATOM   9093  C  CD1   . ILE E  1 39  ? 12.755  -48.435 -18.475 1.00 163.01 ? 37  ILE C CD1   1 
ATOM   9094  N  N     . CYS E  1 40  ? 14.872  -51.355 -22.833 1.00 206.73 ? 38  CYS C N     1 
ATOM   9095  C  CA    . CYS E  1 40  ? 15.725  -52.426 -23.339 1.00 210.98 ? 38  CYS C CA    1 
ATOM   9096  C  C     . CYS E  1 40  ? 16.400  -52.041 -24.649 1.00 203.58 ? 38  CYS C C     1 
ATOM   9097  O  O     . CYS E  1 40  ? 17.506  -52.512 -24.934 1.00 206.87 ? 38  CYS C O     1 
ATOM   9098  C  CB    . CYS E  1 40  ? 14.910  -53.707 -23.516 1.00 221.63 ? 38  CYS C CB    1 
ATOM   9099  S  SG    . CYS E  1 40  ? 14.205  -54.357 -21.985 1.00 225.10 ? 38  CYS C SG    1 
ATOM   9100  N  N     . THR E  1 41  ? 15.758  -51.192 -25.454 1.00 192.65 ? 39  THR C N     1 
ATOM   9101  C  CA    . THR E  1 41  ? 16.373  -50.756 -26.703 1.00 180.18 ? 39  THR C CA    1 
ATOM   9102  C  C     . THR E  1 41  ? 17.481  -49.743 -26.447 1.00 184.06 ? 39  THR C C     1 
ATOM   9103  O  O     . THR E  1 41  ? 18.536  -49.792 -27.091 1.00 180.05 ? 39  THR C O     1 
ATOM   9104  C  CB    . THR E  1 41  ? 15.312  -50.169 -27.636 1.00 167.57 ? 39  THR C CB    1 
ATOM   9105  O  OG1   . THR E  1 41  ? 14.264  -51.126 -27.833 1.00 165.18 ? 39  THR C OG1   1 
ATOM   9106  C  CG2   . THR E  1 41  ? 15.923  -49.814 -28.984 1.00 160.63 ? 39  THR C CG2   1 
ATOM   9107  N  N     . GLU E  1 42  ? 17.263  -48.820 -25.507 1.00 186.35 ? 40  GLU C N     1 
ATOM   9108  C  CA    . GLU E  1 42  ? 18.289  -47.834 -25.183 1.00 190.73 ? 40  GLU C CA    1 
ATOM   9109  C  C     . GLU E  1 42  ? 19.506  -48.498 -24.551 1.00 185.49 ? 40  GLU C C     1 
ATOM   9110  O  O     . GLU E  1 42  ? 20.645  -48.252 -24.967 1.00 188.74 ? 40  GLU C O     1 
ATOM   9111  C  CB    . GLU E  1 42  ? 17.715  -46.762 -24.254 1.00 192.43 ? 40  GLU C CB    1 
ATOM   9112  C  CG    . GLU E  1 42  ? 16.649  -45.885 -24.892 1.00 199.44 ? 40  GLU C CG    1 
ATOM   9113  C  CD    . GLU E  1 42  ? 17.197  -44.994 -25.991 1.00 202.79 ? 40  GLU C CD    1 
ATOM   9114  O  OE1   . GLU E  1 42  ? 18.415  -44.713 -25.983 1.00 201.09 ? 40  GLU C OE1   1 
ATOM   9115  O  OE2   . GLU E  1 42  ? 16.409  -44.573 -26.863 1.00 206.27 ? 40  GLU C OE2   1 
ATOM   9116  N  N     . MET E  1 43  ? 19.285  -49.347 -23.545 1.00 177.90 ? 41  MET C N     1 
ATOM   9117  C  CA    . MET E  1 43  ? 20.393  -50.048 -22.906 1.00 171.46 ? 41  MET C CA    1 
ATOM   9118  C  C     . MET E  1 43  ? 21.099  -51.000 -23.861 1.00 168.15 ? 41  MET C C     1 
ATOM   9119  O  O     . MET E  1 43  ? 22.270  -51.328 -23.639 1.00 168.61 ? 41  MET C O     1 
ATOM   9120  C  CB    . MET E  1 43  ? 19.894  -50.809 -21.677 1.00 172.75 ? 41  MET C CB    1 
ATOM   9121  C  CG    . MET E  1 43  ? 19.300  -49.920 -20.596 1.00 172.12 ? 41  MET C CG    1 
ATOM   9122  S  SD    . MET E  1 43  ? 18.698  -50.850 -19.173 1.00 168.85 ? 41  MET C SD    1 
ATOM   9123  C  CE    . MET E  1 43  ? 20.215  -51.599 -18.588 1.00 166.87 ? 41  MET C CE    1 
ATOM   9124  N  N     . GLU E  1 44  ? 20.417  -51.451 -24.916 1.00 162.89 ? 42  GLU C N     1 
ATOM   9125  C  CA    . GLU E  1 44  ? 21.071  -52.292 -25.913 1.00 154.59 ? 42  GLU C CA    1 
ATOM   9126  C  C     . GLU E  1 44  ? 22.091  -51.497 -26.718 1.00 149.93 ? 42  GLU C C     1 
ATOM   9127  O  O     . GLU E  1 44  ? 23.194  -51.986 -26.989 1.00 149.34 ? 42  GLU C O     1 
ATOM   9128  C  CB    . GLU E  1 44  ? 20.027  -52.920 -26.835 1.00 158.43 ? 42  GLU C CB    1 
ATOM   9129  C  CG    . GLU E  1 44  ? 20.608  -53.720 -27.988 1.00 162.93 ? 42  GLU C CG    1 
ATOM   9130  C  CD    . GLU E  1 44  ? 19.538  -54.399 -28.819 1.00 175.36 ? 42  GLU C CD    1 
ATOM   9131  O  OE1   . GLU E  1 44  ? 19.728  -55.577 -29.188 1.00 181.03 ? 42  GLU C OE1   1 
ATOM   9132  O  OE2   . GLU E  1 44  ? 18.504  -53.756 -29.097 1.00 180.01 ? 42  GLU C OE2   1 
ATOM   9133  N  N     . LYS E  1 45  ? 21.743  -50.267 -27.105 1.00 149.25 ? 43  LYS C N     1 
ATOM   9134  C  CA    . LYS E  1 45  ? 22.683  -49.433 -27.845 1.00 149.17 ? 43  LYS C CA    1 
ATOM   9135  C  C     . LYS E  1 45  ? 23.782  -48.891 -26.940 1.00 139.89 ? 43  LYS C C     1 
ATOM   9136  O  O     . LYS E  1 45  ? 24.901  -48.645 -27.405 1.00 134.79 ? 43  LYS C O     1 
ATOM   9137  C  CB    . LYS E  1 45  ? 21.936  -48.287 -28.529 1.00 153.62 ? 43  LYS C CB    1 
ATOM   9138  C  CG    . LYS E  1 45  ? 22.779  -47.474 -29.501 1.00 151.13 ? 43  LYS C CG    1 
ATOM   9139  C  CD    . LYS E  1 45  ? 21.966  -46.385 -30.195 1.00 150.78 ? 43  LYS C CD    1 
ATOM   9140  C  CE    . LYS E  1 45  ? 21.789  -45.149 -29.319 1.00 153.67 ? 43  LYS C CE    1 
ATOM   9141  N  NZ    . LYS E  1 45  ? 20.796  -45.332 -28.222 1.00 156.26 ? 43  LYS C NZ    1 
ATOM   9142  N  N     . GLU E  1 46  ? 23.489  -48.706 -25.654 1.00 146.29 ? 44  GLU C N     1 
ATOM   9143  C  CA    . GLU E  1 46  ? 24.467  -48.198 -24.700 1.00 147.47 ? 44  GLU C CA    1 
ATOM   9144  C  C     . GLU E  1 46  ? 25.406  -49.277 -24.175 1.00 144.09 ? 44  GLU C C     1 
ATOM   9145  O  O     . GLU E  1 46  ? 26.244  -48.979 -23.317 1.00 138.37 ? 44  GLU C O     1 
ATOM   9146  C  CB    . GLU E  1 46  ? 23.751  -47.526 -23.525 1.00 148.71 ? 44  GLU C CB    1 
ATOM   9147  C  CG    . GLU E  1 46  ? 22.944  -46.297 -23.911 1.00 154.47 ? 44  GLU C CG    1 
ATOM   9148  C  CD    . GLU E  1 46  ? 22.075  -45.789 -22.778 1.00 158.59 ? 44  GLU C CD    1 
ATOM   9149  O  OE1   . GLU E  1 46  ? 22.053  -46.433 -21.707 1.00 161.55 ? 44  GLU C OE1   1 
ATOM   9150  O  OE2   . GLU E  1 46  ? 21.411  -44.747 -22.958 1.00 161.18 ? 44  GLU C OE2   1 
ATOM   9151  N  N     . GLY E  1 47  ? 25.291  -50.511 -24.661 1.00 147.33 ? 45  GLY C N     1 
ATOM   9152  C  CA    . GLY E  1 47  ? 26.141  -51.593 -24.215 1.00 141.41 ? 45  GLY C CA    1 
ATOM   9153  C  C     . GLY E  1 47  ? 25.773  -52.196 -22.878 1.00 135.68 ? 45  GLY C C     1 
ATOM   9154  O  O     . GLY E  1 47  ? 26.468  -53.113 -22.420 1.00 130.00 ? 45  GLY C O     1 
ATOM   9155  N  N     . LYS E  1 48  ? 24.707  -51.718 -22.237 1.00 137.03 ? 46  LYS C N     1 
ATOM   9156  C  CA    . LYS E  1 48  ? 24.293  -52.238 -20.940 1.00 131.40 ? 46  LYS C CA    1 
ATOM   9157  C  C     . LYS E  1 48  ? 23.435  -53.491 -21.049 1.00 139.94 ? 46  LYS C C     1 
ATOM   9158  O  O     . LYS E  1 48  ? 23.210  -54.156 -20.031 1.00 136.82 ? 46  LYS C O     1 
ATOM   9159  C  CB    . LYS E  1 48  ? 23.528  -51.160 -20.168 1.00 127.00 ? 46  LYS C CB    1 
ATOM   9160  C  CG    . LYS E  1 48  ? 24.274  -49.843 -20.040 1.00 125.94 ? 46  LYS C CG    1 
ATOM   9161  C  CD    . LYS E  1 48  ? 23.398  -48.769 -19.418 1.00 124.25 ? 46  LYS C CD    1 
ATOM   9162  C  CE    . LYS E  1 48  ? 24.124  -47.435 -19.357 1.00 125.02 ? 46  LYS C CE    1 
ATOM   9163  N  NZ    . LYS E  1 48  ? 23.260  -46.359 -18.796 1.00 129.99 ? 46  LYS C NZ    1 
ATOM   9164  N  N     . ILE E  1 49  ? 22.956  -53.827 -22.244 1.00 149.86 ? 47  ILE C N     1 
ATOM   9165  C  CA    . ILE E  1 49  ? 22.089  -54.981 -22.454 1.00 160.70 ? 47  ILE C CA    1 
ATOM   9166  C  C     . ILE E  1 49  ? 22.452  -55.621 -23.787 1.00 163.85 ? 47  ILE C C     1 
ATOM   9167  O  O     . ILE E  1 49  ? 22.532  -54.934 -24.810 1.00 170.67 ? 47  ILE C O     1 
ATOM   9168  C  CB    . ILE E  1 49  ? 20.598  -54.589 -22.426 1.00 166.80 ? 47  ILE C CB    1 
ATOM   9169  C  CG1   . ILE E  1 49  ? 20.105  -54.449 -20.984 1.00 166.81 ? 47  ILE C CG1   1 
ATOM   9170  C  CG2   . ILE E  1 49  ? 19.759  -55.600 -23.185 1.00 170.53 ? 47  ILE C CG2   1 
ATOM   9171  C  CD1   . ILE E  1 49  ? 18.620  -54.177 -20.868 1.00 170.14 ? 47  ILE C CD1   1 
ATOM   9172  N  N     . SER E  1 50  ? 22.678  -56.932 -23.774 1.00 158.75 ? 48  SER C N     1 
ATOM   9173  C  CA    . SER E  1 50  ? 22.979  -57.691 -24.977 1.00 154.56 ? 48  SER C CA    1 
ATOM   9174  C  C     . SER E  1 50  ? 21.866  -58.695 -25.245 1.00 153.57 ? 48  SER C C     1 
ATOM   9175  O  O     . SER E  1 50  ? 21.264  -59.243 -24.316 1.00 151.54 ? 48  SER C O     1 
ATOM   9176  C  CB    . SER E  1 50  ? 24.323  -58.422 -24.856 1.00 148.29 ? 48  SER C CB    1 
ATOM   9177  O  OG    . SER E  1 50  ? 25.390  -57.504 -24.697 1.00 141.50 ? 48  SER C OG    1 
ATOM   9178  N  N     . LYS E  1 51  ? 21.597  -58.932 -26.525 1.00 150.33 ? 49  LYS C N     1 
ATOM   9179  C  CA    . LYS E  1 51  ? 20.556  -59.868 -26.915 1.00 147.21 ? 49  LYS C CA    1 
ATOM   9180  C  C     . LYS E  1 51  ? 21.094  -61.294 -26.940 1.00 146.88 ? 49  LYS C C     1 
ATOM   9181  O  O     . LYS E  1 51  ? 22.284  -61.530 -27.171 1.00 144.63 ? 49  LYS C O     1 
ATOM   9182  C  CB    . LYS E  1 51  ? 19.983  -59.499 -28.284 1.00 152.70 ? 49  LYS C CB    1 
ATOM   9183  C  CG    . LYS E  1 51  ? 21.016  -59.424 -29.397 1.00 153.67 ? 49  LYS C CG    1 
ATOM   9184  C  CD    . LYS E  1 51  ? 20.371  -59.041 -30.719 1.00 153.64 ? 49  LYS C CD    1 
ATOM   9185  C  CE    . LYS E  1 51  ? 21.402  -58.935 -31.831 1.00 153.53 ? 49  LYS C CE    1 
ATOM   9186  N  NZ    . LYS E  1 51  ? 20.781  -58.561 -33.132 1.00 159.96 ? 49  LYS C NZ    1 
ATOM   9187  N  N     . ILE E  1 52  ? 20.199  -62.249 -26.694 1.00 151.76 ? 50  ILE C N     1 
ATOM   9188  C  CA    . ILE E  1 52  ? 20.538  -63.664 -26.660 1.00 156.83 ? 50  ILE C CA    1 
ATOM   9189  C  C     . ILE E  1 52  ? 19.583  -64.419 -27.576 1.00 163.79 ? 50  ILE C C     1 
ATOM   9190  O  O     . ILE E  1 52  ? 18.574  -63.887 -28.039 1.00 166.51 ? 50  ILE C O     1 
ATOM   9191  C  CB    . ILE E  1 52  ? 20.492  -64.243 -25.230 1.00 154.02 ? 50  ILE C CB    1 
ATOM   9192  C  CG1   . ILE E  1 52  ? 19.140  -63.946 -24.578 1.00 151.69 ? 50  ILE C CG1   1 
ATOM   9193  C  CG2   . ILE E  1 52  ? 21.633  -63.687 -24.392 1.00 152.58 ? 50  ILE C CG2   1 
ATOM   9194  C  CD1   . ILE E  1 52  ? 19.034  -64.422 -23.145 1.00 149.14 ? 50  ILE C CD1   1 
ATOM   9195  N  N     . GLY E  1 53  ? 19.920  -65.680 -27.832 1.00 164.17 ? 51  GLY C N     1 
ATOM   9196  C  CA    . GLY E  1 53  ? 19.120  -66.525 -28.685 1.00 168.76 ? 51  GLY C CA    1 
ATOM   9197  C  C     . GLY E  1 53  ? 18.627  -67.765 -27.969 1.00 164.36 ? 51  GLY C C     1 
ATOM   9198  O  O     . GLY E  1 53  ? 18.356  -67.750 -26.764 1.00 166.34 ? 51  GLY C O     1 
ATOM   9199  N  N     . PRO E  1 54  ? 18.499  -68.873 -28.704 1.00 160.65 ? 52  PRO C N     1 
ATOM   9200  C  CA    . PRO E  1 54  ? 18.024  -70.122 -28.097 1.00 154.55 ? 52  PRO C CA    1 
ATOM   9201  C  C     . PRO E  1 54  ? 19.065  -70.851 -27.262 1.00 154.90 ? 52  PRO C C     1 
ATOM   9202  O  O     . PRO E  1 54  ? 18.740  -71.887 -26.672 1.00 149.37 ? 52  PRO C O     1 
ATOM   9203  C  CB    . PRO E  1 54  ? 17.624  -70.959 -29.321 1.00 154.51 ? 52  PRO C CB    1 
ATOM   9204  C  CG    . PRO E  1 54  ? 18.532  -70.481 -30.399 1.00 152.61 ? 52  PRO C CG    1 
ATOM   9205  C  CD    . PRO E  1 54  ? 18.724  -69.007 -30.154 1.00 153.76 ? 52  PRO C CD    1 
ATOM   9206  N  N     . GLU E  1 55  ? 20.296  -70.348 -27.191 1.00 160.96 ? 53  GLU C N     1 
ATOM   9207  C  CA    . GLU E  1 55  ? 21.360  -70.996 -26.435 1.00 169.68 ? 53  GLU C CA    1 
ATOM   9208  C  C     . GLU E  1 55  ? 21.344  -70.635 -24.953 1.00 170.63 ? 53  GLU C C     1 
ATOM   9209  O  O     . GLU E  1 55  ? 22.263  -71.027 -24.226 1.00 164.76 ? 53  GLU C O     1 
ATOM   9210  C  CB    . GLU E  1 55  ? 22.726  -70.644 -27.035 1.00 170.94 ? 53  GLU C CB    1 
ATOM   9211  C  CG    . GLU E  1 55  ? 23.154  -69.194 -26.837 1.00 170.75 ? 53  GLU C CG    1 
ATOM   9212  C  CD    . GLU E  1 55  ? 22.442  -68.231 -27.770 1.00 173.03 ? 53  GLU C CD    1 
ATOM   9213  O  OE1   . GLU E  1 55  ? 21.782  -68.698 -28.722 1.00 177.04 ? 53  GLU C OE1   1 
ATOM   9214  O  OE2   . GLU E  1 55  ? 22.544  -67.006 -27.551 1.00 171.01 ? 53  GLU C OE2   1 
ATOM   9215  N  N     . ASN E  1 56  ? 20.327  -69.906 -24.491 1.00 177.26 ? 54  ASN C N     1 
ATOM   9216  C  CA    . ASN E  1 56  ? 20.214  -69.471 -23.100 1.00 180.83 ? 54  ASN C CA    1 
ATOM   9217  C  C     . ASN E  1 56  ? 18.941  -70.073 -22.517 1.00 176.27 ? 54  ASN C C     1 
ATOM   9218  O  O     . ASN E  1 56  ? 17.857  -69.478 -22.621 1.00 183.66 ? 54  ASN C O     1 
ATOM   9219  C  CB    . ASN E  1 56  ? 20.207  -67.946 -23.006 1.00 185.66 ? 54  ASN C CB    1 
ATOM   9220  C  CG    . ASN E  1 56  ? 20.380  -67.441 -21.585 1.00 185.44 ? 54  ASN C CG    1 
ATOM   9221  O  OD1   . ASN E  1 56  ? 19.738  -67.927 -20.655 1.00 186.04 ? 54  ASN C OD1   1 
ATOM   9222  N  ND2   . ASN E  1 56  ? 21.253  -66.455 -21.413 1.00 184.58 ? 54  ASN C ND2   1 
ATOM   9223  N  N     . PRO E  1 57  ? 19.024  -71.259 -21.890 1.00 165.14 ? 55  PRO C N     1 
ATOM   9224  C  CA    . PRO E  1 57  ? 17.838  -71.943 -21.356 1.00 159.10 ? 55  PRO C CA    1 
ATOM   9225  C  C     . PRO E  1 57  ? 17.393  -71.433 -19.986 1.00 160.38 ? 55  PRO C C     1 
ATOM   9226  O  O     . PRO E  1 57  ? 17.218  -72.205 -19.042 1.00 158.72 ? 55  PRO C O     1 
ATOM   9227  C  CB    . PRO E  1 57  ? 18.298  -73.403 -21.291 1.00 155.25 ? 55  PRO C CB    1 
ATOM   9228  C  CG    . PRO E  1 57  ? 19.757  -73.300 -21.001 1.00 150.14 ? 55  PRO C CG    1 
ATOM   9229  C  CD    . PRO E  1 57  ? 20.246  -72.065 -21.723 1.00 154.41 ? 55  PRO C CD    1 
ATOM   9230  N  N     . TYR E  1 58  ? 17.204  -70.119 -19.879 1.00 161.14 ? 56  TYR C N     1 
ATOM   9231  C  CA    . TYR E  1 58  ? 16.783  -69.501 -18.630 1.00 158.71 ? 56  TYR C CA    1 
ATOM   9232  C  C     . TYR E  1 58  ? 15.755  -68.417 -18.924 1.00 165.84 ? 56  TYR C C     1 
ATOM   9233  O  O     . TYR E  1 58  ? 15.619  -67.953 -20.059 1.00 169.66 ? 56  TYR C O     1 
ATOM   9234  C  CB    . TYR E  1 58  ? 17.973  -68.910 -17.860 1.00 145.03 ? 56  TYR C CB    1 
ATOM   9235  C  CG    . TYR E  1 58  ? 19.089  -69.896 -17.597 1.00 134.83 ? 56  TYR C CG    1 
ATOM   9236  C  CD1   . TYR E  1 58  ? 18.931  -70.927 -16.680 1.00 131.58 ? 56  TYR C CD1   1 
ATOM   9237  C  CD2   . TYR E  1 58  ? 20.305  -69.792 -18.261 1.00 129.44 ? 56  TYR C CD2   1 
ATOM   9238  C  CE1   . TYR E  1 58  ? 19.950  -71.830 -16.437 1.00 128.41 ? 56  TYR C CE1   1 
ATOM   9239  C  CE2   . TYR E  1 58  ? 21.329  -70.689 -18.023 1.00 123.75 ? 56  TYR C CE2   1 
ATOM   9240  C  CZ    . TYR E  1 58  ? 21.147  -71.705 -17.111 1.00 123.98 ? 56  TYR C CZ    1 
ATOM   9241  O  OH    . TYR E  1 58  ? 22.163  -72.600 -16.870 1.00 120.70 ? 56  TYR C OH    1 
ATOM   9242  N  N     . ASN E  1 59  ? 15.031  -68.019 -17.880 1.00 167.75 ? 57  ASN C N     1 
ATOM   9243  C  CA    . ASN E  1 59  ? 14.024  -66.972 -17.992 1.00 173.40 ? 57  ASN C CA    1 
ATOM   9244  C  C     . ASN E  1 59  ? 13.668  -66.484 -16.595 1.00 172.68 ? 57  ASN C C     1 
ATOM   9245  O  O     . ASN E  1 59  ? 13.747  -67.238 -15.622 1.00 168.87 ? 57  ASN C O     1 
ATOM   9246  C  CB    . ASN E  1 59  ? 12.770  -67.469 -18.723 1.00 180.86 ? 57  ASN C CB    1 
ATOM   9247  C  CG    . ASN E  1 59  ? 11.796  -66.350 -19.035 1.00 184.40 ? 57  ASN C CG    1 
ATOM   9248  O  OD1   . ASN E  1 59  ? 11.921  -65.668 -20.052 1.00 186.86 ? 57  ASN C OD1   1 
ATOM   9249  N  ND2   . ASN E  1 59  ? 10.817  -66.156 -18.159 1.00 183.62 ? 57  ASN C ND2   1 
ATOM   9250  N  N     . THR E  1 60  ? 13.274  -65.211 -16.510 1.00 172.13 ? 58  THR C N     1 
ATOM   9251  C  CA    . THR E  1 60  ? 12.931  -64.583 -15.241 1.00 166.06 ? 58  THR C CA    1 
ATOM   9252  C  C     . THR E  1 60  ? 11.958  -63.439 -15.497 1.00 162.37 ? 58  THR C C     1 
ATOM   9253  O  O     . THR E  1 60  ? 12.224  -62.604 -16.376 1.00 167.94 ? 58  THR C O     1 
ATOM   9254  C  CB    . THR E  1 60  ? 14.172  -64.060 -14.516 1.00 163.05 ? 58  THR C CB    1 
ATOM   9255  O  OG1   . THR E  1 60  ? 15.012  -65.160 -14.143 1.00 161.69 ? 58  THR C OG1   1 
ATOM   9256  C  CG2   . THR E  1 60  ? 13.779  -63.283 -13.269 1.00 160.94 ? 58  THR C CG2   1 
ATOM   9257  N  N     . PRO E  1 61  ? 10.846  -63.369 -14.768 1.00 156.51 ? 59  PRO C N     1 
ATOM   9258  C  CA    . PRO E  1 61  ? 9.890   -62.280 -14.992 1.00 153.59 ? 59  PRO C CA    1 
ATOM   9259  C  C     . PRO E  1 61  ? 10.411  -60.949 -14.471 1.00 151.94 ? 59  PRO C C     1 
ATOM   9260  O  O     . PRO E  1 61  ? 11.207  -60.887 -13.531 1.00 146.42 ? 59  PRO C O     1 
ATOM   9261  C  CB    . PRO E  1 61  ? 8.651   -62.733 -14.213 1.00 149.89 ? 59  PRO C CB    1 
ATOM   9262  C  CG    . PRO E  1 61  ? 9.194   -63.613 -13.139 1.00 146.75 ? 59  PRO C CG    1 
ATOM   9263  C  CD    . PRO E  1 61  ? 10.371  -64.323 -13.751 1.00 148.43 ? 59  PRO C CD    1 
ATOM   9264  N  N     . VAL E  1 62  ? 9.946   -59.871 -15.106 1.00 157.41 ? 60  VAL C N     1 
ATOM   9265  C  CA    . VAL E  1 62  ? 10.309  -58.512 -14.731 1.00 161.14 ? 60  VAL C CA    1 
ATOM   9266  C  C     . VAL E  1 62  ? 9.045   -57.663 -14.690 1.00 164.92 ? 60  VAL C C     1 
ATOM   9267  O  O     . VAL E  1 62  ? 8.023   -57.995 -15.292 1.00 173.48 ? 60  VAL C O     1 
ATOM   9268  C  CB    . VAL E  1 62  ? 11.339  -57.885 -15.699 1.00 161.85 ? 60  VAL C CB    1 
ATOM   9269  C  CG1   . VAL E  1 62  ? 12.603  -58.731 -15.767 1.00 159.94 ? 60  VAL C CG1   1 
ATOM   9270  C  CG2   . VAL E  1 62  ? 10.730  -57.708 -17.083 1.00 165.73 ? 60  VAL C CG2   1 
ATOM   9271  N  N     . PHE E  1 63  ? 9.128   -56.550 -13.961 1.00 161.57 ? 61  PHE C N     1 
ATOM   9272  C  CA    . PHE E  1 63  ? 8.049   -55.575 -13.917 1.00 162.88 ? 61  PHE C CA    1 
ATOM   9273  C  C     . PHE E  1 63  ? 8.648   -54.179 -13.816 1.00 163.14 ? 61  PHE C C     1 
ATOM   9274  O  O     . PHE E  1 63  ? 9.835   -54.005 -13.527 1.00 161.69 ? 61  PHE C O     1 
ATOM   9275  C  CB    . PHE E  1 63  ? 7.078   -55.845 -12.755 1.00 162.49 ? 61  PHE C CB    1 
ATOM   9276  C  CG    . PHE E  1 63  ? 7.662   -55.595 -11.390 1.00 158.63 ? 61  PHE C CG    1 
ATOM   9277  C  CD1   . PHE E  1 63  ? 8.333   -56.599 -10.712 1.00 152.62 ? 61  PHE C CD1   1 
ATOM   9278  C  CD2   . PHE E  1 63  ? 7.518   -54.360 -10.775 1.00 157.12 ? 61  PHE C CD2   1 
ATOM   9279  C  CE1   . PHE E  1 63  ? 8.862   -56.373 -9.454  1.00 145.43 ? 61  PHE C CE1   1 
ATOM   9280  C  CE2   . PHE E  1 63  ? 8.046   -54.128 -9.519  1.00 149.43 ? 61  PHE C CE2   1 
ATOM   9281  C  CZ    . PHE E  1 63  ? 8.718   -55.136 -8.858  1.00 144.36 ? 61  PHE C CZ    1 
ATOM   9282  N  N     . ALA E  1 64  ? 7.809   -53.176 -14.063 1.00 166.34 ? 62  ALA C N     1 
ATOM   9283  C  CA    . ALA E  1 64  ? 8.217   -51.780 -14.037 1.00 167.15 ? 62  ALA C CA    1 
ATOM   9284  C  C     . ALA E  1 64  ? 7.347   -51.006 -13.058 1.00 170.59 ? 62  ALA C C     1 
ATOM   9285  O  O     . ALA E  1 64  ? 6.133   -51.223 -12.984 1.00 172.47 ? 62  ALA C O     1 
ATOM   9286  C  CB    . ALA E  1 64  ? 8.123   -51.148 -15.429 1.00 170.30 ? 62  ALA C CB    1 
ATOM   9287  N  N     . CYS E  1 65  ? 7.973   -50.100 -12.311 1.00 170.45 ? 63  CYS C N     1 
ATOM   9288  C  CA    . CYS E  1 65  ? 7.282   -49.277 -11.331 1.00 171.68 ? 63  CYS C CA    1 
ATOM   9289  C  C     . CYS E  1 65  ? 7.679   -47.821 -11.521 1.00 168.83 ? 63  CYS C C     1 
ATOM   9290  O  O     . CYS E  1 65  ? 8.856   -47.511 -11.729 1.00 167.18 ? 63  CYS C O     1 
ATOM   9291  C  CB    . CYS E  1 65  ? 7.600   -49.728 -9.899  1.00 168.77 ? 63  CYS C CB    1 
ATOM   9292  S  SG    . CYS E  1 65  ? 6.651   -48.876 -8.616  1.00 169.77 ? 63  CYS C SG    1 
ATOM   9293  N  N     . LYS E  1 66  ? 6.688   -46.935 -11.455 1.00 169.47 ? 64  LYS C N     1 
ATOM   9294  C  CA    . LYS E  1 66  ? 6.939   -45.506 -11.592 1.00 165.34 ? 64  LYS C CA    1 
ATOM   9295  C  C     . LYS E  1 66  ? 7.823   -45.006 -10.457 1.00 169.92 ? 64  LYS C C     1 
ATOM   9296  O  O     . LYS E  1 66  ? 7.589   -45.322 -9.287  1.00 169.26 ? 64  LYS C O     1 
ATOM   9297  C  CB    . LYS E  1 66  ? 5.614   -44.741 -11.598 1.00 158.19 ? 64  LYS C CB    1 
ATOM   9298  C  CG    . LYS E  1 66  ? 5.116   -44.322 -12.972 1.00 154.77 ? 64  LYS C CG    1 
ATOM   9299  C  CD    . LYS E  1 66  ? 5.860   -43.097 -13.480 1.00 150.00 ? 64  LYS C CD    1 
ATOM   9300  C  CE    . LYS E  1 66  ? 5.068   -42.381 -14.564 1.00 145.59 ? 64  LYS C CE    1 
ATOM   9301  N  NZ    . LYS E  1 66  ? 3.764   -41.872 -14.054 1.00 142.24 ? 64  LYS C NZ    1 
ATOM   9302  N  N     . LYS E  1 67  ? 8.846   -44.228 -10.807 1.00 154.83 ? 65  LYS C N     1 
ATOM   9303  C  CA    . LYS E  1 67  ? 9.652   -43.573 -9.787  1.00 155.36 ? 65  LYS C CA    1 
ATOM   9304  C  C     . LYS E  1 67  ? 8.790   -42.601 -8.993  1.00 159.29 ? 65  LYS C C     1 
ATOM   9305  O  O     . LYS E  1 67  ? 7.900   -41.944 -9.541  1.00 166.19 ? 65  LYS C O     1 
ATOM   9306  C  CB    . LYS E  1 67  ? 10.834  -42.838 -10.421 1.00 153.79 ? 65  LYS C CB    1 
ATOM   9307  C  CG    . LYS E  1 67  ? 11.972  -43.745 -10.862 1.00 152.46 ? 65  LYS C CG    1 
ATOM   9308  C  CD    . LYS E  1 67  ? 13.184  -42.933 -11.290 1.00 150.60 ? 65  LYS C CD    1 
ATOM   9309  C  CE    . LYS E  1 67  ? 14.364  -43.829 -11.626 1.00 146.87 ? 65  LYS C CE    1 
ATOM   9310  N  NZ    . LYS E  1 67  ? 15.572  -43.040 -11.995 1.00 145.76 ? 65  LYS C NZ    1 
ATOM   9311  N  N     . LYS E  1 68  ? 9.055   -42.517 -7.692  1.00 156.89 ? 66  LYS C N     1 
ATOM   9312  C  CA    . LYS E  1 68  ? 8.212   -41.731 -6.801  1.00 159.01 ? 66  LYS C CA    1 
ATOM   9313  C  C     . LYS E  1 68  ? 8.309   -40.251 -7.149  1.00 167.44 ? 66  LYS C C     1 
ATOM   9314  O  O     . LYS E  1 68  ? 9.395   -39.663 -7.097  1.00 163.29 ? 66  LYS C O     1 
ATOM   9315  C  CB    . LYS E  1 68  ? 8.613   -41.970 -5.347  1.00 149.14 ? 66  LYS C CB    1 
ATOM   9316  C  CG    . LYS E  1 68  ? 7.550   -41.555 -4.344  1.00 143.26 ? 66  LYS C CG    1 
ATOM   9317  C  CD    . LYS E  1 68  ? 6.251   -42.306 -4.594  1.00 143.20 ? 66  LYS C CD    1 
ATOM   9318  C  CE    . LYS E  1 68  ? 5.147   -41.842 -3.659  1.00 144.39 ? 66  LYS C CE    1 
ATOM   9319  N  NZ    . LYS E  1 68  ? 3.860   -42.539 -3.935  1.00 148.35 ? 66  LYS C NZ    1 
ATOM   9320  N  N     . ASP E  1 69  ? 7.170   -39.658 -7.515  1.00 175.55 ? 67  ASP C N     1 
ATOM   9321  C  CA    . ASP E  1 69  ? 7.065   -38.223 -7.786  1.00 182.18 ? 67  ASP C CA    1 
ATOM   9322  C  C     . ASP E  1 69  ? 7.990   -37.797 -8.925  1.00 178.77 ? 67  ASP C C     1 
ATOM   9323  O  O     . ASP E  1 69  ? 8.661   -36.765 -8.851  1.00 184.97 ? 67  ASP C O     1 
ATOM   9324  C  CB    . ASP E  1 69  ? 7.343   -37.404 -6.522  1.00 184.09 ? 67  ASP C CB    1 
ATOM   9325  C  CG    . ASP E  1 69  ? 6.639   -36.062 -6.528  1.00 189.31 ? 67  ASP C CG    1 
ATOM   9326  O  OD1   . ASP E  1 69  ? 5.715   -35.878 -7.348  1.00 194.34 ? 67  ASP C OD1   1 
ATOM   9327  O  OD2   . ASP E  1 69  ? 7.010   -35.191 -5.714  1.00 188.43 ? 67  ASP C OD2   1 
ATOM   9328  N  N     . SER E  1 70  ? 8.025   -38.594 -9.991  1.00 171.63 ? 68  SER C N     1 
ATOM   9329  C  CA    . SER E  1 70  ? 8.874   -38.287 -11.134 1.00 156.50 ? 68  SER C CA    1 
ATOM   9330  C  C     . SER E  1 70  ? 8.309   -38.966 -12.372 1.00 152.69 ? 68  SER C C     1 
ATOM   9331  O  O     . SER E  1 70  ? 7.533   -39.920 -12.283 1.00 143.33 ? 68  SER C O     1 
ATOM   9332  C  CB    . SER E  1 70  ? 10.323  -38.724 -10.892 1.00 150.81 ? 68  SER C CB    1 
ATOM   9333  O  OG    . SER E  1 70  ? 11.156  -38.346 -11.974 1.00 150.42 ? 68  SER C OG    1 
ATOM   9334  N  N     . THR E  1 71  ? 8.719   -38.456 -13.536 1.00 157.73 ? 69  THR C N     1 
ATOM   9335  C  CA    . THR E  1 71  ? 8.243   -38.997 -14.804 1.00 166.44 ? 69  THR C CA    1 
ATOM   9336  C  C     . THR E  1 71  ? 8.976   -40.272 -15.200 1.00 167.88 ? 69  THR C C     1 
ATOM   9337  O  O     . THR E  1 71  ? 8.408   -41.113 -15.905 1.00 175.28 ? 69  THR C O     1 
ATOM   9338  C  CB    . THR E  1 71  ? 8.395   -37.954 -15.914 1.00 168.90 ? 69  THR C CB    1 
ATOM   9339  O  OG1   . THR E  1 71  ? 9.787   -37.695 -16.139 1.00 167.91 ? 69  THR C OG1   1 
ATOM   9340  C  CG2   . THR E  1 71  ? 7.702   -36.658 -15.527 1.00 168.48 ? 69  THR C CG2   1 
ATOM   9341  N  N     . LYS E  1 72  ? 10.222  -40.431 -14.763 1.00 163.56 ? 70  LYS C N     1 
ATOM   9342  C  CA    . LYS E  1 72  ? 11.022  -41.576 -15.168 1.00 158.08 ? 70  LYS C CA    1 
ATOM   9343  C  C     . LYS E  1 72  ? 10.486  -42.863 -14.547 1.00 159.07 ? 70  LYS C C     1 
ATOM   9344  O  O     . LYS E  1 72  ? 9.795   -42.857 -13.524 1.00 154.10 ? 70  LYS C O     1 
ATOM   9345  C  CB    . LYS E  1 72  ? 12.485  -41.369 -14.777 1.00 150.02 ? 70  LYS C CB    1 
ATOM   9346  C  CG    . LYS E  1 72  ? 13.130  -40.160 -15.435 1.00 147.76 ? 70  LYS C CG    1 
ATOM   9347  C  CD    . LYS E  1 72  ? 14.566  -39.971 -14.978 1.00 141.86 ? 70  LYS C CD    1 
ATOM   9348  C  CE    . LYS E  1 72  ? 15.200  -38.763 -15.649 1.00 142.03 ? 70  LYS C CE    1 
ATOM   9349  N  NZ    . LYS E  1 72  ? 16.597  -38.535 -15.187 1.00 139.87 ? 70  LYS C NZ    1 
ATOM   9350  N  N     . TRP E  1 73  ? 10.814  -43.980 -15.189 1.00 161.72 ? 71  TRP C N     1 
ATOM   9351  C  CA    . TRP E  1 73  ? 10.388  -45.302 -14.755 1.00 164.84 ? 71  TRP C CA    1 
ATOM   9352  C  C     . TRP E  1 73  ? 11.593  -46.113 -14.299 1.00 155.59 ? 71  TRP C C     1 
ATOM   9353  O  O     . TRP E  1 73  ? 12.660  -46.061 -14.919 1.00 154.07 ? 71  TRP C O     1 
ATOM   9354  C  CB    . TRP E  1 73  ? 9.659   -46.042 -15.880 1.00 176.89 ? 71  TRP C CB    1 
ATOM   9355  C  CG    . TRP E  1 73  ? 8.314   -45.472 -16.214 1.00 187.79 ? 71  TRP C CG    1 
ATOM   9356  C  CD1   . TRP E  1 73  ? 8.057   -44.281 -16.830 1.00 193.03 ? 71  TRP C CD1   1 
ATOM   9357  C  CD2   . TRP E  1 73  ? 7.040   -46.077 -15.962 1.00 192.21 ? 71  TRP C CD2   1 
ATOM   9358  N  NE1   . TRP E  1 73  ? 6.701   -44.104 -16.970 1.00 197.72 ? 71  TRP C NE1   1 
ATOM   9359  C  CE2   . TRP E  1 73  ? 6.055   -45.193 -16.446 1.00 196.75 ? 71  TRP C CE2   1 
ATOM   9360  C  CE3   . TRP E  1 73  ? 6.637   -47.278 -15.372 1.00 191.00 ? 71  TRP C CE3   1 
ATOM   9361  C  CZ2   . TRP E  1 73  ? 4.693   -45.473 -16.358 1.00 198.74 ? 71  TRP C CZ2   1 
ATOM   9362  C  CZ3   . TRP E  1 73  ? 5.284   -47.554 -15.285 1.00 192.76 ? 71  TRP C CZ3   1 
ATOM   9363  C  CH2   . TRP E  1 73  ? 4.329   -46.656 -15.775 1.00 196.52 ? 71  TRP C CH2   1 
ATOM   9364  N  N     . ARG E  1 74  ? 11.415  -46.863 -13.216 1.00 148.30 ? 72  ARG C N     1 
ATOM   9365  C  CA    . ARG E  1 74  ? 12.451  -47.736 -12.682 1.00 141.09 ? 72  ARG C CA    1 
ATOM   9366  C  C     . ARG E  1 74  ? 12.125  -49.180 -13.038 1.00 144.80 ? 72  ARG C C     1 
ATOM   9367  O  O     . ARG E  1 74  ? 10.989  -49.628 -12.851 1.00 150.00 ? 72  ARG C O     1 
ATOM   9368  C  CB    . ARG E  1 74  ? 12.573  -47.580 -11.166 1.00 131.07 ? 72  ARG C CB    1 
ATOM   9369  C  CG    . ARG E  1 74  ? 13.704  -48.386 -10.554 1.00 125.80 ? 72  ARG C CG    1 
ATOM   9370  C  CD    . ARG E  1 74  ? 13.642  -48.375 -9.034  1.00 122.41 ? 72  ARG C CD    1 
ATOM   9371  N  NE    . ARG E  1 74  ? 13.594  -47.020 -8.493  1.00 117.78 ? 72  ARG C NE    1 
ATOM   9372  C  CZ    . ARG E  1 74  ? 14.665  -46.267 -8.267  1.00 113.46 ? 72  ARG C CZ    1 
ATOM   9373  N  NH1   . ARG E  1 74  ? 15.876  -46.733 -8.539  1.00 113.58 ? 72  ARG C NH1   1 
ATOM   9374  N  NH2   . ARG E  1 74  ? 14.525  -45.045 -7.771  1.00 110.28 ? 72  ARG C NH2   1 
ATOM   9375  N  N     . LYS E  1 75  ? 13.119  -49.901 -13.548 1.00 141.91 ? 73  LYS C N     1 
ATOM   9376  C  CA    . LYS E  1 75  ? 12.955  -51.293 -13.944 1.00 143.04 ? 73  LYS C CA    1 
ATOM   9377  C  C     . LYS E  1 75  ? 13.439  -52.203 -12.823 1.00 145.42 ? 73  LYS C C     1 
ATOM   9378  O  O     . LYS E  1 75  ? 14.544  -52.021 -12.301 1.00 141.08 ? 73  LYS C O     1 
ATOM   9379  C  CB    . LYS E  1 75  ? 13.720  -51.587 -15.235 1.00 138.81 ? 73  LYS C CB    1 
ATOM   9380  C  CG    . LYS E  1 75  ? 13.547  -53.008 -15.742 1.00 138.31 ? 73  LYS C CG    1 
ATOM   9381  C  CD    . LYS E  1 75  ? 14.273  -53.219 -17.058 1.00 140.37 ? 73  LYS C CD    1 
ATOM   9382  C  CE    . LYS E  1 75  ? 14.084  -54.639 -17.563 1.00 143.12 ? 73  LYS C CE    1 
ATOM   9383  N  NZ    . LYS E  1 75  ? 12.643  -54.984 -17.707 1.00 149.01 ? 73  LYS C NZ    1 
ATOM   9384  N  N     . LEU E  1 76  ? 12.612  -53.181 -12.460 1.00 148.66 ? 74  LEU C N     1 
ATOM   9385  C  CA    . LEU E  1 76  ? 12.916  -54.110 -11.382 1.00 151.19 ? 74  LEU C CA    1 
ATOM   9386  C  C     . LEU E  1 76  ? 12.790  -55.539 -11.889 1.00 157.72 ? 74  LEU C C     1 
ATOM   9387  O  O     . LEU E  1 76  ? 11.851  -55.866 -12.622 1.00 164.81 ? 74  LEU C O     1 
ATOM   9388  C  CB    . LEU E  1 76  ? 11.984  -53.893 -10.183 1.00 150.12 ? 74  LEU C CB    1 
ATOM   9389  C  CG    . LEU E  1 76  ? 11.977  -52.482 -9.592  1.00 145.17 ? 74  LEU C CG    1 
ATOM   9390  C  CD1   . LEU E  1 76  ? 10.976  -52.374 -8.454  1.00 139.70 ? 74  LEU C CD1   1 
ATOM   9391  C  CD2   . LEU E  1 76  ? 13.370  -52.093 -9.124  1.00 141.40 ? 74  LEU C CD2   1 
ATOM   9392  N  N     . VAL E  1 77  ? 13.738  -56.386 -11.496 1.00 156.94 ? 75  VAL C N     1 
ATOM   9393  C  CA    . VAL E  1 77  ? 13.772  -57.787 -11.899 1.00 153.74 ? 75  VAL C CA    1 
ATOM   9394  C  C     . VAL E  1 77  ? 13.475  -58.646 -10.679 1.00 152.09 ? 75  VAL C C     1 
ATOM   9395  O  O     . VAL E  1 77  ? 14.070  -58.450 -9.612  1.00 142.31 ? 75  VAL C O     1 
ATOM   9396  C  CB    . VAL E  1 77  ? 15.127  -58.163 -12.522 1.00 145.50 ? 75  VAL C CB    1 
ATOM   9397  C  CG1   . VAL E  1 77  ? 15.103  -59.604 -13.005 1.00 140.76 ? 75  VAL C CG1   1 
ATOM   9398  C  CG2   . VAL E  1 77  ? 15.468  -57.217 -13.662 1.00 143.97 ? 75  VAL C CG2   1 
ATOM   9399  N  N     . ASP E  1 78  ? 12.556  -59.601 -10.838 1.00 156.07 ? 76  ASP C N     1 
ATOM   9400  C  CA    . ASP E  1 78  ? 12.156  -60.492 -9.748  1.00 153.71 ? 76  ASP C CA    1 
ATOM   9401  C  C     . ASP E  1 78  ? 13.093  -61.698 -9.744  1.00 153.99 ? 76  ASP C C     1 
ATOM   9402  O  O     . ASP E  1 78  ? 12.770  -62.786 -10.225 1.00 156.15 ? 76  ASP C O     1 
ATOM   9403  C  CB    . ASP E  1 78  ? 10.696  -60.900 -9.903  1.00 154.55 ? 76  ASP C CB    1 
ATOM   9404  C  CG    . ASP E  1 78  ? 10.120  -61.517 -8.640  1.00 152.45 ? 76  ASP C CG    1 
ATOM   9405  O  OD1   . ASP E  1 78  ? 10.820  -62.314 -7.982  1.00 150.75 ? 76  ASP C OD1   1 
ATOM   9406  O  OD2   . ASP E  1 78  ? 8.958   -61.203 -8.304  1.00 152.51 ? 76  ASP C OD2   1 
ATOM   9407  N  N     . PHE E  1 79  ? 14.283  -61.490 -9.176  1.00 149.28 ? 77  PHE C N     1 
ATOM   9408  C  CA    . PHE E  1 79  ? 15.307  -62.524 -9.083  1.00 148.33 ? 77  PHE C CA    1 
ATOM   9409  C  C     . PHE E  1 79  ? 15.201  -63.349 -7.805  1.00 147.80 ? 77  PHE C C     1 
ATOM   9410  O  O     . PHE E  1 79  ? 16.229  -63.781 -7.268  1.00 148.01 ? 77  PHE C O     1 
ATOM   9411  C  CB    . PHE E  1 79  ? 16.698  -61.897 -9.192  1.00 146.04 ? 77  PHE C CB    1 
ATOM   9412  C  CG    . PHE E  1 79  ? 17.191  -61.752 -10.602 1.00 147.58 ? 77  PHE C CG    1 
ATOM   9413  C  CD1   . PHE E  1 79  ? 16.816  -62.660 -11.578 1.00 146.58 ? 77  PHE C CD1   1 
ATOM   9414  C  CD2   . PHE E  1 79  ? 18.033  -60.710 -10.952 1.00 146.86 ? 77  PHE C CD2   1 
ATOM   9415  C  CE1   . PHE E  1 79  ? 17.270  -62.531 -12.877 1.00 148.97 ? 77  PHE C CE1   1 
ATOM   9416  C  CE2   . PHE E  1 79  ? 18.490  -60.575 -12.250 1.00 145.77 ? 77  PHE C CE2   1 
ATOM   9417  C  CZ    . PHE E  1 79  ? 18.108  -61.487 -13.213 1.00 148.09 ? 77  PHE C CZ    1 
ATOM   9418  N  N     . ARG E  1 80  ? 13.985  -63.585 -7.305  1.00 147.42 ? 78  ARG C N     1 
ATOM   9419  C  CA    . ARG E  1 80  ? 13.834  -64.342 -6.066  1.00 145.32 ? 78  ARG C CA    1 
ATOM   9420  C  C     . ARG E  1 80  ? 14.289  -65.788 -6.224  1.00 145.87 ? 78  ARG C C     1 
ATOM   9421  O  O     . ARG E  1 80  ? 14.776  -66.389 -5.261  1.00 142.96 ? 78  ARG C O     1 
ATOM   9422  C  CB    . ARG E  1 80  ? 12.383  -64.287 -5.588  1.00 147.08 ? 78  ARG C CB    1 
ATOM   9423  C  CG    . ARG E  1 80  ? 11.967  -62.928 -5.047  1.00 148.58 ? 78  ARG C CG    1 
ATOM   9424  C  CD    . ARG E  1 80  ? 10.512  -62.924 -4.605  1.00 151.70 ? 78  ARG C CD    1 
ATOM   9425  N  NE    . ARG E  1 80  ? 9.601   -63.183 -5.715  1.00 157.23 ? 78  ARG C NE    1 
ATOM   9426  C  CZ    . ARG E  1 80  ? 8.276   -63.191 -5.607  1.00 157.89 ? 78  ARG C CZ    1 
ATOM   9427  N  NH1   . ARG E  1 80  ? 7.703   -62.953 -4.435  1.00 155.52 ? 78  ARG C NH1   1 
ATOM   9428  N  NH2   . ARG E  1 80  ? 7.524   -63.435 -6.672  1.00 156.13 ? 78  ARG C NH2   1 
ATOM   9429  N  N     . GLU E  1 81  ? 14.144  -66.361 -7.420  1.00 151.47 ? 79  GLU C N     1 
ATOM   9430  C  CA    . GLU E  1 81  ? 14.643  -67.712 -7.652  1.00 154.42 ? 79  GLU C CA    1 
ATOM   9431  C  C     . GLU E  1 81  ? 16.139  -67.726 -7.933  1.00 144.18 ? 79  GLU C C     1 
ATOM   9432  O  O     . GLU E  1 81  ? 16.819  -68.699 -7.590  1.00 146.70 ? 79  GLU C O     1 
ATOM   9433  C  CB    . GLU E  1 81  ? 13.884  -68.367 -8.807  1.00 160.78 ? 79  GLU C CB    1 
ATOM   9434  C  CG    . GLU E  1 81  ? 12.479  -68.821 -8.444  1.00 164.70 ? 79  GLU C CG    1 
ATOM   9435  C  CD    . GLU E  1 81  ? 12.475  -69.964 -7.446  1.00 164.60 ? 79  GLU C CD    1 
ATOM   9436  O  OE1   . GLU E  1 81  ? 13.470  -70.718 -7.395  1.00 162.42 ? 79  GLU C OE1   1 
ATOM   9437  O  OE2   . GLU E  1 81  ? 11.476  -70.107 -6.711  1.00 164.51 ? 79  GLU C OE2   1 
ATOM   9438  N  N     . LEU E  1 82  ? 16.667  -66.666 -8.550  1.00 133.99 ? 80  LEU C N     1 
ATOM   9439  C  CA    . LEU E  1 82  ? 18.107  -66.589 -8.776  1.00 119.65 ? 80  LEU C CA    1 
ATOM   9440  C  C     . LEU E  1 82  ? 18.856  -66.348 -7.472  1.00 118.29 ? 80  LEU C C     1 
ATOM   9441  O  O     . LEU E  1 82  ? 19.967  -66.859 -7.285  1.00 115.58 ? 80  LEU C O     1 
ATOM   9442  C  CB    . LEU E  1 82  ? 18.422  -65.490 -9.790  1.00 109.33 ? 80  LEU C CB    1 
ATOM   9443  C  CG    . LEU E  1 82  ? 19.905  -65.216 -10.057 1.00 105.38 ? 80  LEU C CG    1 
ATOM   9444  C  CD1   . LEU E  1 82  ? 20.604  -66.471 -10.560 1.00 104.87 ? 80  LEU C CD1   1 
ATOM   9445  C  CD2   . LEU E  1 82  ? 20.078  -64.070 -11.043 1.00 105.65 ? 80  LEU C CD2   1 
ATOM   9446  N  N     . ASN E  1 83  ? 18.264  -65.575 -6.558  1.00 118.02 ? 81  ASN C N     1 
ATOM   9447  C  CA    . ASN E  1 83  ? 18.919  -65.305 -5.283  1.00 115.57 ? 81  ASN C CA    1 
ATOM   9448  C  C     . ASN E  1 83  ? 19.061  -66.568 -4.444  1.00 121.00 ? 81  ASN C C     1 
ATOM   9449  O  O     . ASN E  1 83  ? 20.044  -66.717 -3.710  1.00 122.39 ? 81  ASN C O     1 
ATOM   9450  C  CB    . ASN E  1 83  ? 18.143  -64.238 -4.508  1.00 116.24 ? 81  ASN C CB    1 
ATOM   9451  C  CG    . ASN E  1 83  ? 18.178  -62.882 -5.187  1.00 118.15 ? 81  ASN C CG    1 
ATOM   9452  O  OD1   . ASN E  1 83  ? 19.170  -62.515 -5.819  1.00 117.43 ? 81  ASN C OD1   1 
ATOM   9453  N  ND2   . ASN E  1 83  ? 17.090  -62.131 -5.063  1.00 117.75 ? 81  ASN C ND2   1 
ATOM   9454  N  N     . LYS E  1 84  ? 18.096  -67.486 -4.540  1.00 125.12 ? 82  LYS C N     1 
ATOM   9455  C  CA    . LYS E  1 84  ? 18.183  -68.737 -3.798  1.00 129.37 ? 82  LYS C CA    1 
ATOM   9456  C  C     . LYS E  1 84  ? 19.328  -69.618 -4.279  1.00 133.28 ? 82  LYS C C     1 
ATOM   9457  O  O     . LYS E  1 84  ? 19.782  -70.487 -3.527  1.00 139.67 ? 82  LYS C O     1 
ATOM   9458  C  CB    . LYS E  1 84  ? 16.865  -69.506 -3.901  1.00 132.20 ? 82  LYS C CB    1 
ATOM   9459  C  CG    . LYS E  1 84  ? 15.674  -68.799 -3.277  1.00 130.69 ? 82  LYS C CG    1 
ATOM   9460  C  CD    . LYS E  1 84  ? 14.399  -69.602 -3.478  1.00 135.69 ? 82  LYS C CD    1 
ATOM   9461  C  CE    . LYS E  1 84  ? 13.192  -68.885 -2.895  1.00 137.25 ? 82  LYS C CE    1 
ATOM   9462  N  NZ    . LYS E  1 84  ? 11.930  -69.638 -3.133  1.00 139.11 ? 82  LYS C NZ    1 
ATOM   9463  N  N     . ARG E  1 85  ? 19.803  -69.413 -5.507  1.00 126.86 ? 83  ARG C N     1 
ATOM   9464  C  CA    . ARG E  1 85  ? 20.889  -70.203 -6.064  1.00 124.13 ? 83  ARG C CA    1 
ATOM   9465  C  C     . ARG E  1 85  ? 22.183  -69.418 -6.225  1.00 118.15 ? 83  ARG C C     1 
ATOM   9466  O  O     . ARG E  1 85  ? 23.211  -70.015 -6.565  1.00 112.93 ? 83  ARG C O     1 
ATOM   9467  C  CB    . ARG E  1 85  ? 20.471  -70.789 -7.421  1.00 129.58 ? 83  ARG C CB    1 
ATOM   9468  C  CG    . ARG E  1 85  ? 19.149  -71.540 -7.370  1.00 132.18 ? 83  ARG C CG    1 
ATOM   9469  C  CD    . ARG E  1 85  ? 18.723  -72.037 -8.741  1.00 138.58 ? 83  ARG C CD    1 
ATOM   9470  N  NE    . ARG E  1 85  ? 17.419  -72.693 -8.693  1.00 140.84 ? 83  ARG C NE    1 
ATOM   9471  C  CZ    . ARG E  1 85  ? 16.822  -73.253 -9.740  1.00 143.03 ? 83  ARG C CZ    1 
ATOM   9472  N  NH1   . ARG E  1 85  ? 17.411  -73.240 -10.928 1.00 144.25 ? 83  ARG C NH1   1 
ATOM   9473  N  NH2   . ARG E  1 85  ? 15.635  -73.827 -9.599  1.00 144.64 ? 83  ARG C NH2   1 
ATOM   9474  N  N     . THR E  1 86  ? 22.162  -68.109 -5.990  1.00 118.61 ? 84  THR C N     1 
ATOM   9475  C  CA    . THR E  1 86  ? 23.367  -67.299 -6.065  1.00 122.91 ? 84  THR C CA    1 
ATOM   9476  C  C     . THR E  1 86  ? 24.152  -67.402 -4.762  1.00 118.61 ? 84  THR C C     1 
ATOM   9477  O  O     . THR E  1 86  ? 23.589  -67.642 -3.690  1.00 120.61 ? 84  THR C O     1 
ATOM   9478  C  CB    . THR E  1 86  ? 23.011  -65.837 -6.351  1.00 124.49 ? 84  THR C CB    1 
ATOM   9479  O  OG1   . THR E  1 86  ? 22.010  -65.782 -7.375  1.00 131.30 ? 84  THR C OG1   1 
ATOM   9480  C  CG2   . THR E  1 86  ? 24.235  -65.063 -6.821  1.00 122.68 ? 84  THR C CG2   1 
ATOM   9481  N  N     . GLN E  1 87  ? 25.469  -67.229 -4.866  1.00 114.88 ? 85  GLN C N     1 
ATOM   9482  C  CA    . GLN E  1 87  ? 26.329  -67.299 -3.694  1.00 107.26 ? 85  GLN C CA    1 
ATOM   9483  C  C     . GLN E  1 87  ? 25.976  -66.201 -2.697  1.00 107.32 ? 85  GLN C C     1 
ATOM   9484  O  O     . GLN E  1 87  ? 25.447  -65.146 -3.057  1.00 108.51 ? 85  GLN C O     1 
ATOM   9485  C  CB    . GLN E  1 87  ? 27.798  -67.172 -4.100  1.00 100.92 ? 85  GLN C CB    1 
ATOM   9486  C  CG    . GLN E  1 87  ? 28.152  -65.822 -4.705  1.00 98.60  ? 85  GLN C CG    1 
ATOM   9487  C  CD    . GLN E  1 87  ? 29.646  -65.566 -4.731  1.00 104.18 ? 85  GLN C CD    1 
ATOM   9488  O  OE1   . GLN E  1 87  ? 30.323  -65.865 -5.714  1.00 113.78 ? 85  GLN C OE1   1 
ATOM   9489  N  NE2   . GLN E  1 87  ? 30.167  -65.005 -3.645  1.00 94.19  ? 85  GLN C NE2   1 
ATOM   9490  N  N     . ASP E  1 88  ? 26.276  -66.460 -1.427  1.00 105.27 ? 86  ASP C N     1 
ATOM   9491  C  CA    . ASP E  1 88  ? 26.059  -65.471 -0.383  1.00 101.99 ? 86  ASP C CA    1 
ATOM   9492  C  C     . ASP E  1 88  ? 27.162  -64.422 -0.412  1.00 94.51  ? 86  ASP C C     1 
ATOM   9493  O  O     . ASP E  1 88  ? 28.330  -64.733 -0.659  1.00 96.86  ? 86  ASP C O     1 
ATOM   9494  C  CB    . ASP E  1 88  ? 26.013  -66.141 0.992   1.00 102.97 ? 86  ASP C CB    1 
ATOM   9495  C  CG    . ASP E  1 88  ? 24.809  -67.046 1.160   1.00 111.51 ? 86  ASP C CG    1 
ATOM   9496  O  OD1   . ASP E  1 88  ? 23.764  -66.772 0.533   1.00 118.91 ? 86  ASP C OD1   1 
ATOM   9497  O  OD2   . ASP E  1 88  ? 24.907  -68.029 1.924   1.00 112.51 ? 86  ASP C OD2   1 
ATOM   9498  N  N     . PHE E  1 89  ? 26.781  -63.175 -0.165  1.00 86.97  ? 87  PHE C N     1 
ATOM   9499  C  CA    . PHE E  1 89  ? 27.717  -62.068 -0.067  1.00 82.78  ? 87  PHE C CA    1 
ATOM   9500  C  C     . PHE E  1 89  ? 27.802  -61.595 1.377   1.00 82.67  ? 87  PHE C C     1 
ATOM   9501  O  O     . PHE E  1 89  ? 26.952  -61.917 2.212   1.00 82.72  ? 87  PHE C O     1 
ATOM   9502  C  CB    . PHE E  1 89  ? 27.295  -60.903 -0.970  1.00 82.84  ? 87  PHE C CB    1 
ATOM   9503  C  CG    . PHE E  1 89  ? 27.237  -61.254 -2.429  1.00 92.87  ? 87  PHE C CG    1 
ATOM   9504  C  CD1   . PHE E  1 89  ? 28.348  -61.089 -3.240  1.00 92.14  ? 87  PHE C CD1   1 
ATOM   9505  C  CD2   . PHE E  1 89  ? 26.069  -61.743 -2.992  1.00 86.11  ? 87  PHE C CD2   1 
ATOM   9506  C  CE1   . PHE E  1 89  ? 28.297  -61.409 -4.582  1.00 97.62  ? 87  PHE C CE1   1 
ATOM   9507  C  CE2   . PHE E  1 89  ? 26.013  -62.066 -4.333  1.00 92.28  ? 87  PHE C CE2   1 
ATOM   9508  C  CZ    . PHE E  1 89  ? 27.127  -61.898 -5.130  1.00 102.15 ? 87  PHE C CZ    1 
ATOM   9509  N  N     . TRP E  1 90  ? 28.847  -60.827 1.668   1.00 82.01  ? 88  TRP C N     1 
ATOM   9510  C  CA    . TRP E  1 90  ? 28.978  -60.145 2.950   1.00 80.21  ? 88  TRP C CA    1 
ATOM   9511  C  C     . TRP E  1 90  ? 28.684  -58.669 2.720   1.00 81.35  ? 88  TRP C C     1 
ATOM   9512  O  O     . TRP E  1 90  ? 29.428  -57.984 2.010   1.00 91.87  ? 88  TRP C O     1 
ATOM   9513  C  CB    . TRP E  1 90  ? 30.361  -60.337 3.564   1.00 77.31  ? 88  TRP C CB    1 
ATOM   9514  C  CG    . TRP E  1 90  ? 30.437  -59.726 4.923   1.00 76.98  ? 88  TRP C CG    1 
ATOM   9515  C  CD1   . TRP E  1 90  ? 30.993  -58.525 5.254   1.00 72.55  ? 88  TRP C CD1   1 
ATOM   9516  C  CD2   . TRP E  1 90  ? 29.895  -60.266 6.133   1.00 78.80  ? 88  TRP C CD2   1 
ATOM   9517  N  NE1   . TRP E  1 90  ? 30.850  -58.294 6.601   1.00 70.79  ? 88  TRP C NE1   1 
ATOM   9518  C  CE2   . TRP E  1 90  ? 30.176  -59.347 7.162   1.00 76.84  ? 88  TRP C CE2   1 
ATOM   9519  C  CE3   . TRP E  1 90  ? 29.207  -61.442 6.446   1.00 78.94  ? 88  TRP C CE3   1 
ATOM   9520  C  CZ2   . TRP E  1 90  ? 29.794  -59.568 8.484   1.00 73.36  ? 88  TRP C CZ2   1 
ATOM   9521  C  CZ3   . TRP E  1 90  ? 28.829  -61.660 7.758   1.00 76.43  ? 88  TRP C CZ3   1 
ATOM   9522  C  CH2   . TRP E  1 90  ? 29.124  -60.728 8.761   1.00 71.56  ? 88  TRP C CH2   1 
ATOM   9523  N  N     . GLU E  1 91  ? 27.602  -58.185 3.322   1.00 71.69  ? 89  GLU C N     1 
ATOM   9524  C  CA    . GLU E  1 91  ? 27.175  -56.811 3.109   1.00 73.90  ? 89  GLU C CA    1 
ATOM   9525  C  C     . GLU E  1 91  ? 28.159  -55.841 3.750   1.00 75.49  ? 89  GLU C C     1 
ATOM   9526  O  O     . GLU E  1 91  ? 28.480  -55.956 4.937   1.00 80.47  ? 89  GLU C O     1 
ATOM   9527  C  CB    . GLU E  1 91  ? 25.773  -56.602 3.679   1.00 74.42  ? 89  GLU C CB    1 
ATOM   9528  C  CG    . GLU E  1 91  ? 24.730  -57.551 3.108   1.00 84.22  ? 89  GLU C CG    1 
ATOM   9529  C  CD    . GLU E  1 91  ? 24.474  -57.324 1.629   1.00 91.22  ? 89  GLU C CD    1 
ATOM   9530  O  OE1   . GLU E  1 91  ? 24.740  -56.206 1.139   1.00 94.00  ? 89  GLU C OE1   1 
ATOM   9531  O  OE2   . GLU E  1 91  ? 24.007  -58.266 0.955   1.00 96.97  ? 89  GLU C OE2   1 
ATOM   9532  N  N     . VAL E  1 92  ? 28.642  -54.882 2.954   1.00 78.84  ? 90  VAL C N     1 
ATOM   9533  C  CA    . VAL E  1 92  ? 29.540  -53.850 3.464   1.00 76.50  ? 90  VAL C CA    1 
ATOM   9534  C  C     . VAL E  1 92  ? 28.790  -52.651 4.026   1.00 72.62  ? 90  VAL C C     1 
ATOM   9535  O  O     . VAL E  1 92  ? 29.417  -51.773 4.639   1.00 70.63  ? 90  VAL C O     1 
ATOM   9536  C  CB    . VAL E  1 92  ? 30.518  -53.382 2.369   1.00 73.94  ? 90  VAL C CB    1 
ATOM   9537  C  CG1   . VAL E  1 92  ? 31.489  -54.496 2.019   1.00 76.27  ? 90  VAL C CG1   1 
ATOM   9538  C  CG2   . VAL E  1 92  ? 29.754  -52.932 1.134   1.00 71.05  ? 90  VAL C CG2   1 
ATOM   9539  N  N     . GLN E  1 93  ? 27.475  -52.581 3.836   1.00 74.40  ? 91  GLN C N     1 
ATOM   9540  C  CA    . GLN E  1 93  ? 26.657  -51.522 4.422   1.00 81.43  ? 91  GLN C CA    1 
ATOM   9541  C  C     . GLN E  1 93  ? 26.393  -51.886 5.877   1.00 82.06  ? 91  GLN C C     1 
ATOM   9542  O  O     . GLN E  1 93  ? 25.505  -52.685 6.180   1.00 89.24  ? 91  GLN C O     1 
ATOM   9543  C  CB    . GLN E  1 93  ? 25.358  -51.351 3.644   1.00 83.89  ? 91  GLN C CB    1 
ATOM   9544  C  CG    . GLN E  1 93  ? 24.494  -50.200 4.127   1.00 85.66  ? 91  GLN C CG    1 
ATOM   9545  C  CD    . GLN E  1 93  ? 25.163  -48.853 3.935   1.00 88.48  ? 91  GLN C CD    1 
ATOM   9546  O  OE1   . GLN E  1 93  ? 25.936  -48.659 2.997   1.00 90.63  ? 91  GLN C OE1   1 
ATOM   9547  N  NE2   . GLN E  1 93  ? 24.872  -47.916 4.828   1.00 88.13  ? 91  GLN C NE2   1 
ATOM   9548  N  N     . LEU E  1 94  ? 27.168  -51.301 6.787   1.00 73.96  ? 92  LEU C N     1 
ATOM   9549  C  CA    . LEU E  1 94  ? 27.100  -51.680 8.191   1.00 73.59  ? 92  LEU C CA    1 
ATOM   9550  C  C     . LEU E  1 94  ? 26.052  -50.902 8.975   1.00 74.49  ? 92  LEU C C     1 
ATOM   9551  O  O     . LEU E  1 94  ? 25.592  -51.387 10.015  1.00 66.59  ? 92  LEU C O     1 
ATOM   9552  C  CB    . LEU E  1 94  ? 28.471  -51.500 8.850   1.00 73.90  ? 92  LEU C CB    1 
ATOM   9553  C  CG    . LEU E  1 94  ? 29.646  -52.170 8.130   1.00 70.60  ? 92  LEU C CG    1 
ATOM   9554  C  CD1   . LEU E  1 94  ? 30.909  -52.107 8.977   1.00 68.51  ? 92  LEU C CD1   1 
ATOM   9555  C  CD2   . LEU E  1 94  ? 29.315  -53.609 7.756   1.00 62.65  ? 92  LEU C CD2   1 
ATOM   9556  N  N     . GLY E  1 95  ? 25.661  -49.722 8.506   1.00 69.59  ? 93  GLY C N     1 
ATOM   9557  C  CA    . GLY E  1 95  ? 24.661  -48.943 9.211   1.00 65.47  ? 93  GLY C CA    1 
ATOM   9558  C  C     . GLY E  1 95  ? 24.231  -47.755 8.381   1.00 66.86  ? 93  GLY C C     1 
ATOM   9559  O  O     . GLY E  1 95  ? 24.683  -47.558 7.250   1.00 72.46  ? 93  GLY C O     1 
ATOM   9560  N  N     . ILE E  1 96  ? 23.352  -46.957 8.967   1.00 71.30  ? 94  ILE C N     1 
ATOM   9561  C  CA    . ILE E  1 96  ? 22.751  -45.799 8.309   1.00 69.70  ? 94  ILE C CA    1 
ATOM   9562  C  C     . ILE E  1 96  ? 23.387  -44.540 8.885   1.00 66.02  ? 94  ILE C C     1 
ATOM   9563  O  O     . ILE E  1 96  ? 23.453  -44.401 10.111  1.00 72.09  ? 94  ILE C O     1 
ATOM   9564  C  CB    . ILE E  1 96  ? 21.222  -45.764 8.496   1.00 63.49  ? 94  ILE C CB    1 
ATOM   9565  C  CG1   . ILE E  1 96  ? 20.612  -47.124 8.148   1.00 64.45  ? 94  ILE C CG1   1 
ATOM   9566  C  CG2   . ILE E  1 96  ? 20.606  -44.665 7.647   1.00 65.02  ? 94  ILE C CG2   1 
ATOM   9567  C  CD1   . ILE E  1 96  ? 20.919  -47.594 6.744   1.00 75.86  ? 94  ILE C CD1   1 
ATOM   9568  N  N     . PRO E  1 97  ? 23.865  -43.617 8.054   1.00 66.77  ? 95  PRO C N     1 
ATOM   9569  C  CA    . PRO E  1 97  ? 24.418  -42.367 8.584   1.00 63.25  ? 95  PRO C CA    1 
ATOM   9570  C  C     . PRO E  1 97  ? 23.338  -41.510 9.222   1.00 72.71  ? 95  PRO C C     1 
ATOM   9571  O  O     . PRO E  1 97  ? 22.166  -41.559 8.842   1.00 75.01  ? 95  PRO C O     1 
ATOM   9572  C  CB    . PRO E  1 97  ? 25.007  -41.680 7.344   1.00 65.70  ? 95  PRO C CB    1 
ATOM   9573  C  CG    . PRO E  1 97  ? 25.141  -42.766 6.319   1.00 68.85  ? 95  PRO C CG    1 
ATOM   9574  C  CD    . PRO E  1 97  ? 24.019  -43.714 6.594   1.00 74.05  ? 95  PRO C CD    1 
ATOM   9575  N  N     . HIS E  1 98  ? 23.750  -40.714 10.207  1.00 72.50  ? 96  HIS C N     1 
ATOM   9576  C  CA    . HIS E  1 98  ? 22.818  -39.850 10.908  1.00 70.56  ? 96  HIS C CA    1 
ATOM   9577  C  C     . HIS E  1 98  ? 23.307  -38.409 10.862  1.00 66.27  ? 96  HIS C C     1 
ATOM   9578  O  O     . HIS E  1 98  ? 24.508  -38.154 11.020  1.00 66.39  ? 96  HIS C O     1 
ATOM   9579  C  CB    . HIS E  1 98  ? 22.641  -40.294 12.367  1.00 62.19  ? 96  HIS C CB    1 
ATOM   9580  C  CG    . HIS E  1 98  ? 21.360  -39.831 12.984  1.00 67.57  ? 96  HIS C CG    1 
ATOM   9581  N  ND1   . HIS E  1 98  ? 21.213  -38.582 13.548  1.00 70.24  ? 96  HIS C ND1   1 
ATOM   9582  C  CD2   . HIS E  1 98  ? 20.161  -40.446 13.117  1.00 68.19  ? 96  HIS C CD2   1 
ATOM   9583  C  CE1   . HIS E  1 98  ? 19.982  -38.449 14.006  1.00 72.09  ? 96  HIS C CE1   1 
ATOM   9584  N  NE2   . HIS E  1 98  ? 19.322  -39.566 13.757  1.00 70.80  ? 96  HIS C NE2   1 
ATOM   9585  N  N     . PRO E  1 99  ? 22.405  -37.449 10.645  1.00 70.55  ? 97  PRO C N     1 
ATOM   9586  C  CA    . PRO E  1 99  ? 22.836  -36.042 10.599  1.00 74.67  ? 97  PRO C CA    1 
ATOM   9587  C  C     . PRO E  1 99  ? 23.398  -35.541 11.915  1.00 77.04  ? 97  PRO C C     1 
ATOM   9588  O  O     . PRO E  1 99  ? 24.187  -34.587 11.916  1.00 85.70  ? 97  PRO C O     1 
ATOM   9589  C  CB    . PRO E  1 99  ? 21.551  -35.296 10.209  1.00 73.46  ? 97  PRO C CB    1 
ATOM   9590  C  CG    . PRO E  1 99  ? 20.443  -36.203 10.636  1.00 75.52  ? 97  PRO C CG    1 
ATOM   9591  C  CD    . PRO E  1 99  ? 20.958  -37.594 10.423  1.00 72.59  ? 97  PRO C CD    1 
ATOM   9592  N  N     . ALA E  1 100 ? 23.021  -36.155 13.040  1.00 70.73  ? 98  ALA C N     1 
ATOM   9593  C  CA    . ALA E  1 100 ? 23.589  -35.766 14.325  1.00 67.41  ? 98  ALA C CA    1 
ATOM   9594  C  C     . ALA E  1 100 ? 25.084  -36.041 14.394  1.00 65.64  ? 98  ALA C C     1 
ATOM   9595  O  O     . ALA E  1 100 ? 25.775  -35.454 15.233  1.00 62.55  ? 98  ALA C O     1 
ATOM   9596  C  CB    . ALA E  1 100 ? 22.873  -36.491 15.465  1.00 61.95  ? 98  ALA C CB    1 
ATOM   9597  N  N     . GLY E  1 101 ? 25.593  -36.922 13.537  1.00 62.36  ? 99  GLY C N     1 
ATOM   9598  C  CA    . GLY E  1 101 ? 27.004  -37.206 13.430  1.00 62.09  ? 99  GLY C CA    1 
ATOM   9599  C  C     . GLY E  1 101 ? 27.765  -36.314 12.480  1.00 78.85  ? 99  GLY C C     1 
ATOM   9600  O  O     . GLY E  1 101 ? 28.995  -36.402 12.412  1.00 82.82  ? 99  GLY C O     1 
ATOM   9601  N  N     . LEU E  1 102 ? 27.074  -35.454 11.737  1.00 76.45  ? 100 LEU C N     1 
ATOM   9602  C  CA    . LEU E  1 102 ? 27.738  -34.532 10.830  1.00 73.77  ? 100 LEU C CA    1 
ATOM   9603  C  C     . LEU E  1 102 ? 28.336  -33.363 11.602  1.00 74.84  ? 100 LEU C C     1 
ATOM   9604  O  O     . LEU E  1 102 ? 27.796  -32.918 12.619  1.00 77.28  ? 100 LEU C O     1 
ATOM   9605  C  CB    . LEU E  1 102 ? 26.760  -34.009 9.777   1.00 67.92  ? 100 LEU C CB    1 
ATOM   9606  C  CG    . LEU E  1 102 ? 26.077  -35.040 8.877   1.00 69.61  ? 100 LEU C CG    1 
ATOM   9607  C  CD1   . LEU E  1 102 ? 25.129  -34.353 7.909   1.00 69.58  ? 100 LEU C CD1   1 
ATOM   9608  C  CD2   . LEU E  1 102 ? 27.108  -35.864 8.127   1.00 67.56  ? 100 LEU C CD2   1 
ATOM   9609  N  N     . LYS E  1 103 ? 29.462  -32.865 11.106  1.00 82.38  ? 101 LYS C N     1 
ATOM   9610  C  CA    . LYS E  1 103 ? 30.129  -31.715 11.695  1.00 85.85  ? 101 LYS C CA    1 
ATOM   9611  C  C     . LYS E  1 103 ? 29.726  -30.440 10.963  1.00 94.35  ? 101 LYS C C     1 
ATOM   9612  O  O     . LYS E  1 103 ? 29.137  -30.469 9.880   1.00 99.10  ? 101 LYS C O     1 
ATOM   9613  C  CB    . LYS E  1 103 ? 31.649  -31.897 11.662  1.00 96.04  ? 101 LYS C CB    1 
ATOM   9614  C  CG    . LYS E  1 103 ? 32.137  -33.149 12.372  1.00 107.55 ? 101 LYS C CG    1 
ATOM   9615  C  CD    . LYS E  1 103 ? 33.653  -33.252 12.335  1.00 117.05 ? 101 LYS C CD    1 
ATOM   9616  C  CE    . LYS E  1 103 ? 34.134  -34.536 12.991  1.00 114.69 ? 101 LYS C CE    1 
ATOM   9617  N  NZ    . LYS E  1 103 ? 35.620  -34.602 13.056  1.00 116.34 ? 101 LYS C NZ    1 
ATOM   9618  N  N     . LYS E  1 104 ? 30.050  -29.306 11.577  1.00 103.87 ? 102 LYS C N     1 
ATOM   9619  C  CA    . LYS E  1 104 ? 29.767  -28.013 10.968  1.00 104.78 ? 102 LYS C CA    1 
ATOM   9620  C  C     . LYS E  1 104 ? 30.701  -27.784 9.785   1.00 97.65  ? 102 LYS C C     1 
ATOM   9621  O  O     . LYS E  1 104 ? 31.926  -27.786 9.942   1.00 91.94  ? 102 LYS C O     1 
ATOM   9622  C  CB    . LYS E  1 104 ? 29.918  -26.897 11.999  1.00 108.70 ? 102 LYS C CB    1 
ATOM   9623  C  CG    . LYS E  1 104 ? 29.752  -25.498 11.429  1.00 118.71 ? 102 LYS C CG    1 
ATOM   9624  C  CD    . LYS E  1 104 ? 28.405  -25.333 10.743  1.00 126.78 ? 102 LYS C CD    1 
ATOM   9625  C  CE    . LYS E  1 104 ? 28.282  -23.963 10.097  1.00 135.91 ? 102 LYS C CE    1 
ATOM   9626  N  NZ    . LYS E  1 104 ? 27.014  -23.822 9.330   1.00 140.79 ? 102 LYS C NZ    1 
ATOM   9627  N  N     . LYS E  1 105 ? 30.121  -27.593 8.603   1.00 98.94  ? 103 LYS C N     1 
ATOM   9628  C  CA    . LYS E  1 105 ? 30.875  -27.349 7.381   1.00 103.37 ? 103 LYS C CA    1 
ATOM   9629  C  C     . LYS E  1 105 ? 30.404  -26.054 6.736   1.00 109.64 ? 103 LYS C C     1 
ATOM   9630  O  O     . LYS E  1 105 ? 29.213  -25.726 6.771   1.00 115.60 ? 103 LYS C O     1 
ATOM   9631  C  CB    . LYS E  1 105 ? 30.726  -28.514 6.397   1.00 102.11 ? 103 LYS C CB    1 
ATOM   9632  C  CG    . LYS E  1 105 ? 31.435  -29.783 6.838   1.00 97.01  ? 103 LYS C CG    1 
ATOM   9633  C  CD    . LYS E  1 105 ? 32.929  -29.545 6.999   1.00 93.38  ? 103 LYS C CD    1 
ATOM   9634  C  CE    . LYS E  1 105 ? 33.642  -30.797 7.483   1.00 95.02  ? 103 LYS C CE    1 
ATOM   9635  N  NZ    . LYS E  1 105 ? 35.109  -30.587 7.623   1.00 99.56  ? 103 LYS C NZ    1 
ATOM   9636  N  N     . LYS E  1 106 ? 31.349  -25.320 6.144   1.00 113.55 ? 104 LYS C N     1 
ATOM   9637  C  CA    . LYS E  1 106 ? 31.014  -24.043 5.524   1.00 117.28 ? 104 LYS C CA    1 
ATOM   9638  C  C     . LYS E  1 106 ? 30.239  -24.240 4.227   1.00 114.83 ? 104 LYS C C     1 
ATOM   9639  O  O     . LYS E  1 106 ? 29.299  -23.490 3.938   1.00 118.35 ? 104 LYS C O     1 
ATOM   9640  C  CB    . LYS E  1 106 ? 32.286  -23.234 5.272   1.00 125.91 ? 104 LYS C CB    1 
ATOM   9641  C  CG    . LYS E  1 106 ? 32.047  -21.877 4.631   1.00 136.54 ? 104 LYS C CG    1 
ATOM   9642  C  CD    . LYS E  1 106 ? 33.357  -21.154 4.366   1.00 143.26 ? 104 LYS C CD    1 
ATOM   9643  C  CE    . LYS E  1 106 ? 34.130  -20.918 5.653   1.00 144.91 ? 104 LYS C CE    1 
ATOM   9644  N  NZ    . LYS E  1 106 ? 35.431  -20.238 5.402   1.00 147.07 ? 104 LYS C NZ    1 
ATOM   9645  N  N     . SER E  1 107 ? 30.613  -25.243 3.435   1.00 108.15 ? 105 SER C N     1 
ATOM   9646  C  CA    . SER E  1 107 ? 29.983  -25.502 2.149   1.00 99.78  ? 105 SER C CA    1 
ATOM   9647  C  C     . SER E  1 107 ? 29.553  -26.959 2.072   1.00 98.31  ? 105 SER C C     1 
ATOM   9648  O  O     . SER E  1 107 ? 30.304  -27.859 2.461   1.00 92.08  ? 105 SER C O     1 
ATOM   9649  C  CB    . SER E  1 107 ? 30.932  -25.167 0.996   1.00 96.62  ? 105 SER C CB    1 
ATOM   9650  O  OG    . SER E  1 107 ? 31.355  -23.816 1.059   1.00 98.94  ? 105 SER C OG    1 
ATOM   9651  N  N     . VAL E  1 108 ? 28.343  -27.185 1.564   1.00 99.10  ? 106 VAL C N     1 
ATOM   9652  C  CA    . VAL E  1 108 ? 27.727  -28.506 1.528   1.00 98.91  ? 106 VAL C CA    1 
ATOM   9653  C  C     . VAL E  1 108 ? 27.185  -28.763 0.128   1.00 101.30 ? 106 VAL C C     1 
ATOM   9654  O  O     . VAL E  1 108 ? 26.603  -27.869 -0.497  1.00 105.36 ? 106 VAL C O     1 
ATOM   9655  C  CB    . VAL E  1 108 ? 26.605  -28.631 2.582   1.00 99.36  ? 106 VAL C CB    1 
ATOM   9656  C  CG1   . VAL E  1 108 ? 25.814  -29.915 2.386   1.00 98.19  ? 106 VAL C CG1   1 
ATOM   9657  C  CG2   . VAL E  1 108 ? 27.186  -28.573 3.988   1.00 94.72  ? 106 VAL C CG2   1 
ATOM   9658  N  N     . THR E  1 109 ? 27.383  -29.985 -0.366  1.00 101.85 ? 107 THR C N     1 
ATOM   9659  C  CA    . THR E  1 109 ? 26.862  -30.406 -1.659  1.00 99.52  ? 107 THR C CA    1 
ATOM   9660  C  C     . THR E  1 109 ? 26.425  -31.861 -1.571  1.00 99.08  ? 107 THR C C     1 
ATOM   9661  O  O     . THR E  1 109 ? 27.125  -32.691 -0.984  1.00 106.71 ? 107 THR C O     1 
ATOM   9662  C  CB    . THR E  1 109 ? 27.909  -30.237 -2.770  1.00 94.94  ? 107 THR C CB    1 
ATOM   9663  O  OG1   . THR E  1 109 ? 28.341  -28.872 -2.820  1.00 101.68 ? 107 THR C OG1   1 
ATOM   9664  C  CG2   . THR E  1 109 ? 27.327  -30.625 -4.122  1.00 88.88  ? 107 THR C CG2   1 
ATOM   9665  N  N     . VAL E  1 110 ? 25.264  -32.163 -2.149  1.00 96.62  ? 108 VAL C N     1 
ATOM   9666  C  CA    . VAL E  1 110 ? 24.715  -33.515 -2.175  1.00 100.15 ? 108 VAL C CA    1 
ATOM   9667  C  C     . VAL E  1 110 ? 24.562  -33.934 -3.630  1.00 112.01 ? 108 VAL C C     1 
ATOM   9668  O  O     . VAL E  1 110 ? 23.878  -33.257 -4.408  1.00 115.01 ? 108 VAL C O     1 
ATOM   9669  C  CB    . VAL E  1 110 ? 23.371  -33.602 -1.434  1.00 103.02 ? 108 VAL C CB    1 
ATOM   9670  C  CG1   . VAL E  1 110 ? 22.809  -35.014 -1.521  1.00 100.71 ? 108 VAL C CG1   1 
ATOM   9671  C  CG2   . VAL E  1 110 ? 23.536  -33.178 0.017   1.00 97.54  ? 108 VAL C CG2   1 
ATOM   9672  N  N     . LEU E  1 111 ? 25.192  -35.046 -3.994  1.00 118.92 ? 109 LEU C N     1 
ATOM   9673  C  CA    . LEU E  1 111 ? 25.169  -35.569 -5.352  1.00 116.80 ? 109 LEU C CA    1 
ATOM   9674  C  C     . LEU E  1 111 ? 24.350  -36.853 -5.410  1.00 114.18 ? 109 LEU C C     1 
ATOM   9675  O  O     . LEU E  1 111 ? 23.932  -37.405 -4.389  1.00 122.73 ? 109 LEU C O     1 
ATOM   9676  C  CB    . LEU E  1 111 ? 26.594  -35.821 -5.859  1.00 110.71 ? 109 LEU C CB    1 
ATOM   9677  C  CG    . LEU E  1 111 ? 27.550  -34.628 -5.823  1.00 109.75 ? 109 LEU C CG    1 
ATOM   9678  C  CD1   . LEU E  1 111 ? 28.926  -35.026 -6.332  1.00 112.70 ? 109 LEU C CD1   1 
ATOM   9679  C  CD2   . LEU E  1 111 ? 26.992  -33.470 -6.631  1.00 114.56 ? 109 LEU C CD2   1 
ATOM   9680  N  N     . ASP E  1 112 ? 24.127  -37.327 -6.634  1.00 108.51 ? 110 ASP C N     1 
ATOM   9681  C  CA    . ASP E  1 112 ? 23.373  -38.559 -6.857  1.00 105.77 ? 110 ASP C CA    1 
ATOM   9682  C  C     . ASP E  1 112 ? 23.770  -39.117 -8.213  1.00 99.99  ? 110 ASP C C     1 
ATOM   9683  O  O     . ASP E  1 112 ? 23.535  -38.471 -9.240  1.00 99.27  ? 110 ASP C O     1 
ATOM   9684  C  CB    . ASP E  1 112 ? 21.867  -38.298 -6.793  1.00 115.95 ? 110 ASP C CB    1 
ATOM   9685  C  CG    . ASP E  1 112 ? 21.049  -39.575 -6.683  1.00 129.61 ? 110 ASP C CG    1 
ATOM   9686  O  OD1   . ASP E  1 112 ? 21.349  -40.555 -7.397  1.00 145.67 ? 110 ASP C OD1   1 
ATOM   9687  O  OD2   . ASP E  1 112 ? 20.097  -39.597 -5.874  1.00 134.44 ? 110 ASP C OD2   1 
ATOM   9688  N  N     . VAL E  1 113 ? 24.364  -40.310 -8.219  1.00 97.27  ? 111 VAL C N     1 
ATOM   9689  C  CA    . VAL E  1 113 ? 24.826  -40.915 -9.461  1.00 103.69 ? 111 VAL C CA    1 
ATOM   9690  C  C     . VAL E  1 113 ? 23.631  -41.421 -10.257 1.00 119.29 ? 111 VAL C C     1 
ATOM   9691  O  O     . VAL E  1 113 ? 22.815  -42.205 -9.754  1.00 139.15 ? 111 VAL C O     1 
ATOM   9692  C  CB    . VAL E  1 113 ? 25.821  -42.048 -9.170  1.00 96.95  ? 111 VAL C CB    1 
ATOM   9693  C  CG1   . VAL E  1 113 ? 26.294  -42.683 -10.468 1.00 100.06 ? 111 VAL C CG1   1 
ATOM   9694  C  CG2   . VAL E  1 113 ? 27.000  -41.524 -8.364  1.00 86.03  ? 111 VAL C CG2   1 
ATOM   9695  N  N     . GLY E  1 114 ? 23.524  -40.975 -11.507 1.00 114.62 ? 112 GLY C N     1 
ATOM   9696  C  CA    . GLY E  1 114 ? 22.451  -41.438 -12.371 1.00 106.20 ? 112 GLY C CA    1 
ATOM   9697  C  C     . GLY E  1 114 ? 22.747  -42.823 -12.926 1.00 104.96 ? 112 GLY C C     1 
ATOM   9698  O  O     . GLY E  1 114 ? 23.859  -43.116 -13.367 1.00 105.77 ? 112 GLY C O     1 
ATOM   9699  N  N     . ASP E  1 115 ? 21.725  -43.678 -12.900 1.00 106.39 ? 113 ASP C N     1 
ATOM   9700  C  CA    . ASP E  1 115 ? 21.833  -45.076 -13.318 1.00 115.21 ? 113 ASP C CA    1 
ATOM   9701  C  C     . ASP E  1 115 ? 22.988  -45.768 -12.591 1.00 111.87 ? 113 ASP C C     1 
ATOM   9702  O  O     . ASP E  1 115 ? 24.002  -46.153 -13.175 1.00 113.66 ? 113 ASP C O     1 
ATOM   9703  C  CB    . ASP E  1 115 ? 21.989  -45.181 -14.839 1.00 127.83 ? 113 ASP C CB    1 
ATOM   9704  C  CG    . ASP E  1 115 ? 20.745  -44.738 -15.584 1.00 135.51 ? 113 ASP C CG    1 
ATOM   9705  O  OD1   . ASP E  1 115 ? 19.636  -44.880 -15.028 1.00 136.49 ? 113 ASP C OD1   1 
ATOM   9706  O  OD2   . ASP E  1 115 ? 20.877  -44.251 -16.727 1.00 136.49 ? 113 ASP C OD2   1 
ATOM   9707  N  N     . ALA E  1 116 ? 22.798  -45.906 -11.279 1.00 105.09 ? 114 ALA C N     1 
ATOM   9708  C  CA    . ALA E  1 116 ? 23.811  -46.479 -10.403 1.00 97.89  ? 114 ALA C CA    1 
ATOM   9709  C  C     . ALA E  1 116 ? 24.153  -47.907 -10.804 1.00 99.03  ? 114 ALA C C     1 
ATOM   9710  O  O     . ALA E  1 116 ? 25.263  -48.177 -11.274 1.00 96.96  ? 114 ALA C O     1 
ATOM   9711  C  CB    . ALA E  1 116 ? 23.340  -46.436 -8.948  1.00 99.65  ? 114 ALA C CB    1 
ATOM   9712  N  N     . TYR E  1 117 ? 23.201  -48.828 -10.628 1.00 102.04 ? 115 TYR C N     1 
ATOM   9713  C  CA    . TYR E  1 117 ? 23.464  -50.232 -10.931 1.00 101.99 ? 115 TYR C CA    1 
ATOM   9714  C  C     . TYR E  1 117 ? 23.734  -50.448 -12.414 1.00 99.65  ? 115 TYR C C     1 
ATOM   9715  O  O     . TYR E  1 117 ? 24.413  -51.411 -12.786 1.00 98.97  ? 115 TYR C O     1 
ATOM   9716  C  CB    . TYR E  1 117 ? 22.288  -51.102 -10.482 1.00 104.91 ? 115 TYR C CB    1 
ATOM   9717  C  CG    . TYR E  1 117 ? 22.096  -51.194 -8.983  1.00 105.94 ? 115 TYR C CG    1 
ATOM   9718  C  CD1   . TYR E  1 117 ? 23.020  -50.645 -8.103  1.00 96.95  ? 115 TYR C CD1   1 
ATOM   9719  C  CD2   . TYR E  1 117 ? 20.990  -51.843 -8.449  1.00 110.15 ? 115 TYR C CD2   1 
ATOM   9720  C  CE1   . TYR E  1 117 ? 22.842  -50.732 -6.734  1.00 91.18  ? 115 TYR C CE1   1 
ATOM   9721  C  CE2   . TYR E  1 117 ? 20.805  -51.937 -7.085  1.00 104.98 ? 115 TYR C CE2   1 
ATOM   9722  C  CZ    . TYR E  1 117 ? 21.733  -51.380 -6.231  1.00 98.75  ? 115 TYR C CZ    1 
ATOM   9723  O  OH    . TYR E  1 117 ? 21.548  -51.472 -4.871  1.00 94.38  ? 115 TYR C OH    1 
ATOM   9724  N  N     . PHE E  1 118 ? 23.215  -49.571 -13.271 1.00 103.81 ? 116 PHE C N     1 
ATOM   9725  C  CA    . PHE E  1 118 ? 23.391  -49.707 -14.711 1.00 111.64 ? 116 PHE C CA    1 
ATOM   9726  C  C     . PHE E  1 118 ? 24.733  -49.178 -15.199 1.00 109.36 ? 116 PHE C C     1 
ATOM   9727  O  O     . PHE E  1 118 ? 24.991  -49.214 -16.407 1.00 114.43 ? 116 PHE C O     1 
ATOM   9728  C  CB    . PHE E  1 118 ? 22.254  -48.992 -15.447 1.00 115.31 ? 116 PHE C CB    1 
ATOM   9729  C  CG    . PHE E  1 118 ? 20.887  -49.519 -15.110 1.00 122.11 ? 116 PHE C CG    1 
ATOM   9730  C  CD1   . PHE E  1 118 ? 20.713  -50.836 -14.711 1.00 124.71 ? 116 PHE C CD1   1 
ATOM   9731  C  CD2   . PHE E  1 118 ? 19.776  -48.697 -15.189 1.00 123.35 ? 116 PHE C CD2   1 
ATOM   9732  C  CE1   . PHE E  1 118 ? 19.457  -51.321 -14.399 1.00 124.33 ? 116 PHE C CE1   1 
ATOM   9733  C  CE2   . PHE E  1 118 ? 18.517  -49.177 -14.879 1.00 125.37 ? 116 PHE C CE2   1 
ATOM   9734  C  CZ    . PHE E  1 118 ? 18.358  -50.490 -14.484 1.00 126.16 ? 116 PHE C CZ    1 
ATOM   9735  N  N     . SER E  1 119 ? 25.587  -48.693 -14.300 1.00 107.89 ? 117 SER C N     1 
ATOM   9736  C  CA    . SER E  1 119 ? 26.910  -48.202 -14.659 1.00 101.14 ? 117 SER C CA    1 
ATOM   9737  C  C     . SER E  1 119 ? 28.030  -49.089 -14.136 1.00 100.65 ? 117 SER C C     1 
ATOM   9738  O  O     . SER E  1 119 ? 29.205  -48.754 -14.318 1.00 102.37 ? 117 SER C O     1 
ATOM   9739  C  CB    . SER E  1 119 ? 27.101  -46.772 -14.140 1.00 99.20  ? 117 SER C CB    1 
ATOM   9740  O  OG    . SER E  1 119 ? 26.058  -45.924 -14.587 1.00 102.10 ? 117 SER C OG    1 
ATOM   9741  N  N     . VAL E  1 120 ? 27.702  -50.200 -13.494 1.00 100.04 ? 118 VAL C N     1 
ATOM   9742  C  CA    . VAL E  1 120 ? 28.682  -51.129 -12.936 1.00 98.18  ? 118 VAL C CA    1 
ATOM   9743  C  C     . VAL E  1 120 ? 28.601  -52.429 -13.724 1.00 95.05  ? 118 VAL C C     1 
ATOM   9744  O  O     . VAL E  1 120 ? 27.507  -52.987 -13.862 1.00 97.93  ? 118 VAL C O     1 
ATOM   9745  C  CB    . VAL E  1 120 ? 28.437  -51.387 -11.437 1.00 95.44  ? 118 VAL C CB    1 
ATOM   9746  C  CG1   . VAL E  1 120 ? 29.380  -52.460 -10.917 1.00 90.16  ? 118 VAL C CG1   1 
ATOM   9747  C  CG2   . VAL E  1 120 ? 28.605  -50.100 -10.650 1.00 88.22  ? 118 VAL C CG2   1 
ATOM   9748  N  N     . PRO E  1 121 ? 29.712  -52.941 -14.246 1.00 98.73  ? 119 PRO C N     1 
ATOM   9749  C  CA    . PRO E  1 121 ? 29.652  -54.166 -15.049 1.00 97.74  ? 119 PRO C CA    1 
ATOM   9750  C  C     . PRO E  1 121 ? 29.347  -55.384 -14.192 1.00 99.78  ? 119 PRO C C     1 
ATOM   9751  O  O     . PRO E  1 121 ? 29.568  -55.406 -12.979 1.00 97.31  ? 119 PRO C O     1 
ATOM   9752  C  CB    . PRO E  1 121 ? 31.053  -54.256 -15.660 1.00 98.59  ? 119 PRO C CB    1 
ATOM   9753  C  CG    . PRO E  1 121 ? 31.923  -53.558 -14.670 1.00 96.18  ? 119 PRO C CG    1 
ATOM   9754  C  CD    . PRO E  1 121 ? 31.089  -52.434 -14.115 1.00 94.72  ? 119 PRO C CD    1 
ATOM   9755  N  N     . LEU E  1 122 ? 28.826  -56.411 -14.852 1.00 101.35 ? 120 LEU C N     1 
ATOM   9756  C  CA    . LEU E  1 122 ? 28.509  -57.680 -14.216 1.00 102.95 ? 120 LEU C CA    1 
ATOM   9757  C  C     . LEU E  1 122 ? 29.554  -58.725 -14.590 1.00 111.89 ? 120 LEU C C     1 
ATOM   9758  O  O     . LEU E  1 122 ? 30.255  -58.602 -15.598 1.00 119.21 ? 120 LEU C O     1 
ATOM   9759  C  CB    . LEU E  1 122 ? 27.109  -58.152 -14.626 1.00 107.20 ? 120 LEU C CB    1 
ATOM   9760  C  CG    . LEU E  1 122 ? 26.471  -59.299 -13.837 1.00 107.08 ? 120 LEU C CG    1 
ATOM   9761  C  CD1   . LEU E  1 122 ? 26.320  -58.929 -12.369 1.00 100.34 ? 120 LEU C CD1   1 
ATOM   9762  C  CD2   . LEU E  1 122 ? 25.126  -59.681 -14.437 1.00 108.38 ? 120 LEU C CD2   1 
ATOM   9763  N  N     . ASP E  1 123 ? 29.660  -59.753 -13.750 1.00 112.13 ? 121 ASP C N     1 
ATOM   9764  C  CA    . ASP E  1 123 ? 30.590  -60.844 -14.011 1.00 121.54 ? 121 ASP C CA    1 
ATOM   9765  C  C     . ASP E  1 123 ? 30.278  -61.492 -15.354 1.00 120.73 ? 121 ASP C C     1 
ATOM   9766  O  O     . ASP E  1 123 ? 29.117  -61.765 -15.671 1.00 121.24 ? 121 ASP C O     1 
ATOM   9767  C  CB    . ASP E  1 123 ? 30.513  -61.880 -12.888 1.00 124.28 ? 121 ASP C CB    1 
ATOM   9768  C  CG    . ASP E  1 123 ? 31.506  -63.010 -13.067 1.00 135.91 ? 121 ASP C CG    1 
ATOM   9769  O  OD1   . ASP E  1 123 ? 32.722  -62.764 -12.916 1.00 137.93 ? 121 ASP C OD1   1 
ATOM   9770  O  OD2   . ASP E  1 123 ? 31.072  -64.145 -13.357 1.00 141.90 ? 121 ASP C OD2   1 
ATOM   9771  N  N     . GLU E  1 124 ? 31.324  -61.729 -16.148 1.00 115.57 ? 122 GLU C N     1 
ATOM   9772  C  CA    . GLU E  1 124 ? 31.135  -62.243 -17.502 1.00 120.01 ? 122 GLU C CA    1 
ATOM   9773  C  C     . GLU E  1 124 ? 30.466  -63.612 -17.485 1.00 124.54 ? 122 GLU C C     1 
ATOM   9774  O  O     . GLU E  1 124 ? 29.503  -63.855 -18.221 1.00 120.43 ? 122 GLU C O     1 
ATOM   9775  C  CB    . GLU E  1 124 ? 32.479  -62.309 -18.229 1.00 122.05 ? 122 GLU C CB    1 
ATOM   9776  C  CG    . GLU E  1 124 ? 32.387  -62.810 -19.662 1.00 128.17 ? 122 GLU C CG    1 
ATOM   9777  C  CD    . GLU E  1 124 ? 31.655  -61.844 -20.574 1.00 132.44 ? 122 GLU C CD    1 
ATOM   9778  O  OE1   . GLU E  1 124 ? 31.719  -60.621 -20.324 1.00 130.65 ? 122 GLU C OE1   1 
ATOM   9779  O  OE2   . GLU E  1 124 ? 31.012  -62.308 -21.539 1.00 133.42 ? 122 GLU C OE2   1 
ATOM   9780  N  N     . ASP E  1 125 ? 30.962  -64.522 -16.645 1.00 123.51 ? 123 ASP C N     1 
ATOM   9781  C  CA    . ASP E  1 125 ? 30.405  -65.868 -16.583 1.00 129.18 ? 123 ASP C CA    1 
ATOM   9782  C  C     . ASP E  1 125 ? 29.054  -65.918 -15.882 1.00 120.61 ? 123 ASP C C     1 
ATOM   9783  O  O     . ASP E  1 125 ? 28.435  -66.988 -15.847 1.00 118.99 ? 123 ASP C O     1 
ATOM   9784  C  CB    . ASP E  1 125 ? 31.385  -66.809 -15.880 1.00 137.67 ? 123 ASP C CB    1 
ATOM   9785  C  CG    . ASP E  1 125 ? 32.696  -66.949 -16.628 1.00 140.80 ? 123 ASP C CG    1 
ATOM   9786  O  OD1   . ASP E  1 125 ? 32.684  -66.874 -17.874 1.00 141.59 ? 123 ASP C OD1   1 
ATOM   9787  O  OD2   . ASP E  1 125 ? 33.741  -67.135 -15.968 1.00 141.49 ? 123 ASP C OD2   1 
ATOM   9788  N  N     . PHE E  1 126 ? 28.581  -64.800 -15.331 1.00 115.81 ? 124 PHE C N     1 
ATOM   9789  C  CA    . PHE E  1 126 ? 27.313  -64.766 -14.617 1.00 108.14 ? 124 PHE C CA    1 
ATOM   9790  C  C     . PHE E  1 126 ? 26.186  -64.130 -15.420 1.00 108.13 ? 124 PHE C C     1 
ATOM   9791  O  O     . PHE E  1 126 ? 25.016  -64.324 -15.073 1.00 108.35 ? 124 PHE C O     1 
ATOM   9792  C  CB    . PHE E  1 126 ? 27.476  -64.014 -13.289 1.00 107.40 ? 124 PHE C CB    1 
ATOM   9793  C  CG    . PHE E  1 126 ? 26.363  -64.261 -12.307 1.00 105.35 ? 124 PHE C CG    1 
ATOM   9794  C  CD1   . PHE E  1 126 ? 26.376  -65.383 -11.496 1.00 104.44 ? 124 PHE C CD1   1 
ATOM   9795  C  CD2   . PHE E  1 126 ? 25.311  -63.367 -12.187 1.00 104.36 ? 124 PHE C CD2   1 
ATOM   9796  C  CE1   . PHE E  1 126 ? 25.357  -65.614 -10.589 1.00 103.88 ? 124 PHE C CE1   1 
ATOM   9797  C  CE2   . PHE E  1 126 ? 24.288  -63.593 -11.283 1.00 100.64 ? 124 PHE C CE2   1 
ATOM   9798  C  CZ    . PHE E  1 126 ? 24.312  -64.717 -10.483 1.00 103.83 ? 124 PHE C CZ    1 
ATOM   9799  N  N     . ARG E  1 127 ? 26.508  -63.391 -16.486 1.00 122.24 ? 125 ARG C N     1 
ATOM   9800  C  CA    . ARG E  1 127 ? 25.473  -62.721 -17.270 1.00 119.11 ? 125 ARG C CA    1 
ATOM   9801  C  C     . ARG E  1 127 ? 24.495  -63.711 -17.887 1.00 128.47 ? 125 ARG C C     1 
ATOM   9802  O  O     . ARG E  1 127 ? 23.336  -63.361 -18.140 1.00 130.19 ? 125 ARG C O     1 
ATOM   9803  C  CB    . ARG E  1 127 ? 26.113  -61.866 -18.366 1.00 114.70 ? 125 ARG C CB    1 
ATOM   9804  C  CG    . ARG E  1 127 ? 27.046  -60.782 -17.855 1.00 113.38 ? 125 ARG C CG    1 
ATOM   9805  C  CD    . ARG E  1 127 ? 27.723  -60.045 -19.001 1.00 111.23 ? 125 ARG C CD    1 
ATOM   9806  N  NE    . ARG E  1 127 ? 28.681  -59.052 -18.523 1.00 114.59 ? 125 ARG C NE    1 
ATOM   9807  C  CZ    . ARG E  1 127 ? 29.408  -58.270 -19.315 1.00 118.44 ? 125 ARG C CZ    1 
ATOM   9808  N  NH1   . ARG E  1 127 ? 29.289  -58.362 -20.632 1.00 129.78 ? 125 ARG C NH1   1 
ATOM   9809  N  NH2   . ARG E  1 127 ? 30.256  -57.395 -18.791 1.00 115.02 ? 125 ARG C NH2   1 
ATOM   9810  N  N     . LYS E  1 128 ? 24.936  -64.948 -18.133 1.00 135.86 ? 126 LYS C N     1 
ATOM   9811  C  CA    . LYS E  1 128 ? 24.074  -65.929 -18.784 1.00 137.20 ? 126 LYS C CA    1 
ATOM   9812  C  C     . LYS E  1 128 ? 22.896  -66.328 -17.903 1.00 138.78 ? 126 LYS C C     1 
ATOM   9813  O  O     . LYS E  1 128 ? 21.850  -66.739 -18.421 1.00 134.77 ? 126 LYS C O     1 
ATOM   9814  C  CB    . LYS E  1 128 ? 24.888  -67.164 -19.169 1.00 133.16 ? 126 LYS C CB    1 
ATOM   9815  C  CG    . LYS E  1 128 ? 25.598  -67.826 -17.999 1.00 132.48 ? 126 LYS C CG    1 
ATOM   9816  C  CD    . LYS E  1 128 ? 26.465  -68.986 -18.457 1.00 131.52 ? 126 LYS C CD    1 
ATOM   9817  C  CE    . LYS E  1 128 ? 27.537  -68.523 -19.430 1.00 134.19 ? 126 LYS C CE    1 
ATOM   9818  N  NZ    . LYS E  1 128 ? 28.411  -67.476 -18.834 1.00 129.96 ? 126 LYS C NZ    1 
ATOM   9819  N  N     . TYR E  1 129 ? 23.038  -66.215 -16.585 1.00 138.46 ? 127 TYR C N     1 
ATOM   9820  C  CA    . TYR E  1 129 ? 21.980  -66.597 -15.658 1.00 138.66 ? 127 TYR C CA    1 
ATOM   9821  C  C     . TYR E  1 129 ? 20.927  -65.511 -15.476 1.00 133.07 ? 127 TYR C C     1 
ATOM   9822  O  O     . TYR E  1 129 ? 20.032  -65.672 -14.639 1.00 121.04 ? 127 TYR C O     1 
ATOM   9823  C  CB    . TYR E  1 129 ? 22.582  -66.969 -14.300 1.00 138.67 ? 127 TYR C CB    1 
ATOM   9824  C  CG    . TYR E  1 129 ? 23.582  -68.100 -14.368 1.00 149.21 ? 127 TYR C CG    1 
ATOM   9825  C  CD1   . TYR E  1 129 ? 23.165  -69.424 -14.329 1.00 152.07 ? 127 TYR C CD1   1 
ATOM   9826  C  CD2   . TYR E  1 129 ? 24.943  -67.844 -14.471 1.00 154.81 ? 127 TYR C CD2   1 
ATOM   9827  C  CE1   . TYR E  1 129 ? 24.076  -70.462 -14.391 1.00 156.60 ? 127 TYR C CE1   1 
ATOM   9828  C  CE2   . TYR E  1 129 ? 25.861  -68.875 -14.534 1.00 158.58 ? 127 TYR C CE2   1 
ATOM   9829  C  CZ    . TYR E  1 129 ? 25.423  -70.181 -14.493 1.00 159.83 ? 127 TYR C CZ    1 
ATOM   9830  O  OH    . TYR E  1 129 ? 26.334  -71.209 -14.555 1.00 164.21 ? 127 TYR C OH    1 
ATOM   9831  N  N     . THR E  1 130 ? 21.010  -64.421 -16.234 1.00 141.96 ? 128 THR C N     1 
ATOM   9832  C  CA    . THR E  1 130 ? 20.054  -63.317 -16.164 1.00 147.77 ? 128 THR C CA    1 
ATOM   9833  C  C     . THR E  1 130 ? 19.367  -63.217 -17.522 1.00 165.88 ? 128 THR C C     1 
ATOM   9834  O  O     . THR E  1 130 ? 19.808  -62.471 -18.399 1.00 176.70 ? 128 THR C O     1 
ATOM   9835  C  CB    . THR E  1 130 ? 20.747  -62.006 -15.788 1.00 138.34 ? 128 THR C CB    1 
ATOM   9836  O  OG1   . THR E  1 130 ? 21.714  -61.670 -16.791 1.00 135.96 ? 128 THR C OG1   1 
ATOM   9837  C  CG2   . THR E  1 130 ? 21.446  -62.138 -14.444 1.00 127.65 ? 128 THR C CG2   1 
ATOM   9838  N  N     . ALA E  1 131 ? 18.283  -63.969 -17.694 1.00 171.34 ? 129 ALA C N     1 
ATOM   9839  C  CA    . ALA E  1 131 ? 17.534  -63.997 -18.941 1.00 177.71 ? 129 ALA C CA    1 
ATOM   9840  C  C     . ALA E  1 131 ? 16.095  -63.572 -18.689 1.00 177.09 ? 129 ALA C C     1 
ATOM   9841  O  O     . ALA E  1 131 ? 15.488  -63.963 -17.686 1.00 177.33 ? 129 ALA C O     1 
ATOM   9842  C  CB    . ALA E  1 131 ? 17.567  -65.391 -19.573 1.00 181.09 ? 129 ALA C CB    1 
ATOM   9843  N  N     . PHE E  1 132 ? 15.552  -62.773 -19.606 1.00 178.20 ? 130 PHE C N     1 
ATOM   9844  C  CA    . PHE E  1 132 ? 14.195  -62.264 -19.469 1.00 175.82 ? 130 PHE C CA    1 
ATOM   9845  C  C     . PHE E  1 132 ? 13.698  -61.806 -20.833 1.00 177.60 ? 130 PHE C C     1 
ATOM   9846  O  O     . PHE E  1 132 ? 14.439  -61.174 -21.590 1.00 180.71 ? 130 PHE C O     1 
ATOM   9847  C  CB    . PHE E  1 132 ? 14.127  -61.114 -18.454 1.00 170.64 ? 130 PHE C CB    1 
ATOM   9848  C  CG    . PHE E  1 132 ? 14.952  -59.912 -18.828 1.00 168.82 ? 130 PHE C CG    1 
ATOM   9849  C  CD1   . PHE E  1 132 ? 16.330  -59.922 -18.680 1.00 168.57 ? 130 PHE C CD1   1 
ATOM   9850  C  CD2   . PHE E  1 132 ? 14.346  -58.763 -19.308 1.00 167.80 ? 130 PHE C CD2   1 
ATOM   9851  C  CE1   . PHE E  1 132 ? 17.088  -58.816 -19.019 1.00 167.11 ? 130 PHE C CE1   1 
ATOM   9852  C  CE2   . PHE E  1 132 ? 15.099  -57.652 -19.644 1.00 165.94 ? 130 PHE C CE2   1 
ATOM   9853  C  CZ    . PHE E  1 132 ? 16.471  -57.680 -19.501 1.00 165.17 ? 130 PHE C CZ    1 
ATOM   9854  N  N     . THR E  1 133 ? 12.445  -62.133 -21.136 1.00 180.52 ? 131 THR C N     1 
ATOM   9855  C  CA    . THR E  1 133 ? 11.821  -61.778 -22.402 1.00 184.74 ? 131 THR C CA    1 
ATOM   9856  C  C     . THR E  1 133 ? 10.974  -60.521 -22.242 1.00 195.86 ? 131 THR C C     1 
ATOM   9857  O  O     . THR E  1 133 ? 10.383  -60.278 -21.187 1.00 186.56 ? 131 THR C O     1 
ATOM   9858  C  CB    . THR E  1 133 ? 10.948  -62.922 -22.927 1.00 176.16 ? 131 THR C CB    1 
ATOM   9859  O  OG1   . THR E  1 133 ? 9.840   -63.124 -22.042 1.00 176.62 ? 131 THR C OG1   1 
ATOM   9860  C  CG2   . THR E  1 133 ? 11.752  -64.209 -23.019 1.00 166.51 ? 131 THR C CG2   1 
ATOM   9861  N  N     . ILE E  1 134 ? 10.921  -59.724 -23.305 1.00 206.98 ? 132 ILE C N     1 
ATOM   9862  C  CA    . ILE E  1 134 ? 10.156  -58.479 -23.305 1.00 219.00 ? 132 ILE C CA    1 
ATOM   9863  C  C     . ILE E  1 134 ? 9.210   -58.484 -24.500 1.00 225.92 ? 132 ILE C C     1 
ATOM   9864  O  O     . ILE E  1 134 ? 9.631   -58.174 -25.624 1.00 231.36 ? 132 ILE C O     1 
ATOM   9865  C  CB    . ILE E  1 134 ? 11.074  -57.246 -23.343 1.00 222.60 ? 132 ILE C CB    1 
ATOM   9866  C  CG1   . ILE E  1 134 ? 12.124  -57.309 -22.232 1.00 223.07 ? 132 ILE C CG1   1 
ATOM   9867  C  CG2   . ILE E  1 134 ? 10.254  -55.970 -23.226 1.00 222.11 ? 132 ILE C CG2   1 
ATOM   9868