data_6B0Q
# 
_entry.id   6B0Q 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.293 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6B0Q         
WWPDB D_1000229812 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6B0Q 
_pdbx_database_status.recvd_initial_deposition_date   2017-09-14 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Horton, J.R.' 1 ? 
'Cheng, X.'    2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_id_ASTM           NARHAD 
_citation.journal_id_CSD            0389 
_citation.journal_id_ISSN           1362-4962 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            46 
_citation.language                  ? 
_citation.page_first                3864 
_citation.page_last                 3877 
_citation.title                     
;Role for first zinc finger of WT1 in DNA sequence specificity: Denys-Drash syndrome-associated WT1 mutant in ZF1 enhances affinity for a subset of WT1 binding sites.
;
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1093/nar/gkx1274 
_citation.pdbx_database_id_PubMed   29294058 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wang, D.'         1 
primary 'Horton, J.R.'     2 
primary 'Zheng, Y.'        3 
primary 'Blumenthal, R.M.' 4 
primary 'Zhang, X.'        5 
primary 'Cheng, X.'        6 
# 
_cell.entry_id           6B0Q 
_cell.length_a           161.664 
_cell.length_b           161.664 
_cell.length_c           42.172 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         6B0Q 
_symmetry.space_group_name_H-M             'P 63' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                173 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Wilms tumor protein'                                    14626.925 2  ? ? ? ? 
2 polymer     syn 
;DNA (5'-D(P*GP*CP*GP*TP*GP*GP*GP*AP*GP*TP*GP*TP*T)-3')
;
4391.849  2  ? ? ? ? 
3 polymer     syn 
;DNA (5'-D(P*AP*AP*CP*AP*CP*TP*CP*CP*CP*AP*CP*GP*C)-3')
;
4169.733  2  ? ? ? ? 
4 non-polymer syn 'ZINC ION'                                               65.409    8  ? ? ? ? 
5 non-polymer syn 'SULFATE ION'                                            96.063    8  ? ? ? ? 
6 water       nat water                                                    18.015    30 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        WT33 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;HMRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHL
KTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQR
;
;HMRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHL
KTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQR
;
D,A ? 
2 polydeoxyribonucleotide no no '(DA)(DG)(DC)(DG)(DT)(DG)(DG)(DG)(DA)(DG)(DT)(DG)(DT)(DT)' AGCGTGGGAGTGTT E,B ? 
3 polydeoxyribonucleotide no no '(DT)(DA)(DA)(DC)(DA)(DC)(DT)(DC)(DC)(DC)(DA)(DC)(DG)(DC)' TAACACTCCCACGC F,C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   HIS n 
1 2   MET n 
1 3   ARG n 
1 4   PRO n 
1 5   PHE n 
1 6   MET n 
1 7   CYS n 
1 8   ALA n 
1 9   TYR n 
1 10  PRO n 
1 11  GLY n 
1 12  CYS n 
1 13  ASN n 
1 14  LYS n 
1 15  ARG n 
1 16  TYR n 
1 17  PHE n 
1 18  LYS n 
1 19  LEU n 
1 20  SER n 
1 21  HIS n 
1 22  LEU n 
1 23  GLN n 
1 24  MET n 
1 25  HIS n 
1 26  SER n 
1 27  ARG n 
1 28  LYS n 
1 29  HIS n 
1 30  THR n 
1 31  GLY n 
1 32  GLU n 
1 33  LYS n 
1 34  PRO n 
1 35  TYR n 
1 36  GLN n 
1 37  CYS n 
1 38  ASP n 
1 39  PHE n 
1 40  LYS n 
1 41  ASP n 
1 42  CYS n 
1 43  GLU n 
1 44  ARG n 
1 45  ARG n 
1 46  PHE n 
1 47  SER n 
1 48  ARG n 
1 49  SER n 
1 50  ASP n 
1 51  GLN n 
1 52  LEU n 
1 53  LYS n 
1 54  ARG n 
1 55  HIS n 
1 56  GLN n 
1 57  ARG n 
1 58  ARG n 
1 59  HIS n 
1 60  THR n 
1 61  GLY n 
1 62  VAL n 
1 63  LYS n 
1 64  PRO n 
1 65  PHE n 
1 66  GLN n 
1 67  CYS n 
1 68  LYS n 
1 69  THR n 
1 70  CYS n 
1 71  GLN n 
1 72  ARG n 
1 73  LYS n 
1 74  PHE n 
1 75  SER n 
1 76  ARG n 
1 77  SER n 
1 78  ASP n 
1 79  HIS n 
1 80  LEU n 
1 81  LYS n 
1 82  THR n 
1 83  HIS n 
1 84  THR n 
1 85  ARG n 
1 86  THR n 
1 87  HIS n 
1 88  THR n 
1 89  GLY n 
1 90  GLU n 
1 91  LYS n 
1 92  PRO n 
1 93  PHE n 
1 94  SER n 
1 95  CYS n 
1 96  ARG n 
1 97  TRP n 
1 98  PRO n 
1 99  SER n 
1 100 CYS n 
1 101 GLN n 
1 102 LYS n 
1 103 LYS n 
1 104 PHE n 
1 105 ALA n 
1 106 ARG n 
1 107 SER n 
1 108 ASP n 
1 109 GLU n 
1 110 LEU n 
1 111 VAL n 
1 112 ARG n 
1 113 HIS n 
1 114 HIS n 
1 115 ASN n 
1 116 MET n 
1 117 HIS n 
1 118 GLN n 
1 119 ARG n 
2 1   DA  n 
2 2   DG  n 
2 3   DC  n 
2 4   DG  n 
2 5   DT  n 
2 6   DG  n 
2 7   DG  n 
2 8   DG  n 
2 9   DA  n 
2 10  DG  n 
2 11  DT  n 
2 12  DG  n 
2 13  DT  n 
2 14  DT  n 
3 1   DT  n 
3 2   DA  n 
3 3   DA  n 
3 4   DC  n 
3 5   DA  n 
3 6   DC  n 
3 7   DT  n 
3 8   DC  n 
3 9   DC  n 
3 10  DC  n 
3 11  DA  n 
3 12  DC  n 
3 13  DG  n 
3 14  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   119 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 WT1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     866768 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 14 'Homo sapiens' ? 9606 ? 
3 1 sample 1 14 'Homo sapiens' ? 9606 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP WT1_HUMAN P19544 P19544-2 1 
;RPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKT
HTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQR
;
304 
2 PDB 6B0Q      6B0Q   ?        2 ? 1   
3 PDB 6B0Q      6B0Q   ?        3 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6B0Q D 3 ? 119 ? P19544 304 ? 420 ? 321 437 
2 2 6B0Q E 1 ? 14  ? 6B0Q   1   ? 14  ? 1   14  
3 3 6B0Q F 1 ? 14  ? 6B0Q   0   ? 13  ? 0   13  
4 1 6B0Q A 3 ? 119 ? P19544 304 ? 420 ? 321 437 
5 2 6B0Q B 1 ? 14  ? 6B0Q   1   ? 14  ? 1   14  
6 3 6B0Q C 1 ? 14  ? 6B0Q   1   ? 14  ? 1   14  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6B0Q HIS D 1 ? UNP P19544 ? ? 'expression tag' 319 1 
1 6B0Q MET D 2 ? UNP P19544 ? ? 'expression tag' 320 2 
4 6B0Q HIS A 1 ? UNP P19544 ? ? 'expression tag' 319 3 
4 6B0Q MET A 2 ? UNP P19544 ? ? 'expression tag' 320 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
SO4 non-polymer         . 'SULFATE ION'                        ? 'O4 S -2'         96.063  
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6B0Q 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.55 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         65.35 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;25% PEG 3350
0.2M Lithium Sulfate
0.1M BIS-TRIS
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RAYONIX MX300-HS' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2017-02-18 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.00000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6B0Q 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.79 
_reflns.d_resolution_low                 38.83 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       30219 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.8 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5.9 
_reflns.pdbx_Rmerge_I_obs                0.114 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            13.5 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  0.051 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.68 
_reflns_shell.d_res_low                   2.79 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.0 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           1516 
_reflns_shell.percent_possible_all        100 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.822 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             5.4 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             0.394 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.686 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 6B0Q 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     30219 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             38.830 
_refine.ls_d_res_high                            2.794 
_refine.ls_percent_reflns_obs                    98.96 
_refine.ls_R_factor_obs                          0.2262 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2254 
_refine.ls_R_factor_R_free                       0.2408 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.99 
_refine.ls_number_reflns_R_free                  1509 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.40 
_refine.pdbx_overall_phase_error                 27.16 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1962 
_refine_hist.pdbx_number_atoms_nucleic_acid   1066 
_refine_hist.pdbx_number_atoms_ligand         48 
_refine_hist.number_atoms_solvent             30 
_refine_hist.number_atoms_total               3106 
_refine_hist.d_res_high                       2.794 
_refine_hist.d_res_low                        38.830 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.004  ? ? 3289 'X-RAY DIFFRACTION' ? 
f_angle_d          0.479  ? ? 4598 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 20.762 ? ? 1759 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.031  ? ? 467  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.003  ? ? 407  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 2.7938 2.8840  2589 0.3390 99.00  0.3735 . . 128 . . . . 
'X-RAY DIFFRACTION' . 2.8840 2.9870  2689 0.3299 100.00 0.4143 . . 140 . . . . 
'X-RAY DIFFRACTION' . 2.9870 3.1066  2597 0.3348 100.00 0.3292 . . 136 . . . . 
'X-RAY DIFFRACTION' . 3.1066 3.2479  2597 0.3014 98.00  0.2492 . . 138 . . . . 
'X-RAY DIFFRACTION' . 3.2479 3.4190  2494 0.2901 95.00  0.3571 . . 128 . . . . 
'X-RAY DIFFRACTION' . 3.4190 3.6331  2567 0.2471 98.00  0.3061 . . 134 . . . . 
'X-RAY DIFFRACTION' . 3.6331 3.9134  2634 0.2120 100.00 0.2584 . . 144 . . . . 
'X-RAY DIFFRACTION' . 3.9134 4.3067  2633 0.1928 100.00 0.2115 . . 146 . . . . 
'X-RAY DIFFRACTION' . 4.3067 4.9289  2651 0.1723 100.00 0.1720 . . 143 . . . . 
'X-RAY DIFFRACTION' . 4.9289 6.2058  2633 0.1676 100.00 0.1661 . . 137 . . . . 
'X-RAY DIFFRACTION' . 6.2058 38.8342 2626 0.1806 99.00  0.1839 . . 135 . . . . 
# 
_struct.entry_id                     6B0Q 
_struct.title                        
;Zinc finger Domain of WT1(-KTS form) with 13+1mer Oligonucleotide with 3' Triplet TGT
;
_struct.pdbx_descriptor              'Wilms tumor protein/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6B0Q 
_struct_keywords.text            'protein-DNA complex Wilms tumor suppressor protein zinc-fingers, Transcription-DNA complex' 
_struct_keywords.pdbx_keywords   Transcription/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 3 ? 
D  N N 1 ? 
E  N N 2 ? 
F  N N 3 ? 
G  N N 4 ? 
H  N N 4 ? 
I  N N 4 ? 
J  N N 4 ? 
K  N N 5 ? 
L  N N 5 ? 
M  N N 5 ? 
N  N N 5 ? 
O  N N 4 ? 
P  N N 4 ? 
Q  N N 4 ? 
R  N N 4 ? 
S  N N 5 ? 
T  N N 5 ? 
U  N N 5 ? 
V  N N 5 ? 
W  N N 6 ? 
X  N N 6 ? 
Y  N N 6 ? 
Z  N N 6 ? 
AA N N 6 ? 
BA N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 LYS A 18  ? ARG A 27  ? LYS D 336 ARG D 345 1 ? 10 
HELX_P HELX_P2  AA2 ARG A 48  ? GLN A 56  ? ARG D 366 GLN D 374 1 ? 9  
HELX_P HELX_P3  AA3 GLN A 56  ? GLY A 61  ? GLN D 374 GLY D 379 1 ? 6  
HELX_P HELX_P4  AA4 ARG A 76  ? GLY A 89  ? ARG D 394 GLY D 407 1 ? 14 
HELX_P HELX_P5  AA5 ARG A 106 ? HIS A 117 ? ARG D 424 HIS D 435 1 ? 12 
HELX_P HELX_P6  AA6 LYS D 18  ? ARG D 27  ? LYS A 336 ARG A 345 1 ? 10 
HELX_P HELX_P7  AA7 ARG D 48  ? GLN D 56  ? ARG A 366 GLN A 374 1 ? 9  
HELX_P HELX_P8  AA8 GLN D 56  ? GLY D 61  ? GLN A 374 GLY A 379 1 ? 6  
HELX_P HELX_P9  AA9 ARG D 76  ? GLY D 89  ? ARG A 394 GLY A 407 1 ? 14 
HELX_P HELX_P10 AB1 ARG D 106 ? GLN D 118 ? ARG A 424 GLN A 436 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A CYS 7   SG  ? ? ? 1_555 G ZN .  ZN ? ? D CYS 325 D ZN 501 1_555 ? ? ? ? ? ? ?            2.336 ? 
metalc2  metalc ? ? A CYS 12  SG  ? ? ? 1_555 G ZN .  ZN ? ? D CYS 330 D ZN 501 1_555 ? ? ? ? ? ? ?            2.292 ? 
metalc3  metalc ? ? A HIS 25  NE2 ? ? ? 1_555 G ZN .  ZN ? ? D HIS 343 D ZN 501 1_555 ? ? ? ? ? ? ?            2.040 ? 
metalc4  metalc ? ? A HIS 29  NE2 ? ? ? 1_555 G ZN .  ZN ? ? D HIS 347 D ZN 501 1_555 ? ? ? ? ? ? ?            2.042 ? 
metalc5  metalc ? ? A CYS 37  SG  ? ? ? 1_555 H ZN .  ZN ? ? D CYS 355 D ZN 502 1_555 ? ? ? ? ? ? ?            2.321 ? 
metalc6  metalc ? ? A CYS 42  SG  ? ? ? 1_555 H ZN .  ZN ? ? D CYS 360 D ZN 502 1_555 ? ? ? ? ? ? ?            2.255 ? 
metalc7  metalc ? ? A HIS 55  NE2 ? ? ? 1_555 H ZN .  ZN ? ? D HIS 373 D ZN 502 1_555 ? ? ? ? ? ? ?            2.031 ? 
metalc8  metalc ? ? A HIS 59  NE2 ? ? ? 1_555 H ZN .  ZN ? ? D HIS 377 D ZN 502 1_555 ? ? ? ? ? ? ?            2.020 ? 
metalc9  metalc ? ? A CYS 67  SG  ? ? ? 1_555 I ZN .  ZN ? ? D CYS 385 D ZN 503 1_555 ? ? ? ? ? ? ?            2.325 ? 
metalc10 metalc ? ? A CYS 70  SG  ? ? ? 1_555 I ZN .  ZN ? ? D CYS 388 D ZN 503 1_555 ? ? ? ? ? ? ?            2.273 ? 
metalc11 metalc ? ? A HIS 83  NE2 ? ? ? 1_555 I ZN .  ZN ? ? D HIS 401 D ZN 503 1_555 ? ? ? ? ? ? ?            2.032 ? 
metalc12 metalc ? ? A HIS 87  NE2 ? ? ? 1_555 I ZN .  ZN ? ? D HIS 405 D ZN 503 1_555 ? ? ? ? ? ? ?            2.033 ? 
metalc13 metalc ? ? A CYS 95  SG  ? ? ? 1_555 J ZN .  ZN ? ? D CYS 413 D ZN 504 1_555 ? ? ? ? ? ? ?            2.323 ? 
metalc14 metalc ? ? A CYS 100 SG  ? ? ? 1_555 J ZN .  ZN ? ? D CYS 418 D ZN 504 1_555 ? ? ? ? ? ? ?            2.317 ? 
metalc15 metalc ? ? A HIS 113 NE2 ? ? ? 1_555 J ZN .  ZN ? ? D HIS 431 D ZN 504 1_555 ? ? ? ? ? ? ?            2.029 ? 
metalc16 metalc ? ? A HIS 117 NE2 ? ? ? 1_555 J ZN .  ZN ? ? D HIS 435 D ZN 504 1_555 ? ? ? ? ? ? ?            2.027 ? 
metalc17 metalc ? ? D CYS 7   SG  ? ? ? 1_555 O ZN .  ZN ? ? A CYS 325 A ZN 501 1_555 ? ? ? ? ? ? ?            2.368 ? 
metalc18 metalc ? ? D CYS 12  SG  ? ? ? 1_555 O ZN .  ZN ? ? A CYS 330 A ZN 501 1_555 ? ? ? ? ? ? ?            2.348 ? 
metalc19 metalc ? ? D HIS 25  NE2 ? ? ? 1_555 O ZN .  ZN ? ? A HIS 343 A ZN 501 1_555 ? ? ? ? ? ? ?            2.034 ? 
metalc20 metalc ? ? D HIS 29  NE2 ? ? ? 1_555 O ZN .  ZN ? ? A HIS 347 A ZN 501 1_555 ? ? ? ? ? ? ?            2.046 ? 
metalc21 metalc ? ? D CYS 37  SG  ? ? ? 1_555 P ZN .  ZN ? ? A CYS 355 A ZN 502 1_555 ? ? ? ? ? ? ?            2.288 ? 
metalc22 metalc ? ? D CYS 42  SG  ? ? ? 1_555 P ZN .  ZN ? ? A CYS 360 A ZN 502 1_555 ? ? ? ? ? ? ?            2.281 ? 
metalc23 metalc ? ? D HIS 55  NE2 ? ? ? 1_555 P ZN .  ZN ? ? A HIS 373 A ZN 502 1_555 ? ? ? ? ? ? ?            2.037 ? 
metalc24 metalc ? ? D HIS 59  NE2 ? ? ? 1_555 P ZN .  ZN ? ? A HIS 377 A ZN 502 1_555 ? ? ? ? ? ? ?            2.025 ? 
metalc25 metalc ? ? D CYS 67  SG  ? ? ? 1_555 Q ZN .  ZN ? ? A CYS 385 A ZN 503 1_555 ? ? ? ? ? ? ?            2.296 ? 
metalc26 metalc ? ? D CYS 70  SG  ? ? ? 1_555 Q ZN .  ZN ? ? A CYS 388 A ZN 503 1_555 ? ? ? ? ? ? ?            2.286 ? 
metalc27 metalc ? ? D HIS 83  NE2 ? ? ? 1_555 Q ZN .  ZN ? ? A HIS 401 A ZN 503 1_555 ? ? ? ? ? ? ?            2.034 ? 
metalc28 metalc ? ? D HIS 87  NE2 ? ? ? 1_555 Q ZN .  ZN ? ? A HIS 405 A ZN 503 1_555 ? ? ? ? ? ? ?            2.032 ? 
metalc29 metalc ? ? D CYS 95  SG  ? ? ? 1_555 R ZN .  ZN ? ? A CYS 413 A ZN 504 1_555 ? ? ? ? ? ? ?            2.305 ? 
metalc30 metalc ? ? D CYS 100 SG  ? ? ? 1_555 R ZN .  ZN ? ? A CYS 418 A ZN 504 1_555 ? ? ? ? ? ? ?            2.262 ? 
metalc31 metalc ? ? D HIS 113 NE2 ? ? ? 1_555 R ZN .  ZN ? ? A HIS 431 A ZN 504 1_555 ? ? ? ? ? ? ?            2.027 ? 
metalc32 metalc ? ? D HIS 117 NE2 ? ? ? 1_555 R ZN .  ZN ? ? A HIS 435 A ZN 504 1_555 ? ? ? ? ? ? ?            2.028 ? 
hydrog1  hydrog ? ? E DG  2   N1  ? ? ? 1_555 F DC 14 N3 ? ? B DG  2   C DC 14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? E DG  2   N2  ? ? ? 1_555 F DC 14 O2 ? ? B DG  2   C DC 14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? E DG  2   O6  ? ? ? 1_555 F DC 14 N4 ? ? B DG  2   C DC 14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? E DC  3   N3  ? ? ? 1_555 F DG 13 N1 ? ? B DC  3   C DG 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? E DC  3   N4  ? ? ? 1_555 F DG 13 O6 ? ? B DC  3   C DG 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? E DC  3   O2  ? ? ? 1_555 F DG 13 N2 ? ? B DC  3   C DG 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? E DG  4   N1  ? ? ? 1_555 F DC 12 N3 ? ? B DG  4   C DC 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? E DG  4   N2  ? ? ? 1_555 F DC 12 O2 ? ? B DG  4   C DC 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? E DG  4   O6  ? ? ? 1_555 F DC 12 N4 ? ? B DG  4   C DC 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? E DT  5   N3  ? ? ? 1_555 F DA 11 N1 ? ? B DT  5   C DA 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? E DT  5   O4  ? ? ? 1_555 F DA 11 N6 ? ? B DT  5   C DA 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? E DG  6   N1  ? ? ? 1_555 F DC 10 N3 ? ? B DG  6   C DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? E DG  6   N2  ? ? ? 1_555 F DC 10 O2 ? ? B DG  6   C DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? E DG  6   O6  ? ? ? 1_555 F DC 10 N4 ? ? B DG  6   C DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? E DG  7   N1  ? ? ? 1_555 F DC 9  N3 ? ? B DG  7   C DC 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? E DG  7   N2  ? ? ? 1_555 F DC 9  O2 ? ? B DG  7   C DC 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? E DG  7   O6  ? ? ? 1_555 F DC 9  N4 ? ? B DG  7   C DC 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? E DG  8   N1  ? ? ? 1_555 F DC 8  N3 ? ? B DG  8   C DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? E DG  8   N2  ? ? ? 1_555 F DC 8  O2 ? ? B DG  8   C DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? E DG  8   O6  ? ? ? 1_555 F DC 8  N4 ? ? B DG  8   C DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? E DA  9   N1  ? ? ? 1_555 F DT 7  N3 ? ? B DA  9   C DT 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? E DA  9   N6  ? ? ? 1_555 F DT 7  O4 ? ? B DA  9   C DT 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? E DG  10  N1  ? ? ? 1_555 F DC 6  N3 ? ? B DG  10  C DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? E DG  10  N2  ? ? ? 1_555 F DC 6  O2 ? ? B DG  10  C DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? E DG  10  O6  ? ? ? 1_555 F DC 6  N4 ? ? B DG  10  C DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? E DT  11  N3  ? ? ? 1_555 F DA 5  N1 ? ? B DT  11  C DA 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? E DT  11  O4  ? ? ? 1_555 F DA 5  N6 ? ? B DT  11  C DA 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? E DG  12  N1  ? ? ? 1_555 F DC 4  N3 ? ? B DG  12  C DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? E DG  12  N2  ? ? ? 1_555 F DC 4  O2 ? ? B DG  12  C DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? E DG  12  O6  ? ? ? 1_555 F DC 4  N4 ? ? B DG  12  C DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? E DT  13  N3  ? ? ? 1_555 F DA 3  N1 ? ? B DT  13  C DA 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? E DT  13  O4  ? ? ? 1_555 F DA 3  N6 ? ? B DT  13  C DA 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? E DT  14  N3  ? ? ? 1_555 F DA 2  N1 ? ? B DT  14  C DA 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? E DT  14  O4  ? ? ? 1_555 F DA 2  N6 ? ? B DT  14  C DA 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? B DG  2   N1  ? ? ? 1_555 C DC 14 N3 ? ? E DG  2   F DC 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? B DG  2   N2  ? ? ? 1_555 C DC 14 O2 ? ? E DG  2   F DC 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? B DG  2   O6  ? ? ? 1_555 C DC 14 N4 ? ? E DG  2   F DC 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? B DC  3   N3  ? ? ? 1_555 C DG 13 N1 ? ? E DC  3   F DG 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? B DC  3   N4  ? ? ? 1_555 C DG 13 O6 ? ? E DC  3   F DG 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? B DC  3   O2  ? ? ? 1_555 C DG 13 N2 ? ? E DC  3   F DG 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? B DG  4   N1  ? ? ? 1_555 C DC 12 N3 ? ? E DG  4   F DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? B DG  4   N2  ? ? ? 1_555 C DC 12 O2 ? ? E DG  4   F DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? B DG  4   O6  ? ? ? 1_555 C DC 12 N4 ? ? E DG  4   F DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? B DT  5   N3  ? ? ? 1_555 C DA 11 N1 ? ? E DT  5   F DA 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? B DT  5   O4  ? ? ? 1_555 C DA 11 N6 ? ? E DT  5   F DA 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? B DG  6   N1  ? ? ? 1_555 C DC 10 N3 ? ? E DG  6   F DC 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? B DG  6   N2  ? ? ? 1_555 C DC 10 O2 ? ? E DG  6   F DC 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ? ? B DG  6   O6  ? ? ? 1_555 C DC 10 N4 ? ? E DG  6   F DC 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ? ? B DG  7   N1  ? ? ? 1_555 C DC 9  N3 ? ? E DG  7   F DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ? ? B DG  7   N2  ? ? ? 1_555 C DC 9  O2 ? ? E DG  7   F DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ? ? B DG  7   O6  ? ? ? 1_555 C DC 9  N4 ? ? E DG  7   F DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52 hydrog ? ? B DG  8   N1  ? ? ? 1_555 C DC 8  N3 ? ? E DG  8   F DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53 hydrog ? ? B DG  8   N2  ? ? ? 1_555 C DC 8  O2 ? ? E DG  8   F DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54 hydrog ? ? B DG  8   O6  ? ? ? 1_555 C DC 8  N4 ? ? E DG  8   F DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55 hydrog ? ? B DA  9   N1  ? ? ? 1_555 C DT 7  N3 ? ? E DA  9   F DT 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56 hydrog ? ? B DA  9   N6  ? ? ? 1_555 C DT 7  O4 ? ? E DA  9   F DT 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57 hydrog ? ? B DG  10  N1  ? ? ? 1_555 C DC 6  N3 ? ? E DG  10  F DC 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58 hydrog ? ? B DG  10  N2  ? ? ? 1_555 C DC 6  O2 ? ? E DG  10  F DC 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59 hydrog ? ? B DG  10  O6  ? ? ? 1_555 C DC 6  N4 ? ? E DG  10  F DC 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60 hydrog ? ? B DT  11  N3  ? ? ? 1_555 C DA 5  N1 ? ? E DT  11  F DA 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61 hydrog ? ? B DT  11  O4  ? ? ? 1_555 C DA 5  N6 ? ? E DT  11  F DA 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62 hydrog ? ? B DG  12  N1  ? ? ? 1_555 C DC 4  N3 ? ? E DG  12  F DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63 hydrog ? ? B DG  12  N2  ? ? ? 1_555 C DC 4  O2 ? ? E DG  12  F DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64 hydrog ? ? B DG  12  O6  ? ? ? 1_555 C DC 4  N4 ? ? E DG  12  F DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog65 hydrog ? ? B DT  13  N3  ? ? ? 1_555 C DA 3  N1 ? ? E DT  13  F DA 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog66 hydrog ? ? B DT  13  O4  ? ? ? 1_555 C DA 3  N6 ? ? E DT  13  F DA 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog67 hydrog ? ? B DT  14  N3  ? ? ? 1_555 C DA 2  N1 ? ? E DT  14  F DA 1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog68 hydrog ? ? B DT  14  O4  ? ? ? 1_555 C DA 2  N6 ? ? E DT  14  F DA 1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 PHE A 5   ? MET A 6   ? PHE D 323 MET D 324 
AA1 2 ARG A 15  ? TYR A 16  ? ARG D 333 TYR D 334 
AA2 1 TYR A 35  ? GLN A 36  ? TYR D 353 GLN D 354 
AA2 2 ARG A 45  ? PHE A 46  ? ARG D 363 PHE D 364 
AA3 1 PHE A 65  ? GLN A 66  ? PHE D 383 GLN D 384 
AA3 2 LYS A 73  ? PHE A 74  ? LYS D 391 PHE D 392 
AA4 1 PHE A 93  ? SER A 94  ? PHE D 411 SER D 412 
AA4 2 LYS A 103 ? PHE A 104 ? LYS D 421 PHE D 422 
AA5 1 PHE D 5   ? MET D 6   ? PHE A 323 MET A 324 
AA5 2 ARG D 15  ? TYR D 16  ? ARG A 333 TYR A 334 
AA6 1 TYR D 35  ? GLN D 36  ? TYR A 353 GLN A 354 
AA6 2 ARG D 45  ? PHE D 46  ? ARG A 363 PHE A 364 
AA7 1 PHE D 65  ? GLN D 66  ? PHE A 383 GLN A 384 
AA7 2 LYS D 73  ? PHE D 74  ? LYS A 391 PHE A 392 
AA8 1 PHE D 93  ? SER D 94  ? PHE A 411 SER A 412 
AA8 2 LYS D 103 ? PHE D 104 ? LYS A 421 PHE A 422 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N PHE A 5  ? N PHE D 323 O TYR A 16  ? O TYR D 334 
AA2 1 2 N TYR A 35 ? N TYR D 353 O PHE A 46  ? O PHE D 364 
AA3 1 2 N PHE A 65 ? N PHE D 383 O PHE A 74  ? O PHE D 392 
AA4 1 2 N PHE A 93 ? N PHE D 411 O PHE A 104 ? O PHE D 422 
AA5 1 2 N PHE D 5  ? N PHE A 323 O TYR D 16  ? O TYR A 334 
AA6 1 2 N TYR D 35 ? N TYR A 353 O PHE D 46  ? O PHE A 364 
AA7 1 2 N PHE D 65 ? N PHE A 383 O PHE D 74  ? O PHE A 392 
AA8 1 2 N PHE D 93 ? N PHE A 411 O PHE D 104 ? O PHE A 422 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software D ZN  501 ? 4 'binding site for residue ZN D 501'  
AC2 Software D ZN  502 ? 4 'binding site for residue ZN D 502'  
AC3 Software D ZN  503 ? 4 'binding site for residue ZN D 503'  
AC4 Software D ZN  504 ? 4 'binding site for residue ZN D 504'  
AC5 Software D SO4 505 ? 4 'binding site for residue SO4 D 505' 
AC6 Software D SO4 506 ? 4 'binding site for residue SO4 D 506' 
AC7 Software D SO4 507 ? 4 'binding site for residue SO4 D 507' 
AC8 Software D SO4 508 ? 1 'binding site for residue SO4 D 508' 
AC9 Software A ZN  501 ? 4 'binding site for residue ZN A 501'  
AD1 Software A ZN  502 ? 4 'binding site for residue ZN A 502'  
AD2 Software A ZN  503 ? 4 'binding site for residue ZN A 503'  
AD3 Software A ZN  504 ? 4 'binding site for residue ZN A 504'  
AD4 Software A SO4 505 ? 2 'binding site for residue SO4 A 505' 
AD5 Software A SO4 506 ? 4 'binding site for residue SO4 A 506' 
AD6 Software A SO4 507 ? 6 'binding site for residue SO4 A 507' 
AD7 Software A SO4 508 ? 1 'binding site for residue SO4 A 508' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS A 7   ? CYS D 325 . ? 1_555 ? 
2  AC1 4 CYS A 12  ? CYS D 330 . ? 1_555 ? 
3  AC1 4 HIS A 25  ? HIS D 343 . ? 1_555 ? 
4  AC1 4 HIS A 29  ? HIS D 347 . ? 1_555 ? 
5  AC2 4 CYS A 37  ? CYS D 355 . ? 1_555 ? 
6  AC2 4 CYS A 42  ? CYS D 360 . ? 1_555 ? 
7  AC2 4 HIS A 55  ? HIS D 373 . ? 1_555 ? 
8  AC2 4 HIS A 59  ? HIS D 377 . ? 1_555 ? 
9  AC3 4 CYS A 67  ? CYS D 385 . ? 1_555 ? 
10 AC3 4 CYS A 70  ? CYS D 388 . ? 1_555 ? 
11 AC3 4 HIS A 83  ? HIS D 401 . ? 1_555 ? 
12 AC3 4 HIS A 87  ? HIS D 405 . ? 1_555 ? 
13 AC4 4 CYS A 95  ? CYS D 413 . ? 1_555 ? 
14 AC4 4 CYS A 100 ? CYS D 418 . ? 1_555 ? 
15 AC4 4 HIS A 113 ? HIS D 431 . ? 1_555 ? 
16 AC4 4 HIS A 117 ? HIS D 435 . ? 1_555 ? 
17 AC5 4 ARG D 3   ? ARG A 321 . ? 2_655 ? 
18 AC5 4 LYS D 14  ? LYS A 332 . ? 2_655 ? 
19 AC5 4 ARG D 15  ? ARG A 333 . ? 2_655 ? 
20 AC5 4 ARG A 44  ? ARG D 362 . ? 1_555 ? 
21 AC6 4 TYR A 16  ? TYR D 334 . ? 1_555 ? 
22 AC6 4 PHE A 17  ? PHE D 335 . ? 1_555 ? 
23 AC6 4 LYS A 18  ? LYS D 336 . ? 1_555 ? 
24 AC6 4 HIS A 21  ? HIS D 339 . ? 1_555 ? 
25 AC7 4 ARG D 119 ? ARG A 437 . ? 2_655 ? 
26 AC7 4 LYS A 18  ? LYS D 336 . ? 1_555 ? 
27 AC7 4 LEU A 19  ? LEU D 337 . ? 1_555 ? 
28 AC7 4 SER A 20  ? SER D 338 . ? 1_555 ? 
29 AC8 1 ARG A 72  ? ARG D 390 . ? 1_555 ? 
30 AC9 4 CYS D 7   ? CYS A 325 . ? 1_555 ? 
31 AC9 4 CYS D 12  ? CYS A 330 . ? 1_555 ? 
32 AC9 4 HIS D 25  ? HIS A 343 . ? 1_555 ? 
33 AC9 4 HIS D 29  ? HIS A 347 . ? 1_555 ? 
34 AD1 4 CYS D 37  ? CYS A 355 . ? 1_555 ? 
35 AD1 4 CYS D 42  ? CYS A 360 . ? 1_555 ? 
36 AD1 4 HIS D 55  ? HIS A 373 . ? 1_555 ? 
37 AD1 4 HIS D 59  ? HIS A 377 . ? 1_555 ? 
38 AD2 4 CYS D 67  ? CYS A 385 . ? 1_555 ? 
39 AD2 4 CYS D 70  ? CYS A 388 . ? 1_555 ? 
40 AD2 4 HIS D 83  ? HIS A 401 . ? 1_555 ? 
41 AD2 4 HIS D 87  ? HIS A 405 . ? 1_555 ? 
42 AD3 4 CYS D 95  ? CYS A 413 . ? 1_555 ? 
43 AD3 4 CYS D 100 ? CYS A 418 . ? 1_555 ? 
44 AD3 4 HIS D 113 ? HIS A 431 . ? 1_555 ? 
45 AD3 4 HIS D 117 ? HIS A 435 . ? 1_555 ? 
46 AD4 2 ARG D 44  ? ARG A 362 . ? 1_555 ? 
47 AD4 2 ARG D 58  ? ARG A 376 . ? 1_555 ? 
48 AD5 4 TYR D 16  ? TYR A 334 . ? 1_555 ? 
49 AD5 4 PHE D 17  ? PHE A 335 . ? 1_555 ? 
50 AD5 4 LYS D 18  ? LYS A 336 . ? 1_555 ? 
51 AD5 4 HIS D 21  ? HIS A 339 . ? 1_555 ? 
52 AD6 6 LYS D 14  ? LYS A 332 . ? 1_555 ? 
53 AD6 6 TYR D 16  ? TYR A 334 . ? 1_555 ? 
54 AD6 6 HIS D 25  ? HIS A 343 . ? 1_555 ? 
55 AD6 6 LYS D 28  ? LYS A 346 . ? 1_555 ? 
56 AD6 6 GLU A 32  ? GLU D 350 . ? 3_665 ? 
57 AD6 6 LYS A 33  ? LYS D 351 . ? 3_665 ? 
58 AD7 1 ARG D 72  ? ARG A 390 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6B0Q 
_atom_sites.fract_transf_matrix[1][1]   0.006186 
_atom_sites.fract_transf_matrix[1][2]   0.003571 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007143 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.023712 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . HIS A  1 1   ? 85.302 34.912  -42.492 1.00 93.94  ? 319 HIS D N     1 
ATOM   2    C  CA    . HIS A  1 1   ? 85.539 33.480  -42.621 1.00 88.01  ? 319 HIS D CA    1 
ATOM   3    C  C     . HIS A  1 1   ? 84.817 32.702  -41.532 1.00 86.80  ? 319 HIS D C     1 
ATOM   4    O  O     . HIS A  1 1   ? 84.762 33.124  -40.378 1.00 88.98  ? 319 HIS D O     1 
ATOM   5    C  CB    . HIS A  1 1   ? 87.036 33.172  -42.572 1.00 85.82  ? 319 HIS D CB    1 
ATOM   6    N  N     . MET A  1 2   ? 84.256 31.561  -41.915 1.00 84.51  ? 320 MET D N     1 
ATOM   7    C  CA    . MET A  1 2   ? 83.603 30.661  -40.984 1.00 83.50  ? 320 MET D CA    1 
ATOM   8    C  C     . MET A  1 2   ? 84.379 29.352  -40.930 1.00 78.33  ? 320 MET D C     1 
ATOM   9    O  O     . MET A  1 2   ? 85.161 29.028  -41.829 1.00 76.85  ? 320 MET D O     1 
ATOM   10   C  CB    . MET A  1 2   ? 82.141 30.410  -41.380 1.00 85.70  ? 320 MET D CB    1 
ATOM   11   C  CG    . MET A  1 2   ? 81.256 29.917  -40.241 1.00 87.29  ? 320 MET D CG    1 
ATOM   12   S  SD    . MET A  1 2   ? 81.069 31.128  -38.918 1.00 92.65  ? 320 MET D SD    1 
ATOM   13   C  CE    . MET A  1 2   ? 80.148 30.171  -37.722 1.00 90.76  ? 320 MET D CE    1 
ATOM   14   N  N     . ARG A  1 3   ? 84.154 28.609  -39.859 1.00 76.37  ? 321 ARG D N     1 
ATOM   15   C  CA    . ARG A  1 3   ? 84.899 27.397  -39.555 1.00 71.51  ? 321 ARG D CA    1 
ATOM   16   C  C     . ARG A  1 3   ? 84.317 26.207  -40.317 1.00 67.00  ? 321 ARG D C     1 
ATOM   17   O  O     . ARG A  1 3   ? 83.099 26.111  -40.484 1.00 67.54  ? 321 ARG D O     1 
ATOM   18   C  CB    . ARG A  1 3   ? 84.872 27.116  -38.053 1.00 71.33  ? 321 ARG D CB    1 
ATOM   19   C  CG    . ARG A  1 3   ? 85.384 28.262  -37.183 1.00 74.92  ? 321 ARG D CG    1 
ATOM   20   C  CD    . ARG A  1 3   ? 84.278 29.237  -36.786 1.00 79.09  ? 321 ARG D CD    1 
ATOM   21   N  NE    . ARG A  1 3   ? 83.956 29.164  -35.364 1.00 79.66  ? 321 ARG D NE    1 
ATOM   22   C  CZ    . ARG A  1 3   ? 83.076 29.952  -34.753 1.00 83.50  ? 321 ARG D CZ    1 
ATOM   23   N  NH1   . ARG A  1 3   ? 82.424 30.882  -35.438 1.00 86.92  ? 321 ARG D NH1   1 
ATOM   24   N  NH2   . ARG A  1 3   ? 82.849 29.812  -33.454 1.00 84.66  ? 321 ARG D NH2   1 
ATOM   25   N  N     . PRO A  1 4   ? 85.164 25.292  -40.781 1.00 62.63  ? 322 PRO D N     1 
ATOM   26   C  CA    . PRO A  1 4   ? 84.669 24.152  -41.566 1.00 59.79  ? 322 PRO D CA    1 
ATOM   27   C  C     . PRO A  1 4   ? 84.066 23.046  -40.714 1.00 58.63  ? 322 PRO D C     1 
ATOM   28   O  O     . PRO A  1 4   ? 83.205 22.296  -41.183 1.00 57.88  ? 322 PRO D O     1 
ATOM   29   C  CB    . PRO A  1 4   ? 85.927 23.650  -42.293 1.00 57.37  ? 322 PRO D CB    1 
ATOM   30   C  CG    . PRO A  1 4   ? 87.013 24.667  -42.004 1.00 59.51  ? 322 PRO D CG    1 
ATOM   31   C  CD    . PRO A  1 4   ? 86.632 25.327  -40.725 1.00 61.53  ? 322 PRO D CD    1 
ATOM   32   N  N     . PHE A  1 5   ? 84.515 22.925  -39.470 1.00 58.97  ? 323 PHE D N     1 
ATOM   33   C  CA    . PHE A  1 5   ? 84.251 21.744  -38.663 1.00 57.35  ? 323 PHE D CA    1 
ATOM   34   C  C     . PHE A  1 5   ? 83.244 22.044  -37.560 1.00 60.57  ? 323 PHE D C     1 
ATOM   35   O  O     . PHE A  1 5   ? 83.012 23.197  -37.192 1.00 64.05  ? 323 PHE D O     1 
ATOM   36   C  CB    . PHE A  1 5   ? 85.558 21.207  -38.077 1.00 55.20  ? 323 PHE D CB    1 
ATOM   37   C  CG    . PHE A  1 5   ? 86.700 21.240  -39.050 1.00 53.26  ? 323 PHE D CG    1 
ATOM   38   C  CD1   . PHE A  1 5   ? 86.677 20.453  -40.189 1.00 50.81  ? 323 PHE D CD1   1 
ATOM   39   C  CD2   . PHE A  1 5   ? 87.787 22.070  -38.837 1.00 54.31  ? 323 PHE D CD2   1 
ATOM   40   C  CE1   . PHE A  1 5   ? 87.721 20.487  -41.093 1.00 50.25  ? 323 PHE D CE1   1 
ATOM   41   C  CE2   . PHE A  1 5   ? 88.835 22.106  -39.737 1.00 53.64  ? 323 PHE D CE2   1 
ATOM   42   C  CZ    . PHE A  1 5   ? 88.801 21.313  -40.866 1.00 51.96  ? 323 PHE D CZ    1 
ATOM   43   N  N     . MET A  1 6   ? 82.650 20.975  -37.033 1.00 60.09  ? 324 MET D N     1 
ATOM   44   C  CA    . MET A  1 6   ? 81.522 21.085  -36.119 1.00 63.40  ? 324 MET D CA    1 
ATOM   45   C  C     . MET A  1 6   ? 81.436 19.814  -35.284 1.00 62.68  ? 324 MET D C     1 
ATOM   46   O  O     . MET A  1 6   ? 81.902 18.751  -35.702 1.00 60.21  ? 324 MET D O     1 
ATOM   47   C  CB    . MET A  1 6   ? 80.220 21.324  -36.901 1.00 65.46  ? 324 MET D CB    1 
ATOM   48   C  CG    . MET A  1 6   ? 78.933 21.250  -36.088 1.00 68.67  ? 324 MET D CG    1 
ATOM   49   S  SD    . MET A  1 6   ? 77.443 21.311  -37.100 1.00 71.31  ? 324 MET D SD    1 
ATOM   50   C  CE    . MET A  1 6   ? 77.476 23.008  -37.665 1.00 73.96  ? 324 MET D CE    1 
ATOM   51   N  N     . CYS A  1 7   ? 80.850 19.941  -34.094 1.00 65.24  ? 325 CYS D N     1 
ATOM   52   C  CA    . CYS A  1 7   ? 80.555 18.795  -33.244 1.00 64.74  ? 325 CYS D CA    1 
ATOM   53   C  C     . CYS A  1 7   ? 79.182 18.239  -33.601 1.00 65.71  ? 325 CYS D C     1 
ATOM   54   O  O     . CYS A  1 7   ? 78.198 18.984  -33.655 1.00 68.54  ? 325 CYS D O     1 
ATOM   55   C  CB    . CYS A  1 7   ? 80.600 19.189  -31.766 1.00 66.94  ? 325 CYS D CB    1 
ATOM   56   S  SG    . CYS A  1 7   ? 80.276 17.830  -30.616 1.00 67.88  ? 325 CYS D SG    1 
ATOM   57   N  N     . ALA A  1 8   ? 79.118 16.930  -33.843 1.00 63.40  ? 326 ALA D N     1 
ATOM   58   C  CA    . ALA A  1 8   ? 77.880 16.274  -34.247 1.00 64.53  ? 326 ALA D CA    1 
ATOM   59   C  C     . ALA A  1 8   ? 76.955 15.965  -33.076 1.00 68.05  ? 326 ALA D C     1 
ATOM   60   O  O     . ALA A  1 8   ? 75.970 15.240  -33.260 1.00 70.43  ? 326 ALA D O     1 
ATOM   61   C  CB    . ALA A  1 8   ? 78.193 14.986  -35.013 1.00 62.49  ? 326 ALA D CB    1 
ATOM   62   N  N     . TYR A  1 9   ? 77.243 16.489  -31.889 1.00 69.77  ? 327 TYR D N     1 
ATOM   63   C  CA    . TYR A  1 9   ? 76.370 16.254  -30.751 1.00 73.98  ? 327 TYR D CA    1 
ATOM   64   C  C     . TYR A  1 9   ? 75.085 17.063  -30.903 1.00 77.37  ? 327 TYR D C     1 
ATOM   65   O  O     . TYR A  1 9   ? 75.122 18.220  -31.336 1.00 77.86  ? 327 TYR D O     1 
ATOM   66   C  CB    . TYR A  1 9   ? 77.068 16.624  -29.443 1.00 74.89  ? 327 TYR D CB    1 
ATOM   67   N  N     . PRO A  1 10  ? 73.943 16.489  -30.555 1.00 79.29  ? 328 PRO D N     1 
ATOM   68   C  CA    . PRO A  1 10  ? 72.672 17.209  -30.700 1.00 83.22  ? 328 PRO D CA    1 
ATOM   69   C  C     . PRO A  1 10  ? 72.501 18.293  -29.649 1.00 87.64  ? 328 PRO D C     1 
ATOM   70   O  O     . PRO A  1 10  ? 71.867 18.073  -28.612 1.00 92.19  ? 328 PRO D O     1 
ATOM   71   C  CB    . PRO A  1 10  ? 71.622 16.100  -30.541 1.00 86.09  ? 328 PRO D CB    1 
ATOM   72   C  CG    . PRO A  1 10  ? 72.373 14.809  -30.731 1.00 82.48  ? 328 PRO D CG    1 
ATOM   73   C  CD    . PRO A  1 10  ? 73.743 15.074  -30.210 1.00 79.34  ? 328 PRO D CD    1 
ATOM   74   N  N     . GLY A  1 11  ? 73.072 19.467  -29.905 1.00 87.94  ? 329 GLY D N     1 
ATOM   75   C  CA    . GLY A  1 11  ? 72.980 20.573  -28.974 1.00 93.54  ? 329 GLY D CA    1 
ATOM   76   C  C     . GLY A  1 11  ? 74.257 21.381  -28.896 1.00 91.69  ? 329 GLY D C     1 
ATOM   77   O  O     . GLY A  1 11  ? 74.230 22.570  -28.565 1.00 94.10  ? 329 GLY D O     1 
ATOM   78   N  N     . CYS A  1 12  ? 75.385 20.746  -29.206 1.00 87.48  ? 330 CYS D N     1 
ATOM   79   C  CA    . CYS A  1 12  ? 76.681 21.421  -29.220 1.00 85.53  ? 330 CYS D CA    1 
ATOM   80   C  C     . CYS A  1 12  ? 76.948 21.901  -30.641 1.00 83.86  ? 330 CYS D C     1 
ATOM   81   O  O     . CYS A  1 12  ? 77.366 21.126  -31.505 1.00 81.40  ? 330 CYS D O     1 
ATOM   82   C  CB    . CYS A  1 12  ? 77.783 20.490  -28.726 1.00 82.07  ? 330 CYS D CB    1 
ATOM   83   S  SG    . CYS A  1 12  ? 79.421 21.251  -28.666 1.00 78.71  ? 330 CYS D SG    1 
ATOM   84   N  N     . ASN A  1 13  ? 76.696 23.186  -30.888 1.00 86.49  ? 331 ASN D N     1 
ATOM   85   C  CA    . ASN A  1 13  ? 76.932 23.800  -32.189 1.00 85.31  ? 331 ASN D CA    1 
ATOM   86   C  C     . ASN A  1 13  ? 78.276 24.518  -32.252 1.00 83.76  ? 331 ASN D C     1 
ATOM   87   O  O     . ASN A  1 13  ? 78.437 25.468  -33.025 1.00 84.93  ? 331 ASN D O     1 
ATOM   88   C  CB    . ASN A  1 13  ? 75.797 24.763  -32.534 1.00 90.02  ? 331 ASN D CB    1 
ATOM   89   N  N     . LYS A  1 14  ? 79.243 24.084  -31.447 1.00 81.84  ? 332 LYS D N     1 
ATOM   90   C  CA    . LYS A  1 14  ? 80.560 24.706  -31.455 1.00 80.66  ? 332 LYS D CA    1 
ATOM   91   C  C     . LYS A  1 14  ? 81.314 24.324  -32.723 1.00 76.26  ? 332 LYS D C     1 
ATOM   92   O  O     . LYS A  1 14  ? 81.400 23.144  -33.076 1.00 73.24  ? 332 LYS D O     1 
ATOM   93   C  CB    . LYS A  1 14  ? 81.352 24.288  -30.218 1.00 80.34  ? 332 LYS D CB    1 
ATOM   94   N  N     . ARG A  1 15  ? 81.859 25.326  -33.407 1.00 75.86  ? 333 ARG D N     1 
ATOM   95   C  CA    . ARG A  1 15  ? 82.563 25.140  -34.667 1.00 71.89  ? 333 ARG D CA    1 
ATOM   96   C  C     . ARG A  1 15  ? 83.979 25.684  -34.538 1.00 71.45  ? 333 ARG D C     1 
ATOM   97   O  O     . ARG A  1 15  ? 84.196 26.731  -33.920 1.00 74.75  ? 333 ARG D O     1 
ATOM   98   C  CB    . ARG A  1 15  ? 81.817 25.836  -35.811 1.00 72.93  ? 333 ARG D CB    1 
ATOM   99   C  CG    . ARG A  1 15  ? 80.306 25.631  -35.763 1.00 74.28  ? 333 ARG D CG    1 
ATOM   100  C  CD    . ARG A  1 15  ? 79.614 26.197  -36.992 1.00 75.73  ? 333 ARG D CD    1 
ATOM   101  N  NE    . ARG A  1 15  ? 78.159 26.146  -36.874 1.00 78.39  ? 333 ARG D NE    1 
ATOM   102  C  CZ    . ARG A  1 15  ? 77.408 27.169  -36.481 1.00 83.11  ? 333 ARG D CZ    1 
ATOM   103  N  NH1   . ARG A  1 15  ? 77.977 28.324  -36.171 1.00 85.56  ? 333 ARG D NH1   1 
ATOM   104  N  NH2   . ARG A  1 15  ? 76.091 27.041  -36.398 1.00 85.98  ? 333 ARG D NH2   1 
ATOM   105  N  N     . TYR A  1 16  ? 84.942 24.973  -35.124 1.00 67.90  ? 334 TYR D N     1 
ATOM   106  C  CA    . TYR A  1 16  ? 86.355 25.261  -34.918 1.00 67.66  ? 334 TYR D CA    1 
ATOM   107  C  C     . TYR A  1 16  ? 87.081 25.381  -36.250 1.00 64.89  ? 334 TYR D C     1 
ATOM   108  O  O     . TYR A  1 16  ? 86.843 24.594  -37.171 1.00 62.35  ? 334 TYR D O     1 
ATOM   109  C  CB    . TYR A  1 16  ? 87.018 24.170  -34.066 1.00 66.82  ? 334 TYR D CB    1 
ATOM   110  C  CG    . TYR A  1 16  ? 86.358 23.960  -32.722 1.00 69.22  ? 334 TYR D CG    1 
ATOM   111  C  CD1   . TYR A  1 16  ? 86.791 24.652  -31.598 1.00 72.43  ? 334 TYR D CD1   1 
ATOM   112  C  CD2   . TYR A  1 16  ? 85.300 23.070  -32.576 1.00 68.42  ? 334 TYR D CD2   1 
ATOM   113  C  CE1   . TYR A  1 16  ? 86.191 24.464  -30.367 1.00 74.34  ? 334 TYR D CE1   1 
ATOM   114  C  CE2   . TYR A  1 16  ? 84.693 22.877  -31.349 1.00 70.17  ? 334 TYR D CE2   1 
ATOM   115  C  CZ    . TYR A  1 16  ? 85.144 23.576  -30.248 1.00 73.04  ? 334 TYR D CZ    1 
ATOM   116  O  OH    . TYR A  1 16  ? 84.547 23.390  -29.023 1.00 75.24  ? 334 TYR D OH    1 
ATOM   117  N  N     . PHE A  1 17  ? 87.964 26.381  -36.347 1.00 65.32  ? 335 PHE D N     1 
ATOM   118  C  CA    . PHE A  1 17  ? 88.827 26.496  -37.518 1.00 62.85  ? 335 PHE D CA    1 
ATOM   119  C  C     . PHE A  1 17  ? 89.786 25.319  -37.619 1.00 60.75  ? 335 PHE D C     1 
ATOM   120  O  O     . PHE A  1 17  ? 90.154 24.909  -38.726 1.00 59.69  ? 335 PHE D O     1 
ATOM   121  C  CB    . PHE A  1 17  ? 89.629 27.799  -37.470 1.00 66.69  ? 335 PHE D CB    1 
ATOM   122  C  CG    . PHE A  1 17  ? 88.802 29.039  -37.653 1.00 67.12  ? 335 PHE D CG    1 
ATOM   123  C  CD1   . PHE A  1 17  ? 88.407 29.444  -38.917 1.00 65.18  ? 335 PHE D CD1   1 
ATOM   124  C  CD2   . PHE A  1 17  ? 88.442 29.813  -36.563 1.00 69.44  ? 335 PHE D CD2   1 
ATOM   125  C  CE1   . PHE A  1 17  ? 87.654 30.589  -39.089 1.00 70.45  ? 335 PHE D CE1   1 
ATOM   126  C  CE2   . PHE A  1 17  ? 87.688 30.959  -36.728 1.00 72.63  ? 335 PHE D CE2   1 
ATOM   127  C  CZ    . PHE A  1 17  ? 87.294 31.348  -37.993 1.00 72.65  ? 335 PHE D CZ    1 
ATOM   128  N  N     . LYS A  1 18  ? 90.198 24.767  -36.483 1.00 62.62  ? 336 LYS D N     1 
ATOM   129  C  CA    . LYS A  1 18  ? 91.216 23.730  -36.424 1.00 59.74  ? 336 LYS D CA    1 
ATOM   130  C  C     . LYS A  1 18  ? 90.588 22.402  -36.027 1.00 58.08  ? 336 LYS D C     1 
ATOM   131  O  O     . LYS A  1 18  ? 89.669 22.359  -35.203 1.00 59.36  ? 336 LYS D O     1 
ATOM   132  C  CB    . LYS A  1 18  ? 92.312 24.102  -35.422 1.00 61.61  ? 336 LYS D CB    1 
ATOM   133  C  CG    . LYS A  1 18  ? 92.802 25.536  -35.533 1.00 65.01  ? 336 LYS D CG    1 
ATOM   134  C  CD    . LYS A  1 18  ? 93.767 25.869  -34.405 1.00 67.62  ? 336 LYS D CD    1 
ATOM   135  C  CE    . LYS A  1 18  ? 94.306 27.287  -34.527 1.00 72.14  ? 336 LYS D CE    1 
ATOM   136  N  NZ    . LYS A  1 18  ? 93.236 28.313  -34.386 1.00 73.36  ? 336 LYS D NZ    1 
ATOM   137  N  N     . LEU A  1 19  ? 91.090 21.317  -36.620 1.00 57.13  ? 337 LEU D N     1 
ATOM   138  C  CA    . LEU A  1 19  ? 90.641 19.985  -36.229 1.00 55.41  ? 337 LEU D CA    1 
ATOM   139  C  C     . LEU A  1 19  ? 91.136 19.614  -34.839 1.00 58.09  ? 337 LEU D C     1 
ATOM   140  O  O     . LEU A  1 19  ? 90.450 18.887  -34.111 1.00 58.52  ? 337 LEU D O     1 
ATOM   141  C  CB    . LEU A  1 19  ? 91.114 18.952  -37.250 1.00 51.60  ? 337 LEU D CB    1 
ATOM   142  C  CG    . LEU A  1 19  ? 90.456 19.004  -38.626 1.00 49.69  ? 337 LEU D CG    1 
ATOM   143  C  CD1   . LEU A  1 19  ? 91.333 18.310  -39.647 1.00 49.29  ? 337 LEU D CD1   1 
ATOM   144  C  CD2   . LEU A  1 19  ? 89.085 18.355  -38.570 1.00 47.74  ? 337 LEU D CD2   1 
ATOM   145  N  N     . SER A  1 20  ? 92.321 20.097  -34.459 1.00 60.22  ? 338 SER D N     1 
ATOM   146  C  CA    . SER A  1 20  ? 92.866 19.787  -33.141 1.00 62.31  ? 338 SER D CA    1 
ATOM   147  C  C     . SER A  1 20  ? 91.966 20.310  -32.029 1.00 64.35  ? 338 SER D C     1 
ATOM   148  O  O     . SER A  1 20  ? 91.794 19.649  -30.998 1.00 65.56  ? 338 SER D O     1 
ATOM   149  C  CB    . SER A  1 20  ? 94.276 20.363  -33.013 1.00 65.53  ? 338 SER D CB    1 
ATOM   150  O  OG    . SER A  1 20  ? 94.304 21.734  -33.376 1.00 67.83  ? 338 SER D OG    1 
ATOM   151  N  N     . HIS A  1 21  ? 91.379 21.494  -32.220 1.00 65.31  ? 339 HIS D N     1 
ATOM   152  C  CA    . HIS A  1 21  ? 90.496 22.049  -31.198 1.00 66.68  ? 339 HIS D CA    1 
ATOM   153  C  C     . HIS A  1 21  ? 89.186 21.276  -31.116 1.00 63.95  ? 339 HIS D C     1 
ATOM   154  O  O     . HIS A  1 21  ? 88.640 21.085  -30.023 1.00 65.38  ? 339 HIS D O     1 
ATOM   155  C  CB    . HIS A  1 21  ? 90.233 23.529  -31.476 1.00 68.21  ? 339 HIS D CB    1 
ATOM   156  C  CG    . HIS A  1 21  ? 91.414 24.411  -31.217 1.00 71.55  ? 339 HIS D CG    1 
ATOM   157  N  ND1   . HIS A  1 21  ? 91.325 25.787  -31.192 1.00 75.21  ? 339 HIS D ND1   1 
ATOM   158  C  CD2   . HIS A  1 21  ? 92.712 24.114  -30.969 1.00 72.68  ? 339 HIS D CD2   1 
ATOM   159  C  CE1   . HIS A  1 21  ? 92.517 26.298  -30.940 1.00 78.42  ? 339 HIS D CE1   1 
ATOM   160  N  NE2   . HIS A  1 21  ? 93.376 25.305  -30.801 1.00 76.58  ? 339 HIS D NE2   1 
ATOM   161  N  N     . LEU A  1 22  ? 88.662 20.828  -32.259 1.00 59.56  ? 340 LEU D N     1 
ATOM   162  C  CA    . LEU A  1 22  ? 87.457 20.005  -32.242 1.00 57.39  ? 340 LEU D CA    1 
ATOM   163  C  C     . LEU A  1 22  ? 87.718 18.664  -31.568 1.00 56.36  ? 340 LEU D C     1 
ATOM   164  O  O     . LEU A  1 22  ? 86.841 18.125  -30.883 1.00 57.53  ? 340 LEU D O     1 
ATOM   165  C  CB    . LEU A  1 22  ? 86.938 19.803  -33.667 1.00 55.38  ? 340 LEU D CB    1 
ATOM   166  C  CG    . LEU A  1 22  ? 85.813 18.783  -33.874 1.00 51.98  ? 340 LEU D CG    1 
ATOM   167  C  CD1   . LEU A  1 22  ? 84.585 19.144  -33.050 1.00 53.91  ? 340 LEU D CD1   1 
ATOM   168  C  CD2   . LEU A  1 22  ? 85.455 18.660  -35.348 1.00 49.73  ? 340 LEU D CD2   1 
ATOM   169  N  N     . GLN A  1 23  ? 88.922 18.115  -31.746 1.00 55.57  ? 341 GLN D N     1 
ATOM   170  C  CA    . GLN A  1 23  ? 89.263 16.849  -31.104 1.00 55.31  ? 341 GLN D CA    1 
ATOM   171  C  C     . GLN A  1 23  ? 89.266 16.984  -29.587 1.00 58.93  ? 341 GLN D C     1 
ATOM   172  O  O     . GLN A  1 23  ? 88.760 16.107  -28.877 1.00 59.83  ? 341 GLN D O     1 
ATOM   173  C  CB    . GLN A  1 23  ? 90.621 16.361  -31.606 1.00 54.32  ? 341 GLN D CB    1 
ATOM   174  C  CG    . GLN A  1 23  ? 90.970 14.947  -31.181 1.00 53.73  ? 341 GLN D CG    1 
ATOM   175  C  CD    . GLN A  1 23  ? 92.331 14.513  -31.687 1.00 53.14  ? 341 GLN D CD    1 
ATOM   176  O  OE1   . GLN A  1 23  ? 93.213 15.340  -31.915 1.00 54.35  ? 341 GLN D OE1   1 
ATOM   177  N  NE2   . GLN A  1 23  ? 92.506 13.210  -31.870 1.00 51.93  ? 341 GLN D NE2   1 
ATOM   178  N  N     . MET A  1 24  ? 89.834 18.078  -29.071 1.00 61.85  ? 342 MET D N     1 
ATOM   179  C  CA    . MET A  1 24  ? 89.796 18.322  -27.633 1.00 66.23  ? 342 MET D CA    1 
ATOM   180  C  C     . MET A  1 24  ? 88.363 18.486  -27.144 1.00 67.95  ? 342 MET D C     1 
ATOM   181  O  O     . MET A  1 24  ? 88.019 18.043  -26.041 1.00 69.41  ? 342 MET D O     1 
ATOM   182  C  CB    . MET A  1 24  ? 90.622 19.563  -27.290 1.00 69.74  ? 342 MET D CB    1 
ATOM   183  C  CG    . MET A  1 24  ? 92.048 19.532  -27.815 1.00 70.09  ? 342 MET D CG    1 
ATOM   184  S  SD    . MET A  1 24  ? 92.859 21.139  -27.692 1.00 74.74  ? 342 MET D SD    1 
ATOM   185  C  CE    . MET A  1 24  ? 94.412 20.800  -28.518 1.00 73.89  ? 342 MET D CE    1 
ATOM   186  N  N     . HIS A  1 25  ? 87.512 19.121  -27.954 1.00 68.71  ? 343 HIS D N     1 
ATOM   187  C  CA    . HIS A  1 25  ? 86.116 19.303  -27.573 1.00 72.26  ? 343 HIS D CA    1 
ATOM   188  C  C     . HIS A  1 25  ? 85.343 17.992  -27.615 1.00 68.69  ? 343 HIS D C     1 
ATOM   189  O  O     . HIS A  1 25  ? 84.438 17.784  -26.800 1.00 70.98  ? 343 HIS D O     1 
ATOM   190  C  CB    . HIS A  1 25  ? 85.454 20.334  -28.488 1.00 76.49  ? 343 HIS D CB    1 
ATOM   191  C  CG    . HIS A  1 25  ? 83.979 20.475  -28.270 1.00 84.92  ? 343 HIS D CG    1 
ATOM   192  N  ND1   . HIS A  1 25  ? 83.443 21.343  -27.344 1.00 90.54  ? 343 HIS D ND1   1 
ATOM   193  C  CD2   . HIS A  1 25  ? 82.928 19.855  -28.857 1.00 85.44  ? 343 HIS D CD2   1 
ATOM   194  C  CE1   . HIS A  1 25  ? 82.125 21.253  -27.371 1.00 92.14  ? 343 HIS D CE1   1 
ATOM   195  N  NE2   . HIS A  1 25  ? 81.787 20.356  -28.280 1.00 88.48  ? 343 HIS D NE2   1 
ATOM   196  N  N     . SER A  1 26  ? 85.681 17.103  -28.553 1.00 63.40  ? 344 SER D N     1 
ATOM   197  C  CA    . SER A  1 26  ? 84.953 15.844  -28.687 1.00 60.99  ? 344 SER D CA    1 
ATOM   198  C  C     . SER A  1 26  ? 85.049 14.998  -27.426 1.00 61.96  ? 344 SER D C     1 
ATOM   199  O  O     . SER A  1 26  ? 84.133 14.224  -27.126 1.00 63.30  ? 344 SER D O     1 
ATOM   200  C  CB    . SER A  1 26  ? 85.480 15.060  -29.889 1.00 57.75  ? 344 SER D CB    1 
ATOM   201  O  OG    . SER A  1 26  ? 84.749 13.861  -30.077 1.00 57.89  ? 344 SER D OG    1 
ATOM   202  N  N     . ARG A  1 27  ? 86.144 15.129  -26.678 1.00 62.09  ? 345 ARG D N     1 
ATOM   203  C  CA    . ARG A  1 27  ? 86.323 14.375  -25.445 1.00 64.51  ? 345 ARG D CA    1 
ATOM   204  C  C     . ARG A  1 27  ? 85.524 14.941  -24.279 1.00 67.45  ? 345 ARG D C     1 
ATOM   205  O  O     . ARG A  1 27  ? 85.425 14.280  -23.241 1.00 69.91  ? 345 ARG D O     1 
ATOM   206  C  CB    . ARG A  1 27  ? 87.809 14.321  -25.084 1.00 66.14  ? 345 ARG D CB    1 
ATOM   207  C  CG    . ARG A  1 27  ? 88.636 13.547  -26.095 1.00 64.38  ? 345 ARG D CG    1 
ATOM   208  C  CD    . ARG A  1 27  ? 90.117 13.856  -25.982 1.00 66.90  ? 345 ARG D CD    1 
ATOM   209  N  NE    . ARG A  1 27  ? 90.878 13.200  -27.041 1.00 65.55  ? 345 ARG D NE    1 
ATOM   210  C  CZ    . ARG A  1 27  ? 92.165 13.421  -27.284 1.00 67.16  ? 345 ARG D CZ    1 
ATOM   211  N  NH1   . ARG A  1 27  ? 92.774 12.777  -28.270 1.00 65.09  ? 345 ARG D NH1   1 
ATOM   212  N  NH2   . ARG A  1 27  ? 92.842 14.287  -26.543 1.00 70.83  ? 345 ARG D NH2   1 
ATOM   213  N  N     . LYS A  1 28  ? 84.950 16.138  -24.421 1.00 68.08  ? 346 LYS D N     1 
ATOM   214  C  CA    . LYS A  1 28  ? 84.121 16.681  -23.351 1.00 72.20  ? 346 LYS D CA    1 
ATOM   215  C  C     . LYS A  1 28  ? 82.784 15.957  -23.254 1.00 73.38  ? 346 LYS D C     1 
ATOM   216  O  O     . LYS A  1 28  ? 82.213 15.858  -22.162 1.00 76.86  ? 346 LYS D O     1 
ATOM   217  C  CB    . LYS A  1 28  ? 83.903 18.180  -23.561 1.00 72.83  ? 346 LYS D CB    1 
ATOM   218  N  N     . HIS A  1 29  ? 82.270 15.445  -24.375 1.00 71.23  ? 347 HIS D N     1 
ATOM   219  C  CA    . HIS A  1 29  ? 81.004 14.723  -24.366 1.00 75.38  ? 347 HIS D CA    1 
ATOM   220  C  C     . HIS A  1 29  ? 81.146 13.288  -23.871 1.00 74.80  ? 347 HIS D C     1 
ATOM   221  O  O     . HIS A  1 29  ? 80.133 12.666  -23.534 1.00 76.18  ? 347 HIS D O     1 
ATOM   222  C  CB    . HIS A  1 29  ? 80.380 14.726  -25.765 1.00 77.03  ? 347 HIS D CB    1 
ATOM   223  C  CG    . HIS A  1 29  ? 79.859 16.063  -26.194 1.00 84.48  ? 347 HIS D CG    1 
ATOM   224  N  ND1   . HIS A  1 29  ? 78.693 16.603  -25.694 1.00 89.85  ? 347 HIS D ND1   1 
ATOM   225  C  CD2   . HIS A  1 29  ? 80.339 16.965  -27.083 1.00 84.13  ? 347 HIS D CD2   1 
ATOM   226  C  CE1   . HIS A  1 29  ? 78.481 17.781  -26.252 1.00 90.42  ? 347 HIS D CE1   1 
ATOM   227  N  NE2   . HIS A  1 29  ? 79.465 18.025  -27.099 1.00 87.70  ? 347 HIS D NE2   1 
ATOM   228  N  N     . THR A  1 30  ? 82.369 12.751  -23.816 1.00 74.20  ? 348 THR D N     1 
ATOM   229  C  CA    . THR A  1 30  ? 82.614 11.402  -23.304 1.00 76.80  ? 348 THR D CA    1 
ATOM   230  C  C     . THR A  1 30  ? 82.458 11.484  -21.788 1.00 75.72  ? 348 THR D C     1 
ATOM   231  O  O     . THR A  1 30  ? 83.428 11.560  -21.026 1.00 76.60  ? 348 THR D O     1 
ATOM   232  C  CB    . THR A  1 30  ? 83.991 10.892  -23.716 1.00 81.21  ? 348 THR D CB    1 
ATOM   233  N  N     . GLY A  1 31  ? 81.202 11.456  -21.355 1.00 73.99  ? 349 GLY D N     1 
ATOM   234  C  CA    . GLY A  1 31  ? 80.795 12.087  -20.119 1.00 72.33  ? 349 GLY D CA    1 
ATOM   235  C  C     . GLY A  1 31  ? 80.634 11.139  -18.956 1.00 72.80  ? 349 GLY D C     1 
ATOM   236  O  O     . GLY A  1 31  ? 79.749 10.272  -18.951 1.00 72.05  ? 349 GLY D O     1 
ATOM   237  N  N     . GLU A  1 32  ? 81.509 11.297  -17.956 1.00 74.25  ? 350 GLU D N     1 
ATOM   238  C  CA    . GLU A  1 32  ? 81.357 10.675  -16.646 1.00 73.44  ? 350 GLU D CA    1 
ATOM   239  C  C     . GLU A  1 32  ? 79.981 10.960  -16.047 1.00 68.23  ? 350 GLU D C     1 
ATOM   240  O  O     . GLU A  1 32  ? 79.212 10.040  -15.743 1.00 67.41  ? 350 GLU D O     1 
ATOM   241  C  CB    . GLU A  1 32  ? 82.479 11.159  -15.712 1.00 76.43  ? 350 GLU D CB    1 
ATOM   242  C  CG    . GLU A  1 32  ? 82.133 11.213  -14.213 1.00 76.16  ? 350 GLU D CG    1 
ATOM   243  C  CD    . GLU A  1 32  ? 81.972 12.649  -13.695 1.00 75.39  ? 350 GLU D CD    1 
ATOM   244  O  OE1   . GLU A  1 32  ? 81.603 13.528  -14.498 1.00 75.01  ? 350 GLU D OE1   1 
ATOM   245  O  OE2   . GLU A  1 32  ? 82.217 12.909  -12.494 1.00 75.03  ? 350 GLU D OE2   1 
ATOM   246  N  N     . LYS A  1 33  ? 79.659 12.243  -15.884 1.00 65.31  ? 351 LYS D N     1 
ATOM   247  C  CA    . LYS A  1 33  ? 78.308 12.690  -15.545 1.00 60.73  ? 351 LYS D CA    1 
ATOM   248  C  C     . LYS A  1 33  ? 78.045 13.963  -16.335 1.00 59.51  ? 351 LYS D C     1 
ATOM   249  O  O     . LYS A  1 33  ? 78.284 15.074  -15.845 1.00 58.59  ? 351 LYS D O     1 
ATOM   250  C  CB    . LYS A  1 33  ? 78.147 12.955  -14.048 1.00 57.27  ? 351 LYS D CB    1 
ATOM   251  C  CG    . LYS A  1 33  ? 78.130 11.741  -13.135 1.00 56.40  ? 351 LYS D CG    1 
ATOM   252  C  CD    . LYS A  1 33  ? 78.333 12.215  -11.699 1.00 54.28  ? 351 LYS D CD    1 
ATOM   253  C  CE    . LYS A  1 33  ? 78.278 11.082  -10.691 1.00 54.22  ? 351 LYS D CE    1 
ATOM   254  N  NZ    . LYS A  1 33  ? 78.796 11.524  -9.362  1.00 53.59  ? 351 LYS D NZ    1 
ATOM   255  N  N     . PRO A  1 34  ? 77.533 13.840  -17.563 1.00 59.07  ? 352 PRO D N     1 
ATOM   256  C  CA    . PRO A  1 34  ? 77.490 15.015  -18.454 1.00 57.85  ? 352 PRO D CA    1 
ATOM   257  C  C     . PRO A  1 34  ? 76.650 16.170  -17.933 1.00 54.00  ? 352 PRO D C     1 
ATOM   258  O  O     . PRO A  1 34  ? 77.069 17.328  -18.053 1.00 54.43  ? 352 PRO D O     1 
ATOM   259  C  CB    . PRO A  1 34  ? 76.913 14.437  -19.755 1.00 59.73  ? 352 PRO D CB    1 
ATOM   260  C  CG    . PRO A  1 34  ? 76.158 13.222  -19.337 1.00 59.73  ? 352 PRO D CG    1 
ATOM   261  C  CD    . PRO A  1 34  ? 76.926 12.650  -18.178 1.00 60.08  ? 352 PRO D CD    1 
ATOM   262  N  N     . TYR A  1 35  ? 75.484 15.898  -17.355 1.00 50.91  ? 353 TYR D N     1 
ATOM   263  C  CA    . TYR A  1 35  ? 74.553 16.957  -16.980 1.00 47.78  ? 353 TYR D CA    1 
ATOM   264  C  C     . TYR A  1 35  ? 74.951 17.556  -15.635 1.00 45.24  ? 353 TYR D C     1 
ATOM   265  O  O     . TYR A  1 35  ? 74.979 16.853  -14.620 1.00 44.28  ? 353 TYR D O     1 
ATOM   266  C  CB    . TYR A  1 35  ? 73.131 16.406  -16.940 1.00 46.51  ? 353 TYR D CB    1 
ATOM   267  C  CG    . TYR A  1 35  ? 72.740 15.721  -18.229 1.00 48.25  ? 353 TYR D CG    1 
ATOM   268  C  CD1   . TYR A  1 35  ? 72.900 14.350  -18.388 1.00 49.66  ? 353 TYR D CD1   1 
ATOM   269  C  CD2   . TYR A  1 35  ? 72.237 16.449  -19.298 1.00 49.15  ? 353 TYR D CD2   1 
ATOM   270  C  CE1   . TYR A  1 35  ? 72.554 13.723  -19.571 1.00 51.64  ? 353 TYR D CE1   1 
ATOM   271  C  CE2   . TYR A  1 35  ? 71.889 15.832  -20.484 1.00 50.85  ? 353 TYR D CE2   1 
ATOM   272  C  CZ    . TYR A  1 35  ? 72.049 14.469  -20.615 1.00 51.92  ? 353 TYR D CZ    1 
ATOM   273  O  OH    . TYR A  1 35  ? 71.703 13.852  -21.795 1.00 54.21  ? 353 TYR D OH    1 
ATOM   274  N  N     . GLN A  1 36  ? 75.253 18.853  -15.630 1.00 44.56  ? 354 GLN D N     1 
ATOM   275  C  CA    . GLN A  1 36  ? 75.688 19.566  -14.437 1.00 43.58  ? 354 GLN D CA    1 
ATOM   276  C  C     . GLN A  1 36  ? 74.727 20.708  -14.135 1.00 42.90  ? 354 GLN D C     1 
ATOM   277  O  O     . GLN A  1 36  ? 74.201 21.349  -15.051 1.00 43.86  ? 354 GLN D O     1 
ATOM   278  C  CB    . GLN A  1 36  ? 77.113 20.110  -14.612 1.00 44.95  ? 354 GLN D CB    1 
ATOM   279  C  CG    . GLN A  1 36  ? 77.634 20.898  -13.420 1.00 44.76  ? 354 GLN D CG    1 
ATOM   280  C  CD    . GLN A  1 36  ? 79.035 21.439  -13.635 1.00 46.93  ? 354 GLN D CD    1 
ATOM   281  O  OE1   . GLN A  1 36  ? 79.960 20.695  -13.961 1.00 48.47  ? 354 GLN D OE1   1 
ATOM   282  N  NE2   . GLN A  1 36  ? 79.198 22.744  -13.452 1.00 47.49  ? 354 GLN D NE2   1 
ATOM   283  N  N     . CYS A  1 37  ? 74.500 20.957  -12.846 1.00 41.51  ? 355 CYS D N     1 
ATOM   284  C  CA    . CYS A  1 37  ? 73.644 22.053  -12.414 1.00 40.93  ? 355 CYS D CA    1 
ATOM   285  C  C     . CYS A  1 37  ? 74.407 23.369  -12.494 1.00 43.26  ? 355 CYS D C     1 
ATOM   286  O  O     . CYS A  1 37  ? 75.531 23.474  -11.994 1.00 44.84  ? 355 CYS D O     1 
ATOM   287  C  CB    . CYS A  1 37  ? 73.152 21.812  -10.987 1.00 39.29  ? 355 CYS D CB    1 
ATOM   288  S  SG    . CYS A  1 37  ? 71.944 23.013  -10.383 1.00 38.82  ? 355 CYS D SG    1 
ATOM   289  N  N     . ASP A  1 38  ? 73.796 24.375  -13.121 1.00 43.85  ? 356 ASP D N     1 
ATOM   290  C  CA    . ASP A  1 38  ? 74.426 25.680  -13.276 1.00 45.80  ? 356 ASP D CA    1 
ATOM   291  C  C     . ASP A  1 38  ? 73.828 26.731  -12.348 1.00 44.54  ? 356 ASP D C     1 
ATOM   292  O  O     . ASP A  1 38  ? 73.985 27.932  -12.593 1.00 46.01  ? 356 ASP D O     1 
ATOM   293  C  CB    . ASP A  1 38  ? 74.350 26.146  -14.730 1.00 48.68  ? 356 ASP D CB    1 
ATOM   294  C  CG    . ASP A  1 38  ? 75.290 25.374  -15.635 1.00 51.49  ? 356 ASP D CG    1 
ATOM   295  O  OD1   . ASP A  1 38  ? 74.804 24.696  -16.565 1.00 52.06  ? 356 ASP D OD1   1 
ATOM   296  O  OD2   . ASP A  1 38  ? 76.516 25.431  -15.402 1.00 53.33  ? 356 ASP D OD2   1 
ATOM   297  N  N     . PHE A  1 39  ? 73.146 26.306  -11.289 1.00 42.66  ? 357 PHE D N     1 
ATOM   298  C  CA    . PHE A  1 39  ? 72.760 27.235  -10.239 1.00 42.88  ? 357 PHE D CA    1 
ATOM   299  C  C     . PHE A  1 39  ? 73.992 27.629  -9.431  1.00 43.88  ? 357 PHE D C     1 
ATOM   300  O  O     . PHE A  1 39  ? 74.957 26.867  -9.323  1.00 43.71  ? 357 PHE D O     1 
ATOM   301  C  CB    . PHE A  1 39  ? 71.697 26.608  -9.336  1.00 41.86  ? 357 PHE D CB    1 
ATOM   302  C  CG    . PHE A  1 39  ? 70.971 27.599  -8.469  1.00 43.24  ? 357 PHE D CG    1 
ATOM   303  C  CD1   . PHE A  1 39  ? 69.898 28.322  -8.968  1.00 44.03  ? 357 PHE D CD1   1 
ATOM   304  C  CD2   . PHE A  1 39  ? 71.354 27.800  -7.153  1.00 44.28  ? 357 PHE D CD2   1 
ATOM   305  C  CE1   . PHE A  1 39  ? 69.225 29.232  -8.170  1.00 45.73  ? 357 PHE D CE1   1 
ATOM   306  C  CE2   . PHE A  1 39  ? 70.685 28.709  -6.349  1.00 45.99  ? 357 PHE D CE2   1 
ATOM   307  C  CZ    . PHE A  1 39  ? 69.619 29.425  -6.859  1.00 46.66  ? 357 PHE D CZ    1 
ATOM   308  N  N     . LYS A  1 40  ? 73.959 28.838  -8.874  1.00 45.34  ? 358 LYS D N     1 
ATOM   309  C  CA    . LYS A  1 40  ? 75.136 29.386  -8.209  1.00 47.64  ? 358 LYS D CA    1 
ATOM   310  C  C     . LYS A  1 40  ? 75.605 28.483  -7.075  1.00 48.08  ? 358 LYS D C     1 
ATOM   311  O  O     . LYS A  1 40  ? 74.830 28.131  -6.180  1.00 47.71  ? 358 LYS D O     1 
ATOM   312  C  CB    . LYS A  1 40  ? 74.846 30.789  -7.675  1.00 49.39  ? 358 LYS D CB    1 
ATOM   313  C  CG    . LYS A  1 40  ? 75.946 31.328  -6.764  1.00 51.62  ? 358 LYS D CG    1 
ATOM   314  C  CD    . LYS A  1 40  ? 75.723 32.787  -6.385  1.00 54.19  ? 358 LYS D CD    1 
ATOM   315  C  CE    . LYS A  1 40  ? 76.006 33.714  -7.556  1.00 55.41  ? 358 LYS D CE    1 
ATOM   316  N  NZ    . LYS A  1 40  ? 75.920 35.147  -7.161  1.00 57.98  ? 358 LYS D NZ    1 
ATOM   317  N  N     . ASP A  1 41  ? 76.881 28.098  -7.137  1.00 49.58  ? 359 ASP D N     1 
ATOM   318  C  CA    . ASP A  1 41  ? 77.562 27.358  -6.073  1.00 50.50  ? 359 ASP D CA    1 
ATOM   319  C  C     . ASP A  1 41  ? 76.920 26.002  -5.798  1.00 48.64  ? 359 ASP D C     1 
ATOM   320  O  O     . ASP A  1 41  ? 76.913 25.530  -4.659  1.00 49.44  ? 359 ASP D O     1 
ATOM   321  C  CB    . ASP A  1 41  ? 77.640 28.182  -4.785  1.00 52.25  ? 359 ASP D CB    1 
ATOM   322  C  CG    . ASP A  1 41  ? 78.501 29.417  -4.941  1.00 55.50  ? 359 ASP D CG    1 
ATOM   323  O  OD1   . ASP A  1 41  ? 79.492 29.357  -5.700  1.00 56.41  ? 359 ASP D OD1   1 
ATOM   324  O  OD2   . ASP A  1 41  ? 78.184 30.449  -4.313  1.00 57.49  ? 359 ASP D OD2   1 
ATOM   325  N  N     . CYS A  1 42  ? 76.382 25.352  -6.828  1.00 46.45  ? 360 CYS D N     1 
ATOM   326  C  CA    . CYS A  1 42  ? 75.924 23.975  -6.702  1.00 43.82  ? 360 CYS D CA    1 
ATOM   327  C  C     . CYS A  1 42  ? 76.767 23.021  -7.538  1.00 44.69  ? 360 CYS D C     1 
ATOM   328  O  O     . CYS A  1 42  ? 77.384 22.102  -6.991  1.00 45.17  ? 360 CYS D O     1 
ATOM   329  C  CB    . CYS A  1 42  ? 74.447 23.865  -7.100  1.00 40.28  ? 360 CYS D CB    1 
ATOM   330  S  SG    . CYS A  1 42  ? 73.850 22.167  -7.154  1.00 36.83  ? 360 CYS D SG    1 
ATOM   331  N  N     . GLU A  1 43  ? 76.815 23.237  -8.856  1.00 45.18  ? 361 GLU D N     1 
ATOM   332  C  CA    . GLU A  1 43  ? 77.699 22.509  -9.772  1.00 46.03  ? 361 GLU D CA    1 
ATOM   333  C  C     . GLU A  1 43  ? 77.636 20.994  -9.573  1.00 44.77  ? 361 GLU D C     1 
ATOM   334  O  O     . GLU A  1 43  ? 78.619 20.283  -9.794  1.00 46.35  ? 361 GLU D O     1 
ATOM   335  C  CB    . GLU A  1 43  ? 79.137 23.016  -9.645  1.00 49.19  ? 361 GLU D CB    1 
ATOM   336  C  CG    . GLU A  1 43  ? 79.260 24.519  -9.853  1.00 51.57  ? 361 GLU D CG    1 
ATOM   337  C  CD    . GLU A  1 43  ? 80.618 25.052  -9.452  1.00 55.15  ? 361 GLU D CD    1 
ATOM   338  O  OE1   . GLU A  1 43  ? 81.443 24.254  -8.968  1.00 56.09  ? 361 GLU D OE1   1 
ATOM   339  O  OE2   . GLU A  1 43  ? 80.860 26.267  -9.617  1.00 57.14  ? 361 GLU D OE2   1 
ATOM   340  N  N     . ARG A  1 44  ? 76.475 20.489  -9.161  1.00 41.64  ? 362 ARG D N     1 
ATOM   341  C  CA    . ARG A  1 44  ? 76.307 19.060  -8.941  1.00 38.91  ? 362 ARG D CA    1 
ATOM   342  C  C     . ARG A  1 44  ? 76.001 18.367  -10.262 1.00 38.36  ? 362 ARG D C     1 
ATOM   343  O  O     . ARG A  1 44  ? 75.109 18.790  -11.004 1.00 37.29  ? 362 ARG D O     1 
ATOM   344  C  CB    . ARG A  1 44  ? 75.191 18.798  -7.930  1.00 35.47  ? 362 ARG D CB    1 
ATOM   345  C  CG    . ARG A  1 44  ? 75.250 17.419  -7.289  1.00 33.97  ? 362 ARG D CG    1 
ATOM   346  C  CD    . ARG A  1 44  ? 74.029 17.145  -6.420  1.00 36.24  ? 362 ARG D CD    1 
ATOM   347  N  NE    . ARG A  1 44  ? 74.327 16.218  -5.331  1.00 37.23  ? 362 ARG D NE    1 
ATOM   348  C  CZ    . ARG A  1 44  ? 74.332 14.894  -5.452  1.00 36.11  ? 362 ARG D CZ    1 
ATOM   349  N  NH1   . ARG A  1 44  ? 74.056 14.332  -6.621  1.00 35.95  ? 362 ARG D NH1   1 
ATOM   350  N  NH2   . ARG A  1 44  ? 74.617 14.132  -4.405  1.00 38.97  ? 362 ARG D NH2   1 
ATOM   351  N  N     . ARG A  1 45  ? 76.740 17.304  -10.554 1.00 39.87  ? 363 ARG D N     1 
ATOM   352  C  CA    . ARG A  1 45  ? 76.630 16.603  -11.822 1.00 41.73  ? 363 ARG D CA    1 
ATOM   353  C  C     . ARG A  1 45  ? 75.747 15.369  -11.679 1.00 40.08  ? 363 ARG D C     1 
ATOM   354  O  O     . ARG A  1 45  ? 75.742 14.702  -10.641 1.00 39.73  ? 363 ARG D O     1 
ATOM   355  C  CB    . ARG A  1 45  ? 78.015 16.209  -12.339 1.00 46.49  ? 363 ARG D CB    1 
ATOM   356  C  CG    . ARG A  1 45  ? 78.933 17.402  -12.555 1.00 50.00  ? 363 ARG D CG    1 
ATOM   357  C  CD    . ARG A  1 45  ? 80.350 16.977  -12.897 1.00 54.68  ? 363 ARG D CD    1 
ATOM   358  N  NE    . ARG A  1 45  ? 81.247 18.126  -12.968 1.00 57.44  ? 363 ARG D NE    1 
ATOM   359  C  CZ    . ARG A  1 45  ? 82.566 18.038  -13.102 1.00 61.49  ? 363 ARG D CZ    1 
ATOM   360  N  NH1   . ARG A  1 45  ? 83.149 16.850  -13.179 1.00 63.95  ? 363 ARG D NH1   1 
ATOM   361  N  NH2   . ARG A  1 45  ? 83.304 19.139  -13.157 1.00 63.64  ? 363 ARG D NH2   1 
ATOM   362  N  N     . PHE A  1 46  ? 74.993 15.077  -12.737 1.00 39.50  ? 364 PHE D N     1 
ATOM   363  C  CA    . PHE A  1 46  ? 74.069 13.955  -12.758 1.00 38.82  ? 364 PHE D CA    1 
ATOM   364  C  C     . PHE A  1 46  ? 74.290 13.126  -14.014 1.00 40.76  ? 364 PHE D C     1 
ATOM   365  O  O     . PHE A  1 46  ? 74.904 13.576  -14.985 1.00 42.19  ? 364 PHE D O     1 
ATOM   366  C  CB    . PHE A  1 46  ? 72.610 14.427  -12.689 1.00 36.97  ? 364 PHE D CB    1 
ATOM   367  C  CG    . PHE A  1 46  ? 72.246 15.059  -11.380 1.00 35.24  ? 364 PHE D CG    1 
ATOM   368  C  CD1   . PHE A  1 46  ? 72.475 16.406  -11.160 1.00 34.93  ? 364 PHE D CD1   1 
ATOM   369  C  CD2   . PHE A  1 46  ? 71.684 14.303  -10.365 1.00 34.67  ? 364 PHE D CD2   1 
ATOM   370  C  CE1   . PHE A  1 46  ? 72.146 16.989  -9.953  1.00 34.27  ? 364 PHE D CE1   1 
ATOM   371  C  CE2   . PHE A  1 46  ? 71.353 14.881  -9.157  1.00 33.94  ? 364 PHE D CE2   1 
ATOM   372  C  CZ    . PHE A  1 46  ? 71.588 16.224  -8.950  1.00 33.80  ? 364 PHE D CZ    1 
ATOM   373  N  N     . SER A  1 47  ? 73.775 11.895  -13.980 1.00 41.10  ? 365 SER D N     1 
ATOM   374  C  CA    . SER A  1 47  ? 73.948 10.980  -15.101 1.00 43.21  ? 365 SER D CA    1 
ATOM   375  C  C     . SER A  1 47  ? 72.912 11.203  -16.195 1.00 43.41  ? 365 SER D C     1 
ATOM   376  O  O     . SER A  1 47  ? 73.190 10.931  -17.368 1.00 45.46  ? 365 SER D O     1 
ATOM   377  C  CB    . SER A  1 47  ? 73.882 9.532   -14.612 1.00 44.21  ? 365 SER D CB    1 
ATOM   378  O  OG    . SER A  1 47  ? 74.777 9.315   -13.535 1.00 44.28  ? 365 SER D OG    1 
ATOM   379  N  N     . ARG A  1 48  ? 71.723 11.684  -15.840 1.00 42.14  ? 366 ARG D N     1 
ATOM   380  C  CA    . ARG A  1 48  ? 70.642 11.869  -16.795 1.00 42.67  ? 366 ARG D CA    1 
ATOM   381  C  C     . ARG A  1 48  ? 70.090 13.284  -16.678 1.00 42.32  ? 366 ARG D C     1 
ATOM   382  O  O     . ARG A  1 48  ? 70.265 13.962  -15.663 1.00 41.35  ? 366 ARG D O     1 
ATOM   383  C  CB    . ARG A  1 48  ? 69.521 10.840  -16.582 1.00 41.49  ? 366 ARG D CB    1 
ATOM   384  C  CG    . ARG A  1 48  ? 70.017 9.430   -16.302 1.00 42.15  ? 366 ARG D CG    1 
ATOM   385  C  CD    . ARG A  1 48  ? 68.917 8.393   -16.459 1.00 42.37  ? 366 ARG D CD    1 
ATOM   386  N  NE    . ARG A  1 48  ? 67.709 8.730   -15.711 1.00 39.65  ? 366 ARG D NE    1 
ATOM   387  C  CZ    . ARG A  1 48  ? 66.731 7.868   -15.451 1.00 39.57  ? 366 ARG D CZ    1 
ATOM   388  N  NH1   . ARG A  1 48  ? 66.825 6.613   -15.871 1.00 41.95  ? 366 ARG D NH1   1 
ATOM   389  N  NH2   . ARG A  1 48  ? 65.663 8.255   -14.767 1.00 37.74  ? 366 ARG D NH2   1 
ATOM   390  N  N     . SER A  1 49  ? 69.415 13.725  -17.743 1.00 43.92  ? 367 SER D N     1 
ATOM   391  C  CA    . SER A  1 49  ? 68.883 15.085  -17.770 1.00 43.87  ? 367 SER D CA    1 
ATOM   392  C  C     . SER A  1 49  ? 67.673 15.229  -16.856 1.00 41.88  ? 367 SER D C     1 
ATOM   393  O  O     . SER A  1 49  ? 67.516 16.256  -16.185 1.00 41.28  ? 367 SER D O     1 
ATOM   394  C  CB    . SER A  1 49  ? 68.521 15.478  -19.202 1.00 46.99  ? 367 SER D CB    1 
ATOM   395  O  OG    . SER A  1 49  ? 67.498 14.643  -19.715 1.00 48.91  ? 367 SER D OG    1 
ATOM   396  N  N     . ASP A  1 50  ? 66.804 14.216  -16.818 1.00 41.32  ? 368 ASP D N     1 
ATOM   397  C  CA    . ASP A  1 50  ? 65.615 14.298  -15.975 1.00 39.31  ? 368 ASP D CA    1 
ATOM   398  C  C     . ASP A  1 50  ? 65.975 14.310  -14.495 1.00 36.15  ? 368 ASP D C     1 
ATOM   399  O  O     . ASP A  1 50  ? 65.241 14.890  -13.686 1.00 35.15  ? 368 ASP D O     1 
ATOM   400  C  CB    . ASP A  1 50  ? 64.665 13.139  -16.283 1.00 40.94  ? 368 ASP D CB    1 
ATOM   401  C  CG    . ASP A  1 50  ? 65.280 11.784  -15.988 1.00 42.45  ? 368 ASP D CG    1 
ATOM   402  O  OD1   . ASP A  1 50  ? 66.515 11.656  -16.100 1.00 43.37  ? 368 ASP D OD1   1 
ATOM   403  O  OD2   . ASP A  1 50  ? 64.528 10.848  -15.643 1.00 43.14  ? 368 ASP D OD2   1 
ATOM   404  N  N     . GLN A  1 51  ? 67.092 13.681  -14.121 1.00 34.85  ? 369 GLN D N     1 
ATOM   405  C  CA    . GLN A  1 51  ? 67.529 13.720  -12.729 1.00 32.91  ? 369 GLN D CA    1 
ATOM   406  C  C     . GLN A  1 51  ? 67.996 15.117  -12.339 1.00 31.63  ? 369 GLN D C     1 
ATOM   407  O  O     . GLN A  1 51  ? 67.738 15.575  -11.220 1.00 30.52  ? 369 GLN D O     1 
ATOM   408  C  CB    . GLN A  1 51  ? 68.641 12.697  -12.500 1.00 33.50  ? 369 GLN D CB    1 
ATOM   409  C  CG    . GLN A  1 51  ? 68.210 11.256  -12.714 1.00 34.44  ? 369 GLN D CG    1 
ATOM   410  C  CD    . GLN A  1 51  ? 69.366 10.282  -12.607 1.00 35.71  ? 369 GLN D CD    1 
ATOM   411  O  OE1   . GLN A  1 51  ? 70.531 10.678  -12.644 1.00 36.04  ? 369 GLN D OE1   1 
ATOM   412  N  NE2   . GLN A  1 51  ? 69.049 8.999   -12.472 1.00 36.54  ? 369 GLN D NE2   1 
ATOM   413  N  N     . LEU A  1 52  ? 68.685 15.806  -13.250 1.00 32.00  ? 370 LEU D N     1 
ATOM   414  C  CA    . LEU A  1 52  ? 69.101 17.179  -12.987 1.00 31.41  ? 370 LEU D CA    1 
ATOM   415  C  C     . LEU A  1 52  ? 67.900 18.109  -12.872 1.00 31.41  ? 370 LEU D C     1 
ATOM   416  O  O     . LEU A  1 52  ? 67.840 18.946  -11.964 1.00 31.06  ? 370 LEU D O     1 
ATOM   417  C  CB    . LEU A  1 52  ? 70.043 17.657  -14.090 1.00 31.72  ? 370 LEU D CB    1 
ATOM   418  C  CG    . LEU A  1 52  ? 70.414 19.138  -14.043 1.00 31.52  ? 370 LEU D CG    1 
ATOM   419  C  CD1   . LEU A  1 52  ? 71.138 19.440  -12.750 1.00 31.29  ? 370 LEU D CD1   1 
ATOM   420  C  CD2   . LEU A  1 52  ? 71.258 19.533  -15.246 1.00 33.51  ? 370 LEU D CD2   1 
ATOM   421  N  N     . LYS A  1 53  ? 66.936 17.980  -13.787 1.00 32.32  ? 371 LYS D N     1 
ATOM   422  C  CA    . LYS A  1 53  ? 65.758 18.840  -13.749 1.00 33.29  ? 371 LYS D CA    1 
ATOM   423  C  C     . LYS A  1 53  ? 64.895 18.566  -12.525 1.00 31.78  ? 371 LYS D C     1 
ATOM   424  O  O     . LYS A  1 53  ? 64.169 19.457  -12.069 1.00 31.58  ? 371 LYS D O     1 
ATOM   425  C  CB    . LYS A  1 53  ? 64.947 18.671  -15.033 1.00 36.21  ? 371 LYS D CB    1 
ATOM   426  C  CG    . LYS A  1 53  ? 65.486 19.485  -16.198 1.00 39.38  ? 371 LYS D CG    1 
ATOM   427  C  CD    . LYS A  1 53  ? 64.703 19.234  -17.474 1.00 42.46  ? 371 LYS D CD    1 
ATOM   428  C  CE    . LYS A  1 53  ? 64.902 20.373  -18.459 1.00 45.12  ? 371 LYS D CE    1 
ATOM   429  N  NZ    . LYS A  1 53  ? 66.340 20.717  -18.623 1.00 46.12  ? 371 LYS D NZ    1 
ATOM   430  N  N     . ARG A  1 54  ? 64.951 17.348  -11.982 1.00 30.76  ? 372 ARG D N     1 
ATOM   431  C  CA    . ARG A  1 54  ? 64.285 17.084  -10.712 1.00 29.51  ? 372 ARG D CA    1 
ATOM   432  C  C     . ARG A  1 54  ? 65.043 17.728  -9.557  1.00 29.09  ? 372 ARG D C     1 
ATOM   433  O  O     . ARG A  1 54  ? 64.432 18.299  -8.645  1.00 28.61  ? 372 ARG D O     1 
ATOM   434  C  CB    . ARG A  1 54  ? 64.148 15.577  -10.492 1.00 28.56  ? 372 ARG D CB    1 
ATOM   435  C  CG    . ARG A  1 54  ? 63.439 15.195  -9.202  1.00 27.28  ? 372 ARG D CG    1 
ATOM   436  C  CD    . ARG A  1 54  ? 63.438 13.689  -8.991  1.00 26.28  ? 372 ARG D CD    1 
ATOM   437  N  NE    . ARG A  1 54  ? 64.787 13.156  -8.831  1.00 24.96  ? 372 ARG D NE    1 
ATOM   438  C  CZ    . ARG A  1 54  ? 65.065 11.868  -8.658  1.00 24.50  ? 372 ARG D CZ    1 
ATOM   439  N  NH1   . ARG A  1 54  ? 64.085 10.975  -8.624  1.00 24.11  ? 372 ARG D NH1   1 
ATOM   440  N  NH2   . ARG A  1 54  ? 66.322 11.472  -8.519  1.00 24.64  ? 372 ARG D NH2   1 
ATOM   441  N  N     . HIS A  1 55  ? 66.376 17.650  -9.588  1.00 29.70  ? 373 HIS D N     1 
ATOM   442  C  CA    . HIS A  1 55  ? 67.194 18.251  -8.538  1.00 30.41  ? 373 HIS D CA    1 
ATOM   443  C  C     . HIS A  1 55  ? 67.016 19.762  -8.484  1.00 30.19  ? 373 HIS D C     1 
ATOM   444  O  O     . HIS A  1 55  ? 66.979 20.351  -7.397  1.00 30.78  ? 373 HIS D O     1 
ATOM   445  C  CB    . HIS A  1 55  ? 68.662 17.896  -8.764  1.00 33.01  ? 373 HIS D CB    1 
ATOM   446  C  CG    . HIS A  1 55  ? 69.621 18.940  -8.282  1.00 37.15  ? 373 HIS D CG    1 
ATOM   447  N  ND1   . HIS A  1 55  ? 70.007 19.045  -6.963  1.00 38.05  ? 373 HIS D ND1   1 
ATOM   448  C  CD2   . HIS A  1 55  ? 70.275 19.923  -8.945  1.00 38.68  ? 373 HIS D CD2   1 
ATOM   449  C  CE1   . HIS A  1 55  ? 70.856 20.049  -6.834  1.00 38.86  ? 373 HIS D CE1   1 
ATOM   450  N  NE2   . HIS A  1 55  ? 71.035 20.599  -8.021  1.00 38.56  ? 373 HIS D NE2   1 
ATOM   451  N  N     . GLN A  1 56  ? 66.905 20.408  -9.646  1.00 29.90  ? 374 GLN D N     1 
ATOM   452  C  CA    . GLN A  1 56  ? 66.792 21.860  -9.694  1.00 30.47  ? 374 GLN D CA    1 
ATOM   453  C  C     . GLN A  1 56  ? 65.512 22.376  -9.051  1.00 30.40  ? 374 GLN D C     1 
ATOM   454  O  O     . GLN A  1 56  ? 65.404 23.585  -8.815  1.00 31.50  ? 374 GLN D O     1 
ATOM   455  C  CB    . GLN A  1 56  ? 66.885 22.343  -11.142 1.00 32.04  ? 374 GLN D CB    1 
ATOM   456  C  CG    . GLN A  1 56  ? 68.275 22.211  -11.742 1.00 33.68  ? 374 GLN D CG    1 
ATOM   457  C  CD    . GLN A  1 56  ? 68.331 22.664  -13.185 1.00 35.92  ? 374 GLN D CD    1 
ATOM   458  O  OE1   . GLN A  1 56  ? 67.331 22.613  -13.901 1.00 37.13  ? 374 GLN D OE1   1 
ATOM   459  N  NE2   . GLN A  1 56  ? 69.501 23.118  -13.619 1.00 36.72  ? 374 GLN D NE2   1 
ATOM   460  N  N     . ARG A  1 57  ? 64.546 21.502  -8.762  1.00 29.53  ? 375 ARG D N     1 
ATOM   461  C  CA    . ARG A  1 57  ? 63.370 21.912  -8.007  1.00 30.28  ? 375 ARG D CA    1 
ATOM   462  C  C     . ARG A  1 57  ? 63.704 22.300  -6.573  1.00 30.61  ? 375 ARG D C     1 
ATOM   463  O  O     . ARG A  1 57  ? 62.860 22.900  -5.900  1.00 32.02  ? 375 ARG D O     1 
ATOM   464  C  CB    . ARG A  1 57  ? 62.325 20.794  -8.012  1.00 30.66  ? 375 ARG D CB    1 
ATOM   465  C  CG    . ARG A  1 57  ? 61.899 20.350  -9.402  1.00 31.87  ? 375 ARG D CG    1 
ATOM   466  C  CD    . ARG A  1 57  ? 60.960 19.159  -9.336  1.00 32.62  ? 375 ARG D CD    1 
ATOM   467  N  NE    . ARG A  1 57  ? 60.732 18.574  -10.654 1.00 33.96  ? 375 ARG D NE    1 
ATOM   468  C  CZ    . ARG A  1 57  ? 60.043 17.458  -10.866 1.00 34.88  ? 375 ARG D CZ    1 
ATOM   469  N  NH1   . ARG A  1 57  ? 59.510 16.802  -9.845  1.00 34.49  ? 375 ARG D NH1   1 
ATOM   470  N  NH2   . ARG A  1 57  ? 59.887 16.997  -12.099 1.00 36.24  ? 375 ARG D NH2   1 
ATOM   471  N  N     . ARG A  1 58  ? 64.907 21.972  -6.094  1.00 29.84  ? 376 ARG D N     1 
ATOM   472  C  CA    . ARG A  1 58  ? 65.329 22.400  -4.766  1.00 30.86  ? 376 ARG D CA    1 
ATOM   473  C  C     . ARG A  1 58  ? 65.681 23.882  -4.741  1.00 33.13  ? 376 ARG D C     1 
ATOM   474  O  O     . ARG A  1 58  ? 65.377 24.578  -3.766  1.00 34.41  ? 376 ARG D O     1 
ATOM   475  C  CB    . ARG A  1 58  ? 66.525 21.570  -4.300  1.00 30.38  ? 376 ARG D CB    1 
ATOM   476  C  CG    . ARG A  1 58  ? 66.270 20.078  -4.228  1.00 30.10  ? 376 ARG D CG    1 
ATOM   477  C  CD    . ARG A  1 58  ? 67.542 19.345  -3.849  1.00 31.19  ? 376 ARG D CD    1 
ATOM   478  N  NE    . ARG A  1 58  ? 68.074 19.812  -2.573  1.00 33.48  ? 376 ARG D NE    1 
ATOM   479  C  CZ    . ARG A  1 58  ? 69.265 19.470  -2.094  1.00 35.03  ? 376 ARG D CZ    1 
ATOM   480  N  NH1   . ARG A  1 58  ? 70.053 18.661  -2.789  1.00 34.91  ? 376 ARG D NH1   1 
ATOM   481  N  NH2   . ARG A  1 58  ? 69.669 19.942  -0.923  1.00 36.37  ? 376 ARG D NH2   1 
ATOM   482  N  N     . HIS A  1 59  ? 66.327 24.379  -5.800  1.00 33.72  ? 377 HIS D N     1 
ATOM   483  C  CA    . HIS A  1 59  ? 66.688 25.791  -5.848  1.00 36.06  ? 377 HIS D CA    1 
ATOM   484  C  C     . HIS A  1 59  ? 65.466 26.678  -6.041  1.00 36.40  ? 377 HIS D C     1 
ATOM   485  O  O     . HIS A  1 59  ? 65.445 27.816  -5.559  1.00 38.43  ? 377 HIS D O     1 
ATOM   486  C  CB    . HIS A  1 59  ? 67.701 26.039  -6.966  1.00 38.25  ? 377 HIS D CB    1 
ATOM   487  C  CG    . HIS A  1 59  ? 68.894 25.136  -6.911  1.00 41.18  ? 377 HIS D CG    1 
ATOM   488  N  ND1   . HIS A  1 59  ? 69.812 25.177  -5.885  1.00 42.59  ? 377 HIS D ND1   1 
ATOM   489  C  CD2   . HIS A  1 59  ? 69.320 24.171  -7.760  1.00 40.97  ? 377 HIS D CD2   1 
ATOM   490  C  CE1   . HIS A  1 59  ? 70.751 24.273  -6.101  1.00 41.98  ? 377 HIS D CE1   1 
ATOM   491  N  NE2   . HIS A  1 59  ? 70.476 23.650  -7.232  1.00 40.33  ? 377 HIS D NE2   1 
ATOM   492  N  N     . THR A  1 60  ? 64.444 26.181  -6.736  1.00 34.84  ? 378 THR D N     1 
ATOM   493  C  CA    . THR A  1 60  ? 63.231 26.953  -6.965  1.00 35.55  ? 378 THR D CA    1 
ATOM   494  C  C     . THR A  1 60  ? 62.164 26.712  -5.907  1.00 35.74  ? 378 THR D C     1 
ATOM   495  O  O     . THR A  1 60  ? 61.276 27.556  -5.741  1.00 37.85  ? 378 THR D O     1 
ATOM   496  C  CB    . THR A  1 60  ? 62.648 26.632  -8.345  1.00 35.17  ? 378 THR D CB    1 
ATOM   497  O  OG1   . THR A  1 60  ? 62.299 25.243  -8.406  1.00 33.84  ? 378 THR D OG1   1 
ATOM   498  C  CG2   . THR A  1 60  ? 63.664 26.939  -9.433  1.00 34.68  ? 378 THR D CG2   1 
ATOM   499  N  N     . GLY A  1 61  ? 62.228 25.590  -5.193  1.00 34.04  ? 379 GLY D N     1 
ATOM   500  C  CA    . GLY A  1 61  ? 61.233 25.293  -4.183  1.00 34.32  ? 379 GLY D CA    1 
ATOM   501  C  C     . GLY A  1 61  ? 59.853 24.993  -4.720  1.00 34.99  ? 379 GLY D C     1 
ATOM   502  O  O     . GLY A  1 61  ? 58.881 25.046  -3.964  1.00 36.10  ? 379 GLY D O     1 
ATOM   503  N  N     . VAL A  1 62  ? 59.737 24.676  -6.010  1.00 34.63  ? 380 VAL D N     1 
ATOM   504  C  CA    . VAL A  1 62  ? 58.433 24.430  -6.609  1.00 35.66  ? 380 VAL D CA    1 
ATOM   505  C  C     . VAL A  1 62  ? 57.893 23.087  -6.134  1.00 34.85  ? 380 VAL D C     1 
ATOM   506  O  O     . VAL A  1 62  ? 58.648 22.124  -5.935  1.00 33.13  ? 380 VAL D O     1 
ATOM   507  C  CB    . VAL A  1 62  ? 58.534 24.493  -8.143  1.00 35.60  ? 380 VAL D CB    1 
ATOM   508  C  CG1   . VAL A  1 62  ? 59.484 23.425  -8.665  1.00 33.42  ? 380 VAL D CG1   1 
ATOM   509  C  CG2   . VAL A  1 62  ? 57.159 24.363  -8.788  1.00 36.88  ? 380 VAL D CG2   1 
ATOM   510  N  N     . LYS A  1 63  ? 56.578 23.023  -5.923  1.00 36.47  ? 381 LYS D N     1 
ATOM   511  C  CA    . LYS A  1 63  ? 55.886 21.796  -5.530  1.00 36.42  ? 381 LYS D CA    1 
ATOM   512  C  C     . LYS A  1 63  ? 54.695 21.617  -6.462  1.00 38.70  ? 381 LYS D C     1 
ATOM   513  O  O     . LYS A  1 63  ? 53.570 22.022  -6.141  1.00 41.11  ? 381 LYS D O     1 
ATOM   514  C  CB    . LYS A  1 63  ? 55.447 21.842  -4.065  1.00 36.83  ? 381 LYS D CB    1 
ATOM   515  C  CG    . LYS A  1 63  ? 56.542 22.240  -3.087  1.00 36.00  ? 381 LYS D CG    1 
ATOM   516  C  CD    . LYS A  1 63  ? 56.024 22.236  -1.655  1.00 36.94  ? 381 LYS D CD    1 
ATOM   517  C  CE    . LYS A  1 63  ? 56.962 22.978  -0.713  1.00 37.33  ? 381 LYS D CE    1 
ATOM   518  N  NZ    . LYS A  1 63  ? 58.322 22.378  -0.679  1.00 35.31  ? 381 LYS D NZ    1 
ATOM   519  N  N     . PRO A  1 64  ? 54.910 21.013  -7.633  1.00 38.63  ? 382 PRO D N     1 
ATOM   520  C  CA    . PRO A  1 64  ? 53.844 20.922  -8.639  1.00 41.05  ? 382 PRO D CA    1 
ATOM   521  C  C     . PRO A  1 64  ? 52.810 19.836  -8.382  1.00 43.14  ? 382 PRO D C     1 
ATOM   522  O  O     . PRO A  1 64  ? 51.850 19.732  -9.154  1.00 45.53  ? 382 PRO D O     1 
ATOM   523  C  CB    . PRO A  1 64  ? 54.627 20.630  -9.926  1.00 39.58  ? 382 PRO D CB    1 
ATOM   524  C  CG    . PRO A  1 64  ? 55.814 19.867  -9.457  1.00 36.72  ? 382 PRO D CG    1 
ATOM   525  C  CD    . PRO A  1 64  ? 56.182 20.452  -8.119  1.00 36.31  ? 382 PRO D CD    1 
ATOM   526  N  N     . PHE A  1 65  ? 52.964 19.027  -7.336  1.00 42.47  ? 383 PHE D N     1 
ATOM   527  C  CA    . PHE A  1 65  ? 52.052 17.923  -7.053  1.00 43.56  ? 383 PHE D CA    1 
ATOM   528  C  C     . PHE A  1 65  ? 51.348 18.190  -5.732  1.00 44.80  ? 383 PHE D C     1 
ATOM   529  O  O     . PHE A  1 65  ? 52.005 18.352  -4.698  1.00 44.03  ? 383 PHE D O     1 
ATOM   530  C  CB    . PHE A  1 65  ? 52.801 16.590  -7.008  1.00 41.76  ? 383 PHE D CB    1 
ATOM   531  C  CG    . PHE A  1 65  ? 53.653 16.335  -8.217  1.00 41.18  ? 383 PHE D CG    1 
ATOM   532  C  CD1   . PHE A  1 65  ? 55.024 16.530  -8.167  1.00 39.40  ? 383 PHE D CD1   1 
ATOM   533  C  CD2   . PHE A  1 65  ? 53.083 15.912  -9.406  1.00 42.64  ? 383 PHE D CD2   1 
ATOM   534  C  CE1   . PHE A  1 65  ? 55.811 16.297  -9.277  1.00 38.88  ? 383 PHE D CE1   1 
ATOM   535  C  CE2   . PHE A  1 65  ? 53.865 15.680  -10.520 1.00 42.14  ? 383 PHE D CE2   1 
ATOM   536  C  CZ    . PHE A  1 65  ? 55.231 15.873  -10.456 1.00 40.23  ? 383 PHE D CZ    1 
ATOM   537  N  N     . GLN A  1 66  ? 50.018 18.226  -5.765  1.00 47.05  ? 384 GLN D N     1 
ATOM   538  C  CA    . GLN A  1 66  ? 49.208 18.563  -4.604  1.00 48.60  ? 384 GLN D CA    1 
ATOM   539  C  C     . GLN A  1 66  ? 48.322 17.387  -4.218  1.00 50.19  ? 384 GLN D C     1 
ATOM   540  O  O     . GLN A  1 66  ? 47.816 16.667  -5.084  1.00 51.07  ? 384 GLN D O     1 
ATOM   541  C  CB    . GLN A  1 66  ? 48.343 19.798  -4.880  1.00 50.82  ? 384 GLN D CB    1 
ATOM   542  C  CG    . GLN A  1 66  ? 47.614 20.337  -3.661  1.00 52.34  ? 384 GLN D CG    1 
ATOM   543  C  CD    . GLN A  1 66  ? 46.730 21.522  -3.988  1.00 55.67  ? 384 GLN D CD    1 
ATOM   544  O  OE1   . GLN A  1 66  ? 46.415 21.775  -5.152  1.00 56.84  ? 384 GLN D OE1   1 
ATOM   545  N  NE2   . GLN A  1 66  ? 46.326 22.260  -2.961  1.00 57.76  ? 384 GLN D NE2   1 
ATOM   546  N  N     . CYS A  1 67  ? 48.140 17.198  -2.912  1.00 50.65  ? 385 CYS D N     1 
ATOM   547  C  CA    . CYS A  1 67  ? 47.267 16.149  -2.405  1.00 51.94  ? 385 CYS D CA    1 
ATOM   548  C  C     . CYS A  1 67  ? 45.814 16.596  -2.496  1.00 55.88  ? 385 CYS D C     1 
ATOM   549  O  O     . CYS A  1 67  ? 45.461 17.686  -2.037  1.00 58.05  ? 385 CYS D O     1 
ATOM   550  C  CB    . CYS A  1 67  ? 47.629 15.805  -0.960  1.00 50.76  ? 385 CYS D CB    1 
ATOM   551  S  SG    . CYS A  1 67  ? 46.637 14.482  -0.223  1.00 51.89  ? 385 CYS D SG    1 
ATOM   552  N  N     . LYS A  1 68  ? 44.969 15.750  -3.089  1.00 57.33  ? 386 LYS D N     1 
ATOM   553  C  CA    . LYS A  1 68  ? 43.562 16.092  -3.262  1.00 61.58  ? 386 LYS D CA    1 
ATOM   554  C  C     . LYS A  1 68  ? 42.781 16.082  -1.954  1.00 64.65  ? 386 LYS D C     1 
ATOM   555  O  O     . LYS A  1 68  ? 41.635 16.544  -1.936  1.00 68.77  ? 386 LYS D O     1 
ATOM   556  C  CB    . LYS A  1 68  ? 42.907 15.131  -4.256  1.00 62.84  ? 386 LYS D CB    1 
ATOM   557  N  N     . THR A  1 69  ? 43.365 15.574  -0.868  1.00 63.57  ? 387 THR D N     1 
ATOM   558  C  CA    . THR A  1 69  ? 42.669 15.467  0.411   1.00 67.07  ? 387 THR D CA    1 
ATOM   559  C  C     . THR A  1 69  ? 43.045 16.589  1.375   1.00 68.69  ? 387 THR D C     1 
ATOM   560  O  O     . THR A  1 69  ? 42.175 17.340  1.825   1.00 72.37  ? 387 THR D O     1 
ATOM   561  C  CB    . THR A  1 69  ? 42.953 14.101  1.050   1.00 65.69  ? 387 THR D CB    1 
ATOM   562  O  OG1   . THR A  1 69  ? 42.594 13.057  0.136   1.00 66.23  ? 387 THR D OG1   1 
ATOM   563  C  CG2   . THR A  1 69  ? 42.150 13.941  2.331   1.00 68.69  ? 387 THR D CG2   1 
ATOM   564  N  N     . CYS A  1 70  ? 44.330 16.721  1.700   1.00 66.78  ? 388 CYS D N     1 
ATOM   565  C  CA    . CYS A  1 70  ? 44.787 17.704  2.675   1.00 68.91  ? 388 CYS D CA    1 
ATOM   566  C  C     . CYS A  1 70  ? 45.382 18.950  2.033   1.00 68.84  ? 388 CYS D C     1 
ATOM   567  O  O     . CYS A  1 70  ? 45.916 19.804  2.750   1.00 69.31  ? 388 CYS D O     1 
ATOM   568  C  CB    . CYS A  1 70  ? 45.811 17.070  3.624   1.00 66.61  ? 388 CYS D CB    1 
ATOM   569  S  SG    . CYS A  1 70  ? 47.417 16.739  2.870   1.00 61.20  ? 388 CYS D SG    1 
ATOM   570  N  N     . GLN A  1 71  ? 45.312 19.068  0.706   1.00 68.22  ? 389 GLN D N     1 
ATOM   571  C  CA    . GLN A  1 71  ? 45.740 20.228  -0.077  1.00 68.29  ? 389 GLN D CA    1 
ATOM   572  C  C     . GLN A  1 71  ? 47.234 20.513  0.024   1.00 64.04  ? 389 GLN D C     1 
ATOM   573  O  O     . GLN A  1 71  ? 47.684 21.575  -0.427  1.00 64.79  ? 389 GLN D O     1 
ATOM   574  C  CB    . GLN A  1 71  ? 44.957 21.492  0.302   1.00 73.20  ? 389 GLN D CB    1 
ATOM   575  C  CG    . GLN A  1 71  ? 43.468 21.262  0.538   1.00 77.70  ? 389 GLN D CG    1 
ATOM   576  C  CD    . GLN A  1 71  ? 42.782 20.565  -0.621  1.00 78.65  ? 389 GLN D CD    1 
ATOM   577  O  OE1   . GLN A  1 71  ? 43.095 20.811  -1.786  1.00 77.81  ? 389 GLN D OE1   1 
ATOM   578  N  NE2   . GLN A  1 71  ? 41.838 19.687  -0.303  1.00 80.62  ? 389 GLN D NE2   1 
ATOM   579  N  N     . ARG A  1 72  ? 48.019 19.601  0.590   1.00 60.16  ? 390 ARG D N     1 
ATOM   580  C  CA    . ARG A  1 72  ? 49.454 19.808  0.709   1.00 55.93  ? 390 ARG D CA    1 
ATOM   581  C  C     . ARG A  1 72  ? 50.147 19.538  -0.622  1.00 52.21  ? 390 ARG D C     1 
ATOM   582  O  O     . ARG A  1 72  ? 49.751 18.654  -1.387  1.00 51.66  ? 390 ARG D O     1 
ATOM   583  C  CB    . ARG A  1 72  ? 50.038 18.907  1.799   1.00 53.86  ? 390 ARG D CB    1 
ATOM   584  C  CG    . ARG A  1 72  ? 51.504 19.164  2.097   1.00 51.13  ? 390 ARG D CG    1 
ATOM   585  C  CD    . ARG A  1 72  ? 51.976 18.397  3.319   1.00 49.90  ? 390 ARG D CD    1 
ATOM   586  N  NE    . ARG A  1 72  ? 53.359 18.722  3.656   1.00 48.44  ? 390 ARG D NE    1 
ATOM   587  C  CZ    . ARG A  1 72  ? 53.982 18.296  4.749   1.00 47.96  ? 390 ARG D CZ    1 
ATOM   588  N  NH1   . ARG A  1 72  ? 53.345 17.524  5.619   1.00 48.51  ? 390 ARG D NH1   1 
ATOM   589  N  NH2   . ARG A  1 72  ? 55.242 18.643  4.974   1.00 47.03  ? 390 ARG D NH2   1 
ATOM   590  N  N     . LYS A  1 73  ? 51.193 20.313  -0.893  1.00 49.03  ? 391 LYS D N     1 
ATOM   591  C  CA    . LYS A  1 73  ? 51.934 20.236  -2.141  1.00 45.47  ? 391 LYS D CA    1 
ATOM   592  C  C     . LYS A  1 73  ? 53.301 19.606  -1.903  1.00 41.90  ? 391 LYS D C     1 
ATOM   593  O  O     . LYS A  1 73  ? 53.908 19.783  -0.844  1.00 41.48  ? 391 LYS D O     1 
ATOM   594  C  CB    . LYS A  1 73  ? 52.092 21.626  -2.763  1.00 45.96  ? 391 LYS D CB    1 
ATOM   595  C  CG    . LYS A  1 73  ? 50.776 22.368  -2.932  1.00 49.06  ? 391 LYS D CG    1 
ATOM   596  C  CD    . LYS A  1 73  ? 50.999 23.816  -3.328  1.00 50.80  ? 391 LYS D CD    1 
ATOM   597  C  CE    . LYS A  1 73  ? 50.488 24.090  -4.732  1.00 52.20  ? 391 LYS D CE    1 
ATOM   598  N  NZ    . LYS A  1 73  ? 51.216 23.290  -5.755  1.00 49.47  ? 391 LYS D NZ    1 
ATOM   599  N  N     . PHE A  1 74  ? 53.778 18.864  -2.901  1.00 40.11  ? 392 PHE D N     1 
ATOM   600  C  CA    . PHE A  1 74  ? 55.035 18.139  -2.803  1.00 37.91  ? 392 PHE D CA    1 
ATOM   601  C  C     . PHE A  1 74  ? 55.864 18.360  -4.060  1.00 36.67  ? 392 PHE D C     1 
ATOM   602  O  O     . PHE A  1 74  ? 55.339 18.667  -5.133  1.00 38.05  ? 392 PHE D O     1 
ATOM   603  C  CB    . PHE A  1 74  ? 54.801 16.639  -2.586  1.00 37.76  ? 392 PHE D CB    1 
ATOM   604  C  CG    . PHE A  1 74  ? 53.974 16.331  -1.377  1.00 39.63  ? 392 PHE D CG    1 
ATOM   605  C  CD1   . PHE A  1 74  ? 52.601 16.190  -1.480  1.00 41.84  ? 392 PHE D CD1   1 
ATOM   606  C  CD2   . PHE A  1 74  ? 54.566 16.199  -0.133  1.00 39.68  ? 392 PHE D CD2   1 
ATOM   607  C  CE1   . PHE A  1 74  ? 51.836 15.914  -0.367  1.00 43.36  ? 392 PHE D CE1   1 
ATOM   608  C  CE2   . PHE A  1 74  ? 53.806 15.923  0.984   1.00 41.26  ? 392 PHE D CE2   1 
ATOM   609  C  CZ    . PHE A  1 74  ? 52.440 15.783  0.867   1.00 42.96  ? 392 PHE D CZ    1 
ATOM   610  N  N     . SER A  1 75  ? 57.179 18.180  -3.913  1.00 34.04  ? 393 SER D N     1 
ATOM   611  C  CA    . SER A  1 75  ? 58.097 18.460  -5.011  1.00 32.42  ? 393 SER D CA    1 
ATOM   612  C  C     . SER A  1 75  ? 58.121 17.347  -6.052  1.00 32.15  ? 393 SER D C     1 
ATOM   613  O  O     . SER A  1 75  ? 58.450 17.605  -7.214  1.00 32.71  ? 393 SER D O     1 
ATOM   614  C  CB    . SER A  1 75  ? 59.508 18.691  -4.469  1.00 30.43  ? 393 SER D CB    1 
ATOM   615  O  OG    . SER A  1 75  ? 59.984 17.547  -3.781  1.00 28.85  ? 393 SER D OG    1 
ATOM   616  N  N     . ARG A  1 76  ? 57.791 16.115  -5.666  1.00 31.56  ? 394 ARG D N     1 
ATOM   617  C  CA    . ARG A  1 76  ? 57.870 14.981  -6.576  1.00 31.47  ? 394 ARG D CA    1 
ATOM   618  C  C     . ARG A  1 76  ? 56.595 14.154  -6.471  1.00 34.02  ? 394 ARG D C     1 
ATOM   619  O  O     . ARG A  1 76  ? 55.902 14.168  -5.451  1.00 35.14  ? 394 ARG D O     1 
ATOM   620  C  CB    . ARG A  1 76  ? 59.104 14.113  -6.287  1.00 29.50  ? 394 ARG D CB    1 
ATOM   621  C  CG    . ARG A  1 76  ? 60.263 14.874  -5.655  1.00 28.28  ? 394 ARG D CG    1 
ATOM   622  C  CD    . ARG A  1 76  ? 61.568 14.114  -5.782  1.00 27.00  ? 394 ARG D CD    1 
ATOM   623  N  NE    . ARG A  1 76  ? 61.397 12.683  -5.555  1.00 25.97  ? 394 ARG D NE    1 
ATOM   624  C  CZ    . ARG A  1 76  ? 62.403 11.832  -5.394  1.00 25.19  ? 394 ARG D CZ    1 
ATOM   625  N  NH1   . ARG A  1 76  ? 63.653 12.273  -5.423  1.00 25.17  ? 394 ARG D NH1   1 
ATOM   626  N  NH2   . ARG A  1 76  ? 62.163 10.542  -5.197  1.00 26.00  ? 394 ARG D NH2   1 
ATOM   627  N  N     . SER A  1 77  ? 56.294 13.422  -7.548  1.00 35.66  ? 395 SER D N     1 
ATOM   628  C  CA    . SER A  1 77  ? 55.028 12.698  -7.633  1.00 37.99  ? 395 SER D CA    1 
ATOM   629  C  C     . SER A  1 77  ? 55.037 11.427  -6.792  1.00 38.20  ? 395 SER D C     1 
ATOM   630  O  O     . SER A  1 77  ? 54.012 11.066  -6.203  1.00 39.45  ? 395 SER D O     1 
ATOM   631  C  CB    . SER A  1 77  ? 54.713 12.362  -9.092  1.00 39.81  ? 395 SER D CB    1 
ATOM   632  O  OG    . SER A  1 77  ? 55.657 11.447  -9.619  1.00 39.69  ? 395 SER D OG    1 
ATOM   633  N  N     . ASP A  1 78  ? 56.174 10.730  -6.732  1.00 37.42  ? 396 ASP D N     1 
ATOM   634  C  CA    . ASP A  1 78  ? 56.244 9.509   -5.936  1.00 37.81  ? 396 ASP D CA    1 
ATOM   635  C  C     . ASP A  1 78  ? 56.053 9.807   -4.455  1.00 38.18  ? 396 ASP D C     1 
ATOM   636  O  O     . ASP A  1 78  ? 55.399 9.040   -3.739  1.00 39.55  ? 396 ASP D O     1 
ATOM   637  C  CB    . ASP A  1 78  ? 57.574 8.795   -6.179  1.00 37.18  ? 396 ASP D CB    1 
ATOM   638  C  CG    . ASP A  1 78  ? 58.769 9.711   -6.004  1.00 36.28  ? 396 ASP D CG    1 
ATOM   639  O  OD1   . ASP A  1 78  ? 58.568 10.939  -5.910  1.00 35.82  ? 396 ASP D OD1   1 
ATOM   640  O  OD2   . ASP A  1 78  ? 59.909 9.203   -5.960  1.00 36.45  ? 396 ASP D OD2   1 
ATOM   641  N  N     . HIS A  1 79  ? 56.612 10.921  -3.977  1.00 37.61  ? 397 HIS D N     1 
ATOM   642  C  CA    . HIS A  1 79  ? 56.413 11.304  -2.585  1.00 37.82  ? 397 HIS D CA    1 
ATOM   643  C  C     . HIS A  1 79  ? 54.969 11.704  -2.317  1.00 40.66  ? 397 HIS D C     1 
ATOM   644  O  O     . HIS A  1 79  ? 54.486 11.562  -1.188  1.00 41.97  ? 397 HIS D O     1 
ATOM   645  C  CB    . HIS A  1 79  ? 57.371 12.435  -2.213  1.00 35.35  ? 397 HIS D CB    1 
ATOM   646  C  CG    . HIS A  1 79  ? 58.811 12.025  -2.216  1.00 33.17  ? 397 HIS D CG    1 
ATOM   647  N  ND1   . HIS A  1 79  ? 59.207 10.706  -2.166  1.00 32.75  ? 397 HIS D ND1   1 
ATOM   648  C  CD2   . HIS A  1 79  ? 59.948 12.758  -2.268  1.00 32.21  ? 397 HIS D CD2   1 
ATOM   649  C  CE1   . HIS A  1 79  ? 60.527 10.644  -2.182  1.00 32.27  ? 397 HIS D CE1   1 
ATOM   650  N  NE2   . HIS A  1 79  ? 61.001 11.875  -2.244  1.00 31.76  ? 397 HIS D NE2   1 
ATOM   651  N  N     . LEU A  1 80  ? 54.266 12.204  -3.335  1.00 41.65  ? 398 LEU D N     1 
ATOM   652  C  CA    . LEU A  1 80  ? 52.832 12.427  -3.195  1.00 43.38  ? 398 LEU D CA    1 
ATOM   653  C  C     . LEU A  1 80  ? 52.073 11.110  -3.106  1.00 44.95  ? 398 LEU D C     1 
ATOM   654  O  O     . LEU A  1 80  ? 51.074 11.019  -2.383  1.00 46.99  ? 398 LEU D O     1 
ATOM   655  C  CB    . LEU A  1 80  ? 52.310 13.263  -4.364  1.00 43.70  ? 398 LEU D CB    1 
ATOM   656  C  CG    . LEU A  1 80  ? 50.788 13.392  -4.471  1.00 45.68  ? 398 LEU D CG    1 
ATOM   657  C  CD1   . LEU A  1 80  ? 50.224 14.130  -3.267  1.00 46.33  ? 398 LEU D CD1   1 
ATOM   658  C  CD2   . LEU A  1 80  ? 50.379 14.070  -5.771  1.00 46.99  ? 398 LEU D CD2   1 
ATOM   659  N  N     . LYS A  1 81  ? 52.538 10.081  -3.818  1.00 44.46  ? 399 LYS D N     1 
ATOM   660  C  CA    . LYS A  1 81  ? 51.836 8.801   -3.828  1.00 45.85  ? 399 LYS D CA    1 
ATOM   661  C  C     . LYS A  1 81  ? 51.832 8.163   -2.443  1.00 45.00  ? 399 LYS D C     1 
ATOM   662  O  O     . LYS A  1 81  ? 50.791 7.698   -1.964  1.00 47.25  ? 399 LYS D O     1 
ATOM   663  C  CB    . LYS A  1 81  ? 52.471 7.863   -4.856  1.00 46.51  ? 399 LYS D CB    1 
ATOM   664  C  CG    . LYS A  1 81  ? 51.827 6.485   -4.924  1.00 49.44  ? 399 LYS D CG    1 
ATOM   665  C  CD    . LYS A  1 81  ? 52.566 5.569   -5.892  1.00 50.35  ? 399 LYS D CD    1 
ATOM   666  C  CE    . LYS A  1 81  ? 52.158 5.824   -7.335  1.00 52.02  ? 399 LYS D CE    1 
ATOM   667  N  NZ    . LYS A  1 81  ? 50.779 5.335   -7.617  1.00 55.38  ? 399 LYS D NZ    1 
ATOM   668  N  N     . THR A  1 82  ? 52.990 8.135   -1.779  1.00 42.31  ? 400 THR D N     1 
ATOM   669  C  CA    . THR A  1 82  ? 53.052 7.568   -0.437  1.00 41.39  ? 400 THR D CA    1 
ATOM   670  C  C     . THR A  1 82  ? 52.416 8.477   0.606   1.00 42.87  ? 400 THR D C     1 
ATOM   671  O  O     . THR A  1 82  ? 52.033 7.992   1.676   1.00 43.13  ? 400 THR D O     1 
ATOM   672  C  CB    . THR A  1 82  ? 54.502 7.265   -0.051  1.00 38.29  ? 400 THR D CB    1 
ATOM   673  O  OG1   . THR A  1 82  ? 55.316 8.419   -0.291  1.00 36.50  ? 400 THR D OG1   1 
ATOM   674  C  CG2   . THR A  1 82  ? 55.034 6.093   -0.863  1.00 37.94  ? 400 THR D CG2   1 
ATOM   675  N  N     . HIS A  1 83  ? 52.297 9.777   0.327   1.00 47.97  ? 401 HIS D N     1 
ATOM   676  C  CA    . HIS A  1 83  ? 51.547 10.651  1.223   1.00 53.57  ? 401 HIS D CA    1 
ATOM   677  C  C     . HIS A  1 83  ? 50.064 10.311  1.202   1.00 53.72  ? 401 HIS D C     1 
ATOM   678  O  O     . HIS A  1 83  ? 49.390 10.380  2.236   1.00 54.78  ? 401 HIS D O     1 
ATOM   679  C  CB    . HIS A  1 83  ? 51.760 12.116  0.847   1.00 51.13  ? 401 HIS D CB    1 
ATOM   680  C  CG    . HIS A  1 83  ? 50.836 13.057  1.555   1.00 58.22  ? 401 HIS D CG    1 
ATOM   681  N  ND1   . HIS A  1 83  ? 51.043 13.468  2.854   1.00 61.21  ? 401 HIS D ND1   1 
ATOM   682  C  CD2   . HIS A  1 83  ? 49.698 13.665  1.145   1.00 62.95  ? 401 HIS D CD2   1 
ATOM   683  C  CE1   . HIS A  1 83  ? 50.074 14.291  3.213   1.00 63.86  ? 401 HIS D CE1   1 
ATOM   684  N  NE2   . HIS A  1 83  ? 49.244 14.427  2.195   1.00 63.93  ? 401 HIS D NE2   1 
ATOM   685  N  N     . THR A  1 84  ? 49.533 9.955   0.030   1.00 53.19  ? 402 THR D N     1 
ATOM   686  C  CA    . THR A  1 84  ? 48.146 9.510   -0.038  1.00 57.86  ? 402 THR D CA    1 
ATOM   687  C  C     . THR A  1 84  ? 47.938 8.224   0.750   1.00 59.05  ? 402 THR D C     1 
ATOM   688  O  O     . THR A  1 84  ? 46.830 7.966   1.233   1.00 62.12  ? 402 THR D O     1 
ATOM   689  C  CB    . THR A  1 84  ? 47.719 9.317   -1.494  1.00 59.14  ? 402 THR D CB    1 
ATOM   690  O  OG1   . THR A  1 84  ? 48.559 8.336   -2.114  1.00 58.37  ? 402 THR D OG1   1 
ATOM   691  C  CG2   . THR A  1 84  ? 47.829 10.628  -2.258  1.00 58.26  ? 402 THR D CG2   1 
ATOM   692  N  N     . ARG A  1 85  ? 48.986 7.407   0.892   1.00 57.04  ? 403 ARG D N     1 
ATOM   693  C  CA    . ARG A  1 85  ? 48.880 6.222   1.735   1.00 57.76  ? 403 ARG D CA    1 
ATOM   694  C  C     . ARG A  1 85  ? 48.688 6.598   3.198   1.00 58.10  ? 403 ARG D C     1 
ATOM   695  O  O     . ARG A  1 85  ? 48.057 5.850   3.952   1.00 60.05  ? 403 ARG D O     1 
ATOM   696  C  CB    . ARG A  1 85  ? 50.115 5.334   1.570   1.00 55.93  ? 403 ARG D CB    1 
ATOM   697  C  CG    . ARG A  1 85  ? 50.317 4.779   0.169   1.00 56.02  ? 403 ARG D CG    1 
ATOM   698  C  CD    . ARG A  1 85  ? 51.139 3.496   0.207   1.00 56.29  ? 403 ARG D CD    1 
ATOM   699  N  NE    . ARG A  1 85  ? 52.226 3.502   -0.769  1.00 55.34  ? 403 ARG D NE    1 
ATOM   700  C  CZ    . ARG A  1 85  ? 52.095 3.120   -2.034  1.00 56.86  ? 403 ARG D CZ    1 
ATOM   701  N  NH1   . ARG A  1 85  ? 50.919 2.703   -2.483  1.00 59.50  ? 403 ARG D NH1   1 
ATOM   702  N  NH2   . ARG A  1 85  ? 53.138 3.157   -2.853  1.00 55.90  ? 403 ARG D NH2   1 
ATOM   703  N  N     . THR A  1 86  ? 49.224 7.749   3.616   1.00 56.53  ? 404 THR D N     1 
ATOM   704  C  CA    . THR A  1 86  ? 48.982 8.230   4.973   1.00 58.00  ? 404 THR D CA    1 
ATOM   705  C  C     . THR A  1 86  ? 47.496 8.474   5.211   1.00 61.11  ? 404 THR D C     1 
ATOM   706  O  O     . THR A  1 86  ? 46.976 8.185   6.296   1.00 63.16  ? 404 THR D O     1 
ATOM   707  C  CB    . THR A  1 86  ? 49.787 9.507   5.229   1.00 57.22  ? 404 THR D CB    1 
ATOM   708  O  OG1   . THR A  1 86  ? 51.186 9.198   5.255   1.00 55.29  ? 404 THR D OG1   1 
ATOM   709  C  CG2   . THR A  1 86  ? 49.392 10.154  6.550   1.00 59.28  ? 404 THR D CG2   1 
ATOM   710  N  N     . HIS A  1 87  ? 46.791 8.990   4.202   1.00 61.87  ? 405 HIS D N     1 
ATOM   711  C  CA    . HIS A  1 87  ? 45.371 9.286   4.356   1.00 65.57  ? 405 HIS D CA    1 
ATOM   712  C  C     . HIS A  1 87  ? 44.515 8.034   4.202   1.00 65.35  ? 405 HIS D C     1 
ATOM   713  O  O     . HIS A  1 87  ? 43.604 7.795   5.002   1.00 67.74  ? 405 HIS D O     1 
ATOM   714  C  CB    . HIS A  1 87  ? 44.945 10.351  3.344   1.00 69.31  ? 405 HIS D CB    1 
ATOM   715  C  CG    . HIS A  1 87  ? 45.509 11.709  3.624   1.00 72.60  ? 405 HIS D CG    1 
ATOM   716  N  ND1   . HIS A  1 87  ? 45.918 12.100  4.881   1.00 73.48  ? 405 HIS D ND1   1 
ATOM   717  C  CD2   . HIS A  1 87  ? 45.733 12.767  2.809   1.00 72.88  ? 405 HIS D CD2   1 
ATOM   718  C  CE1   . HIS A  1 87  ? 46.368 13.341  4.829   1.00 73.01  ? 405 HIS D CE1   1 
ATOM   719  N  NE2   . HIS A  1 87  ? 46.267 13.769  3.583   1.00 71.62  ? 405 HIS D NE2   1 
ATOM   720  N  N     . THR A  1 88  ? 44.789 7.222   3.180   1.00 63.06  ? 406 THR D N     1 
ATOM   721  C  CA    . THR A  1 88  ? 43.964 6.047   2.930   1.00 65.27  ? 406 THR D CA    1 
ATOM   722  C  C     . THR A  1 88  ? 44.252 4.908   3.901   1.00 66.20  ? 406 THR D C     1 
ATOM   723  O  O     . THR A  1 88  ? 43.448 3.973   3.992   1.00 68.58  ? 406 THR D O     1 
ATOM   724  C  CB    . THR A  1 88  ? 44.157 5.558   1.492   1.00 64.19  ? 406 THR D CB    1 
ATOM   725  O  OG1   . THR A  1 88  ? 43.148 4.591   1.174   1.00 67.90  ? 406 THR D OG1   1 
ATOM   726  C  CG2   . THR A  1 88  ? 45.524 4.919   1.325   1.00 60.40  ? 406 THR D CG2   1 
ATOM   727  N  N     . GLY A  1 89  ? 45.373 4.957   4.616   1.00 65.27  ? 407 GLY D N     1 
ATOM   728  C  CA    . GLY A  1 89  ? 45.686 3.953   5.611   1.00 67.52  ? 407 GLY D CA    1 
ATOM   729  C  C     . GLY A  1 89  ? 46.125 2.610   5.074   1.00 68.85  ? 407 GLY D C     1 
ATOM   730  O  O     . GLY A  1 89  ? 46.254 1.663   5.858   1.00 70.13  ? 407 GLY D O     1 
ATOM   731  N  N     . GLU A  1 90  ? 46.365 2.491   3.772   1.00 69.12  ? 408 GLU D N     1 
ATOM   732  C  CA    . GLU A  1 90  ? 46.789 1.217   3.212   1.00 70.36  ? 408 GLU D CA    1 
ATOM   733  C  C     . GLU A  1 90  ? 48.233 0.917   3.600   1.00 66.47  ? 408 GLU D C     1 
ATOM   734  O  O     . GLU A  1 90  ? 49.052 1.821   3.790   1.00 64.65  ? 408 GLU D O     1 
ATOM   735  C  CB    . GLU A  1 90  ? 46.643 1.220   1.690   1.00 72.79  ? 408 GLU D CB    1 
ATOM   736  C  CG    . GLU A  1 90  ? 47.764 1.938   0.953   1.00 70.98  ? 408 GLU D CG    1 
ATOM   737  C  CD    . GLU A  1 90  ? 47.574 1.924   -0.550  1.00 72.94  ? 408 GLU D CD    1 
ATOM   738  O  OE1   . GLU A  1 90  ? 46.411 1.988   -1.004  1.00 76.07  ? 408 GLU D OE1   1 
ATOM   739  O  OE2   . GLU A  1 90  ? 48.586 1.844   -1.277  1.00 71.52  ? 408 GLU D OE2   1 
ATOM   740  N  N     . LYS A  1 91  ? 48.535 -0.372  3.733   1.00 65.57  ? 409 LYS D N     1 
ATOM   741  C  CA    . LYS A  1 91  ? 49.871 -0.840  4.106   1.00 60.96  ? 409 LYS D CA    1 
ATOM   742  C  C     . LYS A  1 91  ? 50.177 -2.103  3.317   1.00 60.12  ? 409 LYS D C     1 
ATOM   743  O  O     . LYS A  1 91  ? 49.990 -3.225  3.805   1.00 61.87  ? 409 LYS D O     1 
ATOM   744  C  CB    . LYS A  1 91  ? 49.971 -1.085  5.614   1.00 59.89  ? 409 LYS D CB    1 
ATOM   745  C  CG    . LYS A  1 91  ? 49.819 0.170   6.463   1.00 57.40  ? 409 LYS D CG    1 
ATOM   746  C  CD    . LYS A  1 91  ? 49.854 -0.141  7.948   1.00 57.74  ? 409 LYS D CD    1 
ATOM   747  C  CE    . LYS A  1 91  ? 49.630 1.117   8.772   1.00 56.98  ? 409 LYS D CE    1 
ATOM   748  N  NZ    . LYS A  1 91  ? 49.657 0.845   10.234  1.00 58.13  ? 409 LYS D NZ    1 
ATOM   749  N  N     . PRO A  1 92  ? 50.650 -1.958  2.075   1.00 57.70  ? 410 PRO D N     1 
ATOM   750  C  CA    . PRO A  1 92  ? 50.884 -3.154  1.247   1.00 58.97  ? 410 PRO D CA    1 
ATOM   751  C  C     . PRO A  1 92  ? 52.011 -4.031  1.760   1.00 57.86  ? 410 PRO D C     1 
ATOM   752  O  O     . PRO A  1 92  ? 51.866 -5.260  1.796   1.00 60.11  ? 410 PRO D O     1 
ATOM   753  C  CB    . PRO A  1 92  ? 51.207 -2.567  -0.137  1.00 58.26  ? 410 PRO D CB    1 
ATOM   754  C  CG    . PRO A  1 92  ? 50.741 -1.137  -0.084  1.00 56.43  ? 410 PRO D CG    1 
ATOM   755  C  CD    . PRO A  1 92  ? 50.911 -0.712  1.337   1.00 54.94  ? 410 PRO D CD    1 
ATOM   756  N  N     . PHE A  1 93  ? 53.133 -3.435  2.156   1.00 54.79  ? 411 PHE D N     1 
ATOM   757  C  CA    . PHE A  1 93  ? 54.285 -4.205  2.607   1.00 55.20  ? 411 PHE D CA    1 
ATOM   758  C  C     . PHE A  1 93  ? 53.979 -4.866  3.945   1.00 56.29  ? 411 PHE D C     1 
ATOM   759  O  O     . PHE A  1 93  ? 53.692 -4.182  4.933   1.00 55.54  ? 411 PHE D O     1 
ATOM   760  C  CB    . PHE A  1 93  ? 55.508 -3.299  2.720   1.00 53.35  ? 411 PHE D CB    1 
ATOM   761  C  CG    . PHE A  1 93  ? 55.803 -2.525  1.468   1.00 53.22  ? 411 PHE D CG    1 
ATOM   762  C  CD1   . PHE A  1 93  ? 56.581 -3.076  0.465   1.00 54.51  ? 411 PHE D CD1   1 
ATOM   763  C  CD2   . PHE A  1 93  ? 55.298 -1.247  1.293   1.00 52.15  ? 411 PHE D CD2   1 
ATOM   764  C  CE1   . PHE A  1 93  ? 56.853 -2.366  -0.690  1.00 53.90  ? 411 PHE D CE1   1 
ATOM   765  C  CE2   . PHE A  1 93  ? 55.566 -0.532  0.141   1.00 51.41  ? 411 PHE D CE2   1 
ATOM   766  C  CZ    . PHE A  1 93  ? 56.345 -1.092  -0.851  1.00 52.19  ? 411 PHE D CZ    1 
ATOM   767  N  N     . SER A  1 94  ? 54.043 -6.194  3.977   1.00 57.57  ? 412 SER D N     1 
ATOM   768  C  CA    . SER A  1 94  ? 53.755 -6.972  5.173   1.00 58.74  ? 412 SER D CA    1 
ATOM   769  C  C     . SER A  1 94  ? 55.013 -7.692  5.634   1.00 58.54  ? 412 SER D C     1 
ATOM   770  O  O     . SER A  1 94  ? 55.793 -8.187  4.814   1.00 58.52  ? 412 SER D O     1 
ATOM   771  C  CB    . SER A  1 94  ? 52.636 -7.987  4.915   1.00 61.85  ? 412 SER D CB    1 
ATOM   772  O  OG    . SER A  1 94  ? 52.362 -8.753  6.075   1.00 63.96  ? 412 SER D OG    1 
ATOM   773  N  N     . CYS A  1 95  ? 55.208 -7.742  6.949   1.00 58.30  ? 413 CYS D N     1 
ATOM   774  C  CA    . CYS A  1 95  ? 56.344 -8.458  7.509   1.00 56.82  ? 413 CYS D CA    1 
ATOM   775  C  C     . CYS A  1 95  ? 56.186 -9.956  7.286   1.00 62.25  ? 413 CYS D C     1 
ATOM   776  O  O     . CYS A  1 95  ? 55.099 -10.515 7.455   1.00 64.41  ? 413 CYS D O     1 
ATOM   777  C  CB    . CYS A  1 95  ? 56.481 -8.159  9.001   1.00 56.56  ? 413 CYS D CB    1 
ATOM   778  S  SG    . CYS A  1 95  ? 57.869 -8.989  9.807   1.00 61.77  ? 413 CYS D SG    1 
ATOM   779  N  N     . ARG A  1 96  ? 57.282 -10.607 6.902   1.00 63.92  ? 414 ARG D N     1 
ATOM   780  C  CA    . ARG A  1 96  ? 57.289 -12.033 6.595   1.00 66.96  ? 414 ARG D CA    1 
ATOM   781  C  C     . ARG A  1 96  ? 58.145 -12.819 7.583   1.00 68.23  ? 414 ARG D C     1 
ATOM   782  O  O     . ARG A  1 96  ? 58.867 -13.745 7.209   1.00 70.05  ? 414 ARG D O     1 
ATOM   783  C  CB    . ARG A  1 96  ? 57.755 -12.270 5.162   1.00 67.59  ? 414 ARG D CB    1 
ATOM   784  C  CG    . ARG A  1 96  ? 56.763 -11.770 4.125   1.00 67.83  ? 414 ARG D CG    1 
ATOM   785  C  CD    . ARG A  1 96  ? 55.469 -12.566 4.196   1.00 71.31  ? 414 ARG D CD    1 
ATOM   786  N  NE    . ARG A  1 96  ? 54.333 -11.831 3.653   1.00 71.22  ? 414 ARG D NE    1 
ATOM   787  C  CZ    . ARG A  1 96  ? 53.090 -12.299 3.620   1.00 73.96  ? 414 ARG D CZ    1 
ATOM   788  N  NH1   . ARG A  1 96  ? 52.822 -13.508 4.094   1.00 77.04  ? 414 ARG D NH1   1 
ATOM   789  N  NH2   . ARG A  1 96  ? 52.113 -11.559 3.113   1.00 73.78  ? 414 ARG D NH2   1 
ATOM   790  N  N     . TRP A  1 97  ? 58.074 -12.447 8.856   1.00 68.05  ? 415 TRP D N     1 
ATOM   791  C  CA    . TRP A  1 97  ? 58.645 -13.227 9.942   1.00 70.43  ? 415 TRP D CA    1 
ATOM   792  C  C     . TRP A  1 97  ? 57.560 -14.064 10.605  1.00 72.72  ? 415 TRP D C     1 
ATOM   793  O  O     . TRP A  1 97  ? 56.417 -13.609 10.731  1.00 72.04  ? 415 TRP D O     1 
ATOM   794  C  CB    . TRP A  1 97  ? 59.299 -12.321 10.986  1.00 69.46  ? 415 TRP D CB    1 
ATOM   795  C  CG    . TRP A  1 97  ? 60.785 -12.193 10.819  1.00 69.58  ? 415 TRP D CG    1 
ATOM   796  C  CD1   . TRP A  1 97  ? 61.449 -11.705 9.731   1.00 68.41  ? 415 TRP D CD1   1 
ATOM   797  C  CD2   . TRP A  1 97  ? 61.791 -12.549 11.776  1.00 71.18  ? 415 TRP D CD2   1 
ATOM   798  N  NE1   . TRP A  1 97  ? 62.806 -11.742 9.949   1.00 68.91  ? 415 TRP D NE1   1 
ATOM   799  C  CE2   . TRP A  1 97  ? 63.041 -12.255 11.197  1.00 70.69  ? 415 TRP D CE2   1 
ATOM   800  C  CE3   . TRP A  1 97  ? 61.755 -13.090 13.064  1.00 73.43  ? 415 TRP D CE3   1 
ATOM   801  C  CZ2   . TRP A  1 97  ? 64.244 -12.483 11.862  1.00 72.16  ? 415 TRP D CZ2   1 
ATOM   802  C  CZ3   . TRP A  1 97  ? 62.949 -13.314 13.721  1.00 74.98  ? 415 TRP D CZ3   1 
ATOM   803  C  CH2   . TRP A  1 97  ? 64.176 -13.013 13.120  1.00 74.33  ? 415 TRP D CH2   1 
ATOM   804  N  N     . PRO A  1 98  ? 57.886 -15.287 11.019  1.00 75.71  ? 416 PRO D N     1 
ATOM   805  C  CA    . PRO A  1 98  ? 56.867 -16.151 11.624  1.00 78.73  ? 416 PRO D CA    1 
ATOM   806  C  C     . PRO A  1 98  ? 56.270 -15.519 12.874  1.00 78.80  ? 416 PRO D C     1 
ATOM   807  O  O     . PRO A  1 98  ? 56.968 -14.884 13.668  1.00 77.58  ? 416 PRO D O     1 
ATOM   808  C  CB    . PRO A  1 98  ? 57.639 -17.434 11.952  1.00 81.54  ? 416 PRO D CB    1 
ATOM   809  C  CG    . PRO A  1 98  ? 58.833 -17.405 11.053  1.00 80.60  ? 416 PRO D CG    1 
ATOM   810  C  CD    . PRO A  1 98  ? 59.192 -15.958 10.910  1.00 76.78  ? 416 PRO D CD    1 
ATOM   811  N  N     . SER A  1 99  ? 54.954 -15.687 13.024  1.00 80.57  ? 417 SER D N     1 
ATOM   812  C  CA    . SER A  1 99  ? 54.197 -15.167 14.166  1.00 81.00  ? 417 SER D CA    1 
ATOM   813  C  C     . SER A  1 99  ? 54.301 -13.648 14.280  1.00 77.90  ? 417 SER D C     1 
ATOM   814  O  O     . SER A  1 99  ? 54.322 -13.099 15.384  1.00 77.97  ? 417 SER D O     1 
ATOM   815  C  CB    . SER A  1 99  ? 54.631 -15.833 15.476  1.00 83.29  ? 417 SER D CB    1 
ATOM   816  N  N     . CYS A  1 100 ? 54.361 -12.954 13.142  1.00 75.69  ? 418 CYS D N     1 
ATOM   817  C  CA    . CYS A  1 100 ? 54.398 -11.492 13.137  1.00 73.31  ? 418 CYS D CA    1 
ATOM   818  C  C     . CYS A  1 100 ? 53.623 -11.010 11.913  1.00 72.42  ? 418 CYS D C     1 
ATOM   819  O  O     . CYS A  1 100 ? 54.149 -11.027 10.797  1.00 71.25  ? 418 CYS D O     1 
ATOM   820  C  CB    . CYS A  1 100 ? 55.830 -10.973 13.129  1.00 71.83  ? 418 CYS D CB    1 
ATOM   821  S  SG    . CYS A  1 100 ? 55.971 -9.177  12.938  1.00 69.04  ? 418 CYS D SG    1 
ATOM   822  N  N     . GLN A  1 101 ? 52.376 -10.590 12.131  1.00 73.34  ? 419 GLN D N     1 
ATOM   823  C  CA    . GLN A  1 101 ? 51.545 -10.023 11.070  1.00 72.74  ? 419 GLN D CA    1 
ATOM   824  C  C     . GLN A  1 101 ? 51.519 -8.508  11.248  1.00 70.34  ? 419 GLN D C     1 
ATOM   825  O  O     . GLN A  1 101 ? 50.599 -7.933  11.830  1.00 71.62  ? 419 GLN D O     1 
ATOM   826  C  CB    . GLN A  1 101 ? 50.144 -10.626 11.100  1.00 75.68  ? 419 GLN D CB    1 
ATOM   827  N  N     . LYS A  1 102 ? 52.557 -7.855  10.729  1.00 67.08  ? 420 LYS D N     1 
ATOM   828  C  CA    . LYS A  1 102 ? 52.701 -6.409  10.816  1.00 64.59  ? 420 LYS D CA    1 
ATOM   829  C  C     . LYS A  1 102 ? 52.859 -5.844  9.413   1.00 61.45  ? 420 LYS D C     1 
ATOM   830  O  O     . LYS A  1 102 ? 53.636 -6.375  8.613   1.00 61.01  ? 420 LYS D O     1 
ATOM   831  C  CB    . LYS A  1 102 ? 53.900 -6.024  11.689  1.00 64.54  ? 420 LYS D CB    1 
ATOM   832  C  CG    . LYS A  1 102 ? 54.014 -4.536  11.964  1.00 63.68  ? 420 LYS D CG    1 
ATOM   833  C  CD    . LYS A  1 102 ? 52.762 -4.008  12.646  1.00 66.33  ? 420 LYS D CD    1 
ATOM   834  C  CE    . LYS A  1 102 ? 52.859 -2.507  12.876  1.00 65.62  ? 420 LYS D CE    1 
ATOM   835  N  NZ    . LYS A  1 102 ? 51.596 -1.938  13.421  1.00 67.86  ? 420 LYS D NZ    1 
ATOM   836  N  N     . LYS A  1 103 ? 52.129 -4.771  9.118   1.00 59.40  ? 421 LYS D N     1 
ATOM   837  C  CA    . LYS A  1 103 ? 52.112 -4.172  7.792   1.00 56.77  ? 421 LYS D CA    1 
ATOM   838  C  C     . LYS A  1 103 ? 52.607 -2.732  7.849   1.00 53.75  ? 421 LYS D C     1 
ATOM   839  O  O     . LYS A  1 103 ? 52.467 -2.048  8.868   1.00 53.55  ? 421 LYS D O     1 
ATOM   840  C  CB    . LYS A  1 103 ? 50.704 -4.222  7.182   1.00 58.07  ? 421 LYS D CB    1 
ATOM   841  C  CG    . LYS A  1 103 ? 50.368 -5.549  6.520   1.00 60.44  ? 421 LYS D CG    1 
ATOM   842  C  CD    . LYS A  1 103 ? 48.919 -5.610  6.064   1.00 62.73  ? 421 LYS D CD    1 
ATOM   843  C  CE    . LYS A  1 103 ? 47.980 -5.844  7.236   1.00 65.06  ? 421 LYS D CE    1 
ATOM   844  N  NZ    . LYS A  1 103 ? 46.585 -6.103  6.783   1.00 68.10  ? 421 LYS D NZ    1 
ATOM   845  N  N     . PHE A  1 104 ? 53.190 -2.281  6.740   1.00 51.17  ? 422 PHE D N     1 
ATOM   846  C  CA    . PHE A  1 104 ? 53.728 -0.934  6.626   1.00 47.66  ? 422 PHE D CA    1 
ATOM   847  C  C     . PHE A  1 104 ? 53.344 -0.352  5.274   1.00 46.94  ? 422 PHE D C     1 
ATOM   848  O  O     . PHE A  1 104 ? 53.049 -1.079  4.322   1.00 48.32  ? 422 PHE D O     1 
ATOM   849  C  CB    . PHE A  1 104 ? 55.254 -0.916  6.791   1.00 45.13  ? 422 PHE D CB    1 
ATOM   850  C  CG    . PHE A  1 104 ? 55.727 -1.469  8.102   1.00 44.96  ? 422 PHE D CG    1 
ATOM   851  C  CD1   . PHE A  1 104 ? 55.998 -2.820  8.242   1.00 46.25  ? 422 PHE D CD1   1 
ATOM   852  C  CD2   . PHE A  1 104 ? 55.903 -0.638  9.196   1.00 44.14  ? 422 PHE D CD2   1 
ATOM   853  C  CE1   . PHE A  1 104 ? 56.434 -3.332  9.448   1.00 47.35  ? 422 PHE D CE1   1 
ATOM   854  C  CE2   . PHE A  1 104 ? 56.339 -1.144  10.405  1.00 45.23  ? 422 PHE D CE2   1 
ATOM   855  C  CZ    . PHE A  1 104 ? 56.605 -2.493  10.531  1.00 46.85  ? 422 PHE D CZ    1 
ATOM   856  N  N     . ALA A  1 105 ? 53.365 0.976   5.195   1.00 45.49  ? 423 ALA D N     1 
ATOM   857  C  CA    . ALA A  1 105 ? 52.953 1.691   3.995   1.00 45.10  ? 423 ALA D CA    1 
ATOM   858  C  C     . ALA A  1 105 ? 54.112 2.030   3.065   1.00 43.06  ? 423 ALA D C     1 
ATOM   859  O  O     . ALA A  1 105 ? 53.886 2.653   2.023   1.00 42.67  ? 423 ALA D O     1 
ATOM   860  C  CB    . ALA A  1 105 ? 52.212 2.977   4.378   1.00 44.87  ? 423 ALA D CB    1 
ATOM   861  N  N     . ARG A  1 106 ? 55.337 1.638   3.407   1.00 41.50  ? 424 ARG D N     1 
ATOM   862  C  CA    . ARG A  1 106 ? 56.496 1.945   2.581   1.00 38.19  ? 424 ARG D CA    1 
ATOM   863  C  C     . ARG A  1 106 ? 57.514 0.822   2.706   1.00 39.86  ? 424 ARG D C     1 
ATOM   864  O  O     . ARG A  1 106 ? 57.621 0.174   3.751   1.00 41.80  ? 424 ARG D O     1 
ATOM   865  C  CB    . ARG A  1 106 ? 57.125 3.287   2.974   1.00 34.28  ? 424 ARG D CB    1 
ATOM   866  C  CG    . ARG A  1 106 ? 56.893 4.394   1.960   1.00 34.66  ? 424 ARG D CG    1 
ATOM   867  C  CD    . ARG A  1 106 ? 57.173 5.764   2.555   1.00 32.95  ? 424 ARG D CD    1 
ATOM   868  N  NE    . ARG A  1 106 ? 58.526 5.874   3.094   1.00 31.58  ? 424 ARG D NE    1 
ATOM   869  C  CZ    . ARG A  1 106 ? 59.021 6.981   3.637   1.00 29.90  ? 424 ARG D CZ    1 
ATOM   870  N  NH1   . ARG A  1 106 ? 58.274 8.075   3.709   1.00 30.26  ? 424 ARG D NH1   1 
ATOM   871  N  NH2   . ARG A  1 106 ? 60.261 6.998   4.105   1.00 30.62  ? 424 ARG D NH2   1 
ATOM   872  N  N     . SER A  1 107 ? 58.261 0.597   1.621   1.00 38.88  ? 425 SER D N     1 
ATOM   873  C  CA    . SER A  1 107 ? 59.241 -0.485  1.607   1.00 39.31  ? 425 SER D CA    1 
ATOM   874  C  C     . SER A  1 107 ? 60.349 -0.245  2.625   1.00 38.04  ? 425 SER D C     1 
ATOM   875  O  O     . SER A  1 107 ? 60.744 -1.166  3.351   1.00 39.13  ? 425 SER D O     1 
ATOM   876  C  CB    . SER A  1 107 ? 59.830 -0.645  0.206   1.00 39.94  ? 425 SER D CB    1 
ATOM   877  O  OG    . SER A  1 107 ? 60.631 0.470   -0.143  1.00 38.59  ? 425 SER D OG    1 
ATOM   878  N  N     . ASP A  1 108 ? 60.867 0.985   2.692   1.00 36.47  ? 426 ASP D N     1 
ATOM   879  C  CA    . ASP A  1 108 ? 61.924 1.288   3.649   1.00 37.23  ? 426 ASP D CA    1 
ATOM   880  C  C     . ASP A  1 108 ? 61.446 1.167   5.090   1.00 38.41  ? 426 ASP D C     1 
ATOM   881  O  O     . ASP A  1 108 ? 62.269 0.949   5.986   1.00 39.21  ? 426 ASP D O     1 
ATOM   882  C  CB    . ASP A  1 108 ? 62.489 2.688   3.392   1.00 36.36  ? 426 ASP D CB    1 
ATOM   883  C  CG    . ASP A  1 108 ? 61.408 3.741   3.251   1.00 36.38  ? 426 ASP D CG    1 
ATOM   884  O  OD1   . ASP A  1 108 ? 60.408 3.483   2.548   1.00 37.09  ? 426 ASP D OD1   1 
ATOM   885  O  OD2   . ASP A  1 108 ? 61.561 4.829   3.844   1.00 36.02  ? 426 ASP D OD2   1 
ATOM   886  N  N     . GLU A  1 109 ? 60.140 1.296   5.333   1.00 39.15  ? 427 GLU D N     1 
ATOM   887  C  CA    . GLU A  1 109 ? 59.613 1.022   6.666   1.00 41.23  ? 427 GLU D CA    1 
ATOM   888  C  C     . GLU A  1 109 ? 59.725 -0.458  7.007   1.00 41.74  ? 427 GLU D C     1 
ATOM   889  O  O     . GLU A  1 109 ? 60.094 -0.816  8.131   1.00 43.13  ? 427 GLU D O     1 
ATOM   890  C  CB    . GLU A  1 109 ? 58.161 1.489   6.766   1.00 43.61  ? 427 GLU D CB    1 
ATOM   891  C  CG    . GLU A  1 109 ? 57.999 2.991   6.919   1.00 44.60  ? 427 GLU D CG    1 
ATOM   892  C  CD    . GLU A  1 109 ? 56.553 3.401   7.109   1.00 46.95  ? 427 GLU D CD    1 
ATOM   893  O  OE1   . GLU A  1 109 ? 55.897 3.757   6.107   1.00 47.01  ? 427 GLU D OE1   1 
ATOM   894  O  OE2   . GLU A  1 109 ? 56.070 3.356   8.260   1.00 48.72  ? 427 GLU D OE2   1 
ATOM   895  N  N     . LEU A  1 110 ? 59.409 -1.333  6.048   1.00 40.21  ? 428 LEU D N     1 
ATOM   896  C  CA    . LEU A  1 110 ? 59.522 -2.768  6.288   1.00 41.07  ? 428 LEU D CA    1 
ATOM   897  C  C     . LEU A  1 110 ? 60.976 -3.189  6.452   1.00 41.71  ? 428 LEU D C     1 
ATOM   898  O  O     . LEU A  1 110 ? 61.285 -4.072  7.261   1.00 44.33  ? 428 LEU D O     1 
ATOM   899  C  CB    . LEU A  1 110 ? 58.863 -3.544  5.148   1.00 43.79  ? 428 LEU D CB    1 
ATOM   900  C  CG    . LEU A  1 110 ? 58.973 -5.068  5.211   1.00 38.39  ? 428 LEU D CG    1 
ATOM   901  C  CD1   . LEU A  1 110 ? 58.396 -5.587  6.517   1.00 39.90  ? 428 LEU D CD1   1 
ATOM   902  C  CD2   . LEU A  1 110 ? 58.280 -5.712  4.021   1.00 39.75  ? 428 LEU D CD2   1 
ATOM   903  N  N     . VAL A  1 111 ? 61.883 -2.572  5.690   1.00 41.04  ? 429 VAL D N     1 
ATOM   904  C  CA    . VAL A  1 111 ? 63.303 -2.889  5.817   1.00 41.88  ? 429 VAL D CA    1 
ATOM   905  C  C     . VAL A  1 111 ? 63.792 -2.569  7.224   1.00 42.92  ? 429 VAL D C     1 
ATOM   906  O  O     . VAL A  1 111 ? 64.502 -3.366  7.851   1.00 44.67  ? 429 VAL D O     1 
ATOM   907  C  CB    . VAL A  1 111 ? 64.120 -2.137  4.752   1.00 39.91  ? 429 VAL D CB    1 
ATOM   908  C  CG1   . VAL A  1 111 ? 65.608 -2.355  4.972   1.00 40.49  ? 429 VAL D CG1   1 
ATOM   909  C  CG2   . VAL A  1 111 ? 63.714 -2.582  3.357   1.00 39.59  ? 429 VAL D CG2   1 
ATOM   910  N  N     . ARG A  1 112 ? 63.413 -1.399  7.744   1.00 42.16  ? 430 ARG D N     1 
ATOM   911  C  CA    . ARG A  1 112 ? 63.786 -1.038  9.108   1.00 43.41  ? 430 ARG D CA    1 
ATOM   912  C  C     . ARG A  1 112 ? 63.211 -2.027  10.116  1.00 45.89  ? 430 ARG D C     1 
ATOM   913  O  O     . ARG A  1 112 ? 63.862 -2.357  11.115  1.00 47.16  ? 430 ARG D O     1 
ATOM   914  C  CB    . ARG A  1 112 ? 63.318 0.384   9.419   1.00 42.33  ? 430 ARG D CB    1 
ATOM   915  C  CG    . ARG A  1 112 ? 63.630 0.850   10.830  1.00 44.19  ? 430 ARG D CG    1 
ATOM   916  C  CD    . ARG A  1 112 ? 63.155 2.274   11.064  1.00 44.08  ? 430 ARG D CD    1 
ATOM   917  N  NE    . ARG A  1 112 ? 63.801 3.222   10.161  1.00 43.54  ? 430 ARG D NE    1 
ATOM   918  C  CZ    . ARG A  1 112 ? 63.606 4.536   10.196  1.00 43.37  ? 430 ARG D CZ    1 
ATOM   919  N  NH1   . ARG A  1 112 ? 62.782 5.061   11.093  1.00 44.56  ? 430 ARG D NH1   1 
ATOM   920  N  NH2   . ARG A  1 112 ? 64.235 5.325   9.337   1.00 41.92  ? 430 ARG D NH2   1 
ATOM   921  N  N     . HIS A  1 113 ? 61.994 -2.515  9.866   1.00 46.95  ? 431 HIS D N     1 
ATOM   922  C  CA    . HIS A  1 113 ? 61.396 -3.504  10.756  1.00 49.09  ? 431 HIS D CA    1 
ATOM   923  C  C     . HIS A  1 113 ? 62.138 -4.833  10.685  1.00 49.65  ? 431 HIS D C     1 
ATOM   924  O  O     . HIS A  1 113 ? 62.385 -5.467  11.717  1.00 54.19  ? 431 HIS D O     1 
ATOM   925  C  CB    . HIS A  1 113 ? 59.919 -3.693  10.410  1.00 53.44  ? 431 HIS D CB    1 
ATOM   926  C  CG    . HIS A  1 113 ? 59.201 -4.644  11.315  1.00 61.91  ? 431 HIS D CG    1 
ATOM   927  N  ND1   . HIS A  1 113 ? 58.871 -4.330  12.615  1.00 64.28  ? 431 HIS D ND1   1 
ATOM   928  C  CD2   . HIS A  1 113 ? 58.749 -5.903  11.106  1.00 65.10  ? 431 HIS D CD2   1 
ATOM   929  C  CE1   . HIS A  1 113 ? 58.247 -5.354  13.169  1.00 66.81  ? 431 HIS D CE1   1 
ATOM   930  N  NE2   . HIS A  1 113 ? 58.160 -6.322  12.275  1.00 66.60  ? 431 HIS D NE2   1 
ATOM   931  N  N     . HIS A  1 114 ? 62.499 -5.270  9.474   1.00 51.19  ? 432 HIS D N     1 
ATOM   932  C  CA    . HIS A  1 114 ? 63.235 -6.522  9.321   1.00 56.77  ? 432 HIS D CA    1 
ATOM   933  C  C     . HIS A  1 114 ? 64.583 -6.475  10.027  1.00 58.89  ? 432 HIS D C     1 
ATOM   934  O  O     . HIS A  1 114 ? 65.052 -7.499  10.536  1.00 61.20  ? 432 HIS D O     1 
ATOM   935  C  CB    . HIS A  1 114 ? 63.431 -6.841  7.837   1.00 57.99  ? 432 HIS D CB    1 
ATOM   936  C  CG    . HIS A  1 114 ? 62.276 -7.562  7.214   1.00 60.37  ? 432 HIS D CG    1 
ATOM   937  N  ND1   . HIS A  1 114 ? 61.391 -8.323  7.947   1.00 62.52  ? 432 HIS D ND1   1 
ATOM   938  C  CD2   . HIS A  1 114 ? 61.864 -7.641  5.927   1.00 60.48  ? 432 HIS D CD2   1 
ATOM   939  C  CE1   . HIS A  1 114 ? 60.482 -8.838  7.138   1.00 63.39  ? 432 HIS D CE1   1 
ATOM   940  N  NE2   . HIS A  1 114 ? 60.746 -8.440  5.907   1.00 62.16  ? 432 HIS D NE2   1 
ATOM   941  N  N     . ASN A  1 115 ? 65.221 -5.304  10.067  1.00 58.42  ? 433 ASN D N     1 
ATOM   942  C  CA    . ASN A  1 115 ? 66.508 -5.187  10.742  1.00 60.58  ? 433 ASN D CA    1 
ATOM   943  C  C     . ASN A  1 115 ? 66.361 -5.183  12.258  1.00 62.37  ? 433 ASN D C     1 
ATOM   944  O  O     . ASN A  1 115 ? 67.235 -5.704  12.960  1.00 64.59  ? 433 ASN D O     1 
ATOM   945  C  CB    . ASN A  1 115 ? 67.232 -3.922  10.279  1.00 59.58  ? 433 ASN D CB    1 
ATOM   946  C  CG    . ASN A  1 115 ? 67.425 -3.881  8.776   1.00 59.28  ? 433 ASN D CG    1 
ATOM   947  O  OD1   . ASN A  1 115 ? 67.240 -2.842  8.143   1.00 57.50  ? 433 ASN D OD1   1 
ATOM   948  N  ND2   . ASN A  1 115 ? 67.790 -5.018  8.194   1.00 61.18  ? 433 ASN D ND2   1 
ATOM   949  N  N     . MET A  1 116 ? 65.274 -4.613  12.783  1.00 62.15  ? 434 MET D N     1 
ATOM   950  C  CA    . MET A  1 116 ? 65.047 -4.646  14.223  1.00 64.72  ? 434 MET D CA    1 
ATOM   951  C  C     . MET A  1 116 ? 64.596 -6.013  14.716  1.00 66.45  ? 434 MET D C     1 
ATOM   952  O  O     . MET A  1 116 ? 64.521 -6.218  15.932  1.00 68.07  ? 434 MET D O     1 
ATOM   953  C  CB    . MET A  1 116 ? 64.019 -3.587  14.629  1.00 65.45  ? 434 MET D CB    1 
ATOM   954  C  CG    . MET A  1 116 ? 64.537 -2.159  14.567  1.00 65.56  ? 434 MET D CG    1 
ATOM   955  S  SD    . MET A  1 116 ? 63.934 -1.141  15.930  1.00 67.78  ? 434 MET D SD    1 
ATOM   956  C  CE    . MET A  1 116 ? 64.781 -1.894  17.319  1.00 71.11  ? 434 MET D CE    1 
ATOM   957  N  N     . HIS A  1 117 ? 64.290 -6.943  13.814  1.00 66.92  ? 435 HIS D N     1 
ATOM   958  C  CA    . HIS A  1 117 ? 64.025 -8.325  14.192  1.00 69.18  ? 435 HIS D CA    1 
ATOM   959  C  C     . HIS A  1 117 ? 65.294 -9.094  14.527  1.00 71.23  ? 435 HIS D C     1 
ATOM   960  O  O     . HIS A  1 117 ? 65.205 -10.260 14.926  1.00 72.86  ? 435 HIS D O     1 
ATOM   961  C  CB    . HIS A  1 117 ? 63.276 -9.049  13.069  1.00 69.53  ? 435 HIS D CB    1 
ATOM   962  C  CG    . HIS A  1 117 ? 61.786 -8.964  13.180  1.00 72.63  ? 435 HIS D CG    1 
ATOM   963  N  ND1   . HIS A  1 117 ? 61.037 -9.895  13.867  1.00 75.64  ? 435 HIS D ND1   1 
ATOM   964  C  CD2   . HIS A  1 117 ? 60.904 -8.064  12.685  1.00 71.25  ? 435 HIS D CD2   1 
ATOM   965  C  CE1   . HIS A  1 117 ? 59.759 -9.570  13.794  1.00 75.25  ? 435 HIS D CE1   1 
ATOM   966  N  NE2   . HIS A  1 117 ? 59.651 -8.463  13.083  1.00 71.76  ? 435 HIS D NE2   1 
ATOM   967  N  N     . GLN A  1 118 ? 66.462 -8.478  14.375  1.00 71.55  ? 436 GLN D N     1 
ATOM   968  C  CA    . GLN A  1 118 ? 67.729 -9.162  14.596  1.00 72.70  ? 436 GLN D CA    1 
ATOM   969  C  C     . GLN A  1 118 ? 68.597 -8.400  15.592  1.00 72.10  ? 436 GLN D C     1 
ATOM   970  O  O     . GLN A  1 118 ? 69.390 -7.540  15.207  1.00 70.53  ? 436 GLN D O     1 
ATOM   971  C  CB    . GLN A  1 118 ? 68.476 -9.337  13.272  1.00 72.18  ? 436 GLN D CB    1 
ATOM   972  C  CG    . GLN A  1 118 ? 67.569 -9.662  12.094  1.00 71.56  ? 436 GLN D CG    1 
ATOM   973  C  CD    . GLN A  1 118 ? 68.340 -10.043 10.848  1.00 72.58  ? 436 GLN D CD    1 
ATOM   974  O  OE1   . GLN A  1 118 ? 69.501 -10.444 10.920  1.00 74.80  ? 436 GLN D OE1   1 
ATOM   975  N  NE2   . GLN A  1 118 ? 67.694 -9.922  9.693   1.00 71.13  ? 436 GLN D NE2   1 
ATOM   976  P  P     . DG  B  2 2   ? 56.175 2.609   11.901  1.00 50.57  ? 2   DG  E P     1 
ATOM   977  O  OP1   . DG  B  2 2   ? 55.124 1.867   12.634  1.00 52.90  ? 2   DG  E OP1   1 
ATOM   978  O  OP2   . DG  B  2 2   ? 56.865 1.982   10.754  1.00 49.46  ? 2   DG  E OP2   1 
ATOM   979  O  "O5'" . DG  B  2 2   ? 55.578 4.002   11.393  1.00 48.69  ? 2   DG  E "O5'" 1 
ATOM   980  C  "C5'" . DG  B  2 2   ? 54.406 4.537   11.992  1.00 48.72  ? 2   DG  E "C5'" 1 
ATOM   981  C  "C4'" . DG  B  2 2   ? 54.170 5.971   11.541  1.00 46.53  ? 2   DG  E "C4'" 1 
ATOM   982  O  "O4'" . DG  B  2 2   ? 55.353 6.768   11.800  1.00 44.63  ? 2   DG  E "O4'" 1 
ATOM   983  C  "C3'" . DG  B  2 2   ? 53.867 6.146   10.058  1.00 44.76  ? 2   DG  E "C3'" 1 
ATOM   984  O  "O3'" . DG  B  2 2   ? 52.972 7.238   9.873   1.00 45.72  ? 2   DG  E "O3'" 1 
ATOM   985  C  "C2'" . DG  B  2 2   ? 55.242 6.434   9.459   1.00 42.24  ? 2   DG  E "C2'" 1 
ATOM   986  C  "C1'" . DG  B  2 2   ? 55.930 7.204   10.582  1.00 42.16  ? 2   DG  E "C1'" 1 
ATOM   987  N  N9    . DG  B  2 2   ? 57.368 6.961   10.648  1.00 40.50  ? 2   DG  E N9    1 
ATOM   988  C  C8    . DG  B  2 2   ? 58.010 5.753   10.509  1.00 40.23  ? 2   DG  E C8    1 
ATOM   989  N  N7    . DG  B  2 2   ? 59.306 5.837   10.620  1.00 39.33  ? 2   DG  E N7    1 
ATOM   990  C  C5    . DG  B  2 2   ? 59.540 7.187   10.851  1.00 38.82  ? 2   DG  E C5    1 
ATOM   991  C  C6    . DG  B  2 2   ? 60.757 7.880   11.051  1.00 37.97  ? 2   DG  E C6    1 
ATOM   992  O  O6    . DG  B  2 2   ? 61.907 7.422   11.067  1.00 37.61  ? 2   DG  E O6    1 
ATOM   993  N  N1    . DG  B  2 2   ? 60.547 9.242   11.248  1.00 37.68  ? 2   DG  E N1    1 
ATOM   994  C  C2    . DG  B  2 2   ? 59.317 9.856   11.251  1.00 38.30  ? 2   DG  E C2    1 
ATOM   995  N  N2    . DG  B  2 2   ? 59.314 11.180  11.458  1.00 38.38  ? 2   DG  E N2    1 
ATOM   996  N  N3    . DG  B  2 2   ? 58.170 9.218   11.064  1.00 39.14  ? 2   DG  E N3    1 
ATOM   997  C  C4    . DG  B  2 2   ? 58.357 7.892   10.870  1.00 39.35  ? 2   DG  E C4    1 
ATOM   998  P  P     . DC  B  2 3   ? 52.386 7.567   8.413   1.00 43.63  ? 3   DC  E P     1 
ATOM   999  O  OP1   . DC  B  2 3   ? 51.059 8.197   8.592   1.00 46.50  ? 3   DC  E OP1   1 
ATOM   1000 O  OP2   . DC  B  2 3   ? 52.523 6.349   7.586   1.00 44.75  ? 3   DC  E OP2   1 
ATOM   1001 O  "O5'" . DC  B  2 3   ? 53.399 8.659   7.834   1.00 43.41  ? 3   DC  E "O5'" 1 
ATOM   1002 C  "C5'" . DC  B  2 3   ? 53.579 9.888   8.516   1.00 42.88  ? 3   DC  E "C5'" 1 
ATOM   1003 C  "C4'" . DC  B  2 3   ? 54.697 10.698  7.887   1.00 40.81  ? 3   DC  E "C4'" 1 
ATOM   1004 O  "O4'" . DC  B  2 3   ? 55.983 10.169  8.298   1.00 40.86  ? 3   DC  E "O4'" 1 
ATOM   1005 C  "C3'" . DC  B  2 3   ? 54.713 10.720  6.349   1.00 40.73  ? 3   DC  E "C3'" 1 
ATOM   1006 O  "O3'" . DC  B  2 3   ? 54.785 12.068  5.894   1.00 39.30  ? 3   DC  E "O3'" 1 
ATOM   1007 C  "C2'" . DC  B  2 3   ? 55.986 9.945   5.997   1.00 38.57  ? 3   DC  E "C2'" 1 
ATOM   1008 C  "C1'" . DC  B  2 3   ? 56.854 10.239  7.203   1.00 39.16  ? 3   DC  E "C1'" 1 
ATOM   1009 N  N1    . DC  B  2 3   ? 57.954 9.260   7.385   1.00 39.13  ? 3   DC  E N1    1 
ATOM   1010 C  C2    . DC  B  2 3   ? 59.199 9.696   7.853   1.00 39.08  ? 3   DC  E C2    1 
ATOM   1011 O  O2    . DC  B  2 3   ? 59.356 10.894  8.127   1.00 39.28  ? 3   DC  E O2    1 
ATOM   1012 N  N3    . DC  B  2 3   ? 60.193 8.789   8.000   1.00 38.79  ? 3   DC  E N3    1 
ATOM   1013 C  C4    . DC  B  2 3   ? 59.976 7.508   7.691   1.00 39.03  ? 3   DC  E C4    1 
ATOM   1014 N  N4    . DC  B  2 3   ? 60.982 6.648   7.851   1.00 38.67  ? 3   DC  E N4    1 
ATOM   1015 C  C5    . DC  B  2 3   ? 58.716 7.052   7.208   1.00 39.75  ? 3   DC  E C5    1 
ATOM   1016 C  C6    . DC  B  2 3   ? 57.746 7.954   7.068   1.00 39.84  ? 3   DC  E C6    1 
ATOM   1017 P  P     . DG  B  2 4   ? 54.506 12.447  4.355   1.00 38.90  ? 4   DG  E P     1 
ATOM   1018 O  OP1   . DG  B  2 4   ? 53.157 13.052  4.286   1.00 40.29  ? 4   DG  E OP1   1 
ATOM   1019 O  OP2   . DG  B  2 4   ? 54.848 11.311  3.469   1.00 38.42  ? 4   DG  E OP2   1 
ATOM   1020 O  "O5'" . DG  B  2 4   ? 55.576 13.596  4.058   1.00 37.57  ? 4   DG  E "O5'" 1 
ATOM   1021 C  "C5'" . DG  B  2 4   ? 55.638 14.740  4.904   1.00 37.88  ? 4   DG  E "C5'" 1 
ATOM   1022 C  "C4'" . DG  B  2 4   ? 57.039 15.327  4.921   1.00 36.81  ? 4   DG  E "C4'" 1 
ATOM   1023 O  "O4'" . DG  B  2 4   ? 57.967 14.358  5.474   1.00 36.30  ? 4   DG  E "O4'" 1 
ATOM   1024 C  "C3'" . DG  B  2 4   ? 57.591 15.719  3.549   1.00 35.68  ? 4   DG  E "C3'" 1 
ATOM   1025 O  "O3'" . DG  B  2 4   ? 58.240 16.980  3.630   1.00 36.08  ? 4   DG  E "O3'" 1 
ATOM   1026 C  "C2'" . DG  B  2 4   ? 58.578 14.598  3.227   1.00 34.36  ? 4   DG  E "C2'" 1 
ATOM   1027 C  "C1'" . DG  B  2 4   ? 59.071 14.209  4.611   1.00 34.91  ? 4   DG  E "C1'" 1 
ATOM   1028 N  N9    . DG  B  2 4   ? 59.529 12.826  4.686   1.00 34.51  ? 4   DG  E N9    1 
ATOM   1029 C  C8    . DG  B  2 4   ? 58.752 11.696  4.620   1.00 34.89  ? 4   DG  E C8    1 
ATOM   1030 N  N7    . DG  B  2 4   ? 59.434 10.589  4.713   1.00 34.62  ? 4   DG  E N7    1 
ATOM   1031 C  C5    . DG  B  2 4   ? 60.751 11.012  4.847   1.00 33.99  ? 4   DG  E C5    1 
ATOM   1032 C  C6    . DG  B  2 4   ? 61.939 10.257  4.989   1.00 33.89  ? 4   DG  E C6    1 
ATOM   1033 O  O6    . DG  B  2 4   ? 62.067 9.025   5.024   1.00 34.33  ? 4   DG  E O6    1 
ATOM   1034 N  N1    . DG  B  2 4   ? 63.060 11.077  5.094   1.00 33.32  ? 4   DG  E N1    1 
ATOM   1035 C  C2    . DG  B  2 4   ? 63.034 12.451  5.068   1.00 33.27  ? 4   DG  E C2    1 
ATOM   1036 N  N2    . DG  B  2 4   ? 64.218 13.070  5.184   1.00 32.93  ? 4   DG  E N2    1 
ATOM   1037 N  N3    . DG  B  2 4   ? 61.926 13.170  4.936   1.00 33.50  ? 4   DG  E N3    1 
ATOM   1038 C  C4    . DG  B  2 4   ? 60.827 12.386  4.831   1.00 33.82  ? 4   DG  E C4    1 
ATOM   1039 P  P     . DT  B  2 5   ? 58.526 17.826  2.295   1.00 35.91  ? 5   DT  E P     1 
ATOM   1040 O  OP1   . DT  B  2 5   ? 58.847 19.214  2.700   1.00 36.22  ? 5   DT  E OP1   1 
ATOM   1041 O  OP2   . DT  B  2 5   ? 57.412 17.569  1.357   1.00 36.70  ? 5   DT  E OP2   1 
ATOM   1042 O  "O5'" . DT  B  2 5   ? 59.841 17.149  1.687   1.00 34.79  ? 5   DT  E "O5'" 1 
ATOM   1043 C  "C5'" . DT  B  2 5   ? 61.076 17.269  2.373   1.00 34.38  ? 5   DT  E "C5'" 1 
ATOM   1044 C  "C4'" . DT  B  2 5   ? 62.183 16.533  1.639   1.00 33.66  ? 5   DT  E "C4'" 1 
ATOM   1045 O  "O4'" . DT  B  2 5   ? 62.195 15.135  2.027   1.00 33.43  ? 5   DT  E "O4'" 1 
ATOM   1046 C  "C3'" . DT  B  2 5   ? 62.080 16.548  0.106   1.00 33.56  ? 5   DT  E "C3'" 1 
ATOM   1047 O  "O3'" . DT  B  2 5   ? 63.345 16.875  -0.448  1.00 34.14  ? 5   DT  E "O3'" 1 
ATOM   1048 C  "C2'" . DT  B  2 5   ? 61.693 15.105  -0.227  1.00 32.81  ? 5   DT  E "C2'" 1 
ATOM   1049 C  "C1'" . DT  B  2 5   ? 62.428 14.369  0.875   1.00 32.42  ? 5   DT  E "C1'" 1 
ATOM   1050 N  N1    . DT  B  2 5   ? 61.958 12.972  1.107   1.00 31.98  ? 5   DT  E N1    1 
ATOM   1051 C  C2    . DT  B  2 5   ? 62.887 11.997  1.386   1.00 31.06  ? 5   DT  E C2    1 
ATOM   1052 O  O2    . DT  B  2 5   ? 64.082 12.218  1.459   1.00 30.22  ? 5   DT  E O2    1 
ATOM   1053 N  N3    . DT  B  2 5   ? 62.365 10.747  1.583   1.00 31.25  ? 5   DT  E N3    1 
ATOM   1054 C  C4    . DT  B  2 5   ? 61.033 10.380  1.526   1.00 31.97  ? 5   DT  E C4    1 
ATOM   1055 O  O4    . DT  B  2 5   ? 60.662 9.227   1.718   1.00 32.07  ? 5   DT  E O4    1 
ATOM   1056 C  C5    . DT  B  2 5   ? 60.110 11.449  1.225   1.00 32.61  ? 5   DT  E C5    1 
ATOM   1057 C  C7    . DT  B  2 5   ? 58.639 11.172  1.137   1.00 33.63  ? 5   DT  E C7    1 
ATOM   1058 C  C6    . DT  B  2 5   ? 60.612 12.680  1.030   1.00 32.47  ? 5   DT  E C6    1 
ATOM   1059 P  P     . DG  B  2 6   ? 63.471 17.974  -1.613  1.00 35.51  ? 6   DG  E P     1 
ATOM   1060 O  OP1   . DG  B  2 6   ? 63.349 19.315  -0.993  1.00 35.95  ? 6   DG  E OP1   1 
ATOM   1061 O  OP2   . DG  B  2 6   ? 62.555 17.577  -2.707  1.00 35.76  ? 6   DG  E OP2   1 
ATOM   1062 O  "O5'" . DG  B  2 6   ? 64.973 17.794  -2.139  1.00 34.21  ? 6   DG  E "O5'" 1 
ATOM   1063 C  "C5'" . DG  B  2 6   ? 65.338 16.637  -2.889  1.00 32.74  ? 6   DG  E "C5'" 1 
ATOM   1064 C  "C4'" . DG  B  2 6   ? 66.624 16.035  -2.347  1.00 31.68  ? 6   DG  E "C4'" 1 
ATOM   1065 O  "O4'" . DG  B  2 6   ? 66.323 15.254  -1.166  1.00 31.40  ? 6   DG  E "O4'" 1 
ATOM   1066 C  "C3'" . DG  B  2 6   ? 67.360 15.107  -3.308  1.00 31.01  ? 6   DG  E "C3'" 1 
ATOM   1067 O  "O3'" . DG  B  2 6   ? 68.405 15.825  -3.948  1.00 30.50  ? 6   DG  E "O3'" 1 
ATOM   1068 C  "C2'" . DG  B  2 6   ? 67.923 14.020  -2.394  1.00 30.64  ? 6   DG  E "C2'" 1 
ATOM   1069 C  "C1'" . DG  B  2 6   ? 66.901 13.972  -1.263  1.00 30.74  ? 6   DG  E "C1'" 1 
ATOM   1070 N  N9    . DG  B  2 6   ? 65.831 12.997  -1.460  1.00 31.06  ? 6   DG  E N9    1 
ATOM   1071 C  C8    . DG  B  2 6   ? 64.496 13.264  -1.639  1.00 31.54  ? 6   DG  E C8    1 
ATOM   1072 N  N7    . DG  B  2 6   ? 63.764 12.195  -1.776  1.00 31.76  ? 6   DG  E N7    1 
ATOM   1073 C  C5    . DG  B  2 6   ? 64.670 11.147  -1.679  1.00 31.55  ? 6   DG  E C5    1 
ATOM   1074 C  C6    . DG  B  2 6   ? 64.458 9.750   -1.752  1.00 32.26  ? 6   DG  E C6    1 
ATOM   1075 O  O6    . DG  B  2 6   ? 63.392 9.142   -1.923  1.00 33.05  ? 6   DG  E O6    1 
ATOM   1076 N  N1    . DG  B  2 6   ? 65.648 9.041   -1.603  1.00 31.95  ? 6   DG  E N1    1 
ATOM   1077 C  C2    . DG  B  2 6   ? 66.883 9.611   -1.409  1.00 31.64  ? 6   DG  E C2    1 
ATOM   1078 N  N2    . DG  B  2 6   ? 67.914 8.763   -1.287  1.00 31.95  ? 6   DG  E N2    1 
ATOM   1079 N  N3    . DG  B  2 6   ? 67.095 10.919  -1.337  1.00 31.20  ? 6   DG  E N3    1 
ATOM   1080 C  C4    . DG  B  2 6   ? 65.948 11.624  -1.481  1.00 31.17  ? 6   DG  E C4    1 
ATOM   1081 P  P     . DG  B  2 7   ? 68.815 15.489  -5.463  1.00 31.42  ? 7   DG  E P     1 
ATOM   1082 O  OP1   . DG  B  2 7   ? 69.830 16.486  -5.874  1.00 32.44  ? 7   DG  E OP1   1 
ATOM   1083 O  OP2   . DG  B  2 7   ? 67.566 15.338  -6.242  1.00 32.37  ? 7   DG  E OP2   1 
ATOM   1084 O  "O5'" . DG  B  2 7   ? 69.509 14.052  -5.368  1.00 30.48  ? 7   DG  E "O5'" 1 
ATOM   1085 C  "C5'" . DG  B  2 7   ? 70.810 13.922  -4.813  1.00 30.25  ? 7   DG  E "C5'" 1 
ATOM   1086 C  "C4'" . DG  B  2 7   ? 71.285 12.481  -4.887  1.00 30.57  ? 7   DG  E "C4'" 1 
ATOM   1087 O  "O4'" . DG  B  2 7   ? 70.271 11.607  -4.324  1.00 30.88  ? 7   DG  E "O4'" 1 
ATOM   1088 C  "C3'" . DG  B  2 7   ? 71.550 11.958  -6.298  1.00 30.82  ? 7   DG  E "C3'" 1 
ATOM   1089 O  "O3'" . DG  B  2 7   ? 72.643 11.041  -6.276  1.00 31.64  ? 7   DG  E "O3'" 1 
ATOM   1090 C  "C2'" . DG  B  2 7   ? 70.238 11.259  -6.640  1.00 30.43  ? 7   DG  E "C2'" 1 
ATOM   1091 C  "C1'" . DG  B  2 7   ? 69.865 10.662  -5.293  1.00 30.42  ? 7   DG  E "C1'" 1 
ATOM   1092 N  N9    . DG  B  2 7   ? 68.433 10.431  -5.144  1.00 30.45  ? 7   DG  E N9    1 
ATOM   1093 C  C8    . DG  B  2 7   ? 67.439 11.379  -5.145  1.00 30.55  ? 7   DG  E C8    1 
ATOM   1094 N  N7    . DG  B  2 7   ? 66.245 10.881  -4.996  1.00 30.97  ? 7   DG  E N7    1 
ATOM   1095 C  C5    . DG  B  2 7   ? 66.459 9.512   -4.891  1.00 30.79  ? 7   DG  E C5    1 
ATOM   1096 C  C6    . DG  B  2 7   ? 65.534 8.457   -4.716  1.00 31.18  ? 7   DG  E C6    1 
ATOM   1097 O  O6    . DG  B  2 7   ? 64.302 8.526   -4.614  1.00 31.70  ? 7   DG  E O6    1 
ATOM   1098 N  N1    . DG  B  2 7   ? 66.168 7.219   -4.660  1.00 31.08  ? 7   DG  E N1    1 
ATOM   1099 C  C2    . DG  B  2 7   ? 67.526 7.027   -4.761  1.00 30.90  ? 7   DG  E C2    1 
ATOM   1100 N  N2    . DG  B  2 7   ? 67.952 5.758   -4.684  1.00 30.85  ? 7   DG  E N2    1 
ATOM   1101 N  N3    . DG  B  2 7   ? 68.404 8.007   -4.926  1.00 30.64  ? 7   DG  E N3    1 
ATOM   1102 C  C4    . DG  B  2 7   ? 67.801 9.219   -4.983  1.00 30.62  ? 7   DG  E C4    1 
ATOM   1103 P  P     . DG  B  2 8   ? 73.374 10.601  -7.640  1.00 32.69  ? 8   DG  E P     1 
ATOM   1104 O  OP1   . DG  B  2 8   ? 74.795 11.003  -7.538  1.00 33.94  ? 8   DG  E OP1   1 
ATOM   1105 O  OP2   . DG  B  2 8   ? 72.558 11.070  -8.783  1.00 32.59  ? 8   DG  E OP2   1 
ATOM   1106 O  "O5'" . DG  B  2 8   ? 73.303 9.005   -7.609  1.00 31.72  ? 8   DG  E "O5'" 1 
ATOM   1107 C  "C5'" . DG  B  2 8   ? 72.067 8.367   -7.327  1.00 31.50  ? 8   DG  E "C5'" 1 
ATOM   1108 C  "C4'" . DG  B  2 8   ? 72.111 6.902   -7.707  1.00 31.67  ? 8   DG  E "C4'" 1 
ATOM   1109 O  "O4'" . DG  B  2 8   ? 70.830 6.299   -7.420  1.00 32.42  ? 8   DG  E "O4'" 1 
ATOM   1110 C  "C3'" . DG  B  2 8   ? 72.348 6.630   -9.179  1.00 31.85  ? 8   DG  E "C3'" 1 
ATOM   1111 O  "O3'" . DG  B  2 8   ? 72.901 5.330   -9.339  1.00 32.01  ? 8   DG  E "O3'" 1 
ATOM   1112 C  "C2'" . DG  B  2 8   ? 70.937 6.721   -9.756  1.00 32.49  ? 8   DG  E "C2'" 1 
ATOM   1113 C  "C1'" . DG  B  2 8   ? 70.074 6.182   -8.612  1.00 33.03  ? 8   DG  E "C1'" 1 
ATOM   1114 N  N9    . DG  B  2 8   ? 68.823 6.917   -8.440  1.00 33.25  ? 8   DG  E N9    1 
ATOM   1115 C  C8    . DG  B  2 8   ? 68.661 8.281   -8.447  1.00 33.09  ? 8   DG  E C8    1 
ATOM   1116 N  N7    . DG  B  2 8   ? 67.426 8.660   -8.270  1.00 33.24  ? 8   DG  E N7    1 
ATOM   1117 C  C5    . DG  B  2 8   ? 66.721 7.470   -8.138  1.00 33.48  ? 8   DG  E C5    1 
ATOM   1118 C  C6    . DG  B  2 8   ? 65.341 7.247   -7.926  1.00 33.63  ? 8   DG  E C6    1 
ATOM   1119 O  O6    . DG  B  2 8   ? 64.437 8.085   -7.808  1.00 33.33  ? 8   DG  E O6    1 
ATOM   1120 N  N1    . DG  B  2 8   ? 65.044 5.889   -7.851  1.00 34.24  ? 8   DG  E N1    1 
ATOM   1121 C  C2    . DG  B  2 8   ? 65.964 4.874   -7.966  1.00 34.50  ? 8   DG  E C2    1 
ATOM   1122 N  N2    . DG  B  2 8   ? 65.487 3.625   -7.866  1.00 35.40  ? 8   DG  E N2    1 
ATOM   1123 N  N3    . DG  B  2 8   ? 67.262 5.069   -8.165  1.00 34.13  ? 8   DG  E N3    1 
ATOM   1124 C  C4    . DG  B  2 8   ? 67.567 6.387   -8.241  1.00 33.74  ? 8   DG  E C4    1 
ATOM   1125 P  P     . DA  B  2 9   ? 73.273 4.776   -10.800 1.00 32.35  ? 9   DA  E P     1 
ATOM   1126 O  OP1   . DA  B  2 9   ? 74.387 3.814   -10.638 1.00 32.97  ? 9   DA  E OP1   1 
ATOM   1127 O  OP2   . DA  B  2 9   ? 73.422 5.938   -11.705 1.00 32.03  ? 9   DA  E OP2   1 
ATOM   1128 O  "O5'" . DA  B  2 9   ? 71.968 3.967   -11.241 1.00 32.12  ? 9   DA  E "O5'" 1 
ATOM   1129 C  "C5'" . DA  B  2 9   ? 71.492 2.909   -10.429 1.00 32.70  ? 9   DA  E "C5'" 1 
ATOM   1130 C  "C4'" . DA  B  2 9   ? 70.119 2.457   -10.884 1.00 33.53  ? 9   DA  E "C4'" 1 
ATOM   1131 O  "O4'" . DA  B  2 9   ? 69.142 3.473   -10.572 1.00 33.33  ? 9   DA  E "O4'" 1 
ATOM   1132 C  "C3'" . DA  B  2 9   ? 69.990 2.187   -12.388 1.00 34.28  ? 9   DA  E "C3'" 1 
ATOM   1133 O  "O3'" . DA  B  2 9   ? 69.643 0.826   -12.601 1.00 35.78  ? 9   DA  E "O3'" 1 
ATOM   1134 C  "C2'" . DA  B  2 9   ? 68.874 3.137   -12.851 1.00 33.88  ? 9   DA  E "C2'" 1 
ATOM   1135 C  "C1'" . DA  B  2 9   ? 68.145 3.437   -11.553 1.00 33.87  ? 9   DA  E "C1'" 1 
ATOM   1136 N  N9    . DA  B  2 9   ? 67.456 4.721   -11.561 1.00 34.13  ? 9   DA  E N9    1 
ATOM   1137 C  C8    . DA  B  2 9   ? 68.011 5.952   -11.766 1.00 33.87  ? 9   DA  E C8    1 
ATOM   1138 N  N7    . DA  B  2 9   ? 67.146 6.937   -11.719 1.00 33.71  ? 9   DA  E N7    1 
ATOM   1139 C  C5    . DA  B  2 9   ? 65.939 6.306   -11.465 1.00 34.15  ? 9   DA  E C5    1 
ATOM   1140 C  C6    . DA  B  2 9   ? 64.629 6.795   -11.299 1.00 34.47  ? 9   DA  E C6    1 
ATOM   1141 N  N6    . DA  B  2 9   ? 64.315 8.092   -11.370 1.00 34.35  ? 9   DA  E N6    1 
ATOM   1142 N  N1    . DA  B  2 9   ? 63.651 5.896   -11.058 1.00 35.04  ? 9   DA  E N1    1 
ATOM   1143 C  C2    . DA  B  2 9   ? 63.971 4.599   -10.988 1.00 35.45  ? 9   DA  E C2    1 
ATOM   1144 N  N3    . DA  B  2 9   ? 65.164 4.021   -11.126 1.00 35.31  ? 9   DA  E N3    1 
ATOM   1145 C  C4    . DA  B  2 9   ? 66.113 4.939   -11.365 1.00 34.59  ? 9   DA  E C4    1 
ATOM   1146 P  P     . DG  B  2 10  ? 69.650 0.202   -14.082 1.00 37.53  ? 10  DG  E P     1 
ATOM   1147 O  OP1   . DG  B  2 10  ? 70.364 -1.092  -14.012 1.00 38.97  ? 10  DG  E OP1   1 
ATOM   1148 O  OP2   . DG  B  2 10  ? 70.108 1.240   -15.031 1.00 37.57  ? 10  DG  E OP2   1 
ATOM   1149 O  "O5'" . DG  B  2 10  ? 68.107 -0.080  -14.379 1.00 37.23  ? 10  DG  E "O5'" 1 
ATOM   1150 C  "C5'" . DG  B  2 10  ? 67.398 -1.028  -13.599 1.00 37.14  ? 10  DG  E "C5'" 1 
ATOM   1151 C  "C4'" . DG  B  2 10  ? 65.933 -1.048  -13.987 1.00 37.06  ? 10  DG  E "C4'" 1 
ATOM   1152 O  "O4'" . DG  B  2 10  ? 65.314 0.208   -13.611 1.00 35.89  ? 10  DG  E "O4'" 1 
ATOM   1153 C  "C3'" . DG  B  2 10  ? 65.667 -1.233  -15.482 1.00 37.49  ? 10  DG  E "C3'" 1 
ATOM   1154 O  "O3'" . DG  B  2 10  ? 64.651 -2.209  -15.676 1.00 38.17  ? 10  DG  E "O3'" 1 
ATOM   1155 C  "C2'" . DG  B  2 10  ? 65.221 0.155   -15.947 1.00 37.02  ? 10  DG  E "C2'" 1 
ATOM   1156 C  "C1'" . DG  B  2 10  ? 64.570 0.715   -14.693 1.00 36.32  ? 10  DG  E "C1'" 1 
ATOM   1157 N  N9    . DG  B  2 10  ? 64.608 2.172   -14.624 1.00 35.80  ? 10  DG  E N9    1 
ATOM   1158 C  C8    . DG  B  2 10  ? 65.722 2.971   -14.689 1.00 35.21  ? 10  DG  E C8    1 
ATOM   1159 N  N7    . DG  B  2 10  ? 65.457 4.243   -14.596 1.00 34.81  ? 10  DG  E N7    1 
ATOM   1160 C  C5    . DG  B  2 10  ? 64.076 4.292   -14.457 1.00 35.21  ? 10  DG  E C5    1 
ATOM   1161 C  C6    . DG  B  2 10  ? 63.215 5.405   -14.313 1.00 35.73  ? 10  DG  E C6    1 
ATOM   1162 O  O6    . DG  B  2 10  ? 63.514 6.606   -14.279 1.00 35.78  ? 10  DG  E O6    1 
ATOM   1163 N  N1    . DG  B  2 10  ? 61.883 5.015   -14.203 1.00 36.52  ? 10  DG  E N1    1 
ATOM   1164 C  C2    . DG  B  2 10  ? 61.440 3.714   -14.228 1.00 37.07  ? 10  DG  E C2    1 
ATOM   1165 N  N2    . DG  B  2 10  ? 60.118 3.534   -14.108 1.00 38.13  ? 10  DG  E N2    1 
ATOM   1166 N  N3    . DG  B  2 10  ? 62.237 2.661   -14.363 1.00 36.99  ? 10  DG  E N3    1 
ATOM   1167 C  C4    . DG  B  2 10  ? 63.538 3.025   -14.472 1.00 35.93  ? 10  DG  E C4    1 
ATOM   1168 P  P     . DT  B  2 11  ? 64.301 -2.733  -17.154 1.00 39.82  ? 11  DT  E P     1 
ATOM   1169 O  OP1   . DT  B  2 11  ? 63.853 -4.138  -17.033 1.00 40.89  ? 11  DT  E OP1   1 
ATOM   1170 O  OP2   . DT  B  2 11  ? 65.437 -2.392  -18.039 1.00 39.56  ? 11  DT  E OP2   1 
ATOM   1171 O  "O5'" . DT  B  2 11  ? 63.055 -1.834  -17.588 1.00 41.15  ? 11  DT  E "O5'" 1 
ATOM   1172 C  "C5'" . DT  B  2 11  ? 61.893 -1.811  -16.777 1.00 42.80  ? 11  DT  E "C5'" 1 
ATOM   1173 C  "C4'" . DT  B  2 11  ? 60.945 -0.715  -17.221 1.00 44.45  ? 11  DT  E "C4'" 1 
ATOM   1174 O  "O4'" . DT  B  2 11  ? 61.485 0.571   -16.868 1.00 43.38  ? 11  DT  E "O4'" 1 
ATOM   1175 C  "C3'" . DT  B  2 11  ? 60.695 -0.654  -18.726 1.00 46.75  ? 11  DT  E "C3'" 1 
ATOM   1176 O  "O3'" . DT  B  2 11  ? 59.417 -1.202  -19.022 1.00 49.27  ? 11  DT  E "O3'" 1 
ATOM   1177 C  "C2'" . DT  B  2 11  ? 60.768 0.848   -19.072 1.00 45.76  ? 11  DT  E "C2'" 1 
ATOM   1178 C  "C1'" . DT  B  2 11  ? 60.899 1.522   -17.709 1.00 43.70  ? 11  DT  E "C1'" 1 
ATOM   1179 N  N1    . DT  B  2 11  ? 61.757 2.743   -17.724 1.00 41.86  ? 11  DT  E N1    1 
ATOM   1180 C  C2    . DT  B  2 11  ? 61.172 3.976   -17.552 1.00 41.16  ? 11  DT  E C2    1 
ATOM   1181 O  O2    . DT  B  2 11  ? 59.975 4.130   -17.386 1.00 41.62  ? 11  DT  E O2    1 
ATOM   1182 N  N3    . DT  B  2 11  ? 62.044 5.032   -17.581 1.00 39.86  ? 11  DT  E N3    1 
ATOM   1183 C  C4    . DT  B  2 11  ? 63.414 4.979   -17.761 1.00 38.97  ? 11  DT  E C4    1 
ATOM   1184 O  O4    . DT  B  2 11  ? 64.114 5.986   -17.771 1.00 38.29  ? 11  DT  E O4    1 
ATOM   1185 C  C5    . DT  B  2 11  ? 63.964 3.655   -17.935 1.00 39.21  ? 11  DT  E C5    1 
ATOM   1186 C  C7    . DT  B  2 11  ? 65.439 3.472   -18.140 1.00 38.24  ? 11  DT  E C7    1 
ATOM   1187 C  C6    . DT  B  2 11  ? 63.119 2.613   -17.909 1.00 40.86  ? 11  DT  E C6    1 
ATOM   1188 P  P     . DG  B  2 12  ? 58.887 -1.260  -20.537 1.00 52.11  ? 12  DG  E P     1 
ATOM   1189 O  OP1   . DG  B  2 12  ? 57.926 -2.382  -20.626 1.00 54.20  ? 12  DG  E OP1   1 
ATOM   1190 O  OP2   . DG  B  2 12  ? 60.059 -1.215  -21.439 1.00 51.85  ? 12  DG  E OP2   1 
ATOM   1191 O  "O5'" . DG  B  2 12  ? 58.086 0.111   -20.708 1.00 52.16  ? 12  DG  E "O5'" 1 
ATOM   1192 C  "C5'" . DG  B  2 12  ? 57.055 0.446   -19.792 1.00 52.13  ? 12  DG  E "C5'" 1 
ATOM   1193 C  "C4'" . DG  B  2 12  ? 56.389 1.748   -20.191 1.00 52.20  ? 12  DG  E "C4'" 1 
ATOM   1194 O  "O4'" . DG  B  2 12  ? 57.261 2.861   -19.869 1.00 50.04  ? 12  DG  E "O4'" 1 
ATOM   1195 C  "C3'" . DG  B  2 12  ? 56.063 1.868   -21.678 1.00 54.01  ? 12  DG  E "C3'" 1 
ATOM   1196 O  "O3'" . DG  B  2 12  ? 54.762 2.410   -21.845 1.00 55.54  ? 12  DG  E "O3'" 1 
ATOM   1197 C  "C2'" . DG  B  2 12  ? 57.144 2.810   -22.209 1.00 52.47  ? 12  DG  E "C2'" 1 
ATOM   1198 C  "C1'" . DG  B  2 12  ? 57.423 3.688   -20.998 1.00 49.78  ? 12  DG  E "C1'" 1 
ATOM   1199 N  N9    . DG  B  2 12  ? 58.781 4.228   -20.974 1.00 47.19  ? 12  DG  E N9    1 
ATOM   1200 C  C8    . DG  B  2 12  ? 59.953 3.512   -20.980 1.00 46.42  ? 12  DG  E C8    1 
ATOM   1201 N  N7    . DG  B  2 12  ? 61.020 4.259   -20.947 1.00 45.25  ? 12  DG  E N7    1 
ATOM   1202 C  C5    . DG  B  2 12  ? 60.526 5.556   -20.916 1.00 44.88  ? 12  DG  E C5    1 
ATOM   1203 C  C6    . DG  B  2 12  ? 61.213 6.792   -20.874 1.00 44.18  ? 12  DG  E C6    1 
ATOM   1204 O  O6    . DG  B  2 12  ? 62.437 6.990   -20.855 1.00 43.52  ? 12  DG  E O6    1 
ATOM   1205 N  N1    . DG  B  2 12  ? 60.333 7.871   -20.854 1.00 44.48  ? 12  DG  E N1    1 
ATOM   1206 C  C2    . DG  B  2 12  ? 58.961 7.768   -20.872 1.00 45.47  ? 12  DG  E C2    1 
ATOM   1207 N  N2    . DG  B  2 12  ? 58.278 8.921   -20.848 1.00 45.65  ? 12  DG  E N2    1 
ATOM   1208 N  N3    . DG  B  2 12  ? 58.304 6.615   -20.911 1.00 46.12  ? 12  DG  E N3    1 
ATOM   1209 C  C4    . DG  B  2 12  ? 59.148 5.555   -20.931 1.00 45.90  ? 12  DG  E C4    1 
ATOM   1210 P  P     . DT  B  2 13  ? 53.981 2.217   -23.235 1.00 58.85  ? 13  DT  E P     1 
ATOM   1211 O  OP1   . DT  B  2 13  ? 52.613 1.741   -22.930 1.00 60.75  ? 13  DT  E OP1   1 
ATOM   1212 O  OP2   . DT  B  2 13  ? 54.853 1.430   -24.136 1.00 59.47  ? 13  DT  E OP2   1 
ATOM   1213 O  "O5'" . DT  B  2 13  ? 53.891 3.698   -23.823 1.00 58.08  ? 13  DT  E "O5'" 1 
ATOM   1214 C  "C5'" . DT  B  2 13  ? 53.327 4.737   -23.038 1.00 56.37  ? 13  DT  E "C5'" 1 
ATOM   1215 C  "C4'" . DT  B  2 13  ? 53.698 6.092   -23.606 1.00 55.12  ? 13  DT  E "C4'" 1 
ATOM   1216 O  "O4'" . DT  B  2 13  ? 55.077 6.379   -23.302 1.00 53.01  ? 13  DT  E "O4'" 1 
ATOM   1217 C  "C3'" . DT  B  2 13  ? 53.567 6.202   -25.128 1.00 56.48  ? 13  DT  E "C3'" 1 
ATOM   1218 O  "O3'" . DT  B  2 13  ? 52.504 7.087   -25.462 1.00 57.31  ? 13  DT  E "O3'" 1 
ATOM   1219 C  "C2'" . DT  B  2 13  ? 54.929 6.739   -25.603 1.00 55.43  ? 13  DT  E "C2'" 1 
ATOM   1220 C  "C1'" . DT  B  2 13  ? 55.592 7.202   -24.311 1.00 53.11  ? 13  DT  E "C1'" 1 
ATOM   1221 N  N1    . DT  B  2 13  ? 57.076 7.061   -24.322 1.00 51.61  ? 13  DT  E N1    1 
ATOM   1222 C  C2    . DT  B  2 13  ? 57.858 8.191   -24.270 1.00 51.07  ? 13  DT  E C2    1 
ATOM   1223 O  O2    . DT  B  2 13  ? 57.399 9.318   -24.213 1.00 51.76  ? 13  DT  E O2    1 
ATOM   1224 N  N3    . DT  B  2 13  ? 59.206 7.954   -24.286 1.00 49.58  ? 13  DT  E N3    1 
ATOM   1225 C  C4    . DT  B  2 13  ? 59.838 6.725   -24.349 1.00 48.92  ? 13  DT  E C4    1 
ATOM   1226 O  O4    . DT  B  2 13  ? 61.059 6.615   -24.358 1.00 47.98  ? 13  DT  E O4    1 
ATOM   1227 C  C5    . DT  B  2 13  ? 58.959 5.582   -24.402 1.00 49.73  ? 13  DT  E C5    1 
ATOM   1228 C  C7    . DT  B  2 13  ? 59.530 4.197   -24.473 1.00 49.76  ? 13  DT  E C7    1 
ATOM   1229 C  C6    . DT  B  2 13  ? 57.636 5.802   -24.386 1.00 51.08  ? 13  DT  E C6    1 
ATOM   1230 P  P     . DT  B  2 14  ? 51.999 7.206   -26.982 1.00 59.77  ? 14  DT  E P     1 
ATOM   1231 O  OP1   . DT  B  2 14  ? 50.606 7.705   -26.954 1.00 61.53  ? 14  DT  E OP1   1 
ATOM   1232 O  OP2   . DT  B  2 14  ? 52.306 5.926   -27.658 1.00 61.08  ? 14  DT  E OP2   1 
ATOM   1233 O  "O5'" . DT  B  2 14  ? 52.941 8.338   -27.607 1.00 58.38  ? 14  DT  E "O5'" 1 
ATOM   1234 C  "C5'" . DT  B  2 14  ? 52.928 9.652   -27.058 1.00 56.36  ? 14  DT  E "C5'" 1 
ATOM   1235 C  "C4'" . DT  B  2 14  ? 54.025 10.508  -27.667 1.00 54.73  ? 14  DT  E "C4'" 1 
ATOM   1236 O  "O4'" . DT  B  2 14  ? 55.280 10.224  -27.025 1.00 52.12  ? 14  DT  E "O4'" 1 
ATOM   1237 C  "C3'" . DT  B  2 14  ? 54.297 10.254  -29.137 1.00 56.10  ? 14  DT  E "C3'" 1 
ATOM   1238 O  "O3'" . DT  B  2 14  ? 53.384 10.997  -29.938 1.00 57.89  ? 14  DT  E "O3'" 1 
ATOM   1239 C  "C2'" . DT  B  2 14  ? 55.735 10.762  -29.302 1.00 54.32  ? 14  DT  E "C2'" 1 
ATOM   1240 C  "C1'" . DT  B  2 14  ? 56.325 10.624  -27.889 1.00 51.31  ? 14  DT  E "C1'" 1 
ATOM   1241 N  N1    . DT  B  2 14  ? 57.432 9.631   -27.798 1.00 48.59  ? 14  DT  E N1    1 
ATOM   1242 C  C2    . DT  B  2 14  ? 58.713 10.076  -27.578 1.00 45.86  ? 14  DT  E C2    1 
ATOM   1243 O  O2    . DT  B  2 14  ? 58.998 11.254  -27.455 1.00 44.67  ? 14  DT  E O2    1 
ATOM   1244 N  N3    . DT  B  2 14  ? 59.657 9.089   -27.508 1.00 44.94  ? 14  DT  E N3    1 
ATOM   1245 C  C4    . DT  B  2 14  ? 59.453 7.728   -27.633 1.00 45.59  ? 14  DT  E C4    1 
ATOM   1246 O  O4    . DT  B  2 14  ? 60.371 6.918   -27.554 1.00 44.79  ? 14  DT  E O4    1 
ATOM   1247 C  C5    . DT  B  2 14  ? 58.086 7.326   -27.862 1.00 47.62  ? 14  DT  E C5    1 
ATOM   1248 C  C7    . DT  B  2 14  ? 57.742 5.874   -28.014 1.00 48.69  ? 14  DT  E C7    1 
ATOM   1249 C  C6    . DT  B  2 14  ? 57.152 8.287   -27.933 1.00 48.79  ? 14  DT  E C6    1 
ATOM   1250 P  P     . DA  C  3 2   ? 71.010 10.368  -26.141 1.00 74.42  ? 1   DA  F P     1 
ATOM   1251 O  OP1   . DA  C  3 2   ? 71.144 9.437   -27.284 1.00 75.40  ? 1   DA  F OP1   1 
ATOM   1252 O  OP2   . DA  C  3 2   ? 72.166 11.185  -25.702 1.00 76.21  ? 1   DA  F OP2   1 
ATOM   1253 O  "O5'" . DA  C  3 2   ? 69.783 11.354  -26.420 1.00 74.09  ? 1   DA  F "O5'" 1 
ATOM   1254 C  "C5'" . DA  C  3 2   ? 69.997 12.581  -27.104 1.00 75.53  ? 1   DA  F "C5'" 1 
ATOM   1255 C  "C4'" . DA  C  3 2   ? 68.807 13.509  -26.932 1.00 74.05  ? 1   DA  F "C4'" 1 
ATOM   1256 O  "O4'" . DA  C  3 2   ? 67.612 12.869  -27.448 1.00 72.28  ? 1   DA  F "O4'" 1 
ATOM   1257 C  "C3'" . DA  C  3 2   ? 68.495 13.893  -25.489 1.00 71.11  ? 1   DA  F "C3'" 1 
ATOM   1258 O  "O3'" . DA  C  3 2   ? 68.057 15.245  -25.427 1.00 73.06  ? 1   DA  F "O3'" 1 
ATOM   1259 C  "C2'" . DA  C  3 2   ? 67.385 12.920  -25.101 1.00 67.67  ? 1   DA  F "C2'" 1 
ATOM   1260 C  "C1'" . DA  C  3 2   ? 66.651 12.723  -26.421 1.00 69.20  ? 1   DA  F "C1'" 1 
ATOM   1261 N  N9    . DA  C  3 2   ? 66.047 11.400  -26.544 1.00 65.65  ? 1   DA  F N9    1 
ATOM   1262 C  C8    . DA  C  3 2   ? 66.698 10.199  -26.555 1.00 63.56  ? 1   DA  F C8    1 
ATOM   1263 N  N7    . DA  C  3 2   ? 65.900 9.165   -26.675 1.00 61.79  ? 1   DA  F N7    1 
ATOM   1264 C  C5    . DA  C  3 2   ? 64.636 9.728   -26.743 1.00 63.03  ? 1   DA  F C5    1 
ATOM   1265 C  C6    . DA  C  3 2   ? 63.352 9.165   -26.874 1.00 61.93  ? 1   DA  F C6    1 
ATOM   1266 N  N6    . DA  C  3 2   ? 63.131 7.850   -26.964 1.00 60.66  ? 1   DA  F N6    1 
ATOM   1267 N  N1    . DA  C  3 2   ? 62.300 10.009  -26.911 1.00 63.31  ? 1   DA  F N1    1 
ATOM   1268 C  C2    . DA  C  3 2   ? 62.525 11.325  -26.822 1.00 65.06  ? 1   DA  F C2    1 
ATOM   1269 N  N3    . DA  C  3 2   ? 63.683 11.970  -26.695 1.00 65.97  ? 1   DA  F N3    1 
ATOM   1270 C  C4    . DA  C  3 2   ? 64.709 11.106  -26.661 1.00 64.78  ? 1   DA  F C4    1 
ATOM   1271 P  P     . DA  C  3 3   ? 67.924 15.988  -24.008 1.00 72.16  ? 2   DA  F P     1 
ATOM   1272 O  OP1   . DA  C  3 3   ? 68.502 17.343  -24.151 1.00 76.07  ? 2   DA  F OP1   1 
ATOM   1273 O  OP2   . DA  C  3 3   ? 68.439 15.072  -22.966 1.00 68.89  ? 2   DA  F OP2   1 
ATOM   1274 O  "O5'" . DA  C  3 3   ? 66.347 16.147  -23.809 1.00 70.39  ? 2   DA  F "O5'" 1 
ATOM   1275 C  "C5'" . DA  C  3 3   ? 65.581 16.860  -24.769 1.00 72.18  ? 2   DA  F "C5'" 1 
ATOM   1276 C  "C4'" . DA  C  3 3   ? 64.100 16.749  -24.459 1.00 70.24  ? 2   DA  F "C4'" 1 
ATOM   1277 O  "O4'" . DA  C  3 3   ? 63.649 15.394  -24.711 1.00 66.93  ? 2   DA  F "O4'" 1 
ATOM   1278 C  "C3'" . DA  C  3 3   ? 63.723 17.070  -23.014 1.00 68.81  ? 2   DA  F "C3'" 1 
ATOM   1279 O  "O3'" . DA  C  3 3   ? 62.568 17.897  -22.985 1.00 71.32  ? 2   DA  F "O3'" 1 
ATOM   1280 C  "C2'" . DA  C  3 3   ? 63.454 15.696  -22.396 1.00 64.30  ? 2   DA  F "C2'" 1 
ATOM   1281 C  "C1'" . DA  C  3 3   ? 62.947 14.905  -23.592 1.00 63.96  ? 2   DA  F "C1'" 1 
ATOM   1282 N  N9    . DA  C  3 3   ? 63.203 13.472  -23.484 1.00 59.95  ? 2   DA  F N9    1 
ATOM   1283 C  C8    . DA  C  3 3   ? 64.401 12.870  -23.216 1.00 58.28  ? 2   DA  F C8    1 
ATOM   1284 N  N7    . DA  C  3 3   ? 64.340 11.561  -23.180 1.00 56.59  ? 2   DA  F N7    1 
ATOM   1285 C  C5    . DA  C  3 3   ? 63.009 11.284  -23.445 1.00 55.73  ? 2   DA  F C5    1 
ATOM   1286 C  C6    . DA  C  3 3   ? 62.294 10.074  -23.549 1.00 54.73  ? 2   DA  F C6    1 
ATOM   1287 N  N6    . DA  C  3 3   ? 62.855 8.872   -23.390 1.00 52.26  ? 2   DA  F N6    1 
ATOM   1288 N  N1    . DA  C  3 3   ? 60.975 10.149  -23.824 1.00 55.45  ? 2   DA  F N1    1 
ATOM   1289 C  C2    . DA  C  3 3   ? 60.417 11.355  -23.983 1.00 58.47  ? 2   DA  F C2    1 
ATOM   1290 N  N3    . DA  C  3 3   ? 60.985 12.558  -23.910 1.00 58.87  ? 2   DA  F N3    1 
ATOM   1291 C  C4    . DA  C  3 3   ? 62.294 12.451  -23.635 1.00 58.06  ? 2   DA  F C4    1 
ATOM   1292 P  P     . DC  C  3 4   ? 62.137 18.631  -21.622 1.00 71.74  ? 3   DC  F P     1 
ATOM   1293 O  OP1   . DC  C  3 4   ? 61.416 19.872  -21.982 1.00 76.18  ? 3   DC  F OP1   1 
ATOM   1294 O  OP2   . DC  C  3 4   ? 63.334 18.695  -20.756 1.00 70.69  ? 3   DC  F OP2   1 
ATOM   1295 O  "O5'" . DC  C  3 4   ? 61.103 17.613  -20.955 1.00 67.95  ? 3   DC  F "O5'" 1 
ATOM   1296 C  "C5'" . DC  C  3 4   ? 59.937 17.228  -21.661 1.00 68.10  ? 3   DC  F "C5'" 1 
ATOM   1297 C  "C4'" . DC  C  3 4   ? 59.264 16.055  -20.979 1.00 65.03  ? 3   DC  F "C4'" 1 
ATOM   1298 O  "O4'" . DC  C  3 4   ? 59.979 14.847  -21.280 1.00 62.19  ? 3   DC  F "O4'" 1 
ATOM   1299 C  "C3'" . DC  C  3 4   ? 59.238 16.134  -19.456 1.00 64.02  ? 3   DC  F "C3'" 1 
ATOM   1300 O  "O3'" . DC  C  3 4   ? 57.970 16.608  -19.018 1.00 67.18  ? 3   DC  F "O3'" 1 
ATOM   1301 C  "C2'" . DC  C  3 4   ? 59.501 14.689  -18.989 1.00 59.56  ? 3   DC  F "C2'" 1 
ATOM   1302 C  "C1'" . DC  C  3 4   ? 59.664 13.905  -20.293 1.00 59.16  ? 3   DC  F "C1'" 1 
ATOM   1303 N  N1    . DC  C  3 4   ? 60.749 12.886  -20.241 1.00 56.63  ? 3   DC  F N1    1 
ATOM   1304 C  C2    . DC  C  3 4   ? 60.430 11.530  -20.378 1.00 54.56  ? 3   DC  F C2    1 
ATOM   1305 O  O2    . DC  C  3 4   ? 59.249 11.202  -20.543 1.00 55.28  ? 3   DC  F O2    1 
ATOM   1306 N  N3    . DC  C  3 4   ? 61.427 10.613  -20.326 1.00 52.03  ? 3   DC  F N3    1 
ATOM   1307 C  C4    . DC  C  3 4   ? 62.689 11.009  -20.146 1.00 51.93  ? 3   DC  F C4    1 
ATOM   1308 N  N4    . DC  C  3 4   ? 63.637 10.069  -20.102 1.00 50.30  ? 3   DC  F N4    1 
ATOM   1309 C  C5    . DC  C  3 4   ? 63.033 12.385  -20.004 1.00 54.65  ? 3   DC  F C5    1 
ATOM   1310 C  C6    . DC  C  3 4   ? 62.041 13.280  -20.056 1.00 56.99  ? 3   DC  F C6    1 
ATOM   1311 P  P     . DA  C  3 5   ? 57.688 16.847  -17.455 1.00 68.43  ? 4   DA  F P     1 
ATOM   1312 O  OP1   . DA  C  3 5   ? 56.604 17.849  -17.340 1.00 72.15  ? 4   DA  F OP1   1 
ATOM   1313 O  OP2   . DA  C  3 5   ? 58.988 17.091  -16.794 1.00 67.63  ? 4   DA  F OP2   1 
ATOM   1314 O  "O5'" . DA  C  3 5   ? 57.138 15.434  -16.948 1.00 65.99  ? 4   DA  F "O5'" 1 
ATOM   1315 C  "C5'" . DA  C  3 5   ? 56.122 14.763  -17.681 1.00 67.23  ? 4   DA  F "C5'" 1 
ATOM   1316 C  "C4'" . DA  C  3 5   ? 56.089 13.290  -17.321 1.00 64.54  ? 4   DA  F "C4'" 1 
ATOM   1317 O  "O4'" . DA  C  3 5   ? 57.284 12.650  -17.797 1.00 61.85  ? 4   DA  F "O4'" 1 
ATOM   1318 C  "C3'" . DA  C  3 5   ? 56.064 13.000  -15.827 1.00 63.62  ? 4   DA  F "C3'" 1 
ATOM   1319 O  "O3'" . DA  C  3 5   ? 54.724 12.820  -15.387 1.00 67.31  ? 4   DA  F "O3'" 1 
ATOM   1320 C  "C2'" . DA  C  3 5   ? 56.883 11.705  -15.680 1.00 58.64  ? 4   DA  F "C2'" 1 
ATOM   1321 C  "C1'" . DA  C  3 5   ? 57.450 11.456  -17.079 1.00 58.16  ? 4   DA  F "C1'" 1 
ATOM   1322 N  N9    . DA  C  3 5   ? 58.865 11.105  -17.068 1.00 55.08  ? 4   DA  F N9    1 
ATOM   1323 C  C8    . DA  C  3 5   ? 59.925 11.955  -16.927 1.00 55.38  ? 4   DA  F C8    1 
ATOM   1324 N  N7    . DA  C  3 5   ? 61.092 11.355  -16.947 1.00 53.76  ? 4   DA  F N7    1 
ATOM   1325 C  C5    . DA  C  3 5   ? 60.774 10.016  -17.107 1.00 52.13  ? 4   DA  F C5    1 
ATOM   1326 C  C6    . DA  C  3 5   ? 61.568 8.856   -17.203 1.00 49.63  ? 4   DA  F C6    1 
ATOM   1327 N  N6    . DA  C  3 5   ? 62.903 8.872   -17.147 1.00 49.59  ? 4   DA  F N6    1 
ATOM   1328 N  N1    . DA  C  3 5   ? 60.933 7.675   -17.358 1.00 48.60  ? 4   DA  F N1    1 
ATOM   1329 C  C2    . DA  C  3 5   ? 59.597 7.664   -17.413 1.00 49.47  ? 4   DA  F C2    1 
ATOM   1330 N  N3    . DA  C  3 5   ? 58.746 8.686   -17.335 1.00 51.18  ? 4   DA  F N3    1 
ATOM   1331 C  C4    . DA  C  3 5   ? 59.405 9.844   -17.181 1.00 52.53  ? 4   DA  F C4    1 
ATOM   1332 P  P     . DC  C  3 6   ? 54.419 12.496  -13.842 1.00 68.57  ? 5   DC  F P     1 
ATOM   1333 O  OP1   . DC  C  3 6   ? 53.021 12.898  -13.568 1.00 72.34  ? 5   DC  F OP1   1 
ATOM   1334 O  OP2   . DC  C  3 6   ? 55.525 13.060  -13.037 1.00 67.97  ? 5   DC  F OP2   1 
ATOM   1335 O  "O5'" . DC  C  3 6   ? 54.527 10.902  -13.751 1.00 65.39  ? 5   DC  F "O5'" 1 
ATOM   1336 C  "C5'" . DC  C  3 6   ? 53.827 10.083  -14.680 1.00 65.81  ? 5   DC  F "C5'" 1 
ATOM   1337 C  "C4'" . DC  C  3 6   ? 54.121 8.616   -14.425 1.00 62.53  ? 5   DC  F "C4'" 1 
ATOM   1338 O  "O4'" . DC  C  3 6   ? 55.481 8.311   -14.829 1.00 59.54  ? 5   DC  F "O4'" 1 
ATOM   1339 C  "C3'" . DC  C  3 6   ? 53.996 8.184   -12.963 1.00 61.35  ? 5   DC  F "C3'" 1 
ATOM   1340 O  "O3'" . DC  C  3 6   ? 53.235 6.987   -12.874 1.00 62.99  ? 5   DC  F "O3'" 1 
ATOM   1341 C  "C2'" . DC  C  3 6   ? 55.446 7.969   -12.521 1.00 57.46  ? 5   DC  F "C2'" 1 
ATOM   1342 C  "C1'" . DC  C  3 6   ? 56.114 7.558   -13.822 1.00 56.03  ? 5   DC  F "C1'" 1 
ATOM   1343 N  N1    . DC  C  3 6   ? 57.574 7.860   -13.856 1.00 53.22  ? 5   DC  F N1    1 
ATOM   1344 C  C2    . DC  C  3 6   ? 58.494 6.826   -14.063 1.00 50.66  ? 5   DC  F C2    1 
ATOM   1345 O  O2    . DC  C  3 6   ? 58.080 5.671   -14.221 1.00 49.87  ? 5   DC  F O2    1 
ATOM   1346 N  N3    . DC  C  3 6   ? 59.818 7.122   -14.087 1.00 49.27  ? 5   DC  F N3    1 
ATOM   1347 C  C4    . DC  C  3 6   ? 60.224 8.382   -13.913 1.00 49.70  ? 5   DC  F C4    1 
ATOM   1348 N  N4    . DC  C  3 6   ? 61.536 8.627   -13.945 1.00 48.65  ? 5   DC  F N4    1 
ATOM   1349 C  C5    . DC  C  3 6   ? 59.300 9.447   -13.699 1.00 52.08  ? 5   DC  F C5    1 
ATOM   1350 C  C6    . DC  C  3 6   ? 58.000 9.141   -13.675 1.00 53.49  ? 5   DC  F C6    1 
ATOM   1351 P  P     . DT  C  3 7   ? 52.738 6.449   -11.444 1.00 64.66  ? 6   DT  F P     1 
ATOM   1352 O  OP1   . DT  C  3 7   ? 51.600 5.530   -11.672 1.00 66.49  ? 6   DT  F OP1   1 
ATOM   1353 O  OP2   . DT  C  3 7   ? 52.574 7.620   -10.555 1.00 66.44  ? 6   DT  F OP2   1 
ATOM   1354 O  "O5'" . DT  C  3 7   ? 53.978 5.598   -10.909 1.00 61.47  ? 6   DT  F "O5'" 1 
ATOM   1355 C  "C5'" . DT  C  3 7   ? 54.518 4.556   -11.707 1.00 60.09  ? 6   DT  F "C5'" 1 
ATOM   1356 C  "C4'" . DT  C  3 7   ? 55.700 3.912   -11.012 1.00 56.86  ? 6   DT  F "C4'" 1 
ATOM   1357 O  "O4'" . DT  C  3 7   ? 56.913 4.628   -11.342 1.00 54.62  ? 6   DT  F "O4'" 1 
ATOM   1358 C  "C3'" . DT  C  3 7   ? 55.611 3.896   -9.482  1.00 56.27  ? 6   DT  F "C3'" 1 
ATOM   1359 O  "O3'" . DT  C  3 7   ? 55.677 2.557   -9.008  1.00 56.85  ? 6   DT  F "O3'" 1 
ATOM   1360 C  "C2'" . DT  C  3 7   ? 56.820 4.726   -9.025  1.00 53.51  ? 6   DT  F "C2'" 1 
ATOM   1361 C  "C1'" . DT  C  3 7   ? 57.752 4.615   -10.220 1.00 51.30  ? 6   DT  F "C1'" 1 
ATOM   1362 N  N1    . DT  C  3 7   ? 58.722 5.742   -10.327 1.00 48.06  ? 6   DT  F N1    1 
ATOM   1363 C  C2    . DT  C  3 7   ? 60.044 5.469   -10.592 1.00 45.39  ? 6   DT  F C2    1 
ATOM   1364 O  O2    . DT  C  3 7   ? 60.473 4.341   -10.755 1.00 44.22  ? 6   DT  F O2    1 
ATOM   1365 N  N3    . DT  C  3 7   ? 60.852 6.572   -10.663 1.00 44.51  ? 6   DT  F N3    1 
ATOM   1366 C  C4    . DT  C  3 7   ? 60.478 7.893   -10.497 1.00 44.84  ? 6   DT  F C4    1 
ATOM   1367 O  O4    . DT  C  3 7   ? 61.280 8.816   -10.579 1.00 44.09  ? 6   DT  F O4    1 
ATOM   1368 C  C5    . DT  C  3 7   ? 59.078 8.108   -10.218 1.00 46.69  ? 6   DT  F C5    1 
ATOM   1369 C  C7    . DT  C  3 7   ? 58.554 9.499   -10.018 1.00 48.18  ? 6   DT  F C7    1 
ATOM   1370 C  C6    . DT  C  3 7   ? 58.278 7.035   -10.146 1.00 47.88  ? 6   DT  F C6    1 
ATOM   1371 P  P     . DC  C  3 8   ? 55.317 2.215   -7.479  1.00 58.00  ? 7   DC  F P     1 
ATOM   1372 O  OP1   . DC  C  3 8   ? 54.371 1.077   -7.493  1.00 59.56  ? 7   DC  F OP1   1 
ATOM   1373 O  OP2   . DC  C  3 8   ? 54.936 3.471   -6.796  1.00 59.38  ? 7   DC  F OP2   1 
ATOM   1374 O  "O5'" . DC  C  3 8   ? 56.710 1.722   -6.863  1.00 55.00  ? 7   DC  F "O5'" 1 
ATOM   1375 C  "C5'" . DC  C  3 8   ? 57.255 0.471   -7.260  1.00 53.14  ? 7   DC  F "C5'" 1 
ATOM   1376 C  "C4'" . DC  C  3 8   ? 58.774 0.502   -7.251  1.00 50.29  ? 7   DC  F "C4'" 1 
ATOM   1377 O  "O4'" . DC  C  3 8   ? 59.243 1.673   -7.943  1.00 50.09  ? 7   DC  F "O4'" 1 
ATOM   1378 C  "C3'" . DC  C  3 8   ? 59.414 0.608   -5.881  1.00 47.92  ? 7   DC  F "C3'" 1 
ATOM   1379 O  "O3'" . DC  C  3 8   ? 59.526 -0.685  -5.291  1.00 46.38  ? 7   DC  F "O3'" 1 
ATOM   1380 C  "C2'" . DC  C  3 8   ? 60.794 1.196   -6.206  1.00 47.15  ? 7   DC  F "C2'" 1 
ATOM   1381 C  "C1'" . DC  C  3 8   ? 60.575 1.916   -7.545  1.00 48.05  ? 7   DC  F "C1'" 1 
ATOM   1382 N  N1    . DC  C  3 8   ? 60.802 3.384   -7.467  1.00 47.20  ? 7   DC  F N1    1 
ATOM   1383 C  C2    . DC  C  3 8   ? 62.088 3.890   -7.676  1.00 46.24  ? 7   DC  F C2    1 
ATOM   1384 O  O2    . DC  C  3 8   ? 63.009 3.104   -7.926  1.00 45.32  ? 7   DC  F O2    1 
ATOM   1385 N  N3    . DC  C  3 8   ? 62.288 5.228   -7.600  1.00 46.74  ? 7   DC  F N3    1 
ATOM   1386 C  C4    . DC  C  3 8   ? 61.267 6.041   -7.328  1.00 47.52  ? 7   DC  F C4    1 
ATOM   1387 N  N4    . DC  C  3 8   ? 61.514 7.353   -7.264  1.00 48.21  ? 7   DC  F N4    1 
ATOM   1388 C  C5    . DC  C  3 8   ? 59.948 5.543   -7.109  1.00 48.23  ? 7   DC  F C5    1 
ATOM   1389 C  C6    . DC  C  3 8   ? 59.764 4.221   -7.186  1.00 47.63  ? 7   DC  F C6    1 
ATOM   1390 P  P     . DC  C  3 9   ? 59.908 -0.839  -3.737  1.00 45.36  ? 8   DC  F P     1 
ATOM   1391 O  OP1   . DC  C  3 9   ? 59.658 -2.246  -3.353  1.00 46.07  ? 8   DC  F OP1   1 
ATOM   1392 O  OP2   . DC  C  3 9   ? 59.246 0.260   -3.001  1.00 46.13  ? 8   DC  F OP2   1 
ATOM   1393 O  "O5'" . DC  C  3 9   ? 61.485 -0.574  -3.690  1.00 43.72  ? 8   DC  F "O5'" 1 
ATOM   1394 C  "C5'" . DC  C  3 9   ? 62.373 -1.415  -4.411  1.00 43.58  ? 8   DC  F "C5'" 1 
ATOM   1395 C  "C4'" . DC  C  3 9   ? 63.802 -0.930  -4.260  1.00 43.63  ? 8   DC  F "C4'" 1 
ATOM   1396 O  "O4'" . DC  C  3 9   ? 63.912 0.421   -4.774  1.00 44.14  ? 8   DC  F "O4'" 1 
ATOM   1397 C  "C3'" . DC  C  3 9   ? 64.311 -0.891  -2.819  1.00 44.45  ? 8   DC  F "C3'" 1 
ATOM   1398 O  "O3'" . DC  C  3 9   ? 65.594 -1.497  -2.736  1.00 46.12  ? 8   DC  F "O3'" 1 
ATOM   1399 C  "C2'" . DC  C  3 9   ? 64.362 0.602   -2.485  1.00 44.39  ? 8   DC  F "C2'" 1 
ATOM   1400 C  "C1'" . DC  C  3 9   ? 64.596 1.232   -3.849  1.00 44.01  ? 8   DC  F "C1'" 1 
ATOM   1401 N  N1    . DC  C  3 9   ? 64.060 2.622   -3.954  1.00 43.25  ? 8   DC  F N1    1 
ATOM   1402 C  C2    . DC  C  3 9   ? 64.927 3.684   -4.235  1.00 43.33  ? 8   DC  F C2    1 
ATOM   1403 O  O2    . DC  C  3 9   ? 66.132 3.453   -4.397  1.00 43.70  ? 8   DC  F O2    1 
ATOM   1404 N  N3    . DC  C  3 9   ? 64.419 4.939   -4.325  1.00 43.78  ? 8   DC  F N3    1 
ATOM   1405 C  C4    . DC  C  3 9   ? 63.112 5.145   -4.143  1.00 43.81  ? 8   DC  F C4    1 
ATOM   1406 N  N4    . DC  C  3 9   ? 62.657 6.396   -4.241  1.00 44.77  ? 8   DC  F N4    1 
ATOM   1407 C  C5    . DC  C  3 9   ? 62.215 4.076   -3.854  1.00 43.62  ? 8   DC  F C5    1 
ATOM   1408 C  C6    . DC  C  3 9   ? 62.727 2.845   -3.768  1.00 43.11  ? 8   DC  F C6    1 
ATOM   1409 P  P     . DC  C  3 10  ? 66.200 -1.903  -1.304  1.00 47.23  ? 9   DC  F P     1 
ATOM   1410 O  OP1   . DC  C  3 10  ? 67.109 -3.054  -1.510  1.00 48.21  ? 9   DC  F OP1   1 
ATOM   1411 O  OP2   . DC  C  3 10  ? 65.071 -2.010  -0.354  1.00 47.32  ? 9   DC  F OP2   1 
ATOM   1412 O  "O5'" . DC  C  3 10  ? 67.068 -0.628  -0.884  1.00 46.06  ? 9   DC  F "O5'" 1 
ATOM   1413 C  "C5'" . DC  C  3 10  ? 68.159 -0.223  -1.694  1.00 45.75  ? 9   DC  F "C5'" 1 
ATOM   1414 C  "C4'" . DC  C  3 10  ? 68.656 1.149   -1.285  1.00 45.13  ? 9   DC  F "C4'" 1 
ATOM   1415 O  "O4'" . DC  C  3 10  ? 67.665 2.146   -1.609  1.00 44.34  ? 9   DC  F "O4'" 1 
ATOM   1416 C  "C3'" . DC  C  3 10  ? 68.949 1.312   0.210   1.00 45.05  ? 9   DC  F "C3'" 1 
ATOM   1417 O  "O3'" . DC  C  3 10  ? 70.339 1.544   0.404   1.00 46.70  ? 9   DC  F "O3'" 1 
ATOM   1418 C  "C2'" . DC  C  3 10  ? 68.102 2.524   0.640   1.00 44.73  ? 9   DC  F "C2'" 1 
ATOM   1419 C  "C1'" . DC  C  3 10  ? 67.783 3.193   -0.689  1.00 44.77  ? 9   DC  F "C1'" 1 
ATOM   1420 N  N1    . DC  C  3 10  ? 66.509 3.964   -0.680  1.00 44.15  ? 9   DC  F N1    1 
ATOM   1421 C  C2    . DC  C  3 10  ? 66.536 5.348   -0.884  1.00 44.99  ? 9   DC  F C2    1 
ATOM   1422 O  O2    . DC  C  3 10  ? 67.623 5.909   -1.067  1.00 45.98  ? 9   DC  F O2    1 
ATOM   1423 N  N3    . DC  C  3 10  ? 65.368 6.036   -0.875  1.00 45.44  ? 9   DC  F N3    1 
ATOM   1424 C  C4    . DC  C  3 10  ? 64.216 5.392   -0.674  1.00 44.79  ? 9   DC  F C4    1 
ATOM   1425 N  N4    . DC  C  3 10  ? 63.090 6.111   -0.674  1.00 45.72  ? 9   DC  F N4    1 
ATOM   1426 C  C5    . DC  C  3 10  ? 64.168 3.982   -0.464  1.00 43.51  ? 9   DC  F C5    1 
ATOM   1427 C  C6    . DC  C  3 10  ? 65.327 3.316   -0.474  1.00 43.10  ? 9   DC  F C6    1 
ATOM   1428 P  P     . DA  C  3 11  ? 70.943 1.678   1.886   1.00 47.70  ? 10  DA  F P     1 
ATOM   1429 O  OP1   . DA  C  3 11  ? 72.373 1.299   1.819   1.00 49.49  ? 10  DA  F OP1   1 
ATOM   1430 O  OP2   . DA  C  3 11  ? 70.030 0.973   2.811   1.00 46.85  ? 10  DA  F OP2   1 
ATOM   1431 O  "O5'" . DA  C  3 11  ? 70.841 3.242   2.198   1.00 47.27  ? 10  DA  F "O5'" 1 
ATOM   1432 C  "C5'" . DA  C  3 11  ? 71.400 4.179   1.291   1.00 47.54  ? 10  DA  F "C5'" 1 
ATOM   1433 C  "C4'" . DA  C  3 11  ? 71.073 5.597   1.716   1.00 47.99  ? 10  DA  F "C4'" 1 
ATOM   1434 O  "O4'" . DA  C  3 11  ? 69.692 5.898   1.404   1.00 46.67  ? 10  DA  F "O4'" 1 
ATOM   1435 C  "C3'" . DA  C  3 11  ? 71.251 5.876   3.211   1.00 48.36  ? 10  DA  F "C3'" 1 
ATOM   1436 O  "O3'" . DA  C  3 11  ? 72.100 7.000   3.391   1.00 50.09  ? 10  DA  F "O3'" 1 
ATOM   1437 C  "C2'" . DA  C  3 11  ? 69.828 6.154   3.712   1.00 47.45  ? 10  DA  F "C2'" 1 
ATOM   1438 C  "C1'" . DA  C  3 11  ? 69.140 6.651   2.452   1.00 47.41  ? 10  DA  F "C1'" 1 
ATOM   1439 N  N9    . DA  C  3 11  ? 67.695 6.441   2.457   1.00 45.84  ? 10  DA  F N9    1 
ATOM   1440 C  C8    . DA  C  3 11  ? 67.039 5.251   2.597   1.00 43.83  ? 10  DA  F C8    1 
ATOM   1441 N  N7    . DA  C  3 11  ? 65.732 5.358   2.560   1.00 42.86  ? 10  DA  F N7    1 
ATOM   1442 C  C5    . DA  C  3 11  ? 65.515 6.715   2.382   1.00 44.65  ? 10  DA  F C5    1 
ATOM   1443 C  C6    . DA  C  3 11  ? 64.339 7.480   2.263   1.00 44.34  ? 10  DA  F C6    1 
ATOM   1444 N  N6    . DA  C  3 11  ? 63.112 6.953   2.309   1.00 43.06  ? 10  DA  F N6    1 
ATOM   1445 N  N1    . DA  C  3 11  ? 64.473 8.811   2.094   1.00 46.13  ? 10  DA  F N1    1 
ATOM   1446 C  C2    . DA  C  3 11  ? 65.704 9.334   2.049   1.00 47.39  ? 10  DA  F C2    1 
ATOM   1447 N  N3    . DA  C  3 11  ? 66.881 8.719   2.149   1.00 47.77  ? 10  DA  F N3    1 
ATOM   1448 C  C4    . DA  C  3 11  ? 66.715 7.397   2.316   1.00 46.18  ? 10  DA  F C4    1 
ATOM   1449 P  P     . DC  C  3 12  ? 72.898 7.199   4.771   1.00 51.46  ? 11  DC  F P     1 
ATOM   1450 O  OP1   . DC  C  3 12  ? 74.337 7.331   4.444   1.00 53.77  ? 11  DC  F OP1   1 
ATOM   1451 O  OP2   . DC  C  3 12  ? 72.442 6.154   5.714   1.00 49.68  ? 11  DC  F OP2   1 
ATOM   1452 O  "O5'" . DC  C  3 12  ? 72.363 8.602   5.313   1.00 51.50  ? 11  DC  F "O5'" 1 
ATOM   1453 C  "C5'" . DC  C  3 12  ? 72.382 9.739   4.465   1.00 51.82  ? 11  DC  F "C5'" 1 
ATOM   1454 C  "C4'" . DC  C  3 12  ? 71.338 10.749  4.900   1.00 51.63  ? 11  DC  F "C4'" 1 
ATOM   1455 O  "O4'" . DC  C  3 12  ? 70.020 10.253  4.586   1.00 49.01  ? 11  DC  F "O4'" 1 
ATOM   1456 C  "C3'" . DC  C  3 12  ? 71.331 11.059  6.399   1.00 52.39  ? 11  DC  F "C3'" 1 
ATOM   1457 O  "O3'" . DC  C  3 12  ? 71.691 12.418  6.609   1.00 54.55  ? 11  DC  F "O3'" 1 
ATOM   1458 C  "C2'" . DC  C  3 12  ? 69.887 10.773  6.850   1.00 51.14  ? 11  DC  F "C2'" 1 
ATOM   1459 C  "C1'" . DC  C  3 12  ? 69.121 10.754  5.535   1.00 50.31  ? 11  DC  F "C1'" 1 
ATOM   1460 N  N1    . DC  C  3 12  ? 67.918 9.875   5.558   1.00 49.28  ? 11  DC  F N1    1 
ATOM   1461 C  C2    . DC  C  3 12  ? 66.644 10.441  5.445   1.00 50.22  ? 11  DC  F C2    1 
ATOM   1462 O  O2    . DC  C  3 12  ? 66.537 11.667  5.329   1.00 52.84  ? 11  DC  F O2    1 
ATOM   1463 N  N3    . DC  C  3 12  ? 65.559 9.627   5.466   1.00 48.60  ? 11  DC  F N3    1 
ATOM   1464 C  C4    . DC  C  3 12  ? 65.718 8.308   5.594   1.00 46.35  ? 11  DC  F C4    1 
ATOM   1465 N  N4    . DC  C  3 12  ? 64.621 7.545   5.610   1.00 44.25  ? 11  DC  F N4    1 
ATOM   1466 C  C5    . DC  C  3 12  ? 67.009 7.713   5.710   1.00 46.02  ? 11  DC  F C5    1 
ATOM   1467 C  C6    . DC  C  3 12  ? 68.069 8.526   5.688   1.00 47.73  ? 11  DC  F C6    1 
ATOM   1468 P  P     . DG  C  3 13  ? 71.887 12.983  8.100   1.00 56.64  ? 12  DG  F P     1 
ATOM   1469 O  OP1   . DG  C  3 13  ? 72.795 14.149  8.028   1.00 60.25  ? 12  DG  F OP1   1 
ATOM   1470 O  OP2   . DG  C  3 13  ? 72.214 11.837  8.976   1.00 55.54  ? 12  DG  F OP2   1 
ATOM   1471 O  "O5'" . DG  C  3 13  ? 70.430 13.494  8.502   1.00 56.07  ? 12  DG  F "O5'" 1 
ATOM   1472 C  "C5'" . DG  C  3 13  ? 69.731 14.381  7.646   1.00 56.59  ? 12  DG  F "C5'" 1 
ATOM   1473 C  "C4'" . DG  C  3 13  ? 68.356 14.678  8.206   1.00 57.11  ? 12  DG  F "C4'" 1 
ATOM   1474 O  "O4'" . DG  C  3 13  ? 67.449 13.602  7.865   1.00 53.81  ? 12  DG  F "O4'" 1 
ATOM   1475 C  "C3'" . DG  C  3 13  ? 68.306 14.818  9.732   1.00 59.41  ? 12  DG  F "C3'" 1 
ATOM   1476 O  "O3'" . DG  C  3 13  ? 67.650 16.025  10.091  1.00 62.71  ? 12  DG  F "O3'" 1 
ATOM   1477 C  "C2'" . DG  C  3 13  ? 67.516 13.589  10.188  1.00 56.77  ? 12  DG  F "C2'" 1 
ATOM   1478 C  "C1'" . DG  C  3 13  ? 66.640 13.321  8.977   1.00 54.89  ? 12  DG  F "C1'" 1 
ATOM   1479 N  N9    . DG  C  3 13  ? 66.188 11.938  8.885   1.00 52.71  ? 12  DG  F N9    1 
ATOM   1480 C  C8    . DG  C  3 13  ? 66.967 10.808  8.929   1.00 51.10  ? 12  DG  F C8    1 
ATOM   1481 N  N7    . DG  C  3 13  ? 66.285 9.702   8.823   1.00 48.30  ? 12  DG  F N7    1 
ATOM   1482 C  C5    . DG  C  3 13  ? 64.968 10.127  8.701   1.00 49.11  ? 12  DG  F C5    1 
ATOM   1483 C  C6    . DG  C  3 13  ? 63.779 9.377   8.555   1.00 47.63  ? 12  DG  F C6    1 
ATOM   1484 O  O6    . DG  C  3 13  ? 63.650 8.146   8.502   1.00 46.43  ? 12  DG  F O6    1 
ATOM   1485 N  N1    . DG  C  3 13  ? 62.658 10.199  8.467   1.00 49.14  ? 12  DG  F N1    1 
ATOM   1486 C  C2    . DG  C  3 13  ? 62.685 11.573  8.514   1.00 51.83  ? 12  DG  F C2    1 
ATOM   1487 N  N2    . DG  C  3 13  ? 61.501 12.195  8.413   1.00 53.43  ? 12  DG  F N2    1 
ATOM   1488 N  N3    . DG  C  3 13  ? 63.793 12.288  8.651   1.00 53.28  ? 12  DG  F N3    1 
ATOM   1489 C  C4    . DG  C  3 13  ? 64.892 11.501  8.739   1.00 51.61  ? 12  DG  F C4    1 
ATOM   1490 P  P     . DC  C  3 14  ? 67.902 16.676  11.538  1.00 67.07  ? 13  DC  F P     1 
ATOM   1491 O  OP1   . DC  C  3 14  ? 68.422 18.048  11.335  1.00 71.50  ? 13  DC  F OP1   1 
ATOM   1492 O  OP2   . DC  C  3 14  ? 68.646 15.696  12.355  1.00 66.19  ? 13  DC  F OP2   1 
ATOM   1493 O  "O5'" . DC  C  3 14  ? 66.446 16.750  12.185  1.00 66.98  ? 13  DC  F "O5'" 1 
ATOM   1494 C  "C5'" . DC  C  3 14  ? 65.374 17.323  11.462  1.00 66.59  ? 13  DC  F "C5'" 1 
ATOM   1495 C  "C4'" . DC  C  3 14  ? 64.052 16.763  11.950  1.00 64.34  ? 13  DC  F "C4'" 1 
ATOM   1496 O  "O4'" . DC  C  3 14  ? 63.896 15.407  11.472  1.00 59.59  ? 13  DC  F "O4'" 1 
ATOM   1497 C  "C3'" . DC  C  3 14  ? 63.903 16.700  13.476  1.00 65.91  ? 13  DC  F "C3'" 1 
ATOM   1498 O  "O3'" . DC  C  3 14  ? 62.772 17.455  13.887  1.00 68.72  ? 13  DC  F "O3'" 1 
ATOM   1499 C  "C2'" . DC  C  3 14  ? 63.726 15.207  13.782  1.00 62.16  ? 13  DC  F "C2'" 1 
ATOM   1500 C  "C1'" . DC  C  3 14  ? 63.233 14.659  12.453  1.00 59.36  ? 13  DC  F "C1'" 1 
ATOM   1501 N  N1    . DC  C  3 14  ? 63.558 13.221  12.250  1.00 56.16  ? 13  DC  F N1    1 
ATOM   1502 C  C2    . DC  C  3 14  ? 62.541 12.320  11.920  1.00 53.85  ? 13  DC  F C2    1 
ATOM   1503 O  O2    . DC  C  3 14  ? 61.383 12.736  11.799  1.00 55.51  ? 13  DC  F O2    1 
ATOM   1504 N  N3    . DC  C  3 14  ? 62.855 11.013  11.740  1.00 50.49  ? 13  DC  F N3    1 
ATOM   1505 C  C4    . DC  C  3 14  ? 64.119 10.606  11.881  1.00 50.09  ? 13  DC  F C4    1 
ATOM   1506 N  N4    . DC  C  3 14  ? 64.382 9.311   11.695  1.00 47.49  ? 13  DC  F N4    1 
ATOM   1507 C  C5    . DC  C  3 14  ? 65.168 11.510  12.217  1.00 52.70  ? 13  DC  F C5    1 
ATOM   1508 C  C6    . DC  C  3 14  ? 64.845 12.795  12.392  1.00 55.65  ? 13  DC  F C6    1 
ATOM   1509 N  N     . HIS D  1 1   ? 45.560 69.138  11.980  1.00 78.73  ? 319 HIS A N     1 
ATOM   1510 C  CA    . HIS D  1 1   ? 44.987 69.536  10.701  1.00 77.49  ? 319 HIS A CA    1 
ATOM   1511 C  C     . HIS D  1 1   ? 46.048 69.534  9.605   1.00 74.14  ? 319 HIS A C     1 
ATOM   1512 O  O     . HIS D  1 1   ? 45.863 70.134  8.546   1.00 73.16  ? 319 HIS A O     1 
ATOM   1513 C  CB    . HIS D  1 1   ? 44.341 70.919  10.808  1.00 81.73  ? 319 HIS A CB    1 
ATOM   1514 N  N     . MET D  1 2   ? 47.160 68.854  9.866   1.00 73.24  ? 320 MET A N     1 
ATOM   1515 C  CA    . MET D  1 2   ? 48.271 68.766  8.931   1.00 70.43  ? 320 MET A CA    1 
ATOM   1516 C  C     . MET D  1 2   ? 48.391 67.350  8.381   1.00 68.14  ? 320 MET A C     1 
ATOM   1517 O  O     . MET D  1 2   ? 47.857 66.391  8.946   1.00 69.13  ? 320 MET A O     1 
ATOM   1518 C  CB    . MET D  1 2   ? 49.586 69.182  9.602   1.00 71.04  ? 320 MET A CB    1 
ATOM   1519 N  N     . ARG D  1 3   ? 49.102 67.234  7.259   1.00 65.98  ? 321 ARG A N     1 
ATOM   1520 C  CA    . ARG D  1 3   ? 49.352 65.954  6.610   1.00 64.15  ? 321 ARG A CA    1 
ATOM   1521 C  C     . ARG D  1 3   ? 50.532 65.262  7.282   1.00 62.66  ? 321 ARG A C     1 
ATOM   1522 O  O     . ARG D  1 3   ? 51.663 65.759  7.217   1.00 62.44  ? 321 ARG A O     1 
ATOM   1523 C  CB    . ARG D  1 3   ? 49.621 66.148  5.116   1.00 63.62  ? 321 ARG A CB    1 
ATOM   1524 C  CG    . ARG D  1 3   ? 48.437 66.695  4.338   1.00 66.78  ? 321 ARG A CG    1 
ATOM   1525 C  CD    . ARG D  1 3   ? 48.849 67.194  2.961   1.00 66.77  ? 321 ARG A CD    1 
ATOM   1526 N  NE    . ARG D  1 3   ? 49.662 68.404  3.042   1.00 69.33  ? 321 ARG A NE    1 
ATOM   1527 C  CZ    . ARG D  1 3   ? 50.148 69.049  1.987   1.00 69.65  ? 321 ARG A CZ    1 
ATOM   1528 N  NH1   . ARG D  1 3   ? 49.906 68.600  0.763   1.00 68.18  ? 321 ARG A NH1   1 
ATOM   1529 N  NH2   . ARG D  1 3   ? 50.878 70.144  2.154   1.00 71.42  ? 321 ARG A NH2   1 
ATOM   1530 N  N     . PRO D  1 4   ? 50.308 64.120  7.938   1.00 61.61  ? 322 PRO A N     1 
ATOM   1531 C  CA    . PRO D  1 4   ? 51.387 63.450  8.672   1.00 61.31  ? 322 PRO A CA    1 
ATOM   1532 C  C     . PRO D  1 4   ? 52.199 62.445  7.868   1.00 58.22  ? 322 PRO A C     1 
ATOM   1533 O  O     . PRO D  1 4   ? 53.248 62.003  8.356   1.00 58.82  ? 322 PRO A O     1 
ATOM   1534 C  CB    . PRO D  1 4   ? 50.621 62.739  9.797   1.00 63.69  ? 322 PRO A CB    1 
ATOM   1535 C  CG    . PRO D  1 4   ? 49.321 62.374  9.154   1.00 62.69  ? 322 PRO A CG    1 
ATOM   1536 C  CD    . PRO D  1 4   ? 49.001 63.480  8.169   1.00 62.05  ? 322 PRO A CD    1 
ATOM   1537 N  N     . PHE D  1 5   ? 51.761 62.076  6.668   1.00 55.89  ? 323 PHE A N     1 
ATOM   1538 C  CA    . PHE D  1 5   ? 52.408 61.038  5.876   1.00 53.99  ? 323 PHE A CA    1 
ATOM   1539 C  C     . PHE D  1 5   ? 53.132 61.671  4.695   1.00 53.19  ? 323 PHE A C     1 
ATOM   1540 O  O     . PHE D  1 5   ? 52.566 62.519  3.998   1.00 53.21  ? 323 PHE A O     1 
ATOM   1541 C  CB    . PHE D  1 5   ? 51.379 60.012  5.397   1.00 52.21  ? 323 PHE A CB    1 
ATOM   1542 C  CG    . PHE D  1 5   ? 50.529 59.453  6.503   1.00 53.22  ? 323 PHE A CG    1 
ATOM   1543 C  CD1   . PHE D  1 5   ? 51.107 59.016  7.684   1.00 54.54  ? 323 PHE A CD1   1 
ATOM   1544 C  CD2   . PHE D  1 5   ? 49.152 59.387  6.373   1.00 53.22  ? 323 PHE A CD2   1 
ATOM   1545 C  CE1   . PHE D  1 5   ? 50.331 58.509  8.707   1.00 56.52  ? 323 PHE A CE1   1 
ATOM   1546 C  CE2   . PHE D  1 5   ? 48.370 58.882  7.396   1.00 55.20  ? 323 PHE A CE2   1 
ATOM   1547 C  CZ    . PHE D  1 5   ? 48.961 58.442  8.563   1.00 56.88  ? 323 PHE A CZ    1 
ATOM   1548 N  N     . MET D  1 6   ? 54.377 61.253  4.468   1.00 52.45  ? 324 MET A N     1 
ATOM   1549 C  CA    . MET D  1 6   ? 55.240 61.891  3.485   1.00 51.26  ? 324 MET A CA    1 
ATOM   1550 C  C     . MET D  1 6   ? 56.031 60.841  2.715   1.00 50.11  ? 324 MET A C     1 
ATOM   1551 O  O     . MET D  1 6   ? 56.401 59.797  3.258   1.00 51.39  ? 324 MET A O     1 
ATOM   1552 C  CB    . MET D  1 6   ? 56.199 62.886  4.161   1.00 53.12  ? 324 MET A CB    1 
ATOM   1553 C  CG    . MET D  1 6   ? 57.131 63.622  3.210   1.00 52.33  ? 324 MET A CG    1 
ATOM   1554 S  SD    . MET D  1 6   ? 58.288 64.723  4.047   1.00 54.81  ? 324 MET A SD    1 
ATOM   1555 C  CE    . MET D  1 6   ? 57.176 65.948  4.724   1.00 55.98  ? 324 MET A CE    1 
ATOM   1556 N  N     . CYS D  1 7   ? 56.280 61.130  1.438   1.00 48.53  ? 325 CYS A N     1 
ATOM   1557 C  CA    . CYS D  1 7   ? 57.156 60.296  0.626   1.00 47.82  ? 325 CYS A CA    1 
ATOM   1558 C  C     . CYS D  1 7   ? 58.608 60.496  1.045   1.00 48.77  ? 325 CYS A C     1 
ATOM   1559 O  O     . CYS D  1 7   ? 59.051 61.623  1.281   1.00 49.30  ? 325 CYS A O     1 
ATOM   1560 C  CB    . CYS D  1 7   ? 56.977 60.636  -0.855  1.00 46.17  ? 325 CYS A CB    1 
ATOM   1561 S  SG    . CYS D  1 7   ? 58.084 59.774  -1.992  1.00 46.37  ? 325 CYS A SG    1 
ATOM   1562 N  N     . ALA D  1 8   ? 59.356 59.396  1.138   1.00 49.07  ? 326 ALA A N     1 
ATOM   1563 C  CA    . ALA D  1 8   ? 60.727 59.449  1.633   1.00 50.78  ? 326 ALA A CA    1 
ATOM   1564 C  C     . ALA D  1 8   ? 61.760 59.734  0.548   1.00 51.58  ? 326 ALA A C     1 
ATOM   1565 O  O     . ALA D  1 8   ? 62.935 59.931  0.876   1.00 53.73  ? 326 ALA A O     1 
ATOM   1566 C  CB    . ALA D  1 8   ? 61.091 58.140  2.342   1.00 52.35  ? 326 ALA A CB    1 
ATOM   1567 N  N     . TYR D  1 9   ? 61.366 59.751  -0.716  1.00 51.15  ? 327 TYR A N     1 
ATOM   1568 C  CA    . TYR D  1 9   ? 62.313 60.048  -1.787  1.00 53.04  ? 327 TYR A CA    1 
ATOM   1569 C  C     . TYR D  1 9   ? 62.743 61.508  -1.711  1.00 52.35  ? 327 TYR A C     1 
ATOM   1570 O  O     . TYR D  1 9   ? 61.889 62.401  -1.780  1.00 51.46  ? 327 TYR A O     1 
ATOM   1571 C  CB    . TYR D  1 9   ? 61.695 59.740  -3.146  1.00 53.65  ? 327 TYR A CB    1 
ATOM   1572 C  CG    . TYR D  1 9   ? 61.604 58.262  -3.456  1.00 56.20  ? 327 TYR A CG    1 
ATOM   1573 C  CD1   . TYR D  1 9   ? 62.568 57.635  -4.237  1.00 58.71  ? 327 TYR A CD1   1 
ATOM   1574 C  CD2   . TYR D  1 9   ? 60.557 57.492  -2.966  1.00 56.38  ? 327 TYR A CD2   1 
ATOM   1575 C  CE1   . TYR D  1 9   ? 62.489 56.284  -4.522  1.00 60.26  ? 327 TYR A CE1   1 
ATOM   1576 C  CE2   . TYR D  1 9   ? 60.470 56.141  -3.246  1.00 57.72  ? 327 TYR A CE2   1 
ATOM   1577 C  CZ    . TYR D  1 9   ? 61.439 55.542  -4.025  1.00 59.73  ? 327 TYR A CZ    1 
ATOM   1578 O  OH    . TYR D  1 9   ? 61.362 54.198  -4.309  1.00 61.53  ? 327 TYR A OH    1 
ATOM   1579 N  N     . PRO D  1 10  ? 64.035 61.794  -1.564  1.00 52.55  ? 328 PRO A N     1 
ATOM   1580 C  CA    . PRO D  1 10  ? 64.481 63.189  -1.441  1.00 52.76  ? 328 PRO A CA    1 
ATOM   1581 C  C     . PRO D  1 10  ? 64.141 63.996  -2.686  1.00 52.92  ? 328 PRO A C     1 
ATOM   1582 O  O     . PRO D  1 10  ? 64.371 63.557  -3.815  1.00 53.37  ? 328 PRO A O     1 
ATOM   1583 C  CB    . PRO D  1 10  ? 65.998 63.060  -1.248  1.00 54.25  ? 328 PRO A CB    1 
ATOM   1584 C  CG    . PRO D  1 10  ? 66.209 61.653  -0.773  1.00 55.34  ? 328 PRO A CG    1 
ATOM   1585 C  CD    . PRO D  1 10  ? 65.148 60.839  -1.442  1.00 53.89  ? 328 PRO A CD    1 
ATOM   1586 N  N     . GLY D  1 11  ? 63.589 65.186  -2.470  1.00 53.17  ? 329 GLY A N     1 
ATOM   1587 C  CA    . GLY D  1 11  ? 63.182 66.032  -3.574  1.00 52.90  ? 329 GLY A CA    1 
ATOM   1588 C  C     . GLY D  1 11  ? 61.694 65.963  -3.843  1.00 51.51  ? 329 GLY A C     1 
ATOM   1589 O  O     . GLY D  1 11  ? 61.063 66.983  -4.135  1.00 51.13  ? 329 GLY A O     1 
ATOM   1590 N  N     . CYS D  1 12  ? 61.119 64.764  -3.747  1.00 50.69  ? 330 CYS A N     1 
ATOM   1591 C  CA    . CYS D  1 12  ? 59.679 64.619  -3.929  1.00 48.62  ? 330 CYS A CA    1 
ATOM   1592 C  C     . CYS D  1 12  ? 58.935 65.004  -2.656  1.00 47.87  ? 330 CYS A C     1 
ATOM   1593 O  O     . CYS D  1 12  ? 58.201 65.998  -2.632  1.00 47.81  ? 330 CYS A O     1 
ATOM   1594 C  CB    . CYS D  1 12  ? 59.350 63.180  -4.339  1.00 47.86  ? 330 CYS A CB    1 
ATOM   1595 S  SG    . CYS D  1 12  ? 57.604 62.852  -4.664  1.00 45.55  ? 330 CYS A SG    1 
ATOM   1596 N  N     . ASN D  1 13  ? 59.147 64.236  -1.586  1.00 48.24  ? 331 ASN A N     1 
ATOM   1597 C  CA    . ASN D  1 13  ? 58.634 64.513  -0.240  1.00 48.17  ? 331 ASN A CA    1 
ATOM   1598 C  C     . ASN D  1 13  ? 57.194 65.027  -0.258  1.00 48.99  ? 331 ASN A C     1 
ATOM   1599 O  O     . ASN D  1 13  ? 56.848 66.017  0.391   1.00 50.55  ? 331 ASN A O     1 
ATOM   1600 C  CB    . ASN D  1 13  ? 59.552 65.490  0.494   1.00 47.46  ? 331 ASN A CB    1 
ATOM   1601 C  CG    . ASN D  1 13  ? 60.976 64.977  0.605   1.00 47.04  ? 331 ASN A CG    1 
ATOM   1602 O  OD1   . ASN D  1 13  ? 61.922 65.651  0.198   1.00 48.06  ? 331 ASN A OD1   1 
ATOM   1603 N  ND2   . ASN D  1 13  ? 61.136 63.779  1.157   1.00 47.44  ? 331 ASN A ND2   1 
ATOM   1604 N  N     . LYS D  1 14  ? 56.343 64.336  -1.010  1.00 48.43  ? 332 LYS A N     1 
ATOM   1605 C  CA    . LYS D  1 14  ? 54.942 64.724  -1.095  1.00 49.01  ? 332 LYS A CA    1 
ATOM   1606 C  C     . LYS D  1 14  ? 54.183 64.251  0.137   1.00 49.97  ? 332 LYS A C     1 
ATOM   1607 O  O     . LYS D  1 14  ? 54.367 63.124  0.606   1.00 50.45  ? 332 LYS A O     1 
ATOM   1608 C  CB    . LYS D  1 14  ? 54.295 64.158  -2.360  1.00 48.45  ? 332 LYS A CB    1 
ATOM   1609 C  CG    . LYS D  1 14  ? 54.700 64.870  -3.643  1.00 48.05  ? 332 LYS A CG    1 
ATOM   1610 C  CD    . LYS D  1 14  ? 53.620 64.742  -4.712  1.00 48.35  ? 332 LYS A CD    1 
ATOM   1611 C  CE    . LYS D  1 14  ? 52.381 65.542  -4.338  1.00 49.83  ? 332 LYS A CE    1 
ATOM   1612 N  NZ    . LYS D  1 14  ? 51.337 65.494  -5.400  1.00 51.11  ? 332 LYS A NZ    1 
ATOM   1613 N  N     . ARG D  1 15  ? 53.324 65.121  0.655   1.00 50.94  ? 333 ARG A N     1 
ATOM   1614 C  CA    . ARG D  1 15  ? 52.564 64.852  1.865   1.00 52.29  ? 333 ARG A CA    1 
ATOM   1615 C  C     . ARG D  1 15  ? 51.145 64.422  1.519   1.00 51.98  ? 333 ARG A C     1 
ATOM   1616 O  O     . ARG D  1 15  ? 50.553 64.894  0.545   1.00 51.89  ? 333 ARG A O     1 
ATOM   1617 C  CB    . ARG D  1 15  ? 52.531 66.085  2.768   1.00 55.21  ? 333 ARG A CB    1 
ATOM   1618 C  CG    . ARG D  1 15  ? 53.901 66.540  3.235   1.00 56.09  ? 333 ARG A CG    1 
ATOM   1619 C  CD    . ARG D  1 15  ? 54.105 68.021  2.972   1.00 57.54  ? 333 ARG A CD    1 
ATOM   1620 N  NE    . ARG D  1 15  ? 55.333 68.519  3.583   1.00 59.02  ? 333 ARG A NE    1 
ATOM   1621 C  CZ    . ARG D  1 15  ? 55.410 68.966  4.831   1.00 62.32  ? 333 ARG A CZ    1 
ATOM   1622 N  NH1   . ARG D  1 15  ? 56.565 69.403  5.316   1.00 63.51  ? 333 ARG A NH1   1 
ATOM   1623 N  NH2   . ARG D  1 15  ? 54.328 68.972  5.597   1.00 64.77  ? 333 ARG A NH2   1 
ATOM   1624 N  N     . TYR D  1 16  ? 50.603 63.516  2.331   1.00 52.23  ? 334 TYR A N     1 
ATOM   1625 C  CA    . TYR D  1 16  ? 49.263 62.990  2.121   1.00 52.34  ? 334 TYR A CA    1 
ATOM   1626 C  C     . TYR D  1 16  ? 48.562 62.820  3.461   1.00 53.39  ? 334 TYR A C     1 
ATOM   1627 O  O     . TYR D  1 16  ? 49.200 62.572  4.487   1.00 53.69  ? 334 TYR A O     1 
ATOM   1628 C  CB    . TYR D  1 16  ? 49.294 61.648  1.374   1.00 51.44  ? 334 TYR A CB    1 
ATOM   1629 C  CG    . TYR D  1 16  ? 49.853 61.739  -0.027  1.00 50.65  ? 334 TYR A CG    1 
ATOM   1630 C  CD1   . TYR D  1 16  ? 49.023 62.000  -1.110  1.00 51.40  ? 334 TYR A CD1   1 
ATOM   1631 C  CD2   . TYR D  1 16  ? 51.209 61.563  -0.268  1.00 49.82  ? 334 TYR A CD2   1 
ATOM   1632 C  CE1   . TYR D  1 16  ? 49.528 62.085  -2.394  1.00 50.85  ? 334 TYR A CE1   1 
ATOM   1633 C  CE2   . TYR D  1 16  ? 51.724 61.647  -1.549  1.00 49.12  ? 334 TYR A CE2   1 
ATOM   1634 C  CZ    . TYR D  1 16  ? 50.879 61.907  -2.608  1.00 49.73  ? 334 TYR A CZ    1 
ATOM   1635 O  OH    . TYR D  1 16  ? 51.385 61.992  -3.884  1.00 49.62  ? 334 TYR A OH    1 
ATOM   1636 N  N     . PHE D  1 17  ? 47.234 62.960  3.438   1.00 54.40  ? 335 PHE A N     1 
ATOM   1637 C  CA    . PHE D  1 17  ? 46.437 62.727  4.637   1.00 56.50  ? 335 PHE A CA    1 
ATOM   1638 C  C     . PHE D  1 17  ? 46.211 61.240  4.881   1.00 57.10  ? 335 PHE A C     1 
ATOM   1639 O  O     . PHE D  1 17  ? 46.302 60.775  6.022   1.00 58.66  ? 335 PHE A O     1 
ATOM   1640 C  CB    . PHE D  1 17  ? 45.091 63.446  4.532   1.00 57.53  ? 335 PHE A CB    1 
ATOM   1641 C  CG    . PHE D  1 17  ? 45.146 64.904  4.887   1.00 58.26  ? 335 PHE A CG    1 
ATOM   1642 C  CD1   . PHE D  1 17  ? 45.408 65.305  6.187   1.00 60.09  ? 335 PHE A CD1   1 
ATOM   1643 C  CD2   . PHE D  1 17  ? 44.913 65.874  3.926   1.00 57.90  ? 335 PHE A CD2   1 
ATOM   1644 C  CE1   . PHE D  1 17  ? 45.451 66.646  6.518   1.00 62.39  ? 335 PHE A CE1   1 
ATOM   1645 C  CE2   . PHE D  1 17  ? 44.952 67.216  4.252   1.00 60.24  ? 335 PHE A CE2   1 
ATOM   1646 C  CZ    . PHE D  1 17  ? 45.222 67.602  5.550   1.00 62.55  ? 335 PHE A CZ    1 
ATOM   1647 N  N     . LYS D  1 18  ? 45.913 60.485  3.830   1.00 56.71  ? 336 LYS A N     1 
ATOM   1648 C  CA    . LYS D  1 18  ? 45.614 59.067  3.944   1.00 57.72  ? 336 LYS A CA    1 
ATOM   1649 C  C     . LYS D  1 18  ? 46.812 58.232  3.512   1.00 56.02  ? 336 LYS A C     1 
ATOM   1650 O  O     . LYS D  1 18  ? 47.564 58.608  2.610   1.00 54.51  ? 336 LYS A O     1 
ATOM   1651 C  CB    . LYS D  1 18  ? 44.392 58.700  3.096   1.00 58.60  ? 336 LYS A CB    1 
ATOM   1652 C  CG    . LYS D  1 18  ? 43.168 59.581  3.327   1.00 61.53  ? 336 LYS A CG    1 
ATOM   1653 C  CD    . LYS D  1 18  ? 42.199 58.977  4.340   1.00 64.42  ? 336 LYS A CD    1 
ATOM   1654 C  CE    . LYS D  1 18  ? 42.616 59.258  5.777   1.00 65.90  ? 336 LYS A CE    1 
ATOM   1655 N  NZ    . LYS D  1 18  ? 41.635 58.723  6.762   1.00 68.88  ? 336 LYS A NZ    1 
ATOM   1656 N  N     . LEU D  1 19  ? 46.982 57.085  4.173   1.00 56.82  ? 337 LEU A N     1 
ATOM   1657 C  CA    . LEU D  1 19  ? 48.080 56.187  3.829   1.00 55.03  ? 337 LEU A CA    1 
ATOM   1658 C  C     . LEU D  1 19  ? 47.880 55.549  2.461   1.00 54.68  ? 337 LEU A C     1 
ATOM   1659 O  O     . LEU D  1 19  ? 48.861 55.198  1.794   1.00 53.62  ? 337 LEU A O     1 
ATOM   1660 C  CB    . LEU D  1 19  ? 48.228 55.107  4.899   1.00 54.90  ? 337 LEU A CB    1 
ATOM   1661 C  CG    . LEU D  1 19  ? 48.754 55.555  6.263   1.00 54.92  ? 337 LEU A CG    1 
ATOM   1662 C  CD1   . LEU D  1 19  ? 48.456 54.504  7.316   1.00 56.66  ? 337 LEU A CD1   1 
ATOM   1663 C  CD2   . LEU D  1 19  ? 50.247 55.828  6.189   1.00 53.61  ? 337 LEU A CD2   1 
ATOM   1664 N  N     . SER D  1 20  ? 46.628 55.389  2.028   1.00 56.02  ? 338 SER A N     1 
ATOM   1665 C  CA    . SER D  1 20  ? 46.367 54.799  0.720   1.00 56.11  ? 338 SER A CA    1 
ATOM   1666 C  C     . SER D  1 20  ? 46.861 55.703  -0.403  1.00 55.02  ? 338 SER A C     1 
ATOM   1667 O  O     . SER D  1 20  ? 47.421 55.220  -1.394  1.00 54.98  ? 338 SER A O     1 
ATOM   1668 C  CB    . SER D  1 20  ? 44.874 54.511  0.562   1.00 58.55  ? 338 SER A CB    1 
ATOM   1669 O  OG    . SER D  1 20  ? 44.108 55.695  0.704   1.00 60.52  ? 338 SER A OG    1 
ATOM   1670 N  N     . HIS D  1 21  ? 46.667 57.016  -0.265  1.00 54.81  ? 339 HIS A N     1 
ATOM   1671 C  CA    . HIS D  1 21  ? 47.139 57.940  -1.290  1.00 53.83  ? 339 HIS A CA    1 
ATOM   1672 C  C     . HIS D  1 21  ? 48.660 58.031  -1.304  1.00 52.38  ? 339 HIS A C     1 
ATOM   1673 O  O     . HIS D  1 21  ? 49.255 58.265  -2.361  1.00 51.66  ? 339 HIS A O     1 
ATOM   1674 C  CB    . HIS D  1 21  ? 46.518 59.322  -1.081  1.00 54.65  ? 339 HIS A CB    1 
ATOM   1675 C  CG    . HIS D  1 21  ? 45.033 59.350  -1.269  1.00 56.23  ? 339 HIS A CG    1 
ATOM   1676 N  ND1   . HIS D  1 21  ? 44.288 60.504  -1.148  1.00 57.97  ? 339 HIS A ND1   1 
ATOM   1677 C  CD2   . HIS D  1 21  ? 44.153 58.366  -1.570  1.00 57.27  ? 339 HIS A CD2   1 
ATOM   1678 C  CE1   . HIS D  1 21  ? 43.015 60.230  -1.365  1.00 59.96  ? 339 HIS A CE1   1 
ATOM   1679 N  NE2   . HIS D  1 21  ? 42.905 58.939  -1.624  1.00 59.28  ? 339 HIS A NE2   1 
ATOM   1680 N  N     . LEU D  1 22  ? 49.303 57.851  -0.148  1.00 52.29  ? 340 LEU A N     1 
ATOM   1681 C  CA    . LEU D  1 22  ? 50.760 57.784  -0.127  1.00 51.28  ? 340 LEU A CA    1 
ATOM   1682 C  C     . LEU D  1 22  ? 51.265 56.486  -0.744  1.00 52.26  ? 340 LEU A C     1 
ATOM   1683 O  O     . LEU D  1 22  ? 52.335 56.471  -1.363  1.00 51.77  ? 340 LEU A O     1 
ATOM   1684 C  CB    . LEU D  1 22  ? 51.278 57.932  1.305   1.00 51.00  ? 340 LEU A CB    1 
ATOM   1685 C  CG    . LEU D  1 22  ? 52.790 57.781  1.498   1.00 50.13  ? 340 LEU A CG    1 
ATOM   1686 C  CD1   . LEU D  1 22  ? 53.542 58.822  0.683   1.00 48.82  ? 340 LEU A CD1   1 
ATOM   1687 C  CD2   . LEU D  1 22  ? 53.173 57.859  2.970   1.00 51.50  ? 340 LEU A CD2   1 
ATOM   1688 N  N     . GLN D  1 23  ? 50.511 55.394  -0.595  1.00 54.08  ? 341 GLN A N     1 
ATOM   1689 C  CA    . GLN D  1 23  ? 50.911 54.133  -1.210  1.00 55.51  ? 341 GLN A CA    1 
ATOM   1690 C  C     . GLN D  1 23  ? 50.839 54.217  -2.730  1.00 57.25  ? 341 GLN A C     1 
ATOM   1691 O  O     . GLN D  1 23  ? 51.768 53.796  -3.429  1.00 58.30  ? 341 GLN A O     1 
ATOM   1692 C  CB    . GLN D  1 23  ? 50.036 52.991  -0.693  1.00 56.01  ? 341 GLN A CB    1 
ATOM   1693 C  CG    . GLN D  1 23  ? 50.488 51.616  -1.159  1.00 56.82  ? 341 GLN A CG    1 
ATOM   1694 C  CD    . GLN D  1 23  ? 49.591 50.503  -0.655  1.00 57.76  ? 341 GLN A CD    1 
ATOM   1695 O  OE1   . GLN D  1 23  ? 48.435 50.734  -0.302  1.00 57.39  ? 341 GLN A OE1   1 
ATOM   1696 N  NE2   . GLN D  1 23  ? 50.123 49.287  -0.616  1.00 59.44  ? 341 GLN A NE2   1 
ATOM   1697 N  N     . MET D  1 24  ? 49.740 54.762  -3.261  1.00 58.30  ? 342 MET A N     1 
ATOM   1698 C  CA    . MET D  1 24  ? 49.608 54.902  -4.708  1.00 59.76  ? 342 MET A CA    1 
ATOM   1699 C  C     . MET D  1 24  ? 50.674 55.823  -5.285  1.00 58.50  ? 342 MET A C     1 
ATOM   1700 O  O     . MET D  1 24  ? 51.091 55.644  -6.436  1.00 59.28  ? 342 MET A O     1 
ATOM   1701 C  CB    . MET D  1 24  ? 48.210 55.414  -5.062  1.00 62.02  ? 342 MET A CB    1 
ATOM   1702 C  CG    . MET D  1 24  ? 47.168 54.316  -5.205  1.00 65.20  ? 342 MET A CG    1 
ATOM   1703 S  SD    . MET D  1 24  ? 45.490 54.941  -5.419  1.00 67.91  ? 342 MET A SD    1 
ATOM   1704 C  CE    . MET D  1 24  ? 45.102 55.451  -3.746  1.00 67.33  ? 342 MET A CE    1 
ATOM   1705 N  N     . HIS D  1 25  ? 51.129 56.808  -4.509  1.00 57.68  ? 343 HIS A N     1 
ATOM   1706 C  CA    . HIS D  1 25  ? 52.210 57.671  -4.973  1.00 57.40  ? 343 HIS A CA    1 
ATOM   1707 C  C     . HIS D  1 25  ? 53.531 56.915  -5.021  1.00 55.82  ? 343 HIS A C     1 
ATOM   1708 O  O     . HIS D  1 25  ? 54.284 57.020  -5.996  1.00 56.58  ? 343 HIS A O     1 
ATOM   1709 C  CB    . HIS D  1 25  ? 52.329 58.900  -4.072  1.00 58.63  ? 343 HIS A CB    1 
ATOM   1710 C  CG    . HIS D  1 25  ? 53.581 59.690  -4.296  1.00 60.99  ? 343 HIS A CG    1 
ATOM   1711 N  ND1   . HIS D  1 25  ? 53.828 60.381  -5.462  1.00 61.67  ? 343 HIS A ND1   1 
ATOM   1712 C  CD2   . HIS D  1 25  ? 54.663 59.889  -3.505  1.00 61.43  ? 343 HIS A CD2   1 
ATOM   1713 C  CE1   . HIS D  1 25  ? 55.004 60.976  -5.379  1.00 61.43  ? 343 HIS A CE1   1 
ATOM   1714 N  NE2   . HIS D  1 25  ? 55.532 60.693  -4.201  1.00 60.40  ? 343 HIS A NE2   1 
ATOM   1715 N  N     . SER D  1 26  ? 53.832 56.146  -3.970  1.00 53.69  ? 344 SER A N     1 
ATOM   1716 C  CA    . SER D  1 26  ? 55.073 55.383  -3.932  1.00 52.72  ? 344 SER A CA    1 
ATOM   1717 C  C     . SER D  1 26  ? 55.121 54.296  -4.999  1.00 52.27  ? 344 SER A C     1 
ATOM   1718 O  O     . SER D  1 26  ? 56.216 53.880  -5.392  1.00 53.57  ? 344 SER A O     1 
ATOM   1719 C  CB    . SER D  1 26  ? 55.267 54.764  -2.546  1.00 54.04  ? 344 SER A CB    1 
ATOM   1720 O  OG    . SER D  1 26  ? 54.217 53.866  -2.233  1.00 55.24  ? 344 SER A OG    1 
ATOM   1721 N  N     . ARG D  1 27  ? 53.965 53.834  -5.478  1.00 51.11  ? 345 ARG A N     1 
ATOM   1722 C  CA    . ARG D  1 27  ? 53.917 52.843  -6.547  1.00 51.89  ? 345 ARG A CA    1 
ATOM   1723 C  C     . ARG D  1 27  ? 54.322 53.407  -7.902  1.00 51.37  ? 345 ARG A C     1 
ATOM   1724 O  O     . ARG D  1 27  ? 54.392 52.643  -8.871  1.00 53.05  ? 345 ARG A O     1 
ATOM   1725 C  CB    . ARG D  1 27  ? 52.514 52.241  -6.641  1.00 52.59  ? 345 ARG A CB    1 
ATOM   1726 C  CG    . ARG D  1 27  ? 52.158 51.317  -5.490  1.00 53.42  ? 345 ARG A CG    1 
ATOM   1727 C  CD    . ARG D  1 27  ? 50.688 50.939  -5.527  1.00 54.74  ? 345 ARG A CD    1 
ATOM   1728 N  NE    . ARG D  1 27  ? 50.349 49.958  -4.502  1.00 56.62  ? 345 ARG A NE    1 
ATOM   1729 C  CZ    . ARG D  1 27  ? 49.110 49.554  -4.240  1.00 58.15  ? 345 ARG A CZ    1 
ATOM   1730 N  NH1   . ARG D  1 27  ? 48.891 48.654  -3.291  1.00 59.79  ? 345 ARG A NH1   1 
ATOM   1731 N  NH2   . ARG D  1 27  ? 48.091 50.053  -4.926  1.00 58.05  ? 345 ARG A NH2   1 
ATOM   1732 N  N     . LYS D  1 28  ? 54.587 54.710  -7.999  1.00 49.58  ? 346 LYS A N     1 
ATOM   1733 C  CA    . LYS D  1 28  ? 55.029 55.313  -9.247  1.00 49.28  ? 346 LYS A CA    1 
ATOM   1734 C  C     . LYS D  1 28  ? 56.534 55.526  -9.307  1.00 49.32  ? 346 LYS A C     1 
ATOM   1735 O  O     . LYS D  1 28  ? 57.070 55.737  -10.400 1.00 50.76  ? 346 LYS A O     1 
ATOM   1736 C  CB    . LYS D  1 28  ? 54.316 56.651  -9.472  1.00 49.55  ? 346 LYS A CB    1 
ATOM   1737 C  CG    . LYS D  1 28  ? 52.802 56.526  -9.525  1.00 50.25  ? 346 LYS A CG    1 
ATOM   1738 C  CD    . LYS D  1 28  ? 52.133 57.877  -9.697  1.00 49.61  ? 346 LYS A CD    1 
ATOM   1739 C  CE    . LYS D  1 28  ? 50.619 57.736  -9.705  1.00 50.28  ? 346 LYS A CE    1 
ATOM   1740 N  NZ    . LYS D  1 28  ? 49.937 59.053  -9.829  1.00 50.32  ? 346 LYS A NZ    1 
ATOM   1741 N  N     . HIS D  1 29  ? 57.222 55.475  -8.170  1.00 57.14  ? 347 HIS A N     1 
ATOM   1742 C  CA    . HIS D  1 29  ? 58.674 55.511  -8.182  1.00 55.12  ? 347 HIS A CA    1 
ATOM   1743 C  C     . HIS D  1 29  ? 59.227 54.170  -8.663  1.00 50.12  ? 347 HIS A C     1 
ATOM   1744 O  O     . HIS D  1 29  ? 58.548 53.139  -8.628  1.00 47.42  ? 347 HIS A O     1 
ATOM   1745 C  CB    . HIS D  1 29  ? 59.216 55.856  -6.794  1.00 58.14  ? 347 HIS A CB    1 
ATOM   1746 C  CG    . HIS D  1 29  ? 58.908 57.255  -6.355  1.00 66.64  ? 347 HIS A CG    1 
ATOM   1747 N  ND1   . HIS D  1 29  ? 59.704 58.331  -6.685  1.00 69.49  ? 347 HIS A ND1   1 
ATOM   1748 C  CD2   . HIS D  1 29  ? 57.891 57.754  -5.612  1.00 69.56  ? 347 HIS A CD2   1 
ATOM   1749 C  CE1   . HIS D  1 29  ? 59.191 59.432  -6.165  1.00 72.41  ? 347 HIS A CE1   1 
ATOM   1750 N  NE2   . HIS D  1 29  ? 58.091 59.110  -5.509  1.00 72.26  ? 347 HIS A NE2   1 
ATOM   1751 N  N     . THR D  1 30  ? 60.478 54.201  -9.128  1.00 50.61  ? 348 THR A N     1 
ATOM   1752 C  CA    . THR D  1 30  ? 61.092 53.018  -9.727  1.00 49.43  ? 348 THR A CA    1 
ATOM   1753 C  C     . THR D  1 30  ? 61.077 51.836  -8.764  1.00 50.26  ? 348 THR A C     1 
ATOM   1754 O  O     . THR D  1 30  ? 60.486 50.788  -9.052  1.00 48.21  ? 348 THR A O     1 
ATOM   1755 C  CB    . THR D  1 30  ? 62.520 53.343  -10.169 1.00 49.84  ? 348 THR A CB    1 
ATOM   1756 N  N     . GLY D  1 31  ? 61.725 51.985  -7.613  1.00 53.91  ? 349 GLY A N     1 
ATOM   1757 C  CA    . GLY D  1 31  ? 61.746 50.924  -6.626  1.00 55.40  ? 349 GLY A CA    1 
ATOM   1758 C  C     . GLY D  1 31  ? 62.828 49.897  -6.882  1.00 55.88  ? 349 GLY A C     1 
ATOM   1759 O  O     . GLY D  1 31  ? 63.226 49.673  -8.029  1.00 54.68  ? 349 GLY A O     1 
ATOM   1760 N  N     . GLU D  1 32  ? 63.306 49.261  -5.817  1.00 57.88  ? 350 GLU A N     1 
ATOM   1761 C  CA    . GLU D  1 32  ? 64.390 48.299  -5.933  1.00 57.77  ? 350 GLU A CA    1 
ATOM   1762 C  C     . GLU D  1 32  ? 63.869 46.940  -6.387  1.00 54.95  ? 350 GLU A C     1 
ATOM   1763 O  O     . GLU D  1 32  ? 62.733 46.551  -6.096  1.00 55.40  ? 350 GLU A O     1 
ATOM   1764 C  CB    . GLU D  1 32  ? 65.126 48.161  -4.599  1.00 60.48  ? 350 GLU A CB    1 
ATOM   1765 N  N     . LYS D  1 33  ? 64.718 46.224  -7.127  1.00 52.48  ? 351 LYS A N     1 
ATOM   1766 C  CA    . LYS D  1 33  ? 64.462 44.853  -7.565  1.00 48.82  ? 351 LYS A CA    1 
ATOM   1767 C  C     . LYS D  1 33  ? 65.529 43.977  -6.918  1.00 47.97  ? 351 LYS A C     1 
ATOM   1768 O  O     . LYS D  1 33  ? 66.505 43.580  -7.573  1.00 47.38  ? 351 LYS A O     1 
ATOM   1769 C  CB    . LYS D  1 33  ? 64.473 44.739  -9.089  1.00 46.64  ? 351 LYS A CB    1 
ATOM   1770 C  CG    . LYS D  1 33  ? 63.625 45.799  -9.782  1.00 46.00  ? 351 LYS A CG    1 
ATOM   1771 C  CD    . LYS D  1 33  ? 63.268 45.415  -11.215 1.00 44.24  ? 351 LYS A CD    1 
ATOM   1772 C  CE    . LYS D  1 33  ? 64.479 45.425  -12.130 1.00 44.51  ? 351 LYS A CE    1 
ATOM   1773 N  NZ    . LYS D  1 33  ? 64.090 45.161  -13.544 1.00 43.46  ? 351 LYS A NZ    1 
ATOM   1774 N  N     . PRO D  1 34  ? 65.371 43.649  -5.632  1.00 47.48  ? 352 PRO A N     1 
ATOM   1775 C  CA    . PRO D  1 34  ? 66.482 43.040  -4.885  1.00 47.74  ? 352 PRO A CA    1 
ATOM   1776 C  C     . PRO D  1 34  ? 66.678 41.554  -5.131  1.00 46.17  ? 352 PRO A C     1 
ATOM   1777 O  O     . PRO D  1 34  ? 67.769 41.043  -4.844  1.00 47.11  ? 352 PRO A O     1 
ATOM   1778 C  CB    . PRO D  1 34  ? 66.093 43.299  -3.424  1.00 49.09  ? 352 PRO A CB    1 
ATOM   1779 C  CG    . PRO D  1 34  ? 64.594 43.285  -3.455  1.00 48.11  ? 352 PRO A CG    1 
ATOM   1780 C  CD    . PRO D  1 34  ? 64.188 43.876  -4.784  1.00 47.21  ? 352 PRO A CD    1 
ATOM   1781 N  N     . TYR D  1 35  ? 65.678 40.845  -5.645  1.00 44.23  ? 353 TYR A N     1 
ATOM   1782 C  CA    . TYR D  1 35  ? 65.768 39.394  -5.785  1.00 44.00  ? 353 TYR A CA    1 
ATOM   1783 C  C     . TYR D  1 35  ? 66.518 39.050  -7.067  1.00 44.10  ? 353 TYR A C     1 
ATOM   1784 O  O     . TYR D  1 35  ? 65.984 39.201  -8.171  1.00 43.16  ? 353 TYR A O     1 
ATOM   1785 C  CB    . TYR D  1 35  ? 64.375 38.773  -5.764  1.00 42.71  ? 353 TYR A CB    1 
ATOM   1786 C  CG    . TYR D  1 35  ? 63.655 38.986  -4.451  1.00 43.91  ? 353 TYR A CG    1 
ATOM   1787 C  CD1   . TYR D  1 35  ? 63.876 38.140  -3.371  1.00 45.06  ? 353 TYR A CD1   1 
ATOM   1788 C  CD2   . TYR D  1 35  ? 62.768 40.041  -4.286  1.00 44.04  ? 353 TYR A CD2   1 
ATOM   1789 C  CE1   . TYR D  1 35  ? 63.226 38.335  -2.165  1.00 46.42  ? 353 TYR A CE1   1 
ATOM   1790 C  CE2   . TYR D  1 35  ? 62.114 40.243  -3.083  1.00 45.19  ? 353 TYR A CE2   1 
ATOM   1791 C  CZ    . TYR D  1 35  ? 62.347 39.387  -2.028  1.00 46.62  ? 353 TYR A CZ    1 
ATOM   1792 O  OH    . TYR D  1 35  ? 61.698 39.585  -0.830  1.00 48.92  ? 353 TYR A OH    1 
ATOM   1793 N  N     . GLN D  1 36  ? 67.754 38.583  -6.919  1.00 45.99  ? 354 GLN A N     1 
ATOM   1794 C  CA    . GLN D  1 36  ? 68.604 38.218  -8.042  1.00 47.18  ? 354 GLN A CA    1 
ATOM   1795 C  C     . GLN D  1 36  ? 68.362 36.773  -8.460  1.00 46.65  ? 354 GLN A C     1 
ATOM   1796 O  O     . GLN D  1 36  ? 67.999 35.921  -7.645  1.00 47.21  ? 354 GLN A O     1 
ATOM   1797 C  CB    . GLN D  1 36  ? 70.080 38.400  -7.681  1.00 50.46  ? 354 GLN A CB    1 
ATOM   1798 C  CG    . GLN D  1 36  ? 70.578 39.833  -7.721  1.00 52.62  ? 354 GLN A CG    1 
ATOM   1799 C  CD    . GLN D  1 36  ? 71.211 40.189  -9.052  1.00 53.43  ? 354 GLN A CD    1 
ATOM   1800 O  OE1   . GLN D  1 36  ? 70.997 39.510  -10.057 1.00 52.77  ? 354 GLN A OE1   1 
ATOM   1801 N  NE2   . GLN D  1 36  ? 72.005 41.253  -9.064  1.00 54.93  ? 354 GLN A NE2   1 
ATOM   1802 N  N     . CYS D  1 37  ? 68.575 36.504  -9.745  1.00 45.39  ? 355 CYS A N     1 
ATOM   1803 C  CA    . CYS D  1 37  ? 68.549 35.143  -10.263 1.00 44.41  ? 355 CYS A CA    1 
ATOM   1804 C  C     . CYS D  1 37  ? 69.967 34.586  -10.261 1.00 46.10  ? 355 CYS A C     1 
ATOM   1805 O  O     . CYS D  1 37  ? 70.896 35.237  -10.750 1.00 46.87  ? 355 CYS A O     1 
ATOM   1806 C  CB    . CYS D  1 37  ? 67.958 35.105  -11.672 1.00 42.20  ? 355 CYS A CB    1 
ATOM   1807 S  SG    . CYS D  1 37  ? 67.645 33.441  -12.297 1.00 41.44  ? 355 CYS A SG    1 
ATOM   1808 N  N     . ASP D  1 38  ? 70.131 33.385  -9.710  1.00 46.97  ? 356 ASP A N     1 
ATOM   1809 C  CA    . ASP D  1 38  ? 71.449 32.812  -9.478  1.00 49.26  ? 356 ASP A CA    1 
ATOM   1810 C  C     . ASP D  1 38  ? 71.869 31.800  -10.535 1.00 48.05  ? 356 ASP A C     1 
ATOM   1811 O  O     . ASP D  1 38  ? 72.975 31.258  -10.444 1.00 50.14  ? 356 ASP A O     1 
ATOM   1812 C  CB    . ASP D  1 38  ? 71.500 32.160  -8.094  1.00 52.60  ? 356 ASP A CB    1 
ATOM   1813 C  CG    . ASP D  1 38  ? 71.374 33.169  -6.972  1.00 55.15  ? 356 ASP A CG    1 
ATOM   1814 O  OD1   . ASP D  1 38  ? 71.867 34.305  -7.135  1.00 56.07  ? 356 ASP A OD1   1 
ATOM   1815 O  OD2   . ASP D  1 38  ? 70.781 32.827  -5.926  1.00 56.34  ? 356 ASP A OD2   1 
ATOM   1816 N  N     . PHE D  1 39  ? 71.028 31.527  -11.528 1.00 45.33  ? 357 PHE A N     1 
ATOM   1817 C  CA    . PHE D  1 39  ? 71.429 30.621  -12.594 1.00 45.17  ? 357 PHE A CA    1 
ATOM   1818 C  C     . PHE D  1 39  ? 72.515 31.258  -13.455 1.00 45.85  ? 357 PHE A C     1 
ATOM   1819 O  O     . PHE D  1 39  ? 72.613 32.483  -13.568 1.00 45.43  ? 357 PHE A O     1 
ATOM   1820 C  CB    . PHE D  1 39  ? 70.225 30.230  -13.451 1.00 43.17  ? 357 PHE A CB    1 
ATOM   1821 C  CG    . PHE D  1 39  ? 69.338 29.197  -12.811 1.00 42.54  ? 357 PHE A CG    1 
ATOM   1822 C  CD1   . PHE D  1 39  ? 69.630 27.848  -12.929 1.00 43.65  ? 357 PHE A CD1   1 
ATOM   1823 C  CD2   . PHE D  1 39  ? 68.220 29.574  -12.085 1.00 41.12  ? 357 PHE A CD2   1 
ATOM   1824 C  CE1   . PHE D  1 39  ? 68.821 26.892  -12.338 1.00 43.55  ? 357 PHE A CE1   1 
ATOM   1825 C  CE2   . PHE D  1 39  ? 67.406 28.623  -11.492 1.00 41.05  ? 357 PHE A CE2   1 
ATOM   1826 C  CZ    . PHE D  1 39  ? 67.708 27.281  -11.619 1.00 42.30  ? 357 PHE A CZ    1 
ATOM   1827 N  N     . LYS D  1 40  ? 73.342 30.404  -14.056 1.00 47.30  ? 358 LYS A N     1 
ATOM   1828 C  CA    . LYS D  1 40  ? 74.488 30.870  -14.827 1.00 48.97  ? 358 LYS A CA    1 
ATOM   1829 C  C     . LYS D  1 40  ? 74.056 31.797  -15.956 1.00 48.44  ? 358 LYS A C     1 
ATOM   1830 O  O     . LYS D  1 40  ? 73.124 31.492  -16.707 1.00 47.32  ? 358 LYS A O     1 
ATOM   1831 C  CB    . LYS D  1 40  ? 75.260 29.677  -15.393 1.00 50.67  ? 358 LYS A CB    1 
ATOM   1832 C  CG    . LYS D  1 40  ? 76.245 30.041  -16.498 1.00 52.18  ? 358 LYS A CG    1 
ATOM   1833 C  CD    . LYS D  1 40  ? 76.981 28.817  -17.025 1.00 54.62  ? 358 LYS A CD    1 
ATOM   1834 C  CE    . LYS D  1 40  ? 78.127 28.422  -16.109 1.00 56.72  ? 358 LYS A CE    1 
ATOM   1835 N  NZ    . LYS D  1 40  ? 79.220 29.432  -16.134 1.00 58.32  ? 358 LYS A NZ    1 
ATOM   1836 N  N     . ASP D  1 41  ? 74.742 32.935  -16.063 1.00 49.59  ? 359 ASP A N     1 
ATOM   1837 C  CA    . ASP D  1 41  ? 74.528 33.920  -17.124 1.00 49.48  ? 359 ASP A CA    1 
ATOM   1838 C  C     . ASP D  1 41  ? 73.067 34.367  -17.182 1.00 48.05  ? 359 ASP A C     1 
ATOM   1839 O  O     . ASP D  1 41  ? 72.355 34.156  -18.165 1.00 47.55  ? 359 ASP A O     1 
ATOM   1840 C  CB    . ASP D  1 41  ? 74.996 33.373  -18.475 1.00 50.35  ? 359 ASP A CB    1 
ATOM   1841 C  CG    . ASP D  1 41  ? 76.480 33.064  -18.493 1.00 53.36  ? 359 ASP A CG    1 
ATOM   1842 O  OD1   . ASP D  1 41  ? 77.242 33.767  -17.795 1.00 54.24  ? 359 ASP A OD1   1 
ATOM   1843 O  OD2   . ASP D  1 41  ? 76.885 32.116  -19.198 1.00 55.06  ? 359 ASP A OD2   1 
ATOM   1844 N  N     . CYS D  1 42  ? 72.629 35.001  -16.096 1.00 47.82  ? 360 CYS A N     1 
ATOM   1845 C  CA    . CYS D  1 42  ? 71.275 35.541  -16.021 1.00 46.43  ? 360 CYS A CA    1 
ATOM   1846 C  C     . CYS D  1 42  ? 71.308 36.770  -15.126 1.00 48.99  ? 360 CYS A C     1 
ATOM   1847 O  O     . CYS D  1 42  ? 71.537 36.653  -13.918 1.00 49.84  ? 360 CYS A O     1 
ATOM   1848 C  CB    . CYS D  1 42  ? 70.293 34.501  -15.492 1.00 43.55  ? 360 CYS A CB    1 
ATOM   1849 S  SG    . CYS D  1 42  ? 68.580 35.066  -15.449 1.00 39.86  ? 360 CYS A SG    1 
ATOM   1850 N  N     . GLU D  1 43  ? 71.077 37.942  -15.716 1.00 50.82  ? 361 GLU A N     1 
ATOM   1851 C  CA    . GLU D  1 43  ? 71.100 39.206  -14.994 1.00 52.39  ? 361 GLU A CA    1 
ATOM   1852 C  C     . GLU D  1 43  ? 69.703 39.693  -14.625 1.00 50.65  ? 361 GLU A C     1 
ATOM   1853 O  O     . GLU D  1 43  ? 69.512 40.890  -14.384 1.00 51.62  ? 361 GLU A O     1 
ATOM   1854 C  CB    . GLU D  1 43  ? 71.831 40.268  -15.818 1.00 54.22  ? 361 GLU A CB    1 
ATOM   1855 N  N     . ARG D  1 44  ? 68.725 38.793  -14.575 1.00 48.15  ? 362 ARG A N     1 
ATOM   1856 C  CA    . ARG D  1 44  ? 67.359 39.174  -14.246 1.00 45.05  ? 362 ARG A CA    1 
ATOM   1857 C  C     . ARG D  1 44  ? 67.219 39.468  -12.758 1.00 44.57  ? 362 ARG A C     1 
ATOM   1858 O  O     . ARG D  1 44  ? 67.762 38.752  -11.912 1.00 44.92  ? 362 ARG A O     1 
ATOM   1859 C  CB    . ARG D  1 44  ? 66.385 38.067  -14.652 1.00 42.61  ? 362 ARG A CB    1 
ATOM   1860 C  CG    . ARG D  1 44  ? 65.828 38.209  -16.059 1.00 40.67  ? 362 ARG A CG    1 
ATOM   1861 C  CD    . ARG D  1 44  ? 64.879 39.392  -16.152 1.00 39.35  ? 362 ARG A CD    1 
ATOM   1862 N  NE    . ARG D  1 44  ? 64.366 39.579  -17.505 1.00 38.76  ? 362 ARG A NE    1 
ATOM   1863 C  CZ    . ARG D  1 44  ? 63.496 40.523  -17.851 1.00 38.04  ? 362 ARG A CZ    1 
ATOM   1864 N  NH1   . ARG D  1 44  ? 63.036 41.370  -16.939 1.00 37.91  ? 362 ARG A NH1   1 
ATOM   1865 N  NH2   . ARG D  1 44  ? 63.084 40.620  -19.108 1.00 37.66  ? 362 ARG A NH2   1 
ATOM   1866 N  N     . ARG D  1 45  ? 66.488 40.537  -12.445 1.00 44.19  ? 363 ARG A N     1 
ATOM   1867 C  CA    . ARG D  1 45  ? 66.176 40.916  -11.076 1.00 44.79  ? 363 ARG A CA    1 
ATOM   1868 C  C     . ARG D  1 45  ? 64.681 41.178  -10.966 1.00 42.59  ? 363 ARG A C     1 
ATOM   1869 O  O     . ARG D  1 45  ? 64.035 41.581  -11.937 1.00 42.11  ? 363 ARG A O     1 
ATOM   1870 C  CB    . ARG D  1 45  ? 66.951 42.165  -10.635 1.00 47.83  ? 363 ARG A CB    1 
ATOM   1871 C  CG    . ARG D  1 45  ? 68.345 42.289  -11.224 1.00 50.66  ? 363 ARG A CG    1 
ATOM   1872 C  CD    . ARG D  1 45  ? 69.106 43.408  -10.545 1.00 54.21  ? 363 ARG A CD    1 
ATOM   1873 N  NE    . ARG D  1 45  ? 69.492 43.046  -9.186  1.00 56.97  ? 363 ARG A NE    1 
ATOM   1874 C  CZ    . ARG D  1 45  ? 69.617 43.917  -8.193  1.00 59.99  ? 363 ARG A CZ    1 
ATOM   1875 N  NH1   . ARG D  1 45  ? 69.369 45.202  -8.406  1.00 61.10  ? 363 ARG A NH1   1 
ATOM   1876 N  NH2   . ARG D  1 45  ? 69.978 43.506  -6.985  1.00 61.66  ? 363 ARG A NH2   1 
ATOM   1877 N  N     . PHE D  1 46  ? 64.133 40.951  -9.773  1.00 41.56  ? 364 PHE A N     1 
ATOM   1878 C  CA    . PHE D  1 46  ? 62.700 41.082  -9.561  1.00 39.81  ? 364 PHE A CA    1 
ATOM   1879 C  C     . PHE D  1 46  ? 62.434 41.756  -8.223  1.00 41.52  ? 364 PHE A C     1 
ATOM   1880 O  O     . PHE D  1 46  ? 63.270 41.742  -7.316  1.00 43.21  ? 364 PHE A O     1 
ATOM   1881 C  CB    . PHE D  1 46  ? 62.003 39.719  -9.633  1.00 37.49  ? 364 PHE A CB    1 
ATOM   1882 C  CG    . PHE D  1 46  ? 62.171 39.039  -10.957 1.00 35.37  ? 364 PHE A CG    1 
ATOM   1883 C  CD1   . PHE D  1 46  ? 63.221 38.163  -11.171 1.00 35.32  ? 364 PHE A CD1   1 
ATOM   1884 C  CD2   . PHE D  1 46  ? 61.300 39.303  -11.999 1.00 34.12  ? 364 PHE A CD2   1 
ATOM   1885 C  CE1   . PHE D  1 46  ? 63.388 37.549  -12.393 1.00 34.54  ? 364 PHE A CE1   1 
ATOM   1886 C  CE2   . PHE D  1 46  ? 61.461 38.690  -13.224 1.00 33.37  ? 364 PHE A CE2   1 
ATOM   1887 C  CZ    . PHE D  1 46  ? 62.509 37.817  -13.422 1.00 33.67  ? 364 PHE A CZ    1 
ATOM   1888 N  N     . SER D  1 47  ? 61.246 42.355  -8.116  1.00 41.34  ? 365 SER A N     1 
ATOM   1889 C  CA    . SER D  1 47  ? 60.887 43.103  -6.917  1.00 43.08  ? 365 SER A CA    1 
ATOM   1890 C  C     . SER D  1 47  ? 60.354 42.202  -5.812  1.00 43.59  ? 365 SER A C     1 
ATOM   1891 O  O     . SER D  1 47  ? 60.536 42.510  -4.629  1.00 45.29  ? 365 SER A O     1 
ATOM   1892 C  CB    . SER D  1 47  ? 59.849 44.174  -7.259  1.00 43.62  ? 365 SER A CB    1 
ATOM   1893 O  OG    . SER D  1 47  ? 60.305 45.008  -8.310  1.00 43.82  ? 365 SER A OG    1 
ATOM   1894 N  N     . ARG D  1 48  ? 59.696 41.103  -6.166  1.00 42.46  ? 366 ARG A N     1 
ATOM   1895 C  CA    . ARG D  1 48  ? 59.104 40.199  -5.194  1.00 42.64  ? 366 ARG A CA    1 
ATOM   1896 C  C     . ARG D  1 48  ? 59.659 38.793  -5.387  1.00 42.84  ? 366 ARG A C     1 
ATOM   1897 O  O     . ARG D  1 48  ? 60.156 38.439  -6.460  1.00 42.25  ? 366 ARG A O     1 
ATOM   1898 C  CB    . ARG D  1 48  ? 57.574 40.190  -5.308  1.00 41.25  ? 366 ARG A CB    1 
ATOM   1899 C  CG    . ARG D  1 48  ? 56.966 41.554  -5.593  1.00 41.39  ? 366 ARG A CG    1 
ATOM   1900 C  CD    . ARG D  1 48  ? 55.450 41.522  -5.508  1.00 41.80  ? 366 ARG A CD    1 
ATOM   1901 N  NE    . ARG D  1 48  ? 54.880 40.351  -6.167  1.00 40.24  ? 366 ARG A NE    1 
ATOM   1902 C  CZ    . ARG D  1 48  ? 53.597 40.234  -6.495  1.00 40.45  ? 366 ARG A CZ    1 
ATOM   1903 N  NH1   . ARG D  1 48  ? 52.754 41.223  -6.235  1.00 41.99  ? 366 ARG A NH1   1 
ATOM   1904 N  NH2   . ARG D  1 48  ? 53.159 39.132  -7.088  1.00 39.49  ? 366 ARG A NH2   1 
ATOM   1905 N  N     . SER D  1 49  ? 59.572 37.990  -4.324  1.00 44.25  ? 367 SER A N     1 
ATOM   1906 C  CA    . SER D  1 49  ? 60.130 36.642  -4.365  1.00 44.50  ? 367 SER A CA    1 
ATOM   1907 C  C     . SER D  1 49  ? 59.355 35.750  -5.328  1.00 42.93  ? 367 SER A C     1 
ATOM   1908 O  O     . SER D  1 49  ? 59.951 35.002  -6.111  1.00 42.50  ? 367 SER A O     1 
ATOM   1909 C  CB    . SER D  1 49  ? 60.142 36.034  -2.961  1.00 47.29  ? 367 SER A CB    1 
ATOM   1910 O  OG    . SER D  1 49  ? 58.824 35.860  -2.470  1.00 48.51  ? 367 SER A OG    1 
ATOM   1911 N  N     . ASP D  1 50  ? 58.020 35.815  -5.280  1.00 42.48  ? 368 ASP A N     1 
ATOM   1912 C  CA    . ASP D  1 50  ? 57.204 34.960  -6.138  1.00 41.28  ? 368 ASP A CA    1 
ATOM   1913 C  C     . ASP D  1 50  ? 57.457 35.234  -7.615  1.00 38.04  ? 368 ASP A C     1 
ATOM   1914 O  O     . ASP D  1 50  ? 57.295 34.334  -8.447  1.00 37.32  ? 368 ASP A O     1 
ATOM   1915 C  CB    . ASP D  1 50  ? 55.721 35.142  -5.807  1.00 43.08  ? 368 ASP A CB    1 
ATOM   1916 C  CG    . ASP D  1 50  ? 55.254 36.573  -5.982  1.00 43.80  ? 368 ASP A CG    1 
ATOM   1917 O  OD1   . ASP D  1 50  ? 56.057 37.493  -5.729  1.00 44.17  ? 368 ASP A OD1   1 
ATOM   1918 O  OD2   . ASP D  1 50  ? 54.086 36.779  -6.372  1.00 44.24  ? 368 ASP A OD2   1 
ATOM   1919 N  N     . GLN D  1 51  ? 57.854 36.461  -7.961  1.00 36.27  ? 369 GLN A N     1 
ATOM   1920 C  CA    . GLN D  1 51  ? 58.220 36.751  -9.343  1.00 34.15  ? 369 GLN A CA    1 
ATOM   1921 C  C     . GLN D  1 51  ? 59.502 36.026  -9.734  1.00 33.18  ? 369 GLN A C     1 
ATOM   1922 O  O     . GLN D  1 51  ? 59.597 35.475  -10.837 1.00 32.46  ? 369 GLN A O     1 
ATOM   1923 C  CB    . GLN D  1 51  ? 58.373 38.258  -9.542  1.00 34.28  ? 369 GLN A CB    1 
ATOM   1924 C  CG    . GLN D  1 51  ? 57.109 39.053  -9.265  1.00 34.73  ? 369 GLN A CG    1 
ATOM   1925 C  CD    . GLN D  1 51  ? 57.322 40.547  -9.402  1.00 35.48  ? 369 GLN A CD    1 
ATOM   1926 O  OE1   . GLN D  1 51  ? 58.431 41.005  -9.677  1.00 35.83  ? 369 GLN A OE1   1 
ATOM   1927 N  NE2   . GLN D  1 51  ? 56.257 41.317  -9.208  1.00 35.99  ? 369 GLN A NE2   1 
ATOM   1928 N  N     . LEU D  1 52  ? 60.497 36.017  -8.844  1.00 33.48  ? 370 LEU A N     1 
ATOM   1929 C  CA    . LEU D  1 52  ? 61.737 35.303  -9.130  1.00 33.46  ? 370 LEU A CA    1 
ATOM   1930 C  C     . LEU D  1 52  ? 61.500 33.801  -9.226  1.00 34.36  ? 370 LEU A C     1 
ATOM   1931 O  O     . LEU D  1 52  ? 62.082 33.127  -10.084 1.00 34.72  ? 370 LEU A O     1 
ATOM   1932 C  CB    . LEU D  1 52  ? 62.779 35.613  -8.057  1.00 33.80  ? 370 LEU A CB    1 
ATOM   1933 C  CG    . LEU D  1 52  ? 64.110 34.867  -8.176  1.00 33.75  ? 370 LEU A CG    1 
ATOM   1934 C  CD1   . LEU D  1 52  ? 64.875 35.316  -9.412  1.00 32.75  ? 370 LEU A CD1   1 
ATOM   1935 C  CD2   . LEU D  1 52  ? 64.946 35.053  -6.919  1.00 35.42  ? 370 LEU A CD2   1 
ATOM   1936 N  N     . LYS D  1 53  ? 60.648 33.260  -8.351  1.00 35.00  ? 371 LYS A N     1 
ATOM   1937 C  CA    . LYS D  1 53  ? 60.322 31.838  -8.407  1.00 35.71  ? 371 LYS A CA    1 
ATOM   1938 C  C     . LYS D  1 53  ? 59.652 31.485  -9.728  1.00 33.86  ? 371 LYS A C     1 
ATOM   1939 O  O     . LYS D  1 53  ? 60.003 30.489  -10.372 1.00 33.67  ? 371 LYS A O     1 
ATOM   1940 C  CB    . LYS D  1 53  ? 59.420 31.463  -7.230  1.00 37.83  ? 371 LYS A CB    1 
ATOM   1941 C  CG    . LYS D  1 53  ? 60.030 31.740  -5.871  1.00 40.15  ? 371 LYS A CG    1 
ATOM   1942 C  CD    . LYS D  1 53  ? 61.270 30.896  -5.662  1.00 41.87  ? 371 LYS A CD    1 
ATOM   1943 C  CE    . LYS D  1 53  ? 62.163 31.493  -4.593  1.00 43.70  ? 371 LYS A CE    1 
ATOM   1944 N  NZ    . LYS D  1 53  ? 63.558 30.995  -4.723  1.00 44.94  ? 371 LYS A NZ    1 
ATOM   1945 N  N     . ARG D  1 54  ? 58.676 32.296  -10.144 1.00 32.23  ? 372 ARG A N     1 
ATOM   1946 C  CA    . ARG D  1 54  ? 57.992 32.058  -11.412 1.00 30.94  ? 372 ARG A CA    1 
ATOM   1947 C  C     . ARG D  1 54  ? 58.954 32.169  -12.588 1.00 31.19  ? 372 ARG A C     1 
ATOM   1948 O  O     . ARG D  1 54  ? 58.881 31.379  -13.537 1.00 31.65  ? 372 ARG A O     1 
ATOM   1949 C  CB    . ARG D  1 54  ? 56.836 33.047  -11.569 1.00 30.48  ? 372 ARG A CB    1 
ATOM   1950 C  CG    . ARG D  1 54  ? 55.959 32.807  -12.786 1.00 28.14  ? 372 ARG A CG    1 
ATOM   1951 C  CD    . ARG D  1 54  ? 54.931 33.916  -12.960 1.00 26.39  ? 372 ARG A CD    1 
ATOM   1952 N  NE    . ARG D  1 54  ? 55.557 35.210  -13.214 1.00 25.41  ? 372 ARG A NE    1 
ATOM   1953 C  CZ    . ARG D  1 54  ? 54.885 36.340  -13.407 1.00 24.92  ? 372 ARG A CZ    1 
ATOM   1954 N  NH1   . ARG D  1 54  ? 55.538 37.473  -13.633 1.00 24.45  ? 372 ARG A NH1   1 
ATOM   1955 N  NH2   . ARG D  1 54  ? 53.559 36.339  -13.374 1.00 25.11  ? 372 ARG A NH2   1 
ATOM   1956 N  N     . HIS D  1 55  ? 59.862 33.148  -12.543 1.00 32.00  ? 373 HIS A N     1 
ATOM   1957 C  CA    . HIS D  1 55  ? 60.833 33.322  -13.618 1.00 32.39  ? 373 HIS A CA    1 
ATOM   1958 C  C     . HIS D  1 55  ? 61.754 32.117  -13.740 1.00 31.91  ? 373 HIS A C     1 
ATOM   1959 O  O     . HIS D  1 55  ? 62.084 31.687  -14.852 1.00 32.12  ? 373 HIS A O     1 
ATOM   1960 C  CB    . HIS D  1 55  ? 61.655 34.585  -13.378 1.00 34.92  ? 373 HIS A CB    1 
ATOM   1961 C  CG    . HIS D  1 55  ? 63.026 34.536  -13.977 1.00 39.62  ? 373 HIS A CG    1 
ATOM   1962 N  ND1   . HIS D  1 55  ? 63.250 34.623  -15.334 1.00 40.30  ? 373 HIS A ND1   1 
ATOM   1963 C  CD2   . HIS D  1 55  ? 64.246 34.406  -13.403 1.00 41.53  ? 373 HIS A CD2   1 
ATOM   1964 C  CE1   . HIS D  1 55  ? 64.547 34.549  -15.570 1.00 41.35  ? 373 HIS A CE1   1 
ATOM   1965 N  NE2   . HIS D  1 55  ? 65.174 34.417  -14.415 1.00 41.22  ? 373 HIS A NE2   1 
ATOM   1966 N  N     . GLN D  1 56  ? 62.187 31.562  -12.608 1.00 31.55  ? 374 GLN A N     1 
ATOM   1967 C  CA    . GLN D  1 56  ? 63.136 30.457  -12.625 1.00 31.86  ? 374 GLN A CA    1 
ATOM   1968 C  C     . GLN D  1 56  ? 62.567 29.193  -13.254 1.00 31.90  ? 374 GLN A C     1 
ATOM   1969 O  O     . GLN D  1 56  ? 63.336 28.267  -13.537 1.00 33.27  ? 374 GLN A O     1 
ATOM   1970 C  CB    . GLN D  1 56  ? 63.627 30.176  -11.206 1.00 32.92  ? 374 GLN A CB    1 
ATOM   1971 C  CG    . GLN D  1 56  ? 64.600 31.227  -10.692 1.00 33.81  ? 374 GLN A CG    1 
ATOM   1972 C  CD    . GLN D  1 56  ? 64.899 31.079  -9.216  1.00 35.97  ? 374 GLN A CD    1 
ATOM   1973 O  OE1   . GLN D  1 56  ? 64.119 30.488  -8.469  1.00 37.39  ? 374 GLN A OE1   1 
ATOM   1974 N  NE2   . GLN D  1 56  ? 66.034 31.617  -8.786  1.00 36.63  ? 374 GLN A NE2   1 
ATOM   1975 N  N     . ARG D  1 57  ? 61.254 29.130  -13.490 1.00 30.88  ? 375 ARG A N     1 
ATOM   1976 C  CA    . ARG D  1 57  ? 60.698 28.020  -14.253 1.00 31.39  ? 375 ARG A CA    1 
ATOM   1977 C  C     . ARG D  1 57  ? 61.198 28.015  -15.692 1.00 31.01  ? 375 ARG A C     1 
ATOM   1978 O  O     . ARG D  1 57  ? 61.077 26.993  -16.376 1.00 31.60  ? 375 ARG A O     1 
ATOM   1979 C  CB    . ARG D  1 57  ? 59.167 28.068  -14.227 1.00 31.40  ? 375 ARG A CB    1 
ATOM   1980 C  CG    . ARG D  1 57  ? 58.561 28.113  -12.830 1.00 32.33  ? 375 ARG A CG    1 
ATOM   1981 C  CD    . ARG D  1 57  ? 57.103 27.682  -12.847 1.00 33.32  ? 375 ARG A CD    1 
ATOM   1982 N  NE    . ARG D  1 57  ? 56.476 27.794  -11.532 1.00 35.01  ? 375 ARG A NE    1 
ATOM   1983 C  CZ    . ARG D  1 57  ? 55.529 28.677  -11.232 1.00 35.28  ? 375 ARG A CZ    1 
ATOM   1984 N  NH1   . ARG D  1 57  ? 55.096 29.518  -12.158 1.00 34.11  ? 375 ARG A NH1   1 
ATOM   1985 N  NH2   . ARG D  1 57  ? 55.008 28.714  -10.012 1.00 36.68  ? 375 ARG A NH2   1 
ATOM   1986 N  N     . ARG D  1 58  ? 61.755 29.133  -16.166 1.00 30.41  ? 376 ARG A N     1 
ATOM   1987 C  CA    . ARG D  1 58  ? 62.350 29.163  -17.497 1.00 31.27  ? 376 ARG A CA    1 
ATOM   1988 C  C     . ARG D  1 58  ? 63.644 28.361  -17.553 1.00 33.63  ? 376 ARG A C     1 
ATOM   1989 O  O     . ARG D  1 58  ? 63.952 27.756  -18.585 1.00 34.57  ? 376 ARG A O     1 
ATOM   1990 C  CB    . ARG D  1 58  ? 62.615 30.607  -17.925 1.00 30.44  ? 376 ARG A CB    1 
ATOM   1991 C  CG    . ARG D  1 58  ? 61.383 31.492  -17.959 1.00 29.53  ? 376 ARG A CG    1 
ATOM   1992 C  CD    . ARG D  1 58  ? 61.777 32.950  -18.120 1.00 29.54  ? 376 ARG A CD    1 
ATOM   1993 N  NE    . ARG D  1 58  ? 62.541 33.177  -19.343 1.00 30.46  ? 376 ARG A NE    1 
ATOM   1994 C  CZ    . ARG D  1 58  ? 63.098 34.338  -19.669 1.00 30.25  ? 376 ARG A CZ    1 
ATOM   1995 N  NH1   . ARG D  1 58  ? 62.980 35.382  -18.859 1.00 29.50  ? 376 ARG A NH1   1 
ATOM   1996 N  NH2   . ARG D  1 58  ? 63.775 34.454  -20.802 1.00 30.80  ? 376 ARG A NH2   1 
ATOM   1997 N  N     . HIS D  1 59  ? 64.412 28.346  -16.461 1.00 34.75  ? 377 HIS A N     1 
ATOM   1998 C  CA    . HIS D  1 59  ? 65.661 27.594  -16.441 1.00 37.11  ? 377 HIS A CA    1 
ATOM   1999 C  C     . HIS D  1 59  ? 65.415 26.110  -16.199 1.00 37.17  ? 377 HIS A C     1 
ATOM   2000 O  O     . HIS D  1 59  ? 66.084 25.261  -16.798 1.00 39.11  ? 377 HIS A O     1 
ATOM   2001 C  CB    . HIS D  1 59  ? 66.599 28.153  -15.369 1.00 40.15  ? 377 HIS A CB    1 
ATOM   2002 C  CG    . HIS D  1 59  ? 66.833 29.628  -15.476 1.00 43.83  ? 377 HIS A CG    1 
ATOM   2003 N  ND1   . HIS D  1 59  ? 67.804 30.170  -16.289 1.00 45.44  ? 377 HIS A ND1   1 
ATOM   2004 C  CD2   . HIS D  1 59  ? 66.224 30.673  -14.867 1.00 43.62  ? 377 HIS A CD2   1 
ATOM   2005 C  CE1   . HIS D  1 59  ? 67.782 31.487  -16.179 1.00 44.73  ? 377 HIS A CE1   1 
ATOM   2006 N  NE2   . HIS D  1 59  ? 66.833 31.818  -15.323 1.00 43.00  ? 377 HIS A NE2   1 
ATOM   2007 N  N     . THR D  1 60  ? 64.460 25.781  -15.328 1.00 35.77  ? 378 THR A N     1 
ATOM   2008 C  CA    . THR D  1 60  ? 64.195 24.384  -15.002 1.00 37.03  ? 378 THR A CA    1 
ATOM   2009 C  C     . THR D  1 60  ? 63.301 23.724  -16.043 1.00 37.30  ? 378 THR A C     1 
ATOM   2010 O  O     . THR D  1 60  ? 63.532 22.569  -16.420 1.00 39.43  ? 378 THR A O     1 
ATOM   2011 C  CB    . THR D  1 60  ? 63.558 24.281  -13.616 1.00 36.91  ? 378 THR A CB    1 
ATOM   2012 O  OG1   . THR D  1 60  ? 62.305 24.977  -13.614 1.00 35.36  ? 378 THR A OG1   1 
ATOM   2013 C  CG2   . THR D  1 60  ? 64.471 24.896  -12.566 1.00 36.96  ? 378 THR A CG2   1 
ATOM   2014 N  N     . GLY D  1 61  ? 62.283 24.435  -16.517 1.00 35.41  ? 379 GLY A N     1 
ATOM   2015 C  CA    . GLY D  1 61  ? 61.360 23.891  -17.489 1.00 35.49  ? 379 GLY A CA    1 
ATOM   2016 C  C     . GLY D  1 61  ? 60.175 23.153  -16.910 1.00 35.86  ? 379 GLY A C     1 
ATOM   2017 O  O     . GLY D  1 61  ? 59.501 22.427  -17.649 1.00 36.54  ? 379 GLY A O     1 
ATOM   2018 N  N     . VAL D  1 62  ? 59.898 23.311  -15.615 1.00 35.63  ? 380 VAL A N     1 
ATOM   2019 C  CA    . VAL D  1 62  ? 58.776 22.609  -15.006 1.00 36.41  ? 380 VAL A CA    1 
ATOM   2020 C  C     . VAL D  1 62  ? 57.465 23.150  -15.563 1.00 35.26  ? 380 VAL A C     1 
ATOM   2021 O  O     . VAL D  1 62  ? 57.364 24.314  -15.976 1.00 33.33  ? 380 VAL A O     1 
ATOM   2022 C  CB    . VAL D  1 62  ? 58.819 22.728  -13.471 1.00 36.83  ? 380 VAL A CB    1 
ATOM   2023 C  CG1   . VAL D  1 62  ? 60.139 22.203  -12.933 1.00 38.27  ? 380 VAL A CG1   1 
ATOM   2024 C  CG2   . VAL D  1 62  ? 58.593 24.171  -13.038 1.00 35.02  ? 380 VAL A CG2   1 
ATOM   2025 N  N     . LYS D  1 63  ? 56.449 22.289  -15.585 1.00 36.46  ? 381 LYS A N     1 
ATOM   2026 C  CA    . LYS D  1 63  ? 55.111 22.637  -16.061 1.00 35.38  ? 381 LYS A CA    1 
ATOM   2027 C  C     . LYS D  1 63  ? 54.108 22.129  -15.034 1.00 36.27  ? 381 LYS A C     1 
ATOM   2028 O  O     . LYS D  1 63  ? 53.494 21.069  -15.217 1.00 37.40  ? 381 LYS A O     1 
ATOM   2029 C  CB    . LYS D  1 63  ? 54.838 22.040  -17.442 1.00 36.17  ? 381 LYS A CB    1 
ATOM   2030 C  CG    . LYS D  1 63  ? 55.929 22.270  -18.476 1.00 35.51  ? 381 LYS A CG    1 
ATOM   2031 C  CD    . LYS D  1 63  ? 55.917 23.692  -19.008 1.00 33.07  ? 381 LYS A CD    1 
ATOM   2032 C  CE    . LYS D  1 63  ? 56.904 23.850  -20.153 1.00 32.71  ? 381 LYS A CE    1 
ATOM   2033 N  NZ    . LYS D  1 63  ? 56.569 22.954  -21.294 1.00 33.75  ? 381 LYS A NZ    1 
ATOM   2034 N  N     . PRO D  1 64  ? 53.922 22.858  -13.933 1.00 36.48  ? 382 PRO A N     1 
ATOM   2035 C  CA    . PRO D  1 64  ? 53.070 22.347  -12.846 1.00 38.56  ? 382 PRO A CA    1 
ATOM   2036 C  C     . PRO D  1 64  ? 51.614 22.157  -13.232 1.00 39.86  ? 382 PRO A C     1 
ATOM   2037 O  O     . PRO D  1 64  ? 50.921 21.354  -12.593 1.00 41.98  ? 382 PRO A O     1 
ATOM   2038 C  CB    . PRO D  1 64  ? 53.215 23.417  -11.754 1.00 37.69  ? 382 PRO A CB    1 
ATOM   2039 C  CG    . PRO D  1 64  ? 54.479 24.151  -12.093 1.00 35.93  ? 382 PRO A CG    1 
ATOM   2040 C  CD    . PRO D  1 64  ? 54.553 24.142  -13.586 1.00 34.87  ? 382 PRO A CD    1 
ATOM   2041 N  N     . PHE D  1 65  ? 51.126 22.858  -14.249 1.00 38.88  ? 383 PHE A N     1 
ATOM   2042 C  CA    . PHE D  1 65  ? 49.707 22.896  -14.573 1.00 39.94  ? 383 PHE A CA    1 
ATOM   2043 C  C     . PHE D  1 65  ? 49.463 22.192  -15.900 1.00 41.13  ? 383 PHE A C     1 
ATOM   2044 O  O     . PHE D  1 65  ? 50.158 22.459  -16.886 1.00 40.18  ? 383 PHE A O     1 
ATOM   2045 C  CB    . PHE D  1 65  ? 49.214 24.343  -14.624 1.00 37.97  ? 383 PHE A CB    1 
ATOM   2046 C  CG    . PHE D  1 65  ? 49.725 25.188  -13.490 1.00 37.11  ? 383 PHE A CG    1 
ATOM   2047 C  CD1   . PHE D  1 65  ? 50.866 25.959  -13.642 1.00 35.40  ? 383 PHE A CD1   1 
ATOM   2048 C  CD2   . PHE D  1 65  ? 49.077 25.193  -12.266 1.00 38.33  ? 383 PHE A CD2   1 
ATOM   2049 C  CE1   . PHE D  1 65  ? 51.343 26.729  -12.598 1.00 35.16  ? 383 PHE A CE1   1 
ATOM   2050 C  CE2   . PHE D  1 65  ? 49.550 25.961  -11.218 1.00 38.14  ? 383 PHE A CE2   1 
ATOM   2051 C  CZ    . PHE D  1 65  ? 50.684 26.731  -11.385 1.00 36.55  ? 383 PHE A CZ    1 
ATOM   2052 N  N     . GLN D  1 66  ? 48.476 21.297  -15.921 1.00 43.46  ? 384 GLN A N     1 
ATOM   2053 C  CA    . GLN D  1 66  ? 48.192 20.463  -17.079 1.00 45.08  ? 384 GLN A CA    1 
ATOM   2054 C  C     . GLN D  1 66  ? 46.730 20.604  -17.476 1.00 46.93  ? 384 GLN A C     1 
ATOM   2055 O  O     . GLN D  1 66  ? 45.847 20.675  -16.616 1.00 48.11  ? 384 GLN A O     1 
ATOM   2056 C  CB    . GLN D  1 66  ? 48.518 18.992  -16.789 1.00 47.10  ? 384 GLN A CB    1 
ATOM   2057 C  CG    . GLN D  1 66  ? 48.322 18.061  -17.972 1.00 47.94  ? 384 GLN A CG    1 
ATOM   2058 C  CD    . GLN D  1 66  ? 48.679 16.626  -17.645 1.00 50.04  ? 384 GLN A CD    1 
ATOM   2059 O  OE1   . GLN D  1 66  ? 48.906 16.279  -16.486 1.00 50.74  ? 384 GLN A OE1   1 
ATOM   2060 N  NE2   . GLN D  1 66  ? 48.733 15.782  -18.668 1.00 51.42  ? 384 GLN A NE2   1 
ATOM   2061 N  N     . CYS D  1 67  ? 46.482 20.639  -18.783 1.00 47.41  ? 385 CYS A N     1 
ATOM   2062 C  CA    . CYS D  1 67  ? 45.126 20.751  -19.302 1.00 48.56  ? 385 CYS A CA    1 
ATOM   2063 C  C     . CYS D  1 67  ? 44.390 19.425  -19.169 1.00 51.89  ? 385 CYS A C     1 
ATOM   2064 O  O     . CYS D  1 67  ? 44.967 18.353  -19.373 1.00 53.58  ? 385 CYS A O     1 
ATOM   2065 C  CB    . CYS D  1 67  ? 45.152 21.192  -20.766 1.00 47.43  ? 385 CYS A CB    1 
ATOM   2066 S  SG    . CYS D  1 67  ? 43.525 21.353  -21.533 1.00 48.63  ? 385 CYS A SG    1 
ATOM   2067 N  N     . LYS D  1 68  ? 43.105 19.504  -18.824 1.00 53.52  ? 386 LYS A N     1 
ATOM   2068 C  CA    . LYS D  1 68  ? 42.272 18.319  -18.657 1.00 57.58  ? 386 LYS A CA    1 
ATOM   2069 C  C     . LYS D  1 68  ? 41.720 17.784  -19.972 1.00 59.68  ? 386 LYS A C     1 
ATOM   2070 O  O     . LYS D  1 68  ? 41.047 16.748  -19.964 1.00 63.16  ? 386 LYS A O     1 
ATOM   2071 C  CB    . LYS D  1 68  ? 41.107 18.624  -17.709 1.00 59.44  ? 386 LYS A CB    1 
ATOM   2072 C  CG    . LYS D  1 68  ? 41.199 17.957  -16.344 1.00 61.72  ? 386 LYS A CG    1 
ATOM   2073 C  CD    . LYS D  1 68  ? 42.357 18.502  -15.523 1.00 59.38  ? 386 LYS A CD    1 
ATOM   2074 C  CE    . LYS D  1 68  ? 42.265 18.041  -14.076 1.00 61.71  ? 386 LYS A CE    1 
ATOM   2075 N  NZ    . LYS D  1 68  ? 41.047 18.578  -13.408 1.00 63.25  ? 386 LYS A NZ    1 
ATOM   2076 N  N     . THR D  1 69  ? 41.982 18.454  -21.094 1.00 58.44  ? 387 THR A N     1 
ATOM   2077 C  CA    . THR D  1 69  ? 41.419 18.065  -22.381 1.00 61.15  ? 387 THR A CA    1 
ATOM   2078 C  C     . THR D  1 69  ? 42.472 17.521  -23.338 1.00 61.44  ? 387 THR A C     1 
ATOM   2079 O  O     . THR D  1 69  ? 42.341 16.393  -23.822 1.00 64.14  ? 387 THR A O     1 
ATOM   2080 C  CB    . THR D  1 69  ? 40.690 19.258  -23.016 1.00 60.75  ? 387 THR A CB    1 
ATOM   2081 O  OG1   . THR D  1 69  ? 39.605 19.665  -22.172 1.00 61.94  ? 387 THR A OG1   1 
ATOM   2082 C  CG2   . THR D  1 69  ? 40.147 18.878  -24.384 1.00 62.72  ? 387 THR A CG2   1 
ATOM   2083 N  N     . CYS D  1 70  ? 43.519 18.291  -23.629 1.00 58.68  ? 388 CYS A N     1 
ATOM   2084 C  CA    . CYS D  1 70  ? 44.568 17.862  -24.544 1.00 58.46  ? 388 CYS A CA    1 
ATOM   2085 C  C     . CYS D  1 70  ? 45.824 17.392  -23.824 1.00 57.87  ? 388 CYS A C     1 
ATOM   2086 O  O     . CYS D  1 70  ? 46.822 17.083  -24.484 1.00 57.83  ? 388 CYS A O     1 
ATOM   2087 C  CB    . CYS D  1 70  ? 44.916 18.994  -25.519 1.00 55.91  ? 388 CYS A CB    1 
ATOM   2088 S  SG    . CYS D  1 70  ? 45.607 20.474  -24.745 1.00 51.81  ? 388 CYS A SG    1 
ATOM   2089 N  N     . GLN D  1 71  ? 45.798 17.343  -22.490 1.00 57.30  ? 389 GLN A N     1 
ATOM   2090 C  CA    . GLN D  1 71  ? 46.892 16.849  -21.652 1.00 56.86  ? 389 GLN A CA    1 
ATOM   2091 C  C     . GLN D  1 71  ? 48.171 17.668  -21.805 1.00 53.52  ? 389 GLN A C     1 
ATOM   2092 O  O     . GLN D  1 71  ? 49.248 17.220  -21.400 1.00 53.87  ? 389 GLN A O     1 
ATOM   2093 C  CB    . GLN D  1 71  ? 47.178 15.366  -21.925 1.00 60.51  ? 389 GLN A CB    1 
ATOM   2094 C  CG    . GLN D  1 71  ? 45.926 14.508  -22.036 1.00 64.22  ? 389 GLN A CG    1 
ATOM   2095 C  CD    . GLN D  1 71  ? 44.997 14.666  -20.847 1.00 64.92  ? 389 GLN A CD    1 
ATOM   2096 O  OE1   . GLN D  1 71  ? 45.439 14.697  -19.697 1.00 64.50  ? 389 GLN A OE1   1 
ATOM   2097 N  NE2   . GLN D  1 71  ? 43.701 14.770  -21.119 1.00 66.03  ? 389 GLN A NE2   1 
ATOM   2098 N  N     . ARG D  1 72  ? 48.077 18.864  -22.378 1.00 51.12  ? 390 ARG A N     1 
ATOM   2099 C  CA    . ARG D  1 72  ? 49.238 19.732  -22.510 1.00 48.78  ? 390 ARG A CA    1 
ATOM   2100 C  C     . ARG D  1 72  ? 49.539 20.409  -21.180 1.00 47.29  ? 390 ARG A C     1 
ATOM   2101 O  O     . ARG D  1 72  ? 48.629 20.772  -20.430 1.00 47.19  ? 390 ARG A O     1 
ATOM   2102 C  CB    . ARG D  1 72  ? 49.006 20.781  -23.598 1.00 47.08  ? 390 ARG A CB    1 
ATOM   2103 C  CG    . ARG D  1 72  ? 50.226 21.634  -23.900 1.00 44.97  ? 390 ARG A CG    1 
ATOM   2104 C  CD    . ARG D  1 72  ? 50.009 22.522  -25.112 1.00 44.17  ? 390 ARG A CD    1 
ATOM   2105 N  NE    . ARG D  1 72  ? 51.227 23.242  -25.478 1.00 43.18  ? 390 ARG A NE    1 
ATOM   2106 C  CZ    . ARG D  1 72  ? 51.351 23.999  -26.563 1.00 42.62  ? 390 ARG A CZ    1 
ATOM   2107 N  NH1   . ARG D  1 72  ? 50.329 24.138  -27.397 1.00 43.10  ? 390 ARG A NH1   1 
ATOM   2108 N  NH2   . ARG D  1 72  ? 52.497 24.616  -26.816 1.00 41.74  ? 390 ARG A NH2   1 
ATOM   2109 N  N     . LYS D  1 73  ? 50.825 20.573  -20.889 1.00 46.08  ? 391 LYS A N     1 
ATOM   2110 C  CA    . LYS D  1 73  ? 51.278 21.136  -19.628 1.00 44.80  ? 391 LYS A CA    1 
ATOM   2111 C  C     . LYS D  1 73  ? 51.839 22.535  -19.852 1.00 43.11  ? 391 LYS A C     1 
ATOM   2112 O  O     . LYS D  1 73  ? 52.406 22.832  -20.907 1.00 43.07  ? 391 LYS A O     1 
ATOM   2113 C  CB    . LYS D  1 73  ? 52.332 20.233  -18.981 1.00 45.41  ? 391 LYS A CB    1 
ATOM   2114 C  CG    . LYS D  1 73  ? 51.916 18.776  -18.868 1.00 48.19  ? 391 LYS A CG    1 
ATOM   2115 C  CD    . LYS D  1 73  ? 52.943 17.962  -18.098 1.00 49.47  ? 391 LYS A CD    1 
ATOM   2116 C  CE    . LYS D  1 73  ? 52.898 18.285  -16.615 1.00 49.02  ? 391 LYS A CE    1 
ATOM   2117 N  NZ    . LYS D  1 73  ? 53.925 17.526  -15.850 1.00 50.67  ? 391 LYS A NZ    1 
ATOM   2118 N  N     . PHE D  1 74  ? 51.669 23.395  -18.850 1.00 42.35  ? 392 PHE A N     1 
ATOM   2119 C  CA    . PHE D  1 74  ? 52.057 24.795  -18.946 1.00 40.73  ? 392 PHE A CA    1 
ATOM   2120 C  C     . PHE D  1 74  ? 52.796 25.220  -17.685 1.00 40.09  ? 392 PHE A C     1 
ATOM   2121 O  O     . PHE D  1 74  ? 52.667 24.606  -16.623 1.00 41.59  ? 392 PHE A O     1 
ATOM   2122 C  CB    . PHE D  1 74  ? 50.838 25.700  -19.168 1.00 40.43  ? 392 PHE A CB    1 
ATOM   2123 C  CG    . PHE D  1 74  ? 50.017 25.320  -20.362 1.00 41.79  ? 392 PHE A CG    1 
ATOM   2124 C  CD1   . PHE D  1 74  ? 48.958 24.437  -20.237 1.00 43.75  ? 392 PHE A CD1   1 
ATOM   2125 C  CD2   . PHE D  1 74  ? 50.312 25.835  -21.613 1.00 41.51  ? 392 PHE A CD2   1 
ATOM   2126 C  CE1   . PHE D  1 74  ? 48.204 24.080  -21.335 1.00 44.79  ? 392 PHE A CE1   1 
ATOM   2127 C  CE2   . PHE D  1 74  ? 49.560 25.481  -22.715 1.00 42.52  ? 392 PHE A CE2   1 
ATOM   2128 C  CZ    . PHE D  1 74  ? 48.507 24.601  -22.576 1.00 44.12  ? 392 PHE A CZ    1 
ATOM   2129 N  N     . SER D  1 75  ? 53.568 26.301  -17.816 1.00 37.60  ? 393 SER A N     1 
ATOM   2130 C  CA    . SER D  1 75  ? 54.416 26.755  -16.719 1.00 36.03  ? 393 SER A CA    1 
ATOM   2131 C  C     . SER D  1 75  ? 53.651 27.573  -15.685 1.00 34.70  ? 393 SER A C     1 
ATOM   2132 O  O     . SER D  1 75  ? 53.994 27.533  -14.499 1.00 35.26  ? 393 SER A O     1 
ATOM   2133 C  CB    . SER D  1 75  ? 55.583 27.578  -17.266 1.00 34.94  ? 393 SER A CB    1 
ATOM   2134 O  OG    . SER D  1 75  ? 55.117 28.705  -17.988 1.00 33.78  ? 393 SER A OG    1 
ATOM   2135 N  N     . ARG D  1 76  ? 52.629 28.317  -16.102 1.00 33.21  ? 394 ARG A N     1 
ATOM   2136 C  CA    . ARG D  1 76  ? 51.893 29.197  -15.206 1.00 32.45  ? 394 ARG A CA    1 
ATOM   2137 C  C     . ARG D  1 76  ? 50.405 28.882  -15.282 1.00 33.67  ? 394 ARG A C     1 
ATOM   2138 O  O     . ARG D  1 76  ? 49.894 28.469  -16.326 1.00 34.35  ? 394 ARG A O     1 
ATOM   2139 C  CB    . ARG D  1 76  ? 52.146 30.674  -15.544 1.00 30.56  ? 394 ARG A CB    1 
ATOM   2140 C  CG    . ARG D  1 76  ? 53.539 30.951  -16.097 1.00 29.90  ? 394 ARG A CG    1 
ATOM   2141 C  CD    . ARG D  1 76  ? 53.848 32.438  -16.118 1.00 29.07  ? 394 ARG A CD    1 
ATOM   2142 N  NE    . ARG D  1 76  ? 52.667 33.241  -16.416 1.00 28.08  ? 394 ARG A NE    1 
ATOM   2143 C  CZ    . ARG D  1 76  ? 52.686 34.560  -16.575 1.00 27.29  ? 394 ARG A CZ    1 
ATOM   2144 N  NH1   . ARG D  1 76  ? 53.830 35.222  -16.474 1.00 28.21  ? 394 ARG A NH1   1 
ATOM   2145 N  NH2   . ARG D  1 76  ? 51.564 35.216  -16.838 1.00 27.78  ? 394 ARG A NH2   1 
ATOM   2146 N  N     . SER D  1 77  ? 49.712 29.084  -14.157 1.00 34.25  ? 395 SER A N     1 
ATOM   2147 C  CA    . SER D  1 77  ? 48.305 28.699  -14.071 1.00 35.42  ? 395 SER A CA    1 
ATOM   2148 C  C     . SER D  1 77  ? 47.425 29.592  -14.937 1.00 35.30  ? 395 SER A C     1 
ATOM   2149 O  O     . SER D  1 77  ? 46.489 29.108  -15.584 1.00 36.46  ? 395 SER A O     1 
ATOM   2150 C  CB    . SER D  1 77  ? 47.835 28.741  -12.617 1.00 36.66  ? 395 SER A CB    1 
ATOM   2151 O  OG    . SER D  1 77  ? 47.759 30.074  -12.142 1.00 35.94  ? 395 SER A OG    1 
ATOM   2152 N  N     . ASP D  1 78  ? 47.704 30.898  -14.957 1.00 34.37  ? 396 ASP A N     1 
ATOM   2153 C  CA    . ASP D  1 78  ? 46.879 31.815  -15.735 1.00 34.46  ? 396 ASP A CA    1 
ATOM   2154 C  C     . ASP D  1 78  ? 46.974 31.530  -17.229 1.00 34.15  ? 396 ASP A C     1 
ATOM   2155 O  O     . ASP D  1 78  ? 46.008 31.762  -17.965 1.00 34.47  ? 396 ASP A O     1 
ATOM   2156 C  CB    . ASP D  1 78  ? 47.278 33.261  -15.436 1.00 34.11  ? 396 ASP A CB    1 
ATOM   2157 C  CG    . ASP D  1 78  ? 48.752 33.521  -15.673 1.00 33.59  ? 396 ASP A CG    1 
ATOM   2158 O  OD1   . ASP D  1 78  ? 49.540 32.554  -15.615 1.00 33.93  ? 396 ASP A OD1   1 
ATOM   2159 O  OD2   . ASP D  1 78  ? 49.123 34.689  -15.912 1.00 33.18  ? 396 ASP A OD2   1 
ATOM   2160 N  N     . HIS D  1 79  ? 48.118 31.024  -17.695 1.00 34.03  ? 397 HIS A N     1 
ATOM   2161 C  CA    . HIS D  1 79  ? 48.240 30.664  -19.104 1.00 34.11  ? 397 HIS A CA    1 
ATOM   2162 C  C     . HIS D  1 79  ? 47.477 29.385  -19.425 1.00 35.51  ? 397 HIS A C     1 
ATOM   2163 O  O     . HIS D  1 79  ? 47.011 29.210  -20.556 1.00 36.27  ? 397 HIS A O     1 
ATOM   2164 C  CB    . HIS D  1 79  ? 49.714 30.524  -19.485 1.00 33.01  ? 397 HIS A CB    1 
ATOM   2165 C  CG    . HIS D  1 79  ? 50.444 31.830  -19.550 1.00 31.98  ? 397 HIS A CG    1 
ATOM   2166 N  ND1   . HIS D  1 79  ? 49.792 33.043  -19.609 1.00 31.74  ? 397 HIS A ND1   1 
ATOM   2167 C  CD2   . HIS D  1 79  ? 51.768 32.113  -19.563 1.00 31.40  ? 397 HIS A CD2   1 
ATOM   2168 C  CE1   . HIS D  1 79  ? 50.683 34.017  -19.658 1.00 31.04  ? 397 HIS A CE1   1 
ATOM   2169 N  NE2   . HIS D  1 79  ? 51.889 33.480  -19.631 1.00 30.75  ? 397 HIS A NE2   1 
ATOM   2170 N  N     . LEU D  1 80  ? 47.338 28.484  -18.450 1.00 36.65  ? 398 LEU A N     1 
ATOM   2171 C  CA    . LEU D  1 80  ? 46.504 27.303  -18.647 1.00 38.91  ? 398 LEU A CA    1 
ATOM   2172 C  C     . LEU D  1 80  ? 45.031 27.681  -18.720 1.00 39.80  ? 398 LEU A C     1 
ATOM   2173 O  O     . LEU D  1 80  ? 44.308 27.233  -19.618 1.00 41.37  ? 398 LEU A O     1 
ATOM   2174 C  CB    . LEU D  1 80  ? 46.742 26.297  -17.521 1.00 39.09  ? 398 LEU A CB    1 
ATOM   2175 C  CG    . LEU D  1 80  ? 45.702 25.180  -17.406 1.00 39.23  ? 398 LEU A CG    1 
ATOM   2176 C  CD1   . LEU D  1 80  ? 45.742 24.277  -18.628 1.00 39.26  ? 398 LEU A CD1   1 
ATOM   2177 C  CD2   . LEU D  1 80  ? 45.900 24.376  -16.130 1.00 38.61  ? 398 LEU A CD2   1 
ATOM   2178 N  N     . LYS D  1 81  ? 44.569 28.496  -17.766 1.00 40.48  ? 399 LYS A N     1 
ATOM   2179 C  CA    . LYS D  1 81  ? 43.191 28.979  -17.776 1.00 42.91  ? 399 LYS A CA    1 
ATOM   2180 C  C     . LYS D  1 81  ? 42.847 29.622  -19.109 1.00 42.13  ? 399 LYS A C     1 
ATOM   2181 O  O     . LYS D  1 81  ? 41.718 29.503  -19.600 1.00 43.27  ? 399 LYS A O     1 
ATOM   2182 C  CB    . LYS D  1 81  ? 42.990 29.978  -16.635 1.00 43.44  ? 399 LYS A CB    1 
ATOM   2183 C  CG    . LYS D  1 81  ? 41.597 30.573  -16.539 1.00 45.25  ? 399 LYS A CG    1 
ATOM   2184 C  CD    . LYS D  1 81  ? 41.508 31.551  -15.376 1.00 45.94  ? 399 LYS A CD    1 
ATOM   2185 C  CE    . LYS D  1 81  ? 40.109 32.129  -15.242 1.00 48.18  ? 399 LYS A CE    1 
ATOM   2186 N  NZ    . LYS D  1 81  ? 40.011 33.055  -14.082 1.00 49.42  ? 399 LYS A NZ    1 
ATOM   2187 N  N     . THR D  1 82  ? 43.817 30.310  -19.707 1.00 40.58  ? 400 THR A N     1 
ATOM   2188 C  CA    . THR D  1 82  ? 43.621 30.881  -21.031 1.00 40.34  ? 400 THR A CA    1 
ATOM   2189 C  C     . THR D  1 82  ? 43.536 29.798  -22.097 1.00 42.86  ? 400 THR A C     1 
ATOM   2190 O  O     . THR D  1 82  ? 42.674 29.859  -22.982 1.00 43.37  ? 400 THR A O     1 
ATOM   2191 C  CB    . THR D  1 82  ? 44.761 31.843  -21.347 1.00 37.04  ? 400 THR A CB    1 
ATOM   2192 O  OG1   . THR D  1 82  ? 44.610 33.037  -20.571 1.00 36.08  ? 400 THR A OG1   1 
ATOM   2193 C  CG2   . THR D  1 82  ? 44.759 32.185  -22.811 1.00 36.57  ? 400 THR A CG2   1 
ATOM   2194 N  N     . HIS D  1 83  ? 44.430 28.806  -22.034 1.00 44.71  ? 401 HIS A N     1 
ATOM   2195 C  CA    . HIS D  1 83  ? 44.465 27.757  -23.050 1.00 47.29  ? 401 HIS A CA    1 
ATOM   2196 C  C     . HIS D  1 83  ? 43.155 26.983  -23.102 1.00 48.78  ? 401 HIS A C     1 
ATOM   2197 O  O     . HIS D  1 83  ? 42.714 26.569  -24.181 1.00 50.46  ? 401 HIS A O     1 
ATOM   2198 C  CB    . HIS D  1 83  ? 45.632 26.808  -22.779 1.00 50.00  ? 401 HIS A CB    1 
ATOM   2199 C  CG    . HIS D  1 83  ? 45.509 25.486  -23.472 1.00 57.21  ? 401 HIS A CG    1 
ATOM   2200 N  ND1   . HIS D  1 83  ? 45.814 25.311  -24.804 1.00 58.72  ? 401 HIS A ND1   1 
ATOM   2201 C  CD2   . HIS D  1 83  ? 45.114 24.274  -23.014 1.00 60.12  ? 401 HIS A CD2   1 
ATOM   2202 C  CE1   . HIS D  1 83  ? 45.612 24.049  -25.138 1.00 60.88  ? 401 HIS A CE1   1 
ATOM   2203 N  NE2   . HIS D  1 83  ? 45.187 23.399  -24.070 1.00 61.18  ? 401 HIS A NE2   1 
ATOM   2204 N  N     . THR D  1 84  ? 42.520 26.773  -21.946 1.00 48.80  ? 402 THR A N     1 
ATOM   2205 C  CA    . THR D  1 84  ? 41.262 26.035  -21.907 1.00 50.53  ? 402 THR A CA    1 
ATOM   2206 C  C     . THR D  1 84  ? 40.171 26.701  -22.736 1.00 51.80  ? 402 THR A C     1 
ATOM   2207 O  O     . THR D  1 84  ? 39.217 26.026  -23.138 1.00 54.43  ? 402 THR A O     1 
ATOM   2208 C  CB    . THR D  1 84  ? 40.783 25.874  -20.462 1.00 50.81  ? 402 THR A CB    1 
ATOM   2209 O  OG1   . THR D  1 84  ? 40.668 27.163  -19.848 1.00 49.71  ? 402 THR A OG1   1 
ATOM   2210 C  CG2   . THR D  1 84  ? 41.762 25.022  -19.664 1.00 50.32  ? 402 THR A CG2   1 
ATOM   2211 N  N     . ARG D  1 85  ? 40.288 28.003  -23.007 1.00 50.72  ? 403 ARG A N     1 
ATOM   2212 C  CA    . ARG D  1 85  ? 39.291 28.673  -23.832 1.00 52.18  ? 403 ARG A CA    1 
ATOM   2213 C  C     . ARG D  1 85  ? 39.391 28.276  -25.299 1.00 53.04  ? 403 ARG A C     1 
ATOM   2214 O  O     . ARG D  1 85  ? 38.422 28.459  -26.042 1.00 54.54  ? 403 ARG A O     1 
ATOM   2215 C  CB    . ARG D  1 85  ? 39.416 30.191  -23.693 1.00 50.98  ? 403 ARG A CB    1 
ATOM   2216 C  CG    . ARG D  1 85  ? 39.081 30.714  -22.308 1.00 51.26  ? 403 ARG A CG    1 
ATOM   2217 C  CD    . ARG D  1 85  ? 38.659 32.173  -22.360 1.00 51.49  ? 403 ARG A CD    1 
ATOM   2218 N  NE    . ARG D  1 85  ? 38.346 32.697  -21.035 1.00 52.44  ? 403 ARG A NE    1 
ATOM   2219 C  CZ    . ARG D  1 85  ? 39.207 33.375  -20.285 1.00 51.40  ? 403 ARG A CZ    1 
ATOM   2220 N  NH1   . ARG D  1 85  ? 40.429 33.614  -20.738 1.00 49.40  ? 403 ARG A NH1   1 
ATOM   2221 N  NH2   . ARG D  1 85  ? 38.848 33.819  -19.088 1.00 52.55  ? 403 ARG A NH2   1 
ATOM   2222 N  N     . THR D  1 86  ? 40.533 27.738  -25.734 1.00 52.58  ? 404 THR A N     1 
ATOM   2223 C  CA    . THR D  1 86  ? 40.633 27.258  -27.109 1.00 54.11  ? 404 THR A CA    1 
ATOM   2224 C  C     . THR D  1 86  ? 39.786 26.012  -27.327 1.00 57.76  ? 404 THR A C     1 
ATOM   2225 O  O     . THR D  1 86  ? 39.250 25.812  -28.423 1.00 59.66  ? 404 THR A O     1 
ATOM   2226 C  CB    . THR D  1 86  ? 42.091 26.970  -27.470 1.00 52.53  ? 404 THR A CB    1 
ATOM   2227 O  OG1   . THR D  1 86  ? 42.585 25.901  -26.654 1.00 52.79  ? 404 THR A OG1   1 
ATOM   2228 C  CG2   . THR D  1 86  ? 42.947 28.207  -27.250 1.00 50.10  ? 404 THR A CG2   1 
ATOM   2229 N  N     . HIS D  1 87  ? 39.653 25.167  -26.303 1.00 59.20  ? 405 HIS A N     1 
ATOM   2230 C  CA    . HIS D  1 87  ? 38.843 23.963  -26.433 1.00 63.52  ? 405 HIS A CA    1 
ATOM   2231 C  C     . HIS D  1 87  ? 37.364 24.240  -26.202 1.00 64.26  ? 405 HIS A C     1 
ATOM   2232 O  O     . HIS D  1 87  ? 36.514 23.572  -26.801 1.00 67.10  ? 405 HIS A O     1 
ATOM   2233 C  CB    . HIS D  1 87  ? 39.330 22.889  -25.457 1.00 67.29  ? 405 HIS A CB    1 
ATOM   2234 C  CG    . HIS D  1 87  ? 40.780 22.547  -25.604 1.00 70.84  ? 405 HIS A CG    1 
ATOM   2235 N  ND1   . HIS D  1 87  ? 41.285 21.905  -26.714 1.00 72.70  ? 405 HIS A ND1   1 
ATOM   2236 C  CD2   . HIS D  1 87  ? 41.832 22.752  -24.777 1.00 69.98  ? 405 HIS A CD2   1 
ATOM   2237 C  CE1   . HIS D  1 87  ? 42.587 21.732  -26.566 1.00 71.69  ? 405 HIS A CE1   1 
ATOM   2238 N  NE2   . HIS D  1 87  ? 42.944 22.237  -25.399 1.00 68.79  ? 405 HIS A NE2   1 
ATOM   2239 N  N     . THR D  1 88  ? 37.034 25.210  -25.350 1.00 62.38  ? 406 THR A N     1 
ATOM   2240 C  CA    . THR D  1 88  ? 35.640 25.503  -25.050 1.00 64.16  ? 406 THR A CA    1 
ATOM   2241 C  C     . THR D  1 88  ? 35.017 26.500  -26.020 1.00 64.04  ? 406 THR A C     1 
ATOM   2242 O  O     . THR D  1 88  ? 33.789 26.516  -26.164 1.00 66.52  ? 406 THR A O     1 
ATOM   2243 C  CB    . THR D  1 88  ? 35.507 26.018  -23.609 1.00 63.69  ? 406 THR A CB    1 
ATOM   2244 O  OG1   . THR D  1 88  ? 34.177 25.778  -23.132 1.00 67.33  ? 406 THR A OG1   1 
ATOM   2245 C  CG2   . THR D  1 88  ? 35.804 27.509  -23.527 1.00 60.85  ? 406 THR A CG2   1 
ATOM   2246 N  N     . GLY D  1 89  ? 35.823 27.328  -26.683 1.00 61.39  ? 407 GLY A N     1 
ATOM   2247 C  CA    . GLY D  1 89  ? 35.317 28.243  -27.686 1.00 61.65  ? 407 GLY A CA    1 
ATOM   2248 C  C     . GLY D  1 89  ? 34.685 29.514  -27.163 1.00 61.04  ? 407 GLY A C     1 
ATOM   2249 O  O     . GLY D  1 89  ? 34.115 30.269  -27.958 1.00 61.94  ? 407 GLY A O     1 
ATOM   2250 N  N     . GLU D  1 90  ? 34.767 29.783  -25.863 1.00 59.85  ? 408 GLU A N     1 
ATOM   2251 C  CA    . GLU D  1 90  ? 34.128 30.962  -25.294 1.00 59.96  ? 408 GLU A CA    1 
ATOM   2252 C  C     . GLU D  1 90  ? 34.944 32.214  -25.588 1.00 57.11  ? 408 GLU A C     1 
ATOM   2253 O  O     . GLU D  1 90  ? 36.178 32.188  -25.572 1.00 54.81  ? 408 GLU A O     1 
ATOM   2254 C  CB    . GLU D  1 90  ? 33.950 30.798  -23.784 1.00 60.61  ? 408 GLU A CB    1 
ATOM   2255 N  N     . LYS D  1 91  ? 34.242 33.316  -25.855 1.00 57.30  ? 409 LYS A N     1 
ATOM   2256 C  CA    . LYS D  1 91  ? 34.860 34.608  -26.153 1.00 54.61  ? 409 LYS A CA    1 
ATOM   2257 C  C     . LYS D  1 91  ? 34.137 35.686  -25.357 1.00 55.00  ? 409 LYS A C     1 
ATOM   2258 O  O     . LYS D  1 91  ? 33.217 36.343  -25.865 1.00 57.02  ? 409 LYS A O     1 
ATOM   2259 C  CB    . LYS D  1 91  ? 34.821 34.913  -27.651 1.00 54.53  ? 409 LYS A CB    1 
ATOM   2260 C  CG    . LYS D  1 91  ? 35.600 33.937  -28.514 1.00 53.49  ? 409 LYS A CG    1 
ATOM   2261 C  CD    . LYS D  1 91  ? 35.588 34.369  -29.971 1.00 54.15  ? 409 LYS A CD    1 
ATOM   2262 C  CE    . LYS D  1 91  ? 36.438 33.447  -30.829 1.00 53.93  ? 409 LYS A CE    1 
ATOM   2263 N  NZ    . LYS D  1 91  ? 36.499 33.904  -32.245 1.00 55.02  ? 409 LYS A NZ    1 
ATOM   2264 N  N     . PRO D  1 92  ? 34.531 35.900  -24.099 1.00 53.58  ? 410 PRO A N     1 
ATOM   2265 C  CA    . PRO D  1 92  ? 33.832 36.902  -23.279 1.00 54.85  ? 410 PRO A CA    1 
ATOM   2266 C  C     . PRO D  1 92  ? 34.079 38.333  -23.724 1.00 53.76  ? 410 PRO A C     1 
ATOM   2267 O  O     . PRO D  1 92  ? 33.172 39.167  -23.613 1.00 56.07  ? 410 PRO A O     1 
ATOM   2268 C  CB    . PRO D  1 92  ? 34.387 36.647  -21.870 1.00 54.30  ? 410 PRO A CB    1 
ATOM   2269 C  CG    . PRO D  1 92  ? 35.740 36.055  -22.110 1.00 51.51  ? 410 PRO A CG    1 
ATOM   2270 C  CD    . PRO D  1 92  ? 35.606 35.220  -23.355 1.00 51.54  ? 410 PRO A CD    1 
ATOM   2271 N  N     . PHE D  1 93  ? 35.272 38.645  -24.224 1.00 50.67  ? 411 PHE A N     1 
ATOM   2272 C  CA    . PHE D  1 93  ? 35.628 40.015  -24.580 1.00 50.02  ? 411 PHE A CA    1 
ATOM   2273 C  C     . PHE D  1 93  ? 35.009 40.367  -25.928 1.00 50.71  ? 411 PHE A C     1 
ATOM   2274 O  O     . PHE D  1 93  ? 35.372 39.789  -26.958 1.00 50.52  ? 411 PHE A O     1 
ATOM   2275 C  CB    . PHE D  1 93  ? 37.145 40.176  -24.611 1.00 47.73  ? 411 PHE A CB    1 
ATOM   2276 C  CG    . PHE D  1 93  ? 37.815 39.816  -23.317 1.00 46.92  ? 411 PHE A CG    1 
ATOM   2277 C  CD1   . PHE D  1 93  ? 37.945 40.753  -22.306 1.00 47.25  ? 411 PHE A CD1   1 
ATOM   2278 C  CD2   . PHE D  1 93  ? 38.311 38.539  -23.109 1.00 46.26  ? 411 PHE A CD2   1 
ATOM   2279 C  CE1   . PHE D  1 93  ? 38.558 40.424  -21.113 1.00 46.62  ? 411 PHE A CE1   1 
ATOM   2280 C  CE2   . PHE D  1 93  ? 38.926 38.205  -21.919 1.00 45.54  ? 411 PHE A CE2   1 
ATOM   2281 C  CZ    . PHE D  1 93  ? 39.050 39.149  -20.920 1.00 45.73  ? 411 PHE A CZ    1 
ATOM   2282 N  N     . SER D  1 94  ? 34.080 41.318  -25.925 1.00 51.27  ? 412 SER A N     1 
ATOM   2283 C  CA    . SER D  1 94  ? 33.426 41.791  -27.134 1.00 51.77  ? 412 SER A CA    1 
ATOM   2284 C  C     . SER D  1 94  ? 33.897 43.202  -27.463 1.00 50.64  ? 412 SER A C     1 
ATOM   2285 O  O     . SER D  1 94  ? 34.260 43.977  -26.574 1.00 50.28  ? 412 SER A O     1 
ATOM   2286 C  CB    . SER D  1 94  ? 31.901 41.773  -26.982 1.00 54.78  ? 412 SER A CB    1 
ATOM   2287 O  OG    . SER D  1 94  ? 31.427 40.453  -26.779 1.00 55.62  ? 412 SER A OG    1 
ATOM   2288 N  N     . CYS D  1 95  ? 33.885 43.528  -28.753 1.00 50.10  ? 413 CYS A N     1 
ATOM   2289 C  CA    . CYS D  1 95  ? 34.357 44.826  -29.214 1.00 48.81  ? 413 CYS A CA    1 
ATOM   2290 C  C     . CYS D  1 95  ? 33.272 45.880  -29.030 1.00 50.49  ? 413 CYS A C     1 
ATOM   2291 O  O     . CYS D  1 95  ? 32.127 45.686  -29.450 1.00 52.67  ? 413 CYS A O     1 
ATOM   2292 C  CB    . CYS D  1 95  ? 34.779 44.747  -30.680 1.00 48.43  ? 413 CYS A CB    1 
ATOM   2293 S  SG    . CYS D  1 95  ? 35.494 46.272  -31.326 1.00 48.24  ? 413 CYS A SG    1 
ATOM   2294 N  N     . ARG D  1 96  ? 33.637 46.998  -28.405 1.00 49.86  ? 414 ARG A N     1 
ATOM   2295 C  CA    . ARG D  1 96  ? 32.709 48.087  -28.135 1.00 52.52  ? 414 ARG A CA    1 
ATOM   2296 C  C     . ARG D  1 96  ? 32.677 49.126  -29.248 1.00 53.87  ? 414 ARG A C     1 
ATOM   2297 O  O     . ARG D  1 96  ? 32.009 50.154  -29.101 1.00 56.13  ? 414 ARG A O     1 
ATOM   2298 C  CB    . ARG D  1 96  ? 33.064 48.762  -26.807 1.00 52.25  ? 414 ARG A CB    1 
ATOM   2299 N  N     . TRP D  1 97  ? 33.379 48.884  -30.349 1.00 52.84  ? 415 TRP A N     1 
ATOM   2300 C  CA    . TRP D  1 97  ? 33.358 49.824  -31.457 1.00 54.11  ? 415 TRP A CA    1 
ATOM   2301 C  C     . TRP D  1 97  ? 31.996 49.778  -32.148 1.00 57.39  ? 415 TRP A C     1 
ATOM   2302 O  O     . TRP D  1 97  ? 31.379 48.712  -32.235 1.00 57.82  ? 415 TRP A O     1 
ATOM   2303 C  CB    . TRP D  1 97  ? 34.470 49.499  -32.454 1.00 51.68  ? 415 TRP A CB    1 
ATOM   2304 C  CG    . TRP D  1 97  ? 34.855 50.649  -33.336 1.00 51.94  ? 415 TRP A CG    1 
ATOM   2305 C  CD1   . TRP D  1 97  ? 34.386 50.915  -34.589 1.00 53.80  ? 415 TRP A CD1   1 
ATOM   2306 C  CD2   . TRP D  1 97  ? 35.787 51.693  -33.027 1.00 50.68  ? 415 TRP A CD2   1 
ATOM   2307 N  NE1   . TRP D  1 97  ? 34.969 52.057  -35.081 1.00 54.42  ? 415 TRP A NE1   1 
ATOM   2308 C  CE2   . TRP D  1 97  ? 35.834 52.555  -34.141 1.00 52.41  ? 415 TRP A CE2   1 
ATOM   2309 C  CE3   . TRP D  1 97  ? 36.588 51.982  -31.918 1.00 48.64  ? 415 TRP A CE3   1 
ATOM   2310 C  CZ2   . TRP D  1 97  ? 36.648 53.684  -34.179 1.00 52.21  ? 415 TRP A CZ2   1 
ATOM   2311 C  CZ3   . TRP D  1 97  ? 37.397 53.104  -31.957 1.00 48.63  ? 415 TRP A CZ3   1 
ATOM   2312 C  CH2   . TRP D  1 97  ? 37.420 53.941  -33.080 1.00 50.38  ? 415 TRP A CH2   1 
ATOM   2313 N  N     . PRO D  1 98  ? 31.497 50.914  -32.632 1.00 60.14  ? 416 PRO A N     1 
ATOM   2314 C  CA    . PRO D  1 98  ? 30.182 50.925  -33.290 1.00 63.10  ? 416 PRO A CA    1 
ATOM   2315 C  C     . PRO D  1 98  ? 30.143 50.012  -34.508 1.00 63.31  ? 416 PRO A C     1 
ATOM   2316 O  O     . PRO D  1 98  ? 31.021 50.058  -35.374 1.00 62.54  ? 416 PRO A O     1 
ATOM   2317 C  CB    . PRO D  1 98  ? 29.996 52.397  -33.678 1.00 64.93  ? 416 PRO A CB    1 
ATOM   2318 C  CG    . PRO D  1 98  ? 30.855 53.150  -32.718 1.00 63.60  ? 416 PRO A CG    1 
ATOM   2319 C  CD    . PRO D  1 98  ? 32.042 52.271  -32.457 1.00 60.55  ? 416 PRO A CD    1 
ATOM   2320 N  N     . SER D  1 99  ? 29.116 49.159  -34.549 1.00 64.67  ? 417 SER A N     1 
ATOM   2321 C  CA    . SER D  1 99  ? 28.790 48.315  -35.700 1.00 65.37  ? 417 SER A CA    1 
ATOM   2322 C  C     . SER D  1 99  ? 29.877 47.287  -36.009 1.00 62.87  ? 417 SER A C     1 
ATOM   2323 O  O     . SER D  1 99  ? 30.042 46.885  -37.162 1.00 63.24  ? 417 SER A O     1 
ATOM   2324 C  CB    . SER D  1 99  ? 28.496 49.160  -36.946 1.00 67.13  ? 417 SER A CB    1 
ATOM   2325 N  N     . CYS D  1 100 ? 30.624 46.842  -34.998 1.00 60.50  ? 418 CYS A N     1 
ATOM   2326 C  CA    . CYS D  1 100 ? 31.619 45.791  -35.191 1.00 58.90  ? 418 CYS A CA    1 
ATOM   2327 C  C     . CYS D  1 100 ? 31.110 44.431  -34.723 1.00 60.08  ? 418 CYS A C     1 
ATOM   2328 O  O     . CYS D  1 100 ? 31.035 43.487  -35.516 1.00 60.89  ? 418 CYS A O     1 
ATOM   2329 C  CB    . CYS D  1 100 ? 32.921 46.150  -34.463 1.00 55.56  ? 418 CYS A CB    1 
ATOM   2330 S  SG    . CYS D  1 100 ? 34.215 44.904  -34.644 1.00 52.09  ? 418 CYS A SG    1 
ATOM   2331 N  N     . GLN D  1 101 ? 30.746 44.324  -33.445 1.00 60.69  ? 419 GLN A N     1 
ATOM   2332 C  CA    . GLN D  1 101 ? 30.226 43.095  -32.844 1.00 62.00  ? 419 GLN A CA    1 
ATOM   2333 C  C     . GLN D  1 101 ? 31.153 41.906  -33.109 1.00 61.39  ? 419 GLN A C     1 
ATOM   2334 O  O     . GLN D  1 101 ? 30.784 40.917  -33.745 1.00 63.02  ? 419 GLN A O     1 
ATOM   2335 C  CB    . GLN D  1 101 ? 28.805 42.805  -33.334 1.00 65.29  ? 419 GLN A CB    1 
ATOM   2336 N  N     . LYS D  1 102 ? 32.375 42.019  -32.599 1.00 59.70  ? 420 LYS A N     1 
ATOM   2337 C  CA    . LYS D  1 102 ? 33.384 40.978  -32.732 1.00 58.88  ? 420 LYS A CA    1 
ATOM   2338 C  C     . LYS D  1 102 ? 33.847 40.545  -31.349 1.00 57.18  ? 420 LYS A C     1 
ATOM   2339 O  O     . LYS D  1 102 ? 33.995 41.375  -30.446 1.00 56.66  ? 420 LYS A O     1 
ATOM   2340 C  CB    . LYS D  1 102 ? 34.574 41.464  -33.565 1.00 58.47  ? 420 LYS A CB    1 
ATOM   2341 C  CG    . LYS D  1 102 ? 34.915 40.556  -34.737 1.00 59.82  ? 420 LYS A CG    1 
ATOM   2342 C  CD    . LYS D  1 102 ? 36.064 41.114  -35.564 1.00 59.72  ? 420 LYS A CD    1 
ATOM   2343 C  CE    . LYS D  1 102 ? 36.314 40.268  -36.805 1.00 61.24  ? 420 LYS A CE    1 
ATOM   2344 N  NZ    . LYS D  1 102 ? 36.647 38.858  -36.463 1.00 60.42  ? 420 LYS A NZ    1 
ATOM   2345 N  N     . LYS D  1 103 ? 34.072 39.244  -31.187 1.00 56.47  ? 421 LYS A N     1 
ATOM   2346 C  CA    . LYS D  1 103 ? 34.399 38.662  -29.895 1.00 54.83  ? 421 LYS A CA    1 
ATOM   2347 C  C     . LYS D  1 103 ? 35.809 38.086  -29.916 1.00 51.82  ? 421 LYS A C     1 
ATOM   2348 O  O     . LYS D  1 103 ? 36.311 37.664  -30.962 1.00 51.50  ? 421 LYS A O     1 
ATOM   2349 C  CB    . LYS D  1 103 ? 33.395 37.569  -29.514 1.00 56.85  ? 421 LYS A CB    1 
ATOM   2350 C  CG    . LYS D  1 103 ? 31.947 38.031  -29.495 1.00 60.06  ? 421 LYS A CG    1 
ATOM   2351 C  CD    . LYS D  1 103 ? 31.017 36.904  -29.078 1.00 62.35  ? 421 LYS A CD    1 
ATOM   2352 C  CE    . LYS D  1 103 ? 29.559 37.321  -29.183 1.00 66.07  ? 421 LYS A CE    1 
ATOM   2353 N  NZ    . LYS D  1 103 ? 29.261 38.511  -28.341 1.00 66.59  ? 421 LYS A NZ    1 
ATOM   2354 N  N     . PHE D  1 104 ? 36.443 38.077  -28.745 1.00 49.61  ? 422 PHE A N     1 
ATOM   2355 C  CA    . PHE D  1 104 ? 37.785 37.536  -28.588 1.00 46.90  ? 422 PHE A CA    1 
ATOM   2356 C  C     . PHE D  1 104 ? 37.863 36.758  -27.283 1.00 46.39  ? 422 PHE A C     1 
ATOM   2357 O  O     . PHE D  1 104 ? 37.072 36.968  -26.361 1.00 47.57  ? 422 PHE A O     1 
ATOM   2358 C  CB    . PHE D  1 104 ? 38.849 38.641  -28.610 1.00 44.81  ? 422 PHE A CB    1 
ATOM   2359 C  CG    . PHE D  1 104 ? 38.886 39.417  -29.892 1.00 45.12  ? 422 PHE A CG    1 
ATOM   2360 C  CD1   . PHE D  1 104 ? 39.636 38.969  -30.966 1.00 44.61  ? 422 PHE A CD1   1 
ATOM   2361 C  CD2   . PHE D  1 104 ? 38.167 40.592  -30.025 1.00 46.31  ? 422 PHE A CD2   1 
ATOM   2362 C  CE1   . PHE D  1 104 ? 39.670 39.681  -32.148 1.00 45.69  ? 422 PHE A CE1   1 
ATOM   2363 C  CE2   . PHE D  1 104 ? 38.196 41.307  -31.204 1.00 47.17  ? 422 PHE A CE2   1 
ATOM   2364 C  CZ    . PHE D  1 104 ? 38.948 40.851  -32.268 1.00 46.94  ? 422 PHE A CZ    1 
ATOM   2365 N  N     . ALA D  1 105 ? 38.844 35.859  -27.210 1.00 44.90  ? 423 ALA A N     1 
ATOM   2366 C  CA    . ALA D  1 105 ? 39.003 35.001  -26.045 1.00 44.19  ? 423 ALA A CA    1 
ATOM   2367 C  C     . ALA D  1 105 ? 39.880 35.608  -24.959 1.00 42.65  ? 423 ALA A C     1 
ATOM   2368 O  O     . ALA D  1 105 ? 39.840 35.133  -23.818 1.00 43.30  ? 423 ALA A O     1 
ATOM   2369 C  CB    . ALA D  1 105 ? 39.584 33.646  -26.461 1.00 43.75  ? 423 ALA A CB    1 
ATOM   2370 N  N     . ARG D  1 106 ? 40.673 36.633  -25.275 1.00 40.92  ? 424 ARG A N     1 
ATOM   2371 C  CA    . ARG D  1 106 ? 41.564 37.245  -24.300 1.00 39.38  ? 424 ARG A CA    1 
ATOM   2372 C  C     . ARG D  1 106 ? 41.460 38.760  -24.375 1.00 38.80  ? 424 ARG A C     1 
ATOM   2373 O  O     . ARG D  1 106 ? 41.105 39.325  -25.412 1.00 39.40  ? 424 ARG A O     1 
ATOM   2374 C  CB    . ARG D  1 106 ? 43.022 36.831  -24.517 1.00 38.35  ? 424 ARG A CB    1 
ATOM   2375 C  CG    . ARG D  1 106 ? 43.206 35.375  -24.853 1.00 38.76  ? 424 ARG A CG    1 
ATOM   2376 C  CD    . ARG D  1 106 ? 44.648 34.958  -24.708 1.00 37.81  ? 424 ARG A CD    1 
ATOM   2377 N  NE    . ARG D  1 106 ? 45.607 35.930  -25.222 1.00 37.41  ? 424 ARG A NE    1 
ATOM   2378 C  CZ    . ARG D  1 106 ? 46.856 35.611  -25.541 1.00 36.77  ? 424 ARG A CZ    1 
ATOM   2379 N  NH1   . ARG D  1 106 ? 47.259 34.357  -25.400 1.00 36.64  ? 424 ARG A NH1   1 
ATOM   2380 N  NH2   . ARG D  1 106 ? 47.698 36.526  -26.005 1.00 36.43  ? 424 ARG A NH2   1 
ATOM   2381 N  N     . SER D  1 107 ? 41.796 39.412  -23.260 1.00 37.91  ? 425 SER A N     1 
ATOM   2382 C  CA    . SER D  1 107 ? 41.712 40.867  -23.201 1.00 37.81  ? 425 SER A CA    1 
ATOM   2383 C  C     . SER D  1 107 ? 42.732 41.523  -24.123 1.00 36.70  ? 425 SER A C     1 
ATOM   2384 O  O     . SER D  1 107 ? 42.418 42.511  -24.798 1.00 37.28  ? 425 SER A O     1 
ATOM   2385 C  CB    . SER D  1 107 ? 41.907 41.347  -21.762 1.00 37.48  ? 425 SER A CB    1 
ATOM   2386 O  OG    . SER D  1 107 ? 43.239 41.132  -21.328 1.00 35.92  ? 425 SER A OG    1 
ATOM   2387 N  N     . ASP D  1 108 ? 43.960 40.996  -24.161 1.00 35.72  ? 426 ASP A N     1 
ATOM   2388 C  CA    . ASP D  1 108 ? 44.990 41.594  -25.005 1.00 36.29  ? 426 ASP A CA    1 
ATOM   2389 C  C     . ASP D  1 108 ? 44.651 41.467  -26.484 1.00 36.64  ? 426 ASP A C     1 
ATOM   2390 O  O     . ASP D  1 108 ? 45.028 42.335  -27.280 1.00 36.80  ? 426 ASP A O     1 
ATOM   2391 C  CB    . ASP D  1 108 ? 46.353 40.962  -24.716 1.00 36.71  ? 426 ASP A CB    1 
ATOM   2392 C  CG    . ASP D  1 108 ? 46.359 39.462  -24.928 1.00 38.07  ? 426 ASP A CG    1 
ATOM   2393 O  OD1   . ASP D  1 108 ? 45.478 38.778  -24.368 1.00 39.03  ? 426 ASP A OD1   1 
ATOM   2394 O  OD2   . ASP D  1 108 ? 47.242 38.967  -25.659 1.00 38.27  ? 426 ASP A OD2   1 
ATOM   2395 N  N     . GLU D  1 109 ? 43.947 40.400  -26.871 1.00 37.31  ? 427 GLU A N     1 
ATOM   2396 C  CA    . GLU D  1 109 ? 43.487 40.285  -28.251 1.00 38.82  ? 427 GLU A CA    1 
ATOM   2397 C  C     . GLU D  1 109 ? 42.521 41.410  -28.598 1.00 39.24  ? 427 GLU A C     1 
ATOM   2398 O  O     . GLU D  1 109 ? 42.602 41.996  -29.684 1.00 40.10  ? 427 GLU A O     1 
ATOM   2399 C  CB    . GLU D  1 109 ? 42.826 38.925  -28.475 1.00 40.86  ? 427 GLU A CB    1 
ATOM   2400 C  CG    . GLU D  1 109 ? 43.738 37.732  -28.234 1.00 41.56  ? 427 GLU A CG    1 
ATOM   2401 C  CD    . GLU D  1 109 ? 43.010 36.406  -28.374 1.00 43.79  ? 427 GLU A CD    1 
ATOM   2402 O  OE1   . GLU D  1 109 ? 43.668 35.349  -28.274 1.00 43.61  ? 427 GLU A OE1   1 
ATOM   2403 O  OE2   . GLU D  1 109 ? 41.779 36.422  -28.585 1.00 45.73  ? 427 GLU A OE2   1 
ATOM   2404 N  N     . LEU D  1 110 ? 41.601 41.725  -27.685 1.00 38.52  ? 428 LEU A N     1 
ATOM   2405 C  CA    . LEU D  1 110 ? 40.663 42.816  -27.924 1.00 38.78  ? 428 LEU A CA    1 
ATOM   2406 C  C     . LEU D  1 110 ? 41.373 44.164  -27.935 1.00 38.56  ? 428 LEU A C     1 
ATOM   2407 O  O     . LEU D  1 110 ? 41.014 45.053  -28.716 1.00 39.85  ? 428 LEU A O     1 
ATOM   2408 C  CB    . LEU D  1 110 ? 39.560 42.798  -26.866 1.00 38.50  ? 428 LEU A CB    1 
ATOM   2409 C  CG    . LEU D  1 110 ? 38.494 43.886  -26.981 1.00 39.58  ? 428 LEU A CG    1 
ATOM   2410 C  CD1   . LEU D  1 110 ? 37.800 43.808  -28.330 1.00 40.82  ? 428 LEU A CD1   1 
ATOM   2411 C  CD2   . LEU D  1 110 ? 37.488 43.775  -25.847 1.00 40.42  ? 428 LEU A CD2   1 
ATOM   2412 N  N     . VAL D  1 111 ? 42.382 44.334  -27.077 1.00 37.01  ? 429 VAL A N     1 
ATOM   2413 C  CA    . VAL D  1 111 ? 43.129 45.589  -27.043 1.00 36.55  ? 429 VAL A CA    1 
ATOM   2414 C  C     . VAL D  1 111 ? 43.846 45.818  -28.368 1.00 37.72  ? 429 VAL A C     1 
ATOM   2415 O  O     . VAL D  1 111 ? 43.834 46.929  -28.914 1.00 38.93  ? 429 VAL A O     1 
ATOM   2416 C  CB    . VAL D  1 111 ? 44.112 45.596  -25.857 1.00 33.88  ? 429 VAL A CB    1 
ATOM   2417 C  CG1   . VAL D  1 111 ? 45.062 46.778  -25.960 1.00 33.45  ? 429 VAL A CG1   1 
ATOM   2418 C  CG2   . VAL D  1 111 ? 43.357 45.631  -24.539 1.00 33.84  ? 429 VAL A CG2   1 
ATOM   2419 N  N     . ARG D  1 112 ? 44.483 44.774  -28.902 1.00 38.06  ? 430 ARG A N     1 
ATOM   2420 C  CA    . ARG D  1 112 ? 45.119 44.879  -30.212 1.00 40.22  ? 430 ARG A CA    1 
ATOM   2421 C  C     . ARG D  1 112 ? 44.102 45.246  -31.286 1.00 42.38  ? 430 ARG A C     1 
ATOM   2422 O  O     . ARG D  1 112 ? 44.347 46.129  -32.116 1.00 43.21  ? 430 ARG A O     1 
ATOM   2423 C  CB    . ARG D  1 112 ? 45.820 43.564  -30.555 1.00 40.62  ? 430 ARG A CB    1 
ATOM   2424 C  CG    . ARG D  1 112 ? 46.351 43.490  -31.976 1.00 43.06  ? 430 ARG A CG    1 
ATOM   2425 C  CD    . ARG D  1 112 ? 46.868 42.096  -32.302 1.00 43.86  ? 430 ARG A CD    1 
ATOM   2426 N  NE    . ARG D  1 112 ? 48.109 41.786  -31.598 1.00 43.67  ? 430 ARG A NE    1 
ATOM   2427 C  CZ    . ARG D  1 112 ? 48.701 40.597  -31.623 1.00 44.01  ? 430 ARG A CZ    1 
ATOM   2428 N  NH1   . ARG D  1 112 ? 48.163 39.600  -32.312 1.00 45.04  ? 430 ARG A NH1   1 
ATOM   2429 N  NH2   . ARG D  1 112 ? 49.829 40.403  -30.954 1.00 43.10  ? 430 ARG A NH2   1 
ATOM   2430 N  N     . HIS D  1 113 ? 42.947 44.575  -31.279 1.00 43.87  ? 431 HIS A N     1 
ATOM   2431 C  CA    . HIS D  1 113 ? 41.892 44.891  -32.237 1.00 46.77  ? 431 HIS A CA    1 
ATOM   2432 C  C     . HIS D  1 113 ? 41.354 46.301  -32.023 1.00 46.89  ? 431 HIS A C     1 
ATOM   2433 O  O     . HIS D  1 113 ? 41.133 47.041  -32.989 1.00 48.49  ? 431 HIS A O     1 
ATOM   2434 C  CB    . HIS D  1 113 ? 40.766 43.864  -32.125 1.00 49.76  ? 431 HIS A CB    1 
ATOM   2435 C  CG    . HIS D  1 113 ? 39.544 44.213  -32.917 1.00 56.92  ? 431 HIS A CG    1 
ATOM   2436 N  ND1   . HIS D  1 113 ? 39.447 43.992  -34.273 1.00 59.34  ? 431 HIS A ND1   1 
ATOM   2437 C  CD2   . HIS D  1 113 ? 38.366 44.764  -32.540 1.00 59.26  ? 431 HIS A CD2   1 
ATOM   2438 C  CE1   . HIS D  1 113 ? 38.262 44.394  -34.698 1.00 61.56  ? 431 HIS A CE1   1 
ATOM   2439 N  NE2   . HIS D  1 113 ? 37.587 44.866  -33.666 1.00 60.92  ? 431 HIS A NE2   1 
ATOM   2440 N  N     . HIS D  1 114 ? 41.132 46.687  -30.763 1.00 45.66  ? 432 HIS A N     1 
ATOM   2441 C  CA    . HIS D  1 114 ? 40.632 48.028  -30.476 1.00 46.98  ? 432 HIS A CA    1 
ATOM   2442 C  C     . HIS D  1 114 ? 41.628 49.100  -30.895 1.00 47.02  ? 432 HIS A C     1 
ATOM   2443 O  O     . HIS D  1 114 ? 41.225 50.188  -31.323 1.00 48.51  ? 432 HIS A O     1 
ATOM   2444 C  CB    . HIS D  1 114 ? 40.302 48.159  -28.988 1.00 47.31  ? 432 HIS A CB    1 
ATOM   2445 C  CG    . HIS D  1 114 ? 39.851 49.529  -28.586 1.00 50.03  ? 432 HIS A CG    1 
ATOM   2446 N  ND1   . HIS D  1 114 ? 38.692 50.101  -29.062 1.00 52.69  ? 432 HIS A ND1   1 
ATOM   2447 C  CD2   . HIS D  1 114 ? 40.404 50.440  -27.750 1.00 50.34  ? 432 HIS A CD2   1 
ATOM   2448 C  CE1   . HIS D  1 114 ? 38.550 51.306  -28.538 1.00 54.03  ? 432 HIS A CE1   1 
ATOM   2449 N  NE2   . HIS D  1 114 ? 39.575 51.535  -27.738 1.00 52.52  ? 432 HIS A NE2   1 
ATOM   2450 N  N     . ASN D  1 115 ? 42.928 48.815  -30.786 1.00 46.07  ? 433 ASN A N     1 
ATOM   2451 C  CA    . ASN D  1 115 ? 43.930 49.783  -31.216 1.00 47.65  ? 433 ASN A CA    1 
ATOM   2452 C  C     . ASN D  1 115 ? 43.940 49.951  -32.730 1.00 50.22  ? 433 ASN A C     1 
ATOM   2453 O  O     . ASN D  1 115 ? 44.236 51.043  -33.227 1.00 51.95  ? 433 ASN A O     1 
ATOM   2454 C  CB    . ASN D  1 115 ? 45.315 49.368  -30.719 1.00 46.23  ? 433 ASN A CB    1 
ATOM   2455 C  CG    . ASN D  1 115 ? 45.465 49.518  -29.218 1.00 45.86  ? 433 ASN A CG    1 
ATOM   2456 O  OD1   . ASN D  1 115 ? 44.904 50.432  -28.614 1.00 46.97  ? 433 ASN A OD1   1 
ATOM   2457 N  ND2   . ASN D  1 115 ? 46.224 48.616  -28.607 1.00 44.50  ? 433 ASN A ND2   1 
ATOM   2458 N  N     . MET D  1 116 ? 43.618 48.894  -33.478 1.00 51.07  ? 434 MET A N     1 
ATOM   2459 C  CA    . MET D  1 116 ? 43.578 49.005  -34.930 1.00 54.13  ? 434 MET A CA    1 
ATOM   2460 C  C     . MET D  1 116 ? 42.317 49.693  -35.433 1.00 55.83  ? 434 MET A C     1 
ATOM   2461 O  O     . MET D  1 116 ? 42.277 50.112  -36.594 1.00 57.13  ? 434 MET A O     1 
ATOM   2462 C  CB    . MET D  1 116 ? 43.710 47.625  -35.577 1.00 55.42  ? 434 MET A CB    1 
ATOM   2463 C  CG    . MET D  1 116 ? 45.101 47.022  -35.460 1.00 55.65  ? 434 MET A CG    1 
ATOM   2464 S  SD    . MET D  1 116 ? 45.552 46.041  -36.903 1.00 58.35  ? 434 MET A SD    1 
ATOM   2465 C  CE    . MET D  1 116 ? 45.528 47.295  -38.184 1.00 61.33  ? 434 MET A CE    1 
ATOM   2466 N  N     . HIS D  1 117 ? 41.284 49.812  -34.595 1.00 55.99  ? 435 HIS A N     1 
ATOM   2467 C  CA    . HIS D  1 117 ? 40.145 50.645  -34.960 1.00 58.42  ? 435 HIS A CA    1 
ATOM   2468 C  C     . HIS D  1 117 ? 40.517 52.121  -34.963 1.00 58.54  ? 435 HIS A C     1 
ATOM   2469 O  O     . HIS D  1 117 ? 39.923 52.909  -35.707 1.00 59.99  ? 435 HIS A O     1 
ATOM   2470 C  CB    . HIS D  1 117 ? 38.974 50.403  -34.006 1.00 60.32  ? 435 HIS A CB    1 
ATOM   2471 C  CG    . HIS D  1 117 ? 38.101 49.251  -34.393 1.00 64.79  ? 435 HIS A CG    1 
ATOM   2472 N  ND1   . HIS D  1 117 ? 37.293 49.272  -35.510 1.00 67.74  ? 435 HIS A ND1   1 
ATOM   2473 C  CD2   . HIS D  1 117 ? 37.895 48.049  -33.804 1.00 64.33  ? 435 HIS A CD2   1 
ATOM   2474 C  CE1   . HIS D  1 117 ? 36.634 48.130  -35.596 1.00 67.96  ? 435 HIS A CE1   1 
ATOM   2475 N  NE2   . HIS D  1 117 ? 36.982 47.371  -34.573 1.00 65.29  ? 435 HIS A NE2   1 
ATOM   2476 N  N     . GLN D  1 118 ? 41.496 52.511  -34.149 1.00 57.51  ? 436 GLN A N     1 
ATOM   2477 C  CA    . GLN D  1 118 ? 41.907 53.901  -34.012 1.00 58.10  ? 436 GLN A CA    1 
ATOM   2478 C  C     . GLN D  1 118 ? 42.954 54.320  -35.038 1.00 58.03  ? 436 GLN A C     1 
ATOM   2479 O  O     . GLN D  1 118 ? 43.500 55.423  -34.928 1.00 58.91  ? 436 GLN A O     1 
ATOM   2480 C  CB    . GLN D  1 118 ? 42.448 54.153  -32.602 1.00 57.04  ? 436 GLN A CB    1 
ATOM   2481 C  CG    . GLN D  1 118 ? 41.502 53.756  -31.481 1.00 57.59  ? 436 GLN A CG    1 
ATOM   2482 C  CD    . GLN D  1 118 ? 42.071 54.067  -30.110 1.00 57.71  ? 436 GLN A CD    1 
ATOM   2483 O  OE1   . GLN D  1 118 ? 42.912 54.954  -29.961 1.00 58.50  ? 436 GLN A OE1   1 
ATOM   2484 N  NE2   . GLN D  1 118 ? 41.618 53.333  -29.100 1.00 56.88  ? 436 GLN A NE2   1 
ATOM   2485 N  N     . ARG D  1 119 ? 43.248 53.476  -36.023 1.00 57.33  ? 437 ARG A N     1 
ATOM   2486 C  CA    . ARG D  1 119 ? 44.252 53.798  -37.035 1.00 57.99  ? 437 ARG A CA    1 
ATOM   2487 C  C     . ARG D  1 119 ? 43.771 54.924  -37.946 1.00 60.37  ? 437 ARG A C     1 
ATOM   2488 O  O     . ARG D  1 119 ? 42.931 54.715  -38.822 1.00 61.29  ? 437 ARG A O     1 
ATOM   2489 C  CB    . ARG D  1 119 ? 44.599 52.559  -37.867 1.00 57.52  ? 437 ARG A CB    1 
ATOM   2490 C  CG    . ARG D  1 119 ? 45.181 51.407  -37.063 1.00 54.79  ? 437 ARG A CG    1 
ATOM   2491 C  CD    . ARG D  1 119 ? 46.604 51.695  -36.617 1.00 54.41  ? 437 ARG A CD    1 
ATOM   2492 N  NE    . ARG D  1 119 ? 47.586 51.037  -37.474 1.00 55.11  ? 437 ARG A NE    1 
ATOM   2493 C  CZ    . ARG D  1 119 ? 48.140 49.859  -37.202 1.00 53.43  ? 437 ARG A CZ    1 
ATOM   2494 N  NH1   . ARG D  1 119 ? 47.809 49.213  -36.093 1.00 51.19  ? 437 ARG A NH1   1 
ATOM   2495 N  NH2   . ARG D  1 119 ? 49.026 49.329  -38.034 1.00 54.18  ? 437 ARG A NH2   1 
ATOM   2496 P  P     . DG  E  2 2   ? 41.630 36.384  -33.253 1.00 58.97  ? 2   DG  B P     1 
ATOM   2497 O  OP1   . DG  E  2 2   ? 42.387 37.652  -33.186 1.00 58.77  ? 2   DG  B OP1   1 
ATOM   2498 O  OP2   . DG  E  2 2   ? 40.603 36.180  -34.301 1.00 61.12  ? 2   DG  B OP2   1 
ATOM   2499 O  "O5'" . DG  E  2 2   ? 42.672 35.176  -33.343 1.00 55.33  ? 2   DG  B "O5'" 1 
ATOM   2500 C  "C5'" . DG  E  2 2   ? 42.302 33.972  -33.996 1.00 54.11  ? 2   DG  B "C5'" 1 
ATOM   2501 C  "C4'" . DG  E  2 2   ? 43.112 32.797  -33.474 1.00 50.48  ? 2   DG  B "C4'" 1 
ATOM   2502 O  "O4'" . DG  E  2 2   ? 44.525 33.056  -33.655 1.00 48.33  ? 2   DG  B "O4'" 1 
ATOM   2503 C  "C3'" . DG  E  2 2   ? 42.929 32.489  -31.995 1.00 47.86  ? 2   DG  B "C3'" 1 
ATOM   2504 O  "O3'" . DG  E  2 2   ? 43.038 31.087  -31.777 1.00 46.88  ? 2   DG  B "O3'" 1 
ATOM   2505 C  "C2'" . DG  E  2 2   ? 44.074 33.258  -31.337 1.00 45.67  ? 2   DG  B "C2'" 1 
ATOM   2506 C  "C1'" . DG  E  2 2   ? 45.166 33.205  -32.402 1.00 45.60  ? 2   DG  B "C1'" 1 
ATOM   2507 N  N9    . DG  E  2 2   ? 45.981 34.416  -32.450 1.00 44.22  ? 2   DG  B N9    1 
ATOM   2508 C  C8    . DG  E  2 2   ? 45.548 35.710  -32.283 1.00 44.39  ? 2   DG  B C8    1 
ATOM   2509 N  N7    . DG  E  2 2   ? 46.500 36.594  -32.381 1.00 43.46  ? 2   DG  B N7    1 
ATOM   2510 C  C5    . DG  E  2 2   ? 47.639 35.839  -32.632 1.00 42.90  ? 2   DG  B C5    1 
ATOM   2511 C  C6    . DG  E  2 2   ? 48.979 36.248  -32.829 1.00 42.50  ? 2   DG  B C6    1 
ATOM   2512 O  O6    . DG  E  2 2   ? 49.440 37.399  -32.824 1.00 42.28  ? 2   DG  B O6    1 
ATOM   2513 N  N1    . DG  E  2 2   ? 49.821 35.162  -33.051 1.00 42.40  ? 2   DG  B N1    1 
ATOM   2514 C  C2    . DG  E  2 2   ? 49.419 33.847  -33.078 1.00 42.76  ? 2   DG  B C2    1 
ATOM   2515 N  N2    . DG  E  2 2   ? 50.376 32.937  -33.307 1.00 42.46  ? 2   DG  B N2    1 
ATOM   2516 N  N3    . DG  E  2 2   ? 48.167 33.450  -32.893 1.00 43.13  ? 2   DG  B N3    1 
ATOM   2517 C  C4    . DG  E  2 2   ? 47.335 34.496  -32.675 1.00 43.09  ? 2   DG  B C4    1 
ATOM   2518 P  P     . DC  E  2 3   ? 42.814 30.474  -30.308 1.00 45.47  ? 3   DC  B P     1 
ATOM   2519 O  OP1   . DC  E  2 3   ? 42.288 29.100  -30.468 1.00 46.82  ? 3   DC  B OP1   1 
ATOM   2520 O  OP2   . DC  E  2 3   ? 42.059 31.467  -29.513 1.00 45.36  ? 3   DC  B OP2   1 
ATOM   2521 O  "O5'" . DC  E  2 3   ? 44.291 30.385  -29.707 1.00 43.20  ? 3   DC  B "O5'" 1 
ATOM   2522 C  "C5'" . DC  E  2 3   ? 45.296 29.685  -30.419 1.00 43.40  ? 3   DC  B "C5'" 1 
ATOM   2523 C  "C4'" . DC  E  2 3   ? 46.655 29.882  -29.775 1.00 41.78  ? 3   DC  B "C4'" 1 
ATOM   2524 O  "O4'" . DC  E  2 3   ? 47.209 31.164  -30.165 1.00 41.04  ? 3   DC  B "O4'" 1 
ATOM   2525 C  "C3'" . DC  E  2 3   ? 46.660 29.862  -28.239 1.00 41.19  ? 3   DC  B "C3'" 1 
ATOM   2526 O  "O3'" . DC  E  2 3   ? 47.650 28.948  -27.779 1.00 41.33  ? 3   DC  B "O3'" 1 
ATOM   2527 C  "C2'" . DC  E  2 3   ? 47.018 31.305  -27.868 1.00 39.66  ? 3   DC  B "C2'" 1 
ATOM   2528 C  "C1'" . DC  E  2 3   ? 47.870 31.704  -29.055 1.00 39.25  ? 3   DC  B "C1'" 1 
ATOM   2529 N  N1    . DC  E  2 3   ? 48.002 33.174  -29.225 1.00 38.40  ? 3   DC  B N1    1 
ATOM   2530 C  C2    . DC  E  2 3   ? 49.212 33.710  -29.678 1.00 37.30  ? 3   DC  B C2    1 
ATOM   2531 O  O2    . DC  E  2 3   ? 50.149 32.947  -29.945 1.00 36.65  ? 3   DC  B O2    1 
ATOM   2532 N  N3    . DC  E  2 3   ? 49.320 35.053  -29.818 1.00 36.98  ? 3   DC  B N3    1 
ATOM   2533 C  C4    . DC  E  2 3   ? 48.286 35.840  -29.517 1.00 37.67  ? 3   DC  B C4    1 
ATOM   2534 N  N4    . DC  E  2 3   ? 48.437 37.157  -29.672 1.00 37.57  ? 3   DC  B N4    1 
ATOM   2535 C  C5    . DC  E  2 3   ? 47.047 35.312  -29.050 1.00 38.84  ? 3   DC  B C5    1 
ATOM   2536 C  C6    . DC  E  2 3   ? 46.952 33.986  -28.917 1.00 38.76  ? 3   DC  B C6    1 
ATOM   2537 P  P     . DG  E  2 4   ? 47.619 28.380  -26.275 1.00 41.58  ? 4   DG  B P     1 
ATOM   2538 O  OP1   . DG  E  2 4   ? 47.007 27.033  -26.314 1.00 42.98  ? 4   DG  B OP1   1 
ATOM   2539 O  OP2   . DG  E  2 4   ? 47.062 29.416  -25.376 1.00 41.73  ? 4   DG  B OP2   1 
ATOM   2540 O  "O5'" . DG  E  2 4   ? 49.167 28.227  -25.907 1.00 39.90  ? 4   DG  B "O5'" 1 
ATOM   2541 C  "C5'" . DG  E  2 4   ? 50.033 27.507  -26.772 1.00 40.14  ? 4   DG  B "C5'" 1 
ATOM   2542 C  "C4'" . DG  E  2 4   ? 51.417 28.132  -26.788 1.00 39.02  ? 4   DG  B "C4'" 1 
ATOM   2543 O  "O4'" . DG  E  2 4   ? 51.333 29.484  -27.305 1.00 39.23  ? 4   DG  B "O4'" 1 
ATOM   2544 C  "C3'" . DG  E  2 4   ? 52.093 28.236  -25.418 1.00 37.59  ? 4   DG  B "C3'" 1 
ATOM   2545 O  "O3'" . DG  E  2 4   ? 53.439 27.788  -25.506 1.00 36.89  ? 4   DG  B "O3'" 1 
ATOM   2546 C  "C2'" . DG  E  2 4   ? 52.017 29.727  -25.090 1.00 37.02  ? 4   DG  B "C2'" 1 
ATOM   2547 C  "C1'" . DG  E  2 4   ? 52.067 30.351  -26.474 1.00 37.75  ? 4   DG  B "C1'" 1 
ATOM   2548 N  N9    . DG  E  2 4   ? 51.452 31.673  -26.529 1.00 37.99  ? 4   DG  B N9    1 
ATOM   2549 C  C8    . DG  E  2 4   ? 50.113 31.963  -26.451 1.00 38.94  ? 4   DG  B C8    1 
ATOM   2550 N  N7    . DG  E  2 4   ? 49.851 33.238  -26.524 1.00 39.12  ? 4   DG  B N7    1 
ATOM   2551 C  C5    . DG  E  2 4   ? 51.098 33.833  -26.655 1.00 38.15  ? 4   DG  B C5    1 
ATOM   2552 C  C6    . DG  E  2 4   ? 51.446 35.199  -26.778 1.00 38.62  ? 4   DG  B C6    1 
ATOM   2553 O  O6    . DG  E  2 4   ? 50.694 36.183  -26.795 1.00 39.69  ? 4   DG  B O6    1 
ATOM   2554 N  N1    . DG  E  2 4   ? 52.823 35.372  -26.888 1.00 37.75  ? 4   DG  B N1    1 
ATOM   2555 C  C2    . DG  E  2 4   ? 53.747 34.353  -26.881 1.00 36.99  ? 4   DG  B C2    1 
ATOM   2556 N  N2    . DG  E  2 4   ? 55.032 34.716  -26.999 1.00 36.65  ? 4   DG  B N2    1 
ATOM   2557 N  N3    . DG  E  2 4   ? 53.433 33.068  -26.767 1.00 36.65  ? 4   DG  B N3    1 
ATOM   2558 C  C4    . DG  E  2 4   ? 52.095 32.884  -26.658 1.00 37.37  ? 4   DG  B C4    1 
ATOM   2559 P  P     . DT  E  2 5   ? 54.261 27.435  -24.171 1.00 35.84  ? 5   DT  B P     1 
ATOM   2560 O  OP1   . DT  E  2 5   ? 55.447 26.640  -24.564 1.00 35.75  ? 5   DT  B OP1   1 
ATOM   2561 O  OP2   . DT  E  2 5   ? 53.298 26.888  -23.191 1.00 36.49  ? 5   DT  B OP2   1 
ATOM   2562 O  "O5'" . DT  E  2 5   ? 54.752 28.859  -23.634 1.00 35.22  ? 5   DT  B "O5'" 1 
ATOM   2563 C  "C5'" . DT  E  2 5   ? 55.592 29.666  -24.443 1.00 35.34  ? 5   DT  B "C5'" 1 
ATOM   2564 C  "C4'" . DT  E  2 5   ? 55.888 30.993  -23.768 1.00 35.14  ? 5   DT  B "C4'" 1 
ATOM   2565 O  "O4'" . DT  E  2 5   ? 54.857 31.960  -24.090 1.00 34.64  ? 5   DT  B "O4'" 1 
ATOM   2566 C  "C3'" . DT  E  2 5   ? 55.966 30.946  -22.235 1.00 35.58  ? 5   DT  B "C3'" 1 
ATOM   2567 O  "O3'" . DT  E  2 5   ? 57.150 31.591  -21.803 1.00 37.23  ? 5   DT  B "O3'" 1 
ATOM   2568 C  "C2'" . DT  E  2 5   ? 54.723 31.727  -21.797 1.00 34.32  ? 5   DT  B "C2'" 1 
ATOM   2569 C  "C1'" . DT  E  2 5   ? 54.602 32.717  -22.938 1.00 33.48  ? 5   DT  B "C1'" 1 
ATOM   2570 N  N1    . DT  E  2 5   ? 53.262 33.360  -23.054 1.00 33.13  ? 5   DT  B N1    1 
ATOM   2571 C  C2    . DT  E  2 5   ? 53.191 34.722  -23.231 1.00 32.51  ? 5   DT  B C2    1 
ATOM   2572 O  O2    . DT  E  2 5   ? 54.174 35.436  -23.303 1.00 31.09  ? 5   DT  B O2    1 
ATOM   2573 N  N3    . DT  E  2 5   ? 51.920 35.222  -23.324 1.00 33.41  ? 5   DT  B N3    1 
ATOM   2574 C  C4    . DT  E  2 5   ? 50.736 34.512  -23.257 1.00 34.06  ? 5   DT  B C4    1 
ATOM   2575 O  O4    . DT  E  2 5   ? 49.640 35.053  -23.352 1.00 34.88  ? 5   DT  B O4    1 
ATOM   2576 C  C5    . DT  E  2 5   ? 50.881 33.087  -23.067 1.00 34.07  ? 5   DT  B C5    1 
ATOM   2577 C  C7    . DT  E  2 5   ? 49.665 32.212  -22.978 1.00 35.21  ? 5   DT  B C7    1 
ATOM   2578 C  C6    . DT  E  2 5   ? 52.124 32.586  -22.973 1.00 33.54  ? 5   DT  B C6    1 
ATOM   2579 P  P     . DG  E  2 6   ? 58.037 30.961  -20.622 1.00 38.88  ? 6   DG  B P     1 
ATOM   2580 O  OP1   . DG  E  2 6   ? 58.914 29.925  -21.218 1.00 39.82  ? 6   DG  B OP1   1 
ATOM   2581 O  OP2   . DG  E  2 6   ? 57.124 30.612  -19.510 1.00 39.31  ? 6   DG  B OP2   1 
ATOM   2582 O  "O5'" . DG  E  2 6   ? 58.944 32.187  -20.139 1.00 37.10  ? 6   DG  B "O5'" 1 
ATOM   2583 C  "C5'" . DG  E  2 6   ? 58.389 33.200  -19.309 1.00 35.66  ? 6   DG  B "C5'" 1 
ATOM   2584 C  "C4'" . DG  E  2 6   ? 58.715 34.578  -19.856 1.00 34.19  ? 6   DG  B "C4'" 1 
ATOM   2585 O  "O4'" . DG  E  2 6   ? 57.801 34.891  -20.934 1.00 33.85  ? 6   DG  B "O4'" 1 
ATOM   2586 C  "C3'" . DG  E  2 6   ? 58.597 35.713  -18.847 1.00 33.28  ? 6   DG  B "C3'" 1 
ATOM   2587 O  "O3'" . DG  E  2 6   ? 59.877 35.980  -18.288 1.00 31.94  ? 6   DG  B "O3'" 1 
ATOM   2588 C  "C2'" . DG  E  2 6   ? 58.108 36.890  -19.691 1.00 33.99  ? 6   DG  B "C2'" 1 
ATOM   2589 C  "C1'" . DG  E  2 6   ? 57.316 36.209  -20.807 1.00 33.80  ? 6   DG  B "C1'" 1 
ATOM   2590 N  N9    . DG  E  2 6   ? 55.874 36.149  -20.574 1.00 34.11  ? 6   DG  B N9    1 
ATOM   2591 C  C8    . DG  E  2 6   ? 55.118 35.019  -20.381 1.00 34.25  ? 6   DG  B C8    1 
ATOM   2592 N  N7    . DG  E  2 6   ? 53.849 35.261  -20.214 1.00 34.72  ? 6   DG  B N7    1 
ATOM   2593 C  C5    . DG  E  2 6   ? 53.752 36.644  -20.307 1.00 35.11  ? 6   DG  B C5    1 
ATOM   2594 C  C6    . DG  E  2 6   ? 52.620 37.487  -20.205 1.00 36.78  ? 6   DG  B C6    1 
ATOM   2595 O  O6    . DG  E  2 6   ? 51.439 37.167  -20.007 1.00 37.67  ? 6   DG  B O6    1 
ATOM   2596 N  N1    . DG  E  2 6   ? 52.961 38.828  -20.359 1.00 36.90  ? 6   DG  B N1    1 
ATOM   2597 C  C2    . DG  E  2 6   ? 54.234 39.295  -20.582 1.00 36.31  ? 6   DG  B C2    1 
ATOM   2598 N  N2    . DG  E  2 6   ? 54.367 40.624  -20.703 1.00 36.80  ? 6   DG  B N2    1 
ATOM   2599 N  N3    . DG  E  2 6   ? 55.305 38.516  -20.679 1.00 35.41  ? 6   DG  B N3    1 
ATOM   2600 C  C4    . DG  E  2 6   ? 54.990 37.206  -20.532 1.00 34.77  ? 6   DG  B C4    1 
ATOM   2601 P  P     . DG  E  2 7   ? 60.010 36.526  -16.784 1.00 32.47  ? 7   DG  B P     1 
ATOM   2602 O  OP1   . DG  E  2 7   ? 61.451 36.534  -16.441 1.00 32.87  ? 7   DG  B OP1   1 
ATOM   2603 O  OP2   . DG  E  2 7   ? 59.054 35.769  -15.948 1.00 32.88  ? 7   DG  B OP2   1 
ATOM   2604 O  "O5'" . DG  E  2 7   ? 59.491 38.035  -16.874 1.00 31.90  ? 7   DG  B "O5'" 1 
ATOM   2605 C  "C5'" . DG  E  2 7   ? 60.252 39.007  -17.573 1.00 31.58  ? 7   DG  B "C5'" 1 
ATOM   2606 C  "C4'" . DG  E  2 7   ? 59.620 40.380  -17.440 1.00 32.31  ? 7   DG  B "C4'" 1 
ATOM   2607 O  "O4'" . DG  E  2 7   ? 58.249 40.331  -17.910 1.00 32.65  ? 7   DG  B "O4'" 1 
ATOM   2608 C  "C3'" . DG  E  2 7   ? 59.564 40.928  -16.017 1.00 32.67  ? 7   DG  B "C3'" 1 
ATOM   2609 O  "O3'" . DG  E  2 7   ? 59.823 42.326  -16.025 1.00 33.81  ? 7   DG  B "O3'" 1 
ATOM   2610 C  "C2'" . DG  E  2 7   ? 58.133 40.620  -15.579 1.00 32.56  ? 7   DG  B "C2'" 1 
ATOM   2611 C  "C1'" . DG  E  2 7   ? 57.368 40.746  -16.889 1.00 33.10  ? 7   DG  B "C1'" 1 
ATOM   2612 N  N9    . DG  E  2 7   ? 56.181 39.898  -16.943 1.00 33.72  ? 7   DG  B N9    1 
ATOM   2613 C  C8    . DG  E  2 7   ? 56.146 38.527  -16.890 1.00 33.40  ? 7   DG  B C8    1 
ATOM   2614 N  N7    . DG  E  2 7   ? 54.942 38.034  -16.962 1.00 33.68  ? 7   DG  B N7    1 
ATOM   2615 C  C5    . DG  E  2 7   ? 54.123 39.150  -17.070 1.00 34.35  ? 7   DG  B C5    1 
ATOM   2616 C  C6    . DG  E  2 7   ? 52.716 39.240  -17.182 1.00 35.48  ? 7   DG  B C6    1 
ATOM   2617 O  O6    . DG  E  2 7   ? 51.889 38.319  -17.207 1.00 35.88  ? 7   DG  B O6    1 
ATOM   2618 N  N1    . DG  E  2 7   ? 52.289 40.562  -17.269 1.00 36.17  ? 7   DG  B N1    1 
ATOM   2619 C  C2    . DG  E  2 7   ? 53.118 41.659  -17.251 1.00 36.21  ? 7   DG  B C2    1 
ATOM   2620 N  N2    . DG  E  2 7   ? 52.522 42.855  -17.345 1.00 37.19  ? 7   DG  B N2    1 
ATOM   2621 N  N3    . DG  E  2 7   ? 54.440 41.589  -17.146 1.00 35.60  ? 7   DG  B N3    1 
ATOM   2622 C  C4    . DG  E  2 7   ? 54.871 40.307  -17.060 1.00 34.60  ? 7   DG  B C4    1 
ATOM   2623 P  P     . DG  E  2 8   ? 60.033 43.119  -14.643 1.00 34.79  ? 8   DG  B P     1 
ATOM   2624 O  OP1   . DG  E  2 8   ? 60.904 44.284  -14.919 1.00 36.13  ? 8   DG  B OP1   1 
ATOM   2625 O  OP2   . DG  E  2 8   ? 60.417 42.132  -13.611 1.00 34.68  ? 8   DG  B OP2   1 
ATOM   2626 O  "O5'" . DG  E  2 8   ? 58.572 43.653  -14.287 1.00 34.13  ? 8   DG  B "O5'" 1 
ATOM   2627 C  "C5'" . DG  E  2 8   ? 57.960 44.627  -15.113 1.00 34.06  ? 8   DG  B "C5'" 1 
ATOM   2628 C  "C4'" . DG  E  2 8   ? 56.603 45.017  -14.562 1.00 34.05  ? 8   DG  B "C4'" 1 
ATOM   2629 O  "O4'" . DG  E  2 8   ? 55.646 43.968  -14.837 1.00 33.61  ? 8   DG  B "O4'" 1 
ATOM   2630 C  "C3'" . DG  E  2 8   ? 56.568 45.255  -13.051 1.00 33.99  ? 8   DG  B "C3'" 1 
ATOM   2631 O  "O3'" . DG  E  2 8   ? 56.005 46.534  -12.779 1.00 34.77  ? 8   DG  B "O3'" 1 
ATOM   2632 C  "C2'" . DG  E  2 8   ? 55.692 44.116  -12.513 1.00 33.65  ? 8   DG  B "C2'" 1 
ATOM   2633 C  "C1'" . DG  E  2 8   ? 54.825 43.781  -13.714 1.00 33.78  ? 8   DG  B "C1'" 1 
ATOM   2634 N  N9    . DG  E  2 8   ? 54.355 42.401  -13.726 1.00 33.41  ? 8   DG  B N9    1 
ATOM   2635 C  C8    . DG  E  2 8   ? 55.126 41.267  -13.652 1.00 32.55  ? 8   DG  B C8    1 
ATOM   2636 N  N7    . DG  E  2 8   ? 54.434 40.163  -13.693 1.00 32.22  ? 8   DG  B N7    1 
ATOM   2637 C  C5    . DG  E  2 8   ? 53.118 40.591  -13.806 1.00 33.13  ? 8   DG  B C5    1 
ATOM   2638 C  C6    . DG  E  2 8   ? 51.922 39.843  -13.893 1.00 33.26  ? 8   DG  B C6    1 
ATOM   2639 O  O6    . DG  E  2 8   ? 51.786 38.612  -13.889 1.00 32.57  ? 8   DG  B O6    1 
ATOM   2640 N  N1    . DG  E  2 8   ? 50.805 40.667  -13.994 1.00 34.71  ? 8   DG  B N1    1 
ATOM   2641 C  C2    . DG  E  2 8   ? 50.840 42.041  -14.009 1.00 35.45  ? 8   DG  B C2    1 
ATOM   2642 N  N2    . DG  E  2 8   ? 49.657 42.664  -14.113 1.00 36.66  ? 8   DG  B N2    1 
ATOM   2643 N  N3    . DG  E  2 8   ? 51.955 42.755  -13.928 1.00 35.18  ? 8   DG  B N3    1 
ATOM   2644 C  C4    . DG  E  2 8   ? 53.052 41.967  -13.829 1.00 33.99  ? 8   DG  B C4    1 
ATOM   2645 P  P     . DA  E  2 9   ? 55.866 47.061  -11.268 1.00 35.19  ? 9   DA  B P     1 
ATOM   2646 O  OP1   . DA  E  2 9   ? 55.914 48.540  -11.307 1.00 35.92  ? 9   DA  B OP1   1 
ATOM   2647 O  OP2   . DA  E  2 9   ? 56.828 46.311  -10.430 1.00 34.36  ? 9   DA  B OP2   1 
ATOM   2648 O  "O5'" . DA  E  2 9   ? 54.391 46.613  -10.850 1.00 35.81  ? 9   DA  B "O5'" 1 
ATOM   2649 C  "C5'" . DA  E  2 9   ? 53.295 46.953  -11.681 1.00 37.33  ? 9   DA  B "C5'" 1 
ATOM   2650 C  "C4'" . DA  E  2 9   ? 52.009 46.341  -11.161 1.00 38.71  ? 9   DA  B "C4'" 1 
ATOM   2651 O  "O4'" . DA  E  2 9   ? 51.983 44.924  -11.450 1.00 38.25  ? 9   DA  B "O4'" 1 
ATOM   2652 C  "C3'" . DA  E  2 9   ? 51.793 46.475  -9.649  1.00 39.81  ? 9   DA  B "C3'" 1 
ATOM   2653 O  "O3'" . DA  E  2 9   ? 50.542 47.096  -9.400  1.00 41.81  ? 9   DA  B "O3'" 1 
ATOM   2654 C  "C2'" . DA  E  2 9   ? 51.811 45.027  -9.144  1.00 39.22  ? 9   DA  B "C2'" 1 
ATOM   2655 C  "C1'" . DA  E  2 9   ? 51.361 44.270  -10.380 1.00 39.29  ? 9   DA  B "C1'" 1 
ATOM   2656 N  N9    . DA  E  2 9   ? 51.765 42.868  -10.391 1.00 39.59  ? 9   DA  B N9    1 
ATOM   2657 C  C8    . DA  E  2 9   ? 53.026 42.372  -10.220 1.00 38.95  ? 9   DA  B C8    1 
ATOM   2658 N  N7    . DA  E  2 9   ? 53.093 41.063  -10.281 1.00 38.28  ? 9   DA  B N7    1 
ATOM   2659 C  C5    . DA  E  2 9   ? 51.783 40.675  -10.509 1.00 39.01  ? 9   DA  B C5    1 
ATOM   2660 C  C6    . DA  E  2 9   ? 51.181 39.412  -10.674 1.00 39.37  ? 9   DA  B C6    1 
ATOM   2661 N  N6    . DA  E  2 9   ? 51.860 38.262  -10.630 1.00 38.63  ? 9   DA  B N6    1 
ATOM   2662 N  N1    . DA  E  2 9   ? 49.849 39.377  -10.886 1.00 40.43  ? 9   DA  B N1    1 
ATOM   2663 C  C2    . DA  E  2 9   ? 49.172 40.531  -10.930 1.00 41.24  ? 9   DA  B C2    1 
ATOM   2664 N  N3    . DA  E  2 9   ? 49.627 41.775  -10.790 1.00 41.28  ? 9   DA  B N3    1 
ATOM   2665 C  C4    . DA  E  2 9   ? 50.952 41.776  -10.580 1.00 40.02  ? 9   DA  B C4    1 
ATOM   2666 P  P     . DG  E  2 10  ? 50.316 47.961  -8.066  1.00 44.17  ? 10  DG  B P     1 
ATOM   2667 O  OP1   . DG  E  2 10  ? 50.048 49.358  -8.478  1.00 45.53  ? 10  DG  B OP1   1 
ATOM   2668 O  OP2   . DG  E  2 10  ? 51.427 47.658  -7.137  1.00 43.73  ? 10  DG  B OP2   1 
ATOM   2669 O  "O5'" . DG  E  2 10  ? 48.983 47.344  -7.437  1.00 44.36  ? 10  DG  B "O5'" 1 
ATOM   2670 C  "C5'" . DG  E  2 10  ? 47.761 47.422  -8.155  1.00 44.51  ? 10  DG  B "C5'" 1 
ATOM   2671 C  "C4'" . DG  E  2 10  ? 46.802 46.337  -7.700  1.00 44.47  ? 10  DG  B "C4'" 1 
ATOM   2672 O  "O4'" . DG  E  2 10  ? 47.301 45.043  -8.112  1.00 42.68  ? 10  DG  B "O4'" 1 
ATOM   2673 C  "C3'" . DG  E  2 10  ? 46.588 46.260  -6.185  1.00 45.58  ? 10  DG  B "C3'" 1 
ATOM   2674 O  "O3'" . DG  E  2 10  ? 45.200 46.339  -5.893  1.00 47.76  ? 10  DG  B "O3'" 1 
ATOM   2675 C  "C2'" . DG  E  2 10  ? 47.178 44.899  -5.789  1.00 44.20  ? 10  DG  B "C2'" 1 
ATOM   2676 C  "C1'" . DG  E  2 10  ? 47.078 44.112  -7.085  1.00 42.87  ? 10  DG  B "C1'" 1 
ATOM   2677 N  N9    . DG  E  2 10  ? 48.084 43.061  -7.202  1.00 40.73  ? 10  DG  B N9    1 
ATOM   2678 C  C8    . DG  E  2 10  ? 49.446 43.227  -7.228  1.00 39.51  ? 10  DG  B C8    1 
ATOM   2679 N  N7    . DG  E  2 10  ? 50.105 42.109  -7.346  1.00 38.25  ? 10  DG  B N7    1 
ATOM   2680 C  C5    . DG  E  2 10  ? 49.117 41.137  -7.406  1.00 38.77  ? 10  DG  B C5    1 
ATOM   2681 C  C6    . DG  E  2 10  ? 49.229 39.733  -7.536  1.00 37.70  ? 10  DG  B C6    1 
ATOM   2682 O  O6    . DG  E  2 10  ? 50.258 39.051  -7.627  1.00 36.65  ? 10  DG  B O6    1 
ATOM   2683 N  N1    . DG  E  2 10  ? 47.981 39.115  -7.557  1.00 38.39  ? 10  DG  B N1    1 
ATOM   2684 C  C2    . DG  E  2 10  ? 46.777 39.772  -7.466  1.00 39.73  ? 10  DG  B C2    1 
ATOM   2685 N  N2    . DG  E  2 10  ? 45.680 39.003  -7.503  1.00 40.38  ? 10  DG  B N2    1 
ATOM   2686 N  N3    . DG  E  2 10  ? 46.657 41.090  -7.342  1.00 40.71  ? 10  DG  B N3    1 
ATOM   2687 C  C4    . DG  E  2 10  ? 47.865 41.706  -7.320  1.00 40.16  ? 10  DG  B C4    1 
ATOM   2688 P  P     . DT  E  2 11  ? 44.692 46.443  -4.373  1.00 50.67  ? 11  DT  B P     1 
ATOM   2689 O  OP1   . DT  E  2 11  ? 43.436 47.225  -4.367  1.00 52.68  ? 11  DT  B OP1   1 
ATOM   2690 O  OP2   . DT  E  2 11  ? 45.837 46.883  -3.545  1.00 50.57  ? 11  DT  B OP2   1 
ATOM   2691 O  "O5'" . DT  E  2 11  ? 44.351 44.931  -3.986  1.00 50.89  ? 11  DT  B "O5'" 1 
ATOM   2692 C  "C5'" . DT  E  2 11  ? 43.421 44.195  -4.767  1.00 51.28  ? 11  DT  B "C5'" 1 
ATOM   2693 C  "C4'" . DT  E  2 11  ? 43.438 42.730  -4.377  1.00 51.38  ? 11  DT  B "C4'" 1 
ATOM   2694 O  "O4'" . DT  E  2 11  ? 44.669 42.130  -4.819  1.00 48.93  ? 11  DT  B "O4'" 1 
ATOM   2695 C  "C3'" . DT  E  2 11  ? 43.373 42.471  -2.872  1.00 53.52  ? 11  DT  B "C3'" 1 
ATOM   2696 O  "O3'" . DT  E  2 11  ? 42.067 42.034  -2.510  1.00 56.31  ? 11  DT  B "O3'" 1 
ATOM   2697 C  "C2'" . DT  E  2 11  ? 44.431 41.381  -2.615  1.00 51.53  ? 11  DT  B "C2'" 1 
ATOM   2698 C  "C1'" . DT  E  2 11  ? 44.924 41.015  -4.012  1.00 48.69  ? 11  DT  B "C1'" 1 
ATOM   2699 N  N1    . DT  E  2 11  ? 46.382 40.716  -4.062  1.00 45.99  ? 11  DT  B N1    1 
ATOM   2700 C  C2    . DT  E  2 11  ? 46.796 39.417  -4.240  1.00 44.90  ? 11  DT  B C2    1 
ATOM   2701 O  O2    . DT  E  2 11  ? 46.025 38.481  -4.367  1.00 45.60  ? 11  DT  B O2    1 
ATOM   2702 N  N3    . DT  E  2 11  ? 48.154 39.249  -4.271  1.00 43.06  ? 11  DT  B N3    1 
ATOM   2703 C  C4    . DT  E  2 11  ? 49.120 40.231  -4.140  1.00 42.28  ? 11  DT  B C4    1 
ATOM   2704 O  O4    . DT  E  2 11  ? 50.319 39.981  -4.181  1.00 41.13  ? 11  DT  B O4    1 
ATOM   2705 C  C5    . DT  E  2 11  ? 48.617 41.571  -3.952  1.00 43.11  ? 11  DT  B C5    1 
ATOM   2706 C  C7    . DT  E  2 11  ? 49.569 42.719  -3.797  1.00 42.36  ? 11  DT  B C7    1 
ATOM   2707 C  C6    . DT  E  2 11  ? 47.288 41.746  -3.922  1.00 44.93  ? 11  DT  B C6    1 
ATOM   2708 P  P     . DG  E  2 12  ? 41.732 41.662  -0.982  1.00 58.91  ? 12  DG  B P     1 
ATOM   2709 O  OP1   . DG  E  2 12  ? 40.282 41.879  -0.777  1.00 61.56  ? 12  DG  B OP1   1 
ATOM   2710 O  OP2   . DG  E  2 12  ? 42.709 42.358  -0.116  1.00 58.56  ? 12  DG  B OP2   1 
ATOM   2711 O  "O5'" . DG  E  2 12  ? 42.007 40.090  -0.906  1.00 58.19  ? 12  DG  B "O5'" 1 
ATOM   2712 C  "C5'" . DG  E  2 12  ? 41.403 39.217  -1.850  1.00 57.61  ? 12  DG  B "C5'" 1 
ATOM   2713 C  "C4'" . DG  E  2 12  ? 41.757 37.772  -1.546  1.00 57.07  ? 12  DG  B "C4'" 1 
ATOM   2714 O  "O4'" . DG  E  2 12  ? 43.133 37.515  -1.923  1.00 54.37  ? 12  DG  B "O4'" 1 
ATOM   2715 C  "C3'" . DG  E  2 12  ? 41.629 37.379  -0.075  1.00 58.93  ? 12  DG  B "C3'" 1 
ATOM   2716 O  "O3'" . DG  E  2 12  ? 41.007 36.106  0.034   1.00 59.45  ? 12  DG  B "O3'" 1 
ATOM   2717 C  "C2'" . DG  E  2 12  ? 43.077 37.349  0.418   1.00 57.52  ? 12  DG  B "C2'" 1 
ATOM   2718 C  "C1'" . DG  E  2 12  ? 43.837 36.951  -0.839  1.00 54.64  ? 12  DG  B "C1'" 1 
ATOM   2719 N  N9    . DG  E  2 12  ? 45.204 37.465  -0.872  1.00 52.54  ? 12  DG  B N9    1 
ATOM   2720 C  C8    . DG  E  2 12  ? 45.590 38.781  -0.823  1.00 52.25  ? 12  DG  B C8    1 
ATOM   2721 N  N7    . DG  E  2 12  ? 46.881 38.949  -0.877  1.00 50.67  ? 12  DG  B N7    1 
ATOM   2722 C  C5    . DG  E  2 12  ? 47.387 37.659  -0.965  1.00 49.97  ? 12  DG  B C5    1 
ATOM   2723 C  C6    . DG  E  2 12  ? 48.726 37.211  -1.050  1.00 48.46  ? 12  DG  B C6    1 
ATOM   2724 O  O6    . DG  E  2 12  ? 49.763 37.889  -1.066  1.00 47.72  ? 12  DG  B O6    1 
ATOM   2725 N  N1    . DG  E  2 12  ? 48.801 35.822  -1.123  1.00 48.35  ? 12  DG  B N1    1 
ATOM   2726 C  C2    . DG  E  2 12  ? 47.717 34.975  -1.114  1.00 49.58  ? 12  DG  B C2    1 
ATOM   2727 N  N2    . DG  E  2 12  ? 47.988 33.664  -1.192  1.00 49.27  ? 12  DG  B N2    1 
ATOM   2728 N  N3    . DG  E  2 12  ? 46.456 35.382  -1.034  1.00 51.00  ? 12  DG  B N3    1 
ATOM   2729 C  C4    . DG  E  2 12  ? 46.367 36.733  -0.963  1.00 51.03  ? 12  DG  B C4    1 
ATOM   2730 P  P     . DT  E  2 13  ? 40.515 35.568  1.465   1.00 61.87  ? 13  DT  B P     1 
ATOM   2731 O  OP1   . DT  E  2 13  ? 39.246 34.832  1.268   1.00 63.80  ? 13  DT  B OP1   1 
ATOM   2732 O  OP2   . DT  E  2 13  ? 40.571 36.700  2.416   1.00 63.04  ? 13  DT  B OP2   1 
ATOM   2733 O  "O5'" . DT  E  2 13  ? 41.648 34.526  1.881   1.00 59.85  ? 13  DT  B "O5'" 1 
ATOM   2734 C  "C5'" . DT  E  2 13  ? 41.958 33.443  1.021   1.00 57.40  ? 13  DT  B "C5'" 1 
ATOM   2735 C  "C4'" . DT  E  2 13  ? 43.043 32.580  1.631   1.00 56.22  ? 13  DT  B "C4'" 1 
ATOM   2736 O  "O4'" . DT  E  2 13  ? 44.335 33.181  1.381   1.00 53.79  ? 13  DT  B "O4'" 1 
ATOM   2737 C  "C3'" . DT  E  2 13  ? 42.930 32.397  3.146   1.00 58.37  ? 13  DT  B "C3'" 1 
ATOM   2738 O  "O3'" . DT  E  2 13  ? 42.932 31.014  3.471   1.00 58.80  ? 13  DT  B "O3'" 1 
ATOM   2739 C  "C2'" . DT  E  2 13  ? 44.158 33.123  3.710   1.00 57.47  ? 13  DT  B "C2'" 1 
ATOM   2740 C  "C1'" . DT  E  2 13  ? 45.127 33.090  2.538   1.00 54.42  ? 13  DT  B "C1'" 1 
ATOM   2741 N  N1    . DT  E  2 13  ? 46.092 34.228  2.533   1.00 53.14  ? 13  DT  B N1    1 
ATOM   2742 C  C2    . DT  E  2 13  ? 47.441 33.968  2.449   1.00 51.71  ? 13  DT  B C2    1 
ATOM   2743 O  O2    . DT  E  2 13  ? 47.901 32.843  2.377   1.00 51.64  ? 13  DT  B O2    1 
ATOM   2744 N  N3    . DT  E  2 13  ? 48.238 35.082  2.451   1.00 50.40  ? 13  DT  B N3    1 
ATOM   2745 C  C4    . DT  E  2 13  ? 47.830 36.401  2.528   1.00 50.61  ? 13  DT  B C4    1 
ATOM   2746 O  O4    . DT  E  2 13  ? 48.624 37.335  2.523   1.00 49.70  ? 13  DT  B O4    1 
ATOM   2747 C  C5    . DT  E  2 13  ? 46.404 36.603  2.614   1.00 52.33  ? 13  DT  B C5    1 
ATOM   2748 C  C7    . DT  E  2 13  ? 45.844 37.991  2.702   1.00 53.10  ? 13  DT  B C7    1 
ATOM   2749 C  C6    . DT  E  2 13  ? 45.614 35.519  2.612   1.00 53.56  ? 13  DT  B C6    1 
ATOM   2750 P  P     . DT  E  2 14  ? 42.481 30.530  4.934   1.00 62.21  ? 14  DT  B P     1 
ATOM   2751 O  OP1   . DT  E  2 14  ? 41.756 29.248  4.783   1.00 63.59  ? 14  DT  B OP1   1 
ATOM   2752 O  OP2   . DT  E  2 14  ? 41.818 31.672  5.600   1.00 63.98  ? 14  DT  B OP2   1 
ATOM   2753 O  "O5'" . DT  E  2 14  ? 43.867 30.255  5.681   1.00 61.14  ? 14  DT  B "O5'" 1 
ATOM   2754 C  "C5'" . DT  E  2 14  ? 44.748 29.252  5.188   1.00 58.96  ? 14  DT  B "C5'" 1 
ATOM   2755 C  "C4'" . DT  E  2 14  ? 46.137 29.404  5.781   1.00 57.57  ? 14  DT  B "C4'" 1 
ATOM   2756 O  "O4'" . DT  E  2 14  ? 46.827 30.490  5.138   1.00 54.92  ? 14  DT  B "O4'" 1 
ATOM   2757 C  "C3'" . DT  E  2 14  ? 46.173 29.768  7.252   1.00 59.86  ? 14  DT  B "C3'" 1 
ATOM   2758 O  "O3'" . DT  E  2 14  ? 46.035 28.598  8.050   1.00 62.11  ? 14  DT  B "O3'" 1 
ATOM   2759 C  "C2'" . DT  E  2 14  ? 47.565 30.395  7.402   1.00 57.45  ? 14  DT  B "C2'" 1 
ATOM   2760 C  "C1'" . DT  E  2 14  ? 47.869 30.924  5.990   1.00 54.05  ? 14  DT  B "C1'" 1 
ATOM   2761 N  N1    . DT  E  2 14  ? 47.968 32.409  5.917   1.00 52.02  ? 14  DT  B N1    1 
ATOM   2762 C  C2    . DT  E  2 14  ? 49.179 32.983  5.613   1.00 49.29  ? 14  DT  B C2    1 
ATOM   2763 O  O2    . DT  E  2 14  ? 50.188 32.336  5.396   1.00 47.66  ? 14  DT  B O2    1 
ATOM   2764 N  N3    . DT  E  2 14  ? 49.169 34.350  5.569   1.00 48.81  ? 14  DT  B N3    1 
ATOM   2765 C  C4    . DT  E  2 14  ? 48.092 35.185  5.795   1.00 50.20  ? 14  DT  B C4    1 
ATOM   2766 O  O4    . DT  E  2 14  ? 48.184 36.407  5.732   1.00 50.13  ? 14  DT  B O4    1 
ATOM   2767 C  C5    . DT  E  2 14  ? 46.851 34.521  6.110   1.00 52.20  ? 14  DT  B C5    1 
ATOM   2768 C  C7    . DT  E  2 14  ? 45.612 35.325  6.375   1.00 53.99  ? 14  DT  B C7    1 
ATOM   2769 C  C6    . DT  E  2 14  ? 46.848 33.180  6.157   1.00 52.98  ? 14  DT  B C6    1 
ATOM   2770 P  P     . DA  F  3 2   ? 57.974 41.087  4.973   1.00 55.41  ? 2   DA  C P     1 
ATOM   2771 O  OP1   . DA  F  3 2   ? 58.702 41.627  6.144   1.00 57.32  ? 2   DA  C OP1   1 
ATOM   2772 O  OP2   . DA  F  3 2   ? 57.926 41.853  3.709   1.00 55.53  ? 2   DA  C OP2   1 
ATOM   2773 O  "O5'" . DA  F  3 2   ? 58.537 39.633  4.622   1.00 54.28  ? 2   DA  C "O5'" 1 
ATOM   2774 C  "C5'" . DA  F  3 2   ? 59.132 38.837  5.636   1.00 54.79  ? 2   DA  C "C5'" 1 
ATOM   2775 C  "C4'" . DA  F  3 2   ? 58.927 37.358  5.352   1.00 53.85  ? 2   DA  C "C4'" 1 
ATOM   2776 O  "O4'" . DA  F  3 2   ? 57.579 36.973  5.723   1.00 52.53  ? 2   DA  C "O4'" 1 
ATOM   2777 C  "C3'" . DA  F  3 2   ? 59.104 36.951  3.893   1.00 52.75  ? 2   DA  C "C3'" 1 
ATOM   2778 O  "O3'" . DA  F  3 2   ? 59.745 35.681  3.815   1.00 53.55  ? 2   DA  C "O3'" 1 
ATOM   2779 C  "C2'" . DA  F  3 2   ? 57.670 36.894  3.368   1.00 50.94  ? 2   DA  C "C2'" 1 
ATOM   2780 C  "C1'" . DA  F  3 2   ? 56.890 36.459  4.602   1.00 51.66  ? 2   DA  C "C1'" 1 
ATOM   2781 N  N9    . DA  F  3 2   ? 55.528 36.981  4.628   1.00 51.23  ? 2   DA  C N9    1 
ATOM   2782 C  C8    . DA  F  3 2   ? 55.151 38.294  4.584   1.00 50.53  ? 2   DA  C C8    1 
ATOM   2783 N  N7    . DA  F  3 2   ? 53.853 38.474  4.620   1.00 49.50  ? 2   DA  C N7    1 
ATOM   2784 C  C5    . DA  F  3 2   ? 53.341 37.189  4.691   1.00 50.23  ? 2   DA  C C5    1 
ATOM   2785 C  C6    . DA  F  3 2   ? 52.024 36.693  4.757   1.00 50.42  ? 2   DA  C C6    1 
ATOM   2786 N  N6    . DA  F  3 2   ? 50.943 37.479  4.760   1.00 50.23  ? 2   DA  C N6    1 
ATOM   2787 N  N1    . DA  F  3 2   ? 51.862 35.355  4.818   1.00 50.77  ? 2   DA  C N1    1 
ATOM   2788 C  C2    . DA  F  3 2   ? 52.947 34.573  4.816   1.00 51.22  ? 2   DA  C C2    1 
ATOM   2789 N  N3    . DA  F  3 2   ? 54.231 34.922  4.756   1.00 51.61  ? 2   DA  C N3    1 
ATOM   2790 C  C4    . DA  F  3 2   ? 54.361 36.256  4.696   1.00 51.06  ? 2   DA  C C4    1 
ATOM   2791 P  P     . DA  F  3 3   ? 60.123 35.046  2.386   1.00 53.02  ? 3   DA  C P     1 
ATOM   2792 O  OP1   . DA  F  3 3   ? 61.409 34.331  2.542   1.00 55.76  ? 3   DA  C OP1   1 
ATOM   2793 O  OP2   . DA  F  3 3   ? 59.986 36.100  1.357   1.00 51.45  ? 3   DA  C OP2   1 
ATOM   2794 O  "O5'" . DA  F  3 3   ? 58.986 33.951  2.147   1.00 51.00  ? 3   DA  C "O5'" 1 
ATOM   2795 C  "C5'" . DA  F  3 3   ? 58.817 32.895  3.080   1.00 51.57  ? 3   DA  C "C5'" 1 
ATOM   2796 C  "C4'" . DA  F  3 3   ? 57.703 31.965  2.641   1.00 50.46  ? 3   DA  C "C4'" 1 
ATOM   2797 O  "O4'" . DA  F  3 3   ? 56.420 32.615  2.830   1.00 48.54  ? 3   DA  C "O4'" 1 
ATOM   2798 C  "C3'" . DA  F  3 3   ? 57.761 31.542  1.175   1.00 49.60  ? 3   DA  C "C3'" 1 
ATOM   2799 O  "O3'" . DA  F  3 3   ? 57.463 30.159  1.061   1.00 51.34  ? 3   DA  C "O3'" 1 
ATOM   2800 C  "C2'" . DA  F  3 3   ? 56.694 32.411  0.509   1.00 47.17  ? 3   DA  C "C2'" 1 
ATOM   2801 C  "C1'" . DA  F  3 3   ? 55.680 32.584  1.630   1.00 47.48  ? 3   DA  C "C1'" 1 
ATOM   2802 N  N9    . DA  F  3 3   ? 54.922 33.827  1.536   1.00 45.69  ? 3   DA  C N9    1 
ATOM   2803 C  C8    . DA  F  3 3   ? 55.425 35.083  1.345   1.00 44.57  ? 3   DA  C C8    1 
ATOM   2804 N  N7    . DA  F  3 3   ? 54.508 36.021  1.306   1.00 42.93  ? 3   DA  C N7    1 
ATOM   2805 C  C5    . DA  F  3 3   ? 53.321 35.332  1.488   1.00 43.95  ? 3   DA  C C5    1 
ATOM   2806 C  C6    . DA  F  3 3   ? 51.978 35.754  1.548   1.00 42.91  ? 3   DA  C C6    1 
ATOM   2807 N  N6    . DA  F  3 3   ? 51.604 37.031  1.424   1.00 42.14  ? 3   DA  C N6    1 
ATOM   2808 N  N1    . DA  F  3 3   ? 51.033 34.810  1.740   1.00 43.71  ? 3   DA  C N1    1 
ATOM   2809 C  C2    . DA  F  3 3   ? 51.414 33.532  1.863   1.00 45.14  ? 3   DA  C C2    1 
ATOM   2810 N  N3    . DA  F  3 3   ? 52.641 33.015  1.824   1.00 46.12  ? 3   DA  C N3    1 
ATOM   2811 C  C4    . DA  F  3 3   ? 53.557 33.977  1.630   1.00 45.19  ? 3   DA  C C4    1 
ATOM   2812 P  P     . DC  F  3 4   ? 57.645 29.408  -0.346  1.00 52.10  ? 4   DC  C P     1 
ATOM   2813 O  OP1   . DC  F  3 4   ? 57.947 27.987  -0.061  1.00 53.98  ? 4   DC  C OP1   1 
ATOM   2814 O  OP2   . DC  F  3 4   ? 58.576 30.211  -1.169  1.00 51.49  ? 4   DC  C OP2   1 
ATOM   2815 O  "O5'" . DC  F  3 4   ? 56.197 29.499  -1.012  1.00 50.34  ? 4   DC  C "O5'" 1 
ATOM   2816 C  "C5'" . DC  F  3 4   ? 55.079 28.930  -0.348  1.00 51.14  ? 4   DC  C "C5'" 1 
ATOM   2817 C  "C4'" . DC  F  3 4   ? 53.789 29.302  -1.051  1.00 50.54  ? 4   DC  C "C4'" 1 
ATOM   2818 O  "O4'" . DC  F  3 4   ? 53.437 30.658  -0.730  1.00 48.02  ? 4   DC  C "O4'" 1 
ATOM   2819 C  "C3'" . DC  F  3 4   ? 53.850 29.248  -2.577  1.00 51.45  ? 4   DC  C "C3'" 1 
ATOM   2820 O  "O3'" . DC  F  3 4   ? 53.203 28.071  -3.046  1.00 55.56  ? 4   DC  C "O3'" 1 
ATOM   2821 C  "C2'" . DC  F  3 4   ? 53.120 30.525  -3.041  1.00 48.19  ? 4   DC  C "C2'" 1 
ATOM   2822 C  "C1'" . DC  F  3 4   ? 52.593 31.129  -1.741  1.00 46.99  ? 4   DC  C "C1'" 1 
ATOM   2823 N  N1    . DC  F  3 4   ? 52.614 32.617  -1.730  1.00 44.97  ? 4   DC  C N1    1 
ATOM   2824 C  C2    . DC  F  3 4   ? 51.416 33.323  -1.584  1.00 44.37  ? 4   DC  C C2    1 
ATOM   2825 O  O2    . DC  F  3 4   ? 50.359 32.694  -1.458  1.00 45.28  ? 4   DC  C O2    1 
ATOM   2826 N  N3    . DC  F  3 4   ? 51.448 34.677  -1.581  1.00 43.46  ? 4   DC  C N3    1 
ATOM   2827 C  C4    . DC  F  3 4   ? 52.611 35.316  -1.721  1.00 42.65  ? 4   DC  C C4    1 
ATOM   2828 N  N4    . DC  F  3 4   ? 52.594 36.652  -1.712  1.00 41.24  ? 4   DC  C N4    1 
ATOM   2829 C  C5    . DC  F  3 4   ? 53.842 34.614  -1.873  1.00 43.18  ? 4   DC  C C5    1 
ATOM   2830 C  C6    . DC  F  3 4   ? 53.797 33.278  -1.874  1.00 44.41  ? 4   DC  C C6    1 
ATOM   2831 P  P     . DA  F  3 5   ? 53.115 27.768  -4.622  1.00 58.13  ? 5   DA  C P     1 
ATOM   2832 O  OP1   . DA  F  3 5   ? 52.952 26.307  -4.791  1.00 60.28  ? 5   DA  C OP1   1 
ATOM   2833 O  OP2   . DA  F  3 5   ? 54.244 28.462  -5.279  1.00 57.48  ? 5   DA  C OP2   1 
ATOM   2834 O  "O5'" . DA  F  3 5   ? 51.763 28.492  -5.074  1.00 57.99  ? 5   DA  C "O5'" 1 
ATOM   2835 C  "C5'" . DA  F  3 5   ? 50.545 28.204  -4.400  1.00 59.69  ? 5   DA  C "C5'" 1 
ATOM   2836 C  "C4'" . DA  F  3 5   ? 49.499 29.264  -4.696  1.00 59.04  ? 5   DA  C "C4'" 1 
ATOM   2837 O  "O4'" . DA  F  3 5   ? 49.913 30.523  -4.139  1.00 57.57  ? 5   DA  C "O4'" 1 
ATOM   2838 C  "C3'" . DA  F  3 5   ? 49.284 29.560  -6.171  1.00 58.25  ? 5   DA  C "C3'" 1 
ATOM   2839 O  "O3'" . DA  F  3 5   ? 48.278 28.699  -6.703  1.00 60.17  ? 5   DA  C "O3'" 1 
ATOM   2840 C  "C2'" . DA  F  3 5   ? 48.827 31.027  -6.178  1.00 56.61  ? 5   DA  C "C2'" 1 
ATOM   2841 C  "C1'" . DA  F  3 5   ? 49.181 31.541  -4.776  1.00 56.79  ? 5   DA  C "C1'" 1 
ATOM   2842 N  N9    . DA  F  3 5   ? 49.979 32.763  -4.797  1.00 55.41  ? 5   DA  C N9    1 
ATOM   2843 C  C8    . DA  F  3 5   ? 51.333 32.862  -4.950  1.00 54.91  ? 5   DA  C C8    1 
ATOM   2844 N  N7    . DA  F  3 5   ? 51.778 34.096  -4.936  1.00 53.54  ? 5   DA  C N7    1 
ATOM   2845 C  C5    . DA  F  3 5   ? 50.635 34.860  -4.766  1.00 54.05  ? 5   DA  C C5    1 
ATOM   2846 C  C6    . DA  F  3 5   ? 50.427 36.250  -4.671  1.00 53.17  ? 5   DA  C C6    1 
ATOM   2847 N  N6    . DA  F  3 5   ? 51.415 37.148  -4.736  1.00 52.83  ? 5   DA  C N6    1 
ATOM   2848 N  N1    . DA  F  3 5   ? 49.159 36.682  -4.504  1.00 53.74  ? 5   DA  C N1    1 
ATOM   2849 C  C2    . DA  F  3 5   ? 48.173 35.780  -4.439  1.00 54.34  ? 5   DA  C C2    1 
ATOM   2850 N  N3    . DA  F  3 5   ? 48.246 34.453  -4.516  1.00 54.84  ? 5   DA  C N3    1 
ATOM   2851 C  C4    . DA  F  3 5   ? 49.517 34.054  -4.681  1.00 54.58  ? 5   DA  C C4    1 
ATOM   2852 P  P     . DC  F  3 6   ? 47.840 28.820  -8.247  1.00 60.57  ? 6   DC  C P     1 
ATOM   2853 O  OP1   . DC  F  3 6   ? 47.210 27.538  -8.634  1.00 63.41  ? 6   DC  C OP1   1 
ATOM   2854 O  OP2   . DC  F  3 6   ? 49.000 29.337  -9.007  1.00 59.20  ? 6   DC  C OP2   1 
ATOM   2855 O  "O5'" . DC  F  3 6   ? 46.721 29.965  -8.249  1.00 58.08  ? 6   DC  C "O5'" 1 
ATOM   2856 C  "C5'" . DC  F  3 6   ? 45.624 29.900  -7.343  1.00 57.45  ? 6   DC  C "C5'" 1 
ATOM   2857 C  "C4'" . DC  F  3 6   ? 44.775 31.157  -7.439  1.00 54.59  ? 6   DC  C "C4'" 1 
ATOM   2858 O  "O4'" . DC  F  3 6   ? 45.554 32.309  -7.018  1.00 51.64  ? 6   DC  C "O4'" 1 
ATOM   2859 C  "C3'" . DC  F  3 6   ? 44.258 31.477  -8.842  1.00 53.60  ? 6   DC  C "C3'" 1 
ATOM   2860 O  "O3'" . DC  F  3 6   ? 42.888 31.853  -8.779  1.00 54.57  ? 6   DC  C "O3'" 1 
ATOM   2861 C  "C2'" . DC  F  3 6   ? 45.143 32.640  -9.293  1.00 50.97  ? 6   DC  C "C2'" 1 
ATOM   2862 C  "C1'" . DC  F  3 6   ? 45.435 33.336  -7.975  1.00 50.05  ? 6   DC  C "C1'" 1 
ATOM   2863 N  N1    . DC  F  3 6   ? 46.706 34.118  -7.990  1.00 47.84  ? 6   DC  C N1    1 
ATOM   2864 C  C2    . DC  F  3 6   ? 46.684 35.494  -7.732  1.00 47.05  ? 6   DC  C C2    1 
ATOM   2865 O  O2    . DC  F  3 6   ? 45.605 36.046  -7.487  1.00 48.09  ? 6   DC  C O2    1 
ATOM   2866 N  N3    . DC  F  3 6   ? 47.852 36.183  -7.754  1.00 45.52  ? 6   DC  C N3    1 
ATOM   2867 C  C4    . DC  F  3 6   ? 48.996 35.549  -8.022  1.00 44.88  ? 6   DC  C C4    1 
ATOM   2868 N  N4    . DC  F  3 6   ? 50.121 36.267  -8.033  1.00 44.31  ? 6   DC  C N4    1 
ATOM   2869 C  C5    . DC  F  3 6   ? 49.035 34.150  -8.290  1.00 45.60  ? 6   DC  C C5    1 
ATOM   2870 C  C6    . DC  F  3 6   ? 47.878 33.484  -8.267  1.00 47.12  ? 6   DC  C C6    1 
ATOM   2871 P  P     . DT  F  3 7   ? 42.023 31.976  -10.127 1.00 56.16  ? 7   DT  C P     1 
ATOM   2872 O  OP1   . DT  F  3 7   ? 40.592 31.899  -9.754  1.00 58.25  ? 7   DT  C OP1   1 
ATOM   2873 O  OP2   . DT  F  3 7   ? 42.582 31.019  -11.106 1.00 56.47  ? 7   DT  C OP2   1 
ATOM   2874 O  "O5'" . DT  F  3 7   ? 42.340 33.452  -10.649 1.00 54.60  ? 7   DT  C "O5'" 1 
ATOM   2875 C  "C5'" . DT  F  3 7   ? 42.104 34.569  -9.802  1.00 53.86  ? 7   DT  C "C5'" 1 
ATOM   2876 C  "C4'" . DT  F  3 7   ? 42.573 35.852  -10.462 1.00 52.05  ? 7   DT  C "C4'" 1 
ATOM   2877 O  "O4'" . DT  F  3 7   ? 43.983 36.051  -10.205 1.00 49.09  ? 7   DT  C "O4'" 1 
ATOM   2878 C  "C3'" . DT  F  3 7   ? 42.402 35.893  -11.985 1.00 52.52  ? 7   DT  C "C3'" 1 
ATOM   2879 O  "O3'" . DT  F  3 7   ? 41.620 37.019  -12.355 1.00 54.12  ? 7   DT  C "O3'" 1 
ATOM   2880 C  "C2'" . DT  F  3 7   ? 43.837 36.000  -12.520 1.00 49.64  ? 7   DT  C "C2'" 1 
ATOM   2881 C  "C1'" . DT  F  3 7   ? 44.560 36.632  -11.343 1.00 47.47  ? 7   DT  C "C1'" 1 
ATOM   2882 N  N1    . DT  F  3 7   ? 46.032 36.371  -11.327 1.00 44.49  ? 7   DT  C N1    1 
ATOM   2883 C  C2    . DT  F  3 7   ? 46.899 37.420  -11.117 1.00 42.35  ? 7   DT  C C2    1 
ATOM   2884 O  O2    . DT  F  3 7   ? 46.530 38.566  -10.934 1.00 42.23  ? 7   DT  C O2    1 
ATOM   2885 N  N3    . DT  F  3 7   ? 48.225 37.076  -11.123 1.00 40.76  ? 7   DT  C N3    1 
ATOM   2886 C  C4    . DT  F  3 7   ? 48.761 35.817  -11.318 1.00 40.41  ? 7   DT  C C4    1 
ATOM   2887 O  O4    . DT  F  3 7   ? 49.969 35.609  -11.307 1.00 39.26  ? 7   DT  C O4    1 
ATOM   2888 C  C5    . DT  F  3 7   ? 47.797 34.763  -11.536 1.00 42.00  ? 7   DT  C C5    1 
ATOM   2889 C  C7    . DT  F  3 7   ? 48.258 33.353  -11.761 1.00 42.13  ? 7   DT  C C7    1 
ATOM   2890 C  C6    . DT  F  3 7   ? 46.495 35.088  -11.531 1.00 43.97  ? 7   DT  C C6    1 
ATOM   2891 P  P     . DC  F  3 8   ? 40.479 36.878  -13.479 1.00 56.55  ? 8   DC  C P     1 
ATOM   2892 O  OP1   . DC  F  3 8   ? 39.163 36.902  -12.801 1.00 58.94  ? 8   DC  C OP1   1 
ATOM   2893 O  OP2   . DC  F  3 8   ? 40.842 35.734  -14.346 1.00 56.85  ? 8   DC  C OP2   1 
ATOM   2894 O  "O5'" . DC  F  3 8   ? 40.629 38.212  -14.346 1.00 54.37  ? 8   DC  C "O5'" 1 
ATOM   2895 C  "C5'" . DC  F  3 8   ? 41.809 38.437  -15.108 1.00 50.82  ? 8   DC  C "C5'" 1 
ATOM   2896 C  "C4'" . DC  F  3 8   ? 42.512 39.701  -14.643 1.00 47.83  ? 8   DC  C "C4'" 1 
ATOM   2897 O  "O4'" . DC  F  3 8   ? 43.550 39.359  -13.695 1.00 46.19  ? 8   DC  C "O4'" 1 
ATOM   2898 C  "C3'" . DC  F  3 8   ? 43.220 40.478  -15.736 1.00 45.51  ? 8   DC  C "C3'" 1 
ATOM   2899 O  "O3'" . DC  F  3 8   ? 42.303 41.365  -16.368 1.00 45.43  ? 8   DC  C "O3'" 1 
ATOM   2900 C  "C2'" . DC  F  3 8   ? 44.287 41.238  -14.952 1.00 44.52  ? 8   DC  C "C2'" 1 
ATOM   2901 C  "C1'" . DC  F  3 8   ? 44.635 40.258  -13.827 1.00 44.59  ? 8   DC  C "C1'" 1 
ATOM   2902 N  N1    . DC  F  3 8   ? 45.881 39.469  -14.075 1.00 43.80  ? 8   DC  C N1    1 
ATOM   2903 C  C2    . DC  F  3 8   ? 47.132 40.075  -13.908 1.00 42.86  ? 8   DC  C C2    1 
ATOM   2904 O  O2    . DC  F  3 8   ? 47.185 41.262  -13.564 1.00 42.88  ? 8   DC  C O2    1 
ATOM   2905 N  N3    . DC  F  3 8   ? 48.252 39.343  -14.130 1.00 42.16  ? 8   DC  C N3    1 
ATOM   2906 C  C4    . DC  F  3 8   ? 48.152 38.064  -14.499 1.00 42.20  ? 8   DC  C C4    1 
ATOM   2907 N  N4    . DC  F  3 8   ? 49.283 37.383  -14.707 1.00 41.15  ? 8   DC  C N4    1 
ATOM   2908 C  C5    . DC  F  3 8   ? 46.887 37.429  -14.671 1.00 43.51  ? 8   DC  C C5    1 
ATOM   2909 C  C6    . DC  F  3 8   ? 45.790 38.161  -14.450 1.00 44.26  ? 8   DC  C C6    1 
ATOM   2910 P  P     . DC  F  3 9   ? 42.499 41.757  -17.912 1.00 43.83  ? 9   DC  C P     1 
ATOM   2911 O  OP1   . DC  F  3 9   ? 41.310 42.509  -18.364 1.00 45.52  ? 9   DC  C OP1   1 
ATOM   2912 O  OP2   . DC  F  3 9   ? 42.908 40.525  -18.621 1.00 42.76  ? 9   DC  C OP2   1 
ATOM   2913 O  "O5'" . DC  F  3 9   ? 43.742 42.758  -17.894 1.00 42.62  ? 9   DC  C "O5'" 1 
ATOM   2914 C  "C5'" . DC  F  3 9   ? 43.674 43.964  -17.146 1.00 44.24  ? 9   DC  C "C5'" 1 
ATOM   2915 C  "C4'" . DC  F  3 9   ? 44.970 44.738  -17.279 1.00 45.83  ? 9   DC  C "C4'" 1 
ATOM   2916 O  "O4'" . DC  F  3 9   ? 46.067 43.923  -16.792 1.00 43.04  ? 9   DC  C "O4'" 1 
ATOM   2917 C  "C3'" . DC  F  3 9   ? 45.323 45.134  -18.709 1.00 48.11  ? 9   DC  C "C3'" 1 
ATOM   2918 O  "O3'" . DC  F  3 9   ? 45.787 46.475  -18.750 1.00 48.73  ? 9   DC  C "O3'" 1 
ATOM   2919 C  "C2'" . DC  F  3 9   ? 46.414 44.141  -19.108 1.00 45.80  ? 9   DC  C "C2'" 1 
ATOM   2920 C  "C1'" . DC  F  3 9   ? 47.073 43.819  -17.775 1.00 42.72  ? 9   DC  C "C1'" 1 
ATOM   2921 N  N1    . DC  F  3 9   ? 47.639 42.439  -17.723 1.00 42.16  ? 9   DC  C N1    1 
ATOM   2922 C  C2    . DC  F  3 9   ? 49.021 42.255  -17.599 1.00 41.84  ? 9   DC  C C2    1 
ATOM   2923 O  O2    . DC  F  3 9   ? 49.758 43.245  -17.524 1.00 42.96  ? 9   DC  C O2    1 
ATOM   2924 N  N3    . DC  F  3 9   ? 49.513 40.991  -17.559 1.00 41.27  ? 9   DC  C N3    1 
ATOM   2925 C  C4    . DC  F  3 9   ? 48.683 39.948  -17.642 1.00 41.82  ? 9   DC  C C4    1 
ATOM   2926 N  N4    . DC  F  3 9   ? 49.212 38.723  -17.599 1.00 40.86  ? 9   DC  C N4    1 
ATOM   2927 C  C5    . DC  F  3 9   ? 47.274 40.117  -17.773 1.00 43.50  ? 9   DC  C C5    1 
ATOM   2928 C  C6    . DC  F  3 9   ? 46.801 41.366  -17.811 1.00 43.57  ? 9   DC  C C6    1 
ATOM   2929 P  P     . DC  F  3 10  ? 45.883 47.247  -20.155 1.00 54.35  ? 10  DC  C P     1 
ATOM   2930 O  OP1   . DC  F  3 10  ? 45.853 48.701  -19.877 1.00 57.62  ? 10  DC  C OP1   1 
ATOM   2931 O  OP2   . DC  F  3 10  ? 44.885 46.647  -21.067 1.00 56.31  ? 10  DC  C OP2   1 
ATOM   2932 O  "O5'" . DC  F  3 10  ? 47.333 46.860  -20.700 1.00 54.10  ? 10  DC  C "O5'" 1 
ATOM   2933 C  "C5'" . DC  F  3 10  ? 48.483 47.195  -19.942 1.00 53.67  ? 10  DC  C "C5'" 1 
ATOM   2934 C  "C4'" . DC  F  3 10  ? 49.724 46.573  -20.549 1.00 52.91  ? 10  DC  C "C4'" 1 
ATOM   2935 O  "O4'" . DC  F  3 10  ? 49.790 45.177  -20.194 1.00 51.47  ? 10  DC  C "O4'" 1 
ATOM   2936 C  "C3'" . DC  F  3 10  ? 49.785 46.628  -22.078 1.00 53.72  ? 10  DC  C "C3'" 1 
ATOM   2937 O  "O3'" . DC  F  3 10  ? 50.858 47.469  -22.487 1.00 54.01  ? 10  DC  C "O3'" 1 
ATOM   2938 C  "C2'" . DC  F  3 10  ? 50.001 45.166  -22.513 1.00 52.38  ? 10  DC  C "C2'" 1 
ATOM   2939 C  "C1'" . DC  F  3 10  ? 50.441 44.487  -21.224 1.00 50.57  ? 10  DC  C "C1'" 1 
ATOM   2940 N  N1    . DC  F  3 10  ? 50.051 43.052  -21.146 1.00 49.05  ? 10  DC  C N1    1 
ATOM   2941 C  C2    . DC  F  3 10  ? 51.027 42.081  -20.895 1.00 48.17  ? 10  DC  C C2    1 
ATOM   2942 O  O2    . DC  F  3 10  ? 52.202 42.433  -20.741 1.00 48.33  ? 10  DC  C O2    1 
ATOM   2943 N  N3    . DC  F  3 10  ? 50.653 40.780  -20.826 1.00 47.35  ? 10  DC  C N3    1 
ATOM   2944 C  C4    . DC  F  3 10  ? 49.373 40.443  -20.997 1.00 47.26  ? 10  DC  C C4    1 
ATOM   2945 N  N4    . DC  F  3 10  ? 49.052 39.149  -20.920 1.00 46.34  ? 10  DC  C N4    1 
ATOM   2946 C  C5    . DC  F  3 10  ? 48.366 41.418  -21.253 1.00 48.55  ? 10  DC  C C5    1 
ATOM   2947 C  C6    . DC  F  3 10  ? 48.746 42.697  -21.319 1.00 49.19  ? 10  DC  C C6    1 
ATOM   2948 P  P     . DA  F  3 11  ? 51.141 47.726  -24.047 1.00 55.22  ? 11  DA  C P     1 
ATOM   2949 O  OP1   . DA  F  3 11  ? 51.834 49.028  -24.170 1.00 57.33  ? 11  DA  C OP1   1 
ATOM   2950 O  OP2   . DA  F  3 11  ? 49.882 47.487  -24.785 1.00 55.86  ? 11  DA  C OP2   1 
ATOM   2951 O  "O5'" . DA  F  3 11  ? 52.170 46.571  -24.437 1.00 53.40  ? 11  DA  C "O5'" 1 
ATOM   2952 C  "C5'" . DA  F  3 11  ? 53.304 46.336  -23.622 1.00 53.24  ? 11  DA  C "C5'" 1 
ATOM   2953 C  "C4'" . DA  F  3 11  ? 53.992 45.051  -24.030 1.00 52.68  ? 11  DA  C "C4'" 1 
ATOM   2954 O  "O4'" . DA  F  3 11  ? 53.202 43.923  -23.607 1.00 51.21  ? 11  DA  C "O4'" 1 
ATOM   2955 C  "C3'" . DA  F  3 11  ? 54.186 44.885  -25.539 1.00 53.39  ? 11  DA  C "C3'" 1 
ATOM   2956 O  "O3'" . DA  F  3 11  ? 55.567 44.984  -25.864 1.00 54.10  ? 11  DA  C "O3'" 1 
ATOM   2957 C  "C2'" . DA  F  3 11  ? 53.626 43.487  -25.851 1.00 51.73  ? 11  DA  C "C2'" 1 
ATOM   2958 C  "C1'" . DA  F  3 11  ? 53.469 42.859  -24.474 1.00 49.56  ? 11  DA  C "C1'" 1 
ATOM   2959 N  N9    . DA  F  3 11  ? 52.365 41.909  -24.403 1.00 47.62  ? 11  DA  C N9    1 
ATOM   2960 C  C8    . DA  F  3 11  ? 51.035 42.178  -24.561 1.00 48.09  ? 11  DA  C C8    1 
ATOM   2961 N  N7    . DA  F  3 11  ? 50.264 41.123  -24.452 1.00 48.42  ? 11  DA  C N7    1 
ATOM   2962 C  C5    . DA  F  3 11  ? 51.151 40.088  -24.208 1.00 46.56  ? 11  DA  C C5    1 
ATOM   2963 C  C6    . DA  F  3 11  ? 50.964 38.709  -23.997 1.00 45.58  ? 11  DA  C C6    1 
ATOM   2964 N  N6    . DA  F  3 11  ? 49.764 38.120  -24.000 1.00 44.67  ? 11  DA  C N6    1 
ATOM   2965 N  N1    . DA  F  3 11  ? 52.062 37.955  -23.781 1.00 45.42  ? 11  DA  C N1    1 
ATOM   2966 C  C2    . DA  F  3 11  ? 53.262 38.549  -23.779 1.00 45.14  ? 11  DA  C C2    1 
ATOM   2967 N  N3    . DA  F  3 11  ? 53.562 39.834  -23.965 1.00 44.96  ? 11  DA  C N3    1 
ATOM   2968 C  C4    . DA  F  3 11  ? 52.451 40.555  -24.176 1.00 46.32  ? 11  DA  C C4    1 
ATOM   2969 P  P     . DC  F  3 12  ? 56.042 45.063  -27.398 1.00 55.78  ? 12  DC  C P     1 
ATOM   2970 O  OP1   . DC  F  3 12  ? 57.003 46.183  -27.506 1.00 57.87  ? 12  DC  C OP1   1 
ATOM   2971 O  OP2   . DC  F  3 12  ? 54.847 45.043  -28.271 1.00 55.87  ? 12  DC  C OP2   1 
ATOM   2972 O  "O5'" . DC  F  3 12  ? 56.825 43.689  -27.619 1.00 54.84  ? 12  DC  C "O5'" 1 
ATOM   2973 C  "C5'" . DC  F  3 12  ? 57.854 43.307  -26.715 1.00 54.96  ? 12  DC  C "C5'" 1 
ATOM   2974 C  "C4'" . DC  F  3 12  ? 58.242 41.856  -26.928 1.00 54.23  ? 12  DC  C "C4'" 1 
ATOM   2975 O  "O4'" . DC  F  3 12  ? 57.146 40.996  -26.526 1.00 52.12  ? 12  DC  C "O4'" 1 
ATOM   2976 C  "C3'" . DC  F  3 12  ? 58.578 41.489  -28.374 1.00 55.21  ? 12  DC  C "C3'" 1 
ATOM   2977 O  "O3'" . DC  F  3 12  ? 59.788 40.747  -28.420 1.00 56.02  ? 12  DC  C "O3'" 1 
ATOM   2978 C  "C2'" . DC  F  3 12  ? 57.380 40.653  -28.830 1.00 53.54  ? 12  DC  C "C2'" 1 
ATOM   2979 C  "C1'" . DC  F  3 12  ? 56.901 40.036  -27.525 1.00 51.45  ? 12  DC  C "C1'" 1 
ATOM   2980 N  N1    . DC  F  3 12  ? 55.444 39.722  -27.524 1.00 49.43  ? 12  DC  C N1    1 
ATOM   2981 C  C2    . DC  F  3 12  ? 55.016 38.403  -27.334 1.00 48.76  ? 12  DC  C C2    1 
ATOM   2982 O  O2    . DC  F  3 12  ? 55.859 37.513  -27.167 1.00 48.61  ? 12  DC  C O2    1 
ATOM   2983 N  N3    . DC  F  3 12  ? 53.686 38.140  -27.336 1.00 48.23  ? 12  DC  C N3    1 
ATOM   2984 C  C4    . DC  F  3 12  ? 52.809 39.130  -27.520 1.00 47.49  ? 12  DC  C C4    1 
ATOM   2985 N  N4    . DC  F  3 12  ? 51.510 38.823  -27.515 1.00 47.11  ? 12  DC  C N4    1 
ATOM   2986 C  C5    . DC  F  3 12  ? 53.228 40.478  -27.716 1.00 48.02  ? 12  DC  C C5    1 
ATOM   2987 C  C6    . DC  F  3 12  ? 54.540 40.725  -27.712 1.00 48.54  ? 12  DC  C C6    1 
ATOM   2988 P  P     . DG  F  3 13  ? 60.487 40.435  -29.832 1.00 57.30  ? 13  DG  C P     1 
ATOM   2989 O  OP1   . DG  F  3 13  ? 61.937 40.256  -29.598 1.00 58.68  ? 13  DG  C OP1   1 
ATOM   2990 O  OP2   . DG  F  3 13  ? 60.013 41.450  -30.799 1.00 58.34  ? 13  DG  C OP2   1 
ATOM   2991 O  "O5'" . DG  F  3 13  ? 59.863 39.029  -30.259 1.00 55.51  ? 13  DG  C "O5'" 1 
ATOM   2992 C  "C5'" . DG  F  3 13  ? 60.018 37.904  -29.411 1.00 53.49  ? 13  DG  C "C5'" 1 
ATOM   2993 C  "C4'" . DG  F  3 13  ? 59.352 36.685  -30.017 1.00 51.95  ? 13  DG  C "C4'" 1 
ATOM   2994 O  "O4'" . DG  F  3 13  ? 57.933 36.711  -29.730 1.00 51.05  ? 13  DG  C "O4'" 1 
ATOM   2995 C  "C3'" . DG  F  3 13  ? 59.487 36.571  -31.537 1.00 51.36  ? 13  DG  C "C3'" 1 
ATOM   2996 O  "O3'" . DG  F  3 13  ? 59.915 35.262  -31.887 1.00 51.36  ? 13  DG  C "O3'" 1 
ATOM   2997 C  "C2'" . DG  F  3 13  ? 58.076 36.866  -32.054 1.00 50.73  ? 13  DG  C "C2'" 1 
ATOM   2998 C  "C1'" . DG  F  3 13  ? 57.211 36.398  -30.894 1.00 50.20  ? 13  DG  C "C1'" 1 
ATOM   2999 N  N9    . DG  F  3 13  ? 55.921 37.077  -30.824 1.00 47.84  ? 13  DG  C N9    1 
ATOM   3000 C  C8    . DG  F  3 13  ? 55.696 38.429  -30.906 1.00 47.15  ? 13  DG  C C8    1 
ATOM   3001 N  N7    . DG  F  3 13  ? 54.438 38.754  -30.805 1.00 46.87  ? 13  DG  C N7    1 
ATOM   3002 C  C5    . DG  F  3 13  ? 53.785 37.540  -30.642 1.00 46.62  ? 13  DG  C C5    1 
ATOM   3003 C  C6    . DG  F  3 13  ? 52.408 37.261  -30.482 1.00 46.80  ? 13  DG  C C6    1 
ATOM   3004 O  O6    . DG  F  3 13  ? 51.463 38.061  -30.450 1.00 46.41  ? 13  DG  C O6    1 
ATOM   3005 N  N1    . DG  F  3 13  ? 52.170 35.896  -30.350 1.00 46.34  ? 13  DG  C N1    1 
ATOM   3006 C  C2    . DG  F  3 13  ? 53.142 34.922  -30.371 1.00 46.08  ? 13  DG  C C2    1 
ATOM   3007 N  N2    . DG  F  3 13  ? 52.719 33.658  -30.228 1.00 46.49  ? 13  DG  C N2    1 
ATOM   3008 N  N3    . DG  F  3 13  ? 54.437 35.170  -30.521 1.00 46.70  ? 13  DG  C N3    1 
ATOM   3009 C  C4    . DG  F  3 13  ? 54.685 36.497  -30.651 1.00 46.93  ? 13  DG  C C4    1 
ATOM   3010 P  P     . DC  F  3 14  ? 60.566 34.983  -33.329 1.00 50.97  ? 14  DC  C P     1 
ATOM   3011 O  OP1   . DC  F  3 14  ? 61.789 34.173  -33.124 1.00 51.97  ? 14  DC  C OP1   1 
ATOM   3012 O  OP2   . DC  F  3 14  ? 60.652 36.277  -34.040 1.00 50.62  ? 14  DC  C OP2   1 
ATOM   3013 O  "O5'" . DC  F  3 14  ? 59.472 34.081  -34.068 1.00 49.73  ? 14  DC  C "O5'" 1 
ATOM   3014 C  "C5'" . DC  F  3 14  ? 59.170 32.785  -33.565 1.00 48.96  ? 14  DC  C "C5'" 1 
ATOM   3015 C  "C4'" . DC  F  3 14  ? 57.754 32.377  -33.929 1.00 47.70  ? 14  DC  C "C4'" 1 
ATOM   3016 O  "O4'" . DC  F  3 14  ? 56.827 33.337  -33.402 1.00 45.83  ? 14  DC  C "O4'" 1 
ATOM   3017 C  "C3'" . DC  F  3 14  ? 57.460 32.335  -35.424 1.00 47.94  ? 14  DC  C "C3'" 1 
ATOM   3018 O  "O3'" . DC  F  3 14  ? 57.633 31.011  -35.916 1.00 48.94  ? 14  DC  C "O3'" 1 
ATOM   3019 C  "C2'" . DC  F  3 14  ? 55.991 32.792  -35.535 1.00 47.34  ? 14  DC  C "C2'" 1 
ATOM   3020 C  "C1'" . DC  F  3 14  ? 55.621 33.200  -34.105 1.00 46.30  ? 14  DC  C "C1'" 1 
ATOM   3021 N  N1    . DC  F  3 14  ? 54.875 34.485  -34.026 1.00 45.58  ? 14  DC  C N1    1 
ATOM   3022 C  C2    . DC  F  3 14  ? 53.510 34.473  -33.723 1.00 45.56  ? 14  DC  C C2    1 
ATOM   3023 O  O2    . DC  F  3 14  ? 52.947 33.390  -33.528 1.00 45.97  ? 14  DC  C O2    1 
ATOM   3024 N  N3    . DC  F  3 14  ? 52.843 35.651  -33.650 1.00 45.44  ? 14  DC  C N3    1 
ATOM   3025 C  C4    . DC  F  3 14  ? 53.489 36.798  -33.867 1.00 45.03  ? 14  DC  C C4    1 
ATOM   3026 N  N4    . DC  F  3 14  ? 52.790 37.933  -33.784 1.00 45.15  ? 14  DC  C N4    1 
ATOM   3027 C  C5    . DC  F  3 14  ? 54.881 36.830  -34.177 1.00 44.69  ? 14  DC  C C5    1 
ATOM   3028 C  C6    . DC  F  3 14  ? 55.527 35.662  -34.246 1.00 44.95  ? 14  DC  C C6    1 
HETATM 3029 ZN ZN    . ZN  G  4 .   ? 80.222 19.104  -28.659 1.00 45.34  ? 501 ZN  D ZN    1 
HETATM 3030 ZN ZN    . ZN  H  4 .   ? 71.839 22.461  -8.131  1.00 23.20  ? 502 ZN  D ZN    1 
HETATM 3031 ZN ZN    . ZN  I  4 .   ? 47.231 14.640  2.019   1.00 35.57  ? 503 ZN  D ZN    1 
HETATM 3032 ZN ZN    . ZN  J  4 .   ? 57.924 -8.322  12.031  1.00 34.21  ? 504 ZN  D ZN    1 
HETATM 3033 S  S     . SO4 K  5 .   ? 75.168 11.925  -1.775  1.00 77.09  ? 505 SO4 D S     1 
HETATM 3034 O  O1    . SO4 K  5 .   ? 74.905 13.359  -1.869  1.00 77.04  ? 505 SO4 D O1    1 
HETATM 3035 O  O2    . SO4 K  5 .   ? 75.831 11.472  -2.994  1.00 77.15  ? 505 SO4 D O2    1 
HETATM 3036 O  O3    . SO4 K  5 .   ? 73.906 11.209  -1.612  1.00 77.08  ? 505 SO4 D O3    1 
HETATM 3037 O  O4    . SO4 K  5 .   ? 76.028 11.662  -0.625  1.00 77.13  ? 505 SO4 D O4    1 
HETATM 3038 S  S     . SO4 L  5 .   ? 89.232 27.759  -33.217 1.00 71.80  ? 506 SO4 D S     1 
HETATM 3039 O  O1    . SO4 L  5 .   ? 90.019 28.816  -33.846 1.00 71.75  ? 506 SO4 D O1    1 
HETATM 3040 O  O2    . SO4 L  5 .   ? 89.669 26.461  -33.723 1.00 71.70  ? 506 SO4 D O2    1 
HETATM 3041 O  O3    . SO4 L  5 .   ? 87.818 27.953  -33.529 1.00 71.67  ? 506 SO4 D O3    1 
HETATM 3042 O  O4    . SO4 L  5 .   ? 89.422 27.807  -31.770 1.00 71.87  ? 506 SO4 D O4    1 
HETATM 3043 S  S     . SO4 M  5 .   ? 94.763 21.434  -37.711 1.00 82.84  ? 507 SO4 D S     1 
HETATM 3044 O  O1    . SO4 M  5 .   ? 95.363 22.765  -37.670 1.00 82.87  ? 507 SO4 D O1    1 
HETATM 3045 O  O2    . SO4 M  5 .   ? 94.680 20.977  -39.095 1.00 82.74  ? 507 SO4 D O2    1 
HETATM 3046 O  O3    . SO4 M  5 .   ? 95.581 20.506  -36.936 1.00 82.78  ? 507 SO4 D O3    1 
HETATM 3047 O  O4    . SO4 M  5 .   ? 93.422 21.486  -37.140 1.00 82.80  ? 507 SO4 D O4    1 
HETATM 3048 S  S     . SO4 N  5 .   ? 56.320 18.056  8.525   1.00 115.16 ? 508 SO4 D S     1 
HETATM 3049 O  O1    . SO4 N  5 .   ? 55.606 16.842  8.140   1.00 115.12 ? 508 SO4 D O1    1 
HETATM 3050 O  O2    . SO4 N  5 .   ? 56.673 18.813  7.327   1.00 115.16 ? 508 SO4 D O2    1 
HETATM 3051 O  O3    . SO4 N  5 .   ? 57.536 17.698  9.250   1.00 115.14 ? 508 SO4 D O3    1 
HETATM 3052 O  O4    . SO4 N  5 .   ? 55.466 18.872  9.382   1.00 115.14 ? 508 SO4 D O4    1 
HETATM 3053 ZN ZN    . ZN  O  4 .   ? 57.561 60.558  -4.164  1.00 32.84  ? 501 ZN  A ZN    1 
HETATM 3054 ZN ZN    . ZN  P  4 .   ? 67.061 33.654  -14.499 1.00 22.95  ? 502 ZN  A ZN    1 
HETATM 3055 ZN ZN    . ZN  Q  4 .   ? 44.016 21.769  -23.737 1.00 36.96  ? 503 ZN  A ZN    1 
HETATM 3056 ZN ZN    . ZN  R  4 .   ? 35.895 45.979  -33.577 1.00 31.58  ? 504 ZN  A ZN    1 
HETATM 3057 S  S     . SO4 S  5 .   ? 65.416 37.847  -20.768 1.00 62.10  ? 505 SO4 A S     1 
HETATM 3058 O  O1    . SO4 S  5 .   ? 64.527 37.614  -21.903 1.00 61.98  ? 505 SO4 A O1    1 
HETATM 3059 O  O2    . SO4 S  5 .   ? 66.754 37.357  -21.089 1.00 61.98  ? 505 SO4 A O2    1 
HETATM 3060 O  O3    . SO4 S  5 .   ? 65.478 39.277  -20.482 1.00 62.03  ? 505 SO4 A O3    1 
HETATM 3061 O  O4    . SO4 S  5 .   ? 64.906 37.140  -19.597 1.00 62.05  ? 505 SO4 A O4    1 
HETATM 3062 S  S     . SO4 T  5 .   ? 45.361 63.254  0.493   1.00 74.75  ? 506 SO4 A S     1 
HETATM 3063 O  O1    . SO4 T  5 .   ? 45.775 63.406  -0.899  1.00 74.77  ? 506 SO4 A O1    1 
HETATM 3064 O  O2    . SO4 T  5 .   ? 43.982 63.709  0.643   1.00 74.73  ? 506 SO4 A O2    1 
HETATM 3065 O  O3    . SO4 T  5 .   ? 45.455 61.848  0.878   1.00 74.60  ? 506 SO4 A O3    1 
HETATM 3066 O  O4    . SO4 T  5 .   ? 46.231 64.053  1.352   1.00 74.75  ? 506 SO4 A O4    1 
HETATM 3067 S  S     . SO4 U  5 .   ? 51.044 62.146  -7.732  1.00 81.13  ? 507 SO4 A S     1 
HETATM 3068 O  O1    . SO4 U  5 .   ? 50.166 62.407  -8.869  1.00 81.17  ? 507 SO4 A O1    1 
HETATM 3069 O  O2    . SO4 U  5 .   ? 52.358 62.729  -7.989  1.00 81.15  ? 507 SO4 A O2    1 
HETATM 3070 O  O3    . SO4 U  5 .   ? 50.473 62.743  -6.528  1.00 80.90  ? 507 SO4 A O3    1 
HETATM 3071 O  O4    . SO4 U  5 .   ? 51.180 60.704  -7.544  1.00 81.10  ? 507 SO4 A O4    1 
HETATM 3072 S  S     . SO4 V  5 .   ? 52.906 25.879  -30.401 1.00 133.89 ? 508 SO4 A S     1 
HETATM 3073 O  O1    . SO4 V  5 .   ? 53.293 24.940  -31.450 1.00 133.89 ? 508 SO4 A O1    1 
HETATM 3074 O  O2    . SO4 V  5 .   ? 52.500 27.145  -31.006 1.00 133.90 ? 508 SO4 A O2    1 
HETATM 3075 O  O3    . SO4 V  5 .   ? 51.793 25.325  -29.637 1.00 133.87 ? 508 SO4 A O3    1 
HETATM 3076 O  O4    . SO4 V  5 .   ? 54.041 26.108  -29.511 1.00 133.85 ? 508 SO4 A O4    1 
HETATM 3077 O  O     . HOH W  6 .   ? 49.114 4.236   5.723   1.00 28.47  ? 601 HOH D O     1 
HETATM 3078 O  O     . HOH W  6 .   ? 57.900 8.396   -1.678  1.00 37.91  ? 602 HOH D O     1 
HETATM 3079 O  O     . HOH W  6 .   ? 61.195 24.991  -10.900 1.00 21.69  ? 603 HOH D O     1 
HETATM 3080 O  O     . HOH W  6 .   ? 61.198 11.039  -8.488  1.00 32.27  ? 604 HOH D O     1 
HETATM 3081 O  O     . HOH W  6 .   ? 82.483 15.492  -30.922 1.00 33.74  ? 605 HOH D O     1 
HETATM 3082 O  O     . HOH W  6 .   ? 77.477 15.502  -23.050 1.00 34.40  ? 606 HOH D O     1 
HETATM 3083 O  O     . HOH W  6 .   ? 84.690 23.476  -25.237 1.00 29.19  ? 607 HOH D O     1 
HETATM 3084 O  O     . HOH W  6 .   ? 81.338 18.098  -9.035  1.00 31.42  ? 608 HOH D O     1 
HETATM 3085 O  O     . HOH W  6 .   ? 60.641 -6.364  16.414  1.00 31.89  ? 609 HOH D O     1 
HETATM 3086 O  O     . HOH W  6 .   ? 76.336 28.532  -40.050 1.00 27.21  ? 610 HOH D O     1 
HETATM 3087 O  O     . HOH X  6 .   ? 60.823 19.966  -1.180  1.00 18.79  ? 101 HOH E O     1 
HETATM 3088 O  O     . HOH X  6 .   ? 58.524 18.505  -1.161  1.00 24.49  ? 102 HOH E O     1 
HETATM 3089 O  O     . HOH X  6 .   ? 57.694 14.948  0.130   1.00 25.59  ? 103 HOH E O     1 
HETATM 3090 O  O     . HOH X  6 .   ? 69.374 3.159   -7.465  1.00 21.77  ? 104 HOH E O     1 
HETATM 3091 O  O     . HOH Y  6 .   ? 54.632 8.463   -9.397  1.00 37.77  ? 101 HOH F O     1 
HETATM 3092 O  O     . HOH Y  6 .   ? 55.469 0.307   -10.133 1.00 27.12  ? 102 HOH F O     1 
HETATM 3093 O  O     . HOH Y  6 .   ? 56.455 4.803   -5.236  1.00 26.80  ? 103 HOH F O     1 
HETATM 3094 O  O     . HOH Z  6 .   ? 65.517 30.593  -5.928  1.00 33.49  ? 601 HOH A O     1 
HETATM 3095 O  O     . HOH Z  6 .   ? 47.335 33.793  -20.359 1.00 29.82  ? 602 HOH A O     1 
HETATM 3096 O  O     . HOH Z  6 .   ? 44.808 56.751  -28.857 1.00 35.78  ? 603 HOH A O     1 
HETATM 3097 O  O     . HOH Z  6 .   ? 43.790 40.631  -32.096 1.00 38.00  ? 604 HOH A O     1 
HETATM 3098 O  O     . HOH Z  6 .   ? 56.358 18.567  -14.116 1.00 27.72  ? 605 HOH A O     1 
HETATM 3099 O  O     . HOH Z  6 .   ? 52.014 30.627  -11.867 1.00 30.07  ? 606 HOH A O     1 
HETATM 3100 O  O     . HOH Z  6 .   ? 52.224 47.816  -2.683  1.00 37.96  ? 607 HOH A O     1 
HETATM 3101 O  O     . HOH Z  6 .   ? 66.689 67.530  -1.653  1.00 17.81  ? 608 HOH A O     1 
HETATM 3102 O  O     . HOH AA 6 .   ? 58.327 36.148  -13.290 1.00 28.19  ? 101 HOH B O     1 
HETATM 3103 O  O     . HOH AA 6 .   ? 55.511 31.735  -28.163 1.00 34.18  ? 102 HOH B O     1 
HETATM 3104 O  O     . HOH AA 6 .   ? 61.644 44.460  -17.762 1.00 33.38  ? 103 HOH B O     1 
HETATM 3105 O  O     . HOH BA 6 .   ? 54.872 38.628  0.532   1.00 31.56  ? 101 HOH C O     1 
HETATM 3106 O  O     . HOH BA 6 .   ? 53.459 25.624  -8.233  1.00 29.85  ? 102 HOH C O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . HIS A 1   ? 1.5379 0.6540 1.3773 0.1545  -0.2916 0.0538  319 HIS D N     
2    C CA    . HIS A 1   ? 1.4041 0.6413 1.2985 0.1194  -0.2737 0.0687  319 HIS D CA    
3    C C     . HIS A 1   ? 1.3383 0.6958 1.2638 0.1535  -0.2725 0.0482  319 HIS D C     
4    O O     . HIS A 1   ? 1.3707 0.7217 1.2884 0.1794  -0.2818 0.0140  319 HIS D O     
5    C CB    . HIS A 1   ? 1.3708 0.5954 1.2945 0.0496  -0.2619 0.0659  319 HIS D CB    
6    N N     . MET A 2   ? 1.2648 0.7266 1.2195 0.1515  -0.2595 0.0690  320 MET D N     
7    C CA    . MET A 2   ? 1.2032 0.7824 1.1869 0.1735  -0.2518 0.0544  320 MET D CA    
8    C C     . MET A 2   ? 1.1033 0.7509 1.1219 0.1218  -0.2325 0.0640  320 MET D C     
9    O O     . MET A 2   ? 1.0906 0.7134 1.1159 0.0756  -0.2233 0.0874  320 MET D O     
10   C CB    . MET A 2   ? 1.2059 0.8562 1.1940 0.2179  -0.2524 0.0675  320 MET D CB    
11   C CG    . MET A 2   ? 1.1851 0.9377 1.1939 0.2552  -0.2452 0.0444  320 MET D CG    
12   S SD    . MET A 2   ? 1.2819 0.9780 1.2604 0.3107  -0.2586 0.0010  320 MET D SD    
13   C CE    . MET A 2   ? 1.2030 1.0367 1.2087 0.3384  -0.2387 -0.0183 320 MET D CE    
14   N N     . ARG A 3   ? 1.0457 0.7748 1.0812 0.1325  -0.2247 0.0457  321 ARG D N     
15   C CA    . ARG A 3   ? 0.9567 0.7437 1.0166 0.0928  -0.2082 0.0498  321 ARG D CA    
16   C C     . ARG A 3   ? 0.8700 0.7319 0.9437 0.0777  -0.1887 0.0792  321 ARG D C     
17   O O     . ARG A 3   ? 0.8610 0.7712 0.9338 0.1075  -0.1878 0.0843  321 ARG D O     
18   C CB    . ARG A 3   ? 0.9403 0.7713 0.9986 0.1132  -0.2083 0.0184  321 ARG D CB    
19   C CG    . ARG A 3   ? 1.0169 0.7750 1.0547 0.1292  -0.2298 -0.0156 321 ARG D CG    
20   C CD    . ARG A 3   ? 1.0871 0.8214 1.0967 0.1876  -0.2400 -0.0343 321 ARG D CD    
21   N NE    . ARG A 3   ? 1.0886 0.8565 1.0817 0.2204  -0.2397 -0.0669 321 ARG D NE    
22   C CZ    . ARG A 3   ? 1.1515 0.9037 1.1176 0.2750  -0.2452 -0.0900 321 ARG D CZ    
23   N NH1   . ARG A 3   ? 1.2148 0.9186 1.1693 0.3062  -0.2540 -0.0837 321 ARG D NH1   
24   N NH2   . ARG A 3   ? 1.1632 0.9445 1.1090 0.3016  -0.2412 -0.1192 321 ARG D NH2   
25   N N     . PRO A 4   ? 0.8063 0.6803 0.8931 0.0320  -0.1732 0.0974  322 PRO D N     
26   C CA    . PRO A 4   ? 0.7500 0.6810 0.8406 0.0132  -0.1544 0.1248  322 PRO D CA    
27   C C     . PRO A 4   ? 0.7042 0.7239 0.7996 0.0209  -0.1387 0.1173  322 PRO D C     
28   O O     . PRO A 4   ? 0.6763 0.7510 0.7719 0.0167  -0.1267 0.1330  322 PRO D O     
29   C CB    . PRO A 4   ? 0.7281 0.6265 0.8253 -0.0359 -0.1413 0.1439  322 PRO D CB    
30   C CG    . PRO A 4   ? 0.7766 0.6040 0.8804 -0.0439 -0.1549 0.1277  322 PRO D CG    
31   C CD    . PRO A 4   ? 0.8025 0.6340 0.9014 -0.0052 -0.1727 0.0942  322 PRO D CD    
32   N N     . PHE A 5   ? 0.7048 0.7361 0.7998 0.0298  -0.1386 0.0933  323 PHE D N     
33   C CA    . PHE A 5   ? 0.6636 0.7624 0.7530 0.0283  -0.1191 0.0896  323 PHE D CA    
34   C C     . PHE A 5   ? 0.6938 0.8332 0.7743 0.0711  -0.1203 0.0648  323 PHE D C     
35   O O     . PHE A 5   ? 0.7497 0.8571 0.8269 0.1045  -0.1387 0.0447  323 PHE D O     
36   C CB    . PHE A 5   ? 0.6417 0.7257 0.7298 0.0072  -0.1161 0.0837  323 PHE D CB    
37   C CG    . PHE A 5   ? 0.6270 0.6652 0.7313 -0.0289 -0.1169 0.1014  323 PHE D CG    
38   C CD1   . PHE A 5   ? 0.5938 0.6389 0.6978 -0.0582 -0.0980 0.1315  323 PHE D CD1   
39   C CD2   . PHE A 5   ? 0.6521 0.6403 0.7712 -0.0355 -0.1349 0.0867  323 PHE D CD2   
40   C CE1   . PHE A 5   ? 0.5965 0.5995 0.7131 -0.0899 -0.0939 0.1476  323 PHE D CE1   
41   C CE2   . PHE A 5   ? 0.6486 0.6014 0.7879 -0.0710 -0.1309 0.1027  323 PHE D CE2   
42   C CZ    . PHE A 5   ? 0.6255 0.5858 0.7629 -0.0965 -0.1087 0.1337  323 PHE D CZ    
43   N N     . MET A 6   ? 0.6685 0.8742 0.7405 0.0690  -0.0974 0.0663  324 MET D N     
44   C CA    . MET A 6   ? 0.6945 0.9539 0.7605 0.1054  -0.0892 0.0471  324 MET D CA    
45   C C     . MET A 6   ? 0.6775 0.9833 0.7207 0.0923  -0.0616 0.0467  324 MET D C     
46   O O     . MET A 6   ? 0.6481 0.9560 0.6837 0.0554  -0.0469 0.0673  324 MET D O     
47   C CB    . MET A 6   ? 0.6963 1.0047 0.7862 0.1192  -0.0881 0.0572  324 MET D CB    
48   C CG    . MET A 6   ? 0.7088 1.0960 0.8044 0.1522  -0.0723 0.0406  324 MET D CG    
49   S SD    . MET A 6   ? 0.7017 1.1695 0.8381 0.1620  -0.0725 0.0547  324 MET D SD    
50   C CE    . MET A 6   ? 0.7571 1.1542 0.8989 0.2067  -0.1100 0.0486  324 MET D CE    
51   N N     . CYS A 7   ? 0.7063 1.0411 0.7314 0.1243  -0.0528 0.0232  325 CYS D N     
52   C CA    . CYS A 7   ? 0.6959 1.0733 0.6906 0.1157  -0.0224 0.0227  325 CYS D CA    
53   C C     . CYS A 7   ? 0.6743 1.1337 0.6886 0.1082  0.0038  0.0333  325 CYS D C     
54   O O     . CYS A 7   ? 0.6873 1.1876 0.7295 0.1385  0.0002  0.0225  325 CYS D O     
55   C CB    . CYS A 7   ? 0.7400 1.1054 0.6980 0.1523  -0.0229 -0.0080 325 CYS D CB    
56   S SG    . CYS A 7   ? 0.7579 1.1598 0.6616 0.1444  0.0167  -0.0084 325 CYS D SG    
57   N N     . ALA A 8   ? 0.6420 1.1253 0.6416 0.0683  0.0298  0.0534  326 ALA D N     
58   C CA    . ALA A 8   ? 0.6233 1.1860 0.6426 0.0490  0.0548  0.0639  326 ALA D CA    
59   C C     . ALA A 8   ? 0.6533 1.2755 0.6568 0.0650  0.0862  0.0469  326 ALA D C     
60   O O     . ALA A 8   ? 0.6551 1.3483 0.6724 0.0408  0.1135  0.0546  326 ALA D O     
61   C CB    . ALA A 8   ? 0.6064 1.1593 0.6085 -0.0050 0.0715  0.0914  326 ALA D CB    
62   N N     . TYR A 9   ? 0.6944 1.2891 0.6673 0.1022  0.0842  0.0234  327 TYR D N     
63   C CA    . TYR A 9   ? 0.7379 1.3839 0.6892 0.1200  0.1174  0.0065  327 TYR D CA    
64   C C     . TYR A 9   ? 0.7349 1.4622 0.7426 0.1518  0.1195  -0.0070 327 TYR D C     
65   O O     . TYR A 9   ? 0.7361 1.4464 0.7760 0.1851  0.0872  -0.0154 327 TYR D O     
66   C CB    . TYR A 9   ? 0.7884 1.3750 0.6822 0.1537  0.1121  -0.0162 327 TYR D CB    
67   N N     . PRO A 10  ? 0.7257 1.5410 0.7462 0.1430  0.1578  -0.0093 328 PRO D N     
68   C CA    . PRO A 10  ? 0.7229 1.6324 0.8066 0.1761  0.1612  -0.0226 328 PRO D CA    
69   C C     . PRO A 10  ? 0.7878 1.6851 0.8569 0.2407  0.1594  -0.0539 328 PRO D C     
70   O O     . PRO A 10  ? 0.8472 1.7622 0.8935 0.2480  0.1882  -0.0672 328 PRO D O     
71   C CB    . PRO A 10  ? 0.7480 1.6872 0.8359 0.1282  0.1875  -0.0140 328 PRO D CB    
72   C CG    . PRO A 10  ? 0.7439 1.6063 0.7836 0.0702  0.1925  0.0074  328 PRO D CG    
73   C CD    . PRO A 10  ? 0.7469 1.5361 0.7314 0.0904  0.1836  0.0043  328 PRO D CD    
74   N N     . GLY A 11  ? 0.8129 1.6433 0.8852 0.2783  0.1181  -0.0632 329 GLY D N     
75   C CA    . GLY A 11  ? 0.9007 1.7022 0.9511 0.3402  0.1123  -0.0945 329 GLY D CA    
76   C C     . GLY A 11  ? 0.9315 1.6104 0.9418 0.3546  0.0716  -0.1029 329 GLY D C     
77   O O     . GLY A 11  ? 0.9781 1.6168 0.9804 0.4052  0.0526  -0.1263 329 GLY D O     
78   N N     . CYS A 12  ? 0.9065 1.5254 0.8918 0.3099  0.0587  -0.0850 330 CYS D N     
79   C CA    . CYS A 12  ? 0.9264 1.4392 0.8842 0.3133  0.0201  -0.0914 330 CYS D CA    
80   C C     . CYS A 12  ? 0.8974 1.3874 0.9016 0.2988  -0.0101 -0.0718 330 CYS D C     
81   O O     . CYS A 12  ? 0.8607 1.3526 0.8796 0.2524  -0.0105 -0.0445 330 CYS D O     
82   C CB    . CYS A 12  ? 0.9143 1.3814 0.8226 0.2783  0.0231  -0.0843 330 CYS D CB    
83   S SG    . CYS A 12  ? 0.9171 1.2718 0.8019 0.2777  -0.0243 -0.0950 330 CYS D SG    
84   N N     . ASN A 13  ? 0.9353 1.3960 0.9550 0.3401  -0.0340 -0.0854 331 ASN D N     
85   C CA    . ASN A 13  ? 0.9220 1.3459 0.9734 0.3327  -0.0634 -0.0679 331 ASN D CA    
86   C C     . ASN A 13  ? 0.9492 1.2594 0.9738 0.3242  -0.0952 -0.0740 331 ASN D C     
87   O O     . ASN A 13  ? 0.9791 1.2339 1.0141 0.3349  -0.1206 -0.0703 331 ASN D O     
88   C CB    . ASN A 13  ? 0.9604 1.4175 1.0424 0.3843  -0.0706 -0.0757 331 ASN D CB    
89   N N     . LYS A 14  ? 0.9485 1.2232 0.9377 0.3046  -0.0946 -0.0834 332 LYS D N     
90   C CA    . LYS A 14  ? 0.9709 1.1509 0.9429 0.2910  -0.1250 -0.0915 332 LYS D CA    
91   C C     . LYS A 14  ? 0.9115 1.0727 0.9132 0.2425  -0.1335 -0.0601 332 LYS D C     
92   O O     . LYS A 14  ? 0.8548 1.0612 0.8667 0.2079  -0.1148 -0.0371 332 LYS D O     
93   C CB    . LYS A 14  ? 0.9879 1.1479 0.9166 0.2861  -0.1249 -0.1111 332 LYS D CB    
94   N N     . ARG A 15  ? 0.9285 1.0162 0.9378 0.2399  -0.1593 -0.0594 333 ARG D N     
95   C CA    . ARG A 15  ? 0.8792 0.9396 0.9127 0.1968  -0.1655 -0.0305 333 ARG D CA    
96   C C     . ARG A 15  ? 0.9023 0.8833 0.9293 0.1736  -0.1874 -0.0415 333 ARG D C     
97   O O     . ARG A 15  ? 0.9707 0.8927 0.9766 0.1962  -0.2071 -0.0693 333 ARG D O     
98   C CB    . ARG A 15  ? 0.8915 0.9388 0.9406 0.2113  -0.1731 -0.0143 333 ARG D CB    
99   C CG    . ARG A 15  ? 0.8768 1.0071 0.9382 0.2466  -0.1587 -0.0132 333 ARG D CG    
100  C CD    . ARG A 15  ? 0.8917 1.0161 0.9695 0.2604  -0.1706 0.0063  333 ARG D CD    
101  N NE    . ARG A 15  ? 0.8894 1.1017 0.9875 0.3005  -0.1614 0.0025  333 ARG D NE    
102  C CZ    . ARG A 15  ? 0.9532 1.1582 1.0462 0.3596  -0.1710 -0.0178 333 ARG D CZ    
103  N NH1   . ARG A 15  ? 1.0300 1.1315 1.0896 0.3830  -0.1906 -0.0361 333 ARG D NH1   
104  N NH2   . ARG A 15  ? 0.9480 1.2491 1.0697 0.3952  -0.1604 -0.0208 333 ARG D NH2   
105  N N     . TYR A 16  ? 0.8512 0.8318 0.8969 0.1277  -0.1833 -0.0210 334 TYR D N     
106  C CA    . TYR A 16  ? 0.8632 0.7930 0.9144 0.1005  -0.2007 -0.0318 334 TYR D CA    
107  C C     . TYR A 16  ? 0.8313 0.7243 0.9099 0.0599  -0.2007 -0.0057 334 TYR D C     
108  O O     . TYR A 16  ? 0.7842 0.7094 0.8753 0.0408  -0.1817 0.0245  334 TYR D O     
109  C CB    . TYR A 16  ? 0.8395 0.8130 0.8862 0.0882  -0.1942 -0.0369 334 TYR D CB    
110  C CG    . TYR A 16  ? 0.8719 0.8767 0.8812 0.1255  -0.1904 -0.0608 334 TYR D CG    
111  C CD1   . TYR A 16  ? 0.9338 0.9019 0.9162 0.1448  -0.2134 -0.0962 334 TYR D CD1   
112  C CD2   . TYR A 16  ? 0.8446 0.9134 0.8417 0.1387  -0.1624 -0.0489 334 TYR D CD2   
113  C CE1   . TYR A 16  ? 0.9650 0.9556 0.9041 0.1800  -0.2074 -0.1181 334 TYR D CE1   
114  C CE2   . TYR A 16  ? 0.8704 0.9660 0.8298 0.1709  -0.1534 -0.0700 334 TYR D CE2   
115  C CZ    . TYR A 16  ? 0.9310 0.9855 0.8588 0.1933  -0.1754 -0.1041 334 TYR D CZ    
116  O OH    . TYR A 16  ? 0.9674 1.0425 0.8488 0.2265  -0.1643 -0.1251 334 TYR D OH    
117  N N     . PHE A 17  ? 0.8589 0.6803 0.9427 0.0445  -0.2206 -0.0185 335 PHE D N     
118  C CA    . PHE A 17  ? 0.8315 0.6156 0.9408 0.0007  -0.2168 0.0043  335 PHE D CA    
119  C C     . PHE A 17  ? 0.7785 0.6124 0.9175 -0.0341 -0.2027 0.0179  335 PHE D C     
120  O O     . PHE A 17  ? 0.7597 0.5917 0.9166 -0.0651 -0.1860 0.0463  335 PHE D O     
121  C CB    . PHE A 17  ? 0.9092 0.6067 1.0180 -0.0140 -0.2387 -0.0156 335 PHE D CB    
122  C CG    . PHE A 17  ? 0.9509 0.5755 1.0240 0.0175  -0.2505 -0.0233 335 PHE D CG    
123  C CD1   . PHE A 17  ? 0.9445 0.5237 1.0083 0.0132  -0.2433 0.0045  335 PHE D CD1   
124  C CD2   . PHE A 17  ? 1.0005 0.5950 1.0428 0.0543  -0.2694 -0.0585 335 PHE D CD2   
125  C CE1   . PHE A 17  ? 1.0480 0.5547 1.0738 0.0483  -0.2558 -0.0014 335 PHE D CE1   
126  C CE2   . PHE A 17  ? 1.0777 0.5990 1.0830 0.0889  -0.2793 -0.0659 335 PHE D CE2   
127  C CZ    . PHE A 17  ? 1.0949 0.5726 1.0929 0.0874  -0.2732 -0.0367 335 PHE D CZ    
128  N N     . LYS A 18  ? 0.7885 0.6632 0.9275 -0.0262 -0.2091 -0.0018 336 LYS D N     
129  C CA    . LYS A 18  ? 0.7291 0.6466 0.8941 -0.0515 -0.2008 0.0068  336 LYS D CA    
130  C C     . LYS A 18  ? 0.6950 0.6747 0.8371 -0.0343 -0.1806 0.0184  336 LYS D C     
131  O O     . LYS A 18  ? 0.7164 0.7139 0.8252 -0.0014 -0.1812 0.0049  336 LYS D O     
132  C CB    . LYS A 18  ? 0.7493 0.6622 0.9292 -0.0565 -0.2280 -0.0247 336 LYS D CB    
133  C CG    . LYS A 18  ? 0.8115 0.6553 1.0034 -0.0724 -0.2510 -0.0449 336 LYS D CG    
134  C CD    . LYS A 18  ? 0.8401 0.6865 1.0426 -0.0766 -0.2823 -0.0810 336 LYS D CD    
135  C CE    . LYS A 18  ? 0.9187 0.6905 1.1316 -0.1008 -0.3043 -0.1027 336 LYS D CE    
136  N NZ    . LYS A 18  ? 0.9747 0.6768 1.1357 -0.0699 -0.3108 -0.1152 336 LYS D NZ    
137  N N     . LEU A 19  ? 0.6685 0.6769 0.8252 -0.0574 -0.1598 0.0433  337 LEU D N     
138  C CA    . LEU A 19  ? 0.6404 0.6961 0.7687 -0.0463 -0.1392 0.0546  337 LEU D CA    
139  C C     . LEU A 19  ? 0.6731 0.7501 0.7838 -0.0259 -0.1534 0.0316  337 LEU D C     
140  O O     . LEU A 19  ? 0.6840 0.7864 0.7531 -0.0048 -0.1417 0.0304  337 LEU D O     
141  C CB    . LEU A 19  ? 0.5843 0.6513 0.7247 -0.0749 -0.1133 0.0862  337 LEU D CB    
142  C CG    . LEU A 19  ? 0.5659 0.6158 0.7062 -0.0935 -0.0953 0.1128  337 LEU D CG    
143  C CD1   . LEU A 19  ? 0.5574 0.6008 0.7145 -0.1251 -0.0747 0.1378  337 LEU D CD1   
144  C CD2   . LEU A 19  ? 0.5431 0.6232 0.6476 -0.0804 -0.0790 0.1219  337 LEU D CD2   
145  N N     . SER A 20  ? 0.6939 0.7608 0.8335 -0.0335 -0.1787 0.0131  338 SER D N     
146  C CA    . SER A 20  ? 0.7202 0.8066 0.8408 -0.0127 -0.1989 -0.0101 338 SER D CA    
147  C C     . SER A 20  ? 0.7661 0.8410 0.8378 0.0215  -0.2111 -0.0364 338 SER D C     
148  O O     . SER A 20  ? 0.7904 0.8838 0.8168 0.0461  -0.2108 -0.0449 338 SER D O     
149  C CB    . SER A 20  ? 0.7454 0.8290 0.9155 -0.0309 -0.2286 -0.0282 338 SER D CB    
150  O OG    . SER A 20  ? 0.7813 0.8207 0.9754 -0.0468 -0.2446 -0.0427 338 SER D OG    
151  N N     . HIS A 21  ? 0.7894 0.8284 0.8636 0.0260  -0.2202 -0.0493 339 HIS D N     
152  C CA    . HIS A 21  ? 0.8268 0.8527 0.8541 0.0625  -0.2287 -0.0756 339 HIS D CA    
153  C C     . HIS A 21  ? 0.7923 0.8531 0.7844 0.0826  -0.1959 -0.0601 339 HIS D C     
154  O O     . HIS A 21  ? 0.8226 0.8945 0.7670 0.1123  -0.1928 -0.0768 339 HIS D O     
155  C CB    . HIS A 21  ? 0.8613 0.8326 0.8978 0.0655  -0.2460 -0.0928 339 HIS D CB    
156  C CG    . HIS A 21  ? 0.9098 0.8407 0.9679 0.0469  -0.2805 -0.1181 339 HIS D CG    
157  N ND1   . HIS A 21  ? 0.9801 0.8458 1.0317 0.0500  -0.3006 -0.1410 339 HIS D ND1   
158  C CD2   . HIS A 21  ? 0.9088 0.8568 0.9961 0.0240  -0.2991 -0.1251 339 HIS D CD2   
159  C CE1   . HIS A 21  ? 1.0205 0.8631 1.0959 0.0239  -0.3293 -0.1618 339 HIS D CE1   
160  N NE2   . HIS A 21  ? 0.9696 0.8683 1.0720 0.0082  -0.3300 -0.1530 339 HIS D NE2   
161  N N     . LEU A 22  ? 0.7240 0.8021 0.7369 0.0646  -0.1705 -0.0290 340 LEU D N     
162  C CA    . LEU A 22  ? 0.6916 0.8111 0.6781 0.0751  -0.1390 -0.0140 340 LEU D CA    
163  C C     . LEU A 22  ? 0.6817 0.8275 0.6322 0.0742  -0.1224 -0.0063 340 LEU D C     
164  O O     . LEU A 22  ? 0.7018 0.8729 0.6111 0.0913  -0.1017 -0.0086 340 LEU D O     
165  C CB    . LEU A 22  ? 0.6527 0.7831 0.6683 0.0515  -0.1207 0.0165  340 LEU D CB    
166  C CG    . LEU A 22  ? 0.5992 0.7789 0.5969 0.0485  -0.0877 0.0358  340 LEU D CG    
167  C CD1   . LEU A 22  ? 0.6207 0.8300 0.5977 0.0830  -0.0810 0.0168  340 LEU D CD1   
168  C CD2   . LEU A 22  ? 0.5600 0.7441 0.5852 0.0223  -0.0774 0.0638  340 LEU D CD2   
169  N N     . GLN A 23  ? 0.6697 0.8085 0.6333 0.0555  -0.1295 0.0029  341 GLN D N     
170  C CA    . GLN A 23  ? 0.6754 0.8284 0.5977 0.0600  -0.1165 0.0111  341 GLN D CA    
171  C C     . GLN A 23  ? 0.7403 0.8877 0.6112 0.0934  -0.1320 -0.0173 341 GLN D C     
172  O O     . GLN A 23  ? 0.7679 0.9247 0.5807 0.1069  -0.1105 -0.0129 341 GLN D O     
173  C CB    . GLN A 23  ? 0.6540 0.8029 0.6071 0.0404  -0.1246 0.0242  341 GLN D CB    
174  C CG    . GLN A 23  ? 0.6588 0.8153 0.5673 0.0464  -0.1078 0.0392  341 GLN D CG    
175  C CD    . GLN A 23  ? 0.6386 0.7969 0.5837 0.0337  -0.1159 0.0507  341 GLN D CD    
176  O OE1   . GLN A 23  ? 0.6344 0.7945 0.6361 0.0250  -0.1427 0.0379  341 GLN D OE1   
177  N NE2   . GLN A 23  ? 0.6343 0.7914 0.5471 0.0321  -0.0908 0.0745  341 GLN D NE2   
178  N N     . MET A 24  ? 0.7798 0.9056 0.6645 0.1051  -0.1686 -0.0469 342 MET D N     
179  C CA    . MET A 24  ? 0.8582 0.9717 0.6867 0.1380  -0.1863 -0.0771 342 MET D CA    
180  C C     . MET A 24  ? 0.8921 1.0119 0.6777 0.1614  -0.1613 -0.0846 342 MET D C     
181  O O     . MET A 24  ? 0.9327 1.0524 0.6520 0.1858  -0.1521 -0.0950 342 MET D O     
182  C CB    . MET A 24  ? 0.9042 0.9883 0.7572 0.1404  -0.2313 -0.1096 342 MET D CB    
183  C CG    . MET A 24  ? 0.8877 0.9770 0.7983 0.1133  -0.2557 -0.1051 342 MET D CG    
184  S SD    . MET A 24  ? 0.9452 0.9979 0.8967 0.1014  -0.3030 -0.1418 342 MET D SD    
185  C CE    . MET A 24  ? 0.8980 0.9797 0.9300 0.0629  -0.3160 -0.1272 342 MET D CE    
186  N N     . HIS A 25  ? 0.8875 1.0142 0.7091 0.1560  -0.1492 -0.0791 343 HIS D N     
187  C CA    . HIS A 25  ? 0.9348 1.0815 0.7294 0.1800  -0.1242 -0.0863 343 HIS D CA    
188  C C     . HIS A 25  ? 0.8843 1.0729 0.6528 0.1703  -0.0812 -0.0612 343 HIS D C     
189  O O     . HIS A 25  ? 0.9216 1.1293 0.6459 0.1914  -0.0574 -0.0705 343 HIS D O     
190  C CB    . HIS A 25  ? 0.9724 1.1182 0.8158 0.1807  -0.1270 -0.0861 343 HIS D CB    
191  C CG    . HIS A 25  ? 1.0708 1.2535 0.9024 0.2061  -0.0999 -0.0905 343 HIS D CG    
192  N ND1   . HIS A 25  ? 1.1569 1.3253 0.9577 0.2465  -0.1051 -0.1221 343 HIS D ND1   
193  C CD2   . HIS A 25  ? 1.0530 1.2912 0.9020 0.1966  -0.0669 -0.0686 343 HIS D CD2   
194  C CE1   . HIS A 25  ? 1.1588 1.3783 0.9639 0.2635  -0.0745 -0.1189 343 HIS D CE1   
195  N NE2   . HIS A 25  ? 1.0864 1.3522 0.9233 0.2318  -0.0524 -0.0870 343 HIS D NE2   
196  N N     . SER A 26  ? 0.8057 1.0056 0.5977 0.1370  -0.0682 -0.0303 344 SER D N     
197  C CA    . SER A 26  ? 0.7741 1.0048 0.5385 0.1209  -0.0269 -0.0063 344 SER D CA    
198  C C     . SER A 26  ? 0.8165 1.0355 0.5022 0.1366  -0.0128 -0.0116 344 SER D C     
199  O O     . SER A 26  ? 0.8388 1.0803 0.4859 0.1320  0.0254  -0.0022 344 SER D O     
200  C CB    . SER A 26  ? 0.7240 0.9528 0.5172 0.0836  -0.0190 0.0252  344 SER D CB    
201  O OG    . SER A 26  ? 0.7288 0.9793 0.4915 0.0632  0.0207  0.0474  344 SER D OG    
202  N N     . ARG A 27  ? 0.8390 1.0224 0.4977 0.1538  -0.0433 -0.0265 345 ARG D N     
203  C CA    . ARG A 27  ? 0.9048 1.0676 0.4786 0.1739  -0.0357 -0.0317 345 ARG D CA    
204  C C     . ARG A 27  ? 0.9592 1.1209 0.4825 0.2064  -0.0291 -0.0594 345 ARG D C     
205  O O     . ARG A 27  ? 1.0232 1.1658 0.4672 0.2216  -0.0137 -0.0616 345 ARG D O     
206  C CB    . ARG A 27  ? 0.9383 1.0702 0.5044 0.1834  -0.0761 -0.0386 345 ARG D CB    
207  C CG    . ARG A 27  ? 0.9031 1.0364 0.5066 0.1566  -0.0749 -0.0099 345 ARG D CG    
208  C CD    . ARG A 27  ? 0.9288 1.0515 0.5617 0.1639  -0.1206 -0.0212 345 ARG D CD    
209  N NE    . ARG A 27  ? 0.8944 1.0240 0.5722 0.1399  -0.1153 0.0055  345 ARG D NE    
210  C CZ    . ARG A 27  ? 0.8962 1.0317 0.6237 0.1377  -0.1479 0.0010  345 ARG D CZ    
211  N NH1   . ARG A 27  ? 0.8550 0.9979 0.6201 0.1179  -0.1357 0.0262  345 ARG D NH1   
212  N NH2   . ARG A 27  ? 0.9386 1.0741 0.6786 0.1540  -0.1918 -0.0300 345 ARG D NH2   
213  N N     . LYS A 28  ? 0.9493 1.1244 0.5131 0.2187  -0.0386 -0.0798 346 LYS D N     
214  C CA    . LYS A 28  ? 1.0175 1.1926 0.5330 0.2529  -0.0272 -0.1068 346 LYS D CA    
215  C C     . LYS A 28  ? 1.0249 1.2448 0.5185 0.2472  0.0284  -0.0931 346 LYS D C     
216  O O     . LYS A 28  ? 1.0890 1.3018 0.5297 0.2655  0.0497  -0.1054 346 LYS D O     
217  C CB    . LYS A 28  ? 1.0117 1.1815 0.5740 0.2715  -0.0526 -0.1327 346 LYS D CB    
218  N N     . HIS A 29  ? 0.9658 1.2277 0.5129 0.2137  0.0516  -0.0659 347 HIS D N     
219  C CA    . HIS A 29  ? 1.0038 1.3110 0.5494 0.1960  0.1014  -0.0520 347 HIS D CA    
220  C C     . HIS A 29  ? 1.0244 1.2842 0.5336 0.1608  0.1232  -0.0304 347 HIS D C     
221  O O     . HIS A 29  ? 1.0410 1.3080 0.5455 0.1394  0.1592  -0.0249 347 HIS D O     
222  C CB    . HIS A 29  ? 0.9803 1.3467 0.5998 0.1692  0.1123  -0.0334 347 HIS D CB    
223  C CG    . HIS A 29  ? 1.0436 1.4382 0.7282 0.1927  0.0925  -0.0510 347 HIS D CG    
224  N ND1   . HIS A 29  ? 1.0935 1.5362 0.7842 0.2209  0.1140  -0.0697 347 HIS D ND1   
225  C CD2   . HIS A 29  ? 1.0257 1.4028 0.7680 0.1940  0.0553  -0.0519 347 HIS D CD2   
226  C CE1   . HIS A 29  ? 1.0792 1.5299 0.8265 0.2426  0.0883  -0.0814 347 HIS D CE1   
227  N NE2   . HIS A 29  ? 1.0497 1.4568 0.8257 0.2250  0.0526  -0.0703 347 HIS D NE2   
228  N N     . THR A 30  ? 1.0579 0.9012 0.8603 0.2214  0.4120  0.0770  348 THR D N     
229  C CA    . THR A 30  ? 1.0965 0.9171 0.9045 0.2409  0.4157  0.0682  348 THR D CA    
230  C C     . THR A 30  ? 1.0509 0.9061 0.9199 0.2406  0.3910  0.0736  348 THR D C     
231  O O     . THR A 30  ? 1.0173 0.9279 0.9654 0.2519  0.3933  0.0955  348 THR D O     
232  C CB    . THR A 30  ? 1.1348 0.9745 0.9763 0.2648  0.4482  0.0848  348 THR D CB    
233  N N     . GLY A 31  ? 1.0529 0.8749 0.8835 0.2260  0.3649  0.0540  349 GLY D N     
234  C CA    . GLY A 31  ? 1.0030 0.8605 0.8846 0.2076  0.3234  0.0591  349 GLY D CA    
235  C C     . GLY A 31  ? 1.0049 0.8543 0.9067 0.2174  0.3089  0.0527  349 GLY D C     
236  O O     . GLY A 31  ? 1.0320 0.8264 0.8793 0.2167  0.3023  0.0311  349 GLY D O     
237  N N     . GLU A 32  ? 0.9785 0.8837 0.9592 0.2246  0.3026  0.0735  350 GLU D N     
238  C CA    . GLU A 32  ? 0.9570 0.8666 0.9667 0.2280  0.2800  0.0727  350 GLU D CA    
239  C C     . GLU A 32  ? 0.9101 0.7940 0.8883 0.2015  0.2406  0.0544  350 GLU D C     
240  O O     . GLU A 32  ? 0.9266 0.7668 0.8680 0.2038  0.2332  0.0377  350 GLU D O     
241  C CB    . GLU A 32  ? 0.9406 0.9235 1.0398 0.2302  0.2713  0.1015  350 GLU D CB    
242  C CG    . GLU A 32  ? 0.9217 0.9212 1.0509 0.2162  0.2314  0.1026  350 GLU D CG    
243  C CD    . GLU A 32  ? 0.8918 0.9259 1.0469 0.1843  0.1993  0.1088  350 GLU D CD    
244  O OE1   . GLU A 32  ? 0.8982 0.9236 1.0282 0.1694  0.2012  0.1036  350 GLU D OE1   
245  O OE2   . GLU A 32  ? 0.8625 0.9288 1.0593 0.1736  0.1725  0.1191  350 GLU D OE2   
246  N N     . LYS A 33  ? 0.8595 0.7693 0.8528 0.1767  0.2168  0.0587  351 LYS D N     
247  C CA    . LYS A 33  ? 0.8198 0.7061 0.7816 0.1533  0.1853  0.0434  351 LYS D CA    
248  C C     . LYS A 33  ? 0.8055 0.6996 0.7560 0.1354  0.1818  0.0470  351 LYS D C     
249  O O     . LYS A 33  ? 0.7694 0.6977 0.7591 0.1210  0.1662  0.0588  351 LYS D O     
250  C CB    . LYS A 33  ? 0.7550 0.6647 0.7564 0.1428  0.1547  0.0471  351 LYS D CB    
251  C CG    . LYS A 33  ? 0.7465 0.6436 0.7527 0.1562  0.1510  0.0433  351 LYS D CG    
252  C CD    . LYS A 33  ? 0.6927 0.6250 0.7446 0.1452  0.1236  0.0533  351 LYS D CD    
253  C CE    . LYS A 33  ? 0.6938 0.6157 0.7506 0.1565  0.1166  0.0523  351 LYS D CE    
254  N NZ    . LYS A 33  ? 0.6569 0.6192 0.7600 0.1472  0.0929  0.0669  351 LYS D NZ    
255  N N     . PRO A 34  ? 0.8307 0.6900 0.7238 0.1343  0.1951  0.0373  352 PRO D N     
256  C CA    . PRO A 34  ? 0.8149 0.6843 0.6987 0.1208  0.1970  0.0459  352 PRO D CA    
257  C C     . PRO A 34  ? 0.7590 0.6377 0.6550 0.0984  0.1651  0.0475  352 PRO D C     
258  O O     . PRO A 34  ? 0.7464 0.6517 0.6702 0.0884  0.1634  0.0622  352 PRO D O     
259  C CB    . PRO A 34  ? 0.8799 0.7016 0.6880 0.1227  0.2125  0.0325  352 PRO D CB    
260  C CG    . PRO A 34  ? 0.9040 0.6861 0.6793 0.1264  0.2038  0.0133  352 PRO D CG    
261  C CD    . PRO A 34  ? 0.8827 0.6879 0.7120 0.1422  0.2064  0.0186  352 PRO D CD    
262  N N     . TYR A 35  ? 0.7338 0.5902 0.6106 0.0906  0.1417  0.0341  353 TYR D N     
263  C CA    . TYR A 35  ? 0.6913 0.5505 0.5735 0.0729  0.1162  0.0356  353 TYR D CA    
264  C C     . TYR A 35  ? 0.6326 0.5190 0.5672 0.0680  0.1015  0.0417  353 TYR D C     
265  O O     . TYR A 35  ? 0.6153 0.5030 0.5641 0.0732  0.0941  0.0357  353 TYR D O     
266  C CB    . TYR A 35  ? 0.6985 0.5269 0.5419 0.0670  0.0995  0.0215  353 TYR D CB    
267  C CG    . TYR A 35  ? 0.7507 0.5476 0.5350 0.0675  0.1104  0.0140  353 TYR D CG    
268  C CD1   . TYR A 35  ? 0.7880 0.5568 0.5419 0.0779  0.1236  0.0012  353 TYR D CD1   
269  C CD2   . TYR A 35  ? 0.7740 0.5649 0.5285 0.0566  0.1076  0.0204  353 TYR D CD2   
270  C CE1   . TYR A 35  ? 0.8469 0.5783 0.5370 0.0755  0.1336  -0.0079 353 TYR D CE1   
271  C CE2   . TYR A 35  ? 0.8268 0.5861 0.5193 0.0537  0.1153  0.0134  353 TYR D CE2   
272  C CZ    . TYR A 35  ? 0.8625 0.5900 0.5203 0.0621  0.1284  -0.0021 353 TYR D CZ    
273  O OH    . TYR A 35  ? 0.9284 0.6162 0.5150 0.0564  0.1360  -0.0113 353 TYR D OH    
274  N N     . GLN A 36  ? 0.6100 0.5143 0.5688 0.0565  0.0968  0.0539  354 GLN D N     
275  C CA    . GLN A 36  ? 0.5770 0.5014 0.5776 0.0470  0.0823  0.0595  354 GLN D CA    
276  C C     . GLN A 36  ? 0.5760 0.4845 0.5697 0.0330  0.0650  0.0579  354 GLN D C     
277  O O     . GLN A 36  ? 0.5986 0.4955 0.5725 0.0292  0.0677  0.0625  354 GLN D O     
278  C CB    . GLN A 36  ? 0.5695 0.5285 0.6099 0.0438  0.0937  0.0775  354 GLN D CB    
279  C CG    . GLN A 36  ? 0.5477 0.5258 0.6273 0.0283  0.0756  0.0841  354 GLN D CG    
280  C CD    . GLN A 36  ? 0.5476 0.5648 0.6706 0.0211  0.0845  0.1050  354 GLN D CD    
281  O OE1   . GLN A 36  ? 0.5504 0.5956 0.6956 0.0347  0.1021  0.1149  354 GLN D OE1   
282  N NE2   . GLN A 36  ? 0.5499 0.5681 0.6864 -0.0003 0.0737  0.1131  354 GLN D NE2   
283  N N     . CYS A 37  ? 0.5543 0.4603 0.5625 0.0265  0.0485  0.0525  355 CYS D N     
284  C CA    . CYS A 37  ? 0.5553 0.4420 0.5580 0.0161  0.0359  0.0506  355 CYS D CA    
285  C C     . CYS A 37  ? 0.5758 0.4687 0.5990 0.0018  0.0361  0.0630  355 CYS D C     
286  O O     . CYS A 37  ? 0.5795 0.4936 0.6305 -0.0061 0.0343  0.0693  355 CYS D O     
287  C CB    . CYS A 37  ? 0.5377 0.4141 0.5411 0.0145  0.0218  0.0391  355 CYS D CB    
288  S SG    . CYS A 37  ? 0.5460 0.3917 0.5374 0.0078  0.0125  0.0347  355 CYS D SG    
289  N N     . ASP A 38  ? 0.5932 0.4683 0.6044 -0.0025 0.0370  0.0688  356 ASP D N     
290  C CA    . ASP A 38  ? 0.6135 0.4868 0.6401 -0.0174 0.0378  0.0813  356 ASP D CA    
291  C C     . ASP A 38  ? 0.6095 0.4508 0.6320 -0.0269 0.0264  0.0760  356 ASP D C     
292  O O     . ASP A 38  ? 0.6325 0.4577 0.6580 -0.0381 0.0274  0.0855  356 ASP D O     
293  C CB    . ASP A 38  ? 0.6537 0.5270 0.6690 -0.0158 0.0501  0.0953  356 ASP D CB    
294  C CG    . ASP A 38  ? 0.6782 0.5803 0.6978 -0.0098 0.0665  0.1027  356 ASP D CG    
295  O OD1   . ASP A 38  ? 0.6961 0.5945 0.6873 0.0015  0.0750  0.1008  356 ASP D OD1   
296  O OD2   . ASP A 38  ? 0.6826 0.6106 0.7332 -0.0166 0.0713  0.1111  356 ASP D OD2   
297  N N     . PHE A 39  ? 0.5933 0.4210 0.6064 -0.0223 0.0176  0.0613  357 PHE D N     
298  C CA    . PHE A 39  ? 0.6098 0.4039 0.6154 -0.0312 0.0100  0.0541  357 PHE D CA    
299  C C     . PHE A 39  ? 0.6162 0.4150 0.6362 -0.0521 0.0011  0.0546  357 PHE D C     
300  O O     . PHE A 39  ? 0.5957 0.4297 0.6354 -0.0552 -0.0020 0.0581  357 PHE D O     
301  C CB    . PHE A 39  ? 0.6068 0.3873 0.5964 -0.0199 0.0059  0.0393  357 PHE D CB    
302  C CG    . PHE A 39  ? 0.6436 0.3819 0.6176 -0.0225 0.0051  0.0320  357 PHE D CG    
303  C CD1   . PHE A 39  ? 0.6632 0.3793 0.6304 -0.0117 0.0131  0.0378  357 PHE D CD1   
304  C CD2   . PHE A 39  ? 0.6664 0.3858 0.6303 -0.0350 -0.0028 0.0204  357 PHE D CD2   
305  C CE1   . PHE A 39  ? 0.7037 0.3772 0.6565 -0.0101 0.0172  0.0316  357 PHE D CE1   
306  C CE2   . PHE A 39  ? 0.7112 0.3836 0.6526 -0.0364 0.0004  0.0116  357 PHE D CE2   
307  C CZ    . PHE A 39  ? 0.7292 0.3775 0.6660 -0.0222 0.0124  0.0169  357 PHE D CZ    
308  N N     . LYS A 40  ? 0.6503 0.4122 0.6603 -0.0672 -0.0033 0.0523  358 LYS D N     
309  C CA    . LYS A 40  ? 0.6756 0.4383 0.6961 -0.0937 -0.0148 0.0549  358 LYS D CA    
310  C C     . LYS A 40  ? 0.6737 0.4559 0.6970 -0.0986 -0.0286 0.0462  358 LYS D C     
311  O O     . LYS A 40  ? 0.6845 0.4447 0.6835 -0.0911 -0.0321 0.0309  358 LYS D O     
312  C CB    . LYS A 40  ? 0.7249 0.4302 0.7217 -0.1094 -0.0173 0.0493  358 LYS D CB    
313  C CG    . LYS A 40  ? 0.7555 0.4527 0.7530 -0.1422 -0.0341 0.0481  358 LYS D CG    
314  C CD    . LYS A 40  ? 0.8203 0.4506 0.7881 -0.1602 -0.0342 0.0423  358 LYS D CD    
315  C CE    . LYS A 40  ? 0.8320 0.4576 0.8157 -0.1663 -0.0246 0.0607  358 LYS D CE    
316  N NZ    . LYS A 40  ? 0.8978 0.4529 0.8524 -0.1864 -0.0251 0.0560  358 LYS D NZ    
317  N N     . ASP A 41  ? 0.6670 0.4939 0.7227 -0.1102 -0.0355 0.0587  359 ASP D N     
318  C CA    . ASP A 41  ? 0.6672 0.5187 0.7328 -0.1186 -0.0519 0.0570  359 ASP D CA    
319  C C     . ASP A 41  ? 0.6426 0.5052 0.7002 -0.0937 -0.0485 0.0478  359 ASP D C     
320  O O     . ASP A 41  ? 0.6577 0.5171 0.7037 -0.0977 -0.0618 0.0398  359 ASP D O     
321  C CB    . ASP A 41  ? 0.7116 0.5238 0.7499 -0.1453 -0.0705 0.0463  359 ASP D CB    
322  C CG    . ASP A 41  ? 0.7522 0.5557 0.8006 -0.1764 -0.0782 0.0570  359 ASP D CG    
323  O OD1   . ASP A 41  ? 0.7336 0.5846 0.8250 -0.1824 -0.0763 0.0776  359 ASP D OD1   
324  O OD2   . ASP A 41  ? 0.8085 0.5552 0.8207 -0.1949 -0.0844 0.0452  359 ASP D OD2   
325  N N     . CYS A 42  ? 0.6104 0.4838 0.6708 -0.0698 -0.0317 0.0492  360 CYS D N     
326  C CA    . CYS A 42  ? 0.5745 0.4602 0.6304 -0.0487 -0.0282 0.0428  360 CYS D CA    
327  C C     . CYS A 42  ? 0.5613 0.4901 0.6467 -0.0360 -0.0176 0.0558  360 CYS D C     
328  O O     . CYS A 42  ? 0.5530 0.5075 0.6556 -0.0314 -0.0229 0.0598  360 CYS D O     
329  C CB    . CYS A 42  ? 0.5489 0.4051 0.5762 -0.0324 -0.0184 0.0317  360 CYS D CB    
330  S SG    . CYS A 42  ? 0.5039 0.3717 0.5240 -0.0100 -0.0135 0.0251  360 CYS D SG    
331  N N     . GLU A 43  ? 0.5640 0.4990 0.6538 -0.0292 -0.0014 0.0636  361 GLU D N     
332  C CA    . GLU A 43  ? 0.5545 0.5258 0.6688 -0.0172 0.0144  0.0767  361 GLU D CA    
333  C C     . GLU A 43  ? 0.5362 0.5165 0.6483 0.0033  0.0191  0.0714  361 GLU D C     
334  O O     . GLU A 43  ? 0.5359 0.5489 0.6761 0.0131  0.0287  0.0832  361 GLU D O     
335  C CB    . GLU A 43  ? 0.5674 0.5769 0.7249 -0.0330 0.0109  0.0960  361 GLU D CB    
336  C CG    . GLU A 43  ? 0.6018 0.5976 0.7602 -0.0563 0.0062  0.1022  361 GLU D CG    
337  C CD    . GLU A 43  ? 0.6208 0.6529 0.8217 -0.0792 -0.0042 0.1209  361 GLU D CD    
338  O OE1   . GLU A 43  ? 0.6086 0.6809 0.8416 -0.0757 -0.0090 0.1305  361 GLU D OE1   
339  O OE2   . GLU A 43  ? 0.6487 0.6696 0.8527 -0.1016 -0.0083 0.1278  361 GLU D OE2   
340  N N     . ARG A 44  ? 0.5168 0.4677 0.5975 0.0105  0.0140  0.0552  362 ARG D N     
341  C CA    . ARG A 44  ? 0.4843 0.4357 0.5583 0.0278  0.0177  0.0495  362 ARG D CA    
342  C C     . ARG A 44  ? 0.4869 0.4293 0.5413 0.0438  0.0378  0.0470  362 ARG D C     
343  O O     . ARG A 44  ? 0.4894 0.4104 0.5171 0.0418  0.0407  0.0413  362 ARG D O     
344  C CB    . ARG A 44  ? 0.4583 0.3825 0.5068 0.0262  0.0042  0.0348  362 ARG D CB    
345  C CG    . ARG A 44  ? 0.4385 0.3656 0.4867 0.0386  0.0026  0.0323  362 ARG D CG    
346  C CD    . ARG A 44  ? 0.4856 0.3853 0.5061 0.0370  -0.0073 0.0190  362 ARG D CD    
347  N NE    . ARG A 44  ? 0.4946 0.4001 0.5200 0.0409  -0.0159 0.0204  362 ARG D NE    
348  C CZ    . ARG A 44  ? 0.4822 0.3851 0.5047 0.0562  -0.0088 0.0206  362 ARG D CZ    
349  N NH1   . ARG A 44  ? 0.4881 0.3796 0.4983 0.0675  0.0071  0.0170  362 ARG D NH1   
350  N NH2   . ARG A 44  ? 0.5150 0.4228 0.5429 0.0593  -0.0178 0.0247  362 ARG D NH2   
351  N N     . ARG A 45  ? 0.4976 0.4543 0.5632 0.0598  0.0517  0.0521  363 ARG D N     
352  C CA    . ARG A 45  ? 0.5340 0.4768 0.5748 0.0746  0.0738  0.0490  363 ARG D CA    
353  C C     . ARG A 45  ? 0.5349 0.4459 0.5419 0.0848  0.0734  0.0339  363 ARG D C     
354  O O     . ARG A 45  ? 0.5274 0.4386 0.5437 0.0885  0.0639  0.0318  363 ARG D O     
355  C CB    . ARG A 45  ? 0.5741 0.5468 0.6454 0.0885  0.0956  0.0643  363 ARG D CB    
356  C CG    . ARG A 45  ? 0.5944 0.6025 0.7027 0.0759  0.0968  0.0821  363 ARG D CG    
357  C CD    . ARG A 45  ? 0.6266 0.6744 0.7767 0.0903  0.1184  0.1017  363 ARG D CD    
358  N NE    . ARG A 45  ? 0.6346 0.7214 0.8266 0.0739  0.1161  0.1214  363 ARG D NE    
359  C CZ    . ARG A 45  ? 0.6526 0.7874 0.8962 0.0806  0.1303  0.1446  363 ARG D CZ    
360  N NH1   . ARG A 45  ? 0.6740 0.8222 0.9337 0.1071  0.1501  0.1509  363 ARG D NH1   
361  N NH2   . ARG A 45  ? 0.6559 0.8252 0.9368 0.0607  0.1256  0.1631  363 ARG D NH2   
362  N N     . PHE A 46  ? 0.5511 0.4335 0.5164 0.0869  0.0825  0.0246  364 PHE D N     
363  C CA    . PHE A 46  ? 0.5663 0.4143 0.4943 0.0913  0.0809  0.0104  364 PHE D CA    
364  C C     . PHE A 46  ? 0.6109 0.4346 0.5031 0.1029  0.1041  0.0056  364 PHE D C     
365  O O     . PHE A 46  ? 0.6271 0.4592 0.5168 0.1057  0.1209  0.0124  364 PHE D O     
366  C CB    . PHE A 46  ? 0.5563 0.3876 0.4609 0.0763  0.0625  0.0024  364 PHE D CB    
367  C CG    . PHE A 46  ? 0.5221 0.3657 0.4512 0.0677  0.0437  0.0036  364 PHE D CG    
368  C CD1   . PHE A 46  ? 0.5051 0.3659 0.4562 0.0583  0.0375  0.0112  364 PHE D CD1   
369  C CD2   . PHE A 46  ? 0.5194 0.3526 0.4453 0.0684  0.0337  -0.0031 364 PHE D CD2   
370  C CE1   . PHE A 46  ? 0.4915 0.3547 0.4560 0.0503  0.0227  0.0100  364 PHE D CE1   
371  C CE2   . PHE A 46  ? 0.5026 0.3431 0.4439 0.0608  0.0193  -0.0027 364 PHE D CE2   
372  C CZ    . PHE A 46  ? 0.4908 0.3443 0.4491 0.0520  0.0143  0.0027  364 PHE D CZ    
373  N N     . SER A 47  ? 0.6374 0.4266 0.4976 0.1085  0.1061  -0.0066 365 SER D N     
374  C CA    . SER A 47  ? 0.6910 0.4445 0.5064 0.1189  0.1292  -0.0147 365 SER D CA    
375  C C     . SER A 47  ? 0.7210 0.4463 0.4822 0.1028  0.1236  -0.0239 365 SER D C     
376  O O     . SER A 47  ? 0.7684 0.4698 0.4890 0.1071  0.1436  -0.0280 365 SER D O     
377  C CB    . SER A 47  ? 0.7197 0.4403 0.5197 0.1305  0.1343  -0.0237 365 SER D CB    
378  O OG    . SER A 47  ? 0.6937 0.4433 0.5453 0.1448  0.1356  -0.0120 365 SER D OG    
379  N N     . ARG A 48  ? 0.7047 0.4328 0.4635 0.0846  0.0974  -0.0259 366 ARG D N     
380  C CA    . ARG A 48  ? 0.7335 0.4411 0.4466 0.0676  0.0868  -0.0306 366 ARG D CA    
381  C C     . ARG A 48  ? 0.7095 0.4489 0.4493 0.0557  0.0691  -0.0189 366 ARG D C     
382  O O     . ARG A 48  ? 0.6725 0.4397 0.4587 0.0574  0.0614  -0.0120 366 ARG D O     
383  C CB    . ARG A 48  ? 0.7405 0.4153 0.4207 0.0567  0.0721  -0.0426 366 ARG D CB    
384  C CG    . ARG A 48  ? 0.7660 0.4065 0.4291 0.0697  0.0873  -0.0535 366 ARG D CG    
385  C CD    . ARG A 48  ? 0.7991 0.3962 0.4146 0.0541  0.0749  -0.0662 366 ARG D CD    
386  N NE    . ARG A 48  ? 0.7504 0.3684 0.3878 0.0369  0.0468  -0.0615 366 ARG D NE    
387  C CZ    . ARG A 48  ? 0.7648 0.3581 0.3805 0.0222  0.0325  -0.0680 366 ARG D CZ    
388  N NH1   . ARG A 48  ? 0.8290 0.3692 0.3958 0.0212  0.0423  -0.0814 366 ARG D NH1   
389  N NH2   . ARG A 48  ? 0.7241 0.3435 0.3666 0.0087  0.0103  -0.0605 366 ARG D NH2   
390  N N     . SER A 49  ? 0.7437 0.4750 0.4499 0.0432  0.0628  -0.0161 367 SER D N     
391  C CA    . SER A 49  ? 0.7266 0.4841 0.4563 0.0344  0.0485  -0.0024 367 SER D CA    
392  C C     . SER A 49  ? 0.6913 0.4579 0.4419 0.0264  0.0257  -0.0012 367 SER D C     
393  O O     . SER A 49  ? 0.6636 0.4525 0.4524 0.0272  0.0189  0.0077  367 SER D O     
394  C CB    . SER A 49  ? 0.7835 0.5311 0.4708 0.0242  0.0477  0.0038  367 SER D CB    
395  O OG    . SER A 49  ? 0.8320 0.5539 0.4726 0.0108  0.0342  -0.0039 367 SER D OG    
396  N N     . ASP A 50  ? 0.6993 0.4466 0.4240 0.0183  0.0152  -0.0097 368 ASP D N     
397  C CA    . ASP A 50  ? 0.6622 0.4220 0.4094 0.0109  -0.0040 -0.0062 368 ASP D CA    
398  C C     . ASP A 50  ? 0.6047 0.3763 0.3924 0.0212  -0.0011 -0.0090 368 ASP D C     
399  O O     . ASP A 50  ? 0.5770 0.3654 0.3929 0.0197  -0.0110 -0.0029 368 ASP D O     
400  C CB    . ASP A 50  ? 0.7025 0.4396 0.4134 -0.0034 -0.0162 -0.0133 368 ASP D CB    
401  C CG    . ASP A 50  ? 0.7396 0.4448 0.4285 0.0023  -0.0043 -0.0293 368 ASP D CG    
402  O OD1   . ASP A 50  ? 0.7546 0.4516 0.4417 0.0172  0.0161  -0.0341 368 ASP D OD1   
403  O OD2   . ASP A 50  ? 0.7582 0.4470 0.4339 -0.0079 -0.0145 -0.0350 368 ASP D OD2   
404  N N     . GLN A 51  ? 0.5905 0.3535 0.3803 0.0324  0.0130  -0.0167 369 GLN D N     
405  C CA    . GLN A 51  ? 0.5498 0.3255 0.3750 0.0404  0.0133  -0.0172 369 GLN D CA    
406  C C     . GLN A 51  ? 0.5146 0.3141 0.3730 0.0423  0.0135  -0.0083 369 GLN D C     
407  O O     . GLN A 51  ? 0.4899 0.2985 0.3712 0.0418  0.0066  -0.0072 369 GLN D O     
408  C CB    . GLN A 51  ? 0.5620 0.3262 0.3845 0.0525  0.0271  -0.0233 369 GLN D CB    
409  C CG    . GLN A 51  ? 0.5968 0.3275 0.3842 0.0511  0.0283  -0.0335 369 GLN D CG    
410  C CD    . GLN A 51  ? 0.6187 0.3343 0.4037 0.0676  0.0461  -0.0374 369 GLN D CD    
411  O OE1   . GLN A 51  ? 0.6088 0.3433 0.4174 0.0799  0.0590  -0.0308 369 GLN D OE1   
412  N NE2   . GLN A 51  ? 0.6491 0.3310 0.4082 0.0681  0.0475  -0.0459 369 GLN D NE2   
413  N N     . LEU A 52  ? 0.5175 0.3234 0.3747 0.0434  0.0224  -0.0021 370 LEU D N     
414  C CA    . LEU A 52  ? 0.4950 0.3182 0.3803 0.0419  0.0220  0.0070  370 LEU D CA    
415  C C     . LEU A 52  ? 0.4931 0.3172 0.3830 0.0356  0.0105  0.0128  370 LEU D C     
416  O O     . LEU A 52  ? 0.4800 0.3082 0.3920 0.0352  0.0070  0.0148  370 LEU D O     
417  C CB    . LEU A 52  ? 0.4980 0.3274 0.3796 0.0431  0.0353  0.0147  370 LEU D CB    
418  C CG    . LEU A 52  ? 0.4831 0.3255 0.3891 0.0380  0.0347  0.0260  370 LEU D CG    
419  C CD1   . LEU A 52  ? 0.4657 0.3191 0.4040 0.0372  0.0313  0.0252  370 LEU D CD1   
420  C CD2   . LEU A 52  ? 0.5083 0.3572 0.4079 0.0380  0.0491  0.0357  370 LEU D CD2   
421  N N     . LYS A 53  ? 0.5136 0.3329 0.3817 0.0308  0.0047  0.0166  371 LYS D N     
422  C CA    . LYS A 53  ? 0.5201 0.3457 0.3989 0.0276  -0.0055 0.0267  371 LYS D CA    
423  C C     . LYS A 53  ? 0.4952 0.3226 0.3897 0.0292  -0.0120 0.0228  371 LYS D C     
424  O O     . LYS A 53  ? 0.4845 0.3171 0.3983 0.0317  -0.0144 0.0306  371 LYS D O     
425  C CB    . LYS A 53  ? 0.5658 0.3912 0.4187 0.0200  -0.0136 0.0349  371 LYS D CB    
426  C CG    . LYS A 53  ? 0.6096 0.4357 0.4509 0.0185  -0.0079 0.0455  371 LYS D CG    
427  C CD    . LYS A 53  ? 0.6605 0.4847 0.4680 0.0084  -0.0184 0.0539  371 LYS D CD    
428  C CE    . LYS A 53  ? 0.6940 0.5230 0.4974 0.0073  -0.0162 0.0709  371 LYS D CE    
429  N NZ    . LYS A 53  ? 0.7079 0.5324 0.5123 0.0124  0.0029  0.0679  371 LYS D NZ    
430  N N     . ARG A 54  ? 0.4873 0.3082 0.3731 0.0288  -0.0128 0.0118  372 ARG D N     
431  C CA    . ARG A 54  ? 0.4663 0.2887 0.3662 0.0304  -0.0164 0.0086  372 ARG D CA    
432  C C     . ARG A 54  ? 0.4558 0.2766 0.3728 0.0358  -0.0106 0.0045  372 ARG D C     
433  O O     . ARG A 54  ? 0.4458 0.2662 0.3750 0.0381  -0.0104 0.0058  372 ARG D O     
434  C CB    . ARG A 54  ? 0.4631 0.2757 0.3464 0.0270  -0.0192 -0.0003 372 ARG D CB    
435  C CG    . ARG A 54  ? 0.4422 0.2566 0.3375 0.0274  -0.0219 -0.0019 372 ARG D CG    
436  C CD    . ARG A 54  ? 0.4403 0.2404 0.3180 0.0236  -0.0240 -0.0097 372 ARG D CD    
437  N NE    . ARG A 54  ? 0.4299 0.2182 0.3004 0.0309  -0.0163 -0.0175 372 ARG D NE    
438  C CZ    . ARG A 54  ? 0.4351 0.2056 0.2903 0.0319  -0.0145 -0.0238 372 ARG D CZ    
439  N NH1   . ARG A 54  ? 0.4385 0.1975 0.2800 0.0226  -0.0211 -0.0249 372 ARG D NH1   
440  N NH2   . ARG A 54  ? 0.4386 0.2032 0.2944 0.0420  -0.0060 -0.0271 372 ARG D NH2   
441  N N     . HIS A 55  ? 0.4639 0.2837 0.3809 0.0373  -0.0054 0.0006  373 HIS D N     
442  C CA    . HIS A 55  ? 0.4681 0.2880 0.3993 0.0376  -0.0042 -0.0018 373 HIS D CA    
443  C C     . HIS A 55  ? 0.4635 0.2792 0.4041 0.0354  -0.0029 0.0037  373 HIS D C     
444  O O     . HIS A 55  ? 0.4732 0.2790 0.4172 0.0340  -0.0034 0.0001  373 HIS D O     
445  C CB    . HIS A 55  ? 0.4966 0.3245 0.4331 0.0387  0.0002  -0.0019 373 HIS D CB    
446  C CG    . HIS A 55  ? 0.5414 0.3751 0.4950 0.0334  -0.0004 0.0017  373 HIS D CG    
447  N ND1   . HIS A 55  ? 0.5512 0.3836 0.5109 0.0291  -0.0071 -0.0019 373 HIS D ND1   
448  C CD2   . HIS A 55  ? 0.5557 0.3951 0.5190 0.0288  0.0035  0.0093  373 HIS D CD2   
449  C CE1   . HIS A 55  ? 0.5562 0.3923 0.5280 0.0202  -0.0089 0.0026  373 HIS D CE1   
450  N NE2   . HIS A 55  ? 0.5493 0.3902 0.5256 0.0201  -0.0019 0.0098  373 HIS D NE2   
451  N N     . GLN A 56  ? 0.4592 0.2775 0.3995 0.0348  -0.0005 0.0127  374 GLN D N     
452  C CA    . GLN A 56  ? 0.4664 0.2761 0.4152 0.0336  0.0021  0.0199  374 GLN D CA    
453  C C     . GLN A 56  ? 0.4676 0.2672 0.4203 0.0393  0.0026  0.0217  374 GLN D C     
454  O O     . GLN A 56  ? 0.4852 0.2689 0.4429 0.0406  0.0074  0.0255  374 GLN D O     
455  C CB    . GLN A 56  ? 0.4853 0.3008 0.4313 0.0325  0.0044  0.0320  374 GLN D CB    
456  C CG    . GLN A 56  ? 0.5034 0.3272 0.4492 0.0281  0.0097  0.0330  374 GLN D CG    
457  C CD    . GLN A 56  ? 0.5335 0.3610 0.4704 0.0266  0.0139  0.0455  374 GLN D CD    
458  O OE1   . GLN A 56  ? 0.5529 0.3802 0.4776 0.0283  0.0096  0.0520  374 GLN D OE1   
459  N NE2   . GLN A 56  ? 0.5395 0.3727 0.4831 0.0222  0.0216  0.0512  374 GLN D NE2   
460  N N     . ARG A 57  ? 0.4545 0.2616 0.4057 0.0430  -0.0003 0.0200  375 ARG D N     
461  C CA    . ARG A 57  ? 0.4630 0.2649 0.4225 0.0502  0.0038  0.0230  375 ARG D CA    
462  C C     . ARG A 57  ? 0.4764 0.2568 0.4297 0.0507  0.0099  0.0115  375 ARG D C     
463  O O     . ARG A 57  ? 0.4976 0.2655 0.4537 0.0587  0.0188  0.0130  375 ARG D O     
464  C CB    . ARG A 57  ? 0.4614 0.2804 0.4232 0.0508  -0.0014 0.0256  375 ARG D CB    
465  C CG    . ARG A 57  ? 0.4715 0.3080 0.4314 0.0460  -0.0107 0.0362  375 ARG D CG    
466  C CD    . ARG A 57  ? 0.4768 0.3268 0.4359 0.0410  -0.0184 0.0375  375 ARG D CD    
467  N NE    . ARG A 57  ? 0.4953 0.3545 0.4407 0.0311  -0.0300 0.0437  375 ARG D NE    
468  C CZ    . ARG A 57  ? 0.5074 0.3736 0.4444 0.0210  -0.0401 0.0443  375 ARG D CZ    
469  N NH1   . ARG A 57  ? 0.4986 0.3673 0.4445 0.0207  -0.0390 0.0409  375 ARG D NH1   
470  N NH2   . ARG A 57  ? 0.5312 0.3989 0.4468 0.0091  -0.0515 0.0484  375 ARG D NH2   
471  N N     . ARG A 58  ? 0.4714 0.2471 0.4153 0.0426  0.0059  0.0013  376 ARG D N     
472  C CA    . ARG A 58  ? 0.4959 0.2493 0.4274 0.0385  0.0078  -0.0090 376 ARG D CA    
473  C C     . ARG A 58  ? 0.5344 0.2620 0.4624 0.0348  0.0128  -0.0085 376 ARG D C     
474  O O     . ARG A 58  ? 0.5658 0.2633 0.4785 0.0355  0.0200  -0.0154 376 ARG D O     
475  C CB    . ARG A 58  ? 0.4884 0.2507 0.4152 0.0295  -0.0016 -0.0156 376 ARG D CB    
476  C CG    . ARG A 58  ? 0.4793 0.2585 0.4059 0.0333  -0.0053 -0.0167 376 ARG D CG    
477  C CD    . ARG A 58  ? 0.4898 0.2784 0.4167 0.0277  -0.0132 -0.0193 376 ARG D CD    
478  N NE    . ARG A 58  ? 0.5272 0.3021 0.4426 0.0192  -0.0183 -0.0248 376 ARG D NE    
479  C CZ    . ARG A 58  ? 0.5422 0.3275 0.4611 0.0116  -0.0283 -0.0237 376 ARG D CZ    
480  N NH1   . ARG A 58  ? 0.5266 0.3361 0.4639 0.0155  -0.0302 -0.0169 376 ARG D NH1   
481  N NH2   . ARG A 58  ? 0.5693 0.3403 0.4722 0.0001  -0.0361 -0.0283 376 ARG D NH2   
482  N N     . HIS A 59  ? 0.5362 0.2707 0.4743 0.0303  0.0106  -0.0005 377 HIS D N     
483  C CA    . HIS A 59  ? 0.5762 0.2831 0.5109 0.0246  0.0150  0.0017  377 HIS D CA    
484  C C     . HIS A 59  ? 0.5862 0.2735 0.5233 0.0386  0.0272  0.0092  377 HIS D C     
485  O O     . HIS A 59  ? 0.6286 0.2774 0.5543 0.0378  0.0353  0.0063  377 HIS D O     
486  C CB    . HIS A 59  ? 0.5946 0.3173 0.5416 0.0158  0.0109  0.0111  377 HIS D CB    
487  C CG    . HIS A 59  ? 0.6211 0.3696 0.5739 0.0065  0.0023  0.0082  377 HIS D CG    
488  N ND1   . HIS A 59  ? 0.6424 0.3852 0.5907 -0.0069 -0.0055 0.0007  377 HIS D ND1   
489  C CD2   . HIS A 59  ? 0.6049 0.3841 0.5675 0.0095  0.0011  0.0132  377 HIS D CD2   
490  C CE1   . HIS A 59  ? 0.6194 0.3939 0.5818 -0.0098 -0.0111 0.0039  377 HIS D CE1   
491  N NE2   . HIS A 59  ? 0.5895 0.3836 0.5593 0.0014  -0.0051 0.0103  377 HIS D NE2   
492  N N     . THR A 60  ? 0.5534 0.2652 0.5052 0.0510  0.0283  0.0202  378 THR D N     
493  C CA    . THR A 60  ? 0.5616 0.2645 0.5245 0.0667  0.0391  0.0328  378 THR D CA    
494  C C     . THR A 60  ? 0.5663 0.2631 0.5286 0.0790  0.0496  0.0286  378 THR D C     
495  O O     . THR A 60  ? 0.5960 0.2757 0.5662 0.0943  0.0642  0.0370  378 THR D O     
496  C CB    . THR A 60  ? 0.5391 0.2764 0.5207 0.0713  0.0322  0.0516  378 THR D CB    
497  O OG1   . THR A 60  ? 0.5115 0.2795 0.4946 0.0689  0.0232  0.0489  378 THR D OG1   
498  C CG2   . THR A 60  ? 0.5327 0.2738 0.5111 0.0605  0.0259  0.0573  378 THR D CG2   
499  N N     . GLY A 61  ? 0.5431 0.2529 0.4972 0.0742  0.0445  0.0175  379 GLY D N     
500  C CA    . GLY A 61  ? 0.5483 0.2548 0.5010 0.0848  0.0559  0.0148  379 GLY D CA    
501  C C     . GLY A 61  ? 0.5359 0.2748 0.5187 0.0982  0.0593  0.0336  379 GLY D C     
502  O O     . GLY A 61  ? 0.5484 0.2853 0.5379 0.1109  0.0741  0.0367  379 GLY D O     
503  N N     . VAL A 62  ? 0.5151 0.2851 0.5156 0.0946  0.0459  0.0475  380 VAL D N     
504  C CA    . VAL A 62  ? 0.5066 0.3115 0.5370 0.1031  0.0441  0.0687  380 VAL D CA    
505  C C     . VAL A 62  ? 0.4871 0.3166 0.5205 0.0975  0.0386  0.0659  380 VAL D C     
506  O O     . VAL A 62  ? 0.4728 0.3001 0.4858 0.0844  0.0291  0.0509  380 VAL D O     
507  C CB    . VAL A 62  ? 0.4959 0.3222 0.5346 0.0968  0.0286  0.0838  380 VAL D CB    
508  C CG1   . VAL A 62  ? 0.4732 0.3065 0.4899 0.0788  0.0130  0.0713  380 VAL D CG1   
509  C CG2   . VAL A 62  ? 0.4885 0.3532 0.5594 0.1031  0.0229  0.1096  380 VAL D CG2   
510  N N     . LYS A 63  ? 0.4902 0.3436 0.5519 0.1080  0.0457  0.0824  381 LYS D N     
511  C CA    . LYS A 63  ? 0.4776 0.3580 0.5479 0.1012  0.0408  0.0847  381 LYS D CA    
512  C C     . LYS A 63  ? 0.4789 0.4048 0.5866 0.1007  0.0300  0.1122  381 LYS D C     
513  O O     . LYS A 63  ? 0.4907 0.4380 0.6332 0.1154  0.0427  0.1315  381 LYS D O     
514  C CB    . LYS A 63  ? 0.4882 0.3548 0.5563 0.1124  0.0627  0.0784  381 LYS D CB    
515  C CG    . LYS A 63  ? 0.5069 0.3259 0.5351 0.1121  0.0724  0.0536  381 LYS D CG    
516  C CD    . LYS A 63  ? 0.5275 0.3306 0.5454 0.1218  0.0945  0.0478  381 LYS D CD    
517  C CE    . LYS A 63  ? 0.5644 0.3143 0.5395 0.1220  0.1052  0.0258  381 LYS D CE    
518  N NZ    . LYS A 63  ? 0.5519 0.2911 0.4984 0.1023  0.0849  0.0087  381 LYS D NZ    
519  N N     . PRO A 64  ? 0.4751 0.4170 0.5756 0.0837  0.0067  0.1159  382 PRO D N     
520  C CA    . PRO A 64  ? 0.4815 0.4659 0.6123 0.0787  -0.0088 0.1436  382 PRO D CA    
521  C C     . PRO A 64  ? 0.4896 0.5088 0.6409 0.0673  -0.0174 0.1545  382 PRO D C     
522  O O     . PRO A 64  ? 0.4969 0.5564 0.6768 0.0600  -0.0330 0.1803  382 PRO D O     
523  C CB    . PRO A 64  ? 0.4754 0.4527 0.5758 0.0615  -0.0296 0.1383  382 PRO D CB    
524  C CG    . PRO A 64  ? 0.4631 0.4077 0.5246 0.0530  -0.0275 0.1087  382 PRO D CG    
525  C CD    . PRO A 64  ? 0.4659 0.3858 0.5281 0.0687  -0.0053 0.0959  382 PRO D CD    
526  N N     . PHE A 65  ? 0.4898 0.4961 0.6278 0.0635  -0.0092 0.1382  383 PHE D N     
527  C CA    . PHE A 65  ? 0.4881 0.5238 0.6430 0.0497  -0.0170 0.1481  383 PHE D CA    
528  C C     . PHE A 65  ? 0.4922 0.5364 0.6737 0.0674  0.0090  0.1545  383 PHE D C     
529  O O     . PHE A 65  ? 0.5026 0.5112 0.6590 0.0775  0.0276  0.1341  383 PHE D O     
530  C CB    . PHE A 65  ? 0.4873 0.4985 0.6008 0.0287  -0.0295 0.1256  383 PHE D CB    
531  C CG    . PHE A 65  ? 0.4976 0.4906 0.5763 0.0149  -0.0481 0.1151  383 PHE D CG    
532  C CD1   . PHE A 65  ? 0.4991 0.4543 0.5438 0.0205  -0.0416 0.0923  383 PHE D CD1   
533  C CD2   . PHE A 65  ? 0.5088 0.5234 0.5881 -0.0046 -0.0717 0.1294  383 PHE D CD2   
534  C CE1   . PHE A 65  ? 0.5080 0.4476 0.5218 0.0101  -0.0540 0.0840  383 PHE D CE1   
535  C CE2   . PHE A 65  ? 0.5228 0.5158 0.5626 -0.0166 -0.0854 0.1187  383 PHE D CE2   
536  C CZ    . PHE A 65  ? 0.5217 0.4773 0.5298 -0.0076 -0.0744 0.0961  383 PHE D CZ    
537  N N     . GLN A 66  ? 0.4880 0.5802 0.7194 0.0704  0.0105  0.1841  384 GLN D N     
538  C CA    . GLN A 66  ? 0.4927 0.5986 0.7554 0.0906  0.0397  0.1953  384 GLN D CA    
539  C C     . GLN A 66  ? 0.4932 0.6353 0.7784 0.0733  0.0340  0.2086  384 GLN D C     
540  O O     . GLN A 66  ? 0.4875 0.6638 0.7891 0.0493  0.0062  0.2242  384 GLN D O     
541  C CB    . GLN A 66  ? 0.4942 0.6295 0.8073 0.1160  0.0541  0.2244  384 GLN D CB    
542  C CG    . GLN A 66  ? 0.5032 0.6423 0.8432 0.1437  0.0927  0.2337  384 GLN D CG    
543  C CD    . GLN A 66  ? 0.5175 0.6859 0.9119 0.1721  0.1090  0.2657  384 GLN D CD    
544  O OE1   . GLN A 66  ? 0.5113 0.7134 0.9348 0.1671  0.0863  0.2886  384 GLN D OE1   
545  N NE2   . GLN A 66  ? 0.5451 0.6984 0.9510 0.2028  0.1496  0.2682  384 GLN D NE2   
546  N N     . CYS A 67  ? 0.5034 0.6354 0.7858 0.0835  0.0599  0.2026  385 CYS D N     
547  C CA    . CYS A 67  ? 0.5005 0.6664 0.8068 0.0686  0.0594  0.2174  385 CYS D CA    
548  C C     . CYS A 67  ? 0.5044 0.7349 0.8839 0.0805  0.0700  0.2577  385 CYS D C     
549  O O     . CYS A 67  ? 0.5232 0.7562 0.9264 0.1124  0.1006  0.2674  385 CYS D O     
550  C CB    . CYS A 67  ? 0.5083 0.6391 0.7814 0.0756  0.0846  0.1979  385 CYS D CB    
551  S SG    . CYS A 67  ? 0.5025 0.6691 0.7999 0.0566  0.0872  0.2157  385 CYS D SG    
552  N N     . LYS A 68  ? 0.4935 0.7755 0.9092 0.0543  0.0451  0.2824  386 LYS D N     
553  C CA    . LYS A 68  ? 0.4968 0.8518 0.9913 0.0620  0.0502  0.3265  386 LYS D CA    
554  C C     . LYS A 68  ? 0.5176 0.8937 1.0451 0.0806  0.0889  0.3404  386 LYS D C     
555  O O     . LYS A 68  ? 0.5258 0.9628 1.1245 0.0962  0.1032  0.3785  386 LYS D O     
556  C CB    . LYS A 68  ? 0.4878 0.8917 1.0081 0.0224  0.0083  0.3493  386 LYS D CB    
557  N N     . THR A 69  ? 0.5357 0.8652 1.0144 0.0803  0.1070  0.3127  387 THR D N     
558  C CA    . THR A 69  ? 0.5680 0.9125 1.0678 0.0954  0.1448  0.3241  387 THR D CA    
559  C C     . THR A 69  ? 0.6132 0.9111 1.0855 0.1351  0.1890  0.3069  387 THR D C     
560  O O     . THR A 69  ? 0.6352 0.9615 1.1531 0.1649  0.2243  0.3305  387 THR D O     
561  C CB    . THR A 69  ? 0.5698 0.8941 1.0320 0.0668  0.1363  0.3090  387 THR D CB    
562  O OG1   . THR A 69  ? 0.5587 0.9172 1.0404 0.0278  0.0954  0.3234  387 THR D OG1   
563  C CG2   . THR A 69  ? 0.5932 0.9382 1.0787 0.0800  0.1752  0.3250  387 THR D CG2   
564  N N     . CYS A 70  ? 0.6380 0.8637 1.0358 0.1357  0.1882  0.2668  388 CYS D N     
565  C CA    . CYS A 70  ? 0.6964 0.8676 1.0543 0.1664  0.2263  0.2461  388 CYS D CA    
566  C C     . CYS A 70  ? 0.7102 0.8496 1.0559 0.1847  0.2255  0.2354  388 CYS D C     
567  O O     . CYS A 70  ? 0.7492 0.8323 1.0519 0.2056  0.2524  0.2139  388 CYS D O     
568  C CB    . CYS A 70  ? 0.7120 0.8243 0.9944 0.1536  0.2269  0.2113  388 CYS D CB    
569  S SG    . CYS A 70  ? 0.6790 0.7434 0.9030 0.1300  0.1852  0.1771  388 CYS D SG    
570  N N     . GLN A 71  ? 0.6812 0.8519 1.0591 0.1751  0.1946  0.2499  389 GLN D N     
571  C CA    . GLN A 71  ? 0.6894 0.8396 1.0657 0.1907  0.1911  0.2474  389 GLN D CA    
572  C C     . GLN A 71  ? 0.6844 0.7619 0.9870 0.1853  0.1839  0.2070  389 GLN D C     
573  O O     . GLN A 71  ? 0.7062 0.7558 0.9997 0.1993  0.1868  0.2017  389 GLN D O     
574  C CB    . GLN A 71  ? 0.7392 0.8924 1.1496 0.2294  0.2312  0.2665  389 GLN D CB    
575  C CG    . GLN A 71  ? 0.7563 0.9708 1.2250 0.2324  0.2438  0.3026  389 GLN D CG    
576  C CD    . GLN A 71  ? 0.7222 1.0136 1.2527 0.2099  0.2062  0.3361  389 GLN D CD    
577  O OE1   . GLN A 71  ? 0.7068 1.0065 1.2431 0.2007  0.1762  0.3405  389 GLN D OE1   
578  N NE2   . GLN A 71  ? 0.7159 1.0605 1.2866 0.1972  0.2056  0.3597  389 GLN D NE2   
579  N N     . ARG A 72  ? 0.6616 0.7097 0.9145 0.1649  0.1739  0.1810  390 ARG D N     
580  C CA    . ARG A 72  ? 0.6494 0.6368 0.8390 0.1581  0.1650  0.1466  390 ARG D CA    
581  C C     . ARG A 72  ? 0.6012 0.5950 0.7875 0.1384  0.1278  0.1429  390 ARG D C     
582  O O     . ARG A 72  ? 0.5732 0.6064 0.7831 0.1191  0.1032  0.1568  390 ARG D O     
583  C CB    . ARG A 72  ? 0.6488 0.6071 0.7905 0.1448  0.1670  0.1245  390 ARG D CB    
584  C CG    . ARG A 72  ? 0.6541 0.5541 0.7344 0.1388  0.1596  0.0922  390 ARG D CG    
585  C CD    . ARG A 72  ? 0.6627 0.5356 0.6976 0.1294  0.1645  0.0752  390 ARG D CD    
586  N NE    . ARG A 72  ? 0.6791 0.5015 0.6598 0.1233  0.1563  0.0480  390 ARG D NE    
587  C CZ    . ARG A 72  ? 0.6991 0.4905 0.6326 0.1157  0.1585  0.0318  390 ARG D CZ    
588  N NH1   . ARG A 72  ? 0.7038 0.5056 0.6339 0.1143  0.1709  0.0388  390 ARG D NH1   
589  N NH2   . ARG A 72  ? 0.7148 0.4670 0.6053 0.1082  0.1474  0.0109  390 ARG D NH2   
590  N N     . LYS A 73  ? 0.5857 0.5378 0.7392 0.1419  0.1247  0.1241  391 LYS D N     
591  C CA    . LYS A 73  ? 0.5427 0.4957 0.6890 0.1269  0.0954  0.1202  391 LYS D CA    
592  C C     . LYS A 73  ? 0.5268 0.4432 0.6222 0.1100  0.0819  0.0913  391 LYS D C     
593  O O     . LYS A 73  ? 0.5452 0.4245 0.6063 0.1140  0.0955  0.0724  391 LYS D O     
594  C CB    . LYS A 73  ? 0.5510 0.4897 0.7057 0.1434  0.1019  0.1258  391 LYS D CB    
595  C CG    . LYS A 73  ? 0.5611 0.5336 0.7694 0.1657  0.1188  0.1572  391 LYS D CG    
596  C CD    . LYS A 73  ? 0.5916 0.5368 0.8018 0.1855  0.1308  0.1609  391 LYS D CD    
597  C CE    . LYS A 73  ? 0.5813 0.5691 0.8328 0.1848  0.1107  0.1902  391 LYS D CE    
598  N NZ    . LYS A 73  ? 0.5509 0.5478 0.7808 0.1557  0.0750  0.1820  391 LYS D NZ    
599  N N     . PHE A 74  ? 0.5024 0.4296 0.5921 0.0912  0.0551  0.0893  392 PHE D N     
600  C CA    . PHE A 74  ? 0.4970 0.3968 0.5467 0.0771  0.0425  0.0665  392 PHE D CA    
601  C C     . PHE A 74  ? 0.4860 0.3808 0.5265 0.0700  0.0254  0.0627  392 PHE D C     
602  O O     . PHE A 74  ? 0.4887 0.4066 0.5505 0.0690  0.0164  0.0788  392 PHE D O     
603  C CB    . PHE A 74  ? 0.4926 0.4045 0.5376 0.0608  0.0315  0.0662  392 PHE D CB    
604  C CG    . PHE A 74  ? 0.5107 0.4303 0.5647 0.0658  0.0487  0.0723  392 PHE D CG    
605  C CD1   . PHE A 74  ? 0.5117 0.4715 0.6067 0.0666  0.0530  0.0962  392 PHE D CD1   
606  C CD2   . PHE A 74  ? 0.5323 0.4213 0.5541 0.0690  0.0607  0.0564  392 PHE D CD2   
607  C CE1   . PHE A 74  ? 0.5244 0.4937 0.6295 0.0720  0.0722  0.1037  392 PHE D CE1   
608  C CE2   . PHE A 74  ? 0.5496 0.4437 0.5745 0.0736  0.0787  0.0625  392 PHE D CE2   
609  C CZ    . PHE A 74  ? 0.5437 0.4778 0.6110 0.0759  0.0863  0.0860  392 PHE D CZ    
610  N N     . SER A 75  ? 0.4727 0.3394 0.4814 0.0645  0.0209  0.0432  393 SER D N     
611  C CA    . SER A 75  ? 0.4577 0.3178 0.4563 0.0595  0.0096  0.0391  393 SER D CA    
612  C C     . SER A 75  ? 0.4521 0.3252 0.4443 0.0448  -0.0081 0.0411  393 SER D C     
613  O O     . SER A 75  ? 0.4598 0.3354 0.4477 0.0410  -0.0166 0.0444  393 SER D O     
614  C CB    . SER A 75  ? 0.4508 0.2817 0.4238 0.0589  0.0121  0.0209  393 SER D CB    
615  O OG    . SER A 75  ? 0.4385 0.2630 0.3947 0.0520  0.0079  0.0105  393 SER D OG    
616  N N     . ARG A 76  ? 0.4453 0.3220 0.4320 0.0357  -0.0131 0.0389  394 ARG D N     
617  C CA    . ARG A 76  ? 0.4493 0.3260 0.4203 0.0202  -0.0285 0.0372  394 ARG D CA    
618  C C     . ARG A 76  ? 0.4700 0.3672 0.4554 0.0087  -0.0355 0.0496  394 ARG D C     
619  O O     . ARG A 76  ? 0.4743 0.3826 0.4782 0.0137  -0.0258 0.0559  394 ARG D O     
620  C CB    . ARG A 76  ? 0.4430 0.2925 0.3853 0.0180  -0.0284 0.0194  394 ARG D CB    
621  C CG    . ARG A 76  ? 0.4339 0.2691 0.3714 0.0292  -0.0189 0.0094  394 ARG D CG    
622  C CD    . ARG A 76  ? 0.4305 0.2481 0.3474 0.0279  -0.0210 -0.0024 394 ARG D CD    
623  N NE    . ARG A 76  ? 0.4249 0.2328 0.3289 0.0213  -0.0251 -0.0055 394 ARG D NE    
624  C CZ    . ARG A 76  ? 0.4259 0.2167 0.3147 0.0234  -0.0244 -0.0135 394 ARG D CZ    
625  N NH1   . ARG A 76  ? 0.4262 0.2147 0.3155 0.0312  -0.0206 -0.0178 394 ARG D NH1   
626  N NH2   . ARG A 76  ? 0.4451 0.2217 0.3210 0.0177  -0.0271 -0.0151 394 ARG D NH2   
627  N N     . SER A 77  ? 0.4934 0.3941 0.4674 -0.0086 -0.0524 0.0534  395 SER D N     
628  C CA    . SER A 77  ? 0.5100 0.4338 0.4997 -0.0251 -0.0638 0.0685  395 SER D CA    
629  C C     . SER A 77  ? 0.5230 0.4294 0.4990 -0.0342 -0.0624 0.0601  395 SER D C     
630  O O     . SER A 77  ? 0.5236 0.4519 0.5234 -0.0411 -0.0622 0.0736  395 SER D O     
631  C CB    . SER A 77  ? 0.5367 0.4651 0.5109 -0.0451 -0.0854 0.0748  395 SER D CB    
632  O OG    . SER A 77  ? 0.5646 0.4524 0.4910 -0.0545 -0.0899 0.0550  395 SER D OG    
633  N N     . ASP A 78  ? 0.5377 0.4061 0.4779 -0.0338 -0.0604 0.0406  396 ASP D N     
634  C CA    . ASP A 78  ? 0.5543 0.4020 0.4802 -0.0408 -0.0588 0.0343  396 ASP D CA    
635  C C     . ASP A 78  ? 0.5490 0.4069 0.4946 -0.0280 -0.0435 0.0380  396 ASP D C     
636  O O     . ASP A 78  ? 0.5634 0.4244 0.5147 -0.0366 -0.0423 0.0447  396 ASP D O     
637  C CB    . ASP A 78  ? 0.5728 0.3789 0.4609 -0.0377 -0.0572 0.0155  396 ASP D CB    
638  C CG    . ASP A 78  ? 0.5628 0.3650 0.4508 -0.0174 -0.0464 0.0067  396 ASP D CG    
639  O OD1   . ASP A 78  ? 0.5420 0.3668 0.4522 -0.0083 -0.0419 0.0130  396 ASP D OD1   
640  O OD2   . ASP A 78  ? 0.5803 0.3568 0.4478 -0.0108 -0.0421 -0.0049 396 ASP D OD2   
641  N N     . HIS A 79  ? 0.5389 0.3989 0.4912 -0.0091 -0.0312 0.0337  397 HIS D N     
642  C CA    . HIS A 79  ? 0.5371 0.4010 0.4989 0.0022  -0.0155 0.0356  397 HIS D CA    
643  C C     . HIS A 79  ? 0.5500 0.4481 0.5467 0.0025  -0.0085 0.0549  397 HIS D C     
644  O O     . HIS A 79  ? 0.5632 0.4656 0.5659 0.0064  0.0048  0.0598  397 HIS D O     
645  C CB    . HIS A 79  ? 0.5125 0.3641 0.4667 0.0185  -0.0059 0.0253  397 HIS D CB    
646  C CG    . HIS A 79  ? 0.5022 0.3278 0.4301 0.0194  -0.0107 0.0104  397 HIS D CG    
647  N ND1   . HIS A 79  ? 0.5082 0.3174 0.4188 0.0119  -0.0173 0.0062  397 HIS D ND1   
648  C CD2   . HIS A 79  ? 0.4964 0.3113 0.4159 0.0272  -0.0093 0.0013  397 HIS D CD2   
649  C CE1   . HIS A 79  ? 0.5124 0.3052 0.4085 0.0178  -0.0185 -0.0036 397 HIS D CE1   
650  N NE2   . HIS A 79  ? 0.5020 0.3005 0.4043 0.0257  -0.0147 -0.0064 397 HIS D NE2   
651  N N     . LEU A 80  ? 0.5455 0.4704 0.5665 -0.0008 -0.0165 0.0683  398 LEU D N     
652  C CA    . LEU A 80  ? 0.5400 0.5057 0.6026 -0.0017 -0.0121 0.0920  398 LEU D CA    
653  C C     . LEU A 80  ? 0.5542 0.5316 0.6222 -0.0243 -0.0227 0.1018  398 LEU D C     
654  O O     . LEU A 80  ? 0.5607 0.5659 0.6587 -0.0239 -0.0119 0.1187  398 LEU D O     
655  C CB    . LEU A 80  ? 0.5256 0.5200 0.6147 -0.0006 -0.0217 0.1075  398 LEU D CB    
656  C CG    . LEU A 80  ? 0.5162 0.5628 0.6568 -0.0042 -0.0227 0.1381  398 LEU D CG    
657  C CD1   . LEU A 80  ? 0.5106 0.5705 0.6793 0.0195  0.0073  0.1473  398 LEU D CD1   
658  C CD2   . LEU A 80  ? 0.5162 0.5907 0.6786 -0.0066 -0.0387 0.1552  398 LEU D CD2   
659  N N     . LYS A 81  ? 0.5658 0.5196 0.6038 -0.0439 -0.0418 0.0916  399 LYS D N     
660  C CA    . LYS A 81  ? 0.5826 0.5394 0.6203 -0.0694 -0.0541 0.1001  399 LYS D CA    
661  C C     . LYS A 81  ? 0.5775 0.5220 0.6105 -0.0664 -0.0388 0.0984  399 LYS D C     
662  O O     . LYS A 81  ? 0.5887 0.5590 0.6475 -0.0780 -0.0366 0.1165  399 LYS D O     
663  C CB    . LYS A 81  ? 0.6175 0.5369 0.6127 -0.0887 -0.0739 0.0853  399 LYS D CB    
664  C CG    . LYS A 81  ? 0.6610 0.5708 0.6466 -0.1185 -0.0880 0.0911  399 LYS D CG    
665  C CD    . LYS A 81  ? 0.7072 0.5659 0.6401 -0.1344 -0.1026 0.0723  399 LYS D CD    
666  C CE    . LYS A 81  ? 0.7266 0.5971 0.6530 -0.1524 -0.1240 0.0776  399 LYS D CE    
667  N NZ    . LYS A 81  ? 0.7510 0.6531 0.7002 -0.1845 -0.1441 0.0999  399 LYS D NZ    
668  N N     . THR A 82  ? 0.5662 0.4740 0.5673 -0.0518 -0.0286 0.0792  400 THR D N     
669  C CA    . THR A 82  ? 0.5622 0.4568 0.5536 -0.0487 -0.0152 0.0786  400 THR D CA    
670  C C     . THR A 82  ? 0.5640 0.4849 0.5801 -0.0320 0.0076  0.0894  400 THR D C     
671  O O     . THR A 82  ? 0.5675 0.4886 0.5826 -0.0334 0.0199  0.0962  400 THR D O     
672  C CB    . THR A 82  ? 0.5507 0.4019 0.5022 -0.0390 -0.0140 0.0582  400 THR D CB    
673  O OG1   . THR A 82  ? 0.5300 0.3789 0.4778 -0.0213 -0.0100 0.0472  400 THR D OG1   
674  C CG2   . THR A 82  ? 0.5659 0.3848 0.4909 -0.0538 -0.0302 0.0495  400 THR D CG2   
675  N N     . HIS A 83  ? 0.6162 0.5551 0.6512 -0.0156 0.0157  0.0913  401 HIS D N     
676  C CA    . HIS A 83  ? 0.6719 0.6327 0.7307 0.0017  0.0410  0.1028  401 HIS D CA    
677  C C     . HIS A 83  ? 0.6427 0.6505 0.7480 -0.0083 0.0440  0.1306  401 HIS D C     
678  O O     . HIS A 83  ? 0.6468 0.6688 0.7658 -0.0002 0.0670  0.1421  401 HIS D O     
679  C CB    . HIS A 83  ? 0.6372 0.6004 0.7051 0.0219  0.0494  0.0993  401 HIS D CB    
680  C CG    . HIS A 83  ? 0.7104 0.6952 0.8066 0.0416  0.0774  0.1136  401 HIS D CG    
681  N ND1   . HIS A 83  ? 0.7651 0.7248 0.8359 0.0567  0.1029  0.1043  401 HIS D ND1   
682  C CD2   . HIS A 83  ? 0.7390 0.7671 0.8857 0.0498  0.0853  0.1377  401 HIS D CD2   
683  C CE1   . HIS A 83  ? 0.7810 0.7627 0.8825 0.0750  0.1288  0.1200  401 HIS D CE1   
684  N NE2   . HIS A 83  ? 0.7502 0.7765 0.9025 0.0725  0.1190  0.1419  401 HIS D NE2   
685  N N     . THR A 84  ? 0.6194 0.6531 0.7486 -0.0269 0.0212  0.1432  402 THR D N     
686  C CA    . THR A 84  ? 0.6462 0.7293 0.8228 -0.0424 0.0187  0.1725  402 THR D CA    
687  C C     . THR A 84  ? 0.6692 0.7413 0.8330 -0.0610 0.0196  0.1751  402 THR D C     
688  O O     . THR A 84  ? 0.6820 0.7935 0.8847 -0.0677 0.0296  0.1998  402 THR D O     
689  C CB    . THR A 84  ? 0.6479 0.7558 0.8434 -0.0645 -0.0120 0.1842  402 THR D CB    
690  O OG1   . THR A 84  ? 0.6692 0.7325 0.8161 -0.0857 -0.0351 0.1636  402 THR D OG1   
691  C CG2   . THR A 84  ? 0.6264 0.7491 0.8383 -0.0454 -0.0120 0.1866  402 THR D CG2   
692  N N     . ARG A 85  ? 0.6782 0.6984 0.7907 -0.0688 0.0105  0.1524  403 ARG D N     
693  C CA    . ARG A 85  ? 0.6985 0.7013 0.7948 -0.0835 0.0135  0.1551  403 ARG D CA    
694  C C     . ARG A 85  ? 0.7010 0.7082 0.7983 -0.0640 0.0449  0.1599  403 ARG D C     
695  O O     . ARG A 85  ? 0.7201 0.7366 0.8251 -0.0753 0.0537  0.1748  403 ARG D O     
696  C CB    . ARG A 85  ? 0.7126 0.6571 0.7552 -0.0907 -0.0008 0.1314  403 ARG D CB    
697  C CG    . ARG A 85  ? 0.7232 0.6521 0.7531 -0.1116 -0.0285 0.1246  403 ARG D CG    
698  C CD    . ARG A 85  ? 0.7609 0.6334 0.7446 -0.1234 -0.0377 0.1096  403 ARG D CD    
699  N NE    . ARG A 85  ? 0.7719 0.6084 0.7222 -0.1190 -0.0493 0.0881  403 ARG D NE    
700  C CZ    . ARG A 85  ? 0.7990 0.6244 0.7373 -0.1387 -0.0690 0.0847  403 ARG D CZ    
701  N NH1   . ARG A 85  ? 0.8176 0.6670 0.7761 -0.1671 -0.0834 0.1019  403 ARG D NH1   
702  N NH2   . ARG A 85  ? 0.8094 0.6004 0.7144 -0.1313 -0.0743 0.0650  403 ARG D NH2   
703  N N     . THR A 86  ? 0.6887 0.6857 0.7737 -0.0364 0.0625  0.1475  404 THR D N     
704  C CA    . THR A 86  ? 0.7094 0.7062 0.7883 -0.0178 0.0945  0.1508  404 THR D CA    
705  C C     . THR A 86  ? 0.7121 0.7635 0.8462 -0.0156 0.1144  0.1807  404 THR D C     
706  O O     . THR A 86  ? 0.7361 0.7937 0.8700 -0.0133 0.1376  0.1919  404 THR D O     
707  C CB    . THR A 86  ? 0.7164 0.6880 0.7696 0.0080  0.1075  0.1312  404 THR D CB    
708  O OG1   . THR A 86  ? 0.7236 0.6492 0.7280 0.0054  0.0917  0.1072  404 THR D OG1   
709  C CG2   . THR A 86  ? 0.7470 0.7153 0.7901 0.0275  0.1433  0.1343  404 THR D CG2   
710  N N     . HIS A 87  ? 0.6910 0.7852 0.8747 -0.0161 0.1059  0.1966  405 HIS D N     
711  C CA    . HIS A 87  ? 0.6964 0.8516 0.9434 -0.0117 0.1245  0.2297  405 HIS D CA    
712  C C     . HIS A 87  ? 0.6721 0.8609 0.9498 -0.0447 0.1089  0.2536  405 HIS D C     
713  O O     . HIS A 87  ? 0.6815 0.9029 0.9895 -0.0448 0.1315  0.2768  405 HIS D O     
714  C CB    . HIS A 87  ? 0.7166 0.9083 1.0086 0.0012  0.1198  0.2418  405 HIS D CB    
715  C CG    . HIS A 87  ? 0.7742 0.9380 1.0461 0.0354  0.1426  0.2252  405 HIS D CG    
716  N ND1   . HIS A 87  ? 0.8118 0.9370 1.0431 0.0556  0.1740  0.2093  405 HIS D ND1   
717  C CD2   . HIS A 87  ? 0.7739 0.9387 1.0567 0.0508  0.1378  0.2221  405 HIS D CD2   
718  C CE1   . HIS A 87  ? 0.8187 0.9197 1.0358 0.0807  0.1873  0.1958  405 HIS D CE1   
719  N NE2   . HIS A 87  ? 0.7821 0.9070 1.0320 0.0791  0.1665  0.2039  405 HIS D NE2   
720  N N     . THR A 88  ? 0.6499 0.8284 0.9176 -0.0740 0.0714  0.2484  406 THR D N     
721  C CA    . THR A 88  ? 0.6604 0.8656 0.9540 -0.1104 0.0529  0.2704  406 THR D CA    
722  C C     . THR A 88  ? 0.6974 0.8647 0.9531 -0.1239 0.0591  0.2642  406 THR D C     
723  O O     . THR A 88  ? 0.7120 0.9022 0.9918 -0.1523 0.0520  0.2862  406 THR D O     
724  C CB    . THR A 88  ? 0.6521 0.8493 0.9374 -0.1392 0.0111  0.2649  406 THR D CB    
725  O OG1   . THR A 88  ? 0.6767 0.9080 0.9951 -0.1773 -0.0082 0.2910  406 THR D OG1   
726  C CG2   . THR A 88  ? 0.6536 0.7750 0.8661 -0.1440 -0.0029 0.2295  406 THR D CG2   
727  N N     . GLY A 89  ? 0.7236 0.8347 0.9215 -0.1060 0.0706  0.2371  407 GLY D N     
728  C CA    . GLY A 89  ? 0.7764 0.8517 0.9373 -0.1151 0.0777  0.2336  407 GLY D CA    
729  C C     . GLY A 89  ? 0.8166 0.8518 0.9474 -0.1459 0.0479  0.2255  407 GLY D C     
730  O O     . GLY A 89  ? 0.8506 0.8579 0.9562 -0.1563 0.0524  0.2279  407 GLY D O     
731  N N     . GLU A 90  ? 0.8236 0.8504 0.9521 -0.1602 0.0190  0.2163  408 GLU D N     
732  C CA    . GLU A 90  ? 0.8669 0.8463 0.9600 -0.1884 -0.0066 0.2064  408 GLU D CA    
733  C C     . GLU A 90  ? 0.8593 0.7733 0.8928 -0.1716 -0.0042 0.1788  408 GLU D C     
734  O O     . GLU A 90  ? 0.8440 0.7498 0.8626 -0.1428 0.0059  0.1624  408 GLU D O     
735  C CB    . GLU A 90  ? 0.8938 0.8786 0.9933 -0.2083 -0.0363 0.2031  408 GLU D CB    
736  C CG    . GLU A 90  ? 0.8903 0.8471 0.9593 -0.1869 -0.0424 0.1760  408 GLU D CG    
737  C CD    . GLU A 90  ? 0.9137 0.8746 0.9830 -0.2080 -0.0708 0.1741  408 GLU D CD    
738  O OE1   . GLU A 90  ? 0.9221 0.9334 1.0349 -0.2295 -0.0829 0.1986  408 GLU D OE1   
739  O OE2   . GLU A 90  ? 0.9255 0.8405 0.9514 -0.2037 -0.0810 0.1497  408 GLU D OE2   
740  N N     . LYS A 91  ? 0.8742 0.7415 0.8755 -0.1904 -0.0136 0.1760  409 LYS D N     
741  C CA    . LYS A 91  ? 0.8530 0.6600 0.8030 -0.1756 -0.0125 0.1553  409 LYS D CA    
742  C C     . LYS A 91  ? 0.8707 0.6241 0.7896 -0.1996 -0.0332 0.1473  409 LYS D C     
743  O O     . LYS A 91  ? 0.9076 0.6313 0.8119 -0.2170 -0.0336 0.1564  409 LYS D O     
744  C CB    . LYS A 91  ? 0.8459 0.6460 0.7838 -0.1646 0.0082  0.1644  409 LYS D CB    
745  C CG    . LYS A 91  ? 0.7964 0.6346 0.7498 -0.1387 0.0319  0.1675  409 LYS D CG    
746  C CD    . LYS A 91  ? 0.8111 0.6389 0.7439 -0.1318 0.0519  0.1772  409 LYS D CD    
747  C CE    . LYS A 91  ? 0.7888 0.6473 0.7289 -0.1076 0.0779  0.1785  409 LYS D CE    
748  N NZ    . LYS A 91  ? 0.8174 0.6628 0.7286 -0.1021 0.0982  0.1873  409 LYS D NZ    
749  N N     . PRO A 92  ? 0.8510 0.5861 0.7551 -0.2014 -0.0491 0.1299  410 PRO D N     
750  C CA    . PRO A 92  ? 0.8989 0.5755 0.7662 -0.2252 -0.0665 0.1203  410 PRO D CA    
751  C C     . PRO A 92  ? 0.9209 0.5325 0.7451 -0.2113 -0.0595 0.1088  410 PRO D C     
752  O O     . PRO A 92  ? 0.9728 0.5376 0.7735 -0.2323 -0.0648 0.1124  410 PRO D O     
753  C CB    . PRO A 92  ? 0.8931 0.5689 0.7515 -0.2241 -0.0802 0.1037  410 PRO D CB    
754  C CG    . PRO A 92  ? 0.8317 0.5771 0.7353 -0.2087 -0.0740 0.1125  410 PRO D CG    
755  C CD    . PRO A 92  ? 0.8019 0.5661 0.7196 -0.1840 -0.0510 0.1195  410 PRO D CD    
756  N N     . PHE A 93  ? 0.8867 0.4941 0.7012 -0.1771 -0.0485 0.0968  411 PHE D N     
757  C CA    . PHE A 93  ? 0.9216 0.4743 0.7016 -0.1606 -0.0430 0.0892  411 PHE D CA    
758  C C     . PHE A 93  ? 0.9371 0.4847 0.7170 -0.1643 -0.0338 0.1080  411 PHE D C     
759  O O     . PHE A 93  ? 0.9070 0.4966 0.7065 -0.1542 -0.0225 0.1190  411 PHE D O     
760  C CB    . PHE A 93  ? 0.8960 0.4576 0.6736 -0.1261 -0.0362 0.0760  411 PHE D CB    
761  C CG    . PHE A 93  ? 0.8900 0.4620 0.6699 -0.1212 -0.0427 0.0599  411 PHE D CG    
762  C CD1   . PHE A 93  ? 0.9324 0.4565 0.6822 -0.1187 -0.0472 0.0441  411 PHE D CD1   
763  C CD2   . PHE A 93  ? 0.8483 0.4749 0.6584 -0.1180 -0.0422 0.0615  411 PHE D CD2   
764  C CE1   . PHE A 93  ? 0.9223 0.4553 0.6704 -0.1149 -0.0519 0.0304  411 PHE D CE1   
765  C CE2   . PHE A 93  ? 0.8357 0.4711 0.6468 -0.1140 -0.0486 0.0490  411 PHE D CE2   
766  C CZ    . PHE A 93  ? 0.8714 0.4610 0.6505 -0.1134 -0.0538 0.0335  411 PHE D CZ    
767  N N     . SER A 94  ? 0.9783 0.4749 0.7344 -0.1768 -0.0368 0.1108  412 SER D N     
768  C CA    . SER A 94  ? 0.9953 0.4858 0.7507 -0.1808 -0.0285 0.1290  412 SER D CA    
769  C C     . SER A 94  ? 1.0141 0.4647 0.7455 -0.1549 -0.0235 0.1234  412 SER D C     
770  O O     . SER A 94  ? 1.0294 0.4481 0.7460 -0.1441 -0.0268 0.1065  412 SER D O     
771  C CB    . SER A 94  ? 1.0333 0.5199 0.7967 -0.2133 -0.0349 0.1376  412 SER D CB    
772  O OG    . SER A 94  ? 1.0623 0.5423 0.8254 -0.2169 -0.0257 0.1561  412 SER D OG    
773  N N     . CYS A 95  ? 1.0103 0.4660 0.7387 -0.1445 -0.0147 0.1397  413 CYS D N     
774  C CA    . CYS A 95  ? 1.0071 0.4327 0.7190 -0.1213 -0.0119 0.1407  413 CYS D CA    
775  C C     . CYS A 95  ? 1.0918 0.4774 0.7958 -0.1324 -0.0129 0.1424  413 CYS D C     
776  O O     . CYS A 95  ? 1.1172 0.5034 0.8269 -0.1585 -0.0130 0.1534  413 CYS D O     
777  C CB    . CYS A 95  ? 1.0000 0.4426 0.7064 -0.1116 -0.0045 0.1599  413 CYS D CB    
778  S SG    . CYS A 95  ? 1.0800 0.4954 0.7714 -0.0845 -0.0047 0.1677  413 CYS D SG    
779  N N     . ARG A 96  ? 1.1283 0.4796 0.8207 -0.1122 -0.0125 0.1326  414 ARG D N     
780  C CA    . ARG A 96  ? 1.1863 0.4912 0.8669 -0.1187 -0.0115 0.1319  414 ARG D CA    
781  C C     . ARG A 96  ? 1.2105 0.4946 0.8872 -0.0978 -0.0056 0.1475  414 ARG D C     
782  O O     . ARG A 96  ? 1.2493 0.4944 0.9179 -0.0849 -0.0023 0.1431  414 ARG D O     
783  C CB    . ARG A 96  ? 1.2076 0.4847 0.8760 -0.1144 -0.0132 0.1080  414 ARG D CB    
784  C CG    . ARG A 96  ? 1.2060 0.4973 0.8739 -0.1412 -0.0220 0.0953  414 ARG D CG    
785  C CD    . ARG A 96  ? 1.2539 0.5351 0.9205 -0.1766 -0.0276 0.1048  414 ARG D CD    
786  N NE    . ARG A 96  ? 1.2358 0.5540 0.9163 -0.2042 -0.0380 0.1040  414 ARG D NE    
787  C CZ    . ARG A 96  ? 1.2657 0.5908 0.9539 -0.2383 -0.0455 0.1141  414 ARG D CZ    
788  N NH1   . ARG A 96  ? 1.3184 0.6108 0.9978 -0.2496 -0.0429 0.1238  414 ARG D NH1   
789  N NH2   . ARG A 96  ? 1.2426 0.6101 0.9505 -0.2613 -0.0560 0.1164  414 ARG D NH2   
790  N N     . TRP A 97  ? 1.1980 0.5084 0.8794 -0.0940 -0.0038 0.1673  415 TRP D N     
791  C CA    . TRP A 97  ? 1.2345 0.5299 0.9117 -0.0805 -0.0006 0.1879  415 TRP D CA    
792  C C     . TRP A 97  ? 1.2681 0.5524 0.9424 -0.1053 0.0028  0.2057  415 TRP D C     
793  O O     . TRP A 97  ? 1.2490 0.5592 0.9290 -0.1290 0.0038  0.2093  415 TRP D O     
794  C CB    . TRP A 97  ? 1.2103 0.5410 0.8878 -0.0617 -0.0020 0.1999  415 TRP D CB    
795  C CG    . TRP A 97  ? 1.2104 0.5399 0.8934 -0.0307 -0.0051 0.1963  415 TRP D CG    
796  C CD1   . TRP A 97  ? 1.1923 0.5237 0.8833 -0.0174 -0.0062 0.1759  415 TRP D CD1   
797  C CD2   . TRP A 97  ? 1.2298 0.5607 0.9142 -0.0096 -0.0078 0.2167  415 TRP D CD2   
798  N NE1   . TRP A 97  ? 1.1938 0.5296 0.8948 0.0107  -0.0081 0.1828  415 TRP D NE1   
799  C CE2   . TRP A 97  ? 1.2171 0.5536 0.9153 0.0156  -0.0106 0.2085  415 TRP D CE2   
800  C CE3   . TRP A 97  ? 1.2609 0.5917 0.9373 -0.0103 -0.0085 0.2430  415 TRP D CE3   
801  C CZ2   . TRP A 97  ? 1.2295 0.5742 0.9383 0.0393  -0.0157 0.2275  415 TRP D CZ2   
802  C CZ3   . TRP A 97  ? 1.2766 0.6133 0.9591 0.0130  -0.0144 0.2609  415 TRP D CZ3   
803  C CH2   . TRP A 97  ? 1.2595 0.6045 0.9603 0.0372  -0.0188 0.2539  415 TRP D CH2   
804  N N     . PRO A 98  ? 1.3200 0.5679 0.9888 -0.1005 0.0056  0.2189  416 PRO D N     
805  C CA    . PRO A 98  ? 1.3634 0.5979 1.0299 -0.1249 0.0094  0.2367  416 PRO D CA    
806  C C     . PRO A 98  ? 1.3496 0.6265 1.0180 -0.1320 0.0138  0.2574  416 PRO D C     
807  O O     . PRO A 98  ? 1.3282 0.6283 0.9913 -0.1121 0.0135  0.2656  416 PRO D O     
808  C CB    . PRO A 98  ? 1.4163 0.6051 1.0766 -0.1098 0.0119  0.2489  416 PRO D CB    
809  C CG    . PRO A 98  ? 1.4103 0.5808 1.0712 -0.0839 0.0101  0.2307  416 PRO D CG    
810  C CD    . PRO A 98  ? 1.3441 0.5615 1.0118 -0.0723 0.0062  0.2195  416 PRO D CD    
811  N N     . SER A 99  ? 1.3661 0.6541 1.0412 -0.1616 0.0182  0.2660  417 SER D N     
812  C CA    . SER A 99  ? 1.3573 0.6855 1.0347 -0.1710 0.0272  0.2865  417 SER D CA    
813  C C     . SER A 99  ? 1.3025 0.6764 0.9809 -0.1611 0.0283  0.2788  417 SER D C     
814  O O     . SER A 99  ? 1.2983 0.6983 0.9659 -0.1538 0.0356  0.2929  417 SER D O     
815  C CB    . SER A 99  ? 1.3950 0.7116 1.0580 -0.1595 0.0324  0.3117  417 SER D CB    
816  N N     . CYS A 100 ? 1.2689 0.6504 0.9567 -0.1611 0.0216  0.2560  418 CYS D N     
817  C CA    . CYS A 100 ? 1.2247 0.6461 0.9146 -0.1533 0.0231  0.2479  418 CYS D CA    
818  C C     . CYS A 100 ? 1.2013 0.6381 0.9123 -0.1715 0.0189  0.2327  418 CYS D C     
819  O O     . CYS A 100 ? 1.1930 0.6103 0.9037 -0.1661 0.0089  0.2121  418 CYS D O     
820  C CB    . CYS A 100 ? 1.2127 0.6278 0.8886 -0.1229 0.0161  0.2365  418 CYS D CB    
821  S SG    . CYS A 100 ? 1.1643 0.6190 0.8398 -0.1133 0.0167  0.2225  418 CYS D SG    
822  N N     . GLN A 101 ? 1.1938 0.6685 0.9242 -0.1927 0.0274  0.2448  419 GLN D N     
823  C CA    . GLN A 101 ? 1.1685 0.6701 0.9251 -0.2114 0.0223  0.2360  419 GLN D CA    
824  C C     . GLN A 101 ? 1.1221 0.6657 0.8849 -0.2003 0.0300  0.2345  419 GLN D C     
825  O O     . GLN A 101 ? 1.1182 0.7045 0.8986 -0.2090 0.0446  0.2510  419 GLN D O     
826  C CB    . GLN A 101 ? 1.1903 0.7119 0.9734 -0.2432 0.0258  0.2529  419 GLN D CB    
827  N N     . LYS A 102 ? 1.0900 0.6207 0.8383 -0.1794 0.0222  0.2148  420 LYS D N     
828  C CA    . LYS A 102 ? 1.0417 0.6140 0.7983 -0.1617 0.0290  0.2056  420 LYS D CA    
829  C C     . LYS A 102 ? 0.9933 0.5741 0.7673 -0.1601 0.0165  0.1840  420 LYS D C     
830  O O     . LYS A 102 ? 1.0075 0.5457 0.7650 -0.1572 0.0036  0.1705  420 LYS D O     
831  C CB    . LYS A 102 ? 1.0547 0.6163 0.7813 -0.1331 0.0317  0.2008  420 LYS D CB    
832  C CG    . LYS A 102 ? 1.0272 0.6321 0.7601 -0.1148 0.0405  0.1894  420 LYS D CG    
833  C CD    . LYS A 102 ? 1.0412 0.6884 0.7907 -0.1232 0.0615  0.2034  420 LYS D CD    
834  C CE    . LYS A 102 ? 1.0203 0.7010 0.7718 -0.1037 0.0729  0.1903  420 LYS D CE    
835  N NZ    . LYS A 102 ? 1.0283 0.7501 0.8001 -0.1077 0.0980  0.2037  420 LYS D NZ    
836  N N     . LYS A 103 ? 0.9390 0.5731 0.7449 -0.1605 0.0221  0.1819  421 LYS D N     
837  C CA    . LYS A 103 ? 0.8947 0.5431 0.7192 -0.1615 0.0103  0.1654  421 LYS D CA    
838  C C     . LYS A 103 ? 0.8436 0.5239 0.6748 -0.1345 0.0172  0.1518  421 LYS D C     
839  O O     . LYS A 103 ? 0.8330 0.5376 0.6643 -0.1215 0.0339  0.1578  421 LYS D O     
840  C CB    . LYS A 103 ? 0.8864 0.5711 0.7489 -0.1902 0.0064  0.1788  421 LYS D CB    
841  C CG    . LYS A 103 ? 0.9335 0.5773 0.7856 -0.2226 -0.0100 0.1833  421 LYS D CG    
842  C CD    . LYS A 103 ? 0.9344 0.6215 0.8274 -0.2557 -0.0162 0.2018  421 LYS D CD    
843  C CE    . LYS A 103 ? 0.9452 0.6649 0.8617 -0.2660 0.0014  0.2306  421 LYS D CE    
844  N NZ    . LYS A 103 ? 0.9536 0.7186 0.9153 -0.2977 -0.0060 0.2492  421 LYS D NZ    
845  N N     . PHE A 104 ? 0.8122 0.4875 0.6445 -0.1271 0.0054  0.1330  422 PHE D N     
846  C CA    . PHE A 104 ? 0.7577 0.4573 0.5957 -0.1040 0.0096  0.1192  422 PHE D CA    
847  C C     . PHE A 104 ? 0.7332 0.4546 0.5955 -0.1102 -0.0002 0.1112  422 PHE D C     
848  O O     . PHE A 104 ? 0.7562 0.4614 0.6185 -0.1302 -0.0142 0.1105  422 PHE D O     
849  C CB    . PHE A 104 ? 0.7463 0.4138 0.5546 -0.0829 0.0050  0.1048  422 PHE D CB    
850  C CG    . PHE A 104 ? 0.7595 0.4067 0.5421 -0.0765 0.0108  0.1147  422 PHE D CG    
851  C CD1   . PHE A 104 ? 0.7957 0.4016 0.5601 -0.0842 0.0050  0.1228  422 PHE D CD1   
852  C CD2   . PHE A 104 ? 0.7465 0.4117 0.5188 -0.0633 0.0218  0.1164  422 PHE D CD2   
853  C CE1   . PHE A 104 ? 0.8232 0.4117 0.5642 -0.0780 0.0090  0.1352  422 PHE D CE1   
854  C CE2   . PHE A 104 ? 0.7761 0.4227 0.5196 -0.0595 0.0248  0.1270  422 PHE D CE2   
855  C CZ    . PHE A 104 ? 0.8130 0.4239 0.5430 -0.0664 0.0177  0.1378  422 PHE D CZ    
856  N N     . ALA A 105 ? 0.6985 0.4528 0.5770 -0.0938 0.0067  0.1053  423 ALA D N     
857  C CA    . ALA A 105 ? 0.6763 0.4570 0.5801 -0.0974 -0.0014 0.1013  423 ALA D CA    
858  C C     . ALA A 105 ? 0.6640 0.4223 0.5499 -0.0856 -0.0120 0.0807  423 ALA D C     
859  O O     . ALA A 105 ? 0.6477 0.4243 0.5491 -0.0877 -0.0194 0.0769  423 ALA D O     
860  C CB    . ALA A 105 ? 0.6469 0.4755 0.5823 -0.0852 0.0148  0.1097  423 ALA D CB    
861  N N     . ARG A 106 ? 0.6663 0.3883 0.5223 -0.0731 -0.0127 0.0699  424 ARG D N     
862  C CA    . ARG A 106 ? 0.6346 0.3390 0.4775 -0.0603 -0.0196 0.0529  424 ARG D CA    
863  C C     . ARG A 106 ? 0.6806 0.3389 0.4951 -0.0560 -0.0231 0.0483  424 ARG D C     
864  O O     . ARG A 106 ? 0.7135 0.3577 0.5171 -0.0550 -0.0188 0.0573  424 ARG D O     
865  C CB    . ARG A 106 ? 0.5764 0.3014 0.4246 -0.0395 -0.0123 0.0459  424 ARG D CB    
866  C CG    . ARG A 106 ? 0.5664 0.3166 0.4340 -0.0369 -0.0145 0.0404  424 ARG D CG    
867  C CD    . ARG A 106 ? 0.5363 0.3055 0.4103 -0.0201 -0.0042 0.0368  424 ARG D CD    
868  N NE    . ARG A 106 ? 0.5324 0.2823 0.3852 -0.0074 -0.0051 0.0275  424 ARG D NE    
869  C CZ    . ARG A 106 ? 0.5102 0.2666 0.3591 0.0040  0.0004  0.0220  424 ARG D CZ    
870  N NH1   . ARG A 106 ? 0.5037 0.2798 0.3664 0.0074  0.0107  0.0233  424 ARG D NH1   
871  N NH2   . ARG A 106 ? 0.5297 0.2721 0.3615 0.0114  -0.0045 0.0163  424 ARG D NH2   
872  N N     . SER A 107 ? 0.6803 0.3144 0.4824 -0.0522 -0.0292 0.0357  425 SER D N     
873  C CA    . SER A 107 ? 0.7093 0.2972 0.4871 -0.0444 -0.0292 0.0322  425 SER D CA    
874  C C     . SER A 107 ? 0.6920 0.2841 0.4694 -0.0223 -0.0247 0.0355  425 SER D C     
875  O O     . SER A 107 ? 0.7186 0.2850 0.4833 -0.0180 -0.0235 0.0441  425 SER D O     
876  C CB    . SER A 107 ? 0.7307 0.2930 0.4940 -0.0418 -0.0320 0.0176  425 SER D CB    
877  O OG    . SER A 107 ? 0.7012 0.2887 0.4763 -0.0243 -0.0298 0.0097  425 SER D OG    
878  N N     . ASP A 108 ? 0.6574 0.2807 0.4477 -0.0096 -0.0238 0.0301  426 ASP D N     
879  C CA    . ASP A 108 ? 0.6651 0.2953 0.4540 0.0067  -0.0236 0.0340  426 ASP D CA    
880  C C     . ASP A 108 ? 0.6807 0.3170 0.4619 0.0021  -0.0212 0.0465  426 ASP D C     
881  O O     . ASP A 108 ? 0.6956 0.3270 0.4672 0.0115  -0.0241 0.0540  426 ASP D O     
882  C CB    . ASP A 108 ? 0.6400 0.2995 0.4419 0.0159  -0.0244 0.0253  426 ASP D CB    
883  C CG    . ASP A 108 ? 0.6277 0.3137 0.4409 0.0071  -0.0207 0.0220  426 ASP D CG    
884  O OD1   . ASP A 108 ? 0.6347 0.3210 0.4537 -0.0052 -0.0205 0.0224  426 ASP D OD1   
885  O OD2   . ASP A 108 ? 0.6159 0.3210 0.4318 0.0121  -0.0183 0.0202  426 ASP D OD2   
886  N N     . GLU A 109 ? 0.6843 0.3333 0.4699 -0.0122 -0.0158 0.0510  427 GLU D N     
887  C CA    . GLU A 109 ? 0.7138 0.3645 0.4884 -0.0172 -0.0098 0.0644  427 GLU D CA    
888  C C     . GLU A 109 ? 0.7366 0.3529 0.4964 -0.0221 -0.0125 0.0761  427 GLU D C     
889  O O     . GLU A 109 ? 0.7624 0.3706 0.5057 -0.0178 -0.0121 0.0874  427 GLU D O     
890  C CB    . GLU A 109 ? 0.7304 0.4067 0.5197 -0.0297 0.0001  0.0692  427 GLU D CB    
891  C CG    . GLU A 109 ? 0.7301 0.4361 0.5285 -0.0213 0.0079  0.0620  427 GLU D CG    
892  C CD    . GLU A 109 ? 0.7444 0.4775 0.5619 -0.0293 0.0217  0.0710  427 GLU D CD    
893  O OE1   . GLU A 109 ? 0.7296 0.4826 0.5740 -0.0344 0.0200  0.0701  427 GLU D OE1   
894  O OE2   . GLU A 109 ? 0.7695 0.5059 0.5758 -0.0302 0.0347  0.0809  427 GLU D OE2   
895  N N     . LEU A 110 ? 0.7249 0.3167 0.4864 -0.0321 -0.0156 0.0741  428 LEU D N     
896  C CA    . LEU A 110 ? 0.7554 0.3049 0.5002 -0.0368 -0.0169 0.0844  428 LEU D CA    
897  C C     . LEU A 110 ? 0.7746 0.3009 0.5093 -0.0149 -0.0201 0.0855  428 LEU D C     
898  O O     . LEU A 110 ? 0.8201 0.3226 0.5415 -0.0113 -0.0202 0.1002  428 LEU D O     
899  C CB    . LEU A 110 ? 0.8000 0.3215 0.5424 -0.0551 -0.0200 0.0791  428 LEU D CB    
900  C CG    . LEU A 110 ? 0.7571 0.2235 0.4782 -0.0614 -0.0203 0.0867  428 LEU D CG    
901  C CD1   . LEU A 110 ? 0.7778 0.2439 0.4941 -0.0708 -0.0164 0.1076  428 LEU D CD1   
902  C CD2   . LEU A 110 ? 0.7807 0.2298 0.4998 -0.0821 -0.0244 0.0764  428 LEU D CD2   
903  N N     . VAL A 111 ? 0.7601 0.2953 0.5038 0.0001  -0.0224 0.0728  429 VAL D N     
904  C CA    . VAL A 111 ? 0.7749 0.2980 0.5184 0.0226  -0.0246 0.0771  429 VAL D CA    
905  C C     . VAL A 111 ? 0.7816 0.3267 0.5226 0.0294  -0.0298 0.0917  429 VAL D C     
906  O O     . VAL A 111 ? 0.8114 0.3392 0.5466 0.0403  -0.0329 0.1074  429 VAL D O     
907  C CB    . VAL A 111 ? 0.7403 0.2778 0.4982 0.0355  -0.0244 0.0625  429 VAL D CB    
908  C CG1   . VAL A 111 ? 0.7448 0.2820 0.5118 0.0595  -0.0260 0.0714  429 VAL D CG1   
909  C CG2   . VAL A 111 ? 0.7473 0.2581 0.4990 0.0281  -0.0194 0.0484  429 VAL D CG2   
910  N N     . ARG A 112 ? 0.7595 0.3403 0.5021 0.0230  -0.0308 0.0874  430 ARG D N     
911  C CA    . ARG A 112 ? 0.7745 0.3710 0.5038 0.0251  -0.0362 0.0990  430 ARG D CA    
912  C C     . ARG A 112 ? 0.8197 0.3954 0.5285 0.0170  -0.0335 0.1169  430 ARG D C     
913  O O     . ARG A 112 ? 0.8416 0.4143 0.5361 0.0227  -0.0409 0.1329  430 ARG D O     
914  C CB    . ARG A 112 ? 0.7515 0.3785 0.4782 0.0183  -0.0333 0.0880  430 ARG D CB    
915  C CG    . ARG A 112 ? 0.7803 0.4168 0.4817 0.0169  -0.0382 0.0964  430 ARG D CG    
916  C CD    . ARG A 112 ? 0.7752 0.4312 0.4686 0.0113  -0.0316 0.0827  430 ARG D CD    
917  N NE    . ARG A 112 ? 0.7564 0.4278 0.4700 0.0174  -0.0367 0.0682  430 ARG D NE    
918  C CZ    . ARG A 112 ? 0.7517 0.4355 0.4607 0.0148  -0.0323 0.0553  430 ARG D CZ    
919  N NH1   . ARG A 112 ? 0.7761 0.4574 0.4597 0.0083  -0.0206 0.0540  430 ARG D NH1   
920  N NH2   . ARG A 112 ? 0.7229 0.4188 0.4512 0.0194  -0.0373 0.0443  430 ARG D NH2   
921  N N     . HIS A 113 ? 0.8377 0.4007 0.5455 0.0019  -0.0243 0.1169  431 HIS D N     
922  C CA    . HIS A 113 ? 0.8777 0.4196 0.5677 -0.0082 -0.0204 0.1355  431 HIS D CA    
923  C C     . HIS A 113 ? 0.9001 0.4016 0.5849 0.0012  -0.0253 0.1484  431 HIS D C     
924  O O     . HIS A 113 ? 0.9662 0.4571 0.6357 0.0034  -0.0278 0.1678  431 HIS D O     
925  C CB    . HIS A 113 ? 0.9303 0.4728 0.6273 -0.0290 -0.0103 0.1343  431 HIS D CB    
926  C CG    . HIS A 113 ? 1.0488 0.5734 0.7303 -0.0425 -0.0044 0.1548  431 HIS D CG    
927  N ND1   . HIS A 113 ? 1.0793 0.6202 0.7427 -0.0453 0.0027  0.1672  431 HIS D ND1   
928  C CD2   . HIS A 113 ? 1.1022 0.5908 0.7804 -0.0552 -0.0036 0.1653  431 HIS D CD2   
929  C CE1   . HIS A 113 ? 1.1220 0.6419 0.7748 -0.0584 0.0080  0.1862  431 HIS D CE1   
930  N NE2   . HIS A 113 ? 1.1267 0.6143 0.7894 -0.0654 0.0036  0.1856  431 HIS D NE2   
931  N N     . HIS A 114 ? 0.9214 0.4032 0.6203 0.0076  -0.0250 0.1370  432 HIS D N     
932  C CA    . HIS A 114 ? 0.9966 0.4559 0.7044 0.0197  -0.0242 0.1434  432 HIS D CA    
933  C C     . HIS A 114 ? 1.0167 0.4901 0.7306 0.0418  -0.0320 0.1578  432 HIS D C     
934  O O     . HIS A 114 ? 1.0493 0.5092 0.7668 0.0501  -0.0323 0.1744  432 HIS D O     
935  C CB    . HIS A 114 ? 1.0134 0.4563 0.7337 0.0235  -0.0192 0.1243  432 HIS D CB    
936  C CG    . HIS A 114 ? 1.0544 0.4720 0.7673 0.0011  -0.0145 0.1167  432 HIS D CG    
937  N ND1   . HIS A 114 ? 1.0894 0.4931 0.7928 -0.0163 -0.0131 0.1305  432 HIS D ND1   
938  C CD2   . HIS A 114 ? 1.0602 0.4652 0.7725 -0.0089 -0.0123 0.0982  432 HIS D CD2   
939  C CE1   . HIS A 114 ? 1.1079 0.4925 0.8082 -0.0369 -0.0114 0.1211  432 HIS D CE1   
940  N NE2   . HIS A 114 ? 1.0914 0.4756 0.7946 -0.0332 -0.0119 0.1012  432 HIS D NE2   
941  N N     . ASN A 115 ? 1.0005 0.5017 0.7174 0.0504  -0.0398 0.1536  433 ASN D N     
942  C CA    . ASN A 115 ? 1.0184 0.5397 0.7436 0.0678  -0.0513 0.1698  433 ASN D CA    
943  C C     . ASN A 115 ? 1.0465 0.5765 0.7469 0.0597  -0.0602 0.1896  433 ASN D C     
944  O O     . ASN A 115 ? 1.0696 0.6079 0.7767 0.0708  -0.0691 0.2106  433 ASN D O     
945  C CB    . ASN A 115 ? 0.9922 0.5425 0.7291 0.0758  -0.0589 0.1591  433 ASN D CB    
946  C CG    . ASN A 115 ? 0.9836 0.5268 0.7421 0.0842  -0.0488 0.1403  433 ASN D CG    
947  O OD1   . ASN A 115 ? 0.9517 0.5161 0.7170 0.0787  -0.0478 0.1220  433 ASN D OD1   
948  N ND2   . ASN A 115 ? 1.0090 0.5323 0.7835 0.0949  -0.0390 0.1421  433 ASN D ND2   
949  N N     . MET A 116 ? 1.0530 0.5833 0.7252 0.0408  -0.0566 0.1849  434 MET D N     
950  C CA    . MET A 116 ? 1.0934 0.6298 0.7358 0.0315  -0.0610 0.2020  434 MET D CA    
951  C C     . MET A 116 ? 1.1229 0.6381 0.7637 0.0275  -0.0539 0.2189  434 MET D C     
952  O O     . MET A 116 ? 1.1495 0.6696 0.7673 0.0218  -0.0572 0.2362  434 MET D O     
953  C CB    . MET A 116 ? 1.1037 0.6578 0.7253 0.0144  -0.0522 0.1883  434 MET D CB    
954  C CG    . MET A 116 ? 1.0938 0.6801 0.7172 0.0161  -0.0591 0.1714  434 MET D CG    
955  S SD    . MET A 116 ? 1.1337 0.7317 0.7100 0.0011  -0.0543 0.1689  434 MET D SD    
956  C CE    . MET A 116 ? 1.1906 0.7791 0.7322 0.0016  -0.0727 0.1990  434 MET D CE    
957  N N     . HIS A 117 ? 1.1303 0.6206 0.7918 0.0286  -0.0445 0.2139  435 HIS D N     
958  C CA    . HIS A 117 ? 1.1667 0.6323 0.8295 0.0260  -0.0392 0.2304  435 HIS D CA    
959  C C     . HIS A 117 ? 1.1877 0.6522 0.8667 0.0470  -0.0473 0.2503  435 HIS D C     
960  O O     . HIS A 117 ? 1.2150 0.6578 0.8956 0.0473  -0.0437 0.2672  435 HIS D O     
961  C CB    . HIS A 117 ? 1.1767 0.6127 0.8522 0.0171  -0.0279 0.2164  435 HIS D CB    
962  C CG    . HIS A 117 ? 1.2213 0.6544 0.8839 -0.0087 -0.0193 0.2132  435 HIS D CG    
963  N ND1   . HIS A 117 ? 1.2673 0.6851 0.9215 -0.0226 -0.0134 0.2297  435 HIS D ND1   
964  C CD2   . HIS A 117 ? 1.1996 0.6464 0.8610 -0.0230 -0.0148 0.1982  435 HIS D CD2   
965  C CE1   . HIS A 117 ? 1.2610 0.6865 0.9116 -0.0448 -0.0055 0.2256  435 HIS D CE1   
966  N NE2   . HIS A 117 ? 1.2092 0.6527 0.8648 -0.0451 -0.0062 0.2072  435 HIS D NE2   
967  N N     . GLN A 118 ? 1.1784 0.6675 0.8727 0.0640  -0.0580 0.2509  436 GLN D N     
968  C CA    . GLN A 118 ? 1.1823 0.6778 0.9020 0.0856  -0.0654 0.2731  436 GLN D CA    
969  C C     . GLN A 118 ? 1.1635 0.6994 0.8766 0.0904  -0.0841 0.2900  436 GLN D C     
970  O O     . GLN A 118 ? 1.1295 0.6926 0.8577 0.0989  -0.0932 0.2839  436 GLN D O     
971  C CB    . GLN A 118 ? 1.1660 0.6553 0.9214 0.1036  -0.0597 0.2608  436 GLN D CB    
972  C CG    . GLN A 118 ? 1.1708 0.6256 0.9227 0.0941  -0.0435 0.2343  436 GLN D CG    
973  C CD    . GLN A 118 ? 1.1786 0.6209 0.9581 0.1122  -0.0354 0.2228  436 GLN D CD    
974  O OE1   . GLN A 118 ? 1.1954 0.6458 1.0009 0.1332  -0.0398 0.2385  436 GLN D OE1   
975  N NE2   . GLN A 118 ? 1.1689 0.5923 0.9416 0.1032  -0.0243 0.1957  436 GLN D NE2   
976  P P     . DG  B 2   ? 0.8962 0.5168 0.5087 0.0454  0.1701  0.1366  2   DG  E P     
977  O OP1   . DG  B 2   ? 0.9232 0.5462 0.5404 0.0384  0.1862  0.1492  2   DG  E OP1   
978  O OP2   . DG  B 2   ? 0.8840 0.4953 0.4999 0.0343  0.1556  0.1306  2   DG  E OP2   
979  O "O5'" . DG  B 2   ? 0.8545 0.5054 0.4900 0.0482  0.1740  0.1378  2   DG  E "O5'" 
980  C "C5'" . DG  B 2   ? 0.8441 0.5153 0.4917 0.0516  0.1917  0.1483  2   DG  E "C5'" 
981  C "C4'" . DG  B 2   ? 0.8013 0.4987 0.4680 0.0594  0.1900  0.1441  2   DG  E "C4'" 
982  O "O4'" . DG  B 2   ? 0.7912 0.4708 0.4336 0.0751  0.1785  0.1305  2   DG  E "O4'" 
983  C "C3'" . DG  B 2   ? 0.7562 0.4830 0.4614 0.0452  0.1792  0.1413  2   DG  E "C3'" 
984  O "O3'" . DG  B 2   ? 0.7498 0.5078 0.4794 0.0504  0.1866  0.1456  2   DG  E "O3'" 
985  C "C2'" . DG  B 2   ? 0.7331 0.4452 0.4266 0.0492  0.1596  0.1258  2   DG  E "C2'" 
986  C "C1'" . DG  B 2   ? 0.7498 0.4412 0.4111 0.0696  0.1618  0.1200  2   DG  E "C1'" 
987  N N9    . DG  B 2   ? 0.7456 0.4108 0.3823 0.0747  0.1469  0.1077  2   DG  E N9    
988  C C8    . DG  B 2   ? 0.7525 0.3985 0.3774 0.0677  0.1393  0.1059  2   DG  E C8    
989  N N7    . DG  B 2   ? 0.7537 0.3817 0.3591 0.0762  0.1262  0.0940  2   DG  E N7    
990  C C5    . DG  B 2   ? 0.7453 0.3802 0.3495 0.0878  0.1246  0.0871  2   DG  E C5    
991  C C6    . DG  B 2   ? 0.7430 0.3672 0.3324 0.0986  0.1122  0.0735  2   DG  E C6    
992  O O6    . DG  B 2   ? 0.7482 0.3572 0.3237 0.1012  0.0997  0.0648  2   DG  E O6    
993  N N1    . DG  B 2   ? 0.7353 0.3683 0.3281 0.1070  0.1153  0.0701  2   DG  E N1    
994  C C2    . DG  B 2   ? 0.7323 0.3828 0.3402 0.1072  0.1291  0.0792  2   DG  E C2    
995  N N2    . DG  B 2   ? 0.7328 0.3861 0.3393 0.1173  0.1305  0.0740  2   DG  E N2    
996  N N3    . DG  B 2   ? 0.7327 0.3975 0.3570 0.0980  0.1407  0.0924  2   DG  E N3    
997  C C4    . DG  B 2   ? 0.7392 0.3949 0.3609 0.0876  0.1375  0.0954  2   DG  E C4    
998  P P     . DC  B 3   ? 0.6976 0.4916 0.4686 0.0382  0.1779  0.1454  3   DC  E P     
999  O OP1   . DC  B 3   ? 0.7145 0.5414 0.5109 0.0417  0.1927  0.1567  3   DC  E OP1   
1000 O OP2   . DC  B 3   ? 0.7096 0.5007 0.4901 0.0182  0.1678  0.1444  3   DC  E OP2   
1001 O "O5'" . DC  B 3   ? 0.6990 0.4876 0.4630 0.0487  0.1633  0.1317  3   DC  E "O5'" 
1002 C "C5'" . DC  B 3   ? 0.6988 0.4819 0.4484 0.0677  0.1687  0.1285  3   DC  E "C5'" 
1003 C "C4'" . DC  B 3   ? 0.6782 0.4516 0.4209 0.0730  0.1533  0.1148  3   DC  E "C4'" 
1004 O "O4'" . DC  B 3   ? 0.6987 0.4409 0.4127 0.0746  0.1441  0.1051  3   DC  E "O4'" 
1005 C "C3'" . DC  B 3   ? 0.6616 0.4547 0.4312 0.0609  0.1405  0.1120  3   DC  E "C3'" 
1006 O "O3'" . DC  B 3   ? 0.6382 0.4401 0.4147 0.0704  0.1380  0.1080  3   DC  E "O3'" 
1007 C "C2'" . DC  B 3   ? 0.6470 0.4174 0.4012 0.0540  0.1264  0.1017  3   DC  E "C2'" 
1008 C "C1'" . DC  B 3   ? 0.6748 0.4170 0.3963 0.0682  0.1282  0.0953  3   DC  E "C1'" 
1009 N N1    . DC  B 3   ? 0.6894 0.4069 0.3903 0.0651  0.1189  0.0883  3   DC  E N1    
1010 C C2    . DC  B 3   ? 0.7032 0.4001 0.3815 0.0757  0.1107  0.0767  3   DC  E C2    
1011 O O2    . DC  B 3   ? 0.7070 0.4040 0.3815 0.0860  0.1116  0.0720  3   DC  E O2    
1012 N N3    . DC  B 3   ? 0.7117 0.3889 0.3730 0.0743  0.1019  0.0708  3   DC  E N3    
1013 C C4    . DC  B 3   ? 0.7151 0.3890 0.3789 0.0633  0.1017  0.0760  3   DC  E C4    
1014 N N4    . DC  B 3   ? 0.7237 0.3765 0.3691 0.0643  0.0932  0.0701  3   DC  E N4    
1015 C C5    . DC  B 3   ? 0.7108 0.4029 0.3966 0.0509  0.1098  0.0872  3   DC  E C5    
1016 C C6    . DC  B 3   ? 0.6978 0.4132 0.4028 0.0521  0.1178  0.0929  3   DC  E C6    
1017 P P     . DG  B 4   ? 0.6156 0.4424 0.4202 0.0626  0.1284  0.1080  4   DG  E P     
1018 O OP1   . DG  B 4   ? 0.6155 0.4720 0.4433 0.0673  0.1387  0.1190  4   DG  E OP1   
1019 O OP2   . DG  B 4   ? 0.6072 0.4342 0.4184 0.0459  0.1169  0.1053  4   DG  E OP2   
1020 O "O5'" . DG  B 4   ? 0.6080 0.4193 0.4000 0.0722  0.1206  0.0969  4   DG  E "O5'" 
1021 C "C5'" . DG  B 4   ? 0.6206 0.4205 0.3981 0.0885  0.1284  0.0949  4   DG  E "C5'" 
1022 C "C4'" . DG  B 4   ? 0.6219 0.3966 0.3801 0.0927  0.1190  0.0814  4   DG  E "C4'" 
1023 O "O4'" . DG  B 4   ? 0.6283 0.3831 0.3677 0.0884  0.1132  0.0748  4   DG  E "O4'" 
1024 C "C3'" . DG  B 4   ? 0.6013 0.3819 0.3724 0.0861  0.1078  0.0765  4   DG  E "C3'" 
1025 O "O3'" . DG  B 4   ? 0.6147 0.3805 0.3757 0.0953  0.1068  0.0690  4   DG  E "O3'" 
1026 C "C2'" . DG  B 4   ? 0.5898 0.3606 0.3552 0.0748  0.0969  0.0696  4   DG  E "C2'" 
1027 C "C1'" . DG  B 4   ? 0.6122 0.3612 0.3530 0.0811  0.0998  0.0656  4   DG  E "C1'" 
1028 N N9    . DG  B 4   ? 0.6120 0.3532 0.3461 0.0725  0.0944  0.0641  4   DG  E N9    
1029 C C8    . DG  B 4   ? 0.6114 0.3613 0.3531 0.0635  0.0980  0.0728  4   DG  E C8    
1030 N N7    . DG  B 4   ? 0.6165 0.3520 0.3469 0.0579  0.0919  0.0691  4   DG  E N7    
1031 C C5    . DG  B 4   ? 0.6185 0.3381 0.3347 0.0642  0.0834  0.0573  4   DG  E C5    
1032 C C6    . DG  B 4   ? 0.6281 0.3302 0.3292 0.0638  0.0741  0.0490  4   DG  E C6    
1033 O O6    . DG  B 4   ? 0.6389 0.3323 0.3333 0.0585  0.0720  0.0507  4   DG  E O6    
1034 N N1    . DG  B 4   ? 0.6258 0.3202 0.3201 0.0707  0.0670  0.0379  4   DG  E N1    
1035 C C2    . DG  B 4   ? 0.6220 0.3209 0.3212 0.0762  0.0689  0.0350  4   DG  E C2    
1036 N N2    . DG  B 4   ? 0.6229 0.3127 0.3157 0.0803  0.0610  0.0235  4   DG  E N2    
1037 N N3    . DG  B 4   ? 0.6170 0.3285 0.3272 0.0777  0.0780  0.0429  4   DG  E N3    
1038 C C4    . DG  B 4   ? 0.6143 0.3373 0.3333 0.0720  0.0847  0.0539  4   DG  E C4    
1039 P P     . DT  B 5   ? 0.6061 0.3781 0.3800 0.0929  0.1006  0.0671  5   DT  E P     
1040 O OP1   . DT  B 5   ? 0.6198 0.3746 0.3819 0.1043  0.1044  0.0622  5   DT  E OP1   
1041 O OP2   . DT  B 5   ? 0.5991 0.3992 0.3960 0.0883  0.1016  0.0780  5   DT  E OP2   
1042 O "O5'" . DT  B 5   ? 0.5960 0.3590 0.3667 0.0817  0.0881  0.0575  5   DT  E "O5'" 
1043 C "C5'" . DT  B 5   ? 0.6041 0.3447 0.3572 0.0837  0.0836  0.0460  5   DT  E "C5'" 
1044 C "C4'" . DT  B 5   ? 0.5949 0.3337 0.3503 0.0736  0.0728  0.0388  5   DT  E "C4'" 
1045 O "O4'" . DT  B 5   ? 0.5939 0.3321 0.3442 0.0688  0.0703  0.0397  5   DT  E "O4'" 
1046 C "C3'" . DT  B 5   ? 0.5831 0.3368 0.3554 0.0657  0.0690  0.0420  5   DT  E "C3'" 
1047 O "O3'" . DT  B 5   ? 0.5936 0.3388 0.3647 0.0624  0.0626  0.0329  5   DT  E "O3'" 
1048 C "C2'" . DT  B 5   ? 0.5684 0.3323 0.3458 0.0568  0.0656  0.0461  5   DT  E "C2'" 
1049 C "C1'" . DT  B 5   ? 0.5745 0.3218 0.3355 0.0585  0.0637  0.0397  5   DT  E "C1'" 
1050 N N1    . DT  B 5   ? 0.5689 0.3181 0.3281 0.0526  0.0636  0.0444  5   DT  E N1    
1051 C C2    . DT  B 5   ? 0.5658 0.3014 0.3130 0.0505  0.0575  0.0379  5   DT  E C2    
1052 O O2    . DT  B 5   ? 0.5608 0.2864 0.3011 0.0534  0.0516  0.0284  5   DT  E O2    
1053 N N3    . DT  B 5   ? 0.5695 0.3038 0.3139 0.0448  0.0587  0.0433  5   DT  E N3    
1054 C C4    . DT  B 5   ? 0.5710 0.3181 0.3258 0.0395  0.0652  0.0539  5   DT  E C4    
1055 O O4    . DT  B 5   ? 0.5745 0.3177 0.3264 0.0328  0.0662  0.0580  5   DT  E O4    
1056 C C5    . DT  B 5   ? 0.5677 0.3334 0.3378 0.0422  0.0708  0.0601  5   DT  E C5    
1057 C C7    . DT  B 5   ? 0.5686 0.3543 0.3549 0.0371  0.0777  0.0718  5   DT  E C7    
1058 C C6    . DT  B 5   ? 0.5663 0.3308 0.3365 0.0494  0.0699  0.0552  5   DT  E C6    
1059 P P     . DG  B 6   ? 0.6068 0.3554 0.3870 0.0616  0.0633  0.0341  6   DG  E P     
1060 O OP1   . DG  B 6   ? 0.6183 0.3551 0.3927 0.0706  0.0695  0.0333  6   DG  E OP1   
1061 O OP2   . DG  B 6   ? 0.5998 0.3671 0.3919 0.0575  0.0628  0.0433  6   DG  E OP2   
1062 O "O5'" . DG  B 6   ? 0.5928 0.3345 0.3727 0.0550  0.0564  0.0240  6   DG  E "O5'" 
1063 C "C5'" . DG  B 6   ? 0.5705 0.3197 0.3539 0.0475  0.0505  0.0228  6   DG  E "C5'" 
1064 C "C4'" . DG  B 6   ? 0.5621 0.3022 0.3393 0.0462  0.0447  0.0122  6   DG  E "C4'" 
1065 O "O4'" . DG  B 6   ? 0.5637 0.2985 0.3308 0.0497  0.0441  0.0122  6   DG  E "O4'" 
1066 C "C3'" . DG  B 6   ? 0.5508 0.2957 0.3315 0.0398  0.0393  0.0089  6   DG  E "C3'" 
1067 O "O3'" . DG  B 6   ? 0.5426 0.2869 0.3293 0.0377  0.0391  0.0033  6   DG  E "O3'" 
1068 C "C2'" . DG  B 6   ? 0.5516 0.2894 0.3231 0.0415  0.0343  0.0031  6   DG  E "C2'" 
1069 C "C1'" . DG  B 6   ? 0.5569 0.2905 0.3205 0.0463  0.0381  0.0086  6   DG  E "C1'" 
1070 N N9    . DG  B 6   ? 0.5590 0.2983 0.3227 0.0425  0.0396  0.0169  6   DG  E N9    
1071 C C8    . DG  B 6   ? 0.5594 0.3090 0.3299 0.0416  0.0450  0.0267  6   DG  E C8    
1072 N N7    . DG  B 6   ? 0.5603 0.3146 0.3318 0.0361  0.0446  0.0322  6   DG  E N7    
1073 C C5    . DG  B 6   ? 0.5646 0.3076 0.3267 0.0340  0.0390  0.0257  6   DG  E C5    
1074 C C6    . DG  B 6   ? 0.5769 0.3150 0.3338 0.0280  0.0364  0.0273  6   DG  E C6    
1075 O O6    . DG  B 6   ? 0.5833 0.3276 0.3448 0.0214  0.0383  0.0346  6   DG  E O6    
1076 N N1    . DG  B 6   ? 0.5810 0.3057 0.3271 0.0302  0.0309  0.0191  6   DG  E N1    
1077 C C2    . DG  B 6   ? 0.5791 0.3000 0.3230 0.0366  0.0278  0.0105  6   DG  E C2    
1078 N N2    . DG  B 6   ? 0.5893 0.3001 0.3244 0.0391  0.0223  0.0037  6   DG  E N2    
1079 N N3    . DG  B 6   ? 0.5696 0.2960 0.3201 0.0401  0.0299  0.0085  6   DG  E N3    
1080 C C4    . DG  B 6   ? 0.5637 0.2991 0.3216 0.0388  0.0357  0.0164  6   DG  E C4    
1081 P P     . DG  B 7   ? 0.5497 0.3018 0.3422 0.0320  0.0382  0.0040  7   DG  E P     
1082 O OP1   . DG  B 7   ? 0.5610 0.3112 0.3602 0.0305  0.0409  -0.0006 7   DG  E OP1   
1083 O OP2   . DG  B 7   ? 0.5591 0.3188 0.3519 0.0305  0.0397  0.0137  7   DG  E OP2   
1084 O "O5'" . DG  B 7   ? 0.5396 0.2908 0.3275 0.0309  0.0321  -0.0019 7   DG  E "O5'" 
1085 C "C5'" . DG  B 7   ? 0.5374 0.2855 0.3264 0.0329  0.0286  -0.0116 7   DG  E "C5'" 
1086 C "C4'" . DG  B 7   ? 0.5439 0.2907 0.3270 0.0337  0.0234  -0.0152 7   DG  E "C4'" 
1087 O "O4'" . DG  B 7   ? 0.5532 0.2941 0.3259 0.0344  0.0222  -0.0101 7   DG  E "O4'" 
1088 C "C3'" . DG  B 7   ? 0.5448 0.2966 0.3295 0.0300  0.0240  -0.0148 7   DG  E "C3'" 
1089 O "O3'" . DG  B 7   ? 0.5563 0.3068 0.3392 0.0331  0.0201  -0.0222 7   DG  E "O3'" 
1090 C "C2'" . DG  B 7   ? 0.5431 0.2930 0.3202 0.0268  0.0235  -0.0072 7   DG  E "C2'" 
1091 C "C1'" . DG  B 7   ? 0.5482 0.2900 0.3177 0.0299  0.0211  -0.0070 7   DG  E "C1'" 
1092 N N9    . DG  B 7   ? 0.5492 0.2915 0.3161 0.0267  0.0227  0.0017  7   DG  E N9    
1093 C C8    . DG  B 7   ? 0.5458 0.2956 0.3192 0.0260  0.0270  0.0088  7   DG  E C8    
1094 N N7    . DG  B 7   ? 0.5505 0.3031 0.3233 0.0228  0.0277  0.0159  7   DG  E N7    
1095 C C5    . DG  B 7   ? 0.5542 0.2977 0.3181 0.0201  0.0237  0.0133  7   DG  E C5    
1096 C C6    . DG  B 7   ? 0.5614 0.3018 0.3214 0.0144  0.0230  0.0183  7   DG  E C6    
1097 O O6    . DG  B 7   ? 0.5628 0.3121 0.3294 0.0103  0.0258  0.0262  7   DG  E O6    
1098 N N1    . DG  B 7   ? 0.5691 0.2948 0.3172 0.0136  0.0190  0.0133  7   DG  E N1    
1099 C C2    . DG  B 7   ? 0.5713 0.2893 0.3135 0.0193  0.0160  0.0047  7   DG  E C2    
1100 N N2    . DG  B 7   ? 0.5799 0.2827 0.3095 0.0196  0.0126  0.0012  7   DG  E N2    
1101 N N3    . DG  B 7   ? 0.5634 0.2883 0.3123 0.0242  0.0165  -0.0001 7   DG  E N3    
1102 C C4    . DG  B 7   ? 0.5561 0.2923 0.3151 0.0235  0.0205  0.0046  7   DG  E C4    
1103 P P     . DG  B 8   ? 0.5674 0.3226 0.3519 0.0318  0.0217  -0.0248 8   DG  E P     
1104 O OP1   . DG  B 8   ? 0.5765 0.3398 0.3732 0.0345  0.0224  -0.0325 8   DG  E OP1   
1105 O OP2   . DG  B 8   ? 0.5654 0.3236 0.3492 0.0266  0.0260  -0.0178 8   DG  E OP2   
1106 O "O5'" . DG  B 8   ? 0.5632 0.3084 0.3336 0.0345  0.0169  -0.0265 8   DG  E "O5'" 
1107 C "C5'" . DG  B 8   ? 0.5670 0.3032 0.3268 0.0314  0.0148  -0.0207 8   DG  E "C5'" 
1108 C "C4'" . DG  B 8   ? 0.5778 0.3020 0.3237 0.0320  0.0114  -0.0228 8   DG  E "C4'" 
1109 O "O4'" . DG  B 8   ? 0.5929 0.3085 0.3304 0.0265  0.0097  -0.0167 8   DG  E "O4'" 
1110 C "C3'" . DG  B 8   ? 0.5807 0.3063 0.3233 0.0297  0.0127  -0.0245 8   DG  E "C3'" 
1111 O "O3'" . DG  B 8   ? 0.5914 0.3039 0.3210 0.0340  0.0098  -0.0297 8   DG  E "O3'" 
1112 C "C2'" . DG  B 8   ? 0.5895 0.3158 0.3291 0.0211  0.0121  -0.0172 8   DG  E "C2'" 
1113 C "C1'" . DG  B 8   ? 0.6004 0.3186 0.3361 0.0190  0.0095  -0.0134 8   DG  E "C1'" 
1114 N N9    . DG  B 8   ? 0.5974 0.3250 0.3411 0.0136  0.0111  -0.0052 8   DG  E N9    
1115 C C8    . DG  B 8   ? 0.5870 0.3275 0.3425 0.0147  0.0150  -0.0017 8   DG  E C8    
1116 N N7    . DG  B 8   ? 0.5850 0.3324 0.3455 0.0109  0.0160  0.0059  8   DG  E N7    
1117 C C5    . DG  B 8   ? 0.5927 0.3330 0.3463 0.0054  0.0124  0.0076  8   DG  E C5    
1118 C C6    . DG  B 8   ? 0.5913 0.3374 0.3493 -0.0012 0.0121  0.0152  8   DG  E C6    
1119 O O6    . DG  B 8   ? 0.5791 0.3392 0.3481 -0.0017 0.0148  0.0221  8   DG  E O6    
1120 N N1    . DG  B 8   ? 0.6060 0.3398 0.3550 -0.0076 0.0085  0.0143  8   DG  E N1    
1121 C C2    . DG  B 8   ? 0.6202 0.3358 0.3549 -0.0059 0.0056  0.0070  8   DG  E C2    
1122 N N2    . DG  B 8   ? 0.6393 0.3409 0.3649 -0.0130 0.0028  0.0073  8   DG  E N2    
1123 N N3    . DG  B 8   ? 0.6182 0.3299 0.3488 0.0022  0.0059  0.0000  8   DG  E N3    
1124 C C4    . DG  B 8   ? 0.6048 0.3306 0.3465 0.0067  0.0094  0.0008  8   DG  E C4    
1125 P P     . DA  B 9   ? 0.6000 0.3089 0.3203 0.0342  0.0110  -0.0333 9   DA  E P     
1126 O OP1   . DA  B 9   ? 0.6134 0.3131 0.3262 0.0438  0.0101  -0.0405 9   DA  E OP1   
1127 O OP2   . DA  B 9   ? 0.5874 0.3117 0.3180 0.0319  0.0164  -0.0313 9   DA  E OP2   
1128 O "O5'" . DA  B 9   ? 0.6063 0.3019 0.3120 0.0254  0.0067  -0.0296 9   DA  E "O5'" 
1129 C "C5'" . DA  B 9   ? 0.6229 0.3015 0.3182 0.0240  0.0026  -0.0291 9   DA  E "C5'" 
1130 C "C4'" . DA  B 9   ? 0.6376 0.3101 0.3262 0.0121  -0.0011 -0.0246 9   DA  E "C4'" 
1131 O "O4'" . DA  B 9   ? 0.6245 0.3140 0.3281 0.0062  0.0001  -0.0168 9   DA  E "O4'" 
1132 C "C3'" . DA  B 9   ? 0.6514 0.3213 0.3297 0.0082  -0.0032 -0.0276 9   DA  E "C3'" 
1133 O "O3'" . DA  B 9   ? 0.6842 0.3311 0.3441 0.0036  -0.0081 -0.0309 9   DA  E "O3'" 
1134 C "C2'" . DA  B 9   ? 0.6366 0.3246 0.3260 -0.0001 -0.0041 -0.0205 9   DA  E "C2'" 
1135 C "C1'" . DA  B 9   ? 0.6304 0.3241 0.3323 -0.0031 -0.0033 -0.0139 9   DA  E "C1'" 
1136 N N9    . DA  B 9   ? 0.6214 0.3360 0.3393 -0.0051 -0.0011 -0.0068 9   DA  E N9    
1137 C C8    . DA  B 9   ? 0.6107 0.3383 0.3380 0.0008  0.0038  -0.0059 9   DA  E C8    
1138 N N7    . DA  B 9   ? 0.6000 0.3421 0.3388 -0.0015 0.0052  0.0014  9   DA  E N7    
1139 C C5    . DA  B 9   ? 0.6052 0.3476 0.3447 -0.0094 0.0009  0.0056  9   DA  E C5    
1140 C C6    . DA  B 9   ? 0.6003 0.3577 0.3517 -0.0141 0.0002  0.0140  9   DA  E C6    
1141 N N6    . DA  B 9   ? 0.5900 0.3626 0.3525 -0.0100 0.0039  0.0197  9   DA  E N6    
1142 N N1    . DA  B 9   ? 0.6077 0.3638 0.3599 -0.0232 -0.0039 0.0165  9   DA  E N1    
1143 C C2    . DA  B 9   ? 0.6238 0.3606 0.3628 -0.0273 -0.0071 0.0109  9   DA  E C2    
1144 N N3    . DA  B 9   ? 0.6327 0.3516 0.3572 -0.0220 -0.0070 0.0029  9   DA  E N3    
1145 C C4    . DA  B 9   ? 0.6209 0.3458 0.3477 -0.0128 -0.0029 0.0007  9   DA  E C4    
1146 P P     . DG  B 10  ? 0.7163 0.3519 0.3577 0.0010  -0.0117 -0.0369 10  DG  E P     
1147 O OP1   . DG  B 10  ? 0.7503 0.3586 0.3717 0.0071  -0.0123 -0.0442 10  DG  E OP1   
1148 O OP2   . DG  B 10  ? 0.7091 0.3625 0.3558 0.0055  -0.0077 -0.0369 10  DG  E OP2   
1149 O "O5'" . DG  B 10  ? 0.7129 0.3481 0.3535 -0.0147 -0.0191 -0.0328 10  DG  E "O5'" 
1150 C "C5'" . DG  B 10  ? 0.7182 0.3376 0.3554 -0.0232 -0.0223 -0.0312 10  DG  E "C5'" 
1151 C "C4'" . DG  B 10  ? 0.7120 0.3403 0.3557 -0.0391 -0.0291 -0.0268 10  DG  E "C4'" 
1152 O "O4'" . DG  B 10  ? 0.6795 0.3375 0.3469 -0.0400 -0.0265 -0.0180 10  DG  E "O4'" 
1153 C "C3'" . DG  B 10  ? 0.7225 0.3489 0.3530 -0.0442 -0.0365 -0.0322 10  DG  E "C3'" 
1154 O "O3'" . DG  B 10  ? 0.7375 0.3512 0.3615 -0.0596 -0.0450 -0.0337 10  DG  E "O3'" 
1155 C "C2'" . DG  B 10  ? 0.7004 0.3583 0.3479 -0.0433 -0.0361 -0.0258 10  DG  E "C2'" 
1156 C "C1'" . DG  B 10  ? 0.6781 0.3526 0.3492 -0.0461 -0.0322 -0.0164 10  DG  E "C1'" 
1157 N N9    . DG  B 10  ? 0.6575 0.3573 0.3455 -0.0390 -0.0271 -0.0101 10  DG  E N9    
1158 C C8    . DG  B 10  ? 0.6488 0.3520 0.3370 -0.0268 -0.0201 -0.0115 10  DG  E C8    
1159 N N7    . DG  B 10  ? 0.6316 0.3556 0.3353 -0.0237 -0.0164 -0.0048 10  DG  E N7    
1160 C C5    . DG  B 10  ? 0.6287 0.3656 0.3436 -0.0329 -0.0213 0.0017  10  DG  E C5    
1161 C C6    . DG  B 10  ? 0.6215 0.3817 0.3543 -0.0326 -0.0200 0.0106  10  DG  E C6    
1162 O O6    . DG  B 10  ? 0.6161 0.3869 0.3563 -0.0244 -0.0141 0.0145  10  DG  E O6    
1163 N N1    . DG  B 10  ? 0.6246 0.3955 0.3673 -0.0432 -0.0260 0.0153  10  DG  E N1    
1164 C C2    . DG  B 10  ? 0.6377 0.3967 0.3740 -0.0547 -0.0326 0.0115  10  DG  E C2    
1165 N N2    . DG  B 10  ? 0.6409 0.4158 0.3922 -0.0655 -0.0376 0.0171  10  DG  E N2    
1166 N N3    . DG  B 10  ? 0.6520 0.3848 0.3688 -0.0555 -0.0339 0.0030  10  DG  E N3    
1167 C C4    . DG  B 10  ? 0.6448 0.3686 0.3518 -0.0433 -0.0280 -0.0014 10  DG  E C4    
1168 P P     . DT  B 11  ? 0.7682 0.3721 0.3726 -0.0670 -0.0555 -0.0416 11  DT  E P     
1169 O OP1   . DT  B 11  ? 0.7963 0.3710 0.3865 -0.0795 -0.0615 -0.0468 11  DT  E OP1   
1170 O OP2   . DT  B 11  ? 0.7715 0.3717 0.3598 -0.0524 -0.0517 -0.0474 11  DT  E OP2   
1171 O "O5'" . DT  B 11  ? 0.7672 0.4045 0.3919 -0.0764 -0.0622 -0.0345 11  DT  E "O5'" 
1172 C "C5'" . DT  B 11  ? 0.7751 0.4279 0.4231 -0.0888 -0.0640 -0.0266 11  DT  E "C5'" 
1173 C "C4'" . DT  B 11  ? 0.7772 0.4661 0.4457 -0.0915 -0.0685 -0.0193 11  DT  E "C4'" 
1174 O "O4'" . DT  B 11  ? 0.7538 0.4606 0.4339 -0.0771 -0.0588 -0.0129 11  DT  E "O4'" 
1175 C "C3'" . DT  B 11  ? 0.8099 0.5025 0.4639 -0.0936 -0.0798 -0.0248 11  DT  E "C3'" 
1176 O "O3'" . DT  B 11  ? 0.8363 0.5373 0.4983 -0.1113 -0.0925 -0.0251 11  DT  E "O3'" 
1177 C "C2'" . DT  B 11  ? 0.7844 0.5048 0.4495 -0.0816 -0.0758 -0.0174 11  DT  E "C2'" 
1178 C "C1'" . DT  B 11  ? 0.7468 0.4789 0.4346 -0.0758 -0.0638 -0.0087 11  DT  E "C1'" 
1179 N N1    . DT  B 11  ? 0.7201 0.4607 0.4098 -0.0601 -0.0540 -0.0052 11  DT  E N1    
1180 C C2    . DT  B 11  ? 0.6956 0.4631 0.4051 -0.0561 -0.0514 0.0044  11  DT  E C2    
1181 O O2    . DT  B 11  ? 0.6889 0.4765 0.4159 -0.0635 -0.0566 0.0106  11  DT  E O2    
1182 N N3    . DT  B 11  ? 0.6785 0.4485 0.3874 -0.0430 -0.0420 0.0067  11  DT  E N3    
1183 C C4    . DT  B 11  ? 0.6780 0.4306 0.3719 -0.0344 -0.0351 0.0006  11  DT  E C4    
1184 O O4    . DT  B 11  ? 0.6668 0.4244 0.3638 -0.0246 -0.0266 0.0033  11  DT  E O4    
1185 C C5    . DT  B 11  ? 0.6956 0.4237 0.3705 -0.0376 -0.0381 -0.0091 11  DT  E C5    
1186 C C7    . DT  B 11  ? 0.6940 0.4051 0.3539 -0.0274 -0.0306 -0.0160 11  DT  E C7    
1187 C C6    . DT  B 11  ? 0.7196 0.4410 0.3918 -0.0499 -0.0473 -0.0116 11  DT  E C6    
1188 P P     . DG  B 12  ? 0.8753 0.5818 0.5230 -0.1166 -0.1082 -0.0313 12  DG  E P     
1189 O OP1   . DG  B 12  ? 0.9038 0.6027 0.5529 -0.1375 -0.1208 -0.0363 12  DG  E OP1   
1190 O OP2   . DG  B 12  ? 0.8894 0.5751 0.5056 -0.1028 -0.1056 -0.0390 12  DG  E OP2   
1191 O "O5'" . DG  B 12  ? 0.8535 0.6023 0.5261 -0.1122 -0.1102 -0.0202 12  DG  E "O5'" 
1192 C "C5'" . DG  B 12  ? 0.8324 0.6090 0.5394 -0.1197 -0.1088 -0.0101 12  DG  E "C5'" 
1193 C "C4'" . DG  B 12  ? 0.8151 0.6286 0.5397 -0.1122 -0.1115 -0.0009 12  DG  E "C4'" 
1194 O "O4'" . DG  B 12  ? 0.7875 0.6023 0.5113 -0.0939 -0.0975 0.0048  12  DG  E "O4'" 
1195 C "C3'" . DG  B 12  ? 0.8411 0.6615 0.5494 -0.1121 -0.1268 -0.0055 12  DG  E "C3'" 
1196 O "O3'" . DG  B 12  ? 0.8393 0.6977 0.5733 -0.1169 -0.1365 0.0021  12  DG  E "O3'" 
1197 C "C2'" . DG  B 12  ? 0.8309 0.6433 0.5194 -0.0925 -0.1177 -0.0044 12  DG  E "C2'" 
1198 C "C1'" . DG  B 12  ? 0.7859 0.6088 0.4968 -0.0833 -0.1015 0.0056  12  DG  E "C1'" 
1199 N N9    . DG  B 12  ? 0.7642 0.5695 0.4595 -0.0685 -0.0881 0.0046  12  DG  E N9    
1200 C C8    . DG  B 12  ? 0.7718 0.5466 0.4453 -0.0660 -0.0824 -0.0043 12  DG  E C8    
1201 N N7    . DG  B 12  ? 0.7608 0.5300 0.4284 -0.0524 -0.0703 -0.0028 12  DG  E N7    
1202 C C5    . DG  B 12  ? 0.7423 0.5363 0.4265 -0.0459 -0.0676 0.0077  12  DG  E C5    
1203 C C6    . DG  B 12  ? 0.7315 0.5295 0.4178 -0.0327 -0.0558 0.0136  12  DG  E C6    
1204 O O6    . DG  B 12  ? 0.7313 0.5147 0.4078 -0.0249 -0.0453 0.0106  12  DG  E O6    
1205 N N1    . DG  B 12  ? 0.7215 0.5438 0.4245 -0.0290 -0.0568 0.0241  12  DG  E N1    
1206 C C2    . DG  B 12  ? 0.7218 0.5659 0.4400 -0.0362 -0.0679 0.0285  12  DG  E C2    
1207 N N2    . DG  B 12  ? 0.7117 0.5782 0.4448 -0.0288 -0.0667 0.0391  12  DG  E N2    
1208 N N3    . DG  B 12  ? 0.7295 0.5736 0.4490 -0.0499 -0.0793 0.0230  12  DG  E N3    
1209 C C4    . DG  B 12  ? 0.7422 0.5587 0.4430 -0.0544 -0.0784 0.0126  12  DG  E C4    
1210 P P     . DT  B 13  ? 0.8805 0.7515 0.6042 -0.1234 -0.1581 -0.0032 13  DT  E P     
1211 O OP1   . DT  B 13  ? 0.8851 0.7833 0.6398 -0.1418 -0.1697 -0.0011 13  DT  E OP1   
1212 O OP2   . DT  B 13  ? 0.9142 0.7482 0.5973 -0.1234 -0.1628 -0.0165 13  DT  E OP2   
1213 O "O5'" . DT  B 13  ? 0.8621 0.7576 0.5872 -0.1047 -0.1571 0.0065  13  DT  E "O5'" 
1214 C "C5'" . DT  B 13  ? 0.8195 0.7458 0.5767 -0.0974 -0.1488 0.0200  13  DT  E "C5'" 
1215 C "C4'" . DT  B 13  ? 0.8049 0.7379 0.5517 -0.0767 -0.1435 0.0275  13  DT  E "C4'" 
1216 O "O4'" . DT  B 13  ? 0.7940 0.6979 0.5224 -0.0659 -0.1264 0.0261  13  DT  E "O4'" 
1217 C "C3'" . DT  B 13  ? 0.8308 0.7643 0.5510 -0.0722 -0.1588 0.0237  13  DT  E "C3'" 
1218 O "O3'" . DT  B 13  ? 0.8229 0.7931 0.5613 -0.0656 -0.1676 0.0337  13  DT  E "O3'" 
1219 C "C2'" . DT  B 13  ? 0.8378 0.7425 0.5257 -0.0564 -0.1459 0.0226  13  DT  E "C2'" 
1220 C "C1'" . DT  B 13  ? 0.8049 0.7034 0.5098 -0.0513 -0.1254 0.0281  13  DT  E "C1'" 
1221 N N1    . DT  B 13  ? 0.8053 0.6702 0.4857 -0.0450 -0.1119 0.0221  13  DT  E N1    
1222 C C2    . DT  B 13  ? 0.8013 0.6617 0.4774 -0.0300 -0.0973 0.0289  13  DT  E C2    
1223 O O2    . DT  B 13  ? 0.7996 0.6787 0.4884 -0.0209 -0.0944 0.0396  13  DT  E O2    
1224 N N3    . DT  B 13  ? 0.7978 0.6309 0.4550 -0.0259 -0.0858 0.0226  13  DT  E N3    
1225 C C4    . DT  B 13  ? 0.8028 0.6122 0.4436 -0.0332 -0.0873 0.0107  13  DT  E C4    
1226 O O4    . DT  B 13  ? 0.8028 0.5913 0.4290 -0.0273 -0.0762 0.0062  13  DT  E O4    
1227 C C5    . DT  B 13  ? 0.8118 0.6230 0.4547 -0.0482 -0.1028 0.0041  13  DT  E C5    
1228 C C7    . DT  B 13  ? 0.8284 0.6106 0.4517 -0.0564 -0.1053 -0.0089 13  DT  E C7    
1229 C C6    . DT  B 13  ? 0.8128 0.6519 0.4761 -0.0544 -0.1143 0.0099  13  DT  E C6    
1230 P P     . DT  B 14  ? 0.8581 0.8383 0.5746 -0.0617 -0.1880 0.0313  14  DT  E P     
1231 O OP1   . DT  B 14  ? 0.8545 0.8798 0.6034 -0.0617 -0.2000 0.0404  14  DT  E OP1   
1232 O OP2   . DT  B 14  ? 0.8923 0.8469 0.5814 -0.0752 -0.1998 0.0158  14  DT  E OP2   
1233 O "O5'" . DT  B 14  ? 0.8558 0.8191 0.5431 -0.0394 -0.1760 0.0374  14  DT  E "O5'" 
1234 C "C5'" . DT  B 14  ? 0.8204 0.7968 0.5243 -0.0241 -0.1620 0.0512  14  DT  E "C5'" 
1235 C "C4'" . DT  B 14  ? 0.8186 0.7700 0.4909 -0.0070 -0.1490 0.0547  14  DT  E "C4'" 
1236 O "O4'" . DT  B 14  ? 0.7977 0.7195 0.4629 -0.0090 -0.1314 0.0494  14  DT  E "O4'" 
1237 C "C3'" . DT  B 14  ? 0.8545 0.7909 0.4862 -0.0030 -0.1602 0.0486  14  DT  E "C3'" 
1238 O "O3'" . DT  B 14  ? 0.8700 0.8303 0.4992 0.0075  -0.1733 0.0571  14  DT  E "O3'" 
1239 C "C2'" . DT  B 14  ? 0.8513 0.7554 0.4570 0.0083  -0.1399 0.0495  14  DT  E "C2'" 
1240 C "C1'" . DT  B 14  ? 0.8074 0.7042 0.4380 0.0022  -0.1232 0.0486  14  DT  E "C1'" 
1241 N N1    . DT  B 14  ? 0.7885 0.6555 0.4021 -0.0051 -0.1166 0.0363  14  DT  E N1    
1242 C C2    . DT  B 14  ? 0.7642 0.6101 0.3683 0.0029  -0.0973 0.0372  14  DT  E C2    
1243 O O2    . DT  B 14  ? 0.7470 0.5951 0.3553 0.0142  -0.0851 0.0472  14  DT  E O2    
1244 N N3    . DT  B 14  ? 0.7653 0.5870 0.3553 -0.0029 -0.0927 0.0257  14  DT  E N3    
1245 C C4    . DT  B 14  ? 0.7792 0.5918 0.3610 -0.0154 -0.1048 0.0137  14  DT  E C4    
1246 O O4    . DT  B 14  ? 0.7818 0.5705 0.3496 -0.0180 -0.0989 0.0043  14  DT  E O4    
1247 C C5    . DT  B 14  ? 0.7949 0.6280 0.3865 -0.0252 -0.1249 0.0131  14  DT  E C5    
1248 C C7    . DT  B 14  ? 0.8145 0.6372 0.3982 -0.0411 -0.1394 0.0000  14  DT  E C7    
1249 C C6    . DT  B 14  ? 0.7948 0.6560 0.4031 -0.0197 -0.1300 0.0243  14  DT  E C6    
1250 P P     . DA  C 2   ? 1.2781 0.9790 0.5705 -0.3421 0.1467  -0.0033 1   DA  F P     
1251 O OP1   . DA  C 2   ? 1.2794 1.0194 0.5663 -0.3322 0.1434  -0.0114 1   DA  F OP1   
1252 O OP2   . DA  C 2   ? 1.2966 1.0013 0.5979 -0.3737 0.1661  -0.0095 1   DA  F OP2   
1253 O "O5'" . DA  C 2   ? 1.3115 0.9406 0.5629 -0.3278 0.1371  0.0268  1   DA  F "O5'" 
1254 C "C5'" . DA  C 2   ? 1.3566 0.9423 0.5708 -0.3411 0.1487  0.0438  1   DA  F "C5'" 
1255 C "C4'" . DA  C 2   ? 1.3702 0.8877 0.5554 -0.3194 0.1391  0.0696  1   DA  F "C4'" 
1256 O "O4'" . DA  C 2   ? 1.3469 0.8739 0.5257 -0.2883 0.1183  0.0819  1   DA  F "O4'" 
1257 C "C3'" . DA  C 2   ? 1.3381 0.8245 0.5394 -0.3138 0.1373  0.0681  1   DA  F "C3'" 
1258 O "O3'" . DA  C 2   ? 1.3990 0.8125 0.5643 -0.3067 0.1413  0.0875  1   DA  F "O3'" 
1259 C "C2'" . DA  C 2   ? 1.2799 0.7890 0.5022 -0.2828 0.1164  0.0711  1   DA  F "C2'" 
1260 C "C1'" . DA  C 2   ? 1.3061 0.8207 0.5026 -0.2654 0.1042  0.0877  1   DA  F "C1'" 
1261 N N9    . DA  C 2   ? 1.2386 0.8008 0.4550 -0.2507 0.0842  0.0806  1   DA  F N9    
1262 C C8    . DA  C 2   ? 1.1863 0.8010 0.4276 -0.2620 0.0835  0.0545  1   DA  F C8    
1263 N N7    . DA  C 2   ? 1.1504 0.7929 0.4046 -0.2452 0.0609  0.0513  1   DA  F N7    
1264 C C5    . DA  C 2   ? 1.1806 0.7953 0.4189 -0.2231 0.0459  0.0793  1   DA  F C5    
1265 C C6    . DA  C 2   ? 1.1546 0.7906 0.4080 -0.1996 0.0179  0.0903  1   DA  F C6    
1266 N N6    . DA  C 2   ? 1.1131 0.7939 0.3977 -0.1984 -0.0007 0.0722  1   DA  F N6    
1267 N N1    . DA  C 2   ? 1.1876 0.7967 0.4210 -0.1775 0.0097  0.1212  1   DA  F N1    
1268 C C2    . DA  C 2   ? 1.2364 0.7937 0.4420 -0.1751 0.0285  0.1367  1   DA  F C2    
1269 N N3    . DA  C 2   ? 1.2604 0.7895 0.4566 -0.1976 0.0536  0.1256  1   DA  F N3    
1270 C C4    . DA  C 2   ? 1.2278 0.7919 0.4417 -0.2227 0.0610  0.0978  1   DA  F C4    
1271 P P     . DA  C 3   ? 1.4029 0.7679 0.5709 -0.3042 0.1445  0.0845  2   DA  F P     
1272 O OP1   . DA  C 3   ? 1.4858 0.7900 0.6144 -0.3257 0.1595  0.0881  2   DA  F OP1   
1273 O OP2   . DA  C 3   ? 1.3298 0.7444 0.5432 -0.3158 0.1438  0.0610  2   DA  F OP2   
1274 O "O5'" . DA  C 3   ? 1.3938 0.7281 0.5528 -0.2566 0.1285  0.1081  2   DA  F "O5'" 
1275 C "C5'" . DA  C 3   ? 1.4408 0.7394 0.5622 -0.2338 0.1249  0.1341  2   DA  F "C5'" 
1276 C "C4'" . DA  C 3   ? 1.4143 0.7116 0.5429 -0.1868 0.1075  0.1542  2   DA  F "C4'" 
1277 O "O4'" . DA  C 3   ? 1.3385 0.7051 0.4992 -0.1785 0.0898  0.1518  2   DA  F "O4'" 
1278 C "C3'" . DA  C 3   ? 1.4012 0.6700 0.5432 -0.1700 0.1085  0.1506  2   DA  F "C3'" 
1279 O "O3'" . DA  C 3   ? 1.4533 0.6827 0.5739 -0.1276 0.1037  0.1753  2   DA  F "O3'" 
1280 C "C2'" . DA  C 3   ? 1.3061 0.6402 0.4966 -0.1650 0.0950  0.1404  2   DA  F "C2'" 
1281 C "C1'" . DA  C 3   ? 1.2848 0.6677 0.4778 -0.1571 0.0792  0.1512  2   DA  F "C1'" 
1282 N N9    . DA  C 3   ? 1.2013 0.6475 0.4288 -0.1714 0.0693  0.1334  2   DA  F N9    
1283 C C8    . DA  C 3   ? 1.1659 0.6377 0.4109 -0.2050 0.0799  0.1062  2   DA  F C8    
1284 N N7    . DA  C 3   ? 1.1085 0.6440 0.3978 -0.2030 0.0653  0.0901  2   DA  F N7    
1285 C C5    . DA  C 3   ? 1.0907 0.6405 0.3863 -0.1728 0.0434  0.1093  2   DA  F C5    
1286 C C6    . DA  C 3   ? 1.0455 0.6527 0.3812 -0.1607 0.0194  0.1047  2   DA  F C6    
1287 N N6    . DA  C 3   ? 0.9870 0.6385 0.3601 -0.1742 0.0147  0.0778  2   DA  F N6    
1288 N N1    . DA  C 3   ? 1.0522 0.6687 0.3860 -0.1342 0.0004  0.1294  2   DA  F N1    
1289 C C2    . DA  C 3   ? 1.1193 0.6898 0.4125 -0.1145 0.0059  0.1574  2   DA  F C2    
1290 N N3    . DA  C 3   ? 1.1621 0.6653 0.4094 -0.1201 0.0286  0.1646  2   DA  F N3    
1291 C C4    . DA  C 3   ? 1.1527 0.6488 0.4043 -0.1531 0.0463  0.1388  2   DA  F C4    
1292 P P     . DC  C 4   ? 1.4764 0.6562 0.5931 -0.1039 0.1094  0.1742  3   DC  F P     
1293 O OP1   . DC  C 4   ? 1.5672 0.6867 0.6406 -0.0721 0.1131  0.1963  3   DC  F OP1   
1294 O OP2   . DC  C 4   ? 1.4684 0.6296 0.5877 -0.1431 0.1228  0.1461  3   DC  F OP2   
1295 O "O5'" . DC  C 4   ? 1.3921 0.6328 0.5567 -0.0712 0.0919  0.1808  3   DC  F "O5'" 
1296 C "C5'" . DC  C 4   ? 1.3751 0.6606 0.5519 -0.0379 0.0739  0.2053  3   DC  F "C5'" 
1297 C "C4'" . DC  C 4   ? 1.2974 0.6495 0.5240 -0.0228 0.0575  0.2053  3   DC  F "C4'" 
1298 O "O4'" . DC  C 4   ? 1.2393 0.6375 0.4862 -0.0584 0.0513  0.1872  3   DC  F "O4'" 
1299 C "C3'" . DC  C 4   ? 1.2837 0.6199 0.5287 -0.0122 0.0648  0.1948  3   DC  F "C3'" 
1300 O "O3'" . DC  C 4   ? 1.3202 0.6598 0.5726 0.0375  0.0597  0.2162  3   DC  F "O3'" 
1301 C "C2'" . DC  C 4   ? 1.1928 0.5897 0.4805 -0.0316 0.0545  0.1800  3   DC  F "C2'" 
1302 C "C1'" . DC  C 4   ? 1.1706 0.6137 0.4635 -0.0521 0.0416  0.1791  3   DC  F "C1'" 
1303 N N1    . DC  C 4   ? 1.1125 0.5978 0.4414 -0.0904 0.0418  0.1469  3   DC  F N1    
1304 C C2    . DC  C 4   ? 1.0438 0.6044 0.4247 -0.0920 0.0220  0.1376  3   DC  F C2    
1305 O O2    . DC  C 4   ? 1.0351 0.6311 0.4342 -0.0670 0.0034  0.1561  3   DC  F O2    
1306 N N3    . DC  C 4   ? 0.9923 0.5845 0.4002 -0.1208 0.0236  0.1088  3   DC  F N3    
1307 C C4    . DC  C 4   ? 1.0055 0.5705 0.3969 -0.1476 0.0434  0.0908  3   DC  F C4    
1308 N N4    . DC  C 4   ? 0.9619 0.5672 0.3823 -0.1700 0.0447  0.0641  3   DC  F N4    
1309 C C5    . DC  C 4   ? 1.0800 0.5745 0.4221 -0.1528 0.0626  0.0998  3   DC  F C5    
1310 C C6    . DC  C 4   ? 1.1352 0.5856 0.4445 -0.1236 0.0614  0.1273  3   DC  F C6    
1311 P P     . DA  C 5   ? 1.3369 0.6596 0.6035 0.0608  0.0680  0.2096  4   DA  F P     
1312 O OP1   . DA  C 5   ? 1.3960 0.6976 0.6477 0.1098  0.0705  0.2300  4   DA  F OP1   
1313 O OP2   . DA  C 5   ? 1.3509 0.6212 0.5974 0.0229  0.0845  0.1814  4   DA  F OP2   
1314 O "O5'" . DA  C 5   ? 1.2583 0.6661 0.5828 0.0674  0.0510  0.2122  4   DA  F "O5'" 
1315 C "C5'" . DA  C 5   ? 1.2409 0.7201 0.5935 0.0853  0.0296  0.2340  4   DA  F "C5'" 
1316 C "C4'" . DA  C 5   ? 1.1570 0.7195 0.5757 0.0671  0.0136  0.2202  4   DA  F "C4'" 
1317 O "O4'" . DA  C 5   ? 1.1211 0.6856 0.5435 0.0201  0.0140  0.1929  4   DA  F "O4'" 
1318 C "C3'" . DA  C 5   ? 1.1270 0.7053 0.5848 0.0757  0.0197  0.2078  4   DA  F "C3'" 
1319 O "O3'" . DA  C 5   ? 1.1437 0.7778 0.6358 0.1149  0.0099  0.2316  4   DA  F "O3'" 
1320 C "C2'" . DA  C 5   ? 1.0327 0.6580 0.5375 0.0351  0.0119  0.1789  4   DA  F "C2'" 
1321 C "C1'" . DA  C 5   ? 1.0346 0.6577 0.5174 0.0056  0.0055  0.1734  4   DA  F "C1'" 
1322 N N9    . DA  C 5   ? 1.0012 0.6094 0.4823 -0.0337 0.0150  0.1425  4   DA  F N9    
1323 C C8    . DA  C 5   ? 1.0391 0.5851 0.4801 -0.0521 0.0352  0.1296  4   DA  F C8    
1324 N N7    . DA  C 5   ? 1.0086 0.5702 0.4639 -0.0863 0.0393  0.1028  4   DA  F N7    
1325 C C5    . DA  C 5   ? 0.9496 0.5784 0.4528 -0.0875 0.0212  0.0971  4   DA  F C5    
1326 C C6    . DA  C 5   ? 0.8942 0.5635 0.4280 -0.1109 0.0165  0.0726  4   DA  F C6    
1327 N N6    . DA  C 5   ? 0.8989 0.5598 0.4256 -0.1370 0.0304  0.0495  4   DA  F N6    
1328 N N1    . DA  C 5   ? 0.8523 0.5717 0.4226 -0.1061 -0.0028 0.0733  4   DA  F N1    
1329 C C2    . DA  C 5   ? 0.8533 0.5918 0.4345 -0.0834 -0.0174 0.0975  4   DA  F C2    
1330 N N3    . DA  C 5   ? 0.8889 0.6059 0.4498 -0.0576 -0.0148 0.1229  4   DA  F N3    
1331 C C4    . DA  C 5   ? 0.9400 0.5966 0.4593 -0.0590 0.0055  0.1210  4   DA  F C4    
1332 P P     . DC  C 6   ? 1.1361 0.7988 0.6705 0.1317  0.0156  0.2259  5   DC  F P     
1333 O OP1   . DC  C 6   ? 1.1696 0.8661 0.7130 0.1828  0.0134  0.2580  5   DC  F OP1   
1334 O OP2   . DC  C 6   ? 1.1633 0.7532 0.6663 0.1172  0.0358  0.2008  5   DC  F OP2   
1335 O "O5'" . DC  C 6   ? 1.0467 0.7901 0.6478 0.0995  -0.0023 0.2114  5   DC  F "O5'" 
1336 C "C5'" . DC  C 6   ? 1.0200 0.8301 0.6504 0.0915  -0.0253 0.2245  5   DC  F "C5'" 
1337 C "C4'" . DC  C 6   ? 0.9441 0.8057 0.6260 0.0582  -0.0382 0.2056  5   DC  F "C4'" 
1338 O "O4'" . DC  C 6   ? 0.9253 0.7488 0.5883 0.0220  -0.0336 0.1757  5   DC  F "O4'" 
1339 C "C3'" . DC  C 6   ? 0.9081 0.7934 0.6296 0.0666  -0.0316 0.2008  5   DC  F "C3'" 
1340 O "O3'" . DC  C 6   ? 0.8860 0.8465 0.6608 0.0567  -0.0503 0.2092  5   DC  F "O3'" 
1341 C "C2'" . DC  C 6   ? 0.8770 0.7182 0.5880 0.0391  -0.0199 0.1672  5   DC  F "C2'" 
1342 C "C1'" . DC  C 6   ? 0.8673 0.6999 0.5615 0.0075  -0.0292 0.1541  5   DC  F "C1'" 
1343 N N1    . DC  C 6   ? 0.8590 0.6398 0.5234 -0.0153 -0.0143 0.1270  5   DC  F N1    
1344 C C2    . DC  C 6   ? 0.8162 0.6116 0.4968 -0.0451 -0.0189 0.1022  5   DC  F C2    
1345 O O2    . DC  C 6   ? 0.7808 0.6198 0.4944 -0.0529 -0.0354 0.1021  5   DC  F O2    
1346 N N3    . DC  C 6   ? 0.8177 0.5789 0.4755 -0.0647 -0.0048 0.0792  5   DC  F N3    
1347 C C4    . DC  C 6   ? 0.8533 0.5629 0.4722 -0.0614 0.0121  0.0800  5   DC  F C4    
1348 N N4    . DC  C 6   ? 0.8544 0.5396 0.4547 -0.0865 0.0249  0.0578  5   DC  F N4    
1349 C C5    . DC  C 6   ? 0.9013 0.5814 0.4963 -0.0321 0.0170  0.1038  5   DC  F C5    
1350 C C6    . DC  C 6   ? 0.8976 0.6173 0.5175 -0.0068 0.0040  0.1269  5   DC  F C6    
1351 P P     . DT  C 7   ? 0.8776 0.8806 0.6987 0.0684  -0.0462 0.2146  6   DT  F P     
1352 O OP1   . DT  C 7   ? 0.8583 0.9422 0.7259 0.0616  -0.0670 0.2352  6   DT  F OP1   
1353 O OP2   . DT  C 7   ? 0.9183 0.8892 0.7167 0.1074  -0.0251 0.2230  6   DT  F OP2   
1354 O "O5'" . DT  C 7   ? 0.8427 0.8210 0.6718 0.0372  -0.0424 0.1822  6   DT  F "O5'" 
1355 C "C5'" . DT  C 7   ? 0.8217 0.8047 0.6569 0.0015  -0.0571 0.1653  6   DT  F "C5'" 
1356 C "C4'" . DT  C 7   ? 0.7869 0.7463 0.6272 -0.0160 -0.0494 0.1371  6   DT  F "C4'" 
1357 O "O4'" . DT  C 7   ? 0.7898 0.6951 0.5904 -0.0230 -0.0361 0.1160  6   DT  F "O4'" 
1358 C "C3'" . DT  C 7   ? 0.7691 0.7378 0.6311 0.0011  -0.0377 0.1393  6   DT  F "C3'" 
1359 O "O3'" . DT  C 7   ? 0.7563 0.7518 0.6518 -0.0158 -0.0467 0.1334  6   DT  F "O3'" 
1360 C "C2'" . DT  C 7   ? 0.7635 0.6778 0.5920 0.0036  -0.0191 0.1173  6   DT  F "C2'" 
1361 C "C1'" . DT  C 7   ? 0.7520 0.6408 0.5564 -0.0223 -0.0230 0.0986  6   DT  F "C1'" 
1362 N N1    . DT  C 7   ? 0.7424 0.5788 0.5047 -0.0247 -0.0067 0.0844  6   DT  F N1    
1363 C C2    . DT  C 7   ? 0.7170 0.5383 0.4692 -0.0490 -0.0024 0.0583  6   DT  F C2    
1364 O O2    . DT  C 7   ? 0.6873 0.5320 0.4606 -0.0635 -0.0108 0.0455  6   DT  F O2    
1365 N N3    . DT  C 7   ? 0.7334 0.5103 0.4475 -0.0554 0.0126  0.0482  6   DT  F N3    
1366 C C4    . DT  C 7   ? 0.7636 0.4976 0.4427 -0.0397 0.0237  0.0604  6   DT  F C4    
1367 O O4    . DT  C 7   ? 0.7822 0.4698 0.4233 -0.0519 0.0368  0.0496  6   DT  F O4    
1368 C C5    . DT  C 7   ? 0.7794 0.5267 0.4678 -0.0078 0.0193  0.0872  6   DT  F C5    
1369 C C7    . DT  C 7   ? 0.8285 0.5265 0.4755 0.0186  0.0317  0.1025  6   DT  F C7    
1370 C C6    . DT  C 7   ? 0.7610 0.5647 0.4933 -0.0025 0.0045  0.0983  6   DT  F C6    
1371 P P     . DC  C 8   ? 0.7528 0.7734 0.6777 -0.0009 -0.0391 0.1422  7   DC  F P     
1372 O OP1   . DC  C 8   ? 0.7434 0.8134 0.7062 -0.0144 -0.0549 0.1596  7   DC  F OP1   
1373 O OP2   . DC  C 8   ? 0.7777 0.7902 0.6882 0.0321  -0.0228 0.1538  7   DC  F OP2   
1374 O "O5'" . DC  C 8   ? 0.7275 0.7170 0.6452 -0.0122 -0.0320 0.1131  7   DC  F "O5'" 
1375 C "C5'" . DC  C 8   ? 0.7016 0.6896 0.6280 -0.0364 -0.0435 0.0987  7   DC  F "C5'" 
1376 C "C4'" . DC  C 8   ? 0.6837 0.6383 0.5889 -0.0431 -0.0352 0.0687  7   DC  F "C4'" 
1377 O "O4'" . DC  C 8   ? 0.7006 0.6286 0.5741 -0.0430 -0.0270 0.0608  7   DC  F "O4'" 
1378 C "C3'" . DC  C 8   ? 0.6534 0.6051 0.5621 -0.0302 -0.0229 0.0598  7   DC  F "C3'" 
1379 O "O3'" . DC  C 8   ? 0.6226 0.5871 0.5526 -0.0340 -0.0293 0.0586  7   DC  F "O3'" 
1380 C "C2'" . DC  C 8   ? 0.6617 0.5864 0.5435 -0.0381 -0.0141 0.0335  7   DC  F "C2'" 
1381 C "C1'" . DC  C 8   ? 0.6861 0.5944 0.5452 -0.0469 -0.0158 0.0367  7   DC  F "C1'" 
1382 N N1    . DC  C 8   ? 0.6951 0.5743 0.5239 -0.0403 -0.0021 0.0354  7   DC  F N1    
1383 C C2    . DC  C 8   ? 0.6982 0.5552 0.5034 -0.0550 0.0073  0.0128  7   DC  F C2    
1384 O O2    . DC  C 8   ? 0.6795 0.5495 0.4930 -0.0686 0.0046  -0.0051 7   DC  F O2    
1385 N N3    . DC  C 8   ? 0.7274 0.5488 0.4995 -0.0539 0.0196  0.0116  7   DC  F N3    
1386 C C4    . DC  C 8   ? 0.7474 0.5511 0.5069 -0.0329 0.0233  0.0314  7   DC  F C4    
1387 N N4    . DC  C 8   ? 0.7860 0.5415 0.5043 -0.0316 0.0361  0.0289  7   DC  F N4    
1388 C C5    . DC  C 8   ? 0.7369 0.5718 0.5237 -0.0125 0.0147  0.0552  7   DC  F C5    
1389 C C6    . DC  C 8   ? 0.7044 0.5785 0.5267 -0.0201 0.0018  0.0565  7   DC  F C6    
1390 P P     . DC  C 9   ? 0.6044 0.5763 0.5430 -0.0182 -0.0200 0.0565  8   DC  F P     
1391 O OP1   . DC  C 9   ? 0.6031 0.5855 0.5620 -0.0230 -0.0289 0.0643  8   DC  F OP1   
1392 O OP2   . DC  C 9   ? 0.6132 0.5915 0.5480 0.0013  -0.0091 0.0704  8   DC  F OP2   
1393 O "O5'" . DC  C 9   ? 0.5957 0.5505 0.5151 -0.0212 -0.0131 0.0267  8   DC  F "O5'" 
1394 C "C5'" . DC  C 9   ? 0.5970 0.5455 0.5134 -0.0334 -0.0191 0.0089  8   DC  F "C5'" 
1395 C "C4'" . DC  C 9   ? 0.6025 0.5503 0.5049 -0.0345 -0.0102 -0.0160 8   DC  F "C4'" 
1396 O "O4'" . DC  C 9   ? 0.6207 0.5543 0.5019 -0.0425 -0.0023 -0.0200 8   DC  F "O4'" 
1397 C "C3'" . DC  C 9   ? 0.6065 0.5685 0.5140 -0.0205 -0.0044 -0.0206 8   DC  F "C3'" 
1398 O "O3'" . DC  C 9   ? 0.6226 0.5984 0.5313 -0.0201 -0.0048 -0.0408 8   DC  F "O3'" 
1399 C "C2'" . DC  C 9   ? 0.6155 0.5672 0.5038 -0.0211 0.0060  -0.0238 8   DC  F "C2'" 
1400 C "C1'" . DC  C 9   ? 0.6224 0.5564 0.4933 -0.0390 0.0076  -0.0310 8   DC  F "C1'" 
1401 N N1    . DC  C 9   ? 0.6298 0.5366 0.4769 -0.0391 0.0156  -0.0233 8   DC  F N1    
1402 C C2    . DC  C 9   ? 0.6469 0.5332 0.4661 -0.0546 0.0246  -0.0393 8   DC  F C2    
1403 O O2    . DC  C 9   ? 0.6456 0.5486 0.4663 -0.0694 0.0257  -0.0592 8   DC  F O2    
1404 N N3    . DC  C 9   ? 0.6750 0.5237 0.4647 -0.0528 0.0325  -0.0315 8   DC  F N3    
1405 C C4    . DC  C 9   ? 0.6779 0.5179 0.4687 -0.0316 0.0318  -0.0087 8   DC  F C4    
1406 N N4    . DC  C 9   ? 0.7152 0.5137 0.4720 -0.0245 0.0407  -0.0012 8   DC  F N4    
1407 C C5    . DC  C 9   ? 0.6529 0.5264 0.4782 -0.0169 0.0227  0.0083  8   DC  F C5    
1408 C C6    . DC  C 9   ? 0.6284 0.5302 0.4792 -0.0236 0.0147  0.0002  8   DC  F C6    
1409 P P     . DC  C 10  ? 0.6268 0.6246 0.5432 -0.0030 -0.0035 -0.0449 9   DC  F P     
1410 O OP1   . DC  C 10  ? 0.6333 0.6428 0.5555 0.0036  -0.0082 -0.0566 9   DC  F OP1   
1411 O OP2   . DC  C 10  ? 0.6263 0.6211 0.5504 0.0095  -0.0038 -0.0223 9   DC  F OP2   
1412 O "O5'" . DC  C 10  ? 0.6131 0.6218 0.5150 -0.0105 0.0050  -0.0622 9   DC  F "O5'" 
1413 C "C5'" . DC  C 10  ? 0.6085 0.6273 0.5026 -0.0275 0.0083  -0.0826 9   DC  F "C5'" 
1414 C "C4'" . DC  C 10  ? 0.6074 0.6246 0.4826 -0.0419 0.0161  -0.0943 9   DC  F "C4'" 
1415 O "O4'" . DC  C 10  ? 0.6176 0.5936 0.4735 -0.0475 0.0210  -0.0822 9   DC  F "O4'" 
1416 C "C3'" . DC  C 10  ? 0.6010 0.6359 0.4748 -0.0309 0.0159  -0.0984 9   DC  F "C3'" 
1417 O "O3'" . DC  C 10  ? 0.6097 0.6815 0.4831 -0.0441 0.0163  -0.1206 9   DC  F "O3'" 
1418 C "C2'" . DC  C 10  ? 0.6185 0.6139 0.4669 -0.0326 0.0226  -0.0908 9   DC  F "C2'" 
1419 C "C1'" . DC  C 10  ? 0.6345 0.5975 0.4692 -0.0498 0.0270  -0.0880 9   DC  F "C1'" 
1420 N N1    . DC  C 10  ? 0.6466 0.5676 0.4631 -0.0401 0.0319  -0.0700 9   DC  F N1    
1421 C C2    . DC  C 10  ? 0.6837 0.5622 0.4634 -0.0530 0.0408  -0.0752 9   DC  F C2    
1422 O O2    . DC  C 10  ? 0.7021 0.5790 0.4658 -0.0781 0.0440  -0.0949 9   DC  F O2    
1423 N N3    . DC  C 10  ? 0.7084 0.5487 0.4692 -0.0371 0.0460  -0.0576 9   DC  F N3    
1424 C C4    . DC  C 10  ? 0.6878 0.5427 0.4711 -0.0126 0.0425  -0.0353 9   DC  F C4    
1425 N N4    . DC  C 10  ? 0.7146 0.5414 0.4811 0.0058  0.0485  -0.0172 9   DC  F N4    
1426 C C5    . DC  C 10  ? 0.6441 0.5428 0.4662 -0.0060 0.0331  -0.0296 9   DC  F C5    
1427 C C6    . DC  C 10  ? 0.6261 0.5507 0.4606 -0.0186 0.0282  -0.0475 9   DC  F C6    
1428 P P     . DA  C 11  ? 0.6130 0.7156 0.4837 -0.0367 0.0133  -0.1300 10  DA  F P     
1429 O OP1   . DA  C 11  ? 0.6111 0.7725 0.4969 -0.0433 0.0098  -0.1484 10  DA  F OP1   
1430 O OP2   . DA  C 11  ? 0.6030 0.6974 0.4798 -0.0077 0.0098  -0.1113 10  DA  F OP2   
1431 O "O5'" . DA  C 11  ? 0.6310 0.6982 0.4669 -0.0587 0.0200  -0.1384 10  DA  F "O5'" 
1432 C "C5'" . DA  C 11  ? 0.6445 0.6979 0.4640 -0.0916 0.0260  -0.1510 10  DA  F "C5'" 
1433 C "C4'" . DA  C 11  ? 0.6821 0.6819 0.4593 -0.1070 0.0326  -0.1555 10  DA  F "C4'" 
1434 O "O4'" . DA  C 11  ? 0.6890 0.6323 0.4518 -0.0902 0.0381  -0.1351 10  DA  F "O4'" 
1435 C "C3'" . DA  C 11  ? 0.6898 0.6967 0.4510 -0.1002 0.0290  -0.1646 10  DA  F "C3'" 
1436 O "O3'" . DA  C 11  ? 0.7260 0.7215 0.4556 -0.1360 0.0310  -0.1861 10  DA  F "O3'" 
1437 C "C2'" . DA  C 11  ? 0.7025 0.6565 0.4440 -0.0726 0.0343  -0.1460 10  DA  F "C2'" 
1438 C "C1'" . DA  C 11  ? 0.7212 0.6277 0.4526 -0.0793 0.0419  -0.1342 10  DA  F "C1'" 
1439 N N9    . DA  C 11  ? 0.7085 0.5897 0.4435 -0.0482 0.0451  -0.1091 10  DA  F N9    
1440 C C8    . DA  C 11  ? 0.6604 0.5735 0.4313 -0.0234 0.0398  -0.0908 10  DA  F C8    
1441 N N7    . DA  C 11  ? 0.6565 0.5463 0.4255 -0.0021 0.0441  -0.0687 10  DA  F N7    
1442 C C5    . DA  C 11  ? 0.7115 0.5469 0.4382 -0.0080 0.0534  -0.0727 10  DA  F C5    
1443 C C6    . DA  C 11  ? 0.7296 0.5222 0.4330 0.0118  0.0622  -0.0554 10  DA  F C6    
1444 N N6    . DA  C 11  ? 0.6996 0.5101 0.4265 0.0393  0.0623  -0.0294 10  DA  F N6    
1445 N N1    . DA  C 11  ? 0.7894 0.5206 0.4429 0.0025  0.0711  -0.0649 10  DA  F N1    
1446 C C2    . DA  C 11  ? 0.8178 0.5342 0.4485 -0.0312 0.0706  -0.0902 10  DA  F C2    
1447 N N3    . DA  C 11  ? 0.7986 0.5631 0.4531 -0.0549 0.0624  -0.1079 10  DA  F N3    
1448 C C4    . DA  C 11  ? 0.7431 0.5662 0.4455 -0.0384 0.0542  -0.0977 10  DA  F C4    
1449 P P     . DC  C 12  ? 0.7361 0.7655 0.4535 -0.1433 0.0228  -0.2054 11  DC  F P     
1450 O OP1   . DC  C 12  ? 0.7415 0.8280 0.4734 -0.1798 0.0182  -0.2242 11  DC  F OP1   
1451 O OP2   . DC  C 12  ? 0.6959 0.7567 0.4350 -0.1024 0.0164  -0.1931 11  DC  F OP2   
1452 O "O5'" . DC  C 12  ? 0.7850 0.7310 0.4407 -0.1545 0.0300  -0.2123 11  DC  F "O5'" 
1453 C "C5'" . DC  C 12  ? 0.8197 0.7041 0.4450 -0.1837 0.0388  -0.2140 11  DC  F "C5'" 
1454 C "C4'" . DC  C 12  ? 0.8665 0.6585 0.4365 -0.1693 0.0481  -0.2091 11  DC  F "C4'" 
1455 O "O4'" . DC  C 12  ? 0.8370 0.6084 0.4167 -0.1294 0.0544  -0.1852 11  DC  F "O4'" 
1456 C "C3'" . DC  C 12  ? 0.8872 0.6720 0.4312 -0.1567 0.0434  -0.2191 11  DC  F "C3'" 
1457 O "O3'" . DC  C 12  ? 0.9468 0.6749 0.4507 -0.1818 0.0454  -0.2283 11  DC  F "O3'" 
1458 C "C2'" . DC  C 12  ? 0.8889 0.6383 0.4161 -0.1093 0.0521  -0.2025 11  DC  F "C2'" 
1459 C "C1'" . DC  C 12  ? 0.8826 0.6045 0.4245 -0.1007 0.0603  -0.1806 11  DC  F "C1'" 
1460 N N1    . DC  C 12  ? 0.8511 0.5938 0.4277 -0.0556 0.0623  -0.1525 11  DC  F N1    
1461 C C2    . DC  C 12  ? 0.8905 0.5765 0.4413 -0.0266 0.0737  -0.1341 11  DC  F C2    
1462 O O2    . DC  C 12  ? 0.9674 0.5778 0.4623 -0.0346 0.0827  -0.1417 11  DC  F O2    
1463 N N3    . DC  C 12  ? 0.8480 0.5640 0.4346 0.0096  0.0748  -0.1075 11  DC  F N3    
1464 C C4    . DC  C 12  ? 0.7785 0.5645 0.4181 0.0151  0.0652  -0.0998 11  DC  F C4    
1465 N N4    . DC  C 12  ? 0.7333 0.5437 0.4044 0.0449  0.0663  -0.0731 11  DC  F N4    
1466 C C5    . DC  C 12  ? 0.7509 0.5854 0.4121 -0.0094 0.0542  -0.1184 11  DC  F C5    
1467 C C6    . DC  C 12  ? 0.7883 0.6054 0.4197 -0.0432 0.0530  -0.1440 11  DC  F C6    
1468 P P     . DG  C 13  ? 0.9895 0.7033 0.4594 -0.1781 0.0392  -0.2432 12  DG  F P     
1469 O OP1   . DG  C 13  ? 1.0532 0.7372 0.4989 -0.2218 0.0376  -0.2556 12  DG  F OP1   
1470 O OP2   . DG  C 13  ? 0.9379 0.7331 0.4393 -0.1607 0.0273  -0.2477 12  DG  F OP2   
1471 O "O5'" . DG  C 13  ? 1.0254 0.6575 0.4477 -0.1378 0.0527  -0.2328 12  DG  F "O5'" 
1472 C "C5'" . DG  C 13  ? 1.0700 0.6203 0.4600 -0.1363 0.0663  -0.2210 12  DG  F "C5'" 
1473 C "C4'" . DG  C 13  ? 1.1085 0.6008 0.4608 -0.0879 0.0787  -0.2087 12  DG  F "C4'" 
1474 O "O4'" . DG  C 13  ? 1.0462 0.5705 0.4279 -0.0519 0.0837  -0.1894 12  DG  F "O4'" 
1475 C "C3'" . DG  C 13  ? 1.1442 0.6400 0.4732 -0.0698 0.0754  -0.2205 12  DG  F "C3'" 
1476 O "O3'" . DG  C 13  ? 1.2348 0.6424 0.5056 -0.0540 0.0865  -0.2191 12  DG  F "O3'" 
1477 C "C2'" . DG  C 13  ? 1.0840 0.6323 0.4409 -0.0264 0.0778  -0.2060 12  DG  F "C2'" 
1478 C "C1'" . DG  C 13  ? 1.0620 0.5914 0.4323 -0.0089 0.0885  -0.1829 12  DG  F "C1'" 
1479 N N9    . DG  C 13  ? 0.9909 0.5939 0.4181 0.0163  0.0859  -0.1631 12  DG  F N9    
1480 C C8    . DG  C 13  ? 0.9238 0.6110 0.4066 0.0018  0.0718  -0.1653 12  DG  F C8    
1481 N N7    . DG  C 13  ? 0.8535 0.5929 0.3887 0.0297  0.0708  -0.1398 12  DG  F N7    
1482 C C5    . DG  C 13  ? 0.8830 0.5809 0.4019 0.0628  0.0844  -0.1189 12  DG  F C5    
1483 C C6    . DG  C 13  ? 0.8404 0.5706 0.3988 0.0969  0.0889  -0.0869 12  DG  F C6    
1484 O O6    . DG  C 13  ? 0.7863 0.5792 0.3987 0.1025  0.0816  -0.0710 12  DG  F O6    
1485 N N1    . DG  C 13  ? 0.8865 0.5672 0.4133 0.1261  0.1035  -0.0726 12  DG  F N1    
1486 C C2    . DG  C 13  ? 0.9709 0.5686 0.4299 0.1257  0.1134  -0.0879 12  DG  F C2    
1487 N N2    . DG  C 13  ? 1.0119 0.5714 0.4468 0.1633  0.1280  -0.0691 12  DG  F N2    
1488 N N3    . DG  C 13  ? 1.0179 0.5727 0.4338 0.0905  0.1093  -0.1188 12  DG  F N3    
1489 C C4    . DG  C 13  ? 0.9647 0.5791 0.4171 0.0588  0.0942  -0.1325 12  DG  F C4    
1490 P P     . DC  C 14  ? 1.3107 0.6974 0.5403 -0.0526 0.0827  -0.2384 13  DC  F P     
1491 O OP1   . DC  C 14  ? 1.4089 0.7181 0.5896 -0.0870 0.0840  -0.2501 13  DC  F OP1   
1492 O OP2   . DC  C 14  ? 1.2575 0.7346 0.5230 -0.0597 0.0675  -0.2516 13  DC  F OP2   
1493 O "O5'" . DC  C 14  ? 1.3297 0.6824 0.5327 0.0076  0.0981  -0.2212 13  DC  F "O5'" 
1494 C "C5'" . DC  C 14  ? 1.3550 0.6417 0.5335 0.0367  0.1141  -0.1996 13  DC  F "C5'" 
1495 C "C4'" . DC  C 14  ? 1.3160 0.6243 0.5043 0.0969  0.1258  -0.1767 13  DC  F "C4'" 
1496 O "O4'" . DC  C 14  ? 1.2092 0.5967 0.4583 0.1049  0.1226  -0.1625 13  DC  F "O4'" 
1497 C "C3'" . DC  C 14  ? 1.3353 0.6620 0.5071 0.1191  0.1257  -0.1851 13  DC  F "C3'" 
1498 O "O3'" . DC  C 14  ? 1.4038 0.6742 0.5332 0.1647  0.1416  -0.1708 13  DC  F "O3'" 
1499 C "C2'" . DC  C 14  ? 1.2364 0.6597 0.4658 0.1368  0.1219  -0.1728 13  DC  F "C2'" 
1500 C "C1'" . DC  C 14  ? 1.1835 0.6218 0.4500 0.1439  0.1264  -0.1506 13  DC  F "C1'" 
1501 N N1    . DC  C 14  ? 1.0955 0.6192 0.4193 0.1375  0.1177  -0.1447 13  DC  F N1    
1502 C C2    . DC  C 14  ? 1.0392 0.6062 0.4007 0.1740  0.1262  -0.1149 13  DC  F C2    
1503 O O2    . DC  C 14  ? 1.0717 0.6143 0.4232 0.2112  0.1405  -0.0938 13  DC  F O2    
1504 N N3    . DC  C 14  ? 0.9489 0.5960 0.3736 0.1639  0.1149  -0.1050 13  DC  F N3    
1505 C C4    . DC  C 14  ? 0.9290 0.6075 0.3667 0.1276  0.0990  -0.1263 13  DC  F C4    
1506 N N4    . DC  C 14  ? 0.8491 0.6041 0.3514 0.1223  0.0877  -0.1135 13  DC  F N4    
1507 C C5    . DC  C 14  ? 0.9948 0.6286 0.3791 0.0947  0.0934  -0.1610 13  DC  F C5    
1508 C C6    . DC  C 14  ? 1.0709 0.6334 0.4100 0.0971  0.1014  -0.1669 13  DC  F C6    
1509 N N     . HIS D 1   ? 0.9016 1.0394 1.0502 -0.0441 0.4032  -0.3927 319 HIS A N     
1510 C CA    . HIS D 1   ? 0.8698 0.9725 1.1019 -0.0093 0.3864  -0.3874 319 HIS A CA    
1511 C C     . HIS D 1   ? 0.8418 0.9169 1.0581 -0.0049 0.3539  -0.3706 319 HIS A C     
1512 O O     . HIS D 1   ? 0.8256 0.8593 1.0950 0.0178  0.3339  -0.3680 319 HIS A O     
1513 C CB    . HIS D 1   ? 0.9218 0.9849 1.1986 0.0030  0.4004  -0.4202 319 HIS A CB    
1514 N N     . MET D 2   ? 0.8474 0.9464 0.9890 -0.0280 0.3427  -0.3516 320 MET A N     
1515 C CA    . MET D 2   ? 0.8282 0.9061 0.9417 -0.0281 0.3000  -0.3194 320 MET A CA    
1516 C C     . MET D 2   ? 0.7908 0.8945 0.9038 -0.0203 0.2758  -0.2705 320 MET A C     
1517 O O     . MET D 2   ? 0.7900 0.9316 0.9051 -0.0235 0.2905  -0.2593 320 MET A O     
1518 C CB    . MET D 2   ? 0.8617 0.9449 0.8927 -0.0608 0.2982  -0.3282 320 MET A CB    
1519 N N     . ARG D 3   ? 0.7728 0.8525 0.8816 -0.0115 0.2398  -0.2422 321 ARG A N     
1520 C CA    . ARG D 3   ? 0.7471 0.8395 0.8510 -0.0034 0.2170  -0.1994 321 ARG A CA    
1521 C C     . ARG D 3   ? 0.7381 0.8665 0.7761 -0.0234 0.2144  -0.1785 321 ARG A C     
1522 O O     . ARG D 3   ? 0.7492 0.8745 0.7488 -0.0353 0.2020  -0.1766 321 ARG A O     
1523 C CB    . ARG D 3   ? 0.7473 0.7990 0.8708 0.0127  0.1836  -0.1811 321 ARG A CB    
1524 C CG    . ARG D 3   ? 0.7747 0.7944 0.9683 0.0322  0.1779  -0.1904 321 ARG A CG    
1525 C CD    . ARG D 3   ? 0.7866 0.7639 0.9864 0.0398  0.1443  -0.1757 321 ARG A CD    
1526 N NE    . ARG D 3   ? 0.8350 0.7894 1.0099 0.0290  0.1424  -0.1933 321 ARG A NE    
1527 C CZ    . ARG D 3   ? 0.8519 0.7697 1.0249 0.0297  0.1158  -0.1829 321 ARG A CZ    
1528 N NH1   . ARG D 3   ? 0.8331 0.7340 1.0234 0.0403  0.0895  -0.1560 321 ARG A NH1   
1529 N NH2   . ARG D 3   ? 0.8890 0.7859 1.0387 0.0161  0.1152  -0.1990 321 ARG A NH2   
1530 N N     . PRO D 4   ? 0.7163 0.8815 0.7433 -0.0287 0.2241  -0.1593 322 PRO A N     
1531 C CA    . PRO D 4   ? 0.7184 0.9221 0.6890 -0.0478 0.2204  -0.1346 322 PRO A CA    
1532 C C     . PRO D 4   ? 0.6817 0.8836 0.6470 -0.0345 0.1943  -0.0918 322 PRO A C     
1533 O O     . PRO D 4   ? 0.6912 0.9249 0.6186 -0.0467 0.1872  -0.0678 322 PRO A O     
1534 C CB    . PRO D 4   ? 0.7376 0.9791 0.7033 -0.0608 0.2452  -0.1338 322 PRO A CB    
1535 C CG    . PRO D 4   ? 0.7109 0.9326 0.7386 -0.0389 0.2492  -0.1353 322 PRO A CG    
1536 C CD    . PRO D 4   ? 0.7040 0.8811 0.7724 -0.0210 0.2409  -0.1598 322 PRO A CD    
1537 N N     . PHE D 5   ? 0.6516 0.8182 0.6538 -0.0110 0.1803  -0.0817 323 PHE A N     
1538 C CA    . PHE D 5   ? 0.6318 0.7901 0.6294 0.0028  0.1616  -0.0464 323 PHE A CA    
1539 C C     . PHE D 5   ? 0.6325 0.7600 0.6284 0.0121  0.1426  -0.0475 323 PHE A C     
1540 O O     . PHE D 5   ? 0.6359 0.7302 0.6557 0.0174  0.1373  -0.0678 323 PHE A O     
1541 C CB    . PHE D 5   ? 0.6047 0.7440 0.6351 0.0165  0.1608  -0.0340 323 PHE A CB    
1542 C CG    . PHE D 5   ? 0.6053 0.7747 0.6421 0.0050  0.1806  -0.0332 323 PHE A CG    
1543 C CD1   . PHE D 5   ? 0.6199 0.8318 0.6206 -0.0122 0.1900  -0.0179 323 PHE A CD1   
1544 C CD2   . PHE D 5   ? 0.5940 0.7541 0.6740 0.0088  0.1891  -0.0455 323 PHE A CD2   
1545 C CE1   . PHE D 5   ? 0.6350 0.8765 0.6362 -0.0269 0.2090  -0.0155 323 PHE A CE1   
1546 C CE2   . PHE D 5   ? 0.6061 0.7988 0.6925 -0.0042 0.2100  -0.0443 323 PHE A CE2   
1547 C CZ    . PHE D 5   ? 0.6284 0.8604 0.6723 -0.0228 0.2208  -0.0299 323 PHE A CZ    
1548 N N     . MET D 6   ? 0.6267 0.7681 0.5979 0.0138  0.1325  -0.0231 324 MET A N     
1549 C CA    . MET D 6   ? 0.6203 0.7439 0.5835 0.0173  0.1180  -0.0228 324 MET A CA    
1550 C C     . MET D 6   ? 0.6079 0.7294 0.5666 0.0336  0.1104  0.0072  324 MET A C     
1551 O O     . MET D 6   ? 0.6169 0.7644 0.5715 0.0382  0.1153  0.0315  324 MET A O     
1552 C CB    . MET D 6   ? 0.6434 0.7963 0.5786 -0.0044 0.1178  -0.0313 324 MET A CB    
1553 C CG    . MET D 6   ? 0.6407 0.7801 0.5674 -0.0057 0.1033  -0.0295 324 MET A CG    
1554 S SD    . MET D 6   ? 0.6711 0.8474 0.5640 -0.0373 0.1007  -0.0367 324 MET A SD    
1555 C CE    . MET D 6   ? 0.6952 0.8412 0.5907 -0.0526 0.1131  -0.0825 324 MET A CE    
1556 N N     . CYS D 7   ? 0.5985 0.6872 0.5584 0.0420  0.0996  0.0054  325 CYS A N     
1557 C CA    . CYS D 7   ? 0.5930 0.6784 0.5455 0.0567  0.0973  0.0276  325 CYS A CA    
1558 C C     . CYS D 7   ? 0.5936 0.7274 0.5320 0.0507  0.0979  0.0441  325 CYS A C     
1559 O O     . CYS D 7   ? 0.5986 0.7486 0.5258 0.0326  0.0927  0.0333  325 CYS A O     
1560 C CB    . CYS D 7   ? 0.5884 0.6271 0.5387 0.0616  0.0870  0.0188  325 CYS A CB    
1561 S SG    . CYS D 7   ? 0.5988 0.6293 0.5338 0.0775  0.0906  0.0375  325 CYS A SG    
1562 N N     . ALA D 8   ? 0.5883 0.7450 0.5309 0.0654  0.1035  0.0717  326 ALA A N     
1563 C CA    . ALA D 8   ? 0.5918 0.8057 0.5318 0.0610  0.1027  0.0944  326 ALA A CA    
1564 C C     . ALA D 8   ? 0.6013 0.8178 0.5406 0.0676  0.1018  0.0995  326 ALA A C     
1565 O O     . ALA D 8   ? 0.6098 0.8795 0.5522 0.0615  0.0999  0.1183  326 ALA A O     
1566 C CB    . ALA D 8   ? 0.5966 0.8409 0.5514 0.0753  0.1085  0.1275  326 ALA A CB    
1567 N N     . TYR D 9   ? 0.6146 0.7798 0.5492 0.0768  0.1028  0.0851  327 TYR A N     
1568 C CA    . TYR D 9   ? 0.6397 0.8077 0.5680 0.0795  0.1048  0.0884  327 TYR A CA    
1569 C C     . TYR D 9   ? 0.6289 0.8162 0.5441 0.0522  0.0929  0.0792  327 TYR A C     
1570 O O     . TYR D 9   ? 0.6324 0.7848 0.5379 0.0372  0.0826  0.0568  327 TYR A O     
1571 C CB    . TYR D 9   ? 0.6723 0.7775 0.5885 0.0894  0.1073  0.0741  327 TYR A CB    
1572 C CG    . TYR D 9   ? 0.7095 0.7921 0.6338 0.1154  0.1222  0.0832  327 TYR A CG    
1573 C CD1   . TYR D 9   ? 0.7395 0.8264 0.6646 0.1330  0.1390  0.0925  327 TYR A CD1   
1574 C CD2   . TYR D 9   ? 0.7182 0.7735 0.6506 0.1218  0.1218  0.0814  327 TYR A CD2   
1575 C CE1   . TYR D 9   ? 0.7666 0.8237 0.6993 0.1577  0.1553  0.0975  327 TYR A CE1   
1576 C CE2   . TYR D 9   ? 0.7426 0.7693 0.6811 0.1433  0.1347  0.0894  327 TYR A CE2   
1577 C CZ    . TYR D 9   ? 0.7692 0.7931 0.7072 0.1619  0.1516  0.0962  327 TYR A CZ    
1578 O OH    . TYR D 9   ? 0.8022 0.7890 0.7465 0.1842  0.1671  0.1010  327 TYR A OH    
1579 N N     . PRO D 10  ? 0.6121 0.8540 0.5307 0.0447  0.0934  0.0967  328 PRO A N     
1580 C CA    . PRO D 10  ? 0.6141 0.8725 0.5181 0.0139  0.0808  0.0886  328 PRO A CA    
1581 C C     . PRO D 10  ? 0.6389 0.8457 0.5260 0.0056  0.0744  0.0713  328 PRO A C     
1582 O O     . PRO D 10  ? 0.6514 0.8415 0.5348 0.0185  0.0821  0.0758  328 PRO A O     
1583 C CB    . PRO D 10  ? 0.6040 0.9355 0.5217 0.0111  0.0838  0.1172  328 PRO A CB    
1584 C CG    . PRO D 10  ? 0.5995 0.9594 0.5438 0.0394  0.0954  0.1412  328 PRO A CG    
1585 C CD    . PRO D 10  ? 0.6040 0.8974 0.5460 0.0638  0.1051  0.1269  328 PRO A CD    
1586 N N     . GLY D 11  ? 0.6549 0.8347 0.5307 -0.0173 0.0608  0.0516  329 GLY A N     
1587 C CA    . GLY D 11  ? 0.6728 0.8012 0.5360 -0.0273 0.0498  0.0396  329 GLY A CA    
1588 C C     . GLY D 11  ? 0.6731 0.7414 0.5426 -0.0170 0.0443  0.0218  329 GLY A C     
1589 O O     . GLY D 11  ? 0.6819 0.7097 0.5511 -0.0300 0.0303  0.0082  329 GLY A O     
1590 N N     . CYS D 12  ? 0.6613 0.7236 0.5411 0.0059  0.0542  0.0241  330 CYS A N     
1591 C CA    . CYS D 12  ? 0.6473 0.6613 0.5388 0.0138  0.0483  0.0099  330 CYS A CA    
1592 C C     . CYS D 12  ? 0.6297 0.6501 0.5390 0.0093  0.0501  -0.0053 330 CYS A C     
1593 O O     . CYS D 12  ? 0.6352 0.6261 0.5553 0.0000  0.0408  -0.0223 330 CYS A O     
1594 C CB    . CYS D 12  ? 0.6412 0.6431 0.5342 0.0357  0.0582  0.0177  330 CYS A CB    
1595 S SG    . CYS D 12  ? 0.6242 0.5730 0.5334 0.0419  0.0486  0.0051  330 CYS A SG    
1596 N N     . ASN D 13  ? 0.6201 0.6798 0.5330 0.0152  0.0631  0.0014  331 ASN A N     
1597 C CA    . ASN D 13  ? 0.6111 0.6881 0.5309 0.0064  0.0696  -0.0122 331 ASN A CA    
1598 C C     . ASN D 13  ? 0.6281 0.6631 0.5701 0.0080  0.0675  -0.0357 331 ASN A C     
1599 O O     . ASN D 13  ? 0.6480 0.6780 0.5946 -0.0050 0.0697  -0.0572 331 ASN A O     
1600 C CB    . ASN D 13  ? 0.5974 0.7068 0.4991 -0.0182 0.0677  -0.0166 331 ASN A CB    
1601 C CG    . ASN D 13  ? 0.5780 0.7413 0.4680 -0.0204 0.0685  0.0110  331 ASN A CG    
1602 O OD1   . ASN D 13  ? 0.5900 0.7668 0.4692 -0.0345 0.0610  0.0169  331 ASN A OD1   
1603 N ND2   . ASN D 13  ? 0.5698 0.7659 0.4667 -0.0065 0.0771  0.0309  331 ASN A ND2   
1604 N N     . LYS D 14  ? 0.6257 0.6305 0.5840 0.0238  0.0640  -0.0319 332 LYS A N     
1605 C CA    . LYS D 14  ? 0.6332 0.6058 0.6233 0.0272  0.0602  -0.0486 332 LYS A CA    
1606 C C     . LYS D 14  ? 0.6319 0.6279 0.6389 0.0295  0.0778  -0.0574 332 LYS A C     
1607 O O     . LYS D 14  ? 0.6326 0.6534 0.6308 0.0347  0.0872  -0.0427 332 LYS A O     
1608 C CB    . LYS D 14  ? 0.6351 0.5711 0.6346 0.0375  0.0464  -0.0389 332 LYS A CB    
1609 C CG    . LYS D 14  ? 0.6451 0.5506 0.6299 0.0304  0.0270  -0.0336 332 LYS A CG    
1610 C CD    . LYS D 14  ? 0.6564 0.5218 0.6587 0.0332  0.0083  -0.0300 332 LYS A CD    
1611 C CE    . LYS D 14  ? 0.6627 0.5158 0.7149 0.0348  0.0021  -0.0431 332 LYS A CE    
1612 N NZ    . LYS D 14  ? 0.6818 0.5024 0.7576 0.0352  -0.0218 -0.0340 332 LYS A NZ    
1613 N N     . ARG D 15  ? 0.6385 0.6257 0.6715 0.0255  0.0836  -0.0810 333 ARG A N     
1614 C CA    . ARG D 15  ? 0.6423 0.6542 0.6902 0.0241  0.1047  -0.0942 333 ARG A CA    
1615 C C     . ARG D 15  ? 0.6283 0.6240 0.7227 0.0371  0.1042  -0.0954 333 ARG A C     
1616 O O     . ARG D 15  ? 0.6284 0.5904 0.7527 0.0442  0.0875  -0.0963 333 ARG A O     
1617 C CB    . ARG D 15  ? 0.6785 0.6939 0.7254 0.0103  0.1184  -0.1246 333 ARG A CB    
1618 C CG    . ARG D 15  ? 0.6986 0.7346 0.6979 -0.0094 0.1175  -0.1239 333 ARG A CG    
1619 C CD    . ARG D 15  ? 0.7280 0.7302 0.7282 -0.0197 0.1109  -0.1457 333 ARG A CD    
1620 N NE    . ARG D 15  ? 0.7544 0.7794 0.7088 -0.0449 0.1112  -0.1483 333 ARG A NE    
1621 C CZ    . ARG D 15  ? 0.7980 0.8414 0.7284 -0.0658 0.1290  -0.1722 333 ARG A CZ    
1622 N NH1   . ARG D 15  ? 0.8203 0.8860 0.7069 -0.0930 0.1244  -0.1714 333 ARG A NH1   
1623 N NH2   . ARG D 15  ? 0.8232 0.8653 0.7723 -0.0621 0.1522  -0.1973 333 ARG A NH2   
1624 N N     . TYR D 16  ? 0.6202 0.6433 0.7212 0.0375  0.1206  -0.0919 334 TYR A N     
1625 C CA    . TYR D 16  ? 0.6084 0.6255 0.7549 0.0461  0.1215  -0.0902 334 TYR A CA    
1626 C C     . TYR D 16  ? 0.6045 0.6585 0.7654 0.0396  0.1499  -0.1038 334 TYR A C     
1627 O O     . TYR D 16  ? 0.6106 0.6960 0.7334 0.0274  0.1654  -0.1034 334 TYR A O     
1628 C CB    . TYR D 16  ? 0.6044 0.6096 0.7406 0.0517  0.1080  -0.0627 334 TYR A CB    
1629 C CG    . TYR D 16  ? 0.6124 0.5803 0.7318 0.0560  0.0833  -0.0519 334 TYR A CG    
1630 C CD1   . TYR D 16  ? 0.6226 0.5585 0.7717 0.0589  0.0628  -0.0508 334 TYR A CD1   
1631 C CD2   . TYR D 16  ? 0.6165 0.5855 0.6910 0.0553  0.0808  -0.0410 334 TYR A CD2   
1632 C CE1   . TYR D 16  ? 0.6348 0.5374 0.7598 0.0579  0.0408  -0.0407 334 TYR A CE1   
1633 C CE2   . TYR D 16  ? 0.6242 0.5622 0.6800 0.0572  0.0628  -0.0328 334 TYR A CE2   
1634 C CZ    . TYR D 16  ? 0.6367 0.5398 0.7131 0.0570  0.0431  -0.0335 334 TYR A CZ    
1635 O OH    . TYR D 16  ? 0.6544 0.5273 0.7038 0.0540  0.0256  -0.0253 334 TYR A OH    
1636 N N     . PHE D 17  ? 0.5986 0.6525 0.8160 0.0460  0.1564  -0.1141 335 PHE A N     
1637 C CA    . PHE D 17  ? 0.6062 0.6985 0.8421 0.0393  0.1869  -0.1268 335 PHE A CA    
1638 C C     . PHE D 17  ? 0.6106 0.7229 0.8361 0.0339  0.1883  -0.0998 335 PHE A C     
1639 O O     . PHE D 17  ? 0.6266 0.7748 0.8273 0.0204  0.2101  -0.0987 335 PHE A O     
1640 C CB    . PHE D 17  ? 0.5946 0.6856 0.9055 0.0501  0.1962  -0.1469 335 PHE A CB    
1641 C CG    . PHE D 17  ? 0.6032 0.6829 0.9275 0.0529  0.2111  -0.1816 335 PHE A CG    
1642 C CD1   . PHE D 17  ? 0.6287 0.7328 0.9216 0.0389  0.2449  -0.2091 335 PHE A CD1   
1643 C CD2   . PHE D 17  ? 0.5974 0.6388 0.9637 0.0671  0.1912  -0.1864 335 PHE A CD2   
1644 C CE1   . PHE D 17  ? 0.6612 0.7465 0.9630 0.0398  0.2609  -0.2454 335 PHE A CE1   
1645 C CE2   . PHE D 17  ? 0.6283 0.6509 1.0098 0.0704  0.2054  -0.2183 335 PHE A CE2   
1646 C CZ    . PHE D 17  ? 0.6619 0.7039 1.0108 0.0571  0.2416  -0.2502 335 PHE A CZ    
1647 N N     . LYS D 18  ? 0.6090 0.6961 0.8498 0.0412  0.1647  -0.0776 336 LYS A N     
1648 C CA    . LYS D 18  ? 0.6211 0.7157 0.8562 0.0356  0.1641  -0.0524 336 LYS A CA    
1649 C C     . LYS D 18  ? 0.6244 0.6973 0.8067 0.0374  0.1492  -0.0288 336 LYS A C     
1650 O O     . LYS D 18  ? 0.6213 0.6648 0.7849 0.0452  0.1318  -0.0285 336 LYS A O     
1651 C CB    . LYS D 18  ? 0.6197 0.6990 0.9078 0.0387  0.1489  -0.0448 336 LYS A CB    
1652 C CG    . LYS D 18  ? 0.6260 0.7282 0.9838 0.0423  0.1609  -0.0652 336 LYS A CG    
1653 C CD    . LYS D 18  ? 0.6374 0.7849 1.0253 0.0316  0.1875  -0.0641 336 LYS A CD    
1654 C CE    . LYS D 18  ? 0.6547 0.8394 1.0099 0.0222  0.2230  -0.0813 336 LYS A CE    
1655 N NZ    . LYS D 18  ? 0.6673 0.8997 1.0499 0.0087  0.2517  -0.0808 336 LYS A NZ    
1656 N N     . LEU D 19  ? 0.6365 0.7249 0.7977 0.0302  0.1577  -0.0075 337 LEU A N     
1657 C CA    . LEU D 19  ? 0.6337 0.7021 0.7551 0.0358  0.1469  0.0171  337 LEU A CA    
1658 C C     . LEU D 19  ? 0.6447 0.6616 0.7714 0.0443  0.1264  0.0259  337 LEU A C     
1659 O O     . LEU D 19  ? 0.6501 0.6403 0.7472 0.0538  0.1174  0.0356  337 LEU A O     
1660 C CB    . LEU D 19  ? 0.6289 0.7237 0.7332 0.0262  0.1594  0.0416  337 LEU A CB    
1661 C CG    . LEU D 19  ? 0.6204 0.7665 0.6996 0.0128  0.1767  0.0395  337 LEU A CG    
1662 C CD1   . LEU D 19  ? 0.6359 0.8099 0.7070 -0.0024 0.1882  0.0649  337 LEU A CD1   
1663 C CD2   . LEU D 19  ? 0.6144 0.7644 0.6580 0.0188  0.1680  0.0478  337 LEU A CD2   
1664 N N     . SER D 20  ? 0.6534 0.6581 0.8172 0.0391  0.1197  0.0222  338 SER A N     
1665 C CA    . SER D 20  ? 0.6718 0.6262 0.8338 0.0405  0.0981  0.0290  338 SER A CA    
1666 C C     . SER D 20  ? 0.6709 0.5986 0.8211 0.0479  0.0809  0.0169  338 SER A C     
1667 O O     . SER D 20  ? 0.6948 0.5813 0.8130 0.0511  0.0689  0.0226  338 SER A O     
1668 C CB    . SER D 20  ? 0.6867 0.6429 0.8949 0.0285  0.0915  0.0301  338 SER A CB    
1669 O OG    . SER D 20  ? 0.6861 0.6716 0.9418 0.0292  0.0930  0.0127  338 SER A OG    
1670 N N     . HIS D 21  ? 0.6534 0.6013 0.8276 0.0498  0.0810  -0.0002 339 HIS A N     
1671 C CA    . HIS D 21  ? 0.6532 0.5758 0.8163 0.0540  0.0632  -0.0082 339 HIS A CA    
1672 C C     . HIS D 21  ? 0.6520 0.5723 0.7659 0.0601  0.0687  -0.0059 339 HIS A C     
1673 O O     . HIS D 21  ? 0.6610 0.5522 0.7497 0.0617  0.0546  -0.0051 339 HIS A O     
1674 C CB    . HIS D 21  ? 0.6430 0.5830 0.8505 0.0554  0.0626  -0.0255 339 HIS A CB    
1675 C CG    . HIS D 21  ? 0.6409 0.5865 0.9091 0.0522  0.0541  -0.0251 339 HIS A CG    
1676 N ND1   . HIS D 21  ? 0.6394 0.5992 0.9637 0.0573  0.0539  -0.0385 339 HIS A ND1   
1677 C CD2   . HIS D 21  ? 0.6497 0.5902 0.9362 0.0439  0.0452  -0.0117 339 HIS A CD2   
1678 C CE1   . HIS D 21  ? 0.6428 0.6127 1.0228 0.0540  0.0451  -0.0312 339 HIS A CE1   
1679 N NE2   . HIS D 21  ? 0.6458 0.6050 1.0016 0.0436  0.0386  -0.0148 339 HIS A NE2   
1680 N N     . LEU D 22  ? 0.6440 0.5988 0.7438 0.0613  0.0884  -0.0028 340 LEU A N     
1681 C CA    . LEU D 22  ? 0.6423 0.6031 0.7028 0.0667  0.0922  0.0053  340 LEU A CA    
1682 C C     . LEU D 22  ? 0.6719 0.6045 0.7093 0.0749  0.0906  0.0235  340 LEU A C     
1683 O O     . LEU D 22  ? 0.6780 0.6000 0.6892 0.0824  0.0892  0.0279  340 LEU A O     
1684 C CB    . LEU D 22  ? 0.6252 0.6349 0.6776 0.0617  0.1097  0.0074  340 LEU A CB    
1685 C CG    . LEU D 22  ? 0.6186 0.6477 0.6386 0.0657  0.1122  0.0222  340 LEU A CG    
1686 C CD1   . LEU D 22  ? 0.6098 0.6283 0.6168 0.0661  0.1021  0.0118  340 LEU A CD1   
1687 C CD2   . LEU D 22  ? 0.6220 0.7027 0.6319 0.0546  0.1252  0.0280  340 LEU A CD2   
1688 N N     . GLN D 23  ? 0.6960 0.6147 0.7441 0.0732  0.0929  0.0334  341 GLN A N     
1689 C CA    . GLN D 23  ? 0.7339 0.6141 0.7610 0.0811  0.0931  0.0473  341 GLN A CA    
1690 C C     . GLN D 23  ? 0.7785 0.6090 0.7877 0.0799  0.0784  0.0366  341 GLN A C     
1691 O O     . GLN D 23  ? 0.8100 0.6154 0.7895 0.0895  0.0825  0.0390  341 GLN A O     
1692 C CB    . GLN D 23  ? 0.7381 0.6095 0.7804 0.0748  0.0972  0.0600  341 GLN A CB    
1693 C CG    . GLN D 23  ? 0.7704 0.5962 0.7922 0.0837  0.1007  0.0744  341 GLN A CG    
1694 C CD    . GLN D 23  ? 0.7822 0.5939 0.8186 0.0737  0.1027  0.0888  341 GLN A CD    
1695 O OE1   . GLN D 23  ? 0.7630 0.5924 0.8253 0.0576  0.0983  0.0848  341 GLN A OE1   
1696 N NE2   . GLN D 23  ? 0.8182 0.5983 0.8420 0.0834  0.1104  0.1067  341 GLN A NE2   
1697 N N     . MET D 24  ? 0.7897 0.6079 0.8175 0.0673  0.0616  0.0259  342 MET A N     
1698 C CA    . MET D 24  ? 0.8302 0.6040 0.8363 0.0600  0.0431  0.0186  342 MET A CA    
1699 C C     . MET D 24  ? 0.8220 0.5987 0.8022 0.0647  0.0415  0.0126  342 MET A C     
1700 O O     . MET D 24  ? 0.8562 0.5965 0.7998 0.0613  0.0356  0.0094  342 MET A O     
1701 C CB    . MET D 24  ? 0.8481 0.6193 0.8890 0.0447  0.0213  0.0145  342 MET A CB    
1702 C CG    . MET D 24  ? 0.8927 0.6405 0.9442 0.0322  0.0144  0.0210  342 MET A CG    
1703 S SD    . MET D 24  ? 0.9018 0.6658 1.0127 0.0153  -0.0108 0.0218  342 MET A SD    
1704 C CE    . MET D 24  ? 0.8541 0.6834 1.0208 0.0257  0.0132  0.0198  342 MET A CE    
1705 N N     . HIS D 25  ? 0.7927 0.6113 0.7877 0.0691  0.0477  0.0101  343 HIS A N     
1706 C CA    . HIS D 25  ? 0.7950 0.6196 0.7663 0.0706  0.0465  0.0069  343 HIS A CA    
1707 C C     . HIS D 25  ? 0.7837 0.6118 0.7252 0.0833  0.0644  0.0156  343 HIS A C     
1708 O O     . HIS D 25  ? 0.8093 0.6200 0.7204 0.0834  0.0642  0.0138  343 HIS A O     
1709 C CB    . HIS D 25  ? 0.7900 0.6542 0.7835 0.0686  0.0485  0.0004  343 HIS A CB    
1710 C CG    . HIS D 25  ? 0.8233 0.7012 0.7929 0.0678  0.0499  0.0002  343 HIS A CG    
1711 N ND1   . HIS D 25  ? 0.8465 0.6994 0.7972 0.0597  0.0348  -0.0020 343 HIS A ND1   
1712 C CD2   . HIS D 25  ? 0.8185 0.7355 0.7798 0.0707  0.0631  0.0048  343 HIS A CD2   
1713 C CE1   . HIS D 25  ? 0.8416 0.7174 0.7750 0.0581  0.0405  0.0001  343 HIS A CE1   
1714 N NE2   . HIS D 25  ? 0.8127 0.7286 0.7536 0.0647  0.0569  0.0042  343 HIS A NE2   
1715 N N     . SER D 26  ? 0.7447 0.5980 0.6971 0.0938  0.0805  0.0270  344 SER A N     
1716 C CA    . SER D 26  ? 0.7347 0.5961 0.6723 0.1099  0.0972  0.0400  344 SER A CA    
1717 C C     . SER D 26  ? 0.7549 0.5617 0.6695 0.1171  0.1029  0.0380  344 SER A C     
1718 O O     . SER D 26  ? 0.7766 0.5819 0.6771 0.1315  0.1180  0.0426  344 SER A O     
1719 C CB    . SER D 26  ? 0.7322 0.6314 0.6898 0.1174  0.1086  0.0582  344 SER A CB    
1720 O OG    . SER D 26  ? 0.7511 0.6269 0.7210 0.1147  0.1083  0.0620  344 SER A OG    
1721 N N     . ARG D 27  ? 0.7558 0.5187 0.6673 0.1061  0.0922  0.0303  345 ARG A N     
1722 C CA    . ARG D 27  ? 0.7961 0.4986 0.6768 0.1065  0.0964  0.0233  345 ARG A CA    
1723 C C     . ARG D 27  ? 0.8107 0.4890 0.6522 0.0975  0.0914  0.0089  345 ARG A C     
1724 O O     . ARG D 27  ? 0.8611 0.4877 0.6668 0.0951  0.0981  -0.0013 345 ARG A O     
1725 C CB    . ARG D 27  ? 0.8149 0.4811 0.7023 0.0905  0.0824  0.0205  345 ARG A CB    
1726 C CG    . ARG D 27  ? 0.8126 0.4886 0.7286 0.0973  0.0915  0.0361  345 ARG A CG    
1727 C CD    . ARG D 27  ? 0.8325 0.4851 0.7620 0.0766  0.0754  0.0346  345 ARG A CD    
1728 N NE    . ARG D 27  ? 0.8474 0.5044 0.7993 0.0794  0.0849  0.0514  345 ARG A NE    
1729 C CZ    . ARG D 27  ? 0.8624 0.5122 0.8348 0.0611  0.0746  0.0554  345 ARG A CZ    
1730 N NH1   . ARG D 27  ? 0.8758 0.5305 0.8653 0.0618  0.0842  0.0737  345 ARG A NH1   
1731 N NH2   . ARG D 27  ? 0.8620 0.5032 0.8406 0.0407  0.0532  0.0444  345 ARG A NH2   
1732 N N     . LYS D 28  ? 0.7765 0.4873 0.6201 0.0900  0.0805  0.0074  346 LYS A N     
1733 C CA    . LYS D 28  ? 0.7918 0.4845 0.5963 0.0782  0.0750  -0.0019 346 LYS A CA    
1734 C C     . LYS D 28  ? 0.7854 0.5091 0.5793 0.0920  0.0966  0.0017  346 LYS A C     
1735 O O     . LYS D 28  ? 0.8222 0.5289 0.5776 0.0839  0.1006  -0.0061 346 LYS A O     
1736 C CB    . LYS D 28  ? 0.7886 0.4907 0.6032 0.0580  0.0458  -0.0028 346 LYS A CB    
1737 C CG    . LYS D 28  ? 0.7989 0.4777 0.6328 0.0439  0.0226  -0.0038 346 LYS A CG    
1738 C CD    . LYS D 28  ? 0.7790 0.4699 0.6360 0.0293  -0.0051 -0.0015 346 LYS A CD    
1739 C CE    . LYS D 28  ? 0.7811 0.4589 0.6705 0.0177  -0.0276 0.0010  346 LYS A CE    
1740 N NZ    . LYS D 28  ? 0.7654 0.4560 0.6906 0.0085  -0.0538 0.0056  346 LYS A NZ    
1741 N N     . HIS D 29  ? 0.9699 0.4875 0.7135 0.1596  -0.0815 -0.1253 347 HIS A N     
1742 C CA    . HIS D 29  ? 0.9422 0.4462 0.7061 0.1357  -0.1023 -0.1183 347 HIS A CA    
1743 C C     . HIS D 29  ? 0.8556 0.4041 0.6446 0.1182  -0.0884 -0.0981 347 HIS A C     
1744 O O     . HIS D 29  ? 0.8125 0.3961 0.5930 0.1251  -0.0670 -0.0936 347 HIS A O     
1745 C CB    . HIS D 29  ? 1.0025 0.4737 0.7331 0.1404  -0.1262 -0.1399 347 HIS A CB    
1746 C CG    . HIS D 29  ? 1.1343 0.5549 0.8430 0.1554  -0.1455 -0.1614 347 HIS A CG    
1747 N ND1   . HIS D 29  ? 1.1715 0.5626 0.9063 0.1390  -0.1696 -0.1576 347 HIS A ND1   
1748 C CD2   . HIS D 29  ? 1.1823 0.6024 0.8582 0.1791  -0.1390 -0.1790 347 HIS A CD2   
1749 C CE1   . HIS D 29  ? 1.2220 0.5912 0.9381 0.1532  -0.1790 -0.1735 347 HIS A CE1   
1750 N NE2   . HIS D 29  ? 1.2261 0.6126 0.9069 0.1782  -0.1606 -0.1873 347 HIS A NE2   
1751 N N     . THR D 30  ? 0.8511 0.3981 0.6739 0.0954  -0.1013 -0.0855 348 THR A N     
1752 C CA    . THR D 30  ? 0.8128 0.4006 0.6646 0.0801  -0.0888 -0.0669 348 THR A CA    
1753 C C     . THR D 30  ? 0.8239 0.4322 0.6535 0.0853  -0.0845 -0.0721 348 THR A C     
1754 O O     . THR D 30  ? 0.7872 0.4286 0.6159 0.0892  -0.0634 -0.0640 348 THR A O     
1755 C CB    . THR D 30  ? 0.8063 0.3893 0.6980 0.0566  -0.1053 -0.0555 348 THR A CB    
1756 N N     . GLY D 31  ? 0.8835 0.4705 0.6943 0.0846  -0.1063 -0.0847 349 GLY A N     
1757 C CA    . GLY D 31  ? 0.9061 0.5079 0.6911 0.0893  -0.1051 -0.0884 349 GLY A CA    
1758 C C     . GLY D 31  ? 0.8924 0.5203 0.7104 0.0725  -0.1082 -0.0736 349 GLY A C     
1759 O O     . GLY D 31  ? 0.8562 0.5055 0.7160 0.0607  -0.0988 -0.0582 349 GLY A O     
1760 N N     . GLU D 32  ? 0.9248 0.5514 0.7228 0.0727  -0.1213 -0.0783 350 GLU A N     
1761 C CA    . GLU D 32  ? 0.9054 0.5543 0.7353 0.0592  -0.1282 -0.0661 350 GLU A CA    
1762 C C     . GLU D 32  ? 0.8564 0.5406 0.6910 0.0619  -0.1040 -0.0531 350 GLU A C     
1763 O O     . GLU D 32  ? 0.8712 0.5607 0.6730 0.0740  -0.0874 -0.0549 350 GLU A O     
1764 C CB    . GLU D 32  ? 0.9539 0.5843 0.7599 0.0587  -0.1558 -0.0757 350 GLU A CB    
1765 N N     . LYS D 33  ? 0.8023 0.5113 0.6806 0.0505  -0.1023 -0.0400 351 LYS A N     
1766 C CA    . LYS D 33  ? 0.7430 0.4815 0.6303 0.0518  -0.0850 -0.0286 351 LYS A CA    
1767 C C     . LYS D 33  ? 0.7266 0.4710 0.6251 0.0467  -0.1031 -0.0254 351 LYS A C     
1768 O O     . LYS D 33  ? 0.6978 0.4614 0.6411 0.0384  -0.1058 -0.0176 351 LYS A O     
1769 C CB    . LYS D 33  ? 0.6945 0.4566 0.6211 0.0465  -0.0663 -0.0178 351 LYS A CB    
1770 C CG    . LYS D 33  ? 0.6915 0.4440 0.6121 0.0498  -0.0542 -0.0198 351 LYS A CG    
1771 C CD    . LYS D 33  ? 0.6535 0.4302 0.5974 0.0483  -0.0324 -0.0086 351 LYS A CD    
1772 C CE    . LYS D 33  ? 0.6364 0.4295 0.6254 0.0360  -0.0334 0.0008  351 LYS A CE    
1773 N NZ    . LYS D 33  ? 0.6114 0.4250 0.6148 0.0361  -0.0120 0.0103  351 LYS A NZ    
1774 N N     . PRO D 34  ? 0.7391 0.4682 0.5968 0.0526  -0.1157 -0.0310 352 PRO A N     
1775 C CA    . PRO D 34  ? 0.7402 0.4679 0.6058 0.0480  -0.1400 -0.0292 352 PRO A CA    
1776 C C     . PRO D 34  ? 0.7069 0.4575 0.5899 0.0479  -0.1339 -0.0167 352 PRO A C     
1777 O O     . PRO D 34  ? 0.7094 0.4645 0.6160 0.0436  -0.1534 -0.0134 352 PRO A O     
1778 C CB    . PRO D 34  ? 0.7867 0.4862 0.5924 0.0558  -0.1546 -0.0398 352 PRO A CB    
1779 C CG    . PRO D 34  ? 0.7859 0.4873 0.5548 0.0665  -0.1282 -0.0408 352 PRO A CG    
1780 C CD    . PRO D 34  ? 0.7596 0.4729 0.5612 0.0646  -0.1086 -0.0391 352 PRO A CD    
1781 N N     . TYR D 35  ? 0.6807 0.4446 0.5550 0.0526  -0.1099 -0.0099 353 TYR A N     
1782 C CA    . TYR D 35  ? 0.6692 0.4479 0.5545 0.0532  -0.1067 0.0011  353 TYR A CA    
1783 C C     . TYR D 35  ? 0.6439 0.4463 0.5853 0.0492  -0.1002 0.0057  353 TYR A C     
1784 O O     . TYR D 35  ? 0.6231 0.4384 0.5783 0.0495  -0.0792 0.0072  353 TYR A O     
1785 C CB    . TYR D 35  ? 0.6623 0.4441 0.5161 0.0583  -0.0861 0.0068  353 TYR A CB    
1786 C CG    . TYR D 35  ? 0.7023 0.4663 0.4998 0.0634  -0.0895 0.0038  353 TYR A CG    
1787 C CD1   . TYR D 35  ? 0.7289 0.4835 0.4994 0.0636  -0.1040 0.0105  353 TYR A CD1   
1788 C CD2   . TYR D 35  ? 0.7156 0.4721 0.4855 0.0692  -0.0783 -0.0055 353 TYR A CD2   
1789 C CE1   . TYR D 35  ? 0.7699 0.5099 0.4841 0.0688  -0.1051 0.0085  353 TYR A CE1   
1790 C CE2   . TYR D 35  ? 0.7526 0.4955 0.4691 0.0763  -0.0790 -0.0097 353 TYR A CE2   
1791 C CZ    . TYR D 35  ? 0.7827 0.5185 0.4700 0.0757  -0.0914 -0.0024 353 TYR A CZ    
1792 O OH    . TYR D 35  ? 0.8351 0.5591 0.4645 0.0832  -0.0901 -0.0058 353 TYR A OH    
1793 N N     . GLN D 36  ? 0.6550 0.4644 0.6280 0.0466  -0.1184 0.0078  354 GLN A N     
1794 C CA    . GLN D 36  ? 0.6430 0.4787 0.6709 0.0450  -0.1124 0.0112  354 GLN A CA    
1795 C C     . GLN D 36  ? 0.6309 0.4769 0.6647 0.0515  -0.1038 0.0173  354 GLN A C     
1796 O O     . GLN D 36  ? 0.6519 0.4842 0.6577 0.0548  -0.1125 0.0214  354 GLN A O     
1797 C CB    . GLN D 36  ? 0.6696 0.5121 0.7354 0.0403  -0.1366 0.0101  354 GLN A CB    
1798 C CG    . GLN D 36  ? 0.6930 0.5320 0.7744 0.0308  -0.1441 0.0054  354 GLN A CG    
1799 C CD    . GLN D 36  ? 0.6753 0.5440 0.8108 0.0252  -0.1288 0.0097  354 GLN A CD    
1800 O OE1   . GLN D 36  ? 0.6551 0.5445 0.8056 0.0303  -0.1072 0.0138  354 GLN A OE1   
1801 N NE2   . GLN D 36  ? 0.6841 0.5547 0.8484 0.0142  -0.1405 0.0092  354 GLN A NE2   
1802 N N     . CYS D 37  ? 0.5958 0.4643 0.6647 0.0532  -0.0873 0.0182  355 CYS A N     
1803 C CA    . CYS D 37  ? 0.5762 0.4535 0.6575 0.0607  -0.0820 0.0211  355 CYS A CA    
1804 C C     . CYS D 37  ? 0.5776 0.4704 0.7037 0.0644  -0.0972 0.0207  355 CYS A C     
1805 O O     . CYS D 37  ? 0.5673 0.4811 0.7325 0.0613  -0.0961 0.0188  355 CYS A O     
1806 C CB    . CYS D 37  ? 0.5407 0.4325 0.6302 0.0631  -0.0564 0.0200  355 CYS A CB    
1807 S SG    . CYS D 37  ? 0.5291 0.4227 0.6229 0.0729  -0.0513 0.0207  355 CYS A SG    
1808 N N     . ASP D 38  ? 0.5928 0.4762 0.7157 0.0708  -0.1118 0.0237  356 ASP A N     
1809 C CA    . ASP D 38  ? 0.6044 0.4993 0.7679 0.0763  -0.1313 0.0234  356 ASP A CA    
1810 C C     . ASP D 38  ? 0.5704 0.4847 0.7705 0.0881  -0.1215 0.0204  356 ASP A C     
1811 O O     . ASP D 38  ? 0.5793 0.5069 0.8188 0.0957  -0.1359 0.0191  356 ASP A O     
1812 C CB    . ASP D 38  ? 0.6644 0.5332 0.8009 0.0772  -0.1587 0.0291  356 ASP A CB    
1813 C CG    . ASP D 38  ? 0.7138 0.5652 0.8166 0.0681  -0.1726 0.0293  356 ASP A CG    
1814 O OD1   . ASP D 38  ? 0.7153 0.5779 0.8373 0.0618  -0.1725 0.0242  356 ASP A OD1   
1815 O OD2   . ASP D 38  ? 0.7531 0.5785 0.8089 0.0672  -0.1838 0.0348  356 ASP A OD2   
1816 N N     . PHE D 39  ? 0.5394 0.4553 0.7278 0.0912  -0.0986 0.0181  357 PHE A N     
1817 C CA    . PHE D 39  ? 0.5215 0.4542 0.7406 0.1042  -0.0890 0.0121  357 PHE A CA    
1818 C C     . PHE D 39  ? 0.5010 0.4723 0.7689 0.1065  -0.0769 0.0076  357 PHE A C     
1819 O O     . PHE D 39  ? 0.4903 0.4732 0.7624 0.0954  -0.0688 0.0100  357 PHE A O     
1820 C CB    . PHE D 39  ? 0.5088 0.4317 0.6998 0.1061  -0.0698 0.0100  357 PHE A CB    
1821 C CG    . PHE D 39  ? 0.5225 0.4134 0.6802 0.1062  -0.0818 0.0152  357 PHE A CG    
1822 C CD1   . PHE D 39  ? 0.5357 0.4165 0.7063 0.1179  -0.0933 0.0127  357 PHE A CD1   
1823 C CD2   . PHE D 39  ? 0.5255 0.3966 0.6404 0.0949  -0.0816 0.0231  357 PHE A CD2   
1824 C CE1   . PHE D 39  ? 0.5545 0.4039 0.6963 0.1155  -0.1056 0.0203  357 PHE A CE1   
1825 C CE2   . PHE D 39  ? 0.5424 0.3878 0.6294 0.0928  -0.0910 0.0310  357 PHE A CE2   
1826 C CZ    . PHE D 39  ? 0.5578 0.3911 0.6583 0.1018  -0.1037 0.0307  357 PHE A CZ    
1827 N N     . LYS D 40  ? 0.5000 0.4912 0.8061 0.1214  -0.0757 0.0014  358 LYS A N     
1828 C CA    . LYS D 40  ? 0.4892 0.5236 0.8478 0.1250  -0.0634 -0.0016 358 LYS A CA    
1829 C C     . LYS D 40  ? 0.4795 0.5307 0.8302 0.1182  -0.0336 -0.0012 358 LYS A C     
1830 O O     . LYS D 40  ? 0.4796 0.5195 0.7990 0.1222  -0.0178 -0.0049 358 LYS A O     
1831 C CB    . LYS D 40  ? 0.4926 0.5450 0.8875 0.1464  -0.0631 -0.0107 358 LYS A CB    
1832 C CG    . LYS D 40  ? 0.4785 0.5812 0.9230 0.1533  -0.0404 -0.0148 358 LYS A CG    
1833 C CD    . LYS D 40  ? 0.4921 0.6125 0.9709 0.1784  -0.0397 -0.0266 358 LYS A CD    
1834 C CE    . LYS D 40  ? 0.4991 0.6310 1.0250 0.1850  -0.0668 -0.0253 358 LYS A CE    
1835 N NZ    . LYS D 40  ? 0.4858 0.6644 1.0656 0.1757  -0.0621 -0.0188 358 LYS A NZ    
1836 N N     . ASP D 41  ? 0.4759 0.5528 0.8556 0.1069  -0.0283 0.0045  359 ASP A N     
1837 C CA    . ASP D 41  ? 0.4688 0.5641 0.8472 0.0988  -0.0016 0.0082  359 ASP A CA    
1838 C C     . ASP D 41  ? 0.4809 0.5431 0.8019 0.0910  0.0052  0.0099  359 ASP A C     
1839 O O     . ASP D 41  ? 0.4823 0.5435 0.7807 0.0964  0.0245  0.0069  359 ASP A O     
1840 C CB    . ASP D 41  ? 0.4602 0.5900 0.8630 0.1137  0.0233  0.0024  359 ASP A CB    
1841 C CG    . ASP D 41  ? 0.4632 0.6343 0.9299 0.1221  0.0203  0.0011  359 ASP A CG    
1842 O OD1   . ASP D 41  ? 0.4588 0.6427 0.9592 0.1097  0.0061  0.0089  359 ASP A OD1   
1843 O OD2   . ASP D 41  ? 0.4721 0.6631 0.9567 0.1420  0.0312  -0.0085 359 ASP A OD2   
1844 N N     . CYS D 42  ? 0.4946 0.5302 0.7922 0.0791  -0.0119 0.0141  360 CYS A N     
1845 C CA    . CYS D 42  ? 0.5030 0.5103 0.7508 0.0723  -0.0064 0.0158  360 CYS A CA    
1846 C C     . CYS D 42  ? 0.5425 0.5357 0.7833 0.0581  -0.0197 0.0203  360 CYS A C     
1847 O O     . CYS D 42  ? 0.5603 0.5376 0.7958 0.0562  -0.0428 0.0195  360 CYS A O     
1848 C CB    . CYS D 42  ? 0.4885 0.4675 0.6986 0.0793  -0.0146 0.0125  360 CYS A CB    
1849 S SG    . CYS D 42  ? 0.4688 0.4211 0.6246 0.0728  -0.0056 0.0147  360 CYS A SG    
1850 N N     . GLU D 43  ? 0.5654 0.5616 0.8038 0.0486  -0.0069 0.0247  361 GLU A N     
1851 C CA    . GLU D 43  ? 0.5930 0.5725 0.8252 0.0356  -0.0198 0.0274  361 GLU A CA    
1852 C C     . GLU D 43  ? 0.5992 0.5461 0.7792 0.0350  -0.0186 0.0252  361 GLU A C     
1853 O O     . GLU D 43  ? 0.6197 0.5514 0.7903 0.0262  -0.0230 0.0263  361 GLU A O     
1854 C CB    . GLU D 43  ? 0.5970 0.5985 0.8648 0.0243  -0.0095 0.0354  361 GLU A CB    
1855 N N     . ARG D 44  ? 0.5815 0.5179 0.7300 0.0442  -0.0133 0.0219  362 ARG A N     
1856 C CA    . ARG D 44  ? 0.5652 0.4774 0.6691 0.0448  -0.0100 0.0204  362 ARG A CA    
1857 C C     . ARG D 44  ? 0.5755 0.4635 0.6546 0.0429  -0.0301 0.0169  362 ARG A C     
1858 O O     . ARG D 44  ? 0.5799 0.4651 0.6617 0.0448  -0.0463 0.0160  362 ARG A O     
1859 C CB    . ARG D 44  ? 0.5413 0.4530 0.6248 0.0534  0.0008  0.0196  362 ARG A CB    
1860 C CG    . ARG D 44  ? 0.5132 0.4360 0.5962 0.0554  0.0217  0.0211  362 ARG A CG    
1861 C CD    . ARG D 44  ? 0.5087 0.4182 0.5682 0.0516  0.0276  0.0226  362 ARG A CD    
1862 N NE    . ARG D 44  ? 0.4988 0.4175 0.5563 0.0534  0.0450  0.0254  362 ARG A NE    
1863 C CZ    . ARG D 44  ? 0.4990 0.4079 0.5386 0.0520  0.0512  0.0276  362 ARG A CZ    
1864 N NH1   . ARG D 44  ? 0.5091 0.3990 0.5324 0.0502  0.0426  0.0258  362 ARG A NH1   
1865 N NH2   . ARG D 44  ? 0.4925 0.4095 0.5289 0.0539  0.0650  0.0310  362 ARG A NH2   
1866 N N     . ARG D 45  ? 0.5858 0.4551 0.6383 0.0404  -0.0297 0.0144  363 ARG A N     
1867 C CA    . ARG D 45  ? 0.6126 0.4570 0.6321 0.0412  -0.0459 0.0088  363 ARG A CA    
1868 C C     . ARG D 45  ? 0.6022 0.4342 0.5818 0.0473  -0.0334 0.0064  363 ARG A C     
1869 O O     . ARG D 45  ? 0.5935 0.4311 0.5754 0.0482  -0.0172 0.0083  363 ARG A O     
1870 C CB    . ARG D 45  ? 0.6520 0.4834 0.6820 0.0332  -0.0626 0.0049  363 ARG A CB    
1871 C CG    . ARG D 45  ? 0.6633 0.5155 0.7459 0.0242  -0.0680 0.0101  363 ARG A CG    
1872 C CD    . ARG D 45  ? 0.7105 0.5463 0.8030 0.0146  -0.0907 0.0064  363 ARG A CD    
1873 N NE    . ARG D 45  ? 0.7560 0.5768 0.8318 0.0167  -0.1159 0.0001  363 ARG A NE    
1874 C CZ    . ARG D 45  ? 0.8107 0.6031 0.8656 0.0135  -0.1383 -0.0084 363 ARG A CZ    
1875 N NH1   . ARG D 45  ? 0.8323 0.6064 0.8828 0.0084  -0.1389 -0.0120 363 ARG A NH1   
1876 N NH2   . ARG D 45  ? 0.8427 0.6218 0.8783 0.0162  -0.1617 -0.0136 363 ARG A NH2   
1877 N N     . PHE D 46  ? 0.6064 0.4232 0.5496 0.0518  -0.0411 0.0029  364 PHE A N     
1878 C CA    . PHE D 46  ? 0.5978 0.4089 0.5060 0.0588  -0.0279 0.0013  364 PHE A CA    
1879 C C     . PHE D 46  ? 0.6397 0.4285 0.5093 0.0632  -0.0392 -0.0074 364 PHE A C     
1880 O O     . PHE D 46  ? 0.6673 0.4441 0.5303 0.0609  -0.0590 -0.0106 364 PHE A O     
1881 C CB    . PHE D 46  ? 0.5666 0.3901 0.4676 0.0612  -0.0179 0.0090  364 PHE A CB    
1882 C CG    . PHE D 46  ? 0.5230 0.3648 0.4560 0.0593  -0.0076 0.0144  364 PHE A CG    
1883 C CD1   . PHE D 46  ? 0.5108 0.3608 0.4702 0.0572  -0.0157 0.0172  364 PHE A CD1   
1884 C CD2   . PHE D 46  ? 0.5034 0.3538 0.4392 0.0612  0.0091  0.0155  364 PHE A CD2   
1885 C CE1   . PHE D 46  ? 0.4871 0.3530 0.4721 0.0581  -0.0056 0.0195  364 PHE A CE1   
1886 C CE2   . PHE D 46  ? 0.4812 0.3463 0.4405 0.0606  0.0176  0.0188  364 PHE A CE2   
1887 C CZ    . PHE D 46  ? 0.4747 0.3474 0.4573 0.0595  0.0111  0.0200  364 PHE A CZ    
1888 N N     . SER D 47  ? 0.6479 0.4317 0.4913 0.0709  -0.0269 -0.0120 365 SER A N     
1889 C CA    . SER D 47  ? 0.6904 0.4531 0.4933 0.0786  -0.0347 -0.0231 365 SER A CA    
1890 C C     . SER D 47  ? 0.7082 0.4734 0.4746 0.0832  -0.0327 -0.0198 365 SER A C     
1891 O O     . SER D 47  ? 0.7476 0.4945 0.4787 0.0875  -0.0456 -0.0277 365 SER A O     
1892 C CB    . SER D 47  ? 0.7026 0.4599 0.4947 0.0877  -0.0221 -0.0306 365 SER A CB    
1893 O OG    . SER D 47  ? 0.6962 0.4490 0.5199 0.0823  -0.0241 -0.0307 365 SER A OG    
1894 N N     . ARG D 48  ? 0.6852 0.4710 0.4573 0.0817  -0.0178 -0.0077 366 ARG A N     
1895 C CA    . ARG D 48  ? 0.6967 0.4869 0.4366 0.0836  -0.0138 -0.0002 366 ARG A CA    
1896 C C     . ARG D 48  ? 0.6901 0.4881 0.4497 0.0746  -0.0200 0.0136  366 ARG A C     
1897 O O     . ARG D 48  ? 0.6665 0.4733 0.4654 0.0696  -0.0200 0.0167  366 ARG A O     
1898 C CB    . ARG D 48  ? 0.6776 0.4851 0.4047 0.0900  0.0101  0.0030  366 ARG A CB    
1899 C CG    . ARG D 48  ? 0.6820 0.4854 0.4051 0.1004  0.0183  -0.0104 366 ARG A CG    
1900 C CD    . ARG D 48  ? 0.6845 0.5086 0.3950 0.1089  0.0409  -0.0076 366 ARG A CD    
1901 N NE    . ARG D 48  ? 0.6488 0.4974 0.3828 0.1005  0.0524  0.0087  366 ARG A NE    
1902 C CZ    . ARG D 48  ? 0.6413 0.5135 0.3821 0.1041  0.0710  0.0139  366 ARG A CZ    
1903 N NH1   . ARG D 48  ? 0.6639 0.5407 0.3907 0.1180  0.0820  0.0037  366 ARG A NH1   
1904 N NH2   . ARG D 48  ? 0.6154 0.5062 0.3788 0.0945  0.0771  0.0284  366 ARG A NH2   
1905 N N     . SER D 49  ? 0.7193 0.5129 0.4493 0.0737  -0.0256 0.0218  367 SER A N     
1906 C CA    . SER D 49  ? 0.7166 0.5117 0.4623 0.0663  -0.0355 0.0350  367 SER A CA    
1907 C C     . SER D 49  ? 0.6827 0.4956 0.4527 0.0623  -0.0196 0.0457  367 SER A C     
1908 O O     . SER D 49  ? 0.6652 0.4809 0.4687 0.0584  -0.0254 0.0493  367 SER A O     
1909 C CB    . SER D 49  ? 0.7701 0.5532 0.4734 0.0658  -0.0460 0.0437  367 SER A CB    
1910 O OG    . SER D 49  ? 0.7927 0.5861 0.4646 0.0675  -0.0265 0.0516  367 SER A OG    
1911 N N     . ASP D 50  ? 0.6779 0.5036 0.4326 0.0638  -0.0001 0.0499  368 ASP A N     
1912 C CA    . ASP D 50  ? 0.6497 0.4916 0.4272 0.0586  0.0123  0.0603  368 ASP A CA    
1913 C C     . ASP D 50  ? 0.5935 0.4419 0.4098 0.0592  0.0154  0.0527  368 ASP A C     
1914 O O     . ASP D 50  ? 0.5746 0.4292 0.4142 0.0547  0.0169  0.0588  368 ASP A O     
1915 C CB    . ASP D 50  ? 0.6730 0.5322 0.4318 0.0604  0.0326  0.0658  368 ASP A CB    
1916 C CG    . ASP D 50  ? 0.6822 0.5466 0.4352 0.0711  0.0437  0.0509  368 ASP A CG    
1917 O OD1   . ASP D 50  ? 0.6955 0.5435 0.4393 0.0767  0.0335  0.0377  368 ASP A OD1   
1918 O OD2   . ASP D 50  ? 0.6791 0.5631 0.4387 0.0738  0.0609  0.0526  368 ASP A OD2   
1919 N N     . GLN D 51  ? 0.5704 0.4157 0.3919 0.0646  0.0156  0.0397  369 GLN A N     
1920 C CA    . GLN D 51  ? 0.5305 0.3815 0.3854 0.0645  0.0184  0.0345  369 GLN A CA    
1921 C C     . GLN D 51  ? 0.5111 0.3584 0.3913 0.0610  0.0051  0.0353  369 GLN A C     
1922 O O     . GLN D 51  ? 0.4909 0.3464 0.3959 0.0601  0.0091  0.0363  369 GLN A O     
1923 C CB    . GLN D 51  ? 0.5343 0.3801 0.3881 0.0694  0.0202  0.0231  369 GLN A CB    
1924 C CG    . GLN D 51  ? 0.5457 0.3954 0.3784 0.0764  0.0334  0.0197  369 GLN A CG    
1925 C CD    . GLN D 51  ? 0.5599 0.3976 0.3906 0.0821  0.0313  0.0080  369 GLN A CD    
1926 O OE1   . GLN D 51  ? 0.5629 0.3899 0.4086 0.0783  0.0200  0.0040  369 GLN A OE1   
1927 N NE2   . GLN D 51  ? 0.5711 0.4106 0.3856 0.0912  0.0417  0.0028  369 GLN A NE2   
1928 N N     . LEU D 52  ? 0.5209 0.3564 0.3948 0.0603  -0.0113 0.0340  370 LEU A N     
1929 C CA    . LEU D 52  ? 0.5115 0.3465 0.4133 0.0589  -0.0248 0.0348  370 LEU A CA    
1930 C C     . LEU D 52  ? 0.5214 0.3562 0.4277 0.0573  -0.0272 0.0443  370 LEU A C     
1931 O O     . LEU D 52  ? 0.5145 0.3544 0.4501 0.0589  -0.0294 0.0431  370 LEU A O     
1932 C CB    . LEU D 52  ? 0.5226 0.3450 0.4167 0.0585  -0.0450 0.0321  370 LEU A CB    
1933 C CG    . LEU D 52  ? 0.5109 0.3350 0.4366 0.0584  -0.0616 0.0332  370 LEU A CG    
1934 C CD1   . LEU D 52  ? 0.4785 0.3192 0.4467 0.0588  -0.0555 0.0271  370 LEU A CD1   
1935 C CD2   . LEU D 52  ? 0.5413 0.3512 0.4535 0.0576  -0.0850 0.0324  370 LEU A CD2   
1936 N N     . LYS D 53  ? 0.5413 0.3698 0.4187 0.0544  -0.0266 0.0541  371 LYS A N     
1937 C CA    . LYS D 53  ? 0.5504 0.3749 0.4316 0.0506  -0.0304 0.0654  371 LYS A CA    
1938 C C     . LYS D 53  ? 0.5162 0.3515 0.4190 0.0502  -0.0179 0.0639  371 LYS A C     
1939 O O     . LYS D 53  ? 0.5082 0.3394 0.4318 0.0509  -0.0246 0.0644  371 LYS A O     
1940 C CB    . LYS D 53  ? 0.5910 0.4101 0.4363 0.0454  -0.0290 0.0790  371 LYS A CB    
1941 C CG    . LYS D 53  ? 0.6347 0.4404 0.4502 0.0465  -0.0428 0.0808  371 LYS A CG    
1942 C CD    . LYS D 53  ? 0.6564 0.4477 0.4869 0.0469  -0.0663 0.0837  371 LYS A CD    
1943 C CE    . LYS D 53  ? 0.6902 0.4699 0.5003 0.0498  -0.0835 0.0795  371 LYS A CE    
1944 N NZ    . LYS D 53  ? 0.6978 0.4709 0.5386 0.0527  -0.1059 0.0769  371 LYS A NZ    
1945 N N     . ARG D 54  ? 0.4933 0.3410 0.3902 0.0504  -0.0012 0.0610  372 ARG A N     
1946 C CA    . ARG D 54  ? 0.4678 0.3253 0.3823 0.0502  0.0088  0.0591  372 ARG A CA    
1947 C C     . ARG D 54  ? 0.4616 0.3215 0.4020 0.0557  0.0074  0.0484  372 ARG A C     
1948 O O     . ARG D 54  ? 0.4623 0.3225 0.4177 0.0567  0.0070  0.0466  372 ARG A O     
1949 C CB    . ARG D 54  ? 0.4610 0.3319 0.3653 0.0510  0.0249  0.0579  372 ARG A CB    
1950 C CG    . ARG D 54  ? 0.4228 0.3041 0.3422 0.0502  0.0330  0.0575  372 ARG A CG    
1951 C CD    . ARG D 54  ? 0.3982 0.2933 0.3112 0.0533  0.0469  0.0552  372 ARG A CD    
1952 N NE    . ARG D 54  ? 0.3869 0.2796 0.2990 0.0600  0.0495  0.0450  372 ARG A NE    
1953 C CZ    . ARG D 54  ? 0.3801 0.2794 0.2873 0.0651  0.0588  0.0410  372 ARG A CZ    
1954 N NH1   . ARG D 54  ? 0.3764 0.2688 0.2837 0.0694  0.0583  0.0332  372 ARG A NH1   
1955 N NH2   . ARG D 54  ? 0.3788 0.2918 0.2835 0.0656  0.0677  0.0456  372 ARG A NH2   
1956 N N     . HIS D 55  ? 0.4695 0.3315 0.4150 0.0591  0.0066  0.0411  373 HIS A N     
1957 C CA    . HIS D 55  ? 0.4631 0.3326 0.4348 0.0635  0.0080  0.0331  373 HIS A CA    
1958 C C     . HIS D 55  ? 0.4520 0.3176 0.4427 0.0669  -0.0037 0.0323  373 HIS A C     
1959 O O     . HIS D 55  ? 0.4464 0.3187 0.4554 0.0722  0.0004  0.0264  373 HIS A O     
1960 C CB    . HIS D 55  ? 0.4927 0.3650 0.4693 0.0636  0.0072  0.0285  373 HIS A CB    
1961 C CG    . HIS D 55  ? 0.5387 0.4203 0.5464 0.0662  0.0036  0.0240  373 HIS A CG    
1962 N ND1   . HIS D 55  ? 0.5366 0.4320 0.5625 0.0694  0.0155  0.0203  373 HIS A ND1   
1963 C CD2   . HIS D 55  ? 0.5571 0.4389 0.5820 0.0667  -0.0101 0.0231  373 HIS A CD2   
1964 C CE1   . HIS D 55  ? 0.5367 0.4434 0.5911 0.0719  0.0118  0.0175  373 HIS A CE1   
1965 N NE2   . HIS D 55  ? 0.5366 0.4359 0.5938 0.0701  -0.0046 0.0191  373 HIS A NE2   
1966 N N     . GLN D 56  ? 0.4534 0.3072 0.4383 0.0655  -0.0190 0.0376  374 GLN A N     
1967 C CA    . GLN D 56  ? 0.4525 0.3006 0.4575 0.0706  -0.0332 0.0368  374 GLN A CA    
1968 C C     . GLN D 56  ? 0.4549 0.2943 0.4628 0.0723  -0.0345 0.0379  374 GLN A C     
1969 O O     . GLN D 56  ? 0.4675 0.3015 0.4949 0.0797  -0.0450 0.0339  374 GLN A O     
1970 C CB    . GLN D 56  ? 0.4742 0.3085 0.4679 0.0683  -0.0519 0.0442  374 GLN A CB    
1971 C CG    . GLN D 56  ? 0.4812 0.3218 0.4816 0.0685  -0.0578 0.0397  374 GLN A CG    
1972 C CD    . GLN D 56  ? 0.5210 0.3456 0.5002 0.0658  -0.0772 0.0468  374 GLN A CD    
1973 O OE1   . GLN D 56  ? 0.5535 0.3639 0.5033 0.0618  -0.0805 0.0571  374 GLN A OE1   
1974 N NE2   . GLN D 56  ? 0.5235 0.3510 0.5173 0.0671  -0.0907 0.0425  374 GLN A NE2   
1975 N N     . ARG D 57  ? 0.4481 0.2858 0.4394 0.0663  -0.0255 0.0425  375 ARG A N     
1976 C CA    . ARG D 57  ? 0.4557 0.2846 0.4525 0.0670  -0.0282 0.0418  375 ARG A CA    
1977 C C     . ARG D 57  ? 0.4417 0.2798 0.4568 0.0773  -0.0212 0.0272  375 ARG A C     
1978 O O     . ARG D 57  ? 0.4506 0.2779 0.4720 0.0817  -0.0273 0.0221  375 ARG A O     
1979 C CB    . ARG D 57  ? 0.4610 0.2910 0.4409 0.0571  -0.0203 0.0503  375 ARG A CB    
1980 C CG    . ARG D 57  ? 0.4812 0.3072 0.4399 0.0474  -0.0225 0.0656  375 ARG A CG    
1981 C CD    . ARG D 57  ? 0.4954 0.3234 0.4471 0.0372  -0.0177 0.0765  375 ARG A CD    
1982 N NE    . ARG D 57  ? 0.5233 0.3534 0.4534 0.0285  -0.0151 0.0920  375 ARG A NE    
1983 C CZ    . ARG D 57  ? 0.5249 0.3733 0.4424 0.0260  0.0007  0.0952  375 ARG A CZ    
1984 N NH1   . ARG D 57  ? 0.5022 0.3657 0.4280 0.0307  0.0127  0.0850  375 ARG A NH1   
1985 N NH2   . ARG D 57  ? 0.5488 0.4006 0.4443 0.0198  0.0045  0.1088  375 ARG A NH2   
1986 N N     . ARG D 58  ? 0.4255 0.2822 0.4477 0.0811  -0.0089 0.0206  376 ARG A N     
1987 C CA    . ARG D 58  ? 0.4272 0.2961 0.4650 0.0912  0.0001  0.0085  376 ARG A CA    
1988 C C     . ARG D 58  ? 0.4490 0.3179 0.5110 0.1024  -0.0094 0.0013  376 ARG A C     
1989 O O     . ARG D 58  ? 0.4570 0.3282 0.5284 0.1135  -0.0064 -0.0097 376 ARG A O     
1990 C CB    . ARG D 58  ? 0.4094 0.2981 0.4492 0.0899  0.0156  0.0072  376 ARG A CB    
1991 C CG    . ARG D 58  ? 0.4048 0.2940 0.4233 0.0820  0.0248  0.0126  376 ARG A CG    
1992 C CD    . ARG D 58  ? 0.3995 0.3020 0.4210 0.0800  0.0353  0.0132  376 ARG A CD    
1993 N NE    . ARG D 58  ? 0.4011 0.3189 0.4372 0.0861  0.0460  0.0073  376 ARG A NE    
1994 C CZ    . ARG D 58  ? 0.3914 0.3219 0.4359 0.0836  0.0552  0.0093  376 ARG A CZ    
1995 N NH1   . ARG D 58  ? 0.3851 0.3110 0.4248 0.0761  0.0526  0.0147  376 ARG A NH1   
1996 N NH2   . ARG D 58  ? 0.3888 0.3359 0.4455 0.0887  0.0670  0.0062  376 ARG A NH2   
1997 N N     . HIS D 59  ? 0.4607 0.3272 0.5325 0.1012  -0.0216 0.0066  377 HIS A N     
1998 C CA    . HIS D 59  ? 0.4807 0.3491 0.5801 0.1131  -0.0326 0.0003  377 HIS A CA    
1999 C C     . HIS D 59  ? 0.4916 0.3328 0.5880 0.1174  -0.0505 0.0008  377 HIS A C     
2000 O O     . HIS D 59  ? 0.5103 0.3497 0.6262 0.1319  -0.0556 -0.0101 377 HIS A O     
2001 C CB    . HIS D 59  ? 0.5124 0.3880 0.6252 0.1101  -0.0425 0.0059  377 HIS A CB    
2002 C CG    . HIS D 59  ? 0.5508 0.4474 0.6670 0.1035  -0.0291 0.0067  377 HIS A CG    
2003 N ND1   . HIS D 59  ? 0.5522 0.4762 0.6982 0.1090  -0.0177 0.0004  377 HIS A ND1   
2004 C CD2   . HIS D 59  ? 0.5567 0.4499 0.6508 0.0919  -0.0259 0.0134  377 HIS A CD2   
2005 C CE1   . HIS D 59  ? 0.5410 0.4747 0.6839 0.0992  -0.0098 0.0045  377 HIS A CE1   
2006 N NE2   . HIS D 59  ? 0.5364 0.4503 0.6473 0.0899  -0.0153 0.0110  377 HIS A NE2   
2007 N N     . THR D 60  ? 0.4889 0.3086 0.5615 0.1054  -0.0600 0.0137  378 THR A N     
2008 C CA    . THR D 60  ? 0.5155 0.3060 0.5854 0.1062  -0.0792 0.0181  378 THR A CA    
2009 C C     . THR D 60  ? 0.5250 0.3039 0.5884 0.1071  -0.0761 0.0115  378 THR A C     
2010 O O     . THR D 60  ? 0.5556 0.3142 0.6285 0.1163  -0.0898 0.0043  378 THR A O     
2011 C CB    . THR D 60  ? 0.5272 0.3013 0.5739 0.0913  -0.0898 0.0376  378 THR A CB    
2012 O OG1   . THR D 60  ? 0.5125 0.2944 0.5367 0.0786  -0.0747 0.0445  378 THR A OG1   
2013 C CG2   . THR D 60  ? 0.5246 0.3061 0.5735 0.0914  -0.0968 0.0425  378 THR A CG2   
2014 N N     . GLY D 61  ? 0.5027 0.2924 0.5502 0.0984  -0.0604 0.0128  379 GLY A N     
2015 C CA    . GLY D 61  ? 0.5095 0.2890 0.5499 0.0976  -0.0596 0.0070  379 GLY A CA    
2016 C C     . GLY D 61  ? 0.5255 0.2832 0.5537 0.0824  -0.0716 0.0217  379 GLY A C     
2017 O O     . GLY D 61  ? 0.5395 0.2823 0.5665 0.0813  -0.0782 0.0169  379 GLY A O     
2018 N N     . VAL D 62  ? 0.5263 0.2823 0.5451 0.0700  -0.0750 0.0400  380 VAL A N     
2019 C CA    . VAL D 62  ? 0.5450 0.2846 0.5539 0.0537  -0.0841 0.0577  380 VAL A CA    
2020 C C     . VAL D 62  ? 0.5274 0.2829 0.5296 0.0442  -0.0701 0.0596  380 VAL A C     
2021 O O     . VAL D 62  ? 0.4960 0.2759 0.4943 0.0478  -0.0523 0.0528  380 VAL A O     
2022 C CB    . VAL D 62  ? 0.5555 0.2930 0.5509 0.0440  -0.0879 0.0774  380 VAL A CB    
2023 C CG1   . VAL D 62  ? 0.5764 0.2979 0.5798 0.0540  -0.1049 0.0757  380 VAL A CG1   
2024 C CG2   . VAL D 62  ? 0.5278 0.2934 0.5093 0.0414  -0.0680 0.0793  380 VAL A CG2   
2025 N N     . LYS D 63  ? 0.5469 0.2880 0.5503 0.0316  -0.0801 0.0698  381 LYS A N     
2026 C CA    . LYS D 63  ? 0.5284 0.2849 0.5310 0.0211  -0.0708 0.0738  381 LYS A CA    
2027 C C     . LYS D 63  ? 0.5410 0.2951 0.5418 0.0011  -0.0751 0.0989  381 LYS A C     
2028 O O     . LYS D 63  ? 0.5585 0.2935 0.5692 -0.0099 -0.0908 0.1065  381 LYS A O     
2029 C CB    . LYS D 63  ? 0.5399 0.2833 0.5510 0.0260  -0.0802 0.0581  381 LYS A CB    
2030 C CG    . LYS D 63  ? 0.5318 0.2745 0.5430 0.0469  -0.0770 0.0339  381 LYS A CG    
2031 C CD    . LYS D 63  ? 0.4928 0.2665 0.4970 0.0530  -0.0547 0.0266  381 LYS A CD    
2032 C CE    . LYS D 63  ? 0.4878 0.2630 0.4919 0.0718  -0.0500 0.0050  381 LYS A CE    
2033 N NZ    . LYS D 63  ? 0.5082 0.2638 0.5103 0.0771  -0.0625 -0.0090 381 LYS A NZ    
2034 N N     . PRO D 64  ? 0.5416 0.3149 0.5295 -0.0044 -0.0617 0.1127  382 PRO A N     
2035 C CA    . PRO D 64  ? 0.5695 0.3431 0.5526 -0.0229 -0.0633 0.1389  382 PRO A CA    
2036 C C     . PRO D 64  ? 0.5763 0.3648 0.5734 -0.0378 -0.0595 0.1489  382 PRO A C     
2037 O O     . PRO D 64  ? 0.6034 0.3867 0.6051 -0.0557 -0.0661 0.1714  382 PRO A O     
2038 C CB    . PRO D 64  ? 0.5585 0.3537 0.5197 -0.0205 -0.0459 0.1452  382 PRO A CB    
2039 C CG    . PRO D 64  ? 0.5379 0.3316 0.4957 -0.0022 -0.0445 0.1244  382 PRO A CG    
2040 C CD    . PRO D 64  ? 0.5189 0.3117 0.4942 0.0064  -0.0458 0.1051  382 PRO A CD    
2041 N N     . PHE D 65  ? 0.5548 0.3622 0.5602 -0.0320 -0.0501 0.1346  383 PHE A N     
2042 C CA    . PHE D 65  ? 0.5557 0.3848 0.5770 -0.0448 -0.0451 0.1437  383 PHE A CA    
2043 C C     . PHE D 65  ? 0.5713 0.3822 0.6093 -0.0452 -0.0631 0.1309  383 PHE A C     
2044 O O     . PHE D 65  ? 0.5642 0.3655 0.5969 -0.0290 -0.0655 0.1082  383 PHE A O     
2045 C CB    . PHE D 65  ? 0.5199 0.3861 0.5366 -0.0371 -0.0215 0.1384  383 PHE A CB    
2046 C CG    . PHE D 65  ? 0.5127 0.3902 0.5070 -0.0305 -0.0059 0.1422  383 PHE A CG    
2047 C CD1   . PHE D 65  ? 0.4980 0.3689 0.4781 -0.0140 -0.0025 0.1249  383 PHE A CD1   
2048 C CD2   . PHE D 65  ? 0.5250 0.4196 0.5117 -0.0412 0.0047  0.1632  383 PHE A CD2   
2049 C CE1   . PHE D 65  ? 0.4997 0.3773 0.4588 -0.0086 0.0081  0.1270  383 PHE A CE1   
2050 C CE2   . PHE D 65  ? 0.5289 0.4306 0.4895 -0.0339 0.0171  0.1644  383 PHE A CE2   
2051 C CZ    . PHE D 65  ? 0.5169 0.4082 0.4638 -0.0177 0.0172  0.1456  383 PHE A CZ    
2052 N N     . GLN D 66  ? 0.5959 0.4023 0.6530 -0.0640 -0.0758 0.1459  384 GLN A N     
2053 C CA    . GLN D 66  ? 0.6195 0.4022 0.6913 -0.0667 -0.0983 0.1347  384 GLN A CA    
2054 C C     . GLN D 66  ? 0.6263 0.4358 0.7212 -0.0813 -0.0974 0.1437  384 GLN A C     
2055 O O     . GLN D 66  ? 0.6278 0.4643 0.7359 -0.0977 -0.0871 0.1676  384 GLN A O     
2056 C CB    . GLN D 66  ? 0.6574 0.3973 0.7349 -0.0769 -0.1243 0.1432  384 GLN A CB    
2057 C CG    . GLN D 66  ? 0.6751 0.3824 0.7641 -0.0777 -0.1513 0.1281  384 GLN A CG    
2058 C CD    . GLN D 66  ? 0.7156 0.3755 0.8103 -0.0865 -0.1790 0.1360  384 GLN A CD    
2059 O OE1   . GLN D 66  ? 0.7272 0.3812 0.8195 -0.0960 -0.1783 0.1578  384 GLN A OE1   
2060 N NE2   . GLN D 66  ? 0.7436 0.3669 0.8433 -0.0825 -0.2049 0.1177  384 GLN A NE2   
2061 N N     . CYS D 67  ? 0.6328 0.4363 0.7323 -0.0747 -0.1082 0.1245  385 CYS A N     
2062 C CA    . CYS D 67  ? 0.6313 0.4586 0.7553 -0.0872 -0.1120 0.1306  385 CYS A CA    
2063 C C     . CYS D 67  ? 0.6709 0.4794 0.8214 -0.1118 -0.1368 0.1474  385 CYS A C     
2064 O O     . CYS D 67  ? 0.7088 0.4723 0.8548 -0.1130 -0.1600 0.1414  385 CYS A O     
2065 C CB    . CYS D 67  ? 0.6214 0.4442 0.7367 -0.0718 -0.1187 0.1046  385 CYS A CB    
2066 S SG    . CYS D 67  ? 0.6173 0.4676 0.7630 -0.0850 -0.1286 0.1095  385 CYS A SG    
2067 N N     . LYS D 68  ? 0.6697 0.5134 0.8503 -0.1313 -0.1321 0.1689  386 LYS A N     
2068 C CA    . LYS D 68  ? 0.7142 0.5466 0.9269 -0.1590 -0.1546 0.1894  386 LYS A CA    
2069 C C     . LYS D 68  ? 0.7420 0.5543 0.9712 -0.1633 -0.1847 0.1740  386 LYS A C     
2070 O O     . LYS D 68  ? 0.7816 0.5787 1.0396 -0.1872 -0.2088 0.1887  386 LYS A O     
2071 C CB    . LYS D 68  ? 0.7103 0.5953 0.9529 -0.1791 -0.1351 0.2209  386 LYS A CB    
2072 C CG    . LYS D 68  ? 0.7400 0.6216 0.9834 -0.1972 -0.1293 0.2513  386 LYS A CG    
2073 C CD    . LYS D 68  ? 0.7262 0.6014 0.9286 -0.1786 -0.1091 0.2467  386 LYS A CD    
2074 C CE    . LYS D 68  ? 0.7541 0.6363 0.9542 -0.1964 -0.0989 0.2801  386 LYS A CE    
2075 N NZ    . LYS D 68  ? 0.7458 0.6885 0.9688 -0.2099 -0.0734 0.3042  386 LYS A NZ    
2076 N N     . THR D 69  ? 0.7331 0.5436 0.9438 -0.1418 -0.1853 0.1458  387 THR A N     
2077 C CA    . THR D 69  ? 0.7699 0.5634 0.9902 -0.1438 -0.2136 0.1296  387 THR A CA    
2078 C C     . THR D 69  ? 0.8029 0.5421 0.9894 -0.1247 -0.2337 0.0986  387 THR A C     
2079 O O     . THR D 69  ? 0.8485 0.5464 1.0420 -0.1339 -0.2666 0.0923  387 THR A O     
2080 C CB    . THR D 69  ? 0.7485 0.5853 0.9745 -0.1351 -0.2008 0.1232  387 THR A CB    
2081 O OG1   . THR D 69  ? 0.7337 0.6228 0.9969 -0.1523 -0.1841 0.1510  387 THR A OG1   
2082 C CG2   . THR D 69  ? 0.7784 0.5955 1.0089 -0.1358 -0.2325 0.1052  387 THR A CG2   
2083 N N     . CYS D 70  ? 0.7802 0.5185 0.9310 -0.0980 -0.2150 0.0788  388 CYS A N     
2084 C CA    . CYS D 70  ? 0.8028 0.4973 0.9213 -0.0767 -0.2287 0.0488  388 CYS A CA    
2085 C C     . CYS D 70  ? 0.8088 0.4773 0.9128 -0.0676 -0.2236 0.0477  388 CYS A C     
2086 O O     . CYS D 70  ? 0.8271 0.4641 0.9061 -0.0468 -0.2306 0.0227  388 CYS A O     
2087 C CB    . CYS D 70  ? 0.7744 0.4859 0.8641 -0.0529 -0.2127 0.0271  388 CYS A CB    
2088 S SG    . CYS D 70  ? 0.7131 0.4659 0.7896 -0.0392 -0.1702 0.0345  388 CYS A SG    
2089 N N     . GLN D 71  ? 0.7920 0.4745 0.9105 -0.0815 -0.2115 0.0741  389 GLN A N     
2090 C CA    . GLN D 71  ? 0.7979 0.4564 0.9061 -0.0759 -0.2099 0.0779  389 GLN A CA    
2091 C C     . GLN D 71  ? 0.7628 0.4278 0.8428 -0.0482 -0.1886 0.0588  389 GLN A C     
2092 O O     . GLN D 71  ? 0.7783 0.4195 0.8489 -0.0379 -0.1914 0.0543  389 GLN A O     
2093 C CB    . GLN D 71  ? 0.8620 0.4634 0.9737 -0.0793 -0.2448 0.0706  389 GLN A CB    
2094 C CG    . GLN D 71  ? 0.9033 0.4922 1.0444 -0.1071 -0.2715 0.0857  389 GLN A CG    
2095 C CD    . GLN D 71  ? 0.8909 0.5162 1.0596 -0.1350 -0.2585 0.1241  389 GLN A CD    
2096 O OE1   . GLN D 71  ? 0.8848 0.5163 1.0495 -0.1384 -0.2440 0.1432  389 GLN A OE1   
2097 N NE2   . GLN D 71  ? 0.8870 0.5383 1.0837 -0.1543 -0.2634 0.1357  389 GLN A NE2   
2098 N N     . ARG D 72  ? 0.7254 0.4227 0.7943 -0.0366 -0.1685 0.0486  390 ARG A N     
2099 C CA    . ARG D 72  ? 0.6998 0.4074 0.7461 -0.0136 -0.1473 0.0339  390 ARG A CA    
2100 C C     . ARG D 72  ? 0.6721 0.4048 0.7199 -0.0174 -0.1252 0.0529  390 ARG A C     
2101 O O     . ARG D 72  ? 0.6577 0.4168 0.7184 -0.0333 -0.1160 0.0741  390 ARG A O     
2102 C CB    . ARG D 72  ? 0.6753 0.4054 0.7081 -0.0016 -0.1354 0.0189  390 ARG A CB    
2103 C CG    . ARG D 72  ? 0.6529 0.3918 0.6638 0.0207  -0.1150 0.0038  390 ARG A CG    
2104 C CD    . ARG D 72  ? 0.6434 0.3974 0.6375 0.0319  -0.1069 -0.0101 390 ARG A CD    
2105 N NE    . ARG D 72  ? 0.6349 0.3960 0.6098 0.0516  -0.0883 -0.0231 390 ARG A NE    
2106 C CZ    . ARG D 72  ? 0.6312 0.4022 0.5861 0.0639  -0.0791 -0.0355 390 ARG A CZ    
2107 N NH1   . ARG D 72  ? 0.6384 0.4114 0.5876 0.0600  -0.0887 -0.0379 390 ARG A NH1   
2108 N NH2   . ARG D 72  ? 0.6216 0.4013 0.5631 0.0793  -0.0612 -0.0439 390 ARG A NH2   
2109 N N     . LYS D 73  ? 0.6635 0.3891 0.6983 -0.0020 -0.1172 0.0446  391 LYS A N     
2110 C CA    . LYS D 73  ? 0.6425 0.3851 0.6747 -0.0038 -0.1008 0.0597  391 LYS A CA    
2111 C C     . LYS D 73  ? 0.6162 0.3862 0.6355 0.0112  -0.0771 0.0495  391 LYS A C     
2112 O O     . LYS D 73  ? 0.6194 0.3873 0.6298 0.0268  -0.0744 0.0296  391 LYS A O     
2113 C CB    . LYS D 73  ? 0.6605 0.3731 0.6917 0.0004  -0.1136 0.0609  391 LYS A CB    
2114 C CG    . LYS D 73  ? 0.7037 0.3804 0.7470 -0.0129 -0.1409 0.0694  391 LYS A CG    
2115 C CD    . LYS D 73  ? 0.7301 0.3772 0.7723 -0.0084 -0.1540 0.0735  391 LYS A CD    
2116 C CE    . LYS D 73  ? 0.7206 0.3833 0.7588 -0.0206 -0.1433 0.0999  391 LYS A CE    
2117 N NZ    . LYS D 73  ? 0.7521 0.3853 0.7878 -0.0156 -0.1583 0.1050  391 LYS A NZ    
2118 N N     . PHE D 74  ? 0.5991 0.3940 0.6161 0.0061  -0.0600 0.0638  392 PHE A N     
2119 C CA    . PHE D 74  ? 0.5740 0.3930 0.5806 0.0173  -0.0393 0.0569  392 PHE A CA    
2120 C C     . PHE D 74  ? 0.5667 0.3905 0.5659 0.0185  -0.0306 0.0654  392 PHE A C     
2121 O O     . PHE D 74  ? 0.5881 0.4043 0.5878 0.0081  -0.0366 0.0811  392 PHE A O     
2122 C CB    . PHE D 74  ? 0.5598 0.4068 0.5695 0.0121  -0.0276 0.0624  392 PHE A CB    
2123 C CG    . PHE D 74  ? 0.5759 0.4193 0.5929 0.0097  -0.0389 0.0554  392 PHE A CG    
2124 C CD1   . PHE D 74  ? 0.5961 0.4361 0.6301 -0.0066 -0.0527 0.0672  392 PHE A CD1   
2125 C CD2   . PHE D 74  ? 0.5759 0.4189 0.5822 0.0229  -0.0368 0.0379  392 PHE A CD2   
2126 C CE1   . PHE D 74  ? 0.6085 0.4436 0.6499 -0.0094 -0.0668 0.0599  392 PHE A CE1   
2127 C CE2   . PHE D 74  ? 0.5899 0.4274 0.5983 0.0215  -0.0496 0.0306  392 PHE A CE2   
2128 C CZ    . PHE D 74  ? 0.6057 0.4385 0.6323 0.0055  -0.0659 0.0407  392 PHE A CZ    
2129 N N     . SER D 75  ? 0.5340 0.3697 0.5251 0.0304  -0.0174 0.0558  393 SER A N     
2130 C CA    . SER D 75  ? 0.5159 0.3536 0.4995 0.0329  -0.0124 0.0603  393 SER A CA    
2131 C C     . SER D 75  ? 0.4958 0.3524 0.4701 0.0257  0.0000  0.0734  393 SER A C     
2132 O O     . SER D 75  ? 0.5074 0.3606 0.4719 0.0227  -0.0009 0.0826  393 SER A O     
2133 C CB    . SER D 75  ? 0.5007 0.3436 0.4834 0.0468  -0.0050 0.0455  393 SER A CB    
2134 O OG    . SER D 75  ? 0.4813 0.3418 0.4603 0.0501  0.0087  0.0403  393 SER A OG    
2135 N N     . ARG D 76  ? 0.4699 0.3461 0.4456 0.0245  0.0111  0.0736  394 ARG A N     
2136 C CA    . ARG D 76  ? 0.4563 0.3529 0.4236 0.0218  0.0250  0.0827  394 ARG A CA    
2137 C C     . ARG D 76  ? 0.4621 0.3754 0.4416 0.0114  0.0275  0.0940  394 ARG A C     
2138 O O     . ARG D 76  ? 0.4663 0.3787 0.4600 0.0091  0.0203  0.0902  394 ARG A O     
2139 C CB    . ARG D 76  ? 0.4310 0.3388 0.3915 0.0332  0.0373  0.0715  394 ARG A CB    
2140 C CG    . ARG D 76  ? 0.4272 0.3223 0.3866 0.0423  0.0339  0.0585  394 ARG A CG    
2141 C CD    . ARG D 76  ? 0.4164 0.3196 0.3684 0.0501  0.0447  0.0518  394 ARG A CD    
2142 N NE    . ARG D 76  ? 0.3988 0.3175 0.3505 0.0514  0.0542  0.0531  394 ARG A NE    
2143 C CZ    . ARG D 76  ? 0.3891 0.3125 0.3354 0.0585  0.0622  0.0478  394 ARG A CZ    
2144 N NH1   . ARG D 76  ? 0.4053 0.3195 0.3470 0.0626  0.0619  0.0416  394 ARG A NH1   
2145 N NH2   . ARG D 76  ? 0.3900 0.3271 0.3383 0.0612  0.0691  0.0491  394 ARG A NH2   
2146 N N     . SER D 77  ? 0.4657 0.3959 0.4396 0.0055  0.0376  0.1078  395 SER A N     
2147 C CA    . SER D 77  ? 0.4678 0.4195 0.4586 -0.0062 0.0412  0.1221  395 SER A CA    
2148 C C     . SER D 77  ? 0.4541 0.4288 0.4583 0.0002  0.0492  0.1146  395 SER A C     
2149 O O     . SER D 77  ? 0.4579 0.4428 0.4846 -0.0080 0.0431  0.1194  395 SER A O     
2150 C CB    . SER D 77  ? 0.4817 0.4501 0.4611 -0.0125 0.0536  0.1392  395 SER A CB    
2151 O OG    . SER D 77  ? 0.4720 0.4576 0.4358 0.0005  0.0707  0.1318  395 SER A OG    
2152 N N     . ASP D 78  ? 0.4444 0.4256 0.4360 0.0145  0.0606  0.1033  396 ASP A N     
2153 C CA    . ASP D 78  ? 0.4352 0.4359 0.4383 0.0220  0.0669  0.0971  396 ASP A CA    
2154 C C     . ASP D 78  ? 0.4321 0.4204 0.4450 0.0229  0.0535  0.0878  396 ASP A C     
2155 O O     . ASP D 78  ? 0.4255 0.4297 0.4543 0.0232  0.0520  0.0878  396 ASP A O     
2156 C CB    . ASP D 78  ? 0.4359 0.4385 0.4215 0.0372  0.0788  0.0869  396 ASP A CB    
2157 C CG    . ASP D 78  ? 0.4441 0.4194 0.4130 0.0432  0.0731  0.0755  396 ASP A CG    
2158 O OD1   . ASP D 78  ? 0.4549 0.4126 0.4218 0.0370  0.0631  0.0769  396 ASP A OD1   
2159 O OD2   . ASP D 78  ? 0.4427 0.4148 0.4030 0.0539  0.0779  0.0658  396 ASP A OD2   
2160 N N     . HIS D 79  ? 0.4429 0.4043 0.4459 0.0243  0.0435  0.0794  397 HIS A N     
2161 C CA    . HIS D 79  ? 0.4467 0.3956 0.4536 0.0265  0.0315  0.0693  397 HIS A CA    
2162 C C     . HIS D 79  ? 0.4599 0.4052 0.4842 0.0136  0.0162  0.0757  397 HIS A C     
2163 O O     . HIS D 79  ? 0.4682 0.4112 0.4986 0.0140  0.0060  0.0694  397 HIS A O     
2164 C CB    . HIS D 79  ? 0.4455 0.3707 0.4380 0.0341  0.0279  0.0575  397 HIS A CB    
2165 C CG    . HIS D 79  ? 0.4358 0.3637 0.4157 0.0453  0.0397  0.0503  397 HIS A CG    
2166 N ND1   . HIS D 79  ? 0.4277 0.3714 0.4067 0.0503  0.0495  0.0511  397 HIS A ND1   
2167 C CD2   . HIS D 79  ? 0.4352 0.3518 0.4062 0.0518  0.0419  0.0430  397 HIS A CD2   
2168 C CE1   . HIS D 79  ? 0.4244 0.3626 0.3923 0.0583  0.0562  0.0450  397 HIS A CE1   
2169 N NE2   . HIS D 79  ? 0.4267 0.3507 0.3911 0.0585  0.0523  0.0405  397 HIS A NE2   
2170 N N     . LEU D 80  ? 0.4729 0.4156 0.5040 0.0013  0.0128  0.0890  398 LEU A N     
2171 C CA    . LEU D 80  ? 0.4957 0.4354 0.5474 -0.0142 -0.0027 0.0985  398 LEU A CA    
2172 C C     . LEU D 80  ? 0.4880 0.4613 0.5629 -0.0209 0.0022  0.1084  398 LEU A C     
2173 O O     . LEU D 80  ? 0.5019 0.4756 0.5942 -0.0270 -0.0125 0.1068  398 LEU A O     
2174 C CB    . LEU D 80  ? 0.5016 0.4295 0.5543 -0.0269 -0.0071 0.1138  398 LEU A CB    
2175 C CG    . LEU D 80  ? 0.4941 0.4242 0.5723 -0.0475 -0.0203 0.1308  398 LEU A CG    
2176 C CD1   . LEU D 80  ? 0.5014 0.4031 0.5874 -0.0497 -0.0451 0.1189  398 LEU A CD1   
2177 C CD2   . LEU D 80  ? 0.4900 0.4115 0.5655 -0.0606 -0.0210 0.1505  398 LEU A CD2   
2178 N N     . LYS D 81  ? 0.4864 0.4890 0.5626 -0.0191 0.0218  0.1179  399 LYS A N     
2179 C CA    . LYS D 81  ? 0.4960 0.5367 0.5976 -0.0219 0.0295  0.1264  399 LYS A CA    
2180 C C     . LYS D 81  ? 0.4835 0.5268 0.5904 -0.0119 0.0222  0.1128  399 LYS A C     
2181 O O     . LYS D 81  ? 0.4816 0.5460 0.6164 -0.0182 0.0150  0.1180  399 LYS A O     
2182 C CB    . LYS D 81  ? 0.4964 0.5642 0.5899 -0.0138 0.0538  0.1319  399 LYS A CB    
2183 C CG    . LYS D 81  ? 0.4954 0.6073 0.6166 -0.0127 0.0652  0.1396  399 LYS A CG    
2184 C CD    . LYS D 81  ? 0.5012 0.6356 0.6085 -0.0010 0.0897  0.1414  399 LYS A CD    
2185 C CE    . LYS D 81  ? 0.5035 0.6858 0.6415 0.0028  0.1027  0.1482  399 LYS A CE    
2186 N NZ    . LYS D 81  ? 0.5179 0.7209 0.6390 0.0169  0.1271  0.1476  399 LYS A NZ    
2187 N N     . THR D 82  ? 0.4794 0.5021 0.5604 0.0032  0.0233  0.0965  400 THR A N     
2188 C CA    . THR D 82  ? 0.4779 0.4979 0.5568 0.0126  0.0154  0.0847  400 THR A CA    
2189 C C     . THR D 82  ? 0.5152 0.5148 0.5985 0.0049  -0.0079 0.0793  400 THR A C     
2190 O O     . THR D 82  ? 0.5143 0.5228 0.6109 0.0041  -0.0197 0.0777  400 THR A O     
2191 C CB    . THR D 82  ? 0.4516 0.4546 0.5011 0.0283  0.0237  0.0717  400 THR A CB    
2192 O OG1   . THR D 82  ? 0.4343 0.4552 0.4813 0.0372  0.0414  0.0742  400 THR A OG1   
2193 C CG2   . THR D 82  ? 0.4520 0.4450 0.4925 0.0361  0.0135  0.0609  400 THR A CG2   
2194 N N     . HIS D 83  ? 0.5523 0.5226 0.6238 0.0005  -0.0166 0.0754  401 HIS A N     
2195 C CA    . HIS D 83  ? 0.5939 0.5385 0.6646 -0.0039 -0.0400 0.0665  401 HIS A CA    
2196 C C     . HIS D 83  ? 0.5978 0.5544 0.7011 -0.0214 -0.0562 0.0780  401 HIS A C     
2197 O O     . HIS D 83  ? 0.6217 0.5673 0.7281 -0.0232 -0.0768 0.0697  401 HIS A O     
2198 C CB    . HIS D 83  ? 0.6438 0.5559 0.7001 -0.0042 -0.0459 0.0611  401 HIS A CB    
2199 C CG    . HIS D 83  ? 0.7429 0.6268 0.8039 -0.0118 -0.0718 0.0548  401 HIS A CG    
2200 N ND1   . HIS D 83  ? 0.7753 0.6379 0.8178 -0.0013 -0.0851 0.0354  401 HIS A ND1   
2201 C CD2   . HIS D 83  ? 0.7777 0.6486 0.8578 -0.0287 -0.0881 0.0652  401 HIS A CD2   
2202 C CE1   . HIS D 83  ? 0.8092 0.6453 0.8587 -0.0100 -0.1095 0.0316  401 HIS A CE1   
2203 N NE2   . HIS D 83  ? 0.8036 0.6431 0.8777 -0.0276 -0.1126 0.0502  401 HIS A NE2   
2204 N N     . THR D 84  ? 0.5822 0.5622 0.7098 -0.0349 -0.0478 0.0976  402 THR A N     
2205 C CA    . THR D 84  ? 0.5860 0.5828 0.7512 -0.0544 -0.0617 0.1122  402 THR A CA    
2206 C C     . THR D 84  ? 0.5864 0.6104 0.7715 -0.0513 -0.0670 0.1101  402 THR A C     
2207 O O     . THR D 84  ? 0.6072 0.6381 0.8228 -0.0662 -0.0868 0.1166  402 THR A O     
2208 C CB    . THR D 84  ? 0.5732 0.5981 0.7592 -0.0681 -0.0454 0.1360  402 THR A CB    
2209 O OG1   . THR D 84  ? 0.5504 0.6076 0.7307 -0.0548 -0.0185 0.1377  402 THR A OG1   
2210 C CG2   . THR D 84  ? 0.5831 0.5774 0.7513 -0.0741 -0.0464 0.1410  402 THR A CG2   
2211 N N     . ARG D 85  ? 0.5730 0.6109 0.7432 -0.0329 -0.0521 0.1017  403 ARG A N     
2212 C CA    . ARG D 85  ? 0.5781 0.6390 0.7656 -0.0278 -0.0594 0.0996  403 ARG A CA    
2213 C C     . ARG D 85  ? 0.6041 0.6352 0.7760 -0.0251 -0.0862 0.0838  403 ARG A C     
2214 O O     . ARG D 85  ? 0.6116 0.6580 0.8027 -0.0263 -0.1013 0.0839  403 ARG A O     
2215 C CB    . ARG D 85  ? 0.5613 0.6402 0.7355 -0.0082 -0.0378 0.0957  403 ARG A CB    
2216 C CG    . ARG D 85  ? 0.5482 0.6610 0.7383 -0.0079 -0.0124 0.1091  403 ARG A CG    
2217 C CD    . ARG D 85  ? 0.5425 0.6795 0.7343 0.0105  0.0012  0.1057  403 ARG A CD    
2218 N NE    . ARG D 85  ? 0.5405 0.7087 0.7433 0.0139  0.0260  0.1153  403 ARG A NE    
2219 C CZ    . ARG D 85  ? 0.5408 0.6980 0.7141 0.0251  0.0442  0.1102  403 ARG A CZ    
2220 N NH1   . ARG D 85  ? 0.5403 0.6595 0.6772 0.0324  0.0408  0.0975  403 ARG A NH1   
2221 N NH2   . ARG D 85  ? 0.5438 0.7290 0.7238 0.0293  0.0656  0.1175  403 ARG A NH2   
2222 N N     . THR D 86  ? 0.6235 0.6136 0.7605 -0.0203 -0.0928 0.0697  404 THR A N     
2223 C CA    . THR D 86  ? 0.6594 0.6197 0.7769 -0.0167 -0.1180 0.0532  404 THR A CA    
2224 C C     . THR D 86  ? 0.6985 0.6512 0.8449 -0.0362 -0.1470 0.0573  404 THR A C     
2225 O O     . THR D 86  ? 0.7265 0.6695 0.8710 -0.0362 -0.1715 0.0480  404 THR A O     
2226 C CB    . THR D 86  ? 0.6662 0.5883 0.7412 -0.0047 -0.1152 0.0363  404 THR A CB    
2227 O OG1   . THR D 86  ? 0.6729 0.5775 0.7552 -0.0151 -0.1173 0.0406  404 THR A OG1   
2228 C CG2   . THR D 86  ? 0.6407 0.5711 0.6917 0.0118  -0.0880 0.0340  404 THR A CG2   
2229 N N     . HIS D 87  ? 0.7073 0.6625 0.8794 -0.0537 -0.1463 0.0721  405 HIS A N     
2230 C CA    . HIS D 87  ? 0.7542 0.7009 0.9582 -0.0755 -0.1748 0.0791  405 HIS A CA    
2231 C C     . HIS D 87  ? 0.7306 0.7251 0.9858 -0.0897 -0.1772 0.0979  405 HIS A C     
2232 O O     . HIS D 87  ? 0.7586 0.7504 1.0403 -0.1041 -0.2064 0.0991  405 HIS A O     
2233 C CB    . HIS D 87  ? 0.8065 0.7330 1.0172 -0.0899 -0.1750 0.0898  405 HIS A CB    
2234 C CG    . HIS D 87  ? 0.8804 0.7631 1.0479 -0.0754 -0.1735 0.0721  405 HIS A CG    
2235 N ND1   . HIS D 87  ? 0.9273 0.7667 1.0683 -0.0670 -0.1973 0.0490  405 HIS A ND1   
2236 C CD2   . HIS D 87  ? 0.8778 0.7552 1.0258 -0.0669 -0.1514 0.0737  405 HIS A CD2   
2237 C CE1   . HIS D 87  ? 0.9338 0.7463 1.0438 -0.0532 -0.1881 0.0374  405 HIS A CE1   
2238 N NE2   . HIS D 87  ? 0.8880 0.7227 1.0031 -0.0537 -0.1615 0.0526  405 HIS A NE2   
2239 N N     . THR D 88  ? 0.6869 0.7255 0.9579 -0.0853 -0.1480 0.1116  406 THR A N     
2240 C CA    . THR D 88  ? 0.6745 0.7651 0.9981 -0.0964 -0.1464 0.1297  406 THR A CA    
2241 C C     . THR D 88  ? 0.6655 0.7753 0.9923 -0.0816 -0.1531 0.1203  406 THR A C     
2242 O O     . THR D 88  ? 0.6691 0.8152 1.0433 -0.0915 -0.1644 0.1312  406 THR A O     
2243 C CB    . THR D 88  ? 0.6496 0.7807 0.9894 -0.0974 -0.1113 0.1487  406 THR A CB    
2244 O OG1   . THR D 88  ? 0.6599 0.8397 1.0586 -0.1159 -0.1115 0.1709  406 THR A OG1   
2245 C CG2   . THR D 88  ? 0.6156 0.7640 0.9323 -0.0716 -0.0858 0.1399  406 THR A CG2   
2246 N N     . GLY D 89  ? 0.6550 0.7427 0.9350 -0.0587 -0.1472 0.1021  407 GLY A N     
2247 C CA    . GLY D 89  ? 0.6560 0.7542 0.9322 -0.0443 -0.1566 0.0938  407 GLY A CA    
2248 C C     . GLY D 89  ? 0.6249 0.7699 0.9244 -0.0326 -0.1339 0.1034  407 GLY A C     
2249 O O     . GLY D 89  ? 0.6311 0.7877 0.9346 -0.0213 -0.1443 0.0992  407 GLY A O     
2250 N N     . GLU D 90  ? 0.5970 0.7675 0.9096 -0.0334 -0.1046 0.1154  408 GLU A N     
2251 C CA    . GLU D 90  ? 0.5759 0.7911 0.9112 -0.0203 -0.0826 0.1227  408 GLU A CA    
2252 C C     . GLU D 90  ? 0.5612 0.7569 0.8519 0.0045  -0.0692 0.1091  408 GLU A C     
2253 O O     . GLU D 90  ? 0.5594 0.7179 0.8053 0.0094  -0.0620 0.0997  408 GLU A O     
2254 C CB    . GLU D 90  ? 0.5654 0.8132 0.9243 -0.0287 -0.0553 0.1391  408 GLU A CB    
2255 N N     . LYS D 91  ? 0.5499 0.7715 0.8560 0.0200  -0.0670 0.1092  409 LYS A N     
2256 C CA    . LYS D 91  ? 0.5337 0.7381 0.8033 0.0428  -0.0567 0.0990  409 LYS A CA    
2257 C C     . LYS D 91  ? 0.5153 0.7609 0.8136 0.0572  -0.0366 0.1050  409 LYS A C     
2258 O O     . LYS D 91  ? 0.5247 0.7932 0.8487 0.0675  -0.0465 0.1062  409 LYS A O     
2259 C CB    . LYS D 91  ? 0.5477 0.7282 0.7960 0.0505  -0.0822 0.0899  409 LYS A CB    
2260 C CG    . LYS D 91  ? 0.5609 0.6983 0.7731 0.0410  -0.1008 0.0803  409 LYS A CG    
2261 C CD    . LYS D 91  ? 0.5866 0.7012 0.7696 0.0513  -0.1229 0.0714  409 LYS A CD    
2262 C CE    . LYS D 91  ? 0.6124 0.6838 0.7529 0.0456  -0.1383 0.0590  409 LYS A CE    
2263 N NZ    . LYS D 91  ? 0.6463 0.6947 0.7494 0.0568  -0.1573 0.0506  409 LYS A NZ    
2264 N N     . PRO D 92  ? 0.4958 0.7509 0.7891 0.0598  -0.0091 0.1078  410 PRO A N     
2265 C CA    . PRO D 92  ? 0.4906 0.7847 0.8086 0.0759  0.0112  0.1110  410 PRO A CA    
2266 C C     . PRO D 92  ? 0.4901 0.7673 0.7851 0.1005  0.0123  0.1003  410 PRO A C     
2267 O O     . PRO D 92  ? 0.4990 0.8078 0.8236 0.1163  0.0158  0.1014  410 PRO A O     
2268 C CB    . PRO D 92  ? 0.4864 0.7847 0.7919 0.0714  0.0378  0.1148  410 PRO A CB    
2269 C CG    . PRO D 92  ? 0.4832 0.7310 0.7431 0.0621  0.0318  0.1084  410 PRO A CG    
2270 C CD    . PRO D 92  ? 0.4878 0.7183 0.7522 0.0494  0.0031  0.1075  410 PRO A CD    
2271 N N     . PHE D 93  ? 0.4835 0.7126 0.7289 0.1044  0.0090  0.0910  411 PHE A N     
2272 C CA    . PHE D 93  ? 0.4905 0.6985 0.7114 0.1252  0.0105  0.0832  411 PHE A CA    
2273 C C     . PHE D 93  ? 0.4982 0.7026 0.7259 0.1313  -0.0145 0.0835  411 PHE A C     
2274 O O     . PHE D 93  ? 0.5113 0.6905 0.7179 0.1217  -0.0331 0.0819  411 PHE A O     
2275 C CB    . PHE D 93  ? 0.4940 0.6558 0.6637 0.1242  0.0167  0.0760  411 PHE A CB    
2276 C CG    . PHE D 93  ? 0.4870 0.6489 0.6470 0.1183  0.0375  0.0755  411 PHE A CG    
2277 C CD1   . PHE D 93  ? 0.4914 0.6578 0.6461 0.1324  0.0560  0.0717  411 PHE A CD1   
2278 C CD2   . PHE D 93  ? 0.4828 0.6375 0.6374 0.0996  0.0364  0.0785  411 PHE A CD2   
2279 C CE1   . PHE D 93  ? 0.4883 0.6533 0.6298 0.1273  0.0730  0.0712  411 PHE A CE1   
2280 C CE2   . PHE D 93  ? 0.4777 0.6310 0.6217 0.0944  0.0533  0.0795  411 PHE A CE2   
2281 C CZ    . PHE D 93  ? 0.4807 0.6398 0.6170 0.1080  0.0716  0.0761  411 PHE A CZ    
2282 N N     . SER D 94  ? 0.4879 0.7167 0.7434 0.1488  -0.0159 0.0847  412 SER A N     
2283 C CA    . SER D 94  ? 0.4925 0.7188 0.7557 0.1573  -0.0409 0.0860  412 SER A CA    
2284 C C     . SER D 94  ? 0.4989 0.6938 0.7314 0.1776  -0.0406 0.0816  412 SER A C     
2285 O O     . SER D 94  ? 0.4982 0.6890 0.7234 0.1895  -0.0210 0.0772  412 SER A O     
2286 C CB    . SER D 94  ? 0.4916 0.7721 0.8176 0.1622  -0.0475 0.0926  412 SER A CB    
2287 O OG    . SER D 94  ? 0.4824 0.7908 0.8400 0.1403  -0.0512 0.0994  412 SER A OG    
2288 N N     . CYS D 95  ? 0.5067 0.6774 0.7194 0.1810  -0.0639 0.0831  413 CYS A N     
2289 C CA    . CYS D 95  ? 0.5124 0.6484 0.6936 0.1972  -0.0670 0.0823  413 CYS A CA    
2290 C C     . CYS D 95  ? 0.5137 0.6728 0.7319 0.2198  -0.0718 0.0836  413 CYS A C     
2291 O O     . CYS D 95  ? 0.5179 0.7085 0.7750 0.2230  -0.0891 0.0878  413 CYS A O     
2292 C CB    . CYS D 95  ? 0.5327 0.6337 0.6737 0.1918  -0.0892 0.0855  413 CYS A CB    
2293 S SG    . CYS D 95  ? 0.5606 0.6147 0.6577 0.2068  -0.0928 0.0893  413 CYS A SG    
2294 N N     . ARG D 96  ? 0.5146 0.6576 0.7224 0.2361  -0.0582 0.0792  414 ARG A N     
2295 C CA    . ARG D 96  ? 0.5318 0.6917 0.7719 0.2615  -0.0612 0.0776  414 ARG A CA    
2296 C C     . ARG D 96  ? 0.5675 0.6919 0.7875 0.2746  -0.0851 0.0829  414 ARG A C     
2297 O O     . ARG D 96  ? 0.5870 0.7162 0.8295 0.2981  -0.0905 0.0813  414 ARG A O     
2298 C CB    . ARG D 96  ? 0.5294 0.6879 0.7680 0.2745  -0.0357 0.0679  414 ARG A CB    
2299 N N     . TRP D 97  ? 0.5807 0.6694 0.7578 0.2610  -0.0993 0.0894  415 TRP A N     
2300 C CA    . TRP D 97  ? 0.6162 0.6703 0.7695 0.2714  -0.1223 0.0976  415 TRP A CA    
2301 C C     . TRP D 97  ? 0.6354 0.7186 0.8265 0.2811  -0.1489 0.1026  415 TRP A C     
2302 O O     . TRP D 97  ? 0.6196 0.7388 0.8385 0.2697  -0.1546 0.1022  415 TRP A O     
2303 C CB    . TRP D 97  ? 0.6185 0.6316 0.7134 0.2539  -0.1276 0.1039  415 TRP A CB    
2304 C CG    . TRP D 97  ? 0.6491 0.6170 0.7072 0.2624  -0.1421 0.1143  415 TRP A CG    
2305 C CD1   . TRP D 97  ? 0.6823 0.6366 0.7251 0.2667  -0.1698 0.1250  415 TRP A CD1   
2306 C CD2   . TRP D 97  ? 0.6550 0.5839 0.6866 0.2665  -0.1311 0.1166  415 TRP A CD2   
2307 N NE1   . TRP D 97  ? 0.7171 0.6263 0.7242 0.2729  -0.1754 0.1356  415 TRP A NE1   
2308 C CE2   . TRP D 97  ? 0.6989 0.5917 0.7007 0.2721  -0.1522 0.1308  415 TRP A CE2   
2309 C CE3   . TRP D 97  ? 0.6329 0.5525 0.6625 0.2651  -0.1073 0.1086  415 TRP A CE3   
2310 C CZ2   . TRP D 97  ? 0.7207 0.5689 0.6942 0.2748  -0.1496 0.1386  415 TRP A CZ2   
2311 C CZ3   . TRP D 97  ? 0.6567 0.5319 0.6590 0.2684  -0.1064 0.1143  415 TRP A CZ3   
2312 C CH2   . TRP D 97  ? 0.6993 0.5395 0.6755 0.2724  -0.1271 0.1298  415 TRP A CH2   
2313 N N     . PRO D 98  ? 0.6739 0.7418 0.8693 0.3016  -0.1674 0.1079  416 PRO A N     
2314 C CA    . PRO D 98  ? 0.6887 0.7854 0.9235 0.3125  -0.1955 0.1130  416 PRO A CA    
2315 C C     . PRO D 98  ? 0.7009 0.7921 0.9123 0.2944  -0.2192 0.1199  416 PRO A C     
2316 O O     . PRO D 98  ? 0.7260 0.7726 0.8777 0.2848  -0.2259 0.1258  416 PRO A O     
2317 C CB    . PRO D 98  ? 0.7252 0.7894 0.9523 0.3365  -0.2117 0.1187  416 PRO A CB    
2318 C CG    . PRO D 98  ? 0.7231 0.7608 0.9325 0.3424  -0.1858 0.1117  416 PRO A CG    
2319 C CD    . PRO D 98  ? 0.7011 0.7268 0.8729 0.3171  -0.1641 0.1089  416 PRO A CD    
2320 N N     . SER D 99  ? 0.6864 0.8248 0.9458 0.2895  -0.2314 0.1187  417 SER A N     
2321 C CA    . SER D 99  ? 0.6996 0.8373 0.9470 0.2756  -0.2609 0.1232  417 SER A CA    
2322 C C     . SER D 99  ? 0.6943 0.8057 0.8889 0.2511  -0.2519 0.1197  417 SER A C     
2323 O O     . SER D 99  ? 0.7204 0.8075 0.8748 0.2427  -0.2748 0.1226  417 SER A O     
2324 C CB    . SER D 99  ? 0.7412 0.8476 0.9617 0.2890  -0.2947 0.1334  417 SER A CB    
2325 N N     . CYS D 100 ? 0.6635 0.7792 0.8561 0.2408  -0.2196 0.1127  418 CYS A N     
2326 C CA    . CYS D 100 ? 0.6640 0.7594 0.8147 0.2192  -0.2106 0.1081  418 CYS A CA    
2327 C C     . CYS D 100 ? 0.6527 0.7862 0.8438 0.2023  -0.2099 0.1030  418 CYS A C     
2328 O O     . CYS D 100 ? 0.6700 0.7969 0.8466 0.1887  -0.2302 0.1012  418 CYS A O     
2329 C CB    . CYS D 100 ? 0.6415 0.7108 0.7587 0.2173  -0.1784 0.1048  418 CYS A CB    
2330 S SG    . CYS D 100 ? 0.6211 0.6672 0.6907 0.1940  -0.1657 0.0983  418 CYS A SG    
2331 N N     . GLN D 101 ? 0.6313 0.8031 0.8714 0.2031  -0.1876 0.1011  419 GLN A N     
2332 C CA    . GLN D 101 ? 0.6201 0.8313 0.9042 0.1859  -0.1839 0.1000  419 GLN A CA    
2333 C C     . GLN D 101 ? 0.6349 0.8187 0.8789 0.1640  -0.1828 0.0949  419 GLN A C     
2334 O O     . GLN D 101 ? 0.6529 0.8391 0.9024 0.1499  -0.2057 0.0939  419 GLN A O     
2335 C CB    . GLN D 101 ? 0.6305 0.8807 0.9695 0.1859  -0.2133 0.1052  419 GLN A CB    
2336 N N     . LYS D 102 ? 0.6357 0.7923 0.8405 0.1622  -0.1571 0.0906  420 LYS A N     
2337 C CA    . LYS D 102 ? 0.6465 0.7767 0.8138 0.1450  -0.1521 0.0847  420 LYS A CA    
2338 C C     . LYS D 102 ? 0.6149 0.7597 0.7981 0.1370  -0.1225 0.0831  420 LYS A C     
2339 O O     . LYS D 102 ? 0.6028 0.7561 0.7941 0.1480  -0.1005 0.0840  420 LYS A O     
2340 C CB    . LYS D 102 ? 0.6801 0.7615 0.7799 0.1496  -0.1509 0.0819  420 LYS A CB    
2341 C CG    . LYS D 102 ? 0.7191 0.7744 0.7795 0.1396  -0.1715 0.0764  420 LYS A CG    
2342 C CD    . LYS D 102 ? 0.7537 0.7670 0.7484 0.1454  -0.1666 0.0757  420 LYS A CD    
2343 C CE    . LYS D 102 ? 0.7955 0.7843 0.7469 0.1392  -0.1875 0.0687  420 LYS A CE    
2344 N NZ    . LYS D 102 ? 0.7831 0.7727 0.7397 0.1245  -0.1848 0.0581  420 LYS A NZ    
2345 N N     . LYS D 103 ? 0.6052 0.7500 0.7905 0.1184  -0.1238 0.0806  421 LYS A N     
2346 C CA    . LYS D 103 ? 0.5739 0.7336 0.7761 0.1084  -0.0997 0.0814  421 LYS A CA    
2347 C C     . LYS D 103 ? 0.5645 0.6856 0.7190 0.1003  -0.0903 0.0742  421 LYS A C     
2348 O O     . LYS D 103 ? 0.5825 0.6731 0.7012 0.0971  -0.1059 0.0681  421 LYS A O     
2349 C CB    . LYS D 103 ? 0.5697 0.7660 0.8242 0.0918  -0.1088 0.0877  421 LYS A CB    
2350 C CG    . LYS D 103 ? 0.5762 0.8187 0.8872 0.0988  -0.1185 0.0956  421 LYS A CG    
2351 C CD    . LYS D 103 ? 0.5738 0.8551 0.9403 0.0789  -0.1259 0.1044  421 LYS A CD    
2352 C CE    . LYS D 103 ? 0.5834 0.9151 1.0117 0.0854  -0.1380 0.1125  421 LYS A CE    
2353 N NZ    . LYS D 103 ? 0.5737 0.9352 1.0213 0.1071  -0.1122 0.1145  421 LYS A NZ    
2354 N N     . PHE D 104 ? 0.5358 0.6596 0.6897 0.0984  -0.0649 0.0745  422 PHE A N     
2355 C CA    . PHE D 104 ? 0.5242 0.6168 0.6408 0.0915  -0.0546 0.0684  422 PHE A CA    
2356 C C     . PHE D 104 ? 0.5050 0.6142 0.6434 0.0797  -0.0391 0.0722  422 PHE A C     
2357 O O     . PHE D 104 ? 0.4964 0.6403 0.6707 0.0805  -0.0283 0.0796  422 PHE A O     
2358 C CB    . PHE D 104 ? 0.5188 0.5861 0.5977 0.1042  -0.0397 0.0648  422 PHE A CB    
2359 C CG    . PHE D 104 ? 0.5384 0.5858 0.5901 0.1144  -0.0536 0.0640  422 PHE A CG    
2360 C CD1   . PHE D 104 ? 0.5549 0.5731 0.5669 0.1111  -0.0632 0.0586  422 PHE A CD1   
2361 C CD2   . PHE D 104 ? 0.5458 0.6035 0.6103 0.1284  -0.0570 0.0689  422 PHE A CD2   
2362 C CE1   . PHE D 104 ? 0.5844 0.5847 0.5667 0.1200  -0.0749 0.0599  422 PHE A CE1   
2363 C CE2   . PHE D 104 ? 0.5727 0.6096 0.6099 0.1371  -0.0712 0.0706  422 PHE A CE2   
2364 C CZ    . PHE D 104 ? 0.5934 0.6020 0.5879 0.1321  -0.0797 0.0671  422 PHE A CZ    
2365 N N     . ALA D 105 ? 0.5022 0.5865 0.6174 0.0698  -0.0376 0.0676  423 ALA A N     
2366 C CA    . ALA D 105 ? 0.4848 0.5786 0.6157 0.0573  -0.0263 0.0726  423 ALA A CA    
2367 C C     . ALA D 105 ? 0.4723 0.5617 0.5867 0.0638  -0.0016 0.0721  423 ALA A C     
2368 O O     . ALA D 105 ? 0.4712 0.5746 0.5995 0.0559  0.0101  0.0786  423 ALA A O     
2369 C CB    . ALA D 105 ? 0.4927 0.5598 0.6098 0.0439  -0.0404 0.0677  423 ALA A CB    
2370 N N     . ARG D 106 ? 0.4669 0.5364 0.5515 0.0770  0.0052  0.0655  424 ARG A N     
2371 C CA    . ARG D 106 ? 0.4554 0.5170 0.5238 0.0827  0.0248  0.0637  424 ARG A CA    
2372 C C     . ARG D 106 ? 0.4502 0.5116 0.5122 0.0992  0.0312  0.0619  424 ARG A C     
2373 O O     . ARG D 106 ? 0.4608 0.5172 0.5191 0.1063  0.0198  0.0613  424 ARG A O     
2374 C CB    . ARG D 106 ? 0.4636 0.4931 0.5003 0.0791  0.0261  0.0571  424 ARG A CB    
2375 C CG    . ARG D 106 ? 0.4718 0.4916 0.5092 0.0663  0.0139  0.0556  424 ARG A CG    
2376 C CD    . ARG D 106 ? 0.4763 0.4709 0.4895 0.0650  0.0191  0.0494  424 ARG A CD    
2377 N NE    . ARG D 106 ? 0.4850 0.4638 0.4726 0.0752  0.0262  0.0439  424 ARG A NE    
2378 C CZ    . ARG D 106 ? 0.4901 0.4493 0.4576 0.0757  0.0284  0.0374  424 ARG A CZ    
2379 N NH1   . ARG D 106 ? 0.4910 0.4413 0.4599 0.0687  0.0225  0.0338  424 ARG A NH1   
2380 N NH2   . ARG D 106 ? 0.4956 0.4445 0.4440 0.0830  0.0359  0.0351  424 ARG A NH2   
2381 N N     . SER D 107 ? 0.4395 0.5030 0.4978 0.1055  0.0476  0.0609  425 SER A N     
2382 C CA    . SER D 107 ? 0.4416 0.5006 0.4943 0.1218  0.0525  0.0579  425 SER A CA    
2383 C C     . SER D 107 ? 0.4490 0.4739 0.4715 0.1249  0.0472  0.0546  425 SER A C     
2384 O O     . SER D 107 ? 0.4599 0.4775 0.4793 0.1354  0.0408  0.0555  425 SER A O     
2385 C CB    . SER D 107 ? 0.4361 0.5010 0.4871 0.1279  0.0696  0.0551  425 SER A CB    
2386 O OG    . SER D 107 ? 0.4329 0.4732 0.4587 0.1213  0.0748  0.0516  425 SER A OG    
2387 N N     . ASP D 108 ? 0.4503 0.4551 0.4519 0.1160  0.0500  0.0521  426 ASP A N     
2388 C CA    . ASP D 108 ? 0.4752 0.4528 0.4508 0.1177  0.0481  0.0510  426 ASP A CA    
2389 C C     . ASP D 108 ? 0.4843 0.4568 0.4510 0.1180  0.0345  0.0534  426 ASP A C     
2390 O O     . ASP D 108 ? 0.4983 0.4535 0.4465 0.1230  0.0320  0.0561  426 ASP A O     
2391 C CB    . ASP D 108 ? 0.4901 0.4538 0.4511 0.1088  0.0546  0.0477  426 ASP A CB    
2392 C CG    . ASP D 108 ? 0.5042 0.4733 0.4691 0.0989  0.0492  0.0461  426 ASP A CG    
2393 O OD1   . ASP D 108 ? 0.5036 0.4910 0.4884 0.0947  0.0470  0.0483  426 ASP A OD1   
2394 O OD2   . ASP D 108 ? 0.5167 0.4719 0.4654 0.0955  0.0471  0.0429  426 ASP A OD2   
2395 N N     . GLU D 109 ? 0.4847 0.4703 0.4628 0.1120  0.0243  0.0531  427 GLU A N     
2396 C CA    . GLU D 109 ? 0.5088 0.4894 0.4768 0.1134  0.0081  0.0541  427 GLU A CA    
2397 C C     . GLU D 109 ? 0.5089 0.4960 0.4862 0.1248  0.0007  0.0594  427 GLU A C     
2398 O O     . GLU D 109 ? 0.5323 0.5036 0.4878 0.1299  -0.0082 0.0625  427 GLU A O     
2399 C CB    . GLU D 109 ? 0.5258 0.5182 0.5085 0.1040  -0.0047 0.0518  427 GLU A CB    
2400 C CG    . GLU D 109 ? 0.5414 0.5230 0.5147 0.0941  -0.0012 0.0460  427 GLU A CG    
2401 C CD    . GLU D 109 ? 0.5611 0.5506 0.5521 0.0838  -0.0165 0.0444  427 GLU A CD    
2402 O OE1   . GLU D 109 ? 0.5653 0.5424 0.5493 0.0765  -0.0177 0.0391  427 GLU A OE1   
2403 O OE2   . GLU D 109 ? 0.5718 0.5796 0.5863 0.0830  -0.0289 0.0488  427 GLU A OE2   
2404 N N     . LEU D 110 ? 0.4812 0.4920 0.4903 0.1299  0.0044  0.0611  428 LEU A N     
2405 C CA    . LEU D 110 ? 0.4774 0.4959 0.5002 0.1438  -0.0027 0.0649  428 LEU A CA    
2406 C C     . LEU D 110 ? 0.4906 0.4829 0.4915 0.1536  0.0033  0.0660  428 LEU A C     
2407 O O     . LEU D 110 ? 0.5129 0.4941 0.5072 0.1632  -0.0080 0.0708  428 LEU A O     
2408 C CB    . LEU D 110 ? 0.4482 0.5025 0.5120 0.1487  0.0033  0.0653  428 LEU A CB    
2409 C CG    . LEU D 110 ? 0.4500 0.5180 0.5359 0.1662  -0.0034 0.0676  428 LEU A CG    
2410 C CD1   . LEU D 110 ? 0.4650 0.5330 0.5531 0.1671  -0.0272 0.0723  428 LEU A CD1   
2411 C CD2   . LEU D 110 ? 0.4329 0.5423 0.5604 0.1714  0.0075  0.0672  428 LEU A CD2   
2412 N N     . VAL D 111 ? 0.4786 0.4590 0.4687 0.1507  0.0187  0.0623  429 VAL A N     
2413 C CA    . VAL D 111 ? 0.4880 0.4411 0.4597 0.1572  0.0227  0.0637  429 VAL A CA    
2414 C C     . VAL D 111 ? 0.5212 0.4494 0.4627 0.1527  0.0155  0.0705  429 VAL A C     
2415 O O     . VAL D 111 ? 0.5465 0.4555 0.4772 0.1600  0.0089  0.0772  429 VAL A O     
2416 C CB    . VAL D 111 ? 0.4580 0.4039 0.4252 0.1528  0.0379  0.0579  429 VAL A CB    
2417 C CG1   . VAL D 111 ? 0.4696 0.3838 0.4177 0.1551  0.0391  0.0602  429 VAL A CG1   
2418 C CG2   . VAL D 111 ? 0.4424 0.4106 0.4327 0.1606  0.0460  0.0519  429 VAL A CG2   
2419 N N     . ARG D 112 ? 0.5306 0.4584 0.4569 0.1414  0.0168  0.0693  430 ARG A N     
2420 C CA    . ARG D 112 ? 0.5749 0.4839 0.4694 0.1381  0.0122  0.0754  430 ARG A CA    
2421 C C     . ARG D 112 ? 0.6046 0.5123 0.4934 0.1457  -0.0059 0.0817  430 ARG A C     
2422 O O     . ARG D 112 ? 0.6294 0.5171 0.4953 0.1489  -0.0107 0.0914  430 ARG A O     
2423 C CB    . ARG D 112 ? 0.5832 0.4955 0.4647 0.1282  0.0162  0.0695  430 ARG A CB    
2424 C CG    . ARG D 112 ? 0.6308 0.5289 0.4766 0.1268  0.0125  0.0736  430 ARG A CG    
2425 C CD    . ARG D 112 ? 0.6432 0.5453 0.4780 0.1207  0.0143  0.0639  430 ARG A CD    
2426 N NE    . ARG D 112 ? 0.6398 0.5415 0.4778 0.1150  0.0311  0.0599  430 ARG A NE    
2427 C CZ    . ARG D 112 ? 0.6445 0.5489 0.4787 0.1112  0.0344  0.0504  430 ARG A CZ    
2428 N NH1   . ARG D 112 ? 0.6605 0.5654 0.4855 0.1118  0.0218  0.0430  430 ARG A NH1   
2429 N NH2   . ARG D 112 ? 0.6307 0.5357 0.4711 0.1072  0.0482  0.0476  430 ARG A NH2   
2430 N N     . HIS D 113 ? 0.6089 0.5383 0.5198 0.1476  -0.0173 0.0779  431 HIS A N     
2431 C CA    . HIS D 113 ? 0.6451 0.5761 0.5557 0.1552  -0.0379 0.0834  431 HIS A CA    
2432 C C     . HIS D 113 ? 0.6446 0.5696 0.5675 0.1689  -0.0420 0.0901  431 HIS A C     
2433 O O     . HIS D 113 ? 0.6767 0.5847 0.5810 0.1752  -0.0558 0.0993  431 HIS A O     
2434 C CB    . HIS D 113 ? 0.6635 0.6228 0.6044 0.1528  -0.0497 0.0781  431 HIS A CB    
2435 C CG    . HIS D 113 ? 0.7481 0.7151 0.6997 0.1614  -0.0729 0.0833  431 HIS A CG    
2436 N ND1   . HIS D 113 ? 0.7937 0.7462 0.7146 0.1606  -0.0919 0.0860  431 HIS A ND1   
2437 C CD2   . HIS D 113 ? 0.7577 0.7464 0.7475 0.1722  -0.0810 0.0859  431 HIS A CD2   
2438 C CE1   . HIS D 113 ? 0.8117 0.7753 0.7520 0.1695  -0.1128 0.0908  431 HIS A CE1   
2439 N NE2   . HIS D 113 ? 0.7809 0.7679 0.7658 0.1770  -0.1062 0.0908  431 HIS A NE2   
2440 N N     . HIS D 114 ? 0.6153 0.5523 0.5671 0.1746  -0.0311 0.0853  432 HIS A N     
2441 C CA    . HIS D 114 ? 0.6307 0.5596 0.5948 0.1904  -0.0351 0.0885  432 HIS A CA    
2442 C C     . HIS D 114 ? 0.6548 0.5448 0.5871 0.1903  -0.0338 0.0967  432 HIS A C     
2443 O O     . HIS D 114 ? 0.6803 0.5526 0.6101 0.2017  -0.0463 0.1044  432 HIS A O     
2444 C CB    . HIS D 114 ? 0.6178 0.5664 0.6132 0.1975  -0.0212 0.0791  432 HIS A CB    
2445 C CG    . HIS D 114 ? 0.6520 0.5899 0.6590 0.2163  -0.0244 0.0785  432 HIS A CG    
2446 N ND1   . HIS D 114 ? 0.6762 0.6228 0.7031 0.2320  -0.0409 0.0821  432 HIS A ND1   
2447 C CD2   . HIS D 114 ? 0.6646 0.5817 0.6665 0.2231  -0.0154 0.0736  432 HIS A CD2   
2448 C CE1   . HIS D 114 ? 0.6962 0.6271 0.7297 0.2490  -0.0409 0.0790  432 HIS A CE1   
2449 N NE2   . HIS D 114 ? 0.6888 0.6004 0.7062 0.2436  -0.0259 0.0734  432 HIS A NE2   
2450 N N     . ASN D 115 ? 0.6545 0.5310 0.5648 0.1771  -0.0199 0.0965  433 ASN A N     
2451 C CA    . ASN D 115 ? 0.6947 0.5375 0.5784 0.1736  -0.0179 0.1069  433 ASN A CA    
2452 C C     . ASN D 115 ? 0.7427 0.5705 0.5951 0.1715  -0.0302 0.1208  433 ASN A C     
2453 O O     . ASN D 115 ? 0.7794 0.5793 0.6150 0.1733  -0.0358 0.1340  433 ASN A O     
2454 C CB    . ASN D 115 ? 0.6812 0.5200 0.5552 0.1596  0.0001  0.1036  433 ASN A CB    
2455 C CG    . ASN D 115 ? 0.6673 0.5111 0.5640 0.1622  0.0102  0.0923  433 ASN A CG    
2456 O OD1   . ASN D 115 ? 0.6792 0.5154 0.5899 0.1746  0.0056  0.0895  433 ASN A OD1   
2457 N ND2   . ASN D 115 ? 0.6458 0.5009 0.5440 0.1519  0.0232  0.0850  433 ASN A ND2   
2458 N N     . MET D 116 ? 0.7516 0.5952 0.5937 0.1677  -0.0358 0.1184  434 MET A N     
2459 C CA    . MET D 116 ? 0.8071 0.6363 0.6133 0.1671  -0.0485 0.1303  434 MET A CA    
2460 C C     . MET D 116 ? 0.8272 0.6527 0.6413 0.1808  -0.0722 0.1373  434 MET A C     
2461 O O     . MET D 116 ? 0.8608 0.6676 0.6422 0.1821  -0.0851 0.1506  434 MET A O     
2462 C CB    . MET D 116 ? 0.8249 0.6681 0.6129 0.1597  -0.0485 0.1227  434 MET A CB    
2463 C CG    . MET D 116 ? 0.8339 0.6759 0.6047 0.1479  -0.0271 0.1188  434 MET A CG    
2464 S SD    . MET D 116 ? 0.8850 0.7244 0.6079 0.1436  -0.0292 0.1176  434 MET A SD    
2465 C CE    . MET D 116 ? 0.9451 0.7585 0.6267 0.1475  -0.0393 0.1398  434 MET A CE    
2466 N N     . HIS D 117 ? 0.8088 0.6535 0.6652 0.1917  -0.0780 0.1291  435 HIS A N     
2467 C CA    . HIS D 117 ? 0.8360 0.6773 0.7063 0.2075  -0.0999 0.1359  435 HIS A CA    
2468 C C     . HIS D 117 ? 0.8530 0.6588 0.7124 0.2144  -0.1022 0.1477  435 HIS A C     
2469 O O     . HIS D 117 ? 0.8796 0.6684 0.7314 0.2247  -0.1228 0.1595  435 HIS A O     
2470 C CB    . HIS D 117 ? 0.8310 0.7072 0.7538 0.2186  -0.1023 0.1238  435 HIS A CB    
2471 C CG    . HIS D 117 ? 0.8717 0.7793 0.8106 0.2153  -0.1143 0.1188  435 HIS A CG    
2472 N ND1   . HIS D 117 ? 0.9117 0.8186 0.8436 0.2205  -0.1406 0.1260  435 HIS A ND1   
2473 C CD2   . HIS D 117 ? 0.8476 0.7865 0.8102 0.2064  -0.1060 0.1079  435 HIS A CD2   
2474 C CE1   . HIS D 117 ? 0.8979 0.8344 0.8500 0.2144  -0.1487 0.1187  435 HIS A CE1   
2475 N NE2   . HIS D 117 ? 0.8511 0.8070 0.8227 0.2054  -0.1276 0.1084  435 HIS A NE2   
2476 N N     . GLN D 118 ? 0.8446 0.6369 0.7036 0.2085  -0.0838 0.1452  436 GLN A N     
2477 C CA    . GLN D 118 ? 0.8664 0.6221 0.7191 0.2132  -0.0868 0.1552  436 GLN A CA    
2478 C C     . GLN D 118 ? 0.8905 0.6148 0.6995 0.1993  -0.0860 0.1751  436 GLN A C     
2479 O O     . GLN D 118 ? 0.9147 0.6060 0.7175 0.1980  -0.0872 0.1858  436 GLN A O     
2480 C CB    . GLN D 118 ? 0.8463 0.6009 0.7201 0.2131  -0.0702 0.1423  436 GLN A CB    
2481 C CG    . GLN D 118 ? 0.8289 0.6166 0.7426 0.2264  -0.0662 0.1234  436 GLN A CG    
2482 C CD    . GLN D 118 ? 0.8281 0.6106 0.7541 0.2274  -0.0509 0.1107  436 GLN A CD    
2483 O OE1   . GLN D 118 ? 0.8544 0.6017 0.7667 0.2237  -0.0505 0.1156  436 GLN A OE1   
2484 N NE2   . GLN D 118 ? 0.7978 0.6145 0.7487 0.2315  -0.0393 0.0952  436 GLN A NE2   
2485 N N     . ARG D 119 ? 0.8886 0.6222 0.6673 0.1889  -0.0840 0.1804  437 ARG A N     
2486 C CA    . ARG D 119 ? 0.9195 0.6295 0.6543 0.1759  -0.0794 0.2001  437 ARG A CA    
2487 C C     . ARG D 119 ? 0.9671 0.6452 0.6814 0.1833  -0.1015 0.2215  437 ARG A C     
2488 O O     . ARG D 119 ? 0.9828 0.6641 0.6818 0.1910  -0.1200 0.2258  437 ARG A O     
2489 C CB    . ARG D 119 ? 0.9172 0.6465 0.6217 0.1669  -0.0717 0.1972  437 ARG A CB    
2490 C CG    . ARG D 119 ? 0.8679 0.6244 0.5894 0.1590  -0.0512 0.1781  437 ARG A CG    
2491 C CD    . ARG D 119 ? 0.8667 0.6150 0.5857 0.1458  -0.0292 0.1827  437 ARG A CD    
2492 N NE    . ARG D 119 ? 0.8852 0.6395 0.5694 0.1347  -0.0147 0.1878  437 ARG A NE    
2493 C CZ    . ARG D 119 ? 0.8552 0.6323 0.5428 0.1295  0.0002  0.1727  437 ARG A CZ    
2494 N NH1   . ARG D 119 ? 0.8093 0.6038 0.5321 0.1322  0.0020  0.1541  437 ARG A NH1   
2495 N NH2   . ARG D 119 ? 0.8736 0.6561 0.5289 0.1225  0.0137  0.1767  437 ARG A NH2   
2496 P P     . DG  E 2   ? 0.7829 0.8729 0.5846 0.2546  -0.1948 0.0370  2   DG  B P     
2497 O OP1   . DG  E 2   ? 0.8038 0.8602 0.5691 0.2689  -0.1705 0.0404  2   DG  B OP1   
2498 O OP2   . DG  E 2   ? 0.8059 0.9068 0.6093 0.2604  -0.2139 0.0319  2   DG  B OP2   
2499 O "O5'" . DG  E 2   ? 0.7434 0.8152 0.5438 0.2387  -0.2015 0.0310  2   DG  B "O5'" 
2500 C "C5'" . DG  E 2   ? 0.7205 0.8003 0.5352 0.2280  -0.2251 0.0233  2   DG  B "C5'" 
2501 C "C4'" . DG  E 2   ? 0.6705 0.7462 0.5014 0.2088  -0.2310 0.0203  2   DG  B "C4'" 
2502 O "O4'" . DG  E 2   ? 0.6686 0.7014 0.4664 0.2103  -0.2113 0.0171  2   DG  B "O4'" 
2503 C "C3'" . DG  E 2   ? 0.6116 0.7194 0.4873 0.1895  -0.2245 0.0289  2   DG  B "C3'" 
2504 O "O3'" . DG  E 2   ? 0.5874 0.7022 0.4915 0.1668  -0.2398 0.0253  2   DG  B "O3'" 
2505 C "C2'" . DG  E 2   ? 0.5987 0.6804 0.4560 0.1901  -0.1958 0.0325  2   DG  B "C2'" 
2506 C "C1'" . DG  E 2   ? 0.6267 0.6626 0.4434 0.1968  -0.1919 0.0234  2   DG  B "C1'" 
2507 N N9    . DG  E 2   ? 0.6304 0.6363 0.4135 0.2098  -0.1669 0.0260  2   DG  B N9    
2508 C C8    . DG  E 2   ? 0.6363 0.6446 0.4058 0.2263  -0.1550 0.0330  2   DG  B C8    
2509 N N7    . DG  E 2   ? 0.6458 0.6202 0.3854 0.2335  -0.1335 0.0342  2   DG  B N7    
2510 C C5    . DG  E 2   ? 0.6482 0.5992 0.3828 0.2215  -0.1301 0.0276  2   DG  B C5    
2511 C C6    . DG  E 2   ? 0.6633 0.5777 0.3739 0.2215  -0.1096 0.0259  2   DG  B C6    
2512 O O6    . DG  E 2   ? 0.6754 0.5680 0.3631 0.2310  -0.0900 0.0305  2   DG  B O6    
2513 N N1    . DG  E 2   ? 0.6635 0.5673 0.3801 0.2086  -0.1134 0.0181  2   DG  B N1    
2514 C C2    . DG  E 2   ? 0.6542 0.5762 0.3944 0.1970  -0.1353 0.0124  2   DG  B C2    
2515 N N2    . DG  E 2   ? 0.6556 0.5610 0.3967 0.1872  -0.1362 0.0045  2   DG  B N2    
2516 N N3    . DG  E 2   ? 0.6404 0.5948 0.4034 0.1952  -0.1552 0.0144  2   DG  B N3    
2517 C C4    . DG  E 2   ? 0.6361 0.6051 0.3959 0.2078  -0.1508 0.0222  2   DG  B C4    
2518 P P     . DC  E 3   ? 0.5430 0.6900 0.4946 0.1433  -0.2367 0.0346  3   DC  B P     
2519 O OP1   . DC  E 3   ? 0.5444 0.7075 0.5271 0.1251  -0.2624 0.0315  3   DC  B OP1   
2520 O OP2   . DC  E 3   ? 0.5268 0.7052 0.4915 0.1517  -0.2238 0.0452  3   DC  B OP2   
2521 O "O5'" . DC  E 3   ? 0.5293 0.6437 0.4683 0.1338  -0.2172 0.0338  3   DC  B "O5'" 
2522 C "C5'" . DC  E 3   ? 0.5504 0.6287 0.4698 0.1302  -0.2221 0.0233  3   DC  B "C5'" 
2523 C "C4'" . DC  E 3   ? 0.5418 0.5944 0.4512 0.1247  -0.2005 0.0236  3   DC  B "C4'" 
2524 O "O4'" . DC  E 3   ? 0.5522 0.5816 0.4257 0.1434  -0.1803 0.0232  3   DC  B "O4'" 
2525 C "C3'" . DC  E 3   ? 0.5174 0.5913 0.4566 0.1099  -0.1900 0.0339  3   DC  B "C3'" 
2526 O "O3'" . DC  E 3   ? 0.5217 0.5788 0.4700 0.0934  -0.1901 0.0310  3   DC  B "O3'" 
2527 C "C2'" . DC  E 3   ? 0.5079 0.5733 0.4259 0.1241  -0.1658 0.0382  3   DC  B "C2'" 
2528 C "C1'" . DC  E 3   ? 0.5284 0.5553 0.4076 0.1379  -0.1600 0.0291  3   DC  B "C1'" 
2529 N N1    . DC  E 3   ? 0.5316 0.5452 0.3823 0.1564  -0.1412 0.0320  3   DC  B N1    
2530 C C2    . DC  E 3   ? 0.5399 0.5164 0.3612 0.1627  -0.1247 0.0277  3   DC  B C2    
2531 O O2    . DC  E 3   ? 0.5382 0.4961 0.3582 0.1540  -0.1258 0.0209  3   DC  B O2    
2532 N N3    . DC  E 3   ? 0.5491 0.5110 0.3449 0.1782  -0.1079 0.0313  3   DC  B N3    
2533 C C4    . DC  E 3   ? 0.5505 0.5326 0.3482 0.1889  -0.1079 0.0380  3   DC  B C4    
2534 N N4    . DC  E 3   ? 0.5645 0.5276 0.3353 0.2046  -0.0920 0.0412  3   DC  B N4    
2535 C C5    . DC  E 3   ? 0.5413 0.5643 0.3700 0.1842  -0.1239 0.0419  3   DC  B C5    
2536 C C6    . DC  E 3   ? 0.5266 0.5644 0.3817 0.1670  -0.1398 0.0392  3   DC  B C6    
2537 P P     . DG  E 4   ? 0.5069 0.5842 0.4889 0.0731  -0.1881 0.0408  4   DG  B P     
2538 O OP1   . DG  E 4   ? 0.5104 0.6021 0.5204 0.0565  -0.2111 0.0412  4   DG  B OP1   
2539 O OP2   . DG  E 4   ? 0.4990 0.6002 0.4861 0.0790  -0.1728 0.0511  4   DG  B OP2   
2540 O "O5'" . DG  E 4   ? 0.5001 0.5449 0.4711 0.0679  -0.1761 0.0360  4   DG  B "O5'" 
2541 C "C5'" . DG  E 4   ? 0.5173 0.5323 0.4757 0.0674  -0.1836 0.0244  4   DG  B "C5'" 
2542 C "C4'" . DG  E 4   ? 0.5199 0.5059 0.4569 0.0742  -0.1641 0.0194  4   DG  B "C4'" 
2543 O "O4'" . DG  E 4   ? 0.5331 0.5135 0.4439 0.0924  -0.1489 0.0198  4   DG  B "O4'" 
2544 C "C3'" . DG  E 4   ? 0.4965 0.4841 0.4479 0.0635  -0.1524 0.0253  4   DG  B "C3'" 
2545 O "O3'" . DG  E 4   ? 0.4977 0.4589 0.4451 0.0600  -0.1489 0.0172  4   DG  B "O3'" 
2546 C "C2'" . DG  E 4   ? 0.4931 0.4839 0.4298 0.0757  -0.1327 0.0303  4   DG  B "C2'" 
2547 C "C1'" . DG  E 4   ? 0.5178 0.4912 0.4252 0.0930  -0.1289 0.0236  4   DG  B "C1'" 
2548 N N9    . DG  E 4   ? 0.5237 0.5039 0.4156 0.1076  -0.1174 0.0289  4   DG  B N9    
2549 C C8    . DG  E 4   ? 0.5242 0.5321 0.4231 0.1131  -0.1242 0.0354  4   DG  B C8    
2550 N N7    . DG  E 4   ? 0.5334 0.5391 0.4138 0.1284  -0.1113 0.0387  4   DG  B N7    
2551 C C5    . DG  E 4   ? 0.5385 0.5123 0.3988 0.1317  -0.0948 0.0346  4   DG  B C5    
2552 C C6    . DG  E 4   ? 0.5590 0.5137 0.3946 0.1451  -0.0766 0.0360  4   DG  B C6    
2553 O O6    . DG  E 4   ? 0.5745 0.5353 0.3983 0.1588  -0.0719 0.0409  4   DG  B O6    
2554 N N1    . DG  E 4   ? 0.5612 0.4866 0.3867 0.1417  -0.0636 0.0312  4   DG  B N1    
2555 C C2    . DG  E 4   ? 0.5501 0.4674 0.3880 0.1288  -0.0676 0.0252  4   DG  B C2    
2556 N N2    . DG  E 4   ? 0.5572 0.4491 0.3864 0.1277  -0.0529 0.0211  4   DG  B N2    
2557 N N3    . DG  E 4   ? 0.5337 0.4664 0.3924 0.1176  -0.0852 0.0233  4   DG  B N3    
2558 C C4    . DG  E 4   ? 0.5305 0.4903 0.3992 0.1190  -0.0980 0.0285  4   DG  B C4    
2559 P P     . DT  E 5   ? 0.4790 0.4383 0.4445 0.0463  -0.1448 0.0207  5   DT  B P     
2560 O OP1   . DT  E 5   ? 0.4861 0.4210 0.4513 0.0435  -0.1485 0.0104  5   DT  B OP1   
2561 O OP2   . DT  E 5   ? 0.4708 0.4560 0.4595 0.0334  -0.1551 0.0316  5   DT  B OP2   
2562 O "O5'" . DT  E 5   ? 0.4765 0.4320 0.4297 0.0546  -0.1225 0.0235  5   DT  B "O5'" 
2563 C "C5'" . DT  E 5   ? 0.4927 0.4259 0.4241 0.0667  -0.1082 0.0163  5   DT  B "C5'" 
2564 C "C4'" . DT  E 5   ? 0.4936 0.4246 0.4171 0.0718  -0.0897 0.0204  5   DT  B "C4'" 
2565 O "O4'" . DT  E 5   ? 0.4889 0.4298 0.3975 0.0841  -0.0847 0.0256  5   DT  B "O4'" 
2566 C "C3'" . DT  E 5   ? 0.4895 0.4321 0.4303 0.0610  -0.0893 0.0267  5   DT  B "C3'" 
2567 O "O3'" . DT  E 5   ? 0.5172 0.4423 0.4549 0.0610  -0.0763 0.0228  5   DT  B "O3'" 
2568 C "C2'" . DT  E 5   ? 0.4677 0.4318 0.4046 0.0672  -0.0860 0.0357  5   DT  B "C2'" 
2569 C "C1'" . DT  E 5   ? 0.4693 0.4210 0.3819 0.0834  -0.0765 0.0325  5   DT  B "C1'" 
2570 N N1    . DT  E 5   ? 0.4605 0.4319 0.3664 0.0940  -0.0769 0.0391  5   DT  B N1    
2571 C C2    . DT  E 5   ? 0.4630 0.4245 0.3479 0.1083  -0.0627 0.0401  5   DT  B C2    
2572 O O2    . DT  E 5   ? 0.4576 0.3943 0.3294 0.1113  -0.0496 0.0364  5   DT  B O2    
2573 N N3    . DT  E 5   ? 0.4689 0.4505 0.3499 0.1191  -0.0649 0.0458  5   DT  B N3    
2574 C C4    . DT  E 5   ? 0.4606 0.4739 0.3597 0.1159  -0.0790 0.0506  5   DT  B C4    
2575 O O4    . DT  E 5   ? 0.4652 0.4979 0.3623 0.1270  -0.0799 0.0553  5   DT  B O4    
2576 C C5    . DT  E 5   ? 0.4504 0.4721 0.3722 0.0986  -0.0932 0.0498  5   DT  B C5    
2577 C C7    . DT  E 5   ? 0.4458 0.5006 0.3912 0.0914  -0.1094 0.0555  5   DT  B C7    
2578 C C6    . DT  E 5   ? 0.4509 0.4500 0.3736 0.0891  -0.0917 0.0441  5   DT  B C6    
2579 P P     . DG  E 6   ? 0.5326 0.4555 0.4892 0.0478  -0.0807 0.0221  6   DG  B P     
2580 O OP1   . DG  E 6   ? 0.5459 0.4559 0.5113 0.0431  -0.0884 0.0139  6   DG  B OP1   
2581 O OP2   . DG  E 6   ? 0.5274 0.4720 0.4942 0.0405  -0.0887 0.0318  6   DG  B OP2   
2582 O "O5'" . DG  E 6   ? 0.5173 0.4258 0.4666 0.0516  -0.0645 0.0194  6   DG  B "O5'" 
2583 C "C5'" . DG  E 6   ? 0.4995 0.4150 0.4404 0.0558  -0.0571 0.0253  6   DG  B "C5'" 
2584 C "C4'" . DG  E 6   ? 0.4927 0.3911 0.4151 0.0669  -0.0407 0.0225  6   DG  B "C4'" 
2585 O "O4'" . DG  E 6   ? 0.4925 0.3942 0.3993 0.0781  -0.0387 0.0249  6   DG  B "O4'" 
2586 C "C3'" . DG  E 6   ? 0.4846 0.3811 0.3988 0.0706  -0.0323 0.0252  6   DG  B "C3'" 
2587 O "O3'" . DG  E 6   ? 0.4707 0.3507 0.3920 0.0642  -0.0282 0.0191  6   DG  B "O3'" 
2588 C "C2'" . DG  E 6   ? 0.5042 0.3912 0.3960 0.0849  -0.0205 0.0265  6   DG  B "C2'" 
2589 C "C1'" . DG  E 6   ? 0.4989 0.3970 0.3882 0.0892  -0.0277 0.0284  6   DG  B "C1'" 
2590 N N9    . DG  E 6   ? 0.4949 0.4180 0.3833 0.0944  -0.0343 0.0358  6   DG  B N9    
2591 C C8    . DG  E 6   ? 0.4830 0.4304 0.3877 0.0871  -0.0484 0.0398  6   DG  B C8    
2592 N N7    . DG  E 6   ? 0.4818 0.4519 0.3855 0.0938  -0.0506 0.0466  6   DG  B N7    
2593 C C5    . DG  E 6   ? 0.4974 0.4558 0.3807 0.1080  -0.0375 0.0465  6   DG  B C5    
2594 C C6    . DG  E 6   ? 0.5170 0.4899 0.3905 0.1219  -0.0337 0.0518  6   DG  B C6    
2595 O O6    . DG  E 6   ? 0.5147 0.5180 0.3987 0.1240  -0.0405 0.0579  6   DG  B O6    
2596 N N1    . DG  E 6   ? 0.5342 0.4829 0.3850 0.1343  -0.0204 0.0495  6   DG  B N1    
2597 C C2    . DG  E 6   ? 0.5408 0.4569 0.3821 0.1316  -0.0114 0.0437  6   DG  B C2    
2598 N N2    . DG  E 6   ? 0.5614 0.4555 0.3814 0.1435  0.0007  0.0431  6   DG  B N2    
2599 N N3    . DG  E 6   ? 0.5287 0.4348 0.3819 0.1182  -0.0141 0.0388  6   DG  B N3    
2600 C C4    . DG  E 6   ? 0.5068 0.4346 0.3797 0.1078  -0.0275 0.0402  6   DG  B C4    
2601 P P     . DG  E 7   ? 0.4776 0.3575 0.3987 0.0616  -0.0283 0.0199  7   DG  B P     
2602 O OP1   . DG  E 7   ? 0.4838 0.3475 0.4176 0.0534  -0.0280 0.0119  7   DG  B OP1   
2603 O OP2   . DG  E 7   ? 0.4734 0.3768 0.3991 0.0583  -0.0388 0.0273  7   DG  B OP2   
2604 O "O5'" . DG  E 7   ? 0.4810 0.3512 0.3797 0.0746  -0.0155 0.0214  7   DG  B "O5'" 
2605 C "C5'" . DG  E 7   ? 0.4881 0.3334 0.3783 0.0785  -0.0033 0.0167  7   DG  B "C5'" 
2606 C "C4'" . DG  E 7   ? 0.5083 0.3435 0.3758 0.0911  0.0062  0.0191  7   DG  B "C4'" 
2607 O "O4'" . DG  E 7   ? 0.5106 0.3632 0.3668 0.1021  0.0049  0.0260  7   DG  B "O4'" 
2608 C "C3'" . DG  E 7   ? 0.5145 0.3487 0.3780 0.0915  0.0043  0.0179  7   DG  B "C3'" 
2609 O "O3'" . DG  E 7   ? 0.5431 0.3515 0.3899 0.0989  0.0147  0.0149  7   DG  B "O3'" 
2610 C "C2'" . DG  E 7   ? 0.5060 0.3675 0.3636 0.0989  -0.0005 0.0255  7   DG  B "C2'" 
2611 C "C1'" . DG  E 7   ? 0.5145 0.3799 0.3632 0.1087  0.0035  0.0297  7   DG  B "C1'" 
2612 N N9    . DG  E 7   ? 0.5095 0.4067 0.3651 0.1103  -0.0046 0.0366  7   DG  B N9    
2613 C C8    . DG  E 7   ? 0.4926 0.4086 0.3679 0.0984  -0.0159 0.0387  7   DG  B C8    
2614 N N7    . DG  E 7   ? 0.4855 0.4288 0.3654 0.1014  -0.0216 0.0456  7   DG  B N7    
2615 C C5    . DG  E 7   ? 0.4992 0.4440 0.3618 0.1176  -0.0135 0.0480  7   DG  B C5    
2616 C C6    . DG  E 7   ? 0.5047 0.4766 0.3665 0.1280  -0.0150 0.0547  7   DG  B C6    
2617 O O6    . DG  E 7   ? 0.4945 0.4959 0.3728 0.1232  -0.0240 0.0605  7   DG  B O6    
2618 N N1    . DG  E 7   ? 0.5236 0.4859 0.3647 0.1456  -0.0053 0.0544  7   DG  B N1    
2619 C C2    . DG  E 7   ? 0.5418 0.4696 0.3643 0.1509  0.0044  0.0487  7   DG  B C2    
2620 N N2    . DG  E 7   ? 0.5636 0.4835 0.3660 0.1689  0.0120  0.0494  7   DG  B N2    
2621 N N3    . DG  E 7   ? 0.5415 0.4445 0.3665 0.1394  0.0060  0.0427  7   DG  B N3    
2622 C C4    . DG  E 7   ? 0.5181 0.4326 0.3639 0.1236  -0.0032 0.0425  7   DG  B C4    
2623 P P     . DG  E 8   ? 0.5619 0.3590 0.4009 0.1000  0.0134  0.0103  8   DG  B P     
2624 O OP1   . DG  E 8   ? 0.5922 0.3558 0.4246 0.0999  0.0224  0.0046  8   DG  B OP1   
2625 O OP2   . DG  E 8   ? 0.5502 0.3621 0.4055 0.0888  0.0015  0.0084  8   DG  B OP2   
2626 O "O5'" . DG  E 8   ? 0.5564 0.3662 0.3742 0.1165  0.0156  0.0160  8   DG  B "O5'" 
2627 C "C5'" . DG  E 8   ? 0.5659 0.3638 0.3645 0.1309  0.0250  0.0187  8   DG  B "C5'" 
2628 C "C4'" . DG  E 8   ? 0.5651 0.3803 0.3482 0.1468  0.0254  0.0232  8   DG  B "C4'" 
2629 O "O4'" . DG  E 8   ? 0.5436 0.3951 0.3383 0.1468  0.0198  0.0307  8   DG  B "O4'" 
2630 C "C3'" . DG  E 8   ? 0.5657 0.3828 0.3428 0.1480  0.0221  0.0196  8   DG  B "C3'" 
2631 O "O3'" . DG  E 8   ? 0.5889 0.3908 0.3414 0.1656  0.0288  0.0178  8   DG  B "O3'" 
2632 C "C2'" . DG  E 8   ? 0.5440 0.4016 0.3330 0.1456  0.0155  0.0268  8   DG  B "C2'" 
2633 C "C1'" . DG  E 8   ? 0.5379 0.4138 0.3317 0.1512  0.0168  0.0339  8   DG  B "C1'" 
2634 N N9    . DG  E 8   ? 0.5150 0.4246 0.3297 0.1414  0.0085  0.0405  8   DG  B N9    
2635 C C8    . DG  E 8   ? 0.4967 0.4094 0.3307 0.1237  0.0003  0.0397  8   DG  B C8    
2636 N N7    . DG  E 8   ? 0.4773 0.4200 0.3270 0.1178  -0.0068 0.0468  8   DG  B N7    
2637 C C5    . DG  E 8   ? 0.4840 0.4479 0.3268 0.1320  -0.0028 0.0527  8   DG  B C5    
2638 C C6    . DG  E 8   ? 0.4686 0.4698 0.3255 0.1321  -0.0073 0.0616  8   DG  B C6    
2639 O O6    . DG  E 8   ? 0.4467 0.4671 0.3237 0.1185  -0.0163 0.0665  8   DG  B O6    
2640 N N1    . DG  E 8   ? 0.4855 0.5012 0.3322 0.1501  -0.0009 0.0648  8   DG  B N1    
2641 C C2    . DG  E 8   ? 0.5100 0.5035 0.3333 0.1667  0.0084  0.0599  8   DG  B C2    
2642 N N2    . DG  E 8   ? 0.5212 0.5336 0.3381 0.1846  0.0129  0.0637  8   DG  B N2    
2643 N N3    . DG  E 8   ? 0.5243 0.4796 0.3328 0.1659  0.0125  0.0518  8   DG  B N3    
2644 C C4    . DG  E 8   ? 0.5088 0.4529 0.3296 0.1476  0.0067  0.0487  8   DG  B C4    
2645 P P     . DA  E 9   ? 0.6006 0.3986 0.3378 0.1724  0.0272  0.0125  9   DA  B P     
2646 O OP1   . DA  E 9   ? 0.6297 0.3925 0.3425 0.1862  0.0337  0.0066  9   DA  B OP1   
2647 O OP2   . DA  E 9   ? 0.5854 0.3837 0.3365 0.1554  0.0184  0.0081  9   DA  B OP2   
2648 O "O5'" . DA  E 9   ? 0.5953 0.4345 0.3308 0.1842  0.0278  0.0209  9   DA  B "O5'" 
2649 C "C5'" . DA  E 9   ? 0.6117 0.4645 0.3420 0.1996  0.0333  0.0270  9   DA  B "C5'" 
2650 C "C4'" . DA  E 9   ? 0.6119 0.5099 0.3490 0.2066  0.0330  0.0351  9   DA  B "C4'" 
2651 O "O4'" . DA  E 9   ? 0.5878 0.5143 0.3514 0.1898  0.0260  0.0420  9   DA  B "O4'" 
2652 C "C3'" . DA  E 9   ? 0.6270 0.5331 0.3526 0.2116  0.0342  0.0330  9   DA  B "C3'" 
2653 O "O3'" . DA  E 9   ? 0.6500 0.5754 0.3632 0.2335  0.0414  0.0360  9   DA  B "O3'" 
2654 C "C2'" . DA  E 9   ? 0.6018 0.5390 0.3495 0.1940  0.0276  0.0400  9   DA  B "C2'" 
2655 C "C1'" . DA  E 9   ? 0.5880 0.5467 0.3580 0.1880  0.0248  0.0475  9   DA  B "C1'" 
2656 N N9    . DA  E 9   ? 0.5789 0.5528 0.3727 0.1669  0.0159  0.0521  9   DA  B N9    
2657 C C8    . DA  E 9   ? 0.5757 0.5284 0.3758 0.1504  0.0092  0.0471  9   DA  B C8    
2658 N N7    . DA  E 9   ? 0.5538 0.5255 0.3754 0.1347  0.0012  0.0529  9   DA  B N7    
2659 C C5    . DA  E 9   ? 0.5478 0.5556 0.3789 0.1398  0.0027  0.0627  9   DA  B C5    
2660 C C6    . DA  E 9   ? 0.5339 0.5735 0.3884 0.1284  -0.0040 0.0723  9   DA  B C6    
2661 N N6    . DA  E 9   ? 0.5201 0.5574 0.3903 0.1099  -0.0138 0.0736  9   DA  B N6    
2662 N N1    . DA  E 9   ? 0.5332 0.6071 0.3957 0.1367  -0.0009 0.0804  9   DA  B N1    
2663 C C2    . DA  E 9   ? 0.5479 0.6240 0.3948 0.1570  0.0084  0.0787  9   DA  B C2    
2664 N N3    . DA  E 9   ? 0.5670 0.6125 0.3889 0.1705  0.0152  0.0699  9   DA  B N3    
2665 C C4    . DA  E 9   ? 0.5645 0.5761 0.3799 0.1600  0.0118  0.0622  9   DA  B C4    
2666 P P     . DG  E 10  ? 0.6920 0.6084 0.3781 0.2496  0.0466  0.0297  10  DG  B P     
2667 O OP1   . DG  E 10  ? 0.7260 0.6147 0.3891 0.2710  0.0524  0.0236  10  DG  B OP1   
2668 O OP2   . DG  E 10  ? 0.6944 0.5909 0.3764 0.2348  0.0404  0.0234  10  DG  B OP2   
2669 O "O5'" . DG  E 10  ? 0.6736 0.6432 0.3687 0.2575  0.0516  0.0400  10  DG  B "O5'" 
2670 C "C5'" . DG  E 10  ? 0.6614 0.6626 0.3672 0.2710  0.0562  0.0473  10  DG  B "C5'" 
2671 C "C4'" . DG  E 10  ? 0.6349 0.6909 0.3638 0.2656  0.0579  0.0594  10  DG  B "C4'" 
2672 O "O4'" . DG  E 10  ? 0.6004 0.6659 0.3553 0.2399  0.0487  0.0654  10  DG  B "O4'" 
2673 C "C3'" . DG  E 10  ? 0.6488 0.7187 0.3644 0.2698  0.0641  0.0604  10  DG  B "C3'" 
2674 O "O3'" . DG  E 10  ? 0.6593 0.7741 0.3812 0.2865  0.0740  0.0681  10  DG  B "O3'" 
2675 C "C2'" . DG  E 10  ? 0.6220 0.7020 0.3555 0.2432  0.0567  0.0670  10  DG  B "C2'" 
2676 C "C1'" . DG  E 10  ? 0.5902 0.6842 0.3545 0.2292  0.0493  0.0732  10  DG  B "C1'" 
2677 N N9    . DG  E 10  ? 0.5624 0.6442 0.3408 0.2040  0.0386  0.0742  10  DG  B N9    
2678 C C8    . DG  E 10  ? 0.5646 0.6038 0.3327 0.1945  0.0322  0.0644  10  DG  B C8    
2679 N N7    . DG  E 10  ? 0.5425 0.5819 0.3289 0.1732  0.0229  0.0675  10  DG  B N7    
2680 C C5    . DG  E 10  ? 0.5273 0.6095 0.3362 0.1672  0.0227  0.0803  10  DG  B C5    
2681 C C6    . DG  E 10  ? 0.5000 0.5985 0.3338 0.1463  0.0137  0.0886  10  DG  B C6    
2682 O O6    . DG  E 10  ? 0.4912 0.5697 0.3315 0.1300  0.0041  0.0858  10  DG  B O6    
2683 N N1    . DG  E 10  ? 0.4873 0.6302 0.3411 0.1454  0.0163  0.1012  10  DG  B N1    
2684 C C2    . DG  E 10  ? 0.4953 0.6669 0.3473 0.1634  0.0267  0.1051  10  DG  B C2    
2685 N N2    . DG  E 10  ? 0.4799 0.6964 0.3579 0.1582  0.0276  0.1178  10  DG  B N2    
2686 N N3    . DG  E 10  ? 0.5207 0.6777 0.3483 0.1851  0.0354  0.0969  10  DG  B N3    
2687 C C4    . DG  E 10  ? 0.5365 0.6469 0.3426 0.1853  0.0325  0.0848  10  DG  B C4    
2688 P P     . DT  E 11  ? 0.6953 0.8302 0.3996 0.2979  0.0849  0.0700  11  DT  B P     
2689 O OP1   . DT  E 11  ? 0.7127 0.8753 0.4135 0.3255  0.0963  0.0710  11  DT  B OP1   
2690 O OP2   . DT  E 11  ? 0.7201 0.8085 0.3927 0.2959  0.0814  0.0585  11  DT  B OP2   
2691 O "O5'" . DT  E 11  ? 0.6739 0.8526 0.4072 0.2761  0.0842  0.0855  11  DT  B "O5'" 
2692 C "C5'" . DT  E 11  ? 0.6514 0.8749 0.4221 0.2696  0.0836  0.0974  11  DT  B "C5'" 
2693 C "C4'" . DT  E 11  ? 0.6357 0.8859 0.4307 0.2439  0.0799  0.1107  11  DT  B "C4'" 
2694 O "O4'" . DT  E 11  ? 0.6153 0.8304 0.4133 0.2221  0.0658  0.1066  11  DT  B "O4'" 
2695 C "C3'" . DT  E 11  ? 0.6649 0.9261 0.4427 0.2440  0.0893  0.1162  11  DT  B "C3'" 
2696 O "O3'" . DT  E 11  ? 0.6741 0.9924 0.4732 0.2476  0.1010  0.1306  11  DT  B "O3'" 
2697 C "C2'" . DT  E 11  ? 0.6452 0.8859 0.4267 0.2167  0.0775  0.1193  11  DT  B "C2'" 
2698 C "C1'" . DT  E 11  ? 0.6064 0.8322 0.4114 0.2027  0.0635  0.1160  11  DT  B "C1'" 
2699 N N1    . DT  E 11  ? 0.5903 0.7711 0.3859 0.1869  0.0509  0.1079  11  DT  B N1    
2700 C C2    . DT  E 11  ? 0.5678 0.7526 0.3857 0.1625  0.0403  0.1155  11  DT  B C2    
2701 O O2    . DT  E 11  ? 0.5556 0.7769 0.4002 0.1517  0.0402  0.1288  11  DT  B O2    
2702 N N3    . DT  E 11  ? 0.5609 0.7050 0.3701 0.1511  0.0293  0.1066  11  DT  B N3    
2703 C C4    . DT  E 11  ? 0.5737 0.6758 0.3571 0.1597  0.0278  0.0917  11  DT  B C4    
2704 O O4    . DT  E 11  ? 0.5701 0.6410 0.3519 0.1478  0.0175  0.0847  11  DT  B O4    
2705 C C5    . DT  E 11  ? 0.5932 0.6910 0.3536 0.1839  0.0386  0.0847  11  DT  B C5    
2706 C C7    . DT  E 11  ? 0.6086 0.6598 0.3411 0.1937  0.0369  0.0685  11  DT  B C7    
2707 C C6    . DT  E 11  ? 0.6015 0.7378 0.3679 0.1971  0.0496  0.0928  11  DT  B C6    
2708 P P     . DG  E 12  ? 0.7045 1.0452 0.4888 0.2483  0.1145  0.1406  12  DG  B P     
2709 O OP1   . DG  E 12  ? 0.7142 1.1102 0.5144 0.2648  0.1310  0.1499  12  DG  B OP1   
2710 O OP2   . DG  E 12  ? 0.7312 1.0244 0.4695 0.2575  0.1139  0.1276  12  DG  B OP2   
2711 O "O5'" . DG  E 12  ? 0.6826 1.0356 0.4929 0.2158  0.1060  0.1553  12  DG  B "O5'" 
2712 C "C5'" . DG  E 12  ? 0.6491 1.0352 0.5047 0.1996  0.0997  0.1660  12  DG  B "C5'" 
2713 C "C4'" . DG  E 12  ? 0.6354 1.0253 0.5077 0.1700  0.0920  0.1792  12  DG  B "C4'" 
2714 O "O4'" . DG  E 12  ? 0.6218 0.9610 0.4831 0.1566  0.0749  0.1691  12  DG  B "O4'" 
2715 C "C3'" . DG  E 12  ? 0.6613 1.0631 0.5148 0.1677  0.1041  0.1909  12  DG  B "C3'" 
2716 O "O3'" . DG  E 12  ? 0.6441 1.0833 0.5314 0.1456  0.1050  0.2109  12  DG  B "O3'" 
2717 C "C2'" . DG  E 12  ? 0.6733 1.0196 0.4927 0.1614  0.0930  0.1810  12  DG  B "C2'" 
2718 C "C1'" . DG  E 12  ? 0.6382 0.9589 0.4790 0.1458  0.0736  0.1735  12  DG  B "C1'" 
2719 N N9    . DG  E 12  ? 0.6389 0.9051 0.4521 0.1480  0.0627  0.1566  12  DG  B N9    
2720 C C8    . DG  E 12  ? 0.6546 0.8924 0.4384 0.1690  0.0658  0.1402  12  DG  B C8    
2721 N N7    . DG  E 12  ? 0.6551 0.8470 0.4230 0.1638  0.0538  0.1278  12  DG  B N7    
2722 C C5    . DG  E 12  ? 0.6405 0.8306 0.4276 0.1394  0.0421  0.1360  12  DG  B C5    
2723 C C6    . DG  E 12  ? 0.6349 0.7871 0.4192 0.1249  0.0264  0.1287  12  DG  B C6    
2724 O O6    . DG  E 12  ? 0.6445 0.7581 0.4106 0.1297  0.0200  0.1135  12  DG  B O6    
2725 N N1    . DG  E 12  ? 0.6222 0.7852 0.4298 0.1029  0.0177  0.1410  12  DG  B N1    
2726 C C2    . DG  E 12  ? 0.6163 0.8202 0.4475 0.0940  0.0232  0.1586  12  DG  B C2    
2727 N N2    . DG  E 12  ? 0.6057 0.8099 0.4564 0.0719  0.0121  0.1685  12  DG  B N2    
2728 N N3    . DG  E 12  ? 0.6195 0.8618 0.4565 0.1058  0.0382  0.1660  12  DG  B N3    
2729 C C4    . DG  E 12  ? 0.6306 0.8639 0.4443 0.1292  0.0470  0.1537  12  DG  B C4    
2730 P P     . DT  E 13  ? 0.6696 1.1353 0.5457 0.1419  0.1216  0.2291  13  DT  B P     
2731 O OP1   . DT  E 13  ? 0.6593 1.1840 0.5809 0.1305  0.1300  0.2482  13  DT  B OP1   
2732 O OP2   . DT  E 13  ? 0.7034 1.1574 0.5342 0.1691  0.1359  0.2199  13  DT  B OP2   
2733 O "O5'" . DT  E 13  ? 0.6608 1.0884 0.5249 0.1179  0.1071  0.2334  13  DT  B "O5'" 
2734 C "C5'" . DT  E 13  ? 0.6206 1.0422 0.5182 0.0922  0.0893  0.2380  13  DT  B "C5'" 
2735 C "C4'" . DT  E 13  ? 0.6243 1.0083 0.5034 0.0746  0.0775  0.2415  13  DT  B "C4'" 
2736 O "O4'" . DT  E 13  ? 0.6196 0.9519 0.4724 0.0818  0.0642  0.2209  13  DT  B "O4'" 
2737 C "C3'" . DT  E 13  ? 0.6604 1.0492 0.5081 0.0771  0.0913  0.2545  13  DT  B "C3'" 
2738 O "O3'" . DT  E 13  ? 0.6592 1.0526 0.5222 0.0514  0.0860  0.2737  13  DT  B "O3'" 
2739 C "C2'" . DT  E 13  ? 0.6820 1.0196 0.4820 0.0906  0.0845  0.2368  13  DT  B "C2'" 
2740 C "C1'" . DT  E 13  ? 0.6498 0.9529 0.4649 0.0824  0.0632  0.2209  13  DT  B "C1'" 
2741 N N1    . DT  E 13  ? 0.6581 0.9200 0.4411 0.0999  0.0578  0.1983  13  DT  B N1    
2742 C C2    . DT  E 13  ? 0.6581 0.8755 0.4311 0.0908  0.0395  0.1879  13  DT  B C2    
2743 O O2    . DT  E 13  ? 0.6555 0.8640 0.4427 0.0705  0.0271  0.1957  13  DT  B O2    
2744 N N3    . DT  E 13  ? 0.6615 0.8448 0.4086 0.1064  0.0359  0.1677  13  DT  B N3    
2745 C C4    . DT  E 13  ? 0.6699 0.8554 0.3978 0.1301  0.0478  0.1571  13  DT  B C4    
2746 O O4    . DT  E 13  ? 0.6774 0.8280 0.3831 0.1415  0.0426  0.1392  13  DT  B O4    
2747 C C5    . DT  E 13  ? 0.6730 0.9049 0.4104 0.1405  0.0665  0.1684  13  DT  B C5    
2748 C C7    . DT  E 13  ? 0.6875 0.9249 0.4052 0.1682  0.0801  0.1578  13  DT  B C7    
2749 C C6    . DT  E 13  ? 0.6668 0.9360 0.4324 0.1249  0.0708  0.1883  13  DT  B C6    
2750 P P     . DT  E 14  ? 0.7041 1.1149 0.5448 0.0487  0.1030  0.2951  14  DT  B P     
2751 O OP1   . DT  E 14  ? 0.6976 1.1397 0.5786 0.0225  0.1036  0.3185  14  DT  B OP1   
2752 O OP2   . DT  E 14  ? 0.7273 1.1608 0.5427 0.0760  0.1254  0.2916  14  DT  B OP2   
2753 O "O5'" . DT  E 14  ? 0.7231 1.0784 0.5216 0.0454  0.0887  0.2894  14  DT  B "O5'" 
2754 C "C5'" . DT  E 14  ? 0.7010 1.0250 0.5142 0.0235  0.0658  0.2893  14  DT  B "C5'" 
2755 C "C4'" . DT  E 14  ? 0.7147 0.9859 0.4866 0.0286  0.0517  0.2765  14  DT  B "C4'" 
2756 O "O4'" . DT  E 14  ? 0.6918 0.9388 0.4560 0.0443  0.0440  0.2508  14  DT  B "O4'" 
2757 C "C3'" . DT  E 14  ? 0.7625 1.0272 0.4845 0.0427  0.0642  0.2816  14  DT  B "C3'" 
2758 O "O3'" . DT  E 14  ? 0.7921 1.0593 0.5084 0.0257  0.0655  0.3051  14  DT  B "O3'" 
2759 C "C2'" . DT  E 14  ? 0.7601 0.9736 0.4493 0.0537  0.0472  0.2584  14  DT  B "C2'" 
2760 C "C1'" . DT  E 14  ? 0.7087 0.9160 0.4290 0.0548  0.0370  0.2394  14  DT  B "C1'" 
2761 N N1    . DT  E 14  ? 0.6928 0.8919 0.3920 0.0795  0.0433  0.2189  14  DT  B N1    
2762 C C2    . DT  E 14  ? 0.6761 0.8334 0.3632 0.0846  0.0274  0.1973  14  DT  B C2    
2763 O O2    . DT  E 14  ? 0.6626 0.7916 0.3565 0.0708  0.0087  0.1935  14  DT  B O2    
2764 N N3    . DT  E 14  ? 0.6789 0.8287 0.3469 0.1065  0.0342  0.1802  14  DT  B N3    
2765 C C4    . DT  E 14  ? 0.6901 0.8688 0.3485 0.1254  0.0545  0.1817  14  DT  B C4    
2766 O O4    . DT  E 14  ? 0.6998 0.8654 0.3396 0.1453  0.0582  0.1651  14  DT  B O4    
2767 C C5    . DT  E 14  ? 0.6950 0.9203 0.3682 0.1202  0.0712  0.2044  14  DT  B C5    
2768 C C7    . DT  E 14  ? 0.7068 0.9701 0.3743 0.1408  0.0946  0.2078  14  DT  B C7    
2769 C C6    . DT  E 14  ? 0.6954 0.9287 0.3887 0.0968  0.0650  0.2221  14  DT  B C6    
2770 P P     . DA  F 2   ? 0.7185 0.7841 0.6028 0.1524  0.0074  -0.1462 2   DA  C P     
2771 O OP1   . DA  F 2   ? 0.7317 0.8269 0.6194 0.1513  0.0151  -0.1743 2   DA  C OP1   
2772 O OP2   . DA  F 2   ? 0.7207 0.7736 0.6156 0.1367  0.0256  -0.1431 2   DA  C OP2   
2773 O "O5'" . DA  F 2   ? 0.7069 0.7795 0.5761 0.1705  -0.0224 -0.1503 2   DA  C "O5'" 
2774 C "C5'" . DA  F 2   ? 0.7122 0.8039 0.5658 0.1901  -0.0409 -0.1649 2   DA  C "C5'" 
2775 C "C4'" . DA  F 2   ? 0.7193 0.7836 0.5431 0.2090  -0.0686 -0.1492 2   DA  C "C4'" 
2776 O "O4'" . DA  F 2   ? 0.7202 0.7453 0.5303 0.2052  -0.0731 -0.1142 2   DA  C "O4'" 
2777 C "C3'" . DA  F 2   ? 0.7106 0.7621 0.5316 0.2076  -0.0751 -0.1459 2   DA  C "C3'" 
2778 O "O3'" . DA  F 2   ? 0.7334 0.7789 0.5225 0.2329  -0.1005 -0.1542 2   DA  C "O3'" 
2779 C "C2'" . DA  F 2   ? 0.7024 0.7117 0.5214 0.1930  -0.0726 -0.1084 2   DA  C "C2'" 
2780 C "C1'" . DA  F 2   ? 0.7229 0.7153 0.5244 0.1976  -0.0801 -0.0907 2   DA  C "C1'" 
2781 N N9    . DA  F 2   ? 0.7188 0.6969 0.5307 0.1807  -0.0674 -0.0605 2   DA  C N9    
2782 C C8    . DA  F 2   ? 0.6966 0.6881 0.5352 0.1685  -0.0418 -0.0582 2   DA  C C8    
2783 N N7    . DA  F 2   ? 0.6871 0.6672 0.5265 0.1604  -0.0357 -0.0278 2   DA  C N7    
2784 C C5    . DA  F 2   ? 0.7119 0.6712 0.5253 0.1617  -0.0587 -0.0093 2   DA  C C5    
2785 C C6    . DA  F 2   ? 0.7227 0.6696 0.5236 0.1513  -0.0648 0.0239  2   DA  C C6    
2786 N N6    . DA  F 2   ? 0.7099 0.6720 0.5268 0.1430  -0.0481 0.0454  2   DA  C N6    
2787 N N1    . DA  F 2   ? 0.7477 0.6666 0.5148 0.1500  -0.0881 0.0339  2   DA  C N1    
2788 C C2    . DA  F 2   ? 0.7668 0.6678 0.5115 0.1647  -0.1044 0.0126  2   DA  C C2    
2789 N N3    . DA  F 2   ? 0.7621 0.6809 0.5180 0.1801  -0.1016 -0.0190 2   DA  C N3    
2790 C C4    . DA  F 2   ? 0.7323 0.6827 0.5250 0.1747  -0.0780 -0.0288 2   DA  C C4    
2791 P P     . DA  F 3   ? 0.7346 0.7677 0.5122 0.2391  -0.1120 -0.1555 3   DA  C P     
2792 O OP1   . DA  F 3   ? 0.7671 0.8283 0.5233 0.2695  -0.1284 -0.1837 3   DA  C OP1   
2793 O OP2   . DA  F 3   ? 0.6991 0.7448 0.5110 0.2148  -0.0906 -0.1545 3   DA  C OP2   
2794 O "O5'" . DA  F 3   ? 0.7429 0.7104 0.4846 0.2391  -0.1295 -0.1214 3   DA  C "O5'" 
2795 C "C5'" . DA  F 3   ? 0.7751 0.7101 0.4743 0.2569  -0.1484 -0.1138 3   DA  C "C5'" 
2796 C "C4'" . DA  F 3   ? 0.7937 0.6649 0.4585 0.2461  -0.1616 -0.0817 3   DA  C "C4'" 
2797 O "O4'" . DA  F 3   ? 0.7620 0.6314 0.4509 0.2175  -0.1471 -0.0553 3   DA  C "O4'" 
2798 C "C3'" . DA  F 3   ? 0.7932 0.6432 0.4484 0.2433  -0.1690 -0.0791 3   DA  C "C3'" 
2799 O "O3'" . DA  F 3   ? 0.8566 0.6420 0.4520 0.2517  -0.1918 -0.0659 3   DA  C "O3'" 
2800 C "C2'" . DA  F 3   ? 0.7472 0.6051 0.4400 0.2111  -0.1511 -0.0574 3   DA  C "C2'" 
2801 C "C1'" . DA  F 3   ? 0.7530 0.6045 0.4467 0.1981  -0.1457 -0.0365 3   DA  C "C1'" 
2802 N N9    . DA  F 3   ? 0.7057 0.5870 0.4433 0.1775  -0.1220 -0.0242 3   DA  C N9    
2803 C C8    . DA  F 3   ? 0.6653 0.5857 0.4425 0.1757  -0.1003 -0.0406 3   DA  C C8    
2804 N N7    . DA  F 3   ? 0.6329 0.5637 0.4346 0.1600  -0.0810 -0.0231 3   DA  C N7    
2805 C C5    . DA  F 3   ? 0.6598 0.5681 0.4420 0.1503  -0.0913 0.0065  3   DA  C C5    
2806 C C6    . DA  F 3   ? 0.6409 0.5564 0.4333 0.1352  -0.0809 0.0353  3   DA  C C6    
2807 N N6    . DA  F 3   ? 0.6130 0.5529 0.4350 0.1323  -0.0566 0.0395  3   DA  C N6    
2808 N N1    . DA  F 3   ? 0.6659 0.5625 0.4323 0.1236  -0.0958 0.0594  3   DA  C N1    
2809 C C2    . DA  F 3   ? 0.7096 0.5691 0.4365 0.1269  -0.1189 0.0554  3   DA  C C2    
2810 N N3    . DA  F 3   ? 0.7337 0.5759 0.4428 0.1461  -0.1307 0.0301  3   DA  C N3    
2811 C C4    . DA  F 3   ? 0.7002 0.5748 0.4420 0.1575  -0.1162 0.0061  3   DA  C C4    
2812 P P     . DC  F 4   ? 0.8868 0.6376 0.4553 0.2554  -0.2048 -0.0660 4   DC  C P     
2813 O OP1   . DC  F 4   ? 0.9442 0.6395 0.4673 0.2689  -0.2137 -0.0683 4   DC  C OP1   
2814 O OP2   . DC  F 4   ? 0.8468 0.6535 0.4559 0.2630  -0.1942 -0.0895 4   DC  C OP2   
2815 O "O5'" . DC  F 4   ? 0.8698 0.5965 0.4465 0.2173  -0.2002 -0.0339 4   DC  C "O5'" 
2816 C "C5'" . DC  F 4   ? 0.9034 0.5891 0.4505 0.1978  -0.2062 -0.0077 4   DC  C "C5'" 
2817 C "C4'" . DC  F 4   ? 0.8858 0.5781 0.4564 0.1615  -0.1972 0.0187  4   DC  C "C4'" 
2818 O "O4'" . DC  F 4   ? 0.8143 0.5658 0.4444 0.1519  -0.1737 0.0222  4   DC  C "O4'" 
2819 C "C3'" . DC  F 4   ? 0.8965 0.5860 0.4722 0.1559  -0.1995 0.0172  4   DC  C "C3'" 
2820 O "O3'" . DC  F 4   ? 0.9829 0.6161 0.5120 0.1378  -0.2140 0.0318  4   DC  C "O3'" 
2821 C "C2'" . DC  F 4   ? 0.8171 0.5612 0.4529 0.1354  -0.1766 0.0297  4   DC  C "C2'" 
2822 C "C1'" . DC  F 4   ? 0.7874 0.5555 0.4427 0.1296  -0.1643 0.0392  4   DC  C "C1'" 
2823 N N1    . DC  F 4   ? 0.7248 0.5476 0.4362 0.1298  -0.1386 0.0350  4   DC  C N1    
2824 C C2    . DC  F 4   ? 0.7008 0.5489 0.4362 0.1119  -0.1236 0.0589  4   DC  C C2    
2825 O O2    . DC  F 4   ? 0.7236 0.5587 0.4384 0.0933  -0.1323 0.0827  4   DC  C O2    
2826 N N3    . DC  F 4   ? 0.6630 0.5489 0.4392 0.1154  -0.0993 0.0551  4   DC  C N3    
2827 C C4    . DC  F 4   ? 0.6427 0.5412 0.4367 0.1294  -0.0896 0.0284  4   DC  C C4    
2828 N N4    . DC  F 4   ? 0.6054 0.5303 0.4312 0.1291  -0.0643 0.0254  4   DC  C N4    
2829 C C5    . DC  F 4   ? 0.6600 0.5450 0.4357 0.1446  -0.1049 0.0032  4   DC  C C5    
2830 C C6    . DC  F 4   ? 0.7020 0.5492 0.4362 0.1474  -0.1293 0.0078  4   DC  C C6    
2831 P P     . DA  F 5   ? 1.0208 0.6420 0.5457 0.1285  -0.2188 0.0323  5   DA  C P     
2832 O OP1   . DA  F 5   ? 1.0875 0.6426 0.5602 0.1187  -0.2307 0.0328  5   DA  C OP1   
2833 O OP2   . DA  F 5   ? 0.9926 0.6484 0.5430 0.1565  -0.2156 0.0096  5   DA  C OP2   
2834 O "O5'" . DA  F 5   ? 0.9975 0.6528 0.5531 0.0954  -0.2094 0.0599  5   DA  C "O5'" 
2835 C "C5'" . DA  F 5   ? 1.0256 0.6739 0.5684 0.0659  -0.2098 0.0848  5   DA  C "C5'" 
2836 C "C4'" . DA  F 5   ? 0.9787 0.6909 0.5738 0.0456  -0.1911 0.1043  5   DA  C "C4'" 
2837 O "O4'" . DA  F 5   ? 0.9269 0.6880 0.5725 0.0645  -0.1705 0.0953  5   DA  C "O4'" 
2838 C "C3'" . DA  F 5   ? 0.9548 0.6885 0.5697 0.0385  -0.1875 0.1069  5   DA  C "C3'" 
2839 O "O3'" . DA  F 5   ? 0.9973 0.7103 0.5788 0.0062  -0.2004 0.1255  5   DA  C "O3'" 
2840 C "C2'" . DA  F 5   ? 0.8908 0.6936 0.5666 0.0407  -0.1617 0.1156  5   DA  C "C2'" 
2841 C "C1'" . DA  F 5   ? 0.8854 0.6980 0.5744 0.0550  -0.1522 0.1088  5   DA  C "C1'" 
2842 N N9    . DA  F 5   ? 0.8435 0.6879 0.5741 0.0770  -0.1322 0.0918  5   DA  C N9    
2843 C C8    . DA  F 5   ? 0.8392 0.6748 0.5723 0.0987  -0.1329 0.0640  5   DA  C C8    
2844 N N7    . DA  F 5   ? 0.7978 0.6672 0.5691 0.1086  -0.1110 0.0533  5   DA  C N7    
2845 C C5    . DA  F 5   ? 0.7885 0.6846 0.5807 0.0971  -0.0949 0.0763  5   DA  C C5    
2846 C C6    . DA  F 5   ? 0.7562 0.6831 0.5811 0.1017  -0.0681 0.0792  5   DA  C C6    
2847 N N6    . DA  F 5   ? 0.7433 0.6769 0.5869 0.1130  -0.0519 0.0572  5   DA  C N6    
2848 N N1    . DA  F 5   ? 0.7530 0.7028 0.5862 0.0939  -0.0581 0.1053  5   DA  C N1    
2849 C C2    . DA  F 5   ? 0.7666 0.7169 0.5810 0.0774  -0.0739 0.1263  5   DA  C C2    
2850 N N3    . DA  F 5   ? 0.7942 0.7132 0.5763 0.0656  -0.0986 0.1257  5   DA  C N3    
2851 C C4    . DA  F 5   ? 0.8050 0.6933 0.5755 0.0786  -0.1080 0.1001  5   DA  C C4    
2852 P P     . DC  F 6   ? 0.9904 0.7261 0.5848 -0.0064 -0.1998 0.1316  6   DC  C P     
2853 O OP1   . DC  F 6   ? 1.0563 0.7500 0.6031 -0.0373 -0.2160 0.1383  6   DC  C OP1   
2854 O OP2   . DC  F 6   ? 0.9639 0.7049 0.5807 0.0244  -0.1942 0.1095  6   DC  C OP2   
2855 O "O5'" . DC  F 6   ? 0.9152 0.7298 0.5616 -0.0179 -0.1785 0.1533  6   DC  C "O5'" 
2856 C "C5'" . DC  F 6   ? 0.9003 0.7384 0.5440 -0.0411 -0.1762 0.1745  6   DC  C "C5'" 
2857 C "C4'" . DC  F 6   ? 0.8207 0.7382 0.5153 -0.0381 -0.1537 0.1913  6   DC  C "C4'" 
2858 O "O4'" . DC  F 6   ? 0.7667 0.6980 0.4975 -0.0049 -0.1345 0.1783  6   DC  C "O4'" 
2859 C "C3'" . DC  F 6   ? 0.7894 0.7459 0.5013 -0.0434 -0.1493 0.1996  6   DC  C "C3'" 
2860 O "O3'" . DC  F 6   ? 0.7738 0.7977 0.5020 -0.0604 -0.1406 0.2248  6   DC  C "O3'" 
2861 C "C2'" . DC  F 6   ? 0.7399 0.7078 0.4887 -0.0081 -0.1305 0.1852  6   DC  C "C2'" 
2862 C "C1'" . DC  F 6   ? 0.7215 0.6935 0.4868 0.0084  -0.1170 0.1812  6   DC  C "C1'" 
2863 N N1    . DC  F 6   ? 0.6920 0.6486 0.4769 0.0372  -0.1045 0.1579  6   DC  C N1    
2864 C C2    . DC  F 6   ? 0.6608 0.6486 0.4783 0.0553  -0.0784 0.1594  6   DC  C C2    
2865 O O2    . DC  F 6   ? 0.6564 0.6848 0.4859 0.0530  -0.0666 0.1808  6   DC  C O2    
2866 N N3    . DC  F 6   ? 0.6418 0.6146 0.4731 0.0746  -0.0665 0.1369  6   DC  C N3    
2867 C C4    . DC  F 6   ? 0.6492 0.5888 0.4672 0.0790  -0.0801 0.1139  6   DC  C C4    
2868 N N4    . DC  F 6   ? 0.6380 0.5743 0.4713 0.0947  -0.0672 0.0913  6   DC  C N4    
2869 C C5    . DC  F 6   ? 0.6802 0.5882 0.4642 0.0673  -0.1070 0.1126  6   DC  C C5    
2870 C C6    . DC  F 6   ? 0.7038 0.6161 0.4703 0.0453  -0.1179 0.1347  6   DC  C C6    
2871 P P     . DT  F 7   ? 0.7724 0.8485 0.5128 -0.0722 -0.1381 0.2367  7   DT  C P     
2872 O OP1   . DT  F 7   ? 0.7751 0.9113 0.5268 -0.0953 -0.1319 0.2519  7   DT  C OP1   
2873 O OP2   . DT  F 7   ? 0.8040 0.8288 0.5126 -0.0840 -0.1576 0.2241  7   DT  C OP2   
2874 O "O5'" . DT  F 7   ? 0.7268 0.8391 0.5087 -0.0337 -0.1140 0.2366  7   DT  C "O5'" 
2875 C "C5'" . DT  F 7   ? 0.6976 0.8431 0.5058 -0.0116 -0.0923 0.2442  7   DT  C "C5'" 
2876 C "C4'" . DT  F 7   ? 0.6622 0.8179 0.4975 0.0229  -0.0692 0.2391  7   DT  C "C4'" 
2877 O "O4'" . DT  F 7   ? 0.6433 0.7422 0.4798 0.0393  -0.0664 0.2135  7   DT  C "O4'" 
2878 C "C3'" . DT  F 7   ? 0.6606 0.8360 0.4990 0.0242  -0.0695 0.2426  7   DT  C "C3'" 
2879 O "O3'" . DT  F 7   ? 0.6553 0.8861 0.5148 0.0452  -0.0468 0.2582  7   DT  C "O3'" 
2880 C "C2'" . DT  F 7   ? 0.6425 0.7622 0.4815 0.0397  -0.0687 0.2173  7   DT  C "C2'" 
2881 C "C1'" . DT  F 7   ? 0.6208 0.7145 0.4685 0.0559  -0.0560 0.2050  7   DT  C "C1'" 
2882 N N1    . DT  F 7   ? 0.6027 0.6429 0.4447 0.0627  -0.0621 0.1767  7   DT  C N1    
2883 C C2    . DT  F 7   ? 0.5741 0.6025 0.4325 0.0835  -0.0415 0.1621  7   DT  C C2    
2884 O O2    . DT  F 7   ? 0.5612 0.6094 0.4339 0.0975  -0.0177 0.1714  7   DT  C O2    
2885 N N3    . DT  F 7   ? 0.5679 0.5601 0.4209 0.0875  -0.0493 0.1355  7   DT  C N3    
2886 C C4    . DT  F 7   ? 0.5809 0.5436 0.4109 0.0789  -0.0751 0.1230  7   DT  C C4    
2887 O O4    . DT  F 7   ? 0.5759 0.5144 0.4012 0.0883  -0.0802 0.0989  7   DT  C O4    
2888 C C5    . DT  F 7   ? 0.6084 0.5716 0.4159 0.0580  -0.0953 0.1398  7   DT  C C5    
2889 C C7    . DT  F 7   ? 0.6372 0.5559 0.4076 0.0481  -0.1231 0.1283  7   DT  C C7    
2890 C C6    . DT  F 7   ? 0.6168 0.6209 0.4330 0.0481  -0.0879 0.1652  7   DT  C C6    
2891 P P     . DC  F 8   ? 0.6642 0.9522 0.5322 0.0352  -0.0475 0.2672  8   DC  C P     
2892 O OP1   . DC  F 8   ? 0.6711 1.0174 0.5508 0.0247  -0.0435 0.2786  8   DC  C OP1   
2893 O OP2   . DC  F 8   ? 0.6834 0.9458 0.5308 0.0108  -0.0712 0.2602  8   DC  C OP2   
2894 O "O5'" . DC  F 8   ? 0.6267 0.9276 0.5114 0.0725  -0.0219 0.2691  8   DC  C "O5'" 
2895 C "C5'" . DC  F 8   ? 0.5986 0.8552 0.4771 0.0870  -0.0193 0.2598  8   DC  C "C5'" 
2896 C "C4'" . DC  F 8   ? 0.5690 0.7962 0.4521 0.1186  0.0069  0.2568  8   DC  C "C4'" 
2897 O "O4'" . DC  F 8   ? 0.5669 0.7405 0.4475 0.1095  -0.0003 0.2354  8   DC  C "O4'" 
2898 C "C3'" . DC  F 8   ? 0.5468 0.7510 0.4314 0.1399  0.0238  0.2498  8   DC  C "C3'" 
2899 O "O3'" . DC  F 8   ? 0.5302 0.7739 0.4219 0.1601  0.0431  0.2625  8   DC  C "O3'" 
2900 C "C2'" . DC  F 8   ? 0.5515 0.7024 0.4376 0.1509  0.0408  0.2314  8   DC  C "C2'" 
2901 C "C1'" . DC  F 8   ? 0.5588 0.6914 0.4440 0.1282  0.0190  0.2185  8   DC  C "C1'" 
2902 N N1    . DC  F 8   ? 0.5641 0.6544 0.4457 0.1155  0.0020  0.1927  8   DC  C N1    
2903 C C2    . DC  F 8   ? 0.5633 0.6161 0.4491 0.1248  0.0152  0.1701  8   DC  C C2    
2904 O O2    . DC  F 8   ? 0.5644 0.6108 0.4540 0.1398  0.0413  0.1716  8   DC  C O2    
2905 N N3    . DC  F 8   ? 0.5648 0.5903 0.4469 0.1170  -0.0007 0.1466  8   DC  C N3    
2906 C C4    . DC  F 8   ? 0.5703 0.5934 0.4397 0.1029  -0.0283 0.1455  8   DC  C C4    
2907 N N4    . DC  F 8   ? 0.5694 0.5638 0.4301 0.1016  -0.0430 0.1220  8   DC  C N4    
2908 C C5    . DC  F 8   ? 0.5804 0.6313 0.4416 0.0893  -0.0415 0.1679  8   DC  C C5    
2909 C C6    . DC  F 8   ? 0.5740 0.6635 0.4443 0.0950  -0.0259 0.1906  8   DC  C C6    
2910 P P     . DC  F 9   ? 0.5098 0.7550 0.4007 0.1744  0.0522  0.2625  9   DC  C P     
2911 O OP1   . DC  F 9   ? 0.5114 0.8064 0.4119 0.1937  0.0679  0.2737  9   DC  C OP1   
2912 O OP2   . DC  F 9   ? 0.4989 0.7410 0.3848 0.1510  0.0251  0.2566  9   DC  C OP2   
2913 O "O5'" . DC  F 9   ? 0.5190 0.7022 0.3982 0.1953  0.0762  0.2547  9   DC  C "O5'" 
2914 C "C5'" . DC  F 9   ? 0.5483 0.7104 0.4220 0.2161  0.1033  0.2562  9   DC  C "C5'" 
2915 C "C4'" . DC  F 9   ? 0.5940 0.6915 0.4559 0.2230  0.1239  0.2411  9   DC  C "C4'" 
2916 O "O4'" . DC  F 9   ? 0.5636 0.6343 0.4374 0.1964  0.1049  0.2142  9   DC  C "O4'" 
2917 C "C3'" . DC  F 9   ? 0.6289 0.7160 0.4832 0.2338  0.1354  0.2420  9   DC  C "C3'" 
2918 O "O3'" . DC  F 9   ? 0.6601 0.6976 0.4938 0.2520  0.1694  0.2400  9   DC  C "O3'" 
2919 C "C2'" . DC  F 9   ? 0.5997 0.6727 0.4676 0.2079  0.1128  0.2175  9   DC  C "C2'" 
2920 C "C1'" . DC  F 9   ? 0.5666 0.6151 0.4416 0.1908  0.1042  0.1979  9   DC  C "C1'" 
2921 N N1    . DC  F 9   ? 0.5552 0.6067 0.4401 0.1677  0.0717  0.1806  9   DC  C N1    
2922 C C2    . DC  F 9   ? 0.5606 0.5805 0.4488 0.1578  0.0683  0.1523  9   DC  C C2    
2923 O O2    . DC  F 9   ? 0.5844 0.5777 0.4702 0.1625  0.0925  0.1412  9   DC  C O2    
2924 N N3    . DC  F 9   ? 0.5530 0.5723 0.4427 0.1433  0.0389  0.1374  9   DC  C N3    
2925 C C4    . DC  F 9   ? 0.5548 0.5945 0.4397 0.1341  0.0145  0.1496  9   DC  C C4    
2926 N N4    . DC  F 9   ? 0.5500 0.5758 0.4266 0.1216  -0.0129 0.1344  9   DC  C N4    
2927 C C5    . DC  F 9   ? 0.5642 0.6400 0.4484 0.1374  0.0178  0.1776  9   DC  C C5    
2928 C C6    . DC  F 9   ? 0.5615 0.6465 0.4473 0.1565  0.0462  0.1922  9   DC  C C6    
2929 P P     . DC  F 10  ? 0.7407 0.7641 0.5603 0.2701  0.1894  0.2448  10  DC  C P     
2930 O OP1   . DC  F 10  ? 0.8055 0.7810 0.6027 0.2902  0.2214  0.2436  10  DC  C OP1   
2931 O OP2   . DC  F 10  ? 0.7384 0.8255 0.5757 0.2744  0.1708  0.2548  10  DC  C OP2   
2932 O "O5'" . DC  F 10  ? 0.7460 0.7383 0.5713 0.2473  0.1844  0.2212  10  DC  C "O5'" 
2933 C "C5'" . DC  F 10  ? 0.7560 0.7022 0.5809 0.2297  0.1936  0.1960  10  DC  C "C5'" 
2934 C "C4'" . DC  F 10  ? 0.7429 0.6852 0.5821 0.2080  0.1805  0.1711  10  DC  C "C4'" 
2935 O "O4'" . DC  F 10  ? 0.7063 0.6808 0.5683 0.1921  0.1441  0.1611  10  DC  C "O4'" 
2936 C "C3'" . DC  F 10  ? 0.7523 0.7029 0.5858 0.2168  0.1848  0.1784  10  DC  C "C3'" 
2937 O "O3'" . DC  F 10  ? 0.7745 0.6836 0.5942 0.2100  0.2098  0.1636  10  DC  C "O3'" 
2938 C "C2'" . DC  F 10  ? 0.7153 0.7036 0.5713 0.2028  0.1478  0.1682  10  DC  C "C2'" 
2939 C "C1'" . DC  F 10  ? 0.6889 0.6743 0.5582 0.1847  0.1291  0.1496  10  DC  C "C1'" 
2940 N N1    . DC  F 10  ? 0.6558 0.6719 0.5361 0.1753  0.0925  0.1496  10  DC  C N1    
2941 C C2    . DC  F 10  ? 0.6441 0.6547 0.5313 0.1605  0.0694  0.1246  10  DC  C C2    
2942 O O2    . DC  F 10  ? 0.6514 0.6438 0.5409 0.1553  0.0791  0.1023  10  DC  C O2    
2943 N N3    . DC  F 10  ? 0.6291 0.6543 0.5157 0.1521  0.0375  0.1253  10  DC  C N3    
2944 C C4    . DC  F 10  ? 0.6204 0.6713 0.5038 0.1525  0.0286  0.1486  10  DC  C C4    
2945 N N4    . DC  F 10  ? 0.6086 0.6667 0.4855 0.1385  -0.0019 0.1477  10  DC  C N4    
2946 C C5    . DC  F 10  ? 0.6305 0.7013 0.5129 0.1676  0.0510  0.1737  10  DC  C C5    
2947 C C6    . DC  F 10  ? 0.6469 0.6961 0.5259 0.1814  0.0824  0.1737  10  DC  C C6    
2948 P P     . DA  F 11  ? 0.7936 0.7017 0.6029 0.2176  0.2207  0.1687  11  DA  C P     
2949 O OP1   . DA  F 11  ? 0.8486 0.7005 0.6290 0.2142  0.2583  0.1630  11  DA  C OP1   
2950 O OP2   . DA  F 11  ? 0.7907 0.7347 0.5969 0.2421  0.2130  0.1968  11  DA  C OP2   
2951 O "O5'" . DA  F 11  ? 0.7529 0.6881 0.5880 0.1967  0.1922  0.1433  11  DA  C "O5'" 
2952 C "C5'" . DA  F 11  ? 0.7496 0.6765 0.5967 0.1740  0.1863  0.1141  11  DA  C "C5'" 
2953 C "C4'" . DA  F 11  ? 0.7249 0.6850 0.5916 0.1650  0.1541  0.0954  11  DA  C "C4'" 
2954 O "O4'" . DA  F 11  ? 0.6951 0.6789 0.5718 0.1683  0.1224  0.1030  11  DA  C "O4'" 
2955 C "C3'" . DA  F 11  ? 0.7298 0.7049 0.5938 0.1721  0.1530  0.0989  11  DA  C "C3'" 
2956 O "O3'" . DA  F 11  ? 0.7375 0.7132 0.6048 0.1583  0.1589  0.0732  11  DA  C "O3'" 
2957 C "C2'" . DA  F 11  ? 0.6944 0.7023 0.5686 0.1771  0.1156  0.1033  11  DA  C "C2'" 
2958 C "C1'" . DA  F 11  ? 0.6648 0.6715 0.5467 0.1683  0.0968  0.0960  11  DA  C "C1'" 
2959 N N9    . DA  F 11  ? 0.6337 0.6596 0.5161 0.1712  0.0710  0.1118  11  DA  C N9    
2960 C C8    . DA  F 11  ? 0.6361 0.6770 0.5140 0.1810  0.0761  0.1397  11  DA  C C8    
2961 N N7    . DA  F 11  ? 0.6329 0.6954 0.5114 0.1751  0.0487  0.1472  11  DA  C N7    
2962 C C5    . DA  F 11  ? 0.6132 0.6638 0.4919 0.1631  0.0243  0.1234  11  DA  C C5    
2963 C C6    . DA  F 11  ? 0.6034 0.6545 0.4738 0.1517  -0.0091 0.1179  11  DA  C C6    
2964 N N6    . DA  F 11  ? 0.5878 0.6577 0.4517 0.1440  -0.0240 0.1363  11  DA  C N6    
2965 N N1    . DA  F 11  ? 0.6100 0.6414 0.4745 0.1482  -0.0260 0.0926  11  DA  C N1    
2966 C C2    . DA  F 11  ? 0.6061 0.6306 0.4786 0.1536  -0.0109 0.0734  11  DA  C C2    
2967 N N3    . DA  F 11  ? 0.6000 0.6259 0.4825 0.1579  0.0205  0.0752  11  DA  C N3    
2968 C C4    . DA  F 11  ? 0.6147 0.6478 0.4974 0.1632  0.0372  0.1014  11  DA  C C4    
2969 P P     . DC  F 12  ? 0.7564 0.7443 0.6187 0.1629  0.1654  0.0730  12  DC  C P     
2970 O OP1   . DC  F 12  ? 0.7941 0.7595 0.6450 0.1474  0.1987  0.0608  12  DC  C OP1   
2971 O OP2   . DC  F 12  ? 0.7584 0.7524 0.6122 0.1836  0.1642  0.1020  12  DC  C OP2   
2972 O "O5'" . DC  F 12  ? 0.7273 0.7510 0.6055 0.1601  0.1301  0.0498  12  DC  C "O5'" 
2973 C "C5'" . DC  F 12  ? 0.7222 0.7554 0.6105 0.1471  0.1198  0.0215  12  DC  C "C5'" 
2974 C "C4'" . DC  F 12  ? 0.7025 0.7623 0.5958 0.1551  0.0824  0.0065  12  DC  C "C4'" 
2975 O "O4'" . DC  F 12  ? 0.6795 0.7311 0.5695 0.1626  0.0576  0.0218  12  DC  C "O4'" 
2976 C "C3'" . DC  F 12  ? 0.7092 0.7896 0.5989 0.1649  0.0760  0.0050  12  DC  C "C3'" 
2977 O "O3'" . DC  F 12  ? 0.7096 0.8168 0.6021 0.1666  0.0585  -0.0237 12  DC  C "O3'" 
2978 C "C2'" . DC  F 12  ? 0.6917 0.7685 0.5742 0.1775  0.0527  0.0257  12  DC  C "C2'" 
2979 C "C1'" . DC  F 12  ? 0.6696 0.7329 0.5524 0.1732  0.0341  0.0254  12  DC  C "C1'" 
2980 N N1    . DC  F 12  ? 0.6479 0.7050 0.5251 0.1759  0.0241  0.0517  12  DC  C N1    
2981 C C2    . DC  F 12  ? 0.6441 0.6979 0.5105 0.1753  -0.0096 0.0507  12  DC  C C2    
2982 O O2    . DC  F 12  ? 0.6466 0.6957 0.5046 0.1775  -0.0305 0.0286  12  DC  C O2    
2983 N N3    . DC  F 12  ? 0.6382 0.6945 0.4998 0.1724  -0.0176 0.0737  12  DC  C N3    
2984 C C4    . DC  F 12  ? 0.6231 0.6900 0.4913 0.1760  0.0056  0.0972  12  DC  C C4    
2985 N N4    . DC  F 12  ? 0.6147 0.6965 0.4789 0.1735  -0.0036 0.1186  12  DC  C N4    
2986 C C5    . DC  F 12  ? 0.6292 0.6916 0.5038 0.1822  0.0401  0.0994  12  DC  C C5    
2987 C C6    . DC  F 12  ? 0.6371 0.6919 0.5154 0.1790  0.0484  0.0763  12  DC  C C6    
2988 P P     . DG  F 13  ? 0.7174 0.8533 0.6064 0.1764  0.0541  -0.0326 13  DG  C P     
2989 O OP1   . DG  F 13  ? 0.7214 0.8921 0.6159 0.1734  0.0514  -0.0644 13  DG  C OP1   
2990 O OP2   . DG  F 13  ? 0.7344 0.8615 0.6205 0.1743  0.0822  -0.0115 13  DG  C OP2   
2991 O "O5'" . DG  F 13  ? 0.7007 0.8317 0.5768 0.1943  0.0168  -0.0272 13  DG  C "O5'" 
2992 C "C5'" . DG  F 13  ? 0.6809 0.8038 0.5476 0.2004  -0.0131 -0.0410 13  DG  C "C5'" 
2993 C "C4'" . DG  F 13  ? 0.6736 0.7813 0.5190 0.2127  -0.0439 -0.0336 13  DG  C "C4'" 
2994 O "O4'" . DG  F 13  ? 0.6704 0.7553 0.5141 0.2039  -0.0454 -0.0075 13  DG  C "O4'" 
2995 C "C3'" . DG  F 13  ? 0.6621 0.7875 0.5017 0.2236  -0.0449 -0.0317 13  DG  C "C3'" 
2996 O "O3'" . DG  F 13  ? 0.6720 0.7927 0.4866 0.2401  -0.0767 -0.0479 13  DG  C "O3'" 
2997 C "C2'" . DG  F 13  ? 0.6577 0.7722 0.4976 0.2184  -0.0391 -0.0015 13  DG  C "C2'" 
2998 C "C1'" . DG  F 13  ? 0.6617 0.7497 0.4959 0.2088  -0.0531 0.0073  13  DG  C "C1'" 
2999 N N9    . DG  F 13  ? 0.6293 0.7162 0.4721 0.2005  -0.0381 0.0357  13  DG  C N9    
3000 C C8    . DG  F 13  ? 0.6130 0.7074 0.4709 0.1991  -0.0045 0.0503  13  DG  C C8    
3001 N N7    . DG  F 13  ? 0.6091 0.7041 0.4677 0.1975  0.0016  0.0754  13  DG  C N7    
3002 C C5    . DG  F 13  ? 0.6112 0.7029 0.4573 0.1922  -0.0299 0.0771  13  DG  C C5    
3003 C C6    . DG  F 13  ? 0.6121 0.7123 0.4538 0.1852  -0.0388 0.0987  13  DG  C C6    
3004 O O6    . DG  F 13  ? 0.5989 0.7162 0.4483 0.1878  -0.0206 0.1216  13  DG  C O6    
3005 N N1    . DG  F 13  ? 0.6171 0.7045 0.4392 0.1747  -0.0721 0.0915  13  DG  C N1    
3006 C C2    . DG  F 13  ? 0.6280 0.6907 0.4322 0.1769  -0.0940 0.0671  13  DG  C C2    
3007 N N2    . DG  F 13  ? 0.6502 0.6901 0.4262 0.1658  -0.1238 0.0641  13  DG  C N2    
3008 N N3    . DG  F 13  ? 0.6347 0.6956 0.4442 0.1893  -0.0866 0.0469  13  DG  C N3    
3009 C C4    . DG  F 13  ? 0.6237 0.7030 0.4566 0.1937  -0.0542 0.0531  13  DG  C C4    
3010 P P     . DC  F 14  ? 0.6616 0.8078 0.4674 0.2571  -0.0815 -0.0576 14  DC  C P     
3011 O OP1   . DC  F 14  ? 0.6759 0.8337 0.4652 0.2760  -0.1001 -0.0869 14  DC  C OP1   
3012 O OP2   . DC  F 14  ? 0.6400 0.8138 0.4694 0.2490  -0.0478 -0.0470 14  DC  C OP2   
3013 O "O5'" . DC  F 14  ? 0.6631 0.7826 0.4440 0.2605  -0.1048 -0.0427 14  DC  C "O5'" 
3014 C "C5'" . DC  F 14  ? 0.6779 0.7572 0.4251 0.2638  -0.1370 -0.0487 14  DC  C "C5'" 
3015 C "C4'" . DC  F 14  ? 0.6739 0.7309 0.4075 0.2503  -0.1483 -0.0267 14  DC  C "C4'" 
3016 O "O4'" . DC  F 14  ? 0.6378 0.7045 0.3992 0.2320  -0.1267 -0.0037 14  DC  C "O4'" 
3017 C "C3'" . DC  F 14  ? 0.6725 0.7480 0.4010 0.2568  -0.1495 -0.0197 14  DC  C "C3'" 
3018 O "O3'" . DC  F 14  ? 0.7081 0.7528 0.3984 0.2642  -0.1772 -0.0341 14  DC  C "O3'" 
3019 C "C2'" . DC  F 14  ? 0.6584 0.7413 0.3992 0.2380  -0.1405 0.0091  14  DC  C "C2'" 
3020 C "C1'" . DC  F 14  ? 0.6444 0.7150 0.4000 0.2232  -0.1314 0.0168  14  DC  C "C1'" 
3021 N N1    . DC  F 14  ? 0.6162 0.7131 0.4025 0.2159  -0.1015 0.0406  14  DC  C N1    
3022 C C2    . DC  F 14  ? 0.6149 0.7149 0.4014 0.2014  -0.1038 0.0627  14  DC  C C2    
3023 O O2    . DC  F 14  ? 0.6348 0.7152 0.3968 0.1890  -0.1303 0.0619  14  DC  C O2    
3024 N N3    . DC  F 14  ? 0.5979 0.7217 0.4068 0.2014  -0.0763 0.0844  14  DC  C N3    
3025 C C4    . DC  F 14  ? 0.5839 0.7169 0.4101 0.2123  -0.0469 0.0845  14  DC  C C4    
3026 N N4    . DC  F 14  ? 0.5771 0.7229 0.4157 0.2153  -0.0197 0.1066  14  DC  C N4    
3027 C C5    . DC  F 14  ? 0.5804 0.7100 0.4075 0.2207  -0.0435 0.0617  14  DC  C C5    
3028 C C6    . DC  F 14  ? 0.5938 0.7110 0.4031 0.2236  -0.0716 0.0404  14  DC  C C6    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   HIS 1   319 319 HIS HIS D . n 
A 1 2   MET 2   320 320 MET MET D . n 
A 1 3   ARG 3   321 321 ARG ARG D . n 
A 1 4   PRO 4   322 322 PRO PRO D . n 
A 1 5   PHE 5   323 323 PHE PHE D . n 
A 1 6   MET 6   324 324 MET MET D . n 
A 1 7   CYS 7   325 325 CYS CYS D . n 
A 1 8   ALA 8   326 326 ALA ALA D . n 
A 1 9   TYR 9   327 327 TYR TYR D . n 
A 1 10  PRO 10  328 328 PRO PRO D . n 
A 1 11  GLY 11  329 329 GLY GLY D . n 
A 1 12  CYS 12  330 330 CYS CYS D . n 
A 1 13  ASN 13  331 331 ASN ASN D . n 
A 1 14  LYS 14  332 332 LYS LYS D . n 
A 1 15  ARG 15  333 333 ARG ARG D . n 
A 1 16  TYR 16  334 334 TYR TYR D . n 
A 1 17  PHE 17  335 335 PHE PHE D . n 
A 1 18  LYS 18  336 336 LYS LYS D . n 
A 1 19  LEU 19  337 337 LEU LEU D . n 
A 1 20  SER 20  338 338 SER SER D . n 
A 1 21  HIS 21  339 339 HIS HIS D . n 
A 1 22  LEU 22  340 340 LEU LEU D . n 
A 1 23  GLN 23  341 341 GLN GLN D . n 
A 1 24  MET 24  342 342 MET MET D . n 
A 1 25  HIS 25  343 343 HIS HIS D . n 
A 1 26  SER 26  344 344 SER SER D . n 
A 1 27  ARG 27  345 345 ARG ARG D . n 
A 1 28  LYS 28  346 346 LYS LYS D . n 
A 1 29  HIS 29  347 347 HIS HIS D . n 
A 1 30  THR 30  348 348 THR THR D . n 
A 1 31  GLY 31  349 349 GLY GLY D . n 
A 1 32  GLU 32  350 350 GLU GLU D . n 
A 1 33  LYS 33  351 351 LYS LYS D . n 
A 1 34  PRO 34  352 352 PRO PRO D . n 
A 1 35  TYR 35  353 353 TYR TYR D . n 
A 1 36  GLN 36  354 354 GLN GLN D . n 
A 1 37  CYS 37  355 355 CYS CYS D . n 
A 1 38  ASP 38  356 356 ASP ASP D . n 
A 1 39  PHE 39  357 357 PHE PHE D . n 
A 1 40  LYS 40  358 358 LYS LYS D . n 
A 1 41  ASP 41  359 359 ASP ASP D . n 
A 1 42  CYS 42  360 360 CYS CYS D . n 
A 1 43  GLU 43  361 361 GLU GLU D . n 
A 1 44  ARG 44  362 362 ARG ARG D . n 
A 1 45  ARG 45  363 363 ARG ARG D . n 
A 1 46  PHE 46  364 364 PHE PHE D . n 
A 1 47  SER 47  365 365 SER SER D . n 
A 1 48  ARG 48  366 366 ARG ARG D . n 
A 1 49  SER 49  367 367 SER SER D . n 
A 1 50  ASP 50  368 368 ASP ASP D . n 
A 1 51  GLN 51  369 369 GLN GLN D . n 
A 1 52  LEU 52  370 370 LEU LEU D . n 
A 1 53  LYS 53  371 371 LYS LYS D . n 
A 1 54  ARG 54  372 372 ARG ARG D . n 
A 1 55  HIS 55  373 373 HIS HIS D . n 
A 1 56  GLN 56  374 374 GLN GLN D . n 
A 1 57  ARG 57  375 375 ARG ARG D . n 
A 1 58  ARG 58  376 376 ARG ARG D . n 
A 1 59  HIS 59  377 377 HIS HIS D . n 
A 1 60  THR 60  378 378 THR THR D . n 
A 1 61  GLY 61  379 379 GLY GLY D . n 
A 1 62  VAL 62  380 380 VAL VAL D . n 
A 1 63  LYS 63  381 381 LYS LYS D . n 
A 1 64  PRO 64  382 382 PRO PRO D . n 
A 1 65  PHE 65  383 383 PHE PHE D . n 
A 1 66  GLN 66  384 384 GLN GLN D . n 
A 1 67  CYS 67  385 385 CYS CYS D . n 
A 1 68  LYS 68  386 386 LYS LYS D . n 
A 1 69  THR 69  387 387 THR THR D . n 
A 1 70  CYS 70  388 388 CYS CYS D . n 
A 1 71  GLN 71  389 389 GLN GLN D . n 
A 1 72  ARG 72  390 390 ARG ARG D . n 
A 1 73  LYS 73  391 391 LYS LYS D . n 
A 1 74  PHE 74  392 392 PHE PHE D . n 
A 1 75  SER 75  393 393 SER SER D . n 
A 1 76  ARG 76  394 394 ARG ARG D . n 
A 1 77  SER 77  395 395 SER SER D . n 
A 1 78  ASP 78  396 396 ASP ASP D . n 
A 1 79  HIS 79  397 397 HIS HIS D . n 
A 1 80  LEU 80  398 398 LEU LEU D . n 
A 1 81  LYS 81  399 399 LYS LYS D . n 
A 1 82  THR 82  400 400 THR THR D . n 
A 1 83  HIS 83  401 401 HIS HIS D . n 
A 1 84  THR 84  402 402 THR THR D . n 
A 1 85  ARG 85  403 403 ARG ARG D . n 
A 1 86  THR 86  404 404 THR THR D . n 
A 1 87  HIS 87  405 405 HIS HIS D . n 
A 1 88  THR 88  406 406 THR THR D . n 
A 1 89  GLY 89  407 407 GLY GLY D . n 
A 1 90  GLU 90  408 408 GLU GLU D . n 
A 1 91  LYS 91  409 409 LYS LYS D . n 
A 1 92  PRO 92  410 410 PRO PRO D . n 
A 1 93  PHE 93  411 411 PHE PHE D . n 
A 1 94  SER 94  412 412 SER SER D . n 
A 1 95  CYS 95  413 413 CYS CYS D . n 
A 1 96  ARG 96  414 414 ARG ARG D . n 
A 1 97  TRP 97  415 415 TRP TRP D . n 
A 1 98  PRO 98  416 416 PRO PRO D . n 
A 1 99  SER 99  417 417 SER SER D . n 
A 1 100 CYS 100 418 418 CYS CYS D . n 
A 1 101 GLN 101 419 419 GLN GLN D . n 
A 1 102 LYS 102 420 420 LYS LYS D . n 
A 1 103 LYS 103 421 421 LYS LYS D . n 
A 1 104 PHE 104 422 422 PHE PHE D . n 
A 1 105 ALA 105 423 423 ALA ALA D . n 
A 1 106 ARG 106 424 424 ARG ARG D . n 
A 1 107 SER 107 425 425 SER SER D . n 
A 1 108 ASP 108 426 426 ASP ASP D . n 
A 1 109 GLU 109 427 427 GLU GLU D . n 
A 1 110 LEU 110 428 428 LEU LEU D . n 
A 1 111 VAL 111 429 429 VAL VAL D . n 
A 1 112 ARG 112 430 430 ARG ARG D . n 
A 1 113 HIS 113 431 431 HIS HIS D . n 
A 1 114 HIS 114 432 432 HIS HIS D . n 
A 1 115 ASN 115 433 433 ASN ASN D . n 
A 1 116 MET 116 434 434 MET MET D . n 
A 1 117 HIS 117 435 435 HIS HIS D . n 
A 1 118 GLN 118 436 436 GLN GLN D . n 
A 1 119 ARG 119 437 ?   ?   ?   D . n 
B 2 1   DA  1   1   ?   ?   ?   E . n 
B 2 2   DG  2   2   2   DG  DG  E . n 
B 2 3   DC  3   3   3   DC  DC  E . n 
B 2 4   DG  4   4   4   DG  DG  E . n 
B 2 5   DT  5   5   5   DT  DT  E . n 
B 2 6   DG  6   6   6   DG  DG  E . n 
B 2 7   DG  7   7   7   DG  DG  E . n 
B 2 8   DG  8   8   8   DG  DG  E . n 
B 2 9   DA  9   9   9   DA  DA  E . n 
B 2 10  DG  10  10  10  DG  DG  E . n 
B 2 11  DT  11  11  11  DT  DT  E . n 
B 2 12  DG  12  12  12  DG  DG  E . n 
B 2 13  DT  13  13  13  DT  DT  E . n 
B 2 14  DT  14  14  14  DT  DT  E . n 
C 3 1   DT  1   0   ?   ?   ?   F . n 
C 3 2   DA  2   1   1   DA  DA  F . n 
C 3 3   DA  3   2   2   DA  DA  F . n 
C 3 4   DC  4   3   3   DC  DC  F . n 
C 3 5   DA  5   4   4   DA  DA  F . n 
C 3 6   DC  6   5   5   DC  DC  F . n 
C 3 7   DT  7   6   6   DT  DT  F . n 
C 3 8   DC  8   7   7   DC  DC  F . n 
C 3 9   DC  9   8   8   DC  DC  F . n 
C 3 10  DC  10  9   9   DC  DC  F . n 
C 3 11  DA  11  10  10  DA  DA  F . n 
C 3 12  DC  12  11  11  DC  DC  F . n 
C 3 13  DG  13  12  12  DG  DG  F . n 
C 3 14  DC  14  13  13  DC  DC  F . n 
D 1 1   HIS 1   319 319 HIS HIS A . n 
D 1 2   MET 2   320 320 MET MET A . n 
D 1 3   ARG 3   321 321 ARG ARG A . n 
D 1 4   PRO 4   322 322 PRO PRO A . n 
D 1 5   PHE 5   323 323 PHE PHE A . n 
D 1 6   MET 6   324 324 MET MET A . n 
D 1 7   CYS 7   325 325 CYS CYS A . n 
D 1 8   ALA 8   326 326 ALA ALA A . n 
D 1 9   TYR 9   327 327 TYR TYR A . n 
D 1 10  PRO 10  328 328 PRO PRO A . n 
D 1 11  GLY 11  329 329 GLY GLY A . n 
D 1 12  CYS 12  330 330 CYS CYS A . n 
D 1 13  ASN 13  331 331 ASN ASN A . n 
D 1 14  LYS 14  332 332 LYS LYS A . n 
D 1 15  ARG 15  333 333 ARG ARG A . n 
D 1 16  TYR 16  334 334 TYR TYR A . n 
D 1 17  PHE 17  335 335 PHE PHE A . n 
D 1 18  LYS 18  336 336 LYS LYS A . n 
D 1 19  LEU 19  337 337 LEU LEU A . n 
D 1 20  SER 20  338 338 SER SER A . n 
D 1 21  HIS 21  339 339 HIS HIS A . n 
D 1 22  LEU 22  340 340 LEU LEU A . n 
D 1 23  GLN 23  341 341 GLN GLN A . n 
D 1 24  MET 24  342 342 MET MET A . n 
D 1 25  HIS 25  343 343 HIS HIS A . n 
D 1 26  SER 26  344 344 SER SER A . n 
D 1 27  ARG 27  345 345 ARG ARG A . n 
D 1 28  LYS 28  346 346 LYS LYS A . n 
D 1 29  HIS 29  347 347 HIS HIS A . n 
D 1 30  THR 30  348 348 THR ALA A . n 
D 1 31  GLY 31  349 349 GLY GLY A . n 
D 1 32  GLU 32  350 350 GLU GLU A . n 
D 1 33  LYS 33  351 351 LYS LYS A . n 
D 1 34  PRO 34  352 352 PRO PRO A . n 
D 1 35  TYR 35  353 353 TYR TYR A . n 
D 1 36  GLN 36  354 354 GLN GLN A . n 
D 1 37  CYS 37  355 355 CYS CYS A . n 
D 1 38  ASP 38  356 356 ASP ASP A . n 
D 1 39  PHE 39  357 357 PHE PHE A . n 
D 1 40  LYS 40  358 358 LYS LYS A . n 
D 1 41  ASP 41  359 359 ASP ASP A . n 
D 1 42  CYS 42  360 360 CYS CYS A . n 
D 1 43  GLU 43  361 361 GLU GLU A . n 
D 1 44  ARG 44  362 362 ARG ARG A . n 
D 1 45  ARG 45  363 363 ARG ARG A . n 
D 1 46  PHE 46  364 364 PHE PHE A . n 
D 1 47  SER 47  365 365 SER SER A . n 
D 1 48  ARG 48  366 366 ARG ARG A . n 
D 1 49  SER 49  367 367 SER SER A . n 
D 1 50  ASP 50  368 368 ASP ASP A . n 
D 1 51  GLN 51  369 369 GLN GLN A . n 
D 1 52  LEU 52  370 370 LEU LEU A . n 
D 1 53  LYS 53  371 371 LYS LYS A . n 
D 1 54  ARG 54  372 372 ARG ARG A . n 
D 1 55  HIS 55  373 373 HIS HIS A . n 
D 1 56  GLN 56  374 374 GLN GLN A . n 
D 1 57  ARG 57  375 375 ARG ARG A . n 
D 1 58  ARG 58  376 376 ARG ARG A . n 
D 1 59  HIS 59  377 377 HIS HIS A . n 
D 1 60  THR 60  378 378 THR THR A . n 
D 1 61  GLY 61  379 379 GLY GLY A . n 
D 1 62  VAL 62  380 380 VAL VAL A . n 
D 1 63  LYS 63  381 381 LYS LYS A . n 
D 1 64  PRO 64  382 382 PRO PRO A . n 
D 1 65  PHE 65  383 383 PHE PHE A . n 
D 1 66  GLN 66  384 384 GLN GLN A . n 
D 1 67  CYS 67  385 385 CYS CYS A . n 
D 1 68  LYS 68  386 386 LYS LYS A . n 
D 1 69  THR 69  387 387 THR THR A . n 
D 1 70  CYS 70  388 388 CYS CYS A . n 
D 1 71  GLN 71  389 389 GLN GLN A . n 
D 1 72  ARG 72  390 390 ARG ARG A . n 
D 1 73  LYS 73  391 391 LYS LYS A . n 
D 1 74  PHE 74  392 392 PHE PHE A . n 
D 1 75  SER 75  393 393 SER SER A . n 
D 1 76  ARG 76  394 394 ARG ARG A . n 
D 1 77  SER 77  395 395 SER SER A . n 
D 1 78  ASP 78  396 396 ASP ASP A . n 
D 1 79  HIS 79  397 397 HIS HIS A . n 
D 1 80  LEU 80  398 398 LEU LEU A . n 
D 1 81  LYS 81  399 399 LYS LYS A . n 
D 1 82  THR 82  400 400 THR THR A . n 
D 1 83  HIS 83  401 401 HIS HIS A . n 
D 1 84  THR 84  402 402 THR THR A . n 
D 1 85  ARG 85  403 403 ARG ARG A . n 
D 1 86  THR 86  404 404 THR THR A . n 
D 1 87  HIS 87  405 405 HIS HIS A . n 
D 1 88  THR 88  406 406 THR THR A . n 
D 1 89  GLY 89  407 407 GLY GLY A . n 
D 1 90  GLU 90  408 408 GLU GLU A . n 
D 1 91  LYS 91  409 409 LYS LYS A . n 
D 1 92  PRO 92  410 410 PRO PRO A . n 
D 1 93  PHE 93  411 411 PHE PHE A . n 
D 1 94  SER 94  412 412 SER SER A . n 
D 1 95  CYS 95  413 413 CYS CYS A . n 
D 1 96  ARG 96  414 414 ARG ARG A . n 
D 1 97  TRP 97  415 415 TRP TRP A . n 
D 1 98  PRO 98  416 416 PRO PRO A . n 
D 1 99  SER 99  417 417 SER SER A . n 
D 1 100 CYS 100 418 418 CYS CYS A . n 
D 1 101 GLN 101 419 419 GLN GLN A . n 
D 1 102 LYS 102 420 420 LYS LYS A . n 
D 1 103 LYS 103 421 421 LYS LYS A . n 
D 1 104 PHE 104 422 422 PHE PHE A . n 
D 1 105 ALA 105 423 423 ALA ALA A . n 
D 1 106 ARG 106 424 424 ARG ARG A . n 
D 1 107 SER 107 425 425 SER SER A . n 
D 1 108 ASP 108 426 426 ASP ASP A . n 
D 1 109 GLU 109 427 427 GLU GLU A . n 
D 1 110 LEU 110 428 428 LEU LEU A . n 
D 1 111 VAL 111 429 429 VAL VAL A . n 
D 1 112 ARG 112 430 430 ARG ARG A . n 
D 1 113 HIS 113 431 431 HIS HIS A . n 
D 1 114 HIS 114 432 432 HIS HIS A . n 
D 1 115 ASN 115 433 433 ASN ASN A . n 
D 1 116 MET 116 434 434 MET MET A . n 
D 1 117 HIS 117 435 435 HIS HIS A . n 
D 1 118 GLN 118 436 436 GLN GLN A . n 
D 1 119 ARG 119 437 437 ARG ARG A . n 
E 2 1   DA  1   1   ?   ?   ?   B . n 
E 2 2   DG  2   2   2   DG  DG  B . n 
E 2 3   DC  3   3   3   DC  DC  B . n 
E 2 4   DG  4   4   4   DG  DG  B . n 
E 2 5   DT  5   5   5   DT  DT  B . n 
E 2 6   DG  6   6   6   DG  DG  B . n 
E 2 7   DG  7   7   7   DG  DG  B . n 
E 2 8   DG  8   8   8   DG  DG  B . n 
E 2 9   DA  9   9   9   DA  DA  B . n 
E 2 10  DG  10  10  10  DG  DG  B . n 
E 2 11  DT  11  11  11  DT  DT  B . n 
E 2 12  DG  12  12  12  DG  DG  B . n 
E 2 13  DT  13  13  13  DT  DT  B . n 
E 2 14  DT  14  14  14  DT  DT  B . n 
F 3 1   DT  1   1   ?   ?   ?   C . n 
F 3 2   DA  2   2   2   DA  DA  C . n 
F 3 3   DA  3   3   3   DA  DA  C . n 
F 3 4   DC  4   4   4   DC  DC  C . n 
F 3 5   DA  5   5   5   DA  DA  C . n 
F 3 6   DC  6   6   6   DC  DC  C . n 
F 3 7   DT  7   7   7   DT  DT  C . n 
F 3 8   DC  8   8   8   DC  DC  C . n 
F 3 9   DC  9   9   9   DC  DC  C . n 
F 3 10  DC  10  10  10  DC  DC  C . n 
F 3 11  DA  11  11  11  DA  DA  C . n 
F 3 12  DC  12  12  12  DC  DC  C . n 
F 3 13  DG  13  13  13  DG  DG  C . n 
F 3 14  DC  14  14  14  DC  DC  C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G  4 ZN  1  501 504 ZN  ZN  D . 
H  4 ZN  1  502 505 ZN  ZN  D . 
I  4 ZN  1  503 506 ZN  ZN  D . 
J  4 ZN  1  504 507 ZN  ZN  D . 
K  5 SO4 1  505 4   SO4 SO4 D . 
L  5 SO4 1  506 5   SO4 SO4 D . 
M  5 SO4 1  507 6   SO4 SO4 D . 
N  5 SO4 1  508 8   SO4 SO4 D . 
O  4 ZN  1  501 504 ZN  ZN  A . 
P  4 ZN  1  502 505 ZN  ZN  A . 
Q  4 ZN  1  503 506 ZN  ZN  A . 
R  4 ZN  1  504 507 ZN  ZN  A . 
S  5 SO4 1  505 1   SO4 SO4 A . 
T  5 SO4 1  506 2   SO4 SO4 A . 
U  5 SO4 1  507 3   SO4 SO4 A . 
V  5 SO4 1  508 7   SO4 SO4 A . 
W  6 HOH 1  601 32  HOH HOH D . 
W  6 HOH 2  602 29  HOH HOH D . 
W  6 HOH 3  603 3   HOH HOH D . 
W  6 HOH 4  604 30  HOH HOH D . 
W  6 HOH 5  605 16  HOH HOH D . 
W  6 HOH 6  606 38  HOH HOH D . 
W  6 HOH 7  607 31  HOH HOH D . 
W  6 HOH 8  608 37  HOH HOH D . 
W  6 HOH 9  609 24  HOH HOH D . 
W  6 HOH 10 610 2   HOH HOH D . 
X  6 HOH 1  101 15  HOH HOH E . 
X  6 HOH 2  102 20  HOH HOH E . 
X  6 HOH 3  103 14  HOH HOH E . 
X  6 HOH 4  104 13  HOH HOH E . 
Y  6 HOH 1  101 9   HOH HOH F . 
Y  6 HOH 2  102 10  HOH HOH F . 
Y  6 HOH 3  103 8   HOH HOH F . 
Z  6 HOH 1  601 19  HOH HOH A . 
Z  6 HOH 2  602 11  HOH HOH A . 
Z  6 HOH 3  603 34  HOH HOH A . 
Z  6 HOH 4  604 7   HOH HOH A . 
Z  6 HOH 5  605 33  HOH HOH A . 
Z  6 HOH 6  606 5   HOH HOH A . 
Z  6 HOH 7  607 36  HOH HOH A . 
Z  6 HOH 8  608 12  HOH HOH A . 
AA 6 HOH 1  101 22  HOH HOH B . 
AA 6 HOH 2  102 35  HOH HOH B . 
AA 6 HOH 3  103 26  HOH HOH B . 
BA 6 HOH 1  101 27  HOH HOH C . 
BA 6 HOH 2  102 25  HOH HOH C . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA trimeric 3 
2 author_and_software_defined_assembly PISA trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,G,H,I,J,K,L,M,N,W,X,Y   
2 1 D,E,F,O,P,Q,R,S,T,U,V,Z,AA,BA 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4690  ? 
1 MORE         -62   ? 
1 'SSA (A^2)'  11860 ? 
2 'ABSA (A^2)' 5050  ? 
2 MORE         -82   ? 
2 'SSA (A^2)'  11950 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG  ? A CYS 7   ? D CYS 325 ? 1_555 ZN ? G ZN . ? D ZN 501 ? 1_555 SG  ? A CYS 12  ? D CYS 330 ? 1_555 121.1 ? 
2  SG  ? A CYS 7   ? D CYS 325 ? 1_555 ZN ? G ZN . ? D ZN 501 ? 1_555 NE2 ? A HIS 25  ? D HIS 343 ? 1_555 118.2 ? 
3  SG  ? A CYS 12  ? D CYS 330 ? 1_555 ZN ? G ZN . ? D ZN 501 ? 1_555 NE2 ? A HIS 25  ? D HIS 343 ? 1_555 72.2  ? 
4  SG  ? A CYS 7   ? D CYS 325 ? 1_555 ZN ? G ZN . ? D ZN 501 ? 1_555 NE2 ? A HIS 29  ? D HIS 347 ? 1_555 111.1 ? 
5  SG  ? A CYS 12  ? D CYS 330 ? 1_555 ZN ? G ZN . ? D ZN 501 ? 1_555 NE2 ? A HIS 29  ? D HIS 347 ? 1_555 111.6 ? 
6  NE2 ? A HIS 25  ? D HIS 343 ? 1_555 ZN ? G ZN . ? D ZN 501 ? 1_555 NE2 ? A HIS 29  ? D HIS 347 ? 1_555 117.8 ? 
7  SG  ? A CYS 37  ? D CYS 355 ? 1_555 ZN ? H ZN . ? D ZN 502 ? 1_555 SG  ? A CYS 42  ? D CYS 360 ? 1_555 114.3 ? 
8  SG  ? A CYS 37  ? D CYS 355 ? 1_555 ZN ? H ZN . ? D ZN 502 ? 1_555 NE2 ? A HIS 55  ? D HIS 373 ? 1_555 106.8 ? 
9  SG  ? A CYS 42  ? D CYS 360 ? 1_555 ZN ? H ZN . ? D ZN 502 ? 1_555 NE2 ? A HIS 55  ? D HIS 373 ? 1_555 102.1 ? 
10 SG  ? A CYS 37  ? D CYS 355 ? 1_555 ZN ? H ZN . ? D ZN 502 ? 1_555 NE2 ? A HIS 59  ? D HIS 377 ? 1_555 108.8 ? 
11 SG  ? A CYS 42  ? D CYS 360 ? 1_555 ZN ? H ZN . ? D ZN 502 ? 1_555 NE2 ? A HIS 59  ? D HIS 377 ? 1_555 119.1 ? 
12 NE2 ? A HIS 55  ? D HIS 373 ? 1_555 ZN ? H ZN . ? D ZN 502 ? 1_555 NE2 ? A HIS 59  ? D HIS 377 ? 1_555 104.4 ? 
13 SG  ? A CYS 67  ? D CYS 385 ? 1_555 ZN ? I ZN . ? D ZN 503 ? 1_555 SG  ? A CYS 70  ? D CYS 388 ? 1_555 116.4 ? 
14 SG  ? A CYS 67  ? D CYS 385 ? 1_555 ZN ? I ZN . ? D ZN 503 ? 1_555 NE2 ? A HIS 83  ? D HIS 401 ? 1_555 109.2 ? 
15 SG  ? A CYS 70  ? D CYS 388 ? 1_555 ZN ? I ZN . ? D ZN 503 ? 1_555 NE2 ? A HIS 83  ? D HIS 401 ? 1_555 89.0  ? 
16 SG  ? A CYS 67  ? D CYS 385 ? 1_555 ZN ? I ZN . ? D ZN 503 ? 1_555 NE2 ? A HIS 87  ? D HIS 405 ? 1_555 126.3 ? 
17 SG  ? A CYS 70  ? D CYS 388 ? 1_555 ZN ? I ZN . ? D ZN 503 ? 1_555 NE2 ? A HIS 87  ? D HIS 405 ? 1_555 98.4  ? 
18 NE2 ? A HIS 83  ? D HIS 401 ? 1_555 ZN ? I ZN . ? D ZN 503 ? 1_555 NE2 ? A HIS 87  ? D HIS 405 ? 1_555 111.0 ? 
19 SG  ? A CYS 95  ? D CYS 413 ? 1_555 ZN ? J ZN . ? D ZN 504 ? 1_555 SG  ? A CYS 100 ? D CYS 418 ? 1_555 104.4 ? 
20 SG  ? A CYS 95  ? D CYS 413 ? 1_555 ZN ? J ZN . ? D ZN 504 ? 1_555 NE2 ? A HIS 113 ? D HIS 431 ? 1_555 113.6 ? 
21 SG  ? A CYS 100 ? D CYS 418 ? 1_555 ZN ? J ZN . ? D ZN 504 ? 1_555 NE2 ? A HIS 113 ? D HIS 431 ? 1_555 114.5 ? 
22 SG  ? A CYS 95  ? D CYS 413 ? 1_555 ZN ? J ZN . ? D ZN 504 ? 1_555 NE2 ? A HIS 117 ? D HIS 435 ? 1_555 119.8 ? 
23 SG  ? A CYS 100 ? D CYS 418 ? 1_555 ZN ? J ZN . ? D ZN 504 ? 1_555 NE2 ? A HIS 117 ? D HIS 435 ? 1_555 119.3 ? 
24 NE2 ? A HIS 113 ? D HIS 431 ? 1_555 ZN ? J ZN . ? D ZN 504 ? 1_555 NE2 ? A HIS 117 ? D HIS 435 ? 1_555 84.7  ? 
25 SG  ? D CYS 7   ? A CYS 325 ? 1_555 ZN ? O ZN . ? A ZN 501 ? 1_555 SG  ? D CYS 12  ? A CYS 330 ? 1_555 121.0 ? 
26 SG  ? D CYS 7   ? A CYS 325 ? 1_555 ZN ? O ZN . ? A ZN 501 ? 1_555 NE2 ? D HIS 25  ? A HIS 343 ? 1_555 105.0 ? 
27 SG  ? D CYS 12  ? A CYS 330 ? 1_555 ZN ? O ZN . ? A ZN 501 ? 1_555 NE2 ? D HIS 25  ? A HIS 343 ? 1_555 87.1  ? 
28 SG  ? D CYS 7   ? A CYS 325 ? 1_555 ZN ? O ZN . ? A ZN 501 ? 1_555 NE2 ? D HIS 29  ? A HIS 347 ? 1_555 108.1 ? 
29 SG  ? D CYS 12  ? A CYS 330 ? 1_555 ZN ? O ZN . ? A ZN 501 ? 1_555 NE2 ? D HIS 29  ? A HIS 347 ? 1_555 123.1 ? 
30 NE2 ? D HIS 25  ? A HIS 343 ? 1_555 ZN ? O ZN . ? A ZN 501 ? 1_555 NE2 ? D HIS 29  ? A HIS 347 ? 1_555 107.1 ? 
31 SG  ? D CYS 37  ? A CYS 355 ? 1_555 ZN ? P ZN . ? A ZN 502 ? 1_555 SG  ? D CYS 42  ? A CYS 360 ? 1_555 106.8 ? 
32 SG  ? D CYS 37  ? A CYS 355 ? 1_555 ZN ? P ZN . ? A ZN 502 ? 1_555 NE2 ? D HIS 55  ? A HIS 373 ? 1_555 103.4 ? 
33 SG  ? D CYS 42  ? A CYS 360 ? 1_555 ZN ? P ZN . ? A ZN 502 ? 1_555 NE2 ? D HIS 55  ? A HIS 373 ? 1_555 113.7 ? 
34 SG  ? D CYS 37  ? A CYS 355 ? 1_555 ZN ? P ZN . ? A ZN 502 ? 1_555 NE2 ? D HIS 59  ? A HIS 377 ? 1_555 109.6 ? 
35 SG  ? D CYS 42  ? A CYS 360 ? 1_555 ZN ? P ZN . ? A ZN 502 ? 1_555 NE2 ? D HIS 59  ? A HIS 377 ? 1_555 117.8 ? 
36 NE2 ? D HIS 55  ? A HIS 373 ? 1_555 ZN ? P ZN . ? A ZN 502 ? 1_555 NE2 ? D HIS 59  ? A HIS 377 ? 1_555 104.6 ? 
37 SG  ? D CYS 67  ? A CYS 385 ? 1_555 ZN ? Q ZN . ? A ZN 503 ? 1_555 SG  ? D CYS 70  ? A CYS 388 ? 1_555 118.0 ? 
38 SG  ? D CYS 67  ? A CYS 385 ? 1_555 ZN ? Q ZN . ? A ZN 503 ? 1_555 NE2 ? D HIS 83  ? A HIS 401 ? 1_555 115.2 ? 
39 SG  ? D CYS 70  ? A CYS 388 ? 1_555 ZN ? Q ZN . ? A ZN 503 ? 1_555 NE2 ? D HIS 83  ? A HIS 401 ? 1_555 88.9  ? 
40 SG  ? D CYS 67  ? A CYS 385 ? 1_555 ZN ? Q ZN . ? A ZN 503 ? 1_555 NE2 ? D HIS 87  ? A HIS 405 ? 1_555 135.6 ? 
41 SG  ? D CYS 70  ? A CYS 388 ? 1_555 ZN ? Q ZN . ? A ZN 503 ? 1_555 NE2 ? D HIS 87  ? A HIS 405 ? 1_555 97.9  ? 
42 NE2 ? D HIS 83  ? A HIS 401 ? 1_555 ZN ? Q ZN . ? A ZN 503 ? 1_555 NE2 ? D HIS 87  ? A HIS 405 ? 1_555 89.2  ? 
43 SG  ? D CYS 95  ? A CYS 413 ? 1_555 ZN ? R ZN . ? A ZN 504 ? 1_555 SG  ? D CYS 100 ? A CYS 418 ? 1_555 113.1 ? 
44 SG  ? D CYS 95  ? A CYS 413 ? 1_555 ZN ? R ZN . ? A ZN 504 ? 1_555 NE2 ? D HIS 113 ? A HIS 431 ? 1_555 104.9 ? 
45 SG  ? D CYS 100 ? A CYS 418 ? 1_555 ZN ? R ZN . ? A ZN 504 ? 1_555 NE2 ? D HIS 113 ? A HIS 431 ? 1_555 109.8 ? 
46 SG  ? D CYS 95  ? A CYS 413 ? 1_555 ZN ? R ZN . ? A ZN 504 ? 1_555 NE2 ? D HIS 117 ? A HIS 435 ? 1_555 119.1 ? 
47 SG  ? D CYS 100 ? A CYS 418 ? 1_555 ZN ? R ZN . ? A ZN 504 ? 1_555 NE2 ? D HIS 117 ? A HIS 435 ? 1_555 119.5 ? 
48 NE2 ? D HIS 113 ? A HIS 431 ? 1_555 ZN ? R ZN . ? A ZN 504 ? 1_555 NE2 ? D HIS 117 ? A HIS 435 ? 1_555 84.7  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2018-01-03 
2 'Structure model' 1 1 2018-01-17 
3 'Structure model' 1 2 2018-05-16 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Data collection'     
3 3 'Structure model' 'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 2 'Structure model' citation_author 
3 3 'Structure model' citation        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.pdbx_database_id_PubMed' 
2 2 'Structure model' '_citation.title'                   
3 2 'Structure model' '_citation_author.name'             
4 3 'Structure model' '_citation.journal_volume'          
5 3 'Structure model' '_citation.page_first'              
6 3 'Structure model' '_citation.page_last'               
7 3 'Structure model' '_citation.year'                    
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 84.4866 21.5915 -32.9613 0.5431 0.6882 0.5412 0.1242  -0.1250 -0.0192 2.0088 5.3753 7.1764 -0.4788 
-0.6787 0.7260  -0.7038 -0.8052 1.1088  0.7266  0.3770  -0.0782 -0.9425 -0.9007 0.3886  
'X-RAY DIFFRACTION' 2 ? refined 61.0605 9.7207  -2.2524  0.3882 0.1658 0.2714 0.0160  -0.0219 -0.0072 2.4737 4.1111 4.0190 0.7616  
-0.6561 -2.1786 0.0013  0.0117  -0.0692 -0.0031 0.1617  0.2067  0.3474  -0.2613 -0.1216 
'X-RAY DIFFRACTION' 3 ? refined 61.5826 7.7622  -7.4844  0.4634 0.2485 0.2524 -0.0147 0.0154  0.0387  1.1120 1.9218 2.1873 -0.5733 
-0.2420 -0.0773 -0.0012 0.1208  -0.0853 0.0112  0.1720  0.2710  0.2528  -0.3466 -0.1561 
'X-RAY DIFFRACTION' 4 ? refined 63.3535 8.9658  -7.4009  0.6724 0.3542 0.3246 -0.0684 0.0562  -0.0016 2.5174 2.3032 6.8776 -0.4056 
-0.2797 -0.7888 -0.0075 0.0942  0.2604  -0.1875 0.5172  0.1194  -1.2866 0.0136  -0.4604 
'X-RAY DIFFRACTION' 5 ? refined 52.6031 60.4911 0.3255   0.4399 0.4395 0.4713 0.0569  0.0926  -0.0194 5.1377 4.6421 4.3529 2.7456  
-0.1088 -1.4559 0.0332  -0.7957 0.1268  -0.0263 -0.2340 0.6867  -0.0044 0.3115  0.2116  
'X-RAY DIFFRACTION' 6 ? refined 50.4605 35.4466 -19.8952 0.3336 0.2782 0.2965 0.0662  0.0644  0.0428  2.8530 3.2545 2.6527 -0.4196 
1.3913  -0.3730 0.1428  -0.0827 -0.1859 0.0084  0.0371  0.1771  0.0588  -0.3130 -0.1737 
'X-RAY DIFFRACTION' 7 ? refined 49.7921 37.1232 -13.7818 0.4003 0.4874 0.3107 0.1112  -0.0262 0.0836  1.4666 2.2713 1.9462 -0.6803 
0.4874  0.0466  0.1928  -0.2109 -0.1659 0.0458  0.0729  0.1887  -0.3001 -0.7425 -0.2255 
'X-RAY DIFFRACTION' 8 ? refined 51.5751 37.2597 -14.4322 0.4988 0.4589 0.3588 0.1129  -0.0462 0.0760  1.2018 0.3389 6.7675 -0.5700 
-0.6443 0.4080  0.4398  0.1358  0.1324  0.0135  0.3524  -0.0219 0.3244  -0.2561 -0.7547 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? 
;chain 'D' and (resid 319 through 347 )
;
'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? 
;chain 'D' and (resid 348 through 436 )
;
'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? 
;chain 'E' and (resid 2 through 14 )
;
'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? 
;chain 'F' and (resid 1 through 13 )
;
'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 319 through 346 )
;
'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 347 through 437 )
;
'X-RAY DIFFRACTION' 7 7 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 2 through 14 )
;
'X-RAY DIFFRACTION' 8 8 ? ? ? ? ? ? ? ? ? 
;chain 'C' and (resid 2 through 14 )
;
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? 1.12_2829 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .         2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .         3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? .         4 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    LYS 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     351 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -116.69 
_pdbx_validate_torsion.psi             78.26 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 D HIS 319 ? CG  ? A HIS 1   CG  
2  1 Y 1 D HIS 319 ? ND1 ? A HIS 1   ND1 
3  1 Y 1 D HIS 319 ? CD2 ? A HIS 1   CD2 
4  1 Y 1 D HIS 319 ? CE1 ? A HIS 1   CE1 
5  1 Y 1 D HIS 319 ? NE2 ? A HIS 1   NE2 
6  1 Y 1 D TYR 327 ? CG  ? A TYR 9   CG  
7  1 Y 1 D TYR 327 ? CD1 ? A TYR 9   CD1 
8  1 Y 1 D TYR 327 ? CD2 ? A TYR 9   CD2 
9  1 Y 1 D TYR 327 ? CE1 ? A TYR 9   CE1 
10 1 Y 1 D TYR 327 ? CE2 ? A TYR 9   CE2 
11 1 Y 1 D TYR 327 ? CZ  ? A TYR 9   CZ  
12 1 Y 1 D TYR 327 ? OH  ? A TYR 9   OH  
13 1 Y 1 D ASN 331 ? CG  ? A ASN 13  CG  
14 1 Y 1 D ASN 331 ? OD1 ? A ASN 13  OD1 
15 1 Y 1 D ASN 331 ? ND2 ? A ASN 13  ND2 
16 1 Y 1 D LYS 332 ? CG  ? A LYS 14  CG  
17 1 Y 1 D LYS 332 ? CD  ? A LYS 14  CD  
18 1 Y 1 D LYS 332 ? CE  ? A LYS 14  CE  
19 1 Y 1 D LYS 332 ? NZ  ? A LYS 14  NZ  
20 1 Y 1 D LYS 346 ? CG  ? A LYS 28  CG  
21 1 Y 1 D LYS 346 ? CD  ? A LYS 28  CD  
22 1 Y 1 D LYS 346 ? CE  ? A LYS 28  CE  
23 1 Y 1 D LYS 346 ? NZ  ? A LYS 28  NZ  
24 1 Y 1 D THR 348 ? OG1 ? A THR 30  OG1 
25 1 Y 1 D THR 348 ? CG2 ? A THR 30  CG2 
26 1 Y 1 D LYS 386 ? CG  ? A LYS 68  CG  
27 1 Y 1 D LYS 386 ? CD  ? A LYS 68  CD  
28 1 Y 1 D LYS 386 ? CE  ? A LYS 68  CE  
29 1 Y 1 D LYS 386 ? NZ  ? A LYS 68  NZ  
30 1 Y 1 D SER 417 ? OG  ? A SER 99  OG  
31 1 Y 1 D GLN 419 ? CG  ? A GLN 101 CG  
32 1 Y 1 D GLN 419 ? CD  ? A GLN 101 CD  
33 1 Y 1 D GLN 419 ? OE1 ? A GLN 101 OE1 
34 1 Y 1 D GLN 419 ? NE2 ? A GLN 101 NE2 
35 1 Y 1 A HIS 319 ? CG  ? D HIS 1   CG  
36 1 Y 1 A HIS 319 ? ND1 ? D HIS 1   ND1 
37 1 Y 1 A HIS 319 ? CD2 ? D HIS 1   CD2 
38 1 Y 1 A HIS 319 ? CE1 ? D HIS 1   CE1 
39 1 Y 1 A HIS 319 ? NE2 ? D HIS 1   NE2 
40 1 Y 1 A MET 320 ? CG  ? D MET 2   CG  
41 1 Y 1 A MET 320 ? SD  ? D MET 2   SD  
42 1 Y 1 A MET 320 ? CE  ? D MET 2   CE  
43 1 Y 1 A THR 348 ? OG1 ? D THR 30  OG1 
44 1 Y 1 A THR 348 ? CG2 ? D THR 30  CG2 
45 1 Y 1 A GLU 350 ? CG  ? D GLU 32  CG  
46 1 Y 1 A GLU 350 ? CD  ? D GLU 32  CD  
47 1 Y 1 A GLU 350 ? OE1 ? D GLU 32  OE1 
48 1 Y 1 A GLU 350 ? OE2 ? D GLU 32  OE2 
49 1 Y 1 A GLU 361 ? CG  ? D GLU 43  CG  
50 1 Y 1 A GLU 361 ? CD  ? D GLU 43  CD  
51 1 Y 1 A GLU 361 ? OE1 ? D GLU 43  OE1 
52 1 Y 1 A GLU 361 ? OE2 ? D GLU 43  OE2 
53 1 Y 1 A GLU 408 ? CG  ? D GLU 90  CG  
54 1 Y 1 A GLU 408 ? CD  ? D GLU 90  CD  
55 1 Y 1 A GLU 408 ? OE1 ? D GLU 90  OE1 
56 1 Y 1 A GLU 408 ? OE2 ? D GLU 90  OE2 
57 1 Y 1 A ARG 414 ? CG  ? D ARG 96  CG  
58 1 Y 1 A ARG 414 ? CD  ? D ARG 96  CD  
59 1 Y 1 A ARG 414 ? NE  ? D ARG 96  NE  
60 1 Y 1 A ARG 414 ? CZ  ? D ARG 96  CZ  
61 1 Y 1 A ARG 414 ? NH1 ? D ARG 96  NH1 
62 1 Y 1 A ARG 414 ? NH2 ? D ARG 96  NH2 
63 1 Y 1 A SER 417 ? OG  ? D SER 99  OG  
64 1 Y 1 A GLN 419 ? CG  ? D GLN 101 CG  
65 1 Y 1 A GLN 419 ? CD  ? D GLN 101 CD  
66 1 Y 1 A GLN 419 ? OE1 ? D GLN 101 OE1 
67 1 Y 1 A GLN 419 ? NE2 ? D GLN 101 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 D ARG 437 ? A ARG 119 
2 1 Y 1 E DA  1   ? B DA  1   
3 1 Y 1 F DT  0   ? C DT  1   
4 1 Y 1 B DA  1   ? E DA  1   
5 1 Y 1 C DT  1   ? F DT  1   
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
6B0Q 'double helix'        
6B0Q 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DG 2  1_555 C DC 14 1_555 -0.257 -0.017 -0.116 -4.283  -3.001  5.384  1  E_DG2:DC13_F E 2  ? F 13 ? 19 1 
1 B DC 3  1_555 C DG 13 1_555 0.537  -0.129 -0.328 13.240  -5.251  6.014  2  E_DC3:DG12_F E 3  ? F 12 ? 19 1 
1 B DG 4  1_555 C DC 12 1_555 -0.385 -0.131 0.177  1.997   -4.997  1.765  3  E_DG4:DC11_F E 4  ? F 11 ? 19 1 
1 B DT 5  1_555 C DA 11 1_555 0.120  0.034  -0.011 5.776   -0.947  8.869  4  E_DT5:DA10_F E 5  ? F 10 ? 20 1 
1 B DG 6  1_555 C DC 10 1_555 -0.313 0.035  0.574  -8.502  -14.421 1.153  5  E_DG6:DC9_F  E 6  ? F 9  ? 19 1 
1 B DG 7  1_555 C DC 9  1_555 -0.050 -0.165 -0.178 -4.223  -2.359  -4.746 6  E_DG7:DC8_F  E 7  ? F 8  ? 19 1 
1 B DG 8  1_555 C DC 8  1_555 -0.403 -0.162 -0.128 0.318   -6.701  5.492  7  E_DG8:DC7_F  E 8  ? F 7  ? 19 1 
1 B DA 9  1_555 C DT 7  1_555 -0.072 -0.020 -0.039 -2.452  -9.202  4.177  8  E_DA9:DT6_F  E 9  ? F 6  ? 20 1 
1 B DG 10 1_555 C DC 6  1_555 0.014  -0.086 -0.229 -1.620  -6.145  -2.732 9  E_DG10:DC5_F E 10 ? F 5  ? 19 1 
1 B DT 11 1_555 C DA 5  1_555 -0.165 -0.029 -0.010 1.629   -9.628  4.217  10 E_DT11:DA4_F E 11 ? F 4  ? 20 1 
1 B DG 12 1_555 C DC 4  1_555 -0.454 0.029  0.327  -3.613  -5.642  8.974  11 E_DG12:DC3_F E 12 ? F 3  ? 19 1 
1 B DT 13 1_555 C DA 3  1_555 -0.227 -0.106 0.440  -4.470  -12.028 -0.866 12 E_DT13:DA2_F E 13 ? F 2  ? 20 1 
1 B DT 14 1_555 C DA 2  1_555 0.005  -0.117 0.176  3.989   -0.051  -0.411 13 E_DT14:DA1_F E 14 ? F 1  ? 20 1 
1 E DG 2  1_555 F DC 14 1_555 -0.465 0.176  0.062  -2.471  -7.767  9.726  14 B_DG2:DC14_C B 2  ? C 14 ? 19 1 
1 E DC 3  1_555 F DG 13 1_555 0.425  0.035  -0.255 11.445  -6.745  5.577  15 B_DC3:DG13_C B 3  ? C 13 ? 19 1 
1 E DG 4  1_555 F DC 12 1_555 -0.166 -0.125 0.160  -1.535  -7.493  -2.996 16 B_DG4:DC12_C B 4  ? C 12 ? 19 1 
1 E DT 5  1_555 F DA 11 1_555 0.221  -0.160 0.130  -2.287  -3.252  5.661  17 B_DT5:DA11_C B 5  ? C 11 ? 20 1 
1 E DG 6  1_555 F DC 10 1_555 -0.335 0.046  0.234  -11.629 -12.853 2.416  18 B_DG6:DC10_C B 6  ? C 10 ? 19 1 
1 E DG 7  1_555 F DC 9  1_555 -0.052 -0.212 0.070  -0.117  -2.846  -2.708 19 B_DG7:DC9_C  B 7  ? C 9  ? 19 1 
1 E DG 8  1_555 F DC 8  1_555 -0.150 -0.154 0.019  -0.396  -17.579 -0.853 20 B_DG8:DC8_C  B 8  ? C 8  ? 19 1 
1 E DA 9  1_555 F DT 7  1_555 -0.132 -0.053 -0.087 -0.301  -9.420  9.261  21 B_DA9:DT7_C  B 9  ? C 7  ? 20 1 
1 E DG 10 1_555 F DC 6  1_555 0.061  -0.090 -0.209 -4.555  -6.489  -3.384 22 B_DG10:DC6_C B 10 ? C 6  ? 19 1 
1 E DT 11 1_555 F DA 5  1_555 -0.220 -0.134 -0.030 2.099   -7.649  4.487  23 B_DT11:DA5_C B 11 ? C 5  ? 20 1 
1 E DG 12 1_555 F DC 4  1_555 -0.399 -0.084 0.224  -1.909  -4.624  5.247  24 B_DG12:DC4_C B 12 ? C 4  ? 19 1 
1 E DT 13 1_555 F DA 3  1_555 -0.305 -0.076 0.626  -0.897  -9.303  1.827  25 B_DT13:DA3_C B 13 ? C 3  ? 20 1 
1 E DT 14 1_555 F DA 2  1_555 0.256  -0.050 0.252  9.299   -6.533  -0.344 26 B_DT14:DA2_C B 14 ? C 2  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DG 2  1_555 C DC 14 1_555 B DC 3  1_555 C DG 13 1_555 0.510  -0.082 2.753 2.304  5.280  31.847 -0.935 -0.572 2.734 9.525  
-4.156 32.350 1  EE_DG2DC3:DG12DC13_FF E 2  ? F 13 ? E 3  ? F 12 ? 
1 B DC 3  1_555 C DG 13 1_555 B DG 4  1_555 C DC 12 1_555 -0.900 -0.477 3.446 -6.971 9.257  31.073 -2.499 0.327  3.294 16.575 
12.481 33.113 2  EE_DC3DG4:DC11DG12_FF E 3  ? F 12 ? E 4  ? F 11 ? 
1 B DG 4  1_555 C DC 12 1_555 B DT 5  1_555 C DA 11 1_555 0.837  -0.576 3.279 2.374  5.773  32.581 -1.976 -1.070 3.185 10.173 
-4.184 33.157 3  EE_DG4DT5:DA10DC11_FF E 4  ? F 11 ? E 5  ? F 10 ? 
1 B DT 5  1_555 C DA 11 1_555 B DG 6  1_555 C DC 10 1_555 -1.064 -0.444 3.595 -6.153 -0.659 34.138 -0.631 0.719  3.732 -1.112 
10.375 34.678 4  EE_DT5DG6:DC9DA10_FF  E 5  ? F 10 ? E 6  ? F 9  ? 
1 B DG 6  1_555 C DC 10 1_555 B DG 7  1_555 C DC 9  1_555 -0.751 -0.872 3.303 4.716  7.655  34.906 -2.464 1.863  2.930 12.507 
-7.704 36.011 5  EE_DG6DG7:DC8DC9_FF   E 6  ? F 9  ? E 7  ? F 8  ? 
1 B DG 7  1_555 C DC 9  1_555 B DG 8  1_555 C DC 8  1_555 0.135  -0.751 3.275 -3.565 7.874  34.026 -2.398 -0.745 3.003 13.194 
5.973  35.076 6  EE_DG7DG8:DC7DC8_FF   E 7  ? F 8  ? E 8  ? F 7  ? 
1 B DG 8  1_555 C DC 8  1_555 B DA 9  1_555 C DT 7  1_555 0.201  -0.326 3.407 0.434  -2.327 32.576 -0.158 -0.278 3.424 -4.142 
-0.773 32.660 7  EE_DG8DA9:DT6DC7_FF   E 8  ? F 7  ? E 9  ? F 6  ? 
1 B DA 9  1_555 C DT 7  1_555 B DG 10 1_555 C DC 6  1_555 -1.198 -0.583 3.296 -2.634 8.139  32.402 -2.356 1.645  3.147 14.277 
4.620  33.483 8  EE_DA9DG10:DC5DT6_FF  E 9  ? F 6  ? E 10 ? F 5  ? 
1 B DG 10 1_555 C DC 6  1_555 B DT 11 1_555 C DA 5  1_555 0.708  -0.931 3.215 -1.525 1.157  30.688 -1.977 -1.626 3.141 2.184  
2.878  30.746 9  EE_DG10DT11:DA4DC5_FF E 10 ? F 5  ? E 11 ? F 4  ? 
1 B DT 11 1_555 C DA 5  1_555 B DG 12 1_555 C DC 4  1_555 -0.268 -0.650 3.362 -3.021 5.961  29.958 -2.418 -0.096 3.188 11.354 
5.755  30.678 10 EE_DT11DG12:DC3DA4_FF E 11 ? F 4  ? E 12 ? F 3  ? 
1 B DG 12 1_555 C DC 4  1_555 B DT 13 1_555 C DA 3  1_555 -0.992 -0.674 3.331 -1.355 2.907  32.453 -1.714 1.528  3.297 5.186  
2.417  32.607 11 EE_DG12DT13:DA2DC3_FF E 12 ? F 3  ? E 13 ? F 2  ? 
1 B DT 13 1_555 C DA 3  1_555 B DT 14 1_555 C DA 2  1_555 0.519  -0.379 3.142 2.148  -2.388 35.820 -0.283 -0.543 3.185 -3.874 
-3.483 35.959 12 EE_DT13DT14:DA1DA2_FF E 13 ? F 2  ? E 14 ? F 1  ? 
1 E DG 2  1_555 F DC 14 1_555 E DC 3  1_555 F DG 13 1_555 0.183  -0.093 2.830 2.318  4.117  30.860 -0.851 0.041  2.800 7.680  
-4.324 31.211 13 BB_DG2DC3:DG13DC14_CC B 2  ? C 14 ? B 3  ? C 13 ? 
1 E DC 3  1_555 F DG 13 1_555 E DG 4  1_555 F DC 12 1_555 -0.963 -0.251 3.489 -6.355 9.565  33.243 -1.970 0.563  3.411 16.132 
10.717 35.118 14 BB_DC3DG4:DC12DG13_CC B 3  ? C 13 ? B 4  ? C 12 ? 
1 E DG 4  1_555 F DC 12 1_555 E DT 5  1_555 F DA 11 1_555 1.161  -0.571 3.462 1.191  4.334  34.757 -1.634 -1.739 3.405 7.217  
-1.983 35.038 15 BB_DG4DT5:DA11DC12_CC B 4  ? C 12 ? B 5  ? C 11 ? 
1 E DT 5  1_555 F DA 11 1_555 E DG 6  1_555 F DC 10 1_555 -0.981 -0.619 3.468 -4.102 -1.099 30.661 -0.930 0.980  3.585 -2.066 
7.711  30.947 16 BB_DT5DG6:DC10DA11_CC B 5  ? C 11 ? B 6  ? C 10 ? 
1 E DG 6  1_555 F DC 10 1_555 E DG 7  1_555 F DC 9  1_555 -0.797 -0.765 3.072 1.439  5.854  34.657 -2.066 1.516  2.874 9.736  
-2.394 35.162 17 BB_DG6DG7:DC9DC10_CC  B 6  ? C 10 ? B 7  ? C 9  ? 
1 E DG 7  1_555 F DC 9  1_555 E DG 8  1_555 F DC 8  1_555 0.076  -0.859 3.380 -2.635 8.727  34.669 -2.654 -0.503 3.067 14.340 
4.330  35.812 18 BB_DG7DG8:DC8DC9_CC   B 7  ? C 9  ? B 8  ? C 8  ? 
1 E DG 8  1_555 F DC 8  1_555 E DA 9  1_555 F DT 7  1_555 0.620  -0.602 3.323 2.216  -2.941 29.849 -0.539 -0.726 3.401 -5.682 
-4.281 30.070 19 BB_DG8DA9:DT7DC8_CC   B 8  ? C 8  ? B 9  ? C 7  ? 
1 E DA 9  1_555 F DT 7  1_555 E DG 10 1_555 F DC 6  1_555 -1.521 -0.382 3.328 -2.968 9.691  33.461 -2.137 2.076  3.216 16.372 
5.013  34.920 20 BB_DA9DG10:DC6DT7_CC  B 9  ? C 7  ? B 10 ? C 6  ? 
1 E DG 10 1_555 F DC 6  1_555 E DT 11 1_555 F DA 5  1_555 0.667  -0.822 3.158 -2.603 -0.762 31.108 -1.389 -1.714 3.112 -1.417 
4.842  31.223 21 BB_DG10DT11:DA5DC6_CC B 10 ? C 6  ? B 11 ? C 5  ? 
1 E DT 11 1_555 F DA 5  1_555 E DG 12 1_555 F DC 4  1_555 -0.515 -0.702 3.338 -2.115 3.527  31.172 -1.966 0.549  3.268 6.528  
3.914  31.435 22 BB_DT11DG12:DC4DA5_CC B 11 ? C 5  ? B 12 ? C 4  ? 
1 E DG 12 1_555 F DC 4  1_555 E DT 13 1_555 F DA 3  1_555 -0.641 -0.837 3.325 -2.141 3.247  31.250 -2.155 0.777  3.259 5.999  
3.956  31.485 23 BB_DG12DT13:DA3DC4_CC B 12 ? C 4  ? B 13 ? C 3  ? 
1 E DT 13 1_555 F DA 3  1_555 E DT 14 1_555 F DA 2  1_555 0.227  -0.175 2.990 3.546  -0.978 36.939 -0.155 0.078  3.002 -1.538 
-5.580 37.115 24 BB_DT13DT14:DA2DA3_CC B 13 ? C 3  ? B 14 ? C 2  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'ZINC ION'    ZN  
5 'SULFATE ION' SO4 
6 water         HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'light scattering' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#