data_6B0O
# 
_entry.id   6B0O 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.321 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6B0O         
WWPDB D_1000229779 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 6B0P unspecified 
PDB . 6B0Q unspecified 
PDB . 6B0R unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6B0O 
_pdbx_database_status.recvd_initial_deposition_date   2017-09-14 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Horton, J.R.' 1 ? 
'Cheng, X.'    2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_id_ASTM           NARHAD 
_citation.journal_id_CSD            0389 
_citation.journal_id_ISSN           1362-4962 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            46 
_citation.language                  ? 
_citation.page_first                3864 
_citation.page_last                 3877 
_citation.title                     
;Role for first zinc finger of WT1 in DNA sequence specificity: Denys-Drash syndrome-associated WT1 mutant in ZF1 enhances affinity for a subset of WT1 binding sites.
;
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1093/nar/gkx1274 
_citation.pdbx_database_id_PubMed   29294058 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Wang, D.'         1 ? 
primary 'Horton, J.R.'     2 ? 
primary 'Zheng, Y.'        3 ? 
primary 'Blumenthal, R.M.' 4 ? 
primary 'Zhang, X.'        5 ? 
primary 'Cheng, X.'        6 ? 
# 
_cell.angle_alpha                  88.28 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   77.71 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  85.81 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6B0O 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     36.927 
_cell.length_a_esd                 ? 
_cell.length_b                     42.657 
_cell.length_b_esd                 ? 
_cell.length_c                     71.821 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        2 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6B0O 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Wilms tumor protein'                                   14626.925 2   ? ? 'UNP residues 304-420' ? 
2 polymer     syn 
;DNA (5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*AP*GP*TP*GP*T)-3')
;
4087.656  2   ? ? ?                      ? 
3 polymer     syn 
;DNA (5'-D(*TP*AP*CP*AP*CP*TP*CP*CP*CP*AP*CP*GP*C)-3')
;
3856.527  2   ? ? ?                      ? 
4 non-polymer syn 'ZINC ION'                                              65.409    8   ? ? ?                      ? 
5 non-polymer syn 1,2-ETHANEDIOL                                          62.068    2   ? ? ?                      ? 
6 water       nat water                                                   18.015    362 ? ? ?                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        WT33 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;HMRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHL
KTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQR
;
;HMRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHL
KTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQR
;
A,D ? 
2 polydeoxyribonucleotide no no '(DA)(DG)(DC)(DG)(DT)(DG)(DG)(DG)(DA)(DG)(DT)(DG)(DT)' AGCGTGGGAGTGT B,E ? 
3 polydeoxyribonucleotide no no '(DT)(DA)(DC)(DA)(DC)(DT)(DC)(DC)(DC)(DA)(DC)(DG)(DC)' TACACTCCCACGC C,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   HIS n 
1 2   MET n 
1 3   ARG n 
1 4   PRO n 
1 5   PHE n 
1 6   MET n 
1 7   CYS n 
1 8   ALA n 
1 9   TYR n 
1 10  PRO n 
1 11  GLY n 
1 12  CYS n 
1 13  ASN n 
1 14  LYS n 
1 15  ARG n 
1 16  TYR n 
1 17  PHE n 
1 18  LYS n 
1 19  LEU n 
1 20  SER n 
1 21  HIS n 
1 22  LEU n 
1 23  GLN n 
1 24  MET n 
1 25  HIS n 
1 26  SER n 
1 27  ARG n 
1 28  LYS n 
1 29  HIS n 
1 30  THR n 
1 31  GLY n 
1 32  GLU n 
1 33  LYS n 
1 34  PRO n 
1 35  TYR n 
1 36  GLN n 
1 37  CYS n 
1 38  ASP n 
1 39  PHE n 
1 40  LYS n 
1 41  ASP n 
1 42  CYS n 
1 43  GLU n 
1 44  ARG n 
1 45  ARG n 
1 46  PHE n 
1 47  SER n 
1 48  ARG n 
1 49  SER n 
1 50  ASP n 
1 51  GLN n 
1 52  LEU n 
1 53  LYS n 
1 54  ARG n 
1 55  HIS n 
1 56  GLN n 
1 57  ARG n 
1 58  ARG n 
1 59  HIS n 
1 60  THR n 
1 61  GLY n 
1 62  VAL n 
1 63  LYS n 
1 64  PRO n 
1 65  PHE n 
1 66  GLN n 
1 67  CYS n 
1 68  LYS n 
1 69  THR n 
1 70  CYS n 
1 71  GLN n 
1 72  ARG n 
1 73  LYS n 
1 74  PHE n 
1 75  SER n 
1 76  ARG n 
1 77  SER n 
1 78  ASP n 
1 79  HIS n 
1 80  LEU n 
1 81  LYS n 
1 82  THR n 
1 83  HIS n 
1 84  THR n 
1 85  ARG n 
1 86  THR n 
1 87  HIS n 
1 88  THR n 
1 89  GLY n 
1 90  GLU n 
1 91  LYS n 
1 92  PRO n 
1 93  PHE n 
1 94  SER n 
1 95  CYS n 
1 96  ARG n 
1 97  TRP n 
1 98  PRO n 
1 99  SER n 
1 100 CYS n 
1 101 GLN n 
1 102 LYS n 
1 103 LYS n 
1 104 PHE n 
1 105 ALA n 
1 106 ARG n 
1 107 SER n 
1 108 ASP n 
1 109 GLU n 
1 110 LEU n 
1 111 VAL n 
1 112 ARG n 
1 113 HIS n 
1 114 HIS n 
1 115 ASN n 
1 116 MET n 
1 117 HIS n 
1 118 GLN n 
1 119 ARG n 
2 1   DA  n 
2 2   DG  n 
2 3   DC  n 
2 4   DG  n 
2 5   DT  n 
2 6   DG  n 
2 7   DG  n 
2 8   DG  n 
2 9   DA  n 
2 10  DG  n 
2 11  DT  n 
2 12  DG  n 
2 13  DT  n 
3 1   DT  n 
3 2   DA  n 
3 3   DC  n 
3 4   DA  n 
3 5   DC  n 
3 6   DT  n 
3 7   DC  n 
3 8   DC  n 
3 9   DC  n 
3 10  DA  n 
3 11  DC  n 
3 12  DG  n 
3 13  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   119 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 WT1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     866768 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 13 'Homo sapiens' ? 9606 ? 
3 1 sample 1 13 'Homo sapiens' ? 9606 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP WT1_HUMAN P19544 P19544-2 1 
;RPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKT
HTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQR
;
304 
2 PDB 6B0O      6B0O   ?        2 ? 1   
3 PDB 6B0O      6B0O   ?        3 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6B0O A 3 ? 119 ? P19544 304 ? 420 ? 321 437 
2 2 6B0O B 1 ? 13  ? 6B0O   1   ? 13  ? 1   13  
3 3 6B0O C 1 ? 13  ? 6B0O   1   ? 13  ? 1   13  
4 1 6B0O D 3 ? 119 ? P19544 304 ? 420 ? 321 437 
5 2 6B0O E 1 ? 13  ? 6B0O   1   ? 13  ? 1   13  
6 3 6B0O F 1 ? 13  ? 6B0O   1   ? 13  ? 1   13  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6B0O HIS A 1 ? UNP P19544 ? ? 'expression tag' 319 1 
1 6B0O MET A 2 ? UNP P19544 ? ? 'expression tag' 320 2 
4 6B0O HIS D 1 ? UNP P19544 ? ? 'expression tag' 319 3 
4 6B0O MET D 2 ? UNP P19544 ? ? 'expression tag' 320 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ?                 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ?                 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                 'C10 H15 N2 O8 P' 322.208 
EDO non-polymer         . 1,2-ETHANEDIOL                       'ETHYLENE GLYCOL' 'C2 H6 O2'        62.068  
GLN 'L-peptide linking' y GLUTAMINE                            ?                 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ?                 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ?                 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ?                 'H2 O'            18.015  
LEU 'L-peptide linking' y LEUCINE                              ?                 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ?                 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ?                 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ?                 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ?                 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ?                 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ?                 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ?                 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ?                 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6B0O 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.47 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         50.13 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;25% PEG 3350
0.2M Ammonium Acetate
0.1M Bis-Tris
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RAYONIX MX300-HS' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-11-29 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 22-BM' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.00000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   22-BM 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6B0O 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.55 
_reflns.d_resolution_low                 29.59 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       59787 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             96.8 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.3 
_reflns.pdbx_Rmerge_I_obs                0.044 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            19.1 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  0.028 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.55 
_reflns_shell.d_res_low                   1.61 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.5 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           5883 
_reflns_shell.percent_possible_all        95.0 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.427 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             3.3 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             0.327 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.793 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6B0O 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.552 
_refine.ls_d_res_low                             29.588 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     118578 
_refine.ls_number_reflns_R_free                  3935 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    95.92 
_refine.ls_percent_reflns_R_free                 3.32 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1933 
_refine.ls_R_factor_R_free                       0.2062 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1928 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.96 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      5kl2 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 22.99 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.16 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1942 
_refine_hist.pdbx_number_atoms_nucleic_acid   1054 
_refine_hist.pdbx_number_atoms_ligand         16 
_refine_hist.number_atoms_solvent             362 
_refine_hist.number_atoms_total               3374 
_refine_hist.d_res_high                       1.552 
_refine_hist.d_res_low                        29.588 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.003  ? 3220 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.528  ? 4553 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 18.295 ? 1765 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.033  ? 471  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.003  ? 407  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.5517 1.5706  . . 129 3993 93.00 . . . 0.3194 . 0.3063 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.5706 1.5905  . . 152 4076 94.00 . . . 0.2832 . 0.2906 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.5905 1.6114  . . 140 3969 95.00 . . . 0.3364 . 0.2888 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.6114 1.6335  . . 125 4088 94.00 . . . 0.2919 . 0.2580 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.6335 1.6568  . . 140 4012 95.00 . . . 0.3015 . 0.2471 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.6568 1.6815  . . 137 4063 95.00 . . . 0.2737 . 0.2439 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.6815 1.7078  . . 149 4010 94.00 . . . 0.2798 . 0.2353 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.7078 1.7358  . . 149 3961 94.00 . . . 0.2281 . 0.2275 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.7358 1.7657  . . 129 4180 95.00 . . . 0.2275 . 0.2283 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.7657 1.7978  . . 128 4038 96.00 . . . 0.2497 . 0.2260 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.7978 1.8324  . . 148 4068 96.00 . . . 0.2511 . 0.2144 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8324 1.8698  . . 134 4109 96.00 . . . 0.2241 . 0.2170 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8698 1.9105  . . 141 3991 95.00 . . . 0.2107 . 0.2245 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9105 1.9549  . . 119 4149 95.00 . . . 0.2486 . 0.2255 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9549 2.0038  . . 149 4057 96.00 . . . 0.2028 . 0.2187 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0038 2.0579  . . 135 4129 97.00 . . . 0.2036 . 0.2188 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0579 2.1185  . . 140 4078 95.00 . . . 0.2292 . 0.2121 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1185 2.1868  . . 152 4125 97.00 . . . 0.2358 . 0.2055 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1868 2.2650  . . 127 4135 96.00 . . . 0.2043 . 0.2085 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2650 2.3556  . . 155 4138 97.00 . . . 0.2313 . 0.2053 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3556 2.4628  . . 132 4161 97.00 . . . 0.2067 . 0.2072 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4628 2.5926  . . 151 4062 97.00 . . . 0.2432 . 0.2034 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5926 2.7549  . . 143 4206 97.00 . . . 0.1975 . 0.2089 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7549 2.9674  . . 138 4145 98.00 . . . 0.2462 . 0.2079 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9674 3.2657  . . 149 4212 98.00 . . . 0.1982 . 0.1973 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2657 3.7374  . . 142 4075 97.00 . . . 0.1920 . 0.1690 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7374 4.7057  . . 146 4217 98.00 . . . 0.1593 . 0.1489 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.7057 29.5933 . . 156 4196 99.00 . . . 0.1584 . 0.1485 . . . . . . . . . . 
# 
_struct.entry_id                     6B0O 
_struct.title                        
;Zinc finger Domain of WT1(-KTS form) with 12+1mer Oligonucleotide with 3' Triplet TGT
;
_struct.pdbx_descriptor              'Wilms tumor protein/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6B0O 
_struct_keywords.text            'protein-DNA complex Wilms tumor suppressor protein zinc-fingers, TRANSCRIPTION-DNA complex' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
K N N 5 ? 
L N N 5 ? 
M N N 4 ? 
N N N 4 ? 
O N N 4 ? 
P N N 4 ? 
Q N N 6 ? 
R N N 6 ? 
S N N 6 ? 
T N N 6 ? 
U N N 6 ? 
V N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 LYS A 18  ? GLY A 31  ? LYS A 336 GLY A 349 1 ? 14 
HELX_P HELX_P2  AA2 ARG A 48  ? GLN A 56  ? ARG A 366 GLN A 374 1 ? 9  
HELX_P HELX_P3  AA3 GLN A 56  ? GLY A 61  ? GLN A 374 GLY A 379 1 ? 6  
HELX_P HELX_P4  AA4 ARG A 76  ? GLY A 89  ? ARG A 394 GLY A 407 1 ? 14 
HELX_P HELX_P5  AA5 ARG A 106 ? ASN A 115 ? ARG A 424 ASN A 433 1 ? 10 
HELX_P HELX_P6  AA6 LYS D 18  ? ARG D 27  ? LYS D 336 ARG D 345 1 ? 10 
HELX_P HELX_P7  AA7 LYS D 28  ? THR D 30  ? LYS D 346 THR D 348 5 ? 3  
HELX_P HELX_P8  AA8 ARG D 48  ? GLY D 61  ? ARG D 366 GLY D 379 1 ? 14 
HELX_P HELX_P9  AA9 ARG D 76  ? GLY D 89  ? ARG D 394 GLY D 407 1 ? 14 
HELX_P HELX_P10 AB1 ARG D 106 ? HIS D 117 ? ARG D 424 HIS D 435 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A CYS 7   SG  ? ? ? 1_555 J ZN .  ZN ? ? A CYS 325 A ZN 504 1_555 ? ? ? ? ? ? ?            2.334 ? 
metalc2  metalc ? ? A CYS 12  SG  ? ? ? 1_555 J ZN .  ZN ? ? A CYS 330 A ZN 504 1_555 ? ? ? ? ? ? ?            2.345 ? 
metalc3  metalc ? ? A HIS 25  NE2 ? ? ? 1_555 J ZN .  ZN ? ? A HIS 343 A ZN 504 1_555 ? ? ? ? ? ? ?            2.096 ? 
metalc4  metalc ? ? A HIS 29  NE2 ? ? ? 1_555 J ZN .  ZN ? ? A HIS 347 A ZN 504 1_555 ? ? ? ? ? ? ?            2.053 ? 
metalc5  metalc ? ? A CYS 37  SG  ? ? ? 1_555 G ZN .  ZN ? ? A CYS 355 A ZN 501 1_555 ? ? ? ? ? ? ?            2.289 ? 
metalc6  metalc ? ? A CYS 42  SG  ? ? ? 1_555 G ZN .  ZN ? ? A CYS 360 A ZN 501 1_555 ? ? ? ? ? ? ?            2.321 ? 
metalc7  metalc ? ? A HIS 55  NE2 ? ? ? 1_555 G ZN .  ZN ? ? A HIS 373 A ZN 501 1_555 ? ? ? ? ? ? ?            2.045 ? 
metalc8  metalc ? ? A HIS 59  NE2 ? ? ? 1_555 G ZN .  ZN ? ? A HIS 377 A ZN 501 1_555 ? ? ? ? ? ? ?            2.039 ? 
metalc9  metalc ? ? A CYS 67  SG  ? ? ? 1_555 H ZN .  ZN ? ? A CYS 385 A ZN 502 1_555 ? ? ? ? ? ? ?            2.338 ? 
metalc10 metalc ? ? A CYS 70  SG  ? ? ? 1_555 H ZN .  ZN ? ? A CYS 388 A ZN 502 1_555 ? ? ? ? ? ? ?            2.315 ? 
metalc11 metalc ? ? A HIS 83  NE2 ? ? ? 1_555 H ZN .  ZN ? ? A HIS 401 A ZN 502 1_555 ? ? ? ? ? ? ?            2.142 ? 
metalc12 metalc ? ? A HIS 87  NE2 ? ? ? 1_555 H ZN .  ZN ? ? A HIS 405 A ZN 502 1_555 ? ? ? ? ? ? ?            2.089 ? 
metalc13 metalc ? ? A CYS 95  SG  ? ? ? 1_555 I ZN .  ZN ? ? A CYS 413 A ZN 503 1_555 ? ? ? ? ? ? ?            2.303 ? 
metalc14 metalc ? ? A CYS 100 SG  ? ? ? 1_555 I ZN .  ZN ? ? A CYS 418 A ZN 503 1_555 ? ? ? ? ? ? ?            2.390 ? 
metalc15 metalc ? ? A HIS 113 NE2 ? ? ? 1_555 I ZN .  ZN ? ? A HIS 431 A ZN 503 1_555 ? ? ? ? ? ? ?            2.074 ? 
metalc16 metalc ? ? A HIS 117 NE2 ? ? ? 1_555 I ZN .  ZN ? ? A HIS 435 A ZN 503 1_555 ? ? ? ? ? ? ?            2.075 ? 
metalc17 metalc ? ? D CYS 7   SG  ? ? ? 1_555 P ZN .  ZN ? ? D CYS 325 D ZN 504 1_555 ? ? ? ? ? ? ?            2.359 ? 
metalc18 metalc ? ? D CYS 12  SG  ? ? ? 1_555 P ZN .  ZN ? ? D CYS 330 D ZN 504 1_555 ? ? ? ? ? ? ?            2.300 ? 
metalc19 metalc ? ? D HIS 25  NE2 ? ? ? 1_555 P ZN .  ZN ? ? D HIS 343 D ZN 504 1_555 ? ? ? ? ? ? ?            2.113 ? 
metalc20 metalc ? ? D HIS 29  NE2 ? ? ? 1_555 P ZN .  ZN ? ? D HIS 347 D ZN 504 1_555 ? ? ? ? ? ? ?            2.114 ? 
metalc21 metalc ? ? D CYS 37  SG  ? ? ? 1_555 M ZN .  ZN ? ? D CYS 355 D ZN 501 1_555 ? ? ? ? ? ? ?            2.322 ? 
metalc22 metalc ? ? D CYS 42  SG  ? ? ? 1_555 M ZN .  ZN ? ? D CYS 360 D ZN 501 1_555 ? ? ? ? ? ? ?            2.300 ? 
metalc23 metalc ? ? D HIS 55  NE2 ? ? ? 1_555 M ZN .  ZN ? ? D HIS 373 D ZN 501 1_555 ? ? ? ? ? ? ?            2.109 ? 
metalc24 metalc ? ? D HIS 59  NE2 ? ? ? 1_555 M ZN .  ZN ? ? D HIS 377 D ZN 501 1_555 ? ? ? ? ? ? ?            2.064 ? 
metalc25 metalc ? ? D CYS 67  SG  ? ? ? 1_555 N ZN .  ZN ? ? D CYS 385 D ZN 502 1_555 ? ? ? ? ? ? ?            2.332 ? 
metalc26 metalc ? ? D CYS 70  SG  ? ? ? 1_555 N ZN .  ZN ? ? D CYS 388 D ZN 502 1_555 ? ? ? ? ? ? ?            2.310 ? 
metalc27 metalc ? ? D HIS 83  NE2 ? ? ? 1_555 N ZN .  ZN ? ? D HIS 401 D ZN 502 1_555 ? ? ? ? ? ? ?            2.106 ? 
metalc28 metalc ? ? D HIS 87  NE2 ? ? ? 1_555 N ZN .  ZN ? ? D HIS 405 D ZN 502 1_555 ? ? ? ? ? ? ?            2.096 ? 
metalc29 metalc ? ? D CYS 95  SG  ? ? ? 1_555 O ZN .  ZN ? ? D CYS 413 D ZN 503 1_555 ? ? ? ? ? ? ?            2.400 ? 
metalc30 metalc ? ? D CYS 100 SG  ? ? ? 1_555 O ZN .  ZN ? ? D CYS 418 D ZN 503 1_555 ? ? ? ? ? ? ?            2.345 ? 
metalc31 metalc ? ? D HIS 113 NE2 ? ? ? 1_555 O ZN .  ZN ? ? D HIS 431 D ZN 503 1_555 ? ? ? ? ? ? ?            2.105 ? 
metalc32 metalc ? ? D HIS 117 NE2 ? ? ? 1_555 O ZN .  ZN ? ? D HIS 435 D ZN 503 1_555 ? ? ? ? ? ? ?            2.139 ? 
hydrog1  hydrog ? ? B DG  2   N1  ? ? ? 1_555 C DC 13 N3 ? ? B DG  2   C DC 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DG  2   N2  ? ? ? 1_555 C DC 13 O2 ? ? B DG  2   C DC 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DG  2   O6  ? ? ? 1_555 C DC 13 N4 ? ? B DG  2   C DC 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DC  3   N3  ? ? ? 1_555 C DG 12 N1 ? ? B DC  3   C DG 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DC  3   N4  ? ? ? 1_555 C DG 12 O6 ? ? B DC  3   C DG 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DC  3   O2  ? ? ? 1_555 C DG 12 N2 ? ? B DC  3   C DG 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DG  4   N1  ? ? ? 1_555 C DC 11 N3 ? ? B DG  4   C DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DG  4   N2  ? ? ? 1_555 C DC 11 O2 ? ? B DG  4   C DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DG  4   O6  ? ? ? 1_555 C DC 11 N4 ? ? B DG  4   C DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DT  5   N3  ? ? ? 1_555 C DA 10 N1 ? ? B DT  5   C DA 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DT  5   O4  ? ? ? 1_555 C DA 10 N6 ? ? B DT  5   C DA 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DG  6   N1  ? ? ? 1_555 C DC 9  N3 ? ? B DG  6   C DC 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DG  6   N2  ? ? ? 1_555 C DC 9  O2 ? ? B DG  6   C DC 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DG  6   O6  ? ? ? 1_555 C DC 9  N4 ? ? B DG  6   C DC 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DG  7   N1  ? ? ? 1_555 C DC 8  N3 ? ? B DG  7   C DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DG  7   N2  ? ? ? 1_555 C DC 8  O2 ? ? B DG  7   C DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DG  7   O6  ? ? ? 1_555 C DC 8  N4 ? ? B DG  7   C DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DG  8   N1  ? ? ? 1_555 C DC 7  N3 ? ? B DG  8   C DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DG  8   N2  ? ? ? 1_555 C DC 7  O2 ? ? B DG  8   C DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DG  8   O6  ? ? ? 1_555 C DC 7  N4 ? ? B DG  8   C DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DA  9   N1  ? ? ? 1_555 C DT 6  N3 ? ? B DA  9   C DT 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DA  9   N6  ? ? ? 1_555 C DT 6  O4 ? ? B DA  9   C DT 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? B DG  10  N1  ? ? ? 1_555 C DC 5  N3 ? ? B DG  10  C DC 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? B DG  10  N2  ? ? ? 1_555 C DC 5  O2 ? ? B DG  10  C DC 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? B DG  10  O6  ? ? ? 1_555 C DC 5  N4 ? ? B DG  10  C DC 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? B DT  11  N3  ? ? ? 1_555 C DA 4  N1 ? ? B DT  11  C DA 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? B DT  11  O4  ? ? ? 1_555 C DA 4  N6 ? ? B DT  11  C DA 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? B DG  12  N1  ? ? ? 1_555 C DC 3  N3 ? ? B DG  12  C DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? B DG  12  N2  ? ? ? 1_555 C DC 3  O2 ? ? B DG  12  C DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? B DG  12  O6  ? ? ? 1_555 C DC 3  N4 ? ? B DG  12  C DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? B DT  13  N3  ? ? ? 1_555 C DA 2  N1 ? ? B DT  13  C DA 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? B DT  13  O4  ? ? ? 1_555 C DA 2  N6 ? ? B DT  13  C DA 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? E DG  2   N1  ? ? ? 1_555 F DC 13 N3 ? ? E DG  2   F DC 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? E DG  2   N2  ? ? ? 1_555 F DC 13 O2 ? ? E DG  2   F DC 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? E DG  2   O6  ? ? ? 1_555 F DC 13 N4 ? ? E DG  2   F DC 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? E DC  3   N3  ? ? ? 1_555 F DG 12 N1 ? ? E DC  3   F DG 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? E DC  3   N4  ? ? ? 1_555 F DG 12 O6 ? ? E DC  3   F DG 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? E DC  3   O2  ? ? ? 1_555 F DG 12 N2 ? ? E DC  3   F DG 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? E DG  4   N1  ? ? ? 1_555 F DC 11 N3 ? ? E DG  4   F DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? E DG  4   N2  ? ? ? 1_555 F DC 11 O2 ? ? E DG  4   F DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? E DG  4   O6  ? ? ? 1_555 F DC 11 N4 ? ? E DG  4   F DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? E DT  5   N3  ? ? ? 1_555 F DA 10 N1 ? ? E DT  5   F DA 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? E DT  5   O4  ? ? ? 1_555 F DA 10 N6 ? ? E DT  5   F DA 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? E DG  6   N1  ? ? ? 1_555 F DC 9  N3 ? ? E DG  6   F DC 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? E DG  6   N2  ? ? ? 1_555 F DC 9  O2 ? ? E DG  6   F DC 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? E DG  6   O6  ? ? ? 1_555 F DC 9  N4 ? ? E DG  6   F DC 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? E DG  7   N1  ? ? ? 1_555 F DC 8  N3 ? ? E DG  7   F DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ? ? E DG  7   N2  ? ? ? 1_555 F DC 8  O2 ? ? E DG  7   F DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ? ? E DG  7   O6  ? ? ? 1_555 F DC 8  N4 ? ? E DG  7   F DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ? ? E DG  8   N1  ? ? ? 1_555 F DC 7  N3 ? ? E DG  8   F DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ? ? E DG  8   N2  ? ? ? 1_555 F DC 7  O2 ? ? E DG  8   F DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52 hydrog ? ? E DG  8   O6  ? ? ? 1_555 F DC 7  N4 ? ? E DG  8   F DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53 hydrog ? ? E DA  9   N1  ? ? ? 1_555 F DT 6  N3 ? ? E DA  9   F DT 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54 hydrog ? ? E DA  9   N6  ? ? ? 1_555 F DT 6  O4 ? ? E DA  9   F DT 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55 hydrog ? ? E DG  10  N1  ? ? ? 1_555 F DC 5  N3 ? ? E DG  10  F DC 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56 hydrog ? ? E DG  10  N2  ? ? ? 1_555 F DC 5  O2 ? ? E DG  10  F DC 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57 hydrog ? ? E DG  10  O6  ? ? ? 1_555 F DC 5  N4 ? ? E DG  10  F DC 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58 hydrog ? ? E DT  11  N3  ? ? ? 1_555 F DA 4  N1 ? ? E DT  11  F DA 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59 hydrog ? ? E DT  11  O4  ? ? ? 1_555 F DA 4  N6 ? ? E DT  11  F DA 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60 hydrog ? ? E DG  12  N1  ? ? ? 1_555 F DC 3  N3 ? ? E DG  12  F DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61 hydrog ? ? E DG  12  N2  ? ? ? 1_555 F DC 3  O2 ? ? E DG  12  F DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62 hydrog ? ? E DG  12  O6  ? ? ? 1_555 F DC 3  N4 ? ? E DG  12  F DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63 hydrog ? ? E DT  13  N3  ? ? ? 1_555 F DA 2  N1 ? ? E DT  13  F DA 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64 hydrog ? ? E DT  13  O4  ? ? ? 1_555 F DA 2  N6 ? ? E DT  13  F DA 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 PHE A 5   ? MET A 6   ? PHE A 323 MET A 324 
AA1 2 ARG A 15  ? TYR A 16  ? ARG A 333 TYR A 334 
AA2 1 TYR A 35  ? GLN A 36  ? TYR A 353 GLN A 354 
AA2 2 ARG A 45  ? PHE A 46  ? ARG A 363 PHE A 364 
AA3 1 PHE A 65  ? GLN A 66  ? PHE A 383 GLN A 384 
AA3 2 LYS A 73  ? PHE A 74  ? LYS A 391 PHE A 392 
AA4 1 PHE A 93  ? SER A 94  ? PHE A 411 SER A 412 
AA4 2 LYS A 103 ? PHE A 104 ? LYS A 421 PHE A 422 
AA5 1 PHE D 5   ? MET D 6   ? PHE D 323 MET D 324 
AA5 2 ARG D 15  ? TYR D 16  ? ARG D 333 TYR D 334 
AA6 1 TYR D 35  ? GLN D 36  ? TYR D 353 GLN D 354 
AA6 2 ARG D 45  ? PHE D 46  ? ARG D 363 PHE D 364 
AA7 1 PHE D 65  ? GLN D 66  ? PHE D 383 GLN D 384 
AA7 2 LYS D 73  ? PHE D 74  ? LYS D 391 PHE D 392 
AA8 1 PHE D 93  ? SER D 94  ? PHE D 411 SER D 412 
AA8 2 LYS D 103 ? PHE D 104 ? LYS D 421 PHE D 422 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N PHE A 5  ? N PHE A 323 O TYR A 16  ? O TYR A 334 
AA2 1 2 N TYR A 35 ? N TYR A 353 O PHE A 46  ? O PHE A 364 
AA3 1 2 N PHE A 65 ? N PHE A 383 O PHE A 74  ? O PHE A 392 
AA4 1 2 N PHE A 93 ? N PHE A 411 O PHE A 104 ? O PHE A 422 
AA5 1 2 N PHE D 5  ? N PHE D 323 O TYR D 16  ? O TYR D 334 
AA6 1 2 N TYR D 35 ? N TYR D 353 O PHE D 46  ? O PHE D 364 
AA7 1 2 N PHE D 65 ? N PHE D 383 O PHE D 74  ? O PHE D 392 
AA8 1 2 N PHE D 93 ? N PHE D 411 O PHE D 104 ? O PHE D 422 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN  501 ? 4 'binding site for residue ZN A 501'  
AC2 Software A ZN  502 ? 4 'binding site for residue ZN A 502'  
AC3 Software A ZN  503 ? 4 'binding site for residue ZN A 503'  
AC4 Software A ZN  504 ? 4 'binding site for residue ZN A 504'  
AC5 Software A EDO 505 ? 5 'binding site for residue EDO A 505' 
AC6 Software A EDO 506 ? 6 'binding site for residue EDO A 506' 
AC7 Software D ZN  501 ? 4 'binding site for residue ZN D 501'  
AC8 Software D ZN  502 ? 4 'binding site for residue ZN D 502'  
AC9 Software D ZN  503 ? 4 'binding site for residue ZN D 503'  
AD1 Software D ZN  504 ? 4 'binding site for residue ZN D 504'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS A 37  ? CYS A 355 . ? 1_555 ? 
2  AC1 4 CYS A 42  ? CYS A 360 . ? 1_555 ? 
3  AC1 4 HIS A 55  ? HIS A 373 . ? 1_555 ? 
4  AC1 4 HIS A 59  ? HIS A 377 . ? 1_555 ? 
5  AC2 4 CYS A 67  ? CYS A 385 . ? 1_555 ? 
6  AC2 4 CYS A 70  ? CYS A 388 . ? 1_555 ? 
7  AC2 4 HIS A 83  ? HIS A 401 . ? 1_555 ? 
8  AC2 4 HIS A 87  ? HIS A 405 . ? 1_555 ? 
9  AC3 4 CYS A 95  ? CYS A 413 . ? 1_555 ? 
10 AC3 4 CYS A 100 ? CYS A 418 . ? 1_555 ? 
11 AC3 4 HIS A 113 ? HIS A 431 . ? 1_555 ? 
12 AC3 4 HIS A 117 ? HIS A 435 . ? 1_555 ? 
13 AC4 4 CYS A 7   ? CYS A 325 . ? 1_555 ? 
14 AC4 4 CYS A 12  ? CYS A 330 . ? 1_555 ? 
15 AC4 4 HIS A 25  ? HIS A 343 . ? 1_555 ? 
16 AC4 4 HIS A 29  ? HIS A 347 . ? 1_555 ? 
17 AC5 5 ASP A 50  ? ASP A 368 . ? 1_555 ? 
18 AC5 5 GLN A 51  ? GLN A 369 . ? 1_555 ? 
19 AC5 5 ARG A 54  ? ARG A 372 . ? 1_555 ? 
20 AC5 5 DA  B 9   ? DA  B 9   . ? 1_555 ? 
21 AC5 5 DC  C 5   ? DC  C 5   . ? 1_555 ? 
22 AC6 6 GLY A 61  ? GLY A 379 . ? 1_555 ? 
23 AC6 6 VAL A 62  ? VAL A 380 . ? 1_555 ? 
24 AC6 6 LYS A 63  ? LYS A 381 . ? 1_555 ? 
25 AC6 6 HOH Q .   ? HOH A 651 . ? 1_555 ? 
26 AC6 6 DC  F 3   ? DC  F 3   . ? 1_555 ? 
27 AC6 6 DA  F 4   ? DA  F 4   . ? 1_555 ? 
28 AC7 4 CYS D 37  ? CYS D 355 . ? 1_555 ? 
29 AC7 4 CYS D 42  ? CYS D 360 . ? 1_555 ? 
30 AC7 4 HIS D 55  ? HIS D 373 . ? 1_555 ? 
31 AC7 4 HIS D 59  ? HIS D 377 . ? 1_555 ? 
32 AC8 4 CYS D 67  ? CYS D 385 . ? 1_555 ? 
33 AC8 4 CYS D 70  ? CYS D 388 . ? 1_555 ? 
34 AC8 4 HIS D 83  ? HIS D 401 . ? 1_555 ? 
35 AC8 4 HIS D 87  ? HIS D 405 . ? 1_555 ? 
36 AC9 4 CYS D 95  ? CYS D 413 . ? 1_555 ? 
37 AC9 4 CYS D 100 ? CYS D 418 . ? 1_555 ? 
38 AC9 4 HIS D 113 ? HIS D 431 . ? 1_555 ? 
39 AC9 4 HIS D 117 ? HIS D 435 . ? 1_555 ? 
40 AD1 4 CYS D 7   ? CYS D 325 . ? 1_555 ? 
41 AD1 4 CYS D 12  ? CYS D 330 . ? 1_555 ? 
42 AD1 4 HIS D 25  ? HIS D 343 . ? 1_555 ? 
43 AD1 4 HIS D 29  ? HIS D 347 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6B0O 
_atom_sites.fract_transf_matrix[1][1]   0.027080 
_atom_sites.fract_transf_matrix[1][2]   -0.001982 
_atom_sites.fract_transf_matrix[1][3]   -0.005873 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.023505 
_atom_sites.fract_transf_matrix[2][3]   -0.000350 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014252 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . HIS A 1 1   ? -44.674 65.164 -285.617 1.00 76.12 ? 319 HIS A N     1 
ATOM   2    C  CA    . HIS A 1 1   ? -43.981 64.055 -284.973 1.00 73.68 ? 319 HIS A CA    1 
ATOM   3    C  C     . HIS A 1 1   ? -42.561 63.912 -285.510 1.00 72.75 ? 319 HIS A C     1 
ATOM   4    O  O     . HIS A 1 1   ? -41.847 62.970 -285.164 1.00 71.03 ? 319 HIS A O     1 
ATOM   5    C  CB    . HIS A 1 1   ? -44.756 62.751 -285.172 1.00 73.40 ? 319 HIS A CB    1 
ATOM   6    N  N     . MET A 1 2   ? -42.158 64.854 -286.360 1.00 72.32 ? 320 MET A N     1 
ATOM   7    C  CA    . MET A 1 2   ? -40.822 64.820 -286.935 1.00 72.09 ? 320 MET A CA    1 
ATOM   8    C  C     . MET A 1 2   ? -39.775 65.128 -285.872 1.00 70.64 ? 320 MET A C     1 
ATOM   9    O  O     . MET A 1 2   ? -39.937 66.044 -285.062 1.00 75.24 ? 320 MET A O     1 
ATOM   10   C  CB    . MET A 1 2   ? -40.712 65.818 -288.087 1.00 72.01 ? 320 MET A CB    1 
ATOM   11   N  N     . ARG A 1 3   ? -38.694 64.350 -285.879 1.00 61.81 ? 321 ARG A N     1 
ATOM   12   C  CA    . ARG A 1 3   ? -37.623 64.519 -284.911 1.00 55.88 ? 321 ARG A CA    1 
ATOM   13   C  C     . ARG A 1 3   ? -36.514 65.355 -285.532 1.00 54.87 ? 321 ARG A C     1 
ATOM   14   O  O     . ARG A 1 3   ? -35.821 64.870 -286.440 1.00 50.77 ? 321 ARG A O     1 
ATOM   15   C  CB    . ARG A 1 3   ? -37.089 63.160 -284.464 1.00 55.48 ? 321 ARG A CB    1 
ATOM   16   C  CG    . ARG A 1 3   ? -38.136 62.307 -283.763 1.00 56.67 ? 321 ARG A CG    1 
ATOM   17   C  CD    . ARG A 1 3   ? -37.720 60.849 -283.683 1.00 58.79 ? 321 ARG A CD    1 
ATOM   18   N  NE    . ARG A 1 3   ? -38.717 60.039 -282.989 1.00 61.00 ? 321 ARG A NE    1 
ATOM   19   C  CZ    . ARG A 1 3   ? -38.666 59.743 -281.694 1.00 61.63 ? 321 ARG A CZ    1 
ATOM   20   N  NH1   . ARG A 1 3   ? -37.661 60.187 -280.952 1.00 60.73 ? 321 ARG A NH1   1 
ATOM   21   N  NH2   . ARG A 1 3   ? -39.616 59.001 -281.142 1.00 59.43 ? 321 ARG A NH2   1 
ATOM   22   N  N     . PRO A 1 4   ? -36.306 66.597 -285.086 1.00 54.84 ? 322 PRO A N     1 
ATOM   23   C  CA    . PRO A 1 4   ? -35.351 67.473 -285.783 1.00 57.53 ? 322 PRO A CA    1 
ATOM   24   C  C     . PRO A 1 4   ? -33.896 67.103 -285.553 1.00 53.28 ? 322 PRO A C     1 
ATOM   25   O  O     . PRO A 1 4   ? -33.052 67.421 -286.400 1.00 51.81 ? 322 PRO A O     1 
ATOM   26   C  CB    . PRO A 1 4   ? -35.666 68.866 -285.213 1.00 58.62 ? 322 PRO A CB    1 
ATOM   27   C  CG    . PRO A 1 4   ? -36.965 68.717 -284.460 1.00 59.54 ? 322 PRO A CG    1 
ATOM   28   C  CD    . PRO A 1 4   ? -37.008 67.299 -284.001 1.00 56.30 ? 322 PRO A CD    1 
ATOM   29   N  N     . PHE A 1 5   ? -33.571 66.451 -284.438 1.00 46.65 ? 323 PHE A N     1 
ATOM   30   C  CA    . PHE A 1 5   ? -32.186 66.174 -284.059 1.00 43.19 ? 323 PHE A CA    1 
ATOM   31   C  C     . PHE A 1 5   ? -31.849 64.742 -284.462 1.00 39.94 ? 323 PHE A C     1 
ATOM   32   O  O     . PHE A 1 5   ? -32.189 63.788 -283.757 1.00 38.34 ? 323 PHE A O     1 
ATOM   33   C  CB    . PHE A 1 5   ? -31.983 66.407 -282.566 1.00 40.70 ? 323 PHE A CB    1 
ATOM   34   C  CG    . PHE A 1 5   ? -32.385 67.781 -282.115 1.00 46.26 ? 323 PHE A CG    1 
ATOM   35   C  CD1   . PHE A 1 5   ? -31.490 68.836 -282.178 1.00 54.10 ? 323 PHE A CD1   1 
ATOM   36   C  CD2   . PHE A 1 5   ? -33.664 68.021 -281.642 1.00 45.63 ? 323 PHE A CD2   1 
ATOM   37   C  CE1   . PHE A 1 5   ? -31.862 70.105 -281.772 1.00 56.93 ? 323 PHE A CE1   1 
ATOM   38   C  CE2   . PHE A 1 5   ? -34.042 69.286 -281.234 1.00 51.68 ? 323 PHE A CE2   1 
ATOM   39   C  CZ    . PHE A 1 5   ? -33.140 70.328 -281.298 1.00 56.32 ? 323 PHE A CZ    1 
ATOM   40   N  N     . MET A 1 6   ? -31.171 64.598 -285.596 1.00 41.05 ? 324 MET A N     1 
ATOM   41   C  CA    . MET A 1 6   ? -30.814 63.300 -286.147 1.00 40.53 ? 324 MET A CA    1 
ATOM   42   C  C     . MET A 1 6   ? -29.322 63.051 -285.982 1.00 39.13 ? 324 MET A C     1 
ATOM   43   O  O     . MET A 1 6   ? -28.510 63.973 -286.112 1.00 40.85 ? 324 MET A O     1 
ATOM   44   C  CB    . MET A 1 6   ? -31.192 63.211 -287.627 1.00 47.49 ? 324 MET A CB    1 
ATOM   45   N  N     . CYS A 1 7   ? -28.968 61.801 -285.697 1.00 37.42 ? 325 CYS A N     1 
ATOM   46   C  CA    . CYS A 1 7   ? -27.568 61.415 -285.601 1.00 36.36 ? 325 CYS A CA    1 
ATOM   47   C  C     . CYS A 1 7   ? -27.004 61.171 -286.995 1.00 41.69 ? 325 CYS A C     1 
ATOM   48   O  O     . CYS A 1 7   ? -27.631 60.497 -287.819 1.00 42.86 ? 325 CYS A O     1 
ATOM   49   C  CB    . CYS A 1 7   ? -27.415 60.165 -284.739 1.00 34.30 ? 325 CYS A CB    1 
ATOM   50   S  SG    . CYS A 1 7   ? -25.708 59.610 -284.555 1.00 33.75 ? 325 CYS A SG    1 
ATOM   51   N  N     . ALA A 1 8   ? -25.819 61.719 -287.256 1.00 38.46 ? 326 ALA A N     1 
ATOM   52   C  CA    . ALA A 1 8   ? -25.171 61.602 -288.555 1.00 43.28 ? 326 ALA A CA    1 
ATOM   53   C  C     . ALA A 1 8   ? -24.106 60.514 -288.588 1.00 46.13 ? 326 ALA A C     1 
ATOM   54   O  O     . ALA A 1 8   ? -23.364 60.417 -289.571 1.00 44.99 ? 326 ALA A O     1 
ATOM   55   C  CB    . ALA A 1 8   ? -24.557 62.943 -288.960 1.00 49.78 ? 326 ALA A CB    1 
ATOM   56   N  N     . TYR A 1 9   ? -24.013 59.698 -287.543 1.00 39.97 ? 327 TYR A N     1 
ATOM   57   C  CA    . TYR A 1 9   ? -23.007 58.648 -287.509 1.00 37.40 ? 327 TYR A CA    1 
ATOM   58   C  C     . TYR A 1 9   ? -23.330 57.583 -288.556 1.00 40.46 ? 327 TYR A C     1 
ATOM   59   O  O     . TYR A 1 9   ? -24.500 57.238 -288.750 1.00 37.96 ? 327 TYR A O     1 
ATOM   60   C  CB    . TYR A 1 9   ? -22.942 58.021 -286.117 1.00 33.66 ? 327 TYR A CB    1 
ATOM   61   C  CG    . TYR A 1 9   ? -21.712 57.180 -285.863 1.00 32.73 ? 327 TYR A CG    1 
ATOM   62   C  CD1   . TYR A 1 9   ? -20.516 57.764 -285.465 1.00 32.35 ? 327 TYR A CD1   1 
ATOM   63   C  CD2   . TYR A 1 9   ? -21.750 55.800 -286.008 1.00 32.70 ? 327 TYR A CD2   1 
ATOM   64   C  CE1   . TYR A 1 9   ? -19.390 56.997 -285.225 1.00 31.65 ? 327 TYR A CE1   1 
ATOM   65   C  CE2   . TYR A 1 9   ? -20.631 55.025 -285.771 1.00 31.94 ? 327 TYR A CE2   1 
ATOM   66   C  CZ    . TYR A 1 9   ? -19.454 55.627 -285.380 1.00 31.31 ? 327 TYR A CZ    1 
ATOM   67   O  OH    . TYR A 1 9   ? -18.340 54.854 -285.143 1.00 30.79 ? 327 TYR A OH    1 
ATOM   68   N  N     . PRO A 1 10  ? -22.322 57.057 -289.251 1.00 42.98 ? 328 PRO A N     1 
ATOM   69   C  CA    . PRO A 1 10  ? -22.588 56.078 -290.315 1.00 48.70 ? 328 PRO A CA    1 
ATOM   70   C  C     . PRO A 1 10  ? -23.256 54.821 -289.775 1.00 49.98 ? 328 PRO A C     1 
ATOM   71   O  O     . PRO A 1 10  ? -22.803 54.226 -288.795 1.00 46.85 ? 328 PRO A O     1 
ATOM   72   C  CB    . PRO A 1 10  ? -21.192 55.780 -290.876 1.00 45.26 ? 328 PRO A CB    1 
ATOM   73   C  CG    . PRO A 1 10  ? -20.373 56.978 -290.514 1.00 40.24 ? 328 PRO A CG    1 
ATOM   74   C  CD    . PRO A 1 10  ? -20.902 57.438 -289.188 1.00 38.23 ? 328 PRO A CD    1 
ATOM   75   N  N     . GLY A 1 11  ? -24.343 54.420 -290.429 1.00 52.04 ? 329 GLY A N     1 
ATOM   76   C  CA    . GLY A 1 11  ? -25.078 53.237 -290.029 1.00 53.57 ? 329 GLY A CA    1 
ATOM   77   C  C     . GLY A 1 11  ? -26.044 53.434 -288.884 1.00 52.26 ? 329 GLY A C     1 
ATOM   78   O  O     . GLY A 1 11  ? -26.596 52.447 -288.385 1.00 50.94 ? 329 GLY A O     1 
ATOM   79   N  N     . CYS A 1 12  ? -26.270 54.672 -288.453 1.00 50.69 ? 330 CYS A N     1 
ATOM   80   C  CA    . CYS A 1 12  ? -27.148 54.972 -287.330 1.00 41.60 ? 330 CYS A CA    1 
ATOM   81   C  C     . CYS A 1 12  ? -28.280 55.871 -287.804 1.00 46.55 ? 330 CYS A C     1 
ATOM   82   O  O     . CYS A 1 12  ? -28.034 56.926 -288.397 1.00 54.08 ? 330 CYS A O     1 
ATOM   83   C  CB    . CYS A 1 12  ? -26.372 55.643 -286.195 1.00 40.32 ? 330 CYS A CB    1 
ATOM   84   S  SG    . CYS A 1 12  ? -27.349 55.958 -284.714 1.00 35.60 ? 330 CYS A SG    1 
ATOM   85   N  N     . ASN A 1 13  ? -29.518 55.455 -287.536 1.00 45.79 ? 331 ASN A N     1 
ATOM   86   C  CA    . ASN A 1 13  ? -30.705 56.193 -287.950 1.00 46.50 ? 331 ASN A CA    1 
ATOM   87   C  C     . ASN A 1 13  ? -31.483 56.747 -286.759 1.00 43.19 ? 331 ASN A C     1 
ATOM   88   O  O     . ASN A 1 13  ? -32.701 56.929 -286.838 1.00 43.17 ? 331 ASN A O     1 
ATOM   89   C  CB    . ASN A 1 13  ? -31.609 55.308 -288.808 1.00 48.14 ? 331 ASN A CB    1 
ATOM   90   N  N     . LYS A 1 14  ? -30.797 57.025 -285.653 1.00 41.95 ? 332 LYS A N     1 
ATOM   91   C  CA    . LYS A 1 14  ? -31.462 57.538 -284.463 1.00 34.94 ? 332 LYS A CA    1 
ATOM   92   C  C     . LYS A 1 14  ? -31.774 59.021 -284.616 1.00 37.20 ? 332 LYS A C     1 
ATOM   93   O  O     . LYS A 1 14  ? -30.943 59.803 -285.085 1.00 37.89 ? 332 LYS A O     1 
ATOM   94   C  CB    . LYS A 1 14  ? -30.595 57.311 -283.224 1.00 35.67 ? 332 LYS A CB    1 
ATOM   95   C  CG    . LYS A 1 14  ? -30.444 55.851 -282.825 1.00 38.93 ? 332 LYS A CG    1 
ATOM   96   C  CD    . LYS A 1 14  ? -31.772 55.261 -282.376 1.00 46.62 ? 332 LYS A CD    1 
ATOM   97   C  CE    . LYS A 1 14  ? -31.634 53.790 -282.019 1.00 51.14 ? 332 LYS A CE    1 
ATOM   98   N  NZ    . LYS A 1 14  ? -30.623 53.574 -280.950 1.00 52.74 ? 332 LYS A NZ    1 
ATOM   99   N  N     . ARG A 1 15  ? -32.988 59.400 -284.221 1.00 38.81 ? 333 ARG A N     1 
ATOM   100  C  CA    . ARG A 1 15  ? -33.424 60.787 -284.235 1.00 39.47 ? 333 ARG A CA    1 
ATOM   101  C  C     . ARG A 1 15  ? -34.167 61.073 -282.939 1.00 36.64 ? 333 ARG A C     1 
ATOM   102  O  O     . ARG A 1 15  ? -34.775 60.176 -282.350 1.00 35.91 ? 333 ARG A O     1 
ATOM   103  C  CB    . ARG A 1 15  ? -34.321 61.091 -285.444 1.00 45.07 ? 333 ARG A CB    1 
ATOM   104  C  CG    . ARG A 1 15  ? -33.709 60.725 -286.787 1.00 53.70 ? 333 ARG A CG    1 
ATOM   105  C  CD    . ARG A 1 15  ? -34.677 60.988 -287.928 1.00 60.54 ? 333 ARG A CD    1 
ATOM   106  N  NE    . ARG A 1 15  ? -34.856 62.415 -288.183 1.00 69.04 ? 333 ARG A NE    1 
ATOM   107  C  CZ    . ARG A 1 15  ? -34.248 63.081 -289.159 1.00 71.44 ? 333 ARG A CZ    1 
ATOM   108  N  NH1   . ARG A 1 15  ? -33.418 62.452 -289.981 1.00 66.04 ? 333 ARG A NH1   1 
ATOM   109  N  NH2   . ARG A 1 15  ? -34.470 64.379 -289.316 1.00 74.34 ? 333 ARG A NH2   1 
ATOM   110  N  N     . TYR A 1 16  ? -34.111 62.327 -282.496 1.00 36.92 ? 334 TYR A N     1 
ATOM   111  C  CA    . TYR A 1 16  ? -34.676 62.704 -281.208 1.00 36.11 ? 334 TYR A CA    1 
ATOM   112  C  C     . TYR A 1 16  ? -35.389 64.044 -281.320 1.00 38.19 ? 334 TYR A C     1 
ATOM   113  O  O     . TYR A 1 16  ? -35.187 64.805 -282.269 1.00 39.55 ? 334 TYR A O     1 
ATOM   114  C  CB    . TYR A 1 16  ? -33.596 62.774 -280.120 1.00 34.18 ? 334 TYR A CB    1 
ATOM   115  C  CG    . TYR A 1 16  ? -32.830 61.483 -279.944 1.00 34.49 ? 334 TYR A CG    1 
ATOM   116  C  CD1   . TYR A 1 16  ? -33.292 60.491 -279.089 1.00 31.36 ? 334 TYR A CD1   1 
ATOM   117  C  CD2   . TYR A 1 16  ? -31.648 61.254 -280.636 1.00 32.52 ? 334 TYR A CD2   1 
ATOM   118  C  CE1   . TYR A 1 16  ? -32.597 59.306 -278.928 1.00 30.07 ? 334 TYR A CE1   1 
ATOM   119  C  CE2   . TYR A 1 16  ? -30.946 60.073 -280.482 1.00 30.95 ? 334 TYR A CE2   1 
ATOM   120  C  CZ    . TYR A 1 16  ? -31.425 59.103 -279.626 1.00 31.11 ? 334 TYR A CZ    1 
ATOM   121  O  OH    . TYR A 1 16  ? -30.731 57.926 -279.467 1.00 31.86 ? 334 TYR A OH    1 
ATOM   122  N  N     . PHE A 1 17  ? -36.232 64.322 -280.324 1.00 39.68 ? 335 PHE A N     1 
ATOM   123  C  CA    . PHE A 1 17  ? -36.954 65.585 -280.244 1.00 41.56 ? 335 PHE A CA    1 
ATOM   124  C  C     . PHE A 1 17  ? -36.178 66.674 -279.518 1.00 42.31 ? 335 PHE A C     1 
ATOM   125  O  O     . PHE A 1 17  ? -36.515 67.855 -279.665 1.00 42.46 ? 335 PHE A O     1 
ATOM   126  C  CB    . PHE A 1 17  ? -38.301 65.389 -279.538 1.00 42.14 ? 335 PHE A CB    1 
ATOM   127  C  CG    . PHE A 1 17  ? -39.326 64.666 -280.364 1.00 49.70 ? 335 PHE A CG    1 
ATOM   128  C  CD1   . PHE A 1 17  ? -39.941 65.295 -281.434 1.00 55.73 ? 335 PHE A CD1   1 
ATOM   129  C  CD2   . PHE A 1 17  ? -39.689 63.364 -280.059 1.00 45.57 ? 335 PHE A CD2   1 
ATOM   130  C  CE1   . PHE A 1 17  ? -40.889 64.635 -282.194 1.00 55.63 ? 335 PHE A CE1   1 
ATOM   131  C  CE2   . PHE A 1 17  ? -40.638 62.698 -280.815 1.00 48.05 ? 335 PHE A CE2   1 
ATOM   132  C  CZ    . PHE A 1 17  ? -41.239 63.335 -281.884 1.00 50.93 ? 335 PHE A CZ    1 
ATOM   133  N  N     . LYS A 1 18  ? -35.162 66.313 -278.738 1.00 38.09 ? 336 LYS A N     1 
ATOM   134  C  CA    . LYS A 1 18  ? -34.395 67.275 -277.961 1.00 40.15 ? 336 LYS A CA    1 
ATOM   135  C  C     . LYS A 1 18  ? -32.920 67.157 -278.309 1.00 39.30 ? 336 LYS A C     1 
ATOM   136  O  O     . LYS A 1 18  ? -32.421 66.059 -278.573 1.00 34.82 ? 336 LYS A O     1 
ATOM   137  C  CB    . LYS A 1 18  ? -34.591 67.062 -276.454 1.00 36.99 ? 336 LYS A CB    1 
ATOM   138  C  CG    . LYS A 1 18  ? -36.043 67.051 -276.009 1.00 39.82 ? 336 LYS A CG    1 
ATOM   139  C  CD    . LYS A 1 18  ? -36.154 67.125 -274.495 1.00 38.02 ? 336 LYS A CD    1 
ATOM   140  C  CE    . LYS A 1 18  ? -37.604 67.050 -274.043 1.00 40.58 ? 336 LYS A CE    1 
ATOM   141  N  NZ    . LYS A 1 18  ? -37.760 67.451 -272.619 1.00 48.23 ? 336 LYS A NZ    1 
ATOM   142  N  N     . LEU A 1 19  ? -32.227 68.299 -278.309 1.00 41.89 ? 337 LEU A N     1 
ATOM   143  C  CA    . LEU A 1 19  ? -30.791 68.294 -278.567 1.00 40.57 ? 337 LEU A CA    1 
ATOM   144  C  C     . LEU A 1 19  ? -30.041 67.526 -277.486 1.00 41.45 ? 337 LEU A C     1 
ATOM   145  O  O     . LEU A 1 19  ? -29.057 66.834 -277.773 1.00 39.14 ? 337 LEU A O     1 
ATOM   146  C  CB    . LEU A 1 19  ? -30.270 69.728 -278.664 1.00 41.98 ? 337 LEU A CB    1 
ATOM   147  C  CG    . LEU A 1 19  ? -28.764 69.899 -278.870 1.00 45.03 ? 337 LEU A CG    1 
ATOM   148  C  CD1   . LEU A 1 19  ? -28.312 69.205 -280.146 1.00 42.92 ? 337 LEU A CD1   1 
ATOM   149  C  CD2   . LEU A 1 19  ? -28.386 71.373 -278.894 1.00 48.06 ? 337 LEU A CD2   1 
ATOM   150  N  N     . SER A 1 20  ? -30.496 67.630 -276.235 1.00 38.29 ? 338 SER A N     1 
ATOM   151  C  CA    . SER A 1 20  ? -29.825 66.934 -275.142 1.00 36.33 ? 338 SER A CA    1 
ATOM   152  C  C     . SER A 1 20  ? -29.898 65.423 -275.320 1.00 31.73 ? 338 SER A C     1 
ATOM   153  O  O     . SER A 1 20  ? -28.952 64.704 -274.973 1.00 32.24 ? 338 SER A O     1 
ATOM   154  C  CB    . SER A 1 20  ? -30.436 67.347 -273.804 1.00 40.44 ? 338 SER A CB    1 
ATOM   155  O  OG    . SER A 1 20  ? -31.812 67.017 -273.748 1.00 40.07 ? 338 SER A OG    1 
ATOM   156  N  N     . HIS A 1 21  ? -31.017 64.920 -275.851 1.00 31.07 ? 339 HIS A N     1 
ATOM   157  C  CA    . HIS A 1 21  ? -31.124 63.490 -276.124 1.00 30.42 ? 339 HIS A CA    1 
ATOM   158  C  C     . HIS A 1 21  ? -30.122 63.059 -277.187 1.00 30.01 ? 339 HIS A C     1 
ATOM   159  O  O     . HIS A 1 21  ? -29.462 62.023 -277.047 1.00 28.91 ? 339 HIS A O     1 
ATOM   160  C  CB    . HIS A 1 21  ? -32.549 63.136 -276.556 1.00 30.61 ? 339 HIS A CB    1 
ATOM   161  C  CG    . HIS A 1 21  ? -33.559 63.237 -275.456 1.00 31.57 ? 339 HIS A CG    1 
ATOM   162  N  ND1   . HIS A 1 21  ? -34.914 63.103 -275.674 1.00 32.93 ? 339 HIS A ND1   1 
ATOM   163  C  CD2   . HIS A 1 21  ? -33.412 63.456 -274.128 1.00 30.84 ? 339 HIS A CD2   1 
ATOM   164  C  CE1   . HIS A 1 21  ? -35.557 63.238 -274.528 1.00 32.13 ? 339 HIS A CE1   1 
ATOM   165  N  NE2   . HIS A 1 21  ? -34.669 63.453 -273.574 1.00 32.24 ? 339 HIS A NE2   1 
ATOM   166  N  N     . LEU A 1 22  ? -29.992 63.847 -278.258 1.00 31.21 ? 340 LEU A N     1 
ATOM   167  C  CA    . LEU A 1 22  ? -29.019 63.527 -279.297 1.00 31.38 ? 340 LEU A CA    1 
ATOM   168  C  C     . LEU A 1 22  ? -27.593 63.639 -278.771 1.00 31.17 ? 340 LEU A C     1 
ATOM   169  O  O     . LEU A 1 22  ? -26.746 62.789 -279.070 1.00 33.07 ? 340 LEU A O     1 
ATOM   170  C  CB    . LEU A 1 22  ? -29.221 64.443 -280.504 1.00 33.46 ? 340 LEU A CB    1 
ATOM   171  C  CG    . LEU A 1 22  ? -28.203 64.290 -281.635 1.00 34.02 ? 340 LEU A CG    1 
ATOM   172  C  CD1   . LEU A 1 22  ? -28.269 62.894 -282.240 1.00 33.51 ? 340 LEU A CD1   1 
ATOM   173  C  CD2   . LEU A 1 22  ? -28.410 65.358 -282.701 1.00 37.28 ? 340 LEU A CD2   1 
ATOM   174  N  N     . GLN A 1 23  ? -27.311 64.680 -277.984 1.00 31.71 ? 341 GLN A N     1 
ATOM   175  C  CA    . GLN A 1 23  ? -25.978 64.838 -277.413 1.00 33.11 ? 341 GLN A CA    1 
ATOM   176  C  C     . GLN A 1 23  ? -25.635 63.676 -276.491 1.00 30.34 ? 341 GLN A C     1 
ATOM   177  O  O     . GLN A 1 23  ? -24.501 63.183 -276.495 1.00 29.38 ? 341 GLN A O     1 
ATOM   178  C  CB    . GLN A 1 23  ? -25.881 66.169 -276.666 1.00 38.50 ? 341 GLN A CB    1 
ATOM   179  C  CG    . GLN A 1 23  ? -25.920 67.392 -277.570 1.00 41.51 ? 341 GLN A CG    1 
ATOM   180  C  CD    . GLN A 1 23  ? -26.019 68.690 -276.793 1.00 42.27 ? 341 GLN A CD    1 
ATOM   181  O  OE1   . GLN A 1 23  ? -26.438 68.705 -275.635 1.00 45.40 ? 341 GLN A OE1   1 
ATOM   182  N  NE2   . GLN A 1 23  ? -25.629 69.790 -277.428 1.00 46.42 ? 341 GLN A NE2   1 
ATOM   183  N  N     . MET A 1 24  ? -26.606 63.218 -275.698 1.00 30.39 ? 342 MET A N     1 
ATOM   184  C  CA    . MET A 1 24  ? -26.376 62.052 -274.853 1.00 26.36 ? 342 MET A CA    1 
ATOM   185  C  C     . MET A 1 24  ? -26.180 60.795 -275.691 1.00 26.59 ? 342 MET A C     1 
ATOM   186  O  O     . MET A 1 24  ? -25.305 59.973 -275.394 1.00 27.23 ? 342 MET A O     1 
ATOM   187  C  CB    . MET A 1 24  ? -27.541 61.873 -273.879 1.00 27.58 ? 342 MET A CB    1 
ATOM   188  C  CG    . MET A 1 24  ? -27.370 60.696 -272.932 1.00 28.99 ? 342 MET A CG    1 
ATOM   189  S  SD    . MET A 1 24  ? -25.891 60.854 -271.911 1.00 33.75 ? 342 MET A SD    1 
ATOM   190  C  CE    . MET A 1 24  ? -26.280 62.335 -270.980 1.00 35.99 ? 342 MET A CE    1 
ATOM   191  N  N     . HIS A 1 25  ? -26.981 60.633 -276.748 1.00 26.49 ? 343 HIS A N     1 
ATOM   192  C  CA    . HIS A 1 25  ? -26.842 59.465 -277.612 1.00 26.31 ? 343 HIS A CA    1 
ATOM   193  C  C     . HIS A 1 25  ? -25.478 59.432 -278.290 1.00 26.40 ? 343 HIS A C     1 
ATOM   194  O  O     . HIS A 1 25  ? -24.906 58.356 -278.494 1.00 26.14 ? 343 HIS A O     1 
ATOM   195  C  CB    . HIS A 1 25  ? -27.953 59.449 -278.660 1.00 27.49 ? 343 HIS A CB    1 
ATOM   196  C  CG    . HIS A 1 25  ? -27.653 58.574 -279.837 1.00 28.41 ? 343 HIS A CG    1 
ATOM   197  N  ND1   . HIS A 1 25  ? -27.689 57.198 -279.769 1.00 28.18 ? 343 HIS A ND1   1 
ATOM   198  C  CD2   . HIS A 1 25  ? -27.293 58.879 -281.106 1.00 31.53 ? 343 HIS A CD2   1 
ATOM   199  C  CE1   . HIS A 1 25  ? -27.374 56.693 -280.948 1.00 31.63 ? 343 HIS A CE1   1 
ATOM   200  N  NE2   . HIS A 1 25  ? -27.129 57.691 -281.777 1.00 29.11 ? 343 HIS A NE2   1 
ATOM   201  N  N     . SER A 1 26  ? -24.942 60.603 -278.645 1.00 27.32 ? 344 SER A N     1 
ATOM   202  C  CA    . SER A 1 26  ? -23.650 60.661 -279.320 1.00 28.51 ? 344 SER A CA    1 
ATOM   203  C  C     . SER A 1 26  ? -22.530 60.055 -278.485 1.00 26.53 ? 344 SER A C     1 
ATOM   204  O  O     . SER A 1 26  ? -21.501 59.657 -279.044 1.00 27.91 ? 344 SER A O     1 
ATOM   205  C  CB    . SER A 1 26  ? -23.310 62.109 -279.676 1.00 35.93 ? 344 SER A CB    1 
ATOM   206  O  OG    . SER A 1 26  ? -24.265 62.645 -280.574 1.00 49.83 ? 344 SER A OG    1 
ATOM   207  N  N     . ARG A 1 27  ? -22.705 59.972 -277.164 1.00 26.41 ? 345 ARG A N     1 
ATOM   208  C  CA    . ARG A 1 27  ? -21.700 59.344 -276.317 1.00 25.05 ? 345 ARG A CA    1 
ATOM   209  C  C     . ARG A 1 27  ? -21.586 57.846 -276.571 1.00 24.72 ? 345 ARG A C     1 
ATOM   210  O  O     . ARG A 1 27  ? -20.560 57.250 -276.226 1.00 29.11 ? 345 ARG A O     1 
ATOM   211  C  CB    . ARG A 1 27  ? -22.015 59.610 -274.844 1.00 24.22 ? 345 ARG A CB    1 
ATOM   212  C  CG    . ARG A 1 27  ? -21.892 61.074 -274.456 1.00 27.99 ? 345 ARG A CG    1 
ATOM   213  C  CD    . ARG A 1 27  ? -22.238 61.309 -272.998 1.00 25.68 ? 345 ARG A CD    1 
ATOM   214  N  NE    . ARG A 1 27  ? -22.003 62.699 -272.618 1.00 33.72 ? 345 ARG A NE    1 
ATOM   215  C  CZ    . ARG A 1 27  ? -22.319 63.215 -271.436 1.00 35.60 ? 345 ARG A CZ    1 
ATOM   216  N  NH1   . ARG A 1 27  ? -22.890 62.455 -270.512 1.00 32.32 ? 345 ARG A NH1   1 
ATOM   217  N  NH2   . ARG A 1 27  ? -22.067 64.491 -271.180 1.00 40.03 ? 345 ARG A NH2   1 
ATOM   218  N  N     . LYS A 1 28  ? -22.609 57.228 -277.167 1.00 24.11 ? 346 LYS A N     1 
ATOM   219  C  CA    . LYS A 1 28  ? -22.516 55.812 -277.509 1.00 23.79 ? 346 LYS A CA    1 
ATOM   220  C  C     . LYS A 1 28  ? -21.451 55.573 -278.572 1.00 29.09 ? 346 LYS A C     1 
ATOM   221  O  O     . LYS A 1 28  ? -20.732 54.568 -278.527 1.00 28.50 ? 346 LYS A O     1 
ATOM   222  C  CB    . LYS A 1 28  ? -23.873 55.293 -277.987 1.00 25.63 ? 346 LYS A CB    1 
ATOM   223  C  CG    . LYS A 1 28  ? -23.862 53.828 -278.400 1.00 31.47 ? 346 LYS A CG    1 
ATOM   224  C  CD    . LYS A 1 28  ? -25.160 53.419 -279.080 1.00 38.61 ? 346 LYS A CD    1 
ATOM   225  C  CE    . LYS A 1 28  ? -25.101 51.968 -279.541 1.00 46.97 ? 346 LYS A CE    1 
ATOM   226  N  NZ    . LYS A 1 28  ? -26.320 51.554 -280.291 1.00 54.69 ? 346 LYS A NZ    1 
ATOM   227  N  N     . HIS A 1 29  ? -21.332 56.489 -279.534 1.00 28.05 ? 347 HIS A N     1 
ATOM   228  C  CA    . HIS A 1 29  ? -20.343 56.335 -280.594 1.00 26.23 ? 347 HIS A CA    1 
ATOM   229  C  C     . HIS A 1 29  ? -18.944 56.722 -280.136 1.00 27.28 ? 347 HIS A C     1 
ATOM   230  O  O     . HIS A 1 29  ? -17.958 56.183 -280.654 1.00 32.44 ? 347 HIS A O     1 
ATOM   231  C  CB    . HIS A 1 29  ? -20.745 57.168 -281.813 1.00 27.74 ? 347 HIS A CB    1 
ATOM   232  C  CG    . HIS A 1 29  ? -22.106 56.842 -282.341 1.00 28.22 ? 347 HIS A CG    1 
ATOM   233  N  ND1   . HIS A 1 29  ? -22.484 55.561 -282.682 1.00 28.13 ? 347 HIS A ND1   1 
ATOM   234  C  CD2   . HIS A 1 29  ? -23.180 57.629 -282.586 1.00 29.40 ? 347 HIS A CD2   1 
ATOM   235  C  CE1   . HIS A 1 29  ? -23.732 55.573 -283.115 1.00 29.12 ? 347 HIS A CE1   1 
ATOM   236  N  NE2   . HIS A 1 29  ? -24.177 56.816 -283.068 1.00 29.57 ? 347 HIS A NE2   1 
ATOM   237  N  N     . THR A 1 30  ? -18.833 57.645 -279.181 1.00 25.80 ? 348 THR A N     1 
ATOM   238  C  CA    . THR A 1 30  ? -17.535 58.053 -278.661 1.00 27.93 ? 348 THR A CA    1 
ATOM   239  C  C     . THR A 1 30  ? -17.076 57.211 -277.479 1.00 29.53 ? 348 THR A C     1 
ATOM   240  O  O     . THR A 1 30  ? -15.877 57.194 -277.178 1.00 30.39 ? 348 THR A O     1 
ATOM   241  C  CB    . THR A 1 30  ? -17.571 59.525 -278.234 1.00 35.58 ? 348 THR A CB    1 
ATOM   242  O  OG1   . THR A 1 30  ? -18.428 59.672 -277.095 1.00 31.44 ? 348 THR A OG1   1 
ATOM   243  C  CG2   . THR A 1 30  ? -18.095 60.394 -279.367 1.00 41.52 ? 348 THR A CG2   1 
ATOM   244  N  N     . GLY A 1 31  ? -17.991 56.516 -276.808 1.00 27.64 ? 349 GLY A N     1 
ATOM   245  C  CA    . GLY A 1 31  ? -17.643 55.766 -275.620 1.00 26.80 ? 349 GLY A CA    1 
ATOM   246  C  C     . GLY A 1 31  ? -17.492 56.594 -274.365 1.00 29.28 ? 349 GLY A C     1 
ATOM   247  O  O     . GLY A 1 31  ? -17.031 56.066 -273.347 1.00 31.38 ? 349 GLY A O     1 
ATOM   248  N  N     . GLU A 1 32  ? -17.864 57.872 -274.402 1.00 26.63 ? 350 GLU A N     1 
ATOM   249  C  CA    . GLU A 1 32  ? -17.729 58.732 -273.233 1.00 26.31 ? 350 GLU A CA    1 
ATOM   250  C  C     . GLU A 1 32  ? -18.724 58.310 -272.159 1.00 26.52 ? 350 GLU A C     1 
ATOM   251  O  O     . GLU A 1 32  ? -19.937 58.307 -272.390 1.00 25.70 ? 350 GLU A O     1 
ATOM   252  C  CB    . GLU A 1 32  ? -17.947 60.192 -273.616 1.00 32.02 ? 350 GLU A CB    1 
ATOM   253  C  CG    . GLU A 1 32  ? -17.806 61.153 -272.447 1.00 39.87 ? 350 GLU A CG    1 
ATOM   254  C  CD    . GLU A 1 32  ? -18.068 62.594 -272.833 1.00 46.24 ? 350 GLU A CD    1 
ATOM   255  O  OE1   . GLU A 1 32  ? -18.745 62.825 -273.857 1.00 46.91 ? 350 GLU A OE1   1 
ATOM   256  O  OE2   . GLU A 1 32  ? -17.592 63.497 -272.114 1.00 49.82 ? 350 GLU A OE2   1 
ATOM   257  N  N     . LYS A 1 33  ? -18.207 57.949 -270.987 1.00 25.81 ? 351 LYS A N     1 
ATOM   258  C  CA    . LYS A 1 33  ? -19.032 57.546 -269.850 1.00 23.79 ? 351 LYS A CA    1 
ATOM   259  C  C     . LYS A 1 33  ? -18.481 58.240 -268.615 1.00 24.43 ? 351 LYS A C     1 
ATOM   260  O  O     . LYS A 1 33  ? -17.665 57.674 -267.873 1.00 24.66 ? 351 LYS A O     1 
ATOM   261  C  CB    . LYS A 1 33  ? -19.050 56.026 -269.684 1.00 23.06 ? 351 LYS A CB    1 
ATOM   262  C  CG    . LYS A 1 33  ? -19.641 55.293 -270.879 1.00 23.97 ? 351 LYS A CG    1 
ATOM   263  C  CD    . LYS A 1 33  ? -19.637 53.787 -270.686 1.00 24.55 ? 351 LYS A CD    1 
ATOM   264  C  CE    . LYS A 1 33  ? -20.229 53.081 -271.899 1.00 30.44 ? 351 LYS A CE    1 
ATOM   265  N  NZ    . LYS A 1 33  ? -20.324 51.608 -271.704 1.00 30.13 ? 351 LYS A NZ    1 
ATOM   266  N  N     . PRO A 1 34  ? -18.903 59.481 -268.360 1.00 25.95 ? 352 PRO A N     1 
ATOM   267  C  CA    . PRO A 1 34  ? -18.262 60.283 -267.308 1.00 24.62 ? 352 PRO A CA    1 
ATOM   268  C  C     . PRO A 1 34  ? -18.624 59.865 -265.893 1.00 23.25 ? 352 PRO A C     1 
ATOM   269  O  O     . PRO A 1 34  ? -17.972 60.335 -264.951 1.00 27.48 ? 352 PRO A O     1 
ATOM   270  C  CB    . PRO A 1 34  ? -18.764 61.708 -267.594 1.00 26.24 ? 352 PRO A CB    1 
ATOM   271  C  CG    . PRO A 1 34  ? -19.394 61.652 -268.963 1.00 30.15 ? 352 PRO A CG    1 
ATOM   272  C  CD    . PRO A 1 34  ? -19.904 60.258 -269.108 1.00 27.26 ? 352 PRO A CD    1 
ATOM   273  N  N     . TYR A 1 35  ? -19.629 59.014 -265.705 1.00 20.80 ? 353 TYR A N     1 
ATOM   274  C  CA    . TYR A 1 35  ? -20.153 58.710 -264.373 1.00 19.79 ? 353 TYR A CA    1 
ATOM   275  C  C     . TYR A 1 35  ? -19.631 57.343 -263.942 1.00 21.42 ? 353 TYR A C     1 
ATOM   276  O  O     . TYR A 1 35  ? -20.226 56.304 -264.226 1.00 21.57 ? 353 TYR A O     1 
ATOM   277  C  CB    . TYR A 1 35  ? -21.675 58.786 -264.373 1.00 22.34 ? 353 TYR A CB    1 
ATOM   278  C  CG    . TYR A 1 35  ? -22.170 60.151 -264.795 1.00 24.70 ? 353 TYR A CG    1 
ATOM   279  C  CD1   . TYR A 1 35  ? -22.213 61.206 -263.892 1.00 26.23 ? 353 TYR A CD1   1 
ATOM   280  C  CD2   . TYR A 1 35  ? -22.563 60.395 -266.105 1.00 25.48 ? 353 TYR A CD2   1 
ATOM   281  C  CE1   . TYR A 1 35  ? -22.650 62.462 -264.277 1.00 27.50 ? 353 TYR A CE1   1 
ATOM   282  C  CE2   . TYR A 1 35  ? -23.002 61.648 -266.500 1.00 27.25 ? 353 TYR A CE2   1 
ATOM   283  C  CZ    . TYR A 1 35  ? -23.044 62.677 -265.582 1.00 29.06 ? 353 TYR A CZ    1 
ATOM   284  O  OH    . TYR A 1 35  ? -23.479 63.926 -265.967 1.00 33.59 ? 353 TYR A OH    1 
ATOM   285  N  N     . GLN A 1 36  ? -18.504 57.362 -263.235 1.00 21.02 ? 354 GLN A N     1 
ATOM   286  C  CA    . GLN A 1 36  ? -17.821 56.158 -262.786 1.00 21.83 ? 354 GLN A CA    1 
ATOM   287  C  C     . GLN A 1 36  ? -18.298 55.762 -261.394 1.00 19.99 ? 354 GLN A C     1 
ATOM   288  O  O     . GLN A 1 36  ? -18.568 56.621 -260.549 1.00 22.64 ? 354 GLN A O     1 
ATOM   289  C  CB    . GLN A 1 36  ? -16.308 56.389 -262.777 1.00 26.46 ? 354 GLN A CB    1 
ATOM   290  C  CG    . GLN A 1 36  ? -15.488 55.287 -262.123 1.00 40.27 ? 354 GLN A CG    1 
ATOM   291  C  CD    . GLN A 1 36  ? -15.415 54.027 -262.963 1.00 46.83 ? 354 GLN A CD    1 
ATOM   292  O  OE1   . GLN A 1 36  ? -15.173 54.083 -264.169 1.00 57.59 ? 354 GLN A OE1   1 
ATOM   293  N  NE2   . GLN A 1 36  ? -15.623 52.880 -262.327 1.00 29.13 ? 354 GLN A NE2   1 
ATOM   294  N  N     . CYS A 1 37  ? -18.403 54.455 -261.161 1.00 19.65 ? 355 CYS A N     1 
ATOM   295  C  CA    . CYS A 1 37  ? -18.753 53.934 -259.847 1.00 19.17 ? 355 CYS A CA    1 
ATOM   296  C  C     . CYS A 1 37  ? -17.492 53.771 -259.009 1.00 20.53 ? 355 CYS A C     1 
ATOM   297  O  O     . CYS A 1 37  ? -16.515 53.161 -259.458 1.00 21.78 ? 355 CYS A O     1 
ATOM   298  C  CB    . CYS A 1 37  ? -19.487 52.599 -259.965 1.00 18.57 ? 355 CYS A CB    1 
ATOM   299  S  SG    . CYS A 1 37  ? -20.007 51.912 -258.378 1.00 18.19 ? 355 CYS A SG    1 
ATOM   300  N  N     . ASP A 1 38  ? -17.519 54.312 -257.791 1.00 20.55 ? 356 ASP A N     1 
ATOM   301  C  CA    . ASP A 1 38  ? -16.355 54.327 -256.914 1.00 22.07 ? 356 ASP A CA    1 
ATOM   302  C  C     . ASP A 1 38  ? -16.503 53.393 -255.717 1.00 21.96 ? 356 ASP A C     1 
ATOM   303  O  O     . ASP A 1 38  ? -15.766 53.533 -254.736 1.00 23.19 ? 356 ASP A O     1 
ATOM   304  C  CB    . ASP A 1 38  ? -16.075 55.753 -256.440 1.00 27.73 ? 356 ASP A CB    1 
ATOM   305  C  CG    . ASP A 1 38  ? -15.464 56.616 -257.523 1.00 38.18 ? 356 ASP A CG    1 
ATOM   306  O  OD1   . ASP A 1 38  ? -14.691 56.082 -258.346 1.00 40.47 ? 356 ASP A OD1   1 
ATOM   307  O  OD2   . ASP A 1 38  ? -15.758 57.829 -257.551 1.00 43.46 ? 356 ASP A OD2   1 
ATOM   308  N  N     . PHE A 1 39  ? -17.430 52.440 -255.777 1.00 20.80 ? 357 PHE A N     1 
ATOM   309  C  CA    . PHE A 1 39  ? -17.631 51.481 -254.698 1.00 20.98 ? 357 PHE A CA    1 
ATOM   310  C  C     . PHE A 1 39  ? -16.755 50.253 -254.923 1.00 22.46 ? 357 PHE A C     1 
ATOM   311  O  O     . PHE A 1 39  ? -16.883 49.579 -255.950 1.00 25.58 ? 357 PHE A O     1 
ATOM   312  C  CB    . PHE A 1 39  ? -19.096 51.053 -254.616 1.00 19.56 ? 357 PHE A CB    1 
ATOM   313  C  CG    . PHE A 1 39  ? -19.989 52.028 -253.901 1.00 21.08 ? 357 PHE A CG    1 
ATOM   314  C  CD1   . PHE A 1 39  ? -20.052 52.043 -252.517 1.00 24.98 ? 357 PHE A CD1   1 
ATOM   315  C  CD2   . PHE A 1 39  ? -20.793 52.906 -254.613 1.00 21.39 ? 357 PHE A CD2   1 
ATOM   316  C  CE1   . PHE A 1 39  ? -20.884 52.930 -251.853 1.00 23.52 ? 357 PHE A CE1   1 
ATOM   317  C  CE2   . PHE A 1 39  ? -21.627 53.795 -253.955 1.00 23.60 ? 357 PHE A CE2   1 
ATOM   318  C  CZ    . PHE A 1 39  ? -21.672 53.805 -252.574 1.00 20.45 ? 357 PHE A CZ    1 
ATOM   319  N  N     . LYS A 1 40  ? -15.873 49.965 -253.966 1.00 23.81 ? 358 LYS A N     1 
ATOM   320  C  CA    . LYS A 1 40  ? -15.206 48.665 -253.848 1.00 30.65 ? 358 LYS A CA    1 
ATOM   321  C  C     . LYS A 1 40  ? -14.585 48.208 -255.172 1.00 31.66 ? 358 LYS A C     1 
ATOM   322  O  O     . LYS A 1 40  ? -14.869 47.123 -255.684 1.00 34.81 ? 358 LYS A O     1 
ATOM   323  C  CB    . LYS A 1 40  ? -16.190 47.618 -253.319 1.00 32.42 ? 358 LYS A CB    1 
ATOM   324  C  CG    . LYS A 1 40  ? -15.546 46.400 -252.681 1.00 34.53 ? 358 LYS A CG    1 
ATOM   325  C  CD    . LYS A 1 40  ? -16.604 45.429 -252.188 1.00 42.21 ? 358 LYS A CD    1 
ATOM   326  C  CE    . LYS A 1 40  ? -15.980 44.261 -251.446 1.00 49.77 ? 358 LYS A CE    1 
ATOM   327  N  NZ    . LYS A 1 40  ? -17.001 43.275 -250.995 1.00 55.81 ? 358 LYS A NZ    1 
ATOM   328  N  N     . ASP A 1 41  ? -13.731 49.068 -255.727 1.00 24.03 ? 359 ASP A N     1 
ATOM   329  C  CA    . ASP A 1 41  ? -12.967 48.794 -256.948 1.00 24.77 ? 359 ASP A CA    1 
ATOM   330  C  C     . ASP A 1 41  ? -13.849 48.489 -258.156 1.00 23.87 ? 359 ASP A C     1 
ATOM   331  O  O     . ASP A 1 41  ? -13.406 47.812 -259.090 1.00 25.35 ? 359 ASP A O     1 
ATOM   332  C  CB    . ASP A 1 41  ? -11.975 47.642 -256.746 1.00 28.09 ? 359 ASP A CB    1 
ATOM   333  C  CG    . ASP A 1 41  ? -11.084 47.837 -255.534 1.00 33.57 ? 359 ASP A CG    1 
ATOM   334  O  OD1   . ASP A 1 41  ? -11.268 47.107 -254.537 1.00 32.08 ? 359 ASP A OD1   1 
ATOM   335  O  OD2   . ASP A 1 41  ? -10.201 48.721 -255.575 1.00 32.58 ? 359 ASP A OD2   1 
ATOM   336  N  N     . CYS A 1 42  ? -15.085 48.976 -258.172 1.00 23.35 ? 360 CYS A N     1 
ATOM   337  C  CA    . CYS A 1 42  ? -15.988 48.680 -259.276 1.00 20.57 ? 360 CYS A CA    1 
ATOM   338  C  C     . CYS A 1 42  ? -15.510 49.344 -260.563 1.00 20.72 ? 360 CYS A C     1 
ATOM   339  O  O     . CYS A 1 42  ? -15.025 50.479 -260.555 1.00 23.11 ? 360 CYS A O     1 
ATOM   340  C  CB    . CYS A 1 42  ? -17.403 49.147 -258.940 1.00 19.74 ? 360 CYS A CB    1 
ATOM   341  S  SG    . CYS A 1 42  ? -18.647 48.711 -260.163 1.00 18.14 ? 360 CYS A SG    1 
ATOM   342  N  N     . GLU A 1 43  ? -15.654 48.627 -261.677 1.00 20.07 ? 361 GLU A N     1 
ATOM   343  C  CA    . GLU A 1 43  ? -15.225 49.109 -262.984 1.00 20.73 ? 361 GLU A CA    1 
ATOM   344  C  C     . GLU A 1 43  ? -16.369 49.660 -263.822 1.00 19.72 ? 361 GLU A C     1 
ATOM   345  O  O     . GLU A 1 43  ? -16.134 50.097 -264.953 1.00 23.89 ? 361 GLU A O     1 
ATOM   346  C  CB    . GLU A 1 43  ? -14.527 47.989 -263.764 1.00 23.63 ? 361 GLU A CB    1 
ATOM   347  C  CG    . GLU A 1 43  ? -13.304 47.404 -263.084 1.00 23.87 ? 361 GLU A CG    1 
ATOM   348  C  CD    . GLU A 1 43  ? -12.546 46.446 -263.987 1.00 30.92 ? 361 GLU A CD    1 
ATOM   349  O  OE1   . GLU A 1 43  ? -12.003 46.900 -265.017 1.00 34.95 ? 361 GLU A OE1   1 
ATOM   350  O  OE2   . GLU A 1 43  ? -12.503 45.240 -263.673 1.00 28.92 ? 361 GLU A OE2   1 
ATOM   351  N  N     . ARG A 1 44  ? -17.593 49.640 -263.305 1.00 18.87 ? 362 ARG A N     1 
ATOM   352  C  CA    . ARG A 1 44  ? -18.736 50.105 -264.075 1.00 17.79 ? 362 ARG A CA    1 
ATOM   353  C  C     . ARG A 1 44  ? -18.708 51.620 -264.222 1.00 19.77 ? 362 ARG A C     1 
ATOM   354  O  O     . ARG A 1 44  ? -18.339 52.347 -263.297 1.00 20.73 ? 362 ARG A O     1 
ATOM   355  C  CB    . ARG A 1 44  ? -20.040 49.670 -263.409 1.00 19.88 ? 362 ARG A CB    1 
ATOM   356  C  CG    . ARG A 1 44  ? -20.371 48.197 -263.589 1.00 26.59 ? 362 ARG A CG    1 
ATOM   357  C  CD    . ARG A 1 44  ? -20.738 47.890 -265.035 1.00 37.53 ? 362 ARG A CD    1 
ATOM   358  N  NE    . ARG A 1 44  ? -21.142 46.498 -265.221 1.00 56.20 ? 362 ARG A NE    1 
ATOM   359  C  CZ    . ARG A 1 44  ? -21.611 45.999 -266.361 1.00 65.45 ? 362 ARG A CZ    1 
ATOM   360  N  NH1   . ARG A 1 44  ? -21.740 46.777 -267.427 1.00 65.25 ? 362 ARG A NH1   1 
ATOM   361  N  NH2   . ARG A 1 44  ? -21.953 44.720 -266.436 1.00 70.04 ? 362 ARG A NH2   1 
ATOM   362  N  N     . ARG A 1 45  ? -19.101 52.092 -265.402 1.00 17.64 ? 363 ARG A N     1 
ATOM   363  C  CA    . ARG A 1 45  ? -19.249 53.516 -265.657 1.00 17.53 ? 363 ARG A CA    1 
ATOM   364  C  C     . ARG A 1 45  ? -20.362 53.706 -266.676 1.00 18.39 ? 363 ARG A C     1 
ATOM   365  O  O     . ARG A 1 45  ? -20.674 52.804 -267.459 1.00 19.32 ? 363 ARG A O     1 
ATOM   366  C  CB    . ARG A 1 45  ? -17.940 54.148 -266.144 1.00 21.99 ? 363 ARG A CB    1 
ATOM   367  C  CG    . ARG A 1 45  ? -17.412 53.584 -267.449 1.00 27.66 ? 363 ARG A CG    1 
ATOM   368  C  CD    . ARG A 1 45  ? -16.039 54.156 -267.765 1.00 33.30 ? 363 ARG A CD    1 
ATOM   369  N  NE    . ARG A 1 45  ? -15.591 53.806 -269.109 1.00 43.54 ? 363 ARG A NE    1 
ATOM   370  C  CZ    . ARG A 1 45  ? -14.965 52.676 -269.419 1.00 54.68 ? 363 ARG A CZ    1 
ATOM   371  N  NH1   . ARG A 1 45  ? -14.712 51.774 -268.481 1.00 55.21 ? 363 ARG A NH1   1 
ATOM   372  N  NH2   . ARG A 1 45  ? -14.595 52.446 -270.671 1.00 58.71 ? 363 ARG A NH2   1 
ATOM   373  N  N     . PHE A 1 46  ? -20.969 54.892 -266.653 1.00 20.21 ? 364 PHE A N     1 
ATOM   374  C  CA    . PHE A 1 46  ? -22.170 55.146 -267.432 1.00 20.06 ? 364 PHE A CA    1 
ATOM   375  C  C     . PHE A 1 46  ? -22.103 56.532 -268.057 1.00 19.93 ? 364 PHE A C     1 
ATOM   376  O  O     . PHE A 1 46  ? -21.407 57.427 -267.570 1.00 22.02 ? 364 PHE A O     1 
ATOM   377  C  CB    . PHE A 1 46  ? -23.430 55.016 -266.564 1.00 16.48 ? 364 PHE A CB    1 
ATOM   378  C  CG    . PHE A 1 46  ? -23.562 53.682 -265.881 1.00 16.84 ? 364 PHE A CG    1 
ATOM   379  C  CD1   . PHE A 1 46  ? -24.274 52.653 -266.476 1.00 19.15 ? 364 PHE A CD1   1 
ATOM   380  C  CD2   . PHE A 1 46  ? -22.970 53.455 -264.648 1.00 16.80 ? 364 PHE A CD2   1 
ATOM   381  C  CE1   . PHE A 1 46  ? -24.396 51.424 -265.853 1.00 19.13 ? 364 PHE A CE1   1 
ATOM   382  C  CE2   . PHE A 1 46  ? -23.087 52.227 -264.022 1.00 17.03 ? 364 PHE A CE2   1 
ATOM   383  C  CZ    . PHE A 1 46  ? -23.802 51.212 -264.626 1.00 18.73 ? 364 PHE A CZ    1 
ATOM   384  N  N     . SER A 1 47  ? -22.843 56.696 -269.157 1.00 22.22 ? 365 SER A N     1 
ATOM   385  C  CA    . SER A 1 47  ? -22.967 57.998 -269.796 1.00 21.18 ? 365 SER A CA    1 
ATOM   386  C  C     . SER A 1 47  ? -24.008 58.881 -269.122 1.00 25.32 ? 365 SER A C     1 
ATOM   387  O  O     . SER A 1 47  ? -24.022 60.093 -269.364 1.00 28.37 ? 365 SER A O     1 
ATOM   388  C  CB    . SER A 1 47  ? -23.323 57.829 -271.274 1.00 25.58 ? 365 SER A CB    1 
ATOM   389  O  OG    . SER A 1 47  ? -22.301 57.134 -271.965 1.00 33.26 ? 365 SER A OG    1 
ATOM   390  N  N     . ARG A 1 48  ? -24.873 58.306 -268.290 1.00 24.72 ? 366 ARG A N     1 
ATOM   391  C  CA    . ARG A 1 48  ? -25.934 59.035 -267.610 1.00 21.20 ? 366 ARG A CA    1 
ATOM   392  C  C     . ARG A 1 48  ? -25.790 58.874 -266.103 1.00 22.03 ? 366 ARG A C     1 
ATOM   393  O  O     . ARG A 1 48  ? -25.460 57.790 -265.613 1.00 20.87 ? 366 ARG A O     1 
ATOM   394  C  CB    . ARG A 1 48  ? -27.311 58.542 -268.062 1.00 25.10 ? 366 ARG A CB    1 
ATOM   395  C  CG    . ARG A 1 48  ? -27.732 59.071 -269.421 1.00 25.54 ? 366 ARG A CG    1 
ATOM   396  C  CD    . ARG A 1 48  ? -28.867 58.257 -270.018 1.00 25.96 ? 366 ARG A CD    1 
ATOM   397  N  NE    . ARG A 1 48  ? -29.975 58.079 -269.084 1.00 22.44 ? 366 ARG A NE    1 
ATOM   398  C  CZ    . ARG A 1 48  ? -31.151 57.555 -269.414 1.00 20.72 ? 366 ARG A CZ    1 
ATOM   399  N  NH1   . ARG A 1 48  ? -31.377 57.161 -270.660 1.00 23.50 ? 366 ARG A NH1   1 
ATOM   400  N  NH2   . ARG A 1 48  ? -32.102 57.428 -268.499 1.00 23.63 ? 366 ARG A NH2   1 
ATOM   401  N  N     . SER A 1 49  ? -26.048 59.960 -265.370 1.00 23.84 ? 367 SER A N     1 
ATOM   402  C  CA    . SER A 1 49  ? -25.899 59.922 -263.919 1.00 22.17 ? 367 SER A CA    1 
ATOM   403  C  C     . SER A 1 49  ? -26.966 59.057 -263.261 1.00 20.67 ? 367 SER A C     1 
ATOM   404  O  O     . SER A 1 49  ? -26.687 58.396 -262.254 1.00 19.56 ? 367 SER A O     1 
ATOM   405  C  CB    . SER A 1 49  ? -25.941 61.340 -263.346 1.00 25.68 ? 367 SER A CB    1 
ATOM   406  O  OG    . SER A 1 49  ? -27.204 61.942 -263.565 1.00 28.15 ? 367 SER A OG    1 
ATOM   407  N  N     . ASP A 1 50  ? -28.185 59.046 -263.806 1.00 22.05 ? 368 ASP A N     1 
ATOM   408  C  CA    . ASP A 1 50  ? -29.246 58.246 -263.203 1.00 21.96 ? 368 ASP A CA    1 
ATOM   409  C  C     . ASP A 1 50  ? -29.009 56.754 -263.402 1.00 19.33 ? 368 ASP A C     1 
ATOM   410  O  O     . ASP A 1 50  ? -29.459 55.943 -262.584 1.00 19.47 ? 368 ASP A O     1 
ATOM   411  C  CB    . ASP A 1 50  ? -30.608 58.660 -263.765 1.00 23.34 ? 368 ASP A CB    1 
ATOM   412  C  CG    . ASP A 1 50  ? -30.650 58.639 -265.279 1.00 28.18 ? 368 ASP A CG    1 
ATOM   413  O  OD1   . ASP A 1 50  ? -29.589 58.821 -265.907 1.00 29.71 ? 368 ASP A OD1   1 
ATOM   414  O  OD2   . ASP A 1 50  ? -31.747 58.448 -265.841 1.00 33.06 ? 368 ASP A OD2   1 
ATOM   415  N  N     . GLN A 1 51  ? -28.306 56.371 -264.472 1.00 17.76 ? 369 GLN A N     1 
ATOM   416  C  CA    . GLN A 1 51  ? -27.934 54.971 -264.641 1.00 18.43 ? 369 GLN A CA    1 
ATOM   417  C  C     . GLN A 1 51  ? -26.901 54.551 -263.601 1.00 17.64 ? 369 GLN A C     1 
ATOM   418  O  O     . GLN A 1 51  ? -26.939 53.421 -263.100 1.00 17.13 ? 369 GLN A O     1 
ATOM   419  C  CB    . GLN A 1 51  ? -27.403 54.732 -266.054 1.00 20.70 ? 369 GLN A CB    1 
ATOM   420  C  CG    . GLN A 1 51  ? -28.453 54.863 -267.146 1.00 21.18 ? 369 GLN A CG    1 
ATOM   421  C  CD    . GLN A 1 51  ? -27.857 54.767 -268.536 1.00 28.80 ? 369 GLN A CD    1 
ATOM   422  O  OE1   . GLN A 1 51  ? -26.663 55.001 -268.729 1.00 30.36 ? 369 GLN A OE1   1 
ATOM   423  N  NE2   . GLN A 1 51  ? -28.687 54.418 -269.514 1.00 28.54 ? 369 GLN A NE2   1 
ATOM   424  N  N     . LEU A 1 52  ? -25.971 55.448 -263.266 1.00 15.90 ? 370 LEU A N     1 
ATOM   425  C  CA    . LEU A 1 52  ? -25.008 55.151 -262.211 1.00 15.05 ? 370 LEU A CA    1 
ATOM   426  C  C     . LEU A 1 52  ? -25.698 54.994 -260.863 1.00 16.33 ? 370 LEU A C     1 
ATOM   427  O  O     . LEU A 1 52  ? -25.392 54.065 -260.106 1.00 15.94 ? 370 LEU A O     1 
ATOM   428  C  CB    . LEU A 1 52  ? -23.946 56.249 -262.142 1.00 16.21 ? 370 LEU A CB    1 
ATOM   429  C  CG    . LEU A 1 52  ? -23.010 56.153 -260.935 1.00 17.18 ? 370 LEU A CG    1 
ATOM   430  C  CD1   . LEU A 1 52  ? -22.200 54.864 -260.985 1.00 19.12 ? 370 LEU A CD1   1 
ATOM   431  C  CD2   . LEU A 1 52  ? -22.097 57.371 -260.845 1.00 19.79 ? 370 LEU A CD2   1 
ATOM   432  N  N     . LYS A 1 53  ? -26.638 55.890 -260.548 1.00 15.81 ? 371 LYS A N     1 
ATOM   433  C  CA    . LYS A 1 53  ? -27.307 55.832 -259.253 1.00 17.66 ? 371 LYS A CA    1 
ATOM   434  C  C     . LYS A 1 53  ? -28.110 54.546 -259.101 1.00 16.84 ? 371 LYS A C     1 
ATOM   435  O  O     . LYS A 1 53  ? -28.109 53.929 -258.029 1.00 16.98 ? 371 LYS A O     1 
ATOM   436  C  CB    . LYS A 1 53  ? -28.203 57.057 -259.071 1.00 24.25 ? 371 LYS A CB    1 
ATOM   437  C  CG    . LYS A 1 53  ? -27.445 58.376 -259.048 1.00 35.23 ? 371 LYS A CG    1 
ATOM   438  C  CD    . LYS A 1 53  ? -28.355 59.554 -258.725 1.00 47.20 ? 371 LYS A CD    1 
ATOM   439  C  CE    . LYS A 1 53  ? -28.689 59.630 -257.239 1.00 55.06 ? 371 LYS A CE    1 
ATOM   440  N  NZ    . LYS A 1 53  ? -29.776 58.699 -256.821 1.00 61.45 ? 371 LYS A NZ    1 
ATOM   441  N  N     . ARG A 1 54  ? -28.797 54.121 -260.165 1.00 15.67 ? 372 ARG A N     1 
ATOM   442  C  CA    . ARG A 1 54  ? -29.506 52.847 -260.112 1.00 18.17 ? 372 ARG A CA    1 
ATOM   443  C  C     . ARG A 1 54  ? -28.534 51.689 -259.927 1.00 18.73 ? 372 ARG A C     1 
ATOM   444  O  O     . ARG A 1 54  ? -28.804 50.757 -259.160 1.00 17.23 ? 372 ARG A O     1 
ATOM   445  C  CB    . ARG A 1 54  ? -30.338 52.650 -261.379 1.00 18.37 ? 372 ARG A CB    1 
ATOM   446  C  CG    . ARG A 1 54  ? -31.133 51.353 -261.392 1.00 16.35 ? 372 ARG A CG    1 
ATOM   447  C  CD    . ARG A 1 54  ? -31.879 51.158 -262.704 1.00 17.51 ? 372 ARG A CD    1 
ATOM   448  N  NE    . ARG A 1 54  ? -30.965 50.986 -263.830 1.00 16.18 ? 372 ARG A NE    1 
ATOM   449  C  CZ    . ARG A 1 54  ? -31.353 50.763 -265.081 1.00 14.87 ? 372 ARG A CZ    1 
ATOM   450  N  NH1   . ARG A 1 54  ? -32.644 50.689 -265.376 1.00 15.68 ? 372 ARG A NH1   1 
ATOM   451  N  NH2   . ARG A 1 54  ? -30.448 50.620 -266.040 1.00 17.98 ? 372 ARG A NH2   1 
ATOM   452  N  N     . HIS A 1 55  ? -27.390 51.737 -260.614 1.00 16.69 ? 373 HIS A N     1 
ATOM   453  C  CA    . HIS A 1 55  ? -26.396 50.678 -260.479 1.00 16.42 ? 373 HIS A CA    1 
ATOM   454  C  C     . HIS A 1 55  ? -25.869 50.581 -259.054 1.00 15.21 ? 373 HIS A C     1 
ATOM   455  O  O     . HIS A 1 55  ? -25.662 49.477 -258.535 1.00 16.67 ? 373 HIS A O     1 
ATOM   456  C  CB    . HIS A 1 55  ? -25.237 50.913 -261.446 1.00 15.09 ? 373 HIS A CB    1 
ATOM   457  C  CG    . HIS A 1 55  ? -23.969 50.239 -261.027 1.00 14.56 ? 373 HIS A CG    1 
ATOM   458  N  ND1   . HIS A 1 55  ? -23.712 48.910 -261.285 1.00 16.30 ? 373 HIS A ND1   1 
ATOM   459  C  CD2   . HIS A 1 55  ? -22.898 50.702 -260.340 1.00 15.44 ? 373 HIS A CD2   1 
ATOM   460  C  CE1   . HIS A 1 55  ? -22.532 48.587 -260.788 1.00 17.78 ? 373 HIS A CE1   1 
ATOM   461  N  NE2   . HIS A 1 55  ? -22.018 49.656 -260.207 1.00 15.21 ? 373 HIS A NE2   1 
ATOM   462  N  N     . GLN A 1 56  ? -25.641 51.723 -258.403 1.00 15.06 ? 374 GLN A N     1 
ATOM   463  C  CA    . GLN A 1 56  ? -25.010 51.713 -257.089 1.00 15.10 ? 374 GLN A CA    1 
ATOM   464  C  C     . GLN A 1 56  ? -25.887 51.082 -256.015 1.00 16.87 ? 374 GLN A C     1 
ATOM   465  O  O     . GLN A 1 56  ? -25.397 50.835 -254.909 1.00 17.48 ? 374 GLN A O     1 
ATOM   466  C  CB    . GLN A 1 56  ? -24.608 53.136 -256.697 1.00 16.14 ? 374 GLN A CB    1 
ATOM   467  C  CG    . GLN A 1 56  ? -23.457 53.678 -257.536 1.00 17.85 ? 374 GLN A CG    1 
ATOM   468  C  CD    . GLN A 1 56  ? -23.014 55.068 -257.121 1.00 22.63 ? 374 GLN A CD    1 
ATOM   469  O  OE1   . GLN A 1 56  ? -21.822 55.377 -257.128 1.00 32.00 ? 374 GLN A OE1   1 
ATOM   470  N  NE2   . GLN A 1 56  ? -23.970 55.915 -256.765 1.00 23.37 ? 374 GLN A NE2   1 
ATOM   471  N  N     . ARG A 1 57  ? -27.158 50.800 -256.313 1.00 18.95 ? 375 ARG A N     1 
ATOM   472  C  CA    . ARG A 1 57  ? -27.973 50.018 -255.391 1.00 17.15 ? 375 ARG A CA    1 
ATOM   473  C  C     . ARG A 1 57  ? -27.446 48.597 -255.233 1.00 19.95 ? 375 ARG A C     1 
ATOM   474  O  O     . ARG A 1 57  ? -27.733 47.948 -254.222 1.00 19.91 ? 375 ARG A O     1 
ATOM   475  C  CB    . ARG A 1 57  ? -29.427 49.994 -255.864 1.00 18.26 ? 375 ARG A CB    1 
ATOM   476  C  CG    . ARG A 1 57  ? -30.049 51.372 -256.010 1.00 17.30 ? 375 ARG A CG    1 
ATOM   477  C  CD    . ARG A 1 57  ? -31.432 51.292 -256.633 1.00 22.10 ? 375 ARG A CD    1 
ATOM   478  N  NE    . ARG A 1 57  ? -31.961 52.617 -256.952 1.00 20.71 ? 375 ARG A NE    1 
ATOM   479  C  CZ    . ARG A 1 57  ? -33.009 52.833 -257.740 1.00 24.35 ? 375 ARG A CZ    1 
ATOM   480  N  NH1   . ARG A 1 57  ? -33.646 51.810 -258.294 1.00 20.64 ? 375 ARG A NH1   1 
ATOM   481  N  NH2   . ARG A 1 57  ? -33.417 54.071 -257.976 1.00 27.94 ? 375 ARG A NH2   1 
ATOM   482  N  N     . ARG A 1 58  ? -26.683 48.100 -256.211 1.00 17.92 ? 376 ARG A N     1 
ATOM   483  C  CA    . ARG A 1 58  ? -26.036 46.800 -256.060 1.00 19.52 ? 376 ARG A CA    1 
ATOM   484  C  C     . ARG A 1 58  ? -25.103 46.783 -254.859 1.00 23.13 ? 376 ARG A C     1 
ATOM   485  O  O     . ARG A 1 58  ? -25.032 45.786 -254.131 1.00 23.76 ? 376 ARG A O     1 
ATOM   486  C  CB    . ARG A 1 58  ? -25.246 46.443 -257.317 1.00 18.61 ? 376 ARG A CB    1 
ATOM   487  C  CG    . ARG A 1 58  ? -26.053 46.305 -258.578 1.00 20.57 ? 376 ARG A CG    1 
ATOM   488  C  CD    . ARG A 1 58  ? -25.242 45.543 -259.606 1.00 24.10 ? 376 ARG A CD    1 
ATOM   489  N  NE    . ARG A 1 58  ? -25.122 44.136 -259.236 1.00 33.02 ? 376 ARG A NE    1 
ATOM   490  C  CZ    . ARG A 1 58  ? -24.464 43.226 -259.947 1.00 45.06 ? 376 ARG A CZ    1 
ATOM   491  N  NH1   . ARG A 1 58  ? -23.856 43.572 -261.073 1.00 44.19 ? 376 ARG A NH1   1 
ATOM   492  N  NH2   . ARG A 1 58  ? -24.415 41.969 -259.529 1.00 49.67 ? 376 ARG A NH2   1 
ATOM   493  N  N     . HIS A 1 59  ? -24.365 47.874 -254.648 1.00 18.58 ? 377 HIS A N     1 
ATOM   494  C  CA    . HIS A 1 59  ? -23.385 47.916 -253.570 1.00 20.29 ? 377 HIS A CA    1 
ATOM   495  C  C     . HIS A 1 59  ? -24.040 48.201 -252.225 1.00 22.69 ? 377 HIS A C     1 
ATOM   496  O  O     . HIS A 1 59  ? -23.701 47.568 -251.219 1.00 24.96 ? 377 HIS A O     1 
ATOM   497  C  CB    . HIS A 1 59  ? -22.319 48.967 -253.876 1.00 20.73 ? 377 HIS A CB    1 
ATOM   498  C  CG    . HIS A 1 59  ? -21.628 48.761 -255.188 1.00 22.50 ? 377 HIS A CG    1 
ATOM   499  N  ND1   . HIS A 1 59  ? -20.700 47.763 -255.391 1.00 23.24 ? 377 HIS A ND1   1 
ATOM   500  C  CD2   . HIS A 1 59  ? -21.731 49.425 -256.364 1.00 20.33 ? 377 HIS A CD2   1 
ATOM   501  C  CE1   . HIS A 1 59  ? -20.260 47.821 -256.635 1.00 23.95 ? 377 HIS A CE1   1 
ATOM   502  N  NE2   . HIS A 1 59  ? -20.870 48.820 -257.247 1.00 20.85 ? 377 HIS A NE2   1 
ATOM   503  N  N     . THR A 1 60  ? -24.978 49.148 -252.188 1.00 20.52 ? 378 THR A N     1 
ATOM   504  C  CA    . THR A 1 60  ? -25.655 49.486 -250.944 1.00 22.82 ? 378 THR A CA    1 
ATOM   505  C  C     . THR A 1 60  ? -26.690 48.446 -250.537 1.00 22.65 ? 378 THR A C     1 
ATOM   506  O  O     . THR A 1 60  ? -27.045 48.376 -249.355 1.00 26.68 ? 378 THR A O     1 
ATOM   507  C  CB    . THR A 1 60  ? -26.327 50.854 -251.069 1.00 21.51 ? 378 THR A CB    1 
ATOM   508  O  OG1   . THR A 1 60  ? -27.349 50.794 -252.073 1.00 22.33 ? 378 THR A OG1   1 
ATOM   509  C  CG2   . THR A 1 60  ? -25.309 51.918 -251.456 1.00 23.34 ? 378 THR A CG2   1 
ATOM   510  N  N     . GLY A 1 61  ? -27.175 47.639 -251.480 1.00 30.02 ? 379 GLY A N     1 
ATOM   511  C  CA    . GLY A 1 61  ? -28.195 46.653 -251.184 1.00 32.72 ? 379 GLY A CA    1 
ATOM   512  C  C     . GLY A 1 61  ? -29.569 47.217 -250.913 1.00 35.30 ? 379 GLY A C     1 
ATOM   513  O  O     . GLY A 1 61  ? -30.442 46.484 -250.439 1.00 33.33 ? 379 GLY A O     1 
ATOM   514  N  N     . VAL A 1 62  ? -29.791 48.499 -251.205 1.00 27.91 ? 380 VAL A N     1 
ATOM   515  C  CA    . VAL A 1 62  ? -31.065 49.132 -250.897 1.00 29.39 ? 380 VAL A CA    1 
ATOM   516  C  C     . VAL A 1 62  ? -32.144 48.614 -251.838 1.00 28.31 ? 380 VAL A C     1 
ATOM   517  O  O     . VAL A 1 62  ? -31.935 48.494 -253.053 1.00 24.98 ? 380 VAL A O     1 
ATOM   518  C  CB    . VAL A 1 62  ? -30.934 50.662 -250.983 1.00 32.66 ? 380 VAL A CB    1 
ATOM   519  C  CG1   . VAL A 1 62  ? -32.267 51.327 -250.693 1.00 38.67 ? 380 VAL A CG1   1 
ATOM   520  C  CG2   . VAL A 1 62  ? -29.869 51.155 -250.014 1.00 37.13 ? 380 VAL A CG2   1 
ATOM   521  N  N     . LYS A 1 63  ? -33.309 48.294 -251.271 1.00 27.23 ? 381 LYS A N     1 
ATOM   522  C  CA    . LYS A 1 63  ? -34.489 47.873 -252.026 1.00 23.19 ? 381 LYS A CA    1 
ATOM   523  C  C     . LYS A 1 63  ? -35.612 48.844 -251.689 1.00 26.99 ? 381 LYS A C     1 
ATOM   524  O  O     . LYS A 1 63  ? -36.411 48.596 -250.772 1.00 30.33 ? 381 LYS A O     1 
ATOM   525  C  CB    . LYS A 1 63  ? -34.869 46.431 -251.697 1.00 29.36 ? 381 LYS A CB    1 
ATOM   526  C  CG    . LYS A 1 63  ? -33.779 45.424 -252.029 1.00 31.16 ? 381 LYS A CG    1 
ATOM   527  C  CD    . LYS A 1 63  ? -34.246 43.993 -251.822 1.00 38.08 ? 381 LYS A CD    1 
ATOM   528  C  CE    . LYS A 1 63  ? -33.172 43.001 -252.243 1.00 45.79 ? 381 LYS A CE    1 
ATOM   529  N  NZ    . LYS A 1 63  ? -33.633 41.589 -252.135 1.00 54.16 ? 381 LYS A NZ    1 
ATOM   530  N  N     . PRO A 1 64  ? -35.712 49.967 -252.407 1.00 24.34 ? 382 PRO A N     1 
ATOM   531  C  CA    . PRO A 1 64  ? -36.625 51.037 -251.976 1.00 28.03 ? 382 PRO A CA    1 
ATOM   532  C  C     . PRO A 1 64  ? -38.091 50.769 -252.260 1.00 26.18 ? 382 PRO A C     1 
ATOM   533  O  O     . PRO A 1 64  ? -38.945 51.452 -251.678 1.00 29.43 ? 382 PRO A O     1 
ATOM   534  C  CB    . PRO A 1 64  ? -36.135 52.261 -252.772 1.00 28.92 ? 382 PRO A CB    1 
ATOM   535  C  CG    . PRO A 1 64  ? -34.814 51.848 -253.387 1.00 27.06 ? 382 PRO A CG    1 
ATOM   536  C  CD    . PRO A 1 64  ? -34.903 50.371 -253.566 1.00 27.69 ? 382 PRO A CD    1 
ATOM   537  N  N     . PHE A 1 65  ? -38.417 49.810 -253.121 1.00 23.54 ? 383 PHE A N     1 
ATOM   538  C  CA    . PHE A 1 65  ? -39.778 49.619 -253.608 1.00 21.23 ? 383 PHE A CA    1 
ATOM   539  C  C     . PHE A 1 65  ? -40.354 48.341 -253.012 1.00 23.05 ? 383 PHE A C     1 
ATOM   540  O  O     . PHE A 1 65  ? -39.855 47.244 -253.286 1.00 28.23 ? 383 PHE A O     1 
ATOM   541  C  CB    . PHE A 1 65  ? -39.792 49.576 -255.135 1.00 21.26 ? 383 PHE A CB    1 
ATOM   542  C  CG    . PHE A 1 65  ? -39.034 50.709 -255.769 1.00 21.88 ? 383 PHE A CG    1 
ATOM   543  C  CD1   . PHE A 1 65  ? -39.631 51.947 -255.943 1.00 27.03 ? 383 PHE A CD1   1 
ATOM   544  C  CD2   . PHE A 1 65  ? -37.719 50.542 -256.171 1.00 21.82 ? 383 PHE A CD2   1 
ATOM   545  C  CE1   . PHE A 1 65  ? -38.933 52.994 -256.518 1.00 30.51 ? 383 PHE A CE1   1 
ATOM   546  C  CE2   . PHE A 1 65  ? -37.017 51.584 -256.746 1.00 24.80 ? 383 PHE A CE2   1 
ATOM   547  C  CZ    . PHE A 1 65  ? -37.625 52.812 -256.920 1.00 25.78 ? 383 PHE A CZ    1 
ATOM   548  N  N     . GLN A 1 66  ? -41.405 48.484 -252.207 1.00 23.85 ? 384 GLN A N     1 
ATOM   549  C  CA    . GLN A 1 66  ? -41.969 47.380 -251.441 1.00 23.59 ? 384 GLN A CA    1 
ATOM   550  C  C     . GLN A 1 66  ? -43.346 47.009 -251.975 1.00 24.04 ? 384 GLN A C     1 
ATOM   551  O  O     . GLN A 1 66  ? -44.192 47.884 -252.191 1.00 25.95 ? 384 GLN A O     1 
ATOM   552  C  CB    . GLN A 1 66  ? -42.065 47.741 -249.956 1.00 24.87 ? 384 GLN A CB    1 
ATOM   553  C  CG    . GLN A 1 66  ? -42.551 46.600 -249.077 1.00 28.82 ? 384 GLN A CG    1 
ATOM   554  C  CD    . GLN A 1 66  ? -42.546 46.952 -247.602 1.00 36.16 ? 384 GLN A CD    1 
ATOM   555  O  OE1   . GLN A 1 66  ? -42.800 48.095 -247.222 1.00 35.49 ? 384 GLN A OE1   1 
ATOM   556  N  NE2   . GLN A 1 66  ? -42.250 45.968 -246.761 1.00 36.23 ? 384 GLN A NE2   1 
ATOM   557  N  N     . CYS A 1 67  ? -43.565 45.711 -252.174 1.00 22.78 ? 385 CYS A N     1 
ATOM   558  C  CA    . CYS A 1 67  ? -44.863 45.220 -252.613 1.00 22.86 ? 385 CYS A CA    1 
ATOM   559  C  C     . CYS A 1 67  ? -45.897 45.403 -251.508 1.00 26.24 ? 385 CYS A C     1 
ATOM   560  O  O     . CYS A 1 67  ? -45.676 44.998 -250.364 1.00 26.14 ? 385 CYS A O     1 
ATOM   561  C  CB    . CYS A 1 67  ? -44.757 43.749 -253.005 1.00 22.90 ? 385 CYS A CB    1 
ATOM   562  S  SG    . CYS A 1 67  ? -46.313 42.989 -253.505 1.00 24.05 ? 385 CYS A SG    1 
ATOM   563  N  N     . LYS A 1 68  ? -47.029 46.015 -251.849 1.00 24.26 ? 386 LYS A N     1 
ATOM   564  C  CA    . LYS A 1 68  ? -48.087 46.242 -250.872 1.00 25.49 ? 386 LYS A CA    1 
ATOM   565  C  C     . LYS A 1 68  ? -48.913 44.995 -250.586 1.00 25.85 ? 386 LYS A C     1 
ATOM   566  O  O     . LYS A 1 68  ? -49.824 45.055 -249.752 1.00 30.41 ? 386 LYS A O     1 
ATOM   567  C  CB    . LYS A 1 68  ? -49.003 47.376 -251.343 1.00 28.53 ? 386 LYS A CB    1 
ATOM   568  C  CG    . LYS A 1 68  ? -48.328 48.741 -251.363 1.00 33.28 ? 386 LYS A CG    1 
ATOM   569  C  CD    . LYS A 1 68  ? -49.290 49.833 -251.801 1.00 38.97 ? 386 LYS A CD    1 
ATOM   570  C  CE    . LYS A 1 68  ? -48.648 51.207 -251.701 1.00 39.55 ? 386 LYS A CE    1 
ATOM   571  N  NZ    . LYS A 1 68  ? -47.452 51.330 -252.579 1.00 41.25 ? 386 LYS A NZ    1 
ATOM   572  N  N     . THR A 1 69  ? -48.619 43.873 -251.243 1.00 28.48 ? 387 THR A N     1 
ATOM   573  C  CA    . THR A 1 69  ? -49.335 42.622 -251.022 1.00 29.36 ? 387 THR A CA    1 
ATOM   574  C  C     . THR A 1 69  ? -48.558 41.647 -250.144 1.00 32.90 ? 387 THR A C     1 
ATOM   575  O  O     . THR A 1 69  ? -49.090 41.161 -249.142 1.00 31.17 ? 387 THR A O     1 
ATOM   576  C  CB    . THR A 1 69  ? -49.666 41.955 -252.364 1.00 28.81 ? 387 THR A CB    1 
ATOM   577  O  OG1   . THR A 1 69  ? -50.553 42.796 -253.115 1.00 29.96 ? 387 THR A OG1   1 
ATOM   578  C  CG2   . THR A 1 69  ? -50.328 40.604 -252.139 1.00 31.10 ? 387 THR A CG2   1 
ATOM   579  N  N     . CYS A 1 70  ? -47.306 41.353 -250.496 1.00 30.98 ? 388 CYS A N     1 
ATOM   580  C  CA    . CYS A 1 70  ? -46.497 40.384 -249.767 1.00 29.01 ? 388 CYS A CA    1 
ATOM   581  C  C     . CYS A 1 70  ? -45.335 41.015 -249.013 1.00 30.70 ? 388 CYS A C     1 
ATOM   582  O  O     . CYS A 1 70  ? -44.585 40.292 -248.347 1.00 32.70 ? 388 CYS A O     1 
ATOM   583  C  CB    . CYS A 1 70  ? -45.962 39.312 -250.723 1.00 31.07 ? 388 CYS A CB    1 
ATOM   584  S  SG    . CYS A 1 70  ? -44.587 39.859 -251.760 1.00 28.35 ? 388 CYS A SG    1 
ATOM   585  N  N     . GLN A 1 71  ? -45.159 42.333 -249.109 1.00 31.12 ? 389 GLN A N     1 
ATOM   586  C  CA    . GLN A 1 71  ? -44.152 43.113 -248.391 1.00 28.95 ? 389 GLN A CA    1 
ATOM   587  C  C     . GLN A 1 71  ? -42.723 42.803 -248.819 1.00 29.91 ? 389 GLN A C     1 
ATOM   588  O  O     . GLN A 1 71  ? -41.779 43.240 -248.148 1.00 32.08 ? 389 GLN A O     1 
ATOM   589  C  CB    . GLN A 1 71  ? -44.273 42.947 -246.870 1.00 35.41 ? 389 GLN A CB    1 
ATOM   590  C  CG    . GLN A 1 71  ? -45.415 43.738 -246.242 1.00 39.87 ? 389 GLN A CG    1 
ATOM   591  C  CD    . GLN A 1 71  ? -46.781 43.235 -246.664 1.00 43.28 ? 389 GLN A CD    1 
ATOM   592  O  OE1   . GLN A 1 71  ? -47.625 44.006 -247.124 1.00 48.07 ? 389 GLN A OE1   1 
ATOM   593  N  NE2   . GLN A 1 71  ? -47.009 41.936 -246.506 1.00 40.61 ? 389 GLN A NE2   1 
ATOM   594  N  N     . ARG A 1 72  ? -42.526 42.072 -249.913 1.00 28.73 ? 390 ARG A N     1 
ATOM   595  C  CA    . ARG A 1 72  ? -41.180 41.887 -250.436 1.00 26.42 ? 390 ARG A CA    1 
ATOM   596  C  C     . ARG A 1 72  ? -40.670 43.202 -251.014 1.00 25.17 ? 390 ARG A C     1 
ATOM   597  O  O     . ARG A 1 72  ? -41.432 43.981 -251.593 1.00 25.09 ? 390 ARG A O     1 
ATOM   598  C  CB    . ARG A 1 72  ? -41.158 40.789 -251.502 1.00 25.92 ? 390 ARG A CB    1 
ATOM   599  C  CG    . ARG A 1 72  ? -39.768 40.486 -252.055 1.00 28.46 ? 390 ARG A CG    1 
ATOM   600  C  CD    . ARG A 1 72  ? -39.745 39.198 -252.863 1.00 28.47 ? 390 ARG A CD    1 
ATOM   601  N  NE    . ARG A 1 72  ? -38.410 38.908 -253.381 1.00 32.64 ? 390 ARG A NE    1 
ATOM   602  C  CZ    . ARG A 1 72  ? -38.058 37.756 -253.943 1.00 36.51 ? 390 ARG A CZ    1 
ATOM   603  N  NH1   . ARG A 1 72  ? -38.942 36.775 -254.063 1.00 37.33 ? 390 ARG A NH1   1 
ATOM   604  N  NH2   . ARG A 1 72  ? -36.819 37.584 -254.384 1.00 33.59 ? 390 ARG A NH2   1 
ATOM   605  N  N     . LYS A 1 73  ? -39.377 43.453 -250.840 1.00 25.66 ? 391 LYS A N     1 
ATOM   606  C  CA    . LYS A 1 73  ? -38.748 44.689 -251.277 1.00 22.39 ? 391 LYS A CA    1 
ATOM   607  C  C     . LYS A 1 73  ? -37.899 44.439 -252.516 1.00 24.43 ? 391 LYS A C     1 
ATOM   608  O  O     . LYS A 1 73  ? -37.337 43.355 -252.698 1.00 25.69 ? 391 LYS A O     1 
ATOM   609  C  CB    . LYS A 1 73  ? -37.893 45.283 -250.157 1.00 24.97 ? 391 LYS A CB    1 
ATOM   610  C  CG    . LYS A 1 73  ? -38.679 45.545 -248.884 1.00 26.85 ? 391 LYS A CG    1 
ATOM   611  C  CD    . LYS A 1 73  ? -37.763 45.852 -247.712 1.00 31.72 ? 391 LYS A CD    1 
ATOM   612  C  CE    . LYS A 1 73  ? -38.550 45.967 -246.415 1.00 42.40 ? 391 LYS A CE    1 
ATOM   613  N  NZ    . LYS A 1 73  ? -37.665 46.161 -245.231 1.00 43.98 ? 391 LYS A NZ    1 
ATOM   614  N  N     . PHE A 1 74  ? -37.810 45.458 -253.371 1.00 20.42 ? 392 PHE A N     1 
ATOM   615  C  CA    . PHE A 1 74  ? -37.162 45.324 -254.667 1.00 19.27 ? 392 PHE A CA    1 
ATOM   616  C  C     . PHE A 1 74  ? -36.274 46.530 -254.934 1.00 19.79 ? 392 PHE A C     1 
ATOM   617  O  O     . PHE A 1 74  ? -36.554 47.643 -254.484 1.00 20.96 ? 392 PHE A O     1 
ATOM   618  C  CB    . PHE A 1 74  ? -38.194 45.168 -255.793 1.00 19.33 ? 392 PHE A CB    1 
ATOM   619  C  CG    . PHE A 1 74  ? -39.048 43.941 -255.655 1.00 19.54 ? 392 PHE A CG    1 
ATOM   620  C  CD1   . PHE A 1 74  ? -38.693 42.760 -256.285 1.00 19.72 ? 392 PHE A CD1   1 
ATOM   621  C  CD2   . PHE A 1 74  ? -40.197 43.965 -254.882 1.00 21.26 ? 392 PHE A CD2   1 
ATOM   622  C  CE1   . PHE A 1 74  ? -39.473 41.627 -256.152 1.00 23.88 ? 392 PHE A CE1   1 
ATOM   623  C  CE2   . PHE A 1 74  ? -40.979 42.835 -254.745 1.00 22.31 ? 392 PHE A CE2   1 
ATOM   624  C  CZ    . PHE A 1 74  ? -40.614 41.667 -255.379 1.00 22.01 ? 392 PHE A CZ    1 
ATOM   625  N  N     . SER A 1 75  ? -35.198 46.290 -255.684 1.00 19.60 ? 393 SER A N     1 
ATOM   626  C  CA    . SER A 1 75  ? -34.242 47.347 -255.985 1.00 19.40 ? 393 SER A CA    1 
ATOM   627  C  C     . SER A 1 75  ? -34.774 48.346 -257.003 1.00 20.61 ? 393 SER A C     1 
ATOM   628  O  O     . SER A 1 75  ? -34.305 49.488 -257.032 1.00 22.13 ? 393 SER A O     1 
ATOM   629  C  CB    . SER A 1 75  ? -32.936 46.740 -256.501 1.00 20.40 ? 393 SER A CB    1 
ATOM   630  O  OG    . SER A 1 75  ? -33.158 46.011 -257.697 1.00 21.14 ? 393 SER A OG    1 
ATOM   631  N  N     . ARG A 1 76  ? -35.738 47.951 -257.832 1.00 18.16 ? 394 ARG A N     1 
ATOM   632  C  CA    . ARG A 1 76  ? -36.182 48.780 -258.943 1.00 17.37 ? 394 ARG A CA    1 
ATOM   633  C  C     . ARG A 1 76  ? -37.700 48.769 -259.038 1.00 20.45 ? 394 ARG A C     1 
ATOM   634  O  O     . ARG A 1 76  ? -38.341 47.747 -258.782 1.00 18.27 ? 394 ARG A O     1 
ATOM   635  C  CB    . ARG A 1 76  ? -35.562 48.302 -260.258 1.00 15.09 ? 394 ARG A CB    1 
ATOM   636  C  CG    . ARG A 1 76  ? -34.087 48.645 -260.382 1.00 16.95 ? 394 ARG A CG    1 
ATOM   637  C  CD    . ARG A 1 76  ? -33.402 47.839 -261.468 1.00 19.39 ? 394 ARG A CD    1 
ATOM   638  N  NE    . ARG A 1 76  ? -34.148 47.849 -262.722 1.00 17.41 ? 394 ARG A NE    1 
ATOM   639  C  CZ    . ARG A 1 76  ? -33.609 47.574 -263.905 1.00 15.77 ? 394 ARG A CZ    1 
ATOM   640  N  NH1   . ARG A 1 76  ? -32.318 47.288 -263.989 1.00 14.97 ? 394 ARG A NH1   1 
ATOM   641  N  NH2   . ARG A 1 76  ? -34.355 47.597 -265.000 1.00 16.25 ? 394 ARG A NH2   1 
ATOM   642  N  N     . SER A 1 77  ? -38.266 49.915 -259.426 1.00 16.63 ? 395 SER A N     1 
ATOM   643  C  CA    . SER A 1 77  ? -39.718 50.063 -259.463 1.00 16.87 ? 395 SER A CA    1 
ATOM   644  C  C     . SER A 1 77  ? -40.345 49.263 -260.597 1.00 17.18 ? 395 SER A C     1 
ATOM   645  O  O     . SER A 1 77  ? -41.469 48.770 -260.451 1.00 18.94 ? 395 SER A O     1 
ATOM   646  C  CB    . SER A 1 77  ? -40.093 51.541 -259.588 1.00 19.28 ? 395 SER A CB    1 
ATOM   647  O  OG    . SER A 1 77  ? -39.668 52.069 -260.833 1.00 20.31 ? 395 SER A OG    1 
ATOM   648  N  N     . ASP A 1 78  ? -39.647 49.123 -261.728 1.00 16.98 ? 396 ASP A N     1 
ATOM   649  C  CA    . ASP A 1 78  ? -40.203 48.347 -262.832 1.00 17.25 ? 396 ASP A CA    1 
ATOM   650  C  C     . ASP A 1 78  ? -40.251 46.864 -262.487 1.00 18.98 ? 396 ASP A C     1 
ATOM   651  O  O     . ASP A 1 78  ? -41.181 46.156 -262.890 1.00 17.10 ? 396 ASP A O     1 
ATOM   652  C  CB    . ASP A 1 78  ? -39.399 48.587 -264.111 1.00 17.45 ? 396 ASP A CB    1 
ATOM   653  C  CG    . ASP A 1 78  ? -37.933 48.220 -263.964 1.00 22.19 ? 396 ASP A CG    1 
ATOM   654  O  OD1   . ASP A 1 78  ? -37.393 48.345 -262.846 1.00 21.97 ? 396 ASP A OD1   1 
ATOM   655  O  OD2   . ASP A 1 78  ? -37.323 47.808 -264.972 1.00 22.17 ? 396 ASP A OD2   1 
ATOM   656  N  N     . HIS A 1 79  ? -39.267 46.382 -261.725 1.00 15.54 ? 397 HIS A N     1 
ATOM   657  C  CA    . HIS A 1 79  ? -39.286 44.986 -261.306 1.00 15.41 ? 397 HIS A CA    1 
ATOM   658  C  C     . HIS A 1 79  ? -40.318 44.743 -260.213 1.00 16.53 ? 397 HIS A C     1 
ATOM   659  O  O     . HIS A 1 79  ? -40.881 43.645 -260.132 1.00 17.71 ? 397 HIS A O     1 
ATOM   660  C  CB    . HIS A 1 79  ? -37.895 44.559 -260.845 1.00 16.42 ? 397 HIS A CB    1 
ATOM   661  C  CG    . HIS A 1 79  ? -36.893 44.498 -261.953 1.00 14.17 ? 397 HIS A CG    1 
ATOM   662  N  ND1   . HIS A 1 79  ? -37.258 44.403 -263.279 1.00 15.55 ? 397 HIS A ND1   1 
ATOM   663  C  CD2   . HIS A 1 79  ? -35.539 44.524 -261.936 1.00 16.98 ? 397 HIS A CD2   1 
ATOM   664  C  CE1   . HIS A 1 79  ? -36.172 44.368 -264.030 1.00 16.57 ? 397 HIS A CE1   1 
ATOM   665  N  NE2   . HIS A 1 79  ? -35.116 44.441 -263.240 1.00 15.19 ? 397 HIS A NE2   1 
ATOM   666  N  N     . LEU A 1 80  ? -40.578 45.742 -259.367 1.00 16.45 ? 398 LEU A N     1 
ATOM   667  C  CA    . LEU A 1 80  ? -41.705 45.640 -258.444 1.00 17.67 ? 398 LEU A CA    1 
ATOM   668  C  C     . LEU A 1 80  ? -43.014 45.507 -259.209 1.00 16.82 ? 398 LEU A C     1 
ATOM   669  O  O     . LEU A 1 80  ? -43.862 44.672 -258.870 1.00 16.62 ? 398 LEU A O     1 
ATOM   670  C  CB    . LEU A 1 80  ? -41.750 46.859 -257.522 1.00 16.08 ? 398 LEU A CB    1 
ATOM   671  C  CG    . LEU A 1 80  ? -43.049 46.993 -256.717 1.00 18.54 ? 398 LEU A CG    1 
ATOM   672  C  CD1   . LEU A 1 80  ? -43.229 45.801 -255.793 1.00 20.69 ? 398 LEU A CD1   1 
ATOM   673  C  CD2   . LEU A 1 80  ? -43.087 48.295 -255.934 1.00 22.21 ? 398 LEU A CD2   1 
ATOM   674  N  N     . LYS A 1 81  ? -43.192 46.319 -260.254 1.00 15.19 ? 399 LYS A N     1 
ATOM   675  C  CA    . LYS A 1 81  ? -44.449 46.321 -260.996 1.00 16.48 ? 399 LYS A CA    1 
ATOM   676  C  C     . LYS A 1 81  ? -44.742 44.953 -261.601 1.00 16.90 ? 399 LYS A C     1 
ATOM   677  O  O     . LYS A 1 81  ? -45.841 44.411 -261.435 1.00 19.15 ? 399 LYS A O     1 
ATOM   678  C  CB    . LYS A 1 81  ? -44.414 47.393 -262.084 1.00 16.06 ? 399 LYS A CB    1 
ATOM   679  C  CG    . LYS A 1 81  ? -45.675 47.454 -262.930 1.00 20.74 ? 399 LYS A CG    1 
ATOM   680  C  CD    . LYS A 1 81  ? -45.550 48.508 -264.015 1.00 25.18 ? 399 LYS A CD    1 
ATOM   681  C  CE    . LYS A 1 81  ? -45.340 49.891 -263.421 1.00 39.98 ? 399 LYS A CE    1 
ATOM   682  N  NZ    . LYS A 1 81  ? -45.185 50.920 -264.484 1.00 44.79 ? 399 LYS A NZ    1 
ATOM   683  N  N     . THR A 1 82  ? -43.770 44.378 -262.315 1.00 16.17 ? 400 THR A N     1 
ATOM   684  C  CA    . THR A 1 82  ? -43.987 43.060 -262.903 1.00 15.69 ? 400 THR A CA    1 
ATOM   685  C  C     . THR A 1 82  ? -44.127 41.984 -261.834 1.00 19.89 ? 400 THR A C     1 
ATOM   686  O  O     . THR A 1 82  ? -44.831 40.991 -262.048 1.00 19.14 ? 400 THR A O     1 
ATOM   687  C  CB    . THR A 1 82  ? -42.852 42.712 -263.867 1.00 17.42 ? 400 THR A CB    1 
ATOM   688  O  OG1   . THR A 1 82  ? -41.598 42.743 -263.174 1.00 17.36 ? 400 THR A OG1   1 
ATOM   689  C  CG2   . THR A 1 82  ? -42.814 43.700 -265.023 1.00 18.64 ? 400 THR A CG2   1 
ATOM   690  N  N     . HIS A 1 83  ? -43.477 42.163 -260.680 1.00 17.48 ? 401 HIS A N     1 
ATOM   691  C  CA    . HIS A 1 83  ? -43.652 41.207 -259.591 1.00 18.12 ? 401 HIS A CA    1 
ATOM   692  C  C     . HIS A 1 83  ? -45.093 41.182 -259.099 1.00 19.78 ? 401 HIS A C     1 
ATOM   693  O  O     . HIS A 1 83  ? -45.641 40.109 -258.821 1.00 20.69 ? 401 HIS A O     1 
ATOM   694  C  CB    . HIS A 1 83  ? -42.720 41.536 -258.428 1.00 18.14 ? 401 HIS A CB    1 
ATOM   695  C  CG    . HIS A 1 83  ? -43.180 40.969 -257.122 1.00 20.79 ? 401 HIS A CG    1 
ATOM   696  N  ND1   . HIS A 1 83  ? -42.944 39.662 -256.755 1.00 19.94 ? 401 HIS A ND1   1 
ATOM   697  C  CD2   . HIS A 1 83  ? -43.882 41.524 -256.105 1.00 22.52 ? 401 HIS A CD2   1 
ATOM   698  C  CE1   . HIS A 1 83  ? -43.471 39.439 -255.563 1.00 22.84 ? 401 HIS A CE1   1 
ATOM   699  N  NE2   . HIS A 1 83  ? -44.046 40.553 -255.148 1.00 18.30 ? 401 HIS A NE2   1 
ATOM   700  N  N     . THR A 1 84  ? -45.719 42.356 -258.971 1.00 19.31 ? 402 THR A N     1 
ATOM   701  C  CA    . THR A 1 84  ? -47.082 42.419 -258.452 1.00 21.06 ? 402 THR A CA    1 
ATOM   702  C  C     . THR A 1 84  ? -48.077 41.696 -259.347 1.00 24.63 ? 402 THR A C     1 
ATOM   703  O  O     . THR A 1 84  ? -49.170 41.349 -258.887 1.00 24.03 ? 402 THR A O     1 
ATOM   704  C  CB    . THR A 1 84  ? -47.520 43.874 -258.267 1.00 22.88 ? 402 THR A CB    1 
ATOM   705  O  OG1   . THR A 1 84  ? -47.519 44.547 -259.532 1.00 23.11 ? 402 THR A OG1   1 
ATOM   706  C  CG2   . THR A 1 84  ? -46.586 44.596 -257.308 1.00 20.38 ? 402 THR A CG2   1 
ATOM   707  N  N     . ARG A 1 85  ? -47.725 41.458 -260.612 1.00 23.84 ? 403 ARG A N     1 
ATOM   708  C  CA    . ARG A 1 85  ? -48.596 40.687 -261.489 1.00 26.72 ? 403 ARG A CA    1 
ATOM   709  C  C     . ARG A 1 85  ? -48.678 39.227 -261.073 1.00 29.55 ? 403 ARG A C     1 
ATOM   710  O  O     . ARG A 1 85  ? -49.613 38.530 -261.481 1.00 33.35 ? 403 ARG A O     1 
ATOM   711  C  CB    . ARG A 1 85  ? -48.115 40.806 -262.935 1.00 23.47 ? 403 ARG A CB    1 
ATOM   712  C  CG    . ARG A 1 85  ? -48.173 42.229 -263.458 1.00 22.81 ? 403 ARG A CG    1 
ATOM   713  C  CD    . ARG A 1 85  ? -47.579 42.358 -264.848 1.00 23.29 ? 403 ARG A CD    1 
ATOM   714  N  NE    . ARG A 1 85  ? -47.624 43.742 -265.311 1.00 22.32 ? 403 ARG A NE    1 
ATOM   715  C  CZ    . ARG A 1 85  ? -46.981 44.198 -266.381 1.00 25.19 ? 403 ARG A CZ    1 
ATOM   716  N  NH1   . ARG A 1 85  ? -46.229 43.381 -267.106 1.00 25.67 ? 403 ARG A NH1   1 
ATOM   717  N  NH2   . ARG A 1 85  ? -47.083 45.476 -266.720 1.00 26.36 ? 403 ARG A NH2   1 
ATOM   718  N  N     . THR A 1 86  ? -47.725 38.749 -260.268 1.00 25.50 ? 404 THR A N     1 
ATOM   719  C  CA    . THR A 1 86  ? -47.825 37.403 -259.718 1.00 28.22 ? 404 THR A CA    1 
ATOM   720  C  C     . THR A 1 86  ? -48.954 37.286 -258.702 1.00 32.00 ? 404 THR A C     1 
ATOM   721  O  O     . THR A 1 86  ? -49.420 36.172 -258.439 1.00 39.87 ? 404 THR A O     1 
ATOM   722  C  CB    . THR A 1 86  ? -46.498 36.992 -259.077 1.00 29.93 ? 404 THR A CB    1 
ATOM   723  O  OG1   . THR A 1 86  ? -46.244 37.808 -257.927 1.00 32.95 ? 404 THR A OG1   1 
ATOM   724  C  CG2   . THR A 1 86  ? -45.358 37.164 -260.067 1.00 31.53 ? 404 THR A CG2   1 
ATOM   725  N  N     . HIS A 1 87  ? -49.402 38.405 -258.130 1.00 26.73 ? 405 HIS A N     1 
ATOM   726  C  CA    . HIS A 1 87  ? -50.549 38.416 -257.231 1.00 29.32 ? 405 HIS A CA    1 
ATOM   727  C  C     . HIS A 1 87  ? -51.854 38.667 -257.981 1.00 33.26 ? 405 HIS A C     1 
ATOM   728  O  O     . HIS A 1 87  ? -52.833 37.940 -257.790 1.00 36.29 ? 405 HIS A O     1 
ATOM   729  C  CB    . HIS A 1 87  ? -50.367 39.483 -256.146 1.00 30.13 ? 405 HIS A CB    1 
ATOM   730  C  CG    . HIS A 1 87  ? -49.081 39.369 -255.389 1.00 30.27 ? 405 HIS A CG    1 
ATOM   731  N  ND1   . HIS A 1 87  ? -48.716 38.228 -254.707 1.00 31.66 ? 405 HIS A ND1   1 
ATOM   732  C  CD2   . HIS A 1 87  ? -48.080 40.260 -255.194 1.00 28.30 ? 405 HIS A CD2   1 
ATOM   733  C  CE1   . HIS A 1 87  ? -47.542 38.418 -254.133 1.00 31.39 ? 405 HIS A CE1   1 
ATOM   734  N  NE2   . HIS A 1 87  ? -47.134 39.643 -254.412 1.00 31.95 ? 405 HIS A NE2   1 
ATOM   735  N  N     . THR A 1 88  ? -51.876 39.693 -258.836 1.00 31.89 ? 406 THR A N     1 
ATOM   736  C  CA    . THR A 1 88  ? -53.092 40.087 -259.539 1.00 35.68 ? 406 THR A CA    1 
ATOM   737  C  C     . THR A 1 88  ? -53.464 39.134 -260.666 1.00 35.53 ? 406 THR A C     1 
ATOM   738  O  O     . THR A 1 88  ? -54.640 39.073 -261.043 1.00 39.67 ? 406 THR A O     1 
ATOM   739  C  CB    . THR A 1 88  ? -52.935 41.496 -260.114 1.00 33.28 ? 406 THR A CB    1 
ATOM   740  O  OG1   . THR A 1 88  ? -51.909 41.492 -261.117 1.00 33.92 ? 406 THR A OG1   1 
ATOM   741  C  CG2   . THR A 1 88  ? -52.554 42.481 -259.020 1.00 25.86 ? 406 THR A CG2   1 
ATOM   742  N  N     . GLY A 1 89  ? -52.500 38.400 -261.214 1.00 44.21 ? 407 GLY A N     1 
ATOM   743  C  CA    . GLY A 1 89  ? -52.765 37.550 -262.355 1.00 45.61 ? 407 GLY A CA    1 
ATOM   744  C  C     . GLY A 1 89  ? -52.853 38.272 -263.679 1.00 47.92 ? 407 GLY A C     1 
ATOM   745  O  O     . GLY A 1 89  ? -53.250 37.658 -264.676 1.00 49.95 ? 407 GLY A O     1 
ATOM   746  N  N     . GLU A 1 90  ? -52.500 39.555 -263.722 1.00 48.29 ? 408 GLU A N     1 
ATOM   747  C  CA    . GLU A 1 90  ? -52.530 40.309 -264.968 1.00 48.93 ? 408 GLU A CA    1 
ATOM   748  C  C     . GLU A 1 90  ? -51.493 39.767 -265.944 1.00 43.51 ? 408 GLU A C     1 
ATOM   749  O  O     . GLU A 1 90  ? -50.313 39.632 -265.604 1.00 41.41 ? 408 GLU A O     1 
ATOM   750  C  CB    . GLU A 1 90  ? -52.278 41.791 -264.696 1.00 51.94 ? 408 GLU A CB    1 
ATOM   751  C  CG    . GLU A 1 90  ? -53.540 42.636 -264.662 1.00 66.18 ? 408 GLU A CG    1 
ATOM   752  C  CD    . GLU A 1 90  ? -54.105 42.885 -266.047 1.00 77.68 ? 408 GLU A CD    1 
ATOM   753  O  OE1   . GLU A 1 90  ? -53.327 43.273 -266.943 1.00 80.35 ? 408 GLU A OE1   1 
ATOM   754  O  OE2   . GLU A 1 90  ? -55.323 42.685 -266.243 1.00 83.61 ? 408 GLU A OE2   1 
ATOM   755  N  N     . LYS A 1 91  ? -51.939 39.453 -267.159 1.00 41.73 ? 409 LYS A N     1 
ATOM   756  C  CA    . LYS A 1 91  ? -51.066 38.951 -268.220 1.00 41.29 ? 409 LYS A CA    1 
ATOM   757  C  C     . LYS A 1 91  ? -51.391 39.708 -269.499 1.00 38.97 ? 409 LYS A C     1 
ATOM   758  O  O     . LYS A 1 91  ? -52.188 39.255 -270.328 1.00 41.86 ? 409 LYS A O     1 
ATOM   759  C  CB    . LYS A 1 91  ? -51.235 37.441 -268.407 1.00 43.41 ? 409 LYS A CB    1 
ATOM   760  C  CG    . LYS A 1 91  ? -50.901 36.619 -267.170 1.00 46.83 ? 409 LYS A CG    1 
ATOM   761  C  CD    . LYS A 1 91  ? -51.106 35.134 -267.418 1.00 49.82 ? 409 LYS A CD    1 
ATOM   762  C  CE    . LYS A 1 91  ? -50.759 34.316 -266.184 1.00 50.90 ? 409 LYS A CE    1 
ATOM   763  N  NZ    . LYS A 1 91  ? -50.922 32.854 -266.417 1.00 54.08 ? 409 LYS A NZ    1 
ATOM   764  N  N     . PRO A 1 92  ? -50.778 40.879 -269.694 1.00 36.35 ? 410 PRO A N     1 
ATOM   765  C  CA    . PRO A 1 92  ? -51.165 41.747 -270.814 1.00 43.02 ? 410 PRO A CA    1 
ATOM   766  C  C     . PRO A 1 92  ? -50.551 41.367 -272.152 1.00 43.80 ? 410 PRO A C     1 
ATOM   767  O  O     . PRO A 1 92  ? -50.768 42.087 -273.134 1.00 45.70 ? 410 PRO A O     1 
ATOM   768  C  CB    . PRO A 1 92  ? -50.669 43.136 -270.362 1.00 43.04 ? 410 PRO A CB    1 
ATOM   769  C  CG    . PRO A 1 92  ? -49.944 42.923 -269.033 1.00 40.35 ? 410 PRO A CG    1 
ATOM   770  C  CD    . PRO A 1 92  ? -49.682 41.460 -268.909 1.00 36.34 ? 410 PRO A CD    1 
ATOM   771  N  N     . PHE A 1 93  ? -49.803 40.270 -272.232 1.00 39.37 ? 411 PHE A N     1 
ATOM   772  C  CA    . PHE A 1 93  ? -49.116 39.870 -273.455 1.00 37.08 ? 411 PHE A CA    1 
ATOM   773  C  C     . PHE A 1 93  ? -49.713 38.559 -273.955 1.00 38.54 ? 411 PHE A C     1 
ATOM   774  O  O     . PHE A 1 93  ? -49.463 37.496 -273.376 1.00 42.35 ? 411 PHE A O     1 
ATOM   775  C  CB    . PHE A 1 93  ? -47.615 39.742 -273.211 1.00 33.62 ? 411 PHE A CB    1 
ATOM   776  C  CG    . PHE A 1 93  ? -46.971 41.015 -272.743 1.00 35.72 ? 411 PHE A CG    1 
ATOM   777  C  CD1   . PHE A 1 93  ? -46.789 41.262 -271.392 1.00 32.95 ? 411 PHE A CD1   1 
ATOM   778  C  CD2   . PHE A 1 93  ? -46.557 41.971 -273.655 1.00 42.66 ? 411 PHE A CD2   1 
ATOM   779  C  CE1   . PHE A 1 93  ? -46.201 42.436 -270.961 1.00 40.38 ? 411 PHE A CE1   1 
ATOM   780  C  CE2   . PHE A 1 93  ? -45.970 43.147 -273.230 1.00 44.97 ? 411 PHE A CE2   1 
ATOM   781  C  CZ    . PHE A 1 93  ? -45.790 43.379 -271.882 1.00 44.72 ? 411 PHE A CZ    1 
ATOM   782  N  N     . SER A 1 94  ? -50.495 38.639 -275.028 1.00 39.19 ? 412 SER A N     1 
ATOM   783  C  CA    . SER A 1 94  ? -51.119 37.479 -275.646 1.00 46.77 ? 412 SER A CA    1 
ATOM   784  C  C     . SER A 1 94  ? -50.342 37.058 -276.888 1.00 47.24 ? 412 SER A C     1 
ATOM   785  O  O     . SER A 1 94  ? -49.692 37.875 -277.546 1.00 46.00 ? 412 SER A O     1 
ATOM   786  C  CB    . SER A 1 94  ? -52.575 37.774 -276.014 1.00 50.82 ? 412 SER A CB    1 
ATOM   787  O  OG    . SER A 1 94  ? -53.348 38.038 -274.856 1.00 54.47 ? 412 SER A OG    1 
ATOM   788  N  N     . CYS A 1 95  ? -50.426 35.765 -277.210 1.00 46.28 ? 413 CYS A N     1 
ATOM   789  C  CA    . CYS A 1 95  ? -49.595 35.214 -278.276 1.00 46.64 ? 413 CYS A CA    1 
ATOM   790  C  C     . CYS A 1 95  ? -50.109 35.606 -279.658 1.00 58.76 ? 413 CYS A C     1 
ATOM   791  O  O     . CYS A 1 95  ? -49.315 35.914 -280.554 1.00 61.71 ? 413 CYS A O     1 
ATOM   792  C  CB    . CYS A 1 95  ? -49.521 33.695 -278.150 1.00 41.48 ? 413 CYS A CB    1 
ATOM   793  S  SG    . CYS A 1 95  ? -48.601 32.912 -279.487 1.00 45.91 ? 413 CYS A SG    1 
ATOM   794  N  N     . ARG A 1 96  ? -51.429 35.576 -279.852 1.00 58.78 ? 414 ARG A N     1 
ATOM   795  C  CA    . ARG A 1 96  ? -52.131 35.868 -281.101 1.00 66.19 ? 414 ARG A CA    1 
ATOM   796  C  C     . ARG A 1 96  ? -51.935 34.791 -282.163 1.00 71.61 ? 414 ARG A C     1 
ATOM   797  O  O     . ARG A 1 96  ? -52.434 34.954 -283.284 1.00 75.39 ? 414 ARG A O     1 
ATOM   798  C  CB    . ARG A 1 96  ? -51.741 37.229 -281.698 1.00 67.12 ? 414 ARG A CB    1 
ATOM   799  N  N     . TRP A 1 97  ? -51.228 33.704 -281.860 1.00 71.03 ? 415 TRP A N     1 
ATOM   800  C  CA    . TRP A 1 97  ? -51.184 32.572 -282.772 1.00 72.96 ? 415 TRP A CA    1 
ATOM   801  C  C     . TRP A 1 97  ? -52.584 31.968 -282.882 1.00 77.79 ? 415 TRP A C     1 
ATOM   802  O  O     . TRP A 1 97  ? -53.351 31.994 -281.914 1.00 78.93 ? 415 TRP A O     1 
ATOM   803  C  CB    . TRP A 1 97  ? -50.180 31.528 -282.278 1.00 71.17 ? 415 TRP A CB    1 
ATOM   804  C  CG    . TRP A 1 97  ? -49.767 30.505 -283.301 1.00 73.44 ? 415 TRP A CG    1 
ATOM   805  C  CD1   . TRP A 1 97  ? -50.220 29.222 -283.407 1.00 73.66 ? 415 TRP A CD1   1 
ATOM   806  C  CD2   . TRP A 1 97  ? -48.815 30.681 -284.360 1.00 73.46 ? 415 TRP A CD2   1 
ATOM   807  N  NE1   . TRP A 1 97  ? -49.611 28.589 -284.464 1.00 73.72 ? 415 TRP A NE1   1 
ATOM   808  C  CE2   . TRP A 1 97  ? -48.744 29.463 -285.065 1.00 74.77 ? 415 TRP A CE2   1 
ATOM   809  C  CE3   . TRP A 1 97  ? -48.017 31.751 -284.779 1.00 71.57 ? 415 TRP A CE3   1 
ATOM   810  C  CZ2   . TRP A 1 97  ? -47.908 29.284 -286.166 1.00 73.15 ? 415 TRP A CZ2   1 
ATOM   811  C  CZ3   . TRP A 1 97  ? -47.187 31.571 -285.873 1.00 71.91 ? 415 TRP A CZ3   1 
ATOM   812  C  CH2   . TRP A 1 97  ? -47.139 30.347 -286.553 1.00 72.55 ? 415 TRP A CH2   1 
ATOM   813  N  N     . PRO A 1 98  ? -52.956 31.439 -284.062 1.00 84.66 ? 416 PRO A N     1 
ATOM   814  C  CA    . PRO A 1 98  ? -54.322 30.925 -284.253 1.00 89.07 ? 416 PRO A CA    1 
ATOM   815  C  C     . PRO A 1 98  ? -54.794 29.966 -283.168 1.00 87.10 ? 416 PRO A C     1 
ATOM   816  O  O     . PRO A 1 98  ? -55.820 30.211 -282.526 1.00 86.77 ? 416 PRO A O     1 
ATOM   817  C  CB    . PRO A 1 98  ? -54.235 30.222 -285.612 1.00 91.89 ? 416 PRO A CB    1 
ATOM   818  C  CG    . PRO A 1 98  ? -53.201 30.996 -286.349 1.00 90.55 ? 416 PRO A CG    1 
ATOM   819  C  CD    . PRO A 1 98  ? -52.187 31.431 -285.321 1.00 86.26 ? 416 PRO A CD    1 
ATOM   820  N  N     . SER A 1 99  ? -54.054 28.879 -282.947 1.00 84.99 ? 417 SER A N     1 
ATOM   821  C  CA    . SER A 1 99  ? -54.484 27.884 -281.971 1.00 84.36 ? 417 SER A CA    1 
ATOM   822  C  C     . SER A 1 99  ? -54.097 28.261 -280.546 1.00 85.06 ? 417 SER A C     1 
ATOM   823  O  O     . SER A 1 99  ? -54.835 27.944 -279.606 1.00 86.34 ? 417 SER A O     1 
ATOM   824  C  CB    . SER A 1 99  ? -53.899 26.515 -282.325 1.00 80.47 ? 417 SER A CB    1 
ATOM   825  N  N     . CYS A 1 100 ? -52.965 28.934 -280.362 1.00 82.52 ? 418 CYS A N     1 
ATOM   826  C  CA    . CYS A 1 100 ? -52.467 29.224 -279.025 1.00 73.24 ? 418 CYS A CA    1 
ATOM   827  C  C     . CYS A 1 100 ? -53.255 30.366 -278.394 1.00 71.93 ? 418 CYS A C     1 
ATOM   828  O  O     . CYS A 1 100 ? -53.514 31.388 -279.039 1.00 78.11 ? 418 CYS A O     1 
ATOM   829  C  CB    . CYS A 1 100 ? -50.979 29.568 -279.072 1.00 63.89 ? 418 CYS A CB    1 
ATOM   830  S  SG    . CYS A 1 100 ? -50.200 29.660 -277.447 1.00 57.22 ? 418 CYS A SG    1 
ATOM   831  N  N     . GLN A 1 101 ? -53.632 30.188 -277.127 1.00 61.23 ? 419 GLN A N     1 
ATOM   832  C  CA    . GLN A 1 101 ? -54.368 31.194 -276.369 1.00 62.43 ? 419 GLN A CA    1 
ATOM   833  C  C     . GLN A 1 101 ? -53.673 31.502 -275.047 1.00 59.52 ? 419 GLN A C     1 
ATOM   834  O  O     . GLN A 1 101 ? -54.325 31.863 -274.063 1.00 62.75 ? 419 GLN A O     1 
ATOM   835  C  CB    . GLN A 1 101 ? -55.808 30.745 -276.127 1.00 68.25 ? 419 GLN A CB    1 
ATOM   836  N  N     . LYS A 1 102 ? -52.351 31.367 -275.010 1.00 56.31 ? 420 LYS A N     1 
ATOM   837  C  CA    . LYS A 1 102 ? -51.598 31.589 -273.785 1.00 51.44 ? 420 LYS A CA    1 
ATOM   838  C  C     . LYS A 1 102 ? -51.276 33.067 -273.612 1.00 48.28 ? 420 LYS A C     1 
ATOM   839  O  O     . LYS A 1 102 ? -51.023 33.783 -274.586 1.00 46.51 ? 420 LYS A O     1 
ATOM   840  C  CB    . LYS A 1 102 ? -50.303 30.775 -273.799 1.00 48.69 ? 420 LYS A CB    1 
ATOM   841  N  N     . LYS A 1 103 ? -51.285 33.520 -272.361 1.00 43.48 ? 421 LYS A N     1 
ATOM   842  C  CA    . LYS A 1 103 ? -50.945 34.890 -272.011 1.00 44.27 ? 421 LYS A CA    1 
ATOM   843  C  C     . LYS A 1 103 ? -49.783 34.890 -271.026 1.00 36.44 ? 421 LYS A C     1 
ATOM   844  O  O     . LYS A 1 103 ? -49.519 33.894 -270.345 1.00 34.37 ? 421 LYS A O     1 
ATOM   845  C  CB    . LYS A 1 103 ? -52.150 35.630 -271.411 1.00 46.41 ? 421 LYS A CB    1 
ATOM   846  N  N     . PHE A 1 104 ? -49.081 36.021 -270.959 1.00 35.85 ? 422 PHE A N     1 
ATOM   847  C  CA    . PHE A 1 104 ? -47.874 36.124 -270.153 1.00 33.60 ? 422 PHE A CA    1 
ATOM   848  C  C     . PHE A 1 104 ? -47.825 37.473 -269.453 1.00 33.88 ? 422 PHE A C     1 
ATOM   849  O  O     . PHE A 1 104 ? -48.388 38.462 -269.929 1.00 34.17 ? 422 PHE A O     1 
ATOM   850  C  CB    . PHE A 1 104 ? -46.617 35.927 -271.009 1.00 30.66 ? 422 PHE A CB    1 
ATOM   851  C  CG    . PHE A 1 104 ? -46.574 34.605 -271.717 1.00 30.27 ? 422 PHE A CG    1 
ATOM   852  C  CD1   . PHE A 1 104 ? -46.044 33.487 -271.095 1.00 30.87 ? 422 PHE A CD1   1 
ATOM   853  C  CD2   . PHE A 1 104 ? -47.080 34.476 -273.000 1.00 29.67 ? 422 PHE A CD2   1 
ATOM   854  C  CE1   . PHE A 1 104 ? -46.012 32.267 -271.743 1.00 28.49 ? 422 PHE A CE1   1 
ATOM   855  C  CE2   . PHE A 1 104 ? -47.050 33.260 -273.652 1.00 32.31 ? 422 PHE A CE2   1 
ATOM   856  C  CZ    . PHE A 1 104 ? -46.516 32.154 -273.022 1.00 30.43 ? 422 PHE A CZ    1 
ATOM   857  N  N     . ALA A 1 105 ? -47.129 37.501 -268.314 1.00 30.01 ? 423 ALA A N     1 
ATOM   858  C  CA    . ALA A 1 105 ? -47.062 38.711 -267.505 1.00 30.59 ? 423 ALA A CA    1 
ATOM   859  C  C     . ALA A 1 105 ? -46.049 39.715 -268.040 1.00 29.82 ? 423 ALA A C     1 
ATOM   860  O  O     . ALA A 1 105 ? -46.206 40.921 -267.818 1.00 33.03 ? 423 ALA A O     1 
ATOM   861  C  CB    . ALA A 1 105 ? -46.725 38.355 -266.057 1.00 29.75 ? 423 ALA A CB    1 
ATOM   862  N  N     . ARG A 1 106 ? -45.007 39.252 -268.729 1.00 26.64 ? 424 ARG A N     1 
ATOM   863  C  CA    . ARG A 1 106 ? -43.962 40.133 -269.228 1.00 29.51 ? 424 ARG A CA    1 
ATOM   864  C  C     . ARG A 1 106 ? -43.748 39.893 -270.715 1.00 30.11 ? 424 ARG A C     1 
ATOM   865  O  O     . ARG A 1 106 ? -44.079 38.831 -271.249 1.00 27.06 ? 424 ARG A O     1 
ATOM   866  C  CB    . ARG A 1 106 ? -42.646 39.935 -268.462 1.00 28.40 ? 424 ARG A CB    1 
ATOM   867  C  CG    . ARG A 1 106 ? -42.809 39.988 -266.951 1.00 25.62 ? 424 ARG A CG    1 
ATOM   868  C  CD    . ARG A 1 106 ? -41.472 40.050 -266.230 1.00 23.40 ? 424 ARG A CD    1 
ATOM   869  N  NE    . ARG A 1 106 ? -40.429 39.284 -266.907 1.00 22.81 ? 424 ARG A NE    1 
ATOM   870  C  CZ    . ARG A 1 106 ? -39.423 38.679 -266.284 1.00 20.73 ? 424 ARG A CZ    1 
ATOM   871  N  NH1   . ARG A 1 106 ? -39.333 38.726 -264.961 1.00 19.48 ? 424 ARG A NH1   1 
ATOM   872  N  NH2   . ARG A 1 106 ? -38.513 38.013 -266.983 1.00 19.75 ? 424 ARG A NH2   1 
ATOM   873  N  N     . SER A 1 107 ? -43.187 40.908 -271.381 1.00 34.17 ? 425 SER A N     1 
ATOM   874  C  CA    . SER A 1 107 ? -42.997 40.831 -272.826 1.00 35.02 ? 425 SER A CA    1 
ATOM   875  C  C     . SER A 1 107 ? -41.951 39.788 -273.201 1.00 33.98 ? 425 SER A C     1 
ATOM   876  O  O     . SER A 1 107 ? -42.098 39.092 -274.213 1.00 32.86 ? 425 SER A O     1 
ATOM   877  C  CB    . SER A 1 107 ? -42.600 42.199 -273.378 1.00 39.93 ? 425 SER A CB    1 
ATOM   878  O  OG    . SER A 1 107 ? -41.314 42.582 -272.921 1.00 38.90 ? 425 SER A OG    1 
ATOM   879  N  N     . ASP A 1 108 ? -40.882 39.671 -272.409 1.00 26.78 ? 426 ASP A N     1 
ATOM   880  C  CA    . ASP A 1 108 ? -39.846 38.692 -272.718 1.00 28.54 ? 426 ASP A CA    1 
ATOM   881  C  C     . ASP A 1 108 ? -40.335 37.259 -272.548 1.00 29.65 ? 426 ASP A C     1 
ATOM   882  O  O     . ASP A 1 108 ? -39.773 36.349 -273.167 1.00 30.11 ? 426 ASP A O     1 
ATOM   883  C  CB    . ASP A 1 108 ? -38.604 38.938 -271.856 1.00 27.96 ? 426 ASP A CB    1 
ATOM   884  C  CG    . ASP A 1 108 ? -38.918 39.000 -270.374 1.00 28.05 ? 426 ASP A CG    1 
ATOM   885  O  OD1   . ASP A 1 108 ? -39.859 39.723 -269.990 1.00 30.17 ? 426 ASP A OD1   1 
ATOM   886  O  OD2   . ASP A 1 108 ? -38.217 38.322 -269.595 1.00 29.20 ? 426 ASP A OD2   1 
ATOM   887  N  N     . GLU A 1 109 ? -41.364 37.036 -271.727 1.00 27.37 ? 427 GLU A N     1 
ATOM   888  C  CA    . GLU A 1 109 ? -41.999 35.722 -271.679 1.00 26.55 ? 427 GLU A CA    1 
ATOM   889  C  C     . GLU A 1 109 ? -42.676 35.400 -273.004 1.00 26.25 ? 427 GLU A C     1 
ATOM   890  O  O     . GLU A 1 109 ? -42.566 34.279 -273.515 1.00 26.97 ? 427 GLU A O     1 
ATOM   891  C  CB    . GLU A 1 109 ? -43.015 35.666 -270.538 1.00 29.77 ? 427 GLU A CB    1 
ATOM   892  C  CG    . GLU A 1 109 ? -42.420 35.479 -269.154 1.00 30.76 ? 427 GLU A CG    1 
ATOM   893  C  CD    . GLU A 1 109 ? -43.485 35.437 -268.075 1.00 36.56 ? 427 GLU A CD    1 
ATOM   894  O  OE1   . GLU A 1 109 ? -44.003 36.512 -267.707 1.00 33.80 ? 427 GLU A OE1   1 
ATOM   895  O  OE2   . GLU A 1 109 ? -43.818 34.326 -267.609 1.00 40.61 ? 427 GLU A OE2   1 
ATOM   896  N  N     . LEU A 1 110 ? -43.387 36.377 -273.572 1.00 26.27 ? 428 LEU A N     1 
ATOM   897  C  CA    . LEU A 1 110 ? -44.060 36.163 -274.848 1.00 27.01 ? 428 LEU A CA    1 
ATOM   898  C  C     . LEU A 1 110 ? -43.056 35.980 -275.980 1.00 29.86 ? 428 LEU A C     1 
ATOM   899  O  O     . LEU A 1 110 ? -43.292 35.196 -276.907 1.00 28.26 ? 428 LEU A O     1 
ATOM   900  C  CB    . LEU A 1 110 ? -44.996 37.333 -275.145 1.00 27.11 ? 428 LEU A CB    1 
ATOM   901  C  CG    . LEU A 1 110 ? -45.753 37.263 -276.470 1.00 29.82 ? 428 LEU A CG    1 
ATOM   902  C  CD1   . LEU A 1 110 ? -46.547 35.970 -276.545 1.00 33.12 ? 428 LEU A CD1   1 
ATOM   903  C  CD2   . LEU A 1 110 ? -46.659 38.473 -276.634 1.00 32.09 ? 428 LEU A CD2   1 
ATOM   904  N  N     . VAL A 1 111 ? -41.930 36.695 -275.919 1.00 31.29 ? 429 VAL A N     1 
ATOM   905  C  CA    . VAL A 1 111 ? -40.911 36.577 -276.959 1.00 35.44 ? 429 VAL A CA    1 
ATOM   906  C  C     . VAL A 1 111 ? -40.356 35.159 -277.001 1.00 37.63 ? 429 VAL A C     1 
ATOM   907  O  O     . VAL A 1 111 ? -40.210 34.560 -278.074 1.00 33.49 ? 429 VAL A O     1 
ATOM   908  C  CB    . VAL A 1 111 ? -39.798 37.617 -276.737 1.00 36.71 ? 429 VAL A CB    1 
ATOM   909  C  CG1   . VAL A 1 111 ? -38.616 37.334 -277.650 1.00 38.53 ? 429 VAL A CG1   1 
ATOM   910  C  CG2   . VAL A 1 111 ? -40.338 39.018 -276.975 1.00 35.16 ? 429 VAL A CG2   1 
ATOM   911  N  N     . ARG A 1 112 ? -40.039 34.598 -275.830 1.00 35.46 ? 430 ARG A N     1 
ATOM   912  C  CA    . ARG A 1 112 ? -39.585 33.212 -275.774 1.00 39.59 ? 430 ARG A CA    1 
ATOM   913  C  C     . ARG A 1 112 ? -40.653 32.260 -276.292 1.00 39.36 ? 430 ARG A C     1 
ATOM   914  O  O     . ARG A 1 112 ? -40.346 31.296 -277.004 1.00 38.33 ? 430 ARG A O     1 
ATOM   915  C  CB    . ARG A 1 112 ? -39.201 32.834 -274.344 1.00 43.52 ? 430 ARG A CB    1 
ATOM   916  C  CG    . ARG A 1 112 ? -37.793 33.212 -273.930 1.00 49.65 ? 430 ARG A CG    1 
ATOM   917  C  CD    . ARG A 1 112 ? -37.492 32.656 -272.549 1.00 47.35 ? 430 ARG A CD    1 
ATOM   918  N  NE    . ARG A 1 112 ? -36.200 33.097 -272.035 1.00 44.73 ? 430 ARG A NE    1 
ATOM   919  C  CZ    . ARG A 1 112 ? -35.805 32.919 -270.779 1.00 37.68 ? 430 ARG A CZ    1 
ATOM   920  N  NH1   . ARG A 1 112 ? -36.607 32.313 -269.914 1.00 33.22 ? 430 ARG A NH1   1 
ATOM   921  N  NH2   . ARG A 1 112 ? -34.614 33.349 -270.387 1.00 38.39 ? 430 ARG A NH2   1 
ATOM   922  N  N     . HIS A 1 113 ? -41.916 32.511 -275.940 1.00 33.21 ? 431 HIS A N     1 
ATOM   923  C  CA    . HIS A 1 113 ? -42.995 31.632 -276.375 1.00 32.17 ? 431 HIS A CA    1 
ATOM   924  C  C     . HIS A 1 113 ? -43.200 31.705 -277.883 1.00 36.70 ? 431 HIS A C     1 
ATOM   925  O  O     . HIS A 1 113 ? -43.479 30.686 -278.525 1.00 38.93 ? 431 HIS A O     1 
ATOM   926  C  CB    . HIS A 1 113 ? -44.287 31.989 -275.644 1.00 33.08 ? 431 HIS A CB    1 
ATOM   927  C  CG    . HIS A 1 113 ? -45.497 31.299 -276.189 1.00 35.34 ? 431 HIS A CG    1 
ATOM   928  N  ND1   . HIS A 1 113 ? -45.748 29.960 -275.980 1.00 36.88 ? 431 HIS A ND1   1 
ATOM   929  C  CD2   . HIS A 1 113 ? -46.523 31.760 -276.944 1.00 35.98 ? 431 HIS A CD2   1 
ATOM   930  C  CE1   . HIS A 1 113 ? -46.878 29.627 -276.578 1.00 37.51 ? 431 HIS A CE1   1 
ATOM   931  N  NE2   . HIS A 1 113 ? -47.368 30.701 -277.169 1.00 41.28 ? 431 HIS A NE2   1 
ATOM   932  N  N     . HIS A 1 114 ? -43.068 32.901 -278.464 1.00 36.52 ? 432 HIS A N     1 
ATOM   933  C  CA    . HIS A 1 114 ? -43.252 33.050 -279.905 1.00 38.74 ? 432 HIS A CA    1 
ATOM   934  C  C     . HIS A 1 114 ? -42.234 32.238 -280.693 1.00 34.33 ? 432 HIS A C     1 
ATOM   935  O  O     . HIS A 1 114 ? -42.504 31.845 -281.833 1.00 37.64 ? 432 HIS A O     1 
ATOM   936  C  CB    . HIS A 1 114 ? -43.169 34.526 -280.297 1.00 43.88 ? 432 HIS A CB    1 
ATOM   937  C  CG    . HIS A 1 114 ? -44.472 35.256 -280.188 1.00 56.15 ? 432 HIS A CG    1 
ATOM   938  N  ND1   . HIS A 1 114 ? -44.557 36.632 -280.192 1.00 58.61 ? 432 HIS A ND1   1 
ATOM   939  C  CD2   . HIS A 1 114 ? -45.743 34.801 -280.082 1.00 59.17 ? 432 HIS A CD2   1 
ATOM   940  C  CE1   . HIS A 1 114 ? -45.824 36.993 -280.088 1.00 58.00 ? 432 HIS A CE1   1 
ATOM   941  N  NE2   . HIS A 1 114 ? -46.564 35.901 -280.020 1.00 58.98 ? 432 HIS A NE2   1 
ATOM   942  N  N     . ASN A 1 115 ? -41.066 31.969 -280.105 1.00 32.94 ? 433 ASN A N     1 
ATOM   943  C  CA    . ASN A 1 115 ? -40.035 31.204 -280.795 1.00 37.45 ? 433 ASN A CA    1 
ATOM   944  C  C     . ASN A 1 115 ? -40.428 29.751 -281.030 1.00 38.77 ? 433 ASN A C     1 
ATOM   945  O  O     . ASN A 1 115 ? -39.765 29.072 -281.822 1.00 40.41 ? 433 ASN A O     1 
ATOM   946  C  CB    . ASN A 1 115 ? -38.723 31.264 -280.010 1.00 43.65 ? 433 ASN A CB    1 
ATOM   947  C  CG    . ASN A 1 115 ? -38.117 32.654 -279.993 1.00 49.19 ? 433 ASN A CG    1 
ATOM   948  O  OD1   . ASN A 1 115 ? -38.368 33.463 -280.887 1.00 56.26 ? 433 ASN A OD1   1 
ATOM   949  N  ND2   . ASN A 1 115 ? -37.311 32.937 -278.977 1.00 47.12 ? 433 ASN A ND2   1 
ATOM   950  N  N     . MET A 1 116 ? -41.479 29.260 -280.372 1.00 35.29 ? 434 MET A N     1 
ATOM   951  C  CA    . MET A 1 116 ? -41.936 27.893 -280.582 1.00 39.74 ? 434 MET A CA    1 
ATOM   952  C  C     . MET A 1 116 ? -42.840 27.749 -281.799 1.00 44.36 ? 434 MET A C     1 
ATOM   953  O  O     . MET A 1 116 ? -43.105 26.618 -282.221 1.00 44.13 ? 434 MET A O     1 
ATOM   954  C  CB    . MET A 1 116 ? -42.678 27.389 -279.341 1.00 41.20 ? 434 MET A CB    1 
ATOM   955  C  CG    . MET A 1 116 ? -41.918 27.578 -278.041 1.00 51.87 ? 434 MET A CG    1 
ATOM   956  S  SD    . MET A 1 116 ? -42.843 26.989 -276.610 1.00 60.17 ? 434 MET A SD    1 
ATOM   957  C  CE    . MET A 1 116 ? -41.863 27.668 -275.274 1.00 66.75 ? 434 MET A CE    1 
ATOM   958  N  N     . HIS A 1 117 ? -43.314 28.853 -282.367 1.00 45.39 ? 435 HIS A N     1 
ATOM   959  C  CA    . HIS A 1 117 ? -44.243 28.827 -283.486 1.00 49.18 ? 435 HIS A CA    1 
ATOM   960  C  C     . HIS A 1 117 ? -43.501 29.011 -284.802 1.00 57.60 ? 435 HIS A C     1 
ATOM   961  O  O     . HIS A 1 117 ? -42.591 29.839 -284.905 1.00 54.88 ? 435 HIS A O     1 
ATOM   962  C  CB    . HIS A 1 117 ? -45.307 29.915 -283.333 1.00 49.04 ? 435 HIS A CB    1 
ATOM   963  C  CG    . HIS A 1 117 ? -46.239 29.689 -282.184 1.00 53.96 ? 435 HIS A CG    1 
ATOM   964  N  ND1   . HIS A 1 117 ? -46.724 28.442 -281.855 1.00 55.43 ? 435 HIS A ND1   1 
ATOM   965  C  CD2   . HIS A 1 117 ? -46.769 30.549 -281.283 1.00 53.06 ? 435 HIS A CD2   1 
ATOM   966  C  CE1   . HIS A 1 117 ? -47.517 28.544 -280.803 1.00 55.83 ? 435 HIS A CE1   1 
ATOM   967  N  NE2   . HIS A 1 117 ? -47.561 29.812 -280.437 1.00 57.33 ? 435 HIS A NE2   1 
ATOM   968  N  N     . GLN A 1 118 ? -43.900 28.235 -285.806 1.00 66.13 ? 436 GLN A N     1 
ATOM   969  C  CA    . GLN A 1 118 ? -43.320 28.325 -287.138 1.00 73.16 ? 436 GLN A CA    1 
ATOM   970  C  C     . GLN A 1 118 ? -44.352 27.837 -288.147 1.00 86.93 ? 436 GLN A C     1 
ATOM   971  O  O     . GLN A 1 118 ? -45.440 27.384 -287.781 1.00 90.09 ? 436 GLN A O     1 
ATOM   972  C  CB    . GLN A 1 118 ? -42.019 27.523 -287.231 1.00 68.62 ? 436 GLN A CB    1 
ATOM   973  N  N     . ARG A 1 119 ? -43.996 27.936 -289.426 1.00 94.42 ? 437 ARG A N     1 
ATOM   974  C  CA    . ARG A 1 119 ? -44.864 27.522 -290.527 1.00 94.78 ? 437 ARG A CA    1 
ATOM   975  C  C     . ARG A 1 119 ? -46.220 28.221 -290.473 1.00 94.64 ? 437 ARG A C     1 
ATOM   976  O  O     . ARG A 1 119 ? -47.236 27.601 -290.161 1.00 95.66 ? 437 ARG A O     1 
ATOM   977  C  CB    . ARG A 1 119 ? -45.055 26.002 -290.521 1.00 93.87 ? 437 ARG A CB    1 
ATOM   978  O  "O5'" . DA  B 2 1   ? -40.186 28.342 -269.169 1.00 49.53 ? 1   DA  B "O5'" 1 
ATOM   979  C  "C5'" . DA  B 2 1   ? -41.137 27.325 -269.460 1.00 47.73 ? 1   DA  B "C5'" 1 
ATOM   980  C  "C4'" . DA  B 2 1   ? -42.131 27.165 -268.321 1.00 45.55 ? 1   DA  B "C4'" 1 
ATOM   981  O  "O4'" . DA  B 2 1   ? -41.463 26.592 -267.164 1.00 49.21 ? 1   DA  B "O4'" 1 
ATOM   982  C  "C3'" . DA  B 2 1   ? -42.775 28.462 -267.833 1.00 33.77 ? 1   DA  B "C3'" 1 
ATOM   983  O  "O3'" . DA  B 2 1   ? -44.140 28.231 -267.509 1.00 37.39 ? 1   DA  B "O3'" 1 
ATOM   984  C  "C2'" . DA  B 2 1   ? -41.960 28.791 -266.589 1.00 32.74 ? 1   DA  B "C2'" 1 
ATOM   985  C  "C1'" . DA  B 2 1   ? -41.698 27.405 -266.036 1.00 46.98 ? 1   DA  B "C1'" 1 
ATOM   986  N  N9    . DA  B 2 1   ? -40.533 27.337 -265.157 1.00 41.60 ? 1   DA  B N9    1 
ATOM   987  C  C8    . DA  B 2 1   ? -40.531 27.312 -263.790 1.00 38.71 ? 1   DA  B C8    1 
ATOM   988  N  N7    . DA  B 2 1   ? -39.332 27.251 -263.262 1.00 37.38 ? 1   DA  B N7    1 
ATOM   989  C  C5    . DA  B 2 1   ? -38.489 27.236 -264.360 1.00 35.46 ? 1   DA  B C5    1 
ATOM   990  C  C6    . DA  B 2 1   ? -37.089 27.179 -264.479 1.00 34.78 ? 1   DA  B C6    1 
ATOM   991  N  N6    . DA  B 2 1   ? -36.262 27.122 -263.429 1.00 32.72 ? 1   DA  B N6    1 
ATOM   992  N  N1    . DA  B 2 1   ? -36.569 27.181 -265.724 1.00 40.00 ? 1   DA  B N1    1 
ATOM   993  C  C2    . DA  B 2 1   ? -37.402 27.239 -266.771 1.00 32.04 ? 1   DA  B C2    1 
ATOM   994  N  N3    . DA  B 2 1   ? -38.728 27.295 -266.783 1.00 38.75 ? 1   DA  B N3    1 
ATOM   995  C  C4    . DA  B 2 1   ? -39.215 27.290 -265.535 1.00 33.50 ? 1   DA  B C4    1 
ATOM   996  P  P     . DG  B 2 2   ? -45.191 29.447 -267.511 1.00 40.95 ? 2   DG  B P     1 
ATOM   997  O  OP1   . DG  B 2 2   ? -46.530 28.875 -267.245 1.00 48.14 ? 2   DG  B OP1   1 
ATOM   998  O  OP2   . DG  B 2 2   ? -44.962 30.232 -268.744 1.00 44.86 ? 2   DG  B OP2   1 
ATOM   999  O  "O5'" . DG  B 2 2   ? -44.757 30.337 -266.251 1.00 36.27 ? 2   DG  B "O5'" 1 
ATOM   1000 C  "C5'" . DG  B 2 2   ? -45.008 29.861 -264.931 1.00 34.31 ? 2   DG  B "C5'" 1 
ATOM   1001 C  "C4'" . DG  B 2 2   ? -44.266 30.691 -263.894 1.00 31.55 ? 2   DG  B "C4'" 1 
ATOM   1002 O  "O4'" . DG  B 2 2   ? -42.835 30.593 -264.115 1.00 31.20 ? 2   DG  B "O4'" 1 
ATOM   1003 C  "C3'" . DG  B 2 2   ? -44.596 32.181 -263.886 1.00 30.35 ? 2   DG  B "C3'" 1 
ATOM   1004 O  "O3'" . DG  B 2 2   ? -44.652 32.646 -262.545 1.00 30.50 ? 2   DG  B "O3'" 1 
ATOM   1005 C  "C2'" . DG  B 2 2   ? -43.430 32.800 -264.656 1.00 29.46 ? 2   DG  B "C2'" 1 
ATOM   1006 C  "C1'" . DG  B 2 2   ? -42.278 31.881 -264.274 1.00 29.79 ? 2   DG  B "C1'" 1 
ATOM   1007 N  N9    . DG  B 2 2   ? -41.234 31.797 -265.293 1.00 27.52 ? 2   DG  B N9    1 
ATOM   1008 C  C8    . DG  B 2 2   ? -41.368 32.043 -266.639 1.00 26.45 ? 2   DG  B C8    1 
ATOM   1009 N  N7    . DG  B 2 2   ? -40.261 31.878 -267.310 1.00 27.68 ? 2   DG  B N7    1 
ATOM   1010 C  C5    . DG  B 2 2   ? -39.334 31.493 -266.349 1.00 27.43 ? 2   DG  B C5    1 
ATOM   1011 C  C6    . DG  B 2 2   ? -37.959 31.176 -266.481 1.00 27.91 ? 2   DG  B C6    1 
ATOM   1012 O  O6    . DG  B 2 2   ? -37.266 31.169 -267.509 1.00 29.89 ? 2   DG  B O6    1 
ATOM   1013 N  N1    . DG  B 2 2   ? -37.389 30.839 -265.258 1.00 26.99 ? 2   DG  B N1    1 
ATOM   1014 C  C2    . DG  B 2 2   ? -38.059 30.812 -264.059 1.00 26.75 ? 2   DG  B C2    1 
ATOM   1015 N  N2    . DG  B 2 2   ? -37.339 30.461 -262.984 1.00 28.38 ? 2   DG  B N2    1 
ATOM   1016 N  N3    . DG  B 2 2   ? -39.346 31.106 -263.921 1.00 28.38 ? 2   DG  B N3    1 
ATOM   1017 C  C4    . DG  B 2 2   ? -39.918 31.438 -265.103 1.00 27.70 ? 2   DG  B C4    1 
ATOM   1018 P  P     . DC  B 2 3   ? -45.025 34.173 -262.217 1.00 30.57 ? 3   DC  B P     1 
ATOM   1019 O  OP1   . DC  B 2 3   ? -45.879 34.160 -261.009 1.00 32.47 ? 3   DC  B OP1   1 
ATOM   1020 O  OP2   . DC  B 2 3   ? -45.533 34.819 -263.448 1.00 28.08 ? 3   DC  B OP2   1 
ATOM   1021 O  "O5'" . DC  B 2 3   ? -43.618 34.820 -261.831 1.00 30.80 ? 3   DC  B "O5'" 1 
ATOM   1022 C  "C5'" . DC  B 2 3   ? -42.793 34.151 -260.893 1.00 25.14 ? 3   DC  B "C5'" 1 
ATOM   1023 C  "C4'" . DC  B 2 3   ? -41.386 34.714 -260.887 1.00 23.92 ? 3   DC  B "C4'" 1 
ATOM   1024 O  "O4'" . DC  B 2 3   ? -40.636 34.225 -262.033 1.00 26.36 ? 3   DC  B "O4'" 1 
ATOM   1025 C  "C3'" . DC  B 2 3   ? -41.285 36.246 -260.946 1.00 22.33 ? 3   DC  B "C3'" 1 
ATOM   1026 O  "O3'" . DC  B 2 3   ? -40.350 36.673 -259.988 1.00 23.27 ? 3   DC  B "O3'" 1 
ATOM   1027 C  "C2'" . DC  B 2 3   ? -40.753 36.494 -262.355 1.00 21.57 ? 3   DC  B "C2'" 1 
ATOM   1028 C  "C1'" . DC  B 2 3   ? -39.847 35.290 -262.488 1.00 23.52 ? 3   DC  B "C1'" 1 
ATOM   1029 N  N1    . DC  B 2 3   ? -39.364 35.028 -263.869 1.00 24.16 ? 3   DC  B N1    1 
ATOM   1030 C  C2    . DC  B 2 3   ? -38.081 34.505 -264.050 1.00 24.77 ? 3   DC  B C2    1 
ATOM   1031 O  O2    . DC  B 2 3   ? -37.391 34.249 -263.054 1.00 25.33 ? 3   DC  B O2    1 
ATOM   1032 N  N3    . DC  B 2 3   ? -37.633 34.283 -265.308 1.00 23.83 ? 3   DC  B N3    1 
ATOM   1033 C  C4    . DC  B 2 3   ? -38.409 34.574 -266.353 1.00 23.72 ? 3   DC  B C4    1 
ATOM   1034 N  N4    . DC  B 2 3   ? -37.924 34.338 -267.575 1.00 23.39 ? 3   DC  B N4    1 
ATOM   1035 C  C5    . DC  B 2 3   ? -39.719 35.116 -266.189 1.00 21.79 ? 3   DC  B C5    1 
ATOM   1036 C  C6    . DC  B 2 3   ? -40.150 35.332 -264.940 1.00 24.34 ? 3   DC  B C6    1 
ATOM   1037 P  P     . DG  B 2 4   ? -40.491 38.108 -259.287 1.00 21.92 ? 4   DG  B P     1 
ATOM   1038 O  OP1   . DG  B 2 4   ? -41.522 37.972 -258.235 1.00 23.74 ? 4   DG  B OP1   1 
ATOM   1039 O  OP2   . DG  B 2 4   ? -40.644 39.135 -260.344 1.00 21.29 ? 4   DG  B OP2   1 
ATOM   1040 O  "O5'" . DG  B 2 4   ? -39.065 38.320 -258.599 1.00 22.21 ? 4   DG  B "O5'" 1 
ATOM   1041 C  "C5'" . DG  B 2 4   ? -38.478 37.262 -257.843 1.00 23.32 ? 4   DG  B "C5'" 1 
ATOM   1042 C  "C4'" . DG  B 2 4   ? -36.969 37.251 -258.011 1.00 24.24 ? 4   DG  B "C4'" 1 
ATOM   1043 O  "O4'" . DG  B 2 4   ? -36.628 36.697 -259.310 1.00 24.50 ? 4   DG  B "O4'" 1 
ATOM   1044 C  "C3'" . DG  B 2 4   ? -36.307 38.625 -257.944 1.00 22.10 ? 4   DG  B "C3'" 1 
ATOM   1045 O  "O3'" . DG  B 2 4   ? -35.106 38.554 -257.194 1.00 25.78 ? 4   DG  B "O3'" 1 
ATOM   1046 C  "C2'" . DG  B 2 4   ? -36.038 38.964 -259.409 1.00 20.10 ? 4   DG  B "C2'" 1 
ATOM   1047 C  "C1'" . DG  B 2 4   ? -35.786 37.589 -260.008 1.00 23.27 ? 4   DG  B "C1'" 1 
ATOM   1048 N  N9    . DG  B 2 4   ? -36.112 37.508 -261.429 1.00 22.65 ? 4   DG  B N9    1 
ATOM   1049 C  C8    . DG  B 2 4   ? -37.357 37.629 -261.997 1.00 22.04 ? 4   DG  B C8    1 
ATOM   1050 N  N7    . DG  B 2 4   ? -37.351 37.510 -263.296 1.00 22.32 ? 4   DG  B N7    1 
ATOM   1051 C  C5    . DG  B 2 4   ? -36.015 37.296 -263.611 1.00 19.33 ? 4   DG  B C5    1 
ATOM   1052 C  C6    . DG  B 2 4   ? -35.397 37.095 -264.867 1.00 20.00 ? 4   DG  B C6    1 
ATOM   1053 O  O6    . DG  B 2 4   ? -35.926 37.067 -265.987 1.00 23.28 ? 4   DG  B O6    1 
ATOM   1054 N  N1    . DG  B 2 4   ? -34.021 36.916 -264.742 1.00 20.71 ? 4   DG  B N1    1 
ATOM   1055 C  C2    . DG  B 2 4   ? -33.331 36.929 -263.552 1.00 23.47 ? 4   DG  B C2    1 
ATOM   1056 N  N2    . DG  B 2 4   ? -32.006 36.738 -263.630 1.00 23.97 ? 4   DG  B N2    1 
ATOM   1057 N  N3    . DG  B 2 4   ? -33.900 37.116 -262.367 1.00 24.10 ? 4   DG  B N3    1 
ATOM   1058 C  C4    . DG  B 2 4   ? -35.239 37.293 -262.472 1.00 19.59 ? 4   DG  B C4    1 
ATOM   1059 P  P     . DT  B 2 5   ? -34.449 39.897 -256.610 1.00 22.66 ? 5   DT  B P     1 
ATOM   1060 O  OP1   . DT  B 2 5   ? -33.507 39.507 -255.535 1.00 26.48 ? 5   DT  B OP1   1 
ATOM   1061 O  OP2   . DT  B 2 5   ? -35.549 40.844 -256.327 1.00 24.31 ? 5   DT  B OP2   1 
ATOM   1062 O  "O5'" . DT  B 2 5   ? -33.608 40.473 -257.838 1.00 23.62 ? 5   DT  B "O5'" 1 
ATOM   1063 C  "C5'" . DT  B 2 5   ? -32.530 39.718 -258.362 1.00 20.41 ? 5   DT  B "C5'" 1 
ATOM   1064 C  "C4'" . DT  B 2 5   ? -31.920 40.414 -259.560 1.00 22.26 ? 5   DT  B "C4'" 1 
ATOM   1065 O  "O4'" . DT  B 2 5   ? -32.622 40.030 -260.772 1.00 21.30 ? 5   DT  B "O4'" 1 
ATOM   1066 C  "C3'" . DT  B 2 5   ? -31.965 41.948 -259.520 1.00 20.75 ? 5   DT  B "C3'" 1 
ATOM   1067 O  "O3'" . DT  B 2 5   ? -30.699 42.463 -259.881 1.00 23.75 ? 5   DT  B "O3'" 1 
ATOM   1068 C  "C2'" . DT  B 2 5   ? -33.016 42.288 -260.577 1.00 21.18 ? 5   DT  B "C2'" 1 
ATOM   1069 C  "C1'" . DT  B 2 5   ? -32.750 41.178 -261.569 1.00 18.27 ? 5   DT  B "C1'" 1 
ATOM   1070 N  N1    . DT  B 2 5   ? -33.823 40.973 -262.588 1.00 17.64 ? 5   DT  B N1    1 
ATOM   1071 C  C2    . DT  B 2 5   ? -33.455 40.648 -263.872 1.00 19.54 ? 5   DT  B C2    1 
ATOM   1072 O  O2    . DT  B 2 5   ? -32.295 40.512 -264.216 1.00 21.03 ? 5   DT  B O2    1 
ATOM   1073 N  N3    . DT  B 2 5   ? -34.494 40.485 -264.745 1.00 18.50 ? 5   DT  B N3    1 
ATOM   1074 C  C4    . DT  B 2 5   ? -35.840 40.614 -264.471 1.00 16.55 ? 5   DT  B C4    1 
ATOM   1075 O  O4    . DT  B 2 5   ? -36.700 40.446 -265.329 1.00 19.67 ? 5   DT  B O4    1 
ATOM   1076 C  C5    . DT  B 2 5   ? -36.165 40.958 -263.104 1.00 16.71 ? 5   DT  B C5    1 
ATOM   1077 C  C7    . DT  B 2 5   ? -37.597 41.122 -262.690 1.00 19.14 ? 5   DT  B C7    1 
ATOM   1078 C  C6    . DT  B 2 5   ? -35.150 41.122 -262.236 1.00 16.78 ? 5   DT  B C6    1 
ATOM   1079 P  P     . DG  B 2 6   ? -30.156 43.823 -259.225 1.00 29.27 ? 6   DG  B P     1 
ATOM   1080 O  OP1   . DG  B 2 6   ? -29.155 43.446 -258.204 1.00 36.43 ? 6   DG  B OP1   1 
ATOM   1081 O  OP2   . DG  B 2 6   ? -31.319 44.660 -258.863 1.00 41.41 ? 6   DG  B OP2   1 
ATOM   1082 O  "O5'" . DG  B 2 6   ? -29.366 44.524 -260.430 1.00 41.23 ? 6   DG  B "O5'" 1 
ATOM   1083 C  "C5'" . DG  B 2 6   ? -28.072 44.056 -260.774 1.00 41.34 ? 6   DG  B "C5'" 1 
ATOM   1084 C  "C4'" . DG  B 2 6   ? -27.892 43.939 -262.280 1.00 26.27 ? 6   DG  B "C4'" 1 
ATOM   1085 O  "O4'" . DG  B 2 6   ? -28.973 43.171 -262.838 1.00 23.05 ? 6   DG  B "O4'" 1 
ATOM   1086 C  "C3'" . DG  B 2 6   ? -27.923 45.248 -263.052 1.00 21.10 ? 6   DG  B "C3'" 1 
ATOM   1087 O  "O3'" . DG  B 2 6   ? -26.627 45.844 -263.058 1.00 21.11 ? 6   DG  B "O3'" 1 
ATOM   1088 C  "C2'" . DG  B 2 6   ? -28.323 44.792 -264.457 1.00 21.31 ? 6   DG  B "C2'" 1 
ATOM   1089 C  "C1'" . DG  B 2 6   ? -29.106 43.497 -264.206 1.00 21.93 ? 6   DG  B "C1'" 1 
ATOM   1090 N  N9    . DG  B 2 6   ? -30.526 43.596 -264.531 1.00 17.95 ? 6   DG  B N9    1 
ATOM   1091 C  C8    . DG  B 2 6   ? -31.570 43.772 -263.653 1.00 18.47 ? 6   DG  B C8    1 
ATOM   1092 N  N7    . DG  B 2 6   ? -32.736 43.814 -264.236 1.00 17.88 ? 6   DG  B N7    1 
ATOM   1093 C  C5    . DG  B 2 6   ? -32.448 43.652 -265.586 1.00 16.50 ? 6   DG  B C5    1 
ATOM   1094 C  C6    . DG  B 2 6   ? -33.313 43.611 -266.705 1.00 15.40 ? 6   DG  B C6    1 
ATOM   1095 O  O6    . DG  B 2 6   ? -34.546 43.713 -266.726 1.00 17.76 ? 6   DG  B O6    1 
ATOM   1096 N  N1    . DG  B 2 6   ? -32.609 43.432 -267.895 1.00 14.79 ? 6   DG  B N1    1 
ATOM   1097 C  C2    . DG  B 2 6   ? -31.244 43.306 -267.989 1.00 15.05 ? 6   DG  B C2    1 
ATOM   1098 N  N2    . DG  B 2 6   ? -30.746 43.139 -269.223 1.00 18.35 ? 6   DG  B N2    1 
ATOM   1099 N  N3    . DG  B 2 6   ? -30.422 43.341 -266.948 1.00 17.64 ? 6   DG  B N3    1 
ATOM   1100 C  C4    . DG  B 2 6   ? -31.092 43.516 -265.783 1.00 17.20 ? 6   DG  B C4    1 
ATOM   1101 P  P     . DG  B 2 7   ? -26.415 47.335 -263.630 1.00 19.96 ? 7   DG  B P     1 
ATOM   1102 O  OP1   . DG  B 2 7   ? -25.049 47.751 -263.255 1.00 19.60 ? 7   DG  B OP1   1 
ATOM   1103 O  OP2   . DG  B 2 7   ? -27.572 48.157 -263.203 1.00 20.64 ? 7   DG  B OP2   1 
ATOM   1104 O  "O5'" . DG  B 2 7   ? -26.479 47.176 -265.220 1.00 19.43 ? 7   DG  B "O5'" 1 
ATOM   1105 C  "C5'" . DG  B 2 7   ? -25.443 46.484 -265.910 1.00 18.48 ? 7   DG  B "C5'" 1 
ATOM   1106 C  "C4'" . DG  B 2 7   ? -25.653 46.548 -267.414 1.00 18.26 ? 7   DG  B "C4'" 1 
ATOM   1107 O  "O4'" . DG  B 2 7   ? -26.983 46.069 -267.743 1.00 20.13 ? 7   DG  B "O4'" 1 
ATOM   1108 C  "C3'" . DG  B 2 7   ? -25.543 47.940 -268.032 1.00 17.06 ? 7   DG  B "C3'" 1 
ATOM   1109 O  "O3'" . DG  B 2 7   ? -24.952 47.842 -269.327 1.00 21.74 ? 7   DG  B "O3'" 1 
ATOM   1110 C  "C2'" . DG  B 2 7   ? -26.999 48.391 -268.109 1.00 19.47 ? 7   DG  B "C2'" 1 
ATOM   1111 C  "C1'" . DG  B 2 7   ? -27.713 47.080 -268.407 1.00 18.91 ? 7   DG  B "C1'" 1 
ATOM   1112 N  N9    . DG  B 2 7   ? -29.089 47.041 -267.920 1.00 16.88 ? 7   DG  B N9    1 
ATOM   1113 C  C8    . DG  B 2 7   ? -29.508 47.173 -266.618 1.00 18.29 ? 7   DG  B C8    1 
ATOM   1114 N  N7    . DG  B 2 7   ? -30.801 47.088 -266.478 1.00 16.55 ? 7   DG  B N7    1 
ATOM   1115 C  C5    . DG  B 2 7   ? -31.272 46.885 -267.768 1.00 15.09 ? 7   DG  B C5    1 
ATOM   1116 C  C6    . DG  B 2 7   ? -32.596 46.720 -268.239 1.00 16.54 ? 7   DG  B C6    1 
ATOM   1117 O  O6    . DG  B 2 7   ? -33.649 46.722 -267.585 1.00 17.67 ? 7   DG  B O6    1 
ATOM   1118 N  N1    . DG  B 2 7   ? -32.634 46.541 -269.620 1.00 17.87 ? 7   DG  B N1    1 
ATOM   1119 C  C2    . DG  B 2 7   ? -31.531 46.521 -270.440 1.00 17.25 ? 7   DG  B C2    1 
ATOM   1120 N  N2    . DG  B 2 7   ? -31.767 46.335 -271.747 1.00 19.97 ? 7   DG  B N2    1 
ATOM   1121 N  N3    . DG  B 2 7   ? -30.283 46.674 -270.011 1.00 16.95 ? 7   DG  B N3    1 
ATOM   1122 C  C4    . DG  B 2 7   ? -30.230 46.852 -268.668 1.00 15.08 ? 7   DG  B C4    1 
ATOM   1123 P  P     . DG  B 2 8   ? -24.584 49.165 -270.162 1.00 22.48 ? 8   DG  B P     1 
ATOM   1124 O  OP1   . DG  B 2 8   ? -23.463 48.821 -271.067 1.00 23.63 ? 8   DG  B OP1   1 
ATOM   1125 O  OP2   . DG  B 2 8   ? -24.442 50.284 -269.205 1.00 24.25 ? 8   DG  B OP2   1 
ATOM   1126 O  "O5'" . DG  B 2 8   ? -25.881 49.425 -271.058 1.00 20.79 ? 8   DG  B "O5'" 1 
ATOM   1127 C  "C5'" . DG  B 2 8   ? -26.222 48.497 -272.081 1.00 21.07 ? 8   DG  B "C5'" 1 
ATOM   1128 C  "C4'" . DG  B 2 8   ? -27.424 48.976 -272.876 1.00 20.41 ? 8   DG  B "C4'" 1 
ATOM   1129 O  "O4'" . DG  B 2 8   ? -28.630 48.781 -272.099 1.00 20.88 ? 8   DG  B "O4'" 1 
ATOM   1130 C  "C3'" . DG  B 2 8   ? -27.396 50.453 -273.279 1.00 19.44 ? 8   DG  B "C3'" 1 
ATOM   1131 O  "O3'" . DG  B 2 8   ? -27.641 50.568 -274.679 1.00 23.26 ? 8   DG  B "O3'" 1 
ATOM   1132 C  "C2'" . DG  B 2 8   ? -28.517 51.086 -272.442 1.00 20.67 ? 8   DG  B "C2'" 1 
ATOM   1133 C  "C1'" . DG  B 2 8   ? -29.456 49.909 -272.224 1.00 18.55 ? 8   DG  B "C1'" 1 
ATOM   1134 N  N9    . DG  B 2 8   ? -30.267 50.009 -271.013 1.00 15.10 ? 8   DG  B N9    1 
ATOM   1135 C  C8    . DG  B 2 8   ? -29.818 50.197 -269.727 1.00 17.30 ? 8   DG  B C8    1 
ATOM   1136 N  N7    . DG  B 2 8   ? -30.776 50.232 -268.842 1.00 15.35 ? 8   DG  B N7    1 
ATOM   1137 C  C5    . DG  B 2 8   ? -31.934 50.046 -269.588 1.00 13.75 ? 8   DG  B C5    1 
ATOM   1138 C  C6    . DG  B 2 8   ? -33.285 49.988 -269.174 1.00 15.20 ? 8   DG  B C6    1 
ATOM   1139 O  O6    . DG  B 2 8   ? -33.740 50.093 -268.027 1.00 14.19 ? 8   DG  B O6    1 
ATOM   1140 N  N1    . DG  B 2 8   ? -34.146 49.786 -270.249 1.00 13.97 ? 8   DG  B N1    1 
ATOM   1141 C  C2    . DG  B 2 8   ? -33.751 49.655 -271.558 1.00 16.49 ? 8   DG  B C2    1 
ATOM   1142 N  N2    . DG  B 2 8   ? -34.728 49.467 -272.458 1.00 18.52 ? 8   DG  B N2    1 
ATOM   1143 N  N3    . DG  B 2 8   ? -32.488 49.707 -271.960 1.00 16.76 ? 8   DG  B N3    1 
ATOM   1144 C  C4    . DG  B 2 8   ? -31.636 49.904 -270.925 1.00 14.50 ? 8   DG  B C4    1 
ATOM   1145 P  P     . DA  B 2 9   ? -27.556 51.995 -275.416 1.00 27.82 ? 9   DA  B P     1 
ATOM   1146 O  OP1   . DA  B 2 9   ? -27.197 51.740 -276.829 1.00 32.35 ? 9   DA  B OP1   1 
ATOM   1147 O  OP2   . DA  B 2 9   ? -26.722 52.899 -274.595 1.00 27.00 ? 9   DA  B OP2   1 
ATOM   1148 O  "O5'" . DA  B 2 9   ? -29.064 52.517 -275.377 1.00 23.98 ? 9   DA  B "O5'" 1 
ATOM   1149 C  "C5'" . DA  B 2 9   ? -30.095 51.685 -275.879 1.00 22.80 ? 9   DA  B "C5'" 1 
ATOM   1150 C  "C4'" . DA  B 2 9   ? -31.462 52.243 -275.537 1.00 21.43 ? 9   DA  B "C4'" 1 
ATOM   1151 O  "O4'" . DA  B 2 9   ? -31.712 52.097 -274.128 1.00 22.48 ? 9   DA  B "O4'" 1 
ATOM   1152 C  "C3'" . DA  B 2 9   ? -31.650 53.730 -275.842 1.00 23.92 ? 9   DA  B "C3'" 1 
ATOM   1153 O  "O3'" . DA  B 2 9   ? -32.527 53.872 -276.952 1.00 27.98 ? 9   DA  B "O3'" 1 
ATOM   1154 C  "C2'" . DA  B 2 9   ? -32.253 54.319 -274.547 1.00 27.37 ? 9   DA  B "C2'" 1 
ATOM   1155 C  "C1'" . DA  B 2 9   ? -32.640 53.073 -273.757 1.00 20.96 ? 9   DA  B "C1'" 1 
ATOM   1156 N  N9    . DA  B 2 9   ? -32.584 53.234 -272.304 1.00 19.06 ? 9   DA  B N9    1 
ATOM   1157 C  C8    . DA  B 2 9   ? -31.481 53.502 -271.542 1.00 19.24 ? 9   DA  B C8    1 
ATOM   1158 N  N7    . DA  B 2 9   ? -31.732 53.574 -270.253 1.00 18.10 ? 9   DA  B N7    1 
ATOM   1159 C  C5    . DA  B 2 9   ? -33.094 53.328 -270.166 1.00 17.82 ? 9   DA  B C5    1 
ATOM   1160 C  C6    . DA  B 2 9   ? -33.984 53.262 -269.071 1.00 16.96 ? 9   DA  B C6    1 
ATOM   1161 N  N6    . DA  B 2 9   ? -33.609 53.449 -267.802 1.00 18.79 ? 9   DA  B N6    1 
ATOM   1162 N  N1    . DA  B 2 9   ? -35.280 52.996 -269.335 1.00 17.50 ? 9   DA  B N1    1 
ATOM   1163 C  C2    . DA  B 2 9   ? -35.655 52.810 -270.605 1.00 17.77 ? 9   DA  B C2    1 
ATOM   1164 N  N3    . DA  B 2 9   ? -34.914 52.845 -271.712 1.00 21.57 ? 9   DA  B N3    1 
ATOM   1165 C  C4    . DA  B 2 9   ? -33.632 53.112 -271.420 1.00 18.27 ? 9   DA  B C4    1 
ATOM   1166 P  P     . DG  B 2 10  ? -32.666 55.278 -277.714 1.00 27.82 ? 10  DG  B P     1 
ATOM   1167 O  OP1   . DG  B 2 10  ? -32.815 54.987 -279.157 1.00 33.23 ? 10  DG  B OP1   1 
ATOM   1168 O  OP2   . DG  B 2 10  ? -31.583 56.177 -277.256 1.00 27.54 ? 10  DG  B OP2   1 
ATOM   1169 O  "O5'" . DG  B 2 10  ? -34.056 55.845 -277.180 1.00 28.27 ? 10  DG  B "O5'" 1 
ATOM   1170 C  "C5'" . DG  B 2 10  ? -35.222 55.044 -277.297 1.00 29.62 ? 10  DG  B "C5'" 1 
ATOM   1171 C  "C4'" . DG  B 2 10  ? -36.365 55.635 -276.497 1.00 26.80 ? 10  DG  B "C4'" 1 
ATOM   1172 O  "O4'" . DG  B 2 10  ? -36.146 55.389 -275.090 1.00 30.36 ? 10  DG  B "O4'" 1 
ATOM   1173 C  "C3'" . DG  B 2 10  ? -36.546 57.146 -276.654 1.00 27.48 ? 10  DG  B "C3'" 1 
ATOM   1174 O  "O3'" . DG  B 2 10  ? -37.866 57.428 -277.097 1.00 33.49 ? 10  DG  B "O3'" 1 
ATOM   1175 C  "C2'" . DG  B 2 10  ? -36.278 57.710 -275.250 1.00 30.47 ? 10  DG  B "C2'" 1 
ATOM   1176 C  "C1'" . DG  B 2 10  ? -36.559 56.511 -274.357 1.00 30.19 ? 10  DG  B "C1'" 1 
ATOM   1177 N  N9    . DG  B 2 10  ? -35.825 56.525 -273.095 1.00 25.26 ? 10  DG  B N9    1 
ATOM   1178 C  C8    . DG  B 2 10  ? -34.463 56.620 -272.928 1.00 22.30 ? 10  DG  B C8    1 
ATOM   1179 N  N7    . DG  B 2 10  ? -34.090 56.598 -271.677 1.00 21.40 ? 10  DG  B N7    1 
ATOM   1180 C  C5    . DG  B 2 10  ? -35.281 56.472 -270.971 1.00 20.52 ? 10  DG  B C5    1 
ATOM   1181 C  C6    . DG  B 2 10  ? -35.511 56.394 -269.577 1.00 16.26 ? 10  DG  B C6    1 
ATOM   1182 O  O6    . DG  B 2 10  ? -34.681 56.421 -268.657 1.00 19.82 ? 10  DG  B O6    1 
ATOM   1183 N  N1    . DG  B 2 10  ? -36.867 56.275 -269.285 1.00 18.52 ? 10  DG  B N1    1 
ATOM   1184 C  C2    . DG  B 2 10  ? -37.872 56.235 -270.220 1.00 21.01 ? 10  DG  B C2    1 
ATOM   1185 N  N2    . DG  B 2 10  ? -39.121 56.115 -269.746 1.00 23.52 ? 10  DG  B N2    1 
ATOM   1186 N  N3    . DG  B 2 10  ? -37.671 56.307 -271.529 1.00 23.54 ? 10  DG  B N3    1 
ATOM   1187 C  C4    . DG  B 2 10  ? -36.356 56.423 -271.830 1.00 22.23 ? 10  DG  B C4    1 
ATOM   1188 P  P     . DT  B 2 11  ? -38.270 58.912 -277.559 1.00 37.72 ? 11  DT  B P     1 
ATOM   1189 O  OP1   . DT  B 2 11  ? -39.295 58.777 -278.619 1.00 47.55 ? 11  DT  B OP1   1 
ATOM   1190 O  OP2   . DT  B 2 11  ? -37.024 59.662 -277.830 1.00 36.12 ? 11  DT  B OP2   1 
ATOM   1191 O  "O5'" . DT  B 2 11  ? -38.958 59.529 -276.254 1.00 39.17 ? 11  DT  B "O5'" 1 
ATOM   1192 C  "C5'" . DT  B 2 11  ? -39.979 58.794 -275.598 1.00 38.85 ? 11  DT  B "C5'" 1 
ATOM   1193 C  "C4'" . DT  B 2 11  ? -40.223 59.317 -274.195 1.00 36.57 ? 11  DT  B "C4'" 1 
ATOM   1194 O  "O4'" . DT  B 2 11  ? -39.117 58.967 -273.328 1.00 33.68 ? 11  DT  B "O4'" 1 
ATOM   1195 C  "C3'" . DT  B 2 11  ? -40.385 60.841 -274.076 1.00 44.55 ? 11  DT  B "C3'" 1 
ATOM   1196 O  "O3'" . DT  B 2 11  ? -41.660 61.142 -273.527 1.00 53.19 ? 11  DT  B "O3'" 1 
ATOM   1197 C  "C2'" . DT  B 2 11  ? -39.252 61.257 -273.125 1.00 43.46 ? 11  DT  B "C2'" 1 
ATOM   1198 C  "C1'" . DT  B 2 11  ? -39.025 59.969 -272.358 1.00 34.14 ? 11  DT  B "C1'" 1 
ATOM   1199 N  N1    . DT  B 2 11  ? -37.702 59.884 -271.666 1.00 24.35 ? 11  DT  B N1    1 
ATOM   1200 C  C2    . DT  B 2 11  ? -37.682 59.652 -270.312 1.00 23.39 ? 11  DT  B C2    1 
ATOM   1201 O  O2    . DT  B 2 11  ? -38.693 59.505 -269.649 1.00 26.02 ? 11  DT  B O2    1 
ATOM   1202 N  N3    . DT  B 2 11  ? -36.434 59.595 -269.756 1.00 20.35 ? 11  DT  B N3    1 
ATOM   1203 C  C4    . DT  B 2 11  ? -35.224 59.746 -270.405 1.00 19.94 ? 11  DT  B C4    1 
ATOM   1204 O  O4    . DT  B 2 11  ? -34.150 59.678 -269.813 1.00 22.22 ? 11  DT  B O4    1 
ATOM   1205 C  C5    . DT  B 2 11  ? -35.313 59.991 -271.828 1.00 20.53 ? 11  DT  B C5    1 
ATOM   1206 C  C7    . DT  B 2 11  ? -34.065 60.172 -272.641 1.00 22.50 ? 11  DT  B C7    1 
ATOM   1207 C  C6    . DT  B 2 11  ? -36.535 60.049 -272.384 1.00 23.91 ? 11  DT  B C6    1 
ATOM   1208 P  P     . DG  B 2 12  ? -42.327 62.585 -273.760 1.00 56.81 ? 12  DG  B P     1 
ATOM   1209 O  OP1   . DG  B 2 12  ? -43.595 62.373 -274.492 1.00 68.92 ? 12  DG  B OP1   1 
ATOM   1210 O  OP2   . DG  B 2 12  ? -41.289 63.480 -274.319 1.00 54.93 ? 12  DG  B OP2   1 
ATOM   1211 O  "O5'" . DG  B 2 12  ? -42.666 63.092 -272.282 1.00 47.85 ? 12  DG  B "O5'" 1 
ATOM   1212 C  "C5'" . DG  B 2 12  ? -43.595 62.373 -271.478 1.00 41.28 ? 12  DG  B "C5'" 1 
ATOM   1213 C  "C4'" . DG  B 2 12  ? -43.290 62.567 -270.005 1.00 38.96 ? 12  DG  B "C4'" 1 
ATOM   1214 O  "O4'" . DG  B 2 12  ? -42.044 61.919 -269.690 1.00 37.03 ? 12  DG  B "O4'" 1 
ATOM   1215 C  "C3'" . DG  B 2 12  ? -43.092 64.011 -269.582 1.00 46.00 ? 12  DG  B "C3'" 1 
ATOM   1216 O  "O3'" . DG  B 2 12  ? -44.344 64.587 -269.221 1.00 52.41 ? 12  DG  B "O3'" 1 
ATOM   1217 C  "C2'" . DG  B 2 12  ? -42.161 63.896 -268.369 1.00 48.02 ? 12  DG  B "C2'" 1 
ATOM   1218 C  "C1'" . DG  B 2 12  ? -41.459 62.548 -268.570 1.00 42.66 ? 12  DG  B "C1'" 1 
ATOM   1219 N  N9    . DG  B 2 12  ? -40.020 62.661 -268.795 1.00 34.81 ? 12  DG  B N9    1 
ATOM   1220 C  C8    . DG  B 2 12  ? -39.370 62.683 -270.005 1.00 30.13 ? 12  DG  B C8    1 
ATOM   1221 N  N7    . DG  B 2 12  ? -38.075 62.787 -269.898 1.00 27.86 ? 12  DG  B N7    1 
ATOM   1222 C  C5    . DG  B 2 12  ? -37.851 62.836 -268.528 1.00 25.27 ? 12  DG  B C5    1 
ATOM   1223 C  C6    . DG  B 2 12  ? -36.639 62.946 -267.809 1.00 22.14 ? 12  DG  B C6    1 
ATOM   1224 O  O6    . DG  B 2 12  ? -35.488 63.025 -268.256 1.00 22.29 ? 12  DG  B O6    1 
ATOM   1225 N  N1    . DG  B 2 12  ? -36.856 62.962 -266.432 1.00 21.54 ? 12  DG  B N1    1 
ATOM   1226 C  C2    . DG  B 2 12  ? -38.088 62.882 -265.829 1.00 24.66 ? 12  DG  B C2    1 
ATOM   1227 N  N2    . DG  B 2 12  ? -38.097 62.912 -264.488 1.00 25.58 ? 12  DG  B N2    1 
ATOM   1228 N  N3    . DG  B 2 12  ? -39.233 62.779 -266.493 1.00 25.56 ? 12  DG  B N3    1 
ATOM   1229 C  C4    . DG  B 2 12  ? -39.038 62.761 -267.835 1.00 28.26 ? 12  DG  B C4    1 
ATOM   1230 P  P     . DT  B 2 13  ? -44.507 66.184 -269.128 1.00 61.32 ? 13  DT  B P     1 
ATOM   1231 O  OP1   . DT  B 2 13  ? -45.944 66.476 -268.930 1.00 68.67 ? 13  DT  B OP1   1 
ATOM   1232 O  OP2   . DT  B 2 13  ? -43.789 66.775 -270.278 1.00 60.63 ? 13  DT  B OP2   1 
ATOM   1233 O  "O5'" . DT  B 2 13  ? -43.712 66.582 -267.796 1.00 58.16 ? 13  DT  B "O5'" 1 
ATOM   1234 C  "C5'" . DT  B 2 13  ? -44.181 66.142 -266.525 1.00 53.57 ? 13  DT  B "C5'" 1 
ATOM   1235 C  "C4'" . DT  B 2 13  ? -43.233 66.571 -265.416 1.00 50.62 ? 13  DT  B "C4'" 1 
ATOM   1236 O  "O4'" . DT  B 2 13  ? -42.028 65.779 -265.469 1.00 44.27 ? 13  DT  B "O4'" 1 
ATOM   1237 C  "C3'" . DT  B 2 13  ? -42.741 68.002 -265.511 1.00 48.74 ? 13  DT  B "C3'" 1 
ATOM   1238 O  "O3'" . DT  B 2 13  ? -43.698 68.883 -264.936 1.00 59.56 ? 13  DT  B "O3'" 1 
ATOM   1239 C  "C2'" . DT  B 2 13  ? -41.455 67.956 -264.685 1.00 40.70 ? 13  DT  B "C2'" 1 
ATOM   1240 C  "C1'" . DT  B 2 13  ? -40.961 66.516 -264.897 1.00 39.46 ? 13  DT  B "C1'" 1 
ATOM   1241 N  N1    . DT  B 2 13  ? -39.769 66.416 -265.794 1.00 30.53 ? 13  DT  B N1    1 
ATOM   1242 C  C2    . DT  B 2 13  ? -38.510 66.383 -265.239 1.00 29.36 ? 13  DT  B C2    1 
ATOM   1243 O  O2    . DT  B 2 13  ? -38.308 66.433 -264.038 1.00 32.04 ? 13  DT  B O2    1 
ATOM   1244 N  N3    . DT  B 2 13  ? -37.486 66.289 -266.145 1.00 25.44 ? 13  DT  B N3    1 
ATOM   1245 C  C4    . DT  B 2 13  ? -37.594 66.225 -267.522 1.00 26.05 ? 13  DT  B C4    1 
ATOM   1246 O  O4    . DT  B 2 13  ? -36.613 66.145 -268.255 1.00 28.28 ? 13  DT  B O4    1 
ATOM   1247 C  C5    . DT  B 2 13  ? -38.942 66.262 -268.039 1.00 31.84 ? 13  DT  B C5    1 
ATOM   1248 C  C7    . DT  B 2 13  ? -39.185 66.202 -269.518 1.00 35.13 ? 13  DT  B C7    1 
ATOM   1249 C  C6    . DT  B 2 13  ? -39.952 66.357 -267.160 1.00 34.34 ? 13  DT  B C6    1 
ATOM   1250 O  "O5'" . DT  C 3 1   ? -24.079 67.603 -267.842 1.00 56.81 ? 1   DT  C "O5'" 1 
ATOM   1251 C  "C5'" . DT  C 3 1   ? -25.221 68.427 -267.652 1.00 46.46 ? 1   DT  C "C5'" 1 
ATOM   1252 C  "C4'" . DT  C 3 1   ? -25.744 68.296 -266.235 1.00 36.31 ? 1   DT  C "C4'" 1 
ATOM   1253 O  "O4'" . DT  C 3 1   ? -27.017 68.987 -266.126 1.00 32.02 ? 1   DT  C "O4'" 1 
ATOM   1254 C  "C3'" . DT  C 3 1   ? -26.022 66.868 -265.788 1.00 30.01 ? 1   DT  C "C3'" 1 
ATOM   1255 O  "O3'" . DT  C 3 1   ? -25.866 66.762 -264.377 1.00 34.59 ? 1   DT  C "O3'" 1 
ATOM   1256 C  "C2'" . DT  C 3 1   ? -27.473 66.680 -266.207 1.00 27.62 ? 1   DT  C "C2'" 1 
ATOM   1257 C  "C1'" . DT  C 3 1   ? -28.053 68.051 -265.894 1.00 27.95 ? 1   DT  C "C1'" 1 
ATOM   1258 N  N1    . DT  C 3 1   ? -29.205 68.404 -266.755 1.00 27.82 ? 1   DT  C N1    1 
ATOM   1259 C  C2    . DT  C 3 1   ? -30.405 68.726 -266.170 1.00 27.77 ? 1   DT  C C2    1 
ATOM   1260 O  O2    . DT  C 3 1   ? -30.578 68.748 -264.965 1.00 27.11 ? 1   DT  C O2    1 
ATOM   1261 N  N3    . DT  C 3 1   ? -31.401 69.033 -267.052 1.00 28.13 ? 1   DT  C N3    1 
ATOM   1262 C  C4    . DT  C 3 1   ? -31.325 69.045 -268.431 1.00 31.59 ? 1   DT  C C4    1 
ATOM   1263 O  O4    . DT  C 3 1   ? -32.284 69.335 -269.140 1.00 35.75 ? 1   DT  C O4    1 
ATOM   1264 C  C5    . DT  C 3 1   ? -30.040 68.693 -268.980 1.00 33.73 ? 1   DT  C C5    1 
ATOM   1265 C  C7    . DT  C 3 1   ? -29.834 68.671 -270.466 1.00 37.28 ? 1   DT  C C7    1 
ATOM   1266 C  C6    . DT  C 3 1   ? -29.053 68.390 -268.126 1.00 31.26 ? 1   DT  C C6    1 
ATOM   1267 P  P     . DA  C 3 2   ? -26.080 65.352 -263.635 1.00 33.23 ? 2   DA  C P     1 
ATOM   1268 O  OP1   . DA  C 3 2   ? -24.964 65.185 -262.678 1.00 36.91 ? 2   DA  C OP1   1 
ATOM   1269 O  OP2   . DA  C 3 2   ? -26.330 64.312 -264.659 1.00 31.17 ? 2   DA  C OP2   1 
ATOM   1270 O  "O5'" . DA  C 3 2   ? -27.428 65.561 -262.803 1.00 35.54 ? 2   DA  C "O5'" 1 
ATOM   1271 C  "C5'" . DA  C 3 2   ? -27.521 66.626 -261.859 1.00 33.14 ? 2   DA  C "C5'" 1 
ATOM   1272 C  "C4'" . DA  C 3 2   ? -28.778 66.498 -261.015 1.00 30.56 ? 2   DA  C "C4'" 1 
ATOM   1273 O  "O4'" . DA  C 3 2   ? -29.933 66.900 -261.796 1.00 32.01 ? 2   DA  C "O4'" 1 
ATOM   1274 C  "C3'" . DA  C 3 2   ? -29.072 65.092 -260.506 1.00 36.63 ? 2   DA  C "C3'" 1 
ATOM   1275 O  "O3'" . DA  C 3 2   ? -29.590 65.147 -259.185 1.00 41.56 ? 2   DA  C "O3'" 1 
ATOM   1276 C  "C2'" . DA  C 3 2   ? -30.104 64.562 -261.501 1.00 33.16 ? 2   DA  C "C2'" 1 
ATOM   1277 C  "C1'" . DA  C 3 2   ? -30.845 65.828 -261.917 1.00 32.38 ? 2   DA  C "C1'" 1 
ATOM   1278 N  N9    . DA  C 3 2   ? -31.321 65.791 -263.299 1.00 29.11 ? 2   DA  C N9    1 
ATOM   1279 C  C8    . DA  C 3 2   ? -30.573 65.578 -264.423 1.00 27.60 ? 2   DA  C C8    1 
ATOM   1280 N  N7    . DA  C 3 2   ? -31.269 65.603 -265.535 1.00 25.84 ? 2   DA  C N7    1 
ATOM   1281 C  C5    . DA  C 3 2   ? -32.563 65.852 -265.112 1.00 23.96 ? 2   DA  C C5    1 
ATOM   1282 C  C6    . DA  C 3 2   ? -33.777 65.996 -265.809 1.00 23.86 ? 2   DA  C C6    1 
ATOM   1283 N  N6    . DA  C 3 2   ? -33.875 65.904 -267.139 1.00 24.51 ? 2   DA  C N6    1 
ATOM   1284 N  N1    . DA  C 3 2   ? -34.889 66.238 -265.085 1.00 24.55 ? 2   DA  C N1    1 
ATOM   1285 C  C2    . DA  C 3 2   ? -34.785 66.330 -263.754 1.00 25.26 ? 2   DA  C C2    1 
ATOM   1286 N  N3    . DA  C 3 2   ? -33.701 66.212 -262.988 1.00 28.50 ? 2   DA  C N3    1 
ATOM   1287 C  C4    . DA  C 3 2   ? -32.613 65.971 -263.736 1.00 24.73 ? 2   DA  C C4    1 
ATOM   1288 P  P     . DC  C 3 3   ? -29.725 63.802 -258.317 1.00 44.98 ? 3   DC  C P     1 
ATOM   1289 O  OP1   . DC  C 3 3   ? -29.656 64.185 -256.889 1.00 47.81 ? 3   DC  C OP1   1 
ATOM   1290 O  OP2   . DC  C 3 3   ? -28.768 62.813 -258.864 1.00 43.87 ? 3   DC  C OP2   1 
ATOM   1291 O  "O5'" . DC  C 3 3   ? -31.208 63.299 -258.636 1.00 38.19 ? 3   DC  C "O5'" 1 
ATOM   1292 C  "C5'" . DC  C 3 3   ? -32.297 64.190 -258.449 1.00 37.79 ? 3   DC  C "C5'" 1 
ATOM   1293 C  "C4'" . DC  C 3 3   ? -33.560 63.662 -259.102 1.00 34.19 ? 3   DC  C "C4'" 1 
ATOM   1294 O  "O4'" . DC  C 3 3   ? -33.489 63.825 -260.534 1.00 31.10 ? 3   DC  C "O4'" 1 
ATOM   1295 C  "C3'" . DC  C 3 3   ? -33.854 62.175 -258.864 1.00 35.09 ? 3   DC  C "C3'" 1 
ATOM   1296 O  "O3'" . DC  C 3 3   ? -35.029 62.048 -258.077 1.00 36.36 ? 3   DC  C "O3'" 1 
ATOM   1297 C  "C2'" . DC  C 3 3   ? -34.046 61.594 -260.280 1.00 32.17 ? 3   DC  C "C2'" 1 
ATOM   1298 C  "C1'" . DC  C 3 3   ? -34.303 62.843 -261.108 1.00 27.95 ? 3   DC  C "C1'" 1 
ATOM   1299 N  N1    . DC  C 3 3   ? -33.956 62.707 -262.556 1.00 24.96 ? 3   DC  C N1    1 
ATOM   1300 C  C2    . DC  C 3 3   ? -34.960 62.861 -263.518 1.00 23.83 ? 3   DC  C C2    1 
ATOM   1301 O  O2    . DC  C 3 3   ? -36.115 63.103 -263.147 1.00 26.86 ? 3   DC  C O2    1 
ATOM   1302 N  N3    . DC  C 3 3   ? -34.639 62.741 -264.829 1.00 21.67 ? 3   DC  C N3    1 
ATOM   1303 C  C4    . DC  C 3 3   ? -33.381 62.480 -265.187 1.00 22.91 ? 3   DC  C C4    1 
ATOM   1304 N  N4    . DC  C 3 3   ? -33.113 62.370 -266.493 1.00 22.89 ? 3   DC  C N4    1 
ATOM   1305 C  C5    . DC  C 3 3   ? -32.342 62.320 -264.221 1.00 23.34 ? 3   DC  C C5    1 
ATOM   1306 C  C6    . DC  C 3 3   ? -32.671 62.441 -262.930 1.00 26.63 ? 3   DC  C C6    1 
ATOM   1307 P  P     . DA  C 3 4   ? -35.574 60.602 -257.643 1.00 37.72 ? 4   DA  C P     1 
ATOM   1308 O  OP1   . DA  C 3 4   ? -36.268 60.770 -256.347 1.00 37.41 ? 4   DA  C OP1   1 
ATOM   1309 O  OP2   . DA  C 3 4   ? -34.468 59.626 -257.770 1.00 32.56 ? 4   DA  C OP2   1 
ATOM   1310 O  "O5'" . DA  C 3 4   ? -36.673 60.267 -258.753 1.00 35.01 ? 4   DA  C "O5'" 1 
ATOM   1311 C  "C5'" . DA  C 3 4   ? -37.688 61.218 -259.047 1.00 36.68 ? 4   DA  C "C5'" 1 
ATOM   1312 C  "C4'" . DA  C 3 4   ? -38.664 60.666 -260.068 1.00 36.24 ? 4   DA  C "C4'" 1 
ATOM   1313 O  "O4'" . DA  C 3 4   ? -38.100 60.792 -261.398 1.00 32.42 ? 4   DA  C "O4'" 1 
ATOM   1314 C  "C3'" . DA  C 3 4   ? -39.020 59.192 -259.878 1.00 36.23 ? 4   DA  C "C3'" 1 
ATOM   1315 O  "O3'" . DA  C 3 4   ? -40.431 59.025 -259.924 1.00 43.08 ? 4   DA  C "O3'" 1 
ATOM   1316 C  "C2'" . DA  C 3 4   ? -38.316 58.484 -261.041 1.00 33.10 ? 4   DA  C "C2'" 1 
ATOM   1317 C  "C1'" . DA  C 3 4   ? -38.238 59.578 -262.098 1.00 27.78 ? 4   DA  C "C1'" 1 
ATOM   1318 N  N9    . DA  C 3 4   ? -37.092 59.440 -262.995 1.00 23.83 ? 4   DA  C N9    1 
ATOM   1319 C  C8    . DA  C 3 4   ? -35.782 59.273 -262.639 1.00 24.47 ? 4   DA  C C8    1 
ATOM   1320 N  N7    . DA  C 3 4   ? -34.961 59.187 -263.660 1.00 25.30 ? 4   DA  C N7    1 
ATOM   1321 C  C5    . DA  C 3 4   ? -35.789 59.310 -264.764 1.00 21.11 ? 4   DA  C C5    1 
ATOM   1322 C  C6    . DA  C 3 4   ? -35.533 59.302 -266.150 1.00 19.14 ? 4   DA  C C6    1 
ATOM   1323 N  N6    . DA  C 3 4   ? -34.310 59.156 -266.673 1.00 21.69 ? 4   DA  C N6    1 
ATOM   1324 N  N1    . DA  C 3 4   ? -36.585 59.449 -266.981 1.00 19.32 ? 4   DA  C N1    1 
ATOM   1325 C  C2    . DA  C 3 4   ? -37.808 59.592 -266.455 1.00 19.88 ? 4   DA  C C2    1 
ATOM   1326 N  N3    . DA  C 3 4   ? -38.172 59.616 -265.174 1.00 20.38 ? 4   DA  C N3    1 
ATOM   1327 C  C4    . DA  C 3 4   ? -37.106 59.469 -264.372 1.00 22.93 ? 4   DA  C C4    1 
ATOM   1328 P  P     . DC  C 3 5   ? -41.099 57.625 -259.506 1.00 49.97 ? 5   DC  C P     1 
ATOM   1329 O  OP1   . DC  C 3 5   ? -42.304 57.924 -258.703 1.00 54.62 ? 5   DC  C OP1   1 
ATOM   1330 O  OP2   . DC  C 3 5   ? -40.040 56.754 -258.945 1.00 48.13 ? 5   DC  C OP2   1 
ATOM   1331 O  "O5'" . DC  C 3 5   ? -41.570 57.017 -260.904 1.00 51.59 ? 5   DC  C "O5'" 1 
ATOM   1332 C  "C5'" . DC  C 3 5   ? -42.277 57.845 -261.815 1.00 46.70 ? 5   DC  C "C5'" 1 
ATOM   1333 C  "C4'" . DC  C 3 5   ? -42.277 57.252 -263.211 1.00 36.28 ? 5   DC  C "C4'" 1 
ATOM   1334 O  "O4'" . DC  C 3 5   ? -40.969 57.390 -263.810 1.00 32.14 ? 5   DC  C "O4'" 1 
ATOM   1335 C  "C3'" . DC  C 3 5   ? -42.621 55.761 -263.283 1.00 31.08 ? 5   DC  C "C3'" 1 
ATOM   1336 O  "O3'" . DC  C 3 5   ? -43.828 55.589 -264.008 1.00 30.80 ? 5   DC  C "O3'" 1 
ATOM   1337 C  "C2'" . DC  C 3 5   ? -41.420 55.124 -264.008 1.00 25.82 ? 5   DC  C "C2'" 1 
ATOM   1338 C  "C1'" . DC  C 3 5   ? -40.787 56.323 -264.697 1.00 24.88 ? 5   DC  C "C1'" 1 
ATOM   1339 N  N1    . DC  C 3 5   ? -39.324 56.170 -264.978 1.00 20.42 ? 5   DC  C N1    1 
ATOM   1340 C  C2    . DC  C 3 5   ? -38.874 56.208 -266.302 1.00 18.77 ? 5   DC  C C2    1 
ATOM   1341 O  O2    . DC  C 3 5   ? -39.696 56.363 -267.212 1.00 23.24 ? 5   DC  C O2    1 
ATOM   1342 N  N3    . DC  C 3 5   ? -37.549 56.076 -266.550 1.00 18.15 ? 5   DC  C N3    1 
ATOM   1343 C  C4    . DC  C 3 5   ? -36.693 55.912 -265.541 1.00 18.00 ? 5   DC  C C4    1 
ATOM   1344 N  N4    . DC  C 3 5   ? -35.396 55.786 -265.838 1.00 17.65 ? 5   DC  C N4    1 
ATOM   1345 C  C5    . DC  C 3 5   ? -37.131 55.870 -264.183 1.00 18.52 ? 5   DC  C C5    1 
ATOM   1346 C  C6    . DC  C 3 5   ? -38.443 56.003 -263.949 1.00 21.96 ? 5   DC  C C6    1 
ATOM   1347 P  P     . DT  C 3 6   ? -44.530 54.148 -264.089 1.00 32.89 ? 6   DT  C P     1 
ATOM   1348 O  OP1   . DT  C 3 6   ? -45.984 54.372 -264.233 1.00 37.36 ? 6   DT  C OP1   1 
ATOM   1349 O  OP2   . DT  C 3 6   ? -44.016 53.318 -262.977 1.00 35.72 ? 6   DT  C OP2   1 
ATOM   1350 O  "O5'" . DT  C 3 6   ? -43.981 53.548 -265.467 1.00 28.06 ? 6   DT  C "O5'" 1 
ATOM   1351 C  "C5'" . DT  C 3 6   ? -44.082 54.322 -266.653 1.00 25.37 ? 6   DT  C "C5'" 1 
ATOM   1352 C  "C4'" . DT  C 3 6   ? -43.274 53.703 -267.776 1.00 26.14 ? 6   DT  C "C4'" 1 
ATOM   1353 O  "O4'" . DT  C 3 6   ? -41.870 53.915 -267.541 1.00 26.07 ? 6   DT  C "O4'" 1 
ATOM   1354 C  "C3'" . DT  C 3 6   ? -43.444 52.191 -267.935 1.00 25.31 ? 6   DT  C "C3'" 1 
ATOM   1355 O  "O3'" . DT  C 3 6   ? -44.227 51.916 -269.089 1.00 28.97 ? 6   DT  C "O3'" 1 
ATOM   1356 C  "C2'" . DT  C 3 6   ? -42.006 51.646 -268.072 1.00 25.27 ? 6   DT  C "C2'" 1 
ATOM   1357 C  "C1'" . DT  C 3 6   ? -41.163 52.910 -268.213 1.00 22.58 ? 6   DT  C "C1'" 1 
ATOM   1358 N  N1    . DT  C 3 6   ? -39.799 52.802 -267.604 1.00 22.30 ? 6   DT  C N1    1 
ATOM   1359 C  C2    . DT  C 3 6   ? -38.694 52.872 -268.420 1.00 17.67 ? 6   DT  C C2    1 
ATOM   1360 O  O2    . DT  C 3 6   ? -38.763 53.013 -269.628 1.00 23.01 ? 6   DT  C O2    1 
ATOM   1361 N  N3    . DT  C 3 6   ? -37.494 52.769 -267.769 1.00 17.99 ? 6   DT  C N3    1 
ATOM   1362 C  C4    . DT  C 3 6   ? -37.291 52.607 -266.413 1.00 18.00 ? 6   DT  C C4    1 
ATOM   1363 O  O4    . DT  C 3 6   ? -36.169 52.525 -265.922 1.00 18.88 ? 6   DT  C O4    1 
ATOM   1364 C  C5    . DT  C 3 6   ? -38.491 52.541 -265.613 1.00 19.79 ? 6   DT  C C5    1 
ATOM   1365 C  C7    . DT  C 3 6   ? -38.398 52.366 -264.125 1.00 22.15 ? 6   DT  C C7    1 
ATOM   1366 C  C6    . DT  C 3 6   ? -39.674 52.641 -266.239 1.00 19.06 ? 6   DT  C C6    1 
ATOM   1367 P  P     . DC  C 3 7   ? -44.843 50.452 -269.323 1.00 30.56 ? 7   DC  C P     1 
ATOM   1368 O  OP1   . DC  C 3 7   ? -46.138 50.618 -270.018 1.00 34.38 ? 7   DC  C OP1   1 
ATOM   1369 O  OP2   . DC  C 3 7   ? -44.790 49.722 -268.035 1.00 32.87 ? 7   DC  C OP2   1 
ATOM   1370 O  "O5'" . DC  C 3 7   ? -43.813 49.772 -270.333 1.00 29.75 ? 7   DC  C "O5'" 1 
ATOM   1371 C  "C5'" . DC  C 3 7   ? -43.475 50.439 -271.541 1.00 30.44 ? 7   DC  C "C5'" 1 
ATOM   1372 C  "C4'" . DC  C 3 7   ? -42.200 49.872 -272.131 1.00 27.67 ? 7   DC  C "C4'" 1 
ATOM   1373 O  "O4'" . DC  C 3 7   ? -41.075 50.261 -271.319 1.00 23.99 ? 7   DC  C "O4'" 1 
ATOM   1374 C  "C3'" . DC  C 3 7   ? -42.149 48.343 -272.202 1.00 29.31 ? 7   DC  C "C3'" 1 
ATOM   1375 O  "O3'" . DC  C 3 7   ? -42.287 47.910 -273.550 1.00 33.00 ? 7   DC  C "O3'" 1 
ATOM   1376 C  "C2'" . DC  C 3 7   ? -40.771 47.972 -271.625 1.00 31.56 ? 7   DC  C "C2'" 1 
ATOM   1377 C  "C1'" . DC  C 3 7   ? -40.062 49.316 -271.512 1.00 23.90 ? 7   DC  C "C1'" 1 
ATOM   1378 N  N1    . DC  C 3 7   ? -39.107 49.383 -270.370 1.00 18.58 ? 7   DC  C N1    1 
ATOM   1379 C  C2    . DC  C 3 7   ? -37.752 49.613 -270.620 1.00 18.78 ? 7   DC  C C2    1 
ATOM   1380 O  O2    . DC  C 3 7   ? -37.374 49.772 -271.787 1.00 21.72 ? 7   DC  C O2    1 
ATOM   1381 N  N3    . DC  C 3 7   ? -36.891 49.661 -269.576 1.00 17.11 ? 7   DC  C N3    1 
ATOM   1382 C  C4    . DC  C 3 7   ? -37.339 49.487 -268.332 1.00 16.99 ? 7   DC  C C4    1 
ATOM   1383 N  N4    . DC  C 3 7   ? -36.451 49.543 -267.334 1.00 16.73 ? 7   DC  C N4    1 
ATOM   1384 C  C5    . DC  C 3 7   ? -38.717 49.246 -268.056 1.00 17.41 ? 7   DC  C C5    1 
ATOM   1385 C  C6    . DC  C 3 7   ? -39.558 49.199 -269.095 1.00 18.67 ? 7   DC  C C6    1 
ATOM   1386 P  P     . DC  C 3 8   ? -42.153 46.351 -273.917 1.00 34.41 ? 8   DC  C P     1 
ATOM   1387 O  OP1   . DC  C 3 8   ? -42.975 46.098 -275.120 1.00 40.88 ? 8   DC  C OP1   1 
ATOM   1388 O  OP2   . DC  C 3 8   ? -42.402 45.567 -272.688 1.00 38.12 ? 8   DC  C OP2   1 
ATOM   1389 O  "O5'" . DC  C 3 8   ? -40.611 46.186 -274.316 1.00 31.69 ? 8   DC  C "O5'" 1 
ATOM   1390 C  "C5'" . DC  C 3 8   ? -40.048 47.023 -275.321 1.00 26.79 ? 8   DC  C "C5'" 1 
ATOM   1391 C  "C4'" . DC  C 3 8   ? -38.586 46.684 -275.551 1.00 27.41 ? 8   DC  C "C4'" 1 
ATOM   1392 O  "O4'" . DC  C 3 8   ? -37.809 47.069 -274.389 1.00 27.56 ? 8   DC  C "O4'" 1 
ATOM   1393 C  "C3'" . DC  C 3 8   ? -38.300 45.201 -275.797 1.00 29.99 ? 8   DC  C "C3'" 1 
ATOM   1394 O  "O3'" . DC  C 3 8   ? -37.454 45.048 -276.931 1.00 32.29 ? 8   DC  C "O3'" 1 
ATOM   1395 C  "C2'" . DC  C 3 8   ? -37.614 44.739 -274.509 1.00 30.02 ? 8   DC  C "C2'" 1 
ATOM   1396 C  "C1'" . DC  C 3 8   ? -36.949 46.017 -274.020 1.00 25.88 ? 8   DC  C "C1'" 1 
ATOM   1397 N  N1    . DC  C 3 8   ? -36.767 46.061 -272.538 1.00 21.39 ? 8   DC  C N1    1 
ATOM   1398 C  C2    . DC  C 3 8   ? -35.479 46.141 -271.997 1.00 20.14 ? 8   DC  C C2    1 
ATOM   1399 O  O2    . DC  C 3 8   ? -34.505 46.175 -272.758 1.00 22.73 ? 8   DC  C O2    1 
ATOM   1400 N  N3    . DC  C 3 8   ? -35.336 46.182 -270.649 1.00 19.41 ? 8   DC  C N3    1 
ATOM   1401 C  C4    . DC  C 3 8   ? -36.412 46.144 -269.860 1.00 17.66 ? 8   DC  C C4    1 
ATOM   1402 N  N4    . DC  C 3 8   ? -36.221 46.186 -268.537 1.00 18.15 ? 8   DC  C N4    1 
ATOM   1403 C  C5    . DC  C 3 8   ? -37.731 46.061 -270.393 1.00 18.14 ? 8   DC  C C5    1 
ATOM   1404 C  C6    . DC  C 3 8   ? -37.860 46.022 -271.724 1.00 22.07 ? 8   DC  C C6    1 
ATOM   1405 P  P     . DC  C 3 9   ? -37.277 43.608 -277.620 1.00 39.05 ? 9   DC  C P     1 
ATOM   1406 O  OP1   . DC  C 3 9   ? -37.015 43.830 -279.058 1.00 42.16 ? 9   DC  C OP1   1 
ATOM   1407 O  OP2   . DC  C 3 9   ? -38.415 42.758 -277.204 1.00 44.12 ? 9   DC  C OP2   1 
ATOM   1408 O  "O5'" . DC  C 3 9   ? -35.948 43.032 -276.948 1.00 34.31 ? 9   DC  C "O5'" 1 
ATOM   1409 C  "C5'" . DC  C 3 9   ? -34.739 43.769 -277.046 1.00 29.70 ? 9   DC  C "C5'" 1 
ATOM   1410 C  "C4'" . DC  C 3 9   ? -33.695 43.231 -276.087 1.00 26.11 ? 9   DC  C "C4'" 1 
ATOM   1411 O  "O4'" . DC  C 3 9   ? -34.048 43.581 -274.733 1.00 24.27 ? 9   DC  C "O4'" 1 
ATOM   1412 C  "C3'" . DC  C 3 9   ? -33.525 41.709 -276.099 1.00 30.47 ? 9   DC  C "C3'" 1 
ATOM   1413 O  "O3'" . DC  C 3 9   ? -32.246 41.375 -276.623 1.00 33.81 ? 9   DC  C "O3'" 1 
ATOM   1414 C  "C2'" . DC  C 3 9   ? -33.668 41.290 -274.622 1.00 29.42 ? 9   DC  C "C2'" 1 
ATOM   1415 C  "C1'" . DC  C 3 9   ? -33.507 42.612 -273.881 1.00 23.74 ? 9   DC  C "C1'" 1 
ATOM   1416 N  N1    . DC  C 3 9   ? -34.227 42.669 -272.572 1.00 22.75 ? 9   DC  C N1    1 
ATOM   1417 C  C2    . DC  C 3 9   ? -33.504 42.902 -271.397 1.00 21.14 ? 9   DC  C C2    1 
ATOM   1418 O  O2    . DC  C 3 9   ? -32.277 43.053 -271.465 1.00 23.54 ? 9   DC  C O2    1 
ATOM   1419 N  N3    . DC  C 3 9   ? -34.168 42.955 -270.216 1.00 19.03 ? 9   DC  C N3    1 
ATOM   1420 C  C4    . DC  C 3 9   ? -35.491 42.787 -270.185 1.00 19.00 ? 9   DC  C C4    1 
ATOM   1421 N  N4    . DC  C 3 9   ? -36.102 42.849 -268.997 1.00 18.57 ? 9   DC  C N4    1 
ATOM   1422 C  C5    . DC  C 3 9   ? -36.246 42.551 -271.372 1.00 19.75 ? 9   DC  C C5    1 
ATOM   1423 C  C6    . DC  C 3 9   ? -35.581 42.500 -272.532 1.00 21.58 ? 9   DC  C C6    1 
ATOM   1424 P  P     . DA  C 3 10  ? -31.835 39.841 -276.862 1.00 39.14 ? 10  DA  C P     1 
ATOM   1425 O  OP1   . DA  C 3 10  ? -30.862 39.808 -277.977 1.00 48.76 ? 10  DA  C OP1   1 
ATOM   1426 O  OP2   . DA  C 3 10  ? -33.078 39.042 -276.944 1.00 40.58 ? 10  DA  C OP2   1 
ATOM   1427 O  "O5'" . DA  C 3 10  ? -31.077 39.444 -275.513 1.00 34.42 ? 10  DA  C "O5'" 1 
ATOM   1428 C  "C5'" . DA  C 3 10  ? -30.014 40.260 -275.036 1.00 32.59 ? 10  DA  C "C5'" 1 
ATOM   1429 C  "C4'" . DA  C 3 10  ? -29.663 39.898 -273.607 1.00 28.78 ? 10  DA  C "C4'" 1 
ATOM   1430 O  "O4'" . DA  C 3 10  ? -30.723 40.323 -272.737 1.00 30.41 ? 10  DA  C "O4'" 1 
ATOM   1431 C  "C3'" . DA  C 3 10  ? -29.505 38.403 -273.353 1.00 33.00 ? 10  DA  C "C3'" 1 
ATOM   1432 O  "O3'" . DA  C 3 10  ? -28.125 38.053 -273.356 1.00 38.38 ? 10  DA  C "O3'" 1 
ATOM   1433 C  "C2'" . DA  C 3 10  ? -30.148 38.170 -271.972 1.00 32.15 ? 10  DA  C "C2'" 1 
ATOM   1434 C  "C1'" . DA  C 3 10  ? -30.682 39.548 -271.569 1.00 30.62 ? 10  DA  C "C1'" 1 
ATOM   1435 N  N9    . DA  C 3 10  ? -32.025 39.509 -270.997 1.00 26.03 ? 10  DA  C N9    1 
ATOM   1436 C  C8    . DA  C 3 10  ? -33.198 39.289 -271.662 1.00 24.51 ? 10  DA  C C8    1 
ATOM   1437 N  N7    . DA  C 3 10  ? -34.259 39.313 -270.888 1.00 25.68 ? 10  DA  C N7    1 
ATOM   1438 C  C5    . DA  C 3 10  ? -33.744 39.569 -269.628 1.00 23.47 ? 10  DA  C C5    1 
ATOM   1439 C  C6    . DA  C 3 10  ? -34.351 39.717 -268.366 1.00 20.33 ? 10  DA  C C6    1 
ATOM   1440 N  N6    . DA  C 3 10  ? -35.671 39.622 -268.168 1.00 20.71 ? 10  DA  C N6    1 
ATOM   1441 N  N1    . DA  C 3 10  ? -33.549 39.966 -267.311 1.00 20.41 ? 10  DA  C N1    1 
ATOM   1442 C  C2    . DA  C 3 10  ? -32.230 40.060 -267.511 1.00 20.53 ? 10  DA  C C2    1 
ATOM   1443 N  N3    . DA  C 3 10  ? -31.544 39.941 -268.648 1.00 21.10 ? 10  DA  C N3    1 
ATOM   1444 C  C4    . DA  C 3 10  ? -32.368 39.694 -269.678 1.00 21.82 ? 10  DA  C C4    1 
ATOM   1445 P  P     . DC  C 3 11  ? -27.682 36.509 -273.348 1.00 46.36 ? 11  DC  C P     1 
ATOM   1446 O  OP1   . DC  C 3 11  ? -26.309 36.426 -273.893 1.00 52.57 ? 11  DC  C OP1   1 
ATOM   1447 O  OP2   . DC  C 3 11  ? -28.772 35.731 -273.978 1.00 47.01 ? 11  DC  C OP2   1 
ATOM   1448 O  "O5'" . DC  C 3 11  ? -27.642 36.137 -271.794 1.00 39.32 ? 11  DC  C "O5'" 1 
ATOM   1449 C  "C5'" . DC  C 3 11  ? -26.880 36.935 -270.899 1.00 34.89 ? 11  DC  C "C5'" 1 
ATOM   1450 C  "C4'" . DC  C 3 11  ? -27.164 36.554 -269.458 1.00 33.25 ? 11  DC  C "C4'" 1 
ATOM   1451 O  "O4'" . DC  C 3 11  ? -28.507 36.957 -269.102 1.00 30.69 ? 11  DC  C "O4'" 1 
ATOM   1452 C  "C3'" . DC  C 3 11  ? -27.068 35.054 -269.155 1.00 33.24 ? 11  DC  C "C3'" 1 
ATOM   1453 O  "O3'" . DC  C 3 11  ? -26.087 34.827 -268.151 1.00 37.28 ? 11  DC  C "O3'" 1 
ATOM   1454 C  "C2'" . DC  C 3 11  ? -28.477 34.670 -268.677 1.00 32.41 ? 11  DC  C "C2'" 1 
ATOM   1455 C  "C1'" . DC  C 3 11  ? -29.045 36.006 -268.222 1.00 26.86 ? 11  DC  C "C1'" 1 
ATOM   1456 N  N1    . DC  C 3 11  ? -30.536 36.084 -268.294 1.00 27.52 ? 11  DC  C N1    1 
ATOM   1457 C  C2    . DC  C 3 11  ? -31.271 36.356 -267.134 1.00 25.18 ? 11  DC  C C2    1 
ATOM   1458 O  O2    . DC  C 3 11  ? -30.671 36.522 -266.065 1.00 27.38 ? 11  DC  C O2    1 
ATOM   1459 N  N3    . DC  C 3 11  ? -32.623 36.427 -267.215 1.00 23.13 ? 11  DC  C N3    1 
ATOM   1460 C  C4    . DC  C 3 11  ? -33.233 36.241 -268.386 1.00 23.28 ? 11  DC  C C4    1 
ATOM   1461 N  N4    . DC  C 3 11  ? -34.567 36.321 -268.416 1.00 22.86 ? 11  DC  C N4    1 
ATOM   1462 C  C5    . DC  C 3 11  ? -32.502 35.964 -269.579 1.00 24.21 ? 11  DC  C C5    1 
ATOM   1463 C  C6    . DC  C 3 11  ? -31.169 35.896 -269.487 1.00 25.73 ? 11  DC  C C6    1 
ATOM   1464 P  P     . DG  C 3 12  ? -25.514 33.349 -267.898 1.00 49.32 ? 12  DG  C P     1 
ATOM   1465 O  OP1   . DG  C 3 12  ? -24.122 33.481 -267.413 1.00 53.04 ? 12  DG  C OP1   1 
ATOM   1466 O  OP2   . DG  C 3 12  ? -25.797 32.537 -269.102 1.00 52.09 ? 12  DG  C OP2   1 
ATOM   1467 O  "O5'" . DG  C 3 12  ? -26.420 32.797 -266.705 1.00 42.99 ? 12  DG  C "O5'" 1 
ATOM   1468 C  "C5'" . DG  C 3 12  ? -26.532 33.546 -265.503 1.00 42.81 ? 12  DG  C "C5'" 1 
ATOM   1469 C  "C4'" . DG  C 3 12  ? -27.651 33.003 -264.638 1.00 39.79 ? 12  DG  C "C4'" 1 
ATOM   1470 O  "O4'" . DG  C 3 12  ? -28.919 33.449 -265.157 1.00 39.68 ? 12  DG  C "O4'" 1 
ATOM   1471 C  "C3'" . DG  C 3 12  ? -27.730 31.475 -264.582 1.00 40.15 ? 12  DG  C "C3'" 1 
ATOM   1472 O  "O3'" . DG  C 3 12  ? -27.364 31.019 -263.285 1.00 45.44 ? 12  DG  C "O3'" 1 
ATOM   1473 C  "C2'" . DG  C 3 12  ? -29.196 31.142 -264.916 1.00 39.43 ? 12  DG  C "C2'" 1 
ATOM   1474 C  "C1'" . DG  C 3 12  ? -29.894 32.496 -264.839 1.00 36.54 ? 12  DG  C "C1'" 1 
ATOM   1475 N  N9    . DG  C 3 12  ? -31.002 32.639 -265.781 1.00 33.45 ? 12  DG  C N9    1 
ATOM   1476 C  C8    . DG  C 3 12  ? -30.955 32.480 -267.146 1.00 32.09 ? 12  DG  C C8    1 
ATOM   1477 N  N7    . DG  C 3 12  ? -32.104 32.676 -267.732 1.00 30.17 ? 12  DG  C N7    1 
ATOM   1478 C  C5    . DG  C 3 12  ? -32.968 32.990 -266.691 1.00 26.75 ? 12  DG  C C5    1 
ATOM   1479 C  C6    . DG  C 3 12  ? -34.349 33.300 -266.713 1.00 25.48 ? 12  DG  C C6    1 
ATOM   1480 O  O6    . DG  C 3 12  ? -35.106 33.363 -267.692 1.00 25.67 ? 12  DG  C O6    1 
ATOM   1481 N  N1    . DG  C 3 12  ? -34.840 33.553 -265.435 1.00 25.05 ? 12  DG  C N1    1 
ATOM   1482 C  C2    . DG  C 3 12  ? -34.093 33.511 -264.282 1.00 25.36 ? 12  DG  C C2    1 
ATOM   1483 N  N2    . DG  C 3 12  ? -34.743 33.784 -263.142 1.00 25.14 ? 12  DG  C N2    1 
ATOM   1484 N  N3    . DG  C 3 12  ? -32.799 33.221 -264.247 1.00 26.66 ? 12  DG  C N3    1 
ATOM   1485 C  C4    . DG  C 3 12  ? -32.305 32.971 -265.483 1.00 29.37 ? 12  DG  C C4    1 
ATOM   1486 P  P     . DC  C 3 13  ? -27.056 29.463 -263.030 1.00 49.93 ? 13  DC  C P     1 
ATOM   1487 O  OP1   . DC  C 3 13  ? -26.011 29.377 -261.985 1.00 56.39 ? 13  DC  C OP1   1 
ATOM   1488 O  OP2   . DC  C 3 13  ? -26.833 28.829 -264.349 1.00 46.38 ? 13  DC  C OP2   1 
ATOM   1489 O  "O5'" . DC  C 3 13  ? -28.429 28.900 -262.437 1.00 51.01 ? 13  DC  C "O5'" 1 
ATOM   1490 C  "C5'" . DC  C 3 13  ? -29.030 29.547 -261.324 1.00 45.11 ? 13  DC  C "C5'" 1 
ATOM   1491 C  "C4'" . DC  C 3 13  ? -30.504 29.194 -261.216 1.00 38.75 ? 13  DC  C "C4'" 1 
ATOM   1492 O  "O4'" . DC  C 3 13  ? -31.232 29.795 -262.307 1.00 37.71 ? 13  DC  C "O4'" 1 
ATOM   1493 C  "C3'" . DC  C 3 13  ? -30.821 27.695 -261.276 1.00 36.99 ? 13  DC  C "C3'" 1 
ATOM   1494 O  "O3'" . DC  C 3 13  ? -31.315 27.251 -260.017 1.00 40.69 ? 13  DC  C "O3'" 1 
ATOM   1495 C  "C2'" . DC  C 3 13  ? -31.888 27.570 -262.379 1.00 36.35 ? 13  DC  C "C2'" 1 
ATOM   1496 C  "C1'" . DC  C 3 13  ? -32.361 29.007 -262.552 1.00 31.37 ? 13  DC  C "C1'" 1 
ATOM   1497 N  N1    . DC  C 3 13  ? -32.877 29.312 -263.919 1.00 30.48 ? 13  DC  C N1    1 
ATOM   1498 C  C2    . DC  C 3 13  ? -34.166 29.836 -264.066 1.00 29.33 ? 13  DC  C C2    1 
ATOM   1499 O  O2    . DC  C 3 13  ? -34.851 30.040 -263.056 1.00 29.05 ? 13  DC  C O2    1 
ATOM   1500 N  N3    . DC  C 3 13  ? -34.628 30.104 -265.311 1.00 28.90 ? 13  DC  C N3    1 
ATOM   1501 C  C4    . DC  C 3 13  ? -33.859 29.868 -266.374 1.00 29.51 ? 13  DC  C C4    1 
ATOM   1502 N  N4    . DC  C 3 13  ? -34.358 30.150 -267.582 1.00 29.30 ? 13  DC  C N4    1 
ATOM   1503 C  C5    . DC  C 3 13  ? -32.541 29.335 -266.246 1.00 30.69 ? 13  DC  C C5    1 
ATOM   1504 C  C6    . DC  C 3 13  ? -32.097 29.072 -265.012 1.00 31.15 ? 13  DC  C C6    1 
ATOM   1505 N  N     . ARG D 1 3   ? 6.669   52.832 -213.344 1.00 47.47 ? 321 ARG D N     1 
ATOM   1506 C  CA    . ARG D 1 3   ? 5.487   52.911 -214.195 1.00 42.13 ? 321 ARG D CA    1 
ATOM   1507 C  C     . ARG D 1 3   ? 4.301   53.477 -213.419 1.00 40.38 ? 321 ARG D C     1 
ATOM   1508 O  O     . ARG D 1 3   ? 3.492   52.728 -212.874 1.00 37.99 ? 321 ARG D O     1 
ATOM   1509 C  CB    . ARG D 1 3   ? 5.146   51.534 -214.766 1.00 43.89 ? 321 ARG D CB    1 
ATOM   1510 C  CG    . ARG D 1 3   ? 6.219   50.970 -215.686 1.00 44.48 ? 321 ARG D CG    1 
ATOM   1511 C  CD    . ARG D 1 3   ? 5.859   49.578 -216.180 1.00 48.84 ? 321 ARG D CD    1 
ATOM   1512 N  NE    . ARG D 1 3   ? 6.826   49.077 -217.154 1.00 53.93 ? 321 ARG D NE    1 
ATOM   1513 C  CZ    . ARG D 1 3   ? 6.697   49.205 -218.471 1.00 58.41 ? 321 ARG D CZ    1 
ATOM   1514 N  NH1   . ARG D 1 3   ? 5.637   49.820 -218.979 1.00 58.37 ? 321 ARG D NH1   1 
ATOM   1515 N  NH2   . ARG D 1 3   ? 7.627   48.719 -219.281 1.00 60.14 ? 321 ARG D NH2   1 
ATOM   1516 N  N     . PRO D 1 4   ? 4.199   54.808 -213.377 1.00 42.93 ? 322 PRO D N     1 
ATOM   1517 C  CA    . PRO D 1 4   ? 3.179   55.439 -212.525 1.00 43.66 ? 322 PRO D CA    1 
ATOM   1518 C  C     . PRO D 1 4   ? 1.768   55.360 -213.080 1.00 39.56 ? 322 PRO D C     1 
ATOM   1519 O  O     . PRO D 1 4   ? 0.815   55.566 -212.318 1.00 38.93 ? 322 PRO D O     1 
ATOM   1520 C  CB    . PRO D 1 4   ? 3.650   56.901 -212.432 1.00 43.19 ? 322 PRO D CB    1 
ATOM   1521 C  CG    . PRO D 1 4   ? 5.052   56.917 -213.000 1.00 40.51 ? 322 PRO D CG    1 
ATOM   1522 C  CD    . PRO D 1 4   ? 5.096   55.801 -213.987 1.00 39.69 ? 322 PRO D CD    1 
ATOM   1523 N  N     . PHE D 1 5   ? 1.594   55.069 -214.366 1.00 34.69 ? 323 PHE D N     1 
ATOM   1524 C  CA    . PHE D 1 5   ? 0.296   55.169 -215.031 1.00 31.56 ? 323 PHE D CA    1 
ATOM   1525 C  C     . PHE D 1 5   ? -0.278  53.771 -215.244 1.00 26.35 ? 323 PHE D C     1 
ATOM   1526 O  O     . PHE D 1 5   ? 0.100   53.073 -216.189 1.00 32.06 ? 323 PHE D O     1 
ATOM   1527 C  CB    . PHE D 1 5   ? 0.432   55.920 -216.353 1.00 29.99 ? 323 PHE D CB    1 
ATOM   1528 C  CG    . PHE D 1 5   ? 1.053   57.280 -216.214 1.00 33.48 ? 323 PHE D CG    1 
ATOM   1529 C  CD1   . PHE D 1 5   ? 0.269   58.389 -215.948 1.00 36.07 ? 323 PHE D CD1   1 
ATOM   1530 C  CD2   . PHE D 1 5   ? 2.422   57.448 -216.345 1.00 32.10 ? 323 PHE D CD2   1 
ATOM   1531 C  CE1   . PHE D 1 5   ? 0.838   59.642 -215.817 1.00 40.26 ? 323 PHE D CE1   1 
ATOM   1532 C  CE2   . PHE D 1 5   ? 2.997   58.698 -216.214 1.00 32.15 ? 323 PHE D CE2   1 
ATOM   1533 C  CZ    . PHE D 1 5   ? 2.203   59.795 -215.950 1.00 36.59 ? 323 PHE D CZ    1 
ATOM   1534 N  N     . MET D 1 6   ? -1.202  53.373 -214.371 1.00 31.52 ? 324 MET D N     1 
ATOM   1535 C  CA    . MET D 1 6   ? -1.902  52.104 -214.510 1.00 30.49 ? 324 MET D CA    1 
ATOM   1536 C  C     . MET D 1 6   ? -3.211  52.306 -215.264 1.00 30.06 ? 324 MET D C     1 
ATOM   1537 O  O     . MET D 1 6   ? -3.909  53.304 -215.063 1.00 31.34 ? 324 MET D O     1 
ATOM   1538 C  CB    . MET D 1 6   ? -2.176  51.474 -213.142 1.00 32.28 ? 324 MET D CB    1 
ATOM   1539 C  CG    . MET D 1 6   ? -3.119  50.273 -213.189 1.00 33.81 ? 324 MET D CG    1 
ATOM   1540 S  SD    . MET D 1 6   ? -3.322  49.411 -211.618 1.00 45.38 ? 324 MET D SD    1 
ATOM   1541 C  CE    . MET D 1 6   ? -1.902  48.322 -211.645 1.00 51.17 ? 324 MET D CE    1 
ATOM   1542 N  N     . CYS D 1 7   ? -3.533  51.356 -216.139 1.00 29.49 ? 325 CYS D N     1 
ATOM   1543 C  CA    . CYS D 1 7   ? -4.781  51.418 -216.888 1.00 30.21 ? 325 CYS D CA    1 
ATOM   1544 C  C     . CYS D 1 7   ? -5.976  51.370 -215.944 1.00 31.62 ? 325 CYS D C     1 
ATOM   1545 O  O     . CYS D 1 7   ? -5.991  50.613 -214.970 1.00 31.17 ? 325 CYS D O     1 
ATOM   1546 C  CB    . CYS D 1 7   ? -4.856  50.265 -217.891 1.00 34.06 ? 325 CYS D CB    1 
ATOM   1547 S  SG    . CYS D 1 7   ? -6.356  50.258 -218.896 1.00 34.14 ? 325 CYS D SG    1 
ATOM   1548 N  N     . ALA D 1 8   ? -6.984  52.187 -216.241 1.00 31.14 ? 326 ALA D N     1 
ATOM   1549 C  CA    . ALA D 1 8   ? -8.174  52.293 -215.409 1.00 36.50 ? 326 ALA D CA    1 
ATOM   1550 C  C     . ALA D 1 8   ? -9.270  51.311 -215.800 1.00 38.74 ? 326 ALA D C     1 
ATOM   1551 O  O     . ALA D 1 8   ? -10.307 51.265 -215.128 1.00 39.43 ? 326 ALA D O     1 
ATOM   1552 C  CB    . ALA D 1 8   ? -8.727  53.720 -215.459 1.00 41.49 ? 326 ALA D CB    1 
ATOM   1553 N  N     . TYR D 1 9   ? -9.075  50.534 -216.861 1.00 36.51 ? 327 TYR D N     1 
ATOM   1554 C  CA    . TYR D 1 9   ? -10.086 49.568 -217.260 1.00 40.93 ? 327 TYR D CA    1 
ATOM   1555 C  C     . TYR D 1 9   ? -10.165 48.446 -216.226 1.00 41.82 ? 327 TYR D C     1 
ATOM   1556 O  O     . TYR D 1 9   ? -9.131  47.967 -215.752 1.00 40.68 ? 327 TYR D O     1 
ATOM   1557 C  CB    . TYR D 1 9   ? -9.768  48.997 -218.642 1.00 45.64 ? 327 TYR D CB    1 
ATOM   1558 C  CG    . TYR D 1 9   ? -10.953 48.354 -219.327 1.00 49.13 ? 327 TYR D CG    1 
ATOM   1559 C  CD1   . TYR D 1 9   ? -11.937 49.129 -219.927 1.00 51.11 ? 327 TYR D CD1   1 
ATOM   1560 C  CD2   . TYR D 1 9   ? -11.086 46.972 -219.378 1.00 52.17 ? 327 TYR D CD2   1 
ATOM   1561 C  CE1   . TYR D 1 9   ? -13.022 48.548 -220.555 1.00 57.98 ? 327 TYR D CE1   1 
ATOM   1562 C  CE2   . TYR D 1 9   ? -12.168 46.382 -220.005 1.00 56.96 ? 327 TYR D CE2   1 
ATOM   1563 C  CZ    . TYR D 1 9   ? -13.132 47.174 -220.592 1.00 61.39 ? 327 TYR D CZ    1 
ATOM   1564 O  OH    . TYR D 1 9   ? -14.211 46.590 -221.216 1.00 69.72 ? 327 TYR D OH    1 
ATOM   1565 N  N     . PRO D 1 10  ? -11.371 48.018 -215.851 1.00 48.51 ? 328 PRO D N     1 
ATOM   1566 C  CA    . PRO D 1 10  ? -11.507 47.021 -214.775 1.00 53.18 ? 328 PRO D CA    1 
ATOM   1567 C  C     . PRO D 1 10  ? -10.827 45.707 -215.127 1.00 51.68 ? 328 PRO D C     1 
ATOM   1568 O  O     . PRO D 1 10  ? -11.141 45.072 -216.136 1.00 55.61 ? 328 PRO D O     1 
ATOM   1569 C  CB    . PRO D 1 10  ? -13.026 46.856 -214.642 1.00 53.09 ? 328 PRO D CB    1 
ATOM   1570 C  CG    . PRO D 1 10  ? -13.601 48.115 -215.211 1.00 52.04 ? 328 PRO D CG    1 
ATOM   1571 C  CD    . PRO D 1 10  ? -12.677 48.505 -216.324 1.00 47.82 ? 328 PRO D CD    1 
ATOM   1572 N  N     . GLY D 1 11  ? -9.884  45.302 -214.279 1.00 47.66 ? 329 GLY D N     1 
ATOM   1573 C  CA    . GLY D 1 11  ? -9.241  44.012 -214.420 1.00 50.95 ? 329 GLY D CA    1 
ATOM   1574 C  C     . GLY D 1 11  ? -8.078  43.965 -215.382 1.00 50.70 ? 329 GLY D C     1 
ATOM   1575 O  O     . GLY D 1 11  ? -7.696  42.873 -215.817 1.00 53.81 ? 329 GLY D O     1 
ATOM   1576 N  N     . CYS D 1 12  ? -7.493  45.112 -215.729 1.00 46.03 ? 330 CYS D N     1 
ATOM   1577 C  CA    . CYS D 1 12  ? -6.384  45.152 -216.677 1.00 47.46 ? 330 CYS D CA    1 
ATOM   1578 C  C     . CYS D 1 12  ? -5.036  45.226 -215.965 1.00 47.75 ? 330 CYS D C     1 
ATOM   1579 O  O     . CYS D 1 12  ? -4.163  44.382 -216.189 1.00 44.22 ? 330 CYS D O     1 
ATOM   1580 C  CB    . CYS D 1 12  ? -6.548  46.338 -217.634 1.00 47.18 ? 330 CYS D CB    1 
ATOM   1581 S  SG    . CYS D 1 12  ? -5.242  46.452 -218.872 1.00 41.80 ? 330 CYS D SG    1 
ATOM   1582 N  N     . ASN D 1 13  ? -4.852  46.243 -215.120 1.00 40.21 ? 331 ASN D N     1 
ATOM   1583 C  CA    . ASN D 1 13  ? -3.670  46.422 -214.279 1.00 45.92 ? 331 ASN D CA    1 
ATOM   1584 C  C     . ASN D 1 13  ? -2.392  46.676 -215.070 1.00 43.59 ? 331 ASN D C     1 
ATOM   1585 O  O     . ASN D 1 13  ? -1.294  46.528 -214.524 1.00 44.99 ? 331 ASN D O     1 
ATOM   1586 C  CB    . ASN D 1 13  ? -3.458  45.224 -213.346 1.00 50.33 ? 331 ASN D CB    1 
ATOM   1587 C  CG    . ASN D 1 13  ? -4.483  45.161 -212.233 1.00 59.68 ? 331 ASN D CG    1 
ATOM   1588 O  OD1   . ASN D 1 13  ? -5.608  45.644 -212.371 1.00 60.35 ? 331 ASN D OD1   1 
ATOM   1589 N  ND2   . ASN D 1 13  ? -4.094  44.563 -211.115 1.00 68.90 ? 331 ASN D ND2   1 
ATOM   1590 N  N     . LYS D 1 14  ? -2.502  47.050 -216.343 1.00 35.27 ? 332 LYS D N     1 
ATOM   1591 C  CA    . LYS D 1 14  ? -1.323  47.402 -217.122 1.00 35.96 ? 332 LYS D CA    1 
ATOM   1592 C  C     . LYS D 1 14  ? -0.773  48.754 -216.680 1.00 34.34 ? 332 LYS D C     1 
ATOM   1593 O  O     . LYS D 1 14  ? -1.527  49.705 -216.461 1.00 37.89 ? 332 LYS D O     1 
ATOM   1594 C  CB    . LYS D 1 14  ? -1.661  47.441 -218.610 1.00 39.37 ? 332 LYS D CB    1 
ATOM   1595 C  CG    . LYS D 1 14  ? -1.766  46.080 -219.273 1.00 47.03 ? 332 LYS D CG    1 
ATOM   1596 C  CD    . LYS D 1 14  ? -0.407  45.416 -219.377 1.00 52.13 ? 332 LYS D CD    1 
ATOM   1597 C  CE    . LYS D 1 14  ? -0.335  44.553 -220.619 1.00 60.12 ? 332 LYS D CE    1 
ATOM   1598 N  NZ    . LYS D 1 14  ? -0.716  45.350 -221.816 1.00 66.94 ? 332 LYS D NZ    1 
ATOM   1599 N  N     . ARG D 1 15  ? 0.552   48.840 -216.567 1.00 33.13 ? 333 ARG D N     1 
ATOM   1600 C  CA    . ARG D 1 15  ? 1.227   50.047 -216.114 1.00 31.86 ? 333 ARG D CA    1 
ATOM   1601 C  C     . ARG D 1 15  ? 2.222   50.521 -217.166 1.00 31.61 ? 333 ARG D C     1 
ATOM   1602 O  O     . ARG D 1 15  ? 2.771   49.720 -217.927 1.00 37.00 ? 333 ARG D O     1 
ATOM   1603 C  CB    . ARG D 1 15  ? 1.946   49.814 -214.780 1.00 34.12 ? 333 ARG D CB    1 
ATOM   1604 C  CG    . ARG D 1 15  ? 1.015   49.688 -213.590 1.00 36.02 ? 333 ARG D CG    1 
ATOM   1605 C  CD    . ARG D 1 15  ? 1.800   49.622 -212.292 1.00 39.81 ? 333 ARG D CD    1 
ATOM   1606 N  NE    . ARG D 1 15  ? 0.944   49.838 -211.131 1.00 45.02 ? 333 ARG D NE    1 
ATOM   1607 C  CZ    . ARG D 1 15  ? 0.675   51.033 -210.617 1.00 47.38 ? 333 ARG D CZ    1 
ATOM   1608 N  NH1   . ARG D 1 15  ? 1.201   52.123 -211.159 1.00 43.98 ? 333 ARG D NH1   1 
ATOM   1609 N  NH2   . ARG D 1 15  ? -0.119  51.140 -209.561 1.00 54.11 ? 333 ARG D NH2   1 
ATOM   1610 N  N     . TYR D 1 16  ? 2.452   51.833 -217.199 1.00 29.01 ? 334 TYR D N     1 
ATOM   1611 C  CA    . TYR D 1 16  ? 3.300   52.444 -218.213 1.00 29.91 ? 334 TYR D CA    1 
ATOM   1612 C  C     . TYR D 1 16  ? 4.072   53.606 -217.608 1.00 35.43 ? 334 TYR D C     1 
ATOM   1613 O  O     . TYR D 1 16  ? 3.678   54.180 -216.590 1.00 35.33 ? 334 TYR D O     1 
ATOM   1614 C  CB    . TYR D 1 16  ? 2.480   52.925 -219.418 1.00 29.26 ? 334 TYR D CB    1 
ATOM   1615 C  CG    . TYR D 1 16  ? 1.770   51.804 -220.138 1.00 28.79 ? 334 TYR D CG    1 
ATOM   1616 C  CD1   . TYR D 1 16  ? 2.408   51.086 -221.138 1.00 30.87 ? 334 TYR D CD1   1 
ATOM   1617 C  CD2   . TYR D 1 16  ? 0.466   51.456 -219.809 1.00 26.37 ? 334 TYR D CD2   1 
ATOM   1618 C  CE1   . TYR D 1 16  ? 1.768   50.056 -221.795 1.00 30.05 ? 334 TYR D CE1   1 
ATOM   1619 C  CE2   . TYR D 1 16  ? -0.183  50.426 -220.460 1.00 28.39 ? 334 TYR D CE2   1 
ATOM   1620 C  CZ    . TYR D 1 16  ? 0.473   49.730 -221.453 1.00 31.59 ? 334 TYR D CZ    1 
ATOM   1621 O  OH    . TYR D 1 16  ? -0.166  48.703 -222.106 1.00 34.37 ? 334 TYR D OH    1 
ATOM   1622 N  N     . PHE D 1 17  ? 5.187   53.949 -218.259 1.00 34.35 ? 335 PHE D N     1 
ATOM   1623 C  CA    . PHE D 1 17  ? 6.031   55.043 -217.793 1.00 32.52 ? 335 PHE D CA    1 
ATOM   1624 C  C     . PHE D 1 17  ? 5.469   56.410 -218.161 1.00 33.69 ? 335 PHE D C     1 
ATOM   1625 O  O     . PHE D 1 17  ? 5.703   57.385 -217.439 1.00 33.00 ? 335 PHE D O     1 
ATOM   1626 C  CB    . PHE D 1 17  ? 7.444   54.908 -218.367 1.00 33.29 ? 335 PHE D CB    1 
ATOM   1627 C  CG    . PHE D 1 17  ? 8.195   53.703 -217.872 1.00 44.29 ? 335 PHE D CG    1 
ATOM   1628 C  CD1   . PHE D 1 17  ? 8.711   53.671 -216.587 1.00 51.35 ? 335 PHE D CD1   1 
ATOM   1629 C  CD2   . PHE D 1 17  ? 8.403   52.612 -218.700 1.00 48.01 ? 335 PHE D CD2   1 
ATOM   1630 C  CE1   . PHE D 1 17  ? 9.409   52.567 -216.132 1.00 55.34 ? 335 PHE D CE1   1 
ATOM   1631 C  CE2   . PHE D 1 17  ? 9.101   51.506 -218.250 1.00 50.04 ? 335 PHE D CE2   1 
ATOM   1632 C  CZ    . PHE D 1 17  ? 9.604   51.483 -216.965 1.00 55.13 ? 335 PHE D CZ    1 
ATOM   1633 N  N     . LYS D 1 18  ? 4.745   56.509 -219.273 1.00 30.18 ? 336 LYS D N     1 
ATOM   1634 C  CA    . LYS D 1 18  ? 4.258   57.785 -219.772 1.00 28.16 ? 336 LYS D CA    1 
ATOM   1635 C  C     . LYS D 1 18  ? 2.755   57.718 -219.992 1.00 27.86 ? 336 LYS D C     1 
ATOM   1636 O  O     . LYS D 1 18  ? 2.206   56.662 -220.321 1.00 28.59 ? 336 LYS D O     1 
ATOM   1637 C  CB    . LYS D 1 18  ? 4.959   58.179 -221.083 1.00 31.96 ? 336 LYS D CB    1 
ATOM   1638 C  CG    . LYS D 1 18  ? 6.468   58.314 -220.964 1.00 39.45 ? 336 LYS D CG    1 
ATOM   1639 C  CD    . LYS D 1 18  ? 6.847   59.441 -220.020 1.00 47.04 ? 336 LYS D CD    1 
ATOM   1640 C  CE    . LYS D 1 18  ? 8.351   59.499 -219.812 1.00 54.00 ? 336 LYS D CE    1 
ATOM   1641 N  NZ    . LYS D 1 18  ? 9.086   59.579 -221.104 1.00 55.68 ? 336 LYS D NZ    1 
ATOM   1642 N  N     . LEU D 1 19  ? 2.094   58.864 -219.806 1.00 27.52 ? 337 LEU D N     1 
ATOM   1643 C  CA    . LEU D 1 19  ? 0.651   58.928 -220.009 1.00 26.56 ? 337 LEU D CA    1 
ATOM   1644 C  C     . LEU D 1 19  ? 0.286   58.671 -221.467 1.00 24.73 ? 337 LEU D C     1 
ATOM   1645 O  O     . LEU D 1 19  ? -0.756  58.072 -221.758 1.00 24.60 ? 337 LEU D O     1 
ATOM   1646 C  CB    . LEU D 1 19  ? 0.119   60.287 -219.552 1.00 27.62 ? 337 LEU D CB    1 
ATOM   1647 C  CG    . LEU D 1 19  ? -1.397  60.484 -219.585 1.00 33.18 ? 337 LEU D CG    1 
ATOM   1648 C  CD1   . LEU D 1 19  ? -2.081  59.415 -218.750 1.00 42.87 ? 337 LEU D CD1   1 
ATOM   1649 C  CD2   . LEU D 1 19  ? -1.771  61.875 -219.088 1.00 38.95 ? 337 LEU D CD2   1 
ATOM   1650 N  N     . SER D 1 20  ? 1.137   59.113 -222.396 1.00 23.79 ? 338 SER D N     1 
ATOM   1651 C  CA    . SER D 1 20  ? 0.866   58.892 -223.813 1.00 23.19 ? 338 SER D CA    1 
ATOM   1652 C  C     . SER D 1 20  ? 0.888   57.408 -224.156 1.00 25.57 ? 338 SER D C     1 
ATOM   1653 O  O     . SER D 1 20  ? 0.109   56.945 -224.997 1.00 22.92 ? 338 SER D O     1 
ATOM   1654 C  CB    . SER D 1 20  ? 1.879   59.654 -224.666 1.00 23.31 ? 338 SER D CB    1 
ATOM   1655 O  OG    . SER D 1 20  ? 3.195   59.182 -224.432 1.00 26.65 ? 338 SER D OG    1 
ATOM   1656 N  N     . HIS D 1 21  ? 1.779   56.646 -223.516 1.00 22.59 ? 339 HIS D N     1 
ATOM   1657 C  CA    . HIS D 1 21  ? 1.814   55.203 -223.736 1.00 23.19 ? 339 HIS D CA    1 
ATOM   1658 C  C     . HIS D 1 21  ? 0.518   54.554 -223.267 1.00 23.50 ? 339 HIS D C     1 
ATOM   1659 O  O     . HIS D 1 21  ? -0.050  53.699 -223.957 1.00 23.36 ? 339 HIS D O     1 
ATOM   1660 C  CB    . HIS D 1 21  ? 3.016   54.590 -223.013 1.00 25.87 ? 339 HIS D CB    1 
ATOM   1661 C  CG    . HIS D 1 21  ? 4.328   55.211 -223.379 1.00 25.46 ? 339 HIS D CG    1 
ATOM   1662 N  ND1   . HIS D 1 21  ? 5.475   55.018 -222.639 1.00 27.72 ? 339 HIS D ND1   1 
ATOM   1663 C  CD2   . HIS D 1 21  ? 4.677   56.021 -224.407 1.00 27.87 ? 339 HIS D CD2   1 
ATOM   1664 C  CE1   . HIS D 1 21  ? 6.472   55.684 -223.193 1.00 31.49 ? 339 HIS D CE1   1 
ATOM   1665 N  NE2   . HIS D 1 21  ? 6.015   56.301 -224.267 1.00 28.82 ? 339 HIS D NE2   1 
ATOM   1666 N  N     . LEU D 1 22  ? 0.032   54.958 -222.091 1.00 22.56 ? 340 LEU D N     1 
ATOM   1667 C  CA    . LEU D 1 22  ? -1.224  54.419 -221.579 1.00 21.88 ? 340 LEU D CA    1 
ATOM   1668 C  C     . LEU D 1 22  ? -2.399  54.838 -222.453 1.00 22.65 ? 340 LEU D C     1 
ATOM   1669 O  O     . LEU D 1 22  ? -3.330  54.053 -222.673 1.00 23.24 ? 340 LEU D O     1 
ATOM   1670 C  CB    . LEU D 1 22  ? -1.436  54.877 -220.137 1.00 23.02 ? 340 LEU D CB    1 
ATOM   1671 C  CG    . LEU D 1 22  ? -2.777  54.499 -219.510 1.00 23.67 ? 340 LEU D CG    1 
ATOM   1672 C  CD1   . LEU D 1 22  ? -2.952  52.990 -219.523 1.00 25.35 ? 340 LEU D CD1   1 
ATOM   1673 C  CD2   . LEU D 1 22  ? -2.884  55.049 -218.098 1.00 23.76 ? 340 LEU D CD2   1 
ATOM   1674 N  N     . GLN D 1 23  ? -2.371  56.073 -222.960 1.00 22.51 ? 341 GLN D N     1 
ATOM   1675 C  CA    . GLN D 1 23  ? -3.451  56.554 -223.815 1.00 25.14 ? 341 GLN D CA    1 
ATOM   1676 C  C     . GLN D 1 23  ? -3.609  55.677 -225.051 1.00 25.76 ? 341 GLN D C     1 
ATOM   1677 O  O     . GLN D 1 23  ? -4.733  55.358 -225.457 1.00 26.38 ? 341 GLN D O     1 
ATOM   1678 C  CB    . GLN D 1 23  ? -3.190  58.005 -224.216 1.00 31.71 ? 341 GLN D CB    1 
ATOM   1679 C  CG    . GLN D 1 23  ? -4.286  58.617 -225.070 1.00 46.21 ? 341 GLN D CG    1 
ATOM   1680 C  CD    . GLN D 1 23  ? -5.612  58.702 -224.341 1.00 64.93 ? 341 GLN D CD    1 
ATOM   1681 O  OE1   . GLN D 1 23  ? -5.723  59.358 -223.305 1.00 69.95 ? 341 GLN D OE1   1 
ATOM   1682 N  NE2   . GLN D 1 23  ? -6.626  58.034 -224.879 1.00 71.08 ? 341 GLN D NE2   1 
ATOM   1683 N  N     . MET D 1 24  ? -2.493  55.271 -225.661 1.00 22.22 ? 342 MET D N     1 
ATOM   1684 C  CA    . MET D 1 24  ? -2.567  54.389 -226.821 1.00 21.93 ? 342 MET D CA    1 
ATOM   1685 C  C     . MET D 1 24  ? -3.038  52.994 -226.425 1.00 24.15 ? 342 MET D C     1 
ATOM   1686 O  O     . MET D 1 24  ? -3.837  52.379 -227.140 1.00 26.76 ? 342 MET D O     1 
ATOM   1687 C  CB    . MET D 1 24  ? -1.207  54.326 -227.519 1.00 21.69 ? 342 MET D CB    1 
ATOM   1688 C  CG    . MET D 1 24  ? -0.803  55.628 -228.196 1.00 20.89 ? 342 MET D CG    1 
ATOM   1689 S  SD    . MET D 1 24  ? 0.754   55.510 -229.099 1.00 21.91 ? 342 MET D SD    1 
ATOM   1690 C  CE    . MET D 1 24  ? 1.919   55.301 -227.755 1.00 23.96 ? 342 MET D CE    1 
ATOM   1691 N  N     . HIS D 1 25  ? -2.561  52.483 -225.288 1.00 25.06 ? 343 HIS D N     1 
ATOM   1692 C  CA    . HIS D 1 25  ? -2.983  51.160 -224.836 1.00 25.42 ? 343 HIS D CA    1 
ATOM   1693 C  C     . HIS D 1 25  ? -4.480  51.111 -224.563 1.00 25.68 ? 343 HIS D C     1 
ATOM   1694 O  O     . HIS D 1 25  ? -5.149  50.129 -224.905 1.00 28.91 ? 343 HIS D O     1 
ATOM   1695 C  CB    . HIS D 1 25  ? -2.212  50.760 -223.579 1.00 24.72 ? 343 HIS D CB    1 
ATOM   1696 C  CG    . HIS D 1 25  ? -2.920  49.744 -222.738 1.00 28.24 ? 343 HIS D CG    1 
ATOM   1697 N  ND1   . HIS D 1 25  ? -2.875  48.393 -223.007 1.00 29.70 ? 343 HIS D ND1   1 
ATOM   1698 C  CD2   . HIS D 1 25  ? -3.700  49.883 -221.639 1.00 30.65 ? 343 HIS D CD2   1 
ATOM   1699 C  CE1   . HIS D 1 25  ? -3.591  47.743 -222.106 1.00 29.82 ? 343 HIS D CE1   1 
ATOM   1700 N  NE2   . HIS D 1 25  ? -4.103  48.624 -221.266 1.00 28.17 ? 343 HIS D NE2   1 
ATOM   1701 N  N     . SER D 1 26  ? -5.024  52.164 -223.945 1.00 25.70 ? 344 SER D N     1 
ATOM   1702 C  CA    . SER D 1 26  ? -6.409  52.132 -223.489 1.00 30.59 ? 344 SER D CA    1 
ATOM   1703 C  C     . SER D 1 26  ? -7.401  52.002 -224.638 1.00 30.67 ? 344 SER D C     1 
ATOM   1704 O  O     . SER D 1 26  ? -8.527  51.540 -224.420 1.00 33.64 ? 344 SER D O     1 
ATOM   1705 C  CB    . SER D 1 26  ? -6.720  53.388 -222.671 1.00 36.81 ? 344 SER D CB    1 
ATOM   1706 O  OG    . SER D 1 26  ? -6.608  54.556 -223.466 1.00 45.28 ? 344 SER D OG    1 
ATOM   1707 N  N     . ARG D 1 27  ? -7.014  52.393 -225.855 1.00 29.90 ? 345 ARG D N     1 
ATOM   1708 C  CA    . ARG D 1 27  ? -7.934  52.313 -226.984 1.00 30.74 ? 345 ARG D CA    1 
ATOM   1709 C  C     . ARG D 1 27  ? -8.269  50.876 -227.362 1.00 34.28 ? 345 ARG D C     1 
ATOM   1710 O  O     . ARG D 1 27  ? -9.268  50.648 -228.053 1.00 37.25 ? 345 ARG D O     1 
ATOM   1711 C  CB    . ARG D 1 27  ? -7.352  53.054 -228.189 1.00 31.99 ? 345 ARG D CB    1 
ATOM   1712 C  CG    . ARG D 1 27  ? -7.125  54.536 -227.940 1.00 35.58 ? 345 ARG D CG    1 
ATOM   1713 C  CD    . ARG D 1 27  ? -6.897  55.290 -229.239 1.00 36.31 ? 345 ARG D CD    1 
ATOM   1714 N  NE    . ARG D 1 27  ? -6.678  56.715 -229.012 1.00 37.19 ? 345 ARG D NE    1 
ATOM   1715 C  CZ    . ARG D 1 27  ? -5.480  57.290 -228.964 1.00 34.82 ? 345 ARG D CZ    1 
ATOM   1716 N  NH1   . ARG D 1 27  ? -4.384  56.563 -229.134 1.00 34.47 ? 345 ARG D NH1   1 
ATOM   1717 N  NH2   . ARG D 1 27  ? -5.379  58.595 -228.750 1.00 37.53 ? 345 ARG D NH2   1 
ATOM   1718 N  N     . LYS D 1 28  ? -7.466  49.904 -226.922 1.00 32.65 ? 346 LYS D N     1 
ATOM   1719 C  CA    . LYS D 1 28  ? -7.772  48.507 -227.201 1.00 35.71 ? 346 LYS D CA    1 
ATOM   1720 C  C     . LYS D 1 28  ? -9.024  48.039 -226.471 1.00 38.80 ? 346 LYS D C     1 
ATOM   1721 O  O     . LYS D 1 28  ? -9.616  47.028 -226.865 1.00 40.00 ? 346 LYS D O     1 
ATOM   1722 C  CB    . LYS D 1 28  ? -6.585  47.620 -226.815 1.00 38.38 ? 346 LYS D CB    1 
ATOM   1723 C  CG    . LYS D 1 28  ? -6.563  47.216 -225.347 1.00 41.12 ? 346 LYS D CG    1 
ATOM   1724 C  CD    . LYS D 1 28  ? -5.205  46.674 -224.928 1.00 47.20 ? 346 LYS D CD    1 
ATOM   1725 C  CE    . LYS D 1 28  ? -4.808  45.447 -225.731 1.00 59.14 ? 346 LYS D CE    1 
ATOM   1726 N  NZ    . LYS D 1 28  ? -3.482  44.923 -225.300 1.00 62.12 ? 346 LYS D NZ    1 
ATOM   1727 N  N     . HIS D 1 29  ? -9.440  48.750 -225.421 1.00 38.53 ? 347 HIS D N     1 
ATOM   1728 C  CA    . HIS D 1 29  ? -10.612 48.365 -224.647 1.00 42.07 ? 347 HIS D CA    1 
ATOM   1729 C  C     . HIS D 1 29  ? -11.912 48.906 -225.221 1.00 46.72 ? 347 HIS D C     1 
ATOM   1730 O  O     . HIS D 1 29  ? -12.986 48.422 -224.846 1.00 52.16 ? 347 HIS D O     1 
ATOM   1731 C  CB    . HIS D 1 29  ? -10.470 48.846 -223.200 1.00 36.50 ? 347 HIS D CB    1 
ATOM   1732 C  CG    . HIS D 1 29  ? -9.309  48.244 -222.471 1.00 36.95 ? 347 HIS D CG    1 
ATOM   1733 N  ND1   . HIS D 1 29  ? -9.162  46.885 -222.299 1.00 39.00 ? 347 HIS D ND1   1 
ATOM   1734 C  CD2   . HIS D 1 29  ? -8.246  48.818 -221.859 1.00 35.88 ? 347 HIS D CD2   1 
ATOM   1735 C  CE1   . HIS D 1 29  ? -8.055  46.646 -221.618 1.00 39.81 ? 347 HIS D CE1   1 
ATOM   1736 N  NE2   . HIS D 1 29  ? -7.482  47.802 -221.338 1.00 40.02 ? 347 HIS D NE2   1 
ATOM   1737 N  N     . THR D 1 30  ? -11.846 49.891 -226.110 1.00 50.23 ? 348 THR D N     1 
ATOM   1738 C  CA    . THR D 1 30  ? -13.053 50.467 -226.678 1.00 49.88 ? 348 THR D CA    1 
ATOM   1739 C  C     . THR D 1 30  ? -13.669 49.518 -227.702 1.00 55.44 ? 348 THR D C     1 
ATOM   1740 O  O     . THR D 1 30  ? -13.019 48.601 -228.211 1.00 58.18 ? 348 THR D O     1 
ATOM   1741 C  CB    . THR D 1 30  ? -12.757 51.821 -227.324 1.00 51.61 ? 348 THR D CB    1 
ATOM   1742 O  OG1   . THR D 1 30  ? -11.819 51.647 -228.392 1.00 53.72 ? 348 THR D OG1   1 
ATOM   1743 C  CG2   . THR D 1 30  ? -12.178 52.785 -226.297 1.00 57.56 ? 348 THR D CG2   1 
ATOM   1744 N  N     . GLY D 1 31  ? -14.944 49.753 -227.998 1.00 57.53 ? 349 GLY D N     1 
ATOM   1745 C  CA    . GLY D 1 31  ? -15.660 48.879 -228.910 1.00 59.22 ? 349 GLY D CA    1 
ATOM   1746 C  C     . GLY D 1 31  ? -15.123 48.979 -230.327 1.00 58.79 ? 349 GLY D C     1 
ATOM   1747 O  O     . GLY D 1 31  ? -14.739 50.051 -230.799 1.00 57.56 ? 349 GLY D O     1 
ATOM   1748 N  N     . GLU D 1 32  ? -15.102 47.840 -231.013 1.00 57.64 ? 350 GLU D N     1 
ATOM   1749 C  CA    . GLU D 1 32  ? -14.583 47.785 -232.370 1.00 54.49 ? 350 GLU D CA    1 
ATOM   1750 C  C     . GLU D 1 32  ? -15.555 48.439 -233.351 1.00 48.16 ? 350 GLU D C     1 
ATOM   1751 O  O     . GLU D 1 32  ? -16.747 48.604 -233.078 1.00 41.39 ? 350 GLU D O     1 
ATOM   1752 C  CB    . GLU D 1 32  ? -14.321 46.337 -232.785 1.00 54.04 ? 350 GLU D CB    1 
ATOM   1753 N  N     . LYS D 1 33  ? -15.019 48.817 -234.515 1.00 41.08 ? 351 LYS D N     1 
ATOM   1754 C  CA    . LYS D 1 33  ? -15.795 49.363 -235.626 1.00 32.75 ? 351 LYS D CA    1 
ATOM   1755 C  C     . LYS D 1 33  ? -15.515 48.496 -236.848 1.00 34.73 ? 351 LYS D C     1 
ATOM   1756 O  O     . LYS D 1 33  ? -14.701 48.861 -237.710 1.00 36.96 ? 351 LYS D O     1 
ATOM   1757 C  CB    . LYS D 1 33  ? -15.449 50.827 -235.891 1.00 28.52 ? 351 LYS D CB    1 
ATOM   1758 C  CG    . LYS D 1 33  ? -15.808 51.771 -234.753 1.00 33.84 ? 351 LYS D CG    1 
ATOM   1759 C  CD    . LYS D 1 33  ? -15.461 53.209 -235.103 1.00 37.80 ? 351 LYS D CD    1 
ATOM   1760 C  CE    . LYS D 1 33  ? -15.862 54.159 -233.987 1.00 46.71 ? 351 LYS D CE    1 
ATOM   1761 N  NZ    . LYS D 1 33  ? -15.517 55.571 -234.310 1.00 50.62 ? 351 LYS D NZ    1 
ATOM   1762 N  N     . PRO D 1 34  ? -16.172 47.338 -236.957 1.00 34.79 ? 352 PRO D N     1 
ATOM   1763 C  CA    . PRO D 1 34  ? -15.826 46.386 -238.021 1.00 35.14 ? 352 PRO D CA    1 
ATOM   1764 C  C     . PRO D 1 34  ? -16.389 46.729 -239.391 1.00 29.83 ? 352 PRO D C     1 
ATOM   1765 O  O     . PRO D 1 34  ? -16.013 46.070 -240.370 1.00 33.95 ? 352 PRO D O     1 
ATOM   1766 C  CB    . PRO D 1 34  ? -16.423 45.070 -237.506 1.00 38.78 ? 352 PRO D CB    1 
ATOM   1767 C  CG    . PRO D 1 34  ? -17.604 45.504 -236.705 1.00 39.89 ? 352 PRO D CG    1 
ATOM   1768 C  CD    . PRO D 1 34  ? -17.216 46.812 -236.058 1.00 37.99 ? 352 PRO D CD    1 
ATOM   1769 N  N     . TYR D 1 35  ? -17.268 47.721 -239.501 1.00 26.42 ? 353 TYR D N     1 
ATOM   1770 C  CA    . TYR D 1 35  ? -17.925 48.050 -240.765 1.00 25.34 ? 353 TYR D CA    1 
ATOM   1771 C  C     . TYR D 1 35  ? -17.244 49.276 -241.361 1.00 28.01 ? 353 TYR D C     1 
ATOM   1772 O  O     . TYR D 1 35  ? -17.461 50.404 -240.910 1.00 29.28 ? 353 TYR D O     1 
ATOM   1773 C  CB    . TYR D 1 35  ? -19.418 48.274 -240.552 1.00 26.15 ? 353 TYR D CB    1 
ATOM   1774 C  CG    . TYR D 1 35  ? -20.120 47.060 -239.990 1.00 28.85 ? 353 TYR D CG    1 
ATOM   1775 C  CD1   . TYR D 1 35  ? -20.467 45.995 -240.810 1.00 32.83 ? 353 TYR D CD1   1 
ATOM   1776 C  CD2   . TYR D 1 35  ? -20.426 46.972 -238.638 1.00 30.79 ? 353 TYR D CD2   1 
ATOM   1777 C  CE1   . TYR D 1 35  ? -21.102 44.878 -240.302 1.00 33.30 ? 353 TYR D CE1   1 
ATOM   1778 C  CE2   . TYR D 1 35  ? -21.063 45.860 -238.120 1.00 33.00 ? 353 TYR D CE2   1 
ATOM   1779 C  CZ    . TYR D 1 35  ? -21.399 44.816 -238.957 1.00 34.09 ? 353 TYR D CZ    1 
ATOM   1780 O  OH    . TYR D 1 35  ? -22.033 43.706 -238.448 1.00 40.35 ? 353 TYR D OH    1 
ATOM   1781 N  N     . GLN D 1 36  ? -16.420 49.052 -242.380 1.00 24.16 ? 354 GLN D N     1 
ATOM   1782 C  CA    . GLN D 1 36  ? -15.654 50.113 -243.016 1.00 24.99 ? 354 GLN D CA    1 
ATOM   1783 C  C     . GLN D 1 36  ? -16.263 50.466 -244.367 1.00 25.54 ? 354 GLN D C     1 
ATOM   1784 O  O     . GLN D 1 36  ? -16.724 49.588 -245.102 1.00 25.68 ? 354 GLN D O     1 
ATOM   1785 C  CB    . GLN D 1 36  ? -14.191 49.698 -243.194 1.00 28.66 ? 354 GLN D CB    1 
ATOM   1786 C  CG    . GLN D 1 36  ? -13.292 50.805 -243.725 1.00 36.45 ? 354 GLN D CG    1 
ATOM   1787 C  CD    . GLN D 1 36  ? -11.823 50.434 -243.683 1.00 44.11 ? 354 GLN D CD    1 
ATOM   1788 O  OE1   . GLN D 1 36  ? -11.464 49.260 -243.773 1.00 48.20 ? 354 GLN D OE1   1 
ATOM   1789 N  NE2   . GLN D 1 36  ? -10.965 51.437 -243.537 1.00 46.50 ? 354 GLN D NE2   1 
ATOM   1790 N  N     . CYS D 1 37  ? -16.263 51.757 -244.685 1.00 23.93 ? 355 CYS D N     1 
ATOM   1791 C  CA    . CYS D 1 37  ? -16.786 52.226 -245.959 1.00 20.98 ? 355 CYS D CA    1 
ATOM   1792 C  C     . CYS D 1 37  ? -15.793 51.923 -247.074 1.00 25.03 ? 355 CYS D C     1 
ATOM   1793 O  O     . CYS D 1 37  ? -14.597 52.201 -246.946 1.00 26.67 ? 355 CYS D O     1 
ATOM   1794 C  CB    . CYS D 1 37  ? -17.073 53.724 -245.896 1.00 21.07 ? 355 CYS D CB    1 
ATOM   1795 S  SG    . CYS D 1 37  ? -17.803 54.390 -247.402 1.00 20.94 ? 355 CYS D SG    1 
ATOM   1796 N  N     . ASP D 1 38  ? -16.293 51.355 -248.170 1.00 20.64 ? 356 ASP D N     1 
ATOM   1797 C  CA    . ASP D 1 38  ? -15.460 50.960 -249.296 1.00 21.43 ? 356 ASP D CA    1 
ATOM   1798 C  C     . ASP D 1 38  ? -15.588 51.909 -250.479 1.00 23.27 ? 356 ASP D C     1 
ATOM   1799 O  O     . ASP D 1 38  ? -15.150 51.572 -251.583 1.00 24.57 ? 356 ASP D O     1 
ATOM   1800 C  CB    . ASP D 1 38  ? -15.797 49.528 -249.717 1.00 29.40 ? 356 ASP D CB    1 
ATOM   1801 C  CG    . ASP D 1 38  ? -17.265 49.350 -250.059 1.00 39.69 ? 356 ASP D CG    1 
ATOM   1802 O  OD1   . ASP D 1 38  ? -17.626 48.281 -250.594 1.00 43.81 ? 356 ASP D OD1   1 
ATOM   1803 O  OD2   . ASP D 1 38  ? -18.058 50.281 -249.804 1.00 40.73 ? 356 ASP D OD2   1 
ATOM   1804 N  N     . PHE D 1 39  ? -16.178 53.082 -250.272 1.00 20.61 ? 357 PHE D N     1 
ATOM   1805 C  CA    . PHE D 1 39  ? -16.191 54.111 -251.299 1.00 21.93 ? 357 PHE D CA    1 
ATOM   1806 C  C     . PHE D 1 39  ? -14.792 54.695 -251.466 1.00 27.03 ? 357 PHE D C     1 
ATOM   1807 O  O     . PHE D 1 39  ? -14.007 54.760 -250.516 1.00 29.74 ? 357 PHE D O     1 
ATOM   1808 C  CB    . PHE D 1 39  ? -17.192 55.209 -250.938 1.00 21.37 ? 357 PHE D CB    1 
ATOM   1809 C  CG    . PHE D 1 39  ? -17.613 56.056 -252.106 1.00 26.86 ? 357 PHE D CG    1 
ATOM   1810 C  CD1   . PHE D 1 39  ? -18.566 55.597 -252.999 1.00 26.01 ? 357 PHE D CD1   1 
ATOM   1811 C  CD2   . PHE D 1 39  ? -17.071 57.317 -252.302 1.00 29.26 ? 357 PHE D CD2   1 
ATOM   1812 C  CE1   . PHE D 1 39  ? -18.964 56.371 -254.071 1.00 27.62 ? 357 PHE D CE1   1 
ATOM   1813 C  CE2   . PHE D 1 39  ? -17.466 58.098 -253.373 1.00 30.04 ? 357 PHE D CE2   1 
ATOM   1814 C  CZ    . PHE D 1 39  ? -18.414 57.622 -254.258 1.00 29.10 ? 357 PHE D CZ    1 
ATOM   1815 N  N     . LYS D 1 40  ? -14.482 55.115 -252.691 1.00 23.73 ? 358 LYS D N     1 
ATOM   1816 C  CA    . LYS D 1 40  ? -13.134 55.567 -253.015 1.00 26.94 ? 358 LYS D CA    1 
ATOM   1817 C  C     . LYS D 1 40  ? -12.698 56.715 -252.112 1.00 26.89 ? 358 LYS D C     1 
ATOM   1818 O  O     . LYS D 1 40  ? -13.415 57.708 -251.956 1.00 30.36 ? 358 LYS D O     1 
ATOM   1819 C  CB    . LYS D 1 40  ? -13.070 55.996 -254.480 1.00 27.88 ? 358 LYS D CB    1 
ATOM   1820 C  CG    . LYS D 1 40  ? -11.753 56.633 -254.888 1.00 34.09 ? 358 LYS D CG    1 
ATOM   1821 C  CD    . LYS D 1 40  ? -11.806 57.121 -256.328 1.00 37.06 ? 358 LYS D CD    1 
ATOM   1822 C  CE    . LYS D 1 40  ? -10.556 57.900 -256.692 1.00 42.22 ? 358 LYS D CE    1 
ATOM   1823 N  NZ    . LYS D 1 40  ? -10.627 58.445 -258.075 1.00 50.54 ? 358 LYS D NZ    1 
ATOM   1824 N  N     . ASP D 1 41  ? -11.517 56.562 -251.510 1.00 29.75 ? 359 ASP D N     1 
ATOM   1825 C  CA    . ASP D 1 41  ? -10.843 57.552 -250.669 1.00 33.24 ? 359 ASP D CA    1 
ATOM   1826 C  C     . ASP D 1 41  ? -11.563 57.831 -249.355 1.00 30.25 ? 359 ASP D C     1 
ATOM   1827 O  O     . ASP D 1 41  ? -11.170 58.754 -248.632 1.00 35.12 ? 359 ASP D O     1 
ATOM   1828 C  CB    . ASP D 1 41  ? -10.618 58.875 -251.412 1.00 36.70 ? 359 ASP D CB    1 
ATOM   1829 C  CG    . ASP D 1 41  ? -9.669  58.729 -252.585 1.00 40.21 ? 359 ASP D CG    1 
ATOM   1830 O  OD1   . ASP D 1 41  ? -8.759  57.875 -252.511 1.00 42.73 ? 359 ASP D OD1   1 
ATOM   1831 O  OD2   . ASP D 1 41  ? -9.832  59.466 -253.581 1.00 43.89 ? 359 ASP D OD2   1 
ATOM   1832 N  N     . CYS D 1 42  ? -12.596 57.066 -249.014 1.00 25.38 ? 360 CYS D N     1 
ATOM   1833 C  CA    . CYS D 1 42  ? -13.257 57.189 -247.721 1.00 28.84 ? 360 CYS D CA    1 
ATOM   1834 C  C     . CYS D 1 42  ? -12.798 56.056 -246.814 1.00 31.72 ? 360 CYS D C     1 
ATOM   1835 O  O     . CYS D 1 42  ? -12.862 54.882 -247.196 1.00 42.11 ? 360 CYS D O     1 
ATOM   1836 C  CB    . CYS D 1 42  ? -14.779 57.166 -247.864 1.00 29.04 ? 360 CYS D CB    1 
ATOM   1837 S  SG    . CYS D 1 42  ? -15.656 57.440 -246.300 1.00 25.85 ? 360 CYS D SG    1 
ATOM   1838 N  N     . GLU D 1 43  ? -12.334 56.410 -245.618 1.00 32.76 ? 361 GLU D N     1 
ATOM   1839 C  CA    . GLU D 1 43  ? -11.815 55.441 -244.663 1.00 37.98 ? 361 GLU D CA    1 
ATOM   1840 C  C     . GLU D 1 43  ? -12.662 55.349 -243.401 1.00 29.92 ? 361 GLU D C     1 
ATOM   1841 O  O     . GLU D 1 43  ? -12.196 54.803 -242.395 1.00 38.52 ? 361 GLU D O     1 
ATOM   1842 C  CB    . GLU D 1 43  ? -10.369 55.785 -244.299 1.00 45.63 ? 361 GLU D CB    1 
ATOM   1843 N  N     . ARG D 1 44  ? -13.890 55.863 -243.427 1.00 27.48 ? 362 ARG D N     1 
ATOM   1844 C  CA    . ARG D 1 44  ? -14.723 55.868 -242.232 1.00 25.36 ? 362 ARG D CA    1 
ATOM   1845 C  C     . ARG D 1 44  ? -15.107 54.451 -241.827 1.00 29.08 ? 362 ARG D C     1 
ATOM   1846 O  O     . ARG D 1 44  ? -15.396 53.598 -242.671 1.00 29.82 ? 362 ARG D O     1 
ATOM   1847 C  CB    . ARG D 1 44  ? -15.985 56.700 -242.456 1.00 30.42 ? 362 ARG D CB    1 
ATOM   1848 C  CG    . ARG D 1 44  ? -15.784 58.201 -242.334 1.00 43.59 ? 362 ARG D CG    1 
ATOM   1849 C  CD    . ARG D 1 44  ? -17.044 58.871 -241.800 1.00 47.37 ? 362 ARG D CD    1 
ATOM   1850 N  NE    . ARG D 1 44  ? -17.184 58.707 -240.355 1.00 47.29 ? 362 ARG D NE    1 
ATOM   1851 C  CZ    . ARG D 1 44  ? -17.039 59.692 -239.473 1.00 45.33 ? 362 ARG D CZ    1 
ATOM   1852 N  NH1   . ARG D 1 44  ? -16.760 60.921 -239.887 1.00 43.92 ? 362 ARG D NH1   1 
ATOM   1853 N  NH2   . ARG D 1 44  ? -17.181 59.452 -238.176 1.00 41.57 ? 362 ARG D NH2   1 
ATOM   1854 N  N     . ARG D 1 45  ? -15.109 54.208 -240.519 1.00 27.45 ? 363 ARG D N     1 
ATOM   1855 C  CA    . ARG D 1 45  ? -15.514 52.936 -239.944 1.00 25.92 ? 363 ARG D CA    1 
ATOM   1856 C  C     . ARG D 1 45  ? -16.648 53.172 -238.956 1.00 24.93 ? 363 ARG D C     1 
ATOM   1857 O  O     . ARG D 1 45  ? -16.739 54.237 -238.338 1.00 29.56 ? 363 ARG D O     1 
ATOM   1858 C  CB    . ARG D 1 45  ? -14.340 52.246 -239.240 1.00 32.42 ? 363 ARG D CB    1 
ATOM   1859 C  CG    . ARG D 1 45  ? -13.078 52.154 -240.084 1.00 41.04 ? 363 ARG D CG    1 
ATOM   1860 C  CD    . ARG D 1 45  ? -11.969 51.441 -239.331 1.00 45.40 ? 363 ARG D CD    1 
ATOM   1861 N  NE    . ARG D 1 45  ? -12.336 50.066 -239.004 1.00 51.74 ? 363 ARG D NE    1 
ATOM   1862 C  CZ    . ARG D 1 45  ? -12.012 49.009 -239.743 1.00 53.92 ? 363 ARG D CZ    1 
ATOM   1863 N  NH1   . ARG D 1 45  ? -11.305 49.163 -240.854 1.00 54.58 ? 363 ARG D NH1   1 
ATOM   1864 N  NH2   . ARG D 1 45  ? -12.393 47.796 -239.367 1.00 55.78 ? 363 ARG D NH2   1 
ATOM   1865 N  N     . PHE D 1 46  ? -17.516 52.172 -238.810 1.00 24.34 ? 364 PHE D N     1 
ATOM   1866 C  CA    . PHE D 1 46  ? -18.696 52.305 -237.968 1.00 24.09 ? 364 PHE D CA    1 
ATOM   1867 C  C     . PHE D 1 46  ? -18.881 51.053 -237.124 1.00 28.02 ? 364 PHE D C     1 
ATOM   1868 O  O     . PHE D 1 46  ? -18.473 49.955 -237.511 1.00 25.00 ? 364 PHE D O     1 
ATOM   1869 C  CB    . PHE D 1 46  ? -19.952 52.570 -238.810 1.00 20.98 ? 364 PHE D CB    1 
ATOM   1870 C  CG    . PHE D 1 46  ? -19.902 53.862 -239.571 1.00 22.03 ? 364 PHE D CG    1 
ATOM   1871 C  CD1   . PHE D 1 46  ? -20.396 55.029 -239.012 1.00 22.99 ? 364 PHE D CD1   1 
ATOM   1872 C  CD2   . PHE D 1 46  ? -19.347 53.915 -240.840 1.00 23.55 ? 364 PHE D CD2   1 
ATOM   1873 C  CE1   . PHE D 1 46  ? -20.343 56.222 -239.706 1.00 25.42 ? 364 PHE D CE1   1 
ATOM   1874 C  CE2   . PHE D 1 46  ? -19.293 55.106 -241.537 1.00 24.67 ? 364 PHE D CE2   1 
ATOM   1875 C  CZ    . PHE D 1 46  ? -19.789 56.261 -240.968 1.00 27.50 ? 364 PHE D CZ    1 
ATOM   1876 N  N     . SER D 1 47  ? -19.509 51.234 -235.960 1.00 26.04 ? 365 SER D N     1 
ATOM   1877 C  CA    . SER D 1 47  ? -19.736 50.111 -235.058 1.00 26.70 ? 365 SER D CA    1 
ATOM   1878 C  C     . SER D 1 47  ? -20.831 49.185 -235.569 1.00 26.56 ? 365 SER D C     1 
ATOM   1879 O  O     . SER D 1 47  ? -20.790 47.977 -235.307 1.00 27.66 ? 365 SER D O     1 
ATOM   1880 C  CB    . SER D 1 47  ? -20.091 50.621 -233.661 1.00 32.40 ? 365 SER D CB    1 
ATOM   1881 O  OG    . SER D 1 47  ? -19.045 51.413 -233.129 1.00 38.98 ? 365 SER D OG    1 
ATOM   1882 N  N     . ARG D 1 48  ? -21.815 49.722 -236.287 1.00 23.61 ? 366 ARG D N     1 
ATOM   1883 C  CA    . ARG D 1 48  ? -22.960 48.948 -236.743 1.00 23.82 ? 366 ARG D CA    1 
ATOM   1884 C  C     . ARG D 1 48  ? -23.144 49.134 -238.242 1.00 24.62 ? 366 ARG D C     1 
ATOM   1885 O  O     . ARG D 1 48  ? -22.809 50.183 -238.801 1.00 23.48 ? 366 ARG D O     1 
ATOM   1886 C  CB    . ARG D 1 48  ? -24.240 49.353 -235.996 1.00 24.98 ? 366 ARG D CB    1 
ATOM   1887 C  CG    . ARG D 1 48  ? -24.008 49.699 -234.532 1.00 28.81 ? 366 ARG D CG    1 
ATOM   1888 C  CD    . ARG D 1 48  ? -25.301 49.761 -233.737 1.00 32.71 ? 366 ARG D CD    1 
ATOM   1889 N  NE    . ARG D 1 48  ? -26.326 50.565 -234.394 1.00 23.74 ? 366 ARG D NE    1 
ATOM   1890 C  CZ    . ARG D 1 48  ? -27.340 51.143 -233.758 1.00 24.54 ? 366 ARG D CZ    1 
ATOM   1891 N  NH1   . ARG D 1 48  ? -27.457 51.020 -232.442 1.00 22.66 ? 366 ARG D NH1   1 
ATOM   1892 N  NH2   . ARG D 1 48  ? -28.232 51.854 -234.434 1.00 23.19 ? 366 ARG D NH2   1 
ATOM   1893 N  N     . SER D 1 49  ? -23.688 48.099 -238.890 1.00 24.03 ? 367 SER D N     1 
ATOM   1894 C  CA    . SER D 1 49  ? -23.843 48.134 -240.341 1.00 24.64 ? 367 SER D CA    1 
ATOM   1895 C  C     . SER D 1 49  ? -24.877 49.163 -240.777 1.00 24.04 ? 367 SER D C     1 
ATOM   1896 O  O     . SER D 1 49  ? -24.739 49.756 -241.853 1.00 23.04 ? 367 SER D O     1 
ATOM   1897 C  CB    . SER D 1 49  ? -24.226 46.751 -240.865 1.00 31.12 ? 367 SER D CB    1 
ATOM   1898 O  OG    . SER D 1 49  ? -25.534 46.392 -240.453 1.00 37.38 ? 367 SER D OG    1 
ATOM   1899 N  N     . ASP D 1 50  ? -25.918 49.386 -239.970 1.00 23.56 ? 368 ASP D N     1 
ATOM   1900 C  CA    . ASP D 1 50  ? -26.931 50.365 -240.347 1.00 22.09 ? 368 ASP D CA    1 
ATOM   1901 C  C     . ASP D 1 50  ? -26.376 51.783 -240.312 1.00 19.13 ? 368 ASP D C     1 
ATOM   1902 O  O     . ASP D 1 50  ? -26.849 52.651 -241.055 1.00 20.21 ? 368 ASP D O     1 
ATOM   1903 C  CB    . ASP D 1 50  ? -28.159 50.238 -239.442 1.00 22.78 ? 368 ASP D CB    1 
ATOM   1904 C  CG    . ASP D 1 50  ? -27.873 50.622 -238.002 1.00 31.52 ? 368 ASP D CG    1 
ATOM   1905 O  OD1   . ASP D 1 50  ? -26.711 50.505 -237.566 1.00 26.31 ? 368 ASP D OD1   1 
ATOM   1906 O  OD2   . ASP D 1 50  ? -28.820 51.038 -237.301 1.00 36.08 ? 368 ASP D OD2   1 
ATOM   1907 N  N     . GLN D 1 51  ? -25.379 52.037 -239.462 1.00 18.02 ? 369 GLN D N     1 
ATOM   1908 C  CA    . GLN D 1 51  ? -24.710 53.333 -239.480 1.00 18.38 ? 369 GLN D CA    1 
ATOM   1909 C  C     . GLN D 1 51  ? -23.886 53.499 -240.749 1.00 16.66 ? 369 GLN D C     1 
ATOM   1910 O  O     . GLN D 1 51  ? -23.810 54.598 -241.310 1.00 19.86 ? 369 GLN D O     1 
ATOM   1911 C  CB    . GLN D 1 51  ? -23.825 53.487 -238.243 1.00 20.37 ? 369 GLN D CB    1 
ATOM   1912 C  CG    . GLN D 1 51  ? -24.576 53.439 -236.924 1.00 21.84 ? 369 GLN D CG    1 
ATOM   1913 C  CD    . GLN D 1 51  ? -23.646 53.278 -235.737 1.00 23.18 ? 369 GLN D CD    1 
ATOM   1914 O  OE1   . GLN D 1 51  ? -22.501 52.849 -235.886 1.00 21.04 ? 369 GLN D OE1   1 
ATOM   1915 N  NE2   . GLN D 1 51  ? -24.134 53.625 -234.551 1.00 24.33 ? 369 GLN D NE2   1 
ATOM   1916 N  N     . LEU D 1 52  ? -23.261 52.416 -241.215 1.00 18.93 ? 370 LEU D N     1 
ATOM   1917 C  CA    . LEU D 1 52  ? -22.522 52.471 -242.471 1.00 18.79 ? 370 LEU D CA    1 
ATOM   1918 C  C     . LEU D 1 52  ? -23.460 52.704 -243.647 1.00 20.26 ? 370 LEU D C     1 
ATOM   1919 O  O     . LEU D 1 52  ? -23.172 53.525 -244.526 1.00 18.83 ? 370 LEU D O     1 
ATOM   1920 C  CB    . LEU D 1 52  ? -21.722 51.183 -242.664 1.00 20.57 ? 370 LEU D CB    1 
ATOM   1921 C  CG    . LEU D 1 52  ? -21.021 51.014 -244.014 1.00 22.10 ? 370 LEU D CG    1 
ATOM   1922 C  CD1   . LEU D 1 52  ? -20.042 52.152 -244.262 1.00 22.18 ? 370 LEU D CD1   1 
ATOM   1923 C  CD2   . LEU D 1 52  ? -20.314 49.669 -244.093 1.00 24.09 ? 370 LEU D CD2   1 
ATOM   1924 N  N     . LYS D 1 53  ? -24.592 51.995 -243.676 1.00 20.12 ? 371 LYS D N     1 
ATOM   1925 C  CA    . LYS D 1 53  ? -25.548 52.166 -244.764 1.00 19.85 ? 371 LYS D CA    1 
ATOM   1926 C  C     . LYS D 1 53  ? -26.083 53.591 -244.810 1.00 21.00 ? 371 LYS D C     1 
ATOM   1927 O  O     . LYS D 1 53  ? -26.196 54.186 -245.888 1.00 20.98 ? 371 LYS D O     1 
ATOM   1928 C  CB    . LYS D 1 53  ? -26.694 51.165 -244.615 1.00 23.79 ? 371 LYS D CB    1 
ATOM   1929 C  CG    . LYS D 1 53  ? -26.263 49.711 -244.728 1.00 38.31 ? 371 LYS D CG    1 
ATOM   1930 C  CD    . LYS D 1 53  ? -25.656 49.429 -246.090 1.00 51.88 ? 371 LYS D CD    1 
ATOM   1931 C  CE    . LYS D 1 53  ? -25.207 47.984 -246.215 1.00 55.84 ? 371 LYS D CE    1 
ATOM   1932 N  NZ    . LYS D 1 53  ? -24.568 47.735 -247.535 1.00 57.28 ? 371 LYS D NZ    1 
ATOM   1933 N  N     . ARG D 1 54  ? -26.415 54.157 -243.647 1.00 17.90 ? 372 ARG D N     1 
ATOM   1934 C  CA    . ARG D 1 54  ? -26.870 55.542 -243.602 1.00 17.82 ? 372 ARG D CA    1 
ATOM   1935 C  C     . ARG D 1 54  ? -25.777 56.492 -244.076 1.00 19.41 ? 372 ARG D C     1 
ATOM   1936 O  O     . ARG D 1 54  ? -26.051 57.449 -244.810 1.00 18.89 ? 372 ARG D O     1 
ATOM   1937 C  CB    . ARG D 1 54  ? -27.317 55.896 -242.183 1.00 16.95 ? 372 ARG D CB    1 
ATOM   1938 C  CG    . ARG D 1 54  ? -27.854 57.308 -242.028 1.00 18.85 ? 372 ARG D CG    1 
ATOM   1939 C  CD    . ARG D 1 54  ? -28.223 57.597 -240.581 1.00 17.68 ? 372 ARG D CD    1 
ATOM   1940 N  NE    . ARG D 1 54  ? -27.059 57.514 -239.700 1.00 18.03 ? 372 ARG D NE    1 
ATOM   1941 C  CZ    . ARG D 1 54  ? -27.104 57.664 -238.380 1.00 19.60 ? 372 ARG D CZ    1 
ATOM   1942 N  NH1   . ARG D 1 54  ? -28.260 57.905 -237.774 1.00 18.14 ? 372 ARG D NH1   1 
ATOM   1943 N  NH2   . ARG D 1 54  ? -25.992 57.571 -237.666 1.00 18.78 ? 372 ARG D NH2   1 
ATOM   1944 N  N     . HIS D 1 55  ? -24.530 56.233 -243.674 1.00 19.08 ? 373 HIS D N     1 
ATOM   1945 C  CA    . HIS D 1 55  ? -23.417 57.083 -244.083 1.00 18.59 ? 373 HIS D CA    1 
ATOM   1946 C  C     . HIS D 1 55  ? -23.227 57.070 -245.594 1.00 20.17 ? 373 HIS D C     1 
ATOM   1947 O  O     . HIS D 1 55  ? -22.968 58.115 -246.202 1.00 20.93 ? 373 HIS D O     1 
ATOM   1948 C  CB    . HIS D 1 55  ? -22.134 56.630 -243.388 1.00 18.90 ? 373 HIS D CB    1 
ATOM   1949 C  CG    . HIS D 1 55  ? -20.882 57.038 -244.104 1.00 21.56 ? 373 HIS D CG    1 
ATOM   1950 N  ND1   . HIS D 1 55  ? -20.307 58.281 -243.949 1.00 22.13 ? 373 HIS D ND1   1 
ATOM   1951 C  CD2   . HIS D 1 55  ? -20.099 56.368 -244.982 1.00 22.75 ? 373 HIS D CD2   1 
ATOM   1952 C  CE1   . HIS D 1 55  ? -19.223 58.359 -244.699 1.00 23.70 ? 373 HIS D CE1   1 
ATOM   1953 N  NE2   . HIS D 1 55  ? -19.074 57.212 -245.337 1.00 21.25 ? 373 HIS D NE2   1 
ATOM   1954 N  N     . GLN D 1 56  ? -23.345 55.896 -246.218 1.00 19.53 ? 374 GLN D N     1 
ATOM   1955 C  CA    . GLN D 1 56  ? -23.075 55.790 -247.647 1.00 23.23 ? 374 GLN D CA    1 
ATOM   1956 C  C     . GLN D 1 56  ? -24.114 56.503 -248.502 1.00 22.11 ? 374 GLN D C     1 
ATOM   1957 O  O     . GLN D 1 56  ? -23.895 56.653 -249.710 1.00 20.10 ? 374 GLN D O     1 
ATOM   1958 C  CB    . GLN D 1 56  ? -22.965 54.318 -248.047 1.00 19.84 ? 374 GLN D CB    1 
ATOM   1959 C  CG    . GLN D 1 56  ? -21.749 53.630 -247.438 1.00 25.23 ? 374 GLN D CG    1 
ATOM   1960 C  CD    . GLN D 1 56  ? -21.415 52.310 -248.101 1.00 30.39 ? 374 GLN D CD    1 
ATOM   1961 O  OE1   . GLN D 1 56  ? -20.246 52.008 -248.348 1.00 33.48 ? 374 GLN D OE1   1 
ATOM   1962 N  NE2   . GLN D 1 56  ? -22.437 51.513 -248.387 1.00 31.47 ? 374 GLN D NE2   1 
ATOM   1963 N  N     . ARG D 1 57  ? -25.227 56.950 -247.914 1.00 23.22 ? 375 ARG D N     1 
ATOM   1964 C  CA    . ARG D 1 57  ? -26.131 57.844 -248.629 1.00 22.63 ? 375 ARG D CA    1 
ATOM   1965 C  C     . ARG D 1 57  ? -25.459 59.163 -248.982 1.00 23.31 ? 375 ARG D C     1 
ATOM   1966 O  O     . ARG D 1 57  ? -25.890 59.833 -249.927 1.00 24.17 ? 375 ARG D O     1 
ATOM   1967 C  CB    . ARG D 1 57  ? -27.390 58.110 -247.801 1.00 19.84 ? 375 ARG D CB    1 
ATOM   1968 C  CG    . ARG D 1 57  ? -28.218 56.873 -247.503 1.00 22.54 ? 375 ARG D CG    1 
ATOM   1969 C  CD    . ARG D 1 57  ? -29.359 57.195 -246.551 1.00 22.44 ? 375 ARG D CD    1 
ATOM   1970 N  NE    . ARG D 1 57  ? -30.041 55.987 -246.097 1.00 21.95 ? 375 ARG D NE    1 
ATOM   1971 C  CZ    . ARG D 1 57  ? -30.900 55.954 -245.085 1.00 29.54 ? 375 ARG D CZ    1 
ATOM   1972 N  NH1   . ARG D 1 57  ? -31.182 57.066 -244.419 1.00 26.09 ? 375 ARG D NH1   1 
ATOM   1973 N  NH2   . ARG D 1 57  ? -31.475 54.812 -244.736 1.00 30.41 ? 375 ARG D NH2   1 
ATOM   1974 N  N     . ARG D 1 58  ? -24.417 59.554 -248.242 1.00 20.17 ? 376 ARG D N     1 
ATOM   1975 C  CA    . ARG D 1 58  ? -23.661 60.747 -248.604 1.00 21.98 ? 376 ARG D CA    1 
ATOM   1976 C  C     . ARG D 1 58  ? -22.933 60.562 -249.927 1.00 25.96 ? 376 ARG D C     1 
ATOM   1977 O  O     . ARG D 1 58  ? -22.774 61.524 -250.688 1.00 29.11 ? 376 ARG D O     1 
ATOM   1978 C  CB    . ARG D 1 58  ? -22.659 61.099 -247.502 1.00 24.87 ? 376 ARG D CB    1 
ATOM   1979 C  CG    . ARG D 1 58  ? -23.272 61.360 -246.135 1.00 25.93 ? 376 ARG D CG    1 
ATOM   1980 C  CD    . ARG D 1 58  ? -22.271 62.057 -245.229 1.00 33.71 ? 376 ARG D CD    1 
ATOM   1981 N  NE    . ARG D 1 58  ? -21.938 63.387 -245.731 1.00 43.19 ? 376 ARG D NE    1 
ATOM   1982 C  CZ    . ARG D 1 58  ? -20.954 64.144 -245.259 1.00 54.23 ? 376 ARG D CZ    1 
ATOM   1983 N  NH1   . ARG D 1 58  ? -20.190 63.703 -244.268 1.00 51.98 ? 376 ARG D NH1   1 
ATOM   1984 N  NH2   . ARG D 1 58  ? -20.729 65.341 -245.783 1.00 61.50 ? 376 ARG D NH2   1 
ATOM   1985 N  N     . HIS D 1 59  ? -22.486 59.339 -250.218 1.00 23.85 ? 377 HIS D N     1 
ATOM   1986 C  CA    . HIS D 1 59  ? -21.762 59.087 -251.459 1.00 23.69 ? 377 HIS D CA    1 
ATOM   1987 C  C     . HIS D 1 59  ? -22.706 58.953 -252.647 1.00 23.16 ? 377 HIS D C     1 
ATOM   1988 O  O     . HIS D 1 59  ? -22.384 59.407 -253.750 1.00 25.66 ? 377 HIS D O     1 
ATOM   1989 C  CB    . HIS D 1 59  ? -20.903 57.831 -251.318 1.00 22.58 ? 377 HIS D CB    1 
ATOM   1990 C  CG    . HIS D 1 59  ? -19.893 57.912 -250.217 1.00 24.66 ? 377 HIS D CG    1 
ATOM   1991 N  ND1   . HIS D 1 59  ? -18.981 58.940 -250.119 1.00 27.33 ? 377 HIS D ND1   1 
ATOM   1992 C  CD2   . HIS D 1 59  ? -19.649 57.091 -249.169 1.00 22.87 ? 377 HIS D CD2   1 
ATOM   1993 C  CE1   . HIS D 1 59  ? -18.220 58.751 -249.056 1.00 28.14 ? 377 HIS D CE1   1 
ATOM   1994 N  NE2   . HIS D 1 59  ? -18.605 57.636 -248.462 1.00 22.06 ? 377 HIS D NE2   1 
ATOM   1995 N  N     . THR D 1 60  ? -23.868 58.330 -252.447 1.00 22.58 ? 378 THR D N     1 
ATOM   1996 C  CA    . THR D 1 60  ? -24.834 58.196 -253.529 1.00 21.76 ? 378 THR D CA    1 
ATOM   1997 C  C     . THR D 1 60  ? -25.696 59.442 -253.701 1.00 26.35 ? 378 THR D C     1 
ATOM   1998 O  O     . THR D 1 60  ? -26.250 59.649 -254.786 1.00 26.42 ? 378 THR D O     1 
ATOM   1999 C  CB    . THR D 1 60  ? -25.734 56.980 -253.288 1.00 26.83 ? 378 THR D CB    1 
ATOM   2000 O  OG1   . THR D 1 60  ? -26.457 57.159 -252.064 1.00 25.17 ? 378 THR D OG1   1 
ATOM   2001 C  CG2   . THR D 1 60  ? -24.902 55.702 -253.194 1.00 24.64 ? 378 THR D CG2   1 
ATOM   2002 N  N     . GLY D 1 61  ? -25.812 60.273 -252.666 1.00 25.24 ? 379 GLY D N     1 
ATOM   2003 C  CA    . GLY D 1 61  ? -26.645 61.458 -252.744 1.00 24.24 ? 379 GLY D CA    1 
ATOM   2004 C  C     . GLY D 1 61  ? -28.131 61.185 -252.746 1.00 27.86 ? 379 GLY D C     1 
ATOM   2005 O  O     . GLY D 1 61  ? -28.914 62.073 -253.093 1.00 28.97 ? 379 GLY D O     1 
ATOM   2006 N  N     . VAL D 1 62  ? -28.541 59.979 -252.356 1.00 23.25 ? 380 VAL D N     1 
ATOM   2007 C  CA    A VAL D 1 62  ? -29.956 59.625 -252.382 0.50 24.13 ? 380 VAL D CA    1 
ATOM   2008 C  CA    B VAL D 1 62  ? -29.955 59.620 -252.377 0.50 24.14 ? 380 VAL D CA    1 
ATOM   2009 C  C     . VAL D 1 62  ? -30.673 60.294 -251.219 1.00 23.17 ? 380 VAL D C     1 
ATOM   2010 O  O     . VAL D 1 62  ? -30.135 60.417 -250.110 1.00 26.22 ? 380 VAL D O     1 
ATOM   2011 C  CB    A VAL D 1 62  ? -30.122 58.095 -252.350 0.50 25.56 ? 380 VAL D CB    1 
ATOM   2012 C  CB    B VAL D 1 62  ? -30.111 58.089 -252.325 0.50 25.67 ? 380 VAL D CB    1 
ATOM   2013 C  CG1   A VAL D 1 62  ? -29.595 57.515 -251.042 0.50 22.01 ? 380 VAL D CG1   1 
ATOM   2014 C  CG1   B VAL D 1 62  ? -31.579 57.691 -252.319 0.50 30.00 ? 380 VAL D CG1   1 
ATOM   2015 C  CG2   A VAL D 1 62  ? -31.576 57.703 -252.579 0.50 29.88 ? 380 VAL D CG2   1 
ATOM   2016 C  CG2   B VAL D 1 62  ? -29.393 57.443 -253.500 0.50 22.47 ? 380 VAL D CG2   1 
ATOM   2017 N  N     . LYS D 1 63  ? -31.899 60.754 -251.475 1.00 23.84 ? 381 LYS D N     1 
ATOM   2018 C  CA    . LYS D 1 63  ? -32.769 61.353 -250.463 1.00 23.71 ? 381 LYS D CA    1 
ATOM   2019 C  C     . LYS D 1 63  ? -34.081 60.582 -250.492 1.00 24.25 ? 381 LYS D C     1 
ATOM   2020 O  O     . LYS D 1 63  ? -35.054 61.002 -251.134 1.00 30.46 ? 381 LYS D O     1 
ATOM   2021 C  CB    . LYS D 1 63  ? -32.978 62.846 -250.718 1.00 24.41 ? 381 LYS D CB    1 
ATOM   2022 C  CG    . LYS D 1 63  ? -31.714 63.682 -250.589 1.00 27.03 ? 381 LYS D CG    1 
ATOM   2023 C  CD    . LYS D 1 63  ? -32.022 65.167 -250.714 1.00 35.01 ? 381 LYS D CD    1 
ATOM   2024 C  CE    . LYS D 1 63  ? -30.784 66.017 -250.474 1.00 43.40 ? 381 LYS D CE    1 
ATOM   2025 N  NZ    . LYS D 1 63  ? -29.722 65.763 -251.486 1.00 49.80 ? 381 LYS D NZ    1 
ATOM   2026 N  N     . PRO D 1 64  ? -34.145 59.438 -249.802 1.00 23.33 ? 382 PRO D N     1 
ATOM   2027 C  CA    . PRO D 1 64  ? -35.286 58.525 -249.982 1.00 28.52 ? 382 PRO D CA    1 
ATOM   2028 C  C     . PRO D 1 64  ? -36.575 58.990 -249.324 1.00 27.79 ? 382 PRO D C     1 
ATOM   2029 O  O     . PRO D 1 64  ? -37.625 58.388 -249.588 1.00 28.97 ? 382 PRO D O     1 
ATOM   2030 C  CB    . PRO D 1 64  ? -34.795 57.215 -249.341 1.00 26.40 ? 382 PRO D CB    1 
ATOM   2031 C  CG    . PRO D 1 64  ? -33.319 57.410 -249.082 1.00 26.75 ? 382 PRO D CG    1 
ATOM   2032 C  CD    . PRO D 1 64  ? -33.134 58.878 -248.894 1.00 23.40 ? 382 PRO D CD    1 
ATOM   2033 N  N     . PHE D 1 65  ? -36.543 60.024 -248.487 1.00 26.62 ? 383 PHE D N     1 
ATOM   2034 C  CA    . PHE D 1 65  ? -37.692 60.417 -247.679 1.00 25.58 ? 383 PHE D CA    1 
ATOM   2035 C  C     . PHE D 1 65  ? -38.177 61.787 -248.129 1.00 26.61 ? 383 PHE D C     1 
ATOM   2036 O  O     . PHE D 1 65  ? -37.442 62.776 -248.024 1.00 35.30 ? 383 PHE D O     1 
ATOM   2037 C  CB    . PHE D 1 65  ? -37.326 60.417 -246.193 1.00 23.67 ? 383 PHE D CB    1 
ATOM   2038 C  CG    . PHE D 1 65  ? -36.671 59.142 -245.741 1.00 23.29 ? 383 PHE D CG    1 
ATOM   2039 C  CD1   . PHE D 1 65  ? -37.437 58.050 -245.368 1.00 27.33 ? 383 PHE D CD1   1 
ATOM   2040 C  CD2   . PHE D 1 65  ? -35.291 59.027 -245.712 1.00 21.28 ? 383 PHE D CD2   1 
ATOM   2041 C  CE1   . PHE D 1 65  ? -36.839 56.871 -244.963 1.00 24.93 ? 383 PHE D CE1   1 
ATOM   2042 C  CE2   . PHE D 1 65  ? -34.686 57.851 -245.306 1.00 24.61 ? 383 PHE D CE2   1 
ATOM   2043 C  CZ    . PHE D 1 65  ? -35.462 56.772 -244.930 1.00 25.85 ? 383 PHE D CZ    1 
ATOM   2044 N  N     . GLN D 1 66  ? -39.414 61.841 -248.621 1.00 23.43 ? 384 GLN D N     1 
ATOM   2045 C  CA    . GLN D 1 66  ? -39.978 63.047 -249.210 1.00 26.69 ? 384 GLN D CA    1 
ATOM   2046 C  C     . GLN D 1 66  ? -41.136 63.566 -248.368 1.00 28.29 ? 384 GLN D C     1 
ATOM   2047 O  O     . GLN D 1 66  ? -42.003 62.795 -247.941 1.00 29.25 ? 384 GLN D O     1 
ATOM   2048 C  CB    . GLN D 1 66  ? -40.451 62.781 -250.643 1.00 27.30 ? 384 GLN D CB    1 
ATOM   2049 C  CG    . GLN D 1 66  ? -40.973 64.012 -251.363 1.00 29.19 ? 384 GLN D CG    1 
ATOM   2050 C  CD    . GLN D 1 66  ? -41.304 63.744 -252.818 1.00 36.88 ? 384 GLN D CD    1 
ATOM   2051 O  OE1   . GLN D 1 66  ? -41.722 62.645 -253.181 1.00 40.04 ? 384 GLN D OE1   1 
ATOM   2052 N  NE2   . GLN D 1 66  ? -41.109 64.751 -253.663 1.00 38.51 ? 384 GLN D NE2   1 
ATOM   2053 N  N     . CYS D 1 67  ? -41.146 64.878 -248.141 1.00 23.42 ? 385 CYS D N     1 
ATOM   2054 C  CA    . CYS D 1 67  ? -42.233 65.507 -247.407 1.00 25.91 ? 385 CYS D CA    1 
ATOM   2055 C  C     . CYS D 1 67  ? -43.511 65.485 -248.235 1.00 32.01 ? 385 CYS D C     1 
ATOM   2056 O  O     . CYS D 1 67  ? -43.499 65.817 -249.423 1.00 33.29 ? 385 CYS D O     1 
ATOM   2057 C  CB    . CYS D 1 67  ? -41.860 66.942 -247.045 1.00 25.08 ? 385 CYS D CB    1 
ATOM   2058 S  SG    . CYS D 1 67  ? -43.154 67.855 -246.171 1.00 28.04 ? 385 CYS D SG    1 
ATOM   2059 N  N     . LYS D 1 68  ? -44.620 65.100 -247.605 1.00 29.61 ? 386 LYS D N     1 
ATOM   2060 C  CA    . LYS D 1 68  ? -45.897 65.027 -248.303 1.00 33.53 ? 386 LYS D CA    1 
ATOM   2061 C  C     . LYS D 1 68  ? -46.561 66.387 -248.473 1.00 37.37 ? 386 LYS D C     1 
ATOM   2062 O  O     . LYS D 1 68  ? -47.603 66.470 -249.132 1.00 40.53 ? 386 LYS D O     1 
ATOM   2063 C  CB    . LYS D 1 68  ? -46.845 64.080 -247.563 1.00 36.68 ? 386 LYS D CB    1 
ATOM   2064 C  CG    . LYS D 1 68  ? -46.248 62.709 -247.285 1.00 42.53 ? 386 LYS D CG    1 
ATOM   2065 C  CD    . LYS D 1 68  ? -47.255 61.787 -246.619 1.00 50.00 ? 386 LYS D CD    1 
ATOM   2066 C  CE    . LYS D 1 68  ? -46.602 60.488 -246.173 1.00 51.34 ? 386 LYS D CE    1 
ATOM   2067 N  NZ    . LYS D 1 68  ? -45.919 59.791 -247.297 1.00 50.59 ? 386 LYS D NZ    1 
ATOM   2068 N  N     . THR D 1 69  ? -45.985 67.448 -247.909 1.00 36.54 ? 387 THR D N     1 
ATOM   2069 C  CA    . THR D 1 69  ? -46.557 68.788 -247.981 1.00 36.40 ? 387 THR D CA    1 
ATOM   2070 C  C     . THR D 1 69  ? -45.856 69.674 -249.004 1.00 39.23 ? 387 THR D C     1 
ATOM   2071 O  O     . THR D 1 69  ? -46.518 70.299 -249.837 1.00 41.54 ? 387 THR D O     1 
ATOM   2072 C  CB    . THR D 1 69  ? -46.513 69.457 -246.602 1.00 36.39 ? 387 THR D CB    1 
ATOM   2073 O  OG1   . THR D 1 69  ? -47.295 68.695 -245.672 1.00 39.59 ? 387 THR D OG1   1 
ATOM   2074 C  CG2   . THR D 1 69  ? -47.064 70.872 -246.680 1.00 32.28 ? 387 THR D CG2   1 
ATOM   2075 N  N     . CYS D 1 70  ? -44.526 69.743 -248.958 1.00 35.35 ? 388 CYS D N     1 
ATOM   2076 C  CA    . CYS D 1 70  ? -43.760 70.603 -249.851 1.00 32.54 ? 388 CYS D CA    1 
ATOM   2077 C  C     . CYS D 1 70  ? -42.892 69.827 -250.833 1.00 34.14 ? 388 CYS D C     1 
ATOM   2078 O  O     . CYS D 1 70  ? -42.185 70.448 -251.634 1.00 37.74 ? 388 CYS D O     1 
ATOM   2079 C  CB    . CYS D 1 70  ? -42.884 71.563 -249.039 1.00 30.92 ? 388 CYS D CB    1 
ATOM   2080 S  SG    . CYS D 1 70  ? -41.449 70.786 -248.262 1.00 31.77 ? 388 CYS D SG    1 
ATOM   2081 N  N     . GLN D 1 71  ? -42.917 68.495 -250.783 1.00 34.58 ? 389 GLN D N     1 
ATOM   2082 C  CA    . GLN D 1 71  ? -42.208 67.598 -251.695 1.00 32.51 ? 389 GLN D CA    1 
ATOM   2083 C  C     . GLN D 1 71  ? -40.692 67.701 -251.590 1.00 31.98 ? 389 GLN D C     1 
ATOM   2084 O  O     . GLN D 1 71  ? -39.985 67.196 -252.472 1.00 32.65 ? 389 GLN D O     1 
ATOM   2085 C  CB    . GLN D 1 71  ? -42.633 67.813 -253.154 1.00 35.76 ? 389 GLN D CB    1 
ATOM   2086 C  CG    . GLN D 1 71  ? -44.025 67.288 -253.484 1.00 37.59 ? 389 GLN D CG    1 
ATOM   2087 C  CD    . GLN D 1 71  ? -45.126 68.080 -252.806 1.00 42.18 ? 389 GLN D CD    1 
ATOM   2088 O  OE1   . GLN D 1 71  ? -45.261 69.284 -253.020 1.00 46.73 ? 389 GLN D OE1   1 
ATOM   2089 N  NE2   . GLN D 1 71  ? -45.913 67.408 -251.973 1.00 46.00 ? 389 GLN D NE2   1 
ATOM   2090 N  N     . ARG D 1 72  ? -40.163 68.327 -250.542 1.00 26.59 ? 390 ARG D N     1 
ATOM   2091 C  CA    . ARG D 1 72  ? -38.721 68.326 -250.343 1.00 25.62 ? 390 ARG D CA    1 
ATOM   2092 C  C     . ARG D 1 72  ? -38.260 66.941 -249.907 1.00 27.89 ? 390 ARG D C     1 
ATOM   2093 O  O     . ARG D 1 72  ? -38.927 66.265 -249.119 1.00 28.36 ? 390 ARG D O     1 
ATOM   2094 C  CB    . ARG D 1 72  ? -38.316 69.375 -249.306 1.00 28.60 ? 390 ARG D CB    1 
ATOM   2095 C  CG    . ARG D 1 72  ? -36.812 69.475 -249.092 1.00 28.65 ? 390 ARG D CG    1 
ATOM   2096 C  CD    . ARG D 1 72  ? -36.428 70.697 -248.270 1.00 31.02 ? 390 ARG D CD    1 
ATOM   2097 N  NE    . ARG D 1 72  ? -34.978 70.818 -248.134 1.00 31.07 ? 390 ARG D NE    1 
ATOM   2098 C  CZ    . ARG D 1 72  ? -34.357 71.883 -247.636 1.00 33.34 ? 390 ARG D CZ    1 
ATOM   2099 N  NH1   . ARG D 1 72  ? -35.059 72.931 -247.226 1.00 31.95 ? 390 ARG D NH1   1 
ATOM   2100 N  NH2   . ARG D 1 72  ? -33.034 71.901 -247.552 1.00 33.76 ? 390 ARG D NH2   1 
ATOM   2101 N  N     . LYS D 1 73  ? -37.118 66.515 -250.435 1.00 24.99 ? 391 LYS D N     1 
ATOM   2102 C  CA    . LYS D 1 73  ? -36.577 65.192 -250.168 1.00 23.74 ? 391 LYS D CA    1 
ATOM   2103 C  C     . LYS D 1 73  ? -35.448 65.273 -249.147 1.00 21.28 ? 391 LYS D C     1 
ATOM   2104 O  O     . LYS D 1 73  ? -34.710 66.260 -249.086 1.00 24.40 ? 391 LYS D O     1 
ATOM   2105 C  CB    . LYS D 1 73  ? -36.080 64.546 -251.462 1.00 27.31 ? 391 LYS D CB    1 
ATOM   2106 C  CG    . LYS D 1 73  ? -37.166 64.426 -252.518 1.00 30.14 ? 391 LYS D CG    1 
ATOM   2107 C  CD    . LYS D 1 73  ? -36.617 63.929 -253.843 1.00 34.88 ? 391 LYS D CD    1 
ATOM   2108 C  CE    . LYS D 1 73  ? -37.707 63.889 -254.902 1.00 41.13 ? 391 LYS D CE    1 
ATOM   2109 N  NZ    . LYS D 1 73  ? -37.182 63.479 -256.235 1.00 44.06 ? 391 LYS D NZ    1 
ATOM   2110 N  N     . PHE D 1 74  ? -35.323 64.220 -248.340 1.00 20.45 ? 392 PHE D N     1 
ATOM   2111 C  CA    . PHE D 1 74  ? -34.375 64.203 -247.237 1.00 18.66 ? 392 PHE D CA    1 
ATOM   2112 C  C     . PHE D 1 74  ? -33.641 62.872 -247.204 1.00 19.80 ? 392 PHE D C     1 
ATOM   2113 O  O     . PHE D 1 74  ? -34.184 61.832 -247.587 1.00 20.71 ? 392 PHE D O     1 
ATOM   2114 C  CB    . PHE D 1 74  ? -35.074 64.448 -245.893 1.00 22.10 ? 392 PHE D CB    1 
ATOM   2115 C  CG    . PHE D 1 74  ? -35.793 65.764 -245.818 1.00 18.35 ? 392 PHE D CG    1 
ATOM   2116 C  CD1   . PHE D 1 74  ? -35.156 66.889 -245.321 1.00 23.59 ? 392 PHE D CD1   1 
ATOM   2117 C  CD2   . PHE D 1 74  ? -37.102 65.878 -246.257 1.00 21.66 ? 392 PHE D CD2   1 
ATOM   2118 C  CE1   . PHE D 1 74  ? -35.813 68.102 -245.256 1.00 23.23 ? 392 PHE D CE1   1 
ATOM   2119 C  CE2   . PHE D 1 74  ? -37.764 67.089 -246.195 1.00 21.84 ? 392 PHE D CE2   1 
ATOM   2120 C  CZ    . PHE D 1 74  ? -37.117 68.201 -245.696 1.00 20.30 ? 392 PHE D CZ    1 
ATOM   2121 N  N     . SER D 1 75  ? -32.396 62.917 -246.729 1.00 20.46 ? 393 SER D N     1 
ATOM   2122 C  CA    . SER D 1 75  ? -31.570 61.718 -246.667 1.00 22.98 ? 393 SER D CA    1 
ATOM   2123 C  C     . SER D 1 75  ? -31.997 60.767 -245.558 1.00 21.34 ? 393 SER D C     1 
ATOM   2124 O  O     . SER D 1 75  ? -31.693 59.571 -245.638 1.00 20.89 ? 393 SER D O     1 
ATOM   2125 C  CB    . SER D 1 75  ? -30.103 62.103 -246.470 1.00 21.77 ? 393 SER D CB    1 
ATOM   2126 O  OG    . SER D 1 75  ? -29.919 62.778 -245.237 1.00 20.78 ? 393 SER D OG    1 
ATOM   2127 N  N     . ARG D 1 76  ? -32.688 61.259 -244.532 1.00 18.83 ? 394 ARG D N     1 
ATOM   2128 C  CA    . ARG D 1 76  ? -32.963 60.462 -243.346 1.00 18.69 ? 394 ARG D CA    1 
ATOM   2129 C  C     . ARG D 1 76  ? -34.397 60.674 -242.885 1.00 24.11 ? 394 ARG D C     1 
ATOM   2130 O  O     . ARG D 1 76  ? -34.959 61.765 -243.020 1.00 19.57 ? 394 ARG D O     1 
ATOM   2131 C  CB    . ARG D 1 76  ? -31.983 60.802 -242.219 1.00 19.85 ? 394 ARG D CB    1 
ATOM   2132 C  CG    . ARG D 1 76  ? -30.570 60.310 -242.483 1.00 18.11 ? 394 ARG D CG    1 
ATOM   2133 C  CD    . ARG D 1 76  ? -29.555 60.987 -241.581 1.00 18.86 ? 394 ARG D CD    1 
ATOM   2134 N  NE    . ARG D 1 76  ? -29.986 61.016 -240.187 1.00 17.52 ? 394 ARG D NE    1 
ATOM   2135 C  CZ    . ARG D 1 76  ? -29.166 61.204 -239.159 1.00 18.34 ? 394 ARG D CZ    1 
ATOM   2136 N  NH1   . ARG D 1 76  ? -27.867 61.363 -239.369 1.00 19.95 ? 394 ARG D NH1   1 
ATOM   2137 N  NH2   . ARG D 1 76  ? -29.642 61.221 -237.923 1.00 20.04 ? 394 ARG D NH2   1 
ATOM   2138 N  N     . SER D 1 77  ? -34.980 59.611 -242.322 1.00 18.39 ? 395 SER D N     1 
ATOM   2139 C  CA    . SER D 1 77  ? -36.385 59.648 -241.928 1.00 16.58 ? 395 SER D CA    1 
ATOM   2140 C  C     . SER D 1 77  ? -36.605 60.489 -240.678 1.00 20.11 ? 395 SER D C     1 
ATOM   2141 O  O     . SER D 1 77  ? -37.657 61.124 -240.542 1.00 19.08 ? 395 SER D O     1 
ATOM   2142 C  CB    . SER D 1 77  ? -36.908 58.228 -241.707 1.00 20.14 ? 395 SER D CB    1 
ATOM   2143 O  OG    . SER D 1 77  ? -36.240 57.598 -240.626 1.00 23.53 ? 395 SER D OG    1 
ATOM   2144 N  N     . ASP D 1 78  ? -35.643 60.496 -239.751 1.00 19.01 ? 396 ASP D N     1 
ATOM   2145 C  CA    . ASP D 1 78  ? -35.801 61.307 -238.549 1.00 18.87 ? 396 ASP D CA    1 
ATOM   2146 C  C     . ASP D 1 78  ? -35.758 62.793 -238.874 1.00 20.38 ? 396 ASP D C     1 
ATOM   2147 O  O     . ASP D 1 78  ? -36.470 63.586 -238.247 1.00 19.54 ? 396 ASP D O     1 
ATOM   2148 C  CB    . ASP D 1 78  ? -34.731 60.944 -237.517 1.00 19.74 ? 396 ASP D CB    1 
ATOM   2149 C  CG    . ASP D 1 78  ? -33.321 61.078 -238.058 1.00 24.98 ? 396 ASP D CG    1 
ATOM   2150 O  OD1   . ASP D 1 78  ? -33.151 61.057 -239.292 1.00 25.44 ? 396 ASP D OD1   1 
ATOM   2151 O  OD2   . ASP D 1 78  ? -32.381 61.199 -237.244 1.00 28.59 ? 396 ASP D OD2   1 
ATOM   2152 N  N     . HIS D 1 79  ? -34.952 63.188 -239.860 1.00 17.57 ? 397 HIS D N     1 
ATOM   2153 C  CA    . HIS D 1 79  ? -34.911 64.591 -240.252 1.00 17.59 ? 397 HIS D CA    1 
ATOM   2154 C  C     . HIS D 1 79  ? -36.145 64.985 -241.053 1.00 17.84 ? 397 HIS D C     1 
ATOM   2155 O  O     . HIS D 1 79  ? -36.564 66.147 -241.008 1.00 19.02 ? 397 HIS D O     1 
ATOM   2156 C  CB    . HIS D 1 79  ? -33.636 64.875 -241.040 1.00 19.43 ? 397 HIS D CB    1 
ATOM   2157 C  CG    . HIS D 1 79  ? -32.388 64.734 -240.228 1.00 18.30 ? 397 HIS D CG    1 
ATOM   2158 N  ND1   . HIS D 1 79  ? -32.383 64.827 -238.852 1.00 19.98 ? 397 HIS D ND1   1 
ATOM   2159 C  CD2   . HIS D 1 79  ? -31.106 64.504 -240.594 1.00 16.57 ? 397 HIS D CD2   1 
ATOM   2160 C  CE1   . HIS D 1 79  ? -31.150 64.665 -238.407 1.00 19.11 ? 397 HIS D CE1   1 
ATOM   2161 N  NE2   . HIS D 1 79  ? -30.356 64.468 -239.444 1.00 17.80 ? 397 HIS D NE2   1 
ATOM   2162 N  N     . LEU D 1 80  ? -36.737 64.043 -241.792 1.00 17.47 ? 398 LEU D N     1 
ATOM   2163 C  CA    . LEU D 1 80  ? -38.032 64.310 -242.408 1.00 18.75 ? 398 LEU D CA    1 
ATOM   2164 C  C     . LEU D 1 80  ? -39.104 64.528 -241.349 1.00 20.93 ? 398 LEU D C     1 
ATOM   2165 O  O     . LEU D 1 80  ? -39.971 65.397 -241.502 1.00 20.91 ? 398 LEU D O     1 
ATOM   2166 C  CB    . LEU D 1 80  ? -38.431 63.160 -243.332 1.00 18.55 ? 398 LEU D CB    1 
ATOM   2167 C  CG    . LEU D 1 80  ? -39.871 63.225 -243.851 1.00 21.26 ? 398 LEU D CG    1 
ATOM   2168 C  CD1   . LEU D 1 80  ? -40.076 64.476 -244.691 1.00 25.31 ? 398 LEU D CD1   1 
ATOM   2169 C  CD2   . LEU D 1 80  ? -40.233 61.973 -244.639 1.00 23.81 ? 398 LEU D CD2   1 
ATOM   2170 N  N     . LYS D 1 81  ? -39.057 63.749 -240.265 1.00 18.06 ? 399 LYS D N     1 
ATOM   2171 C  CA    . LYS D 1 81  ? -40.075 63.858 -239.223 1.00 17.35 ? 399 LYS D CA    1 
ATOM   2172 C  C     . LYS D 1 81  ? -40.051 65.233 -238.567 1.00 23.57 ? 399 LYS D C     1 
ATOM   2173 O  O     . LYS D 1 81  ? -41.098 65.869 -238.396 1.00 23.33 ? 399 LYS D O     1 
ATOM   2174 C  CB    . LYS D 1 81  ? -39.878 62.759 -238.178 1.00 21.13 ? 399 LYS D CB    1 
ATOM   2175 C  CG    . LYS D 1 81  ? -40.871 62.826 -237.026 1.00 23.07 ? 399 LYS D CG    1 
ATOM   2176 C  CD    . LYS D 1 81  ? -40.591 61.762 -235.979 1.00 24.78 ? 399 LYS D CD    1 
ATOM   2177 C  CE    . LYS D 1 81  ? -40.812 60.367 -236.535 1.00 27.36 ? 399 LYS D CE    1 
ATOM   2178 N  NZ    . LYS D 1 81  ? -40.549 59.321 -235.510 1.00 25.61 ? 399 LYS D NZ    1 
ATOM   2179 N  N     . THR D 1 82  ? -38.862 65.708 -238.184 1.00 18.89 ? 400 THR D N     1 
ATOM   2180 C  CA    . THR D 1 82  ? -38.776 67.024 -237.560 1.00 18.54 ? 400 THR D CA    1 
ATOM   2181 C  C     . THR D 1 82  ? -39.056 68.139 -238.560 1.00 22.45 ? 400 THR D C     1 
ATOM   2182 O  O     . THR D 1 82  ? -39.580 69.191 -238.179 1.00 22.77 ? 400 THR D O     1 
ATOM   2183 C  CB    . THR D 1 82  ? -37.405 67.223 -236.910 1.00 20.03 ? 400 THR D CB    1 
ATOM   2184 O  OG1   . THR D 1 82  ? -36.375 67.089 -237.897 1.00 20.01 ? 400 THR D OG1   1 
ATOM   2185 C  CG2   . THR D 1 82  ? -37.185 66.199 -235.807 1.00 23.77 ? 400 THR D CG2   1 
ATOM   2186 N  N     . HIS D 1 83  ? -38.719 67.932 -239.836 1.00 19.54 ? 401 HIS D N     1 
ATOM   2187 C  CA    . HIS D 1 83  ? -39.084 68.911 -240.854 1.00 19.08 ? 401 HIS D CA    1 
ATOM   2188 C  C     . HIS D 1 83  ? -40.596 69.020 -240.995 1.00 21.98 ? 401 HIS D C     1 
ATOM   2189 O  O     . HIS D 1 83  ? -41.133 70.119 -241.179 1.00 24.72 ? 401 HIS D O     1 
ATOM   2190 C  CB    . HIS D 1 83  ? -38.462 68.545 -242.200 1.00 20.39 ? 401 HIS D CB    1 
ATOM   2191 C  CG    . HIS D 1 83  ? -39.128 69.212 -243.363 1.00 20.98 ? 401 HIS D CG    1 
ATOM   2192 N  ND1   . HIS D 1 83  ? -38.818 70.493 -243.763 1.00 20.03 ? 401 HIS D ND1   1 
ATOM   2193 C  CD2   . HIS D 1 83  ? -40.105 68.783 -244.198 1.00 21.45 ? 401 HIS D CD2   1 
ATOM   2194 C  CE1   . HIS D 1 83  ? -39.567 70.822 -244.801 1.00 24.76 ? 401 HIS D CE1   1 
ATOM   2195 N  NE2   . HIS D 1 83  ? -40.357 69.802 -245.084 1.00 23.67 ? 401 HIS D NE2   1 
ATOM   2196 N  N     . THR D 1 84  ? -41.298 67.886 -240.923 1.00 20.29 ? 402 THR D N     1 
ATOM   2197 C  CA    . THR D 1 84  ? -42.751 67.899 -241.060 1.00 23.73 ? 402 THR D CA    1 
ATOM   2198 C  C     . THR D 1 84  ? -43.410 68.715 -239.954 1.00 25.05 ? 402 THR D C     1 
ATOM   2199 O  O     . THR D 1 84  ? -44.477 69.303 -240.166 1.00 28.61 ? 402 THR D O     1 
ATOM   2200 C  CB    . THR D 1 84  ? -43.282 66.463 -241.069 1.00 26.31 ? 402 THR D CB    1 
ATOM   2201 O  OG1   . THR D 1 84  ? -42.672 65.738 -242.145 1.00 26.06 ? 402 THR D OG1   1 
ATOM   2202 C  CG2   . THR D 1 84  ? -44.793 66.438 -241.252 1.00 28.92 ? 402 THR D CG2   1 
ATOM   2203 N  N     . ARG D 1 85  ? -42.782 68.785 -238.778 1.00 25.73 ? 403 ARG D N     1 
ATOM   2204 C  CA    . ARG D 1 85  ? -43.335 69.578 -237.686 1.00 28.21 ? 403 ARG D CA    1 
ATOM   2205 C  C     . ARG D 1 85  ? -43.345 71.068 -238.001 1.00 31.45 ? 403 ARG D C     1 
ATOM   2206 O  O     . ARG D 1 85  ? -44.095 71.818 -237.367 1.00 33.90 ? 403 ARG D O     1 
ATOM   2207 C  CB    . ARG D 1 85  ? -42.553 69.310 -236.400 1.00 31.71 ? 403 ARG D CB    1 
ATOM   2208 C  CG    . ARG D 1 85  ? -42.733 67.897 -235.868 1.00 32.05 ? 403 ARG D CG    1 
ATOM   2209 C  CD    . ARG D 1 85  ? -41.801 67.608 -234.704 1.00 30.19 ? 403 ARG D CD    1 
ATOM   2210 N  NE    . ARG D 1 85  ? -41.972 66.244 -234.208 1.00 30.74 ? 403 ARG D NE    1 
ATOM   2211 C  CZ    . ARG D 1 85  ? -41.150 65.651 -233.350 1.00 30.17 ? 403 ARG D CZ    1 
ATOM   2212 N  NH1   . ARG D 1 85  ? -40.089 66.298 -232.888 1.00 27.69 ? 403 ARG D NH1   1 
ATOM   2213 N  NH2   . ARG D 1 85  ? -41.387 64.407 -232.956 1.00 32.15 ? 403 ARG D NH2   1 
ATOM   2214 N  N     . THR D 1 86  ? -42.536 71.513 -238.966 1.00 28.95 ? 404 THR D N     1 
ATOM   2215 C  CA    . THR D 1 86  ? -42.598 72.902 -239.402 1.00 27.45 ? 404 THR D CA    1 
ATOM   2216 C  C     . THR D 1 86  ? -43.876 73.199 -240.177 1.00 33.69 ? 404 THR D C     1 
ATOM   2217 O  O     . THR D 1 86  ? -44.304 74.357 -240.222 1.00 38.92 ? 404 THR D O     1 
ATOM   2218 C  CB    . THR D 1 86  ? -41.378 73.248 -240.258 1.00 26.40 ? 404 THR D CB    1 
ATOM   2219 O  OG1   . THR D 1 86  ? -41.466 72.570 -241.518 1.00 32.17 ? 404 THR D OG1   1 
ATOM   2220 C  CG2   . THR D 1 86  ? -40.096 72.823 -239.552 1.00 27.36 ? 404 THR D CG2   1 
ATOM   2221 N  N     . HIS D 1 87  ? -44.490 72.185 -240.787 1.00 33.07 ? 405 HIS D N     1 
ATOM   2222 C  CA    . HIS D 1 87  ? -45.773 72.357 -241.456 1.00 35.51 ? 405 HIS D CA    1 
ATOM   2223 C  C     . HIS D 1 87  ? -46.937 72.185 -240.486 1.00 38.26 ? 405 HIS D C     1 
ATOM   2224 O  O     . HIS D 1 87  ? -47.869 72.994 -240.475 1.00 44.27 ? 405 HIS D O     1 
ATOM   2225 C  CB    . HIS D 1 87  ? -45.913 71.360 -242.611 1.00 34.91 ? 405 HIS D CB    1 
ATOM   2226 C  CG    . HIS D 1 87  ? -44.896 71.536 -243.696 1.00 31.88 ? 405 HIS D CG    1 
ATOM   2227 N  ND1   . HIS D 1 87  ? -44.726 72.725 -244.371 1.00 34.20 ? 405 HIS D ND1   1 
ATOM   2228 C  CD2   . HIS D 1 87  ? -44.009 70.667 -244.234 1.00 31.20 ? 405 HIS D CD2   1 
ATOM   2229 C  CE1   . HIS D 1 87  ? -43.770 72.583 -245.273 1.00 35.69 ? 405 HIS D CE1   1 
ATOM   2230 N  NE2   . HIS D 1 87  ? -43.319 71.343 -245.210 1.00 32.47 ? 405 HIS D NE2   1 
ATOM   2231 N  N     . THR D 1 88  ? -46.892 71.134 -239.666 1.00 39.88 ? 406 THR D N     1 
ATOM   2232 C  CA    . THR D 1 88  ? -48.000 70.814 -238.777 1.00 42.82 ? 406 THR D CA    1 
ATOM   2233 C  C     . THR D 1 88  ? -48.047 71.699 -237.540 1.00 44.76 ? 406 THR D C     1 
ATOM   2234 O  O     . THR D 1 88  ? -49.099 71.786 -236.898 1.00 46.10 ? 406 THR D O     1 
ATOM   2235 C  CB    . THR D 1 88  ? -47.918 69.349 -238.344 1.00 38.91 ? 406 THR D CB    1 
ATOM   2236 O  OG1   . THR D 1 88  ? -46.742 69.149 -237.551 1.00 37.26 ? 406 THR D OG1   1 
ATOM   2237 C  CG2   . THR D 1 88  ? -47.861 68.439 -239.561 1.00 38.53 ? 406 THR D CG2   1 
ATOM   2238 N  N     . GLY D 1 89  ? -46.942 72.354 -237.192 1.00 44.94 ? 407 GLY D N     1 
ATOM   2239 C  CA    . GLY D 1 89  ? -46.890 73.148 -235.984 1.00 46.36 ? 407 GLY D CA    1 
ATOM   2240 C  C     . GLY D 1 89  ? -46.754 72.355 -234.705 1.00 46.42 ? 407 GLY D C     1 
ATOM   2241 O  O     . GLY D 1 89  ? -46.867 72.938 -233.620 1.00 45.80 ? 407 GLY D O     1 
ATOM   2242 N  N     . GLU D 1 90  ? -46.521 71.047 -234.795 1.00 40.92 ? 408 GLU D N     1 
ATOM   2243 C  CA    . GLU D 1 90  ? -46.355 70.225 -233.604 1.00 44.11 ? 408 GLU D CA    1 
ATOM   2244 C  C     . GLU D 1 90  ? -45.067 70.599 -232.881 1.00 46.03 ? 408 GLU D C     1 
ATOM   2245 O  O     . GLU D 1 90  ? -43.997 70.676 -233.494 1.00 46.65 ? 408 GLU D O     1 
ATOM   2246 C  CB    . GLU D 1 90  ? -46.339 68.745 -233.980 1.00 45.12 ? 408 GLU D CB    1 
ATOM   2247 C  CG    . GLU D 1 90  ? -46.114 67.809 -232.803 1.00 50.33 ? 408 GLU D CG    1 
ATOM   2248 C  CD    . GLU D 1 90  ? -45.972 66.360 -233.226 1.00 55.67 ? 408 GLU D CD    1 
ATOM   2249 O  OE1   . GLU D 1 90  ? -45.901 66.099 -234.445 1.00 59.59 ? 408 GLU D OE1   1 
ATOM   2250 O  OE2   . GLU D 1 90  ? -45.932 65.481 -232.339 1.00 56.16 ? 408 GLU D OE2   1 
ATOM   2251 N  N     . LYS D 1 91  ? -45.172 70.837 -231.575 1.00 41.94 ? 409 LYS D N     1 
ATOM   2252 C  CA    . LYS D 1 91  ? -44.030 71.241 -230.756 1.00 40.39 ? 409 LYS D CA    1 
ATOM   2253 C  C     . LYS D 1 91  ? -44.092 70.486 -229.436 1.00 42.80 ? 409 LYS D C     1 
ATOM   2254 O  O     . LYS D 1 91  ? -44.687 70.957 -228.458 1.00 49.31 ? 409 LYS D O     1 
ATOM   2255 C  CB    . LYS D 1 91  ? -44.017 72.754 -230.531 1.00 42.23 ? 409 LYS D CB    1 
ATOM   2256 C  CG    . LYS D 1 91  ? -43.915 73.565 -231.816 1.00 41.12 ? 409 LYS D CG    1 
ATOM   2257 C  CD    . LYS D 1 91  ? -44.040 75.057 -231.561 1.00 44.11 ? 409 LYS D CD    1 
ATOM   2258 C  CE    . LYS D 1 91  ? -43.993 75.834 -232.868 1.00 43.08 ? 409 LYS D CE    1 
ATOM   2259 N  NZ    . LYS D 1 91  ? -44.090 77.303 -232.654 1.00 50.96 ? 409 LYS D NZ    1 
ATOM   2260 N  N     . PRO D 1 92  ? -43.480 69.299 -229.371 1.00 36.01 ? 410 PRO D N     1 
ATOM   2261 C  CA    . PRO D 1 92  ? -43.625 68.451 -228.179 1.00 37.02 ? 410 PRO D CA    1 
ATOM   2262 C  C     . PRO D 1 92  ? -42.793 68.884 -226.982 1.00 37.74 ? 410 PRO D C     1 
ATOM   2263 O  O     . PRO D 1 92  ? -42.996 68.341 -225.888 1.00 44.26 ? 410 PRO D O     1 
ATOM   2264 C  CB    . PRO D 1 92  ? -43.170 67.066 -228.677 1.00 36.35 ? 410 PRO D CB    1 
ATOM   2265 C  CG    . PRO D 1 92  ? -43.079 67.178 -230.181 1.00 32.48 ? 410 PRO D CG    1 
ATOM   2266 C  CD    . PRO D 1 92  ? -42.762 68.609 -230.453 1.00 33.80 ? 410 PRO D CD    1 
ATOM   2267 N  N     . PHE D 1 93  ? -41.873 69.831 -227.140 1.00 34.50 ? 411 PHE D N     1 
ATOM   2268 C  CA    . PHE D 1 93  ? -40.954 70.220 -226.077 1.00 36.92 ? 411 PHE D CA    1 
ATOM   2269 C  C     . PHE D 1 93  ? -41.363 71.580 -225.528 1.00 40.14 ? 411 PHE D C     1 
ATOM   2270 O  O     . PHE D 1 93  ? -41.349 72.578 -226.256 1.00 42.43 ? 411 PHE D O     1 
ATOM   2271 C  CB    . PHE D 1 93  ? -39.515 70.249 -226.592 1.00 36.27 ? 411 PHE D CB    1 
ATOM   2272 C  CG    . PHE D 1 93  ? -39.054 68.936 -227.155 1.00 34.16 ? 411 PHE D CG    1 
ATOM   2273 C  CD1   . PHE D 1 93  ? -38.491 67.973 -226.333 1.00 37.95 ? 411 PHE D CD1   1 
ATOM   2274 C  CD2   . PHE D 1 93  ? -39.194 68.658 -228.505 1.00 29.57 ? 411 PHE D CD2   1 
ATOM   2275 C  CE1   . PHE D 1 93  ? -38.072 66.761 -226.848 1.00 43.06 ? 411 PHE D CE1   1 
ATOM   2276 C  CE2   . PHE D 1 93  ? -38.776 67.448 -229.025 1.00 36.30 ? 411 PHE D CE2   1 
ATOM   2277 C  CZ    . PHE D 1 93  ? -38.214 66.499 -228.196 1.00 41.08 ? 411 PHE D CZ    1 
ATOM   2278 N  N     . SER D 1 94  ? -41.716 71.616 -224.245 1.00 38.10 ? 412 SER D N     1 
ATOM   2279 C  CA    . SER D 1 94  ? -42.223 72.814 -223.593 1.00 40.56 ? 412 SER D CA    1 
ATOM   2280 C  C     . SER D 1 94  ? -41.185 73.373 -222.629 1.00 44.19 ? 412 SER D C     1 
ATOM   2281 O  O     . SER D 1 94  ? -40.499 72.618 -221.932 1.00 42.81 ? 412 SER D O     1 
ATOM   2282 C  CB    . SER D 1 94  ? -43.523 72.518 -222.838 1.00 42.47 ? 412 SER D CB    1 
ATOM   2283 O  OG    . SER D 1 94  ? -44.517 72.011 -223.711 1.00 50.76 ? 412 SER D OG    1 
ATOM   2284 N  N     . CYS D 1 95  ? -41.081 74.698 -222.590 1.00 41.86 ? 413 CYS D N     1 
ATOM   2285 C  CA    . CYS D 1 95  ? -40.171 75.348 -221.657 1.00 46.95 ? 413 CYS D CA    1 
ATOM   2286 C  C     . CYS D 1 95  ? -40.672 75.182 -220.229 1.00 49.57 ? 413 CYS D C     1 
ATOM   2287 O  O     . CYS D 1 95  ? -41.875 75.248 -219.962 1.00 51.70 ? 413 CYS D O     1 
ATOM   2288 C  CB    . CYS D 1 95  ? -40.028 76.830 -221.997 1.00 50.04 ? 413 CYS D CB    1 
ATOM   2289 S  SG    . CYS D 1 95  ? -39.023 77.764 -220.822 1.00 49.51 ? 413 CYS D SG    1 
ATOM   2290 N  N     . ARG D 1 96  ? -39.738 74.968 -219.306 1.00 53.96 ? 414 ARG D N     1 
ATOM   2291 C  CA    . ARG D 1 96  ? -40.065 74.736 -217.907 1.00 61.05 ? 414 ARG D CA    1 
ATOM   2292 C  C     . ARG D 1 96  ? -39.895 75.975 -217.040 1.00 67.43 ? 414 ARG D C     1 
ATOM   2293 O  O     . ARG D 1 96  ? -40.060 75.887 -215.819 1.00 69.75 ? 414 ARG D O     1 
ATOM   2294 C  CB    . ARG D 1 96  ? -39.214 73.589 -217.354 1.00 65.09 ? 414 ARG D CB    1 
ATOM   2295 C  CG    . ARG D 1 96  ? -39.655 72.220 -217.848 1.00 69.91 ? 414 ARG D CG    1 
ATOM   2296 C  CD    . ARG D 1 96  ? -38.721 71.117 -217.382 1.00 78.14 ? 414 ARG D CD    1 
ATOM   2297 N  NE    . ARG D 1 96  ? -37.540 70.998 -218.232 1.00 83.64 ? 414 ARG D NE    1 
ATOM   2298 C  CZ    . ARG D 1 96  ? -37.490 70.264 -219.338 1.00 84.54 ? 414 ARG D CZ    1 
ATOM   2299 N  NH1   . ARG D 1 96  ? -38.557 69.582 -219.733 1.00 84.56 ? 414 ARG D NH1   1 
ATOM   2300 N  NH2   . ARG D 1 96  ? -36.374 70.210 -220.052 1.00 82.90 ? 414 ARG D NH2   1 
ATOM   2301 N  N     . TRP D 1 97  ? -39.573 77.124 -217.638 1.00 62.97 ? 415 TRP D N     1 
ATOM   2302 C  CA    . TRP D 1 97  ? -39.506 78.363 -216.881 1.00 61.25 ? 415 TRP D CA    1 
ATOM   2303 C  C     . TRP D 1 97  ? -40.917 78.882 -216.597 1.00 67.64 ? 415 TRP D C     1 
ATOM   2304 O  O     . TRP D 1 97  ? -41.822 78.721 -217.415 1.00 67.73 ? 415 TRP D O     1 
ATOM   2305 C  CB    . TRP D 1 97  ? -38.706 79.415 -217.646 1.00 60.85 ? 415 TRP D CB    1 
ATOM   2306 N  N     . PRO D 1 98  ? -41.121 79.501 -215.434 1.00 80.52 ? 416 PRO D N     1 
ATOM   2307 C  CA    . PRO D 1 98  ? -42.473 79.950 -215.077 1.00 87.43 ? 416 PRO D CA    1 
ATOM   2308 C  C     . PRO D 1 98  ? -42.955 81.077 -215.973 1.00 91.71 ? 416 PRO D C     1 
ATOM   2309 O  O     . PRO D 1 98  ? -42.175 81.903 -216.452 1.00 96.27 ? 416 PRO D O     1 
ATOM   2310 C  CB    . PRO D 1 98  ? -42.307 80.424 -213.627 1.00 90.15 ? 416 PRO D CB    1 
ATOM   2311 C  CG    . PRO D 1 98  ? -40.865 80.774 -213.506 1.00 88.81 ? 416 PRO D CG    1 
ATOM   2312 C  CD    . PRO D 1 98  ? -40.136 79.797 -214.382 1.00 84.91 ? 416 PRO D CD    1 
ATOM   2313 N  N     . SER D 1 99  ? -44.270 81.093 -216.202 1.00 87.71 ? 417 SER D N     1 
ATOM   2314 C  CA    . SER D 1 99  ? -44.958 82.130 -216.970 1.00 81.35 ? 417 SER D CA    1 
ATOM   2315 C  C     . SER D 1 99  ? -44.516 82.170 -218.428 1.00 75.86 ? 417 SER D C     1 
ATOM   2316 O  O     . SER D 1 99  ? -44.758 83.161 -219.126 1.00 78.12 ? 417 SER D O     1 
ATOM   2317 C  CB    . SER D 1 99  ? -44.779 83.511 -216.328 1.00 81.21 ? 417 SER D CB    1 
ATOM   2318 N  N     . CYS D 1 100 ? -43.867 81.112 -218.907 1.00 70.35 ? 418 CYS D N     1 
ATOM   2319 C  CA    . CYS D 1 100 ? -43.419 81.018 -220.291 1.00 63.84 ? 418 CYS D CA    1 
ATOM   2320 C  C     . CYS D 1 100 ? -44.005 79.758 -220.908 1.00 63.09 ? 418 CYS D C     1 
ATOM   2321 O  O     . CYS D 1 100 ? -43.677 78.646 -220.482 1.00 63.63 ? 418 CYS D O     1 
ATOM   2322 C  CB    . CYS D 1 100 ? -41.893 81.000 -220.386 1.00 57.60 ? 418 CYS D CB    1 
ATOM   2323 S  SG    . CYS D 1 100 ? -41.270 80.925 -222.085 1.00 54.02 ? 418 CYS D SG    1 
ATOM   2324 N  N     . GLN D 1 101 ? -44.862 79.935 -221.913 1.00 64.02 ? 419 GLN D N     1 
ATOM   2325 C  CA    . GLN D 1 101 ? -45.511 78.828 -222.605 1.00 66.64 ? 419 GLN D CA    1 
ATOM   2326 C  C     . GLN D 1 101 ? -44.860 78.525 -223.951 1.00 64.20 ? 419 GLN D C     1 
ATOM   2327 O  O     . GLN D 1 101 ? -45.529 78.041 -224.870 1.00 68.68 ? 419 GLN D O     1 
ATOM   2328 C  CB    . GLN D 1 101 ? -46.999 79.124 -222.790 1.00 69.33 ? 419 GLN D CB    1 
ATOM   2329 N  N     . LYS D 1 102 ? -43.563 78.796 -224.083 1.00 57.54 ? 420 LYS D N     1 
ATOM   2330 C  CA    . LYS D 1 102 ? -42.873 78.564 -225.344 1.00 52.86 ? 420 LYS D CA    1 
ATOM   2331 C  C     . LYS D 1 102 ? -42.684 77.071 -225.581 1.00 51.43 ? 420 LYS D C     1 
ATOM   2332 O  O     . LYS D 1 102 ? -42.227 76.343 -224.694 1.00 52.65 ? 420 LYS D O     1 
ATOM   2333 C  CB    . LYS D 1 102 ? -41.522 79.277 -225.348 1.00 48.20 ? 420 LYS D CB    1 
ATOM   2334 N  N     . LYS D 1 103 ? -43.037 76.618 -226.780 1.00 44.11 ? 421 LYS D N     1 
ATOM   2335 C  CA    . LYS D 1 103 ? -42.872 75.231 -227.182 1.00 38.44 ? 421 LYS D CA    1 
ATOM   2336 C  C     . LYS D 1 103 ? -41.996 75.161 -228.426 1.00 37.42 ? 421 LYS D C     1 
ATOM   2337 O  O     . LYS D 1 103 ? -41.865 76.135 -229.173 1.00 36.92 ? 421 LYS D O     1 
ATOM   2338 C  CB    . LYS D 1 103 ? -44.225 74.557 -227.445 1.00 41.62 ? 421 LYS D CB    1 
ATOM   2339 C  CG    . LYS D 1 103 ? -45.112 74.442 -226.218 1.00 49.36 ? 421 LYS D CG    1 
ATOM   2340 C  CD    . LYS D 1 103 ? -46.271 73.493 -226.465 1.00 55.49 ? 421 LYS D CD    1 
ATOM   2341 C  CE    . LYS D 1 103 ? -47.096 73.305 -225.206 1.00 63.12 ? 421 LYS D CE    1 
ATOM   2342 N  NZ    . LYS D 1 103 ? -48.124 72.242 -225.369 1.00 66.45 ? 421 LYS D NZ    1 
ATOM   2343 N  N     . PHE D 1 104 ? -41.386 73.995 -228.641 1.00 36.11 ? 422 PHE D N     1 
ATOM   2344 C  CA    . PHE D 1 104 ? -40.410 73.826 -229.708 1.00 35.23 ? 422 PHE D CA    1 
ATOM   2345 C  C     . PHE D 1 104 ? -40.548 72.446 -230.334 1.00 33.73 ? 422 PHE D C     1 
ATOM   2346 O  O     . PHE D 1 104 ? -41.006 71.495 -229.695 1.00 32.03 ? 422 PHE D O     1 
ATOM   2347 C  CB    . PHE D 1 104 ? -38.980 74.034 -229.191 1.00 34.59 ? 422 PHE D CB    1 
ATOM   2348 C  CG    . PHE D 1 104 ? -38.738 75.409 -228.643 1.00 33.94 ? 422 PHE D CG    1 
ATOM   2349 C  CD1   . PHE D 1 104 ? -38.318 76.434 -229.473 1.00 35.90 ? 422 PHE D CD1   1 
ATOM   2350 C  CD2   . PHE D 1 104 ? -38.952 75.682 -227.303 1.00 36.75 ? 422 PHE D CD2   1 
ATOM   2351 C  CE1   . PHE D 1 104 ? -38.105 77.704 -228.975 1.00 40.12 ? 422 PHE D CE1   1 
ATOM   2352 C  CE2   . PHE D 1 104 ? -38.744 76.949 -226.801 1.00 39.04 ? 422 PHE D CE2   1 
ATOM   2353 C  CZ    . PHE D 1 104 ? -38.319 77.962 -227.639 1.00 43.00 ? 422 PHE D CZ    1 
ATOM   2354 N  N     . ALA D 1 105 ? -40.130 72.349 -231.598 1.00 31.93 ? 423 ALA D N     1 
ATOM   2355 C  CA    . ALA D 1 105 ? -40.292 71.114 -232.355 1.00 31.01 ? 423 ALA D CA    1 
ATOM   2356 C  C     . ALA D 1 105 ? -39.229 70.077 -232.019 1.00 28.00 ? 423 ALA D C     1 
ATOM   2357 O  O     . ALA D 1 105 ? -39.487 68.874 -232.143 1.00 30.48 ? 423 ALA D O     1 
ATOM   2358 C  CB    . ALA D 1 105 ? -40.271 71.414 -233.855 1.00 31.42 ? 423 ALA D CB    1 
ATOM   2359 N  N     . ARG D 1 106 ? -38.040 70.507 -231.603 1.00 26.84 ? 424 ARG D N     1 
ATOM   2360 C  CA    . ARG D 1 106 ? -36.935 69.593 -231.359 1.00 26.74 ? 424 ARG D CA    1 
ATOM   2361 C  C     . ARG D 1 106 ? -36.359 69.829 -229.970 1.00 30.27 ? 424 ARG D C     1 
ATOM   2362 O  O     . ARG D 1 106 ? -36.484 70.915 -229.396 1.00 30.44 ? 424 ARG D O     1 
ATOM   2363 C  CB    . ARG D 1 106 ? -35.838 69.747 -232.425 1.00 27.37 ? 424 ARG D CB    1 
ATOM   2364 C  CG    . ARG D 1 106 ? -36.374 69.944 -233.835 1.00 27.79 ? 424 ARG D CG    1 
ATOM   2365 C  CD    . ARG D 1 106 ? -35.300 69.762 -234.895 1.00 23.56 ? 424 ARG D CD    1 
ATOM   2366 N  NE    . ARG D 1 106 ? -34.023 70.362 -234.513 1.00 22.87 ? 424 ARG D NE    1 
ATOM   2367 C  CZ    . ARG D 1 106 ? -33.099 70.764 -235.381 1.00 22.39 ? 424 ARG D CZ    1 
ATOM   2368 N  NH1   . ARG D 1 106 ? -33.316 70.650 -236.685 1.00 21.81 ? 424 ARG D NH1   1 
ATOM   2369 N  NH2   . ARG D 1 106 ? -31.963 71.291 -234.948 1.00 22.83 ? 424 ARG D NH2   1 
ATOM   2370 N  N     . SER D 1 107 ? -35.723 68.783 -229.433 1.00 28.31 ? 425 SER D N     1 
ATOM   2371 C  CA    . SER D 1 107 ? -35.176 68.861 -228.082 1.00 34.79 ? 425 SER D CA    1 
ATOM   2372 C  C     . SER D 1 107 ? -34.020 69.850 -228.003 1.00 33.79 ? 425 SER D C     1 
ATOM   2373 O  O     . SER D 1 107 ? -33.899 70.592 -227.021 1.00 33.31 ? 425 SER D O     1 
ATOM   2374 C  CB    . SER D 1 107 ? -34.726 67.478 -227.616 1.00 40.43 ? 425 SER D CB    1 
ATOM   2375 O  OG    . SER D 1 107 ? -33.678 66.978 -228.431 1.00 42.99 ? 425 SER D OG    1 
ATOM   2376 N  N     . ASP D 1 108 ? -33.152 69.868 -229.018 1.00 29.90 ? 426 ASP D N     1 
ATOM   2377 C  CA    . ASP D 1 108 ? -32.022 70.790 -228.999 1.00 31.20 ? 426 ASP D CA    1 
ATOM   2378 C  C     . ASP D 1 108 ? -32.460 72.243 -229.128 1.00 29.79 ? 426 ASP D C     1 
ATOM   2379 O  O     . ASP D 1 108 ? -31.710 73.140 -228.730 1.00 33.91 ? 426 ASP D O     1 
ATOM   2380 C  CB    . ASP D 1 108 ? -31.024 70.437 -230.106 1.00 29.42 ? 426 ASP D CB    1 
ATOM   2381 C  CG    . ASP D 1 108 ? -31.641 70.471 -231.489 1.00 32.70 ? 426 ASP D CG    1 
ATOM   2382 O  OD1   . ASP D 1 108 ? -32.784 69.998 -231.645 1.00 31.45 ? 426 ASP D OD1   1 
ATOM   2383 O  OD2   . ASP D 1 108 ? -30.980 70.973 -232.422 1.00 33.71 ? 426 ASP D OD2   1 
ATOM   2384 N  N     . GLU D 1 109 ? -33.653 72.496 -229.669 1.00 33.13 ? 427 GLU D N     1 
ATOM   2385 C  CA    . GLU D 1 109 ? -34.179 73.857 -229.674 1.00 30.44 ? 427 GLU D CA    1 
ATOM   2386 C  C     . GLU D 1 109 ? -34.606 74.280 -228.276 1.00 30.57 ? 427 GLU D C     1 
ATOM   2387 O  O     . GLU D 1 109 ? -34.417 75.439 -227.884 1.00 31.95 ? 427 GLU D O     1 
ATOM   2388 C  CB    . GLU D 1 109 ? -35.347 73.966 -230.653 1.00 30.82 ? 427 GLU D CB    1 
ATOM   2389 C  CG    . GLU D 1 109 ? -34.947 73.833 -232.117 1.00 27.12 ? 427 GLU D CG    1 
ATOM   2390 C  CD    . GLU D 1 109 ? -36.145 73.703 -233.040 1.00 37.38 ? 427 GLU D CD    1 
ATOM   2391 O  OE1   . GLU D 1 109 ? -37.239 73.363 -232.545 1.00 37.33 ? 427 GLU D OE1   1 
ATOM   2392 O  OE2   . GLU D 1 109 ? -35.994 73.942 -234.257 1.00 34.14 ? 427 GLU D OE2   1 
ATOM   2393 N  N     . LEU D 1 110 ? -35.182 73.351 -227.507 1.00 30.78 ? 428 LEU D N     1 
ATOM   2394 C  CA    . LEU D 1 110 ? -35.541 73.654 -226.126 1.00 32.60 ? 428 LEU D CA    1 
ATOM   2395 C  C     . LEU D 1 110 ? -34.304 73.867 -225.262 1.00 33.57 ? 428 LEU D C     1 
ATOM   2396 O  O     . LEU D 1 110 ? -34.330 74.685 -224.335 1.00 35.32 ? 428 LEU D O     1 
ATOM   2397 C  CB    . LEU D 1 110 ? -36.408 72.532 -225.550 1.00 32.83 ? 428 LEU D CB    1 
ATOM   2398 C  CG    . LEU D 1 110 ? -36.791 72.642 -224.072 1.00 34.87 ? 428 LEU D CG    1 
ATOM   2399 C  CD1   . LEU D 1 110 ? -37.567 73.921 -223.815 1.00 39.69 ? 428 LEU D CD1   1 
ATOM   2400 C  CD2   . LEU D 1 110 ? -37.590 71.426 -223.620 1.00 35.25 ? 428 LEU D CD2   1 
ATOM   2401 N  N     . VAL D 1 111 ? -33.217 73.147 -225.549 1.00 34.22 ? 429 VAL D N     1 
ATOM   2402 C  CA    . VAL D 1 111 ? -31.991 73.298 -224.768 1.00 39.87 ? 429 VAL D CA    1 
ATOM   2403 C  C     . VAL D 1 111 ? -31.444 74.714 -224.906 1.00 39.46 ? 429 VAL D C     1 
ATOM   2404 O  O     . VAL D 1 111 ? -31.080 75.358 -223.915 1.00 43.54 ? 429 VAL D O     1 
ATOM   2405 C  CB    . VAL D 1 111 ? -30.952 72.246 -225.194 1.00 42.51 ? 429 VAL D CB    1 
ATOM   2406 C  CG1   . VAL D 1 111 ? -29.611 72.537 -224.541 1.00 42.82 ? 429 VAL D CG1   1 
ATOM   2407 C  CG2   . VAL D 1 111 ? -31.439 70.849 -224.835 1.00 40.50 ? 429 VAL D CG2   1 
ATOM   2408 N  N     . ARG D 1 112 ? -31.382 75.221 -226.140 1.00 37.73 ? 430 ARG D N     1 
ATOM   2409 C  CA    . ARG D 1 112 ? -30.914 76.588 -226.352 1.00 37.91 ? 430 ARG D CA    1 
ATOM   2410 C  C     . ARG D 1 112 ? -31.870 77.601 -225.736 1.00 39.84 ? 430 ARG D C     1 
ATOM   2411 O  O     . ARG D 1 112 ? -31.438 78.640 -225.223 1.00 41.76 ? 430 ARG D O     1 
ATOM   2412 C  CB    . ARG D 1 112 ? -30.737 76.862 -227.845 1.00 42.33 ? 430 ARG D CB    1 
ATOM   2413 C  CG    . ARG D 1 112 ? -29.555 76.149 -228.477 1.00 51.63 ? 430 ARG D CG    1 
ATOM   2414 C  CD    . ARG D 1 112 ? -29.408 76.526 -229.942 1.00 52.63 ? 430 ARG D CD    1 
ATOM   2415 N  NE    . ARG D 1 112 ? -28.248 75.891 -230.560 1.00 50.54 ? 430 ARG D NE    1 
ATOM   2416 C  CZ    . ARG D 1 112 ? -27.948 75.982 -231.851 1.00 45.09 ? 430 ARG D CZ    1 
ATOM   2417 N  NH1   . ARG D 1 112 ? -28.727 76.681 -232.666 1.00 43.09 ? 430 ARG D NH1   1 
ATOM   2418 N  NH2   . ARG D 1 112 ? -26.873 75.372 -232.329 1.00 42.80 ? 430 ARG D NH2   1 
ATOM   2419 N  N     . HIS D 1 113 ? -33.174 77.317 -225.778 1.00 38.03 ? 431 HIS D N     1 
ATOM   2420 C  CA    . HIS D 1 113 ? -34.146 78.214 -225.162 1.00 39.89 ? 431 HIS D CA    1 
ATOM   2421 C  C     . HIS D 1 113 ? -33.988 78.242 -223.648 1.00 41.06 ? 431 HIS D C     1 
ATOM   2422 O  O     . HIS D 1 113 ? -34.134 79.297 -223.021 1.00 46.32 ? 431 HIS D O     1 
ATOM   2423 C  CB    . HIS D 1 113 ? -35.562 77.792 -225.544 1.00 37.30 ? 431 HIS D CB    1 
ATOM   2424 C  CG    . HIS D 1 113 ? -36.633 78.645 -224.938 1.00 45.04 ? 431 HIS D CG    1 
ATOM   2425 N  ND1   . HIS D 1 113 ? -36.893 79.929 -225.367 1.00 48.43 ? 431 HIS D ND1   1 
ATOM   2426 C  CD2   . HIS D 1 113 ? -37.517 78.394 -223.944 1.00 46.42 ? 431 HIS D CD2   1 
ATOM   2427 C  CE1   . HIS D 1 113 ? -37.890 80.433 -224.660 1.00 51.07 ? 431 HIS D CE1   1 
ATOM   2428 N  NE2   . HIS D 1 113 ? -38.287 79.521 -223.791 1.00 54.96 ? 431 HIS D NE2   1 
ATOM   2429 N  N     . HIS D 1 114 ? -33.699 77.088 -223.041 1.00 40.36 ? 432 HIS D N     1 
ATOM   2430 C  CA    . HIS D 1 114 ? -33.447 77.055 -221.605 1.00 44.92 ? 432 HIS D CA    1 
ATOM   2431 C  C     . HIS D 1 114 ? -32.190 77.837 -221.251 1.00 51.00 ? 432 HIS D C     1 
ATOM   2432 O  O     . HIS D 1 114 ? -32.160 78.559 -220.247 1.00 50.09 ? 432 HIS D O     1 
ATOM   2433 C  CB    . HIS D 1 114 ? -33.337 75.608 -221.123 1.00 43.81 ? 432 HIS D CB    1 
ATOM   2434 C  CG    . HIS D 1 114 ? -34.659 74.957 -220.860 1.00 45.39 ? 432 HIS D CG    1 
ATOM   2435 N  ND1   . HIS D 1 114 ? -34.808 73.591 -220.755 1.00 47.24 ? 432 HIS D ND1   1 
ATOM   2436 C  CD2   . HIS D 1 114 ? -35.892 75.485 -220.669 1.00 49.00 ? 432 HIS D CD2   1 
ATOM   2437 C  CE1   . HIS D 1 114 ? -36.075 73.305 -220.516 1.00 46.48 ? 432 HIS D CE1   1 
ATOM   2438 N  NE2   . HIS D 1 114 ? -36.754 74.437 -220.459 1.00 47.40 ? 432 HIS D NE2   1 
ATOM   2439 N  N     . ASN D 1 115 ? -31.139 77.706 -222.065 1.00 54.79 ? 433 ASN D N     1 
ATOM   2440 C  CA    . ASN D 1 115 ? -29.939 78.507 -221.851 1.00 59.25 ? 433 ASN D CA    1 
ATOM   2441 C  C     . ASN D 1 115 ? -30.210 79.986 -222.084 1.00 59.58 ? 433 ASN D C     1 
ATOM   2442 O  O     . ASN D 1 115 ? -29.533 80.841 -221.502 1.00 57.88 ? 433 ASN D O     1 
ATOM   2443 C  CB    . ASN D 1 115 ? -28.811 78.027 -222.763 1.00 57.49 ? 433 ASN D CB    1 
ATOM   2444 C  CG    . ASN D 1 115 ? -28.414 76.590 -222.494 1.00 54.15 ? 433 ASN D CG    1 
ATOM   2445 O  OD1   . ASN D 1 115 ? -28.604 76.077 -221.391 1.00 57.10 ? 433 ASN D OD1   1 
ATOM   2446 N  ND2   . ASN D 1 115 ? -27.855 75.933 -223.503 1.00 53.30 ? 433 ASN D ND2   1 
ATOM   2447 N  N     . MET D 1 116 ? -31.191 80.308 -222.931 1.00 62.24 ? 434 MET D N     1 
ATOM   2448 C  CA    . MET D 1 116 ? -31.540 81.705 -223.161 1.00 68.33 ? 434 MET D CA    1 
ATOM   2449 C  C     . MET D 1 116 ? -32.051 82.356 -221.882 1.00 73.47 ? 434 MET D C     1 
ATOM   2450 O  O     . MET D 1 116 ? -31.790 83.540 -221.631 1.00 78.97 ? 434 MET D O     1 
ATOM   2451 C  CB    . MET D 1 116 ? -32.576 81.805 -224.283 1.00 69.23 ? 434 MET D CB    1 
ATOM   2452 C  CG    . MET D 1 116 ? -32.918 83.222 -224.705 1.00 77.78 ? 434 MET D CG    1 
ATOM   2453 S  SD    . MET D 1 116 ? -34.253 83.950 -223.738 1.00 84.98 ? 434 MET D SD    1 
ATOM   2454 C  CE    . MET D 1 116 ? -34.007 85.684 -224.101 1.00 88.77 ? 434 MET D CE    1 
ATOM   2455 N  N     . HIS D 1 117 ? -32.779 81.596 -221.057 1.00 70.22 ? 435 HIS D N     1 
ATOM   2456 C  CA    . HIS D 1 117 ? -33.203 82.081 -219.749 1.00 72.61 ? 435 HIS D CA    1 
ATOM   2457 C  C     . HIS D 1 117 ? -32.065 82.118 -218.740 1.00 79.22 ? 435 HIS D C     1 
ATOM   2458 O  O     . HIS D 1 117 ? -32.238 82.703 -217.664 1.00 81.75 ? 435 HIS D O     1 
ATOM   2459 C  CB    . HIS D 1 117 ? -34.318 81.201 -219.182 1.00 68.41 ? 435 HIS D CB    1 
ATOM   2460 C  CG    . HIS D 1 117 ? -35.555 81.158 -220.023 1.00 72.50 ? 435 HIS D CG    1 
ATOM   2461 N  ND1   . HIS D 1 117 ? -36.377 82.251 -220.198 1.00 74.29 ? 435 HIS D ND1   1 
ATOM   2462 C  CD2   . HIS D 1 117 ? -36.125 80.145 -220.717 1.00 70.93 ? 435 HIS D CD2   1 
ATOM   2463 C  CE1   . HIS D 1 117 ? -37.393 81.916 -220.974 1.00 74.25 ? 435 HIS D CE1   1 
ATOM   2464 N  NE2   . HIS D 1 117 ? -37.263 80.643 -221.301 1.00 74.03 ? 435 HIS D NE2   1 
ATOM   2465 N  N     . GLN D 1 118 ? -30.920 81.519 -219.061 1.00 82.95 ? 436 GLN D N     1 
ATOM   2466 C  CA    . GLN D 1 118 ? -29.852 81.261 -218.093 1.00 85.04 ? 436 GLN D CA    1 
ATOM   2467 C  C     . GLN D 1 118 ? -30.385 80.440 -216.924 1.00 87.39 ? 436 GLN D C     1 
ATOM   2468 O  O     . GLN D 1 118 ? -30.302 79.210 -216.922 1.00 85.50 ? 436 GLN D O     1 
ATOM   2469 C  CB    . GLN D 1 118 ? -29.224 82.562 -217.579 1.00 87.20 ? 436 GLN D CB    1 
ATOM   2470 C  CG    . GLN D 1 118 ? -28.163 83.156 -218.486 1.00 85.20 ? 436 GLN D CG    1 
ATOM   2471 C  CD    . GLN D 1 118 ? -28.737 84.103 -219.517 1.00 84.77 ? 436 GLN D CD    1 
ATOM   2472 O  OE1   . GLN D 1 118 ? -29.943 84.348 -219.549 1.00 85.01 ? 436 GLN D OE1   1 
ATOM   2473 N  NE2   . GLN D 1 118 ? -27.873 84.646 -220.365 1.00 85.28 ? 436 GLN D NE2   1 
ATOM   2474 O  "O5'" . DA  E 2 1   ? -32.089 81.366 -232.275 1.00 39.50 ? 1   DA  E "O5'" 1 
ATOM   2475 C  "C5'" . DA  E 2 1   ? -32.957 82.374 -231.771 1.00 36.79 ? 1   DA  E "C5'" 1 
ATOM   2476 C  "C4'" . DA  E 2 1   ? -34.178 82.535 -232.661 1.00 35.41 ? 1   DA  E "C4'" 1 
ATOM   2477 O  "O4'" . DA  E 2 1   ? -33.764 82.991 -233.978 1.00 33.87 ? 1   DA  E "O4'" 1 
ATOM   2478 C  "C3'" . DA  E 2 1   ? -34.983 81.257 -232.897 1.00 32.82 ? 1   DA  E "C3'" 1 
ATOM   2479 O  "O3'" . DA  E 2 1   ? -36.372 81.563 -232.944 1.00 37.32 ? 1   DA  E "O3'" 1 
ATOM   2480 C  "C2'" . DA  E 2 1   ? -34.476 80.793 -234.255 1.00 31.06 ? 1   DA  E "C2'" 1 
ATOM   2481 C  "C1'" . DA  E 2 1   ? -34.288 82.123 -234.958 1.00 36.28 ? 1   DA  E "C1'" 1 
ATOM   2482 N  N9    . DA  E 2 1   ? -33.358 82.063 -236.080 1.00 39.38 ? 1   DA  E N9    1 
ATOM   2483 C  C8    . DA  E 2 1   ? -33.671 82.082 -237.411 1.00 37.65 ? 1   DA  E C8    1 
ATOM   2484 N  N7    . DA  E 2 1   ? -32.627 82.014 -238.201 1.00 34.43 ? 1   DA  E N7    1 
ATOM   2485 C  C5    . DA  E 2 1   ? -31.555 81.941 -237.328 1.00 36.85 ? 1   DA  E C5    1 
ATOM   2486 C  C6    . DA  E 2 1   ? -30.167 81.849 -237.537 1.00 36.52 ? 1   DA  E C6    1 
ATOM   2487 N  N6    . DA  E 2 1   ? -29.607 81.812 -238.751 1.00 37.29 ? 1   DA  E N6    1 
ATOM   2488 N  N1    . DA  E 2 1   ? -29.374 81.794 -236.447 1.00 40.25 ? 1   DA  E N1    1 
ATOM   2489 C  C2    . DA  E 2 1   ? -29.940 81.831 -235.235 1.00 40.42 ? 1   DA  E C2    1 
ATOM   2490 N  N3    . DA  E 2 1   ? -31.228 81.917 -234.914 1.00 38.91 ? 1   DA  E N3    1 
ATOM   2491 C  C4    . DA  E 2 1   ? -31.989 81.969 -236.016 1.00 36.60 ? 1   DA  E C4    1 
ATOM   2492 P  P     . DG  E 2 2   ? -37.468 80.399 -232.778 1.00 35.58 ? 2   DG  E P     1 
ATOM   2493 O  OP1   . DG  E 2 2   ? -38.795 81.051 -232.694 1.00 39.16 ? 2   DG  E OP1   1 
ATOM   2494 O  OP2   . DG  E 2 2   ? -37.010 79.509 -231.689 1.00 42.51 ? 2   DG  E OP2   1 
ATOM   2495 O  "O5'" . DG  E 2 2   ? -37.391 79.584 -234.156 1.00 34.38 ? 2   DG  E "O5'" 1 
ATOM   2496 C  "C5'" . DG  E 2 2   ? -37.874 80.179 -235.359 1.00 32.55 ? 2   DG  E "C5'" 1 
ATOM   2497 C  "C4'" A DG  E 2 2   ? -37.512 79.336 -236.573 0.50 30.36 ? 2   DG  E "C4'" 1 
ATOM   2498 C  "C4'" B DG  E 2 2   ? -37.507 79.344 -236.578 0.50 30.39 ? 2   DG  E "C4'" 1 
ATOM   2499 O  "O4'" A DG  E 2 2   ? -36.069 79.259 -236.708 0.50 30.14 ? 2   DG  E "O4'" 1 
ATOM   2500 O  "O4'" B DG  E 2 2   ? -36.064 79.264 -236.706 0.50 30.12 ? 2   DG  E "O4'" 1 
ATOM   2501 C  "C3'" A DG  E 2 2   ? -38.013 77.894 -236.543 0.50 28.91 ? 2   DG  E "C3'" 1 
ATOM   2502 C  "C3'" B DG  E 2 2   ? -38.011 77.904 -236.566 0.50 28.92 ? 2   DG  E "C3'" 1 
ATOM   2503 O  "O3'" A DG  E 2 2   ? -38.432 77.509 -237.846 0.50 31.09 ? 2   DG  E "O3'" 1 
ATOM   2504 O  "O3'" B DG  E 2 2   ? -38.411 77.532 -237.879 0.50 30.99 ? 2   DG  E "O3'" 1 
ATOM   2505 C  "C2'" A DG  E 2 2   ? -36.784 77.109 -236.088 0.50 28.13 ? 2   DG  E "C2'" 1 
ATOM   2506 C  "C2'" B DG  E 2 2   ? -36.788 77.114 -236.100 0.50 28.16 ? 2   DG  E "C2'" 1 
ATOM   2507 C  "C1'" A DG  E 2 2   ? -35.652 77.909 -236.717 0.50 28.40 ? 2   DG  E "C1'" 1 
ATOM   2508 C  "C1'" B DG  E 2 2   ? -35.650 77.913 -236.719 0.50 28.42 ? 2   DG  E "C1'" 1 
ATOM   2509 N  N9    . DG  E 2 2   ? -34.396 77.821 -235.978 1.00 26.57 ? 2   DG  E N9    1 
ATOM   2510 C  C8    . DG  E 2 2   ? -34.240 77.533 -234.643 1.00 31.27 ? 2   DG  E C8    1 
ATOM   2511 N  N7    . DG  E 2 2   ? -32.994 77.534 -234.254 1.00 30.51 ? 2   DG  E N7    1 
ATOM   2512 C  C5    . DG  E 2 2   ? -32.279 77.847 -235.403 1.00 26.52 ? 2   DG  E C5    1 
ATOM   2513 C  C6    . DG  E 2 2   ? -30.882 77.991 -235.600 1.00 28.43 ? 2   DG  E C6    1 
ATOM   2514 O  O6    . DG  E 2 2   ? -29.970 77.868 -234.769 1.00 30.57 ? 2   DG  E O6    1 
ATOM   2515 N  N1    . DG  E 2 2   ? -30.580 78.311 -236.921 1.00 30.91 ? 2   DG  E N1    1 
ATOM   2516 C  C2    . DG  E 2 2   ? -31.508 78.473 -237.923 1.00 29.58 ? 2   DG  E C2    1 
ATOM   2517 N  N2    . DG  E 2 2   ? -31.027 78.781 -239.134 1.00 30.86 ? 2   DG  E N2    1 
ATOM   2518 N  N3    . DG  E 2 2   ? -32.816 78.340 -237.752 1.00 29.46 ? 2   DG  E N3    1 
ATOM   2519 C  C4    . DG  E 2 2   ? -33.128 78.028 -236.472 1.00 27.41 ? 2   DG  E C4    1 
ATOM   2520 P  P     A DC  E 2 3   ? -38.936 76.012 -238.139 0.50 28.77 ? 3   DC  E P     1 
ATOM   2521 P  P     B DC  E 2 3   ? -38.934 76.046 -238.191 0.50 28.30 ? 3   DC  E P     1 
ATOM   2522 O  OP1   A DC  E 2 3   ? -39.953 76.105 -239.210 0.50 30.98 ? 3   DC  E OP1   1 
ATOM   2523 O  OP1   B DC  E 2 3   ? -39.935 76.161 -239.275 0.50 30.26 ? 3   DC  E OP1   1 
ATOM   2524 O  OP2   A DC  E 2 3   ? -39.289 75.364 -236.856 0.50 29.56 ? 3   DC  E OP2   1 
ATOM   2525 O  OP2   B DC  E 2 3   ? -39.312 75.394 -236.918 0.50 29.98 ? 3   DC  E OP2   1 
ATOM   2526 O  "O5'" A DC  E 2 3   ? -37.636 75.289 -238.730 0.50 28.68 ? 3   DC  E "O5'" 1 
ATOM   2527 O  "O5'" B DC  E 2 3   ? -37.639 75.308 -238.774 0.50 28.61 ? 3   DC  E "O5'" 1 
ATOM   2528 C  "C5'" A DC  E 2 3   ? -36.986 75.845 -239.863 0.50 26.75 ? 3   DC  E "C5'" 1 
ATOM   2529 C  "C5'" B DC  E 2 3   ? -36.965 75.867 -239.891 0.50 26.98 ? 3   DC  E "C5'" 1 
ATOM   2530 C  "C4'" A DC  E 2 3   ? -35.701 75.102 -240.190 0.50 25.55 ? 3   DC  E "C4'" 1 
ATOM   2531 C  "C4'" B DC  E 2 3   ? -35.685 75.111 -240.206 0.50 25.54 ? 3   DC  E "C4'" 1 
ATOM   2532 O  "O4'" A DC  E 2 3   ? -34.659 75.450 -239.239 0.50 26.86 ? 3   DC  E "O4'" 1 
ATOM   2533 O  "O4'" B DC  E 2 3   ? -34.646 75.455 -239.251 0.50 26.87 ? 3   DC  E "O4'" 1 
ATOM   2534 C  "C3'" A DC  E 2 3   ? -35.792 73.567 -240.173 0.50 22.38 ? 3   DC  E "C3'" 1 
ATOM   2535 C  "C3'" B DC  E 2 3   ? -35.790 73.577 -240.181 0.50 22.38 ? 3   DC  E "C3'" 1 
ATOM   2536 O  "O3'" A DC  E 2 3   ? -35.207 73.051 -241.357 0.50 22.62 ? 3   DC  E "O3'" 1 
ATOM   2537 O  "O3'" B DC  E 2 3   ? -35.203 73.050 -241.359 0.50 22.61 ? 3   DC  E "O3'" 1 
ATOM   2538 C  "C2'" A DC  E 2 3   ? -34.959 73.187 -238.948 0.50 23.76 ? 3   DC  E "C2'" 1 
ATOM   2539 C  "C2'" B DC  E 2 3   ? -34.969 73.197 -238.949 0.50 23.76 ? 3   DC  E "C2'" 1 
ATOM   2540 C  "C1'" A DC  E 2 3   ? -33.919 74.287 -238.985 0.50 24.57 ? 3   DC  E "C1'" 1 
ATOM   2541 C  "C1'" B DC  E 2 3   ? -33.918 74.287 -238.987 0.50 24.57 ? 3   DC  E "C1'" 1 
ATOM   2542 N  N1    . DC  E 2 3   ? -33.146 74.446 -237.723 1.00 24.31 ? 3   DC  E N1    1 
ATOM   2543 C  C2    . DC  E 2 3   ? -31.802 74.822 -237.790 1.00 25.92 ? 3   DC  E C2    1 
ATOM   2544 O  O2    . DC  E 2 3   ? -31.292 75.029 -238.898 1.00 25.40 ? 3   DC  E O2    1 
ATOM   2545 N  N3    . DC  E 2 3   ? -31.098 74.956 -236.643 1.00 27.40 ? 3   DC  E N3    1 
ATOM   2546 C  C4    . DC  E 2 3   ? -31.685 74.723 -235.470 1.00 27.12 ? 3   DC  E C4    1 
ATOM   2547 N  N4    . DC  E 2 3   ? -30.948 74.870 -234.365 1.00 29.84 ? 3   DC  E N4    1 
ATOM   2548 C  C5    . DC  E 2 3   ? -33.056 74.333 -235.379 1.00 22.94 ? 3   DC  E C5    1 
ATOM   2549 C  C6    . DC  E 2 3   ? -33.742 74.203 -236.522 1.00 24.51 ? 3   DC  E C6    1 
ATOM   2550 P  P     . DG  E 2 4   ? -35.665 71.629 -241.947 1.00 22.12 ? 4   DG  E P     1 
ATOM   2551 O  OP1   . DG  E 2 4   ? -36.903 71.854 -242.724 1.00 24.85 ? 4   DG  E OP1   1 
ATOM   2552 O  OP2   . DG  E 2 4   ? -35.666 70.633 -240.851 1.00 21.06 ? 4   DG  E OP2   1 
ATOM   2553 O  "O5'" . DG  E 2 4   ? -34.476 71.233 -242.941 1.00 22.70 ? 4   DG  E "O5'" 1 
ATOM   2554 C  "C5'" . DG  E 2 4   ? -33.955 72.194 -243.851 1.00 20.48 ? 4   DG  E "C5'" 1 
ATOM   2555 C  "C4'" . DG  E 2 4   ? -32.457 72.017 -244.021 1.00 21.31 ? 4   DG  E "C4'" 1 
ATOM   2556 O  "O4'" . DG  E 2 4   ? -31.773 72.502 -242.836 1.00 26.08 ? 4   DG  E "O4'" 1 
ATOM   2557 C  "C3'" . DG  E 2 4   ? -31.999 70.572 -244.221 1.00 20.87 ? 4   DG  E "C3'" 1 
ATOM   2558 O  "O3'" . DG  E 2 4   ? -31.008 70.510 -245.236 1.00 23.76 ? 4   DG  E "O3'" 1 
ATOM   2559 C  "C2'" . DG  E 2 4   ? -31.433 70.185 -242.856 1.00 21.01 ? 4   DG  E "C2'" 1 
ATOM   2560 C  "C1'" . DG  E 2 4   ? -30.889 71.514 -242.353 1.00 24.02 ? 4   DG  E "C1'" 1 
ATOM   2561 N  N9    . DG  E 2 4   ? -30.850 71.606 -240.895 1.00 20.92 ? 4   DG  E N9    1 
ATOM   2562 C  C8    . DG  E 2 4   ? -31.926 71.630 -240.041 1.00 20.34 ? 4   DG  E C8    1 
ATOM   2563 N  N7    . DG  E 2 4   ? -31.590 71.717 -238.785 1.00 19.61 ? 4   DG  E N7    1 
ATOM   2564 C  C5    . DG  E 2 4   ? -30.202 71.752 -238.804 1.00 19.10 ? 4   DG  E C5    1 
ATOM   2565 C  C6    . DG  E 2 4   ? -29.278 71.842 -237.736 1.00 23.81 ? 4   DG  E C6    1 
ATOM   2566 O  O6    . DG  E 2 4   ? -29.513 71.911 -236.521 1.00 24.49 ? 4   DG  E O6    1 
ATOM   2567 N  N1    . DG  E 2 4   ? -27.962 71.848 -238.192 1.00 23.38 ? 4   DG  E N1    1 
ATOM   2568 C  C2    . DG  E 2 4   ? -27.588 71.775 -239.514 1.00 27.12 ? 4   DG  E C2    1 
ATOM   2569 N  N2    . DG  E 2 4   ? -26.271 71.794 -239.760 1.00 27.32 ? 4   DG  E N2    1 
ATOM   2570 N  N3    . DG  E 2 4   ? -28.444 71.691 -240.525 1.00 24.64 ? 4   DG  E N3    1 
ATOM   2571 C  C4    . DG  E 2 4   ? -29.730 71.684 -240.096 1.00 20.68 ? 4   DG  E C4    1 
ATOM   2572 P  P     . DT  E 2 5   ? -30.662 69.107 -245.938 1.00 21.83 ? 5   DT  E P     1 
ATOM   2573 O  OP1   . DT  E 2 5   ? -29.932 69.398 -247.193 1.00 23.49 ? 5   DT  E OP1   1 
ATOM   2574 O  OP2   . DT  E 2 5   ? -31.908 68.309 -245.974 1.00 21.85 ? 5   DT  E OP2   1 
ATOM   2575 O  "O5'" . DT  E 2 5   ? -29.657 68.402 -244.917 1.00 22.17 ? 5   DT  E "O5'" 1 
ATOM   2576 C  "C5'" . DT  E 2 5   ? -28.336 68.896 -244.771 1.00 24.10 ? 5   DT  E "C5'" 1 
ATOM   2577 C  "C4'" . DT  E 2 5   ? -27.563 68.081 -243.752 1.00 24.14 ? 5   DT  E "C4'" 1 
ATOM   2578 O  "O4'" . DT  E 2 5   ? -27.881 68.537 -242.410 1.00 23.51 ? 5   DT  E "O4'" 1 
ATOM   2579 C  "C3'" . DT  E 2 5   ? -27.851 66.570 -243.763 1.00 21.40 ? 5   DT  E "C3'" 1 
ATOM   2580 O  "O3'" . DT  E 2 5   ? -26.625 65.852 -243.728 1.00 25.77 ? 5   DT  E "O3'" 1 
ATOM   2581 C  "C2'" . DT  E 2 5   ? -28.644 66.362 -242.471 1.00 20.52 ? 5   DT  E "C2'" 1 
ATOM   2582 C  "C1'" . DT  E 2 5   ? -27.991 67.407 -241.588 1.00 22.74 ? 5   DT  E "C1'" 1 
ATOM   2583 N  N1    . DT  E 2 5   ? -28.760 67.755 -240.356 1.00 20.58 ? 5   DT  E N1    1 
ATOM   2584 C  C2    . DT  E 2 5   ? -28.067 68.004 -239.195 1.00 23.31 ? 5   DT  E C2    1 
ATOM   2585 O  O2    . DT  E 2 5   ? -26.852 67.962 -239.122 1.00 26.40 ? 5   DT  E O2    1 
ATOM   2586 N  N3    . DT  E 2 5   ? -28.848 68.308 -238.114 1.00 20.23 ? 5   DT  E N3    1 
ATOM   2587 C  C4    . DT  E 2 5   ? -30.226 68.386 -238.075 1.00 19.48 ? 5   DT  E C4    1 
ATOM   2588 O  O4    . DT  E 2 5   ? -30.837 68.669 -237.051 1.00 22.67 ? 5   DT  E O4    1 
ATOM   2589 C  C5    . DT  E 2 5   ? -30.896 68.112 -239.325 1.00 18.93 ? 5   DT  E C5    1 
ATOM   2590 C  C7    . DT  E 2 5   ? -32.393 68.168 -239.403 1.00 21.70 ? 5   DT  E C7    1 
ATOM   2591 C  C6    . DT  E 2 5   ? -30.140 67.811 -240.396 1.00 19.09 ? 5   DT  E C6    1 
ATOM   2592 P  P     . DG  E 2 6   ? -26.341 64.664 -244.771 1.00 27.40 ? 6   DG  E P     1 
ATOM   2593 O  OP1   . DG  E 2 6   ? -26.103 65.278 -246.095 1.00 33.96 ? 6   DG  E OP1   1 
ATOM   2594 O  OP2   . DG  E 2 6   ? -27.408 63.651 -244.599 1.00 35.51 ? 6   DG  E OP2   1 
ATOM   2595 O  "O5'" . DG  E 2 6   ? -24.973 64.019 -244.245 1.00 27.43 ? 6   DG  E "O5'" 1 
ATOM   2596 C  "C5'" . DG  E 2 6   ? -24.977 63.183 -243.091 1.00 23.53 ? 6   DG  E "C5'" 1 
ATOM   2597 C  "C4'" . DG  E 2 6   ? -23.906 63.610 -242.099 1.00 25.14 ? 6   DG  E "C4'" 1 
ATOM   2598 O  "O4'" . DG  E 2 6   ? -24.343 64.803 -241.405 1.00 25.26 ? 6   DG  E "O4'" 1 
ATOM   2599 C  "C3'" . DG  E 2 6   ? -23.588 62.575 -241.026 1.00 24.11 ? 6   DG  E "C3'" 1 
ATOM   2600 O  "O3'" . DG  E 2 6   ? -22.435 61.836 -241.417 1.00 21.41 ? 6   DG  E "O3'" 1 
ATOM   2601 C  "C2'" . DG  E 2 6   ? -23.312 63.410 -239.776 1.00 22.43 ? 6   DG  E "C2'" 1 
ATOM   2602 C  "C1'" . DG  E 2 6   ? -24.123 64.683 -240.014 1.00 20.30 ? 6   DG  E "C1'" 1 
ATOM   2603 N  N9    . DG  E 2 6   ? -25.421 64.712 -239.337 1.00 22.36 ? 6   DG  E N9    1 
ATOM   2604 C  C8    . DG  E 2 6   ? -26.660 64.697 -239.931 1.00 22.90 ? 6   DG  E C8    1 
ATOM   2605 N  N7    . DG  E 2 6   ? -27.646 64.750 -239.081 1.00 22.19 ? 6   DG  E N7    1 
ATOM   2606 C  C5    . DG  E 2 6   ? -27.024 64.808 -237.840 1.00 22.46 ? 6   DG  E C5    1 
ATOM   2607 C  C6    . DG  E 2 6   ? -27.584 64.880 -236.542 1.00 21.89 ? 6   DG  E C6    1 
ATOM   2608 O  O6    . DG  E 2 6   ? -28.780 64.909 -236.221 1.00 22.87 ? 6   DG  E O6    1 
ATOM   2609 N  N1    . DG  E 2 6   ? -26.601 64.922 -235.557 1.00 22.69 ? 6   DG  E N1    1 
ATOM   2610 C  C2    . DG  E 2 6   ? -25.248 64.898 -235.796 1.00 21.45 ? 6   DG  E C2    1 
ATOM   2611 N  N2    . DG  E 2 6   ? -24.455 64.946 -234.716 1.00 25.23 ? 6   DG  E N2    1 
ATOM   2612 N  N3    . DG  E 2 6   ? -24.708 64.831 -237.008 1.00 23.47 ? 6   DG  E N3    1 
ATOM   2613 C  C4    . DG  E 2 6   ? -25.654 64.790 -237.980 1.00 22.23 ? 6   DG  E C4    1 
ATOM   2614 P  P     . DG  E 2 7   ? -22.301 60.276 -241.059 1.00 21.50 ? 7   DG  E P     1 
ATOM   2615 O  OP1   . DG  E 2 7   ? -21.139 59.750 -241.811 1.00 25.04 ? 7   DG  E OP1   1 
ATOM   2616 O  OP2   . DG  E 2 7   ? -23.630 59.648 -241.232 1.00 23.39 ? 7   DG  E OP2   1 
ATOM   2617 O  "O5'" . DG  E 2 7   ? -21.936 60.267 -239.505 1.00 24.66 ? 7   DG  E "O5'" 1 
ATOM   2618 C  "C5'" . DG  E 2 7   ? -20.747 60.906 -239.055 1.00 25.30 ? 7   DG  E "C5'" 1 
ATOM   2619 C  "C4'" . DG  E 2 7   ? -20.646 60.861 -237.541 1.00 27.02 ? 7   DG  E "C4'" 1 
ATOM   2620 O  "O4'" . DG  E 2 7   ? -21.787 61.540 -236.957 1.00 29.59 ? 7   DG  E "O4'" 1 
ATOM   2621 C  "C3'" . DG  E 2 7   ? -20.630 59.460 -236.934 1.00 28.56 ? 7   DG  E "C3'" 1 
ATOM   2622 O  "O3'" . DG  E 2 7   ? -19.741 59.422 -235.826 1.00 27.95 ? 7   DG  E "O3'" 1 
ATOM   2623 C  "C2'" . DG  E 2 7   ? -22.079 59.254 -236.501 1.00 27.51 ? 7   DG  E "C2'" 1 
ATOM   2624 C  "C1'" . DG  E 2 7   ? -22.487 60.664 -236.098 1.00 28.17 ? 7   DG  E "C1'" 1 
ATOM   2625 N  N9    . DG  E 2 7   ? -23.916 60.923 -236.252 1.00 22.06 ? 7   DG  E N9    1 
ATOM   2626 C  C8    . DG  E 2 7   ? -24.637 60.905 -237.422 1.00 22.22 ? 7   DG  E C8    1 
ATOM   2627 N  N7    . DG  E 2 7   ? -25.900 61.183 -237.257 1.00 22.58 ? 7   DG  E N7    1 
ATOM   2628 C  C5    . DG  E 2 7   ? -26.025 61.403 -235.892 1.00 20.50 ? 7   DG  E C5    1 
ATOM   2629 C  C6    . DG  E 2 7   ? -27.164 61.742 -235.124 1.00 22.81 ? 7   DG  E C6    1 
ATOM   2630 O  O6    . DG  E 2 7   ? -28.327 61.922 -235.512 1.00 22.10 ? 7   DG  E O6    1 
ATOM   2631 N  N1    . DG  E 2 7   ? -26.853 61.873 -233.772 1.00 21.44 ? 7   DG  E N1    1 
ATOM   2632 C  C2    . DG  E 2 7   ? -25.600 61.697 -233.233 1.00 25.19 ? 7   DG  E C2    1 
ATOM   2633 N  N2    . DG  E 2 7   ? -25.494 61.866 -231.908 1.00 23.78 ? 7   DG  E N2    1 
ATOM   2634 N  N3    . DG  E 2 7   ? -24.525 61.379 -233.942 1.00 23.02 ? 7   DG  E N3    1 
ATOM   2635 C  C4    . DG  E 2 7   ? -24.811 61.249 -235.260 1.00 21.94 ? 7   DG  E C4    1 
ATOM   2636 P  P     . DG  E 2 8   ? -19.358 58.017 -235.145 1.00 29.04 ? 8   DG  E P     1 
ATOM   2637 O  OP1   . DG  E 2 8   ? -17.997 58.151 -234.577 1.00 29.51 ? 8   DG  E OP1   1 
ATOM   2638 O  OP2   . DG  E 2 8   ? -19.653 56.945 -236.121 1.00 34.00 ? 8   DG  E OP2   1 
ATOM   2639 O  "O5'" . DG  E 2 8   ? -20.390 57.884 -233.933 1.00 26.27 ? 8   DG  E "O5'" 1 
ATOM   2640 C  "C5'" . DG  E 2 8   ? -20.275 58.746 -232.811 1.00 26.74 ? 8   DG  E "C5'" 1 
ATOM   2641 C  "C4'" . DG  E 2 8   ? -21.242 58.334 -231.720 1.00 23.16 ? 8   DG  E "C4'" 1 
ATOM   2642 O  "O4'" . DG  E 2 8   ? -22.583 58.751 -232.077 1.00 24.01 ? 8   DG  E "O4'" 1 
ATOM   2643 C  "C3'" . DG  E 2 8   ? -21.311 56.830 -231.454 1.00 20.96 ? 8   DG  E "C3'" 1 
ATOM   2644 O  "O3'" . DG  E 2 8   ? -21.265 56.588 -230.052 1.00 24.93 ? 8   DG  E "O3'" 1 
ATOM   2645 C  "C2'" . DG  E 2 8   ? -22.652 56.415 -232.067 1.00 22.37 ? 8   DG  E "C2'" 1 
ATOM   2646 C  "C1'" . DG  E 2 8   ? -23.478 57.680 -231.906 1.00 23.27 ? 8   DG  E "C1'" 1 
ATOM   2647 N  N9    . DG  E 2 8   ? -24.540 57.815 -232.899 1.00 21.75 ? 8   DG  E N9    1 
ATOM   2648 C  C8    . DG  E 2 8   ? -24.448 57.578 -234.250 1.00 18.67 ? 8   DG  E C8    1 
ATOM   2649 N  N7    . DG  E 2 8   ? -25.563 57.796 -234.892 1.00 17.80 ? 8   DG  E N7    1 
ATOM   2650 C  C5    . DG  E 2 8   ? -26.449 58.208 -233.904 1.00 16.93 ? 8   DG  E C5    1 
ATOM   2651 C  C6    . DG  E 2 8   ? -27.810 58.585 -233.998 1.00 16.44 ? 8   DG  E C6    1 
ATOM   2652 O  O6    . DG  E 2 8   ? -28.527 58.630 -235.008 1.00 18.26 ? 8   DG  E O6    1 
ATOM   2653 N  N1    . DG  E 2 8   ? -28.335 58.934 -232.754 1.00 18.24 ? 8   DG  E N1    1 
ATOM   2654 C  C2    . DG  E 2 8   ? -27.631 58.921 -231.572 1.00 21.49 ? 8   DG  E C2    1 
ATOM   2655 N  N2    . DG  E 2 8   ? -28.305 59.291 -230.472 1.00 20.50 ? 8   DG  E N2    1 
ATOM   2656 N  N3    . DG  E 2 8   ? -26.356 58.571 -231.473 1.00 21.51 ? 8   DG  E N3    1 
ATOM   2657 C  C4    . DG  E 2 8   ? -25.832 58.228 -232.673 1.00 19.15 ? 8   DG  E C4    1 
ATOM   2658 P  P     . DA  E 2 9   ? -21.354 55.091 -229.473 1.00 28.17 ? 9   DA  E P     1 
ATOM   2659 O  OP1   . DA  E 2 9   ? -20.595 55.063 -228.203 1.00 30.88 ? 9   DA  E OP1   1 
ATOM   2660 O  OP2   . DA  E 2 9   ? -21.006 54.140 -230.551 1.00 27.57 ? 9   DA  E OP2   1 
ATOM   2661 O  "O5'" . DA  E 2 9   ? -22.903 54.919 -229.129 1.00 25.26 ? 9   DA  E "O5'" 1 
ATOM   2662 C  "C5'" . DA  E 2 9   ? -23.521 55.833 -228.238 1.00 24.51 ? 9   DA  E "C5'" 1 
ATOM   2663 C  "C4'" . DA  E 2 9   ? -25.018 55.601 -228.165 1.00 24.76 ? 9   DA  E "C4'" 1 
ATOM   2664 O  "O4'" . DA  E 2 9   ? -25.641 55.943 -229.432 1.00 24.09 ? 9   DA  E "O4'" 1 
ATOM   2665 C  "C3'" . DA  E 2 9   ? -25.450 54.160 -227.866 1.00 25.50 ? 9   DA  E "C3'" 1 
ATOM   2666 O  "O3'" . DA  E 2 9   ? -26.514 54.185 -226.943 1.00 25.48 ? 9   DA  E "O3'" 1 
ATOM   2667 C  "C2'" . DA  E 2 9   ? -25.935 53.671 -229.225 1.00 23.01 ? 9   DA  E "C2'" 1 
ATOM   2668 C  "C1'" . DA  E 2 9   ? -26.583 54.944 -229.720 1.00 23.78 ? 9   DA  E "C1'" 1 
ATOM   2669 N  N9    . DA  E 2 9   ? -26.901 54.951 -231.142 1.00 21.78 ? 9   DA  E N9    1 
ATOM   2670 C  C8    . DA  E 2 9   ? -26.109 54.543 -232.179 1.00 19.62 ? 9   DA  E C8    1 
ATOM   2671 N  N7    . DA  E 2 9   ? -26.682 54.660 -233.356 1.00 19.06 ? 9   DA  E N7    1 
ATOM   2672 C  C5    . DA  E 2 9   ? -27.936 55.177 -233.063 1.00 19.11 ? 9   DA  E C5    1 
ATOM   2673 C  C6    . DA  E 2 9   ? -29.033 55.531 -233.873 1.00 16.73 ? 9   DA  E C6    1 
ATOM   2674 N  N6    . DA  E 2 9   ? -29.035 55.412 -235.204 1.00 18.49 ? 9   DA  E N6    1 
ATOM   2675 N  N1    . DA  E 2 9   ? -30.133 56.017 -233.260 1.00 19.56 ? 9   DA  E N1    1 
ATOM   2676 C  C2    . DA  E 2 9   ? -30.129 56.137 -231.929 1.00 17.91 ? 9   DA  E C2    1 
ATOM   2677 N  N3    . DA  E 2 9   ? -29.162 55.837 -231.064 1.00 19.74 ? 9   DA  E N3    1 
ATOM   2678 C  C4    . DA  E 2 9   ? -28.083 55.359 -231.704 1.00 18.80 ? 9   DA  E C4    1 
ATOM   2679 P  P     . DG  E 2 10  ? -26.531 53.186 -225.689 1.00 34.94 ? 10  DG  E P     1 
ATOM   2680 O  OP1   . DG  E 2 10  ? -26.447 54.022 -224.471 1.00 39.80 ? 10  DG  E OP1   1 
ATOM   2681 O  OP2   . DG  E 2 10  ? -25.542 52.114 -225.938 1.00 36.44 ? 10  DG  E OP2   1 
ATOM   2682 O  "O5'" . DG  E 2 10  ? -28.001 52.556 -225.739 1.00 39.38 ? 10  DG  E "O5'" 1 
ATOM   2683 C  "C5'" . DG  E 2 10  ? -29.018 53.131 -224.946 1.00 45.24 ? 10  DG  E "C5'" 1 
ATOM   2684 C  "C4'" . DG  E 2 10  ? -30.308 53.333 -225.728 1.00 34.97 ? 10  DG  E "C4'" 1 
ATOM   2685 O  "O4'" . DG  E 2 10  ? -30.057 53.963 -227.003 1.00 25.30 ? 10  DG  E "O4'" 1 
ATOM   2686 C  "C3'" . DG  E 2 10  ? -31.046 52.079 -226.121 1.00 29.16 ? 10  DG  E "C3'" 1 
ATOM   2687 O  "O3'" . DG  E 2 10  ? -31.711 51.523 -225.008 1.00 24.64 ? 10  DG  E "O3'" 1 
ATOM   2688 C  "C2'" . DG  E 2 10  ? -32.035 52.646 -227.134 1.00 22.14 ? 10  DG  E "C2'" 1 
ATOM   2689 C  "C1'" . DG  E 2 10  ? -31.201 53.739 -227.821 1.00 22.47 ? 10  DG  E "C1'" 1 
ATOM   2690 N  N9    . DG  E 2 10  ? -30.786 53.369 -229.169 1.00 20.45 ? 10  DG  E N9    1 
ATOM   2691 C  C8    . DG  E 2 10  ? -29.529 53.007 -229.591 1.00 22.51 ? 10  DG  E C8    1 
ATOM   2692 N  N7    . DG  E 2 10  ? -29.474 52.718 -230.864 1.00 21.73 ? 10  DG  E N7    1 
ATOM   2693 C  C5    . DG  E 2 10  ? -30.779 52.895 -231.310 1.00 19.32 ? 10  DG  E C5    1 
ATOM   2694 C  C6    . DG  E 2 10  ? -31.334 52.732 -232.603 1.00 20.37 ? 10  DG  E C6    1 
ATOM   2695 O  O6    . DG  E 2 10  ? -30.764 52.387 -233.646 1.00 21.49 ? 10  DG  E O6    1 
ATOM   2696 N  N1    . DG  E 2 10  ? -32.698 53.013 -232.618 1.00 18.04 ? 10  DG  E N1    1 
ATOM   2697 C  C2    . DG  E 2 10  ? -33.432 53.402 -231.523 1.00 18.18 ? 10  DG  E C2    1 
ATOM   2698 N  N2    . DG  E 2 10  ? -34.737 53.630 -231.733 1.00 19.48 ? 10  DG  E N2    1 
ATOM   2699 N  N3    . DG  E 2 10  ? -32.924 53.562 -230.309 1.00 18.62 ? 10  DG  E N3    1 
ATOM   2700 C  C4    . DG  E 2 10  ? -31.596 53.290 -230.277 1.00 19.17 ? 10  DG  E C4    1 
ATOM   2701 P  P     . DT  E 2 11  ? -32.304 50.033 -225.103 1.00 26.53 ? 11  DT  E P     1 
ATOM   2702 O  OP1   . DT  E 2 11  ? -32.632 49.585 -223.733 1.00 26.96 ? 11  DT  E OP1   1 
ATOM   2703 O  OP2   . DT  E 2 11  ? -31.370 49.241 -225.935 1.00 27.97 ? 11  DT  E OP2   1 
ATOM   2704 O  "O5'" . DT  E 2 11  ? -33.660 50.205 -225.933 1.00 24.57 ? 11  DT  E "O5'" 1 
ATOM   2705 C  "C5'" . DT  E 2 11  ? -34.740 50.945 -225.383 1.00 24.55 ? 11  DT  E "C5'" 1 
ATOM   2706 C  "C4'" . DT  E 2 11  ? -35.867 51.091 -226.389 1.00 21.73 ? 11  DT  E "C4'" 1 
ATOM   2707 O  "O4'" . DT  E 2 11  ? -35.396 51.821 -227.550 1.00 22.08 ? 11  DT  E "O4'" 1 
ATOM   2708 C  "C3'" . DT  E 2 11  ? -36.391 49.792 -226.968 1.00 23.88 ? 11  DT  E "C3'" 1 
ATOM   2709 O  "O3'" . DT  E 2 11  ? -37.316 49.179 -226.082 1.00 24.42 ? 11  DT  E "O3'" 1 
ATOM   2710 C  "C2'" . DT  E 2 11  ? -37.075 50.294 -228.230 1.00 23.39 ? 11  DT  E "C2'" 1 
ATOM   2711 C  "C1'" . DT  E 2 11  ? -36.083 51.354 -228.705 1.00 22.88 ? 11  DT  E "C1'" 1 
ATOM   2712 N  N1    . DT  E 2 11  ? -35.086 50.830 -229.686 1.00 19.91 ? 11  DT  E N1    1 
ATOM   2713 C  C2    . DT  E 2 11  ? -35.473 50.633 -230.991 1.00 21.07 ? 11  DT  E C2    1 
ATOM   2714 O  O2    . DT  E 2 11  ? -36.599 50.865 -231.396 1.00 21.77 ? 11  DT  E O2    1 
ATOM   2715 N  N3    . DT  E 2 11  ? -34.490 50.152 -231.813 1.00 18.85 ? 11  DT  E N3    1 
ATOM   2716 C  C4    . DT  E 2 11  ? -33.186 49.851 -231.469 1.00 22.14 ? 11  DT  E C4    1 
ATOM   2717 O  O4    . DT  E 2 11  ? -32.375 49.422 -232.282 1.00 22.62 ? 11  DT  E O4    1 
ATOM   2718 C  C5    . DT  E 2 11  ? -32.845 50.077 -230.085 1.00 19.92 ? 11  DT  E C5    1 
ATOM   2719 C  C7    . DT  E 2 11  ? -31.457 49.788 -229.595 1.00 22.62 ? 11  DT  E C7    1 
ATOM   2720 C  C6    . DT  E 2 11  ? -33.801 50.550 -229.269 1.00 18.50 ? 11  DT  E C6    1 
ATOM   2721 P  P     . DG  E 2 12  ? -37.505 47.582 -226.108 1.00 26.80 ? 12  DG  E P     1 
ATOM   2722 O  OP1   . DG  E 2 12  ? -38.523 47.229 -225.094 1.00 28.08 ? 12  DG  E OP1   1 
ATOM   2723 O  OP2   . DG  E 2 12  ? -36.158 46.976 -226.047 1.00 27.81 ? 12  DG  E OP2   1 
ATOM   2724 O  "O5'" . DG  E 2 12  ? -38.130 47.287 -227.554 1.00 27.44 ? 12  DG  E "O5'" 1 
ATOM   2725 C  "C5'" . DG  E 2 12  ? -39.466 47.683 -227.846 1.00 25.99 ? 12  DG  E "C5'" 1 
ATOM   2726 C  "C4'" . DG  E 2 12  ? -39.756 47.579 -229.335 1.00 27.00 ? 12  DG  E "C4'" 1 
ATOM   2727 O  "O4'" . DG  E 2 12  ? -38.754 48.307 -230.083 1.00 27.37 ? 12  DG  E "O4'" 1 
ATOM   2728 C  "C3'" . DG  E 2 12  ? -39.698 46.179 -229.908 1.00 27.59 ? 12  DG  E "C3'" 1 
ATOM   2729 O  "O3'" . DG  E 2 12  ? -40.923 45.503 -229.675 1.00 31.26 ? 12  DG  E "O3'" 1 
ATOM   2730 C  "C2'" . DG  E 2 12  ? -39.489 46.464 -231.391 1.00 27.36 ? 12  DG  E "C2'" 1 
ATOM   2731 C  "C1'" . DG  E 2 12  ? -38.583 47.698 -231.355 1.00 27.44 ? 12  DG  E "C1'" 1 
ATOM   2732 N  N9    . DG  E 2 12  ? -37.169 47.385 -231.545 1.00 23.62 ? 12  DG  E N9    1 
ATOM   2733 C  C8    . DG  E 2 12  ? -36.193 47.327 -230.579 1.00 23.80 ? 12  DG  E C8    1 
ATOM   2734 N  N7    . DG  E 2 12  ? -35.015 47.016 -231.048 1.00 21.60 ? 12  DG  E N7    1 
ATOM   2735 C  C5    . DG  E 2 12  ? -35.224 46.856 -232.413 1.00 21.36 ? 12  DG  E C5    1 
ATOM   2736 C  C6    . DG  E 2 12  ? -34.313 46.516 -233.442 1.00 23.26 ? 12  DG  E C6    1 
ATOM   2737 O  O6    . DG  E 2 12  ? -33.099 46.283 -233.349 1.00 24.62 ? 12  DG  E O6    1 
ATOM   2738 N  N1    . DG  E 2 12  ? -34.938 46.457 -234.685 1.00 21.56 ? 12  DG  E N1    1 
ATOM   2739 C  C2    . DG  E 2 12  ? -36.274 46.694 -234.905 1.00 22.39 ? 12  DG  E C2    1 
ATOM   2740 N  N2    . DG  E 2 12  ? -36.695 46.591 -236.175 1.00 24.66 ? 12  DG  E N2    1 
ATOM   2741 N  N3    . DG  E 2 12  ? -37.138 47.014 -233.951 1.00 23.60 ? 12  DG  E N3    1 
ATOM   2742 C  C4    . DG  E 2 12  ? -36.545 47.077 -232.734 1.00 25.29 ? 12  DG  E C4    1 
ATOM   2743 P  P     . DT  E 2 13  ? -40.962 43.897 -229.659 1.00 34.59 ? 13  DT  E P     1 
ATOM   2744 O  OP1   . DT  E 2 13  ? -42.296 43.480 -229.176 1.00 38.37 ? 13  DT  E OP1   1 
ATOM   2745 O  OP2   . DT  E 2 13  ? -39.749 43.423 -228.956 1.00 33.08 ? 13  DT  E OP2   1 
ATOM   2746 O  "O5'" . DT  E 2 13  ? -40.818 43.492 -231.199 1.00 35.71 ? 13  DT  E "O5'" 1 
ATOM   2747 C  "C5'" . DT  E 2 13  ? -41.832 43.854 -232.128 1.00 37.51 ? 13  DT  E "C5'" 1 
ATOM   2748 C  "C4'" . DT  E 2 13  ? -41.442 43.449 -233.539 1.00 32.47 ? 13  DT  E "C4'" 1 
ATOM   2749 O  "O4'" . DT  E 2 13  ? -40.292 44.215 -233.964 1.00 32.28 ? 13  DT  E "O4'" 1 
ATOM   2750 C  "C3'" . DT  E 2 13  ? -41.015 42.003 -233.697 1.00 36.31 ? 13  DT  E "C3'" 1 
ATOM   2751 O  "O3'" . DT  E 2 13  ? -42.155 41.175 -233.872 1.00 40.38 ? 13  DT  E "O3'" 1 
ATOM   2752 C  "C2'" . DT  E 2 13  ? -40.165 42.060 -234.962 1.00 35.45 ? 13  DT  E "C2'" 1 
ATOM   2753 C  "C1'" . DT  E 2 13  ? -39.507 43.440 -234.856 1.00 35.00 ? 13  DT  E "C1'" 1 
ATOM   2754 N  N1    . DT  E 2 13  ? -38.103 43.398 -234.347 1.00 30.43 ? 13  DT  E N1    1 
ATOM   2755 C  C2    . DT  E 2 13  ? -37.070 43.213 -235.238 1.00 29.13 ? 13  DT  E C2    1 
ATOM   2756 O  O2    . DT  E 2 13  ? -37.239 43.076 -236.436 1.00 31.08 ? 13  DT  E O2    1 
ATOM   2757 N  N3    . DT  E 2 13  ? -35.823 43.189 -234.671 1.00 28.15 ? 13  DT  E N3    1 
ATOM   2758 C  C4    . DT  E 2 13  ? -35.511 43.331 -233.330 1.00 26.09 ? 13  DT  E C4    1 
ATOM   2759 O  O4    . DT  E 2 13  ? -34.356 43.295 -232.918 1.00 29.91 ? 13  DT  E O4    1 
ATOM   2760 C  C5    . DT  E 2 13  ? -36.641 43.523 -232.450 1.00 26.58 ? 13  DT  E C5    1 
ATOM   2761 C  C7    . DT  E 2 13  ? -36.428 43.688 -230.976 1.00 27.04 ? 13  DT  E C7    1 
ATOM   2762 C  C6    . DT  E 2 13  ? -37.867 43.547 -232.995 1.00 30.79 ? 13  DT  E C6    1 
ATOM   2763 O  "O5'" . DT  F 3 1   ? -23.726 38.283 -236.569 1.00 70.03 ? 1   DT  F "O5'" 1 
ATOM   2764 C  "C5'" . DT  F 3 1   ? -23.770 39.656 -236.940 1.00 59.57 ? 1   DT  F "C5'" 1 
ATOM   2765 C  "C4'" . DT  F 3 1   ? -24.752 39.876 -238.076 1.00 49.67 ? 1   DT  F "C4'" 1 
ATOM   2766 O  "O4'" . DT  F 3 1   ? -26.046 39.327 -237.707 1.00 45.22 ? 1   DT  F "O4'" 1 
ATOM   2767 C  "C3'" . DT  F 3 1   ? -25.010 41.338 -238.432 1.00 43.48 ? 1   DT  F "C3'" 1 
ATOM   2768 O  "O3'" . DT  F 3 1   ? -25.269 41.458 -239.828 1.00 45.46 ? 1   DT  F "O3'" 1 
ATOM   2769 C  "C2'" . DT  F 3 1   ? -26.246 41.659 -237.603 1.00 40.16 ? 1   DT  F "C2'" 1 
ATOM   2770 C  "C1'" . DT  F 3 1   ? -27.017 40.354 -237.706 1.00 42.46 ? 1   DT  F "C1'" 1 
ATOM   2771 N  N1    . DT  F 3 1   ? -27.942 40.129 -236.568 1.00 45.10 ? 1   DT  F N1    1 
ATOM   2772 C  C2    . DT  F 3 1   ? -29.280 39.949 -236.817 1.00 42.07 ? 1   DT  F C2    1 
ATOM   2773 O  O2    . DT  F 3 1   ? -29.758 39.956 -237.939 1.00 35.98 ? 1   DT  F O2    1 
ATOM   2774 N  N3    . DT  F 3 1   ? -30.048 39.752 -235.702 1.00 44.89 ? 1   DT  F N3    1 
ATOM   2775 C  C4    . DT  F 3 1   ? -29.620 39.722 -234.387 1.00 49.35 ? 1   DT  F C4    1 
ATOM   2776 O  O4    . DT  F 3 1   ? -30.391 39.539 -233.450 1.00 50.13 ? 1   DT  F O4    1 
ATOM   2777 C  C5    . DT  F 3 1   ? -28.204 39.922 -234.195 1.00 52.14 ? 1   DT  F C5    1 
ATOM   2778 C  C7    . DT  F 3 1   ? -27.620 39.911 -232.813 1.00 57.54 ? 1   DT  F C7    1 
ATOM   2779 C  C6    . DT  F 3 1   ? -27.442 40.115 -235.282 1.00 48.76 ? 1   DT  F C6    1 
ATOM   2780 P  P     . DA  F 3 2   ? -25.569 42.893 -240.489 1.00 46.20 ? 2   DA  F P     1 
ATOM   2781 O  OP1   . DA  F 3 2   ? -24.779 42.975 -241.736 1.00 48.24 ? 2   DA  F OP1   1 
ATOM   2782 O  OP2   . DA  F 3 2   ? -25.407 43.942 -239.458 1.00 42.07 ? 2   DA  F OP2   1 
ATOM   2783 O  "O5'" . DA  F 3 2   ? -27.118 42.813 -240.882 1.00 44.28 ? 2   DA  F "O5'" 1 
ATOM   2784 C  "C5'" . DA  F 3 2   ? -27.560 41.823 -241.805 1.00 44.46 ? 2   DA  F "C5'" 1 
ATOM   2785 C  "C4'" . DA  F 3 2   ? -29.022 42.021 -242.168 1.00 39.12 ? 2   DA  F "C4'" 1 
ATOM   2786 O  "O4'" . DA  F 3 2   ? -29.857 41.725 -241.019 1.00 36.10 ? 2   DA  F "O4'" 1 
ATOM   2787 C  "C3'" . DA  F 3 2   ? -29.392 43.429 -242.620 1.00 36.45 ? 2   DA  F "C3'" 1 
ATOM   2788 O  "O3'" . DA  F 3 2   ? -30.292 43.366 -243.718 1.00 40.03 ? 2   DA  F "O3'" 1 
ATOM   2789 C  "C2'" . DA  F 3 2   ? -30.043 44.044 -241.382 1.00 31.90 ? 2   DA  F "C2'" 1 
ATOM   2790 C  "C1'" . DA  F 3 2   ? -30.676 42.833 -240.709 1.00 30.26 ? 2   DA  F "C1'" 1 
ATOM   2791 N  N9    . DA  F 3 2   ? -30.743 42.948 -239.254 1.00 30.26 ? 2   DA  F N9    1 
ATOM   2792 C  C8    . DA  F 3 2   ? -29.694 43.131 -238.396 1.00 31.11 ? 2   DA  F C8    1 
ATOM   2793 N  N7    . DA  F 3 2   ? -30.046 43.194 -237.135 1.00 31.49 ? 2   DA  F N7    1 
ATOM   2794 C  C5    . DA  F 3 2   ? -31.422 43.038 -237.165 1.00 29.53 ? 2   DA  F C5    1 
ATOM   2795 C  C6    . DA  F 3 2   ? -32.398 43.011 -236.148 1.00 28.69 ? 2   DA  F C6    1 
ATOM   2796 N  N6    . DA  F 3 2   ? -32.112 43.148 -234.849 1.00 25.75 ? 2   DA  F N6    1 
ATOM   2797 N  N1    . DA  F 3 2   ? -33.683 42.838 -236.520 1.00 29.98 ? 2   DA  F N1    1 
ATOM   2798 C  C2    . DA  F 3 2   ? -33.966 42.702 -237.821 1.00 26.84 ? 2   DA  F C2    1 
ATOM   2799 N  N3    . DA  F 3 2   ? -33.137 42.710 -238.864 1.00 27.98 ? 2   DA  F N3    1 
ATOM   2800 C  C4    . DA  F 3 2   ? -31.868 42.883 -238.464 1.00 28.16 ? 2   DA  F C4    1 
ATOM   2801 P  P     . DC  F 3 3   ? -30.522 44.653 -244.652 1.00 40.07 ? 3   DC  F P     1 
ATOM   2802 O  OP1   . DC  F 3 3   ? -30.925 44.168 -245.991 1.00 40.50 ? 3   DC  F OP1   1 
ATOM   2803 O  OP2   . DC  F 3 3   ? -29.342 45.535 -244.515 1.00 44.65 ? 3   DC  F OP2   1 
ATOM   2804 O  "O5'" . DC  F 3 3   ? -31.776 45.378 -243.979 1.00 34.05 ? 3   DC  F "O5'" 1 
ATOM   2805 C  "C5'" . DC  F 3 3   ? -32.981 44.651 -243.792 1.00 32.90 ? 3   DC  F "C5'" 1 
ATOM   2806 C  "C4'" . DC  F 3 3   ? -33.911 45.360 -242.825 1.00 29.89 ? 3   DC  F "C4'" 1 
ATOM   2807 O  "O4'" . DC  F 3 3   ? -33.469 45.155 -241.471 1.00 29.02 ? 3   DC  F "O4'" 1 
ATOM   2808 C  "C3'" . DC  F 3 3   ? -34.008 46.878 -242.998 1.00 27.37 ? 3   DC  F "C3'" 1 
ATOM   2809 O  "O3'" . DC  F 3 3   ? -35.249 47.212 -243.604 1.00 27.08 ? 3   DC  F "O3'" 1 
ATOM   2810 C  "C2'" . DC  F 3 3   ? -33.905 47.437 -241.562 1.00 25.57 ? 3   DC  F "C2'" 1 
ATOM   2811 C  "C1'" . DC  F 3 3   ? -34.017 46.185 -240.698 1.00 24.07 ? 3   DC  F "C1'" 1 
ATOM   2812 N  N1    . DC  F 3 3   ? -33.277 46.268 -239.400 1.00 23.17 ? 3   DC  F N1    1 
ATOM   2813 C  C2    . DC  F 3 3   ? -33.985 46.173 -238.196 1.00 23.75 ? 3   DC  F C2    1 
ATOM   2814 O  O2    . DC  F 3 3   ? -35.212 46.023 -238.230 1.00 27.63 ? 3   DC  F O2    1 
ATOM   2815 N  N3    . DC  F 3 3   ? -33.305 46.248 -237.026 1.00 24.23 ? 3   DC  F N3    1 
ATOM   2816 C  C4    . DC  F 3 3   ? -31.982 46.411 -237.032 1.00 24.99 ? 3   DC  F C4    1 
ATOM   2817 N  N4    . DC  F 3 3   ? -31.355 46.480 -235.852 1.00 25.86 ? 3   DC  F N4    1 
ATOM   2818 C  C5    . DC  F 3 3   ? -31.241 46.509 -238.247 1.00 22.82 ? 3   DC  F C5    1 
ATOM   2819 C  C6    . DC  F 3 3   ? -31.922 46.433 -239.397 1.00 24.90 ? 3   DC  F C6    1 
ATOM   2820 P  P     . DA  F 3 4   ? -35.552 48.721 -244.058 1.00 26.52 ? 4   DA  F P     1 
ATOM   2821 O  OP1   . DA  F 3 4   ? -36.460 48.658 -245.224 1.00 32.44 ? 4   DA  F OP1   1 
ATOM   2822 O  OP2   . DA  F 3 4   ? -34.262 49.438 -244.168 1.00 31.01 ? 4   DA  F OP2   1 
ATOM   2823 O  "O5'" . DA  F 3 4   ? -36.359 49.333 -242.821 1.00 24.83 ? 4   DA  F "O5'" 1 
ATOM   2824 C  "C5'" . DA  F 3 4   ? -37.536 48.688 -242.356 1.00 28.65 ? 4   DA  F "C5'" 1 
ATOM   2825 C  "C4'" . DA  F 3 4   ? -38.132 49.443 -241.184 1.00 24.41 ? 4   DA  F "C4'" 1 
ATOM   2826 O  "O4'" . DA  F 3 4   ? -37.393 49.123 -239.975 1.00 22.91 ? 4   DA  F "O4'" 1 
ATOM   2827 C  "C3'" . DA  F 3 4   ? -38.091 50.970 -241.314 1.00 23.83 ? 4   DA  F "C3'" 1 
ATOM   2828 O  "O3'" . DA  F 3 4   ? -39.319 51.534 -240.860 1.00 23.98 ? 4   DA  F "O3'" 1 
ATOM   2829 C  "C2'" . DA  F 3 4   ? -36.928 51.357 -240.404 1.00 21.25 ? 4   DA  F "C2'" 1 
ATOM   2830 C  "C1'" . DA  F 3 4   ? -37.070 50.319 -239.308 1.00 21.70 ? 4   DA  F "C1'" 1 
ATOM   2831 N  N9    . DA  F 3 4   ? -35.853 50.118 -238.528 1.00 20.66 ? 4   DA  F N9    1 
ATOM   2832 C  C8    . DA  F 3 4   ? -34.579 49.965 -239.003 1.00 20.49 ? 4   DA  F C8    1 
ATOM   2833 N  N7    . DA  F 3 4   ? -33.680 49.805 -238.060 1.00 20.09 ? 4   DA  F N7    1 
ATOM   2834 C  C5    . DA  F 3 4   ? -34.416 49.858 -236.887 1.00 19.97 ? 4   DA  F C5    1 
ATOM   2835 C  C6    . DA  F 3 4   ? -34.051 49.754 -235.530 1.00 19.84 ? 4   DA  F C6    1 
ATOM   2836 N  N6    . DA  F 3 4   ? -32.793 49.568 -235.119 1.00 20.93 ? 4   DA  F N6    1 
ATOM   2837 N  N1    . DA  F 3 4   ? -35.032 49.851 -234.609 1.00 20.07 ? 4   DA  F N1    1 
ATOM   2838 C  C2    . DA  F 3 4   ? -36.291 50.039 -235.024 1.00 20.42 ? 4   DA  F C2    1 
ATOM   2839 N  N3    . DA  F 3 4   ? -36.754 50.151 -236.268 1.00 20.60 ? 4   DA  F N3    1 
ATOM   2840 C  C4    . DA  F 3 4   ? -35.756 50.051 -237.159 1.00 20.32 ? 4   DA  F C4    1 
ATOM   2841 P  P     . DC  F 3 5   ? -39.728 53.031 -241.285 1.00 30.60 ? 5   DC  F P     1 
ATOM   2842 O  OP1   . DC  F 3 5   ? -41.026 53.347 -240.648 1.00 35.58 ? 5   DC  F OP1   1 
ATOM   2843 O  OP2   . DC  F 3 5   ? -39.591 53.117 -242.760 1.00 43.97 ? 5   DC  F OP2   1 
ATOM   2844 O  "O5'" . DC  F 3 5   ? -38.588 53.945 -240.643 1.00 33.45 ? 5   DC  F "O5'" 1 
ATOM   2845 C  "C5'" . DC  F 3 5   ? -38.904 54.868 -239.604 1.00 36.93 ? 5   DC  F "C5'" 1 
ATOM   2846 C  "C4'" . DC  F 3 5   ? -38.949 54.182 -238.248 1.00 30.55 ? 5   DC  F "C4'" 1 
ATOM   2847 O  "O4'" . DC  F 3 5   ? -37.711 53.453 -238.024 1.00 24.76 ? 5   DC  F "O4'" 1 
ATOM   2848 C  "C3'" . DC  F 3 5   ? -39.101 55.139 -237.059 1.00 22.07 ? 5   DC  F "C3'" 1 
ATOM   2849 O  "O3'" . DC  F 3 5   ? -40.147 54.712 -236.198 1.00 23.32 ? 5   DC  F "O3'" 1 
ATOM   2850 C  "C2'" . DC  F 3 5   ? -37.744 55.075 -236.364 1.00 21.49 ? 5   DC  F "C2'" 1 
ATOM   2851 C  "C1'" . DC  F 3 5   ? -37.297 53.666 -236.696 1.00 21.99 ? 5   DC  F "C1'" 1 
ATOM   2852 N  N1    . DC  F 3 5   ? -35.822 53.479 -236.607 1.00 20.35 ? 5   DC  F N1    1 
ATOM   2853 C  C2    . DC  F 3 5   ? -35.232 53.272 -235.356 1.00 19.30 ? 5   DC  F C2    1 
ATOM   2854 O  O2    . DC  F 3 5   ? -35.949 53.243 -234.348 1.00 22.31 ? 5   DC  F O2    1 
ATOM   2855 N  N3    . DC  F 3 5   ? -33.889 53.107 -235.283 1.00 19.28 ? 5   DC  F N3    1 
ATOM   2856 C  C4    . DC  F 3 5   ? -33.151 53.143 -236.393 1.00 18.32 ? 5   DC  F C4    1 
ATOM   2857 N  N4    . DC  F 3 5   ? -31.831 52.974 -236.271 1.00 20.96 ? 5   DC  F N4    1 
ATOM   2858 C  C5    . DC  F 3 5   ? -33.734 53.355 -237.678 1.00 21.57 ? 5   DC  F C5    1 
ATOM   2859 C  C6    . DC  F 3 5   ? -35.060 53.518 -237.737 1.00 19.40 ? 5   DC  F C6    1 
ATOM   2860 P  P     . DT  F 3 6   ? -40.922 55.791 -235.294 1.00 26.53 ? 6   DT  F P     1 
ATOM   2861 O  OP1   . DT  F 3 6   ? -41.960 55.070 -234.527 1.00 32.94 ? 6   DT  F OP1   1 
ATOM   2862 O  OP2   . DT  F 3 6   ? -41.307 56.913 -236.181 1.00 26.78 ? 6   DT  F OP2   1 
ATOM   2863 O  "O5'" . DT  F 3 6   ? -39.810 56.315 -234.265 1.00 25.33 ? 6   DT  F "O5'" 1 
ATOM   2864 C  "C5'" . DT  F 3 6   ? -39.474 55.524 -233.131 1.00 23.91 ? 6   DT  F "C5'" 1 
ATOM   2865 C  "C4'" . DT  F 3 6   ? -38.283 56.101 -232.380 1.00 20.14 ? 6   DT  F "C4'" 1 
ATOM   2866 O  "O4'" . DT  F 3 6   ? -37.060 55.814 -233.083 1.00 21.28 ? 6   DT  F "O4'" 1 
ATOM   2867 C  "C3'" . DT  F 3 6   ? -38.297 57.620 -232.173 1.00 20.29 ? 6   DT  F "C3'" 1 
ATOM   2868 O  "O3'" . DT  F 3 6   ? -38.600 57.900 -230.805 1.00 23.65 ? 6   DT  F "O3'" 1 
ATOM   2869 C  "C2'" . DT  F 3 6   ? -36.866 58.070 -232.558 1.00 20.51 ? 6   DT  F "C2'" 1 
ATOM   2870 C  "C1'" . DT  F 3 6   ? -36.109 56.745 -232.655 1.00 19.31 ? 6   DT  F "C1'" 1 
ATOM   2871 N  N1    . DT  F 3 6   ? -34.957 56.737 -233.624 1.00 18.63 ? 6   DT  F N1    1 
ATOM   2872 C  C2    . DT  F 3 6   ? -33.679 56.555 -233.144 1.00 18.03 ? 6   DT  F C2    1 
ATOM   2873 O  O2    . DT  F 3 6   ? -33.422 56.418 -231.961 1.00 21.06 ? 6   DT  F O2    1 
ATOM   2874 N  N3    . DT  F 3 6   ? -32.702 56.544 -234.104 1.00 17.65 ? 6   DT  F N3    1 
ATOM   2875 C  C4    . DT  F 3 6   ? -32.869 56.692 -235.467 1.00 17.44 ? 6   DT  F C4    1 
ATOM   2876 O  O4    . DT  F 3 6   ? -31.925 56.667 -236.251 1.00 17.38 ? 6   DT  F O4    1 
ATOM   2877 C  C5    . DT  F 3 6   ? -34.233 56.873 -235.906 1.00 17.62 ? 6   DT  F C5    1 
ATOM   2878 C  C7    . DT  F 3 6   ? -34.537 57.043 -237.366 1.00 17.72 ? 6   DT  F C7    1 
ATOM   2879 C  C6    . DT  F 3 6   ? -35.200 56.884 -234.974 1.00 17.96 ? 6   DT  F C6    1 
ATOM   2880 P  P     . DC  F 3 7   ? -38.985 59.385 -230.320 1.00 24.90 ? 7   DC  F P     1 
ATOM   2881 O  OP1   . DC  F 3 7   ? -39.857 59.234 -229.132 1.00 27.66 ? 7   DC  F OP1   1 
ATOM   2882 O  OP2   . DC  F 3 7   ? -39.459 60.166 -231.488 1.00 29.67 ? 7   DC  F OP2   1 
ATOM   2883 O  "O5'" . DC  F 3 7   ? -37.593 59.986 -229.834 1.00 23.38 ? 7   DC  F "O5'" 1 
ATOM   2884 C  "C5'" . DC  F 3 7   ? -36.827 59.276 -228.874 1.00 27.22 ? 7   DC  F "C5'" 1 
ATOM   2885 C  "C4'" . DC  F 3 7   ? -35.433 59.856 -228.757 1.00 22.75 ? 7   DC  F "C4'" 1 
ATOM   2886 O  "O4'" . DC  F 3 7   ? -34.616 59.398 -229.851 1.00 21.38 ? 7   DC  F "O4'" 1 
ATOM   2887 C  "C3'" . DC  F 3 7   ? -35.359 61.385 -228.793 1.00 22.28 ? 7   DC  F "C3'" 1 
ATOM   2888 O  "O3'" . DC  F 3 7   ? -35.039 61.871 -227.492 1.00 30.29 ? 7   DC  F "O3'" 1 
ATOM   2889 C  "C2'" . DC  F 3 7   ? -34.248 61.691 -229.820 1.00 26.65 ? 7   DC  F "C2'" 1 
ATOM   2890 C  "C1'" . DC  F 3 7   ? -33.593 60.331 -230.032 1.00 20.58 ? 7   DC  F "C1'" 1 
ATOM   2891 N  N1    . DC  F 3 7   ? -33.006 60.145 -231.391 1.00 20.00 ? 7   DC  F N1    1 
ATOM   2892 C  C2    . DC  F 3 7   ? -31.659 59.791 -231.512 1.00 22.45 ? 7   DC  F C2    1 
ATOM   2893 O  O2    . DC  F 3 7   ? -30.983 59.639 -230.488 1.00 23.85 ? 7   DC  F O2    1 
ATOM   2894 N  N3    . DC  F 3 7   ? -31.133 59.622 -232.749 1.00 18.35 ? 7   DC  F N3    1 
ATOM   2895 C  C4    . DC  F 3 7   ? -31.897 59.794 -233.828 1.00 18.04 ? 7   DC  F C4    1 
ATOM   2896 N  N4    . DC  F 3 7   ? -31.332 59.617 -235.026 1.00 17.74 ? 7   DC  F N4    1 
ATOM   2897 C  C5    . DC  F 3 7   ? -33.274 60.155 -233.727 1.00 18.13 ? 7   DC  F C5    1 
ATOM   2898 C  C6    . DC  F 3 7   ? -33.783 60.319 -232.500 1.00 18.73 ? 7   DC  F C6    1 
ATOM   2899 P  P     . DC  F 3 8   ? -34.828 63.441 -227.217 1.00 30.08 ? 8   DC  F P     1 
ATOM   2900 O  OP1   . DC  F 3 8   ? -35.465 63.741 -225.916 1.00 34.74 ? 8   DC  F OP1   1 
ATOM   2901 O  OP2   . DC  F 3 8   ? -35.230 64.207 -228.419 1.00 33.28 ? 8   DC  F OP2   1 
ATOM   2902 O  "O5'" . DC  F 3 8   ? -33.247 63.565 -227.037 1.00 34.04 ? 8   DC  F "O5'" 1 
ATOM   2903 C  "C5'" . DC  F 3 8   ? -32.556 62.590 -226.261 1.00 32.62 ? 8   DC  F "C5'" 1 
ATOM   2904 C  "C4'" . DC  F 3 8   ? -31.059 62.675 -226.490 1.00 32.67 ? 8   DC  F "C4'" 1 
ATOM   2905 O  "O4'" . DC  F 3 8   ? -30.744 62.218 -227.830 1.00 31.64 ? 8   DC  F "O4'" 1 
ATOM   2906 C  "C3'" . DC  F 3 8   ? -30.473 64.081 -226.360 1.00 36.54 ? 8   DC  F "C3'" 1 
ATOM   2907 O  "O3'" . DC  F 3 8   ? -29.378 64.068 -225.456 1.00 36.44 ? 8   DC  F "O3'" 1 
ATOM   2908 C  "C2'" . DC  F 3 8   ? -30.038 64.443 -227.784 1.00 32.55 ? 8   DC  F "C2'" 1 
ATOM   2909 C  "C1'" . DC  F 3 8   ? -29.796 63.078 -228.410 1.00 30.82 ? 8   DC  F "C1'" 1 
ATOM   2910 N  N1    . DC  F 3 8   ? -29.992 63.060 -229.890 1.00 26.58 ? 8   DC  F N1    1 
ATOM   2911 C  C2    . DC  F 3 8   ? -28.924 62.723 -230.729 1.00 23.49 ? 8   DC  F C2    1 
ATOM   2912 O  O2    . DC  F 3 8   ? -27.827 62.446 -230.228 1.00 30.27 ? 8   DC  F O2    1 
ATOM   2913 N  N3    . DC  F 3 8   ? -29.123 62.709 -232.071 1.00 24.72 ? 8   DC  F N3    1 
ATOM   2914 C  C4    . DC  F 3 8   ? -30.322 63.013 -232.572 1.00 23.07 ? 8   DC  F C4    1 
ATOM   2915 N  N4    . DC  F 3 8   ? -30.470 62.987 -233.901 1.00 23.61 ? 8   DC  F N4    1 
ATOM   2916 C  C5    . DC  F 3 8   ? -31.421 63.359 -231.733 1.00 23.07 ? 8   DC  F C5    1 
ATOM   2917 C  C6    . DC  F 3 8   ? -31.213 63.369 -230.413 1.00 24.53 ? 8   DC  F C6    1 
ATOM   2918 P  P     . DC  F 3 9   ? -28.831 65.445 -224.837 1.00 45.21 ? 9   DC  F P     1 
ATOM   2919 O  OP1   . DC  F 3 9   ? -28.258 65.144 -223.507 1.00 49.91 ? 9   DC  F OP1   1 
ATOM   2920 O  OP2   . DC  F 3 9   ? -29.900 66.460 -224.965 1.00 49.33 ? 9   DC  F OP2   1 
ATOM   2921 O  "O5'" . DC  F 3 9   ? -27.641 65.843 -225.824 1.00 36.59 ? 9   DC  F "O5'" 1 
ATOM   2922 C  "C5'" . DC  F 3 9   ? -26.612 64.901 -226.082 1.00 37.21 ? 9   DC  F "C5'" 1 
ATOM   2923 C  "C4'" . DC  F 3 9   ? -25.771 65.324 -227.271 1.00 34.46 ? 9   DC  F "C4'" 1 
ATOM   2924 O  "O4'" . DC  F 3 9   ? -26.482 65.050 -228.496 1.00 31.75 ? 9   DC  F "O4'" 1 
ATOM   2925 C  "C3'" . DC  F 3 9   ? -25.414 66.813 -227.314 1.00 38.14 ? 9   DC  F "C3'" 1 
ATOM   2926 O  "O3'" . DC  F 3 9   ? -24.016 66.978 -227.121 1.00 40.99 ? 9   DC  F "O3'" 1 
ATOM   2927 C  "C2'" . DC  F 3 9   ? -25.859 67.278 -228.715 1.00 36.95 ? 9   DC  F "C2'" 1 
ATOM   2928 C  "C1'" . DC  F 3 9   ? -26.045 65.964 -229.461 1.00 29.34 ? 9   DC  F "C1'" 1 
ATOM   2929 N  N1    . DC  F 3 9   ? -27.060 66.026 -230.556 1.00 29.75 ? 9   DC  F N1    1 
ATOM   2930 C  C2    . DC  F 3 9   ? -26.693 65.665 -231.857 1.00 28.45 ? 9   DC  F C2    1 
ATOM   2931 O  O2    . DC  F 3 9   ? -25.530 65.304 -232.077 1.00 28.84 ? 9   DC  F O2    1 
ATOM   2932 N  N3    . DC  F 3 9   ? -27.624 65.721 -232.843 1.00 23.59 ? 9   DC  F N3    1 
ATOM   2933 C  C4    . DC  F 3 9   ? -28.867 66.116 -232.565 1.00 23.03 ? 9   DC  F C4    1 
ATOM   2934 N  N4    . DC  F 3 9   ? -29.749 66.156 -233.569 1.00 22.13 ? 9   DC  F N4    1 
ATOM   2935 C  C5    . DC  F 3 9   ? -29.261 66.488 -231.245 1.00 23.30 ? 9   DC  F C5    1 
ATOM   2936 C  C6    . DC  F 3 9   ? -28.335 66.427 -230.281 1.00 26.76 ? 9   DC  F C6    1 
ATOM   2937 P  P     . DA  F 3 10  ? -23.378 68.450 -227.033 1.00 46.91 ? 10  DA  F P     1 
ATOM   2938 O  OP1   . DA  F 3 10  ? -22.181 68.368 -226.167 1.00 57.77 ? 10  DA  F OP1   1 
ATOM   2939 O  OP2   . DA  F 3 10  ? -24.462 69.399 -226.694 1.00 50.13 ? 10  DA  F OP2   1 
ATOM   2940 O  "O5'" . DA  F 3 10  ? -22.909 68.743 -228.530 1.00 39.59 ? 10  DA  F "O5'" 1 
ATOM   2941 C  "C5'" . DA  F 3 10  ? -22.077 67.806 -229.203 1.00 40.35 ? 10  DA  F "C5'" 1 
ATOM   2942 C  "C4'" . DA  F 3 10  ? -22.051 68.083 -230.693 1.00 36.51 ? 10  DA  F "C4'" 1 
ATOM   2943 O  "O4'" . DA  F 3 10  ? -23.333 67.772 -231.258 1.00 36.77 ? 10  DA  F "O4'" 1 
ATOM   2944 C  "C3'" . DA  F 3 10  ? -21.804 69.538 -231.065 1.00 39.34 ? 10  DA  F "C3'" 1 
ATOM   2945 O  "O3'" . DA  F 3 10  ? -20.412 69.757 -231.278 1.00 43.92 ? 10  DA  F "O3'" 1 
ATOM   2946 C  "C2'" . DA  F 3 10  ? -22.612 69.738 -232.359 1.00 38.92 ? 10  DA  F "C2'" 1 
ATOM   2947 C  "C1'" . DA  F 3 10  ? -23.471 68.472 -232.470 1.00 38.14 ? 10  DA  F "C1'" 1 
ATOM   2948 N  N9    . DA  F 3 10  ? -24.889 68.744 -232.693 1.00 34.06 ? 10  DA  F N9    1 
ATOM   2949 C  C8    . DA  F 3 10  ? -25.811 69.132 -231.762 1.00 30.34 ? 10  DA  F C8    1 
ATOM   2950 N  N7    . DA  F 3 10  ? -27.018 69.301 -232.251 1.00 31.69 ? 10  DA  F N7    1 
ATOM   2951 C  C5    . DA  F 3 10  ? -26.875 69.003 -233.596 1.00 29.58 ? 10  DA  F C5    1 
ATOM   2952 C  C6    . DA  F 3 10  ? -27.790 68.993 -234.667 1.00 23.70 ? 10  DA  F C6    1 
ATOM   2953 N  N6    . DA  F 3 10  ? -29.083 69.305 -234.532 1.00 23.52 ? 10  DA  F N6    1 
ATOM   2954 N  N1    . DA  F 3 10  ? -27.322 68.649 -235.885 1.00 24.10 ? 10  DA  F N1    1 
ATOM   2955 C  C2    . DA  F 3 10  ? -26.028 68.338 -236.015 1.00 28.11 ? 10  DA  F C2    1 
ATOM   2956 N  N3    . DA  F 3 10  ? -25.075 68.311 -235.084 1.00 32.40 ? 10  DA  F N3    1 
ATOM   2957 C  C4    . DA  F 3 10  ? -25.570 68.657 -233.885 1.00 28.28 ? 10  DA  F C4    1 
ATOM   2958 P  P     . DC  F 3 11  ? -19.834 71.253 -231.385 1.00 48.51 ? 11  DC  F P     1 
ATOM   2959 O  OP1   . DC  F 3 11  ? -18.372 71.189 -231.171 1.00 55.25 ? 11  DC  F OP1   1 
ATOM   2960 O  OP2   . DC  F 3 11  ? -20.666 72.117 -230.517 1.00 51.10 ? 11  DC  F OP2   1 
ATOM   2961 O  "O5'" . DC  F 3 11  ? -20.113 71.664 -232.905 1.00 44.68 ? 11  DC  F "O5'" 1 
ATOM   2962 C  "C5'" . DC  F 3 11  ? -19.643 70.834 -233.962 1.00 39.45 ? 11  DC  F "C5'" 1 
ATOM   2963 C  "C4'" . DC  F 3 11  ? -20.213 71.285 -235.294 1.00 38.33 ? 11  DC  F "C4'" 1 
ATOM   2964 O  "O4'" . DC  F 3 11  ? -21.640 71.034 -235.326 1.00 39.30 ? 11  DC  F "O4'" 1 
ATOM   2965 C  "C3'" . DC  F 3 11  ? -20.031 72.775 -235.600 1.00 43.29 ? 11  DC  F "C3'" 1 
ATOM   2966 O  "O3'" . DC  F 3 11  ? -19.337 72.936 -236.830 1.00 45.03 ? 11  DC  F "O3'" 1 
ATOM   2967 C  "C2'" . DC  F 3 11  ? -21.461 73.326 -235.675 1.00 44.48 ? 11  DC  F "C2'" 1 
ATOM   2968 C  "C1'" . DC  F 3 11  ? -22.267 72.083 -236.016 1.00 36.85 ? 11  DC  F "C1'" 1 
ATOM   2969 N  N1    . DC  F 3 11  ? -23.696 72.156 -235.583 1.00 34.33 ? 11  DC  F N1    1 
ATOM   2970 C  C2    . DC  F 3 11  ? -24.715 72.033 -236.535 1.00 31.37 ? 11  DC  F C2    1 
ATOM   2971 O  O2    . DC  F 3 11  ? -24.413 71.862 -237.722 1.00 35.82 ? 11  DC  F O2    1 
ATOM   2972 N  N3    . DC  F 3 11  ? -26.007 72.102 -236.127 1.00 27.73 ? 11  DC  F N3    1 
ATOM   2973 C  C4    . DC  F 3 11  ? -26.291 72.286 -234.837 1.00 27.56 ? 11  DC  F C4    1 
ATOM   2974 N  N4    . DC  F 3 11  ? -27.579 72.349 -234.483 1.00 29.63 ? 11  DC  F N4    1 
ATOM   2975 C  C5    . DC  F 3 11  ? -25.266 72.416 -233.852 1.00 33.00 ? 11  DC  F C5    1 
ATOM   2976 C  C6    . DC  F 3 11  ? -23.997 72.346 -234.266 1.00 32.71 ? 11  DC  F C6    1 
ATOM   2977 P  P     . DG  F 3 12  ? -18.724 74.365 -237.229 1.00 55.02 ? 12  DG  F P     1 
ATOM   2978 O  OP1   . DG  F 3 12  ? -17.518 74.129 -238.054 1.00 70.15 ? 12  DG  F OP1   1 
ATOM   2979 O  OP2   . DG  F 3 12  ? -18.621 75.172 -235.992 1.00 54.72 ? 12  DG  F OP2   1 
ATOM   2980 O  "O5'" . DG  F 3 12  ? -19.855 75.018 -238.149 1.00 49.47 ? 12  DG  F "O5'" 1 
ATOM   2981 C  "C5'" . DG  F 3 12  ? -20.298 74.335 -239.315 1.00 45.08 ? 12  DG  F "C5'" 1 
ATOM   2982 C  "C4'" . DG  F 3 12  ? -21.494 75.041 -239.923 1.00 44.40 ? 12  DG  F "C4'" 1 
ATOM   2983 O  "O4'" . DG  F 3 12  ? -22.675 74.733 -239.154 1.00 44.81 ? 12  DG  F "O4'" 1 
ATOM   2984 C  "C3'" . DG  F 3 12  ? -21.387 76.568 -239.954 1.00 48.86 ? 12  DG  F "C3'" 1 
ATOM   2985 O  "O3'" . DG  F 3 12  ? -21.329 77.026 -241.300 1.00 53.79 ? 12  DG  F "O3'" 1 
ATOM   2986 C  "C2'" . DG  F 3 12  ? -22.651 77.068 -239.233 1.00 46.77 ? 12  DG  F "C2'" 1 
ATOM   2987 C  "C1'" . DG  F 3 12  ? -23.542 75.834 -239.189 1.00 42.78 ? 12  DG  F "C1'" 1 
ATOM   2988 N  N9    . DG  F 3 12  ? -24.398 75.777 -238.006 1.00 38.62 ? 12  DG  F N9    1 
ATOM   2989 C  C8    . DG  F 3 12  ? -24.002 75.878 -236.694 1.00 37.57 ? 12  DG  F C8    1 
ATOM   2990 N  N7    . DG  F 3 12  ? -24.989 75.788 -235.846 1.00 38.06 ? 12  DG  F N7    1 
ATOM   2991 C  C5    . DG  F 3 12  ? -26.111 75.614 -236.645 1.00 35.21 ? 12  DG  F C5    1 
ATOM   2992 C  C6    . DG  F 3 12  ? -27.470 75.458 -236.286 1.00 30.51 ? 12  DG  F C6    1 
ATOM   2993 O  O6    . DG  F 3 12  ? -27.967 75.442 -235.151 1.00 30.68 ? 12  DG  F O6    1 
ATOM   2994 N  N1    . DG  F 3 12  ? -28.285 75.310 -237.406 1.00 29.74 ? 12  DG  F N1    1 
ATOM   2995 C  C2    . DG  F 3 12  ? -27.842 75.312 -238.707 1.00 29.77 ? 12  DG  F C2    1 
ATOM   2996 N  N2    . DG  F 3 12  ? -28.777 75.157 -239.654 1.00 29.30 ? 12  DG  F N2    1 
ATOM   2997 N  N3    . DG  F 3 12  ? -26.570 75.458 -239.058 1.00 32.34 ? 12  DG  F N3    1 
ATOM   2998 C  C4    . DG  F 3 12  ? -25.764 75.604 -237.978 1.00 34.38 ? 12  DG  F C4    1 
ATOM   2999 P  P     . DC  F 3 13  ? -20.965 78.558 -241.616 1.00 60.33 ? 13  DC  F P     1 
ATOM   3000 O  OP1   . DC  F 3 13  ? -20.208 78.592 -242.887 1.00 65.19 ? 13  DC  F OP1   1 
ATOM   3001 O  OP2   . DC  F 3 13  ? -20.370 79.139 -240.393 1.00 57.25 ? 13  DC  F OP2   1 
ATOM   3002 O  "O5'" . DC  F 3 13  ? -22.392 79.244 -241.840 1.00 59.95 ? 13  DC  F "O5'" 1 
ATOM   3003 C  "C5'" . DC  F 3 13  ? -23.314 78.667 -242.754 1.00 51.31 ? 13  DC  F "C5'" 1 
ATOM   3004 C  "C4'" . DC  F 3 13  ? -24.710 79.221 -242.539 1.00 47.83 ? 13  DC  F "C4'" 1 
ATOM   3005 O  "O4'" . DC  F 3 13  ? -25.264 78.687 -241.318 1.00 48.08 ? 13  DC  F "O4'" 1 
ATOM   3006 C  "C3'" . DC  F 3 13  ? -24.788 80.747 -242.405 1.00 51.24 ? 13  DC  F "C3'" 1 
ATOM   3007 O  "O3'" . DC  F 3 13  ? -25.504 81.295 -243.506 1.00 57.85 ? 13  DC  F "O3'" 1 
ATOM   3008 C  "C2'" . DC  F 3 13  ? -25.526 80.981 -241.076 1.00 47.39 ? 13  DC  F "C2'" 1 
ATOM   3009 C  "C1'" . DC  F 3 13  ? -26.163 79.627 -240.802 1.00 46.95 ? 13  DC  F "C1'" 1 
ATOM   3010 N  N1    . DC  F 3 13  ? -26.370 79.346 -239.354 1.00 42.97 ? 13  DC  F N1    1 
ATOM   3011 C  C2    . DC  F 3 13  ? -27.636 78.963 -238.902 1.00 35.14 ? 13  DC  F C2    1 
ATOM   3012 O  O2    . DC  F 3 13  ? -28.561 78.861 -239.717 1.00 34.85 ? 13  DC  F O2    1 
ATOM   3013 N  N3    . DC  F 3 13  ? -27.814 78.712 -237.581 1.00 34.89 ? 13  DC  F N3    1 
ATOM   3014 C  C4    . DC  F 3 13  ? -26.789 78.833 -236.735 1.00 38.14 ? 13  DC  F C4    1 
ATOM   3015 N  N4    . DC  F 3 13  ? -27.012 78.575 -235.442 1.00 36.53 ? 13  DC  F N4    1 
ATOM   3016 C  C5    . DC  F 3 13  ? -25.490 79.224 -237.178 1.00 40.01 ? 13  DC  F C5    1 
ATOM   3017 C  C6    . DC  F 3 13  ? -25.328 79.469 -238.482 1.00 40.51 ? 13  DC  F C6    1 
HETATM 3018 ZN ZN    . ZN  G 4 .   ? -20.371 49.739 -258.997 1.00 17.42 ? 501 ZN  A ZN    1 
HETATM 3019 ZN ZN    . ZN  H 4 .   ? -45.558 40.781 -253.648 1.00 24.85 ? 502 ZN  A ZN    1 
HETATM 3020 ZN ZN    . ZN  I 4 .   ? -48.573 30.697 -278.857 1.00 37.25 ? 503 ZN  A ZN    1 
HETATM 3021 ZN ZN    . ZN  J 4 .   ? -26.040 57.525 -283.560 1.00 28.61 ? 504 ZN  A ZN    1 
HETATM 3022 C  C1    . EDO K 5 .   ? -32.570 55.556 -264.014 1.00 42.20 ? 505 EDO A C1    1 
HETATM 3023 O  O1    . EDO K 5 .   ? -33.624 54.638 -263.703 1.00 42.15 ? 505 EDO A O1    1 
HETATM 3024 C  C2    . EDO K 5 .   ? -32.096 55.327 -265.445 1.00 45.05 ? 505 EDO A C2    1 
HETATM 3025 O  O2    . EDO K 5 .   ? -31.497 54.032 -265.554 1.00 41.46 ? 505 EDO A O2    1 
HETATM 3026 C  C1    . EDO L 5 .   ? -33.964 46.228 -248.043 1.00 50.80 ? 506 EDO A C1    1 
HETATM 3027 O  O1    . EDO L 5 .   ? -32.545 46.046 -248.003 1.00 54.75 ? 506 EDO A O1    1 
HETATM 3028 C  C2    . EDO L 5 .   ? -34.301 47.651 -247.615 1.00 47.96 ? 506 EDO A C2    1 
HETATM 3029 O  O2    . EDO L 5 .   ? -33.629 48.582 -248.471 1.00 44.70 ? 506 EDO A O2    1 
HETATM 3030 ZN ZN    . ZN  M 4 .   ? -17.739 56.649 -246.870 1.00 22.24 ? 501 ZN  D ZN    1 
HETATM 3031 ZN ZN    . ZN  N 4 .   ? -42.125 69.947 -246.219 1.00 27.56 ? 502 ZN  D ZN    1 
HETATM 3032 ZN ZN    . ZN  O 4 .   ? -39.170 79.895 -221.917 1.00 42.35 ? 503 ZN  D ZN    1 
HETATM 3033 ZN ZN    . ZN  P 4 .   ? -5.838  48.300 -220.105 1.00 33.71 ? 504 ZN  D ZN    1 
HETATM 3034 O  O     . HOH Q 6 .   ? -14.378 52.680 -260.262 1.00 49.17 ? 601 HOH A O     1 
HETATM 3035 O  O     . HOH Q 6 .   ? -14.384 51.510 -265.673 1.00 48.82 ? 602 HOH A O     1 
HETATM 3036 O  O     . HOH Q 6 .   ? -22.254 49.121 -267.670 1.00 39.92 ? 603 HOH A O     1 
HETATM 3037 O  O     . HOH Q 6 .   ? -13.372 45.410 -259.599 1.00 31.83 ? 604 HOH A O     1 
HETATM 3038 O  O     . HOH Q 6 .   ? -23.606 45.421 -262.750 1.00 30.14 ? 605 HOH A O     1 
HETATM 3039 O  O     . HOH Q 6 .   ? -49.612 44.289 -254.901 1.00 30.39 ? 606 HOH A O     1 
HETATM 3040 O  O     . HOH Q 6 .   ? -8.739  49.752 -253.809 1.00 31.59 ? 607 HOH A O     1 
HETATM 3041 O  O     . HOH Q 6 .   ? -18.606 62.114 -276.335 1.00 34.92 ? 608 HOH A O     1 
HETATM 3042 O  O     . HOH Q 6 .   ? -28.161 54.704 -255.533 1.00 26.23 ? 609 HOH A O     1 
HETATM 3043 O  O     . HOH Q 6 .   ? -11.079 48.309 -260.180 1.00 35.21 ? 610 HOH A O     1 
HETATM 3044 O  O     . HOH Q 6 .   ? -14.178 44.124 -261.931 1.00 28.83 ? 611 HOH A O     1 
HETATM 3045 O  O     . HOH Q 6 .   ? -14.251 44.983 -257.167 1.00 45.92 ? 612 HOH A O     1 
HETATM 3046 O  O     . HOH Q 6 .   ? -11.875 49.432 -265.957 1.00 33.78 ? 613 HOH A O     1 
HETATM 3047 O  O     . HOH Q 6 .   ? -30.258 46.713 -254.216 1.00 20.49 ? 614 HOH A O     1 
HETATM 3048 O  O     . HOH Q 6 .   ? -28.815 55.739 -277.781 1.00 33.78 ? 615 HOH A O     1 
HETATM 3049 O  O     . HOH Q 6 .   ? -22.264 51.931 -269.476 1.00 30.61 ? 616 HOH A O     1 
HETATM 3050 O  O     . HOH Q 6 .   ? -49.593 37.237 -263.869 1.00 39.06 ? 617 HOH A O     1 
HETATM 3051 O  O     . HOH Q 6 .   ? -24.447 64.198 -268.492 1.00 31.09 ? 618 HOH A O     1 
HETATM 3052 O  O     . HOH Q 6 .   ? -28.271 53.212 -252.933 1.00 27.36 ? 619 HOH A O     1 
HETATM 3053 O  O     . HOH Q 6 .   ? -17.622 53.960 -282.208 1.00 34.17 ? 620 HOH A O     1 
HETATM 3054 O  O     . HOH Q 6 .   ? -39.552 43.910 -264.711 1.00 17.89 ? 621 HOH A O     1 
HETATM 3055 O  O     . HOH Q 6 .   ? -23.162 55.642 -274.112 1.00 34.57 ? 622 HOH A O     1 
HETATM 3056 O  O     . HOH Q 6 .   ? -48.841 39.891 -246.241 1.00 47.78 ? 623 HOH A O     1 
HETATM 3057 O  O     . HOH Q 6 .   ? -41.700 36.603 -254.109 1.00 42.58 ? 624 HOH A O     1 
HETATM 3058 O  O     . HOH Q 6 .   ? -36.432 62.546 -277.926 1.00 35.28 ? 625 HOH A O     1 
HETATM 3059 O  O     . HOH Q 6 .   ? -46.043 47.001 -268.796 1.00 41.68 ? 626 HOH A O     1 
HETATM 3060 O  O     . HOH Q 6 .   ? -24.743 63.477 -285.391 1.00 53.08 ? 627 HOH A O     1 
HETATM 3061 O  O     . HOH Q 6 .   ? -20.754 53.384 -282.754 1.00 34.14 ? 628 HOH A O     1 
HETATM 3062 O  O     . HOH Q 6 .   ? -38.571 45.974 -266.666 1.00 24.02 ? 629 HOH A O     1 
HETATM 3063 O  O     . HOH Q 6 .   ? -24.191 61.338 -283.049 1.00 41.54 ? 630 HOH A O     1 
HETATM 3064 O  O     . HOH Q 6 .   ? -42.370 32.048 -271.822 1.00 31.45 ? 631 HOH A O     1 
HETATM 3065 O  O     . HOH Q 6 .   ? -35.041 50.853 -263.922 1.00 27.94 ? 632 HOH A O     1 
HETATM 3066 O  O     . HOH Q 6 .   ? -19.383 56.795 -257.854 1.00 26.74 ? 633 HOH A O     1 
HETATM 3067 O  O     . HOH Q 6 .   ? -35.993 40.399 -251.133 1.00 50.91 ? 634 HOH A O     1 
HETATM 3068 O  O     . HOH Q 6 .   ? -29.691 48.079 -259.364 1.00 27.83 ? 635 HOH A O     1 
HETATM 3069 O  O     . HOH Q 6 .   ? -35.610 44.922 -258.609 1.00 18.07 ? 636 HOH A O     1 
HETATM 3070 O  O     . HOH Q 6 .   ? -36.393 36.463 -270.726 1.00 33.84 ? 637 HOH A O     1 
HETATM 3071 O  O     . HOH Q 6 .   ? -38.630 54.682 -260.436 1.00 32.12 ? 638 HOH A O     1 
HETATM 3072 O  O     . HOH Q 6 .   ? -15.361 56.125 -270.747 1.00 48.64 ? 639 HOH A O     1 
HETATM 3073 O  O     . HOH Q 6 .   ? -44.659 28.793 -273.619 1.00 39.17 ? 640 HOH A O     1 
HETATM 3074 O  O     . HOH Q 6 .   ? -38.454 30.124 -284.129 1.00 53.91 ? 641 HOH A O     1 
HETATM 3075 O  O     . HOH Q 6 .   ? -31.697 56.397 -260.869 1.00 37.77 ? 642 HOH A O     1 
HETATM 3076 O  O     . HOH Q 6 .   ? -43.747 50.002 -259.244 1.00 25.08 ? 643 HOH A O     1 
HETATM 3077 O  O     . HOH Q 6 .   ? -39.126 42.320 -269.041 1.00 25.68 ? 644 HOH A O     1 
HETATM 3078 O  O     . HOH Q 6 .   ? -19.991 46.287 -253.027 1.00 42.40 ? 645 HOH A O     1 
HETATM 3079 O  O     . HOH Q 6 .   ? -39.058 41.488 -259.587 1.00 18.72 ? 646 HOH A O     1 
HETATM 3080 O  O     . HOH Q 6 .   ? -20.033 53.321 -276.030 1.00 46.89 ? 647 HOH A O     1 
HETATM 3081 O  O     . HOH Q 6 .   ? -49.791 35.559 -254.736 1.00 51.61 ? 648 HOH A O     1 
HETATM 3082 O  O     . HOH Q 6 .   ? -13.316 51.829 -255.028 1.00 34.89 ? 649 HOH A O     1 
HETATM 3083 O  O     . HOH Q 6 .   ? -43.511 38.966 -263.621 1.00 23.59 ? 650 HOH A O     1 
HETATM 3084 O  O     . HOH Q 6 .   ? -32.298 50.091 -246.398 1.00 52.48 ? 651 HOH A O     1 
HETATM 3085 O  O     . HOH Q 6 .   ? -25.457 57.184 -274.635 1.00 35.80 ? 652 HOH A O     1 
HETATM 3086 O  O     . HOH Q 6 .   ? -38.669 48.962 -248.997 1.00 47.69 ? 653 HOH A O     1 
HETATM 3087 O  O     . HOH Q 6 .   ? -17.540 59.789 -261.977 1.00 47.52 ? 654 HOH A O     1 
HETATM 3088 O  O     . HOH Q 6 .   ? -31.039 54.938 -255.480 1.00 33.24 ? 655 HOH A O     1 
HETATM 3089 O  O     . HOH Q 6 .   ? -46.663 34.729 -267.175 1.00 34.12 ? 656 HOH A O     1 
HETATM 3090 O  O     . HOH Q 6 .   ? -16.678 53.197 -272.980 1.00 53.19 ? 657 HOH A O     1 
HETATM 3091 O  O     . HOH Q 6 .   ? -46.815 54.069 -251.779 1.00 36.61 ? 658 HOH A O     1 
HETATM 3092 O  O     . HOH Q 6 .   ? -29.325 61.272 -261.666 1.00 29.81 ? 659 HOH A O     1 
HETATM 3093 O  O     . HOH Q 6 .   ? -37.642 41.864 -249.096 1.00 38.61 ? 660 HOH A O     1 
HETATM 3094 O  O     . HOH Q 6 .   ? -24.087 54.267 -270.226 1.00 37.98 ? 661 HOH A O     1 
HETATM 3095 O  O     . HOH Q 6 .   ? -28.379 54.674 -272.440 1.00 30.60 ? 662 HOH A O     1 
HETATM 3096 O  O     . HOH Q 6 .   ? -35.980 43.733 -245.450 1.00 44.46 ? 663 HOH A O     1 
HETATM 3097 O  O     . HOH Q 6 .   ? -25.250 44.151 -251.667 1.00 55.60 ? 664 HOH A O     1 
HETATM 3098 O  O     . HOH Q 6 .   ? -14.945 57.207 -266.785 1.00 56.55 ? 665 HOH A O     1 
HETATM 3099 O  O     . HOH Q 6 .   ? -18.927 43.228 -253.254 1.00 49.33 ? 666 HOH A O     1 
HETATM 3100 O  O     . HOH Q 6 .   ? -15.298 58.438 -270.627 1.00 36.14 ? 667 HOH A O     1 
HETATM 3101 O  O     . HOH Q 6 .   ? -42.436 51.256 -251.903 1.00 37.44 ? 668 HOH A O     1 
HETATM 3102 O  O     . HOH Q 6 .   ? -34.640 57.114 -283.217 1.00 44.40 ? 669 HOH A O     1 
HETATM 3103 O  O     . HOH Q 6 .   ? -19.436 59.487 -260.441 1.00 53.94 ? 670 HOH A O     1 
HETATM 3104 O  O     . HOH Q 6 .   ? -33.179 71.110 -277.829 1.00 44.68 ? 671 HOH A O     1 
HETATM 3105 O  O     . HOH Q 6 .   ? -15.447 41.612 -248.989 1.00 43.07 ? 672 HOH A O     1 
HETATM 3106 O  O     . HOH Q 6 .   ? -16.464 45.702 -261.679 1.00 25.05 ? 673 HOH A O     1 
HETATM 3107 O  O     . HOH Q 6 .   ? -9.063  48.525 -258.389 1.00 31.23 ? 674 HOH A O     1 
HETATM 3108 O  O     . HOH Q 6 .   ? -35.565 70.595 -278.738 1.00 50.38 ? 675 HOH A O     1 
HETATM 3109 O  O     . HOH Q 6 .   ? -17.356 45.876 -256.939 1.00 33.93 ? 676 HOH A O     1 
HETATM 3110 O  O     . HOH Q 6 .   ? -13.711 56.727 -264.706 1.00 52.31 ? 677 HOH A O     1 
HETATM 3111 O  O     . HOH Q 6 .   ? -43.491 43.380 -269.581 1.00 45.37 ? 678 HOH A O     1 
HETATM 3112 O  O     . HOH Q 6 .   ? -35.823 54.986 -259.669 1.00 46.56 ? 679 HOH A O     1 
HETATM 3113 O  O     . HOH Q 6 .   ? -38.610 61.654 -287.417 1.00 39.16 ? 680 HOH A O     1 
HETATM 3114 O  O     . HOH Q 6 .   ? -19.507 49.781 -267.451 1.00 26.20 ? 681 HOH A O     1 
HETATM 3115 O  O     . HOH Q 6 .   ? -32.322 70.015 -275.403 1.00 38.65 ? 682 HOH A O     1 
HETATM 3116 O  O     . HOH Q 6 .   ? -42.133 50.372 -264.849 1.00 23.16 ? 683 HOH A O     1 
HETATM 3117 O  O     . HOH Q 6 .   ? -29.290 56.739 -272.950 1.00 40.04 ? 684 HOH A O     1 
HETATM 3118 O  O     . HOH Q 6 .   ? -13.833 52.028 -258.114 1.00 44.62 ? 685 HOH A O     1 
HETATM 3119 O  O     . HOH Q 6 .   ? -33.423 69.679 -273.179 1.00 52.12 ? 686 HOH A O     1 
HETATM 3120 O  O     . HOH Q 6 .   ? -35.625 34.787 -255.274 1.00 49.52 ? 687 HOH A O     1 
HETATM 3121 O  O     . HOH Q 6 .   ? -36.053 51.987 -260.449 1.00 22.18 ? 688 HOH A O     1 
HETATM 3122 O  O     . HOH Q 6 .   ? -35.219 30.500 -278.892 1.00 43.97 ? 689 HOH A O     1 
HETATM 3123 O  O     . HOH Q 6 .   ? -44.407 45.359 -268.908 1.00 36.28 ? 690 HOH A O     1 
HETATM 3124 O  O     . HOH Q 6 .   ? -20.408 60.985 -281.800 1.00 43.65 ? 691 HOH A O     1 
HETATM 3125 O  O     . HOH Q 6 .   ? -41.968 44.265 -243.960 1.00 45.05 ? 692 HOH A O     1 
HETATM 3126 O  O     . HOH Q 6 .   ? -47.829 32.364 -267.967 1.00 48.14 ? 693 HOH A O     1 
HETATM 3127 O  O     . HOH Q 6 .   ? -52.264 34.550 -259.086 1.00 60.32 ? 694 HOH A O     1 
HETATM 3128 O  O     . HOH Q 6 .   ? -36.437 36.487 -273.637 1.00 54.55 ? 695 HOH A O     1 
HETATM 3129 O  O     . HOH Q 6 .   ? -27.042 53.405 -283.043 1.00 49.57 ? 696 HOH A O     1 
HETATM 3130 O  O     . HOH Q 6 .   ? -17.229 49.180 -268.043 1.00 51.97 ? 697 HOH A O     1 
HETATM 3131 O  O     . HOH Q 6 .   ? -27.461 43.395 -254.765 1.00 52.62 ? 698 HOH A O     1 
HETATM 3132 O  O     . HOH Q 6 .   ? -48.512 31.817 -264.023 1.00 52.12 ? 699 HOH A O     1 
HETATM 3133 O  O     . HOH Q 6 .   ? -17.815 46.986 -266.490 1.00 44.20 ? 700 HOH A O     1 
HETATM 3134 O  O     . HOH Q 6 .   ? -15.417 60.357 -269.105 1.00 44.88 ? 701 HOH A O     1 
HETATM 3135 O  O     . HOH Q 6 .   ? -30.318 59.110 -273.621 1.00 42.53 ? 702 HOH A O     1 
HETATM 3136 O  O     . HOH Q 6 .   ? -26.068 65.824 -272.899 1.00 52.14 ? 703 HOH A O     1 
HETATM 3137 O  O     . HOH Q 6 .   ? -22.418 51.909 -281.947 1.00 42.87 ? 704 HOH A O     1 
HETATM 3138 O  O     . HOH Q 6 .   ? -42.414 29.974 -273.044 1.00 46.40 ? 705 HOH A O     1 
HETATM 3139 O  O     . HOH Q 6 .   ? -50.502 48.247 -247.637 1.00 50.96 ? 706 HOH A O     1 
HETATM 3140 O  O     . HOH Q 6 .   ? -20.166 63.231 -277.946 1.00 47.23 ? 707 HOH A O     1 
HETATM 3141 O  O     . HOH Q 6 .   ? -30.124 44.126 -253.710 1.00 34.08 ? 708 HOH A O     1 
HETATM 3142 O  O     . HOH Q 6 .   ? -20.542 45.885 -260.079 1.00 44.93 ? 709 HOH A O     1 
HETATM 3143 O  O     . HOH Q 6 .   ? -41.330 43.828 -269.032 1.00 36.62 ? 710 HOH A O     1 
HETATM 3144 O  O     . HOH Q 6 .   ? -43.791 51.529 -254.512 1.00 36.92 ? 711 HOH A O     1 
HETATM 3145 O  O     . HOH Q 6 .   ? -43.827 36.996 -252.726 1.00 50.27 ? 712 HOH A O     1 
HETATM 3146 O  O     . HOH Q 6 .   ? -26.982 57.087 -272.526 1.00 42.47 ? 713 HOH A O     1 
HETATM 3147 O  O     . HOH Q 6 .   ? -45.682 35.215 -253.915 1.00 48.01 ? 714 HOH A O     1 
HETATM 3148 O  O     . HOH Q 6 .   ? -18.229 44.064 -255.631 1.00 53.49 ? 715 HOH A O     1 
HETATM 3149 O  O     . HOH Q 6 .   ? -19.711 63.258 -280.985 1.00 53.65 ? 716 HOH A O     1 
HETATM 3150 O  O     . HOH Q 6 .   ? -30.543 61.446 -272.360 1.00 34.65 ? 717 HOH A O     1 
HETATM 3151 O  O     . HOH Q 6 .   ? -17.870 45.443 -259.433 1.00 38.48 ? 718 HOH A O     1 
HETATM 3152 O  O     . HOH Q 6 .   ? -18.048 60.114 -283.117 1.00 37.70 ? 719 HOH A O     1 
HETATM 3153 O  O     . HOH Q 6 .   ? -43.053 51.876 -257.309 1.00 38.47 ? 720 HOH A O     1 
HETATM 3154 O  O     . HOH Q 6 .   ? -23.154 61.051 -260.311 1.00 42.43 ? 721 HOH A O     1 
HETATM 3155 O  O     . HOH Q 6 .   ? -10.675 55.435 -271.829 1.00 53.60 ? 722 HOH A O     1 
HETATM 3156 O  O     . HOH R 6 .   ? -27.202 42.985 -257.032 1.00 38.40 ? 101 HOH B O     1 
HETATM 3157 O  O     . HOH R 6 .   ? -31.440 40.488 -254.663 1.00 37.60 ? 102 HOH B O     1 
HETATM 3158 O  O     . HOH R 6 .   ? -47.697 34.915 -264.599 1.00 38.84 ? 103 HOH B O     1 
HETATM 3159 O  O     . HOH R 6 .   ? -32.089 57.771 -275.454 1.00 36.08 ? 104 HOH B O     1 
HETATM 3160 O  O     . HOH R 6 .   ? -43.459 32.097 -269.330 1.00 35.81 ? 105 HOH B O     1 
HETATM 3161 O  O     . HOH R 6 .   ? -34.331 63.350 -270.516 1.00 36.68 ? 106 HOH B O     1 
HETATM 3162 O  O     . HOH R 6 .   ? -38.512 42.044 -266.242 1.00 24.85 ? 107 HOH B O     1 
HETATM 3163 O  O     . HOH R 6 .   ? -41.140 40.002 -262.751 1.00 19.37 ? 108 HOH B O     1 
HETATM 3164 O  O     . HOH R 6 .   ? -31.995 61.181 -269.866 1.00 25.21 ? 109 HOH B O     1 
HETATM 3165 O  O     . HOH R 6 .   ? -40.661 30.597 -261.680 1.00 39.20 ? 110 HOH B O     1 
HETATM 3166 O  O     . HOH R 6 .   ? -36.486 41.043 -253.847 1.00 27.30 ? 111 HOH B O     1 
HETATM 3167 O  O     . HOH R 6 .   ? -35.946 66.461 -270.842 1.00 33.61 ? 112 HOH B O     1 
HETATM 3168 O  O     . HOH R 6 .   ? -30.017 47.865 -262.105 1.00 18.35 ? 113 HOH B O     1 
HETATM 3169 O  O     . HOH R 6 .   ? -26.634 51.857 -269.117 1.00 29.48 ? 114 HOH B O     1 
HETATM 3170 O  O     . HOH R 6 .   ? -42.148 35.772 -256.795 1.00 31.80 ? 115 HOH B O     1 
HETATM 3171 O  O     . HOH R 6 .   ? -27.832 42.418 -267.214 1.00 34.16 ? 116 HOH B O     1 
HETATM 3172 O  O     . HOH R 6 .   ? -22.730 50.490 -273.149 1.00 38.16 ? 117 HOH B O     1 
HETATM 3173 O  O     . HOH R 6 .   ? -38.913 35.159 -270.028 1.00 28.66 ? 118 HOH B O     1 
HETATM 3174 O  O     . HOH R 6 .   ? -36.770 64.273 -271.843 1.00 45.21 ? 119 HOH B O     1 
HETATM 3175 O  O     . HOH R 6 .   ? -41.193 58.332 -269.988 1.00 57.51 ? 120 HOH B O     1 
HETATM 3176 O  O     . HOH R 6 .   ? -32.381 36.332 -260.143 1.00 37.68 ? 121 HOH B O     1 
HETATM 3177 O  O     . HOH R 6 .   ? -43.674 36.487 -264.740 1.00 22.17 ? 122 HOH B O     1 
HETATM 3178 O  O     . HOH R 6 .   ? -27.332 55.443 -275.628 1.00 40.17 ? 123 HOH B O     1 
HETATM 3179 O  O     . HOH R 6 .   ? -31.959 48.869 -274.604 1.00 26.95 ? 124 HOH B O     1 
HETATM 3180 O  O     . HOH R 6 .   ? -28.317 45.558 -271.716 1.00 31.59 ? 125 HOH B O     1 
HETATM 3181 O  O     . HOH R 6 .   ? -28.560 53.203 -278.839 1.00 38.82 ? 126 HOH B O     1 
HETATM 3182 O  O     . HOH R 6 .   ? -34.334 43.372 -255.908 1.00 23.90 ? 127 HOH B O     1 
HETATM 3183 O  O     . HOH R 6 .   ? -37.888 32.957 -260.564 1.00 45.99 ? 128 HOH B O     1 
HETATM 3184 O  O     . HOH R 6 .   ? -32.826 36.734 -255.844 1.00 43.48 ? 129 HOH B O     1 
HETATM 3185 O  O     . HOH R 6 .   ? -39.885 32.326 -270.156 1.00 32.42 ? 130 HOH B O     1 
HETATM 3186 O  O     . HOH R 6 .   ? -48.771 34.029 -260.762 1.00 60.03 ? 131 HOH B O     1 
HETATM 3187 O  O     . HOH R 6 .   ? -29.645 39.555 -263.468 1.00 40.14 ? 132 HOH B O     1 
HETATM 3188 O  O     . HOH R 6 .   ? -28.034 50.870 -264.185 1.00 19.46 ? 133 HOH B O     1 
HETATM 3189 O  O     . HOH R 6 .   ? -23.336 45.918 -271.508 1.00 46.42 ? 134 HOH B O     1 
HETATM 3190 O  O     . HOH R 6 .   ? -36.354 42.165 -258.931 1.00 18.78 ? 135 HOH B O     1 
HETATM 3191 O  O     . HOH R 6 .   ? -35.907 52.241 -274.510 1.00 46.97 ? 136 HOH B O     1 
HETATM 3192 O  O     . HOH R 6 .   ? -34.952 56.464 -280.886 1.00 38.93 ? 137 HOH B O     1 
HETATM 3193 O  O     . HOH R 6 .   ? -39.999 54.735 -272.953 1.00 54.63 ? 138 HOH B O     1 
HETATM 3194 O  O     . HOH R 6 .   ? -29.510 46.518 -257.057 1.00 21.91 ? 139 HOH B O     1 
HETATM 3195 O  O     . HOH R 6 .   ? -43.306 27.608 -262.541 1.00 45.45 ? 140 HOH B O     1 
HETATM 3196 O  O     . HOH R 6 .   ? -31.477 43.021 -255.729 1.00 25.84 ? 141 HOH B O     1 
HETATM 3197 O  O     . HOH R 6 .   ? -27.613 41.710 -270.455 1.00 57.75 ? 142 HOH B O     1 
HETATM 3198 O  O     . HOH R 6 .   ? -39.362 31.261 -259.938 1.00 54.27 ? 143 HOH B O     1 
HETATM 3199 O  O     . HOH R 6 .   ? -42.058 55.329 -271.945 1.00 50.46 ? 144 HOH B O     1 
HETATM 3200 O  O     . HOH R 6 .   ? -40.693 33.664 -257.271 1.00 49.99 ? 145 HOH B O     1 
HETATM 3201 O  O     . HOH S 6 .   ? -33.923 37.805 -275.149 1.00 58.09 ? 101 HOH C O     1 
HETATM 3202 O  O     . HOH S 6 .   ? -46.701 50.390 -266.537 1.00 50.77 ? 102 HOH C O     1 
HETATM 3203 O  O     . HOH S 6 .   ? -34.569 57.966 -259.734 1.00 44.63 ? 103 HOH C O     1 
HETATM 3204 O  O     . HOH S 6 .   ? -26.259 62.686 -266.675 1.00 26.76 ? 104 HOH C O     1 
HETATM 3205 O  O     . HOH S 6 .   ? -40.992 42.512 -277.331 1.00 44.12 ? 105 HOH C O     1 
HETATM 3206 O  O     . HOH S 6 .   ? -41.978 57.462 -267.919 1.00 41.03 ? 106 HOH C O     1 
HETATM 3207 O  O     . HOH S 6 .   ? -33.217 46.664 -275.037 1.00 33.68 ? 107 HOH C O     1 
HETATM 3208 O  O     . HOH S 6 .   ? -40.776 60.242 -264.971 1.00 42.18 ? 108 HOH C O     1 
HETATM 3209 O  O     . HOH S 6 .   ? -31.979 32.355 -270.419 1.00 47.07 ? 109 HOH C O     1 
HETATM 3210 O  O     . HOH S 6 .   ? -28.766 39.944 -268.311 1.00 34.53 ? 110 HOH C O     1 
HETATM 3211 O  O     . HOH S 6 .   ? -29.874 43.376 -272.865 1.00 35.42 ? 111 HOH C O     1 
HETATM 3212 O  O     . HOH S 6 .   ? -30.925 65.175 -268.291 1.00 41.06 ? 112 HOH C O     1 
HETATM 3213 O  O     . HOH S 6 .   ? -41.667 51.747 -262.941 1.00 34.85 ? 113 HOH C O     1 
HETATM 3214 O  O     . HOH S 6 .   ? -30.638 61.274 -267.496 1.00 26.55 ? 114 HOH C O     1 
HETATM 3215 O  O     . HOH S 6 .   ? -31.561 33.189 -261.630 1.00 45.04 ? 115 HOH C O     1 
HETATM 3216 O  O     . HOH S 6 .   ? -32.954 29.887 -270.127 1.00 36.09 ? 116 HOH C O     1 
HETATM 3217 O  O     . HOH S 6 .   ? -28.173 37.337 -264.757 1.00 49.83 ? 117 HOH C O     1 
HETATM 3218 O  O     . HOH S 6 .   ? -38.149 41.302 -274.664 1.00 33.66 ? 118 HOH C O     1 
HETATM 3219 O  O     . HOH S 6 .   ? -47.133 53.284 -271.136 1.00 51.21 ? 119 HOH C O     1 
HETATM 3220 O  O     . HOH S 6 .   ? -26.531 63.625 -256.118 1.00 46.17 ? 120 HOH C O     1 
HETATM 3221 O  O     . HOH S 6 .   ? -42.479 47.748 -266.469 1.00 55.44 ? 121 HOH C O     1 
HETATM 3222 O  O     . HOH S 6 .   ? -35.464 48.126 -276.726 1.00 53.78 ? 122 HOH C O     1 
HETATM 3223 O  O     . HOH S 6 .   ? -28.738 31.660 -271.191 1.00 48.95 ? 123 HOH C O     1 
HETATM 3224 O  O     . HOH S 6 .   ? -31.094 59.776 -260.456 1.00 38.68 ? 124 HOH C O     1 
HETATM 3225 O  O     . HOH S 6 .   ? -36.744 38.870 -274.810 1.00 38.90 ? 125 HOH C O     1 
HETATM 3226 O  O     . HOH S 6 .   ? -40.920 46.425 -267.825 1.00 34.45 ? 126 HOH C O     1 
HETATM 3227 O  O     . HOH S 6 .   ? -27.307 71.153 -269.833 1.00 45.23 ? 127 HOH C O     1 
HETATM 3228 O  O     . HOH T 6 .   ? -24.755 51.578 -248.214 1.00 32.27 ? 601 HOH D O     1 
HETATM 3229 O  O     . HOH T 6 .   ? -2.030  43.432 -216.055 1.00 48.66 ? 602 HOH D O     1 
HETATM 3230 O  O     . HOH T 6 .   ? -19.849 48.029 -251.350 1.00 42.05 ? 603 HOH D O     1 
HETATM 3231 O  O     . HOH T 6 .   ? -19.533 61.827 -242.954 1.00 34.46 ? 604 HOH D O     1 
HETATM 3232 O  O     . HOH T 6 .   ? -5.598  41.923 -215.061 1.00 49.03 ? 605 HOH D O     1 
HETATM 3233 O  O     . HOH T 6 .   ? -37.752 73.447 -235.981 1.00 27.85 ? 606 HOH D O     1 
HETATM 3234 O  O     . HOH T 6 .   ? -4.257  50.507 -228.777 1.00 34.09 ? 607 HOH D O     1 
HETATM 3235 O  O     . HOH T 6 .   ? -46.045 66.748 -237.150 1.00 43.08 ? 608 HOH D O     1 
HETATM 3236 O  O     . HOH T 6 .   ? -10.116 51.858 -212.645 1.00 47.01 ? 609 HOH D O     1 
HETATM 3237 O  O     . HOH T 6 .   ? -12.445 53.220 -249.178 1.00 44.57 ? 610 HOH D O     1 
HETATM 3238 O  O     . HOH T 6 .   ? -6.689  47.993 -214.674 1.00 43.13 ? 611 HOH D O     1 
HETATM 3239 O  O     . HOH T 6 .   ? -43.101 60.893 -246.555 1.00 51.64 ? 612 HOH D O     1 
HETATM 3240 O  O     . HOH T 6 .   ? -17.597 46.533 -248.672 1.00 49.93 ? 613 HOH D O     1 
HETATM 3241 O  O     . HOH T 6 .   ? -38.440 67.933 -254.454 1.00 46.43 ? 614 HOH D O     1 
HETATM 3242 O  O     . HOH T 6 .   ? -27.801 61.546 -249.330 1.00 22.92 ? 615 HOH D O     1 
HETATM 3243 O  O     . HOH T 6 .   ? 4.108   58.289 -226.748 1.00 28.56 ? 616 HOH D O     1 
HETATM 3244 O  O     . HOH T 6 .   ? -26.799 53.308 -248.310 1.00 27.95 ? 617 HOH D O     1 
HETATM 3245 O  O     . HOH T 6 .   ? -18.588 49.493 -247.295 1.00 30.22 ? 618 HOH D O     1 
HETATM 3246 O  O     . HOH T 6 .   ? -17.517 56.810 -237.813 1.00 34.07 ? 619 HOH D O     1 
HETATM 3247 O  O     . HOH T 6 .   ? -10.471 52.179 -222.639 1.00 47.04 ? 620 HOH D O     1 
HETATM 3248 O  O     . HOH T 6 .   ? -27.784 47.159 -241.790 1.00 48.80 ? 621 HOH D O     1 
HETATM 3249 O  O     . HOH T 6 .   ? 6.145   50.367 -221.604 1.00 36.68 ? 622 HOH D O     1 
HETATM 3250 O  O     . HOH T 6 .   ? -37.881 58.118 -238.505 1.00 22.64 ? 623 HOH D O     1 
HETATM 3251 O  O     . HOH T 6 .   ? -37.829 70.911 -236.972 1.00 25.06 ? 624 HOH D O     1 
HETATM 3252 O  O     . HOH T 6 .   ? -26.537 60.121 -244.440 1.00 30.22 ? 625 HOH D O     1 
HETATM 3253 O  O     . HOH T 6 .   ? -3.902  54.055 -230.152 1.00 37.93 ? 626 HOH D O     1 
HETATM 3254 O  O     . HOH T 6 .   ? 5.673   52.843 -220.736 1.00 30.30 ? 627 HOH D O     1 
HETATM 3255 O  O     . HOH T 6 .   ? -19.446 46.278 -233.591 1.00 51.53 ? 628 HOH D O     1 
HETATM 3256 O  O     . HOH T 6 .   ? -34.183 65.559 -236.884 1.00 21.21 ? 629 HOH D O     1 
HETATM 3257 O  O     . HOH T 6 .   ? -34.221 77.538 -229.679 1.00 39.06 ? 630 HOH D O     1 
HETATM 3258 O  O     . HOH T 6 .   ? -43.672 65.006 -237.813 1.00 28.26 ? 631 HOH D O     1 
HETATM 3259 O  O     . HOH T 6 .   ? -32.870 60.786 -254.104 1.00 38.56 ? 632 HOH D O     1 
HETATM 3260 O  O     . HOH T 6 .   ? -43.297 73.243 -235.086 1.00 39.68 ? 633 HOH D O     1 
HETATM 3261 O  O     . HOH T 6 .   ? -35.436 54.999 -241.380 1.00 36.49 ? 634 HOH D O     1 
HETATM 3262 O  O     . HOH T 6 .   ? -29.385 52.399 -242.290 1.00 28.29 ? 635 HOH D O     1 
HETATM 3263 O  O     . HOH T 6 .   ? -27.544 54.959 -250.642 1.00 24.20 ? 636 HOH D O     1 
HETATM 3264 O  O     . HOH T 6 .   ? -28.137 68.107 -251.211 1.00 42.28 ? 637 HOH D O     1 
HETATM 3265 O  O     . HOH T 6 .   ? -29.718 53.605 -247.619 1.00 34.63 ? 638 HOH D O     1 
HETATM 3266 O  O     . HOH T 6 .   ? -37.727 60.836 -252.104 1.00 48.65 ? 639 HOH D O     1 
HETATM 3267 O  O     . HOH T 6 .   ? 5.303   60.882 -223.528 1.00 38.51 ? 640 HOH D O     1 
HETATM 3268 O  O     . HOH T 6 .   ? -34.661 68.056 -241.992 1.00 19.76 ? 641 HOH D O     1 
HETATM 3269 O  O     . HOH T 6 .   ? -31.907 64.205 -243.738 1.00 20.46 ? 642 HOH D O     1 
HETATM 3270 O  O     . HOH T 6 .   ? -18.731 61.296 -251.748 1.00 40.67 ? 643 HOH D O     1 
HETATM 3271 O  O     . HOH T 6 .   ? -40.285 60.292 -241.380 1.00 29.54 ? 644 HOH D O     1 
HETATM 3272 O  O     . HOH T 6 .   ? -9.331  55.073 -224.257 1.00 54.87 ? 645 HOH D O     1 
HETATM 3273 O  O     . HOH T 6 .   ? -16.008 46.428 -243.536 1.00 40.79 ? 646 HOH D O     1 
HETATM 3274 O  O     . HOH T 6 .   ? -33.387 57.153 -242.409 1.00 26.50 ? 647 HOH D O     1 
HETATM 3275 O  O     . HOH T 6 .   ? -47.913 71.025 -230.554 1.00 45.36 ? 648 HOH D O     1 
HETATM 3276 O  O     . HOH T 6 .   ? 3.595   61.218 -218.902 1.00 29.11 ? 649 HOH D O     1 
HETATM 3277 O  O     . HOH T 6 .   ? -1.511  53.706 -209.252 1.00 53.79 ? 650 HOH D O     1 
HETATM 3278 O  O     . HOH T 6 .   ? -19.960 61.074 -253.954 1.00 54.79 ? 651 HOH D O     1 
HETATM 3279 O  O     . HOH T 6 .   ? -25.341 50.450 -230.443 1.00 42.26 ? 652 HOH D O     1 
HETATM 3280 O  O     . HOH T 6 .   ? -35.540 68.141 -252.358 1.00 34.28 ? 653 HOH D O     1 
HETATM 3281 O  O     . HOH T 6 .   ? 3.048   61.317 -221.731 1.00 30.21 ? 654 HOH D O     1 
HETATM 3282 O  O     . HOH T 6 .   ? -13.972 56.395 -238.813 1.00 46.04 ? 655 HOH D O     1 
HETATM 3283 O  O     . HOH T 6 .   ? -35.285 80.880 -227.715 1.00 50.77 ? 656 HOH D O     1 
HETATM 3284 O  O     . HOH T 6 .   ? -43.921 63.953 -235.142 1.00 30.88 ? 657 HOH D O     1 
HETATM 3285 O  O     . HOH T 6 .   ? -40.407 74.490 -243.571 1.00 46.36 ? 658 HOH D O     1 
HETATM 3286 O  O     . HOH T 6 .   ? -27.692 64.121 -249.983 1.00 34.02 ? 659 HOH D O     1 
HETATM 3287 O  O     . HOH T 6 .   ? -22.332 58.682 -256.701 1.00 40.15 ? 660 HOH D O     1 
HETATM 3288 O  O     . HOH T 6 .   ? -39.798 75.078 -232.937 1.00 43.91 ? 661 HOH D O     1 
HETATM 3289 O  O     . HOH T 6 .   ? -44.296 64.759 -244.545 1.00 35.77 ? 662 HOH D O     1 
HETATM 3290 O  O     . HOH T 6 .   ? -37.468 59.536 -235.908 1.00 12.77 ? 663 HOH D O     1 
HETATM 3291 O  O     . HOH T 6 .   ? -33.444 53.919 -242.439 1.00 41.04 ? 664 HOH D O     1 
HETATM 3292 O  O     . HOH T 6 .   ? -41.628 68.790 -222.826 1.00 49.16 ? 665 HOH D O     1 
HETATM 3293 O  O     . HOH T 6 .   ? -27.773 48.269 -230.779 1.00 43.80 ? 666 HOH D O     1 
HETATM 3294 O  O     . HOH T 6 .   ? -35.037 65.871 -256.628 1.00 47.67 ? 667 HOH D O     1 
HETATM 3295 O  O     . HOH T 6 .   ? -8.561  57.114 -260.310 1.00 45.35 ? 668 HOH D O     1 
HETATM 3296 O  O     . HOH T 6 .   ? -6.447  49.704 -230.311 1.00 43.21 ? 669 HOH D O     1 
HETATM 3297 O  O     . HOH T 6 .   ? -16.765 61.654 -243.396 1.00 38.75 ? 670 HOH D O     1 
HETATM 3298 O  O     . HOH T 6 .   ? -42.519 62.188 -241.262 1.00 31.46 ? 671 HOH D O     1 
HETATM 3299 O  O     . HOH T 6 .   ? -17.015 60.692 -245.644 1.00 46.40 ? 672 HOH D O     1 
HETATM 3300 O  O     . HOH T 6 .   ? -44.269 62.942 -239.592 1.00 49.60 ? 673 HOH D O     1 
HETATM 3301 O  O     . HOH T 6 .   ? -44.107 62.078 -243.456 1.00 33.02 ? 674 HOH D O     1 
HETATM 3302 O  O     . HOH T 6 .   ? -16.073 61.211 -252.074 1.00 51.44 ? 675 HOH D O     1 
HETATM 3303 O  O     . HOH T 6 .   ? -36.494 62.227 -234.271 1.00 38.37 ? 676 HOH D O     1 
HETATM 3304 O  O     . HOH T 6 .   ? -34.877 65.804 -232.501 1.00 41.23 ? 677 HOH D O     1 
HETATM 3305 O  O     . HOH T 6 .   ? -25.690 46.810 -231.745 1.00 48.11 ? 678 HOH D O     1 
HETATM 3306 O  O     . HOH T 6 .   ? -46.409 60.926 -242.758 1.00 50.71 ? 679 HOH D O     1 
HETATM 3307 O  O     . HOH T 6 .   ? 1.833   63.058 -217.591 1.00 51.59 ? 680 HOH D O     1 
HETATM 3308 O  O     . HOH T 6 .   ? -40.475 58.466 -243.470 1.00 36.36 ? 681 HOH D O     1 
HETATM 3309 O  O     . HOH T 6 .   ? -32.810 54.666 -251.446 1.00 33.69 ? 682 HOH D O     1 
HETATM 3310 O  O     . HOH U 6 .   ? -38.670 43.500 -226.860 1.00 46.59 ? 101 HOH E O     1 
HETATM 3311 O  O     . HOH U 6 .   ? -25.347 50.612 -227.845 1.00 47.01 ? 102 HOH E O     1 
HETATM 3312 O  O     . HOH U 6 .   ? -31.007 46.095 -232.068 1.00 38.44 ? 103 HOH E O     1 
HETATM 3313 O  O     . HOH U 6 .   ? -36.376 77.144 -232.098 1.00 42.75 ? 104 HOH E O     1 
HETATM 3314 O  O     . HOH U 6 .   ? -41.275 75.144 -235.353 1.00 39.75 ? 105 HOH E O     1 
HETATM 3315 O  O     . HOH U 6 .   ? -33.314 68.401 -248.108 1.00 27.87 ? 106 HOH E O     1 
HETATM 3316 O  O     . HOH U 6 .   ? -22.016 55.922 -235.997 1.00 36.74 ? 107 HOH E O     1 
HETATM 3317 O  O     . HOH U 6 .   ? -31.226 74.081 -231.917 1.00 35.45 ? 108 HOH E O     1 
HETATM 3318 O  O     . HOH U 6 .   ? -19.084 53.971 -232.308 1.00 28.42 ? 109 HOH E O     1 
HETATM 3319 O  O     . HOH U 6 .   ? -35.738 69.712 -238.367 1.00 22.45 ? 110 HOH E O     1 
HETATM 3320 O  O     . HOH U 6 .   ? -22.157 61.872 -232.857 1.00 38.91 ? 111 HOH E O     1 
HETATM 3321 O  O     . HOH U 6 .   ? -28.360 65.391 -247.503 1.00 24.24 ? 112 HOH E O     1 
HETATM 3322 O  O     . HOH U 6 .   ? -28.190 67.948 -248.627 1.00 32.86 ? 113 HOH E O     1 
HETATM 3323 O  O     . HOH U 6 .   ? -26.162 60.401 -241.711 1.00 24.39 ? 114 HOH E O     1 
HETATM 3324 O  O     . HOH U 6 .   ? -32.773 67.432 -235.608 1.00 25.19 ? 115 HOH E O     1 
HETATM 3325 O  O     . HOH U 6 .   ? -28.772 48.654 -226.528 1.00 40.64 ? 116 HOH E O     1 
HETATM 3326 O  O     . HOH U 6 .   ? -32.135 76.823 -231.760 1.00 41.37 ? 117 HOH E O     1 
HETATM 3327 O  O     . HOH U 6 .   ? -37.507 74.293 -243.797 1.00 29.84 ? 118 HOH E O     1 
HETATM 3328 O  O     . HOH U 6 .   ? -23.977 64.615 -247.678 1.00 43.19 ? 119 HOH E O     1 
HETATM 3329 O  O     . HOH U 6 .   ? -32.927 46.227 -229.463 1.00 34.48 ? 120 HOH E O     1 
HETATM 3330 O  O     . HOH U 6 .   ? -25.144 59.253 -229.114 1.00 32.48 ? 121 HOH E O     1 
HETATM 3331 O  O     . HOH U 6 .   ? -32.855 43.432 -230.614 1.00 44.43 ? 122 HOH E O     1 
HETATM 3332 O  O     . HOH U 6 .   ? -24.230 57.142 -240.118 1.00 20.24 ? 123 HOH E O     1 
HETATM 3333 O  O     . HOH U 6 .   ? -27.447 72.385 -243.058 1.00 39.68 ? 124 HOH E O     1 
HETATM 3334 O  O     . HOH U 6 .   ? -34.622 78.781 -239.883 1.00 36.06 ? 125 HOH E O     1 
HETATM 3335 O  O     . HOH U 6 .   ? -29.696 48.601 -232.666 1.00 33.37 ? 126 HOH E O     1 
HETATM 3336 O  O     . HOH U 6 .   ? -24.349 68.463 -240.374 1.00 45.19 ? 127 HOH E O     1 
HETATM 3337 O  O     . HOH U 6 .   ? -31.932 75.288 -241.674 1.00 39.75 ? 128 HOH E O     1 
HETATM 3338 O  O     . HOH U 6 .   ? -21.928 65.469 -237.398 1.00 41.94 ? 129 HOH E O     1 
HETATM 3339 O  O     . HOH U 6 .   ? -31.133 65.625 -246.692 1.00 21.29 ? 130 HOH E O     1 
HETATM 3340 O  O     . HOH U 6 .   ? -20.368 51.559 -229.427 1.00 55.96 ? 131 HOH E O     1 
HETATM 3341 O  O     . HOH U 6 .   ? -23.121 52.775 -231.969 1.00 23.30 ? 132 HOH E O     1 
HETATM 3342 O  O     . HOH U 6 .   ? -29.820 56.894 -228.447 1.00 29.24 ? 133 HOH E O     1 
HETATM 3343 O  O     . HOH U 6 .   ? -26.630 61.716 -246.640 1.00 24.04 ? 134 HOH E O     1 
HETATM 3344 O  O     . HOH U 6 .   ? -28.737 72.067 -247.191 1.00 41.27 ? 135 HOH E O     1 
HETATM 3345 O  O     . HOH U 6 .   ? -27.907 53.958 -237.527 1.00 26.78 ? 136 HOH E O     1 
HETATM 3346 O  O     . HOH U 6 .   ? -39.927 47.517 -234.861 1.00 43.05 ? 137 HOH E O     1 
HETATM 3347 O  O     . HOH U 6 .   ? -32.508 46.721 -227.065 1.00 46.43 ? 138 HOH E O     1 
HETATM 3348 O  O     . HOH U 6 .   ? -32.251 67.054 -243.277 1.00 18.29 ? 139 HOH E O     1 
HETATM 3349 O  O     . HOH U 6 .   ? -39.718 81.544 -229.866 1.00 52.41 ? 140 HOH E O     1 
HETATM 3350 O  O     . HOH U 6 .   ? -19.825 54.131 -235.009 1.00 31.55 ? 141 HOH E O     1 
HETATM 3351 O  O     . HOH U 6 .   ? -37.289 81.453 -229.214 1.00 45.54 ? 142 HOH E O     1 
HETATM 3352 O  O     . HOH U 6 .   ? -27.620 50.354 -228.435 1.00 34.11 ? 143 HOH E O     1 
HETATM 3353 O  O     . HOH U 6 .   ? -36.674 82.517 -237.967 1.00 41.72 ? 144 HOH E O     1 
HETATM 3354 O  O     . HOH U 6 .   ? -27.209 49.198 -224.770 1.00 46.32 ? 145 HOH E O     1 
HETATM 3355 O  O     . HOH U 6 .   ? -35.646 76.063 -244.018 1.00 40.95 ? 146 HOH E O     1 
HETATM 3356 O  O     . HOH U 6 .   ? -29.921 45.897 -229.474 1.00 52.07 ? 147 HOH E O     1 
HETATM 3357 O  O     . HOH V 6 .   ? -17.275 72.100 -239.125 1.00 46.88 ? 101 HOH F O     1 
HETATM 3358 O  O     . HOH V 6 .   ? -41.501 59.816 -232.808 1.00 28.29 ? 102 HOH F O     1 
HETATM 3359 O  O     . HOH V 6 .   ? -42.920 54.693 -239.693 1.00 46.14 ? 103 HOH F O     1 
HETATM 3360 O  O     . HOH V 6 .   ? -31.317 50.339 -238.728 1.00 33.37 ? 104 HOH F O     1 
HETATM 3361 O  O     . HOH V 6 .   ? -33.528 50.892 -242.087 1.00 26.55 ? 105 HOH F O     1 
HETATM 3362 O  O     . HOH V 6 .   ? -42.274 56.947 -238.645 1.00 37.51 ? 106 HOH F O     1 
HETATM 3363 O  O     . HOH V 6 .   ? -38.124 52.507 -233.002 1.00 33.12 ? 107 HOH F O     1 
HETATM 3364 O  O     . HOH V 6 .   ? -22.535 68.018 -235.847 1.00 44.72 ? 108 HOH F O     1 
HETATM 3365 O  O     . HOH V 6 .   ? -26.125 61.839 -228.233 1.00 49.12 ? 109 HOH F O     1 
HETATM 3366 O  O     . HOH V 6 .   ? -37.582 62.034 -232.200 1.00 41.69 ? 110 HOH F O     1 
HETATM 3367 O  O     . HOH V 6 .   ? -28.560 72.306 -231.913 1.00 36.46 ? 111 HOH F O     1 
HETATM 3368 O  O     . HOH V 6 .   ? -31.097 58.108 -238.444 1.00 23.46 ? 112 HOH F O     1 
HETATM 3369 O  O     . HOH V 6 .   ? -38.598 49.597 -246.703 1.00 45.53 ? 113 HOH F O     1 
HETATM 3370 O  O     . HOH V 6 .   ? -39.535 50.304 -236.414 1.00 33.39 ? 114 HOH F O     1 
HETATM 3371 O  O     . HOH V 6 .   ? -30.437 59.431 -227.572 1.00 35.18 ? 115 HOH F O     1 
HETATM 3372 O  O     . HOH V 6 .   ? -34.635 42.309 -241.228 1.00 39.40 ? 116 HOH F O     1 
HETATM 3373 O  O     . HOH V 6 .   ? -29.006 47.993 -235.365 1.00 40.24 ? 117 HOH F O     1 
HETATM 3374 O  O     . HOH V 6 .   ? -26.221 75.520 -241.876 1.00 41.93 ? 118 HOH F O     1 
HETATM 3375 O  O     . HOH V 6 .   ? -32.661 57.088 -229.306 1.00 23.21 ? 119 HOH F O     1 
HETATM 3376 O  O     . HOH V 6 .   ? -22.917 64.487 -231.287 1.00 43.54 ? 120 HOH F O     1 
HETATM 3377 O  O     . HOH V 6 .   ? -28.282 43.953 -235.026 1.00 42.91 ? 121 HOH F O     1 
HETATM 3378 O  O     . HOH V 6 .   ? -25.030 78.735 -233.356 1.00 42.02 ? 122 HOH F O     1 
HETATM 3379 O  O     . HOH V 6 .   ? -24.518 45.748 -237.388 1.00 35.18 ? 123 HOH F O     1 
HETATM 3380 O  O     . HOH V 6 .   ? -36.829 53.592 -243.530 1.00 38.12 ? 124 HOH F O     1 
HETATM 3381 O  O     . HOH V 6 .   ? -30.485 53.334 -238.828 1.00 26.95 ? 125 HOH F O     1 
HETATM 3382 O  O     . HOH V 6 .   ? -36.129 66.011 -230.548 1.00 33.02 ? 126 HOH F O     1 
HETATM 3383 O  O     . HOH V 6 .   ? -32.428 67.297 -232.915 1.00 29.57 ? 127 HOH F O     1 
HETATM 3384 O  O     . HOH V 6 .   ? -39.878 50.695 -244.560 1.00 46.42 ? 128 HOH F O     1 
HETATM 3385 O  O     . HOH V 6 .   ? -29.078 75.366 -242.694 1.00 53.91 ? 129 HOH F O     1 
HETATM 3386 O  O     . HOH V 6 .   ? -29.615 43.795 -233.151 1.00 39.78 ? 130 HOH F O     1 
HETATM 3387 O  O     . HOH V 6 .   ? -30.714 67.963 -227.555 1.00 38.90 ? 131 HOH F O     1 
HETATM 3388 O  O     . HOH V 6 .   ? -33.492 63.473 -234.898 1.00 34.43 ? 132 HOH F O     1 
HETATM 3389 O  O     . HOH V 6 .   ? -21.074 76.931 -234.831 1.00 55.28 ? 133 HOH F O     1 
HETATM 3390 O  O     . HOH V 6 .   ? -35.225 52.604 -244.849 1.00 41.22 ? 134 HOH F O     1 
HETATM 3391 O  O     . HOH V 6 .   ? -30.018 47.726 -241.908 1.00 48.37 ? 135 HOH F O     1 
HETATM 3392 O  O     . HOH V 6 .   ? -37.811 64.322 -230.785 1.00 51.32 ? 136 HOH F O     1 
HETATM 3393 O  O     . HOH V 6 .   ? -40.383 58.264 -239.646 1.00 31.68 ? 137 HOH F O     1 
HETATM 3394 O  O     . HOH V 6 .   ? -30.997 50.105 -241.342 1.00 36.96 ? 138 HOH F O     1 
HETATM 3395 O  O     . HOH V 6 .   ? -29.754 43.575 -230.790 1.00 59.56 ? 139 HOH F O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N     . HIS A 1   ? 0.8785 1.1526 0.8612 0.3825  -0.0367 0.1067  319 HIS A N     
2    C  CA    . HIS A 1   ? 0.8514 1.1133 0.8349 0.3518  -0.0350 0.0800  319 HIS A CA    
3    C  C     . HIS A 1   ? 0.8602 1.1071 0.7967 0.3433  -0.0325 0.0845  319 HIS A C     
4    O  O     . HIS A 1   ? 0.8421 1.0808 0.7761 0.3199  -0.0322 0.0642  319 HIS A O     
5    C  CB    . HIS A 1   ? 0.8188 1.1327 0.8374 0.3466  -0.0588 0.0482  319 HIS A CB    
6    N  N     . MET A 2   ? 0.8676 1.1111 0.7690 0.3629  -0.0296 0.1123  320 MET A N     
7    C  CA    . MET A 2   ? 0.8834 1.1142 0.7414 0.3565  -0.0249 0.1190  320 MET A CA    
8    C  C     . MET A 2   ? 0.8879 1.0583 0.7379 0.3320  0.0006  0.1223  320 MET A C     
9    O  O     . MET A 2   ? 0.9561 1.0867 0.8159 0.3312  0.0197  0.1365  320 MET A O     
10   C  CB    . MET A 2   ? 0.8907 1.1311 0.7143 0.3845  -0.0250 0.1517  320 MET A CB    
11   N  N     . ARG A 3   ? 0.7832 0.9484 0.6168 0.3121  0.0004  0.1077  321 ARG A N     
12   C  CA    . ARG A 3   ? 0.7275 0.8419 0.5539 0.2877  0.0210  0.1080  321 ARG A CA    
13   C  C     . ARG A 3   ? 0.7348 0.8259 0.5242 0.2920  0.0349  0.1330  321 ARG A C     
14   O  O     . ARG A 3   ? 0.6838 0.7960 0.4492 0.2928  0.0276  0.1306  321 ARG A O     
15   C  CB    . ARG A 3   ? 0.7168 0.8385 0.5525 0.2635  0.0135  0.0787  321 ARG A CB    
16   C  CG    . ARG A 3   ? 0.7136 0.8504 0.5892 0.2557  0.0047  0.0558  321 ARG A CG    
17   C  CD    . ARG A 3   ? 0.7293 0.8880 0.6164 0.2388  -0.0084 0.0273  321 ARG A CD    
18   N  NE    . ARG A 3   ? 0.7389 0.9107 0.6681 0.2315  -0.0145 0.0078  321 ARG A NE    
19   C  CZ    . ARG A 3   ? 0.7507 0.8934 0.6975 0.2113  -0.0025 0.0005  321 ARG A CZ    
20   N  NH1   . ARG A 3   ? 0.7603 0.8613 0.6857 0.1963  0.0135  0.0089  321 ARG A NH1   
21   N  NH2   . ARG A 3   ? 0.7051 0.8620 0.6911 0.2062  -0.0066 -0.0150 321 ARG A NH2   
22   N  N     . PRO A 4   ? 0.7504 0.7976 0.5358 0.2939  0.0563  0.1561  322 PRO A N     
23   C  CA    . PRO A 4   ? 0.8014 0.8289 0.5555 0.3008  0.0705  0.1831  322 PRO A CA    
24   C  C     . PRO A 4   ? 0.7596 0.7665 0.4983 0.2768  0.0793  0.1756  322 PRO A C     
25   O  O     . PRO A 4   ? 0.7500 0.7563 0.4621 0.2823  0.0861  0.1928  322 PRO A O     
26   C  CB    . PRO A 4   ? 0.8266 0.8102 0.5905 0.3075  0.0916  0.2059  322 PRO A CB    
27   C  CG    . PRO A 4   ? 0.8246 0.8155 0.6220 0.3110  0.0853  0.1926  322 PRO A CG    
28   C  CD    . PRO A 4   ? 0.7712 0.7863 0.5818 0.2919  0.0696  0.1590  322 PRO A CD    
29   N  N     . PHE A 5   ? 0.6755 0.6664 0.4306 0.2512  0.0801  0.1519  323 PHE A N     
30   C  CA    . PHE A 5   ? 0.6427 0.6105 0.3880 0.2278  0.0894  0.1458  323 PHE A CA    
31   C  C     . PHE A 5   ? 0.5899 0.5947 0.3329 0.2204  0.0719  0.1229  323 PHE A C     
32   O  O     . PHE A 5   ? 0.5594 0.5740 0.3232 0.2080  0.0615  0.0990  323 PHE A O     
33   C  CB    . PHE A 5   ? 0.6193 0.5452 0.3818 0.2059  0.1019  0.1367  323 PHE A CB    
34   C  CG    . PHE A 5   ? 0.7005 0.5894 0.4678 0.2135  0.1199  0.1558  323 PHE A CG    
35   C  CD1   . PHE A 5   ? 0.8158 0.6682 0.5714 0.2095  0.1395  0.1746  323 PHE A CD1   
36   C  CD2   . PHE A 5   ? 0.6854 0.5763 0.4721 0.2252  0.1183  0.1546  323 PHE A CD2   
37   C  CE1   . PHE A 5   ? 0.8613 0.6772 0.6246 0.2168  0.1574  0.1912  323 PHE A CE1   
38   C  CE2   . PHE A 5   ? 0.7714 0.6275 0.5647 0.2336  0.1360  0.1715  323 PHE A CE2   
39   C  CZ    . PHE A 5   ? 0.8470 0.6644 0.6286 0.2293  0.1556  0.1893  323 PHE A CZ    
40   N  N     . MET A 6   ? 0.6055 0.6304 0.3239 0.2285  0.0700  0.1307  324 MET A N     
41   C  CA    . MET A 6   ? 0.5880 0.6493 0.3028 0.2244  0.0544  0.1087  324 MET A CA    
42   C  C     . MET A 6   ? 0.5788 0.6218 0.2863 0.2045  0.0650  0.1056  324 MET A C     
43   O  O     . MET A 6   ? 0.6141 0.6320 0.3062 0.2033  0.0825  0.1268  324 MET A O     
44   C  CB    . MET A 6   ? 0.6697 0.7742 0.3606 0.2493  0.0430  0.1157  324 MET A CB    
45   N  N     . CYS A 7   ? 0.5482 0.6034 0.2702 0.1889  0.0549  0.0795  325 CYS A N     
46   C  CA    . CYS A 7   ? 0.5391 0.5856 0.2567 0.1724  0.0619  0.0746  325 CYS A CA    
47   C  C     . CYS A 7   ? 0.6051 0.6817 0.2971 0.1857  0.0606  0.0786  325 CYS A C     
48   O  O     . CYS A 7   ? 0.6087 0.7244 0.2953 0.1997  0.0450  0.0662  325 CYS A O     
49   C  CB    . CYS A 7   ? 0.5028 0.5545 0.2459 0.1541  0.0514  0.0471  325 CYS A CB    
50   S  SG    . CYS A 7   ? 0.4994 0.5400 0.2428 0.1342  0.0596  0.0420  325 CYS A SG    
51   N  N     . ALA A 8   ? 0.5746 0.6346 0.2520 0.1804  0.0772  0.0941  326 ALA A N     
52   C  CA    . ALA A 8   ? 0.6361 0.7220 0.2865 0.1927  0.0804  0.1008  326 ALA A CA    
53   C  C     . ALA A 8   ? 0.6654 0.7645 0.3227 0.1789  0.0785  0.0798  326 ALA A C     
54   O  O     . ALA A 8   ? 0.6496 0.7680 0.2918 0.1848  0.0822  0.0818  326 ALA A O     
55   C  CB    . ALA A 8   ? 0.7308 0.7914 0.3694 0.1956  0.1011  0.1320  326 ALA A CB    
56   N  N     . TYR A 9   ? 0.5813 0.6694 0.2679 0.1592  0.0721  0.0594  327 TYR A N     
57   C  CA    . TYR A 9   ? 0.5418 0.6389 0.2403 0.1458  0.0710  0.0410  327 TYR A CA    
58   C  C     . TYR A 9   ? 0.5679 0.7082 0.2611 0.1575  0.0565  0.0183  327 TYR A C     
59   O  O     . TYR A 9   ? 0.5282 0.6886 0.2254 0.1673  0.0408  0.0058  327 TYR A O     
60   C  CB    . TYR A 9   ? 0.4908 0.5665 0.2218 0.1246  0.0661  0.0270  327 TYR A CB    
61   C  CG    . TYR A 9   ? 0.4731 0.5503 0.2201 0.1094  0.0679  0.0142  327 TYR A CG    
62   C  CD1   . TYR A 9   ? 0.4752 0.5295 0.2243 0.0962  0.0825  0.0274  327 TYR A CD1   
63   C  CD2   . TYR A 9   ? 0.4591 0.5604 0.2230 0.1079  0.0550  -0.0115 327 TYR A CD2   
64   C  CE1   . TYR A 9   ? 0.4592 0.5170 0.2264 0.0831  0.0834  0.0166  327 TYR A CE1   
65   C  CE2   . TYR A 9   ? 0.4432 0.5453 0.2250 0.0953  0.0572  -0.0221 327 TYR A CE2   
66   C  CZ    . TYR A 9   ? 0.4416 0.5230 0.2251 0.0834  0.0708  -0.0075 327 TYR A CZ    
67   O  OH    . TYR A 9   ? 0.4270 0.5117 0.2313 0.0720  0.0720  -0.0174 327 TYR A OH    
68   N  N     . PRO A 10  ? 0.5968 0.7531 0.2833 0.1564  0.0617  0.0106  328 PRO A N     
69   C  CA    . PRO A 10  ? 0.6580 0.8559 0.3364 0.1685  0.0494  -0.0126 328 PRO A CA    
70   C  C     . PRO A 10  ? 0.6595 0.8699 0.3697 0.1617  0.0305  -0.0443 328 PRO A C     
71   O  O     . PRO A 10  ? 0.6151 0.8089 0.3562 0.1439  0.0304  -0.0555 328 PRO A O     
72   C  CB    . PRO A 10  ? 0.6137 0.8147 0.2913 0.1619  0.0618  -0.0138 328 PRO A CB    
73   C  CG    . PRO A 10  ? 0.5637 0.7347 0.2304 0.1572  0.0824  0.0183  328 PRO A CG    
74   C  CD    . PRO A 10  ? 0.5440 0.6829 0.2258 0.1473  0.0813  0.0265  328 PRO A CD    
75   N  N     . GLY A 11  ? 0.6773 0.9184 0.3817 0.1763  0.0144  -0.0585 329 GLY A N     
76   C  CA    . GLY A 11  ? 0.6807 0.9362 0.4187 0.1706  -0.0033 -0.0893 329 GLY A CA    
77   C  C     . GLY A 11  ? 0.6622 0.8969 0.4264 0.1628  -0.0090 -0.0856 329 GLY A C     
78   O  O     . GLY A 11  ? 0.6322 0.8724 0.4307 0.1544  -0.0203 -0.1085 329 GLY A O     
79   N  N     . CYS A 12  ? 0.6549 0.8651 0.4060 0.1652  0.0001  -0.0576 330 CYS A N     
80   C  CA    . CYS A 12  ? 0.5399 0.7272 0.3134 0.1578  -0.0018 -0.0523 330 CYS A CA    
81   C  C     . CYS A 12  ? 0.6038 0.8030 0.3617 0.1769  -0.0067 -0.0386 330 CYS A C     
82   O  O     . CYS A 12  ? 0.7110 0.9059 0.4378 0.1892  0.0029  -0.0143 330 CYS A O     
83   C  CB    . CYS A 12  ? 0.5373 0.6810 0.3135 0.1416  0.0146  -0.0332 330 CYS A CB    
84   S  SG    . CYS A 12  ? 0.4797 0.5940 0.2789 0.1321  0.0151  -0.0277 330 CYS A SG    
85   N  N     . ASN A 13  ? 0.5810 0.7958 0.3630 0.1798  -0.0209 -0.0532 331 ASN A N     
86   C  CA    . ASN A 13  ? 0.5870 0.8185 0.3612 0.1988  -0.0285 -0.0430 331 ASN A CA    
87   C  C     . ASN A 13  ? 0.5473 0.7506 0.3432 0.1931  -0.0232 -0.0321 331 ASN A C     
88   O  O     . ASN A 13  ? 0.5379 0.7580 0.3444 0.2054  -0.0325 -0.0320 331 ASN A O     
89   C  CB    . ASN A 13  ? 0.5877 0.8678 0.3735 0.2097  -0.0506 -0.0701 331 ASN A CB    
90   N  N     . LYS A 14  ? 0.5429 0.7053 0.3457 0.1751  -0.0085 -0.0236 332 LYS A N     
91   C  CA    . LYS A 14  ? 0.4577 0.5920 0.2778 0.1689  -0.0015 -0.0148 332 LYS A CA    
92   C  C     . LYS A 14  ? 0.4986 0.6172 0.2975 0.1836  0.0089  0.0130  332 LYS A C     
93   O  O     . LYS A 14  ? 0.5205 0.6281 0.2912 0.1886  0.0193  0.0315  332 LYS A O     
94   C  CB    . LYS A 14  ? 0.4759 0.5735 0.3059 0.1456  0.0101  -0.0153 332 LYS A CB    
95   C  CG    . LYS A 14  ? 0.5045 0.6121 0.3626 0.1307  0.0015  -0.0399 332 LYS A CG    
96   C  CD    . LYS A 14  ? 0.5867 0.7070 0.4778 0.1308  -0.0075 -0.0536 332 LYS A CD    
97   C  CE    . LYS A 14  ? 0.6302 0.7606 0.5524 0.1172  -0.0150 -0.0768 332 LYS A CE    
98   N  NZ    . LYS A 14  ? 0.6608 0.7598 0.5834 0.0987  -0.0046 -0.0719 332 LYS A NZ    
99   N  N     . ARG A 15  ? 0.5140 0.6308 0.3297 0.1906  0.0074  0.0165  333 ARG A N     
100  C  CA    . ARG A 15  ? 0.5327 0.6314 0.3355 0.2049  0.0182  0.0423  333 ARG A CA    
101  C  C     . ARG A 15  ? 0.4965 0.5710 0.3247 0.1976  0.0252  0.0414  333 ARG A C     
102  O  O     . ARG A 15  ? 0.4735 0.5608 0.3300 0.1895  0.0168  0.0218  333 ARG A O     
103  C  CB    . ARG A 15  ? 0.5944 0.7308 0.3874 0.2321  0.0058  0.0503  333 ARG A CB    
104  C  CG    . ARG A 15  ? 0.7007 0.8717 0.4681 0.2420  -0.0046 0.0464  333 ARG A CG    
105  C  CD    . ARG A 15  ? 0.7767 0.9892 0.5344 0.2698  -0.0195 0.0530  333 ARG A CD    
106  N  NE    . ARG A 15  ? 0.8968 1.0913 0.6352 0.2878  -0.0070 0.0876  333 ARG A NE    
107  C  CZ    . ARG A 15  ? 0.9385 1.1360 0.6399 0.3023  -0.0004 0.1107  333 ARG A CZ    
108  N  NH1   . ARG A 15  ? 0.8708 1.0900 0.5484 0.3010  -0.0048 0.1016  333 ARG A NH1   
109  N  NH2   . ARG A 15  ? 0.9858 1.1637 0.6750 0.3185  0.0124  0.1435  333 ARG A NH2   
110  N  N     . TYR A 16  ? 0.5147 0.5541 0.3341 0.2004  0.0421  0.0623  334 TYR A N     
111  C  CA    . TYR A 16  ? 0.5073 0.5183 0.3466 0.1919  0.0526  0.0609  334 TYR A CA    
112  C  C     . TYR A 16  ? 0.5389 0.5353 0.3767 0.2103  0.0629  0.0821  334 TYR A C     
113  O  O     . TYR A 16  ? 0.5626 0.5601 0.3802 0.2264  0.0660  0.1024  334 TYR A O     
114  C  CB    . TYR A 16  ? 0.4985 0.4690 0.3313 0.1679  0.0668  0.0588  334 TYR A CB    
115  C  CG    . TYR A 16  ? 0.4974 0.4791 0.3338 0.1501  0.0579  0.0405  334 TYR A CG    
116  C  CD1   . TYR A 16  ? 0.4477 0.4352 0.3085 0.1379  0.0525  0.0224  334 TYR A CD1   
117  C  CD2   . TYR A 16  ? 0.4771 0.4636 0.2949 0.1464  0.0565  0.0425  334 TYR A CD2   
118  C  CE1   . TYR A 16  ? 0.4263 0.4228 0.2935 0.1232  0.0451  0.0074  334 TYR A CE1   
119  C  CE2   . TYR A 16  ? 0.4514 0.4484 0.2760 0.1315  0.0488  0.0256  334 TYR A CE2   
120  C  CZ    . TYR A 16  ? 0.4438 0.4447 0.2936 0.1202  0.0430  0.0087  334 TYR A CZ    
121  O  OH    . TYR A 16  ? 0.4472 0.4565 0.3070 0.1066  0.0363  -0.0061 334 TYR A OH    
122  N  N     . PHE A 17  ? 0.5555 0.5367 0.4154 0.2080  0.0702  0.0783  335 PHE A N     
123  C  CA    . PHE A 17  ? 0.5841 0.5468 0.4481 0.2243  0.0825  0.0967  335 PHE A CA    
124  C  C     . PHE A 17  ? 0.6158 0.5258 0.4659 0.2142  0.1052  0.1085  335 PHE A C     
125  O  O     . PHE A 17  ? 0.6241 0.5138 0.4752 0.2284  0.1178  0.1264  335 PHE A O     
126  C  CB    . PHE A 17  ? 0.5773 0.5495 0.4744 0.2281  0.0815  0.0862  335 PHE A CB    
127  C  CG    . PHE A 17  ? 0.6487 0.6737 0.5661 0.2439  0.0602  0.0785  335 PHE A CG    
128  C  CD1   . PHE A 17  ? 0.7180 0.7675 0.6320 0.2709  0.0522  0.0954  335 PHE A CD1   
129  C  CD2   . PHE A 17  ? 0.5797 0.6308 0.5211 0.2321  0.0479  0.0546  335 PHE A CD2   
130  C  CE1   . PHE A 17  ? 0.6927 0.7951 0.6259 0.2855  0.0301  0.0861  335 PHE A CE1   
131  C  CE2   . PHE A 17  ? 0.5866 0.6880 0.5509 0.2454  0.0275  0.0444  335 PHE A CE2   
132  C  CZ    . PHE A 17  ? 0.6157 0.7440 0.5754 0.2718  0.0176  0.0589  335 PHE A CZ    
133  N  N     . LYS A 18  ? 0.5732 0.4611 0.4131 0.1902  0.1104  0.0984  336 LYS A N     
134  C  CA    . LYS A 18  ? 0.6184 0.4580 0.4490 0.1770  0.1304  0.1039  336 LYS A CA    
135  C  C     . LYS A 18  ? 0.6178 0.4478 0.4276 0.1635  0.1318  0.1069  336 LYS A C     
136  O  O     . LYS A 18  ? 0.5547 0.4069 0.3614 0.1532  0.1192  0.0947  336 LYS A O     
137  C  CB    . LYS A 18  ? 0.5812 0.4012 0.4232 0.1588  0.1369  0.0859  336 LYS A CB    
138  C  CG    . LYS A 18  ? 0.6064 0.4346 0.4718 0.1706  0.1387  0.0819  336 LYS A CG    
139  C  CD    . LYS A 18  ? 0.5916 0.3911 0.4617 0.1538  0.1519  0.0683  336 LYS A CD    
140  C  CE    . LYS A 18  ? 0.6114 0.4227 0.5077 0.1648  0.1548  0.0632  336 LYS A CE    
141  N  NZ    . LYS A 18  ? 0.7202 0.4958 0.6166 0.1547  0.1742  0.0553  336 LYS A NZ    
142  N  N     . LEU A 19  ? 0.6653 0.4620 0.4645 0.1634  0.1482  0.1231  337 LEU A N     
143  C  CA    . LEU A 19  ? 0.6573 0.4428 0.4412 0.1490  0.1522  0.1262  337 LEU A CA    
144  C  C     . LEU A 19  ? 0.6704 0.4485 0.4562 0.1225  0.1486  0.1047  337 LEU A C     
145  O  O     . LEU A 19  ? 0.6386 0.4308 0.4178 0.1121  0.1411  0.0996  337 LEU A O     
146  C  CB    . LEU A 19  ? 0.6901 0.4357 0.4694 0.1501  0.1732  0.1450  337 LEU A CB    
147  C  CG    . LEU A 19  ? 0.7364 0.4695 0.5049 0.1340  0.1794  0.1486  337 LEU A CG    
148  C  CD1   . LEU A 19  ? 0.7015 0.4725 0.4568 0.1428  0.1678  0.1554  337 LEU A CD1   
149  C  CD2   . LEU A 19  ? 0.7881 0.4803 0.5578 0.1348  0.2019  0.1674  337 LEU A CD2   
150  N  N     . SER A 20  ? 0.6342 0.3919 0.4289 0.1125  0.1541  0.0924  338 SER A N     
151  C  CA    . SER A 20  ? 0.6122 0.3626 0.4057 0.0885  0.1509  0.0744  338 SER A CA    
152  C  C     . SER A 20  ? 0.5398 0.3270 0.3387 0.0855  0.1326  0.0623  338 SER A C     
153  O  O     . SER A 20  ? 0.5467 0.3360 0.3424 0.0686  0.1271  0.0534  338 SER A O     
154  C  CB    . SER A 20  ? 0.6713 0.3954 0.4697 0.0807  0.1610  0.0639  338 SER A CB    
155  O  OG    . SER A 20  ? 0.6562 0.3982 0.4679 0.0934  0.1569  0.0601  338 SER A OG    
156  N  N     . HIS A 21  ? 0.5181 0.3343 0.3283 0.1013  0.1230  0.0610  339 HIS A N     
157  C  CA    . HIS A 21  ? 0.4953 0.3459 0.3148 0.0982  0.1062  0.0481  339 HIS A CA    
158  C  C     . HIS A 21  ? 0.4873 0.3564 0.2965 0.0987  0.0983  0.0512  339 HIS A C     
159  O  O     . HIS A 21  ? 0.4683 0.3492 0.2809 0.0863  0.0899  0.0400  339 HIS A O     
160  C  CB    . HIS A 21  ? 0.4816 0.3623 0.3192 0.1150  0.0969  0.0445  339 HIS A CB    
161  C  CG    . HIS A 21  ? 0.4922 0.3620 0.3455 0.1138  0.1038  0.0386  339 HIS A CG    
162  N  ND1   . HIS A 21  ? 0.4951 0.3873 0.3689 0.1294  0.0993  0.0372  339 HIS A ND1   
163  C  CD2   . HIS A 21  ? 0.4931 0.3342 0.3446 0.0990  0.1152  0.0330  339 HIS A CD2   
164  C  CE1   . HIS A 21  ? 0.4862 0.3628 0.3717 0.1243  0.1094  0.0318  339 HIS A CE1   
165  N  NE2   . HIS A 21  ? 0.5033 0.3485 0.3732 0.1063  0.1194  0.0291  339 HIS A NE2   
166  N  N     . LEU A 22  ? 0.5055 0.3777 0.3025 0.1140  0.1021  0.0673  340 LEU A N     
167  C  CA    . LEU A 22  ? 0.5061 0.3958 0.2905 0.1158  0.0975  0.0715  340 LEU A CA    
168  C  C     . LEU A 22  ? 0.5131 0.3797 0.2917 0.0953  0.1055  0.0709  340 LEU A C     
169  O  O     . LEU A 22  ? 0.5318 0.4144 0.3104 0.0870  0.0983  0.0630  340 LEU A O     
170  C  CB    . LEU A 22  ? 0.5356 0.4303 0.3054 0.1371  0.1030  0.0926  340 LEU A CB    
171  C  CG    . LEU A 22  ? 0.5432 0.4537 0.2958 0.1398  0.1025  0.0999  340 LEU A CG    
172  C  CD1   . LEU A 22  ? 0.5218 0.4740 0.2773 0.1422  0.0843  0.0823  340 LEU A CD1   
173  C  CD2   . LEU A 22  ? 0.5906 0.5000 0.3259 0.1610  0.1118  0.1260  340 LEU A CD2   
174  N  N     . GLN A 23  ? 0.5331 0.3625 0.3094 0.0865  0.1200  0.0773  341 GLN A N     
175  C  CA    . GLN A 23  ? 0.5586 0.3671 0.3324 0.0661  0.1266  0.0753  341 GLN A CA    
176  C  C     . GLN A 23  ? 0.5175 0.3351 0.3000 0.0491  0.1153  0.0568  341 GLN A C     
177  O  O     . GLN A 23  ? 0.5028 0.3274 0.2861 0.0377  0.1116  0.0531  341 GLN A O     
178  C  CB    . GLN A 23  ? 0.6409 0.4085 0.4136 0.0595  0.1431  0.0813  341 GLN A CB    
179  C  CG    . GLN A 23  ? 0.6853 0.4399 0.4519 0.0747  0.1570  0.1032  341 GLN A CG    
180  C  CD    . GLN A 23  ? 0.7080 0.4196 0.4783 0.0693  0.1746  0.1077  341 GLN A CD    
181  O  OE1   . GLN A 23  ? 0.7516 0.4467 0.5268 0.0605  0.1759  0.0940  341 GLN A OE1   
182  N  NE2   . GLN A 23  ? 0.7676 0.4606 0.5357 0.0750  0.1897  0.1269  341 GLN A NE2   
183  N  N     . MET A 24  ? 0.5156 0.3330 0.3060 0.0477  0.1109  0.0464  342 MET A N     
184  C  CA    . MET A 24  ? 0.4582 0.2859 0.2575 0.0342  0.1006  0.0319  342 MET A CA    
185  C  C     . MET A 24  ? 0.4468 0.3089 0.2545 0.0388  0.0872  0.0262  342 MET A C     
186  O  O     . MET A 24  ? 0.4512 0.3197 0.2638 0.0268  0.0813  0.0199  342 MET A O     
187  C  CB    . MET A 24  ? 0.4729 0.2955 0.2797 0.0347  0.1011  0.0247  342 MET A CB    
188  C  CG    . MET A 24  ? 0.4851 0.3156 0.3006 0.0212  0.0927  0.0130  342 MET A CG    
189  S  SD    . MET A 24  ? 0.5565 0.3654 0.3606 -0.0012 0.0949  0.0109  342 MET A SD    
190  C  CE    . MET A 24  ? 0.6017 0.3740 0.3919 -0.0044 0.1108  0.0118  342 MET A CE    
191  N  N     . HIS A 25  ? 0.4369 0.3223 0.2473 0.0566  0.0819  0.0276  343 HIS A N     
192  C  CA    . HIS A 25  ? 0.4209 0.3397 0.2390 0.0613  0.0693  0.0188  343 HIS A CA    
193  C  C     . HIS A 25  ? 0.4240 0.3464 0.2326 0.0569  0.0712  0.0229  343 HIS A C     
194  O  O     . HIS A 25  ? 0.4117 0.3513 0.2301 0.0511  0.0632  0.0124  343 HIS A O     
195  C  CB    . HIS A 25  ? 0.4268 0.3719 0.2458 0.0822  0.0628  0.0193  343 HIS A CB    
196  C  CG    . HIS A 25  ? 0.4275 0.4056 0.2464 0.0891  0.0523  0.0114  343 HIS A CG    
197  N  ND1   . HIS A 25  ? 0.4111 0.4098 0.2500 0.0834  0.0406  -0.0071 343 HIS A ND1   
198  C  CD2   . HIS A 25  ? 0.4680 0.4610 0.2690 0.1008  0.0531  0.0190  343 HIS A CD2   
199  C  CE1   . HIS A 25  ? 0.4477 0.4727 0.2813 0.0912  0.0341  -0.0131 343 HIS A CE1   
200  N  NE2   . HIS A 25  ? 0.4247 0.4480 0.2335 0.1020  0.0415  0.0028  343 HIS A NE2   
201  N  N     . SER A 26  ? 0.4464 0.3525 0.2392 0.0597  0.0832  0.0383  344 SER A N     
202  C  CA    . SER A 26  ? 0.4623 0.3729 0.2482 0.0560  0.0875  0.0437  344 SER A CA    
203  C  C     . SER A 26  ? 0.4353 0.3399 0.2327 0.0359  0.0852  0.0350  344 SER A C     
204  O  O     . SER A 26  ? 0.4475 0.3658 0.2470 0.0331  0.0848  0.0339  344 SER A O     
205  C  CB    . SER A 26  ? 0.5685 0.4568 0.3399 0.0598  0.1038  0.0634  344 SER A CB    
206  O  OG    . SER A 26  ? 0.7454 0.6427 0.5053 0.0811  0.1055  0.0748  344 SER A OG    
207  N  N     . ARG A 27  ? 0.4375 0.3236 0.2423 0.0228  0.0838  0.0291  345 ARG A N     
208  C  CA    . ARG A 27  ? 0.4177 0.3009 0.2331 0.0051  0.0792  0.0217  345 ARG A CA    
209  C  C     . ARG A 27  ? 0.3993 0.3095 0.2303 0.0062  0.0668  0.0101  345 ARG A C     
210  O  O     . ARG A 27  ? 0.4500 0.3647 0.2915 -0.0046 0.0631  0.0064  345 ARG A O     
211  C  CB    . ARG A 27  ? 0.4150 0.2750 0.2301 -0.0067 0.0798  0.0182  345 ARG A CB    
212  C  CG    . ARG A 27  ? 0.4769 0.3067 0.2799 -0.0114 0.0927  0.0259  345 ARG A CG    
213  C  CD    . ARG A 27  ? 0.4557 0.2644 0.2556 -0.0241 0.0933  0.0192  345 ARG A CD    
214  N  NE    . ARG A 27  ? 0.5703 0.3498 0.3612 -0.0298 0.1061  0.0234  345 ARG A NE    
215  C  CZ    . ARG A 27  ? 0.6042 0.3607 0.3878 -0.0374 0.1111  0.0177  345 ARG A CZ    
216  N  NH1   . ARG A 27  ? 0.5619 0.3223 0.3440 -0.0398 0.1049  0.0095  345 ARG A NH1   
217  N  NH2   . ARG A 27  ? 0.6710 0.4003 0.4498 -0.0425 0.1235  0.0197  345 ARG A NH2   
218  N  N     . LYS A 28  ? 0.3838 0.3127 0.2195 0.0191  0.0602  0.0035  346 LYS A N     
219  C  CA    . LYS A 28  ? 0.3654 0.3195 0.2192 0.0203  0.0496  -0.0096 346 LYS A CA    
220  C  C     . LYS A 28  ? 0.4277 0.3980 0.2797 0.0229  0.0509  -0.0098 346 LYS A C     
221  O  O     . LYS A 28  ? 0.4109 0.3924 0.2797 0.0170  0.0457  -0.0184 346 LYS A O     
222  C  CB    . LYS A 28  ? 0.3798 0.3531 0.2408 0.0336  0.0423  -0.0185 346 LYS A CB    
223  C  CG    . LYS A 28  ? 0.4381 0.4357 0.3220 0.0339  0.0319  -0.0351 346 LYS A CG    
224  C  CD    . LYS A 28  ? 0.5180 0.5380 0.4110 0.0467  0.0240  -0.0465 346 LYS A CD    
225  C  CE    . LYS A 28  ? 0.6078 0.6504 0.5264 0.0462  0.0145  -0.0656 346 LYS A CE    
226  N  NZ    . LYS A 28  ? 0.6941 0.7629 0.6210 0.0591  0.0056  -0.0793 346 LYS A NZ    
227  N  N     . HIS A 29  ? 0.4205 0.3921 0.2532 0.0325  0.0592  0.0006  347 HIS A N     
228  C  CA    . HIS A 29  ? 0.3930 0.3818 0.2218 0.0364  0.0630  0.0012  347 HIS A CA    
229  C  C     . HIS A 29  ? 0.4097 0.3844 0.2426 0.0220  0.0713  0.0090  347 HIS A C     
230  O  O     . HIS A 29  ? 0.4673 0.4576 0.3075 0.0210  0.0729  0.0055  347 HIS A O     
231  C  CB    . HIS A 29  ? 0.4170 0.4153 0.2218 0.0538  0.0698  0.0118  347 HIS A CB    
232  C  CG    . HIS A 29  ? 0.4181 0.4352 0.2191 0.0693  0.0600  0.0041  347 HIS A CG    
233  N  ND1   . HIS A 29  ? 0.4033 0.4462 0.2195 0.0726  0.0471  -0.0164 347 HIS A ND1   
234  C  CD2   . HIS A 29  ? 0.4383 0.4534 0.2255 0.0824  0.0608  0.0133  347 HIS A CD2   
235  C  CE1   . HIS A 29  ? 0.4122 0.4700 0.2244 0.0863  0.0394  -0.0205 347 HIS A CE1   
236  N  NE2   . HIS A 29  ? 0.4290 0.4714 0.2231 0.0932  0.0472  -0.0019 347 HIS A NE2   
237  N  N     . THR A 30  ? 0.4012 0.3481 0.2311 0.0110  0.0770  0.0180  348 THR A N     
238  C  CA    . THR A 30  ? 0.4295 0.3644 0.2673 -0.0047 0.0828  0.0228  348 THR A CA    
239  C  C     . THR A 30  ? 0.4435 0.3779 0.3007 -0.0191 0.0721  0.0133  348 THR A C     
240  O  O     . THR A 30  ? 0.4506 0.3844 0.3195 -0.0310 0.0733  0.0146  348 THR A O     
241  C  CB    . THR A 30  ? 0.5400 0.4454 0.3665 -0.0106 0.0941  0.0349  348 THR A CB    
242  O  OG1   . THR A 30  ? 0.4938 0.3821 0.3186 -0.0152 0.0887  0.0302  348 THR A OG1   
243  C  CG2   . THR A 30  ? 0.6219 0.5258 0.4298 0.0055  0.1053  0.0481  348 THR A CG2   
244  N  N     . GLY A 31  ? 0.3648 0.4493 0.2362 -0.0188 0.0337  0.0158  349 GLY A N     
245  C  CA    . GLY A 31  ? 0.3444 0.4424 0.2315 -0.0053 0.0331  0.0103  349 GLY A CA    
246  C  C     . GLY A 31  ? 0.3733 0.4686 0.2706 -0.0227 0.0307  0.0149  349 GLY A C     
247  O  O     . GLY A 31  ? 0.3889 0.5034 0.3001 -0.0141 0.0303  0.0116  349 GLY A O     
248  N  N     . GLU A 32  ? 0.3523 0.4205 0.2391 -0.0460 0.0290  0.0224  350 GLU A N     
249  C  CA    . GLU A 32  ? 0.3508 0.4093 0.2394 -0.0641 0.0274  0.0252  350 GLU A CA    
250  C  C     . GLU A 32  ? 0.3611 0.3873 0.2593 -0.0492 0.0213  0.0210  350 GLU A C     
251  O  O     . GLU A 32  ? 0.3655 0.3530 0.2581 -0.0399 0.0170  0.0219  350 GLU A O     
252  C  CB    . GLU A 32  ? 0.4431 0.4656 0.3081 -0.0898 0.0273  0.0338  350 GLU A CB    
253  C  CG    . GLU A 32  ? 0.5512 0.5547 0.4088 -0.1104 0.0262  0.0350  350 GLU A CG    
254  C  CD    . GLU A 32  ? 0.6598 0.6138 0.4834 -0.1356 0.0264  0.0434  350 GLU A CD    
255  O  OE1   . GLU A 32  ? 0.6840 0.6062 0.4923 -0.1300 0.0257  0.0493  350 GLU A OE1   
256  O  OE2   . GLU A 32  ? 0.7137 0.6576 0.5218 -0.1616 0.0271  0.0443  350 GLU A OE2   
257  N  N     . LYS A 33  ? 0.3400 0.3883 0.2522 -0.0480 0.0210  0.0176  351 LYS A N     
258  C  CA    . LYS A 33  ? 0.3190 0.3441 0.2409 -0.0357 0.0155  0.0141  351 LYS A CA    
259  C  C     . LYS A 33  ? 0.3227 0.3578 0.2477 -0.0530 0.0157  0.0142  351 LYS A C     
260  O  O     . LYS A 33  ? 0.3075 0.3827 0.2469 -0.0496 0.0163  0.0120  351 LYS A O     
261  C  CB    . LYS A 33  ? 0.3006 0.3411 0.2345 -0.0101 0.0139  0.0088  351 LYS A CB    
262  C  CG    . LYS A 33  ? 0.3221 0.3423 0.2464 0.0041  0.0126  0.0069  351 LYS A CG    
263  C  CD    . LYS A 33  ? 0.3279 0.3518 0.2532 0.0279  0.0115  0.0010  351 LYS A CD    
264  C  CE    . LYS A 33  ? 0.4165 0.4157 0.3244 0.0368  0.0104  -0.0021 351 LYS A CE    
265  N  NZ    . LYS A 33  ? 0.4228 0.4011 0.3209 0.0565  0.0071  -0.0081 351 LYS A NZ    
266  N  N     . PRO A 34  ? 0.3604 0.3574 0.2680 -0.0711 0.0152  0.0168  352 PRO A N     
267  C  CA    . PRO A 34  ? 0.3442 0.3457 0.2456 -0.0940 0.0159  0.0160  352 PRO A CA    
268  C  C     . PRO A 34  ? 0.3221 0.3240 0.2374 -0.0841 0.0122  0.0111  352 PRO A C     
269  O  O     . PRO A 34  ? 0.3718 0.3879 0.2843 -0.1027 0.0126  0.0095  352 PRO A O     
270  C  CB    . PRO A 34  ? 0.3951 0.3376 0.2642 -0.1110 0.0165  0.0195  352 PRO A CB    
271  C  CG    . PRO A 34  ? 0.4537 0.3762 0.3156 -0.0994 0.0167  0.0245  352 PRO A CG    
272  C  CD    . PRO A 34  ? 0.4002 0.3476 0.2879 -0.0715 0.0143  0.0212  352 PRO A CD    
273  N  N     . TYR A 35  ? 0.2923 0.2787 0.2193 -0.0593 0.0084  0.0093  353 TYR A N     
274  C  CA    . TYR A 35  ? 0.2783 0.2589 0.2147 -0.0516 0.0046  0.0059  353 TYR A CA    
275  C  C     . TYR A 35  ? 0.2780 0.2999 0.2361 -0.0368 0.0027  0.0047  353 TYR A C     
276  O  O     . TYR A 35  ? 0.2798 0.2954 0.2445 -0.0170 -0.0003 0.0047  353 TYR A O     
277  C  CB    . TYR A 35  ? 0.3256 0.2657 0.2574 -0.0370 0.0012  0.0065  353 TYR A CB    
278  C  CG    . TYR A 35  ? 0.3781 0.2760 0.2842 -0.0464 0.0038  0.0089  353 TYR A CG    
279  C  CD1   . TYR A 35  ? 0.4122 0.2844 0.3000 -0.0592 0.0055  0.0061  353 TYR A CD1   
280  C  CD2   . TYR A 35  ? 0.3974 0.2784 0.2924 -0.0431 0.0047  0.0140  353 TYR A CD2   
281  C  CE1   . TYR A 35  ? 0.4560 0.2777 0.3111 -0.0658 0.0084  0.0084  353 TYR A CE1   
282  C  CE2   . TYR A 35  ? 0.4441 0.2811 0.3103 -0.0497 0.0072  0.0179  353 TYR A CE2   
283  C  CZ    . TYR A 35  ? 0.4852 0.2891 0.3298 -0.0599 0.0091  0.0152  353 TYR A CZ    
284  O  OH    . TYR A 35  ? 0.5733 0.3219 0.3809 -0.0639 0.0117  0.0191  353 TYR A OH    
285  N  N     . GLN A 36  ? 0.2569 0.3196 0.2223 -0.0472 0.0042  0.0044  354 GLN A N     
286  C  CA    . GLN A 36  ? 0.2465 0.3533 0.2295 -0.0306 0.0031  0.0052  354 GLN A CA    
287  C  C     . GLN A 36  ? 0.2222 0.3238 0.2136 -0.0241 -0.0019 0.0041  354 GLN A C     
288  O  O     . GLN A 36  ? 0.2616 0.3507 0.2479 -0.0404 -0.0028 0.0020  354 GLN A O     
289  C  CB    . GLN A 36  ? 0.2832 0.4510 0.2713 -0.0443 0.0071  0.0076  354 GLN A CB    
290  C  CG    . GLN A 36  ? 0.4348 0.6548 0.4403 -0.0241 0.0062  0.0100  354 GLN A CG    
291  C  CD    . GLN A 36  ? 0.5156 0.7405 0.5233 0.0095  0.0077  0.0106  354 GLN A CD    
292  O  OE1   . GLN A 36  ? 0.6510 0.8843 0.6528 0.0112  0.0124  0.0105  354 GLN A OE1   
293  N  NE2   . GLN A 36  ? 0.2930 0.5093 0.3046 0.0355  0.0040  0.0112  354 GLN A NE2   
294  N  N     . CYS A 37  ? 0.2127 0.3209 0.2129 -0.0002 -0.0050 0.0055  355 CYS A N     
295  C  CA    . CYS A 37  ? 0.2043 0.3123 0.2117 0.0055  -0.0100 0.0064  355 CYS A CA    
296  C  C     . CYS A 37  ? 0.1996 0.3626 0.2179 0.0035  -0.0094 0.0092  355 CYS A C     
297  O  O     . CYS A 37  ? 0.2011 0.4020 0.2245 0.0183  -0.0070 0.0125  355 CYS A O     
298  C  CB    . CYS A 37  ? 0.2058 0.2891 0.2107 0.0287  -0.0145 0.0082  355 CYS A CB    
299  S  SG    . CYS A 37  ? 0.2002 0.2803 0.2106 0.0315  -0.0214 0.0112  355 CYS A SG    
300  N  N     . ASP A 38  ? 0.1965 0.3672 0.2170 -0.0130 -0.0114 0.0081  356 ASP A N     
301  C  CA    . ASP A 38  ? 0.1933 0.4221 0.2231 -0.0208 -0.0113 0.0112  356 ASP A CA    
302  C  C     . ASP A 38  ? 0.1851 0.4255 0.2237 -0.0062 -0.0168 0.0152  356 ASP A C     
303  O  O     . ASP A 38  ? 0.1822 0.4708 0.2282 -0.0143 -0.0179 0.0183  356 ASP A O     
304  C  CB    . ASP A 38  ? 0.2672 0.4995 0.2869 -0.0565 -0.0094 0.0068  356 ASP A CB    
305  C  CG    . ASP A 38  ? 0.3985 0.6432 0.4088 -0.0754 -0.0043 0.0065  356 ASP A CG    
306  O  OD1   . ASP A 38  ? 0.4109 0.6963 0.4304 -0.0626 -0.0017 0.0112  356 ASP A OD1   
307  O  OD2   . ASP A 38  ? 0.4829 0.6950 0.4733 -0.1026 -0.0025 0.0020  356 ASP A OD2   
308  N  N     . PHE A 39  ? 0.1845 0.3852 0.2206 0.0138  -0.0207 0.0167  357 PHE A N     
309  C  CA    . PHE A 39  ? 0.1830 0.3908 0.2232 0.0283  -0.0263 0.0226  357 PHE A CA    
310  C  C     . PHE A 39  ? 0.1929 0.4262 0.2341 0.0577  -0.0263 0.0300  357 PHE A C     
311  O  O     . PHE A 39  ? 0.2442 0.4522 0.2757 0.0760  -0.0246 0.0296  357 PHE A O     
312  C  CB    . PHE A 39  ? 0.1856 0.3400 0.2175 0.0334  -0.0312 0.0225  357 PHE A CB    
313  C  CG    . PHE A 39  ? 0.2106 0.3484 0.2419 0.0130  -0.0319 0.0174  357 PHE A CG    
314  C  CD1   . PHE A 39  ? 0.2530 0.4076 0.2884 0.0058  -0.0351 0.0189  357 PHE A CD1   
315  C  CD2   . PHE A 39  ? 0.2276 0.3334 0.2518 0.0038  -0.0289 0.0114  357 PHE A CD2   
316  C  CE1   . PHE A 39  ? 0.2409 0.3803 0.2723 -0.0094 -0.0346 0.0130  357 PHE A CE1   
317  C  CE2   . PHE A 39  ? 0.2624 0.3521 0.2822 -0.0086 -0.0286 0.0067  357 PHE A CE2   
318  C  CZ    . PHE A 39  ? 0.2159 0.3221 0.2389 -0.0145 -0.0311 0.0069  357 PHE A CZ    
319  N  N     . LYS A 40  ? 0.1917 0.4719 0.2412 0.0642  -0.0285 0.0370  358 LYS A N     
320  C  CA    . LYS A 40  ? 0.2745 0.5697 0.3202 0.0996  -0.0301 0.0465  358 LYS A CA    
321  C  C     . LYS A 40  ? 0.2880 0.5881 0.3269 0.1241  -0.0243 0.0461  358 LYS A C     
322  O  O     . LYS A 40  ? 0.3481 0.6061 0.3684 0.1533  -0.0251 0.0481  358 LYS A O     
323  C  CB    . LYS A 40  ? 0.3218 0.5582 0.3519 0.1129  -0.0369 0.0505  358 LYS A CB    
324  C  CG    . LYS A 40  ? 0.3479 0.5952 0.3690 0.1463  -0.0400 0.0624  358 LYS A CG    
325  C  CD    . LYS A 40  ? 0.4754 0.6547 0.4736 0.1535  -0.0474 0.0672  358 LYS A CD    
326  C  CE    . LYS A 40  ? 0.5720 0.7586 0.5604 0.1747  -0.0495 0.0782  358 LYS A CE    
327  N  NZ    . LYS A 40  ? 0.6812 0.7975 0.6419 0.1783  -0.0572 0.0841  358 LYS A NZ    
328  N  N     . ASP A 41  ? 0.1751 0.4111 0.3269 0.0356  -0.0410 0.0434  359 ASP A N     
329  C  CA    . ASP A 41  ? 0.1775 0.4190 0.3448 0.0453  -0.0297 0.0432  359 ASP A CA    
330  C  C     . ASP A 41  ? 0.1820 0.3932 0.3319 0.0510  -0.0188 0.0358  359 ASP A C     
331  O  O     . ASP A 41  ? 0.1983 0.4092 0.3558 0.0622  -0.0089 0.0346  359 ASP A O     
332  C  CB    . ASP A 41  ? 0.2062 0.4644 0.3966 0.0610  -0.0317 0.0522  359 ASP A CB    
333  C  CG    . ASP A 41  ? 0.2566 0.5508 0.4682 0.0568  -0.0435 0.0612  359 ASP A CG    
334  O  OD1   . ASP A 41  ? 0.2354 0.5334 0.4501 0.0631  -0.0540 0.0702  359 ASP A OD1   
335  O  OD2   . ASP A 41  ? 0.2312 0.5502 0.4566 0.0466  -0.0429 0.0602  359 ASP A OD2   
336  N  N     . CYS A 42  ? 0.1912 0.3782 0.3177 0.0444  -0.0204 0.0304  360 CYS A N     
337  C  CA    . CYS A 42  ? 0.1710 0.3304 0.2803 0.0492  -0.0131 0.0241  360 CYS A CA    
338  C  C     . CYS A 42  ? 0.1728 0.3333 0.2813 0.0487  -0.0014 0.0197  360 CYS A C     
339  O  O     . CYS A 42  ? 0.1980 0.3702 0.3098 0.0381  0.0001  0.0197  360 CYS A O     
340  C  CB    . CYS A 42  ? 0.1736 0.3144 0.2622 0.0406  -0.0181 0.0203  360 CYS A CB    
341  S  SG    . CYS A 42  ? 0.1708 0.2801 0.2385 0.0444  -0.0137 0.0137  360 CYS A SG    
342  N  N     . GLU A 43  ? 0.1720 0.3175 0.2730 0.0589  0.0068  0.0156  361 GLU A N     
343  C  CA    . GLU A 43  ? 0.1818 0.3281 0.2777 0.0592  0.0191  0.0119  361 GLU A CA    
344  C  C     . GLU A 43  ? 0.1864 0.3073 0.2555 0.0538  0.0204  0.0063  361 GLU A C     
345  O  O     . GLU A 43  ? 0.2427 0.3619 0.3030 0.0537  0.0303  0.0042  361 GLU A O     
346  C  CB    . GLU A 43  ? 0.2157 0.3640 0.3182 0.0752  0.0288  0.0097  361 GLU A CB    
347  C  CG    . GLU A 43  ? 0.1992 0.3761 0.3318 0.0832  0.0286  0.0162  361 GLU A CG    
348  C  CD    . GLU A 43  ? 0.2854 0.4645 0.4251 0.1013  0.0409  0.0125  361 GLU A CD    
349  O  OE1   . GLU A 43  ? 0.3326 0.5234 0.4719 0.1018  0.0544  0.0100  361 GLU A OE1   
350  O  OE2   . GLU A 43  ? 0.2627 0.4297 0.4064 0.1151  0.0377  0.0118  361 GLU A OE2   
351  N  N     . ARG A 44  ? 0.1856 0.2892 0.2421 0.0496  0.0111  0.0048  362 ARG A N     
352  C  CA    . ARG A 44  ? 0.1866 0.2688 0.2205 0.0460  0.0112  0.0002  362 ARG A CA    
353  C  C     . ARG A 44  ? 0.2119 0.2973 0.2419 0.0353  0.0127  0.0019  362 ARG A C     
354  O  O     . ARG A 44  ? 0.2161 0.3142 0.2575 0.0276  0.0089  0.0049  362 ARG A O     
355  C  CB    . ARG A 44  ? 0.2208 0.2880 0.2464 0.0446  0.0011  -0.0010 362 ARG A CB    
356  C  CG    . ARG A 44  ? 0.3104 0.3651 0.3348 0.0534  -0.0009 -0.0030 362 ARG A CG    
357  C  CD    . ARG A 44  ? 0.4619 0.4973 0.4669 0.0574  0.0035  -0.0102 362 ARG A CD    
358  N  NE    . ARG A 44  ? 0.7059 0.7232 0.7063 0.0643  0.0007  -0.0144 362 ARG A NE    
359  C  CZ    . ARG A 44  ? 0.8358 0.8335 0.8174 0.0673  0.0021  -0.0224 362 ARG A CZ    
360  N  NH1   . ARG A 44  ? 0.8396 0.8353 0.8042 0.0647  0.0065  -0.0257 362 ARG A NH1   
361  N  NH2   . ARG A 44  ? 0.9016 0.8800 0.8797 0.0723  -0.0017 -0.0270 362 ARG A NH2   
362  N  N     . ARG A 45  ? 0.1952 0.2673 0.2076 0.0345  0.0176  0.0002  363 ARG A N     
363  C  CA    . ARG A 45  ? 0.1979 0.2652 0.2028 0.0249  0.0179  0.0027  363 ARG A CA    
364  C  C     . ARG A 45  ? 0.2238 0.2698 0.2050 0.0266  0.0169  0.0007  363 ARG A C     
365  O  O     . ARG A 45  ? 0.2423 0.2800 0.2116 0.0338  0.0185  -0.0032 363 ARG A O     
366  C  CB    . ARG A 45  ? 0.2464 0.3291 0.2601 0.0196  0.0278  0.0078  363 ARG A CB    
367  C  CG    . ARG A 45  ? 0.3185 0.4060 0.3266 0.0271  0.0398  0.0075  363 ARG A CG    
368  C  CD    . ARG A 45  ? 0.3771 0.4879 0.4002 0.0214  0.0509  0.0139  363 ARG A CD    
369  N  NE    . ARG A 45  ? 0.5101 0.6233 0.5208 0.0277  0.0647  0.0138  363 ARG A NE    
370  C  CZ    . ARG A 45  ? 0.6461 0.7698 0.6617 0.0407  0.0728  0.0092  363 ARG A CZ    
371  N  NH1   . ARG A 45  ? 0.6438 0.7757 0.6783 0.0487  0.0677  0.0063  363 ARG A NH1   
372  N  NH2   . ARG A 45  ? 0.7019 0.8268 0.7022 0.0463  0.0864  0.0078  363 ARG A NH2   
373  N  N     . PHE A 46  ? 0.2523 0.2888 0.2267 0.0200  0.0133  0.0032  364 PHE A N     
374  C  CA    . PHE A 46  ? 0.2631 0.2812 0.2179 0.0218  0.0088  0.0026  364 PHE A CA    
375  C  C     . PHE A 46  ? 0.2675 0.2767 0.2129 0.0158  0.0115  0.0088  364 PHE A C     
376  O  O     . PHE A 46  ? 0.2890 0.3025 0.2450 0.0082  0.0136  0.0124  364 PHE A O     
377  C  CB    . PHE A 46  ? 0.2183 0.2315 0.1763 0.0229  -0.0018 -0.0006 364 PHE A CB    
378  C  CG    . PHE A 46  ? 0.2178 0.2377 0.1843 0.0270  -0.0049 -0.0044 364 PHE A CG    
379  C  CD1   . PHE A 46  ? 0.2532 0.2646 0.2099 0.0318  -0.0080 -0.0077 364 PHE A CD1   
380  C  CD2   . PHE A 46  ? 0.2070 0.2409 0.1905 0.0255  -0.0054 -0.0040 364 PHE A CD2   
381  C  CE1   . PHE A 46  ? 0.2494 0.2632 0.2141 0.0347  -0.0110 -0.0100 364 PHE A CE1   
382  C  CE2   . PHE A 46  ? 0.2059 0.2443 0.1967 0.0295  -0.0084 -0.0051 364 PHE A CE2   
383  C  CZ    . PHE A 46  ? 0.2345 0.2611 0.2161 0.0340  -0.0110 -0.0079 364 PHE A CZ    
384  N  N     . SER A 47  ? 0.3081 0.3035 0.2328 0.0186  0.0101  0.0107  365 SER A N     
385  C  CA    . SER A 47  ? 0.3029 0.2858 0.2161 0.0139  0.0106  0.0187  365 SER A CA    
386  C  C     . SER A 47  ? 0.3581 0.3287 0.2751 0.0135  0.0009  0.0191  365 SER A C     
387  O  O     . SER A 47  ? 0.4022 0.3604 0.3155 0.0089  0.0010  0.0258  365 SER A O     
388  C  CB    . SER A 47  ? 0.3703 0.3441 0.2577 0.0176  0.0119  0.0217  365 SER A CB    
389  O  OG    . SER A 47  ? 0.4659 0.4503 0.3477 0.0178  0.0239  0.0217  365 SER A OG    
390  N  N     . ARG A 48  ? 0.3468 0.3206 0.2719 0.0183  -0.0067 0.0123  366 ARG A N     
391  C  CA    . ARG A 48  ? 0.3033 0.2691 0.2331 0.0204  -0.0146 0.0110  366 ARG A CA    
392  C  C     . ARG A 48  ? 0.3044 0.2810 0.2515 0.0189  -0.0159 0.0044  366 ARG A C     
393  O  O     . ARG A 48  ? 0.2828 0.2731 0.2370 0.0197  -0.0153 0.0007  366 ARG A O     
394  C  CB    . ARG A 48  ? 0.3558 0.3193 0.2784 0.0278  -0.0227 0.0099  366 ARG A CB    
395  C  CG    . ARG A 48  ? 0.3720 0.3229 0.2755 0.0300  -0.0253 0.0172  366 ARG A CG    
396  C  CD    . ARG A 48  ? 0.3788 0.3328 0.2747 0.0353  -0.0338 0.0151  366 ARG A CD    
397  N  NE    . ARG A 48  ? 0.3262 0.2886 0.2377 0.0391  -0.0412 0.0107  366 ARG A NE    
398  C  CZ    . ARG A 48  ? 0.3034 0.2705 0.2133 0.0427  -0.0505 0.0103  366 ARG A CZ    
399  N  NH1   . ARG A 48  ? 0.3465 0.3086 0.2377 0.0429  -0.0548 0.0130  366 ARG A NH1   
400  N  NH2   . ARG A 48  ? 0.3307 0.3096 0.2576 0.0453  -0.0553 0.0071  366 ARG A NH2   
401  N  N     . SER A 49  ? 0.3284 0.2972 0.2803 0.0173  -0.0182 0.0028  367 SER A N     
402  C  CA    . SER A 49  ? 0.2998 0.2787 0.2639 0.0155  -0.0195 -0.0042 367 SER A CA    
403  C  C     . SER A 49  ? 0.2757 0.2656 0.2439 0.0220  -0.0237 -0.0084 367 SER A C     
404  O  O     . SER A 49  ? 0.2542 0.2584 0.2305 0.0203  -0.0237 -0.0121 367 SER A O     
405  C  CB    . SER A 49  ? 0.3490 0.3131 0.3138 0.0131  -0.0211 -0.0073 367 SER A CB    
406  O  OG    . SER A 49  ? 0.3860 0.3375 0.3460 0.0219  -0.0252 -0.0073 367 SER A OG    
407  N  N     . ASP A 50  ? 0.2963 0.2817 0.2598 0.0288  -0.0277 -0.0070 368 ASP A N     
408  C  CA    . ASP A 50  ? 0.2886 0.2870 0.2588 0.0332  -0.0315 -0.0099 368 ASP A CA    
409  C  C     . ASP A 50  ? 0.2514 0.2602 0.2228 0.0312  -0.0315 -0.0090 368 ASP A C     
410  O  O     . ASP A 50  ? 0.2463 0.2677 0.2256 0.0310  -0.0330 -0.0106 368 ASP A O     
411  C  CB    . ASP A 50  ? 0.3080 0.3021 0.2767 0.0407  -0.0368 -0.0081 368 ASP A CB    
412  C  CG    . ASP A 50  ? 0.3766 0.3609 0.3331 0.0418  -0.0398 -0.0020 368 ASP A CG    
413  O  OD1   . ASP A 50  ? 0.4028 0.3765 0.3494 0.0379  -0.0359 0.0014  368 ASP A OD1   
414  O  OD2   . ASP A 50  ? 0.4369 0.4259 0.3935 0.0460  -0.0461 -0.0003 368 ASP A OD2   
415  N  N     . GLN A 51  ? 0.2365 0.2391 0.1993 0.0298  -0.0294 -0.0062 369 GLN A N     
416  C  CA    . GLN A 51  ? 0.2427 0.2512 0.2065 0.0290  -0.0286 -0.0070 369 GLN A CA    
417  C  C     . GLN A 51  ? 0.2255 0.2446 0.2000 0.0260  -0.0248 -0.0077 369 GLN A C     
418  O  O     . GLN A 51  ? 0.2148 0.2409 0.1953 0.0263  -0.0262 -0.0079 369 GLN A O     
419  C  CB    . GLN A 51  ? 0.2791 0.2784 0.2291 0.0297  -0.0255 -0.0056 369 GLN A CB    
420  C  CG    . GLN A 51  ? 0.2925 0.2831 0.2293 0.0323  -0.0315 -0.0046 369 GLN A CG    
421  C  CD    . GLN A 51  ? 0.3980 0.3795 0.3167 0.0326  -0.0274 -0.0031 369 GLN A CD    
422  O  OE1   . GLN A 51  ? 0.4180 0.4001 0.3356 0.0308  -0.0187 -0.0013 369 GLN A OE1   
423  N  NE2   . GLN A 51  ? 0.4017 0.3769 0.3059 0.0344  -0.0336 -0.0036 369 GLN A NE2   
424  N  N     . LEU A 52  ? 0.2023 0.2222 0.1795 0.0226  -0.0209 -0.0073 370 LEU A N     
425  C  CA    . LEU A 52  ? 0.1834 0.2166 0.1719 0.0192  -0.0195 -0.0077 370 LEU A CA    
426  C  C     . LEU A 52  ? 0.1950 0.2368 0.1886 0.0191  -0.0239 -0.0099 370 LEU A C     
427  O  O     . LEU A 52  ? 0.1841 0.2371 0.1843 0.0188  -0.0252 -0.0083 370 LEU A O     
428  C  CB    . LEU A 52  ? 0.1971 0.2305 0.1884 0.0132  -0.0161 -0.0071 370 LEU A CB    
429  C  CG    . LEU A 52  ? 0.1999 0.2496 0.2032 0.0086  -0.0173 -0.0079 370 LEU A CG    
430  C  CD1   . LEU A 52  ? 0.2170 0.2801 0.2293 0.0116  -0.0154 -0.0044 370 LEU A CD1   
431  C  CD2   . LEU A 52  ? 0.2323 0.2809 0.2389 -0.0001 -0.0159 -0.0083 370 LEU A CD2   
432  N  N     . LYS A 53  ? 0.1912 0.2281 0.1815 0.0202  -0.0258 -0.0130 371 LYS A N     
433  C  CA    . LYS A 53  ? 0.2099 0.2575 0.2037 0.0206  -0.0279 -0.0158 371 LYS A CA    
434  C  C     . LYS A 53  ? 0.1953 0.2518 0.1927 0.0223  -0.0301 -0.0123 371 LYS A C     
435  O  O     . LYS A 53  ? 0.1915 0.2606 0.1929 0.0202  -0.0308 -0.0106 371 LYS A O     
436  C  CB    . LYS A 53  ? 0.2970 0.3370 0.2872 0.0240  -0.0281 -0.0207 371 LYS A CB    
437  C  CG    . LYS A 53  ? 0.4412 0.4693 0.4280 0.0201  -0.0268 -0.0245 371 LYS A CG    
438  C  CD    . LYS A 53  ? 0.5977 0.6147 0.5809 0.0246  -0.0271 -0.0310 371 LYS A CD    
439  C  CE    . LYS A 53  ? 0.6929 0.7229 0.6764 0.0256  -0.0267 -0.0381 371 LYS A CE    
440  N  NZ    . LYS A 53  ? 0.7665 0.8139 0.7546 0.0307  -0.0263 -0.0354 371 LYS A NZ    
441  N  N     . ARG A 54  ? 0.1836 0.2330 0.1787 0.0249  -0.0318 -0.0104 372 ARG A N     
442  C  CA    . ARG A 54  ? 0.2121 0.2671 0.2113 0.0242  -0.0349 -0.0072 372 ARG A CA    
443  C  C     . ARG A 54  ? 0.2180 0.2737 0.2198 0.0223  -0.0345 -0.0039 372 ARG A C     
444  O  O     . ARG A 54  ? 0.1946 0.2583 0.2019 0.0201  -0.0363 0.0002  372 ARG A O     
445  C  CB    . ARG A 54  ? 0.2192 0.2650 0.2139 0.0260  -0.0386 -0.0070 372 ARG A CB    
446  C  CG    . ARG A 54  ? 0.1910 0.2401 0.1902 0.0229  -0.0430 -0.0043 372 ARG A CG    
447  C  CD    . ARG A 54  ? 0.2104 0.2511 0.2039 0.0233  -0.0487 -0.0053 372 ARG A CD    
448  N  NE    . ARG A 54  ? 0.2032 0.2278 0.1837 0.0250  -0.0472 -0.0078 372 ARG A NE    
449  C  CZ    . ARG A 54  ? 0.1937 0.2081 0.1632 0.0253  -0.0518 -0.0098 372 ARG A CZ    
450  N  NH1   . ARG A 54  ? 0.2016 0.2207 0.1733 0.0235  -0.0598 -0.0091 372 ARG A NH1   
451  N  NH2   . ARG A 54  ? 0.2419 0.2435 0.1978 0.0275  -0.0480 -0.0125 372 ARG A NH2   
452  N  N     . HIS A 55  ? 0.1956 0.2439 0.1946 0.0236  -0.0316 -0.0046 373 HIS A N     
453  C  CA    . HIS A 55  ? 0.1899 0.2399 0.1939 0.0246  -0.0304 -0.0017 373 HIS A CA    
454  C  C     . HIS A 55  ? 0.1670 0.2321 0.1790 0.0222  -0.0315 0.0018  373 HIS A C     
455  O  O     . HIS A 55  ? 0.1824 0.2509 0.1999 0.0228  -0.0337 0.0071  373 HIS A O     
456  C  CB    . HIS A 55  ? 0.1755 0.2207 0.1771 0.0271  -0.0251 -0.0033 373 HIS A CB    
457  C  CG    . HIS A 55  ? 0.1625 0.2164 0.1743 0.0293  -0.0229 -0.0003 373 HIS A CG    
458  N  ND1   . HIS A 55  ? 0.1856 0.2337 0.2001 0.0344  -0.0232 0.0011  373 HIS A ND1   
459  C  CD2   . HIS A 55  ? 0.1656 0.2342 0.1869 0.0273  -0.0219 0.0019  373 HIS A CD2   
460  C  CE1   . HIS A 55  ? 0.1964 0.2564 0.2229 0.0373  -0.0218 0.0049  373 HIS A CE1   
461  N  NE2   . HIS A 55  ? 0.1574 0.2319 0.1887 0.0323  -0.0215 0.0057  373 HIS A NE2   
462  N  N     . GLN A 56  ? 0.1627 0.2354 0.1740 0.0194  -0.0308 -0.0009 374 GLN A N     
463  C  CA    . GLN A 56  ? 0.1568 0.2444 0.1726 0.0164  -0.0327 0.0015  374 GLN A CA    
464  C  C     . GLN A 56  ? 0.1766 0.2727 0.1918 0.0151  -0.0356 0.0057  374 GLN A C     
465  O  O     . GLN A 56  ? 0.1796 0.2879 0.1968 0.0132  -0.0382 0.0103  374 GLN A O     
466  C  CB    . GLN A 56  ? 0.1700 0.2604 0.1828 0.0125  -0.0320 -0.0045 374 GLN A CB    
467  C  CG    . GLN A 56  ? 0.1915 0.2783 0.2084 0.0112  -0.0292 -0.0051 374 GLN A CG    
468  C  CD    . GLN A 56  ? 0.2524 0.3395 0.2680 0.0047  -0.0294 -0.0101 374 GLN A CD    
469  O  OE1   . GLN A 56  ? 0.3658 0.4607 0.3894 0.0003  -0.0291 -0.0086 374 GLN A OE1   
470  N  NE2   . GLN A 56  ? 0.2673 0.3460 0.2745 0.0041  -0.0300 -0.0161 374 GLN A NE2   
471  N  N     . ARG A 57  ? 0.2052 0.2970 0.2180 0.0155  -0.0355 0.0055  375 ARG A N     
472  C  CA    . ARG A 57  ? 0.1786 0.2801 0.1929 0.0129  -0.0373 0.0120  375 ARG A CA    
473  C  C     . ARG A 57  ? 0.2133 0.3120 0.2328 0.0127  -0.0404 0.0212  375 ARG A C     
474  O  O     . ARG A 57  ? 0.2094 0.3175 0.2296 0.0096  -0.0423 0.0294  375 ARG A O     
475  C  CB    . ARG A 57  ? 0.1929 0.2926 0.2082 0.0125  -0.0370 0.0111  375 ARG A CB    
476  C  CG    . ARG A 57  ? 0.1814 0.2827 0.1934 0.0153  -0.0343 0.0029  375 ARG A CG    
477  C  CD    . ARG A 57  ? 0.2398 0.3434 0.2564 0.0160  -0.0352 0.0032  375 ARG A CD    
478  N  NE    . ARG A 57  ? 0.2235 0.3250 0.2382 0.0215  -0.0333 -0.0041 375 ARG A NE    
479  C  CZ    . ARG A 57  ? 0.2690 0.3688 0.2875 0.0244  -0.0355 -0.0048 375 ARG A CZ    
480  N  NH1   . ARG A 57  ? 0.2198 0.3207 0.2437 0.0207  -0.0399 0.0002  375 ARG A NH1   
481  N  NH2   . ARG A 57  ? 0.3162 0.4123 0.3332 0.0309  -0.0343 -0.0103 375 ARG A NH2   
482  N  N     . ARG A 58  ? 0.1911 0.2761 0.2136 0.0167  -0.0405 0.0205  376 ARG A N     
483  C  CA    . ARG A 58  ? 0.2112 0.2909 0.2395 0.0189  -0.0433 0.0285  376 ARG A CA    
484  C  C     . ARG A 58  ? 0.2504 0.3458 0.2826 0.0192  -0.0456 0.0351  376 ARG A C     
485  O  O     . ARG A 58  ? 0.2570 0.3530 0.2929 0.0195  -0.0494 0.0455  376 ARG A O     
486  C  CB    . ARG A 58  ? 0.2044 0.2683 0.2345 0.0255  -0.0413 0.0243  376 ARG A CB    
487  C  CG    . ARG A 58  ? 0.2370 0.2840 0.2607 0.0254  -0.0409 0.0182  376 ARG A CG    
488  C  CD    . ARG A 58  ? 0.2873 0.3182 0.3102 0.0330  -0.0384 0.0142  376 ARG A CD    
489  N  NE    . ARG A 58  ? 0.4020 0.4221 0.4304 0.0350  -0.0422 0.0206  376 ARG A NE    
490  C  CZ    . ARG A 58  ? 0.5591 0.5636 0.5894 0.0433  -0.0409 0.0188  376 ARG A CZ    
491  N  NH1   . ARG A 58  ? 0.5506 0.5514 0.5772 0.0505  -0.0345 0.0104  376 ARG A NH1   
492  N  NH2   . ARG A 58  ? 0.6199 0.6119 0.6556 0.0448  -0.0454 0.0259  376 ARG A NH2   
493  N  N     . HIS A 59  ? 0.1891 0.2962 0.2207 0.0187  -0.0442 0.0299  377 HIS A N     
494  C  CA    . HIS A 59  ? 0.2038 0.3283 0.2388 0.0177  -0.0482 0.0351  377 HIS A CA    
495  C  C     . HIS A 59  ? 0.2328 0.3711 0.2581 0.0116  -0.0506 0.0377  377 HIS A C     
496  O  O     . HIS A 59  ? 0.2576 0.4078 0.2829 0.0106  -0.0556 0.0473  377 HIS A O     
497  C  CB    . HIS A 59  ? 0.2057 0.3375 0.2445 0.0171  -0.0467 0.0280  377 HIS A CB    
498  C  CG    . HIS A 59  ? 0.2282 0.3511 0.2757 0.0230  -0.0423 0.0258  377 HIS A CG    
499  N  ND1   . HIS A 59  ? 0.2329 0.3578 0.2925 0.0303  -0.0432 0.0324  377 HIS A ND1   
500  C  CD2   . HIS A 59  ? 0.2051 0.3176 0.2499 0.0235  -0.0365 0.0182  377 HIS A CD2   
501  C  CE1   . HIS A 59  ? 0.2429 0.3605 0.3066 0.0352  -0.0368 0.0275  377 HIS A CE1   
502  N  NE2   . HIS A 59  ? 0.2095 0.3195 0.2632 0.0304  -0.0329 0.0195  377 HIS A NE2   
503  N  N     . THR A 60  ? 0.2083 0.3466 0.2249 0.0084  -0.0469 0.0293  378 THR A N     
504  C  CA    . THR A 60  ? 0.2361 0.3890 0.2418 0.0039  -0.0471 0.0297  378 THR A CA    
505  C  C     . THR A 60  ? 0.2336 0.3889 0.2381 0.0020  -0.0466 0.0401  378 THR A C     
506  O  O     . THR A 60  ? 0.2825 0.4534 0.2780 -0.0018 -0.0468 0.0450  378 THR A O     
507  C  CB    . THR A 60  ? 0.2225 0.3740 0.2206 0.0033  -0.0425 0.0163  378 THR A CB    
508  O  OG1   . THR A 60  ? 0.2354 0.3756 0.2373 0.0060  -0.0385 0.0143  378 THR A OG1   
509  C  CG2   . THR A 60  ? 0.2472 0.3938 0.2460 0.0029  -0.0433 0.0069  378 THR A CG2   
510  N  N     . GLY A 61  ? 0.1905 0.6348 0.3154 0.0184  -0.0666 -0.0561 379 GLY A N     
511  C  CA    . GLY A 61  ? 0.2375 0.6734 0.3323 0.0262  -0.0676 -0.0330 379 GLY A CA    
512  C  C     . GLY A 61  ? 0.2801 0.7068 0.3544 0.0177  -0.0602 -0.0460 379 GLY A C     
513  O  O     . GLY A 61  ? 0.2662 0.6870 0.3132 0.0218  -0.0597 -0.0288 379 GLY A O     
514  N  N     . VAL A 62  ? 0.1846 0.6029 0.2730 0.0059  -0.0515 -0.0751 380 VAL A N     
515  C  CA    . VAL A 62  ? 0.2127 0.6183 0.2857 -0.0023 -0.0422 -0.0895 380 VAL A CA    
516  C  C     . VAL A 62  ? 0.2183 0.5745 0.2830 0.0042  -0.0317 -0.0717 380 VAL A C     
517  O  O     . VAL A 62  ? 0.1829 0.5040 0.2622 0.0092  -0.0261 -0.0638 380 VAL A O     
518  C  CB    . VAL A 62  ? 0.2462 0.6511 0.3435 -0.0153 -0.0342 -0.1240 380 VAL A CB    
519  C  CG1   . VAL A 62  ? 0.3295 0.7244 0.4155 -0.0229 -0.0240 -0.1400 380 VAL A CG1   
520  C  CG2   . VAL A 62  ? 0.2882 0.7301 0.3925 -0.0221 -0.0420 -0.1416 380 VAL A CG2   
521  N  N     . LYS A 63  ? 0.2128 0.5673 0.2544 0.0031  -0.0285 -0.0671 381 LYS A N     
522  C  CA    . LYS A 63  ? 0.1775 0.4904 0.2133 0.0070  -0.0194 -0.0541 381 LYS A CA    
523  C  C     . LYS A 63  ? 0.2265 0.5359 0.2630 -0.0022 -0.0099 -0.0757 381 LYS A C     
524  O  O     . LYS A 63  ? 0.2702 0.5941 0.2880 -0.0048 -0.0074 -0.0746 381 LYS A O     
525  C  CB    . LYS A 63  ? 0.2630 0.5755 0.2769 0.0154  -0.0229 -0.0249 381 LYS A CB    
526  C  CG    . LYS A 63  ? 0.2837 0.5984 0.3019 0.0261  -0.0311 -0.0030 381 LYS A CG    
527  C  CD    . LYS A 63  ? 0.3801 0.6849 0.3819 0.0348  -0.0316 0.0270  381 LYS A CD    
528  C  CE    . LYS A 63  ? 0.4760 0.7751 0.4889 0.0467  -0.0369 0.0481  381 LYS A CE    
529  N  NZ    . LYS A 63  ? 0.5911 0.8745 0.5922 0.0551  -0.0349 0.0774  381 LYS A NZ    
530  N  N     . PRO A 64  ? 0.1921 0.4809 0.2518 -0.0069 -0.0026 -0.0945 382 PRO A N     
531  C  CA    . PRO A 64  ? 0.2362 0.5252 0.3037 -0.0155 0.0072  -0.1182 382 PRO A CA    
532  C  C     . PRO A 64  ? 0.2223 0.4873 0.2852 -0.0129 0.0141  -0.1092 382 PRO A C     
533  O  O     . PRO A 64  ? 0.2594 0.5305 0.3282 -0.0191 0.0228  -0.1272 382 PRO A O     
534  C  CB    . PRO A 64  ? 0.2445 0.5122 0.3421 -0.0188 0.0132  -0.1347 382 PRO A CB    
535  C  CG    . PRO A 64  ? 0.2200 0.4847 0.3234 -0.0142 0.0068  -0.1235 382 PRO A CG    
536  C  CD    . PRO A 64  ? 0.2348 0.5014 0.3160 -0.0046 -0.0017 -0.0952 382 PRO A CD    
537  N  N     . PHE A 65  ? 0.1999 0.4383 0.2563 -0.0045 0.0113  -0.0843 383 PHE A N     
538  C  CA    . PHE A 65  ? 0.1781 0.3894 0.2392 -0.0026 0.0166  -0.0782 383 PHE A CA    
539  C  C     . PHE A 65  ? 0.2050 0.4249 0.2458 -0.0003 0.0158  -0.0596 383 PHE A C     
540  O  O     . PHE A 65  ? 0.2765 0.4908 0.3053 0.0058  0.0098  -0.0382 383 PHE A O     
541  C  CB    . PHE A 65  ? 0.1884 0.3597 0.2597 0.0036  0.0145  -0.0673 383 PHE A CB    
542  C  CG    . PHE A 65  ? 0.1934 0.3546 0.2832 0.0017  0.0169  -0.0814 383 PHE A CG    
543  C  CD1   . PHE A 65  ? 0.2545 0.4070 0.3656 -0.0022 0.0244  -0.0988 383 PHE A CD1   
544  C  CD2   . PHE A 65  ? 0.1924 0.3545 0.2820 0.0037  0.0135  -0.0775 383 PHE A CD2   
545  C  CE1   . PHE A 65  ? 0.2958 0.4371 0.4262 -0.0044 0.0287  -0.1105 383 PHE A CE1   
546  C  CE2   . PHE A 65  ? 0.2267 0.3797 0.3360 0.0007  0.0182  -0.0906 383 PHE A CE2   
547  C  CZ    . PHE A 65  ? 0.2365 0.3779 0.3652 -0.0035 0.0260  -0.1063 383 PHE A CZ    
548  N  N     . GLN A 66  ? 0.2116 0.4436 0.2511 -0.0053 0.0239  -0.0674 384 GLN A N     
549  C  CA    . GLN A 66  ? 0.2108 0.4550 0.2304 -0.0048 0.0260  -0.0503 384 GLN A CA    
550  C  C     . GLN A 66  ? 0.2205 0.4409 0.2521 -0.0040 0.0316  -0.0422 384 GLN A C     
551  O  O     . GLN A 66  ? 0.2399 0.4536 0.2923 -0.0072 0.0382  -0.0579 384 GLN A O     
552  C  CB    . GLN A 66  ? 0.2195 0.5027 0.2227 -0.0122 0.0325  -0.0639 384 GLN A CB    
553  C  CG    . GLN A 66  ? 0.2732 0.5699 0.2520 -0.0115 0.0360  -0.0429 384 GLN A CG    
554  C  CD    . GLN A 66  ? 0.3606 0.6983 0.3152 -0.0187 0.0416  -0.0552 384 GLN A CD    
555  O  OE1   . GLN A 66  ? 0.3451 0.6957 0.3077 -0.0263 0.0493  -0.0839 384 GLN A OE1   
556  N  NE2   . GLN A 66  ? 0.3647 0.7227 0.2891 -0.0163 0.0383  -0.0337 384 GLN A NE2   
557  N  N     . CYS A 67  ? 0.2116 0.4203 0.2336 0.0002  0.0292  -0.0181 385 CYS A N     
558  C  CA    . CYS A 67  ? 0.2148 0.4041 0.2497 -0.0003 0.0337  -0.0101 385 CYS A CA    
559  C  C     . CYS A 67  ? 0.2499 0.4610 0.2860 -0.0071 0.0469  -0.0179 385 CYS A C     
560  O  O     . CYS A 67  ? 0.2480 0.4842 0.2611 -0.0094 0.0521  -0.0118 385 CYS A O     
561  C  CB    . CYS A 67  ? 0.2239 0.3976 0.2487 0.0044  0.0300  0.0159  385 CYS A CB    
562  S  SG    . CYS A 67  ? 0.2397 0.3905 0.2836 0.0018  0.0347  0.0243  385 CYS A SG    
563  N  N     . LYS A 68  ? 0.2189 0.4212 0.2818 -0.0098 0.0527  -0.0304 386 LYS A N     
564  C  CA    . LYS A 68  ? 0.2256 0.4483 0.2947 -0.0163 0.0681  -0.0399 386 LYS A CA    
565  C  C     . LYS A 68  ? 0.2316 0.4525 0.2980 -0.0182 0.0752  -0.0200 386 LYS A C     
566  O  O     . LYS A 68  ? 0.2825 0.5220 0.3511 -0.0242 0.0907  -0.0250 386 LYS A O     
567  C  CB    . LYS A 68  ? 0.2543 0.4699 0.3597 -0.0175 0.0725  -0.0605 386 LYS A CB    
568  C  CG    . LYS A 68  ? 0.3105 0.5326 0.4213 -0.0180 0.0723  -0.0841 386 LYS A CG    
569  C  CD    . LYS A 68  ? 0.3733 0.5829 0.5245 -0.0167 0.0759  -0.1002 386 LYS A CD    
570  C  CE    . LYS A 68  ? 0.3755 0.5910 0.5361 -0.0184 0.0799  -0.1248 386 LYS A CE    
571  N  NZ    . LYS A 68  ? 0.4054 0.6021 0.5598 -0.0139 0.0663  -0.1196 386 LYS A NZ    
572  N  N     . THR A 69  ? 0.2734 0.4728 0.3359 -0.0140 0.0664  0.0014  387 THR A N     
573  C  CA    . THR A 69  ? 0.2862 0.4801 0.3493 -0.0163 0.0737  0.0213  387 THR A CA    
574  C  C     . THR A 69  ? 0.3381 0.5444 0.3677 -0.0146 0.0766  0.0427  387 THR A C     
575  O  O     . THR A 69  ? 0.3142 0.5369 0.3334 -0.0193 0.0909  0.0515  387 THR A O     
576  C  CB    . THR A 69  ? 0.2834 0.4443 0.3669 -0.0137 0.0635  0.0302  387 THR A CB    
577  O  OG1   . THR A 69  ? 0.2898 0.4429 0.4055 -0.0151 0.0605  0.0135  387 THR A OG1   
578  C  CG2   . THR A 69  ? 0.3140 0.4670 0.4007 -0.0170 0.0717  0.0505  387 THR A CG2   
579  N  N     . CYS A 70  ? 0.3213 0.5216 0.3341 -0.0077 0.0641  0.0520  388 CYS A N     
580  C  CA    . CYS A 70  ? 0.3022 0.5128 0.2874 -0.0036 0.0639  0.0757  388 CYS A CA    
581  C  C     . CYS A 70  ? 0.3221 0.5625 0.2819 -0.0012 0.0574  0.0694  388 CYS A C     
582  O  O     . CYS A 70  ? 0.3506 0.6051 0.2867 0.0032  0.0550  0.0897  388 CYS A O     
583  C  CB    . CYS A 70  ? 0.3364 0.5167 0.3275 0.0036  0.0556  0.0952  388 CYS A CB    
584  S  SG    . CYS A 70  ? 0.3056 0.4740 0.2976 0.0115  0.0382  0.0860  388 CYS A SG    
585  N  N     . GLN A 71  ? 0.3220 0.5723 0.2883 -0.0040 0.0538  0.0423  389 GLN A N     
586  C  CA    . GLN A 71  ? 0.2905 0.5718 0.2377 -0.0047 0.0482  0.0293  389 GLN A CA    
587  C  C     . GLN A 71  ? 0.3051 0.5850 0.2462 0.0035  0.0330  0.0398  389 GLN A C     
588  O  O     . GLN A 71  ? 0.3277 0.6369 0.2543 0.0030  0.0261  0.0311  389 GLN A O     
589  C  CB    . GLN A 71  ? 0.3708 0.6881 0.2866 -0.0093 0.0569  0.0338  389 GLN A CB    
590  C  CG    . GLN A 71  ? 0.4215 0.7519 0.3414 -0.0191 0.0737  0.0119  389 GLN A CG    
591  C  CD    . GLN A 71  ? 0.4648 0.7713 0.4083 -0.0211 0.0861  0.0196  389 GLN A CD    
592  O  OE1   . GLN A 71  ? 0.5190 0.8154 0.4919 -0.0248 0.0920  -0.0007 389 GLN A OE1   
593  N  NE2   . GLN A 71  ? 0.4368 0.7349 0.3712 -0.0187 0.0901  0.0492  389 GLN A NE2   
594  N  N     . ARG A 72  ? 0.2966 0.5448 0.2503 0.0104  0.0277  0.0563  390 ARG A N     
595  C  CA    . ARG A 72  ? 0.2683 0.5125 0.2232 0.0182  0.0156  0.0624  390 ARG A CA    
596  C  C     . ARG A 72  ? 0.2475 0.4928 0.2159 0.0154  0.0109  0.0354  390 ARG A C     
597  O  O     . ARG A 72  ? 0.2461 0.4769 0.2302 0.0105  0.0158  0.0178  390 ARG A O     
598  C  CB    . ARG A 72  ? 0.2703 0.4767 0.2377 0.0250  0.0141  0.0807  390 ARG A CB    
599  C  CG    . ARG A 72  ? 0.3030 0.5050 0.2733 0.0340  0.0044  0.0889  390 ARG A CG    
600  C  CD    . ARG A 72  ? 0.3117 0.4793 0.2906 0.0408  0.0059  0.1088  390 ARG A CD    
601  N  NE    . ARG A 72  ? 0.3638 0.5276 0.3487 0.0497  -0.0008 0.1152  390 ARG A NE    
602  C  CZ    . ARG A 72  ? 0.4180 0.5594 0.4100 0.0579  0.0005  0.1343  390 ARG A CZ    
603  N  NH1   . ARG A 72  ? 0.4352 0.5542 0.4290 0.0574  0.0080  0.1489  390 ARG A NH1   
604  N  NH2   . ARG A 72  ? 0.3781 0.5195 0.3787 0.0662  -0.0042 0.1380  390 ARG A NH2   
605  N  N     . LYS A 73  ? 0.2487 0.5126 0.2137 0.0185  0.0017  0.0329  391 LYS A N     
606  C  CA    . LYS A 73  ? 0.2015 0.4680 0.1813 0.0151  -0.0014 0.0082  391 LYS A CA    
607  C  C     . LYS A 73  ? 0.2310 0.4717 0.2255 0.0221  -0.0066 0.0147  391 LYS A C     
608  O  O     . LYS A 73  ? 0.2499 0.4851 0.2411 0.0303  -0.0108 0.0361  391 LYS A O     
609  C  CB    . LYS A 73  ? 0.2231 0.5333 0.1924 0.0110  -0.0072 -0.0048 391 LYS A CB    
610  C  CG    . LYS A 73  ? 0.2442 0.5808 0.1951 0.0031  -0.0002 -0.0147 391 LYS A CG    
611  C  CD    . LYS A 73  ? 0.2962 0.6801 0.2290 -0.0005 -0.0085 -0.0240 391 LYS A CD    
612  C  CE    . LYS A 73  ? 0.4316 0.8433 0.3362 -0.0074 -0.0009 -0.0280 391 LYS A CE    
613  N  NZ    . LYS A 73  ? 0.4436 0.8967 0.3309 -0.0104 -0.0108 -0.0334 391 LYS A NZ    
614  N  N     . PHE A 74  ? 0.1799 0.4043 0.1915 0.0190  -0.0047 -0.0038 392 PHE A N     
615  C  CA    . PHE A 74  ? 0.1712 0.3663 0.1946 0.0245  -0.0063 0.0010  392 PHE A CA    
616  C  C     . PHE A 74  ? 0.1703 0.3728 0.2090 0.0209  -0.0066 -0.0184 392 PHE A C     
617  O  O     . PHE A 74  ? 0.1785 0.3932 0.2245 0.0132  -0.0033 -0.0393 392 PHE A O     
618  C  CB    . PHE A 74  ? 0.1839 0.3385 0.2119 0.0251  -0.0020 0.0035  392 PHE A CB    
619  C  CG    . PHE A 74  ? 0.1932 0.3373 0.2118 0.0275  -0.0010 0.0213  392 PHE A CG    
620  C  CD1   . PHE A 74  ? 0.2035 0.3266 0.2190 0.0344  -0.0024 0.0395  392 PHE A CD1   
621  C  CD2   . PHE A 74  ? 0.2122 0.3684 0.2270 0.0224  0.0032  0.0195  392 PHE A CD2   
622  C  CE1   . PHE A 74  ? 0.2614 0.3743 0.2718 0.0355  0.0000  0.0555  392 PHE A CE1   
623  C  CE2   . PHE A 74  ? 0.2303 0.3776 0.2396 0.0235  0.0060  0.0366  392 PHE A CE2   
624  C  CZ    . PHE A 74  ? 0.2345 0.3593 0.2425 0.0298  0.0041  0.0543  392 PHE A CZ    
625  N  N     . SER A 75  ? 0.1685 0.3612 0.2150 0.0263  -0.0085 -0.0116 393 SER A N     
626  C  CA    . SER A 75  ? 0.1581 0.3562 0.2229 0.0226  -0.0069 -0.0284 393 SER A CA    
627  C  C     . SER A 75  ? 0.1806 0.3465 0.2559 0.0189  0.0011  -0.0402 393 SER A C     
628  O  O     . SER A 75  ? 0.1920 0.3646 0.2842 0.0127  0.0050  -0.0585 393 SER A O     
629  C  CB    . SER A 75  ? 0.1685 0.3650 0.2417 0.0299  -0.0090 -0.0169 393 SER A CB    
630  O  OG    . SER A 75  ? 0.1930 0.3484 0.2618 0.0359  -0.0038 -0.0040 393 SER A OG    
631  N  N     . ARG A 76  ? 0.1636 0.2960 0.2305 0.0220  0.0034  -0.0304 394 ARG A N     
632  C  CA    . ARG A 76  ? 0.1618 0.2620 0.2362 0.0209  0.0088  -0.0360 394 ARG A CA    
633  C  C     . ARG A 76  ? 0.2071 0.2928 0.2772 0.0203  0.0083  -0.0346 394 ARG A C     
634  O  O     . ARG A 76  ? 0.1838 0.2685 0.2418 0.0227  0.0047  -0.0227 394 ARG A O     
635  C  CB    . ARG A 76  ? 0.1450 0.2148 0.2137 0.0268  0.0108  -0.0237 394 ARG A CB    
636  C  CG    . ARG A 76  ? 0.1605 0.2408 0.2426 0.0265  0.0148  -0.0286 394 ARG A CG    
637  C  CD    . ARG A 76  ? 0.2019 0.2575 0.2774 0.0330  0.0187  -0.0158 394 ARG A CD    
638  N  NE    . ARG A 76  ? 0.1948 0.2108 0.2560 0.0347  0.0219  -0.0103 394 ARG A NE    
639  C  CZ    . ARG A 76  ? 0.1853 0.1751 0.2387 0.0381  0.0286  -0.0041 394 ARG A CZ    
640  N  NH1   . ARG A 76  ? 0.1682 0.1677 0.2328 0.0402  0.0346  -0.0036 394 ARG A NH1   
641  N  NH2   . ARG A 76  ? 0.2088 0.1650 0.2438 0.0395  0.0293  0.0012  394 ARG A NH2   
642  N  N     . SER A 77  ? 0.1585 0.2313 0.2421 0.0174  0.0124  -0.0458 395 SER A N     
643  C  CA    . SER A 77  ? 0.1639 0.2265 0.2507 0.0173  0.0114  -0.0457 395 SER A CA    
644  C  C     . SER A 77  ? 0.1819 0.2145 0.2565 0.0226  0.0059  -0.0297 395 SER A C     
645  O  O     . SER A 77  ? 0.2046 0.2361 0.2790 0.0226  0.0025  -0.0258 395 SER A O     
646  C  CB    . SER A 77  ? 0.1889 0.2453 0.2983 0.0144  0.0174  -0.0607 395 SER A CB    
647  O  OG    . SER A 77  ? 0.2110 0.2377 0.3229 0.0176  0.0189  -0.0555 395 SER A OG    
648  N  N     . ASP A 78  ? 0.1904 0.1994 0.2554 0.0263  0.0057  -0.0219 396 ASP A N     
649  C  CA    . ASP A 78  ? 0.2080 0.1894 0.2579 0.0302  0.0000  -0.0096 396 ASP A CA    
650  C  C     . ASP A 78  ? 0.2320 0.2192 0.2701 0.0313  -0.0031 -0.0001 396 ASP A C     
651  O  O     . ASP A 78  ? 0.2137 0.1893 0.2469 0.0315  -0.0085 0.0057  396 ASP A O     
652  C  CB    . ASP A 78  ? 0.2232 0.1778 0.2620 0.0332  0.0029  -0.0049 396 ASP A CB    
653  C  CG    . ASP A 78  ? 0.2814 0.2437 0.3180 0.0340  0.0096  -0.0045 396 ASP A CG    
654  O  OD1   . ASP A 78  ? 0.2650 0.2559 0.3137 0.0316  0.0116  -0.0110 396 ASP A OD1   
655  O  OD2   . ASP A 78  ? 0.2933 0.2334 0.3158 0.0370  0.0126  0.0022  396 ASP A OD2   
656  N  N     . HIS A 79  ? 0.1825 0.1890 0.2191 0.0319  -0.0002 0.0018  397 HIS A N     
657  C  CA    . HIS A 79  ? 0.1819 0.1934 0.2102 0.0340  -0.0019 0.0135  397 HIS A CA    
658  C  C     . HIS A 79  ? 0.1878 0.2198 0.2204 0.0304  -0.0029 0.0135  397 HIS A C     
659  O  O     . HIS A 79  ? 0.2061 0.2324 0.2343 0.0308  -0.0039 0.0238  397 HIS A O     
660  C  CB    . HIS A 79  ? 0.1898 0.2166 0.2176 0.0375  0.0005  0.0181  397 HIS A CB    
661  C  CG    . HIS A 79  ? 0.1694 0.1748 0.1941 0.0413  0.0042  0.0197  397 HIS A CG    
662  N  ND1   . HIS A 79  ? 0.2020 0.1733 0.2157 0.0423  0.0049  0.0213  397 HIS A ND1   
663  C  CD2   . HIS A 79  ? 0.1995 0.2147 0.2309 0.0442  0.0081  0.0196  397 HIS A CD2   
664  C  CE1   . HIS A 79  ? 0.2198 0.1791 0.2308 0.0455  0.0112  0.0222  397 HIS A CE1   
665  N  NE2   . HIS A 79  ? 0.1890 0.1747 0.2136 0.0468  0.0136  0.0213  397 HIS A NE2   
666  N  N     . LEU A 80  ? 0.1758 0.2310 0.2181 0.0261  -0.0006 0.0013  398 LEU A N     
667  C  CA    . LEU A 80  ? 0.1845 0.2555 0.2312 0.0221  0.0010  -0.0005 398 LEU A CA    
668  C  C     . LEU A 80  ? 0.1788 0.2275 0.2327 0.0215  -0.0018 0.0012  398 LEU A C     
669  O  O     . LEU A 80  ? 0.1758 0.2255 0.2303 0.0199  -0.0015 0.0086  398 LEU A O     
670  C  CB    . LEU A 80  ? 0.1524 0.2492 0.2094 0.0170  0.0058  -0.0181 398 LEU A CB    
671  C  CG    . LEU A 80  ? 0.1768 0.2856 0.2421 0.0126  0.0104  -0.0231 398 LEU A CG    
672  C  CD1   . LEU A 80  ? 0.2036 0.3274 0.2553 0.0118  0.0124  -0.0097 398 LEU A CD1   
673  C  CD2   . LEU A 80  ? 0.2119 0.3427 0.2891 0.0074  0.0171  -0.0444 398 LEU A CD2   
674  N  N     . LYS A 81  ? 0.1623 0.1916 0.2231 0.0228  -0.0049 -0.0048 399 LYS A N     
675  C  CA    . LYS A 81  ? 0.1814 0.1938 0.2508 0.0227  -0.0107 -0.0033 399 LYS A CA    
676  C  C     . LYS A 81  ? 0.1963 0.1918 0.2542 0.0233  -0.0157 0.0086  399 LYS A C     
677  O  O     . LYS A 81  ? 0.2210 0.2181 0.2886 0.0203  -0.0177 0.0106  399 LYS A O     
678  C  CB    . LYS A 81  ? 0.1810 0.1740 0.2553 0.0257  -0.0146 -0.0075 399 LYS A CB    
679  C  CG    . LYS A 81  ? 0.2420 0.2205 0.3256 0.0267  -0.0240 -0.0048 399 LYS A CG    
680  C  CD    . LYS A 81  ? 0.3047 0.2633 0.3887 0.0311  -0.0283 -0.0047 399 LYS A CD    
681  C  CE    . LYS A 81  ? 0.4814 0.4508 0.5868 0.0312  -0.0200 -0.0150 399 LYS A CE    
682  N  NZ    . LYS A 81  ? 0.5501 0.4968 0.6549 0.0359  -0.0217 -0.0115 399 LYS A NZ    
683  N  N     . THR A 82  ? 0.1986 0.1766 0.2390 0.0266  -0.0167 0.0149  400 THR A N     
684  C  CA    . THR A 82  ? 0.2016 0.1613 0.2332 0.0264  -0.0200 0.0231  400 THR A CA    
685  C  C     . THR A 82  ? 0.2487 0.2231 0.2840 0.0245  -0.0144 0.0313  400 THR A C     
686  O  O     . THR A 82  ? 0.2408 0.2058 0.2806 0.0215  -0.0158 0.0357  400 THR A O     
687  C  CB    . THR A 82  ? 0.2373 0.1742 0.2503 0.0305  -0.0195 0.0263  400 THR A CB    
688  O  OG1   . THR A 82  ? 0.2332 0.1828 0.2435 0.0338  -0.0122 0.0292  400 THR A OG1   
689  C  CG2   . THR A 82  ? 0.2609 0.1807 0.2667 0.0318  -0.0244 0.0211  400 THR A CG2   
690  N  N     . HIS A 83  ? 0.2110 0.2085 0.2447 0.0259  -0.0083 0.0338  401 HIS A N     
691  C  CA    . HIS A 83  ? 0.2132 0.2269 0.2482 0.0244  -0.0028 0.0443  401 HIS A CA    
692  C  C     . HIS A 83  ? 0.2270 0.2485 0.2762 0.0182  -0.0010 0.0415  401 HIS A C     
693  O  O     . HIS A 83  ? 0.2381 0.2568 0.2914 0.0156  0.0029  0.0514  401 HIS A O     
694  C  CB    . HIS A 83  ? 0.2055 0.2490 0.2346 0.0262  0.0011  0.0456  401 HIS A CB    
695  C  CG    . HIS A 83  ? 0.2322 0.2978 0.2601 0.0235  0.0071  0.0546  401 HIS A CG    
696  N  ND1   . HIS A 83  ? 0.2241 0.2871 0.2465 0.0265  0.0103  0.0736  401 HIS A ND1   
697  C  CD2   . HIS A 83  ? 0.2451 0.3340 0.2767 0.0181  0.0121  0.0479  401 HIS A CD2   
698  C  CE1   . HIS A 83  ? 0.2546 0.3387 0.2747 0.0229  0.0168  0.0801  401 HIS A CE1   
699  N  NE2   . HIS A 83  ? 0.1901 0.2908 0.2146 0.0174  0.0185  0.0637  401 HIS A NE2   
700  N  N     . THR A 84  ? 0.2138 0.2454 0.2746 0.0157  -0.0021 0.0282  402 THR A N     
701  C  CA    . THR A 84  ? 0.2258 0.2695 0.3048 0.0101  0.0020  0.0249  402 THR A CA    
702  C  C     . THR A 84  ? 0.2736 0.2970 0.3651 0.0074  -0.0040 0.0277  402 THR A C     
703  O  O     . THR A 84  ? 0.2577 0.2895 0.3660 0.0020  0.0009  0.0291  402 THR A O     
704  C  CB    . THR A 84  ? 0.2389 0.2975 0.3330 0.0089  0.0035  0.0090  402 THR A CB    
705  O  OG1   . THR A 84  ? 0.2455 0.2847 0.3478 0.0118  -0.0063 0.0029  402 THR A OG1   
706  C  CG2   . THR A 84  ? 0.2040 0.2839 0.2866 0.0096  0.0093  0.0026  402 THR A CG2   
707  N  N     . ARG A 85  ? 0.2749 0.2728 0.3581 0.0101  -0.0136 0.0279  403 ARG A N     
708  C  CA    . ARG A 85  ? 0.3142 0.2943 0.4068 0.0063  -0.0207 0.0284  403 ARG A CA    
709  C  C     . ARG A 85  ? 0.3510 0.3267 0.4451 0.0026  -0.0130 0.0392  403 ARG A C     
710  O  O     . ARG A 85  ? 0.3960 0.3643 0.5069 -0.0035 -0.0155 0.0381  403 ARG A O     
711  C  CB    . ARG A 85  ? 0.2869 0.2410 0.3638 0.0095  -0.0318 0.0254  403 ARG A CB    
712  C  CG    . ARG A 85  ? 0.2786 0.2339 0.3543 0.0136  -0.0384 0.0181  403 ARG A CG    
713  C  CD    . ARG A 85  ? 0.2996 0.2289 0.3565 0.0163  -0.0494 0.0167  403 ARG A CD    
714  N  NE    . ARG A 85  ? 0.2862 0.2168 0.3451 0.0207  -0.0540 0.0130  403 ARG A NE    
715  C  CZ    . ARG A 85  ? 0.3354 0.2481 0.3736 0.0251  -0.0574 0.0140  403 ARG A CZ    
716  N  NH1   . ARG A 85  ? 0.3568 0.2495 0.3689 0.0256  -0.0562 0.0166  403 ARG A NH1   
717  N  NH2   . ARG A 85  ? 0.3474 0.2615 0.3925 0.0290  -0.0595 0.0125  403 ARG A NH2   
718  N  N     . THR A 86  ? 0.3029 0.2834 0.3826 0.0061  -0.0040 0.0502  404 THR A N     
719  C  CA    . THR A 86  ? 0.3375 0.3138 0.4211 0.0036  0.0052  0.0641  404 THR A CA    
720  C  C     . THR A 86  ? 0.3727 0.3687 0.4746 -0.0032 0.0143  0.0669  404 THR A C     
721  O  O     . THR A 86  ? 0.4713 0.4600 0.5837 -0.0077 0.0222  0.0772  404 THR A O     
722  C  CB    . THR A 86  ? 0.3637 0.3441 0.4295 0.0108  0.0116  0.0782  404 THR A CB    
723  O  OG1   . THR A 86  ? 0.3940 0.4052 0.4526 0.0124  0.0156  0.0790  404 THR A OG1   
724  C  CG2   . THR A 86  ? 0.3946 0.3572 0.4463 0.0173  0.0054  0.0748  404 THR A CG2   
725  N  N     . HIS A 87  ? 0.2960 0.3158 0.4037 -0.0044 0.0157  0.0578  405 HIS A N     
726  C  CA    . HIS A 87  ? 0.3159 0.3544 0.4439 -0.0115 0.0261  0.0575  405 HIS A CA    
727  C  C     . HIS A 87  ? 0.3571 0.3911 0.5155 -0.0169 0.0189  0.0452  405 HIS A C     
728  O  O     . HIS A 87  ? 0.3870 0.4232 0.5687 -0.0243 0.0257  0.0478  405 HIS A O     
729  C  CB    . HIS A 87  ? 0.3183 0.3868 0.4397 -0.0107 0.0341  0.0518  405 HIS A CB    
730  C  CG    . HIS A 87  ? 0.3263 0.4059 0.4178 -0.0054 0.0374  0.0610  405 HIS A CG    
731  N  ND1   . HIS A 87  ? 0.3485 0.4285 0.4261 -0.0042 0.0450  0.0812  405 HIS A ND1   
732  C  CD2   . HIS A 87  ? 0.3025 0.3946 0.3782 -0.0009 0.0335  0.0529  405 HIS A CD2   
733  C  CE1   . HIS A 87  ? 0.3481 0.4428 0.4018 0.0015  0.0436  0.0856  405 HIS A CE1   
734  N  NE2   . HIS A 87  ? 0.3528 0.4555 0.4056 0.0028  0.0367  0.0672  405 HIS A NE2   
735  N  N     . THR A 88  ? 0.3406 0.3698 0.5011 -0.0132 0.0053  0.0326  406 THR A N     
736  C  CA    . THR A 88  ? 0.3780 0.4086 0.5692 -0.0166 -0.0040 0.0218  406 THR A CA    
737  C  C     . THR A 88  ? 0.3810 0.3897 0.5794 -0.0208 -0.0155 0.0220  406 THR A C     
738  O  O     . THR A 88  ? 0.4215 0.4351 0.6508 -0.0262 -0.0219 0.0152  406 THR A O     
739  C  CB    . THR A 88  ? 0.3468 0.3792 0.5385 -0.0102 -0.0149 0.0112  406 THR A CB    
740  O  OG1   . THR A 88  ? 0.3716 0.3814 0.5358 -0.0047 -0.0259 0.0130  406 THR A OG1   
741  C  CG2   . THR A 88  ? 0.2468 0.3004 0.4353 -0.0075 -0.0031 0.0065  406 THR A CG2   
742  N  N     . GLY A 89  ? 0.3650 0.7026 0.6120 0.0967  -0.0490 -0.2051 407 GLY A N     
743  C  CA    . GLY A 89  ? 0.3816 0.7195 0.6318 0.0856  -0.0561 -0.2003 407 GLY A CA    
744  C  C     . GLY A 89  ? 0.4324 0.7297 0.6586 0.1060  -0.0810 -0.2008 407 GLY A C     
745  O  O     . GLY A 89  ? 0.4563 0.7575 0.6840 0.0995  -0.0900 -0.1998 407 GLY A O     
746  N  N     . GLU A 90  ? 0.4588 0.7152 0.6607 0.1300  -0.0923 -0.2022 408 GLU A N     
747  C  CA    . GLU A 90  ? 0.4921 0.7020 0.6652 0.1493  -0.1150 -0.1991 408 GLU A CA    
748  C  C     . GLU A 90  ? 0.4515 0.6096 0.5922 0.1282  -0.1121 -0.1787 408 GLU A C     
749  O  O     . GLU A 90  ? 0.4400 0.5685 0.5650 0.1089  -0.0955 -0.1647 408 GLU A O     
750  C  CB    . GLU A 90  ? 0.5525 0.7191 0.7020 0.1764  -0.1246 -0.2026 408 GLU A CB    
751  C  CG    . GLU A 90  ? 0.7168 0.9134 0.8842 0.2132  -0.1430 -0.2222 408 GLU A CG    
752  C  CD    . GLU A 90  ? 0.8706 1.0546 1.0263 0.2316  -0.1679 -0.2207 408 GLU A CD    
753  O  OE1   . GLU A 90  ? 0.9415 1.0569 1.0545 0.2345  -0.1771 -0.2060 408 GLU A OE1   
754  O  OE2   . GLU A 90  ? 0.9145 1.1591 1.1031 0.2427  -0.1784 -0.2339 408 GLU A OE2   
755  N  N     . LYS A 91  ? 0.4348 0.5852 0.5655 0.1326  -0.1283 -0.1777 409 LYS A N     
756  C  CA    . LYS A 91  ? 0.4541 0.5604 0.5542 0.1139  -0.1259 -0.1610 409 LYS A CA    
757  C  C     . LYS A 91  ? 0.4459 0.5185 0.5164 0.1353  -0.1509 -0.1597 409 LYS A C     
758  O  O     . LYS A 91  ? 0.4726 0.5689 0.5489 0.1358  -0.1638 -0.1657 409 LYS A O     
759  C  CB    . LYS A 91  ? 0.4609 0.6049 0.5834 0.0866  -0.1140 -0.1620 409 LYS A CB    
760  C  CG    . LYS A 91  ? 0.4903 0.6557 0.6334 0.0630  -0.0873 -0.1573 409 LYS A CG    
761  C  CD    . LYS A 91  ? 0.5141 0.7053 0.6737 0.0366  -0.0762 -0.1571 409 LYS A CD    
762  C  CE    . LYS A 91  ? 0.5116 0.7286 0.6939 0.0153  -0.0502 -0.1523 409 LYS A CE    
763  N  NZ    . LYS A 91  ? 0.5462 0.7718 0.7368 -0.0119 -0.0376 -0.1491 409 LYS A NZ    
764  N  N     . PRO A 92  ? 0.4428 0.4589 0.4796 0.1527  -0.1586 -0.1518 410 PRO A N     
765  C  CA    . PRO A 92  ? 0.5482 0.5311 0.5554 0.1785  -0.1838 -0.1500 410 PRO A CA    
766  C  C     . PRO A 92  ? 0.5849 0.5256 0.5536 0.1665  -0.1877 -0.1348 410 PRO A C     
767  O  O     . PRO A 92  ? 0.6289 0.5396 0.5679 0.1869  -0.2085 -0.1310 410 PRO A O     
768  C  CB    . PRO A 92  ? 0.5741 0.5044 0.5568 0.1972  -0.1861 -0.1457 410 PRO A CB    
769  C  CG    . PRO A 92  ? 0.5320 0.4704 0.5309 0.1786  -0.1627 -0.1460 410 PRO A CG    
770  C  CD    . PRO A 92  ? 0.4598 0.4386 0.4825 0.1479  -0.1445 -0.1436 410 PRO A CD    
771  N  N     . PHE A 93  ? 0.5310 0.4676 0.4974 0.1358  -0.1684 -0.1257 411 PHE A N     
772  C  CA    . PHE A 93  ? 0.5295 0.4226 0.4566 0.1238  -0.1685 -0.1114 411 PHE A CA    
773  C  C     . PHE A 93  ? 0.5287 0.4629 0.4729 0.1074  -0.1684 -0.1200 411 PHE A C     
774  O  O     . PHE A 93  ? 0.5596 0.5206 0.5290 0.0836  -0.1485 -0.1219 411 PHE A O     
775  C  CB    . PHE A 93  ? 0.5075 0.3558 0.4140 0.1034  -0.1455 -0.0935 411 PHE A CB    
776  C  CG    . PHE A 93  ? 0.5544 0.3603 0.4425 0.1156  -0.1461 -0.0861 411 PHE A CG    
777  C  CD1   . PHE A 93  ? 0.5043 0.3291 0.4184 0.1139  -0.1351 -0.0917 411 PHE A CD1   
778  C  CD2   . PHE A 93  ? 0.6774 0.4231 0.5202 0.1275  -0.1575 -0.0738 411 PHE A CD2   
779  C  CE1   . PHE A 93  ? 0.6182 0.4020 0.5141 0.1230  -0.1360 -0.0873 411 PHE A CE1   
780  C  CE2   . PHE A 93  ? 0.7273 0.4294 0.5520 0.1363  -0.1576 -0.0677 411 PHE A CE2   
781  C  CZ    . PHE A 93  ? 0.7088 0.4298 0.5606 0.1334  -0.1470 -0.0755 411 PHE A CZ    
782  N  N     . SER A 94  ? 0.5405 0.4787 0.4697 0.1201  -0.1911 -0.1253 412 SER A N     
783  C  CA    . SER A 94  ? 0.6198 0.5958 0.5614 0.1056  -0.1959 -0.1363 412 SER A CA    
784  C  C     . SER A 94  ? 0.6577 0.5851 0.5520 0.0929  -0.1942 -0.1244 412 SER A C     
785  O  O     . SER A 94  ? 0.6747 0.5487 0.5245 0.1061  -0.2021 -0.1106 412 SER A O     
786  C  CB    . SER A 94  ? 0.6487 0.6731 0.6090 0.1286  -0.2246 -0.1530 412 SER A CB    
787  O  OG    . SER A 94  ? 0.6573 0.7424 0.6700 0.1336  -0.2219 -0.1679 412 SER A OG    
788  N  N     . CYS A 95  ? 0.6370 0.5817 0.5398 0.0669  -0.1828 -0.1302 413 CYS A N     
789  C  CA    . CYS A 95  ? 0.6715 0.5702 0.5304 0.0524  -0.1759 -0.1205 413 CYS A CA    
790  C  C     . CYS A 95  ? 0.8423 0.7274 0.6629 0.0679  -0.2034 -0.1226 413 CYS A C     
791  O  O     . CYS A 95  ? 0.9149 0.7445 0.6854 0.0717  -0.2033 -0.1075 413 CYS A O     
792  C  CB    . CYS A 95  ? 0.5929 0.5120 0.4711 0.0220  -0.1570 -0.1285 413 CYS A CB    
793  S  SG    . CYS A 95  ? 0.6835 0.5525 0.5084 0.0068  -0.1510 -0.1225 413 CYS A SG    
794  N  N     . ARG A 96  ? 0.8177 0.7551 0.6606 0.0763  -0.2267 -0.1408 414 ARG A N     
795  C  CA    . ARG A 96  ? 0.9212 0.8601 0.7337 0.0919  -0.2566 -0.1456 414 ARG A CA    
796  C  C     . ARG A 96  ? 1.0046 0.9296 0.7865 0.0689  -0.2539 -0.1500 414 ARG A C     
797  O  O     . ARG A 96  ? 1.0610 0.9892 0.8144 0.0788  -0.2789 -0.1551 414 ARG A O     
798  C  CB    . ARG A 96  ? 0.9661 0.8523 0.7320 0.1211  -0.2713 -0.1278 414 ARG A CB    
799  N  N     . TRP A 97  ? 1.0016 0.9105 0.7867 0.0399  -0.2250 -0.1485 415 TRP A N     
800  C  CA    . TRP A 97  ? 1.0355 0.9377 0.7989 0.0166  -0.2214 -0.1581 415 TRP A CA    
801  C  C     . TRP A 97  ? 1.0624 1.0320 0.8612 0.0088  -0.2410 -0.1836 415 TRP A C     
802  O  O     . TRP A 97  ? 1.0410 1.0645 0.8934 0.0102  -0.2429 -0.1933 415 TRP A O     
803  C  CB    . TRP A 97  ? 1.0195 0.8963 0.7884 -0.0107 -0.1853 -0.1527 415 TRP A CB    
804  C  CG    . TRP A 97  ? 1.0710 0.9165 0.8027 -0.0311 -0.1757 -0.1572 415 TRP A CG    
805  C  CD1   . TRP A 97  ? 1.0620 0.9275 0.8091 -0.0573 -0.1684 -0.1755 415 TRP A CD1   
806  C  CD2   . TRP A 97  ? 1.1111 0.8976 0.7823 -0.0275 -0.1708 -0.1438 415 TRP A CD2   
807  N  NE1   . TRP A 97  ? 1.0939 0.9144 0.7926 -0.0690 -0.1597 -0.1757 415 TRP A NE1   
808  C  CE2   . TRP A 97  ? 1.1384 0.9123 0.7903 -0.0506 -0.1607 -0.1562 415 TRP A CE2   
809  C  CE3   . TRP A 97  ? 1.1156 0.8576 0.7461 -0.0081 -0.1731 -0.1228 415 TRP A CE3   
810  C  CZ2   . TRP A 97  ? 1.1549 0.8761 0.7483 -0.0530 -0.1524 -0.1489 415 TRP A CZ2   
811  C  CZ3   . TRP A 97  ? 1.1557 0.8472 0.7294 -0.0121 -0.1645 -0.1140 415 TRP A CZ3   
812  C  CH2   . TRP A 97  ? 1.1728 0.8555 0.7283 -0.0334 -0.1541 -0.1274 415 TRP A CH2   
813  N  N     . PRO A 98  ? 1.1589 1.1295 0.9283 -0.0001 -0.2562 -0.1955 416 PRO A N     
814  C  CA    . PRO A 98  ? 1.1807 1.2195 0.9841 -0.0094 -0.2763 -0.2198 416 PRO A CA    
815  C  C     . PRO A 98  ? 1.1199 1.2058 0.9838 -0.0350 -0.2592 -0.2346 416 PRO A C     
816  O  O     . PRO A 98  ? 1.0786 1.2254 0.9930 -0.0279 -0.2668 -0.2405 416 PRO A O     
817  C  CB    . PRO A 98  ? 1.2395 1.2544 0.9974 -0.0265 -0.2786 -0.2251 416 PRO A CB    
818  C  CG    . PRO A 98  ? 1.2658 1.2142 0.9606 -0.0067 -0.2801 -0.2047 416 PRO A CG    
819  C  CD    . PRO A 98  ? 1.2211 1.1333 0.9230 0.0005  -0.2575 -0.1862 416 PRO A CD    
820  N  N     . SER A 99  ? 1.1047 1.1598 0.9647 -0.0644 -0.2297 -0.2346 417 SER A N     
821  C  CA    . SER A 99  ? 1.0662 1.1600 0.9791 -0.0911 -0.2112 -0.2465 417 SER A CA    
822  C  C     . SER A 99  ? 1.0605 1.1617 1.0097 -0.0825 -0.1917 -0.2324 417 SER A C     
823  O  O     . SER A 99  ? 1.0408 1.1972 1.0427 -0.0914 -0.1880 -0.2424 417 SER A O     
824  C  CB    . SER A 99  ? 1.0372 1.0902 0.9300 -0.1243 -0.1861 -0.2506 417 SER A CB    
825  N  N     . CYS A 100 ? 1.0550 1.1040 0.9765 -0.0662 -0.1795 -0.2099 418 CYS A N     
826  C  CA    . CYS A 100 ? 0.9284 0.9767 0.8775 -0.0618 -0.1583 -0.1961 418 CYS A CA    
827  C  C     . CYS A 100 ? 0.8850 0.9808 0.8672 -0.0361 -0.1766 -0.1993 418 CYS A C     
828  O  O     . CYS A 100 ? 0.9720 1.0626 0.9332 -0.0090 -0.2010 -0.1969 418 CYS A O     
829  C  CB    . CYS A 100 ? 0.8465 0.8266 0.7546 -0.0539 -0.1414 -0.1725 418 CYS A CB    
830  S  SG    . CYS A 100 ? 0.7549 0.7281 0.6911 -0.0584 -0.1101 -0.1561 418 CYS A SG    
831  N  N     . GLN A 101 ? 0.7181 0.8581 0.7501 -0.0435 -0.1640 -0.2041 419 GLN A N     
832  C  CA    . GLN A 101 ? 0.7065 0.8930 0.7727 -0.0193 -0.1770 -0.2084 419 GLN A CA    
833  C  C     . GLN A 101 ? 0.6683 0.8436 0.7495 -0.0160 -0.1538 -0.1949 419 GLN A C     
834  O  O     . GLN A 101 ? 0.6805 0.9031 0.8008 -0.0063 -0.1545 -0.2016 419 GLN A O     
835  C  CB    . GLN A 101 ? 0.7365 1.0032 0.8533 -0.0285 -0.1877 -0.2312 419 GLN A CB    
836  N  N     . LYS A 102 ? 0.6577 0.7737 0.7082 -0.0237 -0.1333 -0.1764 420 LYS A N     
837  C  CA    . LYS A 102 ? 0.5956 0.7011 0.6577 -0.0227 -0.1118 -0.1631 420 LYS A CA    
838  C  C     . LYS A 102 ? 0.5678 0.6527 0.6141 0.0074  -0.1243 -0.1550 420 LYS A C     
839  O  O     . LYS A 102 ? 0.5696 0.6187 0.5789 0.0234  -0.1413 -0.1501 420 LYS A O     
840  C  CB    . LYS A 102 ? 0.5854 0.6408 0.6238 -0.0424 -0.0854 -0.1466 420 LYS A CB    
841  N  N     . LYS A 103 ? 0.4912 0.5970 0.5637 0.0146  -0.1154 -0.1540 421 LYS A N     
842  C  CA    . LYS A 103 ? 0.5119 0.5974 0.5726 0.0406  -0.1240 -0.1483 421 LYS A CA    
843  C  C     . LYS A 103 ? 0.4215 0.4830 0.4801 0.0316  -0.1001 -0.1338 421 LYS A C     
844  O  O     . LYS A 103 ? 0.3837 0.4612 0.4611 0.0097  -0.0785 -0.1307 421 LYS A O     
845  C  CB    . LYS A 103 ? 0.5092 0.6495 0.6048 0.0623  -0.1396 -0.1654 421 LYS A CB    
846  N  N     . PHE A 104 ? 0.4351 0.4574 0.4698 0.0479  -0.1042 -0.1244 422 PHE A N     
847  C  CA    . PHE A 104 ? 0.4172 0.4142 0.4454 0.0384  -0.0839 -0.1100 422 PHE A CA    
848  C  C     . PHE A 104 ? 0.4235 0.4128 0.4508 0.0583  -0.0907 -0.1122 422 PHE A C     
849  O  O     . PHE A 104 ? 0.4367 0.4114 0.4503 0.0816  -0.1111 -0.1177 422 PHE A O     
850  C  CB    . PHE A 104 ? 0.4123 0.3517 0.4010 0.0280  -0.0756 -0.0913 422 PHE A CB    
851  C  CG    . PHE A 104 ? 0.4088 0.3478 0.3935 0.0088  -0.0667 -0.0896 422 PHE A CG    
852  C  CD1   . PHE A 104 ? 0.4087 0.3563 0.4081 -0.0126 -0.0424 -0.0826 422 PHE A CD1   
853  C  CD2   . PHE A 104 ? 0.4111 0.3403 0.3759 0.0129  -0.0830 -0.0956 422 PHE A CD2   
854  C  CE1   . PHE A 104 ? 0.3820 0.3242 0.3764 -0.0296 -0.0332 -0.0824 422 PHE A CE1   
855  C  CE2   . PHE A 104 ? 0.4473 0.3739 0.4063 -0.0057 -0.0747 -0.0967 422 PHE A CE2   
856  C  CZ    . PHE A 104 ? 0.4173 0.3480 0.3910 -0.0270 -0.0492 -0.0905 422 PHE A CZ    
857  N  N     . ALA A 105 ? 0.3687 0.3640 0.4075 0.0491  -0.0732 -0.1071 423 ALA A N     
858  C  CA    . ALA A 105 ? 0.3795 0.3663 0.4164 0.0650  -0.0777 -0.1111 423 ALA A CA    
859  C  C     . ALA A 105 ? 0.4053 0.3265 0.4011 0.0709  -0.0834 -0.0983 423 ALA A C     
860  O  O     . ALA A 105 ? 0.4557 0.3576 0.4417 0.0892  -0.0943 -0.1041 423 ALA A O     
861  C  CB    . ALA A 105 ? 0.3515 0.3678 0.4112 0.0518  -0.0579 -0.1104 423 ALA A CB    
862  N  N     . ARG A 106 ? 0.3853 0.2705 0.3564 0.0553  -0.0749 -0.0813 424 ARG A N     
863  C  CA    . ARG A 106 ? 0.4539 0.2798 0.3876 0.0560  -0.0763 -0.0673 424 ARG A CA    
864  C  C     . ARG A 106 ? 0.4841 0.2743 0.3858 0.0546  -0.0820 -0.0570 424 ARG A C     
865  O  O     . ARG A 106 ? 0.4375 0.2454 0.3453 0.0442  -0.0768 -0.0568 424 ARG A O     
866  C  CB    . ARG A 106 ? 0.4424 0.2603 0.3764 0.0359  -0.0558 -0.0540 424 ARG A CB    
867  C  CG    . ARG A 106 ? 0.3871 0.2390 0.3475 0.0361  -0.0501 -0.0635 424 ARG A CG    
868  C  CD    . ARG A 106 ? 0.3618 0.2069 0.3204 0.0182  -0.0336 -0.0510 424 ARG A CD    
869  N  NE    . ARG A 106 ? 0.3645 0.1916 0.3106 0.0008  -0.0199 -0.0315 424 ARG A NE    
870  C  CZ    . ARG A 106 ? 0.3292 0.1724 0.2862 -0.0157 -0.0022 -0.0200 424 ARG A CZ    
871  N  NH1   . ARG A 106 ? 0.2937 0.1731 0.2732 -0.0188 0.0037  -0.0255 424 ARG A NH1   
872  N  NH2   . ARG A 106 ? 0.3266 0.1520 0.2718 -0.0282 0.0101  -0.0026 424 ARG A NH2   
873  N  N     . SER A 107 ? 0.5355 0.3090 0.4538 0.0119  -0.1076 0.0494  425 SER A N     
874  C  CA    . SER A 107 ? 0.5356 0.3431 0.4518 0.0028  -0.1148 0.0496  425 SER A CA    
875  C  C     . SER A 107 ? 0.5167 0.3461 0.4284 0.0023  -0.1034 0.0447  425 SER A C     
876  O  O     . SER A 107 ? 0.4913 0.3488 0.4085 -0.0008 -0.1011 0.0352  425 SER A O     
877  C  CB    . SER A 107 ? 0.6028 0.4137 0.5007 -0.0077 -0.1377 0.0684  425 SER A CB    
878  O  OG    . SER A 107 ? 0.5949 0.4088 0.4744 -0.0136 -0.1388 0.0818  425 SER A OG    
879  N  N     . ASP A 108 ? 0.4325 0.2515 0.3334 0.0069  -0.0977 0.0497  426 ASP A N     
880  C  CA    . ASP A 108 ? 0.4485 0.2923 0.3435 0.0103  -0.0902 0.0423  426 ASP A CA    
881  C  C     . ASP A 108 ? 0.4649 0.2952 0.3665 0.0212  -0.0751 0.0224  426 ASP A C     
882  O  O     . ASP A 108 ? 0.4639 0.3178 0.3624 0.0255  -0.0720 0.0112  426 ASP A O     
883  C  CB    . ASP A 108 ? 0.4471 0.2884 0.3270 0.0129  -0.0906 0.0523  426 ASP A CB    
884  C  CG    . ASP A 108 ? 0.4643 0.2585 0.3430 0.0224  -0.0833 0.0547  426 ASP A CG    
885  O  OD1   . ASP A 108 ? 0.4979 0.2666 0.3819 0.0201  -0.0876 0.0611  426 ASP A OD1   
886  O  OD2   . ASP A 108 ? 0.4844 0.2696 0.3556 0.0330  -0.0747 0.0489  426 ASP A OD2   
887  N  N     . GLU A 109 ? 0.4461 0.2398 0.3542 0.0245  -0.0671 0.0167  427 GLU A N     
888  C  CA    . GLU A 109 ? 0.4403 0.2188 0.3498 0.0284  -0.0550 -0.0015 427 GLU A CA    
889  C  C     . GLU A 109 ? 0.4232 0.2300 0.3443 0.0218  -0.0572 -0.0104 427 GLU A C     
890  O  O     . GLU A 109 ? 0.4323 0.2434 0.3492 0.0249  -0.0518 -0.0243 427 GLU A O     
891  C  CB    . GLU A 109 ? 0.4931 0.2327 0.4053 0.0273  -0.0461 -0.0052 427 GLU A CB    
892  C  CG    . GLU A 109 ? 0.5217 0.2262 0.4209 0.0339  -0.0411 0.0003  427 GLU A CG    
893  C  CD    . GLU A 109 ? 0.6035 0.2786 0.5071 0.0288  -0.0326 -0.0046 427 GLU A CD    
894  O  OE1   . GLU A 109 ? 0.5640 0.2416 0.4785 0.0271  -0.0378 0.0035  427 GLU A OE1   
895  O  OE2   . GLU A 109 ? 0.6634 0.3196 0.5600 0.0249  -0.0217 -0.0175 427 GLU A OE2   
896  N  N     . LEU A 110 ? 0.4139 0.2365 0.3476 0.0138  -0.0664 -0.0037 428 LEU A N     
897  C  CA    . LEU A 110 ? 0.4101 0.2612 0.3550 0.0077  -0.0697 -0.0117 428 LEU A CA    
898  C  C     . LEU A 110 ? 0.4361 0.3238 0.3748 0.0062  -0.0751 -0.0109 428 LEU A C     
899  O  O     . LEU A 110 ? 0.4086 0.3140 0.3510 0.0060  -0.0715 -0.0238 428 LEU A O     
900  C  CB    . LEU A 110 ? 0.4053 0.2638 0.3609 0.0021  -0.0823 -0.0048 428 LEU A CB    
901  C  CG    . LEU A 110 ? 0.4261 0.3139 0.3930 -0.0039 -0.0871 -0.0130 428 LEU A CG    
902  C  CD1   . LEU A 110 ? 0.4660 0.3511 0.4413 -0.0038 -0.0716 -0.0327 428 LEU A CD1   
903  C  CD2   . LEU A 110 ? 0.4517 0.3416 0.4260 -0.0055 -0.1023 -0.0083 428 LEU A CD2   
904  N  N     . VAL A 111 ? 0.4530 0.3551 0.3809 0.0040  -0.0838 0.0031  429 VAL A N     
905  C  CA    . VAL A 111 ? 0.4928 0.4397 0.4142 0.0002  -0.0888 0.0025  429 VAL A CA    
906  C  C     . VAL A 111 ? 0.5203 0.4715 0.4378 0.0137  -0.0782 -0.0157 429 VAL A C     
907  O  O     . VAL A 111 ? 0.4564 0.4393 0.3766 0.0140  -0.0786 -0.0270 429 VAL A O     
908  C  CB    . VAL A 111 ? 0.5086 0.4708 0.4155 -0.0073 -0.0986 0.0199  429 VAL A CB    
909  C  CG1   . VAL A 111 ? 0.5164 0.5318 0.4159 -0.0100 -0.1004 0.0149  429 VAL A CG1   
910  C  CG2   . VAL A 111 ? 0.4913 0.4497 0.3948 -0.0223 -0.1144 0.0370  429 VAL A CG2   
911  N  N     . ARG A 112 ? 0.5074 0.4239 0.4159 0.0260  -0.0703 -0.0194 430 ARG A N     
912  C  CA    . ARG A 112 ? 0.5657 0.4751 0.4635 0.0417  -0.0640 -0.0378 430 ARG A CA    
913  C  C     . ARG A 112 ? 0.5664 0.4607 0.4683 0.0414  -0.0586 -0.0530 430 ARG A C     
914  O  O     . ARG A 112 ? 0.5500 0.4602 0.4460 0.0497  -0.0591 -0.0683 430 ARG A O     
915  C  CB    . ARG A 112 ? 0.6355 0.4991 0.5190 0.0537  -0.0582 -0.0382 430 ARG A CB    
916  C  CG    . ARG A 112 ? 0.7094 0.5946 0.5823 0.0623  -0.0626 -0.0339 430 ARG A CG    
917  C  CD    . ARG A 112 ? 0.7022 0.5390 0.5577 0.0787  -0.0573 -0.0407 430 ARG A CD    
918  N  NE    . ARG A 112 ? 0.6659 0.5200 0.5136 0.0856  -0.0609 -0.0338 430 ARG A NE    
919  C  CZ    . ARG A 112 ? 0.5943 0.4071 0.4301 0.0944  -0.0575 -0.0306 430 ARG A CZ    
920  N  NH1   . ARG A 112 ? 0.5601 0.3127 0.3894 0.0953  -0.0505 -0.0333 430 ARG A NH1   
921  N  NH2   . ARG A 112 ? 0.5986 0.4322 0.4279 0.1002  -0.0611 -0.0250 430 ARG A NH2   
922  N  N     . HIS A 113 ? 0.4950 0.3607 0.4061 0.0320  -0.0538 -0.0502 431 HIS A N     
923  C  CA    . HIS A 113 ? 0.4847 0.3385 0.3991 0.0276  -0.0481 -0.0642 431 HIS A CA    
924  C  C     . HIS A 113 ? 0.5225 0.4229 0.4492 0.0221  -0.0539 -0.0683 431 HIS A C     
925  O  O     . HIS A 113 ? 0.5517 0.4539 0.4734 0.0254  -0.0516 -0.0835 431 HIS A O     
926  C  CB    . HIS A 113 ? 0.5011 0.3298 0.4258 0.0168  -0.0425 -0.0611 431 HIS A CB    
927  C  CG    . HIS A 113 ? 0.5275 0.3564 0.4590 0.0076  -0.0374 -0.0743 431 HIS A CG    
928  N  ND1   . HIS A 113 ? 0.5640 0.3599 0.4775 0.0071  -0.0297 -0.0889 431 HIS A ND1   
929  C  CD2   . HIS A 113 ? 0.5195 0.3767 0.4707 -0.0019 -0.0402 -0.0757 431 HIS A CD2   
930  C  CE1   . HIS A 113 ? 0.5653 0.3717 0.4883 -0.0045 -0.0265 -0.0982 431 HIS A CE1   
931  N  NE2   . HIS A 113 ? 0.5916 0.4375 0.5393 -0.0088 -0.0323 -0.0911 431 HIS A NE2   
932  N  N     . HIS A 114 ? 0.5046 0.4393 0.4438 0.0131  -0.0629 -0.0548 432 HIS A N     
933  C  CA    . HIS A 114 ? 0.5149 0.4930 0.4641 0.0054  -0.0695 -0.0570 432 HIS A CA    
934  C  C     . HIS A 114 ? 0.4512 0.4613 0.3920 0.0135  -0.0707 -0.0683 432 HIS A C     
935  O  O     . HIS A 114 ? 0.4822 0.5189 0.4291 0.0107  -0.0721 -0.0778 432 HIS A O     
936  C  CB    . HIS A 114 ? 0.5702 0.5729 0.5242 -0.0064 -0.0824 -0.0388 432 HIS A CB    
937  C  CG    . HIS A 114 ? 0.7265 0.7143 0.6925 -0.0135 -0.0867 -0.0339 432 HIS A CG    
938  N  ND1   . HIS A 114 ? 0.7581 0.7469 0.7218 -0.0208 -0.1009 -0.0173 432 HIS A ND1   
939  C  CD2   . HIS A 114 ? 0.7654 0.7390 0.7439 -0.0138 -0.0803 -0.0452 432 HIS A CD2   
940  C  CE1   . HIS A 114 ? 0.7509 0.7268 0.7262 -0.0213 -0.1041 -0.0201 432 HIS A CE1   
941  N  NE2   . HIS A 114 ? 0.7612 0.7322 0.7475 -0.0180 -0.0906 -0.0372 432 HIS A NE2   
942  N  N     . ASN A 115 ? 0.4377 0.4491 0.3647 0.0249  -0.0708 -0.0690 433 ASN A N     
943  C  CA    . ASN A 115 ? 0.4856 0.5332 0.4041 0.0369  -0.0734 -0.0834 433 ASN A CA    
944  C  C     . ASN A 115 ? 0.5130 0.5366 0.4236 0.0495  -0.0690 -0.1049 433 ASN A C     
945  O  O     . ASN A 115 ? 0.5245 0.5811 0.4297 0.0605  -0.0730 -0.1200 433 ASN A O     
946  C  CB    . ASN A 115 ? 0.5670 0.6197 0.4717 0.0495  -0.0750 -0.0825 433 ASN A CB    
947  C  CG    . ASN A 115 ? 0.6244 0.7129 0.5318 0.0345  -0.0816 -0.0628 433 ASN A CG    
948  O  OD1   . ASN A 115 ? 0.7006 0.8212 0.6159 0.0161  -0.0879 -0.0527 433 ASN A OD1   
949  N  ND2   . ASN A 115 ? 0.6044 0.6843 0.5015 0.0413  -0.0814 -0.0571 433 ASN A ND2   
950  N  N     . MET A 116 ? 0.4884 0.4568 0.3956 0.0473  -0.0617 -0.1075 434 MET A N     
951  C  CA    . MET A 116 ? 0.5594 0.4980 0.4527 0.0546  -0.0590 -0.1265 434 MET A CA    
952  C  C     . MET A 116 ? 0.6042 0.5693 0.5121 0.0432  -0.0592 -0.1321 434 MET A C     
953  O  O     . MET A 116 ? 0.6104 0.5605 0.5058 0.0493  -0.0592 -0.1488 434 MET A O     
954  C  CB    . MET A 116 ? 0.6058 0.4755 0.4842 0.0513  -0.0513 -0.1273 434 MET A CB    
955  C  CG    . MET A 116 ? 0.7575 0.5946 0.6188 0.0631  -0.0512 -0.1227 434 MET A CG    
956  S  SD    . MET A 116 ? 0.8964 0.6531 0.7367 0.0548  -0.0422 -0.1232 434 MET A SD    
957  C  CE    . MET A 116 ? 0.9865 0.7287 0.8211 0.0650  -0.0427 -0.1100 434 MET A CE    
958  N  N     . HIS A 117 ? 0.5977 0.5982 0.5286 0.0276  -0.0610 -0.1190 435 HIS A N     
959  C  CA    . HIS A 117 ? 0.6332 0.6565 0.5791 0.0161  -0.0613 -0.1232 435 HIS A CA    
960  C  C     . HIS A 117 ? 0.7174 0.8017 0.6696 0.0166  -0.0695 -0.1254 435 HIS A C     
961  O  O     . HIS A 117 ? 0.6706 0.7898 0.6246 0.0141  -0.0758 -0.1142 435 HIS A O     
962  C  CB    . HIS A 117 ? 0.6255 0.6477 0.5900 0.0002  -0.0610 -0.1099 435 HIS A CB    
963  C  CG    . HIS A 117 ? 0.7049 0.6785 0.6669 -0.0034 -0.0520 -0.1112 435 HIS A CG    
964  N  ND1   . HIS A 117 ? 0.7403 0.6774 0.6882 -0.0036 -0.0439 -0.1258 435 HIS A ND1   
965  C  CD2   . HIS A 117 ? 0.6968 0.6534 0.6658 -0.0085 -0.0508 -0.1003 435 HIS A CD2   
966  C  CE1   . HIS A 117 ? 0.7569 0.6606 0.7039 -0.0114 -0.0367 -0.1237 435 HIS A CE1   
967  N  NE2   . HIS A 117 ? 0.7665 0.6836 0.7283 -0.0127 -0.0405 -0.1092 435 HIS A NE2   
968  N  N     . GLN A 118 ? 0.8202 0.9184 0.7739 0.0174  -0.0695 -0.1399 436 GLN A N     
969  C  CA    . GLN A 118 ? 0.8866 1.0459 0.8474 0.0159  -0.0765 -0.1438 436 GLN A CA    
970  C  C     . GLN A 118 ? 1.0558 1.2210 1.0262 0.0085  -0.0750 -0.1533 436 GLN A C     
971  O  O     . GLN A 118 ? 1.1096 1.2336 1.0797 0.0045  -0.0684 -0.1579 436 GLN A O     
972  C  CB    . GLN A 118 ? 0.8266 1.0085 0.7721 0.0358  -0.0803 -0.1586 436 GLN A CB    
973  N  N     . ARG A 119 ? 1.1296 1.3500 1.1078 0.0046  -0.0811 -0.1567 437 ARG A N     
974  C  CA    . ARG A 119 ? 1.1259 1.3610 1.1142 -0.0025 -0.0808 -0.1656 437 ARG A CA    
975  C  C     . ARG A 119 ? 1.1242 1.3434 1.1282 -0.0192 -0.0789 -0.1548 437 ARG A C     
976  O  O     . ARG A 119 ? 1.1491 1.3319 1.1536 -0.0209 -0.0718 -0.1623 437 ARG A O     
977  C  CB    . ARG A 119 ? 1.1302 1.3329 1.1037 0.0114  -0.0767 -0.1870 437 ARG A CB    
978  O  "O5'" . DA  B 1   ? 0.6750 0.3948 0.8123 -0.0257 0.0339  -0.0657 1   DA  B "O5'" 
979  C  "C5'" . DA  B 1   ? 0.6559 0.3609 0.7969 -0.0424 0.0350  -0.0733 1   DA  B "C5'" 
980  C  "C4'" . DA  B 1   ? 0.6251 0.3301 0.7755 -0.0550 0.0382  -0.0576 1   DA  B "C4'" 
981  O  "O4'" . DA  B 1   ? 0.6797 0.3650 0.8249 -0.0454 0.0429  -0.0369 1   DA  B "O4'" 
982  C  "C3'" . DA  B 1   ? 0.4623 0.2023 0.6184 -0.0582 0.0360  -0.0507 1   DA  B "C3'" 
983  O  "O3'" . DA  B 1   ? 0.5024 0.2476 0.6705 -0.0770 0.0385  -0.0483 1   DA  B "O3'" 
984  C  "C2'" . DA  B 1   ? 0.4526 0.1902 0.6012 -0.0442 0.0391  -0.0293 1   DA  B "C2'" 
985  C  "C1'" . DA  B 1   ? 0.6449 0.3466 0.7935 -0.0467 0.0447  -0.0200 1   DA  B "C1'" 
986  N  N9    . DA  B 1   ? 0.5829 0.2752 0.7225 -0.0311 0.0460  -0.0011 1   DA  B N9    
987  C  C8    . DA  B 1   ? 0.5480 0.2388 0.6839 -0.0323 0.0491  0.0207  1   DA  B C8    
988  N  N7    . DA  B 1   ? 0.5360 0.2211 0.6632 -0.0165 0.0474  0.0343  1   DA  B N7    
989  C  C5    . DA  B 1   ? 0.5123 0.1954 0.6396 -0.0039 0.0441  0.0202  1   DA  B C5    
990  C  C6    . DA  B 1   ? 0.5057 0.1870 0.6286 0.0149  0.0414  0.0240  1   DA  B C6    
991  N  N6    . DA  B 1   ? 0.4815 0.1624 0.5992 0.0250  0.0397  0.0445  1   DA  B N6    
992  N  N1    . DA  B 1   ? 0.5712 0.2532 0.6953 0.0227  0.0403  0.0060  1   DA  B N1    
993  C  C2    . DA  B 1   ? 0.4687 0.1529 0.5956 0.0118  0.0407  -0.0142 1   DA  B C2    
994  N  N3    . DA  B 1   ? 0.5511 0.2383 0.6828 -0.0061 0.0414  -0.0197 1   DA  B N3    
995  C  C4    . DA  B 1   ? 0.4845 0.1710 0.6175 -0.0131 0.0436  -0.0017 1   DA  B C4    
996  P  P     . DG  B 2   ? 0.5301 0.3195 0.7065 -0.0854 0.0340  -0.0511 2   DG  B P     
997  O  OP1   . DG  B 2   ? 0.6163 0.4039 0.8089 -0.1068 0.0382  -0.0513 2   DG  B OP1   
998  O  OP2   . DG  B 2   ? 0.5736 0.3854 0.7454 -0.0793 0.0245  -0.0667 2   DG  B OP2   
999  O  "O5'" . DG  B 2   ? 0.4675 0.2736 0.6369 -0.0744 0.0372  -0.0319 2   DG  B "O5'" 
1000 C  "C5'" . DG  B 2   ? 0.4468 0.2401 0.6168 -0.0797 0.0458  -0.0145 2   DG  B "C5'" 
1001 C  "C4'" . DG  B 2   ? 0.4130 0.2164 0.5693 -0.0661 0.0473  0.0012  2   DG  B "C4'" 
1002 O  "O4'" . DG  B 2   ? 0.4179 0.2056 0.5619 -0.0494 0.0437  0.0032  2   DG  B "O4'" 
1003 C  "C3'" . DG  B 2   ? 0.3855 0.2264 0.5411 -0.0619 0.0444  -0.0013 2   DG  B "C3'" 
1004 O  "O3'" . DG  B 2   ? 0.3875 0.2350 0.5365 -0.0623 0.0514  0.0141  2   DG  B "O3'" 
1005 C  "C2'" . DG  B 2   ? 0.3773 0.2211 0.5209 -0.0451 0.0368  -0.0067 2   DG  B "C2'" 
1006 C  "C1'" . DG  B 2   ? 0.3948 0.2075 0.5297 -0.0373 0.0387  0.0023  2   DG  B "C1'" 
1007 N  N9    . DG  B 2   ? 0.3703 0.1746 0.5007 -0.0255 0.0336  -0.0072 2   DG  B N9    
1008 C  C8    . DG  B 2   ? 0.3534 0.1655 0.4862 -0.0257 0.0283  -0.0253 2   DG  B C8    
1009 N  N7    . DG  B 2   ? 0.3746 0.1758 0.5012 -0.0141 0.0266  -0.0307 2   DG  B N7    
1010 C  C5    . DG  B 2   ? 0.3780 0.1635 0.5009 -0.0052 0.0302  -0.0145 2   DG  B C5    
1011 C  C6    . DG  B 2   ? 0.3897 0.1615 0.5092 0.0098  0.0306  -0.0110 2   DG  B C6    
1012 O  O6    . DG  B 2   ? 0.4159 0.1857 0.5342 0.0183  0.0294  -0.0228 2   DG  B O6    
1013 N  N1    . DG  B 2   ? 0.3819 0.1441 0.4994 0.0150  0.0327  0.0088  2   DG  B N1    
1014 C  C2    . DG  B 2   ? 0.3792 0.1426 0.4947 0.0059  0.0352  0.0232  2   DG  B C2    
1015 N  N2    . DG  B 2   ? 0.4046 0.1583 0.5153 0.0125  0.0360  0.0427  2   DG  B N2    
1016 N  N3    . DG  B 2   ? 0.3947 0.1704 0.5131 -0.0084 0.0369  0.0192  2   DG  B N3    
1017 C  C4    . DG  B 2   ? 0.3807 0.1676 0.5043 -0.0126 0.0338  0.0003  2   DG  B C4    
1018 P  P     . DC  B 3   ? 0.3786 0.2588 0.5242 -0.0573 0.0520  0.0148  3   DC  B P     
1019 O  OP1   . DC  B 3   ? 0.4005 0.2859 0.5473 -0.0675 0.0628  0.0260  3   DC  B OP1   
1020 O  OP2   . DC  B 3   ? 0.3355 0.2394 0.4922 -0.0555 0.0450  -0.0004 3   DC  B OP2   
1021 O  "O5'" . DC  B 3   ? 0.3903 0.2649 0.5152 -0.0417 0.0484  0.0222  3   DC  B "O5'" 
1022 C  "C5'" . DC  B 3   ? 0.3293 0.1846 0.4414 -0.0399 0.0517  0.0378  3   DC  B "C5'" 
1023 C  "C4'" . DC  B 3   ? 0.3190 0.1734 0.4165 -0.0251 0.0453  0.0411  3   DC  B "C4'" 
1024 O  "O4'" . DC  B 3   ? 0.3525 0.1940 0.4550 -0.0178 0.0392  0.0325  3   DC  B "O4'" 
1025 C  "C3'" . DC  B 3   ? 0.2927 0.1720 0.3838 -0.0190 0.0422  0.0348  3   DC  B "C3'" 
1026 O  "O3'" . DC  B 3   ? 0.3103 0.1897 0.3840 -0.0124 0.0409  0.0454  3   DC  B "O3'" 
1027 C  "C2'" . DC  B 3   ? 0.2806 0.1618 0.3773 -0.0117 0.0343  0.0216  3   DC  B "C2'" 
1028 C  "C1'" . DC  B 3   ? 0.3138 0.1708 0.4092 -0.0072 0.0331  0.0270  3   DC  B "C1'" 
1029 N  N1    . DC  B 3   ? 0.3220 0.1737 0.4223 -0.0008 0.0279  0.0145  3   DC  B N1    
1030 C  C2    . DC  B 3   ? 0.3354 0.1740 0.4318 0.0101  0.0260  0.0189  3   DC  B C2    
1031 O  O2    . DC  B 3   ? 0.3468 0.1783 0.4372 0.0137  0.0272  0.0342  3   DC  B O2    
1032 N  N3    . DC  B 3   ? 0.3234 0.1594 0.4226 0.0166  0.0230  0.0066  3   DC  B N3    
1033 C  C4    . DC  B 3   ? 0.3177 0.1632 0.4205 0.0115  0.0207  -0.0088 3   DC  B C4    
1034 N  N4    . DC  B 3   ? 0.3145 0.1578 0.4166 0.0174  0.0184  -0.0209 3   DC  B N4    
1035 C  C5    . DC  B 3   ? 0.2868 0.1467 0.3945 0.0006  0.0207  -0.0121 3   DC  B C5    
1036 C  C6    . DC  B 3   ? 0.3181 0.1810 0.4257 -0.0048 0.0250  -0.0005 3   DC  B C6    
1037 P  P     . DG  B 4   ? 0.2914 0.1895 0.3518 -0.0121 0.0433  0.0464  4   DG  B P     
1038 O  OP1   . DG  B 4   ? 0.3141 0.2150 0.3730 -0.0227 0.0535  0.0525  4   DG  B OP1   
1039 O  OP2   . DG  B 4   ? 0.2769 0.1907 0.3412 -0.0068 0.0393  0.0334  4   DG  B OP2   
1040 O  "O5'" . DG  B 4   ? 0.3026 0.1964 0.3450 -0.0050 0.0382  0.0572  4   DG  B "O5'" 
1041 C  "C5'" . DG  B 4   ? 0.3238 0.2023 0.3598 -0.0060 0.0386  0.0729  4   DG  B "C5'" 
1042 C  "C4'" . DG  B 4   ? 0.3380 0.2152 0.3679 0.0048  0.0297  0.0788  4   DG  B "C4'" 
1043 O  "O4'" . DG  B 4   ? 0.3386 0.2080 0.3841 0.0123  0.0259  0.0704  4   DG  B "O4'" 
1044 C  "C3'" . DG  B 4   ? 0.3089 0.2040 0.3269 0.0080  0.0253  0.0742  4   DG  B "C3'" 
1045 O  "O3'" . DG  B 4   ? 0.3588 0.2559 0.3650 0.0121  0.0193  0.0869  4   DG  B "O3'" 
1046 C  "C2'" . DG  B 4   ? 0.2780 0.1773 0.3083 0.0151  0.0209  0.0606  4   DG  B "C2'" 
1047 C  "C1'" . DG  B 4   ? 0.3192 0.2022 0.3629 0.0199  0.0199  0.0628  4   DG  B "C1'" 
1048 N  N9    . DG  B 4   ? 0.3073 0.1892 0.3641 0.0220  0.0194  0.0478  4   DG  B N9    
1049 C  C8    . DG  B 4   ? 0.2961 0.1805 0.3607 0.0151  0.0225  0.0368  4   DG  B C8    
1050 N  N7    . DG  B 4   ? 0.2969 0.1812 0.3700 0.0182  0.0198  0.0245  4   DG  B N7    
1051 C  C5    . DG  B 4   ? 0.2608 0.1418 0.3318 0.0280  0.0162  0.0269  4   DG  B C5    
1052 C  C6    . DG  B 4   ? 0.2680 0.1480 0.3440 0.0348  0.0139  0.0168  4   DG  B C6    
1053 O  O6    . DG  B 4   ? 0.3077 0.1889 0.3881 0.0324  0.0133  0.0033  4   DG  B O6    
1054 N  N1    . DG  B 4   ? 0.2772 0.1575 0.3522 0.0448  0.0120  0.0234  4   DG  B N1    
1055 C  C2    . DG  B 4   ? 0.3132 0.1952 0.3833 0.0476  0.0105  0.0389  4   DG  B C2    
1056 N  N2    . DG  B 4   ? 0.3169 0.2033 0.3904 0.0582  0.0078  0.0439  4   DG  B N2    
1057 N  N3    . DG  B 4   ? 0.3239 0.2059 0.3860 0.0404  0.0116  0.0487  4   DG  B N3    
1058 C  C4    . DG  B 4   ? 0.2668 0.1479 0.3297 0.0310  0.0154  0.0414  4   DG  B C4    
1059 P  P     . DT  B 5   ? 0.3195 0.2334 0.3080 0.0110  0.0149  0.0863  5   DT  B P     
1060 O  OP1   . DT  B 5   ? 0.3717 0.2860 0.3483 0.0118  0.0093  0.1040  5   DT  B OP1   
1061 O  OP2   . DT  B 5   ? 0.3412 0.2622 0.3204 0.0037  0.0213  0.0763  5   DT  B OP2   
1062 O  "O5'" . DT  B 5   ? 0.3257 0.2480 0.3236 0.0191  0.0085  0.0765  5   DT  B "O5'" 
1063 C  "C5'" . DT  B 5   ? 0.2819 0.2038 0.2898 0.0285  0.0022  0.0824  5   DT  B "C5'" 
1064 C  "C4'" . DT  B 5   ? 0.2995 0.2309 0.3153 0.0337  -0.0007 0.0706  5   DT  B "C4'" 
1065 O  "O4'" . DT  B 5   ? 0.2860 0.2086 0.3146 0.0351  0.0036  0.0590  5   DT  B "O4'" 
1066 C  "C3'" . DT  B 5   ? 0.2806 0.2239 0.2840 0.0279  -0.0014 0.0629  5   DT  B "C3'" 
1067 O  "O3'" . DT  B 5   ? 0.3139 0.2702 0.3183 0.0315  -0.0075 0.0628  5   DT  B "O3'" 
1068 C  "C2'" . DT  B 5   ? 0.2849 0.2240 0.2958 0.0271  0.0033  0.0493  5   DT  B "C2'" 
1069 C  "C1'" . DT  B 5   ? 0.2449 0.1774 0.2718 0.0344  0.0027  0.0476  5   DT  B "C1'" 
1070 N  N1    . DT  B 5   ? 0.2357 0.1625 0.2720 0.0336  0.0060  0.0361  5   DT  B N1    
1071 C  C2    . DT  B 5   ? 0.2569 0.1832 0.3025 0.0396  0.0045  0.0286  5   DT  B C2    
1072 O  O2    . DT  B 5   ? 0.2734 0.2046 0.3211 0.0462  0.0018  0.0310  5   DT  B O2    
1073 N  N3    . DT  B 5   ? 0.2427 0.1653 0.2948 0.0372  0.0062  0.0179  5   DT  B N3    
1074 C  C4    . DT  B 5   ? 0.2177 0.1392 0.2720 0.0303  0.0090  0.0147  5   DT  B C4    
1075 O  O4    . DT  B 5   ? 0.2547 0.1763 0.3165 0.0282  0.0089  0.0054  5   DT  B O4    
1076 C  C5    . DT  B 5   ? 0.2218 0.1441 0.2689 0.0253  0.0123  0.0230  5   DT  B C5    
1077 C  C7    . DT  B 5   ? 0.2505 0.1745 0.3022 0.0182  0.0173  0.0200  5   DT  B C7    
1078 C  C6    . DT  B 5   ? 0.2257 0.1494 0.2624 0.0269  0.0107  0.0330  5   DT  B C6    
1079 P  P     . DG  B 6   ? 0.3853 0.3543 0.3724 0.0241  -0.0119 0.0648  6   DG  B P     
1080 O  OP1   . DG  B 6   ? 0.4752 0.4496 0.4595 0.0253  -0.0174 0.0798  6   DG  B OP1   
1081 O  OP2   . DG  B 6   ? 0.5452 0.5094 0.5187 0.0159  -0.0068 0.0567  6   DG  B OP2   
1082 O  "O5'" . DG  B 6   ? 0.5306 0.5112 0.5246 0.0266  -0.0151 0.0574  6   DG  B "O5'" 
1083 C  "C5'" . DG  B 6   ? 0.5238 0.5164 0.5307 0.0337  -0.0195 0.0620  6   DG  B "C5'" 
1084 C  "C4'" . DG  B 6   ? 0.3285 0.3216 0.3482 0.0399  -0.0166 0.0525  6   DG  B "C4'" 
1085 O  "O4'" . DG  B 6   ? 0.2907 0.2682 0.3170 0.0439  -0.0115 0.0472  6   DG  B "O4'" 
1086 C  "C3'" . DG  B 6   ? 0.2634 0.2606 0.2776 0.0350  -0.0156 0.0430  6   DG  B "C3'" 
1087 O  "O3'" . DG  B 6   ? 0.2576 0.2724 0.2720 0.0324  -0.0199 0.0466  6   DG  B "O3'" 
1088 C  "C2'" . DG  B 6   ? 0.2633 0.2569 0.2894 0.0427  -0.0119 0.0357  6   DG  B "C2'" 
1089 C  "C1'" . DG  B 6   ? 0.2744 0.2530 0.3057 0.0463  -0.0092 0.0367  6   DG  B "C1'" 
1090 N  N9    . DG  B 6   ? 0.2290 0.1959 0.2571 0.0428  -0.0059 0.0290  6   DG  B N9    
1091 C  C8    . DG  B 6   ? 0.2404 0.1992 0.2620 0.0372  -0.0039 0.0305  6   DG  B C8    
1092 N  N7    . DG  B 6   ? 0.2340 0.1868 0.2585 0.0359  -0.0012 0.0228  6   DG  B N7    
1093 C  C5    . DG  B 6   ? 0.2136 0.1689 0.2445 0.0403  -0.0022 0.0159  6   DG  B C5    
1094 C  C6    . DG  B 6   ? 0.1990 0.1519 0.2344 0.0404  -0.0016 0.0066  6   DG  B C6    
1095 O  O6    . DG  B 6   ? 0.2291 0.1787 0.2671 0.0371  -0.0006 0.0028  6   DG  B O6    
1096 N  N1    . DG  B 6   ? 0.1891 0.1468 0.2260 0.0446  -0.0026 0.0013  6   DG  B N1    
1097 C  C2    . DG  B 6   ? 0.1898 0.1546 0.2274 0.0489  -0.0027 0.0048  6   DG  B C2    
1098 N  N2    . DG  B 6   ? 0.2294 0.1994 0.2683 0.0525  -0.0016 -0.0019 6   DG  B N2    
1099 N  N3    . DG  B 6   ? 0.2213 0.1905 0.2585 0.0494  -0.0038 0.0141  6   DG  B N3    
1100 C  C4    . DG  B 6   ? 0.2192 0.1825 0.2517 0.0446  -0.0040 0.0193  6   DG  B C4    
1101 P  P     . DG  B 7   ? 0.2442 0.2642 0.2500 0.0240  -0.0202 0.0409  7   DG  B P     
1102 O  OP1   . DG  B 7   ? 0.2317 0.2725 0.2405 0.0203  -0.0258 0.0478  7   DG  B OP1   
1103 O  OP2   . DG  B 7   ? 0.2633 0.2670 0.2538 0.0170  -0.0180 0.0355  7   DG  B OP2   
1104 O  "O5'" . DG  B 7   ? 0.2346 0.2549 0.2488 0.0300  -0.0161 0.0340  7   DG  B "O5'" 
1105 C  "C5'" . DG  B 7   ? 0.2126 0.2477 0.2419 0.0377  -0.0152 0.0355  7   DG  B "C5'" 
1106 C  "C4'" . DG  B 7   ? 0.2099 0.2439 0.2400 0.0402  -0.0105 0.0271  7   DG  B "C4'" 
1107 O  "O4'" . DG  B 7   ? 0.2407 0.2562 0.2680 0.0432  -0.0082 0.0207  7   DG  B "O4'" 
1108 C  "C3'" . DG  B 7   ? 0.1977 0.2343 0.2162 0.0310  -0.0105 0.0252  7   DG  B "C3'" 
1109 O  "O3'" . DG  B 7   ? 0.2518 0.2993 0.2749 0.0341  -0.0063 0.0215  7   DG  B "O3'" 
1110 C  "C2'" . DG  B 7   ? 0.2387 0.2549 0.2463 0.0290  -0.0103 0.0207  7   DG  B "C2'" 
1111 C  "C1'" . DG  B 7   ? 0.2311 0.2402 0.2471 0.0378  -0.0081 0.0162  7   DG  B "C1'" 
1112 N  N9    . DG  B 7   ? 0.2119 0.2053 0.2243 0.0369  -0.0084 0.0142  7   DG  B N9    
1113 C  C8    . DG  B 7   ? 0.2330 0.2202 0.2418 0.0335  -0.0093 0.0182  7   DG  B C8    
1114 N  N7    . DG  B 7   ? 0.2147 0.1908 0.2232 0.0336  -0.0078 0.0149  7   DG  B N7    
1115 C  C5    . DG  B 7   ? 0.1952 0.1706 0.2074 0.0368  -0.0074 0.0084  7   DG  B C5    
1116 C  C6    . DG  B 7   ? 0.2147 0.1838 0.2300 0.0376  -0.0071 0.0029  7   DG  B C6    
1117 O  O6    . DG  B 7   ? 0.2302 0.1935 0.2478 0.0360  -0.0059 0.0026  7   DG  B O6    
1118 N  N1    . DG  B 7   ? 0.2302 0.2029 0.2459 0.0397  -0.0083 -0.0029 7   DG  B N1    
1119 C  C2    . DG  B 7   ? 0.2207 0.2014 0.2335 0.0413  -0.0079 -0.0036 7   DG  B C2    
1120 N  N2    . DG  B 7   ? 0.2550 0.2386 0.2652 0.0424  -0.0085 -0.0100 7   DG  B N2    
1121 N  N3    . DG  B 7   ? 0.2146 0.2024 0.2272 0.0411  -0.0068 0.0017  7   DG  B N3    
1122 C  C4    . DG  B 7   ? 0.1918 0.1768 0.2045 0.0387  -0.0075 0.0077  7   DG  B C4    
1123 P  P     . DG  B 8   ? 0.2628 0.3157 0.2755 0.0252  -0.0050 0.0214  8   DG  B P     
1124 O  OP1   . DG  B 8   ? 0.2675 0.3408 0.2897 0.0290  0.0003  0.0200  8   DG  B OP1   
1125 O  OP2   . DG  B 8   ? 0.2888 0.3393 0.2932 0.0141  -0.0091 0.0264  8   DG  B OP2   
1126 O  "O5'" . DG  B 8   ? 0.2515 0.2862 0.2523 0.0259  -0.0044 0.0159  8   DG  B "O5'" 
1127 C  "C5'" . DG  B 8   ? 0.2540 0.2891 0.2575 0.0334  -0.0011 0.0090  8   DG  B "C5'" 
1128 C  "C4'" . DG  B 8   ? 0.2540 0.2764 0.2452 0.0318  -0.0029 0.0056  8   DG  B "C4'" 
1129 O  "O4'" . DG  B 8   ? 0.2643 0.2719 0.2570 0.0333  -0.0063 0.0048  8   DG  B "O4'" 
1130 C  "C3'" . DG  B 8   ? 0.2470 0.2671 0.2247 0.0238  -0.0044 0.0109  8   DG  B "C3'" 
1131 O  "O3'" . DG  B 8   ? 0.2976 0.3200 0.2660 0.0244  -0.0033 0.0081  8   DG  B "O3'" 
1132 C  "C2'" . DG  B 8   ? 0.2696 0.2720 0.2438 0.0224  -0.0087 0.0128  8   DG  B "C2'" 
1133 C  "C1'" . DG  B 8   ? 0.2414 0.2393 0.2241 0.0295  -0.0093 0.0068  8   DG  B "C1'" 
1134 N  N9    . DG  B 8   ? 0.2002 0.1872 0.1863 0.0296  -0.0109 0.0076  8   DG  B N9    
1135 C  C8    . DG  B 8   ? 0.2282 0.2139 0.2153 0.0264  -0.0105 0.0113  8   DG  B C8    
1136 N  N7    . DG  B 8   ? 0.2065 0.1823 0.1946 0.0269  -0.0106 0.0105  8   DG  B N7    
1137 C  C5    . DG  B 8   ? 0.1866 0.1583 0.1775 0.0309  -0.0114 0.0064  8   DG  B C5    
1138 C  C6    . DG  B 8   ? 0.2055 0.1705 0.2015 0.0330  -0.0111 0.0040  8   DG  B C6    
1139 O  O6    . DG  B 8   ? 0.1941 0.1537 0.1913 0.0318  -0.0087 0.0046  8   DG  B O6    
1140 N  N1    . DG  B 8   ? 0.1880 0.1551 0.1877 0.0362  -0.0138 0.0004  8   DG  B N1    
1141 C  C2    . DG  B 8   ? 0.2192 0.1928 0.2146 0.0368  -0.0162 -0.0011 8   DG  B C2    
1142 N  N2    . DG  B 8   ? 0.2432 0.2196 0.2409 0.0388  -0.0200 -0.0046 8   DG  B N2    
1143 N  N3    . DG  B 8   ? 0.2230 0.2019 0.2120 0.0351  -0.0148 0.0007  8   DG  B N3    
1144 C  C4    . DG  B 8   ? 0.1946 0.1730 0.1834 0.0324  -0.0124 0.0046  8   DG  B C4    
1145 P  P     . DA  B 9   ? 0.3620 0.3810 0.3141 0.0170  -0.0045 0.0150  9   DA  B P     
1146 O  OP1   . DA  B 9   ? 0.4183 0.4485 0.3624 0.0180  -0.0012 0.0112  9   DA  B OP1   
1147 O  OP2   . DA  B 9   ? 0.3518 0.3708 0.3034 0.0088  -0.0037 0.0221  9   DA  B OP2   
1148 O  "O5'" . DA  B 9   ? 0.3209 0.3220 0.2683 0.0193  -0.0109 0.0162  9   DA  B "O5'" 
1149 C  "C5'" . DA  B 9   ? 0.3057 0.3063 0.2544 0.0251  -0.0139 0.0100  9   DA  B "C5'" 
1150 C  "C4'" . DA  B 9   ? 0.2923 0.2798 0.2423 0.0275  -0.0196 0.0125  9   DA  B "C4'" 
1151 O  "O4'" . DA  B 9   ? 0.3044 0.2846 0.2650 0.0284  -0.0183 0.0117  9   DA  B "O4'" 
1152 C  "C3'" . DA  B 9   ? 0.3308 0.3085 0.2695 0.0245  -0.0224 0.0220  9   DA  B "C3'" 
1153 O  "O3'" . DA  B 9   ? 0.3839 0.3641 0.3152 0.0274  -0.0282 0.0235  9   DA  B "O3'" 
1154 C  "C2'" . DA  B 9   ? 0.3772 0.3397 0.3232 0.0261  -0.0229 0.0236  9   DA  B "C2'" 
1155 C  "C1'" . DA  B 9   ? 0.2896 0.2573 0.2494 0.0297  -0.0213 0.0155  9   DA  B "C1'" 
1156 N  N9    . DA  B 9   ? 0.2663 0.2262 0.2316 0.0283  -0.0183 0.0149  9   DA  B N9    
1157 C  C8    . DA  B 9   ? 0.2695 0.2295 0.2321 0.0224  -0.0152 0.0165  9   DA  B C8    
1158 N  N7    . DA  B 9   ? 0.2561 0.2094 0.2221 0.0217  -0.0135 0.0149  9   DA  B N7    
1159 C  C5    . DA  B 9   ? 0.2517 0.2006 0.2248 0.0281  -0.0143 0.0119  9   DA  B C5    
1160 C  C6    . DA  B 9   ? 0.2406 0.1837 0.2200 0.0303  -0.0117 0.0088  9   DA  B C6    
1161 N  N6    . DA  B 9   ? 0.2667 0.2049 0.2424 0.0261  -0.0082 0.0082  9   DA  B N6    
1162 N  N1    . DA  B 9   ? 0.2438 0.1882 0.2329 0.0363  -0.0128 0.0065  9   DA  B N1    
1163 C  C2    . DA  B 9   ? 0.2445 0.1952 0.2353 0.0395  -0.0177 0.0071  9   DA  B C2    
1164 N  N3    . DA  B 9   ? 0.2940 0.2493 0.2763 0.0376  -0.0207 0.0096  9   DA  B N3    
1165 C  C4    . DA  B 9   ? 0.2554 0.2093 0.2295 0.0321  -0.0179 0.0119  9   DA  B C4    
1166 P  P     . DG  B 10  ? 0.3897 0.3603 0.3071 0.0260  -0.0325 0.0356  10  DG  B P     
1167 O  OP1   . DG  B 10  ? 0.4579 0.4406 0.3639 0.0266  -0.0374 0.0356  10  DG  B OP1   
1168 O  OP2   . DG  B 10  ? 0.3917 0.3534 0.3013 0.0185  -0.0277 0.0429  10  DG  B OP2   
1169 O  "O5'" . DG  B 10  ? 0.3958 0.3542 0.3242 0.0333  -0.0375 0.0377  10  DG  B "O5'" 
1170 C  "C5'" . DG  B 10  ? 0.4063 0.3738 0.3453 0.0395  -0.0429 0.0322  10  DG  B "C5'" 
1171 C  "C4'" . DG  B 10  ? 0.3694 0.3271 0.3219 0.0466  -0.0453 0.0347  10  DG  B "C4'" 
1172 O  "O4'" . DG  B 10  ? 0.4133 0.3643 0.3758 0.0457  -0.0380 0.0285  10  DG  B "O4'" 
1173 C  "C3'" . DG  B 10  ? 0.3860 0.3268 0.3315 0.0492  -0.0475 0.0468  10  DG  B "C3'" 
1174 O  "O3'" . DG  B 10  ? 0.4575 0.4019 0.4132 0.0588  -0.0555 0.0510  10  DG  B "O3'" 
1175 C  "C2'" . DG  B 10  ? 0.4284 0.3512 0.3782 0.0476  -0.0393 0.0445  10  DG  B "C2'" 
1176 C  "C1'" . DG  B 10  ? 0.4162 0.3498 0.3811 0.0488  -0.0360 0.0331  10  DG  B "C1'" 
1177 N  N9    . DG  B 10  ? 0.3566 0.2819 0.3214 0.0436  -0.0282 0.0283  10  DG  B N9    
1178 C  C8    . DG  B 10  ? 0.3233 0.2467 0.2774 0.0347  -0.0245 0.0289  10  DG  B C8    
1179 N  N7    . DG  B 10  ? 0.3130 0.2310 0.2690 0.0310  -0.0194 0.0246  10  DG  B N7    
1180 C  C5    . DG  B 10  ? 0.2991 0.2142 0.2664 0.0379  -0.0182 0.0204  10  DG  B C5    
1181 C  C6    . DG  B 10  ? 0.2455 0.1553 0.2171 0.0373  -0.0126 0.0147  10  DG  B C6    
1182 O  O6    . DG  B 10  ? 0.2941 0.2001 0.2587 0.0301  -0.0089 0.0125  10  DG  B O6    
1183 N  N1    . DG  B 10  ? 0.2693 0.1804 0.2541 0.0454  -0.0115 0.0119  10  DG  B N1    
1184 C  C2    . DG  B 10  ? 0.2951 0.2134 0.2899 0.0532  -0.0168 0.0144  10  DG  B C2    
1185 N  N2    . DG  B 10  ? 0.3202 0.2426 0.3307 0.0601  -0.0145 0.0111  10  DG  B N2    
1186 N  N3    . DG  B 10  ? 0.3271 0.2505 0.3167 0.0538  -0.0238 0.0201  10  DG  B N3    
1187 C  C4    . DG  B 10  ? 0.3163 0.2370 0.2912 0.0458  -0.0234 0.0226  10  DG  B C4    
1188 P  P     . DT  B 11  ? 0.5179 0.4474 0.4679 0.0652  -0.0611 0.0661  11  DT  B P     
1189 O  OP1   . DT  B 11  ? 0.6340 0.5819 0.5907 0.0722  -0.0727 0.0699  11  DT  B OP1   
1190 O  OP2   . DT  B 11  ? 0.5097 0.4247 0.4381 0.0568  -0.0580 0.0745  11  DT  B OP2   
1191 O  "O5'" . DT  B 11  ? 0.5363 0.4488 0.5033 0.0730  -0.0554 0.0639  11  DT  B "O5'" 
1192 C  "C5'" . DT  B 11  ? 0.5203 0.4468 0.5091 0.0788  -0.0547 0.0546  11  DT  B "C5'" 
1193 C  "C4'" . DT  B 11  ? 0.4934 0.4035 0.4925 0.0823  -0.0449 0.0491  11  DT  B "C4'" 
1194 O  "O4'" . DT  B 11  ? 0.4626 0.3657 0.4513 0.0714  -0.0364 0.0415  11  DT  B "O4'" 
1195 C  "C3'" . DT  B 11  ? 0.6040 0.4876 0.6010 0.0894  -0.0432 0.0576  11  DT  B "C3'" 
1196 O  "O3'" . DT  B 11  ? 0.7056 0.5903 0.7252 0.1023  -0.0411 0.0551  11  DT  B "O3'" 
1197 C  "C2'" . DT  B 11  ? 0.6024 0.4640 0.5847 0.0789  -0.0332 0.0525  11  DT  B "C2'" 
1198 C  "C1'" . DT  B 11  ? 0.4767 0.3564 0.4639 0.0724  -0.0288 0.0404  11  DT  B "C1'" 
1199 N  N1    . DT  B 11  ? 0.3604 0.2317 0.3332 0.0599  -0.0225 0.0356  11  DT  B N1    
1200 C  C2    . DT  B 11  ? 0.3482 0.2156 0.3248 0.0579  -0.0146 0.0261  11  DT  B C2    
1201 O  O2    . DT  B 11  ? 0.3756 0.2463 0.3666 0.0656  -0.0114 0.0213  11  DT  B O2    
1202 N  N3    . DT  B 11  ? 0.3160 0.1778 0.2793 0.0460  -0.0107 0.0229  11  DT  B N3    
1203 C  C4    . DT  B 11  ? 0.3153 0.1770 0.2653 0.0364  -0.0131 0.0279  11  DT  B C4    
1204 O  O4    . DT  B 11  ? 0.3476 0.2078 0.2890 0.0259  -0.0100 0.0248  11  DT  B O4    
1205 C  C5    . DT  B 11  ? 0.3229 0.1880 0.2692 0.0389  -0.0196 0.0376  11  DT  B C5    
1206 C  C7    . DT  B 11  ? 0.3520 0.2190 0.2839 0.0284  -0.0208 0.0437  11  DT  B C7    
1207 C  C6    . DT  B 11  ? 0.3610 0.2300 0.3174 0.0504  -0.0245 0.0412  11  DT  B C6    
1208 P  P     . DG  B 12  ? 0.7560 0.6197 0.7829 0.1166  -0.0424 0.0655  12  DG  B P     
1209 O  OP1   . DG  B 12  ? 0.8941 0.7827 0.9420 0.1291  -0.0529 0.0718  12  DG  B OP1   
1210 O  OP2   . DG  B 12  ? 0.7491 0.5854 0.7526 0.1107  -0.0432 0.0755  12  DG  B OP2   
1211 O  "O5'" . DG  B 12  ? 0.6443 0.4914 0.6822 0.1213  -0.0283 0.0539  12  DG  B "O5'" 
1212 C  "C5'" . DG  B 12  ? 0.5473 0.4160 0.6052 0.1244  -0.0231 0.0428  12  DG  B "C5'" 
1213 C  "C4'" . DG  B 12  ? 0.5254 0.3746 0.5802 0.1220  -0.0080 0.0307  12  DG  B "C4'" 
1214 O  "O4'" . DG  B 12  ? 0.5088 0.3556 0.5425 0.1050  -0.0051 0.0246  12  DG  B "O4'" 
1215 C  "C3'" . DG  B 12  ? 0.6297 0.4414 0.6767 0.1278  -0.0022 0.0330  12  DG  B "C3'" 
1216 O  "O3'" . DG  B 12  ? 0.7035 0.5142 0.7737 0.1441  0.0033  0.0300  12  DG  B "O3'" 
1217 C  "C2'" . DG  B 12  ? 0.6688 0.4610 0.6946 0.1133  0.0083  0.0216  12  DG  B "C2'" 
1218 C  "C1'" . DG  B 12  ? 0.5947 0.4127 0.6136 0.0998  0.0047  0.0185  12  DG  B "C1'" 
1219 N  N9    . DG  B 12  ? 0.5063 0.3146 0.5019 0.0851  0.0015  0.0216  12  DG  B N9    
1220 C  C8    . DG  B 12  ? 0.4492 0.2602 0.4353 0.0809  -0.0080 0.0328  12  DG  B C8    
1221 N  N7    . DG  B 12  ? 0.4295 0.2322 0.3967 0.0666  -0.0070 0.0324  12  DG  B N7    
1222 C  C5    . DG  B 12  ? 0.4010 0.1950 0.3643 0.0609  0.0023  0.0205  12  DG  B C5    
1223 C  C6    . DG  B 12  ? 0.3693 0.1562 0.3159 0.0456  0.0059  0.0150  12  DG  B C6    
1224 O  O6    . DG  B 12  ? 0.3753 0.1625 0.3093 0.0339  0.0024  0.0197  12  DG  B O6    
1225 N  N1    . DG  B 12  ? 0.3642 0.1447 0.3094 0.0440  0.0147  0.0030  12  DG  B N1    
1226 C  C2    . DG  B 12  ? 0.3989 0.1800 0.3579 0.0560  0.0211  -0.0033 12  DG  B C2    
1227 N  N2    . DG  B 12  ? 0.4146 0.1902 0.3671 0.0514  0.0305  -0.0152 12  DG  B N2    
1228 N  N3    . DG  B 12  ? 0.4010 0.1908 0.3793 0.0708  0.0184  0.0018  12  DG  B N3    
1229 C  C4    . DG  B 12  ? 0.4329 0.2289 0.4118 0.0722  0.0081  0.0138  12  DG  B C4    
1230 P  P     . DT  B 13  ? 0.8281 0.6064 0.8952 0.1495  0.0056  0.0303  13  DT  B P     
1231 O  OP1   . DT  B 13  ? 0.9079 0.7003 1.0008 0.1657  0.0066  0.0268  13  DT  B OP1   
1232 O  OP2   . DT  B 13  ? 0.8300 0.5918 0.8819 0.1455  -0.0047 0.0456  13  DT  B OP2   
1233 O  "O5'" . DT  B 13  ? 0.8035 0.5552 0.8511 0.1376  0.0202  0.0155  13  DT  B "O5'" 
1234 C  "C5'" . DT  B 13  ? 0.7402 0.5019 0.7935 0.1372  0.0326  0.0001  13  DT  B "C5'" 
1235 C  "C4'" . DT  B 13  ? 0.7205 0.4539 0.7491 0.1239  0.0436  -0.0121 13  DT  B "C4'" 
1236 O  "O4'" . DT  B 13  ? 0.6478 0.3798 0.6544 0.1083  0.0420  -0.0109 13  DT  B "O4'" 
1237 C  "C3'" . DT  B 13  ? 0.7124 0.4102 0.7294 0.1220  0.0432  -0.0106 13  DT  B "C3'" 
1238 O  "O3'" . DT  B 13  ? 0.8477 0.5371 0.8781 0.1343  0.0500  -0.0187 13  DT  B "O3'" 
1239 C  "C2'" . DT  B 13  ? 0.6268 0.3050 0.6147 0.1024  0.0496  -0.0198 13  DT  B "C2'" 
1240 C  "C1'" . DT  B 13  ? 0.6056 0.3066 0.5870 0.0947  0.0462  -0.0167 13  DT  B "C1'" 
1241 N  N1    . DT  B 13  ? 0.4993 0.1961 0.4645 0.0827  0.0360  -0.0054 13  DT  B N1    
1242 C  C2    . DT  B 13  ? 0.4944 0.1845 0.4367 0.0628  0.0368  -0.0108 13  DT  B C2    
1243 O  O2    . DT  B 13  ? 0.5343 0.2173 0.4656 0.0549  0.0453  -0.0243 13  DT  B O2    
1244 N  N3    . DT  B 13  ? 0.4465 0.1412 0.3790 0.0521  0.0271  0.0003  13  DT  B N3    
1245 C  C4    . DT  B 13  ? 0.4489 0.1521 0.3887 0.0586  0.0175  0.0155  13  DT  B C4    
1246 O  O4    . DT  B 13  ? 0.4798 0.1863 0.4085 0.0478  0.0110  0.0242  13  DT  B O4    
1247 C  C5    . DT  B 13  ? 0.5130 0.2224 0.4742 0.0789  0.0157  0.0207  13  DT  B C5    
1248 C  C7    . DT  B 13  ? 0.5490 0.2691 0.5167 0.0865  0.0041  0.0375  13  DT  B C7    
1249 C  C6    . DT  B 13  ? 0.5412 0.2478 0.5157 0.0901  0.0248  0.0103  13  DT  B C6    
1250 O  "O5'" . DT  C 1   ? 0.7357 0.6354 0.7876 -0.0635 -0.0620 0.1818  1   DT  C "O5'" 
1251 C  "C5'" . DT  C 1   ? 0.6234 0.4898 0.6520 -0.0651 -0.0581 0.1662  1   DT  C "C5'" 
1252 C  "C4'" . DT  C 1   ? 0.5112 0.3560 0.5125 -0.0805 -0.0649 0.1462  1   DT  C "C4'" 
1253 O  "O4'" . DT  C 1   ? 0.4722 0.2902 0.4542 -0.0720 -0.0537 0.1272  1   DT  C "O4'" 
1254 C  "C3'" . DT  C 1   ? 0.4265 0.2905 0.4231 -0.0766 -0.0680 0.1396  1   DT  C "C3'" 
1255 O  "O3'" . DT  C 1   ? 0.4989 0.3432 0.4722 -0.1006 -0.0795 0.1306  1   DT  C "O3'" 
1256 C  "C2'" . DT  C 1   ? 0.4005 0.2621 0.3870 -0.0551 -0.0545 0.1228  1   DT  C "C2'" 
1257 C  "C1'" . DT  C 1   ? 0.4216 0.2472 0.3933 -0.0608 -0.0488 0.1116  1   DT  C "C1'" 
1258 N  N1    . DT  C 1   ? 0.4191 0.2429 0.3950 -0.0375 -0.0363 0.1041  1   DT  C N1    
1259 C  C2    . DT  C 1   ? 0.4307 0.2312 0.3932 -0.0361 -0.0276 0.0836  1   DT  C C2    
1260 O  O2    . DT  C 1   ? 0.4371 0.2147 0.3783 -0.0536 -0.0271 0.0700  1   DT  C O2    
1261 N  N3    . DT  C 1   ? 0.4299 0.2346 0.4045 -0.0135 -0.0192 0.0801  1   DT  C N3    
1262 C  C4    . DT  C 1   ? 0.4614 0.2867 0.4521 0.0060  -0.0201 0.0944  1   DT  C C4    
1263 O  O4    . DT  C 1   ? 0.5109 0.3372 0.5103 0.0245  -0.0157 0.0912  1   DT  C O4    
1264 C  C5    . DT  C 1   ? 0.4799 0.3248 0.4767 0.0028  -0.0265 0.1140  1   DT  C C5    
1265 C  C7    . DT  C 1   ? 0.5156 0.3789 0.5220 0.0219  -0.0249 0.1298  1   DT  C C7    
1266 C  C6    . DT  C 1   ? 0.4498 0.2948 0.4431 -0.0179 -0.0335 0.1181  1   DT  C C6    
1267 P  P     . DA  C 2   ? 0.4824 0.3368 0.4435 -0.1038 -0.0853 0.1237  2   DA  C P     
1268 O  OP1   . DA  C 2   ? 0.5298 0.3821 0.4905 -0.1297 -0.1058 0.1365  2   DA  C OP1   
1269 O  OP2   . DA  C 2   ? 0.4401 0.3253 0.4189 -0.0792 -0.0766 0.1253  2   DA  C OP2   
1270 O  "O5'" . DA  C 2   ? 0.5350 0.3564 0.4591 -0.1081 -0.0760 0.0978  2   DA  C "O5'" 
1271 C  "C5'" . DA  C 2   ? 0.5275 0.3089 0.4229 -0.1293 -0.0777 0.0879  2   DA  C "C5'" 
1272 C  "C4'" . DA  C 2   ? 0.5148 0.2693 0.3769 -0.1310 -0.0645 0.0631  2   DA  C "C4'" 
1273 O  "O4'" . DA  C 2   ? 0.5276 0.2847 0.4040 -0.1064 -0.0452 0.0524  2   DA  C "O4'" 
1274 C  "C3'" . DA  C 2   ? 0.5908 0.3585 0.4423 -0.1322 -0.0674 0.0595  2   DA  C "C3'" 
1275 O  "O3'" . DA  C 2   ? 0.6804 0.4110 0.4877 -0.1516 -0.0635 0.0422  2   DA  C "O3'" 
1276 C  "C2'" . DA  C 2   ? 0.5304 0.3236 0.4058 -0.1032 -0.0522 0.0533  2   DA  C "C2'" 
1277 C  "C1'" . DA  C 2   ? 0.5249 0.3003 0.4051 -0.0923 -0.0374 0.0434  2   DA  C "C1'" 
1278 N  N9    . DA  C 2   ? 0.4636 0.2662 0.3762 -0.0646 -0.0308 0.0482  2   DA  C N9    
1279 C  C8    . DA  C 2   ? 0.4267 0.2578 0.3643 -0.0526 -0.0378 0.0671  2   DA  C C8    
1280 N  N7    . DA  C 2   ? 0.3937 0.2392 0.3490 -0.0295 -0.0304 0.0669  2   DA  C N7    
1281 C  C5    . DA  C 2   ? 0.3776 0.2063 0.3264 -0.0254 -0.0190 0.0477  2   DA  C C5    
1282 C  C6    . DA  C 2   ? 0.3689 0.2039 0.3339 -0.0048 -0.0101 0.0398  2   DA  C C6    
1283 N  N6    . DA  C 2   ? 0.3636 0.2206 0.3471 0.0148  -0.0137 0.0505  2   DA  C N6    
1284 N  N1    . DA  C 2   ? 0.3848 0.2017 0.3463 -0.0056 0.0025  0.0210  2   DA  C N1    
1285 C  C2    . DA  C 2   ? 0.4113 0.2016 0.3467 -0.0262 0.0076  0.0099  2   DA  C C2    
1286 N  N3    . DA  C 2   ? 0.4644 0.2433 0.3751 -0.0483 -0.0020 0.0154  2   DA  C N3    
1287 C  C4    . DA  C 2   ? 0.4051 0.2067 0.3279 -0.0462 -0.0164 0.0354  2   DA  C C4    
1288 P  P     . DC  C 3   ? 0.7308 0.4633 0.5149 -0.1612 -0.0685 0.0392  3   DC  C P     
1289 O  OP1   . DC  C 3   ? 0.8000 0.4861 0.5304 -0.1901 -0.0711 0.0279  3   DC  C OP1   
1290 O  OP2   . DC  C 3   ? 0.6933 0.4653 0.5081 -0.1552 -0.0855 0.0611  3   DC  C OP2   
1291 O  "O5'" . DC  C 3   ? 0.6389 0.3801 0.4320 -0.1392 -0.0450 0.0221  3   DC  C "O5'" 
1292 C  "C5'" . DC  C 3   ? 0.6467 0.3610 0.4283 -0.1354 -0.0233 0.0019  3   DC  C "C5'" 
1293 C  "C4'" . DC  C 3   ? 0.5844 0.3212 0.3934 -0.1108 -0.0063 -0.0078 3   DC  C "C4'" 
1294 O  "O4'" . DC  C 3   ? 0.5198 0.2905 0.3712 -0.0875 -0.0106 0.0042  3   DC  C "O4'" 
1295 C  "C3'" . DC  C 3   ? 0.5911 0.3451 0.3971 -0.1106 -0.0072 -0.0087 3   DC  C "C3'" 
1296 O  "O3'" . DC  C 3   ? 0.6195 0.3528 0.4094 -0.1125 0.0149  -0.0294 3   DC  C "O3'" 
1297 C  "C2'" . DC  C 3   ? 0.5247 0.3223 0.3755 -0.0849 -0.0109 0.0009  3   DC  C "C2'" 
1298 C  "C1'" . DC  C 3   ? 0.4644 0.2613 0.3363 -0.0704 -0.0044 -0.0002 3   DC  C "C1'" 
1299 N  N1    . DC  C 3   ? 0.4039 0.2342 0.3104 -0.0492 -0.0118 0.0136  3   DC  C N1    
1300 C  C2    . DC  C 3   ? 0.3771 0.2199 0.3086 -0.0278 -0.0027 0.0073  3   DC  C C2    
1301 O  O2    . DC  C 3   ? 0.4194 0.2494 0.3516 -0.0258 0.0118  -0.0090 3   DC  C O2    
1302 N  N3    . DC  C 3   ? 0.3339 0.2016 0.2879 -0.0101 -0.0098 0.0198  3   DC  C N3    
1303 C  C4    . DC  C 3   ? 0.3450 0.2255 0.2999 -0.0126 -0.0214 0.0372  3   DC  C C4    
1304 N  N4    . DC  C 3   ? 0.3322 0.2333 0.3043 0.0045  -0.0247 0.0483  3   DC  C N4    
1305 C  C5    . DC  C 3   ? 0.3590 0.2306 0.2974 -0.0333 -0.0301 0.0446  3   DC  C C5    
1306 C  C6    . DC  C 3   ? 0.4175 0.2637 0.3305 -0.0516 -0.0270 0.0328  3   DC  C C6    
1307 P  P     . DA  C 4   ? 0.6365 0.3779 0.4186 -0.1149 0.0207  -0.0350 4   DA  C P     
1308 O  OP1   . DA  C 4   ? 0.6595 0.3599 0.4021 -0.1311 0.0417  -0.0540 4   DA  C OP1   
1309 O  OP2   . DA  C 4   ? 0.5649 0.3261 0.3463 -0.1202 -0.0014 -0.0168 4   DA  C OP2   
1310 O  "O5'" . DA  C 4   ? 0.5756 0.3495 0.4050 -0.0880 0.0323  -0.0411 4   DA  C "O5'" 
1311 C  "C5'" . DA  C 4   ? 0.5918 0.3602 0.4418 -0.0752 0.0499  -0.0535 4   DA  C "C5'" 
1312 C  "C4'" . DA  C 4   ? 0.5593 0.3632 0.4546 -0.0523 0.0535  -0.0557 4   DA  C "C4'" 
1313 O  "O4'" . DA  C 4   ? 0.4931 0.3250 0.4138 -0.0363 0.0357  -0.0403 4   DA  C "O4'" 
1314 C  "C3'" . DA  C 4   ? 0.5538 0.3730 0.4498 -0.0548 0.0539  -0.0580 4   DA  C "C3'" 
1315 O  "O3'" . DA  C 4   ? 0.6297 0.4554 0.5518 -0.0458 0.0727  -0.0727 4   DA  C "O3'" 
1316 C  "C2'" . DA  C 4   ? 0.4960 0.3491 0.4125 -0.0423 0.0331  -0.0424 4   DA  C "C2'" 
1317 C  "C1'" . DA  C 4   ? 0.4176 0.2804 0.3576 -0.0260 0.0282  -0.0365 4   DA  C "C1'" 
1318 N  N9    . DA  C 4   ? 0.3605 0.2405 0.3044 -0.0201 0.0100  -0.0186 4   DA  C N9    
1319 C  C8    . DA  C 4   ? 0.3770 0.2514 0.3012 -0.0329 -0.0020 -0.0053 4   DA  C C8    
1320 N  N7    . DA  C 4   ? 0.3764 0.2701 0.3147 -0.0228 -0.0134 0.0099  4   DA  C N7    
1321 C  C5    . DA  C 4   ? 0.3100 0.2202 0.2719 -0.0029 -0.0101 0.0059  4   DA  C C5    
1322 C  C6    . DA  C 4   ? 0.2730 0.2032 0.2511 0.0142  -0.0169 0.0163  4   DA  C C6    
1323 N  N6    . DA  C 4   ? 0.3027 0.2415 0.2798 0.0151  -0.0249 0.0326  4   DA  C N6    
1324 N  N1    . DA  C 4   ? 0.2659 0.2065 0.2615 0.0300  -0.0148 0.0096  4   DA  C N1    
1325 C  C2    . DA  C 4   ? 0.2715 0.2073 0.2765 0.0300  -0.0057 -0.0056 4   DA  C C2    
1326 N  N3    . DA  C 4   ? 0.2872 0.2051 0.2820 0.0159  0.0056  -0.0172 4   DA  C N3    
1327 C  C4    . DA  C 4   ? 0.3329 0.2367 0.3017 -0.0008 0.0024  -0.0108 4   DA  C C4    
1328 P  P     . DC  C 5   ? 0.7120 0.5483 0.6384 -0.0499 0.0803  -0.0796 5   DC  C P     
1329 O  OP1   . DC  C 5   ? 0.7714 0.5946 0.7095 -0.0506 0.1079  -0.0970 5   DC  C OP1   
1330 O  OP2   . DC  C 5   ? 0.7029 0.5319 0.5940 -0.0661 0.0684  -0.0703 5   DC  C OP2   
1331 O  "O5'" . DC  C 5   ? 0.7040 0.5811 0.6749 -0.0291 0.0669  -0.0742 5   DC  C "O5'" 
1332 C  "C5'" . DC  C 5   ? 0.6242 0.5166 0.6336 -0.0108 0.0682  -0.0768 5   DC  C "C5'" 
1333 C  "C4'" . DC  C 5   ? 0.4725 0.3981 0.5079 0.0049  0.0492  -0.0686 5   DC  C "C4'" 
1334 O  "O4'" . DC  C 5   ? 0.4262 0.3532 0.4418 0.0060  0.0319  -0.0534 5   DC  C "O4'" 
1335 C  "C3'" . DC  C 5   ? 0.3993 0.3403 0.4414 0.0019  0.0472  -0.0724 5   DC  C "C3'" 
1336 O  "O3'" . DC  C 5   ? 0.3742 0.3380 0.4582 0.0148  0.0469  -0.0789 5   DC  C "O3'" 
1337 C  "C2'" . DC  C 5   ? 0.3350 0.2856 0.3606 0.0042  0.0274  -0.0585 5   DC  C "C2'" 
1338 C  "C1'" . DC  C 5   ? 0.3237 0.2733 0.3482 0.0136  0.0189  -0.0483 5   DC  C "C1'" 
1339 N  N1    . DC  C 5   ? 0.2749 0.2232 0.2778 0.0114  0.0064  -0.0331 5   DC  C N1    
1340 C  C2    . DC  C 5   ? 0.2456 0.2100 0.2574 0.0262  -0.0057 -0.0233 5   DC  C C2    
1341 O  O2    . DC  C 5   ? 0.2907 0.2685 0.3238 0.0394  -0.0085 -0.0275 5   DC  C O2    
1342 N  N3    . DC  C 5   ? 0.2425 0.2069 0.2403 0.0252  -0.0136 -0.0089 5   DC  C N3    
1343 C  C4    . DC  C 5   ? 0.2510 0.2028 0.2303 0.0102  -0.0137 -0.0030 5   DC  C C4    
1344 N  N4    . DC  C 5   ? 0.2469 0.2026 0.2213 0.0104  -0.0219 0.0127  5   DC  C N4    
1345 C  C5    . DC  C 5   ? 0.2686 0.2017 0.2332 -0.0064 -0.0051 -0.0123 5   DC  C C5    
1346 C  C6    . DC  C 5   ? 0.3094 0.2403 0.2847 -0.0050 0.0067  -0.0279 5   DC  C C6    
1347 P  P     . DT  C 6   ? 0.3884 0.3698 0.4913 0.0125  0.0464  -0.0861 6   DT  C P     
1348 O  OP1   . DT  C 6   ? 0.4237 0.4214 0.5744 0.0213  0.0534  -0.0952 6   DT  C OP1   
1349 O  OP2   . DT  C 6   ? 0.4401 0.4047 0.5124 -0.0052 0.0551  -0.0878 6   DT  C OP2   
1350 O  "O5'" . DT  C 6   ? 0.3217 0.3216 0.4229 0.0232  0.0221  -0.0765 6   DT  C "O5'" 
1351 C  "C5'" . DT  C 6   ? 0.2770 0.2913 0.3958 0.0394  0.0082  -0.0710 6   DT  C "C5'" 
1352 C  "C4'" . DT  C 6   ? 0.2898 0.3120 0.3913 0.0457  -0.0100 -0.0622 6   DT  C "C4'" 
1353 O  "O4'" . DT  C 6   ? 0.3048 0.3124 0.3732 0.0412  -0.0099 -0.0512 6   DT  C "O4'" 
1354 C  "C3'" . DT  C 6   ? 0.2773 0.3064 0.3779 0.0405  -0.0137 -0.0680 6   DT  C "C3'" 
1355 O  "O3'" . DT  C 6   ? 0.3101 0.3575 0.4332 0.0501  -0.0277 -0.0718 6   DT  C "O3'" 
1356 C  "C2'" . DT  C 6   ? 0.2912 0.3111 0.3577 0.0392  -0.0190 -0.0574 6   DT  C "C2'" 
1357 C  "C1'" . DT  C 6   ? 0.2636 0.2764 0.3178 0.0439  -0.0198 -0.0458 6   DT  C "C1'" 
1358 N  N1    . DT  C 6   ? 0.2733 0.2725 0.3015 0.0357  -0.0172 -0.0352 6   DT  C N1    
1359 C  C2    . DT  C 6   ? 0.2179 0.2192 0.2341 0.0432  -0.0246 -0.0224 6   DT  C C2    
1360 O  O2    . DT  C 6   ? 0.2819 0.2921 0.3002 0.0558  -0.0321 -0.0202 6   DT  C O2    
1361 N  N3    . DT  C 6   ? 0.2302 0.2221 0.2312 0.0348  -0.0230 -0.0115 6   DT  C N3    
1362 C  C4    . DT  C 6   ? 0.2380 0.2167 0.2292 0.0193  -0.0179 -0.0117 6   DT  C C4    
1363 O  O4    . DT  C 6   ? 0.2552 0.2274 0.2348 0.0120  -0.0208 0.0004  6   DT  C O4    
1364 C  C5    . DT  C 6   ? 0.2610 0.2339 0.2571 0.0113  -0.0087 -0.0263 6   DT  C C5    
1365 C  C7    . DT  C 6   ? 0.3036 0.2572 0.2809 -0.0073 -0.0011 -0.0279 6   DT  C C7    
1366 C  C6    . DT  C 6   ? 0.2407 0.2253 0.2581 0.0204  -0.0075 -0.0373 6   DT  C C6    
1367 P  P     . DC  C 7   ? 0.3250 0.3810 0.4551 0.0454  -0.0346 -0.0809 7   DC  C P     
1368 O  OP1   . DC  C 7   ? 0.3544 0.4303 0.5214 0.0519  -0.0464 -0.0865 7   DC  C OP1   
1369 O  OP2   . DC  C 7   ? 0.3592 0.4049 0.4850 0.0306  -0.0190 -0.0866 7   DC  C OP2   
1370 O  "O5'" . DC  C 7   ? 0.3283 0.3781 0.4241 0.0509  -0.0462 -0.0737 7   DC  C "O5'" 
1371 C  "C5'" . DC  C 7   ? 0.3392 0.3928 0.4244 0.0637  -0.0602 -0.0663 7   DC  C "C5'" 
1372 C  "C4'" . DC  C 7   ? 0.3200 0.3620 0.3695 0.0666  -0.0611 -0.0590 7   DC  C "C4'" 
1373 O  "O4'" . DC  C 7   ? 0.2808 0.3125 0.3181 0.0628  -0.0489 -0.0492 7   DC  C "O4'" 
1374 C  "C3'" . DC  C 7   ? 0.3457 0.3819 0.3859 0.0602  -0.0604 -0.0672 7   DC  C "C3'" 
1375 O  "O3'" . DC  C 7   ? 0.3987 0.4334 0.4217 0.0670  -0.0732 -0.0702 7   DC  C "O3'" 
1376 C  "C2'" . DC  C 7   ? 0.3851 0.4082 0.4059 0.0571  -0.0485 -0.0579 7   DC  C "C2'" 
1377 C  "C1'" . DC  C 7   ? 0.2896 0.3127 0.3057 0.0624  -0.0464 -0.0449 7   DC  C "C1'" 
1378 N  N1    . DC  C 7   ? 0.2269 0.2415 0.2377 0.0543  -0.0363 -0.0365 7   DC  C N1    
1379 C  C2    . DC  C 7   ? 0.2356 0.2456 0.2322 0.0586  -0.0345 -0.0225 7   DC  C C2    
1380 O  O2    . DC  C 7   ? 0.2757 0.2874 0.2620 0.0697  -0.0382 -0.0180 7   DC  C O2    
1381 N  N3    . DC  C 7   ? 0.2175 0.2209 0.2116 0.0499  -0.0292 -0.0132 7   DC  C N3    
1382 C  C4    . DC  C 7   ? 0.2168 0.2143 0.2144 0.0367  -0.0250 -0.0180 7   DC  C C4    
1383 N  N4    . DC  C 7   ? 0.2189 0.2078 0.2089 0.0269  -0.0232 -0.0071 7   DC  C N4    
1384 C  C5    . DC  C 7   ? 0.2175 0.2173 0.2268 0.0322  -0.0227 -0.0333 7   DC  C C5    
1385 C  C6    . DC  C 7   ? 0.2264 0.2369 0.2462 0.0415  -0.0288 -0.0420 7   DC  C C6    
1386 P  P     . DC  C 8   ? 0.4255 0.4487 0.4331 0.0622  -0.0732 -0.0798 8   DC  C P     
1387 O  OP1   . DC  C 8   ? 0.5083 0.5344 0.5104 0.0647  -0.0914 -0.0886 8   DC  C OP1   
1388 O  OP2   . DC  C 8   ? 0.4687 0.4885 0.4910 0.0504  -0.0618 -0.0848 8   DC  C OP2   
1389 O  "O5'" . DC  C 8   ? 0.4071 0.4150 0.3818 0.0700  -0.0644 -0.0692 8   DC  C "O5'" 
1390 C  "C5'" . DC  C 8   ? 0.3527 0.3589 0.3064 0.0811  -0.0685 -0.0603 8   DC  C "C5'" 
1391 C  "C4'" . DC  C 8   ? 0.3722 0.3653 0.3039 0.0869  -0.0548 -0.0504 8   DC  C "C4'" 
1392 O  "O4'" . DC  C 8   ? 0.3674 0.3645 0.3154 0.0832  -0.0442 -0.0387 8   DC  C "O4'" 
1393 C  "C3'" . DC  C 8   ? 0.4149 0.3922 0.3323 0.0855  -0.0482 -0.0589 8   DC  C "C3'" 
1394 O  "O3'" . DC  C 8   ? 0.4592 0.4226 0.3452 0.0956  -0.0422 -0.0553 8   DC  C "O3'" 
1395 C  "C2'" . DC  C 8   ? 0.4095 0.3860 0.3452 0.0799  -0.0355 -0.0517 8   DC  C "C2'" 
1396 C  "C1'" . DC  C 8   ? 0.3503 0.3375 0.2957 0.0817  -0.0330 -0.0358 8   DC  C "C1'" 
1397 N  N1    . DC  C 8   ? 0.2854 0.2763 0.2509 0.0712  -0.0289 -0.0302 8   DC  C N1    
1398 C  C2    . DC  C 8   ? 0.2688 0.2583 0.2381 0.0711  -0.0215 -0.0142 8   DC  C C2    
1399 O  O2    . DC  C 8   ? 0.3049 0.2922 0.2667 0.0809  -0.0156 -0.0047 8   DC  C O2    
1400 N  N3    . DC  C 8   ? 0.2556 0.2454 0.2365 0.0596  -0.0209 -0.0089 8   DC  C N3    
1401 C  C4    . DC  C 8   ? 0.2313 0.2214 0.2183 0.0492  -0.0233 -0.0196 8   DC  C C4    
1402 N  N4    . DC  C 8   ? 0.2379 0.2236 0.2282 0.0367  -0.0214 -0.0141 8   DC  C N4    
1403 C  C5    . DC  C 8   ? 0.2349 0.2292 0.2250 0.0501  -0.0280 -0.0358 8   DC  C C5    
1404 C  C6    . DC  C 8   ? 0.2877 0.2832 0.2677 0.0609  -0.0327 -0.0401 8   DC  C C6    
1405 P  P     . DC  C 9   ? 0.5607 0.5009 0.4221 0.0968  -0.0348 -0.0668 9   DC  C P     
1406 O  OP1   . DC  C 9   ? 0.6183 0.5441 0.4395 0.1060  -0.0338 -0.0667 9   DC  C OP1   
1407 O  OP2   . DC  C 9   ? 0.6214 0.5607 0.4944 0.0856  -0.0451 -0.0831 9   DC  C OP2   
1408 O  "O5'" . DC  C 9   ? 0.4974 0.4330 0.3731 0.0996  -0.0149 -0.0554 9   DC  C "O5'" 
1409 C  "C5'" . DC  C 9   ? 0.4381 0.3767 0.3136 0.1086  -0.0027 -0.0382 9   DC  C "C5'" 
1410 C  "C4'" . DC  C 9   ? 0.3835 0.3234 0.2851 0.1081  0.0100  -0.0265 9   DC  C "C4'" 
1411 O  "O4'" . DC  C 9   ? 0.3466 0.3009 0.2748 0.0966  0.0007  -0.0229 9   DC  C "O4'" 
1412 C  "C3'" . DC  C 9   ? 0.4461 0.3666 0.3452 0.1088  0.0199  -0.0352 9   DC  C "C3'" 
1413 O  "O3'" . DC  C 9   ? 0.4921 0.4033 0.3894 0.1208  0.0394  -0.0250 9   DC  C "O3'" 
1414 C  "C2'" . DC  C 9   ? 0.4204 0.3480 0.3496 0.0979  0.0156  -0.0312 9   DC  C "C2'" 
1415 C  "C1'" . DC  C 9   ? 0.3360 0.2849 0.2812 0.0935  0.0081  -0.0175 9   DC  C "C1'" 
1416 N  N1    . DC  C 9   ? 0.3156 0.2718 0.2769 0.0796  -0.0012 -0.0190 9   DC  C N1    
1417 C  C2    . DC  C 9   ? 0.2872 0.2497 0.2665 0.0736  -0.0010 -0.0027 9   DC  C C2    
1418 O  O2    . DC  C 9   ? 0.3137 0.2790 0.3018 0.0803  0.0052  0.0135  9   DC  C O2    
1419 N  N3    . DC  C 9   ? 0.2574 0.2220 0.2436 0.0598  -0.0075 -0.0046 9   DC  C N3    
1420 C  C4    . DC  C 9   ? 0.2584 0.2222 0.2412 0.0531  -0.0118 -0.0214 9   DC  C C4    
1421 N  N4    . DC  C 9   ? 0.2507 0.2151 0.2399 0.0392  -0.0140 -0.0228 9   DC  C N4    
1422 C  C5    . DC  C 9   ? 0.2722 0.2340 0.2443 0.0591  -0.0142 -0.0371 9   DC  C C5    
1423 C  C6    . DC  C 9   ? 0.3018 0.2582 0.2599 0.0719  -0.0099 -0.0355 9   DC  C C6    
1424 P  P     . DA  C 10  ? 0.5684 0.4551 0.4636 0.1262  0.0561  -0.0314 10  DA  C P     
1425 O  OP1   . DA  C 10  ? 0.6999 0.5742 0.5787 0.1408  0.0775  -0.0265 10  DA  C OP1   
1426 O  OP2   . DA  C 10  ? 0.5971 0.4686 0.4760 0.1173  0.0463  -0.0529 10  DA  C OP2   
1427 O  "O5'" . DA  C 10  ? 0.4906 0.3879 0.4294 0.1233  0.0583  -0.0141 10  DA  C "O5'" 
1428 C  "C5'" . DA  C 10  ? 0.4517 0.3690 0.4174 0.1264  0.0608  0.0088  10  DA  C "C5'" 
1429 C  "C4'" . DA  C 10  ? 0.3893 0.3149 0.3893 0.1187  0.0545  0.0228  10  DA  C "C4'" 
1430 O  "O4'" . DA  C 10  ? 0.4087 0.3420 0.4046 0.1033  0.0360  0.0163  10  DA  C "O4'" 
1431 C  "C3'" . DA  C 10  ? 0.4464 0.3521 0.4554 0.1213  0.0633  0.0194  10  DA  C "C3'" 
1432 O  "O3'" . DA  C 10  ? 0.5037 0.4114 0.5433 0.1326  0.0774  0.0388  10  DA  C "O3'" 
1433 C  "C2'" . DA  C 10  ? 0.4317 0.3398 0.4499 0.1052  0.0471  0.0196  10  DA  C "C2'" 
1434 C  "C1'" . DA  C 10  ? 0.4071 0.3358 0.4204 0.0951  0.0320  0.0219  10  DA  C "C1'" 
1435 N  N9    . DA  C 10  ? 0.3536 0.2804 0.3549 0.0810  0.0204  0.0071  10  DA  C N9    
1436 C  C8    . DA  C 10  ? 0.3436 0.2629 0.3249 0.0790  0.0181  -0.0148 10  DA  C C8    
1437 N  N7    . DA  C 10  ? 0.3571 0.2793 0.3392 0.0653  0.0087  -0.0231 10  DA  C N7    
1438 C  C5    . DA  C 10  ? 0.3222 0.2507 0.3188 0.0574  0.0055  -0.0064 10  DA  C C5    
1439 C  C6    . DA  C 10  ? 0.2811 0.2112 0.2803 0.0417  -0.0010 -0.0055 10  DA  C C6    
1440 N  N6    . DA  C 10  ? 0.2877 0.2168 0.2823 0.0321  -0.0034 -0.0222 10  DA  C N6    
1441 N  N1    . DA  C 10  ? 0.2790 0.2111 0.2855 0.0356  -0.0046 0.0131  10  DA  C N1    
1442 C  C2    . DA  C 10  ? 0.2750 0.2115 0.2935 0.0446  -0.0034 0.0309  10  DA  C C2    
1443 N  N3    . DA  C 10  ? 0.2797 0.2180 0.3041 0.0607  0.0051  0.0329  10  DA  C N3    
1444 C  C4    . DA  C 10  ? 0.2960 0.2283 0.3049 0.0663  0.0101  0.0127  10  DA  C C4    
1445 P  P     . DC  C 11  ? 0.6066 0.4919 0.6629 0.1406  0.0918  0.0395  11  DC  C P     
1446 O  OP1   . DC  C 11  ? 0.6741 0.5642 0.7591 0.1570  0.1117  0.0569  11  DC  C OP1   
1447 O  OP2   . DC  C 11  ? 0.6356 0.4933 0.6574 0.1386  0.0955  0.0128  11  DC  C OP2   
1448 O  "O5'" . DC  C 11  ? 0.5065 0.3988 0.5887 0.1278  0.0745  0.0539  11  DC  C "O5'" 
1449 C  "C5'" . DC  C 11  ? 0.4326 0.3485 0.5445 0.1237  0.0634  0.0788  11  DC  C "C5'" 
1450 C  "C4'" . DC  C 11  ? 0.4100 0.3241 0.5294 0.1083  0.0455  0.0872  11  DC  C "C4'" 
1451 O  "O4'" . DC  C 11  ? 0.3896 0.3006 0.4759 0.0934  0.0344  0.0681  11  DC  C "O4'" 
1452 C  "C3'" . DC  C 11  ? 0.4129 0.3043 0.5457 0.1122  0.0523  0.0891  11  DC  C "C3'" 
1453 O  "O3'" . DC  C 11  ? 0.4490 0.3493 0.6182 0.1108  0.0427  0.1177  11  DC  C "O3'" 
1454 C  "C2'" . DC  C 11  ? 0.4177 0.2936 0.5201 0.0967  0.0436  0.0698  11  DC  C "C2'" 
1455 C  "C1'" . DC  C 11  ? 0.3466 0.2422 0.4317 0.0829  0.0283  0.0673  11  DC  C "C1'" 
1456 N  N1    . DC  C 11  ? 0.3672 0.2562 0.4224 0.0717  0.0246  0.0429  11  DC  C N1    
1457 C  C2    . DC  C 11  ? 0.3397 0.2312 0.3858 0.0535  0.0119  0.0434  11  DC  C C2    
1458 O  O2    . DC  C 11  ? 0.3630 0.2582 0.4192 0.0461  0.0026  0.0635  11  DC  C O2    
1459 N  N3    . DC  C 11  ? 0.3212 0.2095 0.3480 0.0442  0.0105  0.0222  11  DC  C N3    
1460 C  C4    . DC  C 11  ? 0.3281 0.2124 0.3441 0.0511  0.0166  0.0020  11  DC  C C4    
1461 N  N4    . DC  C 11  ? 0.3266 0.2111 0.3308 0.0409  0.0126  -0.0167 11  DC  C N4    
1462 C  C5    . DC  C 11  ? 0.3416 0.2199 0.3582 0.0683  0.0277  0.0004  11  DC  C C5    
1463 C  C6    . DC  C 11  ? 0.3534 0.2342 0.3901 0.0786  0.0334  0.0208  11  DC  C C6    
1464 P  P     . DG  C 12  ? 0.5982 0.4791 0.7967 0.1191  0.0495  0.1302  12  DG  C P     
1465 O  OP1   . DG  C 12  ? 0.6252 0.5332 0.8570 0.1153  0.0391  0.1537  12  DG  C OP1   
1466 O  OP2   . DG  C 12  ? 0.6440 0.5012 0.8340 0.1342  0.0745  0.1102  12  DG  C OP2   
1467 O  "O5'" . DG  C 12  ? 0.5309 0.3960 0.7065 0.0996  0.0335  0.1260  12  DG  C "O5'" 
1468 C  "C5'" . DG  C 12  ? 0.5261 0.4038 0.6965 0.0816  0.0106  0.1408  12  DG  C "C5'" 
1469 C  "C4'" . DG  C 12  ? 0.5042 0.3617 0.6461 0.0641  0.0031  0.1315  12  DG  C "C4'" 
1470 O  "O4'" . DG  C 12  ? 0.5146 0.3704 0.6227 0.0580  0.0086  0.1020  12  DG  C "O4'" 
1471 C  "C3'" . DG  C 12  ? 0.5146 0.3441 0.6669 0.0697  0.0122  0.1321  12  DG  C "C3'" 
1472 O  "O3'" . DG  C 12  ? 0.5812 0.4034 0.7418 0.0589  -0.0039 0.1568  12  DG  C "O3'" 
1473 C  "C2'" . DG  C 12  ? 0.5228 0.3348 0.6406 0.0611  0.0203  0.1011  12  DG  C "C2'" 
1474 C  "C1'" . DG  C 12  ? 0.4879 0.3202 0.5802 0.0490  0.0116  0.0893  12  DG  C "C1'" 
1475 N  N9    . DG  C 12  ? 0.4567 0.2869 0.5273 0.0492  0.0207  0.0591  12  DG  C N9    
1476 C  C8    . DG  C 12  ? 0.4409 0.2681 0.5104 0.0645  0.0342  0.0436  12  DG  C C8    
1477 N  N7    . DG  C 12  ? 0.4248 0.2504 0.4713 0.0590  0.0353  0.0186  12  DG  C N7    
1478 C  C5    . DG  C 12  ? 0.3829 0.2134 0.4200 0.0404  0.0244  0.0177  12  DG  C C5    
1479 C  C6    . DG  C 12  ? 0.3712 0.2050 0.3921 0.0278  0.0212  -0.0029 12  DG  C C6    
1480 O  O6    . DG  C 12  ? 0.3767 0.2110 0.3878 0.0302  0.0235  -0.0240 12  DG  C O6    
1481 N  N1    . DG  C 12  ? 0.3666 0.2021 0.3831 0.0105  0.0147  0.0035  12  DG  C N1    
1482 C  C2    . DG  C 12  ? 0.3705 0.2024 0.3906 0.0047  0.0089  0.0269  12  DG  C C2    
1483 N  N2    . DG  C 12  ? 0.3732 0.2024 0.3797 -0.0136 0.0047  0.0288  12  DG  C N2    
1484 N  N3    . DG  C 12  ? 0.3822 0.2126 0.4183 0.0155  0.0073  0.0475  12  DG  C N3    
1485 C  C4    . DG  C 12  ? 0.4126 0.2435 0.4599 0.0338  0.0166  0.0416  12  DG  C C4    
1486 P  P     . DC  C 13  ? 0.6403 0.4384 0.8183 0.0643  0.0009  0.1660  13  DC  C P     
1487 O  OP1   . DC  C 13  ? 0.7137 0.5277 0.9012 0.0557  -0.0190 0.1900  13  DC  C OP1   
1488 O  OP2   . DC  C 13  ? 0.5915 0.3825 0.7883 0.0857  0.0242  0.1528  13  DC  C OP2   
1489 O  "O5'" . DC  C 13  ? 0.6748 0.4442 0.8190 0.0470  0.0012  0.1519  13  DC  C "O5'" 
1490 C  "C5'" . DC  C 13  ? 0.6094 0.3805 0.7242 0.0240  -0.0152 0.1573  13  DC  C "C5'" 
1491 C  "C4'" . DC  C 13  ? 0.5455 0.2997 0.6273 0.0095  -0.0068 0.1315  13  DC  C "C4'" 
1492 O  "O4'" . DC  C 13  ? 0.5306 0.2991 0.6031 0.0146  0.0039  0.1026  13  DC  C "O4'" 
1493 C  "C3'" . DC  C 13  ? 0.5318 0.2540 0.6198 0.0120  0.0046  0.1269  13  DC  C "C3'" 
1494 O  "O3'" . DC  C 13  ? 0.5925 0.2944 0.6593 -0.0082 -0.0021 0.1358  13  DC  C "O3'" 
1495 C  "C2'" . DC  C 13  ? 0.5280 0.2481 0.6052 0.0149  0.0204  0.0918  13  DC  C "C2'" 
1496 C  "C1'" . DC  C 13  ? 0.4610 0.2103 0.5207 0.0085  0.0147  0.0802  13  DC  C "C1'" 
1497 N  N1    . DC  C 13  ? 0.4480 0.2059 0.5042 0.0179  0.0249  0.0529  13  DC  C N1    
1498 C  C2    . DC  C 13  ? 0.4377 0.2025 0.4743 0.0050  0.0251  0.0301  13  DC  C C2    
1499 O  O2    . DC  C 13  ? 0.4386 0.2026 0.4626 -0.0127 0.0201  0.0329  13  DC  C O2    
1500 N  N3    . DC  C 13  ? 0.4319 0.2020 0.4640 0.0121  0.0311  0.0062  13  DC  C N3    
1501 C  C4    . DC  C 13  ? 0.4386 0.2047 0.4781 0.0305  0.0389  0.0034  13  DC  C C4    
1502 N  N4    . DC  C 13  ? 0.4394 0.2076 0.4664 0.0353  0.0430  -0.0201 13  DC  C N4    
1503 C  C5    . DC  C 13  ? 0.4491 0.2074 0.5096 0.0447  0.0434  0.0252  13  DC  C C5    
1504 C  C6    . DC  C 13  ? 0.4519 0.2080 0.5237 0.0381  0.0350  0.0501  13  DC  C C6    
1505 N  N     . ARG D 3   ? 0.7131 0.6369 0.4538 -0.0023 -0.0112 0.0283  321 ARG D N     
1506 C  CA    . ARG D 3   ? 0.6485 0.5625 0.3897 -0.0145 0.0037  0.0200  321 ARG D CA    
1507 C  C     . ARG D 3   ? 0.6225 0.5605 0.3514 -0.0319 0.0084  0.0084  321 ARG D C     
1508 O  O     . ARG D 3   ? 0.6069 0.5329 0.3038 -0.0450 0.0144  0.0161  321 ARG D O     
1509 C  CB    . ARG D 3   ? 0.6934 0.5638 0.4103 -0.0178 0.0121  0.0350  321 ARG D CB    
1510 C  CG    . ARG D 3   ? 0.7048 0.5485 0.4368 -0.0009 0.0125  0.0430  321 ARG D CG    
1511 C  CD    . ARG D 3   ? 0.7834 0.5812 0.4910 -0.0058 0.0226  0.0538  321 ARG D CD    
1512 N  NE    . ARG D 3   ? 0.8517 0.6230 0.5744 0.0104  0.0263  0.0580  321 ARG D NE    
1513 C  CZ    . ARG D 3   ? 0.9093 0.6681 0.6421 0.0100  0.0367  0.0482  321 ARG D CZ    
1514 N  NH1   . ARG D 3   ? 0.9053 0.6763 0.6363 -0.0055 0.0422  0.0354  321 ARG D NH1   
1515 N  NH2   . ARG D 3   ? 0.9353 0.6702 0.6797 0.0255  0.0418  0.0517  321 ARG D NH2   
1516 N  N     . PRO D 4   ? 0.6342 0.6054 0.3915 -0.0320 0.0074  -0.0103 322 PRO D N     
1517 C  CA    . PRO D 4   ? 0.6373 0.6350 0.3864 -0.0459 0.0120  -0.0234 322 PRO D CA    
1518 C  C     . PRO D 4   ? 0.5883 0.5814 0.3333 -0.0608 0.0262  -0.0262 322 PRO D C     
1519 O  O     . PRO D 4   ? 0.5788 0.5895 0.3109 -0.0734 0.0323  -0.0329 322 PRO D O     
1520 C  CB    . PRO D 4   ? 0.6077 0.6372 0.3963 -0.0396 0.0078  -0.0434 322 PRO D CB    
1521 C  CG    . PRO D 4   ? 0.5681 0.5901 0.3809 -0.0230 -0.0016 -0.0380 322 PRO D CG    
1522 C  CD    . PRO D 4   ? 0.5740 0.5598 0.3741 -0.0191 0.0029  -0.0203 322 PRO D CD    
1523 N  N     . PHE D 5   ? 0.5299 0.5025 0.2856 -0.0603 0.0316  -0.0220 323 PHE D N     
1524 C  CA    . PHE D 5   ? 0.4865 0.4634 0.2491 -0.0736 0.0422  -0.0278 323 PHE D CA    
1525 C  C     . PHE D 5   ? 0.4415 0.3870 0.1725 -0.0854 0.0479  -0.0142 323 PHE D C     
1526 O  O     . PHE D 5   ? 0.5245 0.4410 0.2525 -0.0818 0.0482  -0.0070 323 PHE D O     
1527 C  CB    . PHE D 5   ? 0.4530 0.4347 0.2517 -0.0661 0.0432  -0.0348 323 PHE D CB    
1528 C  CG    . PHE D 5   ? 0.4760 0.4856 0.3106 -0.0553 0.0388  -0.0476 323 PHE D CG    
1529 C  CD1   . PHE D 5   ? 0.4908 0.5306 0.3491 -0.0608 0.0435  -0.0621 323 PHE D CD1   
1530 C  CD2   . PHE D 5   ? 0.4554 0.4605 0.3039 -0.0397 0.0309  -0.0454 323 PHE D CD2   
1531 C  CE1   . PHE D 5   ? 0.5246 0.5868 0.4183 -0.0517 0.0405  -0.0750 323 PHE D CE1   
1532 C  CE2   . PHE D 5   ? 0.4355 0.4656 0.3203 -0.0316 0.0271  -0.0579 323 PHE D CE2   
1533 C  CZ    . PHE D 5   ? 0.4755 0.5326 0.3822 -0.0380 0.0320  -0.0731 323 PHE D CZ    
1534 N  N     . MET D 6   ? 0.5131 0.4640 0.2206 -0.1002 0.0535  -0.0113 324 MET D N     
1535 C  CA    . MET D 6   ? 0.5184 0.4409 0.1991 -0.1146 0.0603  0.0010  324 MET D CA    
1536 C  C     . MET D 6   ? 0.5041 0.4371 0.2009 -0.1295 0.0684  -0.0071 324 MET D C     
1537 O  O     . MET D 6   ? 0.5016 0.4695 0.2196 -0.1342 0.0723  -0.0193 324 MET D O     
1538 C  CB    . MET D 6   ? 0.5526 0.4745 0.1994 -0.1244 0.0636  0.0114  324 MET D CB    
1539 C  CG    . MET D 6   ? 0.5888 0.4806 0.2152 -0.1398 0.0712  0.0247  324 MET D CG    
1540 S  SD    . MET D 6   ? 0.7455 0.6350 0.3437 -0.1443 0.0728  0.0409  324 MET D SD    
1541 C  CE    . MET D 6   ? 0.8434 0.6871 0.4139 -0.1305 0.0642  0.0623  324 MET D CE    
1542 N  N     . CYS D 7   ? 0.5100 0.4127 0.1978 -0.1366 0.0704  -0.0008 325 CYS D N     
1543 C  CA    . CYS D 7   ? 0.5120 0.4239 0.2119 -0.1531 0.0759  -0.0069 325 CYS D CA    
1544 C  C     . CYS D 7   ? 0.5234 0.4576 0.2204 -0.1701 0.0840  -0.0071 325 CYS D C     
1545 O  O     . CYS D 7   ? 0.5286 0.4509 0.2048 -0.1732 0.0859  0.0029  325 CYS D O     
1546 C  CB    . CYS D 7   ? 0.5801 0.4512 0.2629 -0.1609 0.0765  -0.0004 325 CYS D CB    
1547 S  SG    . CYS D 7   ? 0.5711 0.4564 0.2696 -0.1822 0.0793  -0.0088 325 CYS D SG    
1548 N  N     . ALA D 8   ? 0.4965 0.4648 0.2218 -0.1782 0.0877  -0.0179 326 ALA D N     
1549 C  CA    . ALA D 8   ? 0.5525 0.5469 0.2874 -0.1907 0.0952  -0.0203 326 ALA D CA    
1550 C  C     . ALA D 8   ? 0.5858 0.5690 0.3172 -0.2111 0.0992  -0.0151 326 ALA D C     
1551 O  O     . ALA D 8   ? 0.5851 0.5884 0.3247 -0.2222 0.1063  -0.0160 326 ALA D O     
1552 C  CB    . ALA D 8   ? 0.5883 0.6279 0.3602 -0.1880 0.0985  -0.0349 326 ALA D CB    
1553 N  N     . TYR D 9   ? 0.5719 0.5235 0.2917 -0.2165 0.0953  -0.0110 327 TYR D N     
1554 C  CA    . TYR D 9   ? 0.6328 0.5725 0.3499 -0.2374 0.0978  -0.0084 327 TYR D CA    
1555 C  C     . TYR D 9   ? 0.6603 0.5754 0.3532 -0.2439 0.1030  0.0034  327 TYR D C     
1556 O  O     . TYR D 9   ? 0.6642 0.5489 0.3324 -0.2329 0.1013  0.0130  327 TYR D O     
1557 C  CB    . TYR D 9   ? 0.7060 0.6149 0.4131 -0.2415 0.0923  -0.0093 327 TYR D CB    
1558 C  CG    . TYR D 9   ? 0.7482 0.6566 0.4620 -0.2640 0.0920  -0.0124 327 TYR D CG    
1559 C  CD1   . TYR D 9   ? 0.7488 0.6985 0.4948 -0.2720 0.0890  -0.0208 327 TYR D CD1   
1560 C  CD2   . TYR D 9   ? 0.8078 0.6756 0.4989 -0.2759 0.0935  -0.0071 327 TYR D CD2   
1561 C  CE1   . TYR D 9   ? 0.8318 0.7850 0.5862 -0.2908 0.0857  -0.0240 327 TYR D CE1   
1562 C  CE2   . TYR D 9   ? 0.8656 0.7345 0.5642 -0.2960 0.0918  -0.0119 327 TYR D CE2   
1563 C  CZ    . TYR D 9   ? 0.8967 0.8096 0.6264 -0.3032 0.0871  -0.0203 327 TYR D CZ    
1564 O  OH    . TYR D 9   ? 0.9976 0.9152 0.7364 -0.3213 0.0833  -0.0247 327 TYR D OH    
1565 N  N     . PRO D 10  ? 0.7381 0.6661 0.4388 -0.2607 0.1095  0.0044  328 PRO D N     
1566 C  CA    . PRO D 10  ? 0.8107 0.7198 0.4902 -0.2663 0.1163  0.0174  328 PRO D CA    
1567 C  C     . PRO D 10  ? 0.8186 0.6742 0.4709 -0.2671 0.1139  0.0283  328 PRO D C     
1568 O  O     . PRO D 10  ? 0.8755 0.7092 0.5281 -0.2777 0.1115  0.0244  328 PRO D O     
1569 C  CB    . PRO D 10  ? 0.7951 0.7280 0.4942 -0.2858 0.1236  0.0146  328 PRO D CB    
1570 C  CG    . PRO D 10  ? 0.7558 0.7322 0.4892 -0.2847 0.1212  0.0002  328 PRO D CG    
1571 C  CD    . PRO D 10  ? 0.7070 0.6710 0.4391 -0.2740 0.1110  -0.0051 328 PRO D CD    
1572 N  N     . GLY D 11  ? 0.7823 0.6173 0.4114 -0.2547 0.1142  0.0415  329 GLY D N     
1573 C  CA    . GLY D 11  ? 0.8487 0.6326 0.4544 -0.2533 0.1135  0.0543  329 GLY D CA    
1574 C  C     . GLY D 11  ? 0.8579 0.6124 0.4559 -0.2395 0.1062  0.0516  329 GLY D C     
1575 O  O     . GLY D 11  ? 0.9175 0.6266 0.5006 -0.2395 0.1067  0.0588  329 GLY D O     
1576 N  N     . CYS D 12  ? 0.7872 0.5652 0.3965 -0.2269 0.1006  0.0415  330 CYS D N     
1577 C  CA    . CYS D 12  ? 0.8164 0.5675 0.4195 -0.2134 0.0953  0.0390  330 CYS D CA    
1578 C  C     . CYS D 12  ? 0.8287 0.5678 0.4178 -0.1916 0.0912  0.0507  330 CYS D C     
1579 O  O     . CYS D 12  ? 0.8033 0.4998 0.3770 -0.1830 0.0905  0.0600  330 CYS D O     
1580 C  CB    . CYS D 12  ? 0.7956 0.5772 0.4200 -0.2116 0.0917  0.0231  330 CYS D CB    
1581 S  SG    . CYS D 12  ? 0.7383 0.4918 0.3580 -0.1927 0.0864  0.0192  330 CYS D SG    
1582 N  N     . ASN D 13  ? 0.7183 0.4953 0.3142 -0.1823 0.0882  0.0493  331 ASN D N     
1583 C  CA    . ASN D 13  ? 0.7950 0.5716 0.3783 -0.1637 0.0823  0.0593  331 ASN D CA    
1584 C  C     . ASN D 13  ? 0.7714 0.5304 0.3543 -0.1455 0.0762  0.0581  331 ASN D C     
1585 O  O     . ASN D 13  ? 0.7918 0.5487 0.3689 -0.1283 0.0688  0.0670  331 ASN D O     
1586 C  CB    . ASN D 13  ? 0.8679 0.6167 0.4277 -0.1635 0.0835  0.0803  331 ASN D CB    
1587 C  CG    . ASN D 13  ? 0.9787 0.7537 0.5352 -0.1752 0.0889  0.0843  331 ASN D CG    
1588 O  OD1   . ASN D 13  ? 0.9730 0.7745 0.5455 -0.1892 0.0948  0.0722  331 ASN D OD1   
1589 N  ND2   . ASN D 13  ? 1.1044 0.8732 0.6403 -0.1688 0.0872  0.1025  331 ASN D ND2   
1590 N  N     . LYS D 14  ? 0.6612 0.4159 0.2629 -0.1444 0.0760  0.0451  332 LYS D N     
1591 C  CA    . LYS D 14  ? 0.6662 0.4163 0.2837 -0.1225 0.0694  0.0404  332 LYS D CA    
1592 C  C     . LYS D 14  ? 0.6239 0.4172 0.2635 -0.1090 0.0623  0.0324  332 LYS D C     
1593 O  O     . LYS D 14  ? 0.6521 0.4821 0.3055 -0.1172 0.0636  0.0217  332 LYS D O     
1594 C  CB    . LYS D 14  ? 0.7084 0.4495 0.3378 -0.1265 0.0720  0.0278  332 LYS D CB    
1595 C  CG    . LYS D 14  ? 0.8286 0.5204 0.4380 -0.1351 0.0778  0.0321  332 LYS D CG    
1596 C  CD    . LYS D 14  ? 0.9065 0.5631 0.5110 -0.1142 0.0769  0.0402  332 LYS D CD    
1597 C  CE    . LYS D 14  ? 1.0254 0.6388 0.6200 -0.1185 0.0835  0.0343  332 LYS D CE    
1598 N  NZ    . LYS D 14  ? 1.1005 0.7349 0.7082 -0.1227 0.0828  0.0167  332 LYS D NZ    
1599 N  N     . ARG D 15  ? 0.6078 0.3962 0.2546 -0.0880 0.0551  0.0366  333 ARG D N     
1600 C  CA    . ARG D 15  ? 0.5721 0.3976 0.2407 -0.0748 0.0470  0.0294  333 ARG D CA    
1601 C  C     . ARG D 15  ? 0.5599 0.3849 0.2561 -0.0571 0.0439  0.0234  333 ARG D C     
1602 O  O     . ARG D 15  ? 0.6406 0.4323 0.3329 -0.0487 0.0461  0.0298  333 ARG D O     
1603 C  CB    . ARG D 15  ? 0.6054 0.4340 0.2570 -0.0674 0.0390  0.0420  333 ARG D CB    
1604 C  CG    . ARG D 15  ? 0.6344 0.4745 0.2596 -0.0837 0.0424  0.0468  333 ARG D CG    
1605 C  CD    . ARG D 15  ? 0.6842 0.5357 0.2928 -0.0748 0.0320  0.0572  333 ARG D CD    
1606 N  NE    . ARG D 15  ? 0.7492 0.6251 0.3364 -0.0897 0.0361  0.0555  333 ARG D NE    
1607 C  CZ    . ARG D 15  ? 0.7614 0.6784 0.3604 -0.0914 0.0347  0.0379  333 ARG D CZ    
1608 N  NH1   . ARG D 15  ? 0.7003 0.6373 0.3336 -0.0794 0.0282  0.0220  333 ARG D NH1   
1609 N  NH2   . ARG D 15  ? 0.8472 0.7843 0.4243 -0.1052 0.0413  0.0357  333 ARG D NH2   
1610 N  N     . TYR D 16  ? 0.5053 0.3663 0.2306 -0.0511 0.0402  0.0110  334 TYR D N     
1611 C  CA    . TYR D 16  ? 0.5060 0.3699 0.2606 -0.0364 0.0394  0.0055  334 TYR D CA    
1612 C  C     . TYR D 16  ? 0.5557 0.4525 0.3379 -0.0249 0.0310  -0.0008 334 TYR D C     
1613 O  O     . TYR D 16  ? 0.5460 0.4691 0.3274 -0.0310 0.0272  -0.0068 334 TYR D O     
1614 C  CB    . TYR D 16  ? 0.4911 0.3617 0.2590 -0.0443 0.0462  -0.0043 334 TYR D CB    
1615 C  CG    . TYR D 16  ? 0.5049 0.3422 0.2467 -0.0561 0.0529  -0.0003 334 TYR D CG    
1616 C  CD1   . TYR D 16  ? 0.5442 0.3490 0.2796 -0.0482 0.0570  0.0027  334 TYR D CD1   
1617 C  CD2   . TYR D 16  ? 0.4800 0.3179 0.2039 -0.0758 0.0560  -0.0005 334 TYR D CD2   
1618 C  CE1   . TYR D 16  ? 0.5533 0.3253 0.2633 -0.0605 0.0630  0.0036  334 TYR D CE1   
1619 C  CE2   . TYR D 16  ? 0.5232 0.3305 0.2249 -0.0887 0.0613  0.0020  334 TYR D CE2   
1620 C  CZ    . TYR D 16  ? 0.5774 0.3511 0.2716 -0.0813 0.0643  0.0030  334 TYR D CZ    
1621 O  OH    . TYR D 16  ? 0.6307 0.3728 0.3023 -0.0958 0.0694  0.0026  334 TYR D OH    
1622 N  N     . PHE D 17  ? 0.5341 0.4295 0.3416 -0.0088 0.0292  -0.0006 335 PHE D N     
1623 C  CA    . PHE D 17  ? 0.4899 0.4159 0.3300 0.0017  0.0212  -0.0077 335 PHE D CA    
1624 C  C     . PHE D 17  ? 0.4852 0.4402 0.3547 -0.0031 0.0246  -0.0224 335 PHE D C     
1625 O  O     . PHE D 17  ? 0.4594 0.4425 0.3519 -0.0006 0.0185  -0.0321 335 PHE D O     
1626 C  CB    . PHE D 17  ? 0.4958 0.4114 0.3576 0.0201  0.0197  -0.0012 335 PHE D CB    
1627 C  CG    . PHE D 17  ? 0.6496 0.5413 0.4918 0.0287  0.0146  0.0140  335 PHE D CG    
1628 C  CD1   . PHE D 17  ? 0.7358 0.6425 0.5727 0.0317  0.0012  0.0188  335 PHE D CD1   
1629 C  CD2   . PHE D 17  ? 0.7140 0.5678 0.5424 0.0338  0.0231  0.0235  335 PHE D CD2   
1630 C  CE1   . PHE D 17  ? 0.7989 0.6844 0.6194 0.0408  -0.0046 0.0359  335 PHE D CE1   
1631 C  CE2   . PHE D 17  ? 0.7524 0.5823 0.5667 0.0431  0.0193  0.0387  335 PHE D CE2   
1632 C  CZ    . PHE D 17  ? 0.8125 0.6586 0.6237 0.0471  0.0049  0.0465  335 PHE D CZ    
1633 N  N     . LYS D 18  ? 0.4425 0.3913 0.3129 -0.0099 0.0335  -0.0244 336 LYS D N     
1634 C  CA    . LYS D 18  ? 0.3978 0.3716 0.3005 -0.0115 0.0368  -0.0346 336 LYS D CA    
1635 C  C     . LYS D 18  ? 0.3969 0.3742 0.2873 -0.0270 0.0424  -0.0375 336 LYS D C     
1636 O  O     . LYS D 18  ? 0.4235 0.3776 0.2851 -0.0350 0.0458  -0.0309 336 LYS D O     
1637 C  CB    . LYS D 18  ? 0.4400 0.4077 0.3665 -0.0001 0.0414  -0.0314 336 LYS D CB    
1638 C  CG    . LYS D 18  ? 0.5276 0.4957 0.4757 0.0158  0.0374  -0.0285 336 LYS D CG    
1639 C  CD    . LYS D 18  ? 0.6026 0.6021 0.5826 0.0179  0.0301  -0.0390 336 LYS D CD    
1640 C  CE    . LYS D 18  ? 0.6821 0.6849 0.6849 0.0320  0.0238  -0.0360 336 LYS D CE    
1641 N  NZ    . LYS D 18  ? 0.7017 0.6916 0.7222 0.0430  0.0326  -0.0282 336 LYS D NZ    
1642 N  N     . LEU D 19  ? 0.3745 0.3811 0.2899 -0.0314 0.0435  -0.0479 337 LEU D N     
1643 C  CA    . LEU D 19  ? 0.3601 0.3762 0.2728 -0.0450 0.0486  -0.0505 337 LEU D CA    
1644 C  C     . LEU D 19  ? 0.3424 0.3448 0.2526 -0.0464 0.0517  -0.0435 337 LEU D C     
1645 O  O     . LEU D 19  ? 0.3501 0.3450 0.2396 -0.0594 0.0537  -0.0409 337 LEU D O     
1646 C  CB    . LEU D 19  ? 0.3502 0.4001 0.2992 -0.0454 0.0503  -0.0628 337 LEU D CB    
1647 C  CG    . LEU D 19  ? 0.4136 0.4802 0.3668 -0.0583 0.0557  -0.0663 337 LEU D CG    
1648 C  CD1   . LEU D 19  ? 0.5523 0.6095 0.4670 -0.0724 0.0575  -0.0636 337 LEU D CD1   
1649 C  CD2   . LEU D 19  ? 0.4641 0.5618 0.4540 -0.0563 0.0586  -0.0804 337 LEU D CD2   
1650 N  N     . SER D 20  ? 0.3244 0.3246 0.2550 -0.0341 0.0522  -0.0406 338 SER D N     
1651 C  CA    . SER D 20  ? 0.3224 0.3117 0.2470 -0.0354 0.0552  -0.0344 338 SER D CA    
1652 C  C     . SER D 20  ? 0.3781 0.3330 0.2605 -0.0412 0.0564  -0.0292 338 SER D C     
1653 O  O     . SER D 20  ? 0.3524 0.2999 0.2186 -0.0511 0.0575  -0.0277 338 SER D O     
1654 C  CB    . SER D 20  ? 0.3144 0.3059 0.2652 -0.0205 0.0575  -0.0308 338 SER D CB    
1655 O  OG    . SER D 20  ? 0.3645 0.3379 0.3100 -0.0092 0.0578  -0.0281 338 SER D OG    
1656 N  N     . HIS D 21  ? 0.3529 0.2866 0.2188 -0.0350 0.0558  -0.0264 339 HIS D N     
1657 C  CA    . HIS D 21  ? 0.3853 0.2825 0.2135 -0.0400 0.0581  -0.0215 339 HIS D CA    
1658 C  C     . HIS D 21  ? 0.3977 0.2922 0.2030 -0.0594 0.0577  -0.0226 339 HIS D C     
1659 O  O     . HIS D 21  ? 0.4111 0.2838 0.1927 -0.0701 0.0602  -0.0219 339 HIS D O     
1660 C  CB    . HIS D 21  ? 0.4281 0.3062 0.2485 -0.0283 0.0566  -0.0161 339 HIS D CB    
1661 C  CG    . HIS D 21  ? 0.4129 0.2950 0.2594 -0.0094 0.0573  -0.0145 339 HIS D CG    
1662 N  ND1   . HIS D 21  ? 0.4417 0.3180 0.2935 0.0032  0.0535  -0.0097 339 HIS D ND1   
1663 C  CD2   . HIS D 21  ? 0.4322 0.3246 0.3023 -0.0015 0.0615  -0.0157 339 HIS D CD2   
1664 C  CE1   . HIS D 21  ? 0.4771 0.3614 0.3579 0.0177  0.0556  -0.0093 339 HIS D CE1   
1665 N  NE2   . HIS D 21  ? 0.4369 0.3298 0.3283 0.0150  0.0614  -0.0126 339 HIS D NE2   
1666 N  N     . LEU D 22  ? 0.3767 0.2924 0.1880 -0.0649 0.0553  -0.0251 340 LEU D N     
1667 C  CA    . LEU D 22  ? 0.3733 0.2910 0.1672 -0.0838 0.0569  -0.0255 340 LEU D CA    
1668 C  C     . LEU D 22  ? 0.3724 0.3088 0.1793 -0.0952 0.0577  -0.0300 340 LEU D C     
1669 O  O     . LEU D 22  ? 0.3896 0.3155 0.1781 -0.1115 0.0590  -0.0292 340 LEU D O     
1670 C  CB    . LEU D 22  ? 0.3781 0.3192 0.1773 -0.0856 0.0560  -0.0284 340 LEU D CB    
1671 C  CG    . LEU D 22  ? 0.3863 0.3382 0.1748 -0.1049 0.0603  -0.0297 340 LEU D CG    
1672 C  CD1   . LEU D 22  ? 0.4319 0.3476 0.1838 -0.1165 0.0628  -0.0203 340 LEU D CD1   
1673 C  CD2   . LEU D 22  ? 0.3770 0.3550 0.1708 -0.1050 0.0612  -0.0348 340 LEU D CD2   
1674 N  N     . GLN D 23  ? 0.3506 0.3139 0.1906 -0.0867 0.0563  -0.0338 341 GLN D N     
1675 C  CA    . GLN D 23  ? 0.3722 0.3559 0.2272 -0.0956 0.0552  -0.0353 341 GLN D CA    
1676 C  C     . GLN D 23  ? 0.3970 0.3558 0.2261 -0.1028 0.0541  -0.0322 341 GLN D C     
1677 O  O     . GLN D 23  ? 0.4049 0.3698 0.2277 -0.1190 0.0520  -0.0332 341 GLN D O     
1678 C  CB    . GLN D 23  ? 0.4329 0.4442 0.3278 -0.0828 0.0542  -0.0367 341 GLN D CB    
1679 C  CG    . GLN D 23  ? 0.6029 0.6373 0.5155 -0.0903 0.0516  -0.0351 341 GLN D CG    
1680 C  CD    . GLN D 23  ? 0.8269 0.8876 0.7527 -0.1040 0.0526  -0.0396 341 GLN D CD    
1681 O  OE1   . GLN D 23  ? 0.8765 0.9567 0.8245 -0.1001 0.0563  -0.0457 341 GLN D OE1   
1682 N  NE2   . GLN D 23  ? 0.9088 0.9706 0.8215 -0.1206 0.0500  -0.0379 341 GLN D NE2   
1683 N  N     . MET D 24  ? 0.3660 0.2975 0.1809 -0.0911 0.0557  -0.0296 342 MET D N     
1684 C  CA    . MET D 24  ? 0.3810 0.2854 0.1670 -0.0977 0.0562  -0.0295 342 MET D CA    
1685 C  C     . MET D 24  ? 0.4293 0.3050 0.1834 -0.1136 0.0577  -0.0308 342 MET D C     
1686 O  O     . MET D 24  ? 0.4698 0.3391 0.2079 -0.1300 0.0556  -0.0340 342 MET D O     
1687 C  CB    . MET D 24  ? 0.3877 0.2692 0.1673 -0.0803 0.0608  -0.0273 342 MET D CB    
1688 C  CG    . MET D 24  ? 0.3588 0.2666 0.1685 -0.0674 0.0605  -0.0245 342 MET D CG    
1689 S  SD    . MET D 24  ? 0.3817 0.2656 0.1852 -0.0484 0.0687  -0.0212 342 MET D SD    
1690 C  CE    . MET D 24  ? 0.4058 0.2812 0.2232 -0.0341 0.0705  -0.0198 342 MET D CE    
1691 N  N     . HIS D 25  ? 0.4493 0.3083 0.1947 -0.1097 0.0605  -0.0276 343 HIS D N     
1692 C  CA    . HIS D 25  ? 0.4734 0.3025 0.1900 -0.1244 0.0631  -0.0259 343 HIS D CA    
1693 C  C     . HIS D 25  ? 0.4689 0.3186 0.1883 -0.1470 0.0614  -0.0285 343 HIS D C     
1694 O  O     . HIS D 25  ? 0.5236 0.3522 0.2226 -0.1645 0.0622  -0.0304 343 HIS D O     
1695 C  CB    . HIS D 25  ? 0.4709 0.2872 0.1813 -0.1161 0.0651  -0.0187 343 HIS D CB    
1696 C  CG    . HIS D 25  ? 0.5277 0.3282 0.2171 -0.1338 0.0678  -0.0144 343 HIS D CG    
1697 N  ND1   . HIS D 25  ? 0.5703 0.3263 0.2320 -0.1420 0.0718  -0.0117 343 HIS D ND1   
1698 C  CD2   . HIS D 25  ? 0.5495 0.3726 0.2425 -0.1465 0.0686  -0.0128 343 HIS D CD2   
1699 C  CE1   . HIS D 25  ? 0.5772 0.3284 0.2273 -0.1588 0.0745  -0.0066 343 HIS D CE1   
1700 N  NE2   . HIS D 25  ? 0.5365 0.3293 0.2044 -0.1620 0.0730  -0.0071 343 HIS D NE2   
1701 N  N     . SER D 26  ? 0.4460 0.3373 0.1933 -0.1471 0.0598  -0.0295 344 SER D N     
1702 C  CA    . SER D 26  ? 0.4976 0.4122 0.2526 -0.1669 0.0604  -0.0311 344 SER D CA    
1703 C  C     . SER D 26  ? 0.4950 0.4179 0.2524 -0.1824 0.0554  -0.0351 344 SER D C     
1704 O  O     . SER D 26  ? 0.5314 0.4601 0.2868 -0.2031 0.0561  -0.0360 344 SER D O     
1705 C  CB    . SER D 26  ? 0.5510 0.5089 0.3388 -0.1610 0.0614  -0.0333 344 SER D CB    
1706 O  OG    . SER D 26  ? 0.6393 0.6241 0.4571 -0.1513 0.0569  -0.0363 344 SER D OG    
1707 N  N     . ARG D 27  ? 0.4833 0.4083 0.2446 -0.1737 0.0502  -0.0370 345 ARG D N     
1708 C  CA    . ARG D 27  ? 0.4904 0.4264 0.2511 -0.1886 0.0430  -0.0404 345 ARG D CA    
1709 C  C     . ARG D 27  ? 0.5588 0.4583 0.2855 -0.2079 0.0433  -0.0446 345 ARG D C     
1710 O  O     . ARG D 27  ? 0.5924 0.5038 0.3191 -0.2268 0.0366  -0.0488 345 ARG D O     
1711 C  CB    . ARG D 27  ? 0.5030 0.4449 0.2674 -0.1748 0.0381  -0.0399 345 ARG D CB    
1712 C  CG    . ARG D 27  ? 0.5239 0.5014 0.3267 -0.1573 0.0378  -0.0354 345 ARG D CG    
1713 C  CD    . ARG D 27  ? 0.5259 0.5167 0.3370 -0.1478 0.0323  -0.0317 345 ARG D CD    
1714 N  NE    . ARG D 27  ? 0.5130 0.5351 0.3651 -0.1315 0.0333  -0.0269 345 ARG D NE    
1715 C  CZ    . ARG D 27  ? 0.4826 0.4971 0.3432 -0.1121 0.0382  -0.0241 345 ARG D CZ    
1716 N  NH1   . ARG D 27  ? 0.4996 0.4786 0.3315 -0.1049 0.0429  -0.0248 345 ARG D NH1   
1717 N  NH2   . ARG D 27  ? 0.4940 0.5368 0.3951 -0.0999 0.0390  -0.0210 345 ARG D NH2   
1718 N  N     . LYS D 28  ? 0.5618 0.4171 0.2616 -0.2038 0.0505  -0.0436 346 LYS D N     
1719 C  CA    . LYS D 28  ? 0.6237 0.4397 0.2935 -0.2224 0.0524  -0.0481 346 LYS D CA    
1720 C  C     . LYS D 28  ? 0.6561 0.4848 0.3334 -0.2465 0.0531  -0.0471 346 LYS D C     
1721 O  O     . LYS D 28  ? 0.6834 0.4917 0.3448 -0.2680 0.0519  -0.0528 346 LYS D O     
1722 C  CB    . LYS D 28  ? 0.6824 0.4483 0.3274 -0.2106 0.0611  -0.0449 346 LYS D CB    
1723 C  CG    . LYS D 28  ? 0.7220 0.4760 0.3642 -0.2150 0.0675  -0.0358 346 LYS D CG    
1724 C  CD    . LYS D 28  ? 0.8158 0.5337 0.4439 -0.1951 0.0735  -0.0283 346 LYS D CD    
1725 C  CE    . LYS D 28  ? 0.9944 0.6578 0.5950 -0.1964 0.0783  -0.0327 346 LYS D CE    
1726 N  NZ    . LYS D 28  ? 1.0447 0.6772 0.6384 -0.1743 0.0838  -0.0235 346 LYS D NZ    
1727 N  N     . HIS D 29  ? 0.6331 0.4958 0.3351 -0.2444 0.0557  -0.0412 347 HIS D N     
1728 C  CA    . HIS D 29  ? 0.6703 0.5474 0.3809 -0.2665 0.0595  -0.0391 347 HIS D CA    
1729 C  C     . HIS D 29  ? 0.7050 0.6266 0.4437 -0.2823 0.0515  -0.0440 347 HIS D C     
1730 O  O     . HIS D 29  ? 0.7679 0.6996 0.5143 -0.3037 0.0537  -0.0439 347 HIS D O     
1731 C  CB    . HIS D 29  ? 0.5904 0.4846 0.3118 -0.2580 0.0679  -0.0315 347 HIS D CB    
1732 C  CG    . HIS D 29  ? 0.6181 0.4728 0.3129 -0.2449 0.0740  -0.0240 347 HIS D CG    
1733 N  ND1   . HIS D 29  ? 0.6697 0.4769 0.3353 -0.2550 0.0789  -0.0190 347 HIS D ND1   
1734 C  CD2   . HIS D 29  ? 0.6034 0.4607 0.2992 -0.2227 0.0752  -0.0197 347 HIS D CD2   
1735 C  CE1   . HIS D 29  ? 0.6932 0.4762 0.3432 -0.2380 0.0824  -0.0104 347 HIS D CE1   
1736 N  NE2   . HIS D 29  ? 0.6796 0.4939 0.3471 -0.2189 0.0796  -0.0111 347 HIS D NE2   
1737 N  N     . THR D 30  ? 0.5791 0.8719 0.4577 0.1584  -0.1060 0.0775  348 THR D N     
1738 C  CA    . THR D 30  ? 0.5812 0.8536 0.4605 0.1410  -0.0970 0.0790  348 THR D CA    
1739 C  C     . THR D 30  ? 0.6588 0.9055 0.5422 0.1471  -0.0865 0.0885  348 THR D C     
1740 O  O     . THR D 30  ? 0.6887 0.9402 0.5817 0.1612  -0.0865 0.0906  348 THR D O     
1741 C  CB    . THR D 30  ? 0.5842 0.8876 0.4892 0.1177  -0.1006 0.0641  348 THR D CB    
1742 O  OG1   . THR D 30  ? 0.5928 0.9216 0.5266 0.1176  -0.1017 0.0579  348 THR D OG1   
1743 C  CG2   . THR D 30  ? 0.6517 0.9804 0.5549 0.1103  -0.1101 0.0528  348 THR D CG2   
1744 N  N     . GLY D 31  ? 0.6966 0.9163 0.5730 0.1359  -0.0771 0.0933  349 GLY D N     
1745 C  CA    . GLY D 31  ? 0.7287 0.9147 0.6067 0.1396  -0.0643 0.1013  349 GLY D CA    
1746 C  C     . GLY D 31  ? 0.7062 0.9115 0.6161 0.1335  -0.0639 0.0933  349 GLY D C     
1747 O  O     . GLY D 31  ? 0.6747 0.9070 0.6052 0.1163  -0.0680 0.0819  349 GLY D O     
1748 N  N     . GLU D 32  ? 0.6963 0.8851 0.6085 0.1476  -0.0577 0.0996  350 GLU D N     
1749 C  CA    . GLU D 32  ? 0.6418 0.8472 0.5814 0.1445  -0.0565 0.0927  350 GLU D CA    
1750 C  C     . GLU D 32  ? 0.5612 0.7537 0.5150 0.1205  -0.0480 0.0852  350 GLU D C     
1751 O  O     . GLU D 32  ? 0.4885 0.6524 0.4319 0.1091  -0.0407 0.0866  350 GLU D O     
1752 C  CB    . GLU D 32  ? 0.6441 0.8286 0.5804 0.1650  -0.0501 0.1007  350 GLU D CB    
1753 N  N     . LYS D 33  ? 0.4559 0.6714 0.4335 0.1136  -0.0489 0.0769  351 LYS D N     
1754 C  CA    . LYS D 33  ? 0.3498 0.5543 0.3401 0.0945  -0.0414 0.0703  351 LYS D CA    
1755 C  C     . LYS D 33  ? 0.3712 0.5739 0.3743 0.1024  -0.0363 0.0693  351 LYS D C     
1756 O  O     . LYS D 33  ? 0.3841 0.6154 0.4050 0.0994  -0.0390 0.0626  351 LYS D O     
1757 C  CB    . LYS D 33  ? 0.2824 0.5155 0.2856 0.0760  -0.0467 0.0608  351 LYS D CB    
1758 C  CG    . LYS D 33  ? 0.3553 0.5847 0.3456 0.0653  -0.0499 0.0600  351 LYS D CG    
1759 C  CD    . LYS D 33  ? 0.3922 0.6474 0.3967 0.0465  -0.0533 0.0497  351 LYS D CD    
1760 C  CE    . LYS D 33  ? 0.5093 0.7625 0.5028 0.0351  -0.0562 0.0470  351 LYS D CE    
1761 N  NZ    . LYS D 33  ? 0.5467 0.8220 0.5547 0.0166  -0.0577 0.0366  351 LYS D NZ    
1762 N  N     . PRO D 34  ? 0.3863 0.5549 0.3805 0.1119  -0.0277 0.0751  352 PRO D N     
1763 C  CA    . PRO D 34  ? 0.3884 0.5539 0.3929 0.1217  -0.0227 0.0737  352 PRO D CA    
1764 C  C     . PRO D 34  ? 0.3175 0.4798 0.3362 0.1069  -0.0171 0.0650  352 PRO D C     
1765 O  O     . PRO D 34  ? 0.3651 0.5311 0.3938 0.1137  -0.0138 0.0618  352 PRO D O     
1766 C  CB    . PRO D 34  ? 0.4535 0.5789 0.4410 0.1353  -0.0142 0.0826  352 PRO D CB    
1767 C  CG    . PRO D 34  ? 0.4803 0.5823 0.4530 0.1247  -0.0109 0.0859  352 PRO D CG    
1768 C  CD    . PRO D 34  ? 0.4463 0.5778 0.4195 0.1151  -0.0214 0.0832  352 PRO D CD    
1769 N  N     . TYR D 35  ? 0.2760 0.4326 0.2951 0.0884  -0.0162 0.0610  353 TYR D N     
1770 C  CA    . TYR D 35  ? 0.2615 0.4111 0.2901 0.0766  -0.0111 0.0536  353 TYR D CA    
1771 C  C     . TYR D 35  ? 0.2816 0.4615 0.3212 0.0653  -0.0159 0.0476  353 TYR D C     
1772 O  O     . TYR D 35  ? 0.2965 0.4820 0.3341 0.0526  -0.0191 0.0464  353 TYR D O     
1773 C  CB    . TYR D 35  ? 0.2838 0.4044 0.3055 0.0657  -0.0060 0.0528  353 TYR D CB    
1774 C  CG    . TYR D 35  ? 0.3318 0.4205 0.3437 0.0748  0.0017  0.0577  353 TYR D CG    
1775 C  CD1   . TYR D 35  ? 0.3862 0.4582 0.4030 0.0804  0.0091  0.0546  353 TYR D CD1   
1776 C  CD2   . TYR D 35  ? 0.3663 0.4405 0.3631 0.0775  0.0026  0.0651  353 TYR D CD2   
1777 C  CE1   . TYR D 35  ? 0.4058 0.4455 0.4138 0.0876  0.0184  0.0586  353 TYR D CE1   
1778 C  CE2   . TYR D 35  ? 0.4088 0.4502 0.3948 0.0853  0.0121  0.0703  353 TYR D CE2   
1779 C  CZ    . TYR D 35  ? 0.4265 0.4501 0.4188 0.0898  0.0204  0.0670  353 TYR D CZ    
1780 O  OH    . TYR D 35  ? 0.5210 0.5093 0.5029 0.0961  0.0319  0.0715  353 TYR D OH    
1781 N  N     . GLN D 36  ? 0.2232 0.4209 0.2740 0.0695  -0.0150 0.0436  354 GLN D N     
1782 C  CA    . GLN D 36  ? 0.2207 0.4472 0.2817 0.0594  -0.0173 0.0383  354 GLN D CA    
1783 C  C     . GLN D 36  ? 0.2303 0.4470 0.2930 0.0494  -0.0119 0.0332  354 GLN D C     
1784 O  O     . GLN D 36  ? 0.2376 0.4384 0.2998 0.0553  -0.0073 0.0314  354 GLN D O     
1785 C  CB    . GLN D 36  ? 0.2526 0.5107 0.3258 0.0704  -0.0193 0.0366  354 GLN D CB    
1786 C  CG    . GLN D 36  ? 0.3365 0.6268 0.4217 0.0581  -0.0201 0.0304  354 GLN D CG    
1787 C  CD    . GLN D 36  ? 0.4160 0.7443 0.5157 0.0684  -0.0239 0.0278  354 GLN D CD    
1788 O  OE1   . GLN D 36  ? 0.4662 0.7965 0.5688 0.0862  -0.0237 0.0294  354 GLN D OE1   
1789 N  NE2   . GLN D 36  ? 0.4328 0.7916 0.5423 0.0572  -0.0270 0.0227  354 GLN D NE2   
1790 N  N     . CYS D 37  ? 0.2071 0.4320 0.2702 0.0346  -0.0125 0.0307  355 CYS D N     
1791 C  CA    . CYS D 37  ? 0.1730 0.3897 0.2343 0.0264  -0.0081 0.0269  355 CYS D CA    
1792 C  C     . CYS D 37  ? 0.2152 0.4513 0.2846 0.0304  -0.0042 0.0231  355 CYS D C     
1793 O  O     . CYS D 37  ? 0.2236 0.4874 0.3023 0.0296  -0.0048 0.0220  355 CYS D O     
1794 C  CB    . CYS D 37  ? 0.1754 0.3925 0.2325 0.0106  -0.0086 0.0265  355 CYS D CB    
1795 S  SG    . CYS D 37  ? 0.1818 0.3831 0.2309 0.0031  -0.0040 0.0237  355 CYS D SG    
1796 N  N     . ASP D 38  ? 0.1647 0.3880 0.2314 0.0342  -0.0001 0.0200  356 ASP D N     
1797 C  CA    . ASP D 38  ? 0.1677 0.4067 0.2400 0.0388  0.0048  0.0158  356 ASP D CA    
1798 C  C     . ASP D 38  ? 0.1936 0.4318 0.2588 0.0283  0.0090  0.0132  356 ASP D C     
1799 O  O     . ASP D 38  ? 0.2076 0.4528 0.2732 0.0318  0.0142  0.0092  356 ASP D O     
1800 C  CB    . ASP D 38  ? 0.2725 0.4987 0.3457 0.0526  0.0071  0.0132  356 ASP D CB    
1801 C  CG    . ASP D 38  ? 0.4155 0.6128 0.4797 0.0504  0.0075  0.0107  356 ASP D CG    
1802 O  OD1   . ASP D 38  ? 0.4718 0.6556 0.5370 0.0595  0.0100  0.0073  356 ASP D OD1   
1803 O  OD2   . ASP D 38  ? 0.4341 0.6224 0.4910 0.0397  0.0055  0.0113  356 ASP D OD2   
1804 N  N     . PHE D 39  ? 0.1655 0.3948 0.2227 0.0162  0.0077  0.0156  357 PHE D N     
1805 C  CA    . PHE D 39  ? 0.1865 0.4129 0.2338 0.0070  0.0124  0.0150  357 PHE D CA    
1806 C  C     . PHE D 39  ? 0.2397 0.4923 0.2949 -0.0001 0.0180  0.0144  357 PHE D C     
1807 O  O     . PHE D 39  ? 0.2640 0.5349 0.3311 -0.0024 0.0155  0.0146  357 PHE D O     
1808 C  CB    . PHE D 39  ? 0.1899 0.3961 0.2261 -0.0021 0.0095  0.0180  357 PHE D CB    
1809 C  CG    . PHE D 39  ? 0.2688 0.4626 0.2893 -0.0075 0.0133  0.0185  357 PHE D CG    
1810 C  CD1   . PHE D 39  ? 0.2665 0.4449 0.2770 -0.0004 0.0117  0.0157  357 PHE D CD1   
1811 C  CD2   . PHE D 39  ? 0.3004 0.4964 0.3151 -0.0193 0.0186  0.0214  357 PHE D CD2   
1812 C  CE1   . PHE D 39  ? 0.2968 0.4632 0.2893 -0.0030 0.0141  0.0169  357 PHE D CE1   
1813 C  CE2   . PHE D 39  ? 0.3218 0.5018 0.3178 -0.0228 0.0229  0.0236  357 PHE D CE2   
1814 C  CZ    . PHE D 39  ? 0.3187 0.4843 0.3025 -0.0137 0.0200  0.0220  357 PHE D CZ    
1815 N  N     . LYS D 40  ? 0.1988 0.4549 0.2478 -0.0031 0.0257  0.0126  358 LYS D N     
1816 C  CA    . LYS D 40  ? 0.2276 0.5100 0.2861 -0.0102 0.0335  0.0105  358 LYS D CA    
1817 C  C     . LYS D 40  ? 0.2225 0.5129 0.2863 -0.0245 0.0334  0.0119  358 LYS D C     
1818 O  O     . LYS D 40  ? 0.2778 0.5471 0.3285 -0.0337 0.0332  0.0155  358 LYS D O     
1819 C  CB    . LYS D 40  ? 0.2460 0.5227 0.2905 -0.0139 0.0435  0.0100  358 LYS D CB    
1820 C  CG    . LYS D 40  ? 0.3148 0.6143 0.3663 -0.0254 0.0551  0.0080  358 LYS D CG    
1821 C  CD    . LYS D 40  ? 0.3644 0.6494 0.3943 -0.0294 0.0660  0.0096  358 LYS D CD    
1822 C  CE    . LYS D 40  ? 0.4221 0.7252 0.4567 -0.0432 0.0806  0.0080  358 LYS D CE    
1823 N  NZ    . LYS D 40  ? 0.5428 0.8264 0.5509 -0.0461 0.0919  0.0114  358 LYS D NZ    
1824 N  N     . ASP D 41  ? 0.2416 0.5636 0.3251 -0.0256 0.0332  0.0080  359 ASP D N     
1825 C  CA    . ASP D 41  ? 0.2769 0.6157 0.3704 -0.0397 0.0337  0.0059  359 ASP D CA    
1826 C  C     . ASP D 41  ? 0.2442 0.5707 0.3346 -0.0411 0.0237  0.0086  359 ASP D C     
1827 O  O     . ASP D 41  ? 0.3000 0.6376 0.3967 -0.0534 0.0233  0.0059  359 ASP D O     
1828 C  CB    . ASP D 41  ? 0.3261 0.6576 0.4108 -0.0575 0.0457  0.0059  359 ASP D CB    
1829 C  CG    . ASP D 41  ? 0.3629 0.7122 0.4526 -0.0589 0.0579  0.0022  359 ASP D CG    
1830 O  OD1   . ASP D 41  ? 0.3779 0.7584 0.4871 -0.0505 0.0569  -0.0033 359 ASP D OD1   
1831 O  OD2   . ASP D 41  ? 0.4210 0.7525 0.4940 -0.0674 0.0688  0.0050  359 ASP D OD2   
1832 N  N     . CYS D 42  ? 0.1929 0.4973 0.2742 -0.0297 0.0164  0.0127  360 CYS D N     
1833 C  CA    . CYS D 42  ? 0.2410 0.5351 0.3195 -0.0297 0.0079  0.0151  360 CYS D CA    
1834 C  C     . CYS D 42  ? 0.2675 0.5802 0.3574 -0.0159 0.0004  0.0146  360 CYS D C     
1835 O  O     . CYS D 42  ? 0.3990 0.7104 0.4906 -0.0014 -0.0001 0.0155  360 CYS D O     
1836 C  CB    . CYS D 42  ? 0.2609 0.5192 0.3231 -0.0265 0.0057  0.0195  360 CYS D CB    
1837 S  SG    . CYS D 42  ? 0.2269 0.4709 0.2845 -0.0286 -0.0022 0.0220  360 CYS D SG    
1838 N  N     . GLU D 43  ? 0.2730 0.6024 0.3695 -0.0197 -0.0053 0.0129  361 GLU D N     
1839 C  CA    . GLU D 43  ? 0.3301 0.6783 0.4348 -0.0049 -0.0132 0.0131  361 GLU D CA    
1840 C  C     . GLU D 43  ? 0.2389 0.5664 0.3315 0.0002  -0.0204 0.0182  361 GLU D C     
1841 O  O     . GLU D 43  ? 0.3427 0.6831 0.4376 0.0120  -0.0274 0.0196  361 GLU D O     
1842 C  CB    . GLU D 43  ? 0.4069 0.7973 0.5296 -0.0097 -0.0156 0.0058  361 GLU D CB    
1843 N  N     . ARG D 44  ? 0.2231 0.5190 0.3020 -0.0075 -0.0183 0.0212  362 ARG D N     
1844 C  CA    . ARG D 44  ? 0.2054 0.4845 0.2738 -0.0066 -0.0235 0.0247  362 ARG D CA    
1845 C  C     . ARG D 44  ? 0.2586 0.5248 0.3216 0.0110  -0.0260 0.0301  362 ARG D C     
1846 O  O     . ARG D 44  ? 0.2715 0.5264 0.3350 0.0196  -0.0222 0.0314  362 ARG D O     
1847 C  CB    . ARG D 44  ? 0.2831 0.5326 0.3403 -0.0179 -0.0200 0.0256  362 ARG D CB    
1848 C  CG    . ARG D 44  ? 0.4480 0.7032 0.5052 -0.0352 -0.0188 0.0216  362 ARG D CG    
1849 C  CD    . ARG D 44  ? 0.5093 0.7365 0.5540 -0.0413 -0.0191 0.0234  362 ARG D CD    
1850 N  NE    . ARG D 44  ? 0.5088 0.7385 0.5494 -0.0388 -0.0251 0.0238  362 ARG D NE    
1851 C  CZ    . ARG D 44  ? 0.4844 0.7161 0.5218 -0.0500 -0.0266 0.0201  362 ARG D CZ    
1852 N  NH1   . ARG D 44  ? 0.4669 0.6962 0.5055 -0.0650 -0.0219 0.0160  362 ARG D NH1   
1853 N  NH2   . ARG D 44  ? 0.4382 0.6720 0.4694 -0.0461 -0.0321 0.0205  362 ARG D NH2   
1854 N  N     . ARG D 45  ? 0.2394 0.5070 0.2964 0.0167  -0.0319 0.0329  363 ARG D N     
1855 C  CA    . ARG D 45  ? 0.2285 0.4797 0.2767 0.0331  -0.0329 0.0394  363 ARG D CA    
1856 C  C     . ARG D 45  ? 0.2294 0.4552 0.2626 0.0292  -0.0331 0.0431  363 ARG D C     
1857 O  O     . ARG D 45  ? 0.2873 0.5185 0.3175 0.0176  -0.0359 0.0404  363 ARG D O     
1858 C  CB    . ARG D 45  ? 0.3006 0.5785 0.3526 0.0484  -0.0397 0.0409  363 ARG D CB    
1859 C  CG    . ARG D 45  ? 0.3925 0.7042 0.4628 0.0511  -0.0402 0.0353  363 ARG D CG    
1860 C  CD    . ARG D 45  ? 0.4373 0.7759 0.5117 0.0692  -0.0481 0.0365  363 ARG D CD    
1861 N  NE    . ARG D 45  ? 0.5302 0.8432 0.5923 0.0886  -0.0468 0.0453  363 ARG D NE    
1862 C  CZ    . ARG D 45  ? 0.5567 0.8677 0.6243 0.1031  -0.0431 0.0466  363 ARG D CZ    
1863 N  NH1   . ARG D 45  ? 0.5507 0.8866 0.6365 0.1010  -0.0408 0.0396  363 ARG D NH1   
1864 N  NH2   . ARG D 45  ? 0.5941 0.8768 0.6485 0.1195  -0.0405 0.0548  363 ARG D NH2   
1865 N  N     . PHE D 46  ? 0.2344 0.4319 0.2585 0.0382  -0.0288 0.0484  364 PHE D N     
1866 C  CA    . PHE D 46  ? 0.2447 0.4152 0.2554 0.0342  -0.0262 0.0513  364 PHE D CA    
1867 C  C     . PHE D 46  ? 0.3047 0.4572 0.3028 0.0495  -0.0240 0.0592  364 PHE D C     
1868 O  O     . PHE D 46  ? 0.2671 0.4156 0.2672 0.0626  -0.0216 0.0621  364 PHE D O     
1869 C  CB    . PHE D 46  ? 0.2122 0.3594 0.2254 0.0246  -0.0196 0.0480  364 PHE D CB    
1870 C  CG    . PHE D 46  ? 0.2196 0.3773 0.2400 0.0106  -0.0206 0.0421  364 PHE D CG    
1871 C  CD1   . PHE D 46  ? 0.2350 0.3878 0.2506 -0.0015 -0.0215 0.0401  364 PHE D CD1   
1872 C  CD2   . PHE D 46  ? 0.2314 0.4018 0.2617 0.0100  -0.0197 0.0388  364 PHE D CD2   
1873 C  CE1   . PHE D 46  ? 0.2626 0.4208 0.2825 -0.0134 -0.0212 0.0357  364 PHE D CE1   
1874 C  CE2   . PHE D 46  ? 0.2427 0.4188 0.2760 -0.0023 -0.0191 0.0349  364 PHE D CE2   
1875 C  CZ    . PHE D 46  ? 0.2827 0.4516 0.3105 -0.0139 -0.0198 0.0336  364 PHE D CZ    
1876 N  N     . SER D 47  ? 0.2893 0.4275 0.2726 0.0476  -0.0236 0.0627  365 SER D N     
1877 C  CA    . SER D 47  ? 0.3106 0.4265 0.2775 0.0611  -0.0195 0.0713  365 SER D CA    
1878 C  C     . SER D 47  ? 0.3196 0.4026 0.2871 0.0620  -0.0080 0.0723  365 SER D C     
1879 O  O     . SER D 47  ? 0.3427 0.4071 0.3010 0.0755  -0.0026 0.0790  365 SER D O     
1880 C  CB    . SER D 47  ? 0.3913 0.4995 0.3404 0.0575  -0.0205 0.0742  365 SER D CB    
1881 O  OG    . SER D 47  ? 0.4645 0.6044 0.4122 0.0580  -0.0317 0.0722  365 SER D OG    
1882 N  N     . ARG D 48  ? 0.2816 0.3562 0.2594 0.0482  -0.0038 0.0652  366 ARG D N     
1883 C  CA    . ARG D 48  ? 0.2930 0.3389 0.2732 0.0461  0.0068  0.0632  366 ARG D CA    
1884 C  C     . ARG D 48  ? 0.2951 0.3478 0.2926 0.0408  0.0068  0.0547  366 ARG D C     
1885 O  O     . ARG D 48  ? 0.2715 0.3441 0.2767 0.0329  0.0006  0.0501  366 ARG D O     
1886 C  CB    . ARG D 48  ? 0.3156 0.3435 0.2899 0.0352  0.0121  0.0616  366 ARG D CB    
1887 C  CG    . ARG D 48  ? 0.3720 0.3961 0.3266 0.0394  0.0112  0.0694  366 ARG D CG    
1888 C  CD    . ARG D 48  ? 0.4319 0.4333 0.3777 0.0312  0.0198  0.0691  366 ARG D CD    
1889 N  NE    . ARG D 48  ? 0.3142 0.3130 0.2750 0.0173  0.0226  0.0593  366 ARG D NE    
1890 C  CZ    . ARG D 48  ? 0.3287 0.3174 0.2862 0.0080  0.0273  0.0563  366 ARG D CZ    
1891 N  NH1   . ARG D 48  ? 0.3144 0.2942 0.2525 0.0100  0.0301  0.0624  366 ARG D NH1   
1892 N  NH2   . ARG D 48  ? 0.3069 0.2947 0.2794 -0.0023 0.0290  0.0470  366 ARG D NH2   
1893 N  N     . SER D 49  ? 0.2922 0.3266 0.2944 0.0446  0.0145  0.0522  367 SER D N     
1894 C  CA    . SER D 49  ? 0.2927 0.3344 0.3092 0.0406  0.0140  0.0433  367 SER D CA    
1895 C  C     . SER D 49  ? 0.2830 0.3247 0.3057 0.0270  0.0128  0.0358  367 SER D C     
1896 O  O     . SER D 49  ? 0.2633 0.3189 0.2934 0.0229  0.0083  0.0303  367 SER D O     
1897 C  CB    . SER D 49  ? 0.3799 0.4021 0.4005 0.0472  0.0226  0.0403  367 SER D CB    
1898 O  OG    . SER D 49  ? 0.4668 0.4649 0.4884 0.0402  0.0313  0.0361  367 SER D OG    
1899 N  N     . ASP D 50  ? 0.2833 0.3097 0.3020 0.0206  0.0170  0.0357  368 ASP D N     
1900 C  CA    . ASP D 50  ? 0.2622 0.2893 0.2878 0.0097  0.0155  0.0281  368 ASP D CA    
1901 C  C     . ASP D 50  ? 0.2194 0.2652 0.2424 0.0043  0.0070  0.0294  368 ASP D C     
1902 O  O     . ASP D 50  ? 0.2295 0.2802 0.2580 -0.0017 0.0038  0.0237  368 ASP D O     
1903 C  CB    . ASP D 50  ? 0.2780 0.2852 0.3022 0.0042  0.0235  0.0263  368 ASP D CB    
1904 C  CG    . ASP D 50  ? 0.3950 0.3982 0.4045 0.0036  0.0242  0.0344  368 ASP D CG    
1905 O  OD1   . ASP D 50  ? 0.3296 0.3414 0.3288 0.0103  0.0199  0.0424  368 ASP D OD1   
1906 O  OD2   . ASP D 50  ? 0.4568 0.4487 0.4652 -0.0032 0.0294  0.0320  368 ASP D OD2   
1907 N  N     . GLN D 51  ? 0.2048 0.2609 0.2190 0.0067  0.0033  0.0364  369 GLN D N     
1908 C  CA    . GLN D 51  ? 0.2037 0.2779 0.2168 0.0003  -0.0036 0.0364  369 GLN D CA    
1909 C  C     . GLN D 51  ? 0.1739 0.2649 0.1942 0.0014  -0.0070 0.0343  369 GLN D C     
1910 O  O     . GLN D 51  ? 0.2113 0.3102 0.2331 -0.0061 -0.0097 0.0316  369 GLN D O     
1911 C  CB    . GLN D 51  ? 0.2286 0.3130 0.2322 0.0025  -0.0071 0.0422  369 GLN D CB    
1912 C  CG    . GLN D 51  ? 0.2566 0.3243 0.2489 0.0013  -0.0033 0.0449  369 GLN D CG    
1913 C  CD    . GLN D 51  ? 0.2747 0.3515 0.2545 0.0080  -0.0070 0.0513  369 GLN D CD    
1914 O  OE1   . GLN D 51  ? 0.2419 0.3347 0.2227 0.0170  -0.0115 0.0544  369 GLN D OE1   
1915 N  NE2   . GLN D 51  ? 0.2967 0.3640 0.2638 0.0048  -0.0054 0.0529  369 GLN D NE2   
1916 N  N     . LEU D 52  ? 0.2002 0.2955 0.2237 0.0111  -0.0058 0.0357  370 LEU D N     
1917 C  CA    . LEU D 52  ? 0.1911 0.3015 0.2212 0.0126  -0.0074 0.0329  370 LEU D CA    
1918 C  C     . LEU D 52  ? 0.2115 0.3132 0.2451 0.0083  -0.0060 0.0265  370 LEU D C     
1919 O  O     . LEU D 52  ? 0.1902 0.3014 0.2239 0.0036  -0.0081 0.0245  370 LEU D O     
1920 C  CB    . LEU D 52  ? 0.2113 0.3260 0.2443 0.0252  -0.0056 0.0350  370 LEU D CB    
1921 C  CG    . LEU D 52  ? 0.2237 0.3521 0.2639 0.0278  -0.0054 0.0310  370 LEU D CG    
1922 C  CD1   . LEU D 52  ? 0.2161 0.3685 0.2583 0.0211  -0.0091 0.0310  370 LEU D CD1   
1923 C  CD2   . LEU D 52  ? 0.2473 0.3775 0.2905 0.0417  -0.0029 0.0325  370 LEU D CD2   
1924 N  N     . LYS D 53  ? 0.2149 0.2986 0.2509 0.0100  -0.0021 0.0226  371 LYS D N     
1925 C  CA    . LYS D 53  ? 0.2119 0.2902 0.2521 0.0072  -0.0023 0.0147  371 LYS D CA    
1926 C  C     . LYS D 53  ? 0.2273 0.3066 0.2640 -0.0009 -0.0061 0.0139  371 LYS D C     
1927 O  O     . LYS D 53  ? 0.2261 0.3097 0.2614 -0.0020 -0.0087 0.0108  371 LYS D O     
1928 C  CB    . LYS D 53  ? 0.2656 0.3265 0.3118 0.0085  0.0030  0.0089  371 LYS D CB    
1929 C  CG    . LYS D 53  ? 0.4505 0.5055 0.4995 0.0169  0.0084  0.0086  371 LYS D CG    
1930 C  CD    . LYS D 53  ? 0.6175 0.6845 0.6691 0.0216  0.0064  0.0045  371 LYS D CD    
1931 C  CE    . LYS D 53  ? 0.6689 0.7289 0.7240 0.0305  0.0122  0.0027  371 LYS D CE    
1932 N  NZ    . LYS D 53  ? 0.6820 0.7560 0.7385 0.0348  0.0102  -0.0015 371 LYS D NZ    
1933 N  N     . ARG D 54  ? 0.1911 0.2645 0.2246 -0.0059 -0.0058 0.0168  372 ARG D N     
1934 C  CA    . ARG D 54  ? 0.1918 0.2636 0.2215 -0.0130 -0.0086 0.0161  372 ARG D CA    
1935 C  C     . ARG D 54  ? 0.2098 0.2938 0.2339 -0.0163 -0.0113 0.0195  372 ARG D C     
1936 O  O     . ARG D 54  ? 0.2053 0.2870 0.2256 -0.0189 -0.0128 0.0180  372 ARG D O     
1937 C  CB    . ARG D 54  ? 0.1846 0.2485 0.2111 -0.0177 -0.0069 0.0182  372 ARG D CB    
1938 C  CG    . ARG D 54  ? 0.2113 0.2711 0.2340 -0.0245 -0.0088 0.0168  372 ARG D CG    
1939 C  CD    . ARG D 54  ? 0.2002 0.2521 0.2195 -0.0286 -0.0062 0.0177  372 ARG D CD    
1940 N  NE    . ARG D 54  ? 0.2039 0.2647 0.2165 -0.0294 -0.0070 0.0234  372 ARG D NE    
1941 C  CZ    . ARG D 54  ? 0.2272 0.2846 0.2330 -0.0319 -0.0056 0.0254  372 ARG D CZ    
1942 N  NH1   . ARG D 54  ? 0.2136 0.2573 0.2185 -0.0350 -0.0017 0.0224  372 ARG D NH1   
1943 N  NH2   . ARG D 54  ? 0.2148 0.2842 0.2147 -0.0310 -0.0082 0.0296  372 ARG D NH2   
1944 N  N     . HIS D 55  ? 0.2014 0.2984 0.2250 -0.0161 -0.0113 0.0239  373 HIS D N     
1945 C  CA    . HIS D 55  ? 0.1911 0.3027 0.2126 -0.0206 -0.0121 0.0258  373 HIS D CA    
1946 C  C     . HIS D 55  ? 0.2102 0.3249 0.2313 -0.0179 -0.0111 0.0240  373 HIS D C     
1947 O  O     . HIS D 55  ? 0.2214 0.3371 0.2367 -0.0236 -0.0102 0.0247  373 HIS D O     
1948 C  CB    . HIS D 55  ? 0.1878 0.3174 0.2128 -0.0180 -0.0130 0.0288  373 HIS D CB    
1949 C  CG    . HIS D 55  ? 0.2139 0.3632 0.2420 -0.0208 -0.0123 0.0286  373 HIS D CG    
1950 N  ND1   . HIS D 55  ? 0.2189 0.3766 0.2455 -0.0317 -0.0119 0.0283  373 HIS D ND1   
1951 C  CD2   . HIS D 55  ? 0.2232 0.3849 0.2563 -0.0150 -0.0106 0.0279  373 HIS D CD2   
1952 C  CE1   . HIS D 55  ? 0.2314 0.4065 0.2627 -0.0332 -0.0094 0.0274  373 HIS D CE1   
1953 N  NE2   . HIS D 55  ? 0.1980 0.3764 0.2330 -0.0227 -0.0088 0.0273  373 HIS D NE2   
1954 N  N     . GLN D 56  ? 0.2006 0.3154 0.2262 -0.0093 -0.0104 0.0214  374 GLN D N     
1955 C  CA    . GLN D 56  ? 0.2466 0.3659 0.2701 -0.0063 -0.0094 0.0190  374 GLN D CA    
1956 C  C     . GLN D 56  ? 0.2390 0.3464 0.2547 -0.0077 -0.0110 0.0163  374 GLN D C     
1957 O  O     . GLN D 56  ? 0.2149 0.3251 0.2237 -0.0061 -0.0102 0.0157  374 GLN D O     
1958 C  CB    . GLN D 56  ? 0.2009 0.3220 0.2310 0.0033  -0.0079 0.0154  374 GLN D CB    
1959 C  CG    . GLN D 56  ? 0.2624 0.3982 0.2982 0.0071  -0.0065 0.0192  374 GLN D CG    
1960 C  CD    . GLN D 56  ? 0.3246 0.4644 0.3656 0.0171  -0.0039 0.0162  374 GLN D CD    
1961 O  OE1   . GLN D 56  ? 0.3567 0.5140 0.4014 0.0207  -0.0025 0.0175  374 GLN D OE1   
1962 N  NE2   . GLN D 56  ? 0.3428 0.4675 0.3856 0.0215  -0.0026 0.0113  374 GLN D NE2   
1963 N  N     . ARG D 57  ? 0.2574 0.3519 0.2728 -0.0097 -0.0133 0.0147  375 ARG D N     
1964 C  CA    . ARG D 57  ? 0.2560 0.3408 0.2630 -0.0096 -0.0158 0.0130  375 ARG D CA    
1965 C  C     . ARG D 57  ? 0.2690 0.3527 0.2640 -0.0157 -0.0137 0.0189  375 ARG D C     
1966 O  O     . ARG D 57  ? 0.2865 0.3621 0.2698 -0.0134 -0.0147 0.0194  375 ARG D O     
1967 C  CB    . ARG D 57  ? 0.2232 0.2965 0.2343 -0.0105 -0.0181 0.0097  375 ARG D CB    
1968 C  CG    . ARG D 57  ? 0.2535 0.3256 0.2772 -0.0067 -0.0179 0.0030  375 ARG D CG    
1969 C  CD    . ARG D 57  ? 0.2537 0.3161 0.2829 -0.0094 -0.0182 -0.0004 375 ARG D CD    
1970 N  NE    . ARG D 57  ? 0.2442 0.3043 0.2856 -0.0081 -0.0149 -0.0062 375 ARG D NE    
1971 C  CZ    . ARG D 57  ? 0.3408 0.3934 0.3882 -0.0116 -0.0117 -0.0080 375 ARG D CZ    
1972 N  NH1   . ARG D 57  ? 0.3002 0.3484 0.3428 -0.0158 -0.0125 -0.0051 375 ARG D NH1   
1973 N  NH2   . ARG D 57  ? 0.3501 0.3979 0.4075 -0.0114 -0.0065 -0.0129 375 ARG D NH2   
1974 N  N     . ARG D 58  ? 0.2260 0.3174 0.2230 -0.0231 -0.0106 0.0230  376 ARG D N     
1975 C  CA    . ARG D 58  ? 0.2524 0.3431 0.2398 -0.0309 -0.0065 0.0272  376 ARG D CA    
1976 C  C     . ARG D 58  ? 0.3027 0.4000 0.2837 -0.0280 -0.0031 0.0281  376 ARG D C     
1977 O  O     . ARG D 58  ? 0.3503 0.4384 0.3174 -0.0311 0.0007  0.0314  376 ARG D O     
1978 C  CB    . ARG D 58  ? 0.2828 0.3854 0.2768 -0.0402 -0.0043 0.0287  376 ARG D CB    
1979 C  CG    . ARG D 58  ? 0.2979 0.3928 0.2944 -0.0439 -0.0068 0.0280  376 ARG D CG    
1980 C  CD    . ARG D 58  ? 0.3922 0.4976 0.3912 -0.0546 -0.0048 0.0283  376 ARG D CD    
1981 N  NE    . ARG D 58  ? 0.5184 0.6144 0.5082 -0.0640 0.0005  0.0297  376 ARG D NE    
1982 C  CZ    . ARG D 58  ? 0.6547 0.7596 0.6463 -0.0760 0.0047  0.0286  376 ARG D CZ    
1983 N  NH1   . ARG D 58  ? 0.6149 0.7422 0.6179 -0.0788 0.0022  0.0256  376 ARG D NH1   
1984 N  NH2   . ARG D 58  ? 0.7546 0.8457 0.7363 -0.0848 0.0115  0.0300  376 ARG D NH2   
1985 N  N     . HIS D 59  ? 0.2686 0.3797 0.2580 -0.0217 -0.0034 0.0253  377 HIS D N     
1986 C  CA    . HIS D 59  ? 0.2659 0.3849 0.2495 -0.0190 0.0009  0.0253  377 HIS D CA    
1987 C  C     . HIS D 59  ? 0.2668 0.3748 0.2384 -0.0104 -0.0018 0.0227  377 HIS D C     
1988 O  O     . HIS D 59  ? 0.3036 0.4101 0.2612 -0.0095 0.0022  0.0246  377 HIS D O     
1989 C  CB    . HIS D 59  ? 0.2408 0.3791 0.2381 -0.0145 0.0019  0.0226  377 HIS D CB    
1990 C  CG    . HIS D 59  ? 0.2581 0.4119 0.2669 -0.0206 0.0032  0.0244  377 HIS D CG    
1991 N  ND1   . HIS D 59  ? 0.2898 0.4513 0.2974 -0.0315 0.0080  0.0267  377 HIS D ND1   
1992 C  CD2   . HIS D 59  ? 0.2279 0.3919 0.2492 -0.0166 0.0002  0.0237  377 HIS D CD2   
1993 C  CE1   . HIS D 59  ? 0.2899 0.4690 0.3104 -0.0342 0.0066  0.0259  377 HIS D CE1   
1994 N  NE2   . HIS D 59  ? 0.2101 0.3906 0.2376 -0.0241 0.0015  0.0249  377 HIS D NE2   
1995 N  N     . THR D 60  ? 0.2598 0.3614 0.2366 -0.0038 -0.0083 0.0174  378 THR D N     
1996 C  CA    . THR D 60  ? 0.2548 0.3499 0.2222 0.0048  -0.0125 0.0126  378 THR D CA    
1997 C  C     . THR D 60  ? 0.3230 0.4023 0.2760 0.0052  -0.0156 0.0157  378 THR D C     
1998 O  O     . THR D 60  ? 0.3302 0.4043 0.2693 0.0131  -0.0190 0.0138  378 THR D O     
1999 C  CB    . THR D 60  ? 0.3137 0.4104 0.2952 0.0107  -0.0175 0.0035  378 THR D CB    
2000 O  OG1   . THR D 60  ? 0.2920 0.3818 0.2825 0.0067  -0.0196 0.0038  378 THR D OG1   
2001 C  CG2   . THR D 60  ? 0.2780 0.3862 0.2720 0.0125  -0.0139 0.0004  378 THR D CG2   
2002 N  N     . GLY D 61  ? 0.3109 0.3821 0.2659 -0.0019 -0.0147 0.0200  379 GLY D N     
2003 C  CA    . GLY D 61  ? 0.3082 0.3623 0.2506 -0.0005 -0.0172 0.0228  379 GLY D CA    
2004 C  C     . GLY D 61  ? 0.3531 0.4038 0.3018 0.0078  -0.0256 0.0155  379 GLY D C     
2005 O  O     . GLY D 61  ? 0.3750 0.4129 0.3128 0.0124  -0.0290 0.0168  379 GLY D O     
2006 N  N     . VAL D 62  ? 0.2850 0.3464 0.2519 0.0095  -0.0283 0.0073  380 VAL D N     
2007 C  CA    A VAL D 62  ? 0.2929 0.3546 0.2692 0.0162  -0.0353 -0.0023 380 VAL D CA    
2008 C  CA    B VAL D 62  ? 0.2932 0.3548 0.2693 0.0162  -0.0353 -0.0022 380 VAL D CA    
2009 C  C     . VAL D 62  ? 0.2813 0.3344 0.2645 0.0122  -0.0356 -0.0016 380 VAL D C     
2010 O  O     . VAL D 62  ? 0.3193 0.3701 0.3069 0.0033  -0.0305 0.0032  380 VAL D O     
2011 C  CB    A VAL D 62  ? 0.3015 0.3745 0.2952 0.0172  -0.0352 -0.0116 380 VAL D CB    
2012 C  CB    B VAL D 62  ? 0.3030 0.3761 0.2963 0.0174  -0.0354 -0.0116 380 VAL D CB    
2013 C  CG1   A VAL D 62  ? 0.2518 0.3252 0.2593 0.0092  -0.0296 -0.0091 380 VAL D CG1   
2014 C  CG1   B VAL D 62  ? 0.3525 0.4281 0.3592 0.0221  -0.0412 -0.0237 380 VAL D CG1   
2015 C  CG2   A VAL D 62  ? 0.3515 0.4284 0.3554 0.0238  -0.0420 -0.0243 380 VAL D CG2   
2016 C  CG2   B VAL D 62  ? 0.2626 0.3436 0.2477 0.0222  -0.0349 -0.0131 380 VAL D CG2   
2017 N  N     . LYS D 63  ? 0.2909 0.3406 0.2745 0.0194  -0.0419 -0.0073 381 LYS D N     
2018 C  CA    . LYS D 63  ? 0.2891 0.3315 0.2802 0.0176  -0.0425 -0.0088 381 LYS D CA    
2019 C  C     . LYS D 63  ? 0.2863 0.3388 0.2963 0.0228  -0.0477 -0.0224 381 LYS D C     
2020 O  O     . LYS D 63  ? 0.3648 0.4190 0.3735 0.0326  -0.0551 -0.0283 381 LYS D O     
2021 C  CB    . LYS D 63  ? 0.3091 0.3365 0.2817 0.0220  -0.0442 -0.0020 381 LYS D CB    
2022 C  CG    . LYS D 63  ? 0.3514 0.3674 0.3082 0.0136  -0.0368 0.0099  381 LYS D CG    
2023 C  CD    . LYS D 63  ? 0.4648 0.4606 0.4047 0.0168  -0.0364 0.0160  381 LYS D CD    
2024 C  CE    . LYS D 63  ? 0.5796 0.5628 0.5066 0.0054  -0.0271 0.0260  381 LYS D CE    
2025 N  NZ    . LYS D 63  ? 0.6646 0.6500 0.5775 0.0048  -0.0233 0.0317  381 LYS D NZ    
2026 N  N     . PRO D 64  ? 0.2663 0.3257 0.2943 0.0168  -0.0435 -0.0282 382 PRO D N     
2027 C  CA    . PRO D 64  ? 0.3219 0.3921 0.3695 0.0199  -0.0464 -0.0431 382 PRO D CA    
2028 C  C     . PRO D 64  ? 0.3082 0.3789 0.3688 0.0209  -0.0482 -0.0505 382 PRO D C     
2029 O  O     . PRO D 64  ? 0.3132 0.3956 0.3920 0.0234  -0.0510 -0.0648 382 PRO D O     
2030 C  CB    . PRO D 64  ? 0.2907 0.3617 0.3505 0.0117  -0.0382 -0.0443 382 PRO D CB    
2031 C  CG    . PRO D 64  ? 0.3017 0.3673 0.3474 0.0078  -0.0339 -0.0310 382 PRO D CG    
2032 C  CD    . PRO D 64  ? 0.2671 0.3246 0.2973 0.0076  -0.0357 -0.0217 382 PRO D CD    
2033 N  N     . PHE D 65  ? 0.2992 0.3588 0.3534 0.0183  -0.0459 -0.0430 383 PHE D N     
2034 C  CA    . PHE D 65  ? 0.2810 0.3408 0.3500 0.0176  -0.0449 -0.0502 383 PHE D CA    
2035 C  C     . PHE D 65  ? 0.2992 0.3540 0.3577 0.0276  -0.0520 -0.0486 383 PHE D C     
2036 O  O     . PHE D 65  ? 0.4207 0.4605 0.4601 0.0268  -0.0504 -0.0367 383 PHE D O     
2037 C  CB    . PHE D 65  ? 0.2597 0.3094 0.3304 0.0062  -0.0350 -0.0441 383 PHE D CB    
2038 C  CG    . PHE D 65  ? 0.2525 0.3038 0.3287 -0.0013 -0.0281 -0.0431 383 PHE D CG    
2039 C  CD1   . PHE D 65  ? 0.2953 0.3518 0.3912 -0.0046 -0.0231 -0.0538 383 PHE D CD1   
2040 C  CD2   . PHE D 65  ? 0.2330 0.2805 0.2952 -0.0044 -0.0260 -0.0320 383 PHE D CD2   
2041 C  CE1   . PHE D 65  ? 0.2651 0.3188 0.3635 -0.0100 -0.0158 -0.0518 383 PHE D CE1   
2042 C  CE2   . PHE D 65  ? 0.2735 0.3218 0.3399 -0.0087 -0.0201 -0.0306 383 PHE D CE2   
2043 C  CZ    . PHE D 65  ? 0.2832 0.3327 0.3663 -0.0109 -0.0149 -0.0399 383 PHE D CZ    
2044 N  N     . GLN D 66  ? 0.2505 0.3177 0.3222 0.0371  -0.0593 -0.0612 384 GLN D N     
2045 C  CA    . GLN D 66  ? 0.2967 0.3601 0.3572 0.0508  -0.0678 -0.0601 384 GLN D CA    
2046 C  C     . GLN D 66  ? 0.3110 0.3762 0.3878 0.0529  -0.0672 -0.0679 384 GLN D C     
2047 O  O     . GLN D 66  ? 0.3088 0.3904 0.4121 0.0499  -0.0659 -0.0822 384 GLN D O     
2048 C  CB    . GLN D 66  ? 0.2999 0.3788 0.3587 0.0646  -0.0797 -0.0685 384 GLN D CB    
2049 C  CG    . GLN D 66  ? 0.3316 0.4038 0.3735 0.0813  -0.0889 -0.0650 384 GLN D CG    
2050 C  CD    . GLN D 66  ? 0.4280 0.5131 0.4600 0.0960  -0.1010 -0.0702 384 GLN D CD    
2051 O  OE1   . GLN D 66  ? 0.4546 0.5620 0.5049 0.0955  -0.1052 -0.0847 384 GLN D OE1   
2052 N  NE2   . GLN D 66  ? 0.4641 0.5337 0.4655 0.1088  -0.1059 -0.0586 384 GLN D NE2   
2053 N  N     . CYS D 67  ? 0.2604 0.3080 0.3216 0.0575  -0.0669 -0.0590 385 CYS D N     
2054 C  CA    . CYS D 67  ? 0.2877 0.3353 0.3616 0.0620  -0.0667 -0.0658 385 CYS D CA    
2055 C  C     . CYS D 67  ? 0.3531 0.4216 0.4415 0.0785  -0.0786 -0.0800 385 CYS D C     
2056 O  O     . CYS D 67  ? 0.3745 0.4436 0.4468 0.0930  -0.0890 -0.0774 385 CYS D O     
2057 C  CB    . CYS D 67  ? 0.2936 0.3149 0.3443 0.0650  -0.0641 -0.0530 385 CYS D CB    
2058 S  SG    . CYS D 67  ? 0.3270 0.3461 0.3924 0.0712  -0.0626 -0.0614 385 CYS D SG    
2059 N  N     . LYS D 68  ? 0.3067 0.3930 0.4253 0.0765  -0.0768 -0.0955 386 LYS D N     
2060 C  CA    . LYS D 68  ? 0.3411 0.4534 0.4795 0.0912  -0.0883 -0.1125 386 LYS D CA    
2061 C  C     . LYS D 68  ? 0.3947 0.5007 0.5243 0.1100  -0.0961 -0.1107 386 LYS D C     
2062 O  O     . LYS D 68  ? 0.4235 0.5515 0.5650 0.1266  -0.1085 -0.1233 386 LYS D O     
2063 C  CB    . LYS D 68  ? 0.3607 0.4955 0.5373 0.0809  -0.0816 -0.1310 386 LYS D CB    
2064 C  CG    . LYS D 68  ? 0.4304 0.5699 0.6157 0.0642  -0.0737 -0.1338 386 LYS D CG    
2065 C  CD    . LYS D 68  ? 0.5061 0.6653 0.7282 0.0538  -0.0654 -0.1525 386 LYS D CD    
2066 C  CE    . LYS D 68  ? 0.5245 0.6765 0.7498 0.0355  -0.0527 -0.1505 386 LYS D CE    
2067 N  NZ    . LYS D 68  ? 0.5182 0.6722 0.7316 0.0371  -0.0590 -0.1478 386 LYS D NZ    
2068 N  N     . THR D 69  ? 0.4008 0.4777 0.5099 0.1083  -0.0893 -0.0962 387 THR D N     
2069 C  CA    . THR D 69  ? 0.4064 0.4712 0.5054 0.1256  -0.0941 -0.0934 387 THR D CA    
2070 C  C     . THR D 69  ? 0.4631 0.5039 0.5237 0.1389  -0.1004 -0.0770 387 THR D C     
2071 O  O     . THR D 69  ? 0.4942 0.5373 0.5467 0.1611  -0.1121 -0.0786 387 THR D O     
2072 C  CB    . THR D 69  ? 0.4119 0.4576 0.5130 0.1152  -0.0812 -0.0898 387 THR D CB    
2073 O  OG1   . THR D 69  ? 0.4336 0.5015 0.5692 0.1055  -0.0750 -0.1057 387 THR D OG1   
2074 C  CG2   . THR D 69  ? 0.3701 0.3983 0.4582 0.1332  -0.0849 -0.0859 387 THR D CG2   
2075 N  N     . CYS D 70  ? 0.4296 0.4474 0.4660 0.1261  -0.0925 -0.0614 388 CYS D N     
2076 C  CA    . CYS D 70  ? 0.4156 0.4066 0.4143 0.1353  -0.0945 -0.0448 388 CYS D CA    
2077 C  C     . CYS D 70  ? 0.4389 0.4349 0.4234 0.1316  -0.0970 -0.0394 388 CYS D C     
2078 O  O     . CYS D 70  ? 0.5026 0.4767 0.4548 0.1377  -0.0970 -0.0254 388 CYS D O     
2079 C  CB    . CYS D 70  ? 0.4128 0.3692 0.3928 0.1235  -0.0813 -0.0309 388 CYS D CB    
2080 S  SG    . CYS D 70  ? 0.4234 0.3780 0.4057 0.0947  -0.0682 -0.0252 388 CYS D SG    
2081 N  N     . GLN D 71  ? 0.4283 0.4504 0.4353 0.1214  -0.0976 -0.0500 389 GLN D N     
2082 C  CA    . GLN D 71  ? 0.4021 0.4329 0.4002 0.1184  -0.1002 -0.0482 389 GLN D CA    
2083 C  C     . GLN D 71  ? 0.4104 0.4187 0.3861 0.1041  -0.0892 -0.0318 389 GLN D C     
2084 O  O     . GLN D 71  ? 0.4216 0.4334 0.3854 0.1028  -0.0902 -0.0281 389 GLN D O     
2085 C  CB    . GLN D 71  ? 0.4467 0.4845 0.4276 0.1404  -0.1143 -0.0495 389 GLN D CB    
2086 C  CG    . GLN D 71  ? 0.4495 0.5210 0.4579 0.1531  -0.1274 -0.0702 389 GLN D CG    
2087 C  CD    . GLN D 71  ? 0.5023 0.5747 0.5256 0.1625  -0.1295 -0.0763 389 GLN D CD    
2088 O  OE1   . GLN D 71  ? 0.5744 0.6261 0.5751 0.1780  -0.1326 -0.0665 389 GLN D OE1   
2089 N  NE2   . GLN D 71  ? 0.5307 0.6254 0.5916 0.1531  -0.1264 -0.0924 389 GLN D NE2   
2090 N  N     . ARG D 72  ? 0.3507 0.3380 0.3215 0.0928  -0.0785 -0.0231 390 ARG D N     
2091 C  CA    . ARG D 72  ? 0.3476 0.3213 0.3046 0.0769  -0.0682 -0.0113 390 ARG D CA    
2092 C  C     . ARG D 72  ? 0.3628 0.3572 0.3397 0.0635  -0.0653 -0.0176 390 ARG D C     
2093 O  O     . ARG D 72  ? 0.3547 0.3652 0.3575 0.0596  -0.0653 -0.0291 390 ARG D O     
2094 C  CB    . ARG D 72  ? 0.3947 0.3456 0.3462 0.0666  -0.0580 -0.0042 390 ARG D CB    
2095 C  CG    . ARG D 72  ? 0.4047 0.3426 0.3412 0.0511  -0.0481 0.0072  390 ARG D CG    
2096 C  CD    . ARG D 72  ? 0.4463 0.3592 0.3730 0.0426  -0.0388 0.0135  390 ARG D CD    
2097 N  NE    . ARG D 72  ? 0.4536 0.3585 0.3686 0.0272  -0.0298 0.0222  390 ARG D NE    
2098 C  CZ    . ARG D 72  ? 0.4946 0.3763 0.3958 0.0180  -0.0206 0.0289  390 ARG D CZ    
2099 N  NH1   . ARG D 72  ? 0.4859 0.3467 0.3813 0.0233  -0.0189 0.0288  390 ARG D NH1   
2100 N  NH2   . ARG D 72  ? 0.5026 0.3830 0.3972 0.0034  -0.0129 0.0345  390 ARG D NH2   
2101 N  N     . LYS D 73  ? 0.3305 0.3237 0.2952 0.0567  -0.0617 -0.0102 391 LYS D N     
2102 C  CA    . LYS D 73  ? 0.3038 0.3137 0.2845 0.0458  -0.0585 -0.0147 391 LYS D CA    
2103 C  C     . LYS D 73  ? 0.2760 0.2774 0.2551 0.0295  -0.0480 -0.0066 391 LYS D C     
2104 O  O     . LYS D 73  ? 0.3272 0.3115 0.2885 0.0254  -0.0430 0.0037  391 LYS D O     
2105 C  CB    . LYS D 73  ? 0.3489 0.3684 0.3202 0.0512  -0.0627 -0.0147 391 LYS D CB    
2106 C  CG    . LYS D 73  ? 0.3816 0.4115 0.3519 0.0684  -0.0748 -0.0237 391 LYS D CG    
2107 C  CD    . LYS D 73  ? 0.4437 0.4815 0.3999 0.0744  -0.0789 -0.0236 391 LYS D CD    
2108 C  CE    . LYS D 73  ? 0.5196 0.5702 0.4731 0.0927  -0.0924 -0.0337 391 LYS D CE    
2109 N  NZ    . LYS D 73  ? 0.5630 0.6165 0.4944 0.1002  -0.0961 -0.0314 391 LYS D NZ    
2110 N  N     . PHE D 74  ? 0.2554 0.2688 0.2528 0.0204  -0.0443 -0.0115 392 PHE D N     
2111 C  CA    . PHE D 74  ? 0.2342 0.2431 0.2317 0.0067  -0.0360 -0.0054 392 PHE D CA    
2112 C  C     . PHE D 74  ? 0.2417 0.2636 0.2470 0.0015  -0.0336 -0.0060 392 PHE D C     
2113 O  O     . PHE D 74  ? 0.2451 0.2785 0.2633 0.0055  -0.0363 -0.0142 392 PHE D O     
2114 C  CB    . PHE D 74  ? 0.2746 0.2804 0.2846 0.0014  -0.0324 -0.0099 392 PHE D CB    
2115 C  CG    . PHE D 74  ? 0.2338 0.2259 0.2375 0.0069  -0.0338 -0.0100 392 PHE D CG    
2116 C  CD1   . PHE D 74  ? 0.3106 0.2857 0.3001 0.0006  -0.0287 -0.0025 392 PHE D CD1   
2117 C  CD2   . PHE D 74  ? 0.2715 0.2683 0.2833 0.0193  -0.0405 -0.0184 392 PHE D CD2   
2118 C  CE1   . PHE D 74  ? 0.3138 0.2728 0.2959 0.0068  -0.0292 -0.0023 392 PHE D CE1   
2119 C  CE2   . PHE D 74  ? 0.2805 0.2639 0.2856 0.0269  -0.0421 -0.0180 392 PHE D CE2   
2120 C  CZ    . PHE D 74  ? 0.2731 0.2358 0.2625 0.0209  -0.0361 -0.0094 392 PHE D CZ    
2121 N  N     . SER D 75  ? 0.2528 0.2732 0.2514 -0.0074 -0.0283 0.0018  393 SER D N     
2122 C  CA    . SER D 75  ? 0.2787 0.3108 0.2838 -0.0108 -0.0260 0.0022  393 SER D CA    
2123 C  C     . SER D 75  ? 0.2515 0.2874 0.2721 -0.0140 -0.0232 -0.0029 393 SER D C     
2124 O  O     . SER D 75  ? 0.2408 0.2842 0.2687 -0.0132 -0.0217 -0.0048 393 SER D O     
2125 C  CB    . SER D 75  ? 0.2662 0.2990 0.2621 -0.0188 -0.0216 0.0107  393 SER D CB    
2126 O  OG    . SER D 75  ? 0.2559 0.2824 0.2512 -0.0268 -0.0185 0.0127  393 SER D OG    
2127 N  N     . ARG D 76  ? 0.2206 0.2496 0.2453 -0.0171 -0.0212 -0.0050 394 ARG D N     
2128 C  CA    . ARG D 76  ? 0.2154 0.2450 0.2499 -0.0217 -0.0161 -0.0074 394 ARG D CA    
2129 C  C     . ARG D 76  ? 0.2816 0.3074 0.3272 -0.0207 -0.0149 -0.0158 394 ARG D C     
2130 O  O     . ARG D 76  ? 0.2268 0.2471 0.2695 -0.0185 -0.0173 -0.0173 394 ARG D O     
2131 C  CB    . ARG D 76  ? 0.2339 0.2607 0.2597 -0.0294 -0.0123 -0.0001 394 ARG D CB    
2132 C  CG    . ARG D 76  ? 0.2109 0.2462 0.2311 -0.0305 -0.0126 0.0062  394 ARG D CG    
2133 C  CD    . ARG D 76  ? 0.2225 0.2595 0.2346 -0.0378 -0.0109 0.0118  394 ARG D CD    
2134 N  NE    . ARG D 76  ? 0.2075 0.2389 0.2194 -0.0417 -0.0077 0.0106  394 ARG D NE    
2135 C  CZ    . ARG D 76  ? 0.2186 0.2541 0.2240 -0.0468 -0.0068 0.0141  394 ARG D CZ    
2136 N  NH1   . ARG D 76  ? 0.2361 0.2838 0.2381 -0.0486 -0.0089 0.0180  394 ARG D NH1   
2137 N  NH2   . ARG D 76  ? 0.2432 0.2727 0.2457 -0.0499 -0.0038 0.0127  394 ARG D NH2   
2138 N  N     . SER D 77  ? 0.2042 0.2320 0.2625 -0.0224 -0.0099 -0.0214 395 SER D N     
2139 C  CA    . SER D 77  ? 0.1767 0.2040 0.2492 -0.0223 -0.0073 -0.0314 395 SER D CA    
2140 C  C     . SER D 77  ? 0.2261 0.2444 0.2937 -0.0275 -0.0025 -0.0292 395 SER D C     
2141 O  O     . SER D 77  ? 0.2104 0.2282 0.2864 -0.0257 -0.0025 -0.0365 395 SER D O     
2142 C  CB    . SER D 77  ? 0.2159 0.2459 0.3035 -0.0246 -0.0007 -0.0386 395 SER D CB    
2143 O  OG    . SER D 77  ? 0.2638 0.2855 0.3446 -0.0303 0.0076  -0.0315 395 SER D OG    
2144 N  N     . ASP D 78  ? 0.2182 0.2310 0.2730 -0.0334 0.0013  -0.0205 396 ASP D N     
2145 C  CA    . ASP D 78  ? 0.2212 0.2259 0.2697 -0.0386 0.0056  -0.0195 396 ASP D CA    
2146 C  C     . ASP D 78  ? 0.2444 0.2444 0.2857 -0.0371 0.0007  -0.0189 396 ASP D C     
2147 O  O     . ASP D 78  ? 0.2350 0.2289 0.2786 -0.0376 0.0032  -0.0236 396 ASP D O     
2148 C  CB    . ASP D 78  ? 0.2375 0.2398 0.2728 -0.0442 0.0093  -0.0114 396 ASP D CB    
2149 C  CG    . ASP D 78  ? 0.3050 0.3136 0.3305 -0.0439 0.0038  -0.0035 396 ASP D CG    
2150 O  OD1   . ASP D 78  ? 0.3083 0.3220 0.3362 -0.0397 -0.0013 -0.0032 396 ASP D OD1   
2151 O  OD2   . ASP D 78  ? 0.3539 0.3635 0.3687 -0.0478 0.0048  0.0019  396 ASP D OD2   
2152 N  N     . HIS D 79  ? 0.2111 0.2124 0.2440 -0.0347 -0.0051 -0.0135 397 HIS D N     
2153 C  CA    . HIS D 79  ? 0.2176 0.2097 0.2411 -0.0332 -0.0080 -0.0118 397 HIS D CA    
2154 C  C     . HIS D 79  ? 0.2184 0.2099 0.2497 -0.0230 -0.0124 -0.0183 397 HIS D C     
2155 O  O     . HIS D 79  ? 0.2385 0.2192 0.2649 -0.0201 -0.0129 -0.0192 397 HIS D O     
2156 C  CB    . HIS D 79  ? 0.2450 0.2374 0.2557 -0.0348 -0.0107 -0.0038 397 HIS D CB    
2157 C  CG    . HIS D 79  ? 0.2316 0.2280 0.2358 -0.0441 -0.0077 0.0013  397 HIS D CG    
2158 N  ND1   . HIS D 79  ? 0.2542 0.2483 0.2567 -0.0507 -0.0035 0.0001  397 HIS D ND1   
2159 C  CD2   . HIS D 79  ? 0.2087 0.2133 0.2076 -0.0471 -0.0086 0.0069  397 HIS D CD2   
2160 C  CE1   . HIS D 79  ? 0.2428 0.2444 0.2389 -0.0568 -0.0033 0.0045  397 HIS D CE1   
2161 N  NE2   . HIS D 79  ? 0.2242 0.2329 0.2194 -0.0549 -0.0062 0.0085  397 HIS D NE2   
2162 N  N     . LEU D 80  ? 0.2057 0.2088 0.2492 -0.0168 -0.0159 -0.0238 398 LEU D N     
2163 C  CA    . LEU D 80  ? 0.2168 0.2240 0.2716 -0.0068 -0.0207 -0.0331 398 LEU D CA    
2164 C  C     . LEU D 80  ? 0.2407 0.2466 0.3081 -0.0089 -0.0152 -0.0410 398 LEU D C     
2165 O  O     . LEU D 80  ? 0.2405 0.2434 0.3107 -0.0016 -0.0179 -0.0456 398 LEU D O     
2166 C  CB    . LEU D 80  ? 0.2044 0.2274 0.2730 -0.0014 -0.0251 -0.0407 398 LEU D CB    
2167 C  CG    . LEU D 80  ? 0.2296 0.2629 0.3151 0.0083  -0.0303 -0.0536 398 LEU D CG    
2168 C  CD1   . LEU D 80  ? 0.2875 0.3142 0.3601 0.0206  -0.0386 -0.0508 398 LEU D CD1   
2169 C  CD2   . LEU D 80  ? 0.2508 0.3016 0.3522 0.0109  -0.0336 -0.0636 398 LEU D CD2   
2170 N  N     . LYS D 81  ? 0.2016 0.2091 0.2756 -0.0180 -0.0070 -0.0425 399 LYS D N     
2171 C  CA    . LYS D 81  ? 0.1889 0.1955 0.2747 -0.0210 0.0003  -0.0505 399 LYS D CA    
2172 C  C     . LYS D 81  ? 0.2761 0.2692 0.3502 -0.0218 0.0019  -0.0477 399 LYS D C     
2173 O  O     . LYS D 81  ? 0.2700 0.2628 0.3535 -0.0168 0.0026  -0.0557 399 LYS D O     
2174 C  CB    . LYS D 81  ? 0.2360 0.2422 0.3245 -0.0307 0.0103  -0.0499 399 LYS D CB    
2175 C  CG    . LYS D 81  ? 0.2575 0.2621 0.3569 -0.0346 0.0200  -0.0582 399 LYS D CG    
2176 C  CD    . LYS D 81  ? 0.2820 0.2816 0.3781 -0.0436 0.0312  -0.0554 399 LYS D CD    
2177 C  CE    . LYS D 81  ? 0.3075 0.3143 0.4179 -0.0443 0.0342  -0.0598 399 LYS D CE    
2178 N  NZ    . LYS D 81  ? 0.2913 0.2882 0.3937 -0.0516 0.0459  -0.0545 399 LYS D NZ    
2179 N  N     . THR D 82  ? 0.2268 0.2096 0.2815 -0.0282 0.0029  -0.0377 400 THR D N     
2180 C  CA    . THR D 82  ? 0.2307 0.1992 0.2744 -0.0303 0.0053  -0.0367 400 THR D CA    
2181 C  C     . THR D 82  ? 0.2847 0.2449 0.3235 -0.0202 -0.0012 -0.0360 400 THR D C     
2182 O  O     . THR D 82  ? 0.2925 0.2421 0.3304 -0.0167 0.0008  -0.0398 400 THR D O     
2183 C  CB    . THR D 82  ? 0.2578 0.2194 0.2838 -0.0410 0.0082  -0.0287 400 THR D CB    
2184 O  OG1   . THR D 82  ? 0.2598 0.2235 0.2768 -0.0412 0.0029  -0.0207 400 THR D OG1   
2185 C  CG2   . THR D 82  ? 0.3027 0.2704 0.3300 -0.0484 0.0144  -0.0287 400 THR D CG2   
2186 N  N     . HIS D 83  ? 0.2482 0.2118 0.2825 -0.0141 -0.0083 -0.0313 401 HIS D N     
2187 C  CA    . HIS D 83  ? 0.2475 0.2023 0.2751 -0.0017 -0.0145 -0.0302 401 HIS D CA    
2188 C  C     . HIS D 83  ? 0.2759 0.2382 0.3210 0.0101  -0.0175 -0.0413 401 HIS D C     
2189 O  O     . HIS D 83  ? 0.3164 0.2667 0.3563 0.0197  -0.0193 -0.0421 401 HIS D O     
2190 C  CB    . HIS D 83  ? 0.2647 0.2248 0.2851 0.0040  -0.0215 -0.0245 401 HIS D CB    
2191 C  CG    . HIS D 83  ? 0.2755 0.2309 0.2907 0.0204  -0.0292 -0.0251 401 HIS D CG    
2192 N  ND1   . HIS D 83  ? 0.2782 0.2105 0.2722 0.0249  -0.0288 -0.0170 401 HIS D ND1   
2193 C  CD2   . HIS D 83  ? 0.2725 0.2425 0.3001 0.0340  -0.0375 -0.0332 401 HIS D CD2   
2194 C  CE1   . HIS D 83  ? 0.3393 0.2709 0.3304 0.0423  -0.0368 -0.0186 401 HIS D CE1   
2195 N  NE2   . HIS D 83  ? 0.3104 0.2667 0.3224 0.0483  -0.0431 -0.0291 401 HIS D NE2   
2196 N  N     . THR D 84  ? 0.2407 0.2230 0.3072 0.0098  -0.0174 -0.0507 402 THR D N     
2197 C  CA    . THR D 84  ? 0.2730 0.2682 0.3604 0.0205  -0.0206 -0.0636 402 THR D CA    
2198 C  C     . THR D 84  ? 0.2907 0.2777 0.3832 0.0193  -0.0134 -0.0689 402 THR D C     
2199 O  O     . THR D 84  ? 0.3312 0.3220 0.4339 0.0317  -0.0171 -0.0769 402 THR D O     
2200 C  CB    . THR D 84  ? 0.2904 0.3082 0.4009 0.0170  -0.0198 -0.0736 402 THR D CB    
2201 O  OG1   . THR D 84  ? 0.2865 0.3116 0.3919 0.0210  -0.0277 -0.0702 402 THR D OG1   
2202 C  CG2   . THR D 84  ? 0.3088 0.3444 0.4457 0.0258  -0.0218 -0.0897 402 THR D CG2   
2203 N  N     . ARG D 85  ? 0.3057 0.2821 0.3900 0.0056  -0.0036 -0.0650 403 ARG D N     
2204 C  CA    . ARG D 85  ? 0.3400 0.3064 0.4254 0.0041  0.0038  -0.0699 403 ARG D CA    
2205 C  C     . ARG D 85  ? 0.3924 0.3392 0.4632 0.0139  0.0002  -0.0661 403 ARG D C     
2206 O  O     . ARG D 85  ? 0.4240 0.3643 0.4997 0.0180  0.0045  -0.0728 403 ARG D O     
2207 C  CB    . ARG D 85  ? 0.3906 0.3489 0.4653 -0.0121 0.0138  -0.0658 403 ARG D CB    
2208 C  CG    . ARG D 85  ? 0.3861 0.3587 0.4730 -0.0205 0.0198  -0.0691 403 ARG D CG    
2209 C  CD    . ARG D 85  ? 0.3702 0.3345 0.4424 -0.0340 0.0286  -0.0638 403 ARG D CD    
2210 N  NE    . ARG D 85  ? 0.3707 0.3450 0.4523 -0.0399 0.0350  -0.0656 403 ARG D NE    
2211 C  CZ    . ARG D 85  ? 0.3693 0.3398 0.4374 -0.0487 0.0400  -0.0586 403 ARG D CZ    
2212 N  NH1   . ARG D 85  ? 0.3480 0.3092 0.3950 -0.0536 0.0384  -0.0507 403 ARG D NH1   
2213 N  NH2   . ARG D 85  ? 0.3898 0.3658 0.4658 -0.0524 0.0468  -0.0599 403 ARG D NH2   
2214 N  N     . THR D 86  ? 0.3708 0.3062 0.4230 0.0180  -0.0062 -0.0556 404 THR D N     
2215 C  CA    . THR D 86  ? 0.3648 0.2770 0.4011 0.0279  -0.0078 -0.0514 404 THR D CA    
2216 C  C     . THR D 86  ? 0.4374 0.3572 0.4856 0.0487  -0.0158 -0.0585 404 THR D C     
2217 O  O     . THR D 86  ? 0.5120 0.4138 0.5528 0.0594  -0.0155 -0.0586 404 THR D O     
2218 C  CB    . THR D 86  ? 0.3656 0.2606 0.3768 0.0257  -0.0100 -0.0378 404 THR D CB    
2219 O  OG1   . THR D 86  ? 0.4347 0.3416 0.4460 0.0362  -0.0196 -0.0349 404 THR D OG1   
2220 C  CG2   . THR D 86  ? 0.3810 0.2747 0.3837 0.0059  -0.0035 -0.0323 404 THR D CG2   
2221 N  N     . HIS D 87  ? 0.4144 0.3609 0.4813 0.0550  -0.0232 -0.0655 405 HIS D N     
2222 C  CA    . HIS D 87  ? 0.4347 0.3963 0.5181 0.0747  -0.0320 -0.0757 405 HIS D CA    
2223 C  C     . HIS D 87  ? 0.4550 0.4324 0.5663 0.0736  -0.0259 -0.0910 405 HIS D C     
2224 O  O     . HIS D 87  ? 0.5287 0.5056 0.6476 0.0883  -0.0282 -0.0979 405 HIS D O     
2225 C  CB    . HIS D 87  ? 0.4158 0.4019 0.5087 0.0808  -0.0426 -0.0790 405 HIS D CB    
2226 C  CG    . HIS D 87  ? 0.3907 0.3638 0.4568 0.0844  -0.0489 -0.0652 405 HIS D CG    
2227 N  ND1   . HIS D 87  ? 0.4370 0.3850 0.4773 0.0973  -0.0525 -0.0548 405 HIS D ND1   
2228 C  CD2   . HIS D 87  ? 0.3814 0.3621 0.4420 0.0770  -0.0510 -0.0602 405 HIS D CD2   
2229 C  CE1   . HIS D 87  ? 0.4651 0.4063 0.4848 0.0969  -0.0560 -0.0440 405 HIS D CE1   
2230 N  NE2   . HIS D 87  ? 0.4131 0.3751 0.4454 0.0848  -0.0555 -0.0474 405 HIS D NE2   
2231 N  N     . THR D 88  ? 0.4660 0.4571 0.5923 0.0571  -0.0175 -0.0965 406 THR D N     
2232 C  CA    . THR D 88  ? 0.4879 0.4967 0.6424 0.0546  -0.0100 -0.1120 406 THR D CA    
2233 C  C     . THR D 88  ? 0.5205 0.5111 0.6689 0.0492  0.0013  -0.1126 406 THR D C     
2234 O  O     . THR D 88  ? 0.5260 0.5290 0.6964 0.0506  0.0077  -0.1259 406 THR D O     
2235 C  CB    . THR D 88  ? 0.4279 0.4533 0.5972 0.0385  -0.0029 -0.1165 406 THR D CB    
2236 O  OG1   . THR D 88  ? 0.4205 0.4270 0.5681 0.0224  0.0055  -0.1045 406 THR D OG1   
2237 C  CG2   . THR D 88  ? 0.4145 0.4581 0.5912 0.0427  -0.0131 -0.1178 406 THR D CG2   
2238 N  N     . GLY D 89  ? 0.4727 0.5946 0.6401 0.0919  0.0536  -0.1486 407 GLY D N     
2239 C  CA    . GLY D 89  ? 0.5123 0.5979 0.6513 0.0815  0.0692  -0.1494 407 GLY D CA    
2240 C  C     . GLY D 89  ? 0.5209 0.5952 0.6477 0.0466  0.0808  -0.1503 407 GLY D C     
2241 O  O     . GLY D 89  ? 0.5292 0.5786 0.6324 0.0374  0.0948  -0.1537 407 GLY D O     
2242 N  N     . GLU D 90  ? 0.4417 0.5315 0.5814 0.0281  0.0761  -0.1472 408 GLU D N     
2243 C  CA    . GLU D 90  ? 0.4927 0.5671 0.6160 -0.0034 0.0876  -0.1444 408 GLU D CA    
2244 C  C     . GLU D 90  ? 0.5488 0.5749 0.6253 -0.0165 0.0840  -0.1267 408 GLU D C     
2245 O  O     . GLU D 90  ? 0.5661 0.5762 0.6300 -0.0114 0.0677  -0.1120 408 GLU D O     
2246 C  CB    . GLU D 90  ? 0.4922 0.5855 0.6366 -0.0177 0.0822  -0.1429 408 GLU D CB    
2247 C  CG    . GLU D 90  ? 0.5731 0.6438 0.6953 -0.0483 0.0943  -0.1359 408 GLU D CG    
2248 C  CD    . GLU D 90  ? 0.6325 0.7113 0.7713 -0.0618 0.0896  -0.1328 408 GLU D CD    
2249 O  OE1   . GLU D 90  ? 0.6667 0.7668 0.8307 -0.0477 0.0736  -0.1352 408 GLU D OE1   
2250 O  OE2   . GLU D 90  ? 0.6491 0.7110 0.7737 -0.0855 0.1024  -0.1280 408 GLU D OE2   
2251 N  N     . LYS D 91  ? 0.5118 0.5189 0.5629 -0.0335 0.0997  -0.1293 409 LYS D N     
2252 C  CA    . LYS D 91  ? 0.5205 0.4871 0.5269 -0.0459 0.0972  -0.1172 409 LYS D CA    
2253 C  C     . LYS D 91  ? 0.5618 0.5193 0.5451 -0.0706 0.1110  -0.1160 409 LYS D C     
2254 O  O     . LYS D 91  ? 0.6504 0.6031 0.6199 -0.0755 0.1282  -0.1267 409 LYS D O     
2255 C  CB    . LYS D 91  ? 0.5563 0.5015 0.5467 -0.0331 0.1017  -0.1243 409 LYS D CB    
2256 C  CG    . LYS D 91  ? 0.5364 0.4831 0.5429 -0.0067 0.0899  -0.1223 409 LYS D CG    
2257 C  CD    . LYS D 91  ? 0.5902 0.5075 0.5784 0.0061  0.0971  -0.1291 409 LYS D CD    
2258 C  CE    . LYS D 91  ? 0.5748 0.4878 0.5741 0.0333  0.0868  -0.1233 409 LYS D CE    
2259 N  NZ    . LYS D 91  ? 0.6950 0.5689 0.6725 0.0455  0.0949  -0.1281 409 LYS D NZ    
2260 N  N     . PRO D 92  ? 0.4796 0.4332 0.4556 -0.0848 0.1045  -0.1023 410 PRO D N     
2261 C  CA    . PRO D 92  ? 0.5028 0.4473 0.4566 -0.1062 0.1194  -0.0987 410 PRO D CA    
2262 C  C     . PRO D 92  ? 0.5382 0.4535 0.4421 -0.1169 0.1211  -0.0917 410 PRO D C     
2263 O  O     . PRO D 92  ? 0.6314 0.5389 0.5115 -0.1321 0.1356  -0.0890 410 PRO D O     
2264 C  CB    . PRO D 92  ? 0.4919 0.4364 0.4528 -0.1131 0.1093  -0.0849 410 PRO D CB    
2265 C  CG    . PRO D 92  ? 0.4244 0.3889 0.4209 -0.0949 0.0916  -0.0870 410 PRO D CG    
2266 C  CD    . PRO D 92  ? 0.4446 0.4043 0.4353 -0.0792 0.0849  -0.0906 410 PRO D CD    
2267 N  N     . PHE D 93  ? 0.5082 0.4079 0.3949 -0.1103 0.1077  -0.0892 411 PHE D N     
2268 C  CA    . PHE D 93  ? 0.5619 0.4382 0.4028 -0.1215 0.1057  -0.0844 411 PHE D CA    
2269 C  C     . PHE D 93  ? 0.6100 0.4762 0.4389 -0.1183 0.1170  -0.1017 411 PHE D C     
2270 O  O     . PHE D 93  ? 0.6355 0.4974 0.4791 -0.1049 0.1123  -0.1088 411 PHE D O     
2271 C  CB    . PHE D 93  ? 0.5599 0.4278 0.3903 -0.1203 0.0824  -0.0708 411 PHE D CB    
2272 C  CG    . PHE D 93  ? 0.5273 0.4036 0.3669 -0.1209 0.0710  -0.0547 411 PHE D CG    
2273 C  CD1   . PHE D 93  ? 0.5888 0.4559 0.3971 -0.1318 0.0694  -0.0418 411 PHE D CD1   
2274 C  CD2   . PHE D 93  ? 0.4513 0.3435 0.3287 -0.1085 0.0620  -0.0531 411 PHE D CD2   
2275 C  CE1   . PHE D 93  ? 0.6505 0.5200 0.4655 -0.1301 0.0597  -0.0275 411 PHE D CE1   
2276 C  CE2   . PHE D 93  ? 0.5318 0.4297 0.4176 -0.1084 0.0519  -0.0408 411 PHE D CE2   
2277 C  CZ    . PHE D 93  ? 0.6073 0.4916 0.4619 -0.1191 0.0510  -0.0279 411 PHE D CZ    
2278 N  N     . SER D 94  ? 0.5960 0.4560 0.3955 -0.1295 0.1327  -0.1080 412 SER D N     
2279 C  CA    . SER D 94  ? 0.6340 0.4854 0.4216 -0.1261 0.1465  -0.1273 412 SER D CA    
2280 C  C     . SER D 94  ? 0.7030 0.5318 0.4444 -0.1372 0.1412  -0.1290 412 SER D C     
2281 O  O     . SER D 94  ? 0.6963 0.5236 0.4065 -0.1500 0.1381  -0.1184 412 SER D O     
2282 C  CB    . SER D 94  ? 0.6514 0.5192 0.4430 -0.1294 0.1716  -0.1382 412 SER D CB    
2283 O  OG    . SER D 94  ? 0.7317 0.6260 0.5708 -0.1184 0.1775  -0.1435 412 SER D OG    
2284 N  N     . CYS D 95  ? 0.6811 0.4919 0.4174 -0.1314 0.1402  -0.1432 413 CYS D N     
2285 C  CA    . CYS D 95  ? 0.7660 0.5569 0.4610 -0.1434 0.1366  -0.1509 413 CYS D CA    
2286 C  C     . CYS D 95  ? 0.8086 0.6033 0.4714 -0.1517 0.1543  -0.1607 413 CYS D C     
2287 O  O     . CYS D 95  ? 0.8287 0.6326 0.5032 -0.1448 0.1740  -0.1715 413 CYS D O     
2288 C  CB    . CYS D 95  ? 0.8126 0.5780 0.5106 -0.1361 0.1362  -0.1666 413 CYS D CB    
2289 S  SG    . CYS D 95  ? 0.8298 0.5705 0.4808 -0.1531 0.1335  -0.1829 413 CYS D SG    
2290 N  N     . ARG D 96  ? 0.8791 0.6703 0.5009 -0.1654 0.1472  -0.1572 414 ARG D N     
2291 C  CA    . ARG D 96  ? 0.9803 0.7756 0.5636 -0.1731 0.1625  -0.1640 414 ARG D CA    
2292 C  C     . ARG D 96  ? 1.0765 0.8557 0.6297 -0.1766 0.1668  -0.1890 414 ARG D C     
2293 O  O     . ARG D 96  ? 1.1169 0.9004 0.6328 -0.1826 0.1783  -0.1968 414 ARG D O     
2294 C  CB    . ARG D 96  ? 1.0394 0.8430 0.5908 -0.1829 0.1526  -0.1436 414 ARG D CB    
2295 C  CG    . ARG D 96  ? 1.0895 0.9042 0.6627 -0.1808 0.1550  -0.1209 414 ARG D CG    
2296 C  CD    . ARG D 96  ? 1.2045 1.0209 0.7435 -0.1867 0.1440  -0.0990 414 ARG D CD    
2297 N  NE    . ARG D 96  ? 1.2701 1.0878 0.8201 -0.1843 0.1177  -0.0870 414 ARG D NE    
2298 C  CZ    . ARG D 96  ? 1.2685 1.0898 0.8539 -0.1784 0.1096  -0.0725 414 ARG D CZ    
2299 N  NH1   . ARG D 96  ? 1.2578 1.0822 0.8729 -0.1756 0.1250  -0.0693 414 ARG D NH1   
2300 N  NH2   . ARG D 96  ? 1.2441 1.0694 0.8365 -0.1757 0.0863  -0.0629 414 ARG D NH2   
2301 N  N     . TRP D 97  ? 1.0224 0.7814 0.5889 -0.1733 0.1589  -0.2019 415 TRP D N     
2302 C  CA    . TRP D 97  ? 1.0164 0.7549 0.5561 -0.1771 0.1649  -0.2287 415 TRP D CA    
2303 C  C     . TRP D 97  ? 1.0952 0.8306 0.6441 -0.1633 0.1891  -0.2467 415 TRP D C     
2304 O  O     . TRP D 97  ? 1.0816 0.8234 0.6684 -0.1486 0.1967  -0.2424 415 TRP D O     
2305 C  CB    . TRP D 97  ? 1.0168 0.7286 0.5667 -0.1800 0.1508  -0.2362 415 TRP D CB    
2306 N  N     . PRO D 98  ? 1.2653 1.0014 0.7927 -0.1632 0.1964  -0.2614 416 PRO D N     
2307 C  CA    . PRO D 98  ? 1.3474 1.0885 0.8861 -0.1479 0.2179  -0.2762 416 PRO D CA    
2308 C  C     . PRO D 98  ? 1.3996 1.1165 0.9683 -0.1304 0.2198  -0.2886 416 PRO D C     
2309 O  O     . PRO D 98  ? 1.4667 1.1546 1.0365 -0.1323 0.2064  -0.2916 416 PRO D O     
2310 C  CB    . PRO D 98  ? 1.3926 1.1364 0.8963 -0.1526 0.2204  -0.2896 416 PRO D CB    
2311 C  CG    . PRO D 98  ? 1.3865 1.1156 0.8722 -0.1661 0.1982  -0.2900 416 PRO D CG    
2312 C  CD    . PRO D 98  ? 1.3324 1.0677 0.8261 -0.1752 0.1843  -0.2674 416 PRO D CD    
2313 N  N     . SER D 99  ? 1.3358 1.0667 0.9299 -0.1123 0.2370  -0.2945 417 SER D N     
2314 C  CA    . SER D 99  ? 1.2514 0.9654 0.8742 -0.0885 0.2409  -0.3052 417 SER D CA    
2315 C  C     . SER D 99  ? 1.1794 0.8761 0.8269 -0.0831 0.2287  -0.2932 417 SER D C     
2316 O  O     . SER D 99  ? 1.2099 0.8835 0.8749 -0.0631 0.2283  -0.2988 417 SER D O     
2317 C  CB    . SER D 99  ? 1.2662 0.9485 0.8710 -0.0823 0.2398  -0.3242 417 SER D CB    
2318 N  N     . CYS D 100 ? 1.1064 0.8129 0.7538 -0.0985 0.2188  -0.2759 418 CYS D N     
2319 C  CA    . CYS D 100 ? 1.0159 0.7165 0.6933 -0.0918 0.2025  -0.2576 418 CYS D CA    
2320 C  C     . CYS D 100 ? 0.9808 0.7236 0.6926 -0.0867 0.2021  -0.2400 418 CYS D C     
2321 O  O     . CYS D 100 ? 0.9833 0.7477 0.6865 -0.1031 0.1989  -0.2267 418 CYS D O     
2322 C  CB    . CYS D 100 ? 0.9490 0.6319 0.6078 -0.1122 0.1823  -0.2461 418 CYS D CB    
2323 S  SG    . CYS D 100 ? 0.8926 0.5730 0.5871 -0.1045 0.1632  -0.2218 418 CYS D SG    
2324 N  N     . GLN D 101 ? 0.9764 0.7300 0.7260 -0.0632 0.2053  -0.2406 419 GLN D N     
2325 C  CA    . GLN D 101 ? 0.9829 0.7787 0.7704 -0.0575 0.2051  -0.2287 419 GLN D CA    
2326 C  C     . GLN D 101 ? 0.9445 0.7403 0.7546 -0.0537 0.1844  -0.2084 419 GLN D C     
2327 O  O     . GLN D 101 ? 0.9787 0.8045 0.8264 -0.0404 0.1826  -0.2032 419 GLN D O     
2328 C  CB    . GLN D 101 ? 0.9987 0.8190 0.8164 -0.0330 0.2215  -0.2452 419 GLN D CB    
2329 N  N     . LYS D 102 ? 0.8770 0.6435 0.6657 -0.0656 0.1690  -0.1983 420 LYS D N     
2330 C  CA    . LYS D 102 ? 0.8117 0.5775 0.6194 -0.0614 0.1504  -0.1796 420 LYS D CA    
2331 C  C     . LYS D 102 ? 0.7775 0.5768 0.5997 -0.0718 0.1418  -0.1628 420 LYS D C     
2332 O  O     . LYS D 102 ? 0.7986 0.6032 0.5985 -0.0914 0.1423  -0.1584 420 LYS D O     
2333 C  CB    . LYS D 102 ? 0.7734 0.5027 0.5553 -0.0742 0.1384  -0.1751 420 LYS D CB    
2334 N  N     . LYS D 103 ? 0.6661 0.4862 0.5236 -0.0572 0.1340  -0.1537 421 LYS D N     
2335 C  CA    . LYS D 103 ? 0.5789 0.4277 0.4538 -0.0647 0.1258  -0.1397 421 LYS D CA    
2336 C  C     . LYS D 103 ? 0.5627 0.4093 0.4499 -0.0584 0.1056  -0.1236 421 LYS D C     
2337 O  O     . LYS D 103 ? 0.5611 0.3903 0.4515 -0.0440 0.1011  -0.1237 421 LYS D O     
2338 C  CB    . LYS D 103 ? 0.5948 0.4809 0.5055 -0.0548 0.1374  -0.1482 421 LYS D CB    
2339 C  CG    . LYS D 103 ? 0.6931 0.5886 0.5939 -0.0640 0.1596  -0.1626 421 LYS D CG    
2340 C  CD    . LYS D 103 ? 0.7437 0.6817 0.6828 -0.0626 0.1699  -0.1680 421 LYS D CD    
2341 C  CE    . LYS D 103 ? 0.8395 0.7897 0.7689 -0.0750 0.1942  -0.1801 421 LYS D CE    
2342 N  NZ    . LYS D 103 ? 0.8577 0.8461 0.8210 -0.0835 0.2047  -0.1819 421 LYS D NZ    
2343 N  N     . PHE D 104 ? 0.5396 0.4014 0.4311 -0.0686 0.0944  -0.1092 422 PHE D N     
2344 C  CA    . PHE D 104 ? 0.5260 0.3879 0.4248 -0.0648 0.0752  -0.0937 422 PHE D CA    
2345 C  C     . PHE D 104 ? 0.4891 0.3796 0.4127 -0.0634 0.0674  -0.0849 422 PHE D C     
2346 O  O     . PHE D 104 ? 0.4637 0.3654 0.3878 -0.0741 0.0751  -0.0860 422 PHE D O     
2347 C  CB    . PHE D 104 ? 0.5356 0.3773 0.4015 -0.0822 0.0648  -0.0847 422 PHE D CB    
2348 C  CG    . PHE D 104 ? 0.5453 0.3566 0.3877 -0.0864 0.0711  -0.0952 422 PHE D CG    
2349 C  CD1   . PHE D 104 ? 0.5752 0.3673 0.4214 -0.0779 0.0663  -0.0931 422 PHE D CD1   
2350 C  CD2   . PHE D 104 ? 0.5933 0.3936 0.4096 -0.0981 0.0837  -0.1082 422 PHE D CD2   
2351 C  CE1   . PHE D 104 ? 0.6472 0.4051 0.4720 -0.0828 0.0739  -0.1044 422 PHE D CE1   
2352 C  CE2   . PHE D 104 ? 0.6393 0.4097 0.4343 -0.1019 0.0899  -0.1213 422 PHE D CE2   
2353 C  CZ    . PHE D 104 ? 0.6955 0.4427 0.4955 -0.0948 0.0851  -0.1197 422 PHE D CZ    
2354 N  N     . ALA D 105 ? 0.4570 0.3569 0.3993 -0.0505 0.0529  -0.0759 423 ALA D N     
2355 C  CA    . ALA D 105 ? 0.4279 0.3545 0.3957 -0.0465 0.0441  -0.0701 423 ALA D CA    
2356 C  C     . ALA D 105 ? 0.3976 0.3195 0.3468 -0.0626 0.0344  -0.0563 423 ALA D C     
2357 O  O     . ALA D 105 ? 0.4202 0.3556 0.3822 -0.0659 0.0335  -0.0540 423 ALA D O     
2358 C  CB    . ALA D 105 ? 0.4210 0.3609 0.4118 -0.0248 0.0319  -0.0660 423 ALA D CB    
2359 N  N     . ARG D 106 ? 0.3991 0.3023 0.3184 -0.0724 0.0276  -0.0482 424 ARG D N     
2360 C  CA    . ARG D 106 ? 0.4035 0.3069 0.3056 -0.0824 0.0154  -0.0346 424 ARG D CA    
2361 C  C     . ARG D 106 ? 0.4670 0.3530 0.3302 -0.0993 0.0193  -0.0344 424 ARG D C     
2362 O  O     . ARG D 106 ? 0.4788 0.3504 0.3275 -0.1038 0.0266  -0.0438 424 ARG D O     
2363 C  CB    . ARG D 106 ? 0.4070 0.3178 0.3150 -0.0749 -0.0028 -0.0235 424 ARG D CB    
2364 C  CG    . ARG D 106 ? 0.3949 0.3237 0.3373 -0.0555 -0.0074 -0.0243 424 ARG D CG    
2365 C  CD    . ARG D 106 ? 0.3359 0.2753 0.2839 -0.0473 -0.0235 -0.0127 424 ARG D CD    
2366 N  NE    . ARG D 106 ? 0.3385 0.2683 0.2620 -0.0594 -0.0306 -0.0047 424 ARG D NE    
2367 C  CZ    . ARG D 106 ? 0.3287 0.2658 0.2564 -0.0543 -0.0403 0.0038  424 ARG D CZ    
2368 N  NH1   . ARG D 106 ? 0.3089 0.2600 0.2598 -0.0355 -0.0440 0.0067  424 ARG D NH1   
2369 N  NH2   . ARG D 106 ? 0.3415 0.2752 0.2506 -0.0679 -0.0461 0.0089  424 ARG D NH2   
2370 N  N     . SER D 107 ? 0.4481 0.3348 0.2926 -0.1069 0.0139  -0.0239 425 SER D N     
2371 C  CA    . SER D 107 ? 0.5475 0.4225 0.3518 -0.1205 0.0160  -0.0229 425 SER D CA    
2372 C  C     . SER D 107 ? 0.5405 0.4141 0.3294 -0.1256 0.0041  -0.0239 425 SER D C     
2373 O  O     . SER D 107 ? 0.5467 0.4099 0.3089 -0.1364 0.0093  -0.0329 425 SER D O     
2374 C  CB    . SER D 107 ? 0.6250 0.5003 0.4108 -0.1230 0.0108  -0.0085 425 SER D CB    
2375 O  OG    . SER D 107 ? 0.6516 0.5387 0.4432 -0.1158 -0.0093 0.0030  425 SER D OG    
2376 N  N     . ASP D 108 ? 0.4816 0.3674 0.2869 -0.1192 -0.0113 -0.0161 426 ASP D N     
2377 C  CA    . ASP D 108 ? 0.5013 0.3886 0.2954 -0.1272 -0.0212 -0.0175 426 ASP D CA    
2378 C  C     . ASP D 108 ? 0.4881 0.3567 0.2870 -0.1302 -0.0106 -0.0307 426 ASP D C     
2379 O  O     . ASP D 108 ? 0.5485 0.4095 0.3306 -0.1433 -0.0126 -0.0377 426 ASP D O     
2380 C  CB    . ASP D 108 ? 0.4665 0.3748 0.2767 -0.1202 -0.0388 -0.0049 426 ASP D CB    
2381 C  CG    . ASP D 108 ? 0.4948 0.4079 0.3398 -0.1044 -0.0384 -0.0018 426 ASP D CG    
2382 O  OD1   . ASP D 108 ? 0.4741 0.3856 0.3352 -0.0948 -0.0304 -0.0041 426 ASP D OD1   
2383 O  OD2   . ASP D 108 ? 0.5009 0.4230 0.3570 -0.1019 -0.0466 0.0029  426 ASP D OD2   
2384 N  N     . GLU D 109 ? 0.5258 0.3865 0.3463 -0.1180 0.0009  -0.0358 427 GLU D N     
2385 C  CA    . GLU D 109 ? 0.4994 0.3371 0.3202 -0.1171 0.0129  -0.0485 427 GLU D CA    
2386 C  C     . GLU D 109 ? 0.5154 0.3372 0.3091 -0.1288 0.0255  -0.0632 427 GLU D C     
2387 O  O     . GLU D 109 ? 0.5449 0.3449 0.3240 -0.1369 0.0307  -0.0749 427 GLU D O     
2388 C  CB    . GLU D 109 ? 0.4937 0.3330 0.3444 -0.0965 0.0206  -0.0503 427 GLU D CB    
2389 C  CG    . GLU D 109 ? 0.4356 0.2859 0.3090 -0.0832 0.0094  -0.0382 427 GLU D CG    
2390 C  CD    . GLU D 109 ? 0.5507 0.4151 0.4546 -0.0606 0.0129  -0.0394 427 GLU D CD    
2391 O  OE1   . GLU D 109 ? 0.5450 0.4167 0.4567 -0.0576 0.0227  -0.0487 427 GLU D OE1   
2392 O  OE2   . GLU D 109 ? 0.5017 0.3735 0.4219 -0.0459 0.0058  -0.0314 427 GLU D OE2   
2393 N  N     . LEU D 110 ? 0.5177 0.3485 0.3034 -0.1301 0.0320  -0.0633 428 LEU D N     
2394 C  CA    . LEU D 110 ? 0.5543 0.3736 0.3108 -0.1406 0.0447  -0.0763 428 LEU D CA    
2395 C  C     . LEU D 110 ? 0.5782 0.3962 0.3010 -0.1570 0.0347  -0.0778 428 LEU D C     
2396 O  O     . LEU D 110 ? 0.6129 0.4160 0.3130 -0.1665 0.0419  -0.0937 428 LEU D O     
2397 C  CB    . LEU D 110 ? 0.5543 0.3842 0.3088 -0.1395 0.0554  -0.0731 428 LEU D CB    
2398 C  CG    . LEU D 110 ? 0.5946 0.4165 0.3139 -0.1502 0.0691  -0.0835 428 LEU D CG    
2399 C  CD1   . LEU D 110 ? 0.6604 0.4668 0.3807 -0.1473 0.0838  -0.1040 428 LEU D CD1   
2400 C  CD2   . LEU D 110 ? 0.5972 0.4283 0.3140 -0.1510 0.0808  -0.0762 428 LEU D CD2   
2401 N  N     . VAL D 111 ? 0.5815 0.4173 0.3013 -0.1596 0.0174  -0.0635 429 VAL D N     
2402 C  CA    . VAL D 111 ? 0.6601 0.5034 0.3512 -0.1737 0.0053  -0.0662 429 VAL D CA    
2403 C  C     . VAL D 111 ? 0.6590 0.4885 0.3517 -0.1845 0.0047  -0.0806 429 VAL D C     
2404 O  O     . VAL D 111 ? 0.7217 0.5445 0.3883 -0.1986 0.0064  -0.0963 429 VAL D O     
2405 C  CB    . VAL D 111 ? 0.6843 0.5531 0.3777 -0.1704 -0.0140 -0.0483 429 VAL D CB    
2406 C  CG1   . VAL D 111 ? 0.6904 0.5751 0.3615 -0.1839 -0.0285 -0.0536 429 VAL D CG1   
2407 C  CG2   . VAL D 111 ? 0.6609 0.5347 0.3433 -0.1622 -0.0118 -0.0350 429 VAL D CG2   
2408 N  N     . ARG D 112 ? 0.6294 0.4529 0.3513 -0.1784 0.0029  -0.0757 430 ARG D N     
2409 C  CA    . ARG D 112 ? 0.6382 0.4413 0.3608 -0.1897 0.0051  -0.0874 430 ARG D CA    
2410 C  C     . ARG D 112 ? 0.6780 0.4473 0.3886 -0.1909 0.0233  -0.1068 430 ARG D C     
2411 O  O     . ARG D 112 ? 0.7140 0.4659 0.4067 -0.2073 0.0259  -0.1238 430 ARG D O     
2412 C  CB    . ARG D 112 ? 0.6851 0.4855 0.4379 -0.1802 0.0021  -0.0751 430 ARG D CB    
2413 C  CG    . ARG D 112 ? 0.7881 0.6221 0.5514 -0.1815 -0.0160 -0.0592 430 ARG D CG    
2414 C  CD    . ARG D 112 ? 0.7952 0.6234 0.5810 -0.1787 -0.0170 -0.0510 430 ARG D CD    
2415 N  NE    . ARG D 112 ? 0.7533 0.6170 0.5501 -0.1799 -0.0333 -0.0373 430 ARG D NE    
2416 C  CZ    . ARG D 112 ? 0.6743 0.5452 0.4937 -0.1689 -0.0360 -0.0237 430 ARG D CZ    
2417 N  NH1   . ARG D 112 ? 0.6541 0.4982 0.4851 -0.1553 -0.0243 -0.0214 430 ARG D NH1   
2418 N  NH2   . ARG D 112 ? 0.6303 0.5366 0.4592 -0.1693 -0.0504 -0.0126 430 ARG D NH2   
2419 N  N     . HIS D 113 ? 0.6541 0.4158 0.3751 -0.1738 0.0361  -0.1067 431 HIS D N     
2420 C  CA    . HIS D 113 ? 0.6906 0.4247 0.4005 -0.1714 0.0540  -0.1260 431 HIS D CA    
2421 C  C     . HIS D 113 ? 0.7169 0.4524 0.3908 -0.1870 0.0568  -0.1414 431 HIS D C     
2422 O  O     . HIS D 113 ? 0.7979 0.5079 0.4543 -0.1959 0.0649  -0.1617 431 HIS D O     
2423 C  CB    . HIS D 113 ? 0.6495 0.3886 0.3792 -0.1503 0.0661  -0.1234 431 HIS D CB    
2424 C  CG    . HIS D 113 ? 0.7580 0.4748 0.4786 -0.1442 0.0850  -0.1434 431 HIS D CG    
2425 N  ND1   . HIS D 113 ? 0.8098 0.4935 0.5368 -0.1343 0.0936  -0.1531 431 HIS D ND1   
2426 C  CD2   . HIS D 113 ? 0.7791 0.5012 0.4834 -0.1451 0.0980  -0.1552 431 HIS D CD2   
2427 C  CE1   . HIS D 113 ? 0.8510 0.5220 0.5673 -0.1280 0.1100  -0.1714 431 HIS D CE1   
2428 N  NE2   . HIS D 113 ? 0.8963 0.5924 0.5995 -0.1352 0.1133  -0.1735 431 HIS D NE2   
2429 N  N     . HIS D 114 ? 0.7034 0.4667 0.3634 -0.1897 0.0505  -0.1322 432 HIS D N     
2430 C  CA    . HIS D 114 ? 0.7724 0.5409 0.3935 -0.2024 0.0517  -0.1446 432 HIS D CA    
2431 C  C     . HIS D 114 ? 0.8556 0.6221 0.4599 -0.2216 0.0402  -0.1578 432 HIS D C     
2432 O  O     . HIS D 114 ? 0.8570 0.6109 0.4353 -0.2324 0.0464  -0.1800 432 HIS D O     
2433 C  CB    . HIS D 114 ? 0.7537 0.5499 0.3610 -0.1998 0.0454  -0.1274 432 HIS D CB    
2434 C  CG    . HIS D 114 ? 0.7735 0.5691 0.3822 -0.1893 0.0630  -0.1237 432 HIS D CG    
2435 N  ND1   . HIS D 114 ? 0.7928 0.6044 0.3978 -0.1848 0.0619  -0.1048 432 HIS D ND1   
2436 C  CD2   . HIS D 114 ? 0.8220 0.6038 0.4358 -0.1834 0.0832  -0.1374 432 HIS D CD2   
2437 C  CE1   . HIS D 114 ? 0.7826 0.5909 0.3924 -0.1793 0.0817  -0.1071 432 HIS D CE1   
2438 N  NE2   . HIS D 114 ? 0.7971 0.5909 0.4128 -0.1776 0.0944  -0.1272 432 HIS D NE2   
2439 N  N     . ASN D 115 ? 0.8935 0.6750 0.5134 -0.2269 0.0236  -0.1462 433 ASN D N     
2440 C  CA    . ASN D 115 ? 0.9518 0.7359 0.5634 -0.2473 0.0137  -0.1599 433 ASN D CA    
2441 C  C     . ASN D 115 ? 0.9653 0.7110 0.5875 -0.2514 0.0270  -0.1761 433 ASN D C     
2442 O  O     . ASN D 115 ? 0.9460 0.6912 0.5618 -0.2630 0.0267  -0.1912 433 ASN D O     
2443 C  CB    . ASN D 115 ? 0.9142 0.7247 0.5456 -0.2509 -0.0043 -0.1436 433 ASN D CB    
2444 C  CG    . ASN D 115 ? 0.8620 0.7116 0.4839 -0.2426 -0.0188 -0.1262 433 ASN D CG    
2445 O  OD1   . ASN D 115 ? 0.9050 0.7648 0.4996 -0.2397 -0.0178 -0.1284 433 ASN D OD1   
2446 N  ND2   . ASN D 115 ? 0.8362 0.7075 0.4814 -0.2360 -0.0313 -0.1073 433 ASN D ND2   
2447 N  N     . MET D 116 ? 1.0039 0.7178 0.6430 -0.2396 0.0388  -0.1726 434 MET D N     
2448 C  CA    . MET D 116 ? 1.0930 0.7642 0.7390 -0.2385 0.0528  -0.1854 434 MET D CA    
2449 C  C     . MET D 116 ? 1.1689 0.8283 0.7943 -0.2390 0.0640  -0.2068 434 MET D C     
2450 O  O     . MET D 116 ? 1.2461 0.8837 0.8707 -0.2470 0.0684  -0.2207 434 MET D O     
2451 C  CB    . MET D 116 ? 1.1049 0.7528 0.7727 -0.2159 0.0633  -0.1744 434 MET D CB    
2452 C  CG    . MET D 116 ? 1.2297 0.8258 0.8998 -0.2107 0.0783  -0.1857 434 MET D CG    
2453 S  SD    . MET D 116 ? 1.3336 0.9073 0.9880 -0.1974 0.0971  -0.2082 434 MET D SD    
2454 C  CE    . MET D 116 ? 1.3964 0.9231 1.0533 -0.2024 0.1038  -0.2171 434 MET D CE    
2455 N  N     . HIS D 117 ? 1.1290 0.8020 0.7372 -0.2309 0.0697  -0.2099 435 HIS D N     
2456 C  CA    . HIS D 117 ? 1.1677 0.8372 0.7539 -0.2317 0.0790  -0.2294 435 HIS D CA    
2457 C  C     . HIS D 117 ? 1.2484 0.9436 0.8180 -0.2489 0.0657  -0.2374 435 HIS D C     
2458 O  O     . HIS D 117 ? 1.2879 0.9761 0.8420 -0.2523 0.0712  -0.2569 435 HIS D O     
2459 C  CB    . HIS D 117 ? 1.1150 0.7982 0.6860 -0.2201 0.0894  -0.2283 435 HIS D CB    
2460 C  CG    . HIS D 117 ? 1.1665 0.8326 0.7554 -0.2016 0.1041  -0.2246 435 HIS D CG    
2461 N  ND1   . HIS D 117 ? 1.1961 0.8308 0.7959 -0.1878 0.1191  -0.2373 435 HIS D ND1   
2462 C  CD2   . HIS D 117 ? 1.1329 0.8203 0.7418 -0.1887 0.1042  -0.2048 435 HIS D CD2   
2463 C  CE1   . HIS D 117 ? 1.1881 0.8244 0.8086 -0.1688 0.1283  -0.2297 435 HIS D CE1   
2464 N  NE2   . HIS D 117 ? 1.1696 0.8419 0.8013 -0.1688 0.1187  -0.2081 435 HIS D NE2   
2465 N  N     . GLN D 118 ? 1.2836 1.0108 0.8573 -0.2578 0.0478  -0.2237 436 GLN D N     
2466 C  CA    . GLN D 118 ? 1.3030 1.0676 0.8606 -0.2685 0.0329  -0.2279 436 GLN D CA    
2467 C  C     . GLN D 118 ? 1.3364 1.1204 0.8638 -0.2599 0.0353  -0.2270 436 GLN D C     
2468 O  O     . GLN D 118 ? 1.3061 1.1176 0.8250 -0.2546 0.0260  -0.2090 436 GLN D O     
2469 C  CB    . GLN D 118 ? 1.3335 1.0890 0.8906 -0.2825 0.0326  -0.2508 436 GLN D CB    
2470 C  CG    . GLN D 118 ? 1.2997 1.0554 0.8821 -0.2970 0.0242  -0.2492 436 GLN D CG    
2471 C  CD    . GLN D 118 ? 1.3043 1.0106 0.9059 -0.2958 0.0383  -0.2499 436 GLN D CD    
2472 O  OE1   . GLN D 118 ? 1.3030 1.0026 0.9244 -0.3069 0.0354  -0.2466 436 GLN D OE1   
2473 N  NE2   . GLN D 118 ? 1.3241 0.9965 0.9198 -0.2807 0.0544  -0.2537 436 GLN D NE2   
2474 O  "O5'" . DA  E 1   ? 0.6218 0.3057 0.5734 -0.1051 0.0129  -0.0889 1   DA  E "O5'" 
2475 C  "C5'" . DA  E 1   ? 0.6025 0.2589 0.5364 -0.0968 0.0167  -0.0975 1   DA  E "C5'" 
2476 C  "C4'" . DA  E 1   ? 0.5907 0.2361 0.5187 -0.0760 0.0266  -0.0945 1   DA  E "C4'" 
2477 O  "O4'" . DA  E 1   ? 0.5723 0.2073 0.5074 -0.0749 0.0317  -0.0826 1   DA  E "O4'" 
2478 C  "C3'" . DA  E 1   ? 0.5478 0.2179 0.4812 -0.0640 0.0284  -0.0936 1   DA  E "C3'" 
2479 O  "O3'" . DA  E 1   ? 0.6115 0.2710 0.5354 -0.0440 0.0357  -0.0973 1   DA  E "O3'" 
2480 C  "C2'" . DA  E 1   ? 0.5173 0.1974 0.4656 -0.0649 0.0300  -0.0810 1   DA  E "C2'" 
2481 C  "C1'" . DA  E 1   ? 0.5950 0.2459 0.5376 -0.0618 0.0357  -0.0756 1   DA  E "C1'" 
2482 N  N9    . DA  E 1   ? 0.6298 0.2823 0.5840 -0.0673 0.0379  -0.0626 1   DA  E N9    
2483 C  C8    . DA  E 1   ? 0.6093 0.2565 0.5649 -0.0526 0.0452  -0.0523 1   DA  E C8    
2484 N  N7    . DA  E 1   ? 0.5642 0.2138 0.5300 -0.0611 0.0471  -0.0405 1   DA  E N7    
2485 C  C5    . DA  E 1   ? 0.5890 0.2484 0.5629 -0.0838 0.0397  -0.0436 1   DA  E C5    
2486 C  C6    . DA  E 1   ? 0.5759 0.2466 0.5650 -0.1018 0.0376  -0.0349 1   DA  E C6    
2487 N  N6    . DA  E 1   ? 0.5827 0.2539 0.5803 -0.0999 0.0448  -0.0202 1   DA  E N6    
2488 N  N1    . DA  E 1   ? 0.6165 0.3002 0.6125 -0.1204 0.0280  -0.0414 1   DA  E N1    
2489 C  C2    . DA  E 1   ? 0.6225 0.3050 0.6081 -0.1200 0.0218  -0.0554 1   DA  E C2    
2490 N  N3    . DA  E 1   ? 0.6124 0.2837 0.5823 -0.1044 0.0244  -0.0639 1   DA  E N3    
2491 C  C4    . DA  E 1   ? 0.5878 0.2491 0.5539 -0.0870 0.0333  -0.0574 1   DA  E C4    
2492 P  P     . DG  E 2   ? 0.5807 0.2633 0.5079 -0.0307 0.0379  -0.1012 2   DG  E P     
2493 O  OP1   . DG  E 2   ? 0.6337 0.3032 0.5511 -0.0115 0.0450  -0.1058 2   DG  E OP1   
2494 O  OP2   . DG  E 2   ? 0.6622 0.3633 0.5898 -0.0431 0.0319  -0.1067 2   DG  E OP2   
2495 O  "O5'" . DG  E 2   ? 0.5544 0.2541 0.4978 -0.0250 0.0391  -0.0911 2   DG  E "O5'" 
2496 C  "C5'" . DG  E 2   ? 0.5354 0.2221 0.4792 -0.0109 0.0443  -0.0837 2   DG  E "C5'" 
2497 C  "C4'" A DG  E 2   ? 0.4975 0.2005 0.4555 -0.0074 0.0442  -0.0740 2   DG  E "C4'" 
2498 C  "C4'" B DG  E 2   ? 0.4981 0.2007 0.4560 -0.0074 0.0442  -0.0739 2   DG  E "C4'" 
2499 O  "O4'" A DG  E 2   ? 0.4923 0.1962 0.4568 -0.0256 0.0409  -0.0669 2   DG  E "O4'" 
2500 O  "O4'" B DG  E 2   ? 0.4921 0.1958 0.4565 -0.0258 0.0409  -0.0669 2   DG  E "O4'" 
2501 C  "C3'" A DG  E 2   ? 0.4647 0.1988 0.4349 -0.0028 0.0415  -0.0767 2   DG  E "C3'" 
2502 C  "C3'" B DG  E 2   ? 0.4649 0.1987 0.4351 -0.0026 0.0415  -0.0765 2   DG  E "C3'" 
2503 O  "O3'" A DG  E 2   ? 0.4849 0.2324 0.4640 0.0130  0.0411  -0.0680 2   DG  E "O3'" 
2504 O  "O3'" B DG  E 2   ? 0.4841 0.2305 0.4629 0.0130  0.0412  -0.0676 2   DG  E "O3'" 
2505 C  "C2'" A DG  E 2   ? 0.4468 0.1980 0.4242 -0.0229 0.0346  -0.0745 2   DG  E "C2'" 
2506 C  "C2'" B DG  E 2   ? 0.4472 0.1983 0.4246 -0.0227 0.0346  -0.0744 2   DG  E "C2'" 
2507 C  "C1'" A DG  E 2   ? 0.4554 0.1903 0.4332 -0.0316 0.0354  -0.0652 2   DG  E "C1'" 
2508 C  "C1'" B DG  E 2   ? 0.4557 0.1906 0.4335 -0.0316 0.0354  -0.0651 2   DG  E "C1'" 
2509 N  N9    . DG  E 2   ? 0.4310 0.1678 0.4107 -0.0539 0.0305  -0.0659 2   DG  E N9    
2510 C  C8    . DG  E 2   ? 0.4896 0.2342 0.4643 -0.0651 0.0245  -0.0748 2   DG  E C8    
2511 N  N7    . DG  E 2   ? 0.4765 0.2269 0.4557 -0.0824 0.0183  -0.0722 2   DG  E N7    
2512 C  C5    . DG  E 2   ? 0.4248 0.1696 0.4131 -0.0844 0.0220  -0.0610 2   DG  E C5    
2513 C  C6    . DG  E 2   ? 0.4434 0.1939 0.4428 -0.1004 0.0191  -0.0530 2   DG  E C6    
2514 O  O6    . DG  E 2   ? 0.4647 0.2278 0.4690 -0.1161 0.0110  -0.0554 2   DG  E O6    
2515 N  N1    . DG  E 2   ? 0.4755 0.2175 0.4816 -0.0957 0.0269  -0.0407 2   DG  E N1    
2516 C  C2    . DG  E 2   ? 0.4633 0.1960 0.4645 -0.0747 0.0338  -0.0361 2   DG  E C2    
2517 N  N2    . DG  E 2   ? 0.4790 0.2081 0.4856 -0.0696 0.0397  -0.0223 2   DG  E N2    
2518 N  N3    . DG  E 2   ? 0.4654 0.1962 0.4578 -0.0588 0.0345  -0.0439 2   DG  E N3    
2519 C  C4    . DG  E 2   ? 0.4397 0.1748 0.4268 -0.0661 0.0297  -0.0566 2   DG  E C4    
2520 P  P     A DC  E 3   ? 0.4378 0.2232 0.4323 0.0195  0.0352  -0.0671 3   DC  E P     
2521 P  P     B DC  E 3   ? 0.4323 0.2165 0.4265 0.0201  0.0354  -0.0666 3   DC  E P     
2522 O  OP1   A DC  E 3   ? 0.4639 0.2525 0.4607 0.0414  0.0364  -0.0642 3   DC  E OP1   
2523 O  OP1   B DC  E 3   ? 0.4559 0.2421 0.4518 0.0421  0.0368  -0.0633 3   DC  E OP1   
2524 O  OP2   A DC  E 3   ? 0.4417 0.2427 0.4388 0.0114  0.0337  -0.0764 3   DC  E OP2   
2525 O  OP2   B DC  E 3   ? 0.4472 0.2475 0.4444 0.0126  0.0338  -0.0760 3   DC  E OP2   
2526 O  "O5'" A DC  E 3   ? 0.4299 0.2278 0.4320 0.0093  0.0300  -0.0566 3   DC  E "O5'" 
2527 O  "O5'" B DC  E 3   ? 0.4294 0.2264 0.4313 0.0097  0.0302  -0.0562 3   DC  E "O5'" 
2528 C  "C5'" A DC  E 3   ? 0.4100 0.1962 0.4103 0.0145  0.0322  -0.0458 3   DC  E "C5'" 
2529 C  "C5'" B DC  E 3   ? 0.4132 0.1987 0.4133 0.0146  0.0324  -0.0453 3   DC  E "C5'" 
2530 C  "C4'" A DC  E 3   ? 0.3876 0.1877 0.3953 0.0029  0.0284  -0.0367 3   DC  E "C4'" 
2531 C  "C4'" B DC  E 3   ? 0.3875 0.1875 0.3953 0.0028  0.0285  -0.0363 3   DC  E "C4'" 
2532 O  "O4'" A DC  E 3   ? 0.4074 0.1992 0.4140 -0.0178 0.0283  -0.0386 3   DC  E "O4'" 
2533 O  "O4'" B DC  E 3   ? 0.4076 0.1993 0.4142 -0.0179 0.0283  -0.0384 3   DC  E "O4'" 
2534 C  "C3'" A DC  E 3   ? 0.3341 0.1650 0.3511 0.0025  0.0213  -0.0373 3   DC  E "C3'" 
2535 C  "C3'" B DC  E 3   ? 0.3342 0.1649 0.3512 0.0026  0.0214  -0.0372 3   DC  E "C3'" 
2536 O  "O3'" A DC  E 3   ? 0.3325 0.1735 0.3534 0.0073  0.0196  -0.0259 3   DC  E "O3'" 
2537 O  "O3'" B DC  E 3   ? 0.3324 0.1734 0.3534 0.0073  0.0196  -0.0258 3   DC  E "O3'" 
2538 C  "C2'" A DC  E 3   ? 0.3496 0.1858 0.3675 -0.0169 0.0187  -0.0417 3   DC  E "C2'" 
2539 C  "C2'" B DC  E 3   ? 0.3497 0.1855 0.3675 -0.0168 0.0187  -0.0418 3   DC  E "C2'" 
2540 C  "C1'" A DC  E 3   ? 0.3670 0.1843 0.3823 -0.0271 0.0221  -0.0362 3   DC  E "C1'" 
2541 C  "C1'" B DC  E 3   ? 0.3670 0.1843 0.3823 -0.0271 0.0221  -0.0361 3   DC  E "C1'" 
2542 N  N1    . DC  E 3   ? 0.3642 0.1807 0.3789 -0.0473 0.0192  -0.0409 3   DC  E N1    
2543 C  C2    . DC  E 3   ? 0.3828 0.1986 0.4033 -0.0604 0.0188  -0.0331 3   DC  E C2    
2544 O  O2    . DC  E 3   ? 0.3756 0.1890 0.4005 -0.0546 0.0229  -0.0218 3   DC  E O2    
2545 N  N3    . DC  E 3   ? 0.4002 0.2193 0.4216 -0.0788 0.0142  -0.0378 3   DC  E N3    
2546 C  C4    . DC  E 3   ? 0.3989 0.2193 0.4123 -0.0831 0.0104  -0.0496 3   DC  E C4    
2547 N  N4    . DC  E 3   ? 0.4325 0.2563 0.4451 -0.1004 0.0046  -0.0544 3   DC  E N4    
2548 C  C5    . DC  E 3   ? 0.3485 0.1682 0.3550 -0.0696 0.0125  -0.0568 3   DC  E C5    
2549 C  C6    . DC  E 3   ? 0.3675 0.1869 0.3768 -0.0526 0.0165  -0.0522 3   DC  E C6    
2550 P  P     . DG  E 4   ? 0.3170 0.1809 0.3426 0.0183  0.0134  -0.0246 4   DG  E P     
2551 O  OP1   . DG  E 4   ? 0.3535 0.2140 0.3767 0.0368  0.0136  -0.0276 4   DG  E OP1   
2552 O  OP2   . DG  E 4   ? 0.2962 0.1775 0.3265 0.0086  0.0085  -0.0308 4   DG  E OP2   
2553 O  "O5'" . DG  E 4   ? 0.3228 0.1910 0.3487 0.0198  0.0137  -0.0109 4   DG  E "O5'" 
2554 C  "C5'" . DG  E 4   ? 0.3014 0.1540 0.3227 0.0263  0.0200  -0.0009 4   DG  E "C5'" 
2555 C  "C4'" . DG  E 4   ? 0.3081 0.1678 0.3339 0.0173  0.0219  0.0106  4   DG  E "C4'" 
2556 O  "O4'" . DG  E 4   ? 0.3675 0.2245 0.3990 -0.0036 0.0228  0.0079  4   DG  E "O4'" 
2557 C  "C3'" . DG  E 4   ? 0.2936 0.1769 0.3226 0.0196  0.0159  0.0136  4   DG  E "C3'" 
2558 O  "O3'" . DG  E 4   ? 0.3289 0.2162 0.3577 0.0253  0.0198  0.0276  4   DG  E "O3'" 
2559 C  "C2'" . DG  E 4   ? 0.2894 0.1834 0.3253 0.0007  0.0124  0.0083  4   DG  E "C2'" 
2560 C  "C1'" . DG  E 4   ? 0.3316 0.2109 0.3703 -0.0131 0.0177  0.0095  4   DG  E "C1'" 
2561 N  N9    . DG  E 4   ? 0.2915 0.1715 0.3319 -0.0297 0.0141  -0.0009 4   DG  E N9    
2562 C  C8    . DG  E 4   ? 0.2880 0.1618 0.3230 -0.0299 0.0122  -0.0138 4   DG  E C8    
2563 N  N7    . DG  E 4   ? 0.2784 0.1537 0.3131 -0.0450 0.0093  -0.0206 4   DG  E N7    
2564 C  C5    . DG  E 4   ? 0.2662 0.1511 0.3085 -0.0562 0.0082  -0.0124 4   DG  E C5    
2565 C  C6    . DG  E 4   ? 0.3221 0.2148 0.3679 -0.0739 0.0037  -0.0152 4   DG  E C6    
2566 O  O6    . DG  E 4   ? 0.3338 0.2234 0.3732 -0.0829 -0.0001 -0.0261 4   DG  E O6    
2567 N  N1    . DG  E 4   ? 0.3082 0.2147 0.3656 -0.0806 0.0037  -0.0039 4   DG  E N1    
2568 C  C2    . DG  E 4   ? 0.3521 0.2629 0.4154 -0.0706 0.0090  0.0092  4   DG  E C2    
2569 N  N2    . DG  E 4   ? 0.3447 0.2721 0.4211 -0.0790 0.0095  0.0197  4   DG  E N2    
2570 N  N3    . DG  E 4   ? 0.3263 0.2269 0.3830 -0.0531 0.0133  0.0119  4   DG  E N3    
2571 C  C4    . DG  E 4   ? 0.2833 0.1721 0.3303 -0.0471 0.0118  0.0003  4   DG  E C4    
2572 P  P     . DT  E 5   ? 0.2994 0.2047 0.3255 0.0357  0.0155  0.0332  5   DT  E P     
2573 O  OP1   . DT  E 5   ? 0.3231 0.2248 0.3448 0.0471  0.0227  0.0479  5   DT  E OP1   
2574 O  OP2   . DT  E 5   ? 0.3005 0.2089 0.3209 0.0456  0.0079  0.0230  5   DT  E OP2   
2575 O  "O5'" . DT  E 5   ? 0.2948 0.2178 0.3298 0.0201  0.0127  0.0341  5   DT  E "O5'" 
2576 C  "C5'" . DT  E 5   ? 0.3135 0.2445 0.3577 0.0103  0.0176  0.0448  5   DT  E "C5'" 
2577 C  "C4'" . DT  E 5   ? 0.3051 0.2554 0.3566 -0.0024 0.0122  0.0426  5   DT  E "C4'" 
2578 O  "O4'" . DT  E 5   ? 0.2987 0.2425 0.3522 -0.0175 0.0087  0.0302  5   DT  E "O4'" 
2579 C  "C3'" . DT  E 5   ? 0.2697 0.2302 0.3132 0.0077  0.0059  0.0399  5   DT  E "C3'" 
2580 O  "O3'" . DT  E 5   ? 0.3170 0.2972 0.3649 0.0066  0.0054  0.0488  5   DT  E "O3'" 
2581 C  "C2'" . DT  E 5   ? 0.2602 0.2171 0.3022 -0.0023 0.0004  0.0258  5   DT  E "C2'" 
2582 C  "C1'" . DT  E 5   ? 0.2853 0.2420 0.3367 -0.0200 0.0021  0.0249  5   DT  E "C1'" 
2583 N  N1    . DT  E 5   ? 0.2616 0.2099 0.3106 -0.0310 -0.0009 0.0115  5   DT  E N1    
2584 C  C2    . DT  E 5   ? 0.2922 0.2475 0.3459 -0.0471 -0.0036 0.0090  5   DT  E C2    
2585 O  O2    . DT  E 5   ? 0.3232 0.2943 0.3856 -0.0533 -0.0045 0.0172  5   DT  E O2    
2586 N  N3    . DT  E 5   ? 0.2582 0.2040 0.3063 -0.0549 -0.0058 -0.0033 5   DT  E N3    
2587 C  C4    . DT  E 5   ? 0.2558 0.1876 0.2967 -0.0487 -0.0042 -0.0125 5   DT  E C4    
2588 O  O4    . DT  E 5   ? 0.3003 0.2249 0.3361 -0.0555 -0.0049 -0.0227 5   DT  E O4    
2589 C  C5    . DT  E 5   ? 0.2506 0.1784 0.2904 -0.0328 -0.0018 -0.0094 5   DT  E C5    
2590 C  C7    . DT  E 5   ? 0.2903 0.2082 0.3259 -0.0252 -0.0008 -0.0189 5   DT  E C7    
2591 C  C6    . DT  E 5   ? 0.2494 0.1841 0.2919 -0.0246 -0.0007 0.0020  5   DT  E C6    
2592 P  P     . DG  E 6   ? 0.3385 0.3260 0.3766 0.0256  0.0055  0.0572  6   DG  E P     
2593 O  OP1   . DG  E 6   ? 0.4240 0.4061 0.4602 0.0375  0.0130  0.0677  6   DG  E OP1   
2594 O  OP2   . DG  E 6   ? 0.4477 0.4278 0.4736 0.0316  -0.0013 0.0468  6   DG  E OP2   
2595 O  "O5'" . DG  E 6   ? 0.3278 0.3398 0.3747 0.0198  0.0050  0.0657  6   DG  E "O5'" 
2596 C  "C5'" . DG  E 6   ? 0.2768 0.2963 0.3211 0.0139  -0.0017 0.0595  6   DG  E "C5'" 
2597 C  "C4'" . DG  E 6   ? 0.2855 0.3249 0.3447 -0.0020 -0.0031 0.0622  6   DG  E "C4'" 
2598 O  "O4'" . DG  E 6   ? 0.2880 0.3173 0.3544 -0.0189 -0.0037 0.0534  6   DG  E "O4'" 
2599 C  "C3'" . DG  E 6   ? 0.2705 0.3214 0.3243 -0.0037 -0.0097 0.0592  6   DG  E "C3'" 
2600 O  "O3'" . DG  E 6   ? 0.2288 0.3005 0.2843 0.0068  -0.0085 0.0716  6   DG  E "O3'" 
2601 C  "C2'" . DG  E 6   ? 0.2433 0.3015 0.3076 -0.0237 -0.0138 0.0528  6   DG  E "C2'" 
2602 C  "C1'" . DG  E 6   ? 0.2219 0.2597 0.2896 -0.0317 -0.0103 0.0462  6   DG  E "C1'" 
2603 N  N9    . DG  E 6   ? 0.2584 0.2760 0.3152 -0.0348 -0.0127 0.0324  6   DG  E N9    
2604 C  C8    . DG  E 6   ? 0.2744 0.2726 0.3230 -0.0258 -0.0103 0.0271  6   DG  E C8    
2605 N  N7    . DG  E 6   ? 0.2712 0.2578 0.3140 -0.0314 -0.0123 0.0152  6   DG  E N7    
2606 C  C5    . DG  E 6   ? 0.2709 0.2670 0.3154 -0.0444 -0.0162 0.0122  6   DG  E C5    
2607 C  C6    . DG  E 6   ? 0.2681 0.2576 0.3060 -0.0540 -0.0189 0.0008  6   DG  E C6    
2608 O  O6    . DG  E 6   ? 0.2875 0.2624 0.3190 -0.0535 -0.0172 -0.0085 6   DG  E O6    
2609 N  N1    . DG  E 6   ? 0.2730 0.2766 0.3126 -0.0645 -0.0239 0.0012  6   DG  E N1    
2610 C  C2    . DG  E 6   ? 0.2469 0.2715 0.2966 -0.0662 -0.0263 0.0111  6   DG  E C2    
2611 N  N2    . DG  E 6   ? 0.2897 0.3286 0.3404 -0.0766 -0.0328 0.0089  6   DG  E N2    
2612 N  N3    . DG  E 6   ? 0.2669 0.2997 0.3252 -0.0576 -0.0226 0.0225  6   DG  E N3    
2613 C  C4    . DG  E 6   ? 0.2583 0.2743 0.3119 -0.0468 -0.0174 0.0223  6   DG  E C4    
2614 P  P     . DG  E 7   ? 0.2334 0.3097 0.2738 0.0180  -0.0127 0.0726  7   DG  E P     
2615 O  OP1   . DG  E 7   ? 0.2701 0.3671 0.3142 0.0319  -0.0085 0.0876  7   DG  E OP1   
2616 O  OP2   . DG  E 7   ? 0.2725 0.3226 0.2937 0.0250  -0.0144 0.0634  7   DG  E OP2   
2617 O  "O5'" . DG  E 7   ? 0.2677 0.3567 0.3126 0.0034  -0.0194 0.0672  7   DG  E "O5'" 
2618 C  "C5'" . DG  E 7   ? 0.2600 0.3768 0.3244 -0.0076 -0.0211 0.0727  7   DG  E "C5'" 
2619 C  "C4'" . DG  E 7   ? 0.2803 0.4040 0.3423 -0.0193 -0.0293 0.0648  7   DG  E "C4'" 
2620 O  "O4'" . DG  E 7   ? 0.3232 0.4223 0.3787 -0.0310 -0.0305 0.0509  7   DG  E "O4'" 
2621 C  "C3'" . DG  E 7   ? 0.3060 0.4303 0.3489 -0.0071 -0.0329 0.0658  7   DG  E "C3'" 
2622 O  "O3'" . DG  E 7   ? 0.2886 0.4371 0.3364 -0.0140 -0.0402 0.0663  7   DG  E "O3'" 
2623 C  "C2'" . DG  E 7   ? 0.3091 0.4017 0.3344 -0.0094 -0.0327 0.0536  7   DG  E "C2'" 
2624 C  "C1'" . DG  E 7   ? 0.3154 0.4028 0.3520 -0.0278 -0.0338 0.0441  7   DG  E "C1'" 
2625 N  N9    . DG  E 7   ? 0.2502 0.3094 0.2787 -0.0297 -0.0305 0.0340  7   DG  E N9    
2626 C  C8    . DG  E 7   ? 0.2576 0.3017 0.2849 -0.0210 -0.0254 0.0348  7   DG  E C8    
2627 N  N7    . DG  E 7   ? 0.2705 0.2946 0.2930 -0.0249 -0.0241 0.0244  7   DG  E N7    
2628 C  C5    . DG  E 7   ? 0.2450 0.2695 0.2644 -0.0367 -0.0273 0.0167  7   DG  E C5    
2629 C  C6    . DG  E 7   ? 0.2816 0.2901 0.2951 -0.0440 -0.0264 0.0049  7   DG  E C6    
2630 O  O6    . DG  E 7   ? 0.2780 0.2710 0.2907 -0.0418 -0.0228 -0.0012 7   DG  E O6    
2631 N  N1    . DG  E 7   ? 0.2643 0.2777 0.2725 -0.0537 -0.0302 0.0001  7   DG  E N1    
2632 C  C2    . DG  E 7   ? 0.3047 0.3380 0.3143 -0.0563 -0.0358 0.0056  7   DG  E C2    
2633 N  N2    . DG  E 7   ? 0.2889 0.3241 0.2904 -0.0649 -0.0401 -0.0010 7   DG  E N2    
2634 N  N3    . DG  E 7   ? 0.2685 0.3200 0.2863 -0.0496 -0.0370 0.0168  7   DG  E N3    
2635 C  C4    . DG  E 7   ? 0.2555 0.3005 0.2775 -0.0400 -0.0319 0.0220  7   DG  E C4    
2636 P  P     . DG  E 8   ? 0.3065 0.4615 0.3355 -0.0012 -0.0445 0.0697  8   DG  E P     
2637 O  OP1   . DG  E 8   ? 0.2948 0.4875 0.3388 -0.0058 -0.0516 0.0748  8   DG  E OP1   
2638 O  OP2   . DG  E 8   ? 0.3794 0.5204 0.3922 0.0191  -0.0389 0.0766  8   DG  E OP2   
2639 O  "O5'" . DG  E 8   ? 0.2852 0.4166 0.2963 -0.0100 -0.0476 0.0566  8   DG  E "O5'" 
2640 C  "C5'" . DG  E 8   ? 0.2862 0.4270 0.3029 -0.0263 -0.0545 0.0486  8   DG  E "C5'" 
2641 C  "C4'" . DG  E 8   ? 0.2562 0.3740 0.2497 -0.0281 -0.0553 0.0391  8   DG  E "C4'" 
2642 O  "O4'" . DG  E 8   ? 0.2778 0.3663 0.2682 -0.0326 -0.0488 0.0309  8   DG  E "O4'" 
2643 C  "C3'" . DG  E 8   ? 0.2386 0.3487 0.2090 -0.0118 -0.0540 0.0449  8   DG  E "C3'" 
2644 O  "O3'" . DG  E 8   ? 0.2939 0.4050 0.2483 -0.0150 -0.0593 0.0403  8   DG  E "O3'" 
2645 C  "C2'" . DG  E 8   ? 0.2712 0.3480 0.2307 -0.0082 -0.0457 0.0409  8   DG  E "C2'" 
2646 C  "C1'" . DG  E 8   ? 0.2828 0.3492 0.2523 -0.0242 -0.0447 0.0294  8   DG  E "C1'" 
2647 N  N9    . DG  E 8   ? 0.2694 0.3148 0.2421 -0.0231 -0.0381 0.0259  8   DG  E N9    
2648 C  C8    . DG  E 8   ? 0.2288 0.2729 0.2077 -0.0133 -0.0348 0.0322  8   DG  E C8    
2649 N  N7    . DG  E 8   ? 0.2235 0.2489 0.2039 -0.0144 -0.0307 0.0262  8   DG  E N7    
2650 C  C5    . DG  E 8   ? 0.2176 0.2320 0.1938 -0.0254 -0.0303 0.0156  8   DG  E C5    
2651 C  C6    . DG  E 8   ? 0.2166 0.2137 0.1942 -0.0302 -0.0265 0.0061  8   DG  E C6    
2652 O  O6    . DG  E 8   ? 0.2412 0.2289 0.2236 -0.0258 -0.0238 0.0045  8   DG  E O6    
2653 N  N1    . DG  E 8   ? 0.2431 0.2351 0.2148 -0.0401 -0.0260 -0.0023 8   DG  E N1    
2654 C  C2    . DG  E 8   ? 0.2840 0.2852 0.2474 -0.0447 -0.0299 -0.0019 8   DG  E C2    
2655 N  N2    . DG  E 8   ? 0.2770 0.2698 0.2322 -0.0527 -0.0284 -0.0108 8   DG  E N2    
2656 N  N3    . DG  E 8   ? 0.2785 0.2973 0.2413 -0.0404 -0.0350 0.0065  8   DG  E N3    
2657 C  C4    . DG  E 8   ? 0.2440 0.2693 0.2145 -0.0309 -0.0345 0.0153  8   DG  E C4    
2658 P  P     . DA  E 9   ? 0.3490 0.4470 0.2742 -0.0004 -0.0576 0.0451  9   DA  E P     
2659 O  OP1   . DA  E 9   ? 0.3811 0.4959 0.2962 -0.0017 -0.0662 0.0441  9   DA  E OP1   
2660 O  OP2   . DA  E 9   ? 0.3440 0.4396 0.2639 0.0173  -0.0533 0.0563  9   DA  E OP2   
2661 O  "O5'" . DA  E 9   ? 0.3288 0.3912 0.2398 -0.0065 -0.0501 0.0358  9   DA  E "O5'" 
2662 C  "C5'" . DA  E 9   ? 0.3225 0.3783 0.2306 -0.0204 -0.0513 0.0245  9   DA  E "C5'" 
2663 C  "C4'" . DA  E 9   ? 0.3394 0.3644 0.2371 -0.0233 -0.0419 0.0181  9   DA  E "C4'" 
2664 O  "O4'" . DA  E 9   ? 0.3275 0.3452 0.2427 -0.0254 -0.0376 0.0163  9   DA  E "O4'" 
2665 C  "C3'" . DA  E 9   ? 0.3631 0.3682 0.2374 -0.0121 -0.0358 0.0240  9   DA  E "C3'" 
2666 O  "O3'" . DA  E 9   ? 0.3742 0.3586 0.2352 -0.0186 -0.0292 0.0171  9   DA  E "O3'" 
2667 C  "C2'" . DA  E 9   ? 0.3323 0.3265 0.2156 -0.0070 -0.0311 0.0269  9   DA  E "C2'" 
2668 C  "C1'" . DA  E 9   ? 0.3348 0.3299 0.2387 -0.0194 -0.0304 0.0174  9   DA  E "C1'" 
2669 N  N9    . DA  E 9   ? 0.3067 0.2970 0.2240 -0.0161 -0.0281 0.0183  9   DA  E N9    
2670 C  C8    . DA  E 9   ? 0.2756 0.2731 0.1966 -0.0046 -0.0295 0.0271  9   DA  E C8    
2671 N  N7    . DA  E 9   ? 0.2688 0.2570 0.1985 -0.0028 -0.0269 0.0251  9   DA  E N7    
2672 C  C5    . DA  E 9   ? 0.2723 0.2481 0.2056 -0.0137 -0.0237 0.0147  9   DA  E C5    
2673 C  C6    . DA  E 9   ? 0.2428 0.2074 0.1854 -0.0164 -0.0208 0.0079  9   DA  E C6    
2674 N  N6    . DA  E 9   ? 0.2643 0.2260 0.2121 -0.0083 -0.0213 0.0102  9   DA  E N6    
2675 N  N1    . DA  E 9   ? 0.2800 0.2375 0.2256 -0.0264 -0.0175 -0.0015 9   DA  E N1    
2676 C  C2    . DA  E 9   ? 0.2614 0.2204 0.1988 -0.0331 -0.0167 -0.0039 9   DA  E C2    
2677 N  N3    . DA  E 9   ? 0.2856 0.2530 0.2116 -0.0314 -0.0199 0.0014  9   DA  E N3    
2678 C  C4    . DA  E 9   ? 0.2706 0.2474 0.1965 -0.0217 -0.0237 0.0107  9   DA  E C4    
2679 P  P     . DG  E 10  ? 0.5059 0.4834 0.3383 -0.0151 -0.0281 0.0189  10  DG  E P     
2680 O  OP1   . DG  E 10  ? 0.5614 0.5542 0.3966 -0.0238 -0.0351 0.0112  10  DG  E OP1   
2681 O  OP2   . DG  E 10  ? 0.5306 0.5083 0.3458 0.0004  -0.0294 0.0309  10  DG  E OP2   
2682 O  "O5'" . DG  E 10  ? 0.5759 0.5226 0.3976 -0.0181 -0.0150 0.0164  10  DG  E "O5'" 
2683 C  "C5'" . DG  E 10  ? 0.6522 0.5907 0.4761 -0.0290 -0.0092 0.0069  10  DG  E "C5'" 
2684 C  "C4'" . DG  E 10  ? 0.5205 0.4466 0.3616 -0.0354 -0.0015 0.0018  10  DG  E "C4'" 
2685 O  "O4'" . DG  E 10  ? 0.3864 0.3237 0.2510 -0.0358 -0.0070 0.0003  10  DG  E "O4'" 
2686 C  "C3'" . DG  E 10  ? 0.4565 0.3609 0.2906 -0.0332 0.0074  0.0059  10  DG  E "C3'" 
2687 O  "O3'" . DG  E 10  ? 0.4112 0.2995 0.2254 -0.0354 0.0172  0.0069  10  DG  E "O3'" 
2688 C  "C2'" . DG  E 10  ? 0.3589 0.2640 0.2182 -0.0411 0.0096  -0.0025 10  DG  E "C2'" 
2689 C  "C1'" . DG  E 10  ? 0.3510 0.2759 0.2270 -0.0394 -0.0006 -0.0036 10  DG  E "C1'" 
2690 N  N9    . DG  E 10  ? 0.3222 0.2479 0.2068 -0.0324 -0.0043 0.0010  10  DG  E N9    
2691 C  C8    . DG  E 10  ? 0.3469 0.2814 0.2269 -0.0223 -0.0104 0.0097  10  DG  E C8    
2692 N  N7    . DG  E 10  ? 0.3355 0.2671 0.2230 -0.0162 -0.0117 0.0121  10  DG  E N7    
2693 C  C5    . DG  E 10  ? 0.3049 0.2260 0.2032 -0.0234 -0.0075 0.0040  10  DG  E C5    
2694 C  C6    . DG  E 10  ? 0.3169 0.2316 0.2253 -0.0209 -0.0080 0.0015  10  DG  E C6    
2695 O  O6    . DG  E 10  ? 0.3314 0.2460 0.2392 -0.0112 -0.0116 0.0063  10  DG  E O6    
2696 N  N1    . DG  E 10  ? 0.2856 0.1948 0.2051 -0.0300 -0.0040 -0.0075 10  DG  E N1    
2697 C  C2    . DG  E 10  ? 0.2870 0.1964 0.2075 -0.0397 0.0016  -0.0129 10  DG  E C2    
2698 N  N2    . DG  E 10  ? 0.2996 0.2066 0.2338 -0.0464 0.0056  -0.0209 10  DG  E N2    
2699 N  N3    . DG  E 10  ? 0.2953 0.2083 0.2040 -0.0415 0.0029  -0.0107 10  DG  E N3    
2700 C  C4    . DG  E 10  ? 0.3039 0.2226 0.2019 -0.0334 -0.0025 -0.0025 10  DG  E C4    
2701 P  P     . DT  E 11  ? 0.4486 0.3104 0.2491 -0.0339 0.0274  0.0132  11  DT  E P     
2702 O  OP1   . DT  E 11  ? 0.4661 0.3158 0.2423 -0.0346 0.0368  0.0160  11  DT  E OP1   
2703 O  OP2   . DT  E 11  ? 0.4717 0.3263 0.2649 -0.0231 0.0228  0.0214  11  DT  E OP2   
2704 O  "O5'" . DT  E 11  ? 0.4174 0.2743 0.2418 -0.0449 0.0334  0.0052  11  DT  E "O5'" 
2705 C  "C5'" . DT  E 11  ? 0.4116 0.2738 0.2473 -0.0548 0.0402  -0.0029 11  DT  E "C5'" 
2706 C  "C4'" . DT  E 11  ? 0.3668 0.2301 0.2289 -0.0626 0.0427  -0.0099 11  DT  E "C4'" 
2707 O  "O4'" . DT  E 11  ? 0.3606 0.2378 0.2407 -0.0589 0.0313  -0.0132 11  DT  E "O4'" 
2708 C  "C3'" . DT  E 11  ? 0.4010 0.2450 0.2613 -0.0648 0.0473  -0.0064 11  DT  E "C3'" 
2709 O  "O3'" . DT  E 11  ? 0.4148 0.2454 0.2677 -0.0728 0.0610  -0.0049 11  DT  E "O3'" 
2710 C  "C2'" . DT  E 11  ? 0.3819 0.2360 0.2709 -0.0690 0.0424  -0.0147 11  DT  E "C2'" 
2711 C  "C1'" . DT  E 11  ? 0.3681 0.2391 0.2623 -0.0610 0.0310  -0.0155 11  DT  E "C1'" 
2712 N  N1    . DT  E 11  ? 0.3340 0.2007 0.2216 -0.0510 0.0224  -0.0097 11  DT  E N1    
2713 C  C2    . DT  E 11  ? 0.3448 0.2098 0.2461 -0.0502 0.0181  -0.0133 11  DT  E C2    
2714 O  O2    . DT  E 11  ? 0.3467 0.2144 0.2661 -0.0578 0.0202  -0.0210 11  DT  E O2    
2715 N  N3    . DT  E 11  ? 0.3208 0.1820 0.2136 -0.0392 0.0111  -0.0076 11  DT  E N3    
2716 C  C4    . DT  E 11  ? 0.3684 0.2298 0.2429 -0.0291 0.0084  0.0016  11  DT  E C4    
2717 O  O4    . DT  E 11  ? 0.3771 0.2367 0.2456 -0.0181 0.0030  0.0068  11  DT  E O4    
2718 C  C5    . DT  E 11  ? 0.3430 0.2084 0.2054 -0.0309 0.0120  0.0048  11  DT  E C5    
2719 C  C7    . DT  E 11  ? 0.3818 0.2520 0.2258 -0.0195 0.0079  0.0144  11  DT  E C7    
2720 C  C6    . DT  E 11  ? 0.3227 0.1893 0.1908 -0.0417 0.0188  -0.0012 11  DT  E C6    
2721 P  P     . DG  E 12  ? 0.4600 0.2616 0.2968 -0.0746 0.0681  0.0025  12  DG  E P     
2722 O  OP1   . DG  E 12  ? 0.4803 0.2733 0.3134 -0.0846 0.0841  0.0038  12  DG  E OP1   
2723 O  OP2   . DG  E 12  ? 0.4852 0.2762 0.2953 -0.0609 0.0621  0.0117  12  DG  E OP2   
2724 O  "O5'" . DG  E 12  ? 0.4603 0.2612 0.3210 -0.0802 0.0626  -0.0042 12  DG  E "O5'" 
2725 C  "C5'" . DG  E 12  ? 0.4286 0.2410 0.3178 -0.0927 0.0668  -0.0131 12  DG  E "C5'" 
2726 C  "C4'" . DG  E 12  ? 0.4340 0.2491 0.3426 -0.0937 0.0566  -0.0199 12  DG  E "C4'" 
2727 O  "O4'" . DG  E 12  ? 0.4346 0.2616 0.3436 -0.0813 0.0437  -0.0205 12  DG  E "O4'" 
2728 C  "C3'" . DG  E 12  ? 0.4555 0.2421 0.3508 -0.0950 0.0559  -0.0167 12  DG  E "C3'" 
2729 O  "O3'" . DG  E 12  ? 0.5014 0.2788 0.4074 -0.1108 0.0659  -0.0194 12  DG  E "O3'" 
2730 C  "C2'" . DG  E 12  ? 0.4458 0.2399 0.3538 -0.0888 0.0416  -0.0231 12  DG  E "C2'" 
2731 C  "C1'" . DG  E 12  ? 0.4394 0.2552 0.3480 -0.0771 0.0352  -0.0216 12  DG  E "C1'" 
2732 N  N9    . DG  E 12  ? 0.4019 0.2087 0.2869 -0.0628 0.0295  -0.0131 12  DG  E N9    
2733 C  C8    . DG  E 12  ? 0.4122 0.2165 0.2756 -0.0556 0.0323  -0.0042 12  DG  E C8    
2734 N  N7    . DG  E 12  ? 0.3909 0.1910 0.2389 -0.0418 0.0256  0.0024  12  DG  E N7    
2735 C  C5    . DG  E 12  ? 0.3852 0.1826 0.2436 -0.0395 0.0186  -0.0025 12  DG  E C5    
2736 C  C6    . DG  E 12  ? 0.4141 0.2068 0.2629 -0.0253 0.0106  0.0012  12  DG  E C6    
2737 O  O6    . DG  E 12  ? 0.4370 0.2297 0.2686 -0.0117 0.0083  0.0102  12  DG  E O6    
2738 N  N1    . DG  E 12  ? 0.3894 0.1790 0.2508 -0.0269 0.0051  -0.0068 12  DG  E N1    
2739 C  C2    . DG  E 12  ? 0.3918 0.1848 0.2742 -0.0408 0.0060  -0.0171 12  DG  E C2    
2740 N  N2    . DG  E 12  ? 0.4182 0.2091 0.3095 -0.0394 -0.0016 -0.0244 12  DG  E N2    
2741 N  N3    . DG  E 12  ? 0.4007 0.2011 0.2950 -0.0540 0.0137  -0.0201 12  DG  E N3    
2742 C  C4    . DG  E 12  ? 0.4264 0.2276 0.3069 -0.0524 0.0201  -0.0124 12  DG  E C4    
2743 P  P     . DT  E 13  ? 0.5635 0.3025 0.4484 -0.1161 0.0718  -0.0138 13  DT  E P     
2744 O  OP1   . DT  E 13  ? 0.6055 0.3444 0.5078 -0.1344 0.0841  -0.0163 13  DT  E OP1   
2745 O  OP2   . DT  E 13  ? 0.5640 0.2813 0.4115 -0.1030 0.0747  -0.0017 13  DT  E OP2   
2746 O  "O5'" . DT  E 13  ? 0.5790 0.3098 0.4681 -0.1124 0.0575  -0.0204 13  DT  E "O5'" 
2747 C  "C5'" . DT  E 13  ? 0.5843 0.3347 0.5063 -0.1212 0.0501  -0.0326 13  DT  E "C5'" 
2748 C  "C4'" . DT  E 13  ? 0.5259 0.2652 0.4427 -0.1128 0.0357  -0.0371 13  DT  E "C4'" 
2749 O  "O4'" . DT  E 13  ? 0.5240 0.2718 0.4306 -0.0955 0.0272  -0.0346 13  DT  E "O4'" 
2750 C  "C3'" . DT  E 13  ? 0.5958 0.2990 0.4847 -0.1092 0.0369  -0.0312 13  DT  E "C3'" 
2751 O  "O3'" . DT  E 13  ? 0.6430 0.3432 0.5480 -0.1226 0.0383  -0.0358 13  DT  E "O3'" 
2752 C  "C2'" . DT  E 13  ? 0.5918 0.2870 0.4683 -0.0941 0.0231  -0.0340 13  DT  E "C2'" 
2753 C  "C1'" . DT  E 13  ? 0.5747 0.2974 0.4576 -0.0838 0.0196  -0.0324 13  DT  E "C1'" 
2754 N  N1    . DT  E 13  ? 0.5281 0.2445 0.3837 -0.0673 0.0216  -0.0200 13  DT  E N1    
2755 C  C2    . DT  E 13  ? 0.5198 0.2285 0.3585 -0.0498 0.0129  -0.0169 13  DT  E C2    
2756 O  O2    . DT  E 13  ? 0.5450 0.2489 0.3869 -0.0465 0.0038  -0.0238 13  DT  E O2    
2757 N  N3    . DT  E 13  ? 0.5148 0.2229 0.3320 -0.0353 0.0151  -0.0052 13  DT  E N3    
2758 C  C4    . DT  E 13  ? 0.4898 0.2025 0.2989 -0.0366 0.0237  0.0026  13  DT  E C4    
2759 O  O4    . DT  E 13  ? 0.5440 0.2582 0.3343 -0.0225 0.0235  0.0125  13  DT  E O4    
2760 C  C5    . DT  E 13  ? 0.4896 0.2066 0.3136 -0.0546 0.0329  -0.0013 13  DT  E C5    
2761 C  C7    . DT  E 13  ? 0.4979 0.2184 0.3112 -0.0559 0.0426  0.0062  13  DT  E C7    
2762 C  C6    . DT  E 13  ? 0.5345 0.2537 0.3818 -0.0691 0.0320  -0.0120 13  DT  E C6    
2763 O  "O5'" . DT  F 1   ? 0.9840 0.7560 0.9210 0.1584  0.0708  0.1228  1   DT  F "O5'" 
2764 C  "C5'" . DT  F 1   ? 0.8394 0.6472 0.7766 0.1521  0.0679  0.1178  1   DT  F "C5'" 
2765 C  "C4'" . DT  F 1   ? 0.7299 0.5180 0.6394 0.1522  0.0704  0.0871  1   DT  F "C4'" 
2766 O  "O4'" . DT  F 1   ? 0.6882 0.4466 0.5832 0.1328  0.0621  0.0689  1   DT  F "O4'" 
2767 C  "C3'" . DT  F 1   ? 0.6411 0.4623 0.5487 0.1427  0.0654  0.0807  1   DT  F "C3'" 
2768 O  "O3'" . DT  F 1   ? 0.6794 0.4846 0.5632 0.1554  0.0717  0.0605  1   DT  F "O3'" 
2769 C  "C2'" . DT  F 1   ? 0.6000 0.4216 0.5042 0.1137  0.0518  0.0704  1   DT  F "C2'" 
2770 C  "C1'" . DT  F 1   ? 0.6491 0.4256 0.5387 0.1129  0.0525  0.0547  1   DT  F "C1'" 
2771 N  N1    . DT  F 1   ? 0.6830 0.4542 0.5764 0.0876  0.0441  0.0533  1   DT  F N1    
2772 C  C2    . DT  F 1   ? 0.6541 0.4066 0.5378 0.0732  0.0389  0.0299  1   DT  F C2    
2773 O  O2    . DT  F 1   ? 0.5865 0.3243 0.4561 0.0805  0.0378  0.0094  1   DT  F O2    
2774 N  N3    . DT  F 1   ? 0.6877 0.4392 0.5787 0.0499  0.0347  0.0320  1   DT  F N3    
2775 C  C4    . DT  F 1   ? 0.7374 0.5013 0.6364 0.0398  0.0347  0.0541  1   DT  F C4    
2776 O  O4    . DT  F 1   ? 0.7481 0.5082 0.6483 0.0189  0.0334  0.0546  1   DT  F O4    
2777 C  C5    . DT  F 1   ? 0.7642 0.5466 0.6702 0.0553  0.0364  0.0775  1   DT  F C5    
2778 C  C7    . DT  F 1   ? 0.8258 0.6224 0.7379 0.0454  0.0322  0.1032  1   DT  F C7    
2779 C  C6    . DT  F 1   ? 0.7196 0.5067 0.6262 0.0780  0.0413  0.0763  1   DT  F C6    
2780 P  P     . DA  F 2   ? 0.6824 0.5139 0.5591 0.1507  0.0681  0.0526  2   DA  F P     
2781 O  OP1   . DA  F 2   ? 0.7138 0.5416 0.5776 0.1770  0.0837  0.0536  2   DA  F OP1   
2782 O  OP2   . DA  F 2   ? 0.6096 0.4794 0.5093 0.1323  0.0592  0.0672  2   DA  F OP2   
2783 O  "O5'" . DA  F 2   ? 0.6739 0.4810 0.5274 0.1363  0.0566  0.0236  2   DA  F "O5'" 
2784 C  "C5'" . DA  F 2   ? 0.6993 0.4647 0.5251 0.1472  0.0590  0.0036  2   DA  F "C5'" 
2785 C  "C4'" . DA  F 2   ? 0.6407 0.3941 0.4516 0.1311  0.0439  -0.0215 2   DA  F "C4'" 
2786 O  "O4'" . DA  F 2   ? 0.5958 0.3498 0.4260 0.1070  0.0342  -0.0232 2   DA  F "O4'" 
2787 C  "C3'" . DA  F 2   ? 0.5982 0.3799 0.4067 0.1271  0.0372  -0.0248 2   DA  F "C3'" 
2788 O  "O3'" . DA  F 2   ? 0.6613 0.4192 0.4405 0.1295  0.0281  -0.0484 2   DA  F "O3'" 
2789 C  "C2'" . DA  F 2   ? 0.5227 0.3303 0.3592 0.1019  0.0273  -0.0207 2   DA  F "C2'" 
2790 C  "C1'" . DA  F 2   ? 0.5087 0.2906 0.3505 0.0894  0.0239  -0.0278 2   DA  F "C1'" 
2791 N  N9    . DA  F 2   ? 0.4947 0.2943 0.3607 0.0714  0.0237  -0.0140 2   DA  F N9    
2792 C  C8    . DA  F 2   ? 0.4955 0.3127 0.3739 0.0740  0.0302  0.0095  2   DA  F C8    
2793 N  N7    . DA  F 2   ? 0.4930 0.3191 0.3843 0.0550  0.0274  0.0171  2   DA  F N7    
2794 C  C5    . DA  F 2   ? 0.4721 0.2865 0.3635 0.0394  0.0216  -0.0021 2   DA  F C5    
2795 C  C6    . DA  F 2   ? 0.4570 0.2736 0.3596 0.0165  0.0198  -0.0046 2   DA  F C6    
2796 N  N6    . DA  F 2   ? 0.4143 0.2422 0.3220 0.0049  0.0231  0.0121  2   DA  F N6    
2797 N  N1    . DA  F 2   ? 0.4746 0.2822 0.3823 0.0056  0.0145  -0.0245 2   DA  F N1    
2798 C  C2    . DA  F 2   ? 0.4423 0.2372 0.3404 0.0163  0.0078  -0.0412 2   DA  F C2    
2799 N  N3    . DA  F 2   ? 0.4652 0.2532 0.3446 0.0377  0.0085  -0.0418 2   DA  F N3    
2800 C  C4    . DA  F 2   ? 0.4641 0.2633 0.3426 0.0489  0.0174  -0.0213 2   DA  F C4    
2801 P  P     . DC  F 3   ? 0.6612 0.4363 0.4248 0.1339  0.0221  -0.0530 3   DC  F P     
2802 O  OP1   . DC  F 3   ? 0.6925 0.4312 0.4150 0.1436  0.0159  -0.0746 3   DC  F OP1   
2803 O  OP2   . DC  F 3   ? 0.7057 0.5114 0.4793 0.1447  0.0355  -0.0305 3   DC  F OP2   
2804 O  "O5'" . DC  F 3   ? 0.5685 0.3665 0.3589 0.1090  0.0055  -0.0585 3   DC  F "O5'" 
2805 C  "C5'" . DC  F 3   ? 0.5580 0.3383 0.3536 0.0932  -0.0079 -0.0765 3   DC  F "C5'" 
2806 C  "C4'" . DC  F 3   ? 0.4988 0.3074 0.3296 0.0711  -0.0157 -0.0754 3   DC  F "C4'" 
2807 O  "O4'" . DC  F 3   ? 0.4764 0.2973 0.3289 0.0628  -0.0051 -0.0591 3   DC  F "O4'" 
2808 C  "C3'" . DC  F 3   ? 0.4538 0.2933 0.2929 0.0708  -0.0198 -0.0708 3   DC  F "C3'" 
2809 O  "O3'" . DC  F 3   ? 0.4499 0.2885 0.2905 0.0643  -0.0371 -0.0878 3   DC  F "O3'" 
2810 C  "C2'" . DC  F 3   ? 0.4119 0.2774 0.2823 0.0557  -0.0136 -0.0581 3   DC  F "C2'" 
2811 C  "C1'" . DC  F 3   ? 0.3964 0.2447 0.2736 0.0465  -0.0090 -0.0577 3   DC  F "C1'" 
2812 N  N1    . DC  F 3   ? 0.3755 0.2381 0.2669 0.0390  0.0011  -0.0394 3   DC  F N1    
2813 C  C2    . DC  F 3   ? 0.3752 0.2422 0.2850 0.0188  0.0018  -0.0401 3   DC  F C2    
2814 O  O2    . DC  F 3   ? 0.4218 0.2853 0.3429 0.0075  -0.0046 -0.0552 3   DC  F O2    
2815 N  N3    . DC  F 3   ? 0.3765 0.2528 0.2912 0.0120  0.0092  -0.0234 3   DC  F N3    
2816 C  C4    . DC  F 3   ? 0.3859 0.2693 0.2942 0.0237  0.0136  -0.0063 3   DC  F C4    
2817 N  N4    . DC  F 3   ? 0.3924 0.2851 0.3052 0.0152  0.0169  0.0103  3   DC  F N4    
2818 C  C5    . DC  F 3   ? 0.3629 0.2447 0.2596 0.0446  0.0148  -0.0044 3   DC  F C5    
2819 C  C6    . DC  F 3   ? 0.3971 0.2666 0.2824 0.0519  0.0096  -0.0215 3   DC  F C6    
2820 P  P     . DA  F 4   ? 0.4326 0.2959 0.2792 0.0663  -0.0451 -0.0858 4   DA  F P     
2821 O  OP1   . DA  F 4   ? 0.5172 0.3671 0.3481 0.0686  -0.0647 -0.1029 4   DA  F OP1   
2822 O  OP2   . DA  F 4   ? 0.4880 0.3647 0.3256 0.0786  -0.0320 -0.0675 4   DA  F OP2   
2823 O  "O5'" . DA  F 4   ? 0.3885 0.2771 0.2778 0.0466  -0.0453 -0.0849 4   DA  F "O5'" 
2824 C  "C5'" . DA  F 4   ? 0.4302 0.3161 0.3424 0.0308  -0.0534 -0.0980 4   DA  F "C5'" 
2825 C  "C4'" . DA  F 4   ? 0.3558 0.2675 0.3042 0.0162  -0.0473 -0.0941 4   DA  F "C4'" 
2826 O  "O4'" . DA  F 4   ? 0.3364 0.2483 0.2856 0.0099  -0.0311 -0.0819 4   DA  F "O4'" 
2827 C  "C3'" . DA  F 4   ? 0.3387 0.2724 0.2944 0.0217  -0.0481 -0.0883 4   DA  F "C3'" 
2828 O  "O3'" . DA  F 4   ? 0.3228 0.2739 0.3143 0.0101  -0.0518 -0.0959 4   DA  F "O3'" 
2829 C  "C2'" . DA  F 4   ? 0.3054 0.2460 0.2559 0.0214  -0.0319 -0.0719 4   DA  F "C2'" 
2830 C  "C1'" . DA  F 4   ? 0.3107 0.2439 0.2698 0.0075  -0.0236 -0.0722 4   DA  F "C1'" 
2831 N  N9    . DA  F 4   ? 0.3020 0.2336 0.2493 0.0076  -0.0117 -0.0565 4   DA  F N9    
2832 C  C8    . DA  F 4   ? 0.3084 0.2348 0.2355 0.0215  -0.0084 -0.0444 4   DA  F C8    
2833 N  N7    . DA  F 4   ? 0.3025 0.2322 0.2288 0.0175  0.0000  -0.0298 4   DA  F N7    
2834 C  C5    . DA  F 4   ? 0.2947 0.2289 0.2352 -0.0007 0.0030  -0.0334 4   DA  F C5    
2835 C  C6    . DA  F 4   ? 0.2921 0.2289 0.2329 -0.0134 0.0101  -0.0230 4   DA  F C6    
2836 N  N6    . DA  F 4   ? 0.3087 0.2468 0.2397 -0.0096 0.0123  -0.0055 4   DA  F N6    
2837 N  N1    . DA  F 4   ? 0.2906 0.2297 0.2422 -0.0299 0.0147  -0.0304 4   DA  F N1    
2838 C  C2    . DA  F 4   ? 0.2883 0.2302 0.2573 -0.0330 0.0121  -0.0465 4   DA  F C2    
2839 N  N3    . DA  F 4   ? 0.2887 0.2307 0.2632 -0.0226 0.0022  -0.0568 4   DA  F N3    
2840 C  C4    . DA  F 4   ? 0.2934 0.2297 0.2490 -0.0066 -0.0021 -0.0497 4   DA  F C4    
2841 P  P     . DC  F 5   ? 0.3953 0.3655 0.4018 0.0163  -0.0582 -0.0949 5   DC  F P     
2842 O  OP1   . DC  F 5   ? 0.4387 0.4253 0.4878 0.0045  -0.0600 -0.1043 5   DC  F OP1   
2843 O  OP2   . DC  F 5   ? 0.5774 0.5371 0.5563 0.0318  -0.0736 -0.0960 5   DC  F OP2   
2844 O  "O5'" . DC  F 5   ? 0.4331 0.4091 0.4289 0.0193  -0.0434 -0.0800 5   DC  F "O5'" 
2845 C  "C5'" . DC  F 5   ? 0.4647 0.4546 0.4837 0.0098  -0.0330 -0.0787 5   DC  F "C5'" 
2846 C  "C4'" . DC  F 5   ? 0.3822 0.3704 0.4082 -0.0059 -0.0194 -0.0796 5   DC  F "C4'" 
2847 O  "O4'" . DC  F 5   ? 0.3220 0.2982 0.3206 -0.0048 -0.0138 -0.0686 5   DC  F "O4'" 
2848 C  "C3'" . DC  F 5   ? 0.2671 0.2649 0.3065 -0.0153 -0.0063 -0.0786 5   DC  F "C3'" 
2849 O  "O3'" . DC  F 5   ? 0.2740 0.2760 0.3360 -0.0289 0.0032  -0.0872 5   DC  F "O3'" 
2850 C  "C2'" . DC  F 5   ? 0.2709 0.2620 0.2835 -0.0177 0.0014  -0.0652 5   DC  F "C2'" 
2851 C  "C1'" . DC  F 5   ? 0.2863 0.2656 0.2837 -0.0161 -0.0011 -0.0616 5   DC  F "C1'" 
2852 N  N1    . DC  F 5   ? 0.2746 0.2494 0.2491 -0.0111 0.0009  -0.0464 5   DC  F N1    
2853 C  C2    . DC  F 5   ? 0.2645 0.2378 0.2312 -0.0223 0.0091  -0.0375 5   DC  F C2    
2854 O  O2    . DC  F 5   ? 0.3002 0.2733 0.2740 -0.0359 0.0163  -0.0435 5   DC  F O2    
2855 N  N3    . DC  F 5   ? 0.2692 0.2421 0.2212 -0.0177 0.0089  -0.0217 5   DC  F N3    
2856 C  C4    . DC  F 5   ? 0.2588 0.2327 0.2047 -0.0021 0.0047  -0.0149 5   DC  F C4    
2857 N  N4    . DC  F 5   ? 0.2936 0.2708 0.2321 0.0022  0.0062  0.0022  5   DC  F N4    
2858 C  C5    . DC  F 5   ? 0.3000 0.2722 0.2473 0.0099  -0.0014 -0.0245 5   DC  F C5    
2859 C  C6    . DC  F 5   ? 0.2678 0.2404 0.2291 0.0044  -0.0050 -0.0400 5   DC  F C6    
2860 P  P     . DT  F 6   ? 0.3032 0.3163 0.3885 -0.0352 0.0162  -0.0933 6   DT  F P     
2861 O  OP1   . DT  F 6   ? 0.3746 0.3926 0.4842 -0.0478 0.0265  -0.1010 6   DT  F OP1   
2862 O  OP2   . DT  F 6   ? 0.2979 0.3199 0.3999 -0.0227 0.0065  -0.0960 6   DT  F OP2   
2863 O  "O5'" . DT  F 6   ? 0.3005 0.3052 0.3569 -0.0408 0.0274  -0.0846 6   DT  F "O5'" 
2864 C  "C5'" . DT  F 6   ? 0.2911 0.2875 0.3299 -0.0544 0.0394  -0.0808 6   DT  F "C5'" 
2865 C  "C4'" . DT  F 6   ? 0.2560 0.2448 0.2646 -0.0576 0.0412  -0.0707 6   DT  F "C4'" 
2866 O  "O4'" . DT  F 6   ? 0.2759 0.2632 0.2695 -0.0478 0.0284  -0.0584 6   DT  F "O4'" 
2867 C  "C3'" . DT  F 6   ? 0.2570 0.2463 0.2677 -0.0569 0.0451  -0.0752 6   DT  F "C3'" 
2868 O  "O3'" . DT  F 6   ? 0.3053 0.2874 0.3058 -0.0706 0.0614  -0.0811 6   DT  F "O3'" 
2869 C  "C2'" . DT  F 6   ? 0.2679 0.2540 0.2574 -0.0527 0.0345  -0.0616 6   DT  F "C2'" 
2870 C  "C1'" . DT  F 6   ? 0.2574 0.2424 0.2340 -0.0516 0.0288  -0.0504 6   DT  F "C1'" 
2871 N  N1    . DT  F 6   ? 0.2502 0.2382 0.2195 -0.0401 0.0179  -0.0370 6   DT  F N1    
2872 C  C2    . DT  F 6   ? 0.2486 0.2357 0.2009 -0.0443 0.0156  -0.0221 6   DT  F C2    
2873 O  O2    . DT  F 6   ? 0.2931 0.2754 0.2316 -0.0578 0.0193  -0.0192 6   DT  F O2    
2874 N  N3    . DT  F 6   ? 0.2423 0.2347 0.1938 -0.0318 0.0089  -0.0096 6   DT  F N3    
2875 C  C4    . DT  F 6   ? 0.2363 0.2315 0.1949 -0.0163 0.0050  -0.0112 6   DT  F C4    
2876 O  O4    . DT  F 6   ? 0.2357 0.2346 0.1900 -0.0051 0.0024  0.0009  6   DT  F O4    
2877 C  C5    . DT  F 6   ? 0.2347 0.2286 0.2060 -0.0135 0.0043  -0.0272 6   DT  F C5    
2878 C  C7    . DT  F 6   ? 0.2346 0.2296 0.2090 0.0024  -0.0031 -0.0291 6   DT  F C7    
2879 C  C6    . DT  F 6   ? 0.2368 0.2290 0.2167 -0.0253 0.0106  -0.0389 6   DT  F C6    
2880 P  P     . DC  F 7   ? 0.3232 0.2990 0.3237 -0.0727 0.0717  -0.0910 7   DC  F P     
2881 O  OP1   . DC  F 7   ? 0.3614 0.3317 0.3577 -0.0846 0.0928  -0.1004 7   DC  F OP1   
2882 O  OP2   . DC  F 7   ? 0.3702 0.3552 0.4020 -0.0578 0.0644  -0.0956 7   DC  F OP2   
2883 O  "O5'" . DC  F 7   ? 0.3193 0.2833 0.2857 -0.0787 0.0641  -0.0812 7   DC  F "O5'" 
2884 C  "C5'" . DC  F 7   ? 0.3815 0.3370 0.3156 -0.0917 0.0647  -0.0732 7   DC  F "C5'" 
2885 C  "C4'" . DC  F 7   ? 0.3334 0.2840 0.2470 -0.0951 0.0515  -0.0621 7   DC  F "C4'" 
2886 O  "O4'" . DC  F 7   ? 0.3078 0.2711 0.2335 -0.0836 0.0370  -0.0479 7   DC  F "O4'" 
2887 C  "C3'" . DC  F 7   ? 0.3295 0.2715 0.2456 -0.0944 0.0516  -0.0699 7   DC  F "C3'" 
2888 O  "O3'" . DC  F 7   ? 0.4483 0.3723 0.3304 -0.1105 0.0548  -0.0734 7   DC  F "O3'" 
2889 C  "C2'" . DC  F 7   ? 0.3777 0.3296 0.3053 -0.0849 0.0350  -0.0555 7   DC  F "C2'" 
2890 C  "C1'" . DC  F 7   ? 0.2993 0.2619 0.2209 -0.0840 0.0275  -0.0403 7   DC  F "C1'" 
2891 N  N1    . DC  F 7   ? 0.2821 0.2578 0.2200 -0.0693 0.0177  -0.0282 7   DC  F N1    
2892 C  C2    . DC  F 7   ? 0.3131 0.2959 0.2441 -0.0700 0.0081  -0.0098 7   DC  F C2    
2893 O  O2    . DC  F 7   ? 0.3380 0.3170 0.2512 -0.0834 0.0049  -0.0037 7   DC  F O2    
2894 N  N3    . DC  F 7   ? 0.2532 0.2471 0.1971 -0.0553 0.0030  0.0015  7   DC  F N3    
2895 C  C4    . DC  F 7   ? 0.2442 0.2399 0.2013 -0.0414 0.0046  -0.0053 7   DC  F C4    
2896 N  N4    . DC  F 7   ? 0.2361 0.2397 0.1981 -0.0272 0.0008  0.0062  7   DC  F N4    
2897 C  C5    . DC  F 7   ? 0.2444 0.2341 0.2105 -0.0410 0.0103  -0.0233 7   DC  F C5    
2898 C  C6    . DC  F 7   ? 0.2573 0.2383 0.2162 -0.0548 0.0182  -0.0343 7   DC  F C6    
2899 P  P     . DC  F 8   ? 0.4551 0.3603 0.3275 -0.1157 0.0546  -0.0827 8   DC  F P     
2900 O  OP1   . DC  F 8   ? 0.5307 0.4154 0.3738 -0.1275 0.0717  -0.0983 8   DC  F OP1   
2901 O  OP2   . DC  F 8   ? 0.4829 0.3931 0.3883 -0.1010 0.0519  -0.0845 8   DC  F OP2   
2902 O  "O5'" . DC  F 8   ? 0.5124 0.4167 0.3644 -0.1268 0.0347  -0.0662 8   DC  F "O5'" 
2903 C  "C5'" . DC  F 8   ? 0.5016 0.4090 0.3288 -0.1375 0.0277  -0.0545 8   DC  F "C5'" 
2904 C  "C4'" . DC  F 8   ? 0.4988 0.4157 0.3269 -0.1422 0.0064  -0.0350 8   DC  F "C4'" 
2905 O  "O4'" . DC  F 8   ? 0.4664 0.4060 0.3297 -0.1249 0.0017  -0.0221 8   DC  F "O4'" 
2906 C  "C3'" . DC  F 8   ? 0.5548 0.4570 0.3766 -0.1522 -0.0020 -0.0391 8   DC  F "C3'" 
2907 O  "O3'" . DC  F 8   ? 0.5646 0.4614 0.3586 -0.1711 -0.0187 -0.0295 8   DC  F "O3'" 
2908 C  "C2'" . DC  F 8   ? 0.4856 0.4050 0.3462 -0.1378 -0.0082 -0.0277 8   DC  F "C2'" 
2909 C  "C1'" . DC  F 8   ? 0.4501 0.3945 0.3266 -0.1254 -0.0102 -0.0119 8   DC  F "C1'" 
2910 N  N1    . DC  F 8   ? 0.3808 0.3401 0.2889 -0.1053 -0.0076 -0.0067 8   DC  F N1    
2911 C  C2    . DC  F 8   ? 0.3296 0.3087 0.2541 -0.0975 -0.0163 0.0141  8   DC  F C2    
2912 O  O2    . DC  F 8   ? 0.4145 0.4014 0.3342 -0.1074 -0.0269 0.0288  8   DC  F O2    
2913 N  N3    . DC  F 8   ? 0.3350 0.3243 0.2798 -0.0790 -0.0127 0.0181  8   DC  F N3    
2914 C  C4    . DC  F 8   ? 0.3144 0.2964 0.2656 -0.0692 -0.0046 0.0032  8   DC  F C4    
2915 N  N4    . DC  F 8   ? 0.3135 0.3040 0.2794 -0.0517 -0.0041 0.0082  8   DC  F N4    
2916 C  C5    . DC  F 8   ? 0.3227 0.2886 0.2653 -0.0764 0.0035  -0.0169 8   DC  F C5    
2917 C  C6    . DC  F 8   ? 0.3526 0.3069 0.2726 -0.0939 0.0036  -0.0216 8   DC  F C6    
2918 P  P     . DC  F 9   ? 0.6895 0.5634 0.4647 -0.1892 -0.0302 -0.0364 9   DC  F P     
2919 O  OP1   . DC  F 9   ? 0.7666 0.6300 0.4998 -0.2098 -0.0438 -0.0327 9   DC  F OP1   
2920 O  OP2   . DC  F 9   ? 0.7497 0.5995 0.5250 -0.1850 -0.0142 -0.0590 9   DC  F OP2   
2921 O  "O5'" . DC  F 9   ? 0.5597 0.4562 0.3742 -0.1850 -0.0463 -0.0156 9   DC  F "O5'" 
2922 C  "C5'" . DC  F 9   ? 0.5534 0.4780 0.3826 -0.1845 -0.0607 0.0091  9   DC  F "C5'" 
2923 C  "C4'" . DC  F 9   ? 0.4973 0.4435 0.3687 -0.1761 -0.0673 0.0266  9   DC  F "C4'" 
2924 O  "O4'" . DC  F 9   ? 0.4517 0.4076 0.3471 -0.1527 -0.0513 0.0248  9   DC  F "O4'" 
2925 C  "C3'" . DC  F 9   ? 0.5476 0.4774 0.4240 -0.1886 -0.0748 0.0223  9   DC  F "C3'" 
2926 O  "O3'" . DC  F 9   ? 0.5736 0.5197 0.4643 -0.2030 -0.0961 0.0431  9   DC  F "O3'" 
2927 C  "C2'" . DC  F 9   ? 0.5203 0.4554 0.4284 -0.1686 -0.0616 0.0228  9   DC  F "C2'" 
2928 C  "C1'" . DC  F 9   ? 0.4102 0.3716 0.3331 -0.1481 -0.0536 0.0334  9   DC  F "C1'" 
2929 N  N1    . DC  F 9   ? 0.4104 0.3719 0.3480 -0.1266 -0.0384 0.0261  9   DC  F N1    
2930 C  C2    . DC  F 9   ? 0.3780 0.3620 0.3409 -0.1089 -0.0360 0.0429  9   DC  F C2    
2931 O  O2    . DC  F 9   ? 0.3715 0.3761 0.3482 -0.1105 -0.0437 0.0637  9   DC  F O2    
2932 N  N3    . DC  F 9   ? 0.3142 0.2968 0.2854 -0.0902 -0.0255 0.0361  9   DC  F N3    
2933 C  C4    . DC  F 9   ? 0.3161 0.2799 0.2792 -0.0884 -0.0177 0.0151  9   DC  F C4    
2934 N  N4    . DC  F 9   ? 0.3003 0.2655 0.2751 -0.0701 -0.0109 0.0105  9   DC  F N4    
2935 C  C5    . DC  F 9   ? 0.3337 0.2761 0.2756 -0.1047 -0.0165 -0.0020 9   DC  F C5    
2936 C  C6    . DC  F 9   ? 0.3836 0.3237 0.3093 -0.1236 -0.0268 0.0034  9   DC  F C6    
2937 P  P     . DA  F 10  ? 0.6499 0.5820 0.5503 -0.2217 -0.1098 0.0442  10  DA  F P     
2938 O  OP1   . DA  F 10  ? 0.7855 0.7282 0.6812 -0.2439 -0.1354 0.0585  10  DA  F OP1   
2939 O  OP2   . DA  F 10  ? 0.7131 0.6041 0.5875 -0.2258 -0.0994 0.0166  10  DA  F OP2   
2940 O  "O5'" . DA  F 10  ? 0.5324 0.4897 0.4823 -0.2054 -0.1035 0.0639  10  DA  F "O5'" 
2941 C  "C5'" . DA  F 10  ? 0.5188 0.5152 0.4991 -0.1936 -0.1049 0.0893  10  DA  F "C5'" 
2942 C  "C4'" . DA  F 10  ? 0.4539 0.4647 0.4685 -0.1747 -0.0918 0.1017  10  DA  F "C4'" 
2943 O  "O4'" . DA  F 10  ? 0.4650 0.4650 0.4672 -0.1535 -0.0731 0.0862  10  DA  F "O4'" 
2944 C  "C3'" . DA  F 10  ? 0.4901 0.4851 0.5194 -0.1856 -0.0949 0.1027  10  DA  F "C3'" 
2945 O  "O3'" . DA  F 10  ? 0.5274 0.5485 0.5927 -0.1962 -0.1067 0.1292  10  DA  F "O3'" 
2946 C  "C2'" . DA  F 10  ? 0.4838 0.4737 0.5214 -0.1618 -0.0754 0.0998  10  DA  F "C2'" 
2947 C  "C1'" . DA  F 10  ? 0.4760 0.4746 0.4984 -0.1415 -0.0639 0.0916  10  DA  F "C1'" 
2948 N  N9    . DA  F 10  ? 0.4377 0.4128 0.4436 -0.1294 -0.0515 0.0694  10  DA  F N9    
2949 C  C8    . DA  F 10  ? 0.4087 0.3550 0.3892 -0.1380 -0.0499 0.0447  10  DA  F C8    
2950 N  N7    . DA  F 10  ? 0.4306 0.3648 0.4088 -0.1223 -0.0372 0.0302  10  DA  F N7    
2951 C  C5    . DA  F 10  ? 0.3902 0.3446 0.3892 -0.1032 -0.0326 0.0462  10  DA  F C5    
2952 C  C6    . DA  F 10  ? 0.3136 0.2678 0.3190 -0.0818 -0.0233 0.0428  10  DA  F C6    
2953 N  N6    . DA  F 10  ? 0.3193 0.2556 0.3189 -0.0756 -0.0166 0.0222  10  DA  F N6    
2954 N  N1    . DA  F 10  ? 0.3080 0.2815 0.3261 -0.0668 -0.0211 0.0614  10  DA  F N1    
2955 C  C2    . DA  F 10  ? 0.3485 0.3420 0.3774 -0.0718 -0.0249 0.0825  10  DA  F C2    
2956 N  N3    . DA  F 10  ? 0.3996 0.3996 0.4317 -0.0910 -0.0342 0.0893  10  DA  F N3    
2957 C  C4    . DA  F 10  ? 0.3606 0.3392 0.3746 -0.1067 -0.0392 0.0698  10  DA  F C4    
2958 P  P     . DC  F 11  ? 0.5829 0.5906 0.6698 -0.2144 -0.1146 0.1358  11  DC  F P     
2959 O  OP1   . DC  F 11  ? 0.6473 0.6870 0.7648 -0.2231 -0.1291 0.1589  11  DC  F OP1   
2960 O  OP2   . DC  F 11  ? 0.6427 0.6036 0.6953 -0.2288 -0.1185 0.1078  11  DC  F OP2   
2961 O  "O5'" . DC  F 11  ? 0.5260 0.5378 0.6339 -0.1913 -0.0937 0.1458  11  DC  F "O5'" 
2962 C  "C5'" . DC  F 11  ? 0.4386 0.4871 0.5732 -0.1717 -0.0823 0.1695  11  DC  F "C5'" 
2963 C  "C4'" . DC  F 11  ? 0.4264 0.4662 0.5637 -0.1509 -0.0636 0.1720  11  DC  F "C4'" 
2964 O  "O4'" . DC  F 11  ? 0.4584 0.4733 0.5617 -0.1367 -0.0558 0.1458  11  DC  F "O4'" 
2965 C  "C3'" . DC  F 11  ? 0.4912 0.5101 0.6436 -0.1640 -0.0657 0.1776  11  DC  F "C3'" 
2966 O  "O3'" . DC  F 11  ? 0.4963 0.5368 0.6777 -0.1527 -0.0534 0.2049  11  DC  F "O3'" 
2967 C  "C2'" . DC  F 11  ? 0.5294 0.5085 0.6520 -0.1552 -0.0594 0.1515  11  DC  F "C2'" 
2968 C  "C1'" . DC  F 11  ? 0.4356 0.4262 0.5384 -0.1307 -0.0486 0.1418  11  DC  F "C1'" 
2969 N  N1    . DC  F 11  ? 0.4230 0.3844 0.4969 -0.1242 -0.0454 0.1125  11  DC  F N1    
2970 C  C2    . DC  F 11  ? 0.3891 0.3461 0.4567 -0.0999 -0.0334 0.1077  11  DC  F C2    
2971 O  O2    . DC  F 11  ? 0.4363 0.4096 0.5151 -0.0848 -0.0261 0.1268  11  DC  F O2    
2972 N  N3    . DC  F 11  ? 0.3562 0.2917 0.4057 -0.0938 -0.0302 0.0827  11  DC  F N3    
2973 C  C4    . DC  F 11  ? 0.3656 0.2822 0.3992 -0.1098 -0.0350 0.0624  11  DC  F C4    
2974 N  N4    . DC  F 11  ? 0.4027 0.3003 0.4228 -0.1021 -0.0282 0.0391  11  DC  F N4    
2975 C  C5    . DC  F 11  ? 0.4354 0.3518 0.4665 -0.1349 -0.0473 0.0655  11  DC  F C5    
2976 C  C6    . DC  F 11  ? 0.4163 0.3566 0.4698 -0.1416 -0.0538 0.0910  11  DC  F C6    
2977 P  P     . DG  F 12  ? 0.6193 0.6478 0.8233 -0.1634 -0.0540 0.2167  12  DG  F P     
2978 O  OP1   . DG  F 12  ? 0.7877 0.8548 1.0228 -0.1526 -0.0448 0.2423  12  DG  F OP1   
2979 O  OP2   . DG  F 12  ? 0.6264 0.6290 0.8238 -0.1897 -0.0731 0.1995  12  DG  F OP2   
2980 O  "O5'" . DG  F 12  ? 0.5654 0.5619 0.7525 -0.1485 -0.0409 0.2121  12  DG  F "O5'" 
2981 C  "C5'" . DG  F 12  ? 0.5082 0.5183 0.6865 -0.1191 -0.0233 0.2210  12  DG  F "C5'" 
2982 C  "C4'" . DG  F 12  ? 0.5177 0.4940 0.6752 -0.1048 -0.0174 0.2095  12  DG  F "C4'" 
2983 O  "O4'" . DG  F 12  ? 0.5384 0.4951 0.6691 -0.1017 -0.0233 0.1777  12  DG  F "O4'" 
2984 C  "C3'" . DG  F 12  ? 0.5796 0.5256 0.7511 -0.1203 -0.0213 0.2154  12  DG  F "C3'" 
2985 O  "O3'" . DG  F 12  ? 0.6412 0.5854 0.8173 -0.1049 -0.0082 0.2375  12  DG  F "O3'" 
2986 C  "C2'" . DG  F 12  ? 0.5740 0.4807 0.7225 -0.1217 -0.0281 0.1836  12  DG  F "C2'" 
2987 C  "C1'" . DG  F 12  ? 0.5274 0.4468 0.6513 -0.1015 -0.0241 0.1657  12  DG  F "C1'" 
2988 N  N9    . DG  F 12  ? 0.4879 0.3864 0.5930 -0.1088 -0.0308 0.1345  12  DG  F N9    
2989 C  C8    . DG  F 12  ? 0.4788 0.3688 0.5800 -0.1332 -0.0421 0.1219  12  DG  F C8    
2990 N  N7    . DG  F 12  ? 0.4997 0.3686 0.5779 -0.1333 -0.0425 0.0936  12  DG  F N7    
2991 C  C5    . DG  F 12  ? 0.4661 0.3325 0.5393 -0.1077 -0.0320 0.0878  12  DG  F C5    
2992 C  C6    . DG  F 12  ? 0.4169 0.2675 0.4748 -0.0962 -0.0265 0.0623  12  DG  F C6    
2993 O  O6    . DG  F 12  ? 0.4301 0.2635 0.4720 -0.1059 -0.0269 0.0390  12  DG  F O6    
2994 N  N1    . DG  F 12  ? 0.4036 0.2602 0.4661 -0.0711 -0.0198 0.0666  12  DG  F N1    
2995 C  C2    . DG  F 12  ? 0.3956 0.2679 0.4678 -0.0583 -0.0179 0.0916  12  DG  F C2    
2996 N  N2    . DG  F 12  ? 0.3899 0.2634 0.4600 -0.0353 -0.0144 0.0917  12  DG  F N2    
2997 N  N3    . DG  F 12  ? 0.4199 0.3054 0.5034 -0.0679 -0.0192 0.1155  12  DG  F N3    
2998 C  C4    . DG  F 12  ? 0.4453 0.3285 0.5324 -0.0927 -0.0265 0.1124  12  DG  F C4    
2999 P  P     . DC  F 13  ? 0.7268 0.6468 0.9186 -0.1157 -0.0083 0.2476  13  DC  F P     
3000 O  OP1   . DC  F 13  ? 0.7774 0.7226 0.9771 -0.1016 0.0064  0.2715  13  DC  F OP1   
3001 O  OP2   . DC  F 13  ? 0.6865 0.5964 0.8925 -0.1445 -0.0232 0.2361  13  DC  F OP2   
3002 O  "O5'" . DC  F 13  ? 0.7430 0.6188 0.9162 -0.1038 -0.0083 0.2366  13  DC  F "O5'" 
3003 C  "C5'" . DC  F 13  ? 0.6400 0.5199 0.7898 -0.0741 0.0000  0.2355  13  DC  F "C5'" 
3004 C  "C4'" . DC  F 13  ? 0.6126 0.4573 0.7475 -0.0644 -0.0052 0.2115  13  DC  F "C4'" 
3005 O  "O4'" . DC  F 13  ? 0.6190 0.4633 0.7445 -0.0712 -0.0125 0.1802  13  DC  F "O4'" 
3006 C  "C3'" . DC  F 13  ? 0.6650 0.4681 0.8138 -0.0770 -0.0087 0.2139  13  DC  F "C3'" 
3007 O  "O3'" . DC  F 13  ? 0.7570 0.5411 0.8998 -0.0561 -0.0041 0.2260  13  DC  F "O3'" 
3008 C  "C2'" . DC  F 13  ? 0.6268 0.4047 0.7690 -0.0870 -0.0170 0.1789  13  DC  F "C2'" 
3009 C  "C1'" . DC  F 13  ? 0.6182 0.4236 0.7419 -0.0736 -0.0164 0.1603  13  DC  F "C1'" 
3010 N  N1    . DC  F 13  ? 0.5731 0.3711 0.6883 -0.0895 -0.0226 0.1312  13  DC  F N1    
3011 C  C2    . DC  F 13  ? 0.4817 0.2709 0.5826 -0.0765 -0.0206 0.1047  13  DC  F C2    
3012 O  O2    . DC  F 13  ? 0.4776 0.2691 0.5773 -0.0528 -0.0165 0.1064  13  DC  F O2    
3013 N  N3    . DC  F 13  ? 0.4861 0.2648 0.5748 -0.0904 -0.0233 0.0787  13  DC  F N3    
3014 C  C4    . DC  F 13  ? 0.5286 0.3046 0.6160 -0.1168 -0.0312 0.0784  13  DC  F C4    
3015 N  N4    . DC  F 13  ? 0.5190 0.2819 0.5869 -0.1299 -0.0341 0.0528  13  DC  F N4    
3016 C  C5    . DC  F 13  ? 0.5424 0.3289 0.6490 -0.1316 -0.0366 0.1056  13  DC  F C5    
3017 C  C6    . DC  F 13  ? 0.5400 0.3377 0.6615 -0.1170 -0.0304 0.1315  13  DC  F C6    
3018 ZN ZN    . ZN  G .   ? 0.1770 0.2548 0.2300 0.0221  -0.0057 0.0145  501 ZN  A ZN    
3019 ZN ZN    . ZN  H .   ? 0.2690 0.3958 0.2792 -0.0031 0.0231  0.0680  502 ZN  A ZN    
3020 ZN ZN    . ZN  I .   ? 0.5608 0.4206 0.4341 0.0082  -0.0702 -0.0972 503 ZN  A ZN    
3021 ZN ZN    . ZN  J .   ? 0.4435 0.4292 0.2144 0.0882  0.0345  -0.0149 504 ZN  A ZN    
3030 ZN ZN    . ZN  M .   ? 0.2305 0.3708 0.2439 -0.0296 -0.0037 0.0220  501 ZN  D ZN    
3031 ZN ZN    . ZN  N .   ? 0.3261 0.3702 0.3509 0.0849  -0.0648 -0.0298 502 ZN  D ZN    
3032 ZN ZN    . ZN  O .   ? 0.7255 0.4547 0.4290 -0.1397 0.0914  -0.1314 503 ZN  D ZN    
3033 ZN ZN    . ZN  P .   ? 0.6202 0.4377 0.2229 -0.2357 0.0586  -0.0143 504 ZN  D ZN    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   HIS 1   319 319 HIS HIS A . n 
A 1 2   MET 2   320 320 MET MET A . n 
A 1 3   ARG 3   321 321 ARG ARG A . n 
A 1 4   PRO 4   322 322 PRO PRO A . n 
A 1 5   PHE 5   323 323 PHE PHE A . n 
A 1 6   MET 6   324 324 MET MET A . n 
A 1 7   CYS 7   325 325 CYS CYS A . n 
A 1 8   ALA 8   326 326 ALA ALA A . n 
A 1 9   TYR 9   327 327 TYR TYR A . n 
A 1 10  PRO 10  328 328 PRO PRO A . n 
A 1 11  GLY 11  329 329 GLY GLY A . n 
A 1 12  CYS 12  330 330 CYS CYS A . n 
A 1 13  ASN 13  331 331 ASN ASN A . n 
A 1 14  LYS 14  332 332 LYS LYS A . n 
A 1 15  ARG 15  333 333 ARG ARG A . n 
A 1 16  TYR 16  334 334 TYR TYR A . n 
A 1 17  PHE 17  335 335 PHE PHE A . n 
A 1 18  LYS 18  336 336 LYS LYS A . n 
A 1 19  LEU 19  337 337 LEU LEU A . n 
A 1 20  SER 20  338 338 SER SER A . n 
A 1 21  HIS 21  339 339 HIS HIS A . n 
A 1 22  LEU 22  340 340 LEU LEU A . n 
A 1 23  GLN 23  341 341 GLN GLN A . n 
A 1 24  MET 24  342 342 MET MET A . n 
A 1 25  HIS 25  343 343 HIS HIS A . n 
A 1 26  SER 26  344 344 SER SER A . n 
A 1 27  ARG 27  345 345 ARG ARG A . n 
A 1 28  LYS 28  346 346 LYS LYS A . n 
A 1 29  HIS 29  347 347 HIS HIS A . n 
A 1 30  THR 30  348 348 THR THR A . n 
A 1 31  GLY 31  349 349 GLY GLY A . n 
A 1 32  GLU 32  350 350 GLU GLU A . n 
A 1 33  LYS 33  351 351 LYS LYS A . n 
A 1 34  PRO 34  352 352 PRO PRO A . n 
A 1 35  TYR 35  353 353 TYR TYR A . n 
A 1 36  GLN 36  354 354 GLN GLN A . n 
A 1 37  CYS 37  355 355 CYS CYS A . n 
A 1 38  ASP 38  356 356 ASP ASP A . n 
A 1 39  PHE 39  357 357 PHE PHE A . n 
A 1 40  LYS 40  358 358 LYS LYS A . n 
A 1 41  ASP 41  359 359 ASP ASP A . n 
A 1 42  CYS 42  360 360 CYS CYS A . n 
A 1 43  GLU 43  361 361 GLU GLU A . n 
A 1 44  ARG 44  362 362 ARG ARG A . n 
A 1 45  ARG 45  363 363 ARG ARG A . n 
A 1 46  PHE 46  364 364 PHE PHE A . n 
A 1 47  SER 47  365 365 SER SER A . n 
A 1 48  ARG 48  366 366 ARG ARG A . n 
A 1 49  SER 49  367 367 SER SER A . n 
A 1 50  ASP 50  368 368 ASP ASP A . n 
A 1 51  GLN 51  369 369 GLN GLN A . n 
A 1 52  LEU 52  370 370 LEU LEU A . n 
A 1 53  LYS 53  371 371 LYS LYS A . n 
A 1 54  ARG 54  372 372 ARG ARG A . n 
A 1 55  HIS 55  373 373 HIS HIS A . n 
A 1 56  GLN 56  374 374 GLN GLN A . n 
A 1 57  ARG 57  375 375 ARG ARG A . n 
A 1 58  ARG 58  376 376 ARG ARG A . n 
A 1 59  HIS 59  377 377 HIS HIS A . n 
A 1 60  THR 60  378 378 THR THR A . n 
A 1 61  GLY 61  379 379 GLY GLY A . n 
A 1 62  VAL 62  380 380 VAL VAL A . n 
A 1 63  LYS 63  381 381 LYS LYS A . n 
A 1 64  PRO 64  382 382 PRO PRO A . n 
A 1 65  PHE 65  383 383 PHE PHE A . n 
A 1 66  GLN 66  384 384 GLN GLN A . n 
A 1 67  CYS 67  385 385 CYS CYS A . n 
A 1 68  LYS 68  386 386 LYS LYS A . n 
A 1 69  THR 69  387 387 THR THR A . n 
A 1 70  CYS 70  388 388 CYS CYS A . n 
A 1 71  GLN 71  389 389 GLN GLN A . n 
A 1 72  ARG 72  390 390 ARG ARG A . n 
A 1 73  LYS 73  391 391 LYS LYS A . n 
A 1 74  PHE 74  392 392 PHE PHE A . n 
A 1 75  SER 75  393 393 SER SER A . n 
A 1 76  ARG 76  394 394 ARG ARG A . n 
A 1 77  SER 77  395 395 SER SER A . n 
A 1 78  ASP 78  396 396 ASP ASP A . n 
A 1 79  HIS 79  397 397 HIS HIS A . n 
A 1 80  LEU 80  398 398 LEU LEU A . n 
A 1 81  LYS 81  399 399 LYS LYS A . n 
A 1 82  THR 82  400 400 THR THR A . n 
A 1 83  HIS 83  401 401 HIS HIS A . n 
A 1 84  THR 84  402 402 THR THR A . n 
A 1 85  ARG 85  403 403 ARG ARG A . n 
A 1 86  THR 86  404 404 THR THR A . n 
A 1 87  HIS 87  405 405 HIS HIS A . n 
A 1 88  THR 88  406 406 THR THR A . n 
A 1 89  GLY 89  407 407 GLY GLY A . n 
A 1 90  GLU 90  408 408 GLU GLU A . n 
A 1 91  LYS 91  409 409 LYS LYS A . n 
A 1 92  PRO 92  410 410 PRO PRO A . n 
A 1 93  PHE 93  411 411 PHE PHE A . n 
A 1 94  SER 94  412 412 SER SER A . n 
A 1 95  CYS 95  413 413 CYS CYS A . n 
A 1 96  ARG 96  414 414 ARG ARG A . n 
A 1 97  TRP 97  415 415 TRP TRP A . n 
A 1 98  PRO 98  416 416 PRO PRO A . n 
A 1 99  SER 99  417 417 SER SER A . n 
A 1 100 CYS 100 418 418 CYS CYS A . n 
A 1 101 GLN 101 419 419 GLN GLN A . n 
A 1 102 LYS 102 420 420 LYS LYS A . n 
A 1 103 LYS 103 421 421 LYS LYS A . n 
A 1 104 PHE 104 422 422 PHE PHE A . n 
A 1 105 ALA 105 423 423 ALA ALA A . n 
A 1 106 ARG 106 424 424 ARG ARG A . n 
A 1 107 SER 107 425 425 SER SER A . n 
A 1 108 ASP 108 426 426 ASP ASP A . n 
A 1 109 GLU 109 427 427 GLU GLU A . n 
A 1 110 LEU 110 428 428 LEU LEU A . n 
A 1 111 VAL 111 429 429 VAL VAL A . n 
A 1 112 ARG 112 430 430 ARG ARG A . n 
A 1 113 HIS 113 431 431 HIS HIS A . n 
A 1 114 HIS 114 432 432 HIS HIS A . n 
A 1 115 ASN 115 433 433 ASN ASN A . n 
A 1 116 MET 116 434 434 MET MET A . n 
A 1 117 HIS 117 435 435 HIS HIS A . n 
A 1 118 GLN 118 436 436 GLN GLN A . n 
A 1 119 ARG 119 437 437 ARG ARG A . n 
B 2 1   DA  1   1   1   DA  DA  B . n 
B 2 2   DG  2   2   2   DG  DG  B . n 
B 2 3   DC  3   3   3   DC  DC  B . n 
B 2 4   DG  4   4   4   DG  DG  B . n 
B 2 5   DT  5   5   5   DT  DT  B . n 
B 2 6   DG  6   6   6   DG  DG  B . n 
B 2 7   DG  7   7   7   DG  DG  B . n 
B 2 8   DG  8   8   8   DG  DG  B . n 
B 2 9   DA  9   9   9   DA  DA  B . n 
B 2 10  DG  10  10  10  DG  DG  B . n 
B 2 11  DT  11  11  11  DT  DT  B . n 
B 2 12  DG  12  12  12  DG  DG  B . n 
B 2 13  DT  13  13  13  DT  DT  B . n 
C 3 1   DT  1   1   1   DT  DT  C . n 
C 3 2   DA  2   2   2   DA  DA  C . n 
C 3 3   DC  3   3   3   DC  DC  C . n 
C 3 4   DA  4   4   4   DA  DA  C . n 
C 3 5   DC  5   5   5   DC  DC  C . n 
C 3 6   DT  6   6   6   DT  DT  C . n 
C 3 7   DC  7   7   7   DC  DC  C . n 
C 3 8   DC  8   8   8   DC  DC  C . n 
C 3 9   DC  9   9   9   DC  DC  C . n 
C 3 10  DA  10  10  10  DA  DA  C . n 
C 3 11  DC  11  11  11  DC  DC  C . n 
C 3 12  DG  12  12  12  DG  DG  C . n 
C 3 13  DC  13  13  13  DC  DC  C . n 
D 1 1   HIS 1   319 ?   ?   ?   D . n 
D 1 2   MET 2   320 ?   ?   ?   D . n 
D 1 3   ARG 3   321 321 ARG ARG D . n 
D 1 4   PRO 4   322 322 PRO PRO D . n 
D 1 5   PHE 5   323 323 PHE PHE D . n 
D 1 6   MET 6   324 324 MET MET D . n 
D 1 7   CYS 7   325 325 CYS CYS D . n 
D 1 8   ALA 8   326 326 ALA ALA D . n 
D 1 9   TYR 9   327 327 TYR TYR D . n 
D 1 10  PRO 10  328 328 PRO PRO D . n 
D 1 11  GLY 11  329 329 GLY GLY D . n 
D 1 12  CYS 12  330 330 CYS CYS D . n 
D 1 13  ASN 13  331 331 ASN ASN D . n 
D 1 14  LYS 14  332 332 LYS LYS D . n 
D 1 15  ARG 15  333 333 ARG ARG D . n 
D 1 16  TYR 16  334 334 TYR TYR D . n 
D 1 17  PHE 17  335 335 PHE PHE D . n 
D 1 18  LYS 18  336 336 LYS LYS D . n 
D 1 19  LEU 19  337 337 LEU LEU D . n 
D 1 20  SER 20  338 338 SER SER D . n 
D 1 21  HIS 21  339 339 HIS HIS D . n 
D 1 22  LEU 22  340 340 LEU LEU D . n 
D 1 23  GLN 23  341 341 GLN GLN D . n 
D 1 24  MET 24  342 342 MET MET D . n 
D 1 25  HIS 25  343 343 HIS HIS D . n 
D 1 26  SER 26  344 344 SER SER D . n 
D 1 27  ARG 27  345 345 ARG ARG D . n 
D 1 28  LYS 28  346 346 LYS LYS D . n 
D 1 29  HIS 29  347 347 HIS HIS D . n 
D 1 30  THR 30  348 348 THR THR D . n 
D 1 31  GLY 31  349 349 GLY GLY D . n 
D 1 32  GLU 32  350 350 GLU GLU D . n 
D 1 33  LYS 33  351 351 LYS LYS D . n 
D 1 34  PRO 34  352 352 PRO PRO D . n 
D 1 35  TYR 35  353 353 TYR TYR D . n 
D 1 36  GLN 36  354 354 GLN GLN D . n 
D 1 37  CYS 37  355 355 CYS CYS D . n 
D 1 38  ASP 38  356 356 ASP ASP D . n 
D 1 39  PHE 39  357 357 PHE PHE D . n 
D 1 40  LYS 40  358 358 LYS LYS D . n 
D 1 41  ASP 41  359 359 ASP ASP D . n 
D 1 42  CYS 42  360 360 CYS CYS D . n 
D 1 43  GLU 43  361 361 GLU GLU D . n 
D 1 44  ARG 44  362 362 ARG ARG D . n 
D 1 45  ARG 45  363 363 ARG ARG D . n 
D 1 46  PHE 46  364 364 PHE PHE D . n 
D 1 47  SER 47  365 365 SER SER D . n 
D 1 48  ARG 48  366 366 ARG ARG D . n 
D 1 49  SER 49  367 367 SER SER D . n 
D 1 50  ASP 50  368 368 ASP ASP D . n 
D 1 51  GLN 51  369 369 GLN GLN D . n 
D 1 52  LEU 52  370 370 LEU LEU D . n 
D 1 53  LYS 53  371 371 LYS LYS D . n 
D 1 54  ARG 54  372 372 ARG ARG D . n 
D 1 55  HIS 55  373 373 HIS HIS D . n 
D 1 56  GLN 56  374 374 GLN GLN D . n 
D 1 57  ARG 57  375 375 ARG ARG D . n 
D 1 58  ARG 58  376 376 ARG ARG D . n 
D 1 59  HIS 59  377 377 HIS HIS D . n 
D 1 60  THR 60  378 378 THR THR D . n 
D 1 61  GLY 61  379 379 GLY GLY D . n 
D 1 62  VAL 62  380 380 VAL VAL D . n 
D 1 63  LYS 63  381 381 LYS LYS D . n 
D 1 64  PRO 64  382 382 PRO PRO D . n 
D 1 65  PHE 65  383 383 PHE PHE D . n 
D 1 66  GLN 66  384 384 GLN GLN D . n 
D 1 67  CYS 67  385 385 CYS CYS D . n 
D 1 68  LYS 68  386 386 LYS LYS D . n 
D 1 69  THR 69  387 387 THR THR D . n 
D 1 70  CYS 70  388 388 CYS CYS D . n 
D 1 71  GLN 71  389 389 GLN GLN D . n 
D 1 72  ARG 72  390 390 ARG ARG D . n 
D 1 73  LYS 73  391 391 LYS LYS D . n 
D 1 74  PHE 74  392 392 PHE PHE D . n 
D 1 75  SER 75  393 393 SER SER D . n 
D 1 76  ARG 76  394 394 ARG ARG D . n 
D 1 77  SER 77  395 395 SER SER D . n 
D 1 78  ASP 78  396 396 ASP ASP D . n 
D 1 79  HIS 79  397 397 HIS HIS D . n 
D 1 80  LEU 80  398 398 LEU LEU D . n 
D 1 81  LYS 81  399 399 LYS LYS D . n 
D 1 82  THR 82  400 400 THR THR D . n 
D 1 83  HIS 83  401 401 HIS HIS D . n 
D 1 84  THR 84  402 402 THR THR D . n 
D 1 85  ARG 85  403 403 ARG ARG D . n 
D 1 86  THR 86  404 404 THR THR D . n 
D 1 87  HIS 87  405 405 HIS HIS D . n 
D 1 88  THR 88  406 406 THR THR D . n 
D 1 89  GLY 89  407 407 GLY GLY D . n 
D 1 90  GLU 90  408 408 GLU GLU D . n 
D 1 91  LYS 91  409 409 LYS LYS D . n 
D 1 92  PRO 92  410 410 PRO PRO D . n 
D 1 93  PHE 93  411 411 PHE PHE D . n 
D 1 94  SER 94  412 412 SER SER D . n 
D 1 95  CYS 95  413 413 CYS CYS D . n 
D 1 96  ARG 96  414 414 ARG ARG D . n 
D 1 97  TRP 97  415 415 TRP TRP D . n 
D 1 98  PRO 98  416 416 PRO PRO D . n 
D 1 99  SER 99  417 417 SER SER D . n 
D 1 100 CYS 100 418 418 CYS CYS D . n 
D 1 101 GLN 101 419 419 GLN GLN D . n 
D 1 102 LYS 102 420 420 LYS LYS D . n 
D 1 103 LYS 103 421 421 LYS LYS D . n 
D 1 104 PHE 104 422 422 PHE PHE D . n 
D 1 105 ALA 105 423 423 ALA ALA D . n 
D 1 106 ARG 106 424 424 ARG ARG D . n 
D 1 107 SER 107 425 425 SER SER D . n 
D 1 108 ASP 108 426 426 ASP ASP D . n 
D 1 109 GLU 109 427 427 GLU GLU D . n 
D 1 110 LEU 110 428 428 LEU LEU D . n 
D 1 111 VAL 111 429 429 VAL VAL D . n 
D 1 112 ARG 112 430 430 ARG ARG D . n 
D 1 113 HIS 113 431 431 HIS HIS D . n 
D 1 114 HIS 114 432 432 HIS HIS D . n 
D 1 115 ASN 115 433 433 ASN ASN D . n 
D 1 116 MET 116 434 434 MET MET D . n 
D 1 117 HIS 117 435 435 HIS HIS D . n 
D 1 118 GLN 118 436 436 GLN GLN D . n 
D 1 119 ARG 119 437 ?   ?   ?   D . n 
E 2 1   DA  1   1   1   DA  DA  E . n 
E 2 2   DG  2   2   2   DG  DG  E . n 
E 2 3   DC  3   3   3   DC  DC  E . n 
E 2 4   DG  4   4   4   DG  DG  E . n 
E 2 5   DT  5   5   5   DT  DT  E . n 
E 2 6   DG  6   6   6   DG  DG  E . n 
E 2 7   DG  7   7   7   DG  DG  E . n 
E 2 8   DG  8   8   8   DG  DG  E . n 
E 2 9   DA  9   9   9   DA  DA  E . n 
E 2 10  DG  10  10  10  DG  DG  E . n 
E 2 11  DT  11  11  11  DT  DT  E . n 
E 2 12  DG  12  12  12  DG  DG  E . n 
E 2 13  DT  13  13  13  DT  DT  E . n 
F 3 1   DT  1   1   1   DT  DT  F . n 
F 3 2   DA  2   2   2   DA  DA  F . n 
F 3 3   DC  3   3   3   DC  DC  F . n 
F 3 4   DA  4   4   4   DA  DA  F . n 
F 3 5   DC  5   5   5   DC  DC  F . n 
F 3 6   DT  6   6   6   DT  DT  F . n 
F 3 7   DC  7   7   7   DC  DC  F . n 
F 3 8   DC  8   8   8   DC  DC  F . n 
F 3 9   DC  9   9   9   DC  DC  F . n 
F 3 10  DA  10  10  10  DA  DA  F . n 
F 3 11  DC  11  11  11  DC  DC  F . n 
F 3 12  DG  12  12  12  DG  DG  F . n 
F 3 13  DC  13  13  13  DC  DC  F . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 4 ZN  1   501 505 ZN  ZN  A . 
H 4 ZN  1   502 506 ZN  ZN  A . 
I 4 ZN  1   503 507 ZN  ZN  A . 
J 4 ZN  1   504 508 ZN  ZN  A . 
K 5 EDO 1   505 501 EDO EDO A . 
L 5 EDO 1   506 502 EDO EDO A . 
M 4 ZN  1   501 505 ZN  ZN  D . 
N 4 ZN  1   502 506 ZN  ZN  D . 
O 4 ZN  1   503 507 ZN  ZN  D . 
P 4 ZN  1   504 508 ZN  ZN  D . 
Q 6 HOH 1   601 414 HOH HOH A . 
Q 6 HOH 2   602 309 HOH HOH A . 
Q 6 HOH 3   603 146 HOH HOH A . 
Q 6 HOH 4   604 126 HOH HOH A . 
Q 6 HOH 5   605 73  HOH HOH A . 
Q 6 HOH 6   606 121 HOH HOH A . 
Q 6 HOH 7   607 69  HOH HOH A . 
Q 6 HOH 8   608 106 HOH HOH A . 
Q 6 HOH 9   609 36  HOH HOH A . 
Q 6 HOH 10  610 196 HOH HOH A . 
Q 6 HOH 11  611 56  HOH HOH A . 
Q 6 HOH 12  612 336 HOH HOH A . 
Q 6 HOH 13  613 129 HOH HOH A . 
Q 6 HOH 14  614 5   HOH HOH A . 
Q 6 HOH 15  615 159 HOH HOH A . 
Q 6 HOH 16  616 118 HOH HOH A . 
Q 6 HOH 17  617 97  HOH HOH A . 
Q 6 HOH 18  618 389 HOH HOH A . 
Q 6 HOH 19  619 52  HOH HOH A . 
Q 6 HOH 20  620 119 HOH HOH A . 
Q 6 HOH 21  621 4   HOH HOH A . 
Q 6 HOH 22  622 195 HOH HOH A . 
Q 6 HOH 23  623 403 HOH HOH A . 
Q 6 HOH 24  624 267 HOH HOH A . 
Q 6 HOH 25  625 137 HOH HOH A . 
Q 6 HOH 26  626 340 HOH HOH A . 
Q 6 HOH 27  627 367 HOH HOH A . 
Q 6 HOH 28  628 169 HOH HOH A . 
Q 6 HOH 29  629 34  HOH HOH A . 
Q 6 HOH 30  630 183 HOH HOH A . 
Q 6 HOH 31  631 181 HOH HOH A . 
Q 6 HOH 32  632 40  HOH HOH A . 
Q 6 HOH 33  633 30  HOH HOH A . 
Q 6 HOH 34  634 204 HOH HOH A . 
Q 6 HOH 35  635 61  HOH HOH A . 
Q 6 HOH 36  636 8   HOH HOH A . 
Q 6 HOH 37  637 81  HOH HOH A . 
Q 6 HOH 38  638 75  HOH HOH A . 
Q 6 HOH 39  639 383 HOH HOH A . 
Q 6 HOH 40  640 161 HOH HOH A . 
Q 6 HOH 41  641 366 HOH HOH A . 
Q 6 HOH 42  642 149 HOH HOH A . 
Q 6 HOH 43  643 51  HOH HOH A . 
Q 6 HOH 44  644 77  HOH HOH A . 
Q 6 HOH 45  645 208 HOH HOH A . 
Q 6 HOH 46  646 6   HOH HOH A . 
Q 6 HOH 47  647 192 HOH HOH A . 
Q 6 HOH 48  648 288 HOH HOH A . 
Q 6 HOH 49  649 54  HOH HOH A . 
Q 6 HOH 50  650 28  HOH HOH A . 
Q 6 HOH 51  651 307 HOH HOH A . 
Q 6 HOH 52  652 64  HOH HOH A . 
Q 6 HOH 53  653 342 HOH HOH A . 
Q 6 HOH 54  654 156 HOH HOH A . 
Q 6 HOH 55  655 70  HOH HOH A . 
Q 6 HOH 56  656 230 HOH HOH A . 
Q 6 HOH 57  657 237 HOH HOH A . 
Q 6 HOH 58  658 139 HOH HOH A . 
Q 6 HOH 59  659 93  HOH HOH A . 
Q 6 HOH 60  660 160 HOH HOH A . 
Q 6 HOH 61  661 175 HOH HOH A . 
Q 6 HOH 62  662 173 HOH HOH A . 
Q 6 HOH 63  663 308 HOH HOH A . 
Q 6 HOH 64  664 378 HOH HOH A . 
Q 6 HOH 65  665 187 HOH HOH A . 
Q 6 HOH 66  666 228 HOH HOH A . 
Q 6 HOH 67  667 190 HOH HOH A . 
Q 6 HOH 68  668 390 HOH HOH A . 
Q 6 HOH 69  669 294 HOH HOH A . 
Q 6 HOH 70  670 418 HOH HOH A . 
Q 6 HOH 71  671 277 HOH HOH A . 
Q 6 HOH 72  672 402 HOH HOH A . 
Q 6 HOH 73  673 21  HOH HOH A . 
Q 6 HOH 74  674 167 HOH HOH A . 
Q 6 HOH 75  675 408 HOH HOH A . 
Q 6 HOH 76  676 232 HOH HOH A . 
Q 6 HOH 77  677 392 HOH HOH A . 
Q 6 HOH 78  678 396 HOH HOH A . 
Q 6 HOH 79  679 78  HOH HOH A . 
Q 6 HOH 80  680 298 HOH HOH A . 
Q 6 HOH 81  681 38  HOH HOH A . 
Q 6 HOH 82  682 172 HOH HOH A . 
Q 6 HOH 83  683 24  HOH HOH A . 
Q 6 HOH 84  684 133 HOH HOH A . 
Q 6 HOH 85  685 407 HOH HOH A . 
Q 6 HOH 86  686 268 HOH HOH A . 
Q 6 HOH 87  687 401 HOH HOH A . 
Q 6 HOH 88  688 257 HOH HOH A . 
Q 6 HOH 89  689 269 HOH HOH A . 
Q 6 HOH 90  690 394 HOH HOH A . 
Q 6 HOH 91  691 328 HOH HOH A . 
Q 6 HOH 92  692 363 HOH HOH A . 
Q 6 HOH 93  693 147 HOH HOH A . 
Q 6 HOH 94  694 252 HOH HOH A . 
Q 6 HOH 95  695 259 HOH HOH A . 
Q 6 HOH 96  696 387 HOH HOH A . 
Q 6 HOH 97  697 197 HOH HOH A . 
Q 6 HOH 98  698 163 HOH HOH A . 
Q 6 HOH 99  699 334 HOH HOH A . 
Q 6 HOH 100 700 338 HOH HOH A . 
Q 6 HOH 101 701 256 HOH HOH A . 
Q 6 HOH 102 702 345 HOH HOH A . 
Q 6 HOH 103 703 385 HOH HOH A . 
Q 6 HOH 104 704 358 HOH HOH A . 
Q 6 HOH 105 705 271 HOH HOH A . 
Q 6 HOH 106 706 296 HOH HOH A . 
Q 6 HOH 107 707 318 HOH HOH A . 
Q 6 HOH 108 708 92  HOH HOH A . 
Q 6 HOH 109 709 295 HOH HOH A . 
Q 6 HOH 110 710 184 HOH HOH A . 
Q 6 HOH 111 711 164 HOH HOH A . 
Q 6 HOH 112 712 266 HOH HOH A . 
Q 6 HOH 113 713 215 HOH HOH A . 
Q 6 HOH 114 714 312 HOH HOH A . 
Q 6 HOH 115 715 419 HOH HOH A . 
Q 6 HOH 116 716 314 HOH HOH A . 
Q 6 HOH 117 717 398 HOH HOH A . 
Q 6 HOH 118 718 162 HOH HOH A . 
Q 6 HOH 119 719 264 HOH HOH A . 
Q 6 HOH 120 720 305 HOH HOH A . 
Q 6 HOH 121 721 214 HOH HOH A . 
Q 6 HOH 122 722 280 HOH HOH A . 
R 6 HOH 1   101 168 HOH HOH B . 
R 6 HOH 2   102 245 HOH HOH B . 
R 6 HOH 3   103 213 HOH HOH B . 
R 6 HOH 4   104 108 HOH HOH B . 
R 6 HOH 5   105 63  HOH HOH B . 
R 6 HOH 6   106 143 HOH HOH B . 
R 6 HOH 7   107 49  HOH HOH B . 
R 6 HOH 8   108 3   HOH HOH B . 
R 6 HOH 9   109 25  HOH HOH B . 
R 6 HOH 10  110 124 HOH HOH B . 
R 6 HOH 11  111 41  HOH HOH B . 
R 6 HOH 12  112 229 HOH HOH B . 
R 6 HOH 13  113 10  HOH HOH B . 
R 6 HOH 14  114 57  HOH HOH B . 
R 6 HOH 15  115 84  HOH HOH B . 
R 6 HOH 16  116 130 HOH HOH B . 
R 6 HOH 17  117 220 HOH HOH B . 
R 6 HOH 18  118 100 HOH HOH B . 
R 6 HOH 19  119 406 HOH HOH B . 
R 6 HOH 20  120 421 HOH HOH B . 
R 6 HOH 21  121 128 HOH HOH B . 
R 6 HOH 22  122 18  HOH HOH B . 
R 6 HOH 23  123 200 HOH HOH B . 
R 6 HOH 24  124 74  HOH HOH B . 
R 6 HOH 25  125 44  HOH HOH B . 
R 6 HOH 26  126 142 HOH HOH B . 
R 6 HOH 27  127 31  HOH HOH B . 
R 6 HOH 28  128 270 HOH HOH B . 
R 6 HOH 29  129 239 HOH HOH B . 
R 6 HOH 30  130 48  HOH HOH B . 
R 6 HOH 31  131 306 HOH HOH B . 
R 6 HOH 32  132 274 HOH HOH B . 
R 6 HOH 33  133 12  HOH HOH B . 
R 6 HOH 34  134 282 HOH HOH B . 
R 6 HOH 35  135 14  HOH HOH B . 
R 6 HOH 36  136 404 HOH HOH B . 
R 6 HOH 37  137 191 HOH HOH B . 
R 6 HOH 38  138 151 HOH HOH B . 
R 6 HOH 39  139 19  HOH HOH B . 
R 6 HOH 40  140 417 HOH HOH B . 
R 6 HOH 41  141 68  HOH HOH B . 
R 6 HOH 42  142 290 HOH HOH B . 
R 6 HOH 43  143 244 HOH HOH B . 
R 6 HOH 44  144 155 HOH HOH B . 
R 6 HOH 45  145 310 HOH HOH B . 
S 6 HOH 1   101 311 HOH HOH C . 
S 6 HOH 2   102 416 HOH HOH C . 
S 6 HOH 3   103 238 HOH HOH C . 
S 6 HOH 4   104 39  HOH HOH C . 
S 6 HOH 5   105 125 HOH HOH C . 
S 6 HOH 6   106 251 HOH HOH C . 
S 6 HOH 7   107 67  HOH HOH C . 
S 6 HOH 8   108 212 HOH HOH C . 
S 6 HOH 9   109 409 HOH HOH C . 
S 6 HOH 10  110 98  HOH HOH C . 
S 6 HOH 11  111 99  HOH HOH C . 
S 6 HOH 12  112 399 HOH HOH C . 
S 6 HOH 13  113 42  HOH HOH C . 
S 6 HOH 14  114 47  HOH HOH C . 
S 6 HOH 15  115 171 HOH HOH C . 
S 6 HOH 16  116 87  HOH HOH C . 
S 6 HOH 17  117 382 HOH HOH C . 
S 6 HOH 18  118 66  HOH HOH C . 
S 6 HOH 19  119 216 HOH HOH C . 
S 6 HOH 20  120 391 HOH HOH C . 
S 6 HOH 21  121 352 HOH HOH C . 
S 6 HOH 22  122 198 HOH HOH C . 
S 6 HOH 23  123 304 HOH HOH C . 
S 6 HOH 24  124 297 HOH HOH C . 
S 6 HOH 25  125 339 HOH HOH C . 
S 6 HOH 26  126 89  HOH HOH C . 
S 6 HOH 27  127 225 HOH HOH C . 
T 6 HOH 1   601 88  HOH HOH D . 
T 6 HOH 2   602 397 HOH HOH D . 
T 6 HOH 3   603 158 HOH HOH D . 
T 6 HOH 4   604 71  HOH HOH D . 
T 6 HOH 5   605 356 HOH HOH D . 
T 6 HOH 6   606 27  HOH HOH D . 
T 6 HOH 7   607 194 HOH HOH D . 
T 6 HOH 8   608 222 HOH HOH D . 
T 6 HOH 9   609 405 HOH HOH D . 
T 6 HOH 10  610 201 HOH HOH D . 
T 6 HOH 11  611 263 HOH HOH D . 
T 6 HOH 12  612 262 HOH HOH D . 
T 6 HOH 13  613 283 HOH HOH D . 
T 6 HOH 14  614 320 HOH HOH D . 
T 6 HOH 15  615 26  HOH HOH D . 
T 6 HOH 16  616 76  HOH HOH D . 
T 6 HOH 17  617 91  HOH HOH D . 
T 6 HOH 18  618 114 HOH HOH D . 
T 6 HOH 19  619 83  HOH HOH D . 
T 6 HOH 20  620 346 HOH HOH D . 
T 6 HOH 21  621 152 HOH HOH D . 
T 6 HOH 22  622 145 HOH HOH D . 
T 6 HOH 23  623 20  HOH HOH D . 
T 6 HOH 24  624 35  HOH HOH D . 
T 6 HOH 25  625 86  HOH HOH D . 
T 6 HOH 26  626 165 HOH HOH D . 
T 6 HOH 27  627 59  HOH HOH D . 
T 6 HOH 28  628 377 HOH HOH D . 
T 6 HOH 29  629 16  HOH HOH D . 
T 6 HOH 30  630 153 HOH HOH D . 
T 6 HOH 31  631 95  HOH HOH D . 
T 6 HOH 32  632 219 HOH HOH D . 
T 6 HOH 33  633 112 HOH HOH D . 
T 6 HOH 34  634 178 HOH HOH D . 
T 6 HOH 35  635 82  HOH HOH D . 
T 6 HOH 36  636 46  HOH HOH D . 
T 6 HOH 37  637 281 HOH HOH D . 
T 6 HOH 38  638 131 HOH HOH D . 
T 6 HOH 39  639 350 HOH HOH D . 
T 6 HOH 40  640 170 HOH HOH D . 
T 6 HOH 41  641 11  HOH HOH D . 
T 6 HOH 42  642 9   HOH HOH D . 
T 6 HOH 43  643 179 HOH HOH D . 
T 6 HOH 44  644 72  HOH HOH D . 
T 6 HOH 45  645 331 HOH HOH D . 
T 6 HOH 46  646 258 HOH HOH D . 
T 6 HOH 47  647 395 HOH HOH D . 
T 6 HOH 48  648 189 HOH HOH D . 
T 6 HOH 49  649 60  HOH HOH D . 
T 6 HOH 50  650 374 HOH HOH D . 
T 6 HOH 51  651 300 HOH HOH D . 
T 6 HOH 52  652 150 HOH HOH D . 
T 6 HOH 53  653 120 HOH HOH D . 
T 6 HOH 54  654 53  HOH HOH D . 
T 6 HOH 55  655 224 HOH HOH D . 
T 6 HOH 56  656 242 HOH HOH D . 
T 6 HOH 57  657 115 HOH HOH D . 
T 6 HOH 58  658 321 HOH HOH D . 
T 6 HOH 59  659 113 HOH HOH D . 
T 6 HOH 60  660 122 HOH HOH D . 
T 6 HOH 61  661 241 HOH HOH D . 
T 6 HOH 62  662 104 HOH HOH D . 
T 6 HOH 63  663 1   HOH HOH D . 
T 6 HOH 64  664 337 HOH HOH D . 
T 6 HOH 65  665 359 HOH HOH D . 
T 6 HOH 66  666 254 HOH HOH D . 
T 6 HOH 67  667 360 HOH HOH D . 
T 6 HOH 68  668 322 HOH HOH D . 
T 6 HOH 69  669 275 HOH HOH D . 
T 6 HOH 70  670 293 HOH HOH D . 
T 6 HOH 71  671 80  HOH HOH D . 
T 6 HOH 72  672 354 HOH HOH D . 
T 6 HOH 73  673 347 HOH HOH D . 
T 6 HOH 74  674 157 HOH HOH D . 
T 6 HOH 75  675 279 HOH HOH D . 
T 6 HOH 76  676 217 HOH HOH D . 
T 6 HOH 77  677 249 HOH HOH D . 
T 6 HOH 78  678 299 HOH HOH D . 
T 6 HOH 79  679 273 HOH HOH D . 
T 6 HOH 80  680 357 HOH HOH D . 
T 6 HOH 81  681 136 HOH HOH D . 
T 6 HOH 82  682 400 HOH HOH D . 
U 6 HOH 1   101 285 HOH HOH E . 
U 6 HOH 2   102 176 HOH HOH E . 
U 6 HOH 3   103 180 HOH HOH E . 
U 6 HOH 4   104 144 HOH HOH E . 
U 6 HOH 5   105 218 HOH HOH E . 
U 6 HOH 6   106 17  HOH HOH E . 
U 6 HOH 7   107 102 HOH HOH E . 
U 6 HOH 8   108 221 HOH HOH E . 
U 6 HOH 9   109 101 HOH HOH E . 
U 6 HOH 10  110 15  HOH HOH E . 
U 6 HOH 11  111 134 HOH HOH E . 
U 6 HOH 12  112 33  HOH HOH E . 
U 6 HOH 13  113 166 HOH HOH E . 
U 6 HOH 14  114 22  HOH HOH E . 
U 6 HOH 15  115 43  HOH HOH E . 
U 6 HOH 16  116 174 HOH HOH E . 
U 6 HOH 17  117 209 HOH HOH E . 
U 6 HOH 18  118 105 HOH HOH E . 
U 6 HOH 19  119 154 HOH HOH E . 
U 6 HOH 20  120 140 HOH HOH E . 
U 6 HOH 21  121 85  HOH HOH E . 
U 6 HOH 22  122 234 HOH HOH E . 
U 6 HOH 23  123 2   HOH HOH E . 
U 6 HOH 24  124 103 HOH HOH E . 
U 6 HOH 25  125 65  HOH HOH E . 
U 6 HOH 26  126 135 HOH HOH E . 
U 6 HOH 27  127 292 HOH HOH E . 
U 6 HOH 28  128 138 HOH HOH E . 
U 6 HOH 29  129 248 HOH HOH E . 
U 6 HOH 30  130 13  HOH HOH E . 
U 6 HOH 31  131 240 HOH HOH E . 
U 6 HOH 32  132 55  HOH HOH E . 
U 6 HOH 33  133 90  HOH HOH E . 
U 6 HOH 34  134 50  HOH HOH E . 
U 6 HOH 35  135 289 HOH HOH E . 
U 6 HOH 36  136 32  HOH HOH E . 
U 6 HOH 37  137 315 HOH HOH E . 
U 6 HOH 38  138 227 HOH HOH E . 
U 6 HOH 39  139 7   HOH HOH E . 
U 6 HOH 40  140 420 HOH HOH E . 
U 6 HOH 41  141 107 HOH HOH E . 
U 6 HOH 42  142 247 HOH HOH E . 
U 6 HOH 43  143 223 HOH HOH E . 
U 6 HOH 44  144 410 HOH HOH E . 
U 6 HOH 45  145 226 HOH HOH E . 
U 6 HOH 46  146 344 HOH HOH E . 
U 6 HOH 47  147 412 HOH HOH E . 
V 6 HOH 1   101 303 HOH HOH F . 
V 6 HOH 2   102 79  HOH HOH F . 
V 6 HOH 3   103 236 HOH HOH F . 
V 6 HOH 4   104 109 HOH HOH F . 
V 6 HOH 5   105 45  HOH HOH F . 
V 6 HOH 6   106 199 HOH HOH F . 
V 6 HOH 7   107 188 HOH HOH F . 
V 6 HOH 8   108 235 HOH HOH F . 
V 6 HOH 9   109 211 HOH HOH F . 
V 6 HOH 10  110 148 HOH HOH F . 
V 6 HOH 11  111 123 HOH HOH F . 
V 6 HOH 12  112 29  HOH HOH F . 
V 6 HOH 13  113 291 HOH HOH F . 
V 6 HOH 14  114 110 HOH HOH F . 
V 6 HOH 15  115 141 HOH HOH F . 
V 6 HOH 16  116 205 HOH HOH F . 
V 6 HOH 17  117 343 HOH HOH F . 
V 6 HOH 18  118 182 HOH HOH F . 
V 6 HOH 19  119 23  HOH HOH F . 
V 6 HOH 20  120 111 HOH HOH F . 
V 6 HOH 21  121 261 HOH HOH F . 
V 6 HOH 22  122 278 HOH HOH F . 
V 6 HOH 23  123 117 HOH HOH F . 
V 6 HOH 24  124 177 HOH HOH F . 
V 6 HOH 25  125 58  HOH HOH F . 
V 6 HOH 26  126 62  HOH HOH F . 
V 6 HOH 27  127 94  HOH HOH F . 
V 6 HOH 28  128 349 HOH HOH F . 
V 6 HOH 29  129 272 HOH HOH F . 
V 6 HOH 30  130 116 HOH HOH F . 
V 6 HOH 31  131 265 HOH HOH F . 
V 6 HOH 32  132 335 HOH HOH F . 
V 6 HOH 33  133 324 HOH HOH F . 
V 6 HOH 34  134 250 HOH HOH F . 
V 6 HOH 35  135 276 HOH HOH F . 
V 6 HOH 36  136 233 HOH HOH F . 
V 6 HOH 37  137 186 HOH HOH F . 
V 6 HOH 38  138 127 HOH HOH F . 
V 6 HOH 39  139 362 HOH HOH F . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA trimeric 3 
2 author_and_software_defined_assembly PISA trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,G,H,I,J,K,L,Q,R,S 
2 1 D,E,F,M,N,O,P,T,U,V     
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4960  ? 
1 MORE         -19   ? 
1 'SSA (A^2)'  10900 ? 
2 'ABSA (A^2)' 4070  ? 
2 MORE         -18   ? 
2 'SSA (A^2)'  11780 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG  ? A CYS 7   ? A CYS 325 ? 1_555 ZN ? J ZN . ? A ZN 504 ? 1_555 SG  ? A CYS 12  ? A CYS 330 ? 1_555 117.8 ? 
2  SG  ? A CYS 7   ? A CYS 325 ? 1_555 ZN ? J ZN . ? A ZN 504 ? 1_555 NE2 ? A HIS 25  ? A HIS 343 ? 1_555 111.5 ? 
3  SG  ? A CYS 12  ? A CYS 330 ? 1_555 ZN ? J ZN . ? A ZN 504 ? 1_555 NE2 ? A HIS 25  ? A HIS 343 ? 1_555 100.5 ? 
4  SG  ? A CYS 7   ? A CYS 325 ? 1_555 ZN ? J ZN . ? A ZN 504 ? 1_555 NE2 ? A HIS 29  ? A HIS 347 ? 1_555 106.4 ? 
5  SG  ? A CYS 12  ? A CYS 330 ? 1_555 ZN ? J ZN . ? A ZN 504 ? 1_555 NE2 ? A HIS 29  ? A HIS 347 ? 1_555 113.2 ? 
6  NE2 ? A HIS 25  ? A HIS 343 ? 1_555 ZN ? J ZN . ? A ZN 504 ? 1_555 NE2 ? A HIS 29  ? A HIS 347 ? 1_555 107.2 ? 
7  SG  ? A CYS 37  ? A CYS 355 ? 1_555 ZN ? G ZN . ? A ZN 501 ? 1_555 SG  ? A CYS 42  ? A CYS 360 ? 1_555 116.0 ? 
8  SG  ? A CYS 37  ? A CYS 355 ? 1_555 ZN ? G ZN . ? A ZN 501 ? 1_555 NE2 ? A HIS 55  ? A HIS 373 ? 1_555 109.1 ? 
9  SG  ? A CYS 42  ? A CYS 360 ? 1_555 ZN ? G ZN . ? A ZN 501 ? 1_555 NE2 ? A HIS 55  ? A HIS 373 ? 1_555 106.4 ? 
10 SG  ? A CYS 37  ? A CYS 355 ? 1_555 ZN ? G ZN . ? A ZN 501 ? 1_555 NE2 ? A HIS 59  ? A HIS 377 ? 1_555 103.6 ? 
11 SG  ? A CYS 42  ? A CYS 360 ? 1_555 ZN ? G ZN . ? A ZN 501 ? 1_555 NE2 ? A HIS 59  ? A HIS 377 ? 1_555 114.4 ? 
12 NE2 ? A HIS 55  ? A HIS 373 ? 1_555 ZN ? G ZN . ? A ZN 501 ? 1_555 NE2 ? A HIS 59  ? A HIS 377 ? 1_555 107.0 ? 
13 SG  ? A CYS 67  ? A CYS 385 ? 1_555 ZN ? H ZN . ? A ZN 502 ? 1_555 SG  ? A CYS 70  ? A CYS 388 ? 1_555 117.5 ? 
14 SG  ? A CYS 67  ? A CYS 385 ? 1_555 ZN ? H ZN . ? A ZN 502 ? 1_555 NE2 ? A HIS 83  ? A HIS 401 ? 1_555 111.8 ? 
15 SG  ? A CYS 70  ? A CYS 388 ? 1_555 ZN ? H ZN . ? A ZN 502 ? 1_555 NE2 ? A HIS 83  ? A HIS 401 ? 1_555 103.5 ? 
16 SG  ? A CYS 67  ? A CYS 385 ? 1_555 ZN ? H ZN . ? A ZN 502 ? 1_555 NE2 ? A HIS 87  ? A HIS 405 ? 1_555 107.1 ? 
17 SG  ? A CYS 70  ? A CYS 388 ? 1_555 ZN ? H ZN . ? A ZN 502 ? 1_555 NE2 ? A HIS 87  ? A HIS 405 ? 1_555 113.4 ? 
18 NE2 ? A HIS 83  ? A HIS 401 ? 1_555 ZN ? H ZN . ? A ZN 502 ? 1_555 NE2 ? A HIS 87  ? A HIS 405 ? 1_555 102.6 ? 
19 SG  ? A CYS 95  ? A CYS 413 ? 1_555 ZN ? I ZN . ? A ZN 503 ? 1_555 SG  ? A CYS 100 ? A CYS 418 ? 1_555 124.8 ? 
20 SG  ? A CYS 95  ? A CYS 413 ? 1_555 ZN ? I ZN . ? A ZN 503 ? 1_555 NE2 ? A HIS 113 ? A HIS 431 ? 1_555 103.2 ? 
21 SG  ? A CYS 100 ? A CYS 418 ? 1_555 ZN ? I ZN . ? A ZN 503 ? 1_555 NE2 ? A HIS 113 ? A HIS 431 ? 1_555 85.2  ? 
22 SG  ? A CYS 95  ? A CYS 413 ? 1_555 ZN ? I ZN . ? A ZN 503 ? 1_555 NE2 ? A HIS 117 ? A HIS 435 ? 1_555 102.0 ? 
23 SG  ? A CYS 100 ? A CYS 418 ? 1_555 ZN ? I ZN . ? A ZN 503 ? 1_555 NE2 ? A HIS 117 ? A HIS 435 ? 1_555 126.6 ? 
24 NE2 ? A HIS 113 ? A HIS 431 ? 1_555 ZN ? I ZN . ? A ZN 503 ? 1_555 NE2 ? A HIS 117 ? A HIS 435 ? 1_555 109.7 ? 
25 SG  ? D CYS 7   ? D CYS 325 ? 1_555 ZN ? P ZN . ? D ZN 504 ? 1_555 SG  ? D CYS 12  ? D CYS 330 ? 1_555 116.7 ? 
26 SG  ? D CYS 7   ? D CYS 325 ? 1_555 ZN ? P ZN . ? D ZN 504 ? 1_555 NE2 ? D HIS 25  ? D HIS 343 ? 1_555 109.6 ? 
27 SG  ? D CYS 12  ? D CYS 330 ? 1_555 ZN ? P ZN . ? D ZN 504 ? 1_555 NE2 ? D HIS 25  ? D HIS 343 ? 1_555 101.8 ? 
28 SG  ? D CYS 7   ? D CYS 325 ? 1_555 ZN ? P ZN . ? D ZN 504 ? 1_555 NE2 ? D HIS 29  ? D HIS 347 ? 1_555 108.9 ? 
29 SG  ? D CYS 12  ? D CYS 330 ? 1_555 ZN ? P ZN . ? D ZN 504 ? 1_555 NE2 ? D HIS 29  ? D HIS 347 ? 1_555 109.0 ? 
30 NE2 ? D HIS 25  ? D HIS 343 ? 1_555 ZN ? P ZN . ? D ZN 504 ? 1_555 NE2 ? D HIS 29  ? D HIS 347 ? 1_555 110.7 ? 
31 SG  ? D CYS 37  ? D CYS 355 ? 1_555 ZN ? M ZN . ? D ZN 501 ? 1_555 SG  ? D CYS 42  ? D CYS 360 ? 1_555 114.6 ? 
32 SG  ? D CYS 37  ? D CYS 355 ? 1_555 ZN ? M ZN . ? D ZN 501 ? 1_555 NE2 ? D HIS 55  ? D HIS 373 ? 1_555 114.1 ? 
33 SG  ? D CYS 42  ? D CYS 360 ? 1_555 ZN ? M ZN . ? D ZN 501 ? 1_555 NE2 ? D HIS 55  ? D HIS 373 ? 1_555 107.5 ? 
34 SG  ? D CYS 37  ? D CYS 355 ? 1_555 ZN ? M ZN . ? D ZN 501 ? 1_555 NE2 ? D HIS 59  ? D HIS 377 ? 1_555 106.1 ? 
35 SG  ? D CYS 42  ? D CYS 360 ? 1_555 ZN ? M ZN . ? D ZN 501 ? 1_555 NE2 ? D HIS 59  ? D HIS 377 ? 1_555 114.0 ? 
36 NE2 ? D HIS 55  ? D HIS 373 ? 1_555 ZN ? M ZN . ? D ZN 501 ? 1_555 NE2 ? D HIS 59  ? D HIS 377 ? 1_555 99.6  ? 
37 SG  ? D CYS 67  ? D CYS 385 ? 1_555 ZN ? N ZN . ? D ZN 502 ? 1_555 SG  ? D CYS 70  ? D CYS 388 ? 1_555 118.2 ? 
38 SG  ? D CYS 67  ? D CYS 385 ? 1_555 ZN ? N ZN . ? D ZN 502 ? 1_555 NE2 ? D HIS 83  ? D HIS 401 ? 1_555 107.3 ? 
39 SG  ? D CYS 70  ? D CYS 388 ? 1_555 ZN ? N ZN . ? D ZN 502 ? 1_555 NE2 ? D HIS 83  ? D HIS 401 ? 1_555 104.8 ? 
40 SG  ? D CYS 67  ? D CYS 385 ? 1_555 ZN ? N ZN . ? D ZN 502 ? 1_555 NE2 ? D HIS 87  ? D HIS 405 ? 1_555 109.6 ? 
41 SG  ? D CYS 70  ? D CYS 388 ? 1_555 ZN ? N ZN . ? D ZN 502 ? 1_555 NE2 ? D HIS 87  ? D HIS 405 ? 1_555 110.5 ? 
42 NE2 ? D HIS 83  ? D HIS 401 ? 1_555 ZN ? N ZN . ? D ZN 502 ? 1_555 NE2 ? D HIS 87  ? D HIS 405 ? 1_555 105.3 ? 
43 SG  ? D CYS 95  ? D CYS 413 ? 1_555 ZN ? O ZN . ? D ZN 503 ? 1_555 SG  ? D CYS 100 ? D CYS 418 ? 1_555 118.5 ? 
44 SG  ? D CYS 95  ? D CYS 413 ? 1_555 ZN ? O ZN . ? D ZN 503 ? 1_555 NE2 ? D HIS 113 ? D HIS 431 ? 1_555 102.9 ? 
45 SG  ? D CYS 100 ? D CYS 418 ? 1_555 ZN ? O ZN . ? D ZN 503 ? 1_555 NE2 ? D HIS 113 ? D HIS 431 ? 1_555 112.9 ? 
46 SG  ? D CYS 95  ? D CYS 413 ? 1_555 ZN ? O ZN . ? D ZN 503 ? 1_555 NE2 ? D HIS 117 ? D HIS 435 ? 1_555 97.2  ? 
47 SG  ? D CYS 100 ? D CYS 418 ? 1_555 ZN ? O ZN . ? D ZN 503 ? 1_555 NE2 ? D HIS 117 ? D HIS 435 ? 1_555 131.7 ? 
48 NE2 ? D HIS 113 ? D HIS 431 ? 1_555 ZN ? O ZN . ? D ZN 503 ? 1_555 NE2 ? D HIS 117 ? D HIS 435 ? 1_555 86.8  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2018-01-03 
2 'Structure model' 1 1 2018-01-17 
3 'Structure model' 1 2 2018-05-16 
4 'Structure model' 1 3 2020-01-01 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' 'Data collection'            
3 3 'Structure model' 'Database references'        
4 4 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation           
2 2 'Structure model' citation_author    
3 3 'Structure model' citation           
4 4 'Structure model' pdbx_audit_support 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.pdbx_database_id_PubMed'        
2 2 'Structure model' '_citation.title'                          
3 2 'Structure model' '_citation_author.name'                    
4 3 'Structure model' '_citation.journal_volume'                 
5 3 'Structure model' '_citation.page_first'                     
6 3 'Structure model' '_citation.page_last'                      
7 3 'Structure model' '_citation.year'                           
8 4 'Structure model' '_pdbx_audit_support.funding_organization' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? 1.12_2829 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .         2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .         3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? .         4 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             "O4'" 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             DC 
_pdbx_validate_rmsd_angle.auth_seq_id_1              3 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             "C1'" 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             DC 
_pdbx_validate_rmsd_angle.auth_seq_id_2              3 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             N1 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             DC 
_pdbx_validate_rmsd_angle.auth_seq_id_3              3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                110.53 
_pdbx_validate_rmsd_angle.angle_target_value         108.30 
_pdbx_validate_rmsd_angle.angle_deviation            2.23 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.30 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A HIS 319 ? CG  ? A HIS 1   CG  
2  1 Y 1 A HIS 319 ? ND1 ? A HIS 1   ND1 
3  1 Y 1 A HIS 319 ? CD2 ? A HIS 1   CD2 
4  1 Y 1 A HIS 319 ? CE1 ? A HIS 1   CE1 
5  1 Y 1 A HIS 319 ? NE2 ? A HIS 1   NE2 
6  1 Y 1 A MET 320 ? CG  ? A MET 2   CG  
7  1 Y 1 A MET 320 ? SD  ? A MET 2   SD  
8  1 Y 1 A MET 320 ? CE  ? A MET 2   CE  
9  1 Y 1 A MET 324 ? CG  ? A MET 6   CG  
10 1 Y 1 A MET 324 ? SD  ? A MET 6   SD  
11 1 Y 1 A MET 324 ? CE  ? A MET 6   CE  
12 1 Y 1 A ASN 331 ? CG  ? A ASN 13  CG  
13 1 Y 1 A ASN 331 ? OD1 ? A ASN 13  OD1 
14 1 Y 1 A ASN 331 ? ND2 ? A ASN 13  ND2 
15 1 Y 1 A ARG 414 ? CG  ? A ARG 96  CG  
16 1 Y 1 A ARG 414 ? CD  ? A ARG 96  CD  
17 1 Y 1 A ARG 414 ? NE  ? A ARG 96  NE  
18 1 Y 1 A ARG 414 ? CZ  ? A ARG 96  CZ  
19 1 Y 1 A ARG 414 ? NH1 ? A ARG 96  NH1 
20 1 Y 1 A ARG 414 ? NH2 ? A ARG 96  NH2 
21 1 Y 1 A SER 417 ? OG  ? A SER 99  OG  
22 1 Y 1 A GLN 419 ? CG  ? A GLN 101 CG  
23 1 Y 1 A GLN 419 ? CD  ? A GLN 101 CD  
24 1 Y 1 A GLN 419 ? OE1 ? A GLN 101 OE1 
25 1 Y 1 A GLN 419 ? NE2 ? A GLN 101 NE2 
26 1 Y 1 A LYS 420 ? CG  ? A LYS 102 CG  
27 1 Y 1 A LYS 420 ? CD  ? A LYS 102 CD  
28 1 Y 1 A LYS 420 ? CE  ? A LYS 102 CE  
29 1 Y 1 A LYS 420 ? NZ  ? A LYS 102 NZ  
30 1 Y 1 A LYS 421 ? CG  ? A LYS 103 CG  
31 1 Y 1 A LYS 421 ? CD  ? A LYS 103 CD  
32 1 Y 1 A LYS 421 ? CE  ? A LYS 103 CE  
33 1 Y 1 A LYS 421 ? NZ  ? A LYS 103 NZ  
34 1 Y 1 A GLN 436 ? CG  ? A GLN 118 CG  
35 1 Y 1 A GLN 436 ? CD  ? A GLN 118 CD  
36 1 Y 1 A GLN 436 ? OE1 ? A GLN 118 OE1 
37 1 Y 1 A GLN 436 ? NE2 ? A GLN 118 NE2 
38 1 Y 1 A ARG 437 ? CG  ? A ARG 119 CG  
39 1 Y 1 A ARG 437 ? CD  ? A ARG 119 CD  
40 1 Y 1 A ARG 437 ? NE  ? A ARG 119 NE  
41 1 Y 1 A ARG 437 ? CZ  ? A ARG 119 CZ  
42 1 Y 1 A ARG 437 ? NH1 ? A ARG 119 NH1 
43 1 Y 1 A ARG 437 ? NH2 ? A ARG 119 NH2 
44 1 Y 1 D GLU 350 ? CG  ? D GLU 32  CG  
45 1 Y 1 D GLU 350 ? CD  ? D GLU 32  CD  
46 1 Y 1 D GLU 350 ? OE1 ? D GLU 32  OE1 
47 1 Y 1 D GLU 350 ? OE2 ? D GLU 32  OE2 
48 1 Y 1 D GLU 361 ? CG  ? D GLU 43  CG  
49 1 Y 1 D GLU 361 ? CD  ? D GLU 43  CD  
50 1 Y 1 D GLU 361 ? OE1 ? D GLU 43  OE1 
51 1 Y 1 D GLU 361 ? OE2 ? D GLU 43  OE2 
52 1 Y 1 D TRP 415 ? CG  ? D TRP 97  CG  
53 1 Y 1 D TRP 415 ? CD1 ? D TRP 97  CD1 
54 1 Y 1 D TRP 415 ? CD2 ? D TRP 97  CD2 
55 1 Y 1 D TRP 415 ? NE1 ? D TRP 97  NE1 
56 1 Y 1 D TRP 415 ? CE2 ? D TRP 97  CE2 
57 1 Y 1 D TRP 415 ? CE3 ? D TRP 97  CE3 
58 1 Y 1 D TRP 415 ? CZ2 ? D TRP 97  CZ2 
59 1 Y 1 D TRP 415 ? CZ3 ? D TRP 97  CZ3 
60 1 Y 1 D TRP 415 ? CH2 ? D TRP 97  CH2 
61 1 Y 1 D SER 417 ? OG  ? D SER 99  OG  
62 1 Y 1 D GLN 419 ? CG  ? D GLN 101 CG  
63 1 Y 1 D GLN 419 ? CD  ? D GLN 101 CD  
64 1 Y 1 D GLN 419 ? OE1 ? D GLN 101 OE1 
65 1 Y 1 D GLN 419 ? NE2 ? D GLN 101 NE2 
66 1 Y 1 D LYS 420 ? CG  ? D LYS 102 CG  
67 1 Y 1 D LYS 420 ? CD  ? D LYS 102 CD  
68 1 Y 1 D LYS 420 ? CE  ? D LYS 102 CE  
69 1 Y 1 D LYS 420 ? NZ  ? D LYS 102 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 D HIS 319 ? D HIS 1   
2 1 Y 1 D MET 320 ? D MET 2   
3 1 Y 1 D ARG 437 ? D ARG 119 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
6B0O 'double helix'        
6B0O 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DG 2  1_555 C DC 13 1_555 -0.414 -0.137 -0.167 -6.624  -6.743  5.658  1  B_DG2:DC13_C B 2  ? C 13 ? 19 1 
1 B DC 3  1_555 C DG 12 1_555 0.338  -0.132 -0.206 7.998   -6.957  2.329  2  B_DC3:DG12_C B 3  ? C 12 ? 19 1 
1 B DG 4  1_555 C DC 11 1_555 -0.235 -0.158 0.037  -1.591  -6.893  -0.576 3  B_DG4:DC11_C B 4  ? C 11 ? 19 1 
1 B DT 5  1_555 C DA 10 1_555 0.151  -0.138 -0.003 5.715   -7.049  5.311  4  B_DT5:DA10_C B 5  ? C 10 ? 20 1 
1 B DG 6  1_555 C DC 9  1_555 -0.191 -0.194 0.205  -5.677  -10.782 -0.272 5  B_DG6:DC9_C  B 6  ? C 9  ? 19 1 
1 B DG 7  1_555 C DC 8  1_555 -0.220 -0.161 0.202  4.441   -4.206  -3.632 6  B_DG7:DC8_C  B 7  ? C 8  ? 19 1 
1 B DG 8  1_555 C DC 7  1_555 -0.254 -0.210 -0.150 -4.834  -11.593 0.260  7  B_DG8:DC7_C  B 8  ? C 7  ? 19 1 
1 B DA 9  1_555 C DT 6  1_555 0.153  -0.124 0.252  3.277   -16.355 9.817  8  B_DA9:DT6_C  B 9  ? C 6  ? 20 1 
1 B DG 10 1_555 C DC 5  1_555 -0.286 -0.186 0.216  3.457   -10.453 2.796  9  B_DG10:DC5_C B 10 ? C 5  ? 19 1 
1 B DT 11 1_555 C DA 4  1_555 0.137  -0.113 -0.148 8.057   -9.648  6.904  10 B_DT11:DA4_C B 11 ? C 4  ? 20 1 
1 B DG 12 1_555 C DC 3  1_555 -0.386 -0.240 0.138  -9.450  -12.249 5.625  11 B_DG12:DC3_C B 12 ? C 3  ? 19 1 
1 B DT 13 1_555 C DA 2  1_555 -0.091 -0.142 -0.030 -5.859  -3.548  0.707  12 B_DT13:DA2_C B 13 ? C 2  ? 20 1 
1 E DG 2  1_555 F DC 13 1_555 -0.379 -0.108 -0.183 -7.000  -7.760  6.111  13 E_DG2:DC13_F E 2  ? F 13 ? 19 1 
1 E DC 3  1_555 F DG 12 1_555 0.654  -0.130 -0.278 8.260   -5.860  5.179  14 E_DC3:DG12_F E 3  ? F 12 ? 19 1 
1 E DG 4  1_555 F DC 11 1_555 -0.264 -0.194 0.060  -0.922  -4.836  -0.737 15 E_DG4:DC11_F E 4  ? F 11 ? 19 1 
1 E DT 5  1_555 F DA 10 1_555 0.124  -0.178 0.016  6.496   -7.366  6.717  16 E_DT5:DA10_F E 5  ? F 10 ? 20 1 
1 E DG 6  1_555 F DC 9  1_555 -0.352 -0.049 0.286  -10.281 -13.072 -0.281 17 E_DG6:DC9_F  E 6  ? F 9  ? 19 1 
1 E DG 7  1_555 F DC 8  1_555 -0.200 -0.104 0.196  0.989   -6.413  -2.637 18 E_DG7:DC8_F  E 7  ? F 8  ? 19 1 
1 E DG 8  1_555 F DC 7  1_555 -0.311 -0.143 0.035  2.925   -6.856  2.013  19 E_DG8:DC7_F  E 8  ? F 7  ? 19 1 
1 E DA 9  1_555 F DT 6  1_555 0.224  -0.078 0.248  11.477  -14.461 10.014 20 E_DA9:DT6_F  E 9  ? F 6  ? 20 1 
1 E DG 10 1_555 F DC 5  1_555 -0.232 -0.114 -0.011 -12.157 -14.698 -2.070 21 E_DG10:DC5_F E 10 ? F 5  ? 19 1 
1 E DT 11 1_555 F DA 4  1_555 -0.216 -0.096 0.158  -14.255 -9.783  -3.427 22 E_DT11:DA4_F E 11 ? F 4  ? 20 1 
1 E DG 12 1_555 F DC 3  1_555 -0.264 -0.092 -0.079 -15.775 -12.958 4.050  23 E_DG12:DC3_F E 12 ? F 3  ? 19 1 
1 E DT 13 1_555 F DA 2  1_555 -0.001 -0.112 -0.005 -10.117 -3.854  -0.203 24 E_DT13:DA2_F E 13 ? F 2  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DG 2  1_555 C DC 13 1_555 B DC 3  1_555 C DG 12 1_555 0.144  -0.141 2.875 0.013  10.041 25.824 -2.418 -0.299 2.636 21.462 
-0.028 27.676 1  BB_DG2DC3:DG12DC13_CC B 2  ? C 13 ? B 3  ? C 12 ? 
1 B DC 3  1_555 C DG 12 1_555 B DG 4  1_555 C DC 11 1_555 -1.028 -0.149 3.426 -7.763 9.744  33.409 -1.774 0.462  3.400 16.264 
12.957 35.594 2  BB_DC3DG4:DC11DG12_CC B 3  ? C 12 ? B 4  ? C 11 ? 
1 B DG 4  1_555 C DC 11 1_555 B DT 5  1_555 C DA 10 1_555 0.548  -0.608 3.268 -0.066 7.917  29.032 -2.755 -1.070 3.000 15.434 
0.128  30.069 3  BB_DG4DT5:DA10DC11_CC B 4  ? C 11 ? B 5  ? C 10 ? 
1 B DT 5  1_555 C DA 10 1_555 B DG 6  1_555 C DC 9  1_555 -0.966 -0.407 3.553 -5.163 0.374  34.316 -0.746 0.743  3.651 0.630  
8.690  34.692 4  BB_DT5DG6:DC9DA10_CC  B 5  ? C 10 ? B 6  ? C 9  ? 
1 B DG 6  1_555 C DC 9  1_555 B DG 7  1_555 C DC 8  1_555 -0.694 -0.595 3.112 0.197  3.157  33.728 -1.499 1.222  3.041 5.427  
-0.339 33.872 5  BB_DG6DG7:DC8DC9_CC   B 6  ? C 9  ? B 7  ? C 8  ? 
1 B DG 7  1_555 C DC 8  1_555 B DG 8  1_555 C DC 7  1_555 0.228  -0.758 3.601 2.080  3.890  34.960 -1.883 -0.040 3.506 6.444  
-3.445 35.229 6  BB_DG7DG8:DC7DC8_CC   B 7  ? C 8  ? B 8  ? C 7  ? 
1 B DG 8  1_555 C DC 7  1_555 B DA 9  1_555 C DT 6  1_555 0.697  -0.548 3.076 -1.440 2.464  31.262 -1.444 -1.539 2.991 4.560  
2.665  31.388 7  BB_DG8DA9:DT6DC7_CC   B 8  ? C 7  ? B 9  ? C 6  ? 
1 B DA 9  1_555 C DT 6  1_555 B DG 10 1_555 C DC 5  1_555 -0.704 -0.642 3.244 -1.835 5.791  30.676 -2.267 0.965  3.110 10.813 
3.426  31.258 8  BB_DA9DG10:DC5DT6_CC  B 9  ? C 6  ? B 10 ? C 5  ? 
1 B DG 10 1_555 C DC 5  1_555 B DT 11 1_555 C DA 4  1_555 0.476  -0.643 3.214 1.950  2.102  30.037 -1.654 -0.525 3.187 4.045  
-3.752 30.170 9  BB_DG10DT11:DA4DC5_CC B 10 ? C 5  ? B 11 ? C 4  ? 
1 B DT 11 1_555 C DA 4  1_555 B DG 12 1_555 C DC 3  1_555 -0.435 -0.566 3.678 -6.516 3.496  36.808 -1.395 -0.285 3.633 5.469  
10.193 37.518 10 BB_DT11DG12:DC3DA4_CC B 11 ? C 4  ? B 12 ? C 3  ? 
1 B DG 12 1_555 C DC 3  1_555 B DT 13 1_555 C DA 2  1_555 -0.634 -0.923 3.255 1.363  3.010  31.374 -2.246 1.414  3.125 5.547  
-2.512 31.543 11 BB_DG12DT13:DA2DC3_CC B 12 ? C 3  ? B 13 ? C 2  ? 
1 E DG 2  1_555 F DC 13 1_555 E DC 3  1_555 F DG 12 1_555 0.307  -0.209 2.846 0.343  10.553 26.939 -2.436 -0.549 2.586 21.627 
-0.703 28.899 12 EE_DG2DC3:DG12DC13_FF E 2  ? F 13 ? E 3  ? F 12 ? 
1 E DC 3  1_555 F DG 12 1_555 E DG 4  1_555 F DC 11 1_555 -1.118 -0.201 3.492 -8.391 9.383  32.063 -1.959 0.443  3.475 16.229 
14.513 34.385 13 EE_DC3DG4:DC11DG12_FF E 3  ? F 12 ? E 4  ? F 11 ? 
1 E DG 4  1_555 F DC 11 1_555 E DT 5  1_555 F DA 10 1_555 0.468  -0.585 3.293 -0.080 10.405 29.086 -3.081 -0.895 2.914 19.931 
0.154  30.854 14 EE_DG4DT5:DA10DC11_FF E 4  ? F 11 ? E 5  ? F 10 ? 
1 E DT 5  1_555 F DA 10 1_555 E DG 6  1_555 F DC 9  1_555 -1.081 -0.373 3.673 -5.362 -0.550 34.165 -0.530 0.867  3.799 -0.929 
9.056  34.575 15 EE_DT5DG6:DC9DA10_FF  E 5  ? F 10 ? E 6  ? F 9  ? 
1 E DG 6  1_555 F DC 9  1_555 E DG 7  1_555 F DC 8  1_555 -0.661 -0.669 3.071 1.059  5.686  33.579 -1.975 1.284  2.901 9.751  
-1.816 34.059 16 EE_DG6DG7:DC8DC9_FF   E 6  ? F 9  ? E 7  ? F 8  ? 
1 E DG 7  1_555 F DC 8  1_555 E DG 8  1_555 F DC 7  1_555 0.134  -0.435 3.338 1.510  1.223  34.290 -0.931 0.014  3.323 2.072  
-2.558 34.343 17 EE_DG7DG8:DC7DC8_FF   E 7  ? F 8  ? E 8  ? F 7  ? 
1 E DG 8  1_555 F DC 7  1_555 E DA 9  1_555 F DT 6  1_555 0.585  -0.553 3.109 -1.419 5.383  29.740 -2.076 -1.389 2.935 10.373 
2.734  30.245 18 EE_DG8DA9:DT6DC7_FF   E 8  ? F 7  ? E 9  ? F 6  ? 
1 E DA 9  1_555 F DT 6  1_555 E DG 10 1_555 F DC 5  1_555 -1.083 -0.900 3.751 -5.383 0.123  37.352 -1.411 0.861  3.862 0.190  
8.352  37.725 19 EE_DA9DG10:DC5DT6_FF  E 9  ? F 6  ? E 10 ? F 5  ? 
1 E DG 10 1_555 F DC 5  1_555 E DT 11 1_555 F DA 4  1_555 -1.073 -1.287 3.347 -1.314 -3.403 29.770 -1.750 1.789  3.512 -6.592 
2.546  29.988 20 EE_DG10DT11:DA4DC5_FF E 10 ? F 5  ? E 11 ? F 4  ? 
1 E DT 11 1_555 F DA 4  1_555 E DG 12 1_555 F DC 3  1_555 0.768  -1.093 3.321 2.907  9.359  30.871 -3.581 -0.875 2.931 17.052 
-5.297 32.353 21 EE_DT11DG12:DC3DA4_FF E 11 ? F 4  ? E 12 ? F 3  ? 
1 E DG 12 1_555 F DC 3  1_555 E DT 13 1_555 F DA 2  1_555 -0.554 -1.063 3.214 0.817  3.634  31.332 -2.605 1.165  3.059 6.698  
-1.507 31.547 22 EE_DG12DT13:DA2DC3_FF E 12 ? F 3  ? E 13 ? F 2  ? 
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           GM049245-23 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'ZINC ION'     ZN  
5 1,2-ETHANEDIOL EDO 
6 water          HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'light scattering' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#