data_6B0Z
# 
_entry.id   6B0Z 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6B0Z         
WWPDB D_1000230113 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6B0Z 
_pdbx_database_status.recvd_initial_deposition_date   2017-09-15 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Xie, X.'       1 ? 
'Kulathila, R.' 2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'ACS Med Chem Lett' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1948-5875 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            8 
_citation.language                  ? 
_citation.page_first                1116 
_citation.page_last                 1121 
_citation.title                     
'Discovery and Evaluation of Clinical Candidate IDH305, a Brain Penetrant Mutant IDH1 Inhibitor.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/acsmedchemlett.7b00342 
_citation.pdbx_database_id_PubMed   29057061 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Cho, Y.S.'      1  
primary 'Levell, J.R.'   2  
primary 'Liu, G.'        3  
primary 'Caferro, T.'    4  
primary 'Sutton, J.'     5  
primary 'Shafer, C.M.'   6  
primary 'Costales, A.'   7  
primary 'Manning, J.R.'  8  
primary 'Zhao, Q.'       9  
primary 'Sendzik, M.'    10 
primary 'Shultz, M.'     11 
primary 'Chenail, G.'    12 
primary 'Dooley, J.'     13 
primary 'Villalba, B.'   14 
primary 'Farsidjani, A.' 15 
primary 'Chen, J.'       16 
primary 'Kulathila, R.'  17 
primary 'Xie, X.'        18 
primary 'Dodd, S.'       19 
primary 'Gould, T.'      20 
primary 'Liang, G.'      21 
primary 'Heimbach, T.'   22 
primary 'Slocum, K.'     23 
primary 'Firestone, B.'  24 
primary 'Pu, M.'         25 
primary 'Pagliarini, R.' 26 
primary 'Growney, J.D.'  27 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6B0Z 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     81.495 
_cell.length_a_esd                 ? 
_cell.length_b                     155.312 
_cell.length_b_esd                 ? 
_cell.length_c                     163.054 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        16 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6B0Z 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Isocitrate dehydrogenase [NADP] cytoplasmic' 46912.391 4   1.1.1.42 R132H ? ? 
2 non-polymer syn 'NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' 745.421   4   ?        ?     ? ? 
3 non-polymer syn 
;(4R)-4-[(1S)-1-fluoroethyl]-3-[2-({(1S)-1-[4-methyl-2'-(trifluoromethyl)[3,4'-bipyridin]-6-yl]ethyl}amino)pyrimidin-4-yl]-1,3-oxazolidin-2-one
;
490.453   6   ?        ?     ? ? 
4 non-polymer syn 'CITRATE ANION' 189.100   4   ?        ?     ? ? 
5 water       nat water 18.015    511 ?        ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'IDH,Cytosolic NADP-isocitrate dehydrogenase,IDP,NADP(+)-specific ICDH,Oxalosuccinate decarboxylase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPGMSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKHNVGVKCATIT
PDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIIIGHHAYGDQYRATDFVVPGPGKVEITYT
PSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKS
QFEAQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDGKTVEAEAAHGTVTRHYR
MYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEF
MDKLGENLKIKLAQAKL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPGMSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKHNVGVKCATIT
PDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIIIGHHAYGDQYRATDFVVPGPGKVEITYT
PSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKS
QFEAQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDGKTVEAEAAHGTVTRHYR
MYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEF
MDKLGENLKIKLAQAKL
;
_entity_poly.pdbx_strand_id                 A,C,B,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   GLY n 
1 4   MET n 
1 5   SER n 
1 6   LYS n 
1 7   LYS n 
1 8   ILE n 
1 9   SER n 
1 10  GLY n 
1 11  GLY n 
1 12  SER n 
1 13  VAL n 
1 14  VAL n 
1 15  GLU n 
1 16  MET n 
1 17  GLN n 
1 18  GLY n 
1 19  ASP n 
1 20  GLU n 
1 21  MET n 
1 22  THR n 
1 23  ARG n 
1 24  ILE n 
1 25  ILE n 
1 26  TRP n 
1 27  GLU n 
1 28  LEU n 
1 29  ILE n 
1 30  LYS n 
1 31  GLU n 
1 32  LYS n 
1 33  LEU n 
1 34  ILE n 
1 35  PHE n 
1 36  PRO n 
1 37  TYR n 
1 38  VAL n 
1 39  GLU n 
1 40  LEU n 
1 41  ASP n 
1 42  LEU n 
1 43  HIS n 
1 44  SER n 
1 45  TYR n 
1 46  ASP n 
1 47  LEU n 
1 48  GLY n 
1 49  ILE n 
1 50  GLU n 
1 51  ASN n 
1 52  ARG n 
1 53  ASP n 
1 54  ALA n 
1 55  THR n 
1 56  ASN n 
1 57  ASP n 
1 58  GLN n 
1 59  VAL n 
1 60  THR n 
1 61  LYS n 
1 62  ASP n 
1 63  ALA n 
1 64  ALA n 
1 65  GLU n 
1 66  ALA n 
1 67  ILE n 
1 68  LYS n 
1 69  LYS n 
1 70  HIS n 
1 71  ASN n 
1 72  VAL n 
1 73  GLY n 
1 74  VAL n 
1 75  LYS n 
1 76  CYS n 
1 77  ALA n 
1 78  THR n 
1 79  ILE n 
1 80  THR n 
1 81  PRO n 
1 82  ASP n 
1 83  GLU n 
1 84  LYS n 
1 85  ARG n 
1 86  VAL n 
1 87  GLU n 
1 88  GLU n 
1 89  PHE n 
1 90  LYS n 
1 91  LEU n 
1 92  LYS n 
1 93  GLN n 
1 94  MET n 
1 95  TRP n 
1 96  LYS n 
1 97  SER n 
1 98  PRO n 
1 99  ASN n 
1 100 GLY n 
1 101 THR n 
1 102 ILE n 
1 103 ARG n 
1 104 ASN n 
1 105 ILE n 
1 106 LEU n 
1 107 GLY n 
1 108 GLY n 
1 109 THR n 
1 110 VAL n 
1 111 PHE n 
1 112 ARG n 
1 113 GLU n 
1 114 ALA n 
1 115 ILE n 
1 116 ILE n 
1 117 CYS n 
1 118 LYS n 
1 119 ASN n 
1 120 ILE n 
1 121 PRO n 
1 122 ARG n 
1 123 LEU n 
1 124 VAL n 
1 125 SER n 
1 126 GLY n 
1 127 TRP n 
1 128 VAL n 
1 129 LYS n 
1 130 PRO n 
1 131 ILE n 
1 132 ILE n 
1 133 ILE n 
1 134 GLY n 
1 135 HIS n 
1 136 HIS n 
1 137 ALA n 
1 138 TYR n 
1 139 GLY n 
1 140 ASP n 
1 141 GLN n 
1 142 TYR n 
1 143 ARG n 
1 144 ALA n 
1 145 THR n 
1 146 ASP n 
1 147 PHE n 
1 148 VAL n 
1 149 VAL n 
1 150 PRO n 
1 151 GLY n 
1 152 PRO n 
1 153 GLY n 
1 154 LYS n 
1 155 VAL n 
1 156 GLU n 
1 157 ILE n 
1 158 THR n 
1 159 TYR n 
1 160 THR n 
1 161 PRO n 
1 162 SER n 
1 163 ASP n 
1 164 GLY n 
1 165 THR n 
1 166 GLN n 
1 167 LYS n 
1 168 VAL n 
1 169 THR n 
1 170 TYR n 
1 171 LEU n 
1 172 VAL n 
1 173 HIS n 
1 174 ASN n 
1 175 PHE n 
1 176 GLU n 
1 177 GLU n 
1 178 GLY n 
1 179 GLY n 
1 180 GLY n 
1 181 VAL n 
1 182 ALA n 
1 183 MET n 
1 184 GLY n 
1 185 MET n 
1 186 TYR n 
1 187 ASN n 
1 188 GLN n 
1 189 ASP n 
1 190 LYS n 
1 191 SER n 
1 192 ILE n 
1 193 GLU n 
1 194 ASP n 
1 195 PHE n 
1 196 ALA n 
1 197 HIS n 
1 198 SER n 
1 199 SER n 
1 200 PHE n 
1 201 GLN n 
1 202 MET n 
1 203 ALA n 
1 204 LEU n 
1 205 SER n 
1 206 LYS n 
1 207 GLY n 
1 208 TRP n 
1 209 PRO n 
1 210 LEU n 
1 211 TYR n 
1 212 LEU n 
1 213 SER n 
1 214 THR n 
1 215 LYS n 
1 216 ASN n 
1 217 THR n 
1 218 ILE n 
1 219 LEU n 
1 220 LYS n 
1 221 LYS n 
1 222 TYR n 
1 223 ASP n 
1 224 GLY n 
1 225 ARG n 
1 226 PHE n 
1 227 LYS n 
1 228 ASP n 
1 229 ILE n 
1 230 PHE n 
1 231 GLN n 
1 232 GLU n 
1 233 ILE n 
1 234 TYR n 
1 235 ASP n 
1 236 LYS n 
1 237 GLN n 
1 238 TYR n 
1 239 LYS n 
1 240 SER n 
1 241 GLN n 
1 242 PHE n 
1 243 GLU n 
1 244 ALA n 
1 245 GLN n 
1 246 LYS n 
1 247 ILE n 
1 248 TRP n 
1 249 TYR n 
1 250 GLU n 
1 251 HIS n 
1 252 ARG n 
1 253 LEU n 
1 254 ILE n 
1 255 ASP n 
1 256 ASP n 
1 257 MET n 
1 258 VAL n 
1 259 ALA n 
1 260 GLN n 
1 261 ALA n 
1 262 MET n 
1 263 LYS n 
1 264 SER n 
1 265 GLU n 
1 266 GLY n 
1 267 GLY n 
1 268 PHE n 
1 269 ILE n 
1 270 TRP n 
1 271 ALA n 
1 272 CYS n 
1 273 LYS n 
1 274 ASN n 
1 275 TYR n 
1 276 ASP n 
1 277 GLY n 
1 278 ASP n 
1 279 VAL n 
1 280 GLN n 
1 281 SER n 
1 282 ASP n 
1 283 SER n 
1 284 VAL n 
1 285 ALA n 
1 286 GLN n 
1 287 GLY n 
1 288 TYR n 
1 289 GLY n 
1 290 SER n 
1 291 LEU n 
1 292 GLY n 
1 293 MET n 
1 294 MET n 
1 295 THR n 
1 296 SER n 
1 297 VAL n 
1 298 LEU n 
1 299 VAL n 
1 300 CYS n 
1 301 PRO n 
1 302 ASP n 
1 303 GLY n 
1 304 LYS n 
1 305 THR n 
1 306 VAL n 
1 307 GLU n 
1 308 ALA n 
1 309 GLU n 
1 310 ALA n 
1 311 ALA n 
1 312 HIS n 
1 313 GLY n 
1 314 THR n 
1 315 VAL n 
1 316 THR n 
1 317 ARG n 
1 318 HIS n 
1 319 TYR n 
1 320 ARG n 
1 321 MET n 
1 322 TYR n 
1 323 GLN n 
1 324 LYS n 
1 325 GLY n 
1 326 GLN n 
1 327 GLU n 
1 328 THR n 
1 329 SER n 
1 330 THR n 
1 331 ASN n 
1 332 PRO n 
1 333 ILE n 
1 334 ALA n 
1 335 SER n 
1 336 ILE n 
1 337 PHE n 
1 338 ALA n 
1 339 TRP n 
1 340 THR n 
1 341 ARG n 
1 342 GLY n 
1 343 LEU n 
1 344 ALA n 
1 345 HIS n 
1 346 ARG n 
1 347 ALA n 
1 348 LYS n 
1 349 LEU n 
1 350 ASP n 
1 351 ASN n 
1 352 ASN n 
1 353 LYS n 
1 354 GLU n 
1 355 LEU n 
1 356 ALA n 
1 357 PHE n 
1 358 PHE n 
1 359 ALA n 
1 360 ASN n 
1 361 ALA n 
1 362 LEU n 
1 363 GLU n 
1 364 GLU n 
1 365 VAL n 
1 366 SER n 
1 367 ILE n 
1 368 GLU n 
1 369 THR n 
1 370 ILE n 
1 371 GLU n 
1 372 ALA n 
1 373 GLY n 
1 374 PHE n 
1 375 MET n 
1 376 THR n 
1 377 LYS n 
1 378 ASP n 
1 379 LEU n 
1 380 ALA n 
1 381 ALA n 
1 382 CYS n 
1 383 ILE n 
1 384 LYS n 
1 385 GLY n 
1 386 LEU n 
1 387 PRO n 
1 388 ASN n 
1 389 VAL n 
1 390 GLN n 
1 391 ARG n 
1 392 SER n 
1 393 ASP n 
1 394 TYR n 
1 395 LEU n 
1 396 ASN n 
1 397 THR n 
1 398 PHE n 
1 399 GLU n 
1 400 PHE n 
1 401 MET n 
1 402 ASP n 
1 403 LYS n 
1 404 LEU n 
1 405 GLY n 
1 406 GLU n 
1 407 ASN n 
1 408 LEU n 
1 409 LYS n 
1 410 ILE n 
1 411 LYS n 
1 412 LEU n 
1 413 ALA n 
1 414 GLN n 
1 415 ALA n 
1 416 LYS n 
1 417 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   417 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'IDH1, PICD' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    IDHC_HUMAN 
_struct_ref.pdbx_db_accession          O75874 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKHNVGVKCATITPDE
KRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPSD
GTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFE
AQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQ
KGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDK
LGENLKIKLAQAKL
;
_struct_ref.pdbx_align_begin           1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6B0Z A 4 ? 417 ? O75874 1 ? 414 ? 1 414 
2 1 6B0Z C 4 ? 417 ? O75874 1 ? 414 ? 1 414 
3 1 6B0Z B 4 ? 417 ? O75874 1 ? 414 ? 1 414 
4 1 6B0Z D 4 ? 417 ? O75874 1 ? 414 ? 1 414 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6B0Z GLY A 1   ? UNP O75874 ?   ?   'expression tag'      -2  1  
1 6B0Z PRO A 2   ? UNP O75874 ?   ?   'expression tag'      -1  2  
1 6B0Z GLY A 3   ? UNP O75874 ?   ?   'expression tag'      0   3  
1 6B0Z HIS A 135 ? UNP O75874 ARG 132 'engineered mutation' 132 4  
2 6B0Z GLY C 1   ? UNP O75874 ?   ?   'expression tag'      -2  5  
2 6B0Z PRO C 2   ? UNP O75874 ?   ?   'expression tag'      -1  6  
2 6B0Z GLY C 3   ? UNP O75874 ?   ?   'expression tag'      0   7  
2 6B0Z HIS C 135 ? UNP O75874 ARG 132 'engineered mutation' 132 8  
3 6B0Z GLY B 1   ? UNP O75874 ?   ?   'expression tag'      -2  9  
3 6B0Z PRO B 2   ? UNP O75874 ?   ?   'expression tag'      -1  10 
3 6B0Z GLY B 3   ? UNP O75874 ?   ?   'expression tag'      0   11 
3 6B0Z HIS B 135 ? UNP O75874 ARG 132 'engineered mutation' 132 12 
4 6B0Z GLY D 1   ? UNP O75874 ?   ?   'expression tag'      -2  13 
4 6B0Z PRO D 2   ? UNP O75874 ?   ?   'expression tag'      -1  14 
4 6B0Z GLY D 3   ? UNP O75874 ?   ?   'expression tag'      0   15 
4 6B0Z HIS D 135 ? UNP O75874 ARG 132 'engineered mutation' 132 16 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'        133.103 
C81 non-polymer         . 
;(4R)-4-[(1S)-1-fluoroethyl]-3-[2-({(1S)-1-[4-methyl-2'-(trifluoromethyl)[3,4'-bipyridin]-6-yl]ethyl}amino)pyrimidin-4-yl]-1,3-oxazolidin-2-one
;
? 'C23 H22 F4 N6 O2'  490.453 
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'      121.158 
FLC non-polymer         . 'CITRATE ANION' ? 'C6 H5 O7 -3'       189.100 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'     149.211 
NDP non-polymer         . 'NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' ? 'C21 H30 N7 O17 P3' 745.421 
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6B0Z 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.75 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         55.27 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            294 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;co-crystallization of protein (20-24mG/mL) /compound complex at 1/1.5 molar ratio;

reservoir solution: 1.5-1.8M Tri Ammonium Citrate, 0.1M Bis-Tris pH6.5
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 X 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-06-19 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 17-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   17-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6B0Z 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.334 
_reflns.d_resolution_low                 163.054 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       584723 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.6 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            15.0 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  . 
_reflns_shell.d_res_low                   ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                107.210 
_refine.B_iso_mean                               48.3298 
_refine.B_iso_min                                20.390 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6B0Z 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.3340 
_refine.ls_d_res_low                             43.7040 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     88623 
_refine.ls_number_reflns_R_free                  4444 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.9200 
_refine.ls_percent_reflns_R_free                 5.0100 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1912 
_refine.ls_R_factor_R_free                       0.2352 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1888 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 23.4400 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.2500 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.3340 
_refine_hist.d_res_low                        43.7040 
_refine_hist.pdbx_number_atoms_ligand         454 
_refine_hist.number_atoms_solvent             511 
_refine_hist.number_atoms_total               13767 
_refine_hist.pdbx_number_residues_total       1617 
_refine_hist.pdbx_B_iso_mean_ligand           52.69 
_refine_hist.pdbx_B_iso_mean_solvent          42.60 
_refine_hist.pdbx_number_atoms_protein        12802 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.003  ? 13583 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.708  ? 18386 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.047  ? 1976  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.004  ? 2311  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 13.760 ? 10342 ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.3336 2.3601  2939 . 164 2775 100.0000 . . . 0.2892 0.0000 0.2433 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.3601 2.3879  2916 . 119 2797 100.0000 . . . 0.2906 0.0000 0.2437 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.3879 2.4170  2925 . 178 2747 100.0000 . . . 0.2984 0.0000 0.2404 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.4170 2.4476  2915 . 143 2772 100.0000 . . . 0.3105 0.0000 0.2350 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.4476 2.4798  2910 . 149 2761 100.0000 . . . 0.3014 0.0000 0.2287 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.4798 2.5138  2887 . 149 2738 100.0000 . . . 0.3334 0.0000 0.2346 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.5138 2.5497  2991 . 134 2857 100.0000 . . . 0.3192 0.0000 0.2312 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.5497 2.5877  2910 . 139 2771 100.0000 . . . 0.2697 0.0000 0.2279 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.5877 2.6282  2942 . 129 2813 100.0000 . . . 0.2749 0.0000 0.2233 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.6282 2.6712  2865 . 137 2728 100.0000 . . . 0.2631 0.0000 0.2226 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.6712 2.7173  2969 . 152 2817 100.0000 . . . 0.2614 0.0000 0.2223 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.7173 2.7667  2888 . 142 2746 100.0000 . . . 0.2961 0.0000 0.2196 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.7667 2.8199  2951 . 140 2811 100.0000 . . . 0.3029 0.0000 0.2268 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.8199 2.8774  2927 . 149 2778 100.0000 . . . 0.2669 0.0000 0.2273 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.8774 2.9400  2932 . 150 2782 100.0000 . . . 0.2856 0.0000 0.2315 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.9400 3.0084  2955 . 142 2813 100.0000 . . . 0.2681 0.0000 0.2246 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.0084 3.0836  2934 . 142 2792 100.0000 . . . 0.2756 0.0000 0.2254 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.0836 3.1669  2964 . 149 2815 100.0000 . . . 0.2844 0.0000 0.2210 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.1669 3.2601  2937 . 150 2787 100.0000 . . . 0.2651 0.0000 0.2139 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.2601 3.3653  2945 . 161 2784 100.0000 . . . 0.2580 0.0000 0.2062 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.3653 3.4855  2916 . 151 2765 100.0000 . . . 0.2399 0.0000 0.1938 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.4855 3.6250  2977 . 143 2834 100.0000 . . . 0.2489 0.0000 0.1828 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.6250 3.7899  2964 . 167 2797 100.0000 . . . 0.2167 0.0000 0.1726 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.7899 3.9896  2966 . 157 2809 100.0000 . . . 0.2126 0.0000 0.1621 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.9896 4.2394  2977 . 168 2809 100.0000 . . . 0.2185 0.0000 0.1583 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 4.2394 4.5664  2977 . 147 2830 100.0000 . . . 0.1977 0.0000 0.1476 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 4.5664 5.0253  3003 . 146 2857 100.0000 . . . 0.1768 0.0000 0.1439 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 5.0253 5.7511  3004 . 137 2867 100.0000 . . . 0.1941 0.0000 0.1662 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 5.7511 7.2404  3058 . 143 2915 100.0000 . . . 0.2171 0.0000 0.1827 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 7.2404 43.7113 3179 . 167 3012 99.0000  . . . 0.1789 0.0000 0.1650 . . . . . . 30 . . . 
# 
_struct.entry_id                     6B0Z 
_struct.title                        'IDH1 R132H mutant in complex with IDH305' 
_struct.pdbx_descriptor              'Isocitrate dehydrogenase [NADP] cytoplasmic (E.C.1.1.1.42)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6B0Z 
_struct_keywords.text            'Isocitrate dehydrogenase, Rossmann fold, NADPH, inhibitor, OXIDOREDUCTASE' 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 3 ? 
I N N 2 ? 
J N N 3 ? 
K N N 4 ? 
L N N 2 ? 
M N N 3 ? 
N N N 4 ? 
O N N 2 ? 
P N N 3 ? 
Q N N 4 ? 
R N N 3 ? 
S N N 5 ? 
T N N 5 ? 
U N N 5 ? 
V N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 19  ? LEU A 33  ? ASP A 16  LEU A 30  1 ? 15 
HELX_P HELX_P2  AA2 GLY A 48  ? THR A 55  ? GLY A 45  THR A 52  1 ? 8  
HELX_P HELX_P3  AA3 ASP A 57  ? ASN A 71  ? ASP A 54  ASN A 68  1 ? 15 
HELX_P HELX_P4  AA4 ASP A 82  ? LYS A 90  ? ASP A 79  LYS A 87  1 ? 9  
HELX_P HELX_P5  AA5 SER A 97  ? GLY A 107 ? SER A 94  GLY A 104 1 ? 11 
HELX_P HELX_P6  AA6 ASP A 189 ? GLY A 207 ? ASP A 186 GLY A 204 1 ? 19 
HELX_P HELX_P7  AA7 LYS A 221 ? TYR A 238 ? LYS A 218 TYR A 235 1 ? 18 
HELX_P HELX_P8  AA8 TYR A 238 ? GLN A 245 ? TYR A 235 GLN A 242 1 ? 8  
HELX_P HELX_P9  AA9 ILE A 254 ? LYS A 263 ? ILE A 251 LYS A 260 1 ? 10 
HELX_P HELX_P10 AB1 SER A 281 ? GLY A 289 ? SER A 278 GLY A 286 1 ? 9  
HELX_P HELX_P11 AB2 SER A 290 ? GLY A 292 ? SER A 287 GLY A 289 5 ? 3  
HELX_P HELX_P12 AB3 VAL A 315 ? LYS A 324 ? VAL A 312 LYS A 321 1 ? 10 
HELX_P HELX_P13 AB4 PRO A 332 ? ASN A 351 ? PRO A 329 ASN A 348 1 ? 20 
HELX_P HELX_P14 AB5 ASN A 352 ? ALA A 372 ? ASN A 349 ALA A 369 1 ? 21 
HELX_P HELX_P15 AB6 THR A 376 ? GLY A 385 ? THR A 373 GLY A 382 1 ? 10 
HELX_P HELX_P16 AB7 LEU A 386 ? VAL A 389 ? LEU A 383 VAL A 386 5 ? 4  
HELX_P HELX_P17 AB8 GLN A 390 ? TYR A 394 ? GLN A 387 TYR A 391 5 ? 5  
HELX_P HELX_P18 AB9 ASN A 396 ? GLN A 414 ? ASN A 393 GLN A 411 1 ? 19 
HELX_P HELX_P19 AC1 ASP B 19  ? LEU B 33  ? ASP C 16  LEU C 30  1 ? 15 
HELX_P HELX_P20 AC2 GLY B 48  ? THR B 55  ? GLY C 45  THR C 52  1 ? 8  
HELX_P HELX_P21 AC3 ASP B 57  ? ASN B 71  ? ASP C 54  ASN C 68  1 ? 15 
HELX_P HELX_P22 AC4 ASP B 82  ? LYS B 90  ? ASP C 79  LYS C 87  1 ? 9  
HELX_P HELX_P23 AC5 SER B 97  ? GLY B 107 ? SER C 94  GLY C 104 1 ? 11 
HELX_P HELX_P24 AC6 ASP B 189 ? GLY B 207 ? ASP C 186 GLY C 204 1 ? 19 
HELX_P HELX_P25 AC7 LYS B 221 ? TYR B 238 ? LYS C 218 TYR C 235 1 ? 18 
HELX_P HELX_P26 AC8 TYR B 238 ? GLN B 245 ? TYR C 235 GLN C 242 1 ? 8  
HELX_P HELX_P27 AC9 ILE B 254 ? SER B 264 ? ILE C 251 SER C 261 1 ? 11 
HELX_P HELX_P28 AD1 ASP B 276 ? SER B 281 ? ASP C 273 SER C 278 1 ? 6  
HELX_P HELX_P29 AD2 SER B 281 ? GLY B 289 ? SER C 278 GLY C 286 1 ? 9  
HELX_P HELX_P30 AD3 SER B 290 ? GLY B 292 ? SER C 287 GLY C 289 5 ? 3  
HELX_P HELX_P31 AD4 VAL B 315 ? LYS B 324 ? VAL C 312 LYS C 321 1 ? 10 
HELX_P HELX_P32 AD5 PRO B 332 ? ASN B 351 ? PRO C 329 ASN C 348 1 ? 20 
HELX_P HELX_P33 AD6 ASN B 352 ? ALA B 372 ? ASN C 349 ALA C 369 1 ? 21 
HELX_P HELX_P34 AD7 THR B 376 ? GLY B 385 ? THR C 373 GLY C 382 1 ? 10 
HELX_P HELX_P35 AD8 GLN B 390 ? TYR B 394 ? GLN C 387 TYR C 391 5 ? 5  
HELX_P HELX_P36 AD9 ASN B 396 ? ALA B 415 ? ASN C 393 ALA C 412 1 ? 20 
HELX_P HELX_P37 AE1 ASP C 19  ? LEU C 33  ? ASP B 16  LEU B 30  1 ? 15 
HELX_P HELX_P38 AE2 GLY C 48  ? THR C 55  ? GLY B 45  THR B 52  1 ? 8  
HELX_P HELX_P39 AE3 ASP C 57  ? ASN C 71  ? ASP B 54  ASN B 68  1 ? 15 
HELX_P HELX_P40 AE4 ASP C 82  ? LYS C 90  ? ASP B 79  LYS B 87  1 ? 9  
HELX_P HELX_P41 AE5 SER C 97  ? GLY C 107 ? SER B 94  GLY B 104 1 ? 11 
HELX_P HELX_P42 AE6 ASP C 140 ? ALA C 144 ? ASP B 137 ALA B 141 5 ? 5  
HELX_P HELX_P43 AE7 ASP C 189 ? GLY C 207 ? ASP B 186 GLY B 204 1 ? 19 
HELX_P HELX_P44 AE8 LYS C 221 ? TYR C 238 ? LYS B 218 TYR B 235 1 ? 18 
HELX_P HELX_P45 AE9 TYR C 238 ? GLN C 245 ? TYR B 235 GLN B 242 1 ? 8  
HELX_P HELX_P46 AF1 ILE C 254 ? SER C 264 ? ILE B 251 SER B 261 1 ? 11 
HELX_P HELX_P47 AF2 ASP C 276 ? SER C 281 ? ASP B 273 SER B 278 1 ? 6  
HELX_P HELX_P48 AF3 SER C 281 ? GLY C 289 ? SER B 278 GLY B 286 1 ? 9  
HELX_P HELX_P49 AF4 SER C 290 ? GLY C 292 ? SER B 287 GLY B 289 5 ? 3  
HELX_P HELX_P50 AF5 VAL C 315 ? LYS C 324 ? VAL B 312 LYS B 321 1 ? 10 
HELX_P HELX_P51 AF6 PRO C 332 ? ASN C 351 ? PRO B 329 ASN B 348 1 ? 20 
HELX_P HELX_P52 AF7 ASN C 352 ? ALA C 372 ? ASN B 349 ALA B 369 1 ? 21 
HELX_P HELX_P53 AF8 THR C 376 ? GLY C 385 ? THR B 373 GLY B 382 1 ? 10 
HELX_P HELX_P54 AF9 LEU C 386 ? VAL C 389 ? LEU B 383 VAL B 386 5 ? 4  
HELX_P HELX_P55 AG1 GLN C 390 ? TYR C 394 ? GLN B 387 TYR B 391 5 ? 5  
HELX_P HELX_P56 AG2 ASN C 396 ? ALA C 415 ? ASN B 393 ALA B 412 1 ? 20 
HELX_P HELX_P57 AG3 ASP D 19  ? LEU D 33  ? ASP D 16  LEU D 30  1 ? 15 
HELX_P HELX_P58 AG4 GLY D 48  ? ASP D 53  ? GLY D 45  ASP D 50  1 ? 6  
HELX_P HELX_P59 AG5 ASP D 57  ? ASN D 71  ? ASP D 54  ASN D 68  1 ? 15 
HELX_P HELX_P60 AG6 ASP D 82  ? LYS D 90  ? ASP D 79  LYS D 87  1 ? 9  
HELX_P HELX_P61 AG7 SER D 97  ? GLY D 107 ? SER D 94  GLY D 104 1 ? 11 
HELX_P HELX_P62 AG8 ASP D 189 ? GLY D 207 ? ASP D 186 GLY D 204 1 ? 19 
HELX_P HELX_P63 AG9 LYS D 221 ? TYR D 238 ? LYS D 218 TYR D 235 1 ? 18 
HELX_P HELX_P64 AH1 TYR D 238 ? GLN D 245 ? TYR D 235 GLN D 242 1 ? 8  
HELX_P HELX_P65 AH2 ILE D 254 ? LYS D 263 ? ILE D 251 LYS D 260 1 ? 10 
HELX_P HELX_P66 AH3 SER D 281 ? GLY D 289 ? SER D 278 GLY D 286 1 ? 9  
HELX_P HELX_P67 AH4 SER D 290 ? GLY D 292 ? SER D 287 GLY D 289 5 ? 3  
HELX_P HELX_P68 AH5 VAL D 315 ? LYS D 324 ? VAL D 312 LYS D 321 1 ? 10 
HELX_P HELX_P69 AH6 PRO D 332 ? ASP D 350 ? PRO D 329 ASP D 347 1 ? 19 
HELX_P HELX_P70 AH7 ASN D 352 ? ALA D 372 ? ASN D 349 ALA D 369 1 ? 21 
HELX_P HELX_P71 AH8 THR D 376 ? GLY D 385 ? THR D 373 GLY D 382 1 ? 10 
HELX_P HELX_P72 AH9 LEU D 386 ? VAL D 389 ? LEU D 383 VAL D 386 5 ? 4  
HELX_P HELX_P73 AI1 GLN D 390 ? TYR D 394 ? GLN D 387 TYR D 391 5 ? 5  
HELX_P HELX_P74 AI2 ASN D 396 ? GLN D 414 ? ASN D 393 GLN D 411 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 10 ? 
AA2 ? 4  ? 
AA3 ? 4  ? 
AA4 ? 10 ? 
AA5 ? 10 ? 
AA6 ? 4  ? 
AA7 ? 4  ? 
AA8 ? 10 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2  ? parallel      
AA1 2 3  ? parallel      
AA1 3 4  ? parallel      
AA1 4 5  ? anti-parallel 
AA1 5 6  ? anti-parallel 
AA1 6 7  ? anti-parallel 
AA1 7 8  ? parallel      
AA1 8 9  ? parallel      
AA1 9 10 ? parallel      
AA2 1 2  ? anti-parallel 
AA2 2 3  ? anti-parallel 
AA2 3 4  ? anti-parallel 
AA3 1 2  ? anti-parallel 
AA3 2 3  ? anti-parallel 
AA3 3 4  ? anti-parallel 
AA4 1 2  ? parallel      
AA4 2 3  ? parallel      
AA4 3 4  ? parallel      
AA4 4 5  ? anti-parallel 
AA4 5 6  ? anti-parallel 
AA4 6 7  ? anti-parallel 
AA4 7 8  ? parallel      
AA4 8 9  ? parallel      
AA4 9 10 ? parallel      
AA5 1 2  ? parallel      
AA5 2 3  ? parallel      
AA5 3 4  ? parallel      
AA5 4 5  ? anti-parallel 
AA5 5 6  ? anti-parallel 
AA5 6 7  ? anti-parallel 
AA5 7 8  ? parallel      
AA5 8 9  ? parallel      
AA5 9 10 ? parallel      
AA6 1 2  ? anti-parallel 
AA6 2 3  ? anti-parallel 
AA6 3 4  ? anti-parallel 
AA7 1 2  ? anti-parallel 
AA7 2 3  ? anti-parallel 
AA7 3 4  ? anti-parallel 
AA8 1 2  ? parallel      
AA8 2 3  ? parallel      
AA8 3 4  ? parallel      
AA8 4 5  ? anti-parallel 
AA8 5 6  ? anti-parallel 
AA8 6 7  ? anti-parallel 
AA8 7 8  ? parallel      
AA8 8 9  ? parallel      
AA8 9 10 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  VAL A 38  ? ASP A 46  ? VAL A 35  ASP A 43  
AA1 2  ILE A 8   ? GLN A 17  ? ILE A 5   GLN A 14  
AA1 3  VAL A 72  ? LYS A 75  ? VAL A 69  LYS A 72  
AA1 4  VAL A 306 ? ALA A 310 ? VAL A 303 ALA A 307 
AA1 5  MET A 294 ? VAL A 299 ? MET A 291 VAL A 296 
AA1 6  THR A 109 ? ALA A 114 ? THR A 106 ALA A 111 
AA1 7  ILE A 131 ? HIS A 135 ? ILE A 128 HIS A 132 
AA1 8  PHE A 268 ? CYS A 272 ? PHE A 265 CYS A 269 
AA1 9  LEU A 210 ? THR A 214 ? LEU A 207 THR A 211 
AA1 10 TYR A 249 ? LEU A 253 ? TYR A 246 LEU A 250 
AA2 1  THR A 145 ? VAL A 149 ? THR A 142 VAL A 146 
AA2 2  GLY A 180 ? GLN A 188 ? GLY A 177 GLN A 185 
AA2 3  GLY B 180 ? GLN B 188 ? GLY C 177 GLN C 185 
AA2 4  ALA B 144 ? VAL B 149 ? ALA C 141 VAL C 146 
AA3 1  VAL A 168 ? PHE A 175 ? VAL A 165 PHE A 172 
AA3 2  GLY A 153 ? PRO A 161 ? GLY A 150 PRO A 158 
AA3 3  GLY B 153 ? PRO B 161 ? GLY C 150 PRO C 158 
AA3 4  VAL B 168 ? PHE B 175 ? VAL C 165 PHE C 172 
AA4 1  VAL B 38  ? ASP B 46  ? VAL C 35  ASP C 43  
AA4 2  ILE B 8   ? GLN B 17  ? ILE C 5   GLN C 14  
AA4 3  VAL B 72  ? LYS B 75  ? VAL C 69  LYS C 72  
AA4 4  VAL B 306 ? ALA B 310 ? VAL C 303 ALA C 307 
AA4 5  MET B 294 ? VAL B 299 ? MET C 291 VAL C 296 
AA4 6  THR B 109 ? ALA B 114 ? THR C 106 ALA C 111 
AA4 7  ILE B 132 ? HIS B 136 ? ILE C 129 HIS C 133 
AA4 8  ILE B 269 ? CYS B 272 ? ILE C 266 CYS C 269 
AA4 9  LEU B 210 ? THR B 214 ? LEU C 207 THR C 211 
AA4 10 TYR B 249 ? LEU B 253 ? TYR C 246 LEU C 250 
AA5 1  VAL C 38  ? ASP C 46  ? VAL B 35  ASP B 43  
AA5 2  ILE C 8   ? GLN C 17  ? ILE B 5   GLN B 14  
AA5 3  VAL C 72  ? LYS C 75  ? VAL B 69  LYS B 72  
AA5 4  VAL C 306 ? ALA C 310 ? VAL B 303 ALA B 307 
AA5 5  MET C 294 ? VAL C 299 ? MET B 291 VAL B 296 
AA5 6  THR C 109 ? ALA C 114 ? THR B 106 ALA B 111 
AA5 7  ILE C 132 ? HIS C 136 ? ILE B 129 HIS B 133 
AA5 8  ILE C 269 ? CYS C 272 ? ILE B 266 CYS B 269 
AA5 9  LEU C 210 ? THR C 214 ? LEU B 207 THR B 211 
AA5 10 TYR C 249 ? LEU C 253 ? TYR B 246 LEU B 250 
AA6 1  THR C 145 ? VAL C 149 ? THR B 142 VAL B 146 
AA6 2  GLY C 180 ? GLN C 188 ? GLY B 177 GLN B 185 
AA6 3  GLY D 180 ? GLN D 188 ? GLY D 177 GLN D 185 
AA6 4  ALA D 144 ? VAL D 149 ? ALA D 141 VAL D 146 
AA7 1  VAL C 168 ? PHE C 175 ? VAL B 165 PHE B 172 
AA7 2  GLY C 153 ? PRO C 161 ? GLY B 150 PRO B 158 
AA7 3  GLY D 153 ? PRO D 161 ? GLY D 150 PRO D 158 
AA7 4  VAL D 168 ? PHE D 175 ? VAL D 165 PHE D 172 
AA8 1  VAL D 38  ? ASP D 46  ? VAL D 35  ASP D 43  
AA8 2  ILE D 8   ? GLN D 17  ? ILE D 5   GLN D 14  
AA8 3  VAL D 72  ? LYS D 75  ? VAL D 69  LYS D 72  
AA8 4  VAL D 306 ? ALA D 310 ? VAL D 303 ALA D 307 
AA8 5  MET D 294 ? VAL D 299 ? MET D 291 VAL D 296 
AA8 6  THR D 109 ? ALA D 114 ? THR D 106 ALA D 111 
AA8 7  ILE D 131 ? HIS D 135 ? ILE D 128 HIS D 132 
AA8 8  PHE D 268 ? CYS D 272 ? PHE D 265 CYS D 269 
AA8 9  LEU D 210 ? THR D 214 ? LEU D 207 THR D 211 
AA8 10 TYR D 249 ? LEU D 253 ? TYR D 246 LEU D 250 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2  O GLU A 39  ? O GLU A 36  N ILE A 8   ? N ILE A 5   
AA1 2 3  N VAL A 14  ? N VAL A 11  O VAL A 72  ? O VAL A 69  
AA1 3 4  N GLY A 73  ? N GLY A 70  O ALA A 308 ? O ALA A 305 
AA1 4 5  O GLU A 307 ? O GLU A 304 N LEU A 298 ? N LEU A 295 
AA1 5 6  O VAL A 299 ? O VAL A 296 N THR A 109 ? N THR A 106 
AA1 6 7  N ARG A 112 ? N ARG A 109 O ILE A 133 ? O ILE A 130 
AA1 7 8  N GLY A 134 ? N GLY A 131 O CYS A 272 ? O CYS A 269 
AA1 8 9  O ALA A 271 ? O ALA A 268 N TYR A 211 ? N TYR A 208 
AA1 9 10 N LEU A 212 ? N LEU A 209 O ARG A 252 ? O ARG A 249 
AA2 1 2  N VAL A 149 ? N VAL A 146 O GLY A 180 ? O GLY A 177 
AA2 2 3  N VAL A 181 ? N VAL A 178 O ASN B 187 ? O ASN C 184 
AA2 3 4  O GLY B 180 ? O GLY C 177 N VAL B 149 ? N VAL C 146 
AA3 1 2  O TYR A 170 ? O TYR A 167 N ILE A 157 ? N ILE A 154 
AA3 2 3  N GLU A 156 ? N GLU A 153 O THR B 158 ? O THR C 155 
AA3 3 4  N ILE B 157 ? N ILE C 154 O TYR B 170 ? O TYR C 167 
AA4 1 2  O GLU B 39  ? O GLU C 36  N GLY B 10  ? N GLY C 7   
AA4 2 3  N VAL B 14  ? N VAL C 11  O VAL B 72  ? O VAL C 69  
AA4 3 4  N GLY B 73  ? N GLY C 70  O ALA B 308 ? O ALA C 305 
AA4 4 5  O GLU B 307 ? O GLU C 304 N LEU B 298 ? N LEU C 295 
AA4 5 6  O VAL B 299 ? O VAL C 296 N THR B 109 ? N THR C 106 
AA4 6 7  N ARG B 112 ? N ARG C 109 O ILE B 133 ? O ILE C 130 
AA4 7 8  N GLY B 134 ? N GLY C 131 O TRP B 270 ? O TRP C 267 
AA4 8 9  O ALA B 271 ? O ALA C 268 N TYR B 211 ? N TYR C 208 
AA4 9 10 N LEU B 212 ? N LEU C 209 O ARG B 252 ? O ARG C 249 
AA5 1 2  O HIS C 43  ? O HIS B 40  N VAL C 13  ? N VAL B 10  
AA5 2 3  N VAL C 14  ? N VAL B 11  O VAL C 72  ? O VAL B 69  
AA5 3 4  N GLY C 73  ? N GLY B 70  O ALA C 308 ? O ALA B 305 
AA5 4 5  O GLU C 307 ? O GLU B 304 N LEU C 298 ? N LEU B 295 
AA5 5 6  O VAL C 299 ? O VAL B 296 N THR C 109 ? N THR B 106 
AA5 6 7  N VAL C 110 ? N VAL B 107 O HIS C 135 ? O HIS B 132 
AA5 7 8  N GLY C 134 ? N GLY B 131 O CYS C 272 ? O CYS B 269 
AA5 8 9  O ALA C 271 ? O ALA B 268 N TYR C 211 ? N TYR B 208 
AA5 9 10 N LEU C 212 ? N LEU B 209 O ARG C 252 ? O ARG B 249 
AA6 1 2  N VAL C 149 ? N VAL B 146 O GLY C 180 ? O GLY B 177 
AA6 2 3  N VAL C 181 ? N VAL B 178 O ASN D 187 ? O ASN D 184 
AA6 3 4  O GLY D 180 ? O GLY D 177 N VAL D 149 ? N VAL D 146 
AA7 1 2  O TYR C 170 ? O TYR B 167 N ILE C 157 ? N ILE B 154 
AA7 2 3  N THR C 158 ? N THR B 155 O GLU D 156 ? O GLU D 153 
AA7 3 4  N ILE D 157 ? N ILE D 154 O TYR D 170 ? O TYR D 167 
AA8 1 2  O ASP D 41  ? O ASP D 38  N GLY D 11  ? N GLY D 8   
AA8 2 3  N VAL D 14  ? N VAL D 11  O VAL D 74  ? O VAL D 71  
AA8 3 4  N GLY D 73  ? N GLY D 70  O ALA D 308 ? O ALA D 305 
AA8 4 5  O GLU D 307 ? O GLU D 304 N LEU D 298 ? N LEU D 295 
AA8 5 6  O VAL D 299 ? O VAL D 296 N THR D 109 ? N THR D 106 
AA8 6 7  N ARG D 112 ? N ARG D 109 O ILE D 133 ? O ILE D 130 
AA8 7 8  N GLY D 134 ? N GLY D 131 O CYS D 272 ? O CYS D 269 
AA8 8 9  O ALA D 271 ? O ALA D 268 N TYR D 211 ? N TYR D 208 
AA8 9 10 N LEU D 212 ? N LEU D 209 O ARG D 252 ? O ARG D 249 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A NDP 501 ? 22 'binding site for residue NDP A 501' 
AC2 Software A C81 502 ? 15 'binding site for residue C81 A 502' 
AC3 Software A FLC 503 ? 5  'binding site for residue FLC A 503' 
AC4 Software A C81 504 ? 13 'binding site for residue C81 A 504' 
AC5 Software C NDP 501 ? 16 'binding site for residue NDP C 501' 
AC6 Software C C81 502 ? 13 'binding site for residue C81 C 502' 
AC7 Software C FLC 503 ? 5  'binding site for residue FLC C 503' 
AC8 Software B NDP 501 ? 27 'binding site for residue NDP B 501' 
AC9 Software B C81 502 ? 14 'binding site for residue C81 B 502' 
AD1 Software B FLC 503 ? 6  'binding site for residue FLC B 503' 
AD2 Software D NDP 501 ? 18 'binding site for residue NDP D 501' 
AD3 Software D C81 502 ? 15 'binding site for residue C81 D 502' 
AD4 Software D FLC 503 ? 4  'binding site for residue FLC D 503' 
AD5 Software D C81 504 ? 11 'binding site for residue C81 D 504' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 22 LYS A 75  ? LYS A 72  . ? 1_555 ? 
2   AC1 22 ALA A 77  ? ALA A 74  . ? 1_555 ? 
3   AC1 22 THR A 78  ? THR A 75  . ? 1_555 ? 
4   AC1 22 THR A 80  ? THR A 77  . ? 1_555 ? 
5   AC1 22 ARG A 85  ? ARG A 82  . ? 1_555 ? 
6   AC1 22 ASN A 99  ? ASN A 96  . ? 1_555 ? 
7   AC1 22 LEU A 291 ? LEU A 288 . ? 1_555 ? 
8   AC1 22 HIS A 312 ? HIS A 309 . ? 1_555 ? 
9   AC1 22 GLY A 313 ? GLY A 310 . ? 1_555 ? 
10  AC1 22 THR A 314 ? THR A 311 . ? 1_555 ? 
11  AC1 22 VAL A 315 ? VAL A 312 . ? 1_555 ? 
12  AC1 22 THR A 316 ? THR A 313 . ? 1_555 ? 
13  AC1 22 ARG A 317 ? ARG A 314 . ? 1_555 ? 
14  AC1 22 HIS A 318 ? HIS A 315 . ? 1_555 ? 
15  AC1 22 THR A 330 ? THR A 327 . ? 1_555 ? 
16  AC1 22 ASN A 331 ? ASN A 328 . ? 1_555 ? 
17  AC1 22 FLC G .   ? FLC A 503 . ? 1_555 ? 
18  AC1 22 HOH S .   ? HOH A 601 . ? 1_555 ? 
19  AC1 22 HOH S .   ? HOH A 613 . ? 1_555 ? 
20  AC1 22 HOH S .   ? HOH A 660 . ? 1_555 ? 
21  AC1 22 HOH S .   ? HOH A 702 . ? 1_555 ? 
22  AC1 22 HOH S .   ? HOH A 729 . ? 1_555 ? 
23  AC2 15 ARG A 112 ? ARG A 109 . ? 1_555 ? 
24  AC2 15 ALA A 114 ? ALA A 111 . ? 1_555 ? 
25  AC2 15 ARG A 122 ? ARG A 119 . ? 1_555 ? 
26  AC2 15 LEU A 123 ? LEU A 120 . ? 1_555 ? 
27  AC2 15 TRP A 127 ? TRP A 124 . ? 1_555 ? 
28  AC2 15 ILE A 131 ? ILE A 128 . ? 1_555 ? 
29  AC2 15 ILE A 133 ? ILE A 130 . ? 1_555 ? 
30  AC2 15 VAL A 258 ? VAL A 255 . ? 1_555 ? 
31  AC2 15 MET A 262 ? MET A 259 . ? 1_555 ? 
32  AC2 15 SER A 281 ? SER A 278 . ? 1_555 ? 
33  AC2 15 ALA A 285 ? ALA A 282 . ? 1_555 ? 
34  AC2 15 TYR A 288 ? TYR A 285 . ? 1_555 ? 
35  AC2 15 SER A 290 ? SER A 287 . ? 1_555 ? 
36  AC2 15 MET A 294 ? MET A 291 . ? 1_555 ? 
37  AC2 15 C81 H .   ? C81 A 504 . ? 1_555 ? 
38  AC3 5  THR A 80  ? THR A 77  . ? 1_555 ? 
39  AC3 5  SER A 97  ? SER A 94  . ? 1_555 ? 
40  AC3 5  ASN A 99  ? ASN A 96  . ? 1_555 ? 
41  AC3 5  ARG A 103 ? ARG A 100 . ? 1_555 ? 
42  AC3 5  NDP E .   ? NDP A 501 . ? 1_555 ? 
43  AC4 13 LEU A 123 ? LEU A 120 . ? 1_555 ? 
44  AC4 13 HIS A 135 ? HIS A 132 . ? 1_555 ? 
45  AC4 13 ILE A 254 ? ILE A 251 . ? 1_555 ? 
46  AC4 13 CYS A 272 ? CYS A 269 . ? 1_555 ? 
47  AC4 13 ASN A 274 ? ASN A 271 . ? 1_555 ? 
48  AC4 13 GLN A 280 ? GLN A 277 . ? 1_555 ? 
49  AC4 13 SER A 281 ? SER A 278 . ? 1_555 ? 
50  AC4 13 VAL A 284 ? VAL A 281 . ? 1_555 ? 
51  AC4 13 C81 F .   ? C81 A 502 . ? 1_555 ? 
52  AC4 13 LEU B 123 ? LEU C 120 . ? 1_555 ? 
53  AC4 13 GLN B 280 ? GLN C 277 . ? 1_555 ? 
54  AC4 13 VAL B 284 ? VAL C 281 . ? 1_555 ? 
55  AC4 13 C81 J .   ? C81 C 502 . ? 1_555 ? 
56  AC5 16 LYS B 75  ? LYS C 72  . ? 1_555 ? 
57  AC5 16 THR B 78  ? THR C 75  . ? 1_555 ? 
58  AC5 16 THR B 80  ? THR C 77  . ? 1_555 ? 
59  AC5 16 ARG B 85  ? ARG C 82  . ? 1_555 ? 
60  AC5 16 ASN B 99  ? ASN C 96  . ? 1_555 ? 
61  AC5 16 LEU B 291 ? LEU C 288 . ? 1_555 ? 
62  AC5 16 GLU B 309 ? GLU C 306 . ? 1_555 ? 
63  AC5 16 HIS B 312 ? HIS C 309 . ? 1_555 ? 
64  AC5 16 GLY B 313 ? GLY C 310 . ? 1_555 ? 
65  AC5 16 THR B 314 ? THR C 311 . ? 1_555 ? 
66  AC5 16 VAL B 315 ? VAL C 312 . ? 1_555 ? 
67  AC5 16 THR B 316 ? THR C 313 . ? 1_555 ? 
68  AC5 16 ARG B 317 ? ARG C 314 . ? 1_555 ? 
69  AC5 16 HIS B 318 ? HIS C 315 . ? 1_555 ? 
70  AC5 16 ASN B 331 ? ASN C 328 . ? 1_555 ? 
71  AC5 16 FLC K .   ? FLC C 503 . ? 1_555 ? 
72  AC6 13 C81 H .   ? C81 A 504 . ? 1_555 ? 
73  AC6 13 ARG B 112 ? ARG C 109 . ? 1_555 ? 
74  AC6 13 ALA B 114 ? ALA C 111 . ? 1_555 ? 
75  AC6 13 ARG B 122 ? ARG C 119 . ? 1_555 ? 
76  AC6 13 LEU B 123 ? LEU C 120 . ? 1_555 ? 
77  AC6 13 ILE B 131 ? ILE C 128 . ? 1_555 ? 
78  AC6 13 VAL B 258 ? VAL C 255 . ? 1_555 ? 
79  AC6 13 TYR B 275 ? TYR C 272 . ? 1_555 ? 
80  AC6 13 GLN B 280 ? GLN C 277 . ? 1_555 ? 
81  AC6 13 SER B 281 ? SER C 278 . ? 1_555 ? 
82  AC6 13 TYR B 288 ? TYR C 285 . ? 1_555 ? 
83  AC6 13 SER B 290 ? SER C 287 . ? 1_555 ? 
84  AC6 13 MET B 294 ? MET C 291 . ? 1_555 ? 
85  AC7 5  THR B 80  ? THR C 77  . ? 1_555 ? 
86  AC7 5  SER B 97  ? SER C 94  . ? 1_555 ? 
87  AC7 5  ASN B 99  ? ASN C 96  . ? 1_555 ? 
88  AC7 5  ARG B 103 ? ARG C 100 . ? 1_555 ? 
89  AC7 5  NDP I .   ? NDP C 501 . ? 1_555 ? 
90  AC8 27 LYS C 75  ? LYS B 72  . ? 1_555 ? 
91  AC8 27 ALA C 77  ? ALA B 74  . ? 1_555 ? 
92  AC8 27 THR C 78  ? THR B 75  . ? 1_555 ? 
93  AC8 27 THR C 80  ? THR B 77  . ? 1_555 ? 
94  AC8 27 ARG C 85  ? ARG B 82  . ? 1_555 ? 
95  AC8 27 ASN C 99  ? ASN B 96  . ? 1_555 ? 
96  AC8 27 GLN C 286 ? GLN B 283 . ? 1_555 ? 
97  AC8 27 LEU C 291 ? LEU B 288 . ? 1_555 ? 
98  AC8 27 GLU C 309 ? GLU B 306 . ? 1_555 ? 
99  AC8 27 HIS C 312 ? HIS B 309 . ? 1_555 ? 
100 AC8 27 GLY C 313 ? GLY B 310 . ? 1_555 ? 
101 AC8 27 THR C 314 ? THR B 311 . ? 1_555 ? 
102 AC8 27 VAL C 315 ? VAL B 312 . ? 1_555 ? 
103 AC8 27 THR C 316 ? THR B 313 . ? 1_555 ? 
104 AC8 27 ARG C 317 ? ARG B 314 . ? 1_555 ? 
105 AC8 27 HIS C 318 ? HIS B 315 . ? 1_555 ? 
106 AC8 27 ASN C 331 ? ASN B 328 . ? 1_555 ? 
107 AC8 27 FLC N .   ? FLC B 503 . ? 1_555 ? 
108 AC8 27 HOH U .   ? HOH B 605 . ? 1_555 ? 
109 AC8 27 HOH U .   ? HOH B 609 . ? 1_555 ? 
110 AC8 27 HOH U .   ? HOH B 612 . ? 1_555 ? 
111 AC8 27 HOH U .   ? HOH B 634 . ? 1_555 ? 
112 AC8 27 HOH U .   ? HOH B 701 . ? 1_555 ? 
113 AC8 27 HOH U .   ? HOH B 716 . ? 1_555 ? 
114 AC8 27 HOH U .   ? HOH B 742 . ? 1_555 ? 
115 AC8 27 HOH U .   ? HOH B 745 . ? 1_555 ? 
116 AC8 27 LYS D 263 ? LYS D 260 . ? 1_555 ? 
117 AC9 14 ARG C 112 ? ARG B 109 . ? 1_555 ? 
118 AC9 14 ALA C 114 ? ALA B 111 . ? 1_555 ? 
119 AC9 14 ILE C 116 ? ILE B 113 . ? 1_555 ? 
120 AC9 14 ARG C 122 ? ARG B 119 . ? 1_555 ? 
121 AC9 14 LEU C 123 ? LEU B 120 . ? 1_555 ? 
122 AC9 14 TRP C 127 ? TRP B 124 . ? 1_555 ? 
123 AC9 14 ILE C 131 ? ILE B 128 . ? 1_555 ? 
124 AC9 14 ILE C 133 ? ILE B 130 . ? 1_555 ? 
125 AC9 14 VAL C 258 ? VAL B 255 . ? 1_555 ? 
126 AC9 14 GLN C 280 ? GLN B 277 . ? 1_555 ? 
127 AC9 14 SER C 281 ? SER B 278 . ? 1_555 ? 
128 AC9 14 VAL C 284 ? VAL B 281 . ? 1_555 ? 
129 AC9 14 SER C 290 ? SER B 287 . ? 1_555 ? 
130 AC9 14 C81 R .   ? C81 D 504 . ? 1_555 ? 
131 AD1 6  THR C 80  ? THR B 77  . ? 1_555 ? 
132 AD1 6  SER C 97  ? SER B 94  . ? 1_555 ? 
133 AD1 6  ASN C 99  ? ASN B 96  . ? 1_555 ? 
134 AD1 6  ARG C 103 ? ARG B 100 . ? 1_555 ? 
135 AD1 6  NDP L .   ? NDP B 501 . ? 1_555 ? 
136 AD1 6  HOH U .   ? HOH B 621 . ? 1_555 ? 
137 AD2 18 LYS D 75  ? LYS D 72  . ? 1_555 ? 
138 AD2 18 ALA D 77  ? ALA D 74  . ? 1_555 ? 
139 AD2 18 THR D 78  ? THR D 75  . ? 1_555 ? 
140 AD2 18 THR D 80  ? THR D 77  . ? 1_555 ? 
141 AD2 18 ARG D 85  ? ARG D 82  . ? 1_555 ? 
142 AD2 18 ASN D 99  ? ASN D 96  . ? 1_555 ? 
143 AD2 18 LEU D 291 ? LEU D 288 . ? 1_555 ? 
144 AD2 18 GLU D 309 ? GLU D 306 . ? 1_555 ? 
145 AD2 18 HIS D 312 ? HIS D 309 . ? 1_555 ? 
146 AD2 18 GLY D 313 ? GLY D 310 . ? 1_555 ? 
147 AD2 18 THR D 314 ? THR D 311 . ? 1_555 ? 
148 AD2 18 VAL D 315 ? VAL D 312 . ? 1_555 ? 
149 AD2 18 THR D 316 ? THR D 313 . ? 1_555 ? 
150 AD2 18 ARG D 317 ? ARG D 314 . ? 1_555 ? 
151 AD2 18 HIS D 318 ? HIS D 315 . ? 1_555 ? 
152 AD2 18 THR D 330 ? THR D 327 . ? 1_555 ? 
153 AD2 18 ASN D 331 ? ASN D 328 . ? 1_555 ? 
154 AD2 18 FLC Q .   ? FLC D 503 . ? 1_555 ? 
155 AD3 15 ARG D 112 ? ARG D 109 . ? 1_555 ? 
156 AD3 15 ALA D 114 ? ALA D 111 . ? 1_555 ? 
157 AD3 15 ILE D 116 ? ILE D 113 . ? 1_555 ? 
158 AD3 15 ARG D 122 ? ARG D 119 . ? 1_555 ? 
159 AD3 15 LEU D 123 ? LEU D 120 . ? 1_555 ? 
160 AD3 15 TRP D 127 ? TRP D 124 . ? 1_555 ? 
161 AD3 15 ILE D 131 ? ILE D 128 . ? 1_555 ? 
162 AD3 15 ILE D 133 ? ILE D 130 . ? 1_555 ? 
163 AD3 15 VAL D 258 ? VAL D 255 . ? 1_555 ? 
164 AD3 15 MET D 262 ? MET D 259 . ? 1_555 ? 
165 AD3 15 ALA D 285 ? ALA D 282 . ? 1_555 ? 
166 AD3 15 TYR D 288 ? TYR D 285 . ? 1_555 ? 
167 AD3 15 SER D 290 ? SER D 287 . ? 1_555 ? 
168 AD3 15 MET D 294 ? MET D 291 . ? 1_555 ? 
169 AD3 15 C81 R .   ? C81 D 504 . ? 1_555 ? 
170 AD4 4  THR D 80  ? THR D 77  . ? 1_555 ? 
171 AD4 4  SER D 97  ? SER D 94  . ? 1_555 ? 
172 AD4 4  ASN D 99  ? ASN D 96  . ? 1_555 ? 
173 AD4 4  NDP O .   ? NDP D 501 . ? 1_555 ? 
174 AD5 11 LEU C 123 ? LEU B 120 . ? 1_555 ? 
175 AD5 11 GLN C 280 ? GLN B 277 . ? 1_555 ? 
176 AD5 11 VAL C 284 ? VAL B 281 . ? 1_555 ? 
177 AD5 11 C81 M .   ? C81 B 502 . ? 1_555 ? 
178 AD5 11 LEU D 123 ? LEU D 120 . ? 1_555 ? 
179 AD5 11 HIS D 135 ? HIS D 132 . ? 1_555 ? 
180 AD5 11 CYS D 272 ? CYS D 269 . ? 1_555 ? 
181 AD5 11 GLN D 280 ? GLN D 277 . ? 1_555 ? 
182 AD5 11 SER D 281 ? SER D 278 . ? 1_555 ? 
183 AD5 11 VAL D 284 ? VAL D 281 . ? 1_555 ? 
184 AD5 11 C81 P .   ? C81 D 502 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6B0Z 
_atom_sites.fract_transf_matrix[1][1]   0.012271 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006439 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006133 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
F 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . LYS A 1 6   ? 13.958 31.492  -8.615  1.00 72.83  ? 3   LYS A N   1 
ATOM   2     C CA  . LYS A 1 6   ? 15.372 31.314  -8.920  1.00 71.25  ? 3   LYS A CA  1 
ATOM   3     C C   . LYS A 1 6   ? 16.198 31.451  -7.632  1.00 75.36  ? 3   LYS A C   1 
ATOM   4     O O   . LYS A 1 6   ? 15.793 32.133  -6.691  1.00 73.45  ? 3   LYS A O   1 
ATOM   5     C CB  . LYS A 1 6   ? 15.800 32.320  -10.007 1.00 68.83  ? 3   LYS A CB  1 
ATOM   6     C CG  . LYS A 1 6   ? 17.273 32.329  -10.421 1.00 71.13  ? 3   LYS A CG  1 
ATOM   7     C CD  . LYS A 1 6   ? 18.090 33.278  -9.562  1.00 72.33  ? 3   LYS A CD  1 
ATOM   8     C CE  . LYS A 1 6   ? 17.291 34.518  -9.196  1.00 75.59  ? 3   LYS A CE  1 
ATOM   9     N NZ  . LYS A 1 6   ? 18.153 35.567  -8.589  1.00 78.98  ? 3   LYS A NZ  1 
ATOM   10    N N   . LYS A 1 7   ? 17.357 30.796  -7.612  1.00 64.20  ? 4   LYS A N   1 
ATOM   11    C CA  . LYS A 1 7   ? 18.125 30.519  -6.408  1.00 49.42  ? 4   LYS A CA  1 
ATOM   12    C C   . LYS A 1 7   ? 19.173 31.592  -6.127  1.00 47.95  ? 4   LYS A C   1 
ATOM   13    O O   . LYS A 1 7   ? 19.613 32.322  -7.017  1.00 48.08  ? 4   LYS A O   1 
ATOM   14    C CB  . LYS A 1 7   ? 18.807 29.158  -6.536  1.00 46.34  ? 4   LYS A CB  1 
ATOM   15    C CG  . LYS A 1 7   ? 17.822 28.025  -6.707  1.00 53.45  ? 4   LYS A CG  1 
ATOM   16    C CD  . LYS A 1 7   ? 18.512 26.686  -6.837  1.00 47.92  ? 4   LYS A CD  1 
ATOM   17    C CE  . LYS A 1 7   ? 17.482 25.576  -6.909  1.00 41.44  ? 4   LYS A CE  1 
ATOM   18    N NZ  . LYS A 1 7   ? 18.121 24.236  -6.932  1.00 50.71  ? 4   LYS A NZ  1 
ATOM   19    N N   . ILE A 1 8   ? 19.587 31.651  -4.863  1.00 46.35  ? 5   ILE A N   1 
ATOM   20    C CA  . ILE A 1 8   ? 20.594 32.598  -4.395  1.00 45.04  ? 5   ILE A CA  1 
ATOM   21    C C   . ILE A 1 8   ? 21.978 32.134  -4.832  1.00 42.74  ? 5   ILE A C   1 
ATOM   22    O O   . ILE A 1 8   ? 22.273 30.932  -4.851  1.00 41.18  ? 5   ILE A O   1 
ATOM   23    C CB  . ILE A 1 8   ? 20.521 32.735  -2.863  1.00 46.17  ? 5   ILE A CB  1 
ATOM   24    C CG1 . ILE A 1 8   ? 19.070 32.892  -2.403  1.00 47.21  ? 5   ILE A CG1 1 
ATOM   25    C CG2 . ILE A 1 8   ? 21.372 33.906  -2.375  1.00 48.65  ? 5   ILE A CG2 1 
ATOM   26    C CD1 . ILE A 1 8   ? 18.919 33.029  -0.903  1.00 36.94  ? 5   ILE A CD1 1 
ATOM   27    N N   . SER A 1 9   ? 22.840 33.091  -5.179  1.00 41.62  ? 6   SER A N   1 
ATOM   28    C CA  . SER A 1 9   ? 24.251 32.820  -5.440  1.00 45.06  ? 6   SER A CA  1 
ATOM   29    C C   . SER A 1 9   ? 25.006 32.908  -4.118  1.00 43.88  ? 6   SER A C   1 
ATOM   30    O O   . SER A 1 9   ? 25.168 33.998  -3.559  1.00 48.79  ? 6   SER A O   1 
ATOM   31    C CB  . SER A 1 9   ? 24.819 33.800  -6.465  1.00 45.38  ? 6   SER A CB  1 
ATOM   32    O OG  . SER A 1 9   ? 24.474 33.417  -7.784  1.00 65.20  ? 6   SER A OG  1 
ATOM   33    N N   . GLY A 1 10  ? 25.468 31.763  -3.621  1.00 39.63  ? 7   GLY A N   1 
ATOM   34    C CA  . GLY A 1 10  ? 26.093 31.699  -2.313  1.00 39.06  ? 7   GLY A CA  1 
ATOM   35    C C   . GLY A 1 10  ? 27.589 31.934  -2.299  1.00 41.15  ? 7   GLY A C   1 
ATOM   36    O O   . GLY A 1 10  ? 28.144 32.330  -1.271  1.00 41.07  ? 7   GLY A O   1 
ATOM   37    N N   . GLY A 1 11  ? 28.257 31.690  -3.418  1.00 39.08  ? 8   GLY A N   1 
ATOM   38    C CA  . GLY A 1 11  ? 29.684 31.929  -3.496  1.00 36.37  ? 8   GLY A CA  1 
ATOM   39    C C   . GLY A 1 11  ? 30.522 30.727  -3.095  1.00 37.96  ? 8   GLY A C   1 
ATOM   40    O O   . GLY A 1 11  ? 30.060 29.583  -3.016  1.00 30.08  ? 8   GLY A O   1 
ATOM   41    N N   . SER A 1 12  ? 31.793 31.014  -2.825  1.00 36.20  ? 9   SER A N   1 
ATOM   42    C CA  . SER A 1 12  ? 32.796 29.986  -2.559  1.00 40.41  ? 9   SER A CA  1 
ATOM   43    C C   . SER A 1 12  ? 32.620 29.421  -1.153  1.00 39.33  ? 9   SER A C   1 
ATOM   44    O O   . SER A 1 12  ? 32.766 30.140  -0.159  1.00 38.00  ? 9   SER A O   1 
ATOM   45    C CB  . SER A 1 12  ? 34.191 30.576  -2.737  1.00 42.96  ? 9   SER A CB  1 
ATOM   46    O OG  . SER A 1 12  ? 35.189 29.578  -2.623  1.00 47.75  ? 9   SER A OG  1 
ATOM   47    N N   . VAL A 1 13  ? 32.320 28.127  -1.064  1.00 32.21  ? 10  VAL A N   1 
ATOM   48    C CA  . VAL A 1 13  ? 32.156 27.441  0.212   1.00 38.45  ? 10  VAL A CA  1 
ATOM   49    C C   . VAL A 1 13  ? 32.915 26.123  0.162   1.00 35.78  ? 10  VAL A C   1 
ATOM   50    O O   . VAL A 1 13  ? 32.766 25.350  -0.790  1.00 35.17  ? 10  VAL A O   1 
ATOM   51    C CB  . VAL A 1 13  ? 30.673 27.199  0.550   1.00 35.71  ? 10  VAL A CB  1 
ATOM   52    C CG1 . VAL A 1 13  ? 30.541 26.149  1.639   1.00 36.97  ? 10  VAL A CG1 1 
ATOM   53    C CG2 . VAL A 1 13  ? 30.014 28.498  0.989   1.00 35.32  ? 10  VAL A CG2 1 
ATOM   54    N N   . VAL A 1 14  ? 33.727 25.874  1.185   1.00 31.38  ? 11  VAL A N   1 
ATOM   55    C CA  . VAL A 1 14  ? 34.445 24.615  1.329   1.00 27.45  ? 11  VAL A CA  1 
ATOM   56    C C   . VAL A 1 14  ? 33.596 23.673  2.172   1.00 34.55  ? 11  VAL A C   1 
ATOM   57    O O   . VAL A 1 14  ? 33.233 23.999  3.308   1.00 33.69  ? 11  VAL A O   1 
ATOM   58    C CB  . VAL A 1 14  ? 35.825 24.832  1.965   1.00 29.87  ? 11  VAL A CB  1 
ATOM   59    C CG1 . VAL A 1 14  ? 36.505 23.496  2.228   1.00 30.60  ? 11  VAL A CG1 1 
ATOM   60    C CG2 . VAL A 1 14  ? 36.688 25.717  1.070   1.00 30.20  ? 11  VAL A CG2 1 
ATOM   61    N N   . GLU A 1 15  ? 33.274 22.508  1.616   1.00 33.48  ? 12  GLU A N   1 
ATOM   62    C CA  . GLU A 1 15  ? 32.463 21.505  2.290   1.00 34.88  ? 12  GLU A CA  1 
ATOM   63    C C   . GLU A 1 15  ? 33.280 20.236  2.493   1.00 36.33  ? 12  GLU A C   1 
ATOM   64    O O   . GLU A 1 15  ? 34.071 19.851  1.625   1.00 36.58  ? 12  GLU A O   1 
ATOM   65    C CB  . GLU A 1 15  ? 31.198 21.195  1.483   1.00 34.72  ? 12  GLU A CB  1 
ATOM   66    C CG  . GLU A 1 15  ? 30.292 20.153  2.115   1.00 42.99  ? 12  GLU A CG  1 
ATOM   67    C CD  . GLU A 1 15  ? 29.829 19.105  1.124   1.00 39.56  ? 12  GLU A CD  1 
ATOM   68    O OE1 . GLU A 1 15  ? 30.220 19.187  -0.060  1.00 46.61  ? 12  GLU A OE1 1 
ATOM   69    O OE2 . GLU A 1 15  ? 29.077 18.197  1.531   1.00 36.72  ? 12  GLU A OE2 1 
ATOM   70    N N   . MET A 1 16  ? 33.089 19.591  3.644   1.00 35.13  ? 13  MET A N   1 
ATOM   71    C CA  . MET A 1 16  ? 33.784 18.356  3.987   1.00 31.26  ? 13  MET A CA  1 
ATOM   72    C C   . MET A 1 16  ? 32.767 17.300  4.392   1.00 33.93  ? 13  MET A C   1 
ATOM   73    O O   . MET A 1 16  ? 32.079 17.452  5.408   1.00 35.63  ? 13  MET A O   1 
ATOM   74    C CB  . MET A 1 16  ? 34.797 18.585  5.111   1.00 25.74  ? 13  MET A CB  1 
ATOM   75    C CG  . MET A 1 16  ? 36.063 19.295  4.661   1.00 31.60  ? 13  MET A CG  1 
ATOM   76    S SD  . MET A 1 16  ? 36.726 20.396  5.921   1.00 37.71  ? 13  MET A SD  1 
ATOM   77    C CE  . MET A 1 16  ? 35.558 21.752  5.805   1.00 27.88  ? 13  MET A CE  1 
ATOM   78    N N   . GLN A 1 17  ? 32.681 16.235  3.601   1.00 32.41  ? 14  GLN A N   1 
ATOM   79    C CA  . GLN A 1 17  ? 31.785 15.127  3.890   1.00 33.77  ? 14  GLN A CA  1 
ATOM   80    C C   . GLN A 1 17  ? 32.429 14.176  4.893   1.00 34.49  ? 14  GLN A C   1 
ATOM   81    O O   . GLN A 1 17  ? 33.653 14.030  4.947   1.00 29.84  ? 14  GLN A O   1 
ATOM   82    C CB  . GLN A 1 17  ? 31.426 14.386  2.602   1.00 36.00  ? 14  GLN A CB  1 
ATOM   83    C CG  . GLN A 1 17  ? 30.810 15.292  1.537   1.00 34.37  ? 14  GLN A CG  1 
ATOM   84    C CD  . GLN A 1 17  ? 30.705 14.626  0.176   1.00 46.28  ? 14  GLN A CD  1 
ATOM   85    O OE1 . GLN A 1 17  ? 31.346 13.608  -0.083  1.00 43.21  ? 14  GLN A OE1 1 
ATOM   86    N NE2 . GLN A 1 17  ? 29.896 15.206  -0.705  1.00 53.06  ? 14  GLN A NE2 1 
ATOM   87    N N   . GLY A 1 18  ? 31.586 13.527  5.694   1.00 30.69  ? 15  GLY A N   1 
ATOM   88    C CA  . GLY A 1 18  ? 32.035 12.766  6.844   1.00 32.70  ? 15  GLY A CA  1 
ATOM   89    C C   . GLY A 1 18  ? 31.521 11.337  6.817   1.00 36.37  ? 15  GLY A C   1 
ATOM   90    O O   . GLY A 1 18  ? 31.409 10.707  5.763   1.00 34.15  ? 15  GLY A O   1 
ATOM   91    N N   . ASP A 1 19  ? 31.195 10.828  8.006   1.00 30.70  ? 16  ASP A N   1 
ATOM   92    C CA  . ASP A 1 19  ? 30.956 9.408   8.223   1.00 37.19  ? 16  ASP A CA  1 
ATOM   93    C C   . ASP A 1 19  ? 29.626 9.150   8.928   1.00 42.31  ? 16  ASP A C   1 
ATOM   94    O O   . ASP A 1 19  ? 29.054 10.029  9.586   1.00 34.65  ? 16  ASP A O   1 
ATOM   95    C CB  . ASP A 1 19  ? 32.080 8.781   9.061   1.00 31.58  ? 16  ASP A CB  1 
ATOM   96    C CG  . ASP A 1 19  ? 33.420 8.774   8.343   1.00 37.54  ? 16  ASP A CG  1 
ATOM   97    O OD1 . ASP A 1 19  ? 33.509 8.183   7.245   1.00 37.79  ? 16  ASP A OD1 1 
ATOM   98    O OD2 . ASP A 1 19  ? 34.391 9.345   8.885   1.00 32.55  ? 16  ASP A OD2 1 
ATOM   99    N N   . GLU A 1 20  ? 29.154 7.912   8.759   1.00 38.27  ? 17  GLU A N   1 
ATOM   100   C CA  . GLU A 1 20  ? 28.108 7.245   9.552   1.00 36.74  ? 17  GLU A CA  1 
ATOM   101   C C   . GLU A 1 20  ? 26.841 8.100   9.619   1.00 32.15  ? 17  GLU A C   1 
ATOM   102   O O   . GLU A 1 20  ? 26.358 8.549   8.573   1.00 42.02  ? 17  GLU A O   1 
ATOM   103   C CB  . GLU A 1 20  ? 28.687 6.832   10.893  1.00 39.19  ? 17  GLU A CB  1 
ATOM   104   C CG  . GLU A 1 20  ? 29.841 5.849   10.786  1.00 39.72  ? 17  GLU A CG  1 
ATOM   105   C CD  . GLU A 1 20  ? 30.386 5.454   12.141  1.00 45.74  ? 17  GLU A CD  1 
ATOM   106   O OE1 . GLU A 1 20  ? 30.537 6.345   13.003  1.00 39.20  ? 17  GLU A OE1 1 
ATOM   107   O OE2 . GLU A 1 20  ? 30.642 4.249   12.352  1.00 45.51  ? 17  GLU A OE2 1 
ATOM   108   N N   . MET A 1 21  ? 26.262 8.321   10.801  1.00 36.58  ? 18  MET A N   1 
ATOM   109   C CA  . MET A 1 21  ? 24.930 8.912   10.888  1.00 37.58  ? 18  MET A CA  1 
ATOM   110   C C   . MET A 1 21  ? 24.927 10.365  10.441  1.00 34.55  ? 18  MET A C   1 
ATOM   111   O O   . MET A 1 21  ? 23.984 10.810  9.777   1.00 40.04  ? 18  MET A O   1 
ATOM   112   C CB  . MET A 1 21  ? 24.391 8.796   12.317  1.00 39.69  ? 18  MET A CB  1 
ATOM   113   C CG  . MET A 1 21  ? 22.893 9.031   12.426  1.00 44.39  ? 18  MET A CG  1 
ATOM   114   S SD  . MET A 1 21  ? 21.922 7.722   11.662  1.00 44.06  ? 18  MET A SD  1 
ATOM   115   C CE  . MET A 1 21  ? 20.943 8.673   10.505  1.00 39.63  ? 18  MET A CE  1 
ATOM   116   N N   . THR A 1 22  ? 25.963 11.124  10.801  1.00 34.44  ? 19  THR A N   1 
ATOM   117   C CA  . THR A 1 22  ? 26.017 12.518  10.383  1.00 33.26  ? 19  THR A CA  1 
ATOM   118   C C   . THR A 1 22  ? 26.153 12.644  8.872   1.00 34.56  ? 19  THR A C   1 
ATOM   119   O O   . THR A 1 22  ? 25.667 13.619  8.290   1.00 34.33  ? 19  THR A O   1 
ATOM   120   C CB  . THR A 1 22  ? 27.165 13.238  11.090  1.00 33.98  ? 19  THR A CB  1 
ATOM   121   O OG1 . THR A 1 22  ? 28.319 12.384  11.123  1.00 39.26  ? 19  THR A OG1 1 
ATOM   122   C CG2 . THR A 1 22  ? 26.762 13.600  12.511  1.00 31.67  ? 19  THR A CG2 1 
ATOM   123   N N   . ARG A 1 23  ? 26.794 11.670  8.219   1.00 35.58  ? 20  ARG A N   1 
ATOM   124   C CA  . ARG A 1 23  ? 26.871 11.700  6.761   1.00 40.32  ? 20  ARG A CA  1 
ATOM   125   C C   . ARG A 1 23  ? 25.481 11.655  6.142   1.00 34.98  ? 20  ARG A C   1 
ATOM   126   O O   . ARG A 1 23  ? 25.176 12.416  5.216   1.00 35.05  ? 20  ARG A O   1 
ATOM   127   C CB  . ARG A 1 23  ? 27.723 10.542  6.239   1.00 36.94  ? 20  ARG A CB  1 
ATOM   128   C CG  . ARG A 1 23  ? 27.795 10.502  4.715   1.00 30.92  ? 20  ARG A CG  1 
ATOM   129   C CD  . ARG A 1 23  ? 28.794 9.479   4.192   1.00 35.88  ? 20  ARG A CD  1 
ATOM   130   N NE  . ARG A 1 23  ? 29.202 9.793   2.824   1.00 47.61  ? 20  ARG A NE  1 
ATOM   131   C CZ  . ARG A 1 23  ? 30.393 10.280  2.486   1.00 49.95  ? 20  ARG A CZ  1 
ATOM   132   N NH1 . ARG A 1 23  ? 30.665 10.544  1.214   1.00 49.16  ? 20  ARG A NH1 1 
ATOM   133   N NH2 . ARG A 1 23  ? 31.319 10.491  3.412   1.00 38.73  ? 20  ARG A NH2 1 
ATOM   134   N N   . ILE A 1 24  ? 24.622 10.769  6.651   1.00 35.62  ? 21  ILE A N   1 
ATOM   135   C CA  . ILE A 1 24  ? 23.249 10.676  6.159   1.00 42.89  ? 21  ILE A CA  1 
ATOM   136   C C   . ILE A 1 24  ? 22.528 12.006  6.350   1.00 40.40  ? 21  ILE A C   1 
ATOM   137   O O   . ILE A 1 24  ? 21.874 12.521  5.434   1.00 45.34  ? 21  ILE A O   1 
ATOM   138   C CB  . ILE A 1 24  ? 22.502 9.528   6.865   1.00 43.37  ? 21  ILE A CB  1 
ATOM   139   C CG1 . ILE A 1 24  ? 23.289 8.220   6.760   1.00 46.25  ? 21  ILE A CG1 1 
ATOM   140   C CG2 . ILE A 1 24  ? 21.099 9.369   6.285   1.00 46.11  ? 21  ILE A CG2 1 
ATOM   141   C CD1 . ILE A 1 24  ? 23.623 7.804   5.336   1.00 47.17  ? 21  ILE A CD1 1 
ATOM   142   N N   . ILE A 1 25  ? 22.646 12.584  7.546   1.00 41.54  ? 22  ILE A N   1 
ATOM   143   C CA  . ILE A 1 25  ? 21.976 13.845  7.845   1.00 40.38  ? 22  ILE A CA  1 
ATOM   144   C C   . ILE A 1 25  ? 22.563 14.974  7.008   1.00 39.87  ? 22  ILE A C   1 
ATOM   145   O O   . ILE A 1 25  ? 21.836 15.855  6.530   1.00 34.65  ? 22  ILE A O   1 
ATOM   146   C CB  . ILE A 1 25  ? 22.076 14.130  9.355   1.00 37.38  ? 22  ILE A CB  1 
ATOM   147   C CG1 . ILE A 1 25  ? 21.112 13.229  10.124  1.00 36.51  ? 22  ILE A CG1 1 
ATOM   148   C CG2 . ILE A 1 25  ? 21.825 15.599  9.655   1.00 36.23  ? 22  ILE A CG2 1 
ATOM   149   C CD1 . ILE A 1 25  ? 21.485 13.040  11.569  1.00 43.82  ? 22  ILE A CD1 1 
ATOM   150   N N   . TRP A 1 26  ? 23.883 14.955  6.807   1.00 34.07  ? 23  TRP A N   1 
ATOM   151   C CA  . TRP A 1 26  ? 24.552 15.987  6.021   1.00 35.95  ? 23  TRP A CA  1 
ATOM   152   C C   . TRP A 1 26  ? 23.961 16.087  4.620   1.00 37.38  ? 23  TRP A C   1 
ATOM   153   O O   . TRP A 1 26  ? 23.614 17.179  4.156   1.00 37.83  ? 23  TRP A O   1 
ATOM   154   C CB  . TRP A 1 26  ? 26.047 15.679  5.962   1.00 31.55  ? 23  TRP A CB  1 
ATOM   155   C CG  . TRP A 1 26  ? 26.910 16.789  5.480   1.00 33.28  ? 23  TRP A CG  1 
ATOM   156   C CD1 . TRP A 1 26  ? 27.433 16.932  4.230   1.00 36.97  ? 23  TRP A CD1 1 
ATOM   157   C CD2 . TRP A 1 26  ? 27.390 17.898  6.248   1.00 40.10  ? 23  TRP A CD2 1 
ATOM   158   N NE1 . TRP A 1 26  ? 28.197 18.072  4.165   1.00 38.87  ? 23  TRP A NE1 1 
ATOM   159   C CE2 . TRP A 1 26  ? 28.188 18.682  5.392   1.00 38.87  ? 23  TRP A CE2 1 
ATOM   160   C CE3 . TRP A 1 26  ? 27.218 18.307  7.575   1.00 30.71  ? 23  TRP A CE3 1 
ATOM   161   C CZ2 . TRP A 1 26  ? 28.812 19.854  5.818   1.00 33.20  ? 23  TRP A CZ2 1 
ATOM   162   C CZ3 . TRP A 1 26  ? 27.838 19.470  7.996   1.00 35.58  ? 23  TRP A CZ3 1 
ATOM   163   C CH2 . TRP A 1 26  ? 28.625 20.230  7.120   1.00 34.34  ? 23  TRP A CH2 1 
ATOM   164   N N   . GLU A 1 27  ? 23.839 14.949  3.928   1.00 41.54  ? 24  GLU A N   1 
ATOM   165   C CA  . GLU A 1 27  ? 23.260 14.952  2.588   1.00 43.53  ? 24  GLU A CA  1 
ATOM   166   C C   . GLU A 1 27  ? 21.801 15.385  2.619   1.00 42.13  ? 24  GLU A C   1 
ATOM   167   O O   . GLU A 1 27  ? 21.347 16.135  1.744   1.00 41.75  ? 24  GLU A O   1 
ATOM   168   C CB  . GLU A 1 27  ? 23.392 13.566  1.958   1.00 38.24  ? 24  GLU A CB  1 
ATOM   169   C CG  . GLU A 1 27  ? 24.827 13.071  1.822   1.00 43.39  ? 24  GLU A CG  1 
ATOM   170   C CD  . GLU A 1 27  ? 25.719 14.045  1.070   1.00 51.18  ? 24  GLU A CD  1 
ATOM   171   O OE1 . GLU A 1 27  ? 26.893 14.214  1.469   1.00 53.65  ? 24  GLU A OE1 1 
ATOM   172   O OE2 . GLU A 1 27  ? 25.250 14.633  0.074   1.00 53.59  ? 24  GLU A OE2 1 
ATOM   173   N N   . LEU A 1 28  ? 21.049 14.915  3.618   1.00 40.18  ? 25  LEU A N   1 
ATOM   174   C CA  . LEU A 1 28  ? 19.665 15.347  3.780   1.00 42.17  ? 25  LEU A CA  1 
ATOM   175   C C   . LEU A 1 28  ? 19.576 16.861  3.910   1.00 42.28  ? 25  LEU A C   1 
ATOM   176   O O   . LEU A 1 28  ? 18.688 17.492  3.324   1.00 47.30  ? 25  LEU A O   1 
ATOM   177   C CB  . LEU A 1 28  ? 19.049 14.670  5.003   1.00 43.08  ? 25  LEU A CB  1 
ATOM   178   C CG  . LEU A 1 28  ? 18.111 13.488  4.775   1.00 53.57  ? 25  LEU A CG  1 
ATOM   179   C CD1 . LEU A 1 28  ? 17.633 12.947  6.112   1.00 52.59  ? 25  LEU A CD1 1 
ATOM   180   C CD2 . LEU A 1 28  ? 16.932 13.898  3.907   1.00 59.42  ? 25  LEU A CD2 1 
ATOM   181   N N   . ILE A 1 29  ? 20.495 17.457  4.671   1.00 37.92  ? 26  ILE A N   1 
ATOM   182   C CA  . ILE A 1 29  ? 20.529 18.909  4.814   1.00 37.08  ? 26  ILE A CA  1 
ATOM   183   C C   . ILE A 1 29  ? 20.726 19.566  3.454   1.00 42.99  ? 26  ILE A C   1 
ATOM   184   O O   . ILE A 1 29  ? 19.992 20.488  3.076   1.00 40.05  ? 26  ILE A O   1 
ATOM   185   C CB  . ILE A 1 29  ? 21.635 19.321  5.803   1.00 38.63  ? 26  ILE A CB  1 
ATOM   186   C CG1 . ILE A 1 29  ? 21.216 19.008  7.237   1.00 36.65  ? 26  ILE A CG1 1 
ATOM   187   C CG2 . ILE A 1 29  ? 21.974 20.802  5.649   1.00 29.43  ? 26  ILE A CG2 1 
ATOM   188   C CD1 . ILE A 1 29  ? 22.354 19.098  8.223   1.00 35.43  ? 26  ILE A CD1 1 
ATOM   189   N N   . LYS A 1 30  ? 21.717 19.093  2.694   1.00 38.91  ? 27  LYS A N   1 
ATOM   190   C CA  . LYS A 1 30  ? 22.014 19.695  1.398   1.00 44.21  ? 27  LYS A CA  1 
ATOM   191   C C   . LYS A 1 30  ? 20.854 19.512  0.426   1.00 45.76  ? 27  LYS A C   1 
ATOM   192   O O   . LYS A 1 30  ? 20.474 20.449  -0.286  1.00 40.62  ? 27  LYS A O   1 
ATOM   193   C CB  . LYS A 1 30  ? 23.300 19.097  0.824   1.00 37.38  ? 27  LYS A CB  1 
ATOM   194   C CG  . LYS A 1 30  ? 24.517 19.268  1.720   1.00 42.83  ? 27  LYS A CG  1 
ATOM   195   C CD  . LYS A 1 30  ? 25.819 19.055  0.957   1.00 48.51  ? 27  LYS A CD  1 
ATOM   196   C CE  . LYS A 1 30  ? 25.820 17.736  0.206   1.00 44.08  ? 27  LYS A CE  1 
ATOM   197   N NZ  . LYS A 1 30  ? 27.200 17.282  -0.130  1.00 40.91  ? 27  LYS A NZ  1 
ATOM   198   N N   . GLU A 1 31  ? 20.275 18.310  0.386   1.00 44.18  ? 28  GLU A N   1 
ATOM   199   C CA  . GLU A 1 31  ? 19.189 18.052  -0.554  1.00 57.26  ? 28  GLU A CA  1 
ATOM   200   C C   . GLU A 1 31  ? 17.935 18.834  -0.179  1.00 56.01  ? 28  GLU A C   1 
ATOM   201   O O   . GLU A 1 31  ? 17.299 19.455  -1.038  1.00 51.87  ? 28  GLU A O   1 
ATOM   202   C CB  . GLU A 1 31  ? 18.882 16.554  -0.619  1.00 49.06  ? 28  GLU A CB  1 
ATOM   203   C CG  . GLU A 1 31  ? 17.778 16.202  -1.614  1.00 59.64  ? 28  GLU A CG  1 
ATOM   204   C CD  . GLU A 1 31  ? 17.326 14.755  -1.515  1.00 71.41  ? 28  GLU A CD  1 
ATOM   205   O OE1 . GLU A 1 31  ? 17.216 14.238  -0.383  1.00 69.54  ? 28  GLU A OE1 1 
ATOM   206   O OE2 . GLU A 1 31  ? 17.074 14.138  -2.571  1.00 71.95  ? 28  GLU A OE2 1 
ATOM   207   N N   . LYS A 1 32  ? 17.567 18.822  1.103   1.00 47.70  ? 29  LYS A N   1 
ATOM   208   C CA  . LYS A 1 32  ? 16.274 19.370  1.498   1.00 41.89  ? 29  LYS A CA  1 
ATOM   209   C C   . LYS A 1 32  ? 16.341 20.857  1.828   1.00 48.81  ? 29  LYS A C   1 
ATOM   210   O O   . LYS A 1 32  ? 15.390 21.596  1.548   1.00 48.45  ? 29  LYS A O   1 
ATOM   211   C CB  . LYS A 1 32  ? 15.722 18.599  2.695   1.00 44.36  ? 29  LYS A CB  1 
ATOM   212   C CG  . LYS A 1 32  ? 15.217 17.206  2.370   1.00 52.29  ? 29  LYS A CG  1 
ATOM   213   C CD  . LYS A 1 32  ? 14.126 16.798  3.350   1.00 65.93  ? 29  LYS A CD  1 
ATOM   214   C CE  . LYS A 1 32  ? 13.401 15.549  2.885   1.00 68.94  ? 29  LYS A CE  1 
ATOM   215   N NZ  . LYS A 1 32  ? 12.922 15.681  1.482   1.00 67.85  ? 29  LYS A NZ  1 
ATOM   216   N N   . LEU A 1 33  ? 17.439 21.321  2.422   1.00 41.64  ? 30  LEU A N   1 
ATOM   217   C CA  . LEU A 1 33  ? 17.466 22.659  3.002   1.00 37.53  ? 30  LEU A CA  1 
ATOM   218   C C   . LEU A 1 33  ? 18.389 23.644  2.300   1.00 39.99  ? 30  LEU A C   1 
ATOM   219   O O   . LEU A 1 33  ? 18.096 24.841  2.303   1.00 38.79  ? 30  LEU A O   1 
ATOM   220   C CB  . LEU A 1 33  ? 17.849 22.584  4.488   1.00 38.31  ? 30  LEU A CB  1 
ATOM   221   C CG  . LEU A 1 33  ? 16.979 21.662  5.349   1.00 45.49  ? 30  LEU A CG  1 
ATOM   222   C CD1 . LEU A 1 33  ? 17.529 21.553  6.766   1.00 38.88  ? 30  LEU A CD1 1 
ATOM   223   C CD2 . LEU A 1 33  ? 15.530 22.139  5.367   1.00 44.98  ? 30  LEU A CD2 1 
ATOM   224   N N   . ILE A 1 34  ? 19.486 23.190  1.694   1.00 36.58  ? 31  ILE A N   1 
ATOM   225   C CA  . ILE A 1 34  ? 20.448 24.115  1.100   1.00 33.36  ? 31  ILE A CA  1 
ATOM   226   C C   . ILE A 1 34  ? 20.218 24.263  -0.398  1.00 40.45  ? 31  ILE A C   1 
ATOM   227   O O   . ILE A 1 34  ? 19.847 25.340  -0.879  1.00 37.21  ? 31  ILE A O   1 
ATOM   228   C CB  . ILE A 1 34  ? 21.899 23.673  1.370   1.00 41.13  ? 31  ILE A CB  1 
ATOM   229   C CG1 . ILE A 1 34  ? 22.124 23.409  2.857   1.00 46.04  ? 31  ILE A CG1 1 
ATOM   230   C CG2 . ILE A 1 34  ? 22.875 24.719  0.838   1.00 33.91  ? 31  ILE A CG2 1 
ATOM   231   C CD1 . ILE A 1 34  ? 21.837 24.602  3.741   1.00 37.62  ? 31  ILE A CD1 1 
ATOM   232   N N   . PHE A 1 35  ? 20.455 23.185  -1.142  1.00 38.57  ? 32  PHE A N   1 
ATOM   233   C CA  . PHE A 1 35  ? 20.470 23.258  -2.601  1.00 43.54  ? 32  PHE A CA  1 
ATOM   234   C C   . PHE A 1 35  ? 19.188 23.794  -3.233  1.00 37.30  ? 32  PHE A C   1 
ATOM   235   O O   . PHE A 1 35  ? 19.290 24.472  -4.270  1.00 43.49  ? 32  PHE A O   1 
ATOM   236   C CB  . PHE A 1 35  ? 20.816 21.877  -3.176  1.00 42.80  ? 32  PHE A CB  1 
ATOM   237   C CG  . PHE A 1 35  ? 22.257 21.481  -2.985  1.00 48.43  ? 32  PHE A CG  1 
ATOM   238   C CD1 . PHE A 1 35  ? 23.219 22.431  -2.672  1.00 45.17  ? 32  PHE A CD1 1 
ATOM   239   C CD2 . PHE A 1 35  ? 22.650 20.161  -3.132  1.00 49.59  ? 32  PHE A CD2 1 
ATOM   240   C CE1 . PHE A 1 35  ? 24.547 22.068  -2.503  1.00 46.01  ? 32  PHE A CE1 1 
ATOM   241   C CE2 . PHE A 1 35  ? 23.976 19.791  -2.964  1.00 44.21  ? 32  PHE A CE2 1 
ATOM   242   C CZ  . PHE A 1 35  ? 24.925 20.745  -2.649  1.00 43.99  ? 32  PHE A CZ  1 
ATOM   243   N N   . PRO A 1 36  ? 17.981 23.546  -2.707  1.00 38.78  ? 33  PRO A N   1 
ATOM   244   C CA  . PRO A 1 36  ? 16.785 24.140  -3.330  1.00 40.52  ? 33  PRO A CA  1 
ATOM   245   C C   . PRO A 1 36  ? 16.729 25.660  -3.276  1.00 43.52  ? 33  PRO A C   1 
ATOM   246   O O   . PRO A 1 36  ? 15.876 26.245  -3.957  1.00 45.77  ? 33  PRO A O   1 
ATOM   247   C CB  . PRO A 1 36  ? 15.629 23.529  -2.528  1.00 39.33  ? 33  PRO A CB  1 
ATOM   248   C CG  . PRO A 1 36  ? 16.170 22.243  -2.036  1.00 45.92  ? 33  PRO A CG  1 
ATOM   249   C CD  . PRO A 1 36  ? 17.603 22.531  -1.707  1.00 39.23  ? 33  PRO A CD  1 
ATOM   250   N N   . TYR A 1 37  ? 17.595 26.320  -2.504  1.00 40.34  ? 34  TYR A N   1 
ATOM   251   C CA  . TYR A 1 37  ? 17.535 27.768  -2.362  1.00 37.19  ? 34  TYR A CA  1 
ATOM   252   C C   . TYR A 1 37  ? 18.844 28.486  -2.647  1.00 38.52  ? 34  TYR A C   1 
ATOM   253   O O   . TYR A 1 37  ? 18.811 29.692  -2.914  1.00 39.42  ? 34  TYR A O   1 
ATOM   254   C CB  . TYR A 1 37  ? 17.065 28.150  -0.947  1.00 41.48  ? 34  TYR A CB  1 
ATOM   255   C CG  . TYR A 1 37  ? 15.793 27.454  -0.532  1.00 39.40  ? 34  TYR A CG  1 
ATOM   256   C CD1 . TYR A 1 37  ? 14.556 27.896  -0.986  1.00 43.40  ? 34  TYR A CD1 1 
ATOM   257   C CD2 . TYR A 1 37  ? 15.826 26.348  0.306   1.00 37.70  ? 34  TYR A CD2 1 
ATOM   258   C CE1 . TYR A 1 37  ? 13.387 27.259  -0.612  1.00 36.78  ? 34  TYR A CE1 1 
ATOM   259   C CE2 . TYR A 1 37  ? 14.663 25.703  0.684   1.00 34.63  ? 34  TYR A CE2 1 
ATOM   260   C CZ  . TYR A 1 37  ? 13.447 26.163  0.224   1.00 40.67  ? 34  TYR A CZ  1 
ATOM   261   O OH  . TYR A 1 37  ? 12.290 25.521  0.602   1.00 42.13  ? 34  TYR A OH  1 
ATOM   262   N N   . VAL A 1 38  ? 19.984 27.797  -2.598  1.00 41.33  ? 35  VAL A N   1 
ATOM   263   C CA  . VAL A 1 38  ? 21.290 28.420  -2.777  1.00 44.99  ? 35  VAL A CA  1 
ATOM   264   C C   . VAL A 1 38  ? 22.086 27.650  -3.820  1.00 36.96  ? 35  VAL A C   1 
ATOM   265   O O   . VAL A 1 38  ? 22.093 26.415  -3.823  1.00 35.00  ? 35  VAL A O   1 
ATOM   266   C CB  . VAL A 1 38  ? 22.080 28.488  -1.450  1.00 37.59  ? 35  VAL A CB  1 
ATOM   267   C CG1 . VAL A 1 38  ? 23.240 29.472  -1.564  1.00 36.62  ? 35  VAL A CG1 1 
ATOM   268   C CG2 . VAL A 1 38  ? 21.168 28.874  -0.291  1.00 41.57  ? 35  VAL A CG2 1 
ATOM   269   N N   . GLU A 1 39  ? 22.748 28.384  -4.708  1.00 36.70  ? 36  GLU A N   1 
ATOM   270   C CA  . GLU A 1 39  ? 23.754 27.826  -5.599  1.00 40.04  ? 36  GLU A CA  1 
ATOM   271   C C   . GLU A 1 39  ? 25.129 28.176  -5.050  1.00 40.58  ? 36  GLU A C   1 
ATOM   272   O O   . GLU A 1 39  ? 25.379 29.329  -4.682  1.00 39.33  ? 36  GLU A O   1 
ATOM   273   C CB  . GLU A 1 39  ? 23.606 28.363  -7.024  1.00 42.92  ? 36  GLU A CB  1 
ATOM   274   C CG  . GLU A 1 39  ? 22.445 27.778  -7.824  1.00 48.74  ? 36  GLU A CG  1 
ATOM   275   C CD  . GLU A 1 39  ? 22.527 26.269  -8.015  1.00 48.84  ? 36  GLU A CD  1 
ATOM   276   O OE1 . GLU A 1 39  ? 21.510 25.679  -8.433  1.00 55.59  ? 36  GLU A OE1 1 
ATOM   277   O OE2 . GLU A 1 39  ? 23.595 25.672  -7.762  1.00 46.86  ? 36  GLU A OE2 1 
ATOM   278   N N   . LEU A 1 40  ? 26.015 27.186  -4.997  1.00 35.37  ? 37  LEU A N   1 
ATOM   279   C CA  . LEU A 1 40  ? 27.328 27.346  -4.392  1.00 38.15  ? 37  LEU A CA  1 
ATOM   280   C C   . LEU A 1 40  ? 28.425 26.957  -5.371  1.00 37.44  ? 37  LEU A C   1 
ATOM   281   O O   . LEU A 1 40  ? 28.312 25.953  -6.085  1.00 35.88  ? 37  LEU A O   1 
ATOM   282   C CB  . LEU A 1 40  ? 27.452 26.501  -3.118  1.00 29.99  ? 37  LEU A CB  1 
ATOM   283   C CG  . LEU A 1 40  ? 26.538 26.914  -1.965  1.00 35.62  ? 37  LEU A CG  1 
ATOM   284   C CD1 . LEU A 1 40  ? 26.630 25.922  -0.816  1.00 32.80  ? 37  LEU A CD1 1 
ATOM   285   C CD2 . LEU A 1 40  ? 26.897 28.312  -1.500  1.00 31.35  ? 37  LEU A CD2 1 
ATOM   286   N N   . ASP A 1 41  ? 29.484 27.768  -5.403  1.00 33.96  ? 38  ASP A N   1 
ATOM   287   C CA  . ASP A 1 41  ? 30.762 27.371  -5.992  1.00 33.98  ? 38  ASP A CA  1 
ATOM   288   C C   . ASP A 1 41  ? 31.415 26.426  -4.988  1.00 36.65  ? 38  ASP A C   1 
ATOM   289   O O   . ASP A 1 41  ? 32.293 26.793  -4.204  1.00 38.99  ? 38  ASP A O   1 
ATOM   290   C CB  . ASP A 1 41  ? 31.634 28.587  -6.286  1.00 33.44  ? 38  ASP A CB  1 
ATOM   291   C CG  . ASP A 1 41  ? 31.008 29.527  -7.304  1.00 41.29  ? 38  ASP A CG  1 
ATOM   292   O OD1 . ASP A 1 41  ? 30.154 29.073  -8.097  1.00 40.41  ? 38  ASP A OD1 1 
ATOM   293   O OD2 . ASP A 1 41  ? 31.373 30.722  -7.315  1.00 45.33  ? 38  ASP A OD2 1 
ATOM   294   N N   . LEU A 1 42  ? 30.957 25.178  -5.012  1.00 31.58  ? 39  LEU A N   1 
ATOM   295   C CA  . LEU A 1 42  ? 31.176 24.241  -3.917  1.00 31.98  ? 39  LEU A CA  1 
ATOM   296   C C   . LEU A 1 42  ? 32.520 23.537  -4.074  1.00 38.68  ? 39  LEU A C   1 
ATOM   297   O O   . LEU A 1 42  ? 32.703 22.717  -4.981  1.00 33.43  ? 39  LEU A O   1 
ATOM   298   C CB  . LEU A 1 42  ? 30.033 23.232  -3.864  1.00 29.62  ? 39  LEU A CB  1 
ATOM   299   C CG  . LEU A 1 42  ? 29.897 22.403  -2.590  1.00 34.07  ? 39  LEU A CG  1 
ATOM   300   C CD1 . LEU A 1 42  ? 29.676 23.297  -1.380  1.00 33.06  ? 39  LEU A CD1 1 
ATOM   301   C CD2 . LEU A 1 42  ? 28.770 21.393  -2.735  1.00 30.08  ? 39  LEU A CD2 1 
ATOM   302   N N   . HIS A 1 43  ? 33.458 23.855  -3.183  1.00 33.08  ? 40  HIS A N   1 
ATOM   303   C CA  . HIS A 1 43  ? 34.726 23.133  -3.077  1.00 32.95  ? 40  HIS A CA  1 
ATOM   304   C C   . HIS A 1 43  ? 34.502 21.986  -2.100  1.00 34.59  ? 40  HIS A C   1 
ATOM   305   O O   . HIS A 1 43  ? 34.502 22.180  -0.881  1.00 29.77  ? 40  HIS A O   1 
ATOM   306   C CB  . HIS A 1 43  ? 35.842 24.064  -2.619  1.00 33.67  ? 40  HIS A CB  1 
ATOM   307   C CG  . HIS A 1 43  ? 35.851 25.386  -3.322  1.00 34.52  ? 40  HIS A CG  1 
ATOM   308   N ND1 . HIS A 1 43  ? 36.613 25.629  -4.445  1.00 41.84  ? 40  HIS A ND1 1 
ATOM   309   C CD2 . HIS A 1 43  ? 35.187 26.538  -3.062  1.00 36.10  ? 40  HIS A CD2 1 
ATOM   310   C CE1 . HIS A 1 43  ? 36.420 26.874  -4.845  1.00 36.43  ? 40  HIS A CE1 1 
ATOM   311   N NE2 . HIS A 1 43  ? 35.559 27.447  -4.023  1.00 39.09  ? 40  HIS A NE2 1 
ATOM   312   N N   . SER A 1 44  ? 34.304 20.786  -2.637  1.00 29.85  ? 41  SER A N   1 
ATOM   313   C CA  . SER A 1 44  ? 33.799 19.653  -1.874  1.00 32.70  ? 41  SER A CA  1 
ATOM   314   C C   . SER A 1 44  ? 34.885 18.601  -1.699  1.00 35.62  ? 41  SER A C   1 
ATOM   315   O O   . SER A 1 44  ? 35.512 18.174  -2.675  1.00 41.54  ? 41  SER A O   1 
ATOM   316   C CB  . SER A 1 44  ? 32.574 19.045  -2.561  1.00 26.28  ? 41  SER A CB  1 
ATOM   317   O OG  . SER A 1 44  ? 32.012 18.009  -1.779  1.00 37.91  ? 41  SER A OG  1 
ATOM   318   N N   . TYR A 1 45  ? 35.089 18.180  -0.454  1.00 30.61  ? 42  TYR A N   1 
ATOM   319   C CA  . TYR A 1 45  ? 36.108 17.205  -0.102  1.00 29.69  ? 42  TYR A CA  1 
ATOM   320   C C   . TYR A 1 45  ? 35.475 16.096  0.723   1.00 33.25  ? 42  TYR A C   1 
ATOM   321   O O   . TYR A 1 45  ? 34.683 16.357  1.633   1.00 32.98  ? 42  TYR A O   1 
ATOM   322   C CB  . TYR A 1 45  ? 37.258 17.876  0.654   1.00 26.56  ? 42  TYR A CB  1 
ATOM   323   C CG  . TYR A 1 45  ? 37.925 18.943  -0.181  1.00 36.24  ? 42  TYR A CG  1 
ATOM   324   C CD1 . TYR A 1 45  ? 37.429 20.242  -0.208  1.00 28.31  ? 42  TYR A CD1 1 
ATOM   325   C CD2 . TYR A 1 45  ? 39.024 18.644  -0.976  1.00 28.14  ? 42  TYR A CD2 1 
ATOM   326   C CE1 . TYR A 1 45  ? 38.019 21.215  -0.987  1.00 25.09  ? 42  TYR A CE1 1 
ATOM   327   C CE2 . TYR A 1 45  ? 39.624 19.613  -1.756  1.00 33.31  ? 42  TYR A CE2 1 
ATOM   328   C CZ  . TYR A 1 45  ? 39.118 20.897  -1.758  1.00 35.45  ? 42  TYR A CZ  1 
ATOM   329   O OH  . TYR A 1 45  ? 39.715 21.861  -2.537  1.00 34.15  ? 42  TYR A OH  1 
ATOM   330   N N   . ASP A 1 46  ? 35.815 14.858  0.384   1.00 35.36  ? 43  ASP A N   1 
ATOM   331   C CA  . ASP A 1 46  ? 35.246 13.677  1.025   1.00 36.74  ? 43  ASP A CA  1 
ATOM   332   C C   . ASP A 1 46  ? 36.218 13.211  2.101   1.00 35.30  ? 43  ASP A C   1 
ATOM   333   O O   . ASP A 1 46  ? 37.219 12.549  1.807   1.00 32.80  ? 43  ASP A O   1 
ATOM   334   C CB  . ASP A 1 46  ? 34.981 12.581  -0.003  1.00 34.00  ? 43  ASP A CB  1 
ATOM   335   C CG  . ASP A 1 46  ? 34.154 11.437  0.558   1.00 35.42  ? 43  ASP A CG  1 
ATOM   336   O OD1 . ASP A 1 46  ? 33.922 11.405  1.786   1.00 39.94  ? 43  ASP A OD1 1 
ATOM   337   O OD2 . ASP A 1 46  ? 33.741 10.561  -0.230  1.00 41.13  ? 43  ASP A OD2 1 
ATOM   338   N N   . LEU A 1 47  ? 35.920 13.556  3.353   1.00 32.08  ? 44  LEU A N   1 
ATOM   339   C CA  . LEU A 1 47  ? 36.695 13.087  4.492   1.00 30.59  ? 44  LEU A CA  1 
ATOM   340   C C   . LEU A 1 47  ? 36.113 11.815  5.096   1.00 35.70  ? 44  LEU A C   1 
ATOM   341   O O   . LEU A 1 47  ? 36.396 11.498  6.257   1.00 33.47  ? 44  LEU A O   1 
ATOM   342   C CB  . LEU A 1 47  ? 36.809 14.185  5.550   1.00 28.67  ? 44  LEU A CB  1 
ATOM   343   C CG  . LEU A 1 47  ? 37.415 15.503  5.058   1.00 35.56  ? 44  LEU A CG  1 
ATOM   344   C CD1 . LEU A 1 47  ? 37.853 16.363  6.233   1.00 35.19  ? 44  LEU A CD1 1 
ATOM   345   C CD2 . LEU A 1 47  ? 38.577 15.256  4.104   1.00 30.80  ? 44  LEU A CD2 1 
ATOM   346   N N   . GLY A 1 48  ? 35.298 11.089  4.332   1.00 33.80  ? 45  GLY A N   1 
ATOM   347   C CA  . GLY A 1 48  ? 34.861 9.767   4.731   1.00 31.04  ? 45  GLY A CA  1 
ATOM   348   C C   . GLY A 1 48  ? 36.061 8.883   5.000   1.00 33.04  ? 45  GLY A C   1 
ATOM   349   O O   . GLY A 1 48  ? 37.112 9.061   4.376   1.00 30.04  ? 45  GLY A O   1 
ATOM   350   N N   . ILE A 1 49  ? 35.923 7.925   5.918   1.00 26.50  ? 46  ILE A N   1 
ATOM   351   C CA  . ILE A 1 49  ? 37.092 7.202   6.416   1.00 31.90  ? 46  ILE A CA  1 
ATOM   352   C C   . ILE A 1 49  ? 37.757 6.403   5.298   1.00 35.54  ? 46  ILE A C   1 
ATOM   353   O O   . ILE A 1 49  ? 38.988 6.389   5.175   1.00 35.55  ? 46  ILE A O   1 
ATOM   354   C CB  . ILE A 1 49  ? 36.708 6.313   7.615   1.00 35.66  ? 46  ILE A CB  1 
ATOM   355   C CG1 . ILE A 1 49  ? 37.948 5.592   8.156   1.00 34.93  ? 46  ILE A CG1 1 
ATOM   356   C CG2 . ILE A 1 49  ? 35.589 5.340   7.244   1.00 36.79  ? 46  ILE A CG2 1 
ATOM   357   C CD1 . ILE A 1 49  ? 39.019 6.534   8.675   1.00 32.56  ? 46  ILE A CD1 1 
ATOM   358   N N   . GLU A 1 50  ? 36.956 5.741   4.458   1.00 35.26  ? 47  GLU A N   1 
ATOM   359   C CA  . GLU A 1 50  ? 37.530 4.933   3.385   1.00 38.88  ? 47  GLU A CA  1 
ATOM   360   C C   . GLU A 1 50  ? 38.301 5.798   2.395   1.00 33.26  ? 47  GLU A C   1 
ATOM   361   O O   . GLU A 1 50  ? 39.361 5.395   1.901   1.00 38.87  ? 47  GLU A O   1 
ATOM   362   C CB  . GLU A 1 50  ? 36.432 4.143   2.666   1.00 37.89  ? 47  GLU A CB  1 
ATOM   363   C CG  . GLU A 1 50  ? 35.609 3.225   3.565   1.00 45.90  ? 47  GLU A CG  1 
ATOM   364   C CD  . GLU A 1 50  ? 36.226 1.849   3.747   1.00 62.78  ? 47  GLU A CD  1 
ATOM   365   O OE1 . GLU A 1 50  ? 37.469 1.744   3.811   1.00 68.27  ? 47  GLU A OE1 1 
ATOM   366   O OE2 . GLU A 1 50  ? 35.457 0.867   3.815   1.00 63.61  ? 47  GLU A OE2 1 
ATOM   367   N N   . ASN A 1 51  ? 37.793 6.998   2.101   1.00 31.88  ? 48  ASN A N   1 
ATOM   368   C CA  . ASN A 1 51  ? 38.487 7.862   1.151   1.00 30.02  ? 48  ASN A CA  1 
ATOM   369   C C   . ASN A 1 51  ? 39.730 8.496   1.763   1.00 31.61  ? 48  ASN A C   1 
ATOM   370   O O   . ASN A 1 51  ? 40.710 8.743   1.048   1.00 33.94  ? 48  ASN A O   1 
ATOM   371   C CB  . ASN A 1 51  ? 37.550 8.943   0.621   1.00 25.79  ? 48  ASN A CB  1 
ATOM   372   C CG  . ASN A 1 51  ? 38.164 9.727   -0.517  1.00 32.07  ? 48  ASN A CG  1 
ATOM   373   O OD1 . ASN A 1 51  ? 38.542 9.160   -1.542  1.00 30.80  ? 48  ASN A OD1 1 
ATOM   374   N ND2 . ASN A 1 51  ? 38.273 11.040  -0.342  1.00 27.61  ? 48  ASN A ND2 1 
ATOM   375   N N   . ARG A 1 52  ? 39.715 8.776   3.068   1.00 34.02  ? 49  ARG A N   1 
ATOM   376   C CA  . ARG A 1 52  ? 40.945 9.200   3.729   1.00 35.57  ? 49  ARG A CA  1 
ATOM   377   C C   . ARG A 1 52  ? 41.993 8.098   3.667   1.00 31.58  ? 49  ARG A C   1 
ATOM   378   O O   . ARG A 1 52  ? 43.176 8.365   3.424   1.00 34.43  ? 49  ARG A O   1 
ATOM   379   C CB  . ARG A 1 52  ? 40.662 9.599   5.177   1.00 33.58  ? 49  ARG A CB  1 
ATOM   380   C CG  . ARG A 1 52  ? 40.105 11.005  5.332   1.00 31.03  ? 49  ARG A CG  1 
ATOM   381   C CD  . ARG A 1 52  ? 39.824 11.334  6.787   1.00 27.82  ? 49  ARG A CD  1 
ATOM   382   N NE  . ARG A 1 52  ? 38.556 10.779  7.252   1.00 34.27  ? 49  ARG A NE  1 
ATOM   383   C CZ  . ARG A 1 52  ? 38.365 10.262  8.462   1.00 34.35  ? 49  ARG A CZ  1 
ATOM   384   N NH1 . ARG A 1 52  ? 39.364 10.217  9.334   1.00 27.67  ? 49  ARG A NH1 1 
ATOM   385   N NH2 . ARG A 1 52  ? 37.175 9.784   8.799   1.00 31.94  ? 49  ARG A NH2 1 
ATOM   386   N N   . ASP A 1 53  ? 41.570 6.849   3.868   1.00 33.16  ? 50  ASP A N   1 
ATOM   387   C CA  . ASP A 1 53  ? 42.492 5.723   3.759   1.00 38.16  ? 50  ASP A CA  1 
ATOM   388   C C   . ASP A 1 53  ? 43.012 5.579   2.333   1.00 36.26  ? 50  ASP A C   1 
ATOM   389   O O   . ASP A 1 53  ? 44.211 5.367   2.114   1.00 33.55  ? 50  ASP A O   1 
ATOM   390   C CB  . ASP A 1 53  ? 41.797 4.438   4.212   1.00 32.01  ? 50  ASP A CB  1 
ATOM   391   C CG  . ASP A 1 53  ? 42.777 3.334   4.560   1.00 38.62  ? 50  ASP A CG  1 
ATOM   392   O OD1 . ASP A 1 53  ? 43.651 3.558   5.424   1.00 42.21  ? 50  ASP A OD1 1 
ATOM   393   O OD2 . ASP A 1 53  ? 42.671 2.240   3.969   1.00 39.52  ? 50  ASP A OD2 1 
ATOM   394   N N   . ALA A 1 54  ? 42.121 5.702   1.346   1.00 35.93  ? 51  ALA A N   1 
ATOM   395   C CA  . ALA A 1 54  ? 42.523 5.501   -0.043  1.00 33.24  ? 51  ALA A CA  1 
ATOM   396   C C   . ALA A 1 54  ? 43.467 6.596   -0.526  1.00 32.74  ? 51  ALA A C   1 
ATOM   397   O O   . ALA A 1 54  ? 44.334 6.337   -1.368  1.00 30.99  ? 51  ALA A O   1 
ATOM   398   C CB  . ALA A 1 54  ? 41.289 5.430   -0.944  1.00 33.81  ? 51  ALA A CB  1 
ATOM   399   N N   . THR A 1 55  ? 43.326 7.817   -0.008  1.00 29.33  ? 52  THR A N   1 
ATOM   400   C CA  . THR A 1 55  ? 44.180 8.930   -0.402  1.00 34.08  ? 52  THR A CA  1 
ATOM   401   C C   . THR A 1 55  ? 45.331 9.165   0.568   1.00 31.11  ? 52  THR A C   1 
ATOM   402   O O   . THR A 1 55  ? 46.051 10.158  0.422   1.00 33.35  ? 52  THR A O   1 
ATOM   403   C CB  . THR A 1 55  ? 43.359 10.216  -0.540  1.00 33.66  ? 52  THR A CB  1 
ATOM   404   O OG1 . THR A 1 55  ? 42.870 10.611  0.746   1.00 29.29  ? 52  THR A OG1 1 
ATOM   405   C CG2 . THR A 1 55  ? 42.186 10.010  -1.489  1.00 29.13  ? 52  THR A CG2 1 
ATOM   406   N N   . ASN A 1 56  ? 45.518 8.281   1.550   1.00 31.00  ? 53  ASN A N   1 
ATOM   407   C CA  . ASN A 1 56  ? 46.569 8.439   2.557   1.00 40.91  ? 53  ASN A CA  1 
ATOM   408   C C   . ASN A 1 56  ? 46.448 9.783   3.272   1.00 32.72  ? 53  ASN A C   1 
ATOM   409   O O   . ASN A 1 56  ? 47.439 10.484  3.489   1.00 35.36  ? 53  ASN A O   1 
ATOM   410   C CB  . ASN A 1 56  ? 47.962 8.271   1.937   1.00 35.25  ? 53  ASN A CB  1 
ATOM   411   C CG  . ASN A 1 56  ? 48.209 6.864   1.432   1.00 37.25  ? 53  ASN A CG  1 
ATOM   412   O OD1 . ASN A 1 56  ? 47.926 5.886   2.122   1.00 37.39  ? 53  ASN A OD1 1 
ATOM   413   N ND2 . ASN A 1 56  ? 48.734 6.755   0.217   1.00 33.34  ? 53  ASN A ND2 1 
ATOM   414   N N   . ASP A 1 57  ? 45.213 10.153  3.613   1.00 32.84  ? 54  ASP A N   1 
ATOM   415   C CA  . ASP A 1 57  ? 44.861 11.361  4.357   1.00 37.49  ? 54  ASP A CA  1 
ATOM   416   C C   . ASP A 1 57  ? 45.158 12.646  3.593   1.00 34.39  ? 54  ASP A C   1 
ATOM   417   O O   . ASP A 1 57  ? 45.067 13.736  4.175   1.00 30.56  ? 54  ASP A O   1 
ATOM   418   C CB  . ASP A 1 57  ? 45.558 11.408  5.724   1.00 30.28  ? 54  ASP A CB  1 
ATOM   419   C CG  . ASP A 1 57  ? 44.729 12.115  6.777   1.00 37.88  ? 54  ASP A CG  1 
ATOM   420   O OD1 . ASP A 1 57  ? 43.487 11.982  6.747   1.00 34.07  ? 54  ASP A OD1 1 
ATOM   421   O OD2 . ASP A 1 57  ? 45.317 12.795  7.644   1.00 38.48  ? 54  ASP A OD2 1 
ATOM   422   N N   . GLN A 1 58  ? 45.502 12.558  2.306   1.00 33.26  ? 55  GLN A N   1 
ATOM   423   C CA  . GLN A 1 58  ? 45.795 13.765  1.539   1.00 29.46  ? 55  GLN A CA  1 
ATOM   424   C C   . GLN A 1 58  ? 44.560 14.643  1.397   1.00 31.09  ? 55  GLN A C   1 
ATOM   425   O O   . GLN A 1 58  ? 44.663 15.877  1.396   1.00 29.06  ? 55  GLN A O   1 
ATOM   426   C CB  . GLN A 1 58  ? 46.345 13.399  0.161   1.00 35.25  ? 55  GLN A CB  1 
ATOM   427   C CG  . GLN A 1 58  ? 46.819 14.606  -0.634  1.00 28.81  ? 55  GLN A CG  1 
ATOM   428   C CD  . GLN A 1 58  ? 47.946 15.347  0.061   1.00 36.39  ? 55  GLN A CD  1 
ATOM   429   O OE1 . GLN A 1 58  ? 48.969 14.756  0.406   1.00 33.48  ? 55  GLN A OE1 1 
ATOM   430   N NE2 . GLN A 1 58  ? 47.756 16.643  0.287   1.00 29.38  ? 55  GLN A NE2 1 
ATOM   431   N N   . VAL A 1 59  ? 43.384 14.026  1.276   1.00 32.36  ? 56  VAL A N   1 
ATOM   432   C CA  . VAL A 1 59  ? 42.155 14.800  1.121   1.00 30.58  ? 56  VAL A CA  1 
ATOM   433   C C   . VAL A 1 59  ? 41.913 15.665  2.352   1.00 29.62  ? 56  VAL A C   1 
ATOM   434   O O   . VAL A 1 59  ? 41.397 16.786  2.250   1.00 34.20  ? 56  VAL A O   1 
ATOM   435   C CB  . VAL A 1 59  ? 40.964 13.864  0.825   1.00 30.00  ? 56  VAL A CB  1 
ATOM   436   C CG1 . VAL A 1 59  ? 40.680 12.955  2.015   1.00 28.09  ? 56  VAL A CG1 1 
ATOM   437   C CG2 . VAL A 1 59  ? 39.727 14.672  0.445   1.00 26.10  ? 56  VAL A CG2 1 
ATOM   438   N N   . THR A 1 60  ? 42.311 15.175  3.527   1.00 29.97  ? 57  THR A N   1 
ATOM   439   C CA  . THR A 1 60  ? 42.179 15.964  4.746   1.00 32.05  ? 57  THR A CA  1 
ATOM   440   C C   . THR A 1 60  ? 43.025 17.229  4.669   1.00 31.74  ? 57  THR A C   1 
ATOM   441   O O   . THR A 1 60  ? 42.553 18.328  4.985   1.00 35.00  ? 57  THR A O   1 
ATOM   442   C CB  . THR A 1 60  ? 42.577 15.122  5.959   1.00 32.18  ? 57  THR A CB  1 
ATOM   443   O OG1 . THR A 1 60  ? 41.773 13.937  5.999   1.00 31.60  ? 57  THR A OG1 1 
ATOM   444   C CG2 . THR A 1 60  ? 42.379 15.909  7.245   1.00 33.96  ? 57  THR A CG2 1 
ATOM   445   N N   . LYS A 1 61  ? 44.282 17.093  4.237   1.00 28.13  ? 58  LYS A N   1 
ATOM   446   C CA  . LYS A 1 61  ? 45.152 18.258  4.114   1.00 32.02  ? 58  LYS A CA  1 
ATOM   447   C C   . LYS A 1 61  ? 44.669 19.200  3.018   1.00 32.82  ? 58  LYS A C   1 
ATOM   448   O O   . LYS A 1 61  ? 44.759 20.425  3.162   1.00 32.68  ? 58  LYS A O   1 
ATOM   449   C CB  . LYS A 1 61  ? 46.588 17.816  3.832   1.00 33.46  ? 58  LYS A CB  1 
ATOM   450   C CG  . LYS A 1 61  ? 47.177 16.861  4.858   1.00 39.02  ? 58  LYS A CG  1 
ATOM   451   C CD  . LYS A 1 61  ? 48.544 16.367  4.405   1.00 36.38  ? 58  LYS A CD  1 
ATOM   452   C CE  . LYS A 1 61  ? 48.943 15.079  5.110   1.00 54.75  ? 58  LYS A CE  1 
ATOM   453   N NZ  . LYS A 1 61  ? 50.321 14.648  4.737   1.00 58.33  ? 58  LYS A NZ  1 
ATOM   454   N N   . ASP A 1 62  ? 44.160 18.647  1.913   1.00 27.65  ? 59  ASP A N   1 
ATOM   455   C CA  . ASP A 1 62  ? 43.694 19.487  0.813   1.00 35.34  ? 59  ASP A CA  1 
ATOM   456   C C   . ASP A 1 62  ? 42.473 20.303  1.219   1.00 30.25  ? 59  ASP A C   1 
ATOM   457   O O   . ASP A 1 62  ? 42.321 21.458  0.801   1.00 29.66  ? 59  ASP A O   1 
ATOM   458   C CB  . ASP A 1 62  ? 43.376 18.623  -0.406  1.00 35.25  ? 59  ASP A CB  1 
ATOM   459   C CG  . ASP A 1 62  ? 44.618 18.215  -1.172  1.00 34.98  ? 59  ASP A CG  1 
ATOM   460   O OD1 . ASP A 1 62  ? 45.732 18.344  -0.622  1.00 33.70  ? 59  ASP A OD1 1 
ATOM   461   O OD2 . ASP A 1 62  ? 44.478 17.752  -2.324  1.00 32.48  ? 59  ASP A OD2 1 
ATOM   462   N N   . ALA A 1 63  ? 41.585 19.716  2.023   1.00 29.37  ? 60  ALA A N   1 
ATOM   463   C CA  . ALA A 1 63  ? 40.437 20.466  2.517   1.00 32.98  ? 60  ALA A CA  1 
ATOM   464   C C   . ALA A 1 63  ? 40.882 21.642  3.377   1.00 34.68  ? 60  ALA A C   1 
ATOM   465   O O   . ALA A 1 63  ? 40.299 22.731  3.309   1.00 30.33  ? 60  ALA A O   1 
ATOM   466   C CB  . ALA A 1 63  ? 39.505 19.542  3.302   1.00 20.39  ? 60  ALA A CB  1 
ATOM   467   N N   . ALA A 1 64  ? 41.931 21.448  4.180   1.00 30.85  ? 61  ALA A N   1 
ATOM   468   C CA  . ALA A 1 64  ? 42.385 22.511  5.069   1.00 31.87  ? 61  ALA A CA  1 
ATOM   469   C C   . ALA A 1 64  ? 42.959 23.682  4.281   1.00 32.59  ? 61  ALA A C   1 
ATOM   470   O O   . ALA A 1 64  ? 42.647 24.844  4.565   1.00 30.55  ? 61  ALA A O   1 
ATOM   471   C CB  . ALA A 1 64  ? 43.414 21.967  6.059   1.00 29.86  ? 61  ALA A CB  1 
ATOM   472   N N   . GLU A 1 65  ? 43.803 23.400  3.279   1.00 32.38  ? 62  GLU A N   1 
ATOM   473   C CA  A GLU A 1 65  ? 44.327 24.465  2.429   0.52 33.69  ? 62  GLU A CA  1 
ATOM   474   C CA  B GLU A 1 65  ? 44.319 24.499  2.473   0.48 33.91  ? 62  GLU A CA  1 
ATOM   475   C C   . GLU A 1 65  ? 43.211 25.156  1.660   1.00 32.81  ? 62  GLU A C   1 
ATOM   476   O O   . GLU A 1 65  ? 43.312 26.345  1.340   1.00 27.86  ? 62  GLU A O   1 
ATOM   477   C CB  A GLU A 1 65  ? 45.362 23.902  1.454   0.52 33.34  ? 62  GLU A CB  1 
ATOM   478   C CB  B GLU A 1 65  ? 45.463 24.030  1.566   0.48 33.35  ? 62  GLU A CB  1 
ATOM   479   C CG  A GLU A 1 65  ? 46.571 23.255  2.113   0.52 34.85  ? 62  GLU A CG  1 
ATOM   480   C CG  B GLU A 1 65  ? 45.124 22.949  0.556   0.48 37.45  ? 62  GLU A CG  1 
ATOM   481   C CD  A GLU A 1 65  ? 47.467 24.255  2.814   0.52 40.13  ? 62  GLU A CD  1 
ATOM   482   C CD  B GLU A 1 65  ? 45.987 23.033  -0.698  0.48 36.32  ? 62  GLU A CD  1 
ATOM   483   O OE1 A GLU A 1 65  ? 47.414 25.455  2.467   0.52 41.41  ? 62  GLU A OE1 1 
ATOM   484   O OE1 B GLU A 1 65  ? 46.773 23.997  -0.819  0.48 36.02  ? 62  GLU A OE1 1 
ATOM   485   O OE2 A GLU A 1 65  ? 48.231 23.839  3.709   0.52 40.69  ? 62  GLU A OE2 1 
ATOM   486   O OE2 B GLU A 1 65  ? 45.881 22.137  -1.562  0.48 31.52  ? 62  GLU A OE2 1 
ATOM   487   N N   . ALA A 1 66  ? 42.139 24.419  1.349   1.00 26.16  ? 63  ALA A N   1 
ATOM   488   C CA  . ALA A 1 66  ? 41.005 25.022  0.656   1.00 30.77  ? 63  ALA A CA  1 
ATOM   489   C C   . ALA A 1 66  ? 40.267 26.006  1.556   1.00 31.02  ? 63  ALA A C   1 
ATOM   490   O O   . ALA A 1 66  ? 39.892 27.099  1.115   1.00 29.57  ? 63  ALA A O   1 
ATOM   491   C CB  . ALA A 1 66  ? 40.053 23.936  0.152   1.00 25.23  ? 63  ALA A CB  1 
ATOM   492   N N   . ILE A 1 67  ? 40.040 25.631  2.818   1.00 26.49  ? 64  ILE A N   1 
ATOM   493   C CA  . ILE A 1 67  ? 39.456 26.564  3.780   1.00 29.95  ? 64  ILE A CA  1 
ATOM   494   C C   . ILE A 1 67  ? 40.329 27.804  3.896   1.00 32.80  ? 64  ILE A C   1 
ATOM   495   O O   . ILE A 1 67  ? 39.837 28.940  3.888   1.00 34.37  ? 64  ILE A O   1 
ATOM   496   C CB  . ILE A 1 67  ? 39.285 25.894  5.155   1.00 31.22  ? 64  ILE A CB  1 
ATOM   497   C CG1 . ILE A 1 67  ? 38.375 24.674  5.080   1.00 28.03  ? 64  ILE A CG1 1 
ATOM   498   C CG2 . ILE A 1 67  ? 38.713 26.892  6.154   1.00 32.96  ? 64  ILE A CG2 1 
ATOM   499   C CD1 . ILE A 1 67  ? 38.228 23.980  6.416   1.00 29.54  ? 64  ILE A CD1 1 
ATOM   500   N N   . LYS A 1 68  ? 41.642 27.597  4.016   1.00 29.55  ? 65  LYS A N   1 
ATOM   501   C CA  . LYS A 1 68  ? 42.588 28.702  4.096   1.00 33.17  ? 65  LYS A CA  1 
ATOM   502   C C   . LYS A 1 68  ? 42.451 29.625  2.893   1.00 40.28  ? 65  LYS A C   1 
ATOM   503   O O   . LYS A 1 68  ? 42.473 30.854  3.033   1.00 37.96  ? 65  LYS A O   1 
ATOM   504   C CB  . LYS A 1 68  ? 44.000 28.132  4.195   1.00 32.53  ? 65  LYS A CB  1 
ATOM   505   C CG  . LYS A 1 68  ? 45.070 29.060  4.716   1.00 44.59  ? 65  LYS A CG  1 
ATOM   506   C CD  . LYS A 1 68  ? 46.218 28.213  5.250   1.00 44.65  ? 65  LYS A CD  1 
ATOM   507   C CE  . LYS A 1 68  ? 47.554 28.888  5.047   1.00 44.16  ? 65  LYS A CE  1 
ATOM   508   N NZ  . LYS A 1 68  ? 47.598 30.197  5.744   1.00 60.76  ? 65  LYS A NZ  1 
ATOM   509   N N   . LYS A 1 69  ? 42.283 29.049  1.701   1.00 35.31  ? 66  LYS A N   1 
ATOM   510   C CA  . LYS A 1 69  ? 42.170 29.867  0.499   1.00 36.05  ? 66  LYS A CA  1 
ATOM   511   C C   . LYS A 1 69  ? 40.829 30.593  0.435   1.00 38.49  ? 66  LYS A C   1 
ATOM   512   O O   . LYS A 1 69  ? 40.776 31.772  0.064   1.00 36.23  ? 66  LYS A O   1 
ATOM   513   C CB  . LYS A 1 69  ? 42.371 29.000  -0.745  1.00 42.29  ? 66  LYS A CB  1 
ATOM   514   C CG  . LYS A 1 69  ? 42.132 29.738  -2.052  1.00 47.36  ? 66  LYS A CG  1 
ATOM   515   C CD  . LYS A 1 69  ? 42.503 28.886  -3.252  1.00 53.45  ? 66  LYS A CD  1 
ATOM   516   C CE  . LYS A 1 69  ? 42.484 29.719  -4.521  1.00 63.59  ? 66  LYS A CE  1 
ATOM   517   N NZ  . LYS A 1 69  ? 43.208 31.008  -4.340  1.00 69.40  ? 66  LYS A NZ  1 
ATOM   518   N N   . HIS A 1 70  ? 39.737 29.920  0.806   1.00 35.41  ? 67  HIS A N   1 
ATOM   519   C CA  . HIS A 1 70  ? 38.395 30.430  0.543   1.00 40.20  ? 67  HIS A CA  1 
ATOM   520   C C   . HIS A 1 70  ? 37.648 30.918  1.784   1.00 35.53  ? 67  HIS A C   1 
ATOM   521   O O   . HIS A 1 70  ? 36.494 31.346  1.657   1.00 37.07  ? 67  HIS A O   1 
ATOM   522   C CB  . HIS A 1 70  ? 37.562 29.363  -0.175  1.00 31.02  ? 67  HIS A CB  1 
ATOM   523   C CG  . HIS A 1 70  ? 38.040 29.061  -1.563  1.00 43.73  ? 67  HIS A CG  1 
ATOM   524   N ND1 . HIS A 1 70  ? 37.965 29.980  -2.587  1.00 42.24  ? 67  HIS A ND1 1 
ATOM   525   C CD2 . HIS A 1 70  ? 38.589 27.945  -2.100  1.00 39.74  ? 67  HIS A CD2 1 
ATOM   526   C CE1 . HIS A 1 70  ? 38.452 29.447  -3.693  1.00 37.19  ? 67  HIS A CE1 1 
ATOM   527   N NE2 . HIS A 1 70  ? 38.838 28.213  -3.425  1.00 45.59  ? 67  HIS A NE2 1 
ATOM   528   N N   . ASN A 1 71  ? 38.260 30.844  2.972   1.00 34.27  ? 68  ASN A N   1 
ATOM   529   C CA  . ASN A 1 71  ? 37.783 31.506  4.189   1.00 36.11  ? 68  ASN A CA  1 
ATOM   530   C C   . ASN A 1 71  ? 36.506 30.934  4.808   1.00 36.10  ? 68  ASN A C   1 
ATOM   531   O O   . ASN A 1 71  ? 36.106 31.381  5.888   1.00 38.77  ? 68  ASN A O   1 
ATOM   532   C CB  . ASN A 1 71  ? 37.555 33.006  3.942   1.00 31.66  ? 68  ASN A CB  1 
ATOM   533   C CG  . ASN A 1 71  ? 38.785 33.717  3.413   1.00 35.95  ? 68  ASN A CG  1 
ATOM   534   O OD1 . ASN A 1 71  ? 38.735 34.375  2.373   1.00 36.88  ? 68  ASN A OD1 1 
ATOM   535   N ND2 . ASN A 1 71  ? 39.897 33.590  4.127   1.00 38.68  ? 68  ASN A ND2 1 
ATOM   536   N N   . VAL A 1 72  ? 35.843 29.972  4.167   1.00 35.84  ? 69  VAL A N   1 
ATOM   537   C CA  . VAL A 1 72  ? 34.608 29.417  4.722   1.00 33.37  ? 69  VAL A CA  1 
ATOM   538   C C   . VAL A 1 72  ? 34.625 27.905  4.568   1.00 32.21  ? 69  VAL A C   1 
ATOM   539   O O   . VAL A 1 72  ? 34.587 27.392  3.445   1.00 32.42  ? 69  VAL A O   1 
ATOM   540   C CB  . VAL A 1 72  ? 33.340 29.994  4.062   1.00 36.84  ? 69  VAL A CB  1 
ATOM   541   C CG1 . VAL A 1 72  ? 32.102 29.369  4.679   1.00 30.96  ? 69  VAL A CG1 1 
ATOM   542   C CG2 . VAL A 1 72  ? 33.288 31.510  4.217   1.00 35.69  ? 69  VAL A CG2 1 
ATOM   543   N N   . GLY A 1 73  ? 34.660 27.197  5.685   1.00 30.40  ? 70  GLY A N   1 
ATOM   544   C CA  . GLY A 1 73  ? 34.556 25.748  5.689   1.00 30.16  ? 70  GLY A CA  1 
ATOM   545   C C   . GLY A 1 73  ? 33.368 25.306  6.521   1.00 35.84  ? 70  GLY A C   1 
ATOM   546   O O   . GLY A 1 73  ? 33.087 25.887  7.572   1.00 35.45  ? 70  GLY A O   1 
ATOM   547   N N   . VAL A 1 74  ? 32.661 24.293  6.028   1.00 32.66  ? 71  VAL A N   1 
ATOM   548   C CA  . VAL A 1 74  ? 31.593 23.627  6.764   1.00 32.95  ? 71  VAL A CA  1 
ATOM   549   C C   . VAL A 1 74  ? 31.888 22.134  6.733   1.00 34.16  ? 71  VAL A C   1 
ATOM   550   O O   . VAL A 1 74  ? 32.115 21.561  5.661   1.00 36.43  ? 71  VAL A O   1 
ATOM   551   C CB  . VAL A 1 74  ? 30.199 23.949  6.183   1.00 34.70  ? 71  VAL A CB  1 
ATOM   552   C CG1 . VAL A 1 74  ? 29.910 25.439  6.315   1.00 30.44  ? 71  VAL A CG1 1 
ATOM   553   C CG2 . VAL A 1 74  ? 30.095 23.530  4.720   1.00 31.16  ? 71  VAL A CG2 1 
ATOM   554   N N   . LYS A 1 75  ? 31.925 21.511  7.909   1.00 34.79  ? 72  LYS A N   1 
ATOM   555   C CA  . LYS A 1 75  ? 32.483 20.173  8.044   1.00 33.43  ? 72  LYS A CA  1 
ATOM   556   C C   . LYS A 1 75  ? 31.502 19.240  8.733   1.00 35.32  ? 72  LYS A C   1 
ATOM   557   O O   . LYS A 1 75  ? 30.945 19.576  9.784   1.00 36.90  ? 72  LYS A O   1 
ATOM   558   C CB  . LYS A 1 75  ? 33.800 20.197  8.823   1.00 31.85  ? 72  LYS A CB  1 
ATOM   559   C CG  . LYS A 1 75  ? 34.357 18.810  9.077   1.00 31.50  ? 72  LYS A CG  1 
ATOM   560   C CD  . LYS A 1 75  ? 35.687 18.843  9.798   1.00 32.81  ? 72  LYS A CD  1 
ATOM   561   C CE  . LYS A 1 75  ? 36.241 17.437  9.970   1.00 32.84  ? 72  LYS A CE  1 
ATOM   562   N NZ  . LYS A 1 75  ? 35.311 16.561  10.742  1.00 32.93  ? 72  LYS A NZ  1 
ATOM   563   N N   . CYS A 1 76  ? 31.315 18.066  8.140   1.00 29.89  ? 73  CYS A N   1 
ATOM   564   C CA  . CYS A 1 76  ? 30.554 16.978  8.729   1.00 30.14  ? 73  CYS A CA  1 
ATOM   565   C C   . CYS A 1 76  ? 31.452 16.157  9.647   1.00 30.33  ? 73  CYS A C   1 
ATOM   566   O O   . CYS A 1 76  ? 32.669 16.091  9.458   1.00 32.13  ? 73  CYS A O   1 
ATOM   567   C CB  . CYS A 1 76  ? 29.965 16.096  7.624   1.00 33.00  ? 73  CYS A CB  1 
ATOM   568   S SG  . CYS A 1 76  ? 29.169 14.574  8.163   1.00 34.93  ? 73  CYS A SG  1 
ATOM   569   N N   . ALA A 1 77  ? 30.838 15.531  10.649  1.00 26.31  ? 74  ALA A N   1 
ATOM   570   C CA  . ALA A 1 77  ? 31.593 14.773  11.638  1.00 33.71  ? 74  ALA A CA  1 
ATOM   571   C C   . ALA A 1 77  ? 32.299 13.583  10.992  1.00 35.50  ? 74  ALA A C   1 
ATOM   572   O O   . ALA A 1 77  ? 31.801 12.973  10.042  1.00 33.21  ? 74  ALA A O   1 
ATOM   573   C CB  . ALA A 1 77  ? 30.669 14.297  12.758  1.00 32.40  ? 74  ALA A CB  1 
ATOM   574   N N   . THR A 1 78  ? 33.476 13.251  11.524  1.00 29.63  ? 75  THR A N   1 
ATOM   575   C CA  . THR A 1 78  ? 34.350 12.249  10.932  1.00 31.17  ? 75  THR A CA  1 
ATOM   576   C C   . THR A 1 78  ? 34.804 11.253  11.988  1.00 35.87  ? 75  THR A C   1 
ATOM   577   O O   . THR A 1 78  ? 34.998 11.604  13.156  1.00 34.88  ? 75  THR A O   1 
ATOM   578   C CB  . THR A 1 78  ? 35.588 12.885  10.283  1.00 32.43  ? 75  THR A CB  1 
ATOM   579   O OG1 . THR A 1 78  ? 36.189 13.811  11.197  1.00 34.24  ? 75  THR A OG1 1 
ATOM   580   C CG2 . THR A 1 78  ? 35.212 13.611  9.001   1.00 31.15  ? 75  THR A CG2 1 
ATOM   581   N N   . ILE A 1 79  ? 34.982 10.004  11.558  1.00 29.57  ? 76  ILE A N   1 
ATOM   582   C CA  . ILE A 1 79  ? 35.538 8.978   12.431  1.00 38.68  ? 76  ILE A CA  1 
ATOM   583   C C   . ILE A 1 79  ? 37.010 9.274   12.674  1.00 35.24  ? 76  ILE A C   1 
ATOM   584   O O   . ILE A 1 79  ? 37.795 9.416   11.727  1.00 35.92  ? 76  ILE A O   1 
ATOM   585   C CB  . ILE A 1 79  ? 35.374 7.583   11.809  1.00 38.13  ? 76  ILE A CB  1 
ATOM   586   C CG1 . ILE A 1 79  ? 33.906 7.195   11.683  1.00 36.97  ? 76  ILE A CG1 1 
ATOM   587   C CG2 . ILE A 1 79  ? 36.125 6.547   12.633  1.00 36.23  ? 76  ILE A CG2 1 
ATOM   588   C CD1 . ILE A 1 79  ? 33.697 5.919   10.886  1.00 36.31  ? 76  ILE A CD1 1 
ATOM   589   N N   . THR A 1 80  ? 37.399 9.360   13.942  1.00 35.46  ? 77  THR A N   1 
ATOM   590   C CA  . THR A 1 80  ? 38.812 9.384   14.268  1.00 36.78  ? 77  THR A CA  1 
ATOM   591   C C   . THR A 1 80  ? 39.257 7.965   14.567  1.00 36.49  ? 77  THR A C   1 
ATOM   592   O O   . THR A 1 80  ? 38.758 7.360   15.529  1.00 38.34  ? 77  THR A O   1 
ATOM   593   C CB  . THR A 1 80  ? 39.098 10.292  15.453  1.00 38.76  ? 77  THR A CB  1 
ATOM   594   O OG1 . THR A 1 80  ? 38.927 11.657  15.054  1.00 41.70  ? 77  THR A OG1 1 
ATOM   595   C CG2 . THR A 1 80  ? 40.529 10.091  15.930  1.00 38.26  ? 77  THR A CG2 1 
ATOM   596   N N   . PRO A 1 81  ? 40.167 7.400   13.781  1.00 40.13  ? 78  PRO A N   1 
ATOM   597   C CA  . PRO A 1 81  ? 40.462 5.967   13.899  1.00 41.61  ? 78  PRO A CA  1 
ATOM   598   C C   . PRO A 1 81  ? 41.082 5.618   15.245  1.00 44.13  ? 78  PRO A C   1 
ATOM   599   O O   . PRO A 1 81  ? 41.973 6.313   15.739  1.00 37.18  ? 78  PRO A O   1 
ATOM   600   C CB  . PRO A 1 81  ? 41.441 5.714   12.746  1.00 40.64  ? 78  PRO A CB  1 
ATOM   601   C CG  . PRO A 1 81  ? 41.216 6.852   11.789  1.00 38.05  ? 78  PRO A CG  1 
ATOM   602   C CD  . PRO A 1 81  ? 40.887 8.024   12.658  1.00 39.91  ? 78  PRO A CD  1 
ATOM   603   N N   . ASP A 1 82  ? 40.578 4.548   15.849  1.00 44.63  ? 79  ASP A N   1 
ATOM   604   C CA  . ASP A 1 82  ? 41.258 3.854   16.933  1.00 46.17  ? 79  ASP A CA  1 
ATOM   605   C C   . ASP A 1 82  ? 41.592 2.444   16.454  1.00 51.11  ? 79  ASP A C   1 
ATOM   606   O O   . ASP A 1 82  ? 41.347 2.086   15.298  1.00 48.98  ? 79  ASP A O   1 
ATOM   607   C CB  . ASP A 1 82  ? 40.420 3.848   18.221  1.00 39.30  ? 79  ASP A CB  1 
ATOM   608   C CG  . ASP A 1 82  ? 39.050 3.204   18.051  1.00 47.36  ? 79  ASP A CG  1 
ATOM   609   O OD1 . ASP A 1 82  ? 38.852 2.401   17.116  1.00 50.00  ? 79  ASP A OD1 1 
ATOM   610   O OD2 . ASP A 1 82  ? 38.159 3.497   18.879  1.00 59.56  ? 79  ASP A OD2 1 
ATOM   611   N N   . GLU A 1 83  ? 42.152 1.635   17.356  1.00 52.83  ? 80  GLU A N   1 
ATOM   612   C CA  . GLU A 1 83  ? 42.589 0.297   16.966  1.00 52.64  ? 80  GLU A CA  1 
ATOM   613   C C   . GLU A 1 83  ? 41.427 -0.546  16.456  1.00 51.36  ? 80  GLU A C   1 
ATOM   614   O O   . GLU A 1 83  ? 41.588 -1.337  15.516  1.00 44.49  ? 80  GLU A O   1 
ATOM   615   C CB  . GLU A 1 83  ? 43.293 -0.391  18.138  1.00 62.83  ? 80  GLU A CB  1 
ATOM   616   C CG  . GLU A 1 83  ? 44.548 -1.142  17.708  1.00 72.48  ? 80  GLU A CG  1 
ATOM   617   C CD  . GLU A 1 83  ? 45.220 -1.905  18.833  1.00 85.45  ? 80  GLU A CD  1 
ATOM   618   O OE1 . GLU A 1 83  ? 45.338 -3.143  18.720  1.00 93.82  ? 80  GLU A OE1 1 
ATOM   619   O OE2 . GLU A 1 83  ? 45.646 -1.268  19.818  1.00 87.63  ? 80  GLU A OE2 1 
ATOM   620   N N   . LYS A 1 84  ? 40.240 -0.372  17.046  1.00 51.19  ? 81  LYS A N   1 
ATOM   621   C CA  . LYS A 1 84  ? 39.083 -1.129  16.581  1.00 54.18  ? 81  LYS A CA  1 
ATOM   622   C C   . LYS A 1 84  ? 38.570 -0.608  15.244  1.00 52.08  ? 81  LYS A C   1 
ATOM   623   O O   . LYS A 1 84  ? 38.042 -1.386  14.439  1.00 48.01  ? 81  LYS A O   1 
ATOM   624   C CB  . LYS A 1 84  ? 37.965 -1.099  17.620  1.00 54.11  ? 81  LYS A CB  1 
ATOM   625   C CG  . LYS A 1 84  ? 36.899 -2.165  17.377  1.00 73.14  ? 81  LYS A CG  1 
ATOM   626   C CD  . LYS A 1 84  ? 35.484 -1.605  17.366  1.00 74.61  ? 81  LYS A CD  1 
ATOM   627   C CE  . LYS A 1 84  ? 34.879 -1.638  18.762  1.00 66.92  ? 81  LYS A CE  1 
ATOM   628   N NZ  . LYS A 1 84  ? 33.412 -1.388  18.749  1.00 64.96  ? 81  LYS A NZ  1 
ATOM   629   N N   . ARG A 1 85  ? 38.708 0.697   14.985  1.00 49.25  ? 82  ARG A N   1 
ATOM   630   C CA  . ARG A 1 85  ? 38.357 1.213   13.666  1.00 45.53  ? 82  ARG A CA  1 
ATOM   631   C C   . ARG A 1 85  ? 39.335 0.714   12.611  1.00 43.56  ? 82  ARG A C   1 
ATOM   632   O O   . ARG A 1 85  ? 38.944 0.460   11.466  1.00 45.50  ? 82  ARG A O   1 
ATOM   633   C CB  . ARG A 1 85  ? 38.320 2.741   13.680  1.00 45.05  ? 82  ARG A CB  1 
ATOM   634   C CG  . ARG A 1 85  ? 37.238 3.356   14.557  1.00 43.63  ? 82  ARG A CG  1 
ATOM   635   C CD  . ARG A 1 85  ? 35.830 3.021   14.083  1.00 40.45  ? 82  ARG A CD  1 
ATOM   636   N NE  . ARG A 1 85  ? 34.872 4.022   14.547  1.00 45.32  ? 82  ARG A NE  1 
ATOM   637   C CZ  . ARG A 1 85  ? 33.614 4.113   14.127  1.00 41.51  ? 82  ARG A CZ  1 
ATOM   638   N NH1 . ARG A 1 85  ? 33.144 3.252   13.236  1.00 38.80  ? 82  ARG A NH1 1 
ATOM   639   N NH2 . ARG A 1 85  ? 32.822 5.064   14.607  1.00 38.61  ? 82  ARG A NH2 1 
ATOM   640   N N   . VAL A 1 86  ? 40.610 0.571   12.982  1.00 45.85  ? 83  VAL A N   1 
ATOM   641   C CA  . VAL A 1 86  ? 41.613 0.066   12.049  1.00 45.21  ? 83  VAL A CA  1 
ATOM   642   C C   . VAL A 1 86  ? 41.197 -1.294  11.503  1.00 50.21  ? 83  VAL A C   1 
ATOM   643   O O   . VAL A 1 86  ? 41.348 -1.572  10.308  1.00 53.28  ? 83  VAL A O   1 
ATOM   644   C CB  . VAL A 1 86  ? 42.993 0.009   12.730  1.00 43.22  ? 83  VAL A CB  1 
ATOM   645   C CG1 . VAL A 1 86  ? 43.965 -0.819  11.905  1.00 37.12  ? 83  VAL A CG1 1 
ATOM   646   C CG2 . VAL A 1 86  ? 43.539 1.417   12.934  1.00 41.63  ? 83  VAL A CG2 1 
ATOM   647   N N   . GLU A 1 87  ? 40.647 -2.153  12.363  1.00 46.88  ? 84  GLU A N   1 
ATOM   648   C CA  . GLU A 1 87  ? 40.243 -3.482  11.915  1.00 55.01  ? 84  GLU A CA  1 
ATOM   649   C C   . GLU A 1 87  ? 38.889 -3.443  11.216  1.00 56.13  ? 84  GLU A C   1 
ATOM   650   O O   . GLU A 1 87  ? 38.643 -4.227  10.286  1.00 56.64  ? 84  GLU A O   1 
ATOM   651   C CB  . GLU A 1 87  ? 40.214 -4.452  13.099  1.00 54.96  ? 84  GLU A CB  1 
ATOM   652   C CG  . GLU A 1 87  ? 39.266 -5.635  12.931  1.00 64.20  ? 84  GLU A CG  1 
ATOM   653   C CD  . GLU A 1 87  ? 39.967 -6.858  12.366  1.00 76.04  ? 84  GLU A CD  1 
ATOM   654   O OE1 . GLU A 1 87  ? 39.311 -7.909  12.197  1.00 77.87  ? 84  GLU A OE1 1 
ATOM   655   O OE2 . GLU A 1 87  ? 41.177 -6.760  12.070  1.00 73.37  ? 84  GLU A OE2 1 
ATOM   656   N N   . GLU A 1 88  ? 38.008 -2.525  11.637  1.00 45.78  ? 85  GLU A N   1 
ATOM   657   C CA  . GLU A 1 88  ? 36.690 -2.436  11.016  1.00 42.59  ? 85  GLU A CA  1 
ATOM   658   C C   . GLU A 1 88  ? 36.792 -2.122  9.527   1.00 43.15  ? 85  GLU A C   1 
ATOM   659   O O   . GLU A 1 88  ? 36.069 -2.704  8.709   1.00 45.81  ? 85  GLU A O   1 
ATOM   660   C CB  . GLU A 1 88  ? 35.838 -1.380  11.715  1.00 45.06  ? 85  GLU A CB  1 
ATOM   661   C CG  . GLU A 1 88  ? 34.449 -1.220  11.091  1.00 43.50  ? 85  GLU A CG  1 
ATOM   662   C CD  . GLU A 1 88  ? 33.622 -0.095  11.698  1.00 46.36  ? 85  GLU A CD  1 
ATOM   663   O OE1 . GLU A 1 88  ? 34.100 0.567   12.640  1.00 40.06  ? 85  GLU A OE1 1 
ATOM   664   O OE2 . GLU A 1 88  ? 32.486 0.129   11.222  1.00 41.30  ? 85  GLU A OE2 1 
ATOM   665   N N   . PHE A 1 89  ? 37.685 -1.208  9.153   1.00 48.46  ? 86  PHE A N   1 
ATOM   666   C CA  . PHE A 1 89  ? 37.820 -0.784  7.766   1.00 51.99  ? 86  PHE A CA  1 
ATOM   667   C C   . PHE A 1 89  ? 39.108 -1.277  7.119   1.00 51.50  ? 86  PHE A C   1 
ATOM   668   O O   . PHE A 1 89  ? 39.395 -0.899  5.979   1.00 55.91  ? 86  PHE A O   1 
ATOM   669   C CB  . PHE A 1 89  ? 37.743 0.743   7.668   1.00 48.82  ? 86  PHE A CB  1 
ATOM   670   C CG  . PHE A 1 89  ? 36.468 1.325   8.202   1.00 44.06  ? 86  PHE A CG  1 
ATOM   671   C CD1 . PHE A 1 89  ? 35.357 1.463   7.385   1.00 46.74  ? 86  PHE A CD1 1 
ATOM   672   C CD2 . PHE A 1 89  ? 36.381 1.744   9.518   1.00 45.09  ? 86  PHE A CD2 1 
ATOM   673   C CE1 . PHE A 1 89  ? 34.181 2.001   7.874   1.00 43.55  ? 86  PHE A CE1 1 
ATOM   674   C CE2 . PHE A 1 89  ? 35.210 2.285   10.013  1.00 38.65  ? 86  PHE A CE2 1 
ATOM   675   C CZ  . PHE A 1 89  ? 34.108 2.412   9.191   1.00 42.79  ? 86  PHE A CZ  1 
ATOM   676   N N   . LYS A 1 90  ? 39.884 -2.114  7.811   1.00 49.77  ? 87  LYS A N   1 
ATOM   677   C CA  . LYS A 1 90  ? 41.189 -2.573  7.326   1.00 56.60  ? 87  LYS A CA  1 
ATOM   678   C C   . LYS A 1 90  ? 42.059 -1.388  6.910   1.00 51.87  ? 87  LYS A C   1 
ATOM   679   O O   . LYS A 1 90  ? 42.598 -1.333  5.802   1.00 49.08  ? 87  LYS A O   1 
ATOM   680   C CB  . LYS A 1 90  ? 41.038 -3.571  6.175   1.00 54.84  ? 87  LYS A CB  1 
ATOM   681   C CG  . LYS A 1 90  ? 40.062 -4.703  6.439   1.00 57.48  ? 87  LYS A CG  1 
ATOM   682   C CD  . LYS A 1 90  ? 40.378 -5.450  7.726   1.00 65.52  ? 87  LYS A CD  1 
ATOM   683   C CE  . LYS A 1 90  ? 39.265 -6.434  8.055   1.00 70.11  ? 87  LYS A CE  1 
ATOM   684   N NZ  . LYS A 1 90  ? 39.441 -7.061  9.389   1.00 65.96  ? 87  LYS A NZ  1 
ATOM   685   N N   . LEU A 1 91  ? 42.184 -0.425  7.819   1.00 39.87  ? 88  LEU A N   1 
ATOM   686   C CA  . LEU A 1 91  ? 42.928 0.791   7.526   1.00 42.12  ? 88  LEU A CA  1 
ATOM   687   C C   . LEU A 1 91  ? 44.409 0.488   7.336   1.00 43.69  ? 88  LEU A C   1 
ATOM   688   O O   . LEU A 1 91  ? 44.961 -0.439  7.936   1.00 47.49  ? 88  LEU A O   1 
ATOM   689   C CB  . LEU A 1 91  ? 42.741 1.812   8.651   1.00 41.57  ? 88  LEU A CB  1 
ATOM   690   C CG  . LEU A 1 91  ? 41.302 2.255   8.920   1.00 42.11  ? 88  LEU A CG  1 
ATOM   691   C CD1 . LEU A 1 91  ? 41.259 3.329   9.994   1.00 38.73  ? 88  LEU A CD1 1 
ATOM   692   C CD2 . LEU A 1 91  ? 40.661 2.757   7.638   1.00 39.25  ? 88  LEU A CD2 1 
ATOM   693   N N   . LYS A 1 92  ? 45.054 1.284   6.477   1.00 43.72  ? 89  LYS A N   1 
ATOM   694   C CA  . LYS A 1 92  ? 46.494 1.151   6.284   1.00 40.33  ? 89  LYS A CA  1 
ATOM   695   C C   . LYS A 1 92  ? 47.259 1.517   7.548   1.00 44.63  ? 89  LYS A C   1 
ATOM   696   O O   . LYS A 1 92  ? 48.349 0.986   7.790   1.00 37.21  ? 89  LYS A O   1 
ATOM   697   C CB  . LYS A 1 92  ? 46.959 2.034   5.128   1.00 40.23  ? 89  LYS A CB  1 
ATOM   698   C CG  . LYS A 1 92  ? 46.316 1.740   3.783   1.00 39.71  ? 89  LYS A CG  1 
ATOM   699   C CD  . LYS A 1 92  ? 46.621 2.875   2.815   1.00 37.10  ? 89  LYS A CD  1 
ATOM   700   C CE  . LYS A 1 92  ? 46.056 2.624   1.429   1.00 32.42  ? 89  LYS A CE  1 
ATOM   701   N NZ  . LYS A 1 92  ? 46.269 3.805   0.543   1.00 38.00  ? 89  LYS A NZ  1 
ATOM   702   N N   . GLN A 1 93  ? 46.709 2.424   8.349   1.00 42.93  ? 90  GLN A N   1 
ATOM   703   C CA  . GLN A 1 93  ? 47.311 2.877   9.595   1.00 45.81  ? 90  GLN A CA  1 
ATOM   704   C C   . GLN A 1 93  ? 46.247 3.658   10.353  1.00 44.71  ? 90  GLN A C   1 
ATOM   705   O O   . GLN A 1 93  ? 45.199 4.005   9.803   1.00 38.86  ? 90  GLN A O   1 
ATOM   706   C CB  . GLN A 1 93  ? 48.561 3.731   9.346   1.00 44.55  ? 90  GLN A CB  1 
ATOM   707   C CG  . GLN A 1 93  ? 48.311 4.972   8.504   1.00 44.01  ? 90  GLN A CG  1 
ATOM   708   C CD  . GLN A 1 93  ? 49.569 5.793   8.281   1.00 49.50  ? 90  GLN A CD  1 
ATOM   709   O OE1 . GLN A 1 93  ? 50.270 5.617   7.284   1.00 61.07  ? 90  GLN A OE1 1 
ATOM   710   N NE2 . GLN A 1 93  ? 49.858 6.701   9.206   1.00 49.34  ? 90  GLN A NE2 1 
ATOM   711   N N   . MET A 1 94  ? 46.521 3.922   11.628  1.00 46.94  ? 91  MET A N   1 
ATOM   712   C CA  . MET A 1 94  ? 45.591 4.672   12.469  1.00 43.07  ? 91  MET A CA  1 
ATOM   713   C C   . MET A 1 94  ? 45.737 6.148   12.127  1.00 45.11  ? 91  MET A C   1 
ATOM   714   O O   . MET A 1 94  ? 46.547 6.870   12.713  1.00 44.63  ? 91  MET A O   1 
ATOM   715   C CB  . MET A 1 94  ? 45.854 4.410   13.945  1.00 45.80  ? 91  MET A CB  1 
ATOM   716   C CG  . MET A 1 94  ? 44.751 4.932   14.852  1.00 42.25  ? 91  MET A CG  1 
ATOM   717   S SD  . MET A 1 94  ? 45.055 4.620   16.599  1.00 53.99  ? 91  MET A SD  1 
ATOM   718   C CE  . MET A 1 94  ? 45.317 2.848   16.587  1.00 41.03  ? 91  MET A CE  1 
ATOM   719   N N   . TRP A 1 95  ? 44.938 6.598   11.163  1.00 44.78  ? 92  TRP A N   1 
ATOM   720   C CA  . TRP A 1 95  ? 45.048 7.965   10.674  1.00 36.95  ? 92  TRP A CA  1 
ATOM   721   C C   . TRP A 1 95  ? 44.764 8.969   11.783  1.00 38.59  ? 92  TRP A C   1 
ATOM   722   O O   . TRP A 1 95  ? 43.921 8.740   12.654  1.00 38.06  ? 92  TRP A O   1 
ATOM   723   C CB  . TRP A 1 95  ? 44.088 8.184   9.505   1.00 39.71  ? 92  TRP A CB  1 
ATOM   724   C CG  . TRP A 1 95  ? 44.355 7.270   8.357   1.00 37.87  ? 92  TRP A CG  1 
ATOM   725   C CD1 . TRP A 1 95  ? 43.570 6.245   7.920   1.00 33.91  ? 92  TRP A CD1 1 
ATOM   726   C CD2 . TRP A 1 95  ? 45.501 7.294   7.500   1.00 35.43  ? 92  TRP A CD2 1 
ATOM   727   N NE1 . TRP A 1 95  ? 44.156 5.630   6.839   1.00 40.28  ? 92  TRP A NE1 1 
ATOM   728   C CE2 . TRP A 1 95  ? 45.343 6.257   6.561   1.00 35.42  ? 92  TRP A CE2 1 
ATOM   729   C CE3 . TRP A 1 95  ? 46.646 8.096   7.435   1.00 37.61  ? 92  TRP A CE3 1 
ATOM   730   C CZ2 . TRP A 1 95  ? 46.286 5.999   5.568   1.00 40.05  ? 92  TRP A CZ2 1 
ATOM   731   C CZ3 . TRP A 1 95  ? 47.582 7.839   6.448   1.00 35.93  ? 92  TRP A CZ3 1 
ATOM   732   C CH2 . TRP A 1 95  ? 47.397 6.798   5.529   1.00 38.43  ? 92  TRP A CH2 1 
ATOM   733   N N   . LYS A 1 96  ? 45.490 10.082  11.749  1.00 34.45  ? 93  LYS A N   1 
ATOM   734   C CA  . LYS A 1 96  ? 45.303 11.145  12.722  1.00 35.64  ? 93  LYS A CA  1 
ATOM   735   C C   . LYS A 1 96  ? 43.947 11.812  12.518  1.00 40.55  ? 93  LYS A C   1 
ATOM   736   O O   . LYS A 1 96  ? 43.428 11.882  11.400  1.00 37.74  ? 93  LYS A O   1 
ATOM   737   C CB  . LYS A 1 96  ? 46.437 12.168  12.602  1.00 36.25  ? 93  LYS A CB  1 
ATOM   738   C CG  . LYS A 1 96  ? 46.175 13.528  13.235  1.00 47.11  ? 93  LYS A CG  1 
ATOM   739   C CD  . LYS A 1 96  ? 47.267 14.524  12.859  1.00 50.56  ? 93  LYS A CD  1 
ATOM   740   C CE  . LYS A 1 96  ? 46.963 15.919  13.386  1.00 50.83  ? 93  LYS A CE  1 
ATOM   741   N NZ  . LYS A 1 96  ? 47.949 16.927  12.896  1.00 51.82  ? 93  LYS A NZ  1 
ATOM   742   N N   . SER A 1 97  ? 43.363 12.278  13.625  1.00 31.83  ? 94  SER A N   1 
ATOM   743   C CA  . SER A 1 97  ? 42.100 13.005  13.624  1.00 38.53  ? 94  SER A CA  1 
ATOM   744   C C   . SER A 1 97  ? 42.093 14.076  12.541  1.00 36.35  ? 94  SER A C   1 
ATOM   745   O O   . SER A 1 97  ? 42.989 14.929  12.510  1.00 33.21  ? 94  SER A O   1 
ATOM   746   C CB  . SER A 1 97  ? 41.850 13.646  14.990  1.00 39.58  ? 94  SER A CB  1 
ATOM   747   O OG  . SER A 1 97  ? 40.736 14.522  14.939  1.00 43.88  ? 94  SER A OG  1 
ATOM   748   N N   . PRO A 1 98  ? 41.112 14.054  11.631  1.00 35.54  ? 95  PRO A N   1 
ATOM   749   C CA  . PRO A 1 98  ? 41.034 15.127  10.625  1.00 32.57  ? 95  PRO A CA  1 
ATOM   750   C C   . PRO A 1 98  ? 40.939 16.494  11.263  1.00 33.95  ? 95  PRO A C   1 
ATOM   751   O O   . PRO A 1 98  ? 41.517 17.466  10.760  1.00 31.84  ? 95  PRO A O   1 
ATOM   752   C CB  . PRO A 1 98  ? 39.755 14.787  9.846   1.00 35.77  ? 95  PRO A CB  1 
ATOM   753   C CG  . PRO A 1 98  ? 39.550 13.333  10.057  1.00 36.55  ? 95  PRO A CG  1 
ATOM   754   C CD  . PRO A 1 98  ? 40.063 13.038  11.441  1.00 34.35  ? 95  PRO A CD  1 
ATOM   755   N N   . ASN A 1 99  ? 40.224 16.576  12.384  1.00 32.39  ? 96  ASN A N   1 
ATOM   756   C CA  . ASN A 1 99  ? 40.047 17.849  13.066  1.00 40.46  ? 96  ASN A CA  1 
ATOM   757   C C   . ASN A 1 99  ? 41.378 18.399  13.561  1.00 36.58  ? 96  ASN A C   1 
ATOM   758   O O   . ASN A 1 99  ? 41.660 19.590  13.397  1.00 35.71  ? 96  ASN A O   1 
ATOM   759   C CB  . ASN A 1 99  ? 39.051 17.669  14.209  1.00 43.82  ? 96  ASN A CB  1 
ATOM   760   C CG  . ASN A 1 99  ? 37.775 16.976  13.753  1.00 49.35  ? 96  ASN A CG  1 
ATOM   761   O OD1 . ASN A 1 99  ? 36.973 17.555  13.020  1.00 36.46  ? 96  ASN A OD1 1 
ATOM   762   N ND2 . ASN A 1 99  ? 37.605 15.718  14.149  1.00 39.31  ? 96  ASN A ND2 1 
ATOM   763   N N   . GLY A 1 100 ? 42.227 17.539  14.130  1.00 35.36  ? 97  GLY A N   1 
ATOM   764   C CA  . GLY A 1 100 ? 43.546 17.988  14.544  1.00 34.34  ? 97  GLY A CA  1 
ATOM   765   C C   . GLY A 1 100 ? 44.396 18.455  13.377  1.00 39.63  ? 97  GLY A C   1 
ATOM   766   O O   . GLY A 1 100 ? 45.136 19.436  13.489  1.00 35.24  ? 97  GLY A O   1 
ATOM   767   N N   . THR A 1 101 ? 44.288 17.769  12.236  1.00 34.49  ? 98  THR A N   1 
ATOM   768   C CA  . THR A 1 101 ? 45.034 18.176  11.051  1.00 34.72  ? 98  THR A CA  1 
ATOM   769   C C   . THR A 1 101 ? 44.582 19.547  10.566  1.00 31.01  ? 98  THR A C   1 
ATOM   770   O O   . THR A 1 101 ? 45.408 20.405  10.236  1.00 36.64  ? 98  THR A O   1 
ATOM   771   C CB  . THR A 1 101 ? 44.871 17.129  9.947   1.00 37.52  ? 98  THR A CB  1 
ATOM   772   O OG1 . THR A 1 101 ? 45.446 15.889  10.375  1.00 28.72  ? 98  THR A OG1 1 
ATOM   773   C CG2 . THR A 1 101 ? 45.559 17.584  8.667   1.00 28.62  ? 98  THR A CG2 1 
ATOM   774   N N   . ILE A 1 102 ? 43.268 19.777  10.539  1.00 37.25  ? 99  ILE A N   1 
ATOM   775   C CA  . ILE A 1 102 ? 42.738 21.024  9.995   1.00 34.13  ? 99  ILE A CA  1 
ATOM   776   C C   . ILE A 1 102 ? 43.138 22.208  10.870  1.00 36.50  ? 99  ILE A C   1 
ATOM   777   O O   . ILE A 1 102 ? 43.622 23.231  10.371  1.00 35.42  ? 99  ILE A O   1 
ATOM   778   C CB  . ILE A 1 102 ? 41.209 20.931  9.829   1.00 35.34  ? 99  ILE A CB  1 
ATOM   779   C CG1 . ILE A 1 102 ? 40.846 19.964  8.704   1.00 35.51  ? 99  ILE A CG1 1 
ATOM   780   C CG2 . ILE A 1 102 ? 40.612 22.312  9.584   1.00 31.34  ? 99  ILE A CG2 1 
ATOM   781   C CD1 . ILE A 1 102 ? 39.368 19.656  8.619   1.00 33.78  ? 99  ILE A CD1 1 
ATOM   782   N N   . ARG A 1 103 ? 42.940 22.092  12.188  1.00 34.09  ? 100 ARG A N   1 
ATOM   783   C CA  . ARG A 1 103 ? 43.272 23.203  13.077  1.00 40.20  ? 100 ARG A CA  1 
ATOM   784   C C   . ARG A 1 103 ? 44.770 23.477  13.096  1.00 40.37  ? 100 ARG A C   1 
ATOM   785   O O   . ARG A 1 103 ? 45.189 24.639  13.170  1.00 39.61  ? 100 ARG A O   1 
ATOM   786   C CB  . ARG A 1 103 ? 42.763 22.944  14.498  1.00 39.62  ? 100 ARG A CB  1 
ATOM   787   C CG  . ARG A 1 103 ? 41.397 22.287  14.591  1.00 49.59  ? 100 ARG A CG  1 
ATOM   788   C CD  . ARG A 1 103 ? 40.849 22.359  16.006  1.00 51.55  ? 100 ARG A CD  1 
ATOM   789   N NE  . ARG A 1 103 ? 40.035 21.195  16.340  1.00 56.98  ? 100 ARG A NE  1 
ATOM   790   C CZ  . ARG A 1 103 ? 40.521 20.100  16.914  1.00 60.30  ? 100 ARG A CZ  1 
ATOM   791   N NH1 . ARG A 1 103 ? 39.724 19.078  17.190  1.00 60.32  ? 100 ARG A NH1 1 
ATOM   792   N NH2 . ARG A 1 103 ? 41.811 20.033  17.219  1.00 49.97  ? 100 ARG A NH2 1 
ATOM   793   N N   . ASN A 1 104 ? 45.594 22.425  13.030  1.00 33.71  ? 101 ASN A N   1 
ATOM   794   C CA  . ASN A 1 104 ? 47.036 22.630  12.942  1.00 43.57  ? 101 ASN A CA  1 
ATOM   795   C C   . ASN A 1 104 ? 47.392 23.479  11.730  1.00 43.66  ? 101 ASN A C   1 
ATOM   796   O O   . ASN A 1 104 ? 48.249 24.367  11.809  1.00 44.63  ? 101 ASN A O   1 
ATOM   797   C CB  . ASN A 1 104 ? 47.753 21.283  12.885  1.00 44.80  ? 101 ASN A CB  1 
ATOM   798   C CG  . ASN A 1 104 ? 49.232 21.423  12.568  1.00 58.16  ? 101 ASN A CG  1 
ATOM   799   O OD1 . ASN A 1 104 ? 50.044 21.693  13.453  1.00 61.41  ? 101 ASN A OD1 1 
ATOM   800   N ND2 . ASN A 1 104 ? 49.591 21.231  11.302  1.00 56.45  ? 101 ASN A ND2 1 
ATOM   801   N N   . ILE A 1 105 ? 46.730 23.230  10.600  1.00 38.95  ? 102 ILE A N   1 
ATOM   802   C CA  . ILE A 1 105 ? 47.022 23.985  9.388   1.00 39.27  ? 102 ILE A CA  1 
ATOM   803   C C   . ILE A 1 105 ? 46.439 25.392  9.473   1.00 33.33  ? 102 ILE A C   1 
ATOM   804   O O   . ILE A 1 105 ? 47.071 26.367  9.049   1.00 31.01  ? 102 ILE A O   1 
ATOM   805   C CB  . ILE A 1 105 ? 46.502 23.222  8.155   1.00 37.43  ? 102 ILE A CB  1 
ATOM   806   C CG1 . ILE A 1 105 ? 47.262 21.907  7.994   1.00 36.66  ? 102 ILE A CG1 1 
ATOM   807   C CG2 . ILE A 1 105 ? 46.611 24.083  6.901   1.00 31.42  ? 102 ILE A CG2 1 
ATOM   808   C CD1 . ILE A 1 105 ? 46.810 21.074  6.815   1.00 32.28  ? 102 ILE A CD1 1 
ATOM   809   N N   . LEU A 1 106 ? 45.234 25.525  10.030  1.00 33.63  ? 103 LEU A N   1 
ATOM   810   C CA  . LEU A 1 106 ? 44.555 26.817  10.017  1.00 31.72  ? 103 LEU A CA  1 
ATOM   811   C C   . LEU A 1 106 ? 44.931 27.693  11.204  1.00 37.55  ? 103 LEU A C   1 
ATOM   812   O O   . LEU A 1 106 ? 44.905 28.924  11.091  1.00 36.37  ? 103 LEU A O   1 
ATOM   813   C CB  . LEU A 1 106 ? 43.039 26.618  9.995   1.00 28.29  ? 103 LEU A CB  1 
ATOM   814   C CG  . LEU A 1 106 ? 42.399 25.952  8.774   1.00 39.26  ? 103 LEU A CG  1 
ATOM   815   C CD1 . LEU A 1 106 ? 40.884 25.969  8.911   1.00 31.22  ? 103 LEU A CD1 1 
ATOM   816   C CD2 . LEU A 1 106 ? 42.832 26.637  7.483   1.00 31.24  ? 103 LEU A CD2 1 
ATOM   817   N N   . GLY A 1 107 ? 45.268 27.093  12.340  1.00 34.42  ? 104 GLY A N   1 
ATOM   818   C CA  . GLY A 1 107 ? 45.356 27.840  13.582  1.00 27.00  ? 104 GLY A CA  1 
ATOM   819   C C   . GLY A 1 107 ? 43.982 28.340  14.006  1.00 32.70  ? 104 GLY A C   1 
ATOM   820   O O   . GLY A 1 107 ? 42.962 28.101  13.358  1.00 34.64  ? 104 GLY A O   1 
ATOM   821   N N   . GLY A 1 108 ? 43.965 29.038  15.132  1.00 28.76  ? 105 GLY A N   1 
ATOM   822   C CA  . GLY A 1 108 ? 42.758 29.674  15.620  1.00 31.94  ? 105 GLY A CA  1 
ATOM   823   C C   . GLY A 1 108 ? 42.191 28.989  16.852  1.00 30.62  ? 105 GLY A C   1 
ATOM   824   O O   . GLY A 1 108 ? 42.768 28.058  17.417  1.00 30.78  ? 105 GLY A O   1 
ATOM   825   N N   . THR A 1 109 ? 41.017 29.479  17.246  1.00 31.19  ? 106 THR A N   1 
ATOM   826   C CA  . THR A 1 109 ? 40.363 29.103  18.490  1.00 27.97  ? 106 THR A CA  1 
ATOM   827   C C   . THR A 1 109 ? 38.964 28.568  18.209  1.00 29.15  ? 106 THR A C   1 
ATOM   828   O O   . THR A 1 109 ? 38.218 29.137  17.405  1.00 32.63  ? 106 THR A O   1 
ATOM   829   C CB  . THR A 1 109 ? 40.278 30.303  19.443  1.00 30.95  ? 106 THR A CB  1 
ATOM   830   O OG1 . THR A 1 109 ? 41.589 30.844  19.644  1.00 33.60  ? 106 THR A OG1 1 
ATOM   831   C CG2 . THR A 1 109 ? 39.690 29.890  20.788  1.00 25.60  ? 106 THR A CG2 1 
ATOM   832   N N   . VAL A 1 110 ? 38.614 27.477  18.883  1.00 25.56  ? 107 VAL A N   1 
ATOM   833   C CA  . VAL A 1 110 ? 37.307 26.844  18.743  1.00 32.43  ? 107 VAL A CA  1 
ATOM   834   C C   . VAL A 1 110 ? 36.344 27.467  19.747  1.00 34.00  ? 107 VAL A C   1 
ATOM   835   O O   . VAL A 1 110 ? 36.628 27.510  20.949  1.00 32.94  ? 107 VAL A O   1 
ATOM   836   C CB  . VAL A 1 110 ? 37.405 25.326  18.951  1.00 36.31  ? 107 VAL A CB  1 
ATOM   837   C CG1 . VAL A 1 110 ? 36.038 24.677  18.791  1.00 37.66  ? 107 VAL A CG1 1 
ATOM   838   C CG2 . VAL A 1 110 ? 38.410 24.719  17.976  1.00 34.99  ? 107 VAL A CG2 1 
ATOM   839   N N   . PHE A 1 111 ? 35.204 27.942  19.255  1.00 31.03  ? 108 PHE A N   1 
ATOM   840   C CA  . PHE A 1 111 ? 34.145 28.487  20.093  1.00 33.94  ? 108 PHE A CA  1 
ATOM   841   C C   . PHE A 1 111 ? 32.895 27.633  19.952  1.00 34.81  ? 108 PHE A C   1 
ATOM   842   O O   . PHE A 1 111 ? 32.467 27.327  18.833  1.00 38.24  ? 108 PHE A O   1 
ATOM   843   C CB  . PHE A 1 111 ? 33.831 29.936  19.718  1.00 25.76  ? 108 PHE A CB  1 
ATOM   844   C CG  . PHE A 1 111 ? 34.919 30.903  20.077  1.00 34.06  ? 108 PHE A CG  1 
ATOM   845   C CD1 . PHE A 1 111 ? 34.978 31.451  21.347  1.00 31.37  ? 108 PHE A CD1 1 
ATOM   846   C CD2 . PHE A 1 111 ? 35.878 31.269  19.147  1.00 30.08  ? 108 PHE A CD2 1 
ATOM   847   C CE1 . PHE A 1 111 ? 35.977 32.342  21.688  1.00 34.33  ? 108 PHE A CE1 1 
ATOM   848   C CE2 . PHE A 1 111 ? 36.879 32.163  19.481  1.00 36.34  ? 108 PHE A CE2 1 
ATOM   849   C CZ  . PHE A 1 111 ? 36.929 32.699  20.753  1.00 30.93  ? 108 PHE A CZ  1 
ATOM   850   N N   . ARG A 1 112 ? 32.315 27.253  21.084  1.00 27.19  ? 109 ARG A N   1 
ATOM   851   C CA  . ARG A 1 112 ? 31.103 26.455  21.126  1.00 29.16  ? 109 ARG A CA  1 
ATOM   852   C C   . ARG A 1 112 ? 29.946 27.297  21.646  1.00 35.99  ? 109 ARG A C   1 
ATOM   853   O O   . ARG A 1 112 ? 30.133 28.204  22.462  1.00 31.83  ? 109 ARG A O   1 
ATOM   854   C CB  . ARG A 1 112 ? 31.296 25.216  22.005  1.00 35.62  ? 109 ARG A CB  1 
ATOM   855   C CG  . ARG A 1 112 ? 32.342 24.266  21.453  1.00 39.42  ? 109 ARG A CG  1 
ATOM   856   C CD  . ARG A 1 112 ? 32.346 22.930  22.163  1.00 44.03  ? 109 ARG A CD  1 
ATOM   857   N NE  . ARG A 1 112 ? 33.128 21.951  21.413  1.00 52.26  ? 109 ARG A NE  1 
ATOM   858   C CZ  . ARG A 1 112 ? 34.413 21.697  21.630  1.00 56.26  ? 109 ARG A CZ  1 
ATOM   859   N NH1 . ARG A 1 112 ? 35.045 20.793  20.894  1.00 59.73  ? 109 ARG A NH1 1 
ATOM   860   N NH2 . ARG A 1 112 ? 35.068 22.347  22.583  1.00 55.03  ? 109 ARG A NH2 1 
ATOM   861   N N   . GLU A 1 113 ? 28.747 26.991  21.156  1.00 29.85  ? 110 GLU A N   1 
ATOM   862   C CA  . GLU A 1 113 ? 27.558 27.751  21.508  1.00 33.26  ? 110 GLU A CA  1 
ATOM   863   C C   . GLU A 1 113 ? 26.347 26.833  21.465  1.00 33.24  ? 110 GLU A C   1 
ATOM   864   O O   . GLU A 1 113 ? 26.138 26.123  20.478  1.00 30.83  ? 110 GLU A O   1 
ATOM   865   C CB  . GLU A 1 113 ? 27.356 28.935  20.555  1.00 26.37  ? 110 GLU A CB  1 
ATOM   866   C CG  . GLU A 1 113 ? 26.120 29.766  20.866  1.00 30.11  ? 110 GLU A CG  1 
ATOM   867   C CD  . GLU A 1 113 ? 25.882 30.864  19.848  1.00 34.12  ? 110 GLU A CD  1 
ATOM   868   O OE1 . GLU A 1 113 ? 24.844 31.549  19.951  1.00 41.72  ? 110 GLU A OE1 1 
ATOM   869   O OE2 . GLU A 1 113 ? 26.728 31.039  18.945  1.00 36.14  ? 110 GLU A OE2 1 
ATOM   870   N N   . ALA A 1 114 ? 25.555 26.857  22.531  1.00 32.90  ? 111 ALA A N   1 
ATOM   871   C CA  . ALA A 1 114 ? 24.327 26.085  22.571  1.00 31.39  ? 111 ALA A CA  1 
ATOM   872   C C   . ALA A 1 114 ? 23.195 26.846  21.892  1.00 37.10  ? 111 ALA A C   1 
ATOM   873   O O   . ALA A 1 114 ? 23.137 28.080  21.914  1.00 33.25  ? 111 ALA A O   1 
ATOM   874   C CB  . ALA A 1 114 ? 23.940 25.754  24.011  1.00 28.71  ? 111 ALA A CB  1 
ATOM   875   N N   . ILE A 1 115 ? 22.296 26.092  21.272  1.00 32.93  ? 112 ILE A N   1 
ATOM   876   C CA  . ILE A 1 115 ? 21.105 26.649  20.642  1.00 37.16  ? 112 ILE A CA  1 
ATOM   877   C C   . ILE A 1 115 ? 19.966 26.564  21.650  1.00 36.30  ? 112 ILE A C   1 
ATOM   878   O O   . ILE A 1 115 ? 19.656 25.482  22.159  1.00 33.51  ? 112 ILE A O   1 
ATOM   879   C CB  . ILE A 1 115 ? 20.763 25.900  19.346  1.00 34.90  ? 112 ILE A CB  1 
ATOM   880   C CG1 . ILE A 1 115 ? 21.889 26.076  18.325  1.00 37.67  ? 112 ILE A CG1 1 
ATOM   881   C CG2 . ILE A 1 115 ? 19.441 26.390  18.778  1.00 34.22  ? 112 ILE A CG2 1 
ATOM   882   C CD1 . ILE A 1 115 ? 22.164 24.839  17.500  1.00 39.14  ? 112 ILE A CD1 1 
ATOM   883   N N   . ILE A 1 116 ? 19.348 27.702  21.946  1.00 36.19  ? 113 ILE A N   1 
ATOM   884   C CA  . ILE A 1 116 ? 18.355 27.798  23.010  1.00 40.78  ? 113 ILE A CA  1 
ATOM   885   C C   . ILE A 1 116 ? 16.962 27.910  22.408  1.00 39.86  ? 113 ILE A C   1 
ATOM   886   O O   . ILE A 1 116 ? 16.714 28.748  21.531  1.00 39.25  ? 113 ILE A O   1 
ATOM   887   C CB  . ILE A 1 116 ? 18.646 28.988  23.939  1.00 38.23  ? 113 ILE A CB  1 
ATOM   888   C CG1 . ILE A 1 116 ? 19.912 28.730  24.749  1.00 45.47  ? 113 ILE A CG1 1 
ATOM   889   C CG2 . ILE A 1 116 ? 17.467 29.252  24.860  1.00 44.31  ? 113 ILE A CG2 1 
ATOM   890   C CD1 . ILE A 1 116 ? 20.148 29.752  25.828  1.00 49.45  ? 113 ILE A CD1 1 
ATOM   891   N N   . CYS A 1 117 ? 16.057 27.057  22.882  1.00 35.99  ? 114 CYS A N   1 
ATOM   892   C CA  . CYS A 1 117 ? 14.636 27.135  22.587  1.00 36.70  ? 114 CYS A CA  1 
ATOM   893   C C   . CYS A 1 117 ? 13.892 27.333  23.899  1.00 40.91  ? 114 CYS A C   1 
ATOM   894   O O   . CYS A 1 117 ? 14.225 26.703  24.908  1.00 43.81  ? 114 CYS A O   1 
ATOM   895   C CB  . CYS A 1 117 ? 14.142 25.869  21.883  1.00 35.57  ? 114 CYS A CB  1 
ATOM   896   S SG  . CYS A 1 117 ? 15.146 25.376  20.469  1.00 39.71  ? 114 CYS A SG  1 
ATOM   897   N N   . LYS A 1 118 ? 12.886 28.212  23.884  1.00 40.44  ? 115 LYS A N   1 
ATOM   898   C CA  . LYS A 1 118 ? 12.216 28.585  25.127  1.00 44.07  ? 115 LYS A CA  1 
ATOM   899   C C   . LYS A 1 118 ? 11.475 27.409  25.754  1.00 45.46  ? 115 LYS A C   1 
ATOM   900   O O   . LYS A 1 118 ? 11.250 27.396  26.970  1.00 43.82  ? 115 LYS A O   1 
ATOM   901   C CB  . LYS A 1 118 ? 11.259 29.750  24.880  1.00 47.65  ? 115 LYS A CB  1 
ATOM   902   C CG  . LYS A 1 118 ? 10.019 29.389  24.085  1.00 51.52  ? 115 LYS A CG  1 
ATOM   903   C CD  . LYS A 1 118 ? 9.187  30.621  23.769  1.00 60.12  ? 115 LYS A CD  1 
ATOM   904   C CE  . LYS A 1 118 ? 9.885  31.523  22.763  1.00 60.03  ? 115 LYS A CE  1 
ATOM   905   N NZ  . LYS A 1 118 ? 8.969  32.579  22.242  1.00 64.21  ? 115 LYS A NZ  1 
ATOM   906   N N   . ASN A 1 119 ? 11.099 26.412  24.958  1.00 39.54  ? 116 ASN A N   1 
ATOM   907   C CA  . ASN A 1 119 ? 10.409 25.242  25.483  1.00 39.88  ? 116 ASN A CA  1 
ATOM   908   C C   . ASN A 1 119 ? 11.355 24.146  25.956  1.00 40.82  ? 116 ASN A C   1 
ATOM   909   O O   . ASN A 1 119 ? 10.885 23.088  26.380  1.00 38.11  ? 116 ASN A O   1 
ATOM   910   C CB  . ASN A 1 119 ? 9.450  24.672  24.431  1.00 45.23  ? 116 ASN A CB  1 
ATOM   911   C CG  . ASN A 1 119 ? 10.167 24.214  23.174  1.00 44.39  ? 116 ASN A CG  1 
ATOM   912   O OD1 . ASN A 1 119 ? 11.156 24.813  22.755  1.00 48.71  ? 116 ASN A OD1 1 
ATOM   913   N ND2 . ASN A 1 119 ? 9.666  23.147  22.565  1.00 48.94  ? 116 ASN A ND2 1 
ATOM   914   N N   . ILE A 1 120 ? 12.661 24.365  25.908  1.00 44.81  ? 117 ILE A N   1 
ATOM   915   C CA  . ILE A 1 120 ? 13.644 23.341  26.251  1.00 38.24  ? 117 ILE A CA  1 
ATOM   916   C C   . ILE A 1 120 ? 14.347 23.751  27.541  1.00 43.16  ? 117 ILE A C   1 
ATOM   917   O O   . ILE A 1 120 ? 14.954 24.830  27.596  1.00 44.85  ? 117 ILE A O   1 
ATOM   918   C CB  . ILE A 1 120 ? 14.654 23.114  25.117  1.00 43.82  ? 117 ILE A CB  1 
ATOM   919   C CG1 . ILE A 1 120 ? 13.919 22.754  23.833  1.00 40.58  ? 117 ILE A CG1 1 
ATOM   920   C CG2 . ILE A 1 120 ? 15.648 22.028  25.502  1.00 39.07  ? 117 ILE A CG2 1 
ATOM   921   C CD1 . ILE A 1 120 ? 13.082 21.496  23.961  1.00 42.55  ? 117 ILE A CD1 1 
ATOM   922   N N   . PRO A 1 121 ? 14.295 22.932  28.591  1.00 39.25  ? 118 PRO A N   1 
ATOM   923   C CA  . PRO A 1 121 ? 14.965 23.287  29.846  1.00 38.78  ? 118 PRO A CA  1 
ATOM   924   C C   . PRO A 1 121 ? 16.461 23.479  29.647  1.00 43.70  ? 118 PRO A C   1 
ATOM   925   O O   . PRO A 1 121 ? 17.087 22.827  28.808  1.00 37.93  ? 118 PRO A O   1 
ATOM   926   C CB  . PRO A 1 121 ? 14.673 22.087  30.752  1.00 47.71  ? 118 PRO A CB  1 
ATOM   927   C CG  . PRO A 1 121 ? 13.408 21.511  30.216  1.00 45.30  ? 118 PRO A CG  1 
ATOM   928   C CD  . PRO A 1 121 ? 13.480 21.712  28.725  1.00 44.31  ? 118 PRO A CD  1 
ATOM   929   N N   . ARG A 1 122 ? 17.027 24.398  30.418  1.00 41.44  ? 119 ARG A N   1 
ATOM   930   C CA  . ARG A 1 122 ? 18.463 24.614  30.466  1.00 41.45  ? 119 ARG A CA  1 
ATOM   931   C C   . ARG A 1 122 ? 19.030 24.018  31.750  1.00 38.86  ? 119 ARG A C   1 
ATOM   932   O O   . ARG A 1 122 ? 18.330 23.875  32.756  1.00 42.53  ? 119 ARG A O   1 
ATOM   933   C CB  . ARG A 1 122 ? 18.796 26.107  30.383  1.00 38.34  ? 119 ARG A CB  1 
ATOM   934   C CG  . ARG A 1 122 ? 18.824 26.668  28.966  1.00 41.48  ? 119 ARG A CG  1 
ATOM   935   C CD  . ARG A 1 122 ? 17.435 27.049  28.488  1.00 36.74  ? 119 ARG A CD  1 
ATOM   936   N NE  . ARG A 1 122 ? 16.786 27.952  29.431  1.00 42.88  ? 119 ARG A NE  1 
ATOM   937   C CZ  . ARG A 1 122 ? 15.524 27.837  29.829  1.00 43.69  ? 119 ARG A CZ  1 
ATOM   938   N NH1 . ARG A 1 122 ? 15.021 28.706  30.696  1.00 37.65  ? 119 ARG A NH1 1 
ATOM   939   N NH2 . ARG A 1 122 ? 14.768 26.852  29.364  1.00 33.89  ? 119 ARG A NH2 1 
ATOM   940   N N   . LEU A 1 123 ? 20.315 23.649  31.695  1.00 43.38  ? 120 LEU A N   1 
ATOM   941   C CA  . LEU A 1 123 ? 20.983 23.126  32.884  1.00 40.27  ? 120 LEU A CA  1 
ATOM   942   C C   . LEU A 1 123 ? 20.921 24.135  34.025  1.00 41.50  ? 120 LEU A C   1 
ATOM   943   O O   . LEU A 1 123 ? 20.625 23.775  35.171  1.00 42.69  ? 120 LEU A O   1 
ATOM   944   C CB  . LEU A 1 123 ? 22.432 22.765  32.556  1.00 38.82  ? 120 LEU A CB  1 
ATOM   945   C CG  . LEU A 1 123 ? 23.300 22.221  33.695  1.00 34.05  ? 120 LEU A CG  1 
ATOM   946   C CD1 . LEU A 1 123 ? 22.743 20.910  34.236  1.00 38.19  ? 120 LEU A CD1 1 
ATOM   947   C CD2 . LEU A 1 123 ? 24.743 22.051  33.242  1.00 36.47  ? 120 LEU A CD2 1 
ATOM   948   N N   . VAL A 1 124 ? 21.197 25.400  33.727  1.00 44.59  ? 121 VAL A N   1 
ATOM   949   C CA  . VAL A 1 124 ? 20.926 26.517  34.625  1.00 41.78  ? 121 VAL A CA  1 
ATOM   950   C C   . VAL A 1 124 ? 19.819 27.333  33.975  1.00 41.89  ? 121 VAL A C   1 
ATOM   951   O O   . VAL A 1 124 ? 20.011 27.891  32.887  1.00 38.77  ? 121 VAL A O   1 
ATOM   952   C CB  . VAL A 1 124 ? 22.182 27.366  34.876  1.00 43.97  ? 121 VAL A CB  1 
ATOM   953   C CG1 . VAL A 1 124 ? 21.851 28.586  35.723  1.00 34.24  ? 121 VAL A CG1 1 
ATOM   954   C CG2 . VAL A 1 124 ? 23.266 26.522  35.534  1.00 42.38  ? 121 VAL A CG2 1 
ATOM   955   N N   . SER A 1 125 ? 18.653 27.386  34.628  1.00 40.55  ? 122 SER A N   1 
ATOM   956   C CA  . SER A 1 125 ? 17.464 27.907  33.959  1.00 40.90  ? 122 SER A CA  1 
ATOM   957   C C   . SER A 1 125 ? 17.564 29.404  33.691  1.00 31.88  ? 122 SER A C   1 
ATOM   958   O O   . SER A 1 125 ? 16.903 29.912  32.775  1.00 38.45  ? 122 SER A O   1 
ATOM   959   C CB  . SER A 1 125 ? 16.215 27.595  34.780  1.00 44.59  ? 122 SER A CB  1 
ATOM   960   O OG  . SER A 1 125 ? 16.343 28.059  36.110  1.00 51.73  ? 122 SER A OG  1 
ATOM   961   N N   . GLY A 1 126 ? 18.376 30.127  34.465  1.00 39.88  ? 123 GLY A N   1 
ATOM   962   C CA  . GLY A 1 126 ? 18.562 31.549  34.214  1.00 32.97  ? 123 GLY A CA  1 
ATOM   963   C C   . GLY A 1 126 ? 19.219 31.853  32.883  1.00 35.85  ? 123 GLY A C   1 
ATOM   964   O O   . GLY A 1 126 ? 19.051 32.957  32.355  1.00 39.13  ? 123 GLY A O   1 
ATOM   965   N N   . TRP A 1 127 ? 19.960 30.899  32.326  1.00 32.78  ? 124 TRP A N   1 
ATOM   966   C CA  . TRP A 1 127 ? 20.567 31.067  31.007  1.00 38.99  ? 124 TRP A CA  1 
ATOM   967   C C   . TRP A 1 127 ? 19.465 31.070  29.957  1.00 41.72  ? 124 TRP A C   1 
ATOM   968   O O   . TRP A 1 127 ? 19.037 30.014  29.483  1.00 38.40  ? 124 TRP A O   1 
ATOM   969   C CB  . TRP A 1 127 ? 21.576 29.959  30.730  1.00 35.11  ? 124 TRP A CB  1 
ATOM   970   C CG  . TRP A 1 127 ? 22.741 29.937  31.666  1.00 38.18  ? 124 TRP A CG  1 
ATOM   971   C CD1 . TRP A 1 127 ? 23.196 30.965  32.439  1.00 33.45  ? 124 TRP A CD1 1 
ATOM   972   C CD2 . TRP A 1 127 ? 23.609 28.828  31.920  1.00 39.94  ? 124 TRP A CD2 1 
ATOM   973   N NE1 . TRP A 1 127 ? 24.292 30.562  33.162  1.00 34.47  ? 124 TRP A NE1 1 
ATOM   974   C CE2 . TRP A 1 127 ? 24.566 29.254  32.861  1.00 39.87  ? 124 TRP A CE2 1 
ATOM   975   C CE3 . TRP A 1 127 ? 23.668 27.514  31.444  1.00 37.89  ? 124 TRP A CE3 1 
ATOM   976   C CZ2 . TRP A 1 127 ? 25.571 28.413  33.336  1.00 41.24  ? 124 TRP A CZ2 1 
ATOM   977   C CZ3 . TRP A 1 127 ? 24.665 26.681  31.916  1.00 40.30  ? 124 TRP A CZ3 1 
ATOM   978   C CH2 . TRP A 1 127 ? 25.603 27.133  32.852  1.00 41.42  ? 124 TRP A CH2 1 
ATOM   979   N N   . VAL A 1 128 ? 18.997 32.262  29.592  1.00 37.03  ? 125 VAL A N   1 
ATOM   980   C CA  . VAL A 1 128 ? 17.969 32.412  28.567  1.00 40.89  ? 125 VAL A CA  1 
ATOM   981   C C   . VAL A 1 128 ? 18.540 32.858  27.232  1.00 42.99  ? 125 VAL A C   1 
ATOM   982   O O   . VAL A 1 128 ? 17.817 32.819  26.222  1.00 45.46  ? 125 VAL A O   1 
ATOM   983   C CB  . VAL A 1 128 ? 16.862 33.387  29.017  1.00 41.32  ? 125 VAL A CB  1 
ATOM   984   C CG1 . VAL A 1 128 ? 16.065 32.784  30.167  1.00 34.38  ? 125 VAL A CG1 1 
ATOM   985   C CG2 . VAL A 1 128 ? 17.461 34.726  29.415  1.00 37.81  ? 125 VAL A CG2 1 
ATOM   986   N N   . LYS A 1 129 ? 19.797 33.289  27.194  1.00 42.36  ? 126 LYS A N   1 
ATOM   987   C CA  . LYS A 1 129 ? 20.548 33.589  25.989  1.00 39.68  ? 126 LYS A CA  1 
ATOM   988   C C   . LYS A 1 129 ? 21.742 32.650  25.905  1.00 40.97  ? 126 LYS A C   1 
ATOM   989   O O   . LYS A 1 129 ? 22.262 32.214  26.939  1.00 37.37  ? 126 LYS A O   1 
ATOM   990   C CB  . LYS A 1 129 ? 21.037 35.043  25.983  1.00 36.84  ? 126 LYS A CB  1 
ATOM   991   C CG  . LYS A 1 129 ? 19.916 36.066  25.967  1.00 45.07  ? 126 LYS A CG  1 
ATOM   992   C CD  . LYS A 1 129 ? 20.395 37.433  26.436  1.00 49.69  ? 126 LYS A CD  1 
ATOM   993   C CE  . LYS A 1 129 ? 19.219 38.336  26.788  1.00 51.13  ? 126 LYS A CE  1 
ATOM   994   N NZ  . LYS A 1 129 ? 19.666 39.583  27.471  1.00 65.04  ? 126 LYS A NZ  1 
ATOM   995   N N   . PRO A 1 130 ? 22.181 32.294  24.698  1.00 41.83  ? 127 PRO A N   1 
ATOM   996   C CA  . PRO A 1 130 ? 23.315 31.371  24.583  1.00 39.98  ? 127 PRO A CA  1 
ATOM   997   C C   . PRO A 1 130 ? 24.582 31.977  25.165  1.00 40.15  ? 127 PRO A C   1 
ATOM   998   O O   . PRO A 1 130 ? 24.768 33.195  25.180  1.00 33.34  ? 127 PRO A O   1 
ATOM   999   C CB  . PRO A 1 130 ? 23.449 31.149  23.069  1.00 36.65  ? 127 PRO A CB  1 
ATOM   1000  C CG  . PRO A 1 130 ? 22.105 31.509  22.509  1.00 39.54  ? 127 PRO A CG  1 
ATOM   1001  C CD  . PRO A 1 130 ? 21.617 32.634  23.381  1.00 32.93  ? 127 PRO A CD  1 
ATOM   1002  N N   . ILE A 1 131 ? 25.445 31.104  25.675  1.00 34.37  ? 128 ILE A N   1 
ATOM   1003  C CA  . ILE A 1 131 ? 26.774 31.475  26.143  1.00 33.83  ? 128 ILE A CA  1 
ATOM   1004  C C   . ILE A 1 131 ? 27.782 30.834  25.202  1.00 35.50  ? 128 ILE A C   1 
ATOM   1005  O O   . ILE A 1 131 ? 27.676 29.641  24.890  1.00 31.50  ? 128 ILE A O   1 
ATOM   1006  C CB  . ILE A 1 131 ? 27.011 31.031  27.598  1.00 33.13  ? 128 ILE A CB  1 
ATOM   1007  C CG1 . ILE A 1 131 ? 26.118 31.827  28.551  1.00 38.90  ? 128 ILE A CG1 1 
ATOM   1008  C CG2 . ILE A 1 131 ? 28.470 31.219  27.984  1.00 33.41  ? 128 ILE A CG2 1 
ATOM   1009  C CD1 . ILE A 1 131 ? 26.070 31.268  29.959  1.00 34.89  ? 128 ILE A CD1 1 
ATOM   1010  N N   . ILE A 1 132 ? 28.745 31.625  24.735  1.00 30.77  ? 129 ILE A N   1 
ATOM   1011  C CA  . ILE A 1 132 ? 29.767 31.158  23.806  1.00 30.63  ? 129 ILE A CA  1 
ATOM   1012  C C   . ILE A 1 132 ? 31.073 30.996  24.568  1.00 30.97  ? 129 ILE A C   1 
ATOM   1013  O O   . ILE A 1 132 ? 31.517 31.921  25.262  1.00 29.48  ? 129 ILE A O   1 
ATOM   1014  C CB  . ILE A 1 132 ? 29.935 32.126  22.622  1.00 27.88  ? 129 ILE A CB  1 
ATOM   1015  C CG1 . ILE A 1 132 ? 28.656 32.188  21.793  1.00 29.80  ? 129 ILE A CG1 1 
ATOM   1016  C CG2 . ILE A 1 132 ? 31.099 31.702  21.743  1.00 24.23  ? 129 ILE A CG2 1 
ATOM   1017  C CD1 . ILE A 1 132 ? 28.675 33.263  20.726  1.00 37.16  ? 129 ILE A CD1 1 
ATOM   1018  N N   . ILE A 1 133 ? 31.693 29.827  24.434  1.00 31.02  ? 130 ILE A N   1 
ATOM   1019  C CA  . ILE A 1 133 ? 32.888 29.475  25.188  1.00 29.69  ? 130 ILE A CA  1 
ATOM   1020  C C   . ILE A 1 133 ? 33.982 29.047  24.220  1.00 29.58  ? 130 ILE A C   1 
ATOM   1021  O O   . ILE A 1 133 ? 33.760 28.188  23.358  1.00 32.06  ? 130 ILE A O   1 
ATOM   1022  C CB  . ILE A 1 133 ? 32.604 28.360  26.209  1.00 30.98  ? 130 ILE A CB  1 
ATOM   1023  C CG1 . ILE A 1 133 ? 31.739 28.891  27.345  1.00 32.28  ? 130 ILE A CG1 1 
ATOM   1024  C CG2 . ILE A 1 133 ? 33.904 27.772  26.747  1.00 37.98  ? 130 ILE A CG2 1 
ATOM   1025  C CD1 . ILE A 1 133 ? 31.673 27.960  28.524  1.00 39.90  ? 130 ILE A CD1 1 
ATOM   1026  N N   . GLY A 1 134 ? 35.157 29.653  24.364  1.00 32.50  ? 131 GLY A N   1 
ATOM   1027  C CA  . GLY A 1 134 ? 36.329 29.229  23.627  1.00 31.87  ? 131 GLY A CA  1 
ATOM   1028  C C   . GLY A 1 134 ? 37.466 28.873  24.559  1.00 35.80  ? 131 GLY A C   1 
ATOM   1029  O O   . GLY A 1 134 ? 37.738 29.595  25.524  1.00 37.51  ? 131 GLY A O   1 
ATOM   1030  N N   . HIS A 1 135 ? 38.127 27.752  24.294  1.00 36.94  ? 132 HIS A N   1 
ATOM   1031  C CA  . HIS A 1 135 ? 39.261 27.307  25.086  1.00 45.31  ? 132 HIS A CA  1 
ATOM   1032  C C   . HIS A 1 135 ? 40.549 27.517  24.307  1.00 45.77  ? 132 HIS A C   1 
ATOM   1033  O O   . HIS A 1 135 ? 40.582 27.393  23.079  1.00 42.68  ? 132 HIS A O   1 
ATOM   1034  C CB  . HIS A 1 135 ? 39.137 25.828  25.466  1.00 44.22  ? 132 HIS A CB  1 
ATOM   1035  C CG  . HIS A 1 135 ? 38.070 25.552  26.477  1.00 51.12  ? 132 HIS A CG  1 
ATOM   1036  N ND1 . HIS A 1 135 ? 36.791 25.179  26.126  1.00 49.97  ? 132 HIS A ND1 1 
ATOM   1037  C CD2 . HIS A 1 135 ? 38.092 25.597  27.830  1.00 51.57  ? 132 HIS A CD2 1 
ATOM   1038  C CE1 . HIS A 1 135 ? 36.070 25.005  27.219  1.00 54.82  ? 132 HIS A CE1 1 
ATOM   1039  N NE2 . HIS A 1 135 ? 36.836 25.252  28.267  1.00 54.02  ? 132 HIS A NE2 1 
ATOM   1040  N N   . HIS A 1 136 ? 41.610 27.845  25.037  1.00 38.65  ? 133 HIS A N   1 
ATOM   1041  C CA  . HIS A 1 136 ? 42.943 27.851  24.459  1.00 51.43  ? 133 HIS A CA  1 
ATOM   1042  C C   . HIS A 1 136 ? 43.441 26.416  24.345  1.00 53.02  ? 133 HIS A C   1 
ATOM   1043  O O   . HIS A 1 136 ? 43.339 25.639  25.299  1.00 56.78  ? 133 HIS A O   1 
ATOM   1044  C CB  . HIS A 1 136 ? 43.895 28.682  25.317  1.00 43.44  ? 133 HIS A CB  1 
ATOM   1045  C CG  . HIS A 1 136 ? 45.267 28.810  24.738  1.00 52.38  ? 133 HIS A CG  1 
ATOM   1046  N ND1 . HIS A 1 136 ? 45.515 29.490  23.565  1.00 50.58  ? 133 HIS A ND1 1 
ATOM   1047  C CD2 . HIS A 1 136 ? 46.463 28.337  25.161  1.00 49.80  ? 133 HIS A CD2 1 
ATOM   1048  C CE1 . HIS A 1 136 ? 46.807 29.437  23.295  1.00 48.50  ? 133 HIS A CE1 1 
ATOM   1049  N NE2 . HIS A 1 136 ? 47.405 28.743  24.247  1.00 53.62  ? 133 HIS A NE2 1 
ATOM   1050  N N   . ALA A 1 137 ? 43.962 26.060  23.177  1.00 58.56  ? 134 ALA A N   1 
ATOM   1051  C CA  . ALA A 1 137 ? 44.461 24.708  22.955  1.00 64.94  ? 134 ALA A CA  1 
ATOM   1052  C C   . ALA A 1 137 ? 45.689 24.719  22.051  1.00 63.20  ? 134 ALA A C   1 
ATOM   1053  O O   . ALA A 1 137 ? 46.313 23.683  21.824  1.00 70.87  ? 134 ALA A O   1 
ATOM   1054  C CB  . ALA A 1 137 ? 43.368 23.828  22.358  1.00 58.07  ? 134 ALA A CB  1 
ATOM   1055  N N   . ALA A 1 144 ? 53.580 19.718  25.826  1.00 43.03  ? 141 ALA A N   1 
ATOM   1056  C CA  . ALA A 1 144 ? 53.906 19.298  27.184  1.00 45.98  ? 141 ALA A CA  1 
ATOM   1057  C C   . ALA A 1 144 ? 54.849 18.097  27.173  1.00 46.51  ? 141 ALA A C   1 
ATOM   1058  O O   . ALA A 1 144 ? 54.750 17.226  26.308  1.00 48.64  ? 141 ALA A O   1 
ATOM   1059  C CB  . ALA A 1 144 ? 52.636 18.971  27.962  1.00 37.46  ? 141 ALA A CB  1 
ATOM   1060  N N   . THR A 1 145 ? 55.764 18.059  28.141  1.00 41.43  ? 142 THR A N   1 
ATOM   1061  C CA  . THR A 1 145 ? 56.753 16.992  28.263  1.00 43.56  ? 142 THR A CA  1 
ATOM   1062  C C   . THR A 1 145 ? 56.709 16.458  29.688  1.00 38.18  ? 142 THR A C   1 
ATOM   1063  O O   . THR A 1 145 ? 57.170 17.128  30.618  1.00 37.53  ? 142 THR A O   1 
ATOM   1064  C CB  . THR A 1 145 ? 58.156 17.496  27.919  1.00 44.13  ? 142 THR A CB  1 
ATOM   1065  O OG1 . THR A 1 145 ? 58.117 18.218  26.682  1.00 49.21  ? 142 THR A OG1 1 
ATOM   1066  C CG2 . THR A 1 145 ? 59.130 16.332  27.790  1.00 43.27  ? 142 THR A CG2 1 
ATOM   1067  N N   . ASP A 1 146 ? 56.160 15.258  29.860  1.00 34.54  ? 143 ASP A N   1 
ATOM   1068  C CA  . ASP A 1 146 ? 56.046 14.621  31.163  1.00 33.83  ? 143 ASP A CA  1 
ATOM   1069  C C   . ASP A 1 146 ? 56.897 13.359  31.204  1.00 34.74  ? 143 ASP A C   1 
ATOM   1070  O O   . ASP A 1 146 ? 57.236 12.779  30.169  1.00 36.05  ? 143 ASP A O   1 
ATOM   1071  C CB  . ASP A 1 146 ? 54.583 14.291  31.492  1.00 33.01  ? 143 ASP A CB  1 
ATOM   1072  C CG  . ASP A 1 146 ? 53.960 13.317  30.505  1.00 42.46  ? 143 ASP A CG  1 
ATOM   1073  O OD1 . ASP A 1 146 ? 54.290 13.387  29.303  1.00 41.18  ? 143 ASP A OD1 1 
ATOM   1074  O OD2 . ASP A 1 146 ? 53.128 12.487  30.933  1.00 40.64  ? 143 ASP A OD2 1 
ATOM   1075  N N   . PHE A 1 147 ? 57.249 12.940  32.418  1.00 27.67  ? 144 PHE A N   1 
ATOM   1076  C CA  . PHE A 1 147 ? 58.122 11.786  32.586  1.00 34.07  ? 144 PHE A CA  1 
ATOM   1077  C C   . PHE A 1 147 ? 57.967 11.234  33.997  1.00 32.97  ? 144 PHE A C   1 
ATOM   1078  O O   . PHE A 1 147 ? 57.330 11.838  34.863  1.00 32.50  ? 144 PHE A O   1 
ATOM   1079  C CB  . PHE A 1 147 ? 59.586 12.146  32.297  1.00 31.03  ? 144 PHE A CB  1 
ATOM   1080  C CG  . PHE A 1 147 ? 60.138 13.223  33.193  1.00 34.98  ? 144 PHE A CG  1 
ATOM   1081  C CD1 . PHE A 1 147 ? 60.020 14.562  32.848  1.00 36.79  ? 144 PHE A CD1 1 
ATOM   1082  C CD2 . PHE A 1 147 ? 60.784 12.896  34.375  1.00 33.32  ? 144 PHE A CD2 1 
ATOM   1083  C CE1 . PHE A 1 147 ? 60.531 15.554  33.667  1.00 35.18  ? 144 PHE A CE1 1 
ATOM   1084  C CE2 . PHE A 1 147 ? 61.297 13.882  35.200  1.00 36.85  ? 144 PHE A CE2 1 
ATOM   1085  C CZ  . PHE A 1 147 ? 61.170 15.214  34.845  1.00 40.80  ? 144 PHE A CZ  1 
ATOM   1086  N N   . VAL A 1 148 ? 58.575 10.072  34.211  1.00 29.67  ? 145 VAL A N   1 
ATOM   1087  C CA  . VAL A 1 148 ? 58.559 9.390   35.498  1.00 30.03  ? 145 VAL A CA  1 
ATOM   1088  C C   . VAL A 1 148 ? 59.830 9.737   36.255  1.00 33.42  ? 145 VAL A C   1 
ATOM   1089  O O   . VAL A 1 148 ? 60.935 9.663   35.700  1.00 37.85  ? 145 VAL A O   1 
ATOM   1090  C CB  . VAL A 1 148 ? 58.436 7.868   35.308  1.00 36.49  ? 145 VAL A CB  1 
ATOM   1091  C CG1 . VAL A 1 148 ? 58.576 7.145   36.644  1.00 29.13  ? 145 VAL A CG1 1 
ATOM   1092  C CG2 . VAL A 1 148 ? 57.119 7.519   34.638  1.00 33.35  ? 145 VAL A CG2 1 
ATOM   1093  N N   . VAL A 1 149 ? 59.688 10.112  37.523  1.00 31.99  ? 146 VAL A N   1 
ATOM   1094  C CA  . VAL A 1 149 ? 60.813 10.333  38.414  1.00 33.84  ? 146 VAL A CA  1 
ATOM   1095  C C   . VAL A 1 149 ? 61.122 9.003   39.111  1.00 40.56  ? 146 VAL A C   1 
ATOM   1096  O O   . VAL A 1 149 ? 60.303 8.564   39.939  1.00 35.75  ? 146 VAL A O   1 
ATOM   1097  C CB  . VAL A 1 149 ? 60.530 11.446  39.425  1.00 37.10  ? 146 VAL A CB  1 
ATOM   1098  C CG1 . VAL A 1 149 ? 61.701 11.614  40.371  1.00 31.02  ? 146 VAL A CG1 1 
ATOM   1099  C CG2 . VAL A 1 149 ? 60.258 12.752  38.693  1.00 35.27  ? 146 VAL A CG2 1 
ATOM   1100  N N   . PRO A 1 150 ? 62.242 8.348   38.814  1.00 38.14  ? 147 PRO A N   1 
ATOM   1101  C CA  . PRO A 1 150 ? 62.443 6.987   39.340  1.00 34.44  ? 147 PRO A CA  1 
ATOM   1102  C C   . PRO A 1 150 ? 62.608 6.953   40.844  1.00 39.45  ? 147 PRO A C   1 
ATOM   1103  O O   . PRO A 1 150 ? 62.220 5.970   41.487  1.00 39.80  ? 147 PRO A O   1 
ATOM   1104  C CB  . PRO A 1 150 ? 63.714 6.506   38.619  1.00 39.04  ? 147 PRO A CB  1 
ATOM   1105  C CG  . PRO A 1 150 ? 63.947 7.477   37.510  1.00 45.70  ? 147 PRO A CG  1 
ATOM   1106  C CD  . PRO A 1 150 ? 63.360 8.778   37.956  1.00 39.83  ? 147 PRO A CD  1 
ATOM   1107  N N   . GLY A 1 151 ? 63.168 8.004   41.426  1.00 36.51  ? 148 GLY A N   1 
ATOM   1108  C CA  . GLY A 1 151 ? 63.400 8.044   42.845  1.00 33.07  ? 148 GLY A CA  1 
ATOM   1109  C C   . GLY A 1 151 ? 63.909 9.395   43.293  1.00 38.05  ? 148 GLY A C   1 
ATOM   1110  O O   . GLY A 1 151 ? 63.843 10.385  42.557  1.00 34.76  ? 148 GLY A O   1 
ATOM   1111  N N   . PRO A 1 152 ? 64.447 9.452   44.509  1.00 39.13  ? 149 PRO A N   1 
ATOM   1112  C CA  . PRO A 1 152 ? 64.809 10.744  45.101  1.00 39.32  ? 149 PRO A CA  1 
ATOM   1113  C C   . PRO A 1 152 ? 65.823 11.509  44.262  1.00 40.45  ? 149 PRO A C   1 
ATOM   1114  O O   . PRO A 1 152 ? 66.726 10.933  43.651  1.00 39.72  ? 149 PRO A O   1 
ATOM   1115  C CB  . PRO A 1 152 ? 65.378 10.356  46.470  1.00 39.41  ? 149 PRO A CB  1 
ATOM   1116  C CG  . PRO A 1 152 ? 64.693 9.059   46.792  1.00 41.14  ? 149 PRO A CG  1 
ATOM   1117  C CD  . PRO A 1 152 ? 64.599 8.346   45.470  1.00 32.99  ? 149 PRO A CD  1 
ATOM   1118  N N   . GLY A 1 153 ? 65.649 12.818  44.231  1.00 35.78  ? 150 GLY A N   1 
ATOM   1119  C CA  . GLY A 1 153 ? 66.483 13.699  43.438  1.00 34.23  ? 150 GLY A CA  1 
ATOM   1120  C C   . GLY A 1 153 ? 65.727 14.958  43.073  1.00 37.70  ? 150 GLY A C   1 
ATOM   1121  O O   . GLY A 1 153 ? 64.522 15.080  43.286  1.00 35.55  ? 150 GLY A O   1 
ATOM   1122  N N   . LYS A 1 154 ? 66.465 15.907  42.503  1.00 34.16  ? 151 LYS A N   1 
ATOM   1123  C CA  . LYS A 1 154 ? 65.918 17.214  42.163  1.00 38.28  ? 151 LYS A CA  1 
ATOM   1124  C C   . LYS A 1 154 ? 65.356 17.221  40.747  1.00 36.44  ? 151 LYS A C   1 
ATOM   1125  O O   . LYS A 1 154 ? 66.005 16.745  39.809  1.00 37.07  ? 151 LYS A O   1 
ATOM   1126  C CB  . LYS A 1 154 ? 66.982 18.306  42.293  1.00 38.72  ? 151 LYS A CB  1 
ATOM   1127  C CG  . LYS A 1 154 ? 67.293 18.732  43.717  1.00 50.50  ? 151 LYS A CG  1 
ATOM   1128  C CD  . LYS A 1 154 ? 68.188 19.965  43.726  1.00 49.93  ? 151 LYS A CD  1 
ATOM   1129  C CE  . LYS A 1 154 ? 68.516 20.406  45.144  1.00 55.92  ? 151 LYS A CE  1 
ATOM   1130  N NZ  . LYS A 1 154 ? 69.663 21.359  45.182  1.00 62.20  ? 151 LYS A NZ  1 
ATOM   1131  N N   . VAL A 1 155 ? 64.150 17.763  40.604  1.00 32.74  ? 152 VAL A N   1 
ATOM   1132  C CA  . VAL A 1 155 ? 63.579 18.116  39.311  1.00 32.12  ? 152 VAL A CA  1 
ATOM   1133  C C   . VAL A 1 155 ? 63.637 19.632  39.201  1.00 33.55  ? 152 VAL A C   1 
ATOM   1134  O O   . VAL A 1 155 ? 63.049 20.345  40.026  1.00 32.70  ? 152 VAL A O   1 
ATOM   1135  C CB  . VAL A 1 155 ? 62.139 17.607  39.153  1.00 35.81  ? 152 VAL A CB  1 
ATOM   1136  C CG1 . VAL A 1 155 ? 61.478 18.258  37.938  1.00 30.75  ? 152 VAL A CG1 1 
ATOM   1137  C CG2 . VAL A 1 155 ? 62.119 16.094  39.027  1.00 34.69  ? 152 VAL A CG2 1 
ATOM   1138  N N   . GLU A 1 156 ? 64.353 20.124  38.195  1.00 30.50  ? 153 GLU A N   1 
ATOM   1139  C CA  . GLU A 1 156 ? 64.542 21.550  37.990  1.00 36.74  ? 153 GLU A CA  1 
ATOM   1140  C C   . GLU A 1 156 ? 64.163 21.911  36.562  1.00 32.65  ? 153 GLU A C   1 
ATOM   1141  O O   . GLU A 1 156 ? 64.286 21.097  35.643  1.00 30.98  ? 153 GLU A O   1 
ATOM   1142  C CB  . GLU A 1 156 ? 65.994 21.961  38.267  1.00 29.95  ? 153 GLU A CB  1 
ATOM   1143  C CG  . GLU A 1 156 ? 66.448 21.695  39.692  1.00 37.31  ? 153 GLU A CG  1 
ATOM   1144  C CD  . GLU A 1 156 ? 67.949 21.840  39.862  1.00 37.69  ? 153 GLU A CD  1 
ATOM   1145  O OE1 . GLU A 1 156 ? 68.378 22.722  40.633  1.00 38.45  ? 153 GLU A OE1 1 
ATOM   1146  O OE2 . GLU A 1 156 ? 68.698 21.070  39.223  1.00 35.94  ? 153 GLU A OE2 1 
ATOM   1147  N N   . ILE A 1 157 ? 63.701 23.144  36.383  1.00 30.26  ? 154 ILE A N   1 
ATOM   1148  C CA  . ILE A 1 157 ? 63.344 23.672  35.073  1.00 32.88  ? 154 ILE A CA  1 
ATOM   1149  C C   . ILE A 1 157 ? 64.151 24.947  34.846  1.00 32.36  ? 154 ILE A C   1 
ATOM   1150  O O   . ILE A 1 157 ? 64.155 25.852  35.690  1.00 32.76  ? 154 ILE A O   1 
ATOM   1151  C CB  . ILE A 1 157 ? 61.822 23.899  34.946  1.00 29.76  ? 154 ILE A CB  1 
ATOM   1152  C CG1 . ILE A 1 157 ? 61.441 24.221  33.498  1.00 32.31  ? 154 ILE A CG1 1 
ATOM   1153  C CG2 . ILE A 1 157 ? 61.316 24.959  35.920  1.00 31.03  ? 154 ILE A CG2 1 
ATOM   1154  C CD1 . ILE A 1 157 ? 59.940 24.193  33.250  1.00 33.18  ? 154 ILE A CD1 1 
ATOM   1155  N N   . THR A 1 158 ? 64.866 24.993  33.724  1.00 31.68  ? 155 THR A N   1 
ATOM   1156  C CA  . THR A 1 158 ? 65.863 26.018  33.458  1.00 33.09  ? 155 THR A CA  1 
ATOM   1157  C C   . THR A 1 158 ? 65.509 26.796  32.199  1.00 37.25  ? 155 THR A C   1 
ATOM   1158  O O   . THR A 1 158 ? 64.911 26.256  31.263  1.00 33.46  ? 155 THR A O   1 
ATOM   1159  C CB  . THR A 1 158 ? 67.264 25.408  33.284  1.00 33.77  ? 155 THR A CB  1 
ATOM   1160  O OG1 . THR A 1 158 ? 67.282 24.586  32.111  1.00 36.06  ? 155 THR A OG1 1 
ATOM   1161  C CG2 . THR A 1 158 ? 67.644 24.558  34.493  1.00 32.26  ? 155 THR A CG2 1 
ATOM   1162  N N   . TYR A 1 159 ? 65.898 28.068  32.181  1.00 34.58  ? 156 TYR A N   1 
ATOM   1163  C CA  . TYR A 1 159 ? 65.783 28.919  31.005  1.00 33.39  ? 156 TYR A CA  1 
ATOM   1164  C C   . TYR A 1 159 ? 67.158 29.469  30.656  1.00 36.77  ? 156 TYR A C   1 
ATOM   1165  O O   . TYR A 1 159 ? 67.822 30.072  31.506  1.00 35.08  ? 156 TYR A O   1 
ATOM   1166  C CB  . TYR A 1 159 ? 64.804 30.072  31.240  1.00 25.79  ? 156 TYR A CB  1 
ATOM   1167  C CG  . TYR A 1 159 ? 64.849 31.118  30.148  1.00 36.62  ? 156 TYR A CG  1 
ATOM   1168  C CD1 . TYR A 1 159 ? 64.463 30.809  28.849  1.00 39.48  ? 156 TYR A CD1 1 
ATOM   1169  C CD2 . TYR A 1 159 ? 65.281 32.412  30.412  1.00 33.16  ? 156 TYR A CD2 1 
ATOM   1170  C CE1 . TYR A 1 159 ? 64.506 31.758  27.844  1.00 35.51  ? 156 TYR A CE1 1 
ATOM   1171  C CE2 . TYR A 1 159 ? 65.323 33.369  29.414  1.00 37.55  ? 156 TYR A CE2 1 
ATOM   1172  C CZ  . TYR A 1 159 ? 64.936 33.037  28.132  1.00 36.78  ? 156 TYR A CZ  1 
ATOM   1173  O OH  . TYR A 1 159 ? 64.976 33.984  27.134  1.00 37.96  ? 156 TYR A OH  1 
ATOM   1174  N N   . THR A 1 160 ? 67.582 29.266  29.412  1.00 31.26  ? 157 THR A N   1 
ATOM   1175  C CA  . THR A 1 160 ? 68.875 29.768  28.946  1.00 38.02  ? 157 THR A CA  1 
ATOM   1176  C C   . THR A 1 160 ? 68.680 30.674  27.740  1.00 42.62  ? 157 THR A C   1 
ATOM   1177  O O   . THR A 1 160 ? 68.405 30.185  26.628  1.00 37.87  ? 157 THR A O   1 
ATOM   1178  C CB  . THR A 1 160 ? 69.821 28.622  28.605  1.00 41.31  ? 157 THR A CB  1 
ATOM   1179  O OG1 . THR A 1 160 ? 69.977 27.775  29.753  1.00 39.84  ? 157 THR A OG1 1 
ATOM   1180  C CG2 . THR A 1 160 ? 71.178 29.174  28.185  1.00 33.21  ? 157 THR A CG2 1 
ATOM   1181  N N   . PRO A 1 161 ? 68.814 31.991  27.906  1.00 37.63  ? 158 PRO A N   1 
ATOM   1182  C CA  . PRO A 1 161 ? 68.580 32.909  26.785  1.00 42.84  ? 158 PRO A CA  1 
ATOM   1183  C C   . PRO A 1 161 ? 69.562 32.666  25.650  1.00 41.85  ? 158 PRO A C   1 
ATOM   1184  O O   . PRO A 1 161 ? 70.647 32.114  25.844  1.00 50.37  ? 158 PRO A O   1 
ATOM   1185  C CB  . PRO A 1 161 ? 68.781 34.295  27.410  1.00 42.69  ? 158 PRO A CB  1 
ATOM   1186  C CG  . PRO A 1 161 ? 68.613 34.094  28.878  1.00 46.00  ? 158 PRO A CG  1 
ATOM   1187  C CD  . PRO A 1 161 ? 69.091 32.704  29.164  1.00 39.93  ? 158 PRO A CD  1 
ATOM   1188  N N   . SER A 1 162 ? 69.155 33.079  24.447  1.00 39.59  ? 159 SER A N   1 
ATOM   1189  C CA  . SER A 1 162 ? 69.973 32.856  23.259  1.00 48.00  ? 159 SER A CA  1 
ATOM   1190  C C   . SER A 1 162 ? 71.288 33.622  23.296  1.00 49.56  ? 159 SER A C   1 
ATOM   1191  O O   . SER A 1 162 ? 72.222 33.259  22.572  1.00 51.19  ? 159 SER A O   1 
ATOM   1192  C CB  . SER A 1 162 ? 69.194 33.232  22.000  1.00 45.04  ? 159 SER A CB  1 
ATOM   1193  O OG  . SER A 1 162 ? 68.137 32.317  21.768  1.00 46.22  ? 159 SER A OG  1 
ATOM   1194  N N   . ASP A 1 163 ? 71.394 34.674  24.108  1.00 52.34  ? 160 ASP A N   1 
ATOM   1195  C CA  . ASP A 1 163 ? 72.691 35.324  24.243  1.00 60.43  ? 160 ASP A CA  1 
ATOM   1196  C C   . ASP A 1 163 ? 73.597 34.585  25.219  1.00 65.31  ? 160 ASP A C   1 
ATOM   1197  O O   . ASP A 1 163 ? 74.824 34.703  25.128  1.00 67.53  ? 160 ASP A O   1 
ATOM   1198  C CB  . ASP A 1 163 ? 72.527 36.781  24.679  1.00 47.51  ? 160 ASP A CB  1 
ATOM   1199  C CG  . ASP A 1 163 ? 71.429 36.967  25.704  1.00 63.38  ? 160 ASP A CG  1 
ATOM   1200  O OD1 . ASP A 1 163 ? 71.470 36.295  26.753  1.00 62.01  ? 160 ASP A OD1 1 
ATOM   1201  O OD2 . ASP A 1 163 ? 70.529 37.800  25.456  1.00 64.78  ? 160 ASP A OD2 1 
ATOM   1202  N N   . GLY A 1 164 ? 73.025 33.808  26.136  1.00 62.76  ? 161 GLY A N   1 
ATOM   1203  C CA  . GLY A 1 164 ? 73.810 33.216  27.200  1.00 56.64  ? 161 GLY A CA  1 
ATOM   1204  C C   . GLY A 1 164 ? 74.247 34.188  28.273  1.00 66.10  ? 161 GLY A C   1 
ATOM   1205  O O   . GLY A 1 164 ? 75.094 33.833  29.103  1.00 64.36  ? 161 GLY A O   1 
ATOM   1206  N N   . THR A 1 165 ? 73.701 35.409  28.280  1.00 62.94  ? 162 THR A N   1 
ATOM   1207  C CA  . THR A 1 165 ? 74.071 36.389  29.298  1.00 51.25  ? 162 THR A CA  1 
ATOM   1208  C C   . THR A 1 165 ? 73.723 35.910  30.697  1.00 62.46  ? 162 THR A C   1 
ATOM   1209  O O   . THR A 1 165 ? 74.408 36.264  31.662  1.00 55.73  ? 162 THR A O   1 
ATOM   1210  C CB  . THR A 1 165 ? 73.378 37.719  29.020  1.00 49.47  ? 162 THR A CB  1 
ATOM   1211  O OG1 . THR A 1 165 ? 71.970 37.495  28.871  1.00 51.99  ? 162 THR A OG1 1 
ATOM   1212  C CG2 . THR A 1 165 ? 73.923 38.330  27.746  1.00 62.23  ? 162 THR A CG2 1 
ATOM   1213  N N   . GLN A 1 166 ? 72.667 35.115  30.834  1.00 57.41  ? 163 GLN A N   1 
ATOM   1214  C CA  . GLN A 1 166 ? 72.329 34.567  32.134  1.00 56.06  ? 163 GLN A CA  1 
ATOM   1215  C C   . GLN A 1 166 ? 71.676 33.200  31.956  1.00 55.24  ? 163 GLN A C   1 
ATOM   1216  O O   . GLN A 1 166 ? 71.691 32.609  30.872  1.00 54.46  ? 163 GLN A O   1 
ATOM   1217  C CB  . GLN A 1 166 ? 71.450 35.532  32.944  1.00 48.71  ? 163 GLN A CB  1 
ATOM   1218  C CG  . GLN A 1 166 ? 70.283 36.162  32.218  1.00 47.00  ? 163 GLN A CG  1 
ATOM   1219  C CD  . GLN A 1 166 ? 69.444 37.017  33.153  1.00 55.97  ? 163 GLN A CD  1 
ATOM   1220  O OE1 . GLN A 1 166 ? 68.778 36.502  34.054  1.00 54.02  ? 163 GLN A OE1 1 
ATOM   1221  N NE2 . GLN A 1 166 ? 69.503 38.331  32.969  1.00 55.96  ? 163 GLN A NE2 1 
ATOM   1222  N N   . LYS A 1 167 ? 71.125 32.699  33.058  1.00 48.56  ? 164 LYS A N   1 
ATOM   1223  C CA  . LYS A 1 167 ? 70.524 31.378  33.152  1.00 42.21  ? 164 LYS A CA  1 
ATOM   1224  C C   . LYS A 1 167 ? 69.768 31.302  34.469  1.00 43.87  ? 164 LYS A C   1 
ATOM   1225  O O   . LYS A 1 167 ? 70.338 31.576  35.530  1.00 40.66  ? 164 LYS A O   1 
ATOM   1226  C CB  . LYS A 1 167 ? 71.590 30.281  33.073  1.00 47.01  ? 164 LYS A CB  1 
ATOM   1227  C CG  . LYS A 1 167 ? 71.038 28.887  32.798  1.00 49.39  ? 164 LYS A CG  1 
ATOM   1228  C CD  . LYS A 1 167 ? 72.034 27.806  33.196  1.00 50.52  ? 164 LYS A CD  1 
ATOM   1229  C CE  . LYS A 1 167 ? 71.497 26.420  32.871  1.00 52.48  ? 164 LYS A CE  1 
ATOM   1230  N NZ  . LYS A 1 167 ? 72.356 25.339  33.430  1.00 73.34  ? 164 LYS A NZ  1 
ATOM   1231  N N   . VAL A 1 168 ? 68.487 30.958  34.415  1.00 36.43  ? 165 VAL A N   1 
ATOM   1232  C CA  . VAL A 1 168 ? 67.655 30.842  35.605  1.00 31.16  ? 165 VAL A CA  1 
ATOM   1233  C C   . VAL A 1 168 ? 67.288 29.379  35.781  1.00 36.25  ? 165 VAL A C   1 
ATOM   1234  O O   . VAL A 1 168 ? 66.820 28.731  34.837  1.00 33.18  ? 165 VAL A O   1 
ATOM   1235  C CB  . VAL A 1 168 ? 66.393 31.718  35.510  1.00 36.71  ? 165 VAL A CB  1 
ATOM   1236  C CG1 . VAL A 1 168 ? 65.784 31.919  36.888  1.00 34.11  ? 165 VAL A CG1 1 
ATOM   1237  C CG2 . VAL A 1 168 ? 66.720 33.060  34.870  1.00 41.10  ? 165 VAL A CG2 1 
ATOM   1238  N N   . THR A 1 169 ? 67.517 28.854  36.983  1.00 37.60  ? 166 THR A N   1 
ATOM   1239  C CA  . THR A 1 169 ? 67.178 27.477  37.323  1.00 37.92  ? 166 THR A CA  1 
ATOM   1240  C C   . THR A 1 169 ? 66.121 27.514  38.417  1.00 34.48  ? 166 THR A C   1 
ATOM   1241  O O   . THR A 1 169 ? 66.392 27.964  39.536  1.00 35.51  ? 166 THR A O   1 
ATOM   1242  C CB  . THR A 1 169 ? 68.412 26.696  37.770  1.00 41.12  ? 166 THR A CB  1 
ATOM   1243  O OG1 . THR A 1 169 ? 69.358 26.648  36.695  1.00 37.73  ? 166 THR A OG1 1 
ATOM   1244  C CG2 . THR A 1 169 ? 68.031 25.272  38.170  1.00 33.34  ? 166 THR A CG2 1 
ATOM   1245  N N   . TYR A 1 170 ? 64.917 27.061  38.085  1.00 36.27  ? 167 TYR A N   1 
ATOM   1246  C CA  . TYR A 1 170 ? 63.805 27.004  39.021  1.00 31.53  ? 167 TYR A CA  1 
ATOM   1247  C C   . TYR A 1 170 ? 63.676 25.590  39.570  1.00 35.31  ? 167 TYR A C   1 
ATOM   1248  O O   . TYR A 1 170 ? 63.763 24.611  38.821  1.00 33.42  ? 167 TYR A O   1 
ATOM   1249  C CB  . TYR A 1 170 ? 62.493 27.411  38.346  1.00 36.25  ? 167 TYR A CB  1 
ATOM   1250  C CG  . TYR A 1 170 ? 62.484 28.791  37.720  1.00 36.58  ? 167 TYR A CG  1 
ATOM   1251  C CD1 . TYR A 1 170 ? 62.931 28.988  36.418  1.00 33.71  ? 167 TYR A CD1 1 
ATOM   1252  C CD2 . TYR A 1 170 ? 62.002 29.890  38.421  1.00 38.88  ? 167 TYR A CD2 1 
ATOM   1253  C CE1 . TYR A 1 170 ? 62.912 30.243  35.837  1.00 32.59  ? 167 TYR A CE1 1 
ATOM   1254  C CE2 . TYR A 1 170 ? 61.981 31.152  37.847  1.00 40.85  ? 167 TYR A CE2 1 
ATOM   1255  C CZ  . TYR A 1 170 ? 62.437 31.322  36.556  1.00 40.38  ? 167 TYR A CZ  1 
ATOM   1256  O OH  . TYR A 1 170 ? 62.420 32.573  35.981  1.00 41.30  ? 167 TYR A OH  1 
ATOM   1257  N N   . LEU A 1 171 ? 63.472 25.487  40.878  1.00 38.43  ? 168 LEU A N   1 
ATOM   1258  C CA  . LEU A 1 171 ? 63.246 24.193  41.507  1.00 38.58  ? 168 LEU A CA  1 
ATOM   1259  C C   . LEU A 1 171 ? 61.783 23.803  41.349  1.00 35.55  ? 168 LEU A C   1 
ATOM   1260  O O   . LEU A 1 171 ? 60.891 24.509  41.831  1.00 34.05  ? 168 LEU A O   1 
ATOM   1261  C CB  . LEU A 1 171 ? 63.628 24.231  42.984  1.00 39.89  ? 168 LEU A CB  1 
ATOM   1262  C CG  . LEU A 1 171 ? 63.327 22.941  43.756  1.00 40.87  ? 168 LEU A CG  1 
ATOM   1263  C CD1 . LEU A 1 171 ? 64.159 21.778  43.225  1.00 36.43  ? 168 LEU A CD1 1 
ATOM   1264  C CD2 . LEU A 1 171 ? 63.544 23.127  45.252  1.00 37.52  ? 168 LEU A CD2 1 
ATOM   1265  N N   . VAL A 1 172 ? 61.533 22.686  40.669  1.00 29.05  ? 169 VAL A N   1 
ATOM   1266  C CA  . VAL A 1 172 ? 60.177 22.156  40.615  1.00 33.12  ? 169 VAL A CA  1 
ATOM   1267  C C   . VAL A 1 172 ? 59.858 21.391  41.892  1.00 38.64  ? 169 VAL A C   1 
ATOM   1268  O O   . VAL A 1 172 ? 58.859 21.670  42.567  1.00 32.75  ? 169 VAL A O   1 
ATOM   1269  C CB  . VAL A 1 172 ? 59.993 21.279  39.363  1.00 32.93  ? 169 VAL A CB  1 
ATOM   1270  C CG1 . VAL A 1 172 ? 58.609 20.645  39.355  1.00 34.88  ? 169 VAL A CG1 1 
ATOM   1271  C CG2 . VAL A 1 172 ? 60.224 22.101  38.102  1.00 29.88  ? 169 VAL A CG2 1 
ATOM   1272  N N   . HIS A 1 173 ? 60.709 20.431  42.252  1.00 34.30  ? 170 HIS A N   1 
ATOM   1273  C CA  . HIS A 1 173 ? 60.546 19.696  43.498  1.00 35.09  ? 170 HIS A CA  1 
ATOM   1274  C C   . HIS A 1 173 ? 61.798 18.886  43.782  1.00 36.45  ? 170 HIS A C   1 
ATOM   1275  O O   . HIS A 1 173 ? 62.395 18.309  42.870  1.00 36.33  ? 170 HIS A O   1 
ATOM   1276  C CB  . HIS A 1 173 ? 59.331 18.761  43.455  1.00 37.05  ? 170 HIS A CB  1 
ATOM   1277  C CG  . HIS A 1 173 ? 59.024 18.126  44.775  1.00 41.61  ? 170 HIS A CG  1 
ATOM   1278  N ND1 . HIS A 1 173 ? 58.608 18.851  45.870  1.00 39.16  ? 170 HIS A ND1 1 
ATOM   1279  C CD2 . HIS A 1 173 ? 59.085 16.835  45.180  1.00 38.39  ? 170 HIS A CD2 1 
ATOM   1280  C CE1 . HIS A 1 173 ? 58.421 18.035  46.892  1.00 38.23  ? 170 HIS A CE1 1 
ATOM   1281  N NE2 . HIS A 1 173 ? 58.703 16.806  46.500  1.00 40.11  ? 170 HIS A NE2 1 
ATOM   1282  N N   . ASN A 1 174 ? 62.181 18.845  45.053  1.00 34.19  ? 171 ASN A N   1 
ATOM   1283  C CA  . ASN A 1 174 ? 63.214 17.934  45.527  1.00 38.99  ? 171 ASN A CA  1 
ATOM   1284  C C   . ASN A 1 174 ? 62.525 16.694  46.083  1.00 38.85  ? 171 ASN A C   1 
ATOM   1285  O O   . ASN A 1 174 ? 61.917 16.741  47.157  1.00 36.30  ? 171 ASN A O   1 
ATOM   1286  C CB  . ASN A 1 174 ? 64.085 18.607  46.584  1.00 36.36  ? 171 ASN A CB  1 
ATOM   1287  C CG  . ASN A 1 174 ? 65.262 17.744  47.006  1.00 46.18  ? 171 ASN A CG  1 
ATOM   1288  O OD1 . ASN A 1 174 ? 65.753 16.919  46.233  1.00 45.80  ? 171 ASN A OD1 1 
ATOM   1289  N ND2 . ASN A 1 174 ? 65.717 17.926  48.239  1.00 54.22  ? 171 ASN A ND2 1 
ATOM   1290  N N   . PHE A 1 175 ? 62.596 15.592  45.341  1.00 35.20  ? 172 PHE A N   1 
ATOM   1291  C CA  . PHE A 1 175 ? 62.030 14.327  45.792  1.00 37.01  ? 172 PHE A CA  1 
ATOM   1292  C C   . PHE A 1 175 ? 62.929 13.731  46.867  1.00 37.09  ? 172 PHE A C   1 
ATOM   1293  O O   . PHE A 1 175 ? 64.095 13.421  46.599  1.00 39.11  ? 172 PHE A O   1 
ATOM   1294  C CB  . PHE A 1 175 ? 61.891 13.355  44.623  1.00 35.97  ? 172 PHE A CB  1 
ATOM   1295  C CG  . PHE A 1 175 ? 60.809 13.720  43.648  1.00 38.47  ? 172 PHE A CG  1 
ATOM   1296  C CD1 . PHE A 1 175 ? 61.029 14.685  42.675  1.00 39.48  ? 172 PHE A CD1 1 
ATOM   1297  C CD2 . PHE A 1 175 ? 59.577 13.087  43.693  1.00 35.46  ? 172 PHE A CD2 1 
ATOM   1298  C CE1 . PHE A 1 175 ? 60.033 15.020  41.772  1.00 32.97  ? 172 PHE A CE1 1 
ATOM   1299  C CE2 . PHE A 1 175 ? 58.578 13.414  42.794  1.00 34.81  ? 172 PHE A CE2 1 
ATOM   1300  C CZ  . PHE A 1 175 ? 58.805 14.383  41.831  1.00 42.46  ? 172 PHE A CZ  1 
ATOM   1301  N N   . GLU A 1 176 ? 62.397 13.566  48.080  1.00 41.58  ? 173 GLU A N   1 
ATOM   1302  C CA  . GLU A 1 176 ? 63.181 13.011  49.175  1.00 48.58  ? 173 GLU A CA  1 
ATOM   1303  C C   . GLU A 1 176 ? 62.744 11.619  49.610  1.00 49.73  ? 173 GLU A C   1 
ATOM   1304  O O   . GLU A 1 176 ? 63.537 10.915  50.244  1.00 56.88  ? 173 GLU A O   1 
ATOM   1305  C CB  . GLU A 1 176 ? 63.151 13.950  50.393  1.00 44.72  ? 173 GLU A CB  1 
ATOM   1306  C CG  . GLU A 1 176 ? 63.822 15.296  50.140  1.00 50.00  ? 173 GLU A CG  1 
ATOM   1307  C CD  . GLU A 1 176 ? 63.782 16.217  51.347  1.00 49.79  ? 173 GLU A CD  1 
ATOM   1308  O OE1 . GLU A 1 176 ? 64.761 16.226  52.124  1.00 56.24  ? 173 GLU A OE1 1 
ATOM   1309  O OE2 . GLU A 1 176 ? 62.773 16.933  51.518  1.00 51.79  ? 173 GLU A OE2 1 
ATOM   1310  N N   . GLU A 1 177 ? 61.519 11.201  49.284  1.00 42.56  ? 174 GLU A N   1 
ATOM   1311  C CA  . GLU A 1 177 ? 61.005 9.878   49.647  1.00 52.64  ? 174 GLU A CA  1 
ATOM   1312  C C   . GLU A 1 177 ? 60.417 9.231   48.395  1.00 47.83  ? 174 GLU A C   1 
ATOM   1313  O O   . GLU A 1 177 ? 59.243 9.436   48.074  1.00 62.04  ? 174 GLU A O   1 
ATOM   1314  C CB  . GLU A 1 177 ? 59.965 9.970   50.767  1.00 52.16  ? 174 GLU A CB  1 
ATOM   1315  C CG  . GLU A 1 177 ? 60.267 10.997  51.849  1.00 63.70  ? 174 GLU A CG  1 
ATOM   1316  C CD  . GLU A 1 177 ? 61.198 10.461  52.923  1.00 70.40  ? 174 GLU A CD  1 
ATOM   1317  O OE1 . GLU A 1 177 ? 61.313 9.223   53.050  1.00 71.50  ? 174 GLU A OE1 1 
ATOM   1318  O OE2 . GLU A 1 177 ? 61.812 11.277  53.644  1.00 69.29  ? 174 GLU A OE2 1 
ATOM   1319  N N   . GLY A 1 178 ? 61.226 8.447   47.698  1.00 48.62  ? 175 GLY A N   1 
ATOM   1320  C CA  . GLY A 1 178 ? 60.754 7.750   46.525  1.00 44.45  ? 175 GLY A CA  1 
ATOM   1321  C C   . GLY A 1 178 ? 60.662 8.643   45.301  1.00 45.12  ? 175 GLY A C   1 
ATOM   1322  O O   . GLY A 1 178 ? 61.199 9.754   45.242  1.00 44.77  ? 175 GLY A O   1 
ATOM   1323  N N   . GLY A 1 179 ? 59.950 8.130   44.301  1.00 43.60  ? 176 GLY A N   1 
ATOM   1324  C CA  . GLY A 1 179 ? 59.819 8.830   43.040  1.00 40.17  ? 176 GLY A CA  1 
ATOM   1325  C C   . GLY A 1 179 ? 58.439 9.403   42.794  1.00 39.67  ? 176 GLY A C   1 
ATOM   1326  O O   . GLY A 1 179 ? 57.717 9.743   43.737  1.00 40.99  ? 176 GLY A O   1 
ATOM   1327  N N   . GLY A 1 180 ? 58.064 9.507   41.522  1.00 37.19  ? 177 GLY A N   1 
ATOM   1328  C CA  . GLY A 1 180 ? 56.808 10.119  41.140  1.00 36.84  ? 177 GLY A CA  1 
ATOM   1329  C C   . GLY A 1 180 ? 56.801 10.552  39.689  1.00 37.06  ? 177 GLY A C   1 
ATOM   1330  O O   . GLY A 1 180 ? 57.311 9.838   38.819  1.00 40.90  ? 177 GLY A O   1 
ATOM   1331  N N   . VAL A 1 181 ? 56.231 11.725  39.415  1.00 31.74  ? 178 VAL A N   1 
ATOM   1332  C CA  . VAL A 1 181 ? 56.105 12.235  38.057  1.00 32.67  ? 178 VAL A CA  1 
ATOM   1333  C C   . VAL A 1 181 ? 56.382 13.731  38.056  1.00 35.80  ? 178 VAL A C   1 
ATOM   1334  O O   . VAL A 1 181 ? 56.315 14.402  39.087  1.00 35.65  ? 178 VAL A O   1 
ATOM   1335  C CB  . VAL A 1 181 ? 54.709 11.958  37.451  1.00 35.25  ? 178 VAL A CB  1 
ATOM   1336  C CG1 . VAL A 1 181 ? 54.568 10.487  37.091  1.00 33.57  ? 178 VAL A CG1 1 
ATOM   1337  C CG2 . VAL A 1 181 ? 53.612 12.390  38.413  1.00 31.04  ? 178 VAL A CG2 1 
ATOM   1338  N N   . ALA A 1 182 ? 56.703 14.245  36.872  1.00 34.79  ? 179 ALA A N   1 
ATOM   1339  C CA  . ALA A 1 182 ? 56.929 15.667  36.678  1.00 37.10  ? 179 ALA A CA  1 
ATOM   1340  C C   . ALA A 1 182 ? 56.694 15.998  35.213  1.00 32.76  ? 179 ALA A C   1 
ATOM   1341  O O   . ALA A 1 182 ? 56.704 15.117  34.350  1.00 33.39  ? 179 ALA A O   1 
ATOM   1342  C CB  . ALA A 1 182 ? 58.339 16.087  37.110  1.00 32.66  ? 179 ALA A CB  1 
ATOM   1343  N N   . MET A 1 183 ? 56.476 17.282  34.938  1.00 33.85  ? 180 MET A N   1 
ATOM   1344  C CA  . MET A 1 183 ? 56.210 17.712  33.575  1.00 35.72  ? 180 MET A CA  1 
ATOM   1345  C C   . MET A 1 183 ? 56.569 19.180  33.414  1.00 35.59  ? 180 MET A C   1 
ATOM   1346  O O   . MET A 1 183 ? 56.510 19.961  34.368  1.00 28.98  ? 180 MET A O   1 
ATOM   1347  C CB  . MET A 1 183 ? 54.744 17.493  33.186  1.00 30.99  ? 180 MET A CB  1 
ATOM   1348  C CG  . MET A 1 183 ? 53.742 18.121  34.139  1.00 36.01  ? 180 MET A CG  1 
ATOM   1349  S SD  . MET A 1 183 ? 52.036 17.775  33.663  1.00 51.99  ? 180 MET A SD  1 
ATOM   1350  C CE  . MET A 1 183 ? 52.047 18.300  31.952  1.00 47.24  ? 180 MET A CE  1 
ATOM   1351  N N   . GLY A 1 184 ? 56.945 19.537  32.197  1.00 33.17  ? 181 GLY A N   1 
ATOM   1352  C CA  . GLY A 1 184 ? 57.117 20.927  31.812  1.00 37.48  ? 181 GLY A CA  1 
ATOM   1353  C C   . GLY A 1 184 ? 56.170 21.261  30.676  1.00 34.92  ? 181 GLY A C   1 
ATOM   1354  O O   . GLY A 1 184 ? 55.956 20.444  29.778  1.00 37.11  ? 181 GLY A O   1 
ATOM   1355  N N   . MET A 1 185 ? 55.592 22.458  30.732  1.00 33.69  ? 182 MET A N   1 
ATOM   1356  C CA  . MET A 1 185 ? 54.691 22.933  29.693  1.00 39.92  ? 182 MET A CA  1 
ATOM   1357  C C   . MET A 1 185 ? 55.011 24.388  29.390  1.00 40.00  ? 182 MET A C   1 
ATOM   1358  O O   . MET A 1 185 ? 55.687 25.071  30.165  1.00 37.06  ? 182 MET A O   1 
ATOM   1359  C CB  . MET A 1 185 ? 53.218 22.770  30.095  1.00 39.56  ? 182 MET A CB  1 
ATOM   1360  C CG  . MET A 1 185 ? 52.935 23.015  31.568  1.00 49.28  ? 182 MET A CG  1 
ATOM   1361  S SD  . MET A 1 185 ? 51.199 22.755  31.990  1.00 77.96  ? 182 MET A SD  1 
ATOM   1362  C CE  . MET A 1 185 ? 50.732 21.518  30.782  1.00 53.41  ? 182 MET A CE  1 
ATOM   1363  N N   . TYR A 1 186 ? 54.513 24.859  28.249  1.00 35.41  ? 183 TYR A N   1 
ATOM   1364  C CA  . TYR A 1 186 ? 54.912 26.158  27.736  1.00 33.19  ? 183 TYR A CA  1 
ATOM   1365  C C   . TYR A 1 186 ? 53.823 26.720  26.835  1.00 36.64  ? 183 TYR A C   1 
ATOM   1366  O O   . TYR A 1 186 ? 52.960 25.995  26.334  1.00 37.29  ? 183 TYR A O   1 
ATOM   1367  C CB  . TYR A 1 186 ? 56.224 26.062  26.947  1.00 30.10  ? 183 TYR A CB  1 
ATOM   1368  C CG  . TYR A 1 186 ? 56.045 25.401  25.597  1.00 35.04  ? 183 TYR A CG  1 
ATOM   1369  C CD1 . TYR A 1 186 ? 56.066 24.019  25.473  1.00 33.40  ? 183 TYR A CD1 1 
ATOM   1370  C CD2 . TYR A 1 186 ? 55.841 26.158  24.449  1.00 35.19  ? 183 TYR A CD2 1 
ATOM   1371  C CE1 . TYR A 1 186 ? 55.894 23.408  24.244  1.00 33.20  ? 183 TYR A CE1 1 
ATOM   1372  C CE2 . TYR A 1 186 ? 55.665 25.558  23.218  1.00 28.73  ? 183 TYR A CE2 1 
ATOM   1373  C CZ  . TYR A 1 186 ? 55.694 24.183  23.120  1.00 36.91  ? 183 TYR A CZ  1 
ATOM   1374  O OH  . TYR A 1 186 ? 55.524 23.577  21.896  1.00 38.24  ? 183 TYR A OH  1 
ATOM   1375  N N   . ASN A 1 187 ? 53.900 28.030  26.620  1.00 34.98  ? 184 ASN A N   1 
ATOM   1376  C CA  . ASN A 1 187 ? 53.115 28.732  25.619  1.00 36.54  ? 184 ASN A CA  1 
ATOM   1377  C C   . ASN A 1 187 ? 53.991 29.814  25.008  1.00 35.35  ? 184 ASN A C   1 
ATOM   1378  O O   . ASN A 1 187 ? 54.729 30.499  25.724  1.00 37.81  ? 184 ASN A O   1 
ATOM   1379  C CB  . ASN A 1 187 ? 51.854 29.367  26.221  1.00 35.51  ? 184 ASN A CB  1 
ATOM   1380  C CG  . ASN A 1 187 ? 50.607 28.544  25.976  1.00 46.32  ? 184 ASN A CG  1 
ATOM   1381  O OD1 . ASN A 1 187 ? 50.123 28.447  24.849  1.00 44.47  ? 184 ASN A OD1 1 
ATOM   1382  N ND2 . ASN A 1 187 ? 50.070 27.957  27.040  1.00 47.20  ? 184 ASN A ND2 1 
ATOM   1383  N N   . GLN A 1 188 ? 53.921 29.956  23.689  1.00 31.43  ? 185 GLN A N   1 
ATOM   1384  C CA  . GLN A 1 188 ? 54.569 31.067  23.007  1.00 34.94  ? 185 GLN A CA  1 
ATOM   1385  C C   . GLN A 1 188 ? 53.620 32.258  22.972  1.00 33.26  ? 185 GLN A C   1 
ATOM   1386  O O   . GLN A 1 188 ? 52.401 32.086  22.876  1.00 32.01  ? 185 GLN A O   1 
ATOM   1387  C CB  . GLN A 1 188 ? 54.985 30.675  21.586  1.00 32.26  ? 185 GLN A CB  1 
ATOM   1388  C CG  . GLN A 1 188 ? 56.122 29.662  21.525  1.00 41.13  ? 185 GLN A CG  1 
ATOM   1389  C CD  . GLN A 1 188 ? 56.860 29.681  20.195  1.00 47.07  ? 185 GLN A CD  1 
ATOM   1390  O OE1 . GLN A 1 188 ? 58.086 29.793  20.154  1.00 44.78  ? 185 GLN A OE1 1 
ATOM   1391  N NE2 . GLN A 1 188 ? 56.113 29.579  19.101  1.00 33.41  ? 185 GLN A NE2 1 
ATOM   1392  N N   . ASP A 1 189 ? 54.190 33.464  23.072  1.00 31.53  ? 186 ASP A N   1 
ATOM   1393  C CA  . ASP A 1 189 ? 53.389 34.686  23.034  1.00 31.22  ? 186 ASP A CA  1 
ATOM   1394  C C   . ASP A 1 189 ? 52.455 34.701  21.831  1.00 29.41  ? 186 ASP A C   1 
ATOM   1395  O O   . ASP A 1 189 ? 51.273 35.042  21.950  1.00 31.80  ? 186 ASP A O   1 
ATOM   1396  C CB  . ASP A 1 189 ? 54.302 35.912  22.997  1.00 31.40  ? 186 ASP A CB  1 
ATOM   1397  C CG  . ASP A 1 189 ? 54.892 36.247  24.347  1.00 38.51  ? 186 ASP A CG  1 
ATOM   1398  O OD1 . ASP A 1 189 ? 54.403 35.711  25.365  1.00 35.15  ? 186 ASP A OD1 1 
ATOM   1399  O OD2 . ASP A 1 189 ? 55.843 37.057  24.390  1.00 41.58  ? 186 ASP A OD2 1 
ATOM   1400  N N   . LYS A 1 190 ? 52.981 34.333  20.660  1.00 30.63  ? 187 LYS A N   1 
ATOM   1401  C CA  . LYS A 1 190 ? 52.202 34.363  19.426  1.00 32.13  ? 187 LYS A CA  1 
ATOM   1402  C C   . LYS A 1 190 ? 50.914 33.555  19.545  1.00 33.96  ? 187 LYS A C   1 
ATOM   1403  O O   . LYS A 1 190 ? 49.856 33.978  19.065  1.00 34.42  ? 187 LYS A O   1 
ATOM   1404  C CB  . LYS A 1 190 ? 53.055 33.836  18.273  1.00 32.55  ? 187 LYS A CB  1 
ATOM   1405  C CG  . LYS A 1 190 ? 52.306 33.648  16.970  1.00 35.54  ? 187 LYS A CG  1 
ATOM   1406  C CD  . LYS A 1 190 ? 51.987 34.974  16.304  1.00 38.72  ? 187 LYS A CD  1 
ATOM   1407  C CE  . LYS A 1 190 ? 51.275 34.751  14.974  1.00 47.35  ? 187 LYS A CE  1 
ATOM   1408  N NZ  . LYS A 1 190 ? 51.697 33.475  14.319  1.00 53.06  ? 187 LYS A NZ  1 
ATOM   1409  N N   . SER A 1 191 ? 50.987 32.385  20.178  1.00 30.36  ? 188 SER A N   1 
ATOM   1410  C CA  . SER A 1 191 ? 49.790 31.575  20.366  1.00 26.94  ? 188 SER A CA  1 
ATOM   1411  C C   . SER A 1 191 ? 48.815 32.251  21.322  1.00 34.34  ? 188 SER A C   1 
ATOM   1412  O O   . SER A 1 191 ? 47.595 32.184  21.127  1.00 33.07  ? 188 SER A O   1 
ATOM   1413  C CB  . SER A 1 191 ? 50.187 30.185  20.861  1.00 26.27  ? 188 SER A CB  1 
ATOM   1414  O OG  . SER A 1 191 ? 49.201 29.643  21.716  1.00 48.89  ? 188 SER A OG  1 
ATOM   1415  N N   . ILE A 1 192 ? 49.336 32.919  22.353  1.00 30.54  ? 189 ILE A N   1 
ATOM   1416  C CA  . ILE A 1 192 ? 48.489 33.715  23.238  1.00 30.97  ? 189 ILE A CA  1 
ATOM   1417  C C   . ILE A 1 192 ? 47.870 34.877  22.470  1.00 33.85  ? 189 ILE A C   1 
ATOM   1418  O O   . ILE A 1 192 ? 46.682 35.188  22.626  1.00 29.31  ? 189 ILE A O   1 
ATOM   1419  C CB  . ILE A 1 192 ? 49.298 34.213  24.449  1.00 35.43  ? 189 ILE A CB  1 
ATOM   1420  C CG1 . ILE A 1 192 ? 49.890 33.034  25.217  1.00 34.62  ? 189 ILE A CG1 1 
ATOM   1421  C CG2 . ILE A 1 192 ? 48.425 35.078  25.360  1.00 28.78  ? 189 ILE A CG2 1 
ATOM   1422  C CD1 . ILE A 1 192 ? 50.828 33.447  26.330  1.00 26.16  ? 189 ILE A CD1 1 
ATOM   1423  N N   . GLU A 1 193 ? 48.671 35.537  21.629  1.00 29.33  ? 190 GLU A N   1 
ATOM   1424  C CA  . GLU A 1 193 ? 48.169 36.665  20.849  1.00 31.76  ? 190 GLU A CA  1 
ATOM   1425  C C   . GLU A 1 193 ? 47.064 36.226  19.893  1.00 28.28  ? 190 GLU A C   1 
ATOM   1426  O O   . GLU A 1 193 ? 46.033 36.899  19.770  1.00 30.28  ? 190 GLU A O   1 
ATOM   1427  C CB  . GLU A 1 193 ? 49.321 37.326  20.089  1.00 29.66  ? 190 GLU A CB  1 
ATOM   1428  C CG  . GLU A 1 193 ? 50.358 38.004  20.983  1.00 30.32  ? 190 GLU A CG  1 
ATOM   1429  C CD  . GLU A 1 193 ? 51.655 38.319  20.252  1.00 35.60  ? 190 GLU A CD  1 
ATOM   1430  O OE1 . GLU A 1 193 ? 51.788 37.933  19.069  1.00 30.91  ? 190 GLU A OE1 1 
ATOM   1431  O OE2 . GLU A 1 193 ? 52.537 38.962  20.857  1.00 43.52  ? 190 GLU A OE2 1 
ATOM   1432  N N   . ASP A 1 194 ? 47.263 35.098  19.204  1.00 25.02  ? 191 ASP A N   1 
ATOM   1433  C CA  . ASP A 1 194 ? 46.220 34.568  18.327  1.00 33.97  ? 191 ASP A CA  1 
ATOM   1434  C C   . ASP A 1 194 ? 44.936 34.297  19.101  1.00 29.94  ? 191 ASP A C   1 
ATOM   1435  O O   . ASP A 1 194 ? 43.836 34.600  18.624  1.00 26.98  ? 191 ASP A O   1 
ATOM   1436  C CB  . ASP A 1 194 ? 46.698 33.284  17.648  1.00 28.79  ? 191 ASP A CB  1 
ATOM   1437  C CG  . ASP A 1 194 ? 47.800 33.527  16.638  1.00 32.26  ? 191 ASP A CG  1 
ATOM   1438  O OD1 . ASP A 1 194 ? 48.009 34.691  16.238  1.00 29.33  ? 191 ASP A OD1 1 
ATOM   1439  O OD2 . ASP A 1 194 ? 48.455 32.541  16.239  1.00 38.36  ? 191 ASP A OD2 1 
ATOM   1440  N N   . PHE A 1 195 ? 45.064 33.715  20.296  1.00 27.57  ? 192 PHE A N   1 
ATOM   1441  C CA  . PHE A 1 195 ? 43.911 33.465  21.153  1.00 32.04  ? 192 PHE A CA  1 
ATOM   1442  C C   . PHE A 1 195 ? 43.165 34.759  21.458  1.00 32.02  ? 192 PHE A C   1 
ATOM   1443  O O   . PHE A 1 195 ? 41.928 34.791  21.451  1.00 24.26  ? 192 PHE A O   1 
ATOM   1444  C CB  . PHE A 1 195 ? 44.392 32.783  22.434  1.00 31.03  ? 192 PHE A CB  1 
ATOM   1445  C CG  . PHE A 1 195 ? 43.302 32.406  23.397  1.00 32.04  ? 192 PHE A CG  1 
ATOM   1446  C CD1 . PHE A 1 195 ? 42.030 32.073  22.966  1.00 26.02  ? 192 PHE A CD1 1 
ATOM   1447  C CD2 . PHE A 1 195 ? 43.574 32.371  24.757  1.00 32.65  ? 192 PHE A CD2 1 
ATOM   1448  C CE1 . PHE A 1 195 ? 41.046 31.722  23.877  1.00 30.55  ? 192 PHE A CE1 1 
ATOM   1449  C CE2 . PHE A 1 195 ? 42.601 32.024  25.668  1.00 29.27  ? 192 PHE A CE2 1 
ATOM   1450  C CZ  . PHE A 1 195 ? 41.335 31.698  25.231  1.00 29.71  ? 192 PHE A CZ  1 
ATOM   1451  N N   . ALA A 1 196 ? 43.901 35.844  21.706  1.00 25.33  ? 193 ALA A N   1 
ATOM   1452  C CA  . ALA A 1 196 ? 43.260 37.131  21.961  1.00 29.70  ? 193 ALA A CA  1 
ATOM   1453  C C   . ALA A 1 196 ? 42.523 37.633  20.725  1.00 30.64  ? 193 ALA A C   1 
ATOM   1454  O O   . ALA A 1 196 ? 41.345 38.003  20.800  1.00 28.19  ? 193 ALA A O   1 
ATOM   1455  C CB  . ALA A 1 196 ? 44.297 38.156  22.420  1.00 26.26  ? 193 ALA A CB  1 
ATOM   1456  N N   . HIS A 1 197 ? 43.201 37.643  19.574  1.00 28.19  ? 194 HIS A N   1 
ATOM   1457  C CA  . HIS A 1 197 ? 42.595 38.187  18.361  1.00 30.32  ? 194 HIS A CA  1 
ATOM   1458  C C   . HIS A 1 197 ? 41.329 37.427  17.983  1.00 29.52  ? 194 HIS A C   1 
ATOM   1459  O O   . HIS A 1 197 ? 40.293 38.036  17.700  1.00 27.41  ? 194 HIS A O   1 
ATOM   1460  C CB  . HIS A 1 197 ? 43.603 38.172  17.213  1.00 26.51  ? 194 HIS A CB  1 
ATOM   1461  C CG  . HIS A 1 197 ? 44.551 39.330  17.230  1.00 27.18  ? 194 HIS A CG  1 
ATOM   1462  N ND1 . HIS A 1 197 ? 44.170 40.604  16.872  1.00 28.39  ? 194 HIS A ND1 1 
ATOM   1463  C CD2 . HIS A 1 197 ? 45.861 39.409  17.565  1.00 31.48  ? 194 HIS A CD2 1 
ATOM   1464  C CE1 . HIS A 1 197 ? 45.203 41.420  16.985  1.00 30.40  ? 194 HIS A CE1 1 
ATOM   1465  N NE2 . HIS A 1 197 ? 46.242 40.719  17.402  1.00 33.24  ? 194 HIS A NE2 1 
ATOM   1466  N N   . SER A 1 198 ? 41.390 36.092  17.986  1.00 30.92  ? 195 SER A N   1 
ATOM   1467  C CA  . SER A 1 198 ? 40.194 35.303  17.712  1.00 30.45  ? 195 SER A CA  1 
ATOM   1468  C C   . SER A 1 198 ? 39.077 35.638  18.693  1.00 32.63  ? 195 SER A C   1 
ATOM   1469  O O   . SER A 1 198 ? 37.910 35.758  18.300  1.00 27.72  ? 195 SER A O   1 
ATOM   1470  C CB  . SER A 1 198 ? 40.522 33.812  17.766  1.00 29.05  ? 195 SER A CB  1 
ATOM   1471  O OG  . SER A 1 198 ? 41.533 33.475  16.834  1.00 30.73  ? 195 SER A OG  1 
ATOM   1472  N N   . SER A 1 199 ? 39.418 35.803  19.973  1.00 26.07  ? 196 SER A N   1 
ATOM   1473  C CA  . SER A 1 199 ? 38.406 36.114  20.978  1.00 29.68  ? 196 SER A CA  1 
ATOM   1474  C C   . SER A 1 199 ? 37.791 37.486  20.728  1.00 31.71  ? 196 SER A C   1 
ATOM   1475  O O   . SER A 1 199 ? 36.567 37.651  20.791  1.00 29.15  ? 196 SER A O   1 
ATOM   1476  C CB  . SER A 1 199 ? 39.021 36.046  22.375  1.00 26.66  ? 196 SER A CB  1 
ATOM   1477  O OG  . SER A 1 199 ? 39.460 34.734  22.676  1.00 27.73  ? 196 SER A OG  1 
ATOM   1478  N N   . PHE A 1 200 ? 38.630 38.484  20.440  1.00 28.78  ? 197 PHE A N   1 
ATOM   1479  C CA  . PHE A 1 200 ? 38.113 39.819  20.152  1.00 30.92  ? 197 PHE A CA  1 
ATOM   1480  C C   . PHE A 1 200 ? 37.308 39.832  18.858  1.00 34.18  ? 197 PHE A C   1 
ATOM   1481  O O   . PHE A 1 200 ? 36.246 40.464  18.788  1.00 32.86  ? 197 PHE A O   1 
ATOM   1482  C CB  . PHE A 1 200 ? 39.261 40.828  20.082  1.00 31.15  ? 197 PHE A CB  1 
ATOM   1483  C CG  . PHE A 1 200 ? 39.963 41.041  21.395  1.00 29.16  ? 197 PHE A CG  1 
ATOM   1484  C CD1 . PHE A 1 200 ? 39.247 41.355  22.540  1.00 33.35  ? 197 PHE A CD1 1 
ATOM   1485  C CD2 . PHE A 1 200 ? 41.340 40.922  21.483  1.00 24.88  ? 197 PHE A CD2 1 
ATOM   1486  C CE1 . PHE A 1 200 ? 39.895 41.546  23.750  1.00 30.66  ? 197 PHE A CE1 1 
ATOM   1487  C CE2 . PHE A 1 200 ? 41.993 41.108  22.683  1.00 24.07  ? 197 PHE A CE2 1 
ATOM   1488  C CZ  . PHE A 1 200 ? 41.272 41.421  23.820  1.00 30.68  ? 197 PHE A CZ  1 
ATOM   1489  N N   . GLN A 1 201 ? 37.796 39.142  17.822  1.00 34.45  ? 198 GLN A N   1 
ATOM   1490  C CA  . GLN A 1 201 ? 37.051 39.071  16.568  1.00 35.14  ? 198 GLN A CA  1 
ATOM   1491  C C   . GLN A 1 201 ? 35.704 38.388  16.771  1.00 37.41  ? 198 GLN A C   1 
ATOM   1492  O O   . GLN A 1 201 ? 34.700 38.781  16.163  1.00 34.55  ? 198 GLN A O   1 
ATOM   1493  C CB  . GLN A 1 201 ? 37.871 38.332  15.508  1.00 34.79  ? 198 GLN A CB  1 
ATOM   1494  C CG  . GLN A 1 201 ? 39.155 39.031  15.078  1.00 33.15  ? 198 GLN A CG  1 
ATOM   1495  C CD  . GLN A 1 201 ? 38.933 40.115  14.047  1.00 40.14  ? 198 GLN A CD  1 
ATOM   1496  O OE1 . GLN A 1 201 ? 37.803 40.389  13.645  1.00 52.09  ? 198 GLN A OE1 1 
ATOM   1497  N NE2 . GLN A 1 201 ? 40.020 40.734  13.602  1.00 43.68  ? 198 GLN A NE2 1 
ATOM   1498  N N   . MET A 1 202 ? 35.662 37.365  17.629  1.00 32.00  ? 199 MET A N   1 
ATOM   1499  C CA  . MET A 1 202 ? 34.406 36.673  17.900  1.00 26.59  ? 199 MET A CA  1 
ATOM   1500  C C   . MET A 1 202 ? 33.408 37.587  18.599  1.00 35.97  ? 199 MET A C   1 
ATOM   1501  O O   . MET A 1 202 ? 32.215 37.580  18.275  1.00 35.49  ? 199 MET A O   1 
ATOM   1502  C CB  . MET A 1 202 ? 34.667 35.423  18.739  1.00 29.04  ? 199 MET A CB  1 
ATOM   1503  C CG  . MET A 1 202 ? 33.406 34.692  19.162  1.00 36.87  ? 199 MET A CG  1 
ATOM   1504  S SD  . MET A 1 202 ? 32.371 34.224  17.763  1.00 46.41  ? 199 MET A SD  1 
ATOM   1505  C CE  . MET A 1 202 ? 32.798 32.503  17.604  1.00 35.37  ? 199 MET A CE  1 
ATOM   1506  N N   . ALA A 1 203 ? 33.878 38.386  19.560  1.00 28.55  ? 200 ALA A N   1 
ATOM   1507  C CA  . ALA A 1 203 ? 32.977 39.279  20.282  1.00 34.33  ? 200 ALA A CA  1 
ATOM   1508  C C   . ALA A 1 203 ? 32.422 40.363  19.365  1.00 32.83  ? 200 ALA A C   1 
ATOM   1509  O O   . ALA A 1 203 ? 31.230 40.685  19.428  1.00 34.34  ? 200 ALA A O   1 
ATOM   1510  C CB  . ALA A 1 203 ? 33.700 39.903  21.476  1.00 29.86  ? 200 ALA A CB  1 
ATOM   1511  N N   . LEU A 1 204 ? 33.268 40.931  18.502  1.00 36.21  ? 201 LEU A N   1 
ATOM   1512  C CA  . LEU A 1 204 ? 32.810 41.969  17.585  1.00 39.37  ? 201 LEU A CA  1 
ATOM   1513  C C   . LEU A 1 204 ? 31.851 41.406  16.544  1.00 40.26  ? 201 LEU A C   1 
ATOM   1514  O O   . LEU A 1 204 ? 30.882 42.071  16.159  1.00 42.13  ? 201 LEU A O   1 
ATOM   1515  C CB  . LEU A 1 204 ? 34.009 42.621  16.903  1.00 35.86  ? 201 LEU A CB  1 
ATOM   1516  C CG  . LEU A 1 204 ? 34.861 43.537  17.775  1.00 39.43  ? 201 LEU A CG  1 
ATOM   1517  C CD1 . LEU A 1 204 ? 36.126 43.920  17.036  1.00 36.08  ? 201 LEU A CD1 1 
ATOM   1518  C CD2 . LEU A 1 204 ? 34.076 44.778  18.173  1.00 37.89  ? 201 LEU A CD2 1 
ATOM   1519  N N   . SER A 1 205 ? 32.111 40.184  16.074  1.00 38.18  ? 202 SER A N   1 
ATOM   1520  C CA  . SER A 1 205 ? 31.223 39.565  15.097  1.00 38.62  ? 202 SER A CA  1 
ATOM   1521  C C   . SER A 1 205 ? 29.850 39.292  15.699  1.00 38.89  ? 202 SER A C   1 
ATOM   1522  O O   . SER A 1 205 ? 28.823 39.486  15.039  1.00 36.88  ? 202 SER A O   1 
ATOM   1523  C CB  . SER A 1 205 ? 31.848 38.273  14.572  1.00 40.59  ? 202 SER A CB  1 
ATOM   1524  O OG  . SER A 1 205 ? 30.877 37.459  13.939  1.00 48.26  ? 202 SER A OG  1 
ATOM   1525  N N   . LYS A 1 206 ? 29.813 38.855  16.956  1.00 42.75  ? 203 LYS A N   1 
ATOM   1526  C CA  . LYS A 1 206 ? 28.562 38.542  17.633  1.00 41.02  ? 203 LYS A CA  1 
ATOM   1527  C C   . LYS A 1 206 ? 27.916 39.753  18.292  1.00 41.98  ? 203 LYS A C   1 
ATOM   1528  O O   . LYS A 1 206 ? 26.718 39.705  18.600  1.00 39.43  ? 203 LYS A O   1 
ATOM   1529  C CB  . LYS A 1 206 ? 28.799 37.464  18.695  1.00 38.30  ? 203 LYS A CB  1 
ATOM   1530  C CG  . LYS A 1 206 ? 28.401 36.062  18.271  1.00 46.93  ? 203 LYS A CG  1 
ATOM   1531  C CD  . LYS A 1 206 ? 26.900 35.860  18.365  1.00 40.42  ? 203 LYS A CD  1 
ATOM   1532  C CE  . LYS A 1 206 ? 26.499 34.498  17.825  1.00 56.46  ? 203 LYS A CE  1 
ATOM   1533  N NZ  . LYS A 1 206 ? 25.029 34.281  17.910  1.00 52.78  ? 203 LYS A NZ  1 
ATOM   1534  N N   . GLY A 1 207 ? 28.669 40.828  18.516  1.00 39.45  ? 204 GLY A N   1 
ATOM   1535  C CA  . GLY A 1 207 ? 28.135 41.970  19.235  1.00 32.45  ? 204 GLY A CA  1 
ATOM   1536  C C   . GLY A 1 207 ? 27.873 41.704  20.701  1.00 40.51  ? 204 GLY A C   1 
ATOM   1537  O O   . GLY A 1 207 ? 26.930 42.264  21.267  1.00 35.81  ? 204 GLY A O   1 
ATOM   1538  N N   . TRP A 1 208 ? 28.684 40.856  21.334  1.00 31.56  ? 205 TRP A N   1 
ATOM   1539  C CA  . TRP A 1 208 ? 28.518 40.488  22.730  1.00 29.61  ? 205 TRP A CA  1 
ATOM   1540  C C   . TRP A 1 208 ? 29.784 40.802  23.519  1.00 33.25  ? 205 TRP A C   1 
ATOM   1541  O O   . TRP A 1 208 ? 30.885 40.810  22.958  1.00 31.40  ? 205 TRP A O   1 
ATOM   1542  C CB  . TRP A 1 208 ? 28.193 38.995  22.875  1.00 32.00  ? 205 TRP A CB  1 
ATOM   1543  C CG  . TRP A 1 208 ? 26.809 38.620  22.437  1.00 35.20  ? 205 TRP A CG  1 
ATOM   1544  C CD1 . TRP A 1 208 ? 25.821 39.465  22.023  1.00 39.41  ? 205 TRP A CD1 1 
ATOM   1545  C CD2 . TRP A 1 208 ? 26.258 37.298  22.379  1.00 32.63  ? 205 TRP A CD2 1 
ATOM   1546  N NE1 . TRP A 1 208 ? 24.690 38.751  21.706  1.00 38.82  ? 205 TRP A NE1 1 
ATOM   1547  C CE2 . TRP A 1 208 ? 24.932 37.419  21.916  1.00 39.42  ? 205 TRP A CE2 1 
ATOM   1548  C CE3 . TRP A 1 208 ? 26.757 36.025  22.672  1.00 36.54  ? 205 TRP A CE3 1 
ATOM   1549  C CZ2 . TRP A 1 208 ? 24.098 36.313  21.740  1.00 41.93  ? 205 TRP A CZ2 1 
ATOM   1550  C CZ3 . TRP A 1 208 ? 25.927 34.927  22.496  1.00 37.79  ? 205 TRP A CZ3 1 
ATOM   1551  C CH2 . TRP A 1 208 ? 24.613 35.079  22.034  1.00 36.65  ? 205 TRP A CH2 1 
ATOM   1552  N N   . PRO A 1 209 ? 29.660 41.068  24.818  1.00 26.70  ? 206 PRO A N   1 
ATOM   1553  C CA  . PRO A 1 209 ? 30.852 41.310  25.638  1.00 25.49  ? 206 PRO A CA  1 
ATOM   1554  C C   . PRO A 1 209 ? 31.701 40.056  25.773  1.00 30.21  ? 206 PRO A C   1 
ATOM   1555  O O   . PRO A 1 209 ? 31.251 38.932  25.537  1.00 29.08  ? 206 PRO A O   1 
ATOM   1556  C CB  . PRO A 1 209 ? 30.273 41.738  26.991  1.00 30.64  ? 206 PRO A CB  1 
ATOM   1557  C CG  . PRO A 1 209 ? 28.904 41.136  27.018  1.00 28.74  ? 206 PRO A CG  1 
ATOM   1558  C CD  . PRO A 1 209 ? 28.419 41.218  25.597  1.00 27.42  ? 206 PRO A CD  1 
ATOM   1559  N N   . LEU A 1 210 ? 32.958 40.267  26.163  1.00 31.99  ? 207 LEU A N   1 
ATOM   1560  C CA  . LEU A 1 210 ? 33.948 39.201  26.226  1.00 29.94  ? 207 LEU A CA  1 
ATOM   1561  C C   . LEU A 1 210 ? 34.576 39.168  27.611  1.00 30.20  ? 207 LEU A C   1 
ATOM   1562  O O   . LEU A 1 210 ? 34.927 40.216  28.163  1.00 33.68  ? 207 LEU A O   1 
ATOM   1563  C CB  . LEU A 1 210 ? 35.037 39.390  25.162  1.00 24.83  ? 207 LEU A CB  1 
ATOM   1564  C CG  . LEU A 1 210 ? 36.267 38.488  25.289  1.00 34.77  ? 207 LEU A CG  1 
ATOM   1565  C CD1 . LEU A 1 210 ? 35.898 37.022  25.076  1.00 28.24  ? 207 LEU A CD1 1 
ATOM   1566  C CD2 . LEU A 1 210 ? 37.367 38.917  24.326  1.00 25.42  ? 207 LEU A CD2 1 
ATOM   1567  N N   . TYR A 1 211 ? 34.719 37.964  28.161  1.00 31.41  ? 208 TYR A N   1 
ATOM   1568  C CA  . TYR A 1 211 ? 35.406 37.737  29.424  1.00 31.01  ? 208 TYR A CA  1 
ATOM   1569  C C   . TYR A 1 211 ? 36.498 36.695  29.240  1.00 26.30  ? 208 TYR A C   1 
ATOM   1570  O O   . TYR A 1 211 ? 36.292 35.670  28.582  1.00 28.53  ? 208 TYR A O   1 
ATOM   1571  C CB  . TYR A 1 211 ? 34.442 37.277  30.520  1.00 26.69  ? 208 TYR A CB  1 
ATOM   1572  C CG  . TYR A 1 211 ? 33.350 38.270  30.813  1.00 28.93  ? 208 TYR A CG  1 
ATOM   1573  C CD1 . TYR A 1 211 ? 33.558 39.313  31.706  1.00 29.68  ? 208 TYR A CD1 1 
ATOM   1574  C CD2 . TYR A 1 211 ? 32.114 38.175  30.190  1.00 27.23  ? 208 TYR A CD2 1 
ATOM   1575  C CE1 . TYR A 1 211 ? 32.564 40.231  31.973  1.00 32.37  ? 208 TYR A CE1 1 
ATOM   1576  C CE2 . TYR A 1 211 ? 31.112 39.087  30.451  1.00 32.94  ? 208 TYR A CE2 1 
ATOM   1577  C CZ  . TYR A 1 211 ? 31.343 40.113  31.343  1.00 32.79  ? 208 TYR A CZ  1 
ATOM   1578  O OH  . TYR A 1 211 ? 30.348 41.024  31.605  1.00 41.63  ? 208 TYR A OH  1 
ATOM   1579  N N   . LEU A 1 212 ? 37.660 36.971  29.821  1.00 29.44  ? 209 LEU A N   1 
ATOM   1580  C CA  . LEU A 1 212 ? 38.759 36.021  29.899  1.00 28.30  ? 209 LEU A CA  1 
ATOM   1581  C C   . LEU A 1 212 ? 38.905 35.571  31.344  1.00 30.51  ? 209 LEU A C   1 
ATOM   1582  O O   . LEU A 1 212 ? 39.020 36.405  32.249  1.00 28.63  ? 209 LEU A O   1 
ATOM   1583  C CB  . LEU A 1 212 ? 40.068 36.644  29.410  1.00 25.46  ? 209 LEU A CB  1 
ATOM   1584  C CG  . LEU A 1 212 ? 41.328 35.844  29.753  1.00 30.99  ? 209 LEU A CG  1 
ATOM   1585  C CD1 . LEU A 1 212 ? 41.344 34.520  28.997  1.00 34.27  ? 209 LEU A CD1 1 
ATOM   1586  C CD2 . LEU A 1 212 ? 42.597 36.650  29.489  1.00 30.47  ? 209 LEU A CD2 1 
ATOM   1587  N N   . SER A 1 213 ? 38.892 34.259  31.560  1.00 26.38  ? 210 SER A N   1 
ATOM   1588  C CA  . SER A 1 213 ? 39.093 33.690  32.883  1.00 27.65  ? 210 SER A CA  1 
ATOM   1589  C C   . SER A 1 213 ? 40.473 33.053  32.972  1.00 32.10  ? 210 SER A C   1 
ATOM   1590  O O   . SER A 1 213 ? 40.907 32.355  32.051  1.00 27.29  ? 210 SER A O   1 
ATOM   1591  C CB  . SER A 1 213 ? 38.009 32.660  33.213  1.00 28.87  ? 210 SER A CB  1 
ATOM   1592  O OG  . SER A 1 213 ? 38.104 31.520  32.379  1.00 36.93  ? 210 SER A OG  1 
ATOM   1593  N N   . THR A 1 214 ? 41.173 33.326  34.074  1.00 26.75  ? 211 THR A N   1 
ATOM   1594  C CA  . THR A 1 214 ? 42.463 32.712  34.364  1.00 31.55  ? 211 THR A CA  1 
ATOM   1595  C C   . THR A 1 214 ? 42.518 32.347  35.841  1.00 33.03  ? 211 THR A C   1 
ATOM   1596  O O   . THR A 1 214 ? 41.607 32.651  36.618  1.00 24.27  ? 211 THR A O   1 
ATOM   1597  C CB  . THR A 1 214 ? 43.647 33.635  34.028  1.00 31.67  ? 211 THR A CB  1 
ATOM   1598  O OG1 . THR A 1 214 ? 43.692 34.716  34.967  1.00 33.13  ? 211 THR A OG1 1 
ATOM   1599  C CG2 . THR A 1 214 ? 43.547 34.193  32.613  1.00 26.41  ? 211 THR A CG2 1 
ATOM   1600  N N   . LYS A 1 215 ? 43.612 31.688  36.219  1.00 27.99  ? 212 LYS A N   1 
ATOM   1601  C CA  . LYS A 1 215 ? 43.949 31.449  37.615  1.00 36.69  ? 212 LYS A CA  1 
ATOM   1602  C C   . LYS A 1 215 ? 45.206 32.240  37.956  1.00 32.15  ? 212 LYS A C   1 
ATOM   1603  O O   . LYS A 1 215 ? 46.184 31.682  38.464  1.00 30.38  ? 212 LYS A O   1 
ATOM   1604  C CB  . LYS A 1 215 ? 44.155 29.951  37.868  1.00 34.72  ? 212 LYS A CB  1 
ATOM   1605  C CG  . LYS A 1 215 ? 44.099 29.532  39.330  1.00 37.69  ? 212 LYS A CG  1 
ATOM   1606  C CD  . LYS A 1 215 ? 42.704 29.683  39.904  1.00 46.26  ? 212 LYS A CD  1 
ATOM   1607  C CE  . LYS A 1 215 ? 42.625 29.095  41.305  1.00 50.68  ? 212 LYS A CE  1 
ATOM   1608  N NZ  . LYS A 1 215 ? 41.219 28.986  41.784  1.00 47.23  ? 212 LYS A NZ  1 
ATOM   1609  N N   . ASN A 1 216 ? 45.197 33.542  37.662  1.00 29.49  ? 213 ASN A N   1 
ATOM   1610  C CA  . ASN A 1 216 ? 46.388 34.361  37.856  1.00 35.72  ? 213 ASN A CA  1 
ATOM   1611  C C   . ASN A 1 216 ? 46.667 34.665  39.324  1.00 37.34  ? 213 ASN A C   1 
ATOM   1612  O O   . ASN A 1 216 ? 47.700 35.275  39.623  1.00 35.77  ? 213 ASN A O   1 
ATOM   1613  C CB  . ASN A 1 216 ? 46.273 35.663  37.063  1.00 35.09  ? 213 ASN A CB  1 
ATOM   1614  C CG  . ASN A 1 216 ? 45.222 36.598  37.626  1.00 36.73  ? 213 ASN A CG  1 
ATOM   1615  O OD1 . ASN A 1 216 ? 44.208 36.160  38.170  1.00 36.20  ? 213 ASN A OD1 1 
ATOM   1616  N ND2 . ASN A 1 216 ? 45.461 37.898  37.498  1.00 42.30  ? 213 ASN A ND2 1 
ATOM   1617  N N   . THR A 1 217 ? 45.778 34.268  40.240  1.00 34.71  ? 214 THR A N   1 
ATOM   1618  C CA  . THR A 1 217 ? 46.124 34.305  41.656  1.00 42.29  ? 214 THR A CA  1 
ATOM   1619  C C   . THR A 1 217 ? 47.148 33.232  41.997  1.00 41.98  ? 214 THR A C   1 
ATOM   1620  O O   . THR A 1 217 ? 47.949 33.407  42.921  1.00 45.50  ? 214 THR A O   1 
ATOM   1621  C CB  . THR A 1 217 ? 44.876 34.111  42.515  1.00 36.79  ? 214 THR A CB  1 
ATOM   1622  O OG1 . THR A 1 217 ? 44.154 32.965  42.044  1.00 45.66  ? 214 THR A OG1 1 
ATOM   1623  C CG2 . THR A 1 217 ? 43.978 35.332  42.437  1.00 35.83  ? 214 THR A CG2 1 
ATOM   1624  N N   . ILE A 1 218 ? 47.126 32.119  41.270  1.00 40.97  ? 215 ILE A N   1 
ATOM   1625  C CA  . ILE A 1 218 ? 48.007 30.982  41.517  1.00 39.83  ? 215 ILE A CA  1 
ATOM   1626  C C   . ILE A 1 218 ? 49.148 30.947  40.506  1.00 38.77  ? 215 ILE A C   1 
ATOM   1627  O O   . ILE A 1 218 ? 50.322 30.971  40.878  1.00 34.61  ? 215 ILE A O   1 
ATOM   1628  C CB  . ILE A 1 218 ? 47.211 29.657  41.507  1.00 44.99  ? 215 ILE A CB  1 
ATOM   1629  C CG1 . ILE A 1 218 ? 46.084 29.699  42.541  1.00 42.43  ? 215 ILE A CG1 1 
ATOM   1630  C CG2 . ILE A 1 218 ? 48.133 28.475  41.759  1.00 44.57  ? 215 ILE A CG2 1 
ATOM   1631  C CD1 . ILE A 1 218 ? 46.530 30.096  43.935  1.00 48.21  ? 215 ILE A CD1 1 
ATOM   1632  N N   . LEU A 1 219 ? 48.820 30.887  39.216  1.00 34.44  ? 216 LEU A N   1 
ATOM   1633  C CA  . LEU A 1 219 ? 49.815 30.951  38.147  1.00 33.69  ? 216 LEU A CA  1 
ATOM   1634  C C   . LEU A 1 219 ? 50.047 32.419  37.785  1.00 33.75  ? 216 LEU A C   1 
ATOM   1635  O O   . LEU A 1 219 ? 49.637 32.915  36.733  1.00 32.95  ? 216 LEU A O   1 
ATOM   1636  C CB  . LEU A 1 219 ? 49.352 30.131  36.949  1.00 33.35  ? 216 LEU A CB  1 
ATOM   1637  C CG  . LEU A 1 219 ? 48.971 28.675  37.241  1.00 39.47  ? 216 LEU A CG  1 
ATOM   1638  C CD1 . LEU A 1 219 ? 48.296 28.027  36.038  1.00 39.02  ? 216 LEU A CD1 1 
ATOM   1639  C CD2 . LEU A 1 219 ? 50.182 27.860  37.675  1.00 38.25  ? 216 LEU A CD2 1 
ATOM   1640  N N   . LYS A 1 220 ? 50.722 33.117  38.706  1.00 32.27  ? 217 LYS A N   1 
ATOM   1641  C CA  . LYS A 1 220 ? 50.868 34.567  38.591  1.00 32.58  ? 217 LYS A CA  1 
ATOM   1642  C C   . LYS A 1 220 ? 51.616 34.959  37.324  1.00 28.41  ? 217 LYS A C   1 
ATOM   1643  O O   . LYS A 1 220 ? 51.291 35.969  36.691  1.00 35.94  ? 217 LYS A O   1 
ATOM   1644  C CB  . LYS A 1 220 ? 51.588 35.128  39.816  1.00 37.10  ? 217 LYS A CB  1 
ATOM   1645  C CG  . LYS A 1 220 ? 50.871 34.937  41.144  1.00 43.95  ? 217 LYS A CG  1 
ATOM   1646  C CD  . LYS A 1 220 ? 51.525 35.819  42.200  1.00 43.71  ? 217 LYS A CD  1 
ATOM   1647  C CE  . LYS A 1 220 ? 50.798 35.760  43.530  1.00 52.21  ? 217 LYS A CE  1 
ATOM   1648  N NZ  . LYS A 1 220 ? 51.091 34.498  44.258  1.00 58.52  ? 217 LYS A NZ  1 
ATOM   1649  N N   . LYS A 1 221 ? 52.624 34.179  36.941  1.00 29.00  ? 218 LYS A N   1 
ATOM   1650  C CA  . LYS A 1 221 ? 53.393 34.482  35.741  1.00 32.27  ? 218 LYS A CA  1 
ATOM   1651  C C   . LYS A 1 221 ? 52.738 33.897  34.498  1.00 31.37  ? 218 LYS A C   1 
ATOM   1652  O O   . LYS A 1 221 ? 52.519 34.610  33.512  1.00 33.27  ? 218 LYS A O   1 
ATOM   1653  C CB  . LYS A 1 221 ? 54.821 33.947  35.881  1.00 30.12  ? 218 LYS A CB  1 
ATOM   1654  C CG  . LYS A 1 221 ? 55.446 34.212  37.236  1.00 35.81  ? 218 LYS A CG  1 
ATOM   1655  C CD  . LYS A 1 221 ? 55.475 35.692  37.559  1.00 41.86  ? 218 LYS A CD  1 
ATOM   1656  C CE  . LYS A 1 221 ? 56.860 36.112  38.002  1.00 54.20  ? 218 LYS A CE  1 
ATOM   1657  N NZ  . LYS A 1 221 ? 57.731 36.343  36.825  1.00 55.51  ? 218 LYS A NZ  1 
ATOM   1658  N N   . TYR A 1 222 ? 52.414 32.603  34.545  1.00 31.41  ? 219 TYR A N   1 
ATOM   1659  C CA  . TYR A 1 222 ? 51.864 31.916  33.383  1.00 28.21  ? 219 TYR A CA  1 
ATOM   1660  C C   . TYR A 1 222 ? 50.540 32.534  32.947  1.00 33.44  ? 219 TYR A C   1 
ATOM   1661  O O   . TYR A 1 222 ? 50.376 32.925  31.785  1.00 34.42  ? 219 TYR A O   1 
ATOM   1662  C CB  . TYR A 1 222 ? 51.689 30.435  33.710  1.00 31.61  ? 219 TYR A CB  1 
ATOM   1663  C CG  . TYR A 1 222 ? 51.687 29.522  32.511  1.00 33.39  ? 219 TYR A CG  1 
ATOM   1664  C CD1 . TYR A 1 222 ? 50.551 29.378  31.727  1.00 31.96  ? 219 TYR A CD1 1 
ATOM   1665  C CD2 . TYR A 1 222 ? 52.819 28.793  32.168  1.00 29.05  ? 219 TYR A CD2 1 
ATOM   1666  C CE1 . TYR A 1 222 ? 50.541 28.541  30.633  1.00 32.41  ? 219 TYR A CE1 1 
ATOM   1667  C CE2 . TYR A 1 222 ? 52.820 27.952  31.077  1.00 29.78  ? 219 TYR A CE2 1 
ATOM   1668  C CZ  . TYR A 1 222 ? 51.677 27.829  30.312  1.00 35.11  ? 219 TYR A CZ  1 
ATOM   1669  O OH  . TYR A 1 222 ? 51.667 26.994  29.221  1.00 34.08  ? 219 TYR A OH  1 
ATOM   1670  N N   . ASP A 1 223 ? 49.584 32.643  33.874  1.00 28.56  ? 220 ASP A N   1 
ATOM   1671  C CA  . ASP A 1 223 ? 48.267 33.162  33.522  1.00 29.50  ? 220 ASP A CA  1 
ATOM   1672  C C   . ASP A 1 223 ? 48.246 34.682  33.442  1.00 35.32  ? 220 ASP A C   1 
ATOM   1673  O O   . ASP A 1 223 ? 47.424 35.245  32.708  1.00 33.22  ? 220 ASP A O   1 
ATOM   1674  C CB  . ASP A 1 223 ? 47.222 32.678  34.526  1.00 28.69  ? 220 ASP A CB  1 
ATOM   1675  C CG  . ASP A 1 223 ? 46.766 31.262  34.249  1.00 33.44  ? 220 ASP A CG  1 
ATOM   1676  O OD1 . ASP A 1 223 ? 47.448 30.561  33.470  1.00 33.29  ? 220 ASP A OD1 1 
ATOM   1677  O OD2 . ASP A 1 223 ? 45.726 30.852  34.806  1.00 34.35  ? 220 ASP A OD2 1 
ATOM   1678  N N   . GLY A 1 224 ? 49.121 35.364  34.190  1.00 34.67  ? 221 GLY A N   1 
ATOM   1679  C CA  . GLY A 1 224 ? 49.208 36.810  34.065  1.00 34.43  ? 221 GLY A CA  1 
ATOM   1680  C C   . GLY A 1 224 ? 49.604 37.252  32.671  1.00 34.83  ? 221 GLY A C   1 
ATOM   1681  O O   . GLY A 1 224 ? 49.182 38.316  32.206  1.00 31.94  ? 221 GLY A O   1 
ATOM   1682  N N   . ARG A 1 225 ? 50.412 36.440  31.983  1.00 32.10  ? 222 ARG A N   1 
ATOM   1683  C CA  . ARG A 1 225 ? 50.776 36.738  30.604  1.00 32.65  ? 222 ARG A CA  1 
ATOM   1684  C C   . ARG A 1 225 ? 49.559 36.725  29.692  1.00 32.98  ? 222 ARG A C   1 
ATOM   1685  O O   . ARG A 1 225 ? 49.471 37.537  28.763  1.00 36.77  ? 222 ARG A O   1 
ATOM   1686  C CB  . ARG A 1 225 ? 51.815 35.733  30.114  1.00 33.66  ? 222 ARG A CB  1 
ATOM   1687  C CG  . ARG A 1 225 ? 52.480 36.092  28.800  1.00 36.69  ? 222 ARG A CG  1 
ATOM   1688  C CD  . ARG A 1 225 ? 53.290 37.362  28.939  1.00 40.21  ? 222 ARG A CD  1 
ATOM   1689  N NE  . ARG A 1 225 ? 54.672 37.176  28.514  1.00 40.97  ? 222 ARG A NE  1 
ATOM   1690  C CZ  . ARG A 1 225 ? 55.201 37.729  27.429  1.00 54.28  ? 222 ARG A CZ  1 
ATOM   1691  N NH1 . ARG A 1 225 ? 54.459 38.507  26.652  1.00 50.09  ? 222 ARG A NH1 1 
ATOM   1692  N NH2 . ARG A 1 225 ? 56.472 37.505  27.119  1.00 44.57  ? 222 ARG A NH2 1 
ATOM   1693  N N   . PHE A 1 226 ? 48.617 35.811  29.936  1.00 27.90  ? 223 PHE A N   1 
ATOM   1694  C CA  . PHE A 1 226 ? 47.378 35.803  29.165  1.00 32.91  ? 223 PHE A CA  1 
ATOM   1695  C C   . PHE A 1 226 ? 46.588 37.081  29.413  1.00 29.44  ? 223 PHE A C   1 
ATOM   1696  O O   . PHE A 1 226 ? 46.086 37.709  28.473  1.00 24.68  ? 223 PHE A O   1 
ATOM   1697  C CB  . PHE A 1 226 ? 46.538 34.581  29.535  1.00 25.73  ? 223 PHE A CB  1 
ATOM   1698  C CG  . PHE A 1 226 ? 46.940 33.324  28.820  1.00 27.42  ? 223 PHE A CG  1 
ATOM   1699  C CD1 . PHE A 1 226 ? 48.059 32.615  29.227  1.00 31.12  ? 223 PHE A CD1 1 
ATOM   1700  C CD2 . PHE A 1 226 ? 46.199 32.845  27.751  1.00 27.55  ? 223 PHE A CD2 1 
ATOM   1701  C CE1 . PHE A 1 226 ? 48.437 31.452  28.580  1.00 35.28  ? 223 PHE A CE1 1 
ATOM   1702  C CE2 . PHE A 1 226 ? 46.571 31.680  27.098  1.00 30.04  ? 223 PHE A CE2 1 
ATOM   1703  C CZ  . PHE A 1 226 ? 47.692 30.983  27.513  1.00 38.78  ? 223 PHE A CZ  1 
ATOM   1704  N N   . LYS A 1 227 ? 46.477 37.479  30.682  1.00 27.67  ? 224 LYS A N   1 
ATOM   1705  C CA  . LYS A 1 227 ? 45.768 38.703  31.034  1.00 30.31  ? 224 LYS A CA  1 
ATOM   1706  C C   . LYS A 1 227 ? 46.461 39.929  30.452  1.00 32.15  ? 224 LYS A C   1 
ATOM   1707  O O   . LYS A 1 227 ? 45.804 40.838  29.931  1.00 31.48  ? 224 LYS A O   1 
ATOM   1708  C CB  . LYS A 1 227 ? 45.661 38.811  32.555  1.00 31.29  ? 224 LYS A CB  1 
ATOM   1709  C CG  . LYS A 1 227 ? 45.212 40.168  33.066  1.00 37.66  ? 224 LYS A CG  1 
ATOM   1710  C CD  . LYS A 1 227 ? 45.048 40.147  34.575  1.00 34.82  ? 224 LYS A CD  1 
ATOM   1711  C CE  . LYS A 1 227 ? 44.690 41.526  35.098  1.00 35.61  ? 224 LYS A CE  1 
ATOM   1712  N NZ  . LYS A 1 227 ? 44.288 41.498  36.529  1.00 41.49  ? 224 LYS A NZ  1 
ATOM   1713  N N   . ASP A 1 228 ? 47.794 39.970  30.531  1.00 31.71  ? 225 ASP A N   1 
ATOM   1714  C CA  . ASP A 1 228 ? 48.528 41.126  30.024  1.00 31.76  ? 225 ASP A CA  1 
ATOM   1715  C C   . ASP A 1 228 ? 48.408 41.245  28.510  1.00 32.49  ? 225 ASP A C   1 
ATOM   1716  O O   . ASP A 1 228 ? 48.224 42.347  27.982  1.00 30.29  ? 225 ASP A O   1 
ATOM   1717  C CB  . ASP A 1 228 ? 49.998 41.043  30.435  1.00 31.47  ? 225 ASP A CB  1 
ATOM   1718  C CG  . ASP A 1 228 ? 50.204 41.272  31.917  1.00 34.67  ? 225 ASP A CG  1 
ATOM   1719  O OD1 . ASP A 1 228 ? 49.256 41.727  32.590  1.00 35.38  ? 225 ASP A OD1 1 
ATOM   1720  O OD2 . ASP A 1 228 ? 51.320 40.999  32.409  1.00 37.57  ? 225 ASP A OD2 1 
ATOM   1721  N N   . ILE A 1 229 ? 48.510 40.125  27.793  1.00 27.98  ? 226 ILE A N   1 
ATOM   1722  C CA  . ILE A 1 229 ? 48.490 40.184  26.336  1.00 27.65  ? 226 ILE A CA  1 
ATOM   1723  C C   . ILE A 1 229 ? 47.081 40.471  25.826  1.00 31.28  ? 226 ILE A C   1 
ATOM   1724  O O   . ILE A 1 229 ? 46.903 41.173  24.822  1.00 24.71  ? 226 ILE A O   1 
ATOM   1725  C CB  . ILE A 1 229 ? 49.080 38.889  25.747  1.00 30.71  ? 226 ILE A CB  1 
ATOM   1726  C CG1 . ILE A 1 229 ? 50.604 38.903  25.885  1.00 28.74  ? 226 ILE A CG1 1 
ATOM   1727  C CG2 . ILE A 1 229 ? 48.665 38.705  24.295  1.00 27.03  ? 226 ILE A CG2 1 
ATOM   1728  C CD1 . ILE A 1 229 ? 51.268 37.608  25.489  1.00 32.93  ? 226 ILE A CD1 1 
ATOM   1729  N N   . PHE A 1 230 ? 46.060 39.954  26.511  1.00 26.96  ? 227 PHE A N   1 
ATOM   1730  C CA  . PHE A 1 230 ? 44.687 40.296  26.152  1.00 27.81  ? 227 PHE A CA  1 
ATOM   1731  C C   . PHE A 1 230 ? 44.431 41.788  26.335  1.00 30.47  ? 227 PHE A C   1 
ATOM   1732  O O   . PHE A 1 230 ? 43.904 42.455  25.436  1.00 28.19  ? 227 PHE A O   1 
ATOM   1733  C CB  . PHE A 1 230 ? 43.703 39.479  26.990  1.00 24.03  ? 227 PHE A CB  1 
ATOM   1734  C CG  . PHE A 1 230 ? 43.225 38.219  26.320  1.00 28.41  ? 227 PHE A CG  1 
ATOM   1735  C CD1 . PHE A 1 230 ? 44.106 37.190  26.029  1.00 24.93  ? 227 PHE A CD1 1 
ATOM   1736  C CD2 . PHE A 1 230 ? 41.886 38.063  25.990  1.00 28.68  ? 227 PHE A CD2 1 
ATOM   1737  C CE1 . PHE A 1 230 ? 43.661 36.027  25.419  1.00 29.42  ? 227 PHE A CE1 1 
ATOM   1738  C CE2 . PHE A 1 230 ? 41.435 36.907  25.380  1.00 26.72  ? 227 PHE A CE2 1 
ATOM   1739  C CZ  . PHE A 1 230 ? 42.322 35.886  25.095  1.00 27.07  ? 227 PHE A CZ  1 
ATOM   1740  N N   . GLN A 1 231 ? 44.800 42.327  27.501  1.00 31.91  ? 228 GLN A N   1 
ATOM   1741  C CA  . GLN A 1 231 ? 44.583 43.745  27.770  1.00 32.92  ? 228 GLN A CA  1 
ATOM   1742  C C   . GLN A 1 231 ? 45.369 44.616  26.801  1.00 35.95  ? 228 GLN A C   1 
ATOM   1743  O O   . GLN A 1 231 ? 44.856 45.626  26.304  1.00 31.97  ? 228 GLN A O   1 
ATOM   1744  C CB  . GLN A 1 231 ? 44.976 44.068  29.212  1.00 36.96  ? 228 GLN A CB  1 
ATOM   1745  C CG  . GLN A 1 231 ? 44.441 45.397  29.723  1.00 27.73  ? 228 GLN A CG  1 
ATOM   1746  C CD  . GLN A 1 231 ? 42.927 45.461  29.688  1.00 36.08  ? 228 GLN A CD  1 
ATOM   1747  O OE1 . GLN A 1 231 ? 42.344 46.316  29.021  1.00 41.51  ? 228 GLN A OE1 1 
ATOM   1748  N NE2 . GLN A 1 231 ? 42.281 44.553  30.409  1.00 33.73  ? 228 GLN A NE2 1 
ATOM   1749  N N   . GLU A 1 232 ? 46.616 44.236  26.521  1.00 33.93  ? 229 GLU A N   1 
ATOM   1750  C CA  . GLU A 1 232 ? 47.457 45.024  25.626  1.00 34.39  ? 229 GLU A CA  1 
ATOM   1751  C C   . GLU A 1 232 ? 46.861 45.083  24.225  1.00 34.82  ? 229 GLU A C   1 
ATOM   1752  O O   . GLU A 1 232 ? 46.737 46.162  23.634  1.00 33.65  ? 229 GLU A O   1 
ATOM   1753  C CB  . GLU A 1 232 ? 48.866 44.432  25.605  1.00 33.81  ? 229 GLU A CB  1 
ATOM   1754  C CG  . GLU A 1 232 ? 49.842 45.083  24.648  1.00 45.49  ? 229 GLU A CG  1 
ATOM   1755  C CD  . GLU A 1 232 ? 51.233 44.485  24.769  1.00 62.41  ? 229 GLU A CD  1 
ATOM   1756  O OE1 . GLU A 1 232 ? 51.454 43.685  25.705  1.00 59.61  ? 229 GLU A OE1 1 
ATOM   1757  O OE2 . GLU A 1 232 ? 52.103 44.815  23.936  1.00 63.94  ? 229 GLU A OE2 1 
ATOM   1758  N N   . ILE A 1 233 ? 46.470 43.928  23.683  1.00 34.92  ? 230 ILE A N   1 
ATOM   1759  C CA  . ILE A 1 233 ? 45.898 43.897  22.339  1.00 34.60  ? 230 ILE A CA  1 
ATOM   1760  C C   . ILE A 1 233 ? 44.553 44.612  22.312  1.00 37.67  ? 230 ILE A C   1 
ATOM   1761  O O   . ILE A 1 233 ? 44.237 45.334  21.357  1.00 35.18  ? 230 ILE A O   1 
ATOM   1762  C CB  . ILE A 1 233 ? 45.790 42.445  21.836  1.00 33.02  ? 230 ILE A CB  1 
ATOM   1763  C CG1 . ILE A 1 233 ? 47.185 41.870  21.583  1.00 31.22  ? 230 ILE A CG1 1 
ATOM   1764  C CG2 . ILE A 1 233 ? 44.928 42.365  20.580  1.00 25.47  ? 230 ILE A CG2 1 
ATOM   1765  C CD1 . ILE A 1 233 ? 47.184 40.419  21.161  1.00 29.94  ? 230 ILE A CD1 1 
ATOM   1766  N N   . TYR A 1 234 ? 43.745 44.435  23.360  1.00 31.98  ? 231 TYR A N   1 
ATOM   1767  C CA  . TYR A 1 234 ? 42.467 45.137  23.437  1.00 38.45  ? 231 TYR A CA  1 
ATOM   1768  C C   . TYR A 1 234 ? 42.662 46.647  23.377  1.00 35.83  ? 231 TYR A C   1 
ATOM   1769  O O   . TYR A 1 234 ? 42.021 47.335  22.574  1.00 33.51  ? 231 TYR A O   1 
ATOM   1770  C CB  . TYR A 1 234 ? 41.725 44.756  24.718  1.00 31.93  ? 231 TYR A CB  1 
ATOM   1771  C CG  . TYR A 1 234 ? 40.382 45.442  24.868  1.00 33.66  ? 231 TYR A CG  1 
ATOM   1772  C CD1 . TYR A 1 234 ? 39.305 45.089  24.065  1.00 32.53  ? 231 TYR A CD1 1 
ATOM   1773  C CD2 . TYR A 1 234 ? 40.195 46.450  25.807  1.00 37.48  ? 231 TYR A CD2 1 
ATOM   1774  C CE1 . TYR A 1 234 ? 38.078 45.711  24.198  1.00 34.56  ? 231 TYR A CE1 1 
ATOM   1775  C CE2 . TYR A 1 234 ? 38.971 47.080  25.947  1.00 35.53  ? 231 TYR A CE2 1 
ATOM   1776  C CZ  . TYR A 1 234 ? 37.915 46.705  25.139  1.00 38.25  ? 231 TYR A CZ  1 
ATOM   1777  O OH  . TYR A 1 234 ? 36.693 47.323  25.267  1.00 44.55  ? 231 TYR A OH  1 
ATOM   1778  N N   . ASP A 1 235 ? 43.550 47.177  24.222  1.00 34.39  ? 232 ASP A N   1 
ATOM   1779  C CA  . ASP A 1 235 ? 43.700 48.625  24.331  1.00 41.44  ? 232 ASP A CA  1 
ATOM   1780  C C   . ASP A 1 235 ? 44.129 49.245  23.007  1.00 38.82  ? 232 ASP A C   1 
ATOM   1781  O O   . ASP A 1 235 ? 43.644 50.319  22.631  1.00 44.50  ? 232 ASP A O   1 
ATOM   1782  C CB  . ASP A 1 235 ? 44.706 48.965  25.429  1.00 36.31  ? 232 ASP A CB  1 
ATOM   1783  C CG  . ASP A 1 235 ? 44.143 48.756  26.819  1.00 39.31  ? 232 ASP A CG  1 
ATOM   1784  O OD1 . ASP A 1 235 ? 42.909 48.608  26.950  1.00 45.66  ? 232 ASP A OD1 1 
ATOM   1785  O OD2 . ASP A 1 235 ? 44.934 48.736  27.785  1.00 48.39  ? 232 ASP A OD2 1 
ATOM   1786  N N   . LYS A 1 236 ? 45.018 48.578  22.276  1.00 38.91  ? 233 LYS A N   1 
ATOM   1787  C CA  . LYS A 1 236 ? 45.571 49.172  21.067  1.00 37.41  ? 233 LYS A CA  1 
ATOM   1788  C C   . LYS A 1 236 ? 44.754 48.890  19.812  1.00 37.21  ? 233 LYS A C   1 
ATOM   1789  O O   . LYS A 1 236 ? 44.804 49.689  18.870  1.00 45.72  ? 233 LYS A O   1 
ATOM   1790  C CB  . LYS A 1 236 ? 47.009 48.689  20.845  1.00 43.48  ? 233 LYS A CB  1 
ATOM   1791  C CG  . LYS A 1 236 ? 47.918 48.837  22.058  1.00 49.82  ? 233 LYS A CG  1 
ATOM   1792  C CD  . LYS A 1 236 ? 49.286 48.213  21.802  1.00 62.21  ? 233 LYS A CD  1 
ATOM   1793  C CE  . LYS A 1 236 ? 50.154 48.245  23.052  1.00 59.57  ? 233 LYS A CE  1 
ATOM   1794  N NZ  . LYS A 1 236 ? 51.432 47.498  22.871  1.00 64.98  ? 233 LYS A NZ  1 
ATOM   1795  N N   . GLN A 1 237 ? 43.995 47.790  19.759  1.00 36.75  ? 234 GLN A N   1 
ATOM   1796  C CA  . GLN A 1 237 ? 43.432 47.349  18.489  1.00 34.00  ? 234 GLN A CA  1 
ATOM   1797  C C   . GLN A 1 237 ? 41.927 47.114  18.464  1.00 34.02  ? 234 GLN A C   1 
ATOM   1798  O O   . GLN A 1 237 ? 41.365 47.050  17.367  1.00 39.41  ? 234 GLN A O   1 
ATOM   1799  C CB  . GLN A 1 237 ? 44.130 46.063  18.009  1.00 39.23  ? 234 GLN A CB  1 
ATOM   1800  C CG  . GLN A 1 237 ? 45.614 46.243  17.724  1.00 42.16  ? 234 GLN A CG  1 
ATOM   1801  C CD  . GLN A 1 237 ? 46.260 44.996  17.153  1.00 43.33  ? 234 GLN A CD  1 
ATOM   1802  O OE1 . GLN A 1 237 ? 45.825 44.470  16.128  1.00 47.52  ? 234 GLN A OE1 1 
ATOM   1803  N NE2 . GLN A 1 237 ? 47.312 44.522  17.809  1.00 34.97  ? 234 GLN A NE2 1 
ATOM   1804  N N   . TYR A 1 238 ? 41.254 46.984  19.606  1.00 32.32  ? 235 TYR A N   1 
ATOM   1805  C CA  . TYR A 1 238 ? 39.825 46.679  19.582  1.00 36.00  ? 235 TYR A CA  1 
ATOM   1806  C C   . TYR A 1 238 ? 38.962 47.544  20.487  1.00 35.72  ? 235 TYR A C   1 
ATOM   1807  O O   . TYR A 1 238 ? 37.732 47.486  20.356  1.00 36.30  ? 235 TYR A O   1 
ATOM   1808  C CB  . TYR A 1 238 ? 39.580 45.202  19.945  1.00 32.97  ? 235 TYR A CB  1 
ATOM   1809  C CG  . TYR A 1 238 ? 40.198 44.224  18.972  1.00 29.52  ? 235 TYR A CG  1 
ATOM   1810  C CD1 . TYR A 1 238 ? 39.573 43.917  17.769  1.00 28.41  ? 235 TYR A CD1 1 
ATOM   1811  C CD2 . TYR A 1 238 ? 41.413 43.614  19.253  1.00 32.28  ? 235 TYR A CD2 1 
ATOM   1812  C CE1 . TYR A 1 238 ? 40.138 43.027  16.877  1.00 33.90  ? 235 TYR A CE1 1 
ATOM   1813  C CE2 . TYR A 1 238 ? 41.987 42.721  18.366  1.00 28.78  ? 235 TYR A CE2 1 
ATOM   1814  C CZ  . TYR A 1 238 ? 41.347 42.432  17.180  1.00 33.39  ? 235 TYR A CZ  1 
ATOM   1815  O OH  . TYR A 1 238 ? 41.916 41.544  16.299  1.00 34.11  ? 235 TYR A OH  1 
ATOM   1816  N N   . LYS A 1 239 ? 39.548 48.347  21.376  1.00 31.42  ? 236 LYS A N   1 
ATOM   1817  C CA  . LYS A 1 239 ? 38.760 49.052  22.384  1.00 38.54  ? 236 LYS A CA  1 
ATOM   1818  C C   . LYS A 1 239 ? 37.731 49.982  21.747  1.00 40.92  ? 236 LYS A C   1 
ATOM   1819  O O   . LYS A 1 239 ? 36.577 50.044  22.190  1.00 41.83  ? 236 LYS A O   1 
ATOM   1820  C CB  . LYS A 1 239 ? 39.692 49.828  23.314  1.00 46.04  ? 236 LYS A CB  1 
ATOM   1821  C CG  . LYS A 1 239 ? 38.996 50.690  24.355  1.00 49.73  ? 236 LYS A CG  1 
ATOM   1822  C CD  . LYS A 1 239 ? 40.030 51.404  25.211  1.00 46.82  ? 236 LYS A CD  1 
ATOM   1823  C CE  . LYS A 1 239 ? 39.489 52.703  25.784  1.00 66.64  ? 236 LYS A CE  1 
ATOM   1824  N NZ  . LYS A 1 239 ? 39.216 53.714  24.724  1.00 60.43  ? 236 LYS A NZ  1 
ATOM   1825  N N   . SER A 1 240 ? 38.127 50.714  20.702  1.00 41.50  ? 237 SER A N   1 
ATOM   1826  C CA  . SER A 1 240 ? 37.192 51.628  20.051  1.00 39.98  ? 237 SER A CA  1 
ATOM   1827  C C   . SER A 1 240 ? 36.110 50.867  19.296  1.00 39.68  ? 237 SER A C   1 
ATOM   1828  O O   . SER A 1 240 ? 34.941 51.271  19.302  1.00 40.69  ? 237 SER A O   1 
ATOM   1829  C CB  . SER A 1 240 ? 37.945 52.570  19.112  1.00 40.35  ? 237 SER A CB  1 
ATOM   1830  O OG  . SER A 1 240 ? 38.832 53.404  19.838  1.00 49.51  ? 237 SER A OG  1 
ATOM   1831  N N   . GLN A 1 241 ? 36.477 49.763  18.639  1.00 38.05  ? 238 GLN A N   1 
ATOM   1832  C CA  . GLN A 1 241 ? 35.479 48.944  17.961  1.00 41.48  ? 238 GLN A CA  1 
ATOM   1833  C C   . GLN A 1 241 ? 34.498 48.329  18.951  1.00 40.67  ? 238 GLN A C   1 
ATOM   1834  O O   . GLN A 1 241 ? 33.323 48.136  18.618  1.00 39.75  ? 238 GLN A O   1 
ATOM   1835  C CB  . GLN A 1 241 ? 36.160 47.850  17.143  1.00 37.17  ? 238 GLN A CB  1 
ATOM   1836  C CG  . GLN A 1 241 ? 37.112 48.360  16.076  1.00 36.45  ? 238 GLN A CG  1 
ATOM   1837  C CD  . GLN A 1 241 ? 37.853 47.234  15.380  1.00 42.54  ? 238 GLN A CD  1 
ATOM   1838  O OE1 . GLN A 1 241 ? 39.035 47.004  15.634  1.00 47.13  ? 238 GLN A OE1 1 
ATOM   1839  N NE2 . GLN A 1 241 ? 37.159 46.524  14.498  1.00 34.49  ? 238 GLN A NE2 1 
ATOM   1840  N N   . PHE A 1 242 ? 34.961 48.015  20.163  1.00 35.22  ? 239 PHE A N   1 
ATOM   1841  C CA  . PHE A 1 242 ? 34.062 47.504  21.193  1.00 39.80  ? 239 PHE A CA  1 
ATOM   1842  C C   . PHE A 1 242 ? 33.110 48.594  21.671  1.00 37.45  ? 239 PHE A C   1 
ATOM   1843  O O   . PHE A 1 242 ? 31.901 48.365  21.803  1.00 36.81  ? 239 PHE A O   1 
ATOM   1844  C CB  . PHE A 1 242 ? 34.871 46.953  22.368  1.00 34.43  ? 239 PHE A CB  1 
ATOM   1845  C CG  . PHE A 1 242 ? 35.225 45.497  22.241  1.00 39.79  ? 239 PHE A CG  1 
ATOM   1846  C CD1 . PHE A 1 242 ? 35.958 45.036  21.161  1.00 31.90  ? 239 PHE A CD1 1 
ATOM   1847  C CD2 . PHE A 1 242 ? 34.841 44.592  23.220  1.00 36.62  ? 239 PHE A CD2 1 
ATOM   1848  C CE1 . PHE A 1 242 ? 36.291 43.697  21.049  1.00 33.63  ? 239 PHE A CE1 1 
ATOM   1849  C CE2 . PHE A 1 242 ? 35.171 43.253  23.115  1.00 32.76  ? 239 PHE A CE2 1 
ATOM   1850  C CZ  . PHE A 1 242 ? 35.896 42.805  22.029  1.00 34.33  ? 239 PHE A CZ  1 
ATOM   1851  N N   . GLU A 1 243 ? 33.643 49.788  21.943  1.00 38.98  ? 240 GLU A N   1 
ATOM   1852  C CA  . GLU A 1 243 ? 32.806 50.887  22.411  1.00 44.60  ? 240 GLU A CA  1 
ATOM   1853  C C   . GLU A 1 243 ? 31.779 51.292  21.363  1.00 43.99  ? 240 GLU A C   1 
ATOM   1854  O O   . GLU A 1 243 ? 30.681 51.740  21.711  1.00 48.15  ? 240 GLU A O   1 
ATOM   1855  C CB  . GLU A 1 243 ? 33.677 52.083  22.791  1.00 46.19  ? 240 GLU A CB  1 
ATOM   1856  C CG  . GLU A 1 243 ? 34.298 51.987  24.177  1.00 41.01  ? 240 GLU A CG  1 
ATOM   1857  C CD  . GLU A 1 243 ? 35.527 52.862  24.324  1.00 47.14  ? 240 GLU A CD  1 
ATOM   1858  O OE1 . GLU A 1 243 ? 36.054 53.325  23.291  1.00 51.92  ? 240 GLU A OE1 1 
ATOM   1859  O OE2 . GLU A 1 243 ? 35.966 53.085  25.472  1.00 54.42  ? 240 GLU A OE2 1 
ATOM   1860  N N   . ALA A 1 244 ? 32.111 51.135  20.078  1.00 38.44  ? 241 ALA A N   1 
ATOM   1861  C CA  . ALA A 1 244 ? 31.168 51.496  19.024  1.00 44.59  ? 241 ALA A CA  1 
ATOM   1862  C C   . ALA A 1 244 ? 29.949 50.581  19.038  1.00 48.05  ? 241 ALA A C   1 
ATOM   1863  O O   . ALA A 1 244 ? 28.832 51.018  18.739  1.00 47.04  ? 241 ALA A O   1 
ATOM   1864  C CB  . ALA A 1 244 ? 31.859 51.453  17.661  1.00 37.02  ? 241 ALA A CB  1 
ATOM   1865  N N   . GLN A 1 245 ? 30.141 49.311  19.386  1.00 45.51  ? 242 GLN A N   1 
ATOM   1866  C CA  . GLN A 1 245 ? 29.041 48.368  19.538  1.00 44.48  ? 242 GLN A CA  1 
ATOM   1867  C C   . GLN A 1 245 ? 28.534 48.286  20.974  1.00 39.94  ? 242 GLN A C   1 
ATOM   1868  O O   . GLN A 1 245 ? 27.668 47.456  21.264  1.00 38.49  ? 242 GLN A O   1 
ATOM   1869  C CB  . GLN A 1 245 ? 29.467 46.980  19.053  1.00 43.04  ? 242 GLN A CB  1 
ATOM   1870  C CG  . GLN A 1 245 ? 29.685 46.893  17.551  1.00 46.17  ? 242 GLN A CG  1 
ATOM   1871  C CD  . GLN A 1 245 ? 29.702 45.465  17.039  1.00 46.04  ? 242 GLN A CD  1 
ATOM   1872  O OE1 . GLN A 1 245 ? 28.820 44.667  17.357  1.00 47.85  ? 242 GLN A OE1 1 
ATOM   1873  N NE2 . GLN A 1 245 ? 30.714 45.134  16.247  1.00 43.39  ? 242 GLN A NE2 1 
ATOM   1874  N N   . LYS A 1 246 ? 29.054 49.128  21.868  1.00 40.48  ? 243 LYS A N   1 
ATOM   1875  C CA  . LYS A 1 246 ? 28.658 49.150  23.279  1.00 42.08  ? 243 LYS A CA  1 
ATOM   1876  C C   . LYS A 1 246 ? 28.857 47.788  23.942  1.00 43.80  ? 243 LYS A C   1 
ATOM   1877  O O   . LYS A 1 246 ? 28.063 47.355  24.779  1.00 42.67  ? 243 LYS A O   1 
ATOM   1878  C CB  . LYS A 1 246 ? 27.216 49.636  23.447  1.00 44.61  ? 243 LYS A CB  1 
ATOM   1879  C CG  . LYS A 1 246 ? 27.014 51.104  23.094  1.00 47.81  ? 243 LYS A CG  1 
ATOM   1880  C CD  . LYS A 1 246 ? 25.646 51.600  23.538  1.00 51.01  ? 243 LYS A CD  1 
ATOM   1881  C CE  . LYS A 1 246 ? 25.525 53.108  23.376  1.00 50.31  ? 243 LYS A CE  1 
ATOM   1882  N NZ  . LYS A 1 246 ? 25.690 53.527  21.958  1.00 47.69  ? 243 LYS A NZ  1 
ATOM   1883  N N   . ILE A 1 247 ? 29.937 47.106  23.563  1.00 38.64  ? 244 ILE A N   1 
ATOM   1884  C CA  . ILE A 1 247 ? 30.360 45.896  24.261  1.00 37.25  ? 244 ILE A CA  1 
ATOM   1885  C C   . ILE A 1 247 ? 31.648 46.214  25.011  1.00 36.50  ? 244 ILE A C   1 
ATOM   1886  O O   . ILE A 1 247 ? 32.164 47.334  24.926  1.00 35.98  ? 244 ILE A O   1 
ATOM   1887  C CB  . ILE A 1 247 ? 30.538 44.710  23.294  1.00 35.45  ? 244 ILE A CB  1 
ATOM   1888  C CG1 . ILE A 1 247 ? 31.517 45.062  22.174  1.00 31.84  ? 244 ILE A CG1 1 
ATOM   1889  C CG2 . ILE A 1 247 ? 29.188 44.290  22.712  1.00 32.04  ? 244 ILE A CG2 1 
ATOM   1890  C CD1 . ILE A 1 247 ? 31.739 43.931  21.186  1.00 36.54  ? 244 ILE A CD1 1 
ATOM   1891  N N   . TRP A 1 248 ? 32.174 45.237  25.749  1.00 35.04  ? 245 TRP A N   1 
ATOM   1892  C CA  . TRP A 1 248 ? 33.327 45.471  26.607  1.00 37.77  ? 245 TRP A CA  1 
ATOM   1893  C C   . TRP A 1 248 ? 34.090 44.169  26.802  1.00 37.06  ? 245 TRP A C   1 
ATOM   1894  O O   . TRP A 1 248 ? 33.588 43.080  26.510  1.00 32.71  ? 245 TRP A O   1 
ATOM   1895  C CB  . TRP A 1 248 ? 32.901 46.047  27.963  1.00 31.63  ? 245 TRP A CB  1 
ATOM   1896  C CG  . TRP A 1 248 ? 31.970 45.142  28.720  1.00 37.41  ? 245 TRP A CG  1 
ATOM   1897  C CD1 . TRP A 1 248 ? 32.314 44.205  29.650  1.00 33.74  ? 245 TRP A CD1 1 
ATOM   1898  C CD2 . TRP A 1 248 ? 30.541 45.085  28.604  1.00 34.12  ? 245 TRP A CD2 1 
ATOM   1899  N NE1 . TRP A 1 248 ? 31.190 43.570  30.123  1.00 34.27  ? 245 TRP A NE1 1 
ATOM   1900  C CE2 . TRP A 1 248 ? 30.089 44.093  29.498  1.00 27.78  ? 245 TRP A CE2 1 
ATOM   1901  C CE3 . TRP A 1 248 ? 29.601 45.779  27.835  1.00 38.01  ? 245 TRP A CE3 1 
ATOM   1902  C CZ2 . TRP A 1 248 ? 28.738 43.775  29.641  1.00 34.03  ? 245 TRP A CZ2 1 
ATOM   1903  C CZ3 . TRP A 1 248 ? 28.260 45.462  27.979  1.00 33.22  ? 245 TRP A CZ3 1 
ATOM   1904  C CH2 . TRP A 1 248 ? 27.842 44.470  28.875  1.00 32.53  ? 245 TRP A CH2 1 
ATOM   1905  N N   . TYR A 1 249 ? 35.319 44.298  27.304  1.00 31.10  ? 246 TYR A N   1 
ATOM   1906  C CA  . TYR A 1 249 ? 36.168 43.162  27.633  1.00 33.06  ? 246 TYR A CA  1 
ATOM   1907  C C   . TYR A 1 249 ? 36.671 43.292  29.065  1.00 31.13  ? 246 TYR A C   1 
ATOM   1908  O O   . TYR A 1 249 ? 37.083 44.377  29.488  1.00 32.55  ? 246 TYR A O   1 
ATOM   1909  C CB  . TYR A 1 249 ? 37.377 43.047  26.697  1.00 32.28  ? 246 TYR A CB  1 
ATOM   1910  C CG  . TYR A 1 249 ? 38.457 42.192  27.317  1.00 29.94  ? 246 TYR A CG  1 
ATOM   1911  C CD1 . TYR A 1 249 ? 38.289 40.821  27.429  1.00 24.67  ? 246 TYR A CD1 1 
ATOM   1912  C CD2 . TYR A 1 249 ? 39.616 42.756  27.841  1.00 26.99  ? 246 TYR A CD2 1 
ATOM   1913  C CE1 . TYR A 1 249 ? 39.247 40.029  28.018  1.00 28.53  ? 246 TYR A CE1 1 
ATOM   1914  C CE2 . TYR A 1 249 ? 40.584 41.968  28.435  1.00 31.44  ? 246 TYR A CE2 1 
ATOM   1915  C CZ  . TYR A 1 249 ? 40.391 40.603  28.519  1.00 29.12  ? 246 TYR A CZ  1 
ATOM   1916  O OH  . TYR A 1 249 ? 41.340 39.800  29.106  1.00 27.43  ? 246 TYR A OH  1 
ATOM   1917  N N   . GLU A 1 250 ? 36.671 42.176  29.798  1.00 31.62  ? 247 GLU A N   1 
ATOM   1918  C CA  . GLU A 1 250 ? 37.152 42.156  31.173  1.00 30.28  ? 247 GLU A CA  1 
ATOM   1919  C C   . GLU A 1 250 ? 37.779 40.810  31.509  1.00 29.34  ? 247 GLU A C   1 
ATOM   1920  O O   . GLU A 1 250 ? 37.303 39.762  31.063  1.00 30.70  ? 247 GLU A O   1 
ATOM   1921  C CB  . GLU A 1 250 ? 36.023 42.450  32.168  1.00 31.01  ? 247 GLU A CB  1 
ATOM   1922  C CG  . GLU A 1 250 ? 35.650 43.919  32.276  1.00 37.08  ? 247 GLU A CG  1 
ATOM   1923  C CD  . GLU A 1 250 ? 34.435 44.150  33.151  1.00 44.81  ? 247 GLU A CD  1 
ATOM   1924  O OE1 . GLU A 1 250 ? 33.780 45.202  32.995  1.00 49.86  ? 247 GLU A OE1 1 
ATOM   1925  O OE2 . GLU A 1 250 ? 34.136 43.283  33.998  1.00 41.43  ? 247 GLU A OE2 1 
ATOM   1926  N N   . HIS A 1 251 ? 38.842 40.853  32.309  1.00 30.71  ? 248 HIS A N   1 
ATOM   1927  C CA  . HIS A 1 251 ? 39.434 39.648  32.872  1.00 29.11  ? 248 HIS A CA  1 
ATOM   1928  C C   . HIS A 1 251 ? 38.711 39.250  34.151  1.00 31.99  ? 248 HIS A C   1 
ATOM   1929  O O   . HIS A 1 251 ? 38.241 40.104  34.908  1.00 33.38  ? 248 HIS A O   1 
ATOM   1930  C CB  . HIS A 1 251 ? 40.918 39.864  33.172  1.00 30.17  ? 248 HIS A CB  1 
ATOM   1931  C CG  . HIS A 1 251 ? 41.547 38.746  33.949  1.00 31.14  ? 248 HIS A CG  1 
ATOM   1932  N ND1 . HIS A 1 251 ? 41.630 38.752  35.325  1.00 29.15  ? 248 HIS A ND1 1 
ATOM   1933  C CD2 . HIS A 1 251 ? 42.128 37.592  33.543  1.00 29.03  ? 248 HIS A CD2 1 
ATOM   1934  C CE1 . HIS A 1 251 ? 42.230 37.649  35.734  1.00 30.02  ? 248 HIS A CE1 1 
ATOM   1935  N NE2 . HIS A 1 251 ? 42.544 36.928  34.673  1.00 30.99  ? 248 HIS A NE2 1 
ATOM   1936  N N   . ARG A 1 252 ? 38.635 37.944  34.395  1.00 29.63  ? 249 ARG A N   1 
ATOM   1937  C CA  . ARG A 1 252 ? 38.009 37.409  35.594  1.00 31.71  ? 249 ARG A CA  1 
ATOM   1938  C C   . ARG A 1 252 ? 38.845 36.256  36.119  1.00 30.63  ? 249 ARG A C   1 
ATOM   1939  O O   . ARG A 1 252 ? 39.307 35.415  35.344  1.00 30.08  ? 249 ARG A O   1 
ATOM   1940  C CB  . ARG A 1 252 ? 36.584 36.911  35.315  1.00 33.54  ? 249 ARG A CB  1 
ATOM   1941  C CG  . ARG A 1 252 ? 35.548 38.001  35.136  1.00 36.82  ? 249 ARG A CG  1 
ATOM   1942  C CD  . ARG A 1 252 ? 35.269 38.738  36.435  1.00 40.51  ? 249 ARG A CD  1 
ATOM   1943  N NE  . ARG A 1 252 ? 34.173 39.688  36.272  1.00 38.53  ? 249 ARG A NE  1 
ATOM   1944  C CZ  . ARG A 1 252 ? 34.315 40.916  35.786  1.00 41.08  ? 249 ARG A CZ  1 
ATOM   1945  N NH1 . ARG A 1 252 ? 33.259 41.709  35.667  1.00 41.80  ? 249 ARG A NH1 1 
ATOM   1946  N NH2 . ARG A 1 252 ? 35.511 41.354  35.415  1.00 35.52  ? 249 ARG A NH2 1 
ATOM   1947  N N   . LEU A 1 253 ? 39.052 36.225  37.432  1.00 35.07  ? 250 LEU A N   1 
ATOM   1948  C CA  . LEU A 1 253 ? 39.528 35.001  38.057  1.00 33.66  ? 250 LEU A CA  1 
ATOM   1949  C C   . LEU A 1 253 ? 38.484 33.916  37.829  1.00 33.37  ? 250 LEU A C   1 
ATOM   1950  O O   . LEU A 1 253 ? 37.280 34.183  37.874  1.00 30.10  ? 250 LEU A O   1 
ATOM   1951  C CB  . LEU A 1 253 ? 39.768 35.225  39.551  1.00 35.82  ? 250 LEU A CB  1 
ATOM   1952  C CG  . LEU A 1 253 ? 40.035 34.004  40.434  1.00 40.51  ? 250 LEU A CG  1 
ATOM   1953  C CD1 . LEU A 1 253 ? 41.376 33.366  40.085  1.00 35.95  ? 250 LEU A CD1 1 
ATOM   1954  C CD2 . LEU A 1 253 ? 39.976 34.383  41.909  1.00 37.76  ? 250 LEU A CD2 1 
ATOM   1955  N N   . ILE A 1 254 ? 38.945 32.693  37.549  1.00 34.91  ? 251 ILE A N   1 
ATOM   1956  C CA  . ILE A 1 254 ? 38.016 31.630  37.163  1.00 33.27  ? 251 ILE A CA  1 
ATOM   1957  C C   . ILE A 1 254 ? 36.969 31.405  38.246  1.00 38.99  ? 251 ILE A C   1 
ATOM   1958  O O   . ILE A 1 254 ? 35.788 31.185  37.948  1.00 41.63  ? 251 ILE A O   1 
ATOM   1959  C CB  . ILE A 1 254 ? 38.783 30.336  36.825  1.00 36.61  ? 251 ILE A CB  1 
ATOM   1960  C CG1 . ILE A 1 254 ? 37.804 29.209  36.466  1.00 34.27  ? 251 ILE A CG1 1 
ATOM   1961  C CG2 . ILE A 1 254 ? 39.691 29.929  37.972  1.00 35.33  ? 251 ILE A CG2 1 
ATOM   1962  C CD1 . ILE A 1 254 ? 37.028 29.456  35.186  1.00 33.82  ? 251 ILE A CD1 1 
ATOM   1963  N N   . ASP A 1 255 ? 37.378 31.480  39.517  1.00 37.36  ? 252 ASP A N   1 
ATOM   1964  C CA  . ASP A 1 255 ? 36.429 31.349  40.620  1.00 43.72  ? 252 ASP A CA  1 
ATOM   1965  C C   . ASP A 1 255 ? 35.263 32.316  40.462  1.00 42.67  ? 252 ASP A C   1 
ATOM   1966  O O   . ASP A 1 255 ? 34.095 31.914  40.505  1.00 43.60  ? 252 ASP A O   1 
ATOM   1967  C CB  . ASP A 1 255 ? 37.129 31.591  41.960  1.00 39.71  ? 252 ASP A CB  1 
ATOM   1968  C CG  . ASP A 1 255 ? 38.368 30.743  42.138  1.00 43.20  ? 252 ASP A CG  1 
ATOM   1969  O OD1 . ASP A 1 255 ? 39.237 30.754  41.241  1.00 48.12  ? 252 ASP A OD1 1 
ATOM   1970  O OD2 . ASP A 1 255 ? 38.477 30.073  43.187  1.00 58.20  ? 252 ASP A OD2 1 
ATOM   1971  N N   . ASP A 1 256 ? 35.565 33.601  40.267  1.00 36.62  ? 253 ASP A N   1 
ATOM   1972  C CA  . ASP A 1 256 ? 34.505 34.597  40.154  1.00 35.92  ? 253 ASP A CA  1 
ATOM   1973  C C   . ASP A 1 256 ? 33.725 34.449  38.855  1.00 41.85  ? 253 ASP A C   1 
ATOM   1974  O O   . ASP A 1 256 ? 32.520 34.727  38.824  1.00 42.10  ? 253 ASP A O   1 
ATOM   1975  C CB  . ASP A 1 256 ? 35.090 36.005  40.252  1.00 42.96  ? 253 ASP A CB  1 
ATOM   1976  C CG  . ASP A 1 256 ? 35.995 36.177  41.453  1.00 40.23  ? 253 ASP A CG  1 
ATOM   1977  O OD1 . ASP A 1 256 ? 35.716 35.571  42.509  1.00 40.65  ? 253 ASP A OD1 1 
ATOM   1978  O OD2 . ASP A 1 256 ? 36.994 36.916  41.336  1.00 45.89  ? 253 ASP A OD2 1 
ATOM   1979  N N   . MET A 1 257 ? 34.389 34.023  37.778  1.00 37.09  ? 254 MET A N   1 
ATOM   1980  C CA  . MET A 1 257 ? 33.697 33.867  36.503  1.00 42.51  ? 254 MET A CA  1 
ATOM   1981  C C   . MET A 1 257 ? 32.631 32.782  36.588  1.00 38.88  ? 254 MET A C   1 
ATOM   1982  O O   . MET A 1 257 ? 31.527 32.942  36.055  1.00 35.39  ? 254 MET A O   1 
ATOM   1983  C CB  . MET A 1 257 ? 34.699 33.551  35.395  1.00 34.49  ? 254 MET A CB  1 
ATOM   1984  C CG  . MET A 1 257 ? 34.084 33.517  34.014  1.00 32.19  ? 254 MET A CG  1 
ATOM   1985  S SD  . MET A 1 257 ? 33.459 35.133  33.521  1.00 33.67  ? 254 MET A SD  1 
ATOM   1986  C CE  . MET A 1 257 ? 32.433 34.681  32.123  1.00 32.66  ? 254 MET A CE  1 
ATOM   1987  N N   . VAL A 1 258 ? 32.945 31.676  37.265  1.00 42.46  ? 255 VAL A N   1 
ATOM   1988  C CA  . VAL A 1 258 ? 31.984 30.585  37.412  1.00 39.98  ? 255 VAL A CA  1 
ATOM   1989  C C   . VAL A 1 258 ? 30.729 31.075  38.121  1.00 41.57  ? 255 VAL A C   1 
ATOM   1990  O O   . VAL A 1 258 ? 29.603 30.782  37.703  1.00 45.52  ? 255 VAL A O   1 
ATOM   1991  C CB  . VAL A 1 258 ? 32.630 29.400  38.152  1.00 41.87  ? 255 VAL A CB  1 
ATOM   1992  C CG1 . VAL A 1 258 ? 31.577 28.372  38.547  1.00 44.83  ? 255 VAL A CG1 1 
ATOM   1993  C CG2 . VAL A 1 258 ? 33.705 28.764  37.288  1.00 40.54  ? 255 VAL A CG2 1 
ATOM   1994  N N   . ALA A 1 259 ? 30.903 31.844  39.196  1.00 44.67  ? 256 ALA A N   1 
ATOM   1995  C CA  . ALA A 1 259 ? 29.750 32.365  39.923  1.00 41.66  ? 256 ALA A CA  1 
ATOM   1996  C C   . ALA A 1 259 ? 29.011 33.416  39.101  1.00 44.96  ? 256 ALA A C   1 
ATOM   1997  O O   . ALA A 1 259 ? 27.775 33.417  39.046  1.00 52.43  ? 256 ALA A O   1 
ATOM   1998  C CB  . ALA A 1 259 ? 30.192 32.941  41.269  1.00 48.05  ? 256 ALA A CB  1 
ATOM   1999  N N   . GLN A 1 260 ? 29.753 34.319  38.453  1.00 44.75  ? 257 GLN A N   1 
ATOM   2000  C CA  . GLN A 1 260 ? 29.119 35.329  37.610  1.00 41.77  ? 257 GLN A CA  1 
ATOM   2001  C C   . GLN A 1 260 ? 28.322 34.686  36.481  1.00 43.92  ? 257 GLN A C   1 
ATOM   2002  O O   . GLN A 1 260 ? 27.226 35.147  36.142  1.00 39.10  ? 257 GLN A O   1 
ATOM   2003  C CB  . GLN A 1 260 ? 30.177 36.278  37.044  1.00 36.71  ? 257 GLN A CB  1 
ATOM   2004  C CG  . GLN A 1 260 ? 29.682 37.136  35.885  1.00 42.65  ? 257 GLN A CG  1 
ATOM   2005  C CD  . GLN A 1 260 ? 30.780 37.978  35.264  1.00 48.52  ? 257 GLN A CD  1 
ATOM   2006  O OE1 . GLN A 1 260 ? 31.587 38.585  35.969  1.00 49.93  ? 257 GLN A OE1 1 
ATOM   2007  N NE2 . GLN A 1 260 ? 30.816 38.019  33.936  1.00 34.44  ? 257 GLN A NE2 1 
ATOM   2008  N N   . ALA A 1 261 ? 28.853 33.613  35.890  1.00 35.61  ? 258 ALA A N   1 
ATOM   2009  C CA  . ALA A 1 261 ? 28.165 32.974  34.774  1.00 39.84  ? 258 ALA A CA  1 
ATOM   2010  C C   . ALA A 1 261 ? 26.884 32.285  35.231  1.00 44.42  ? 258 ALA A C   1 
ATOM   2011  O O   . ALA A 1 261 ? 25.851 32.371  34.556  1.00 41.40  ? 258 ALA A O   1 
ATOM   2012  C CB  . ALA A 1 261 ? 29.096 31.976  34.085  1.00 30.71  ? 258 ALA A CB  1 
ATOM   2013  N N   . MET A 1 262 ? 26.926 31.601  36.377  1.00 39.56  ? 259 MET A N   1 
ATOM   2014  C CA  . MET A 1 262 ? 25.747 30.895  36.866  1.00 46.05  ? 259 MET A CA  1 
ATOM   2015  C C   . MET A 1 262 ? 24.637 31.844  37.295  1.00 48.02  ? 259 MET A C   1 
ATOM   2016  O O   . MET A 1 262 ? 23.473 31.431  37.351  1.00 44.65  ? 259 MET A O   1 
ATOM   2017  C CB  . MET A 1 262 ? 26.127 29.977  38.023  1.00 40.49  ? 259 MET A CB  1 
ATOM   2018  C CG  . MET A 1 262 ? 27.042 28.841  37.609  1.00 46.07  ? 259 MET A CG  1 
ATOM   2019  S SD  . MET A 1 262 ? 27.346 27.691  38.953  1.00 57.95  ? 259 MET A SD  1 
ATOM   2020  C CE  . MET A 1 262 ? 25.703 27.017  39.193  1.00 54.85  ? 259 MET A CE  1 
ATOM   2021  N N   . LYS A 1 263 ? 24.963 33.100  37.593  1.00 42.02  ? 260 LYS A N   1 
ATOM   2022  C CA  . LYS A 1 263 ? 23.962 34.108  37.911  1.00 43.36  ? 260 LYS A CA  1 
ATOM   2023  C C   . LYS A 1 263 ? 23.661 35.020  36.729  1.00 44.81  ? 260 LYS A C   1 
ATOM   2024  O O   . LYS A 1 263 ? 22.904 35.985  36.877  1.00 49.74  ? 260 LYS A O   1 
ATOM   2025  C CB  . LYS A 1 263 ? 24.407 34.927  39.125  1.00 45.06  ? 260 LYS A CB  1 
ATOM   2026  C CG  . LYS A 1 263 ? 24.636 34.072  40.368  1.00 49.30  ? 260 LYS A CG  1 
ATOM   2027  C CD  . LYS A 1 263 ? 24.896 34.905  41.613  1.00 55.68  ? 260 LYS A CD  1 
ATOM   2028  C CE  . LYS A 1 263 ? 24.911 34.021  42.853  1.00 55.45  ? 260 LYS A CE  1 
ATOM   2029  N NZ  . LYS A 1 263 ? 25.155 34.793  44.102  1.00 64.05  ? 260 LYS A NZ  1 
ATOM   2030  N N   . SER A 1 264 ? 24.229 34.731  35.564  1.00 38.89  ? 261 SER A N   1 
ATOM   2031  C CA  . SER A 1 264 ? 23.986 35.498  34.353  1.00 41.33  ? 261 SER A CA  1 
ATOM   2032  C C   . SER A 1 264 ? 22.820 34.908  33.567  1.00 36.99  ? 261 SER A C   1 
ATOM   2033  O O   . SER A 1 264 ? 22.463 33.738  33.717  1.00 40.94  ? 261 SER A O   1 
ATOM   2034  C CB  . SER A 1 264 ? 25.240 35.526  33.477  1.00 35.97  ? 261 SER A CB  1 
ATOM   2035  O OG  . SER A 1 264 ? 24.964 36.070  32.197  1.00 41.21  ? 261 SER A OG  1 
ATOM   2036  N N   . GLU A 1 265 ? 22.224 35.742  32.721  1.00 33.94  ? 262 GLU A N   1 
ATOM   2037  C CA  . GLU A 1 265 ? 21.211 35.291  31.781  1.00 42.40  ? 262 GLU A CA  1 
ATOM   2038  C C   . GLU A 1 265 ? 21.804 34.837  30.454  1.00 38.52  ? 262 GLU A C   1 
ATOM   2039  O O   . GLU A 1 265 ? 21.052 34.444  29.557  1.00 41.78  ? 262 GLU A O   1 
ATOM   2040  C CB  . GLU A 1 265 ? 20.185 36.404  31.532  1.00 34.85  ? 262 GLU A CB  1 
ATOM   2041  C CG  . GLU A 1 265 ? 20.731 37.593  30.760  1.00 44.83  ? 262 GLU A CG  1 
ATOM   2042  C CD  . GLU A 1 265 ? 19.678 38.660  30.521  1.00 62.66  ? 262 GLU A CD  1 
ATOM   2043  O OE1 . GLU A 1 265 ? 19.984 39.658  29.836  1.00 60.35  ? 262 GLU A OE1 1 
ATOM   2044  O OE2 . GLU A 1 265 ? 18.543 38.499  31.021  1.00 61.00  ? 262 GLU A OE2 1 
ATOM   2045  N N   . GLY A 1 266 ? 23.122 34.878  30.311  1.00 37.24  ? 263 GLY A N   1 
ATOM   2046  C CA  . GLY A 1 266 ? 23.769 34.509  29.070  1.00 35.11  ? 263 GLY A CA  1 
ATOM   2047  C C   . GLY A 1 266 ? 24.045 35.712  28.191  1.00 37.63  ? 263 GLY A C   1 
ATOM   2048  O O   . GLY A 1 266 ? 23.966 36.871  28.607  1.00 32.60  ? 263 GLY A O   1 
ATOM   2049  N N   . GLY A 1 267 ? 24.373 35.413  26.938  1.00 33.71  ? 264 GLY A N   1 
ATOM   2050  C CA  . GLY A 1 267 ? 24.682 36.450  25.972  1.00 33.84  ? 264 GLY A CA  1 
ATOM   2051  C C   . GLY A 1 267 ? 26.051 37.072  26.132  1.00 39.95  ? 264 GLY A C   1 
ATOM   2052  O O   . GLY A 1 267 ? 26.177 38.303  26.080  1.00 40.65  ? 264 GLY A O   1 
ATOM   2053  N N   . PHE A 1 268 ? 27.085 36.257  26.340  1.00 31.25  ? 265 PHE A N   1 
ATOM   2054  C CA  . PHE A 1 268 ? 28.452 36.748  26.427  1.00 31.80  ? 265 PHE A CA  1 
ATOM   2055  C C   . PHE A 1 268 ? 29.407 35.699  25.870  1.00 33.12  ? 265 PHE A C   1 
ATOM   2056  O O   . PHE A 1 268 ? 29.067 34.520  25.749  1.00 32.23  ? 265 PHE A O   1 
ATOM   2057  C CB  . PHE A 1 268 ? 28.838 37.120  27.872  1.00 33.10  ? 265 PHE A CB  1 
ATOM   2058  C CG  . PHE A 1 268 ? 28.687 35.992  28.863  1.00 33.14  ? 265 PHE A CG  1 
ATOM   2059  C CD1 . PHE A 1 268 ? 27.484 35.786  29.525  1.00 34.84  ? 265 PHE A CD1 1 
ATOM   2060  C CD2 . PHE A 1 268 ? 29.751 35.152  29.150  1.00 31.83  ? 265 PHE A CD2 1 
ATOM   2061  C CE1 . PHE A 1 268 ? 27.345 34.758  30.443  1.00 34.70  ? 265 PHE A CE1 1 
ATOM   2062  C CE2 . PHE A 1 268 ? 29.617 34.120  30.066  1.00 37.31  ? 265 PHE A CE2 1 
ATOM   2063  C CZ  . PHE A 1 268 ? 28.414 33.925  30.714  1.00 33.13  ? 265 PHE A CZ  1 
ATOM   2064  N N   . ILE A 1 269 ? 30.607 36.153  25.509  1.00 31.66  ? 266 ILE A N   1 
ATOM   2065  C CA  . ILE A 1 269 ? 31.703 35.279  25.108  1.00 33.05  ? 266 ILE A CA  1 
ATOM   2066  C C   . ILE A 1 269 ? 32.567 35.013  26.330  1.00 30.36  ? 266 ILE A C   1 
ATOM   2067  O O   . ILE A 1 269 ? 32.836 35.924  27.126  1.00 34.22  ? 266 ILE A O   1 
ATOM   2068  C CB  . ILE A 1 269 ? 32.551 35.895  23.976  1.00 32.25  ? 266 ILE A CB  1 
ATOM   2069  C CG1 . ILE A 1 269 ? 31.687 36.666  22.976  1.00 33.60  ? 266 ILE A CG1 1 
ATOM   2070  C CG2 . ILE A 1 269 ? 33.353 34.808  23.263  1.00 27.48  ? 266 ILE A CG2 1 
ATOM   2071  C CD1 . ILE A 1 269 ? 30.718 35.815  22.198  1.00 33.44  ? 266 ILE A CD1 1 
ATOM   2072  N N   . TRP A 1 270 ? 33.016 33.770  26.477  1.00 28.92  ? 267 TRP A N   1 
ATOM   2073  C CA  . TRP A 1 270 ? 33.849 33.354  27.603  1.00 29.79  ? 267 TRP A CA  1 
ATOM   2074  C C   . TRP A 1 270 ? 35.091 32.673  27.033  1.00 29.33  ? 267 TRP A C   1 
ATOM   2075  O O   . TRP A 1 270 ? 35.039 31.513  26.611  1.00 30.08  ? 267 TRP A O   1 
ATOM   2076  C CB  . TRP A 1 270 ? 33.061 32.439  28.541  1.00 27.54  ? 267 TRP A CB  1 
ATOM   2077  C CG  . TRP A 1 270 ? 33.807 31.931  29.748  1.00 32.33  ? 267 TRP A CG  1 
ATOM   2078  C CD1 . TRP A 1 270 ? 35.124 32.128  30.058  1.00 34.03  ? 267 TRP A CD1 1 
ATOM   2079  C CD2 . TRP A 1 270 ? 33.260 31.143  30.812  1.00 35.94  ? 267 TRP A CD2 1 
ATOM   2080  N NE1 . TRP A 1 270 ? 35.431 31.500  31.242  1.00 32.88  ? 267 TRP A NE1 1 
ATOM   2081  C CE2 . TRP A 1 270 ? 34.303 30.892  31.727  1.00 33.96  ? 267 TRP A CE2 1 
ATOM   2082  C CE3 . TRP A 1 270 ? 31.989 30.624  31.079  1.00 33.84  ? 267 TRP A CE3 1 
ATOM   2083  C CZ2 . TRP A 1 270 ? 34.112 30.145  32.888  1.00 35.59  ? 267 TRP A CZ2 1 
ATOM   2084  C CZ3 . TRP A 1 270 ? 31.802 29.883  32.234  1.00 32.57  ? 267 TRP A CZ3 1 
ATOM   2085  C CH2 . TRP A 1 270 ? 32.858 29.651  33.123  1.00 33.46  ? 267 TRP A CH2 1 
ATOM   2086  N N   . ALA A 1 271 ? 36.203 33.402  27.010  1.00 27.15  ? 268 ALA A N   1 
ATOM   2087  C CA  . ALA A 1 271 ? 37.499 32.844  26.642  1.00 27.78  ? 268 ALA A CA  1 
ATOM   2088  C C   . ALA A 1 271 ? 38.129 32.244  27.892  1.00 30.31  ? 268 ALA A C   1 
ATOM   2089  O O   . ALA A 1 271 ? 38.338 32.949  28.884  1.00 29.02  ? 268 ALA A O   1 
ATOM   2090  C CB  . ALA A 1 271 ? 38.403 33.914  26.033  1.00 29.59  ? 268 ALA A CB  1 
ATOM   2091  N N   . CYS A 1 272 ? 38.443 30.953  27.837  1.00 26.18  ? 269 CYS A N   1 
ATOM   2092  C CA  A CYS A 1 272 ? 38.877 30.201  29.005  0.46 33.33  ? 269 CYS A CA  1 
ATOM   2093  C CA  B CYS A 1 272 ? 38.870 30.179  28.999  0.54 33.67  ? 269 CYS A CA  1 
ATOM   2094  C C   . CYS A 1 272 ? 40.338 29.806  28.853  1.00 35.40  ? 269 CYS A C   1 
ATOM   2095  O O   . CYS A 1 272 ? 40.714 29.148  27.877  1.00 31.30  ? 269 CYS A O   1 
ATOM   2096  C CB  A CYS A 1 272 ? 38.004 28.962  29.204  0.46 35.80  ? 269 CYS A CB  1 
ATOM   2097  C CB  B CYS A 1 272 ? 38.031 28.907  29.150  0.54 35.48  ? 269 CYS A CB  1 
ATOM   2098  S SG  A CYS A 1 272 ? 38.551 27.906  30.548  0.46 50.18  ? 269 CYS A SG  1 
ATOM   2099  S SG  B CYS A 1 272 ? 36.279 29.143  29.470  0.54 41.83  ? 269 CYS A SG  1 
ATOM   2100  N N   . LYS A 1 273 ? 41.152 30.199  29.827  1.00 44.52  ? 270 LYS A N   1 
ATOM   2101  C CA  . LYS A 1 273 ? 42.529 29.736  29.930  1.00 44.72  ? 270 LYS A CA  1 
ATOM   2102  C C   . LYS A 1 273 ? 42.563 28.700  31.048  1.00 52.53  ? 270 LYS A C   1 
ATOM   2103  O O   . LYS A 1 273 ? 42.391 29.039  32.224  1.00 50.99  ? 270 LYS A O   1 
ATOM   2104  C CB  . LYS A 1 273 ? 43.502 30.881  30.207  1.00 42.44  ? 270 LYS A CB  1 
ATOM   2105  C CG  . LYS A 1 273 ? 44.972 30.500  29.989  1.00 47.11  ? 270 LYS A CG  1 
ATOM   2106  C CD  . LYS A 1 273 ? 45.538 29.730  31.171  1.00 44.18  ? 270 LYS A CD  1 
ATOM   2107  C CE  . LYS A 1 273 ? 46.728 28.874  30.783  1.00 43.12  ? 270 LYS A CE  1 
ATOM   2108  N NZ  . LYS A 1 273 ? 47.222 28.112  31.963  1.00 44.00  ? 270 LYS A NZ  1 
ATOM   2109  N N   . ASN A 1 274 ? 42.780 27.443  30.678  1.00 52.83  ? 271 ASN A N   1 
ATOM   2110  C CA  . ASN A 1 274 ? 42.934 26.372  31.653  1.00 63.69  ? 271 ASN A CA  1 
ATOM   2111  C C   . ASN A 1 274 ? 44.389 25.923  31.721  1.00 60.78  ? 271 ASN A C   1 
ATOM   2112  O O   . ASN A 1 274 ? 44.902 25.611  32.794  1.00 74.67  ? 271 ASN A O   1 
ATOM   2113  C CB  . ASN A 1 274 ? 42.026 25.191  31.306  1.00 64.71  ? 271 ASN A CB  1 
ATOM   2114  C CG  . ASN A 1 274 ? 40.571 25.461  31.634  1.00 69.18  ? 271 ASN A CG  1 
ATOM   2115  O OD1 . ASN A 1 274 ? 40.261 26.147  32.609  1.00 66.74  ? 271 ASN A OD1 1 
ATOM   2116  N ND2 . ASN A 1 274 ? 39.669 24.924  30.820  1.00 68.97  ? 271 ASN A ND2 1 
ATOM   2117  N N   . GLN A 1 280 ? 36.100 20.212  28.151  1.00 61.34  ? 277 GLN A N   1 
ATOM   2118  C CA  . GLN A 1 280 ? 35.505 21.117  27.175  1.00 68.63  ? 277 GLN A CA  1 
ATOM   2119  C C   . GLN A 1 280 ? 33.992 20.956  27.167  1.00 56.39  ? 277 GLN A C   1 
ATOM   2120  O O   . GLN A 1 280 ? 33.457 20.002  27.732  1.00 53.04  ? 277 GLN A O   1 
ATOM   2121  C CB  . GLN A 1 280 ? 36.076 20.894  25.767  1.00 65.53  ? 277 GLN A CB  1 
ATOM   2122  C CG  . GLN A 1 280 ? 37.607 20.891  25.650  1.00 74.08  ? 277 GLN A CG  1 
ATOM   2123  C CD  . GLN A 1 280 ? 38.275 19.722  26.352  1.00 88.59  ? 277 GLN A CD  1 
ATOM   2124  O OE1 . GLN A 1 280 ? 38.791 19.862  27.462  1.00 95.76  ? 277 GLN A OE1 1 
ATOM   2125  N NE2 . GLN A 1 280 ? 38.272 18.561  25.705  1.00 81.39  ? 277 GLN A NE2 1 
ATOM   2126  N N   . SER A 1 281 ? 33.310 21.902  26.516  1.00 54.00  ? 278 SER A N   1 
ATOM   2127  C CA  . SER A 1 281 ? 31.871 22.053  26.713  1.00 52.09  ? 278 SER A CA  1 
ATOM   2128  C C   . SER A 1 281 ? 31.086 20.859  26.191  1.00 45.27  ? 278 SER A C   1 
ATOM   2129  O O   . SER A 1 281 ? 30.017 20.541  26.726  1.00 43.59  ? 278 SER A O   1 
ATOM   2130  C CB  . SER A 1 281 ? 31.383 23.331  26.032  1.00 43.38  ? 278 SER A CB  1 
ATOM   2131  O OG  . SER A 1 281 ? 31.908 24.478  26.672  1.00 56.45  ? 278 SER A OG  1 
ATOM   2132  N N   . ASP A 1 282 ? 31.588 20.191  25.151  1.00 47.36  ? 279 ASP A N   1 
ATOM   2133  C CA  . ASP A 1 282 ? 30.805 19.138  24.511  1.00 42.01  ? 279 ASP A CA  1 
ATOM   2134  C C   . ASP A 1 282 ? 30.549 17.966  25.451  1.00 39.27  ? 279 ASP A C   1 
ATOM   2135  O O   . ASP A 1 282 ? 29.545 17.262  25.297  1.00 36.15  ? 279 ASP A O   1 
ATOM   2136  C CB  . ASP A 1 282 ? 31.504 18.674  23.232  1.00 44.53  ? 279 ASP A CB  1 
ATOM   2137  C CG  . ASP A 1 282 ? 32.956 18.323  23.462  1.00 51.52  ? 279 ASP A CG  1 
ATOM   2138  O OD1 . ASP A 1 282 ? 33.404 17.284  22.936  1.00 57.89  ? 279 ASP A OD1 1 
ATOM   2139  O OD2 . ASP A 1 282 ? 33.645 19.087  24.168  1.00 60.50  ? 279 ASP A OD2 1 
ATOM   2140  N N   . SER A 1 283 ? 31.425 17.750  26.436  1.00 42.58  ? 280 SER A N   1 
ATOM   2141  C CA  . SER A 1 283 ? 31.220 16.643  27.366  1.00 45.15  ? 280 SER A CA  1 
ATOM   2142  C C   . SER A 1 283 ? 30.057 16.920  28.313  1.00 46.08  ? 280 SER A C   1 
ATOM   2143  O O   . SER A 1 283 ? 29.335 15.995  28.706  1.00 37.12  ? 280 SER A O   1 
ATOM   2144  C CB  . SER A 1 283 ? 32.503 16.373  28.151  1.00 45.48  ? 280 SER A CB  1 
ATOM   2145  O OG  . SER A 1 283 ? 33.605 16.189  27.280  1.00 52.43  ? 280 SER A OG  1 
ATOM   2146  N N   . VAL A 1 284 ? 29.862 18.184  28.693  1.00 38.13  ? 281 VAL A N   1 
ATOM   2147  C CA  . VAL A 1 284 ? 28.737 18.530  29.555  1.00 43.53  ? 281 VAL A CA  1 
ATOM   2148  C C   . VAL A 1 284 ? 27.430 18.445  28.779  1.00 40.35  ? 281 VAL A C   1 
ATOM   2149  O O   . VAL A 1 284 ? 26.415 17.962  29.298  1.00 40.73  ? 281 VAL A O   1 
ATOM   2150  C CB  . VAL A 1 284 ? 28.945 19.925  30.172  1.00 48.06  ? 281 VAL A CB  1 
ATOM   2151  C CG1 . VAL A 1 284 ? 27.753 20.308  31.041  1.00 43.40  ? 281 VAL A CG1 1 
ATOM   2152  C CG2 . VAL A 1 284 ? 30.230 19.950  30.979  1.00 49.90  ? 281 VAL A CG2 1 
ATOM   2153  N N   . ALA A 1 285 ? 27.431 18.908  27.525  1.00 36.45  ? 282 ALA A N   1 
ATOM   2154  C CA  . ALA A 1 285 ? 26.252 18.757  26.680  1.00 38.25  ? 282 ALA A CA  1 
ATOM   2155  C C   . ALA A 1 285 ? 25.886 17.288  26.513  1.00 37.76  ? 282 ALA A C   1 
ATOM   2156  O O   . ALA A 1 285 ? 24.703 16.926  26.551  1.00 38.37  ? 282 ALA A O   1 
ATOM   2157  C CB  . ALA A 1 285 ? 26.492 19.413  25.319  1.00 37.12  ? 282 ALA A CB  1 
ATOM   2158  N N   . GLN A 1 286 ? 26.892 16.425  26.351  1.00 39.44  ? 283 GLN A N   1 
ATOM   2159  C CA  . GLN A 1 286 ? 26.632 14.994  26.227  1.00 42.55  ? 283 GLN A CA  1 
ATOM   2160  C C   . GLN A 1 286 ? 25.994 14.436  27.492  1.00 38.70  ? 283 GLN A C   1 
ATOM   2161  O O   . GLN A 1 286 ? 25.038 13.654  27.423  1.00 41.39  ? 283 GLN A O   1 
ATOM   2162  C CB  . GLN A 1 286 ? 27.932 14.258  25.913  1.00 41.08  ? 283 GLN A CB  1 
ATOM   2163  C CG  . GLN A 1 286 ? 27.758 12.798  25.541  1.00 44.07  ? 283 GLN A CG  1 
ATOM   2164  C CD  . GLN A 1 286 ? 29.066 12.161  25.120  1.00 46.36  ? 283 GLN A CD  1 
ATOM   2165  O OE1 . GLN A 1 286 ? 29.943 12.827  24.567  1.00 48.96  ? 283 GLN A OE1 1 
ATOM   2166  N NE2 . GLN A 1 286 ? 29.210 10.870  25.388  1.00 43.61  ? 283 GLN A NE2 1 
ATOM   2167  N N   . GLY A 1 287 ? 26.511 14.825  28.660  1.00 38.71  ? 284 GLY A N   1 
ATOM   2168  C CA  . GLY A 1 287 ? 25.884 14.409  29.904  1.00 45.52  ? 284 GLY A CA  1 
ATOM   2169  C C   . GLY A 1 287 ? 24.475 14.951  30.044  1.00 42.91  ? 284 GLY A C   1 
ATOM   2170  O O   . GLY A 1 287 ? 23.568 14.248  30.498  1.00 44.93  ? 284 GLY A O   1 
ATOM   2171  N N   . TYR A 1 288 ? 24.268 16.205  29.641  1.00 42.75  ? 285 TYR A N   1 
ATOM   2172  C CA  . TYR A 1 288 ? 22.944 16.810  29.690  1.00 38.18  ? 285 TYR A CA  1 
ATOM   2173  C C   . TYR A 1 288 ? 22.020 16.296  28.594  1.00 40.38  ? 285 TYR A C   1 
ATOM   2174  O O   . TYR A 1 288 ? 20.804 16.494  28.685  1.00 38.90  ? 285 TYR A O   1 
ATOM   2175  C CB  . TYR A 1 288 ? 23.061 18.333  29.586  1.00 40.24  ? 285 TYR A CB  1 
ATOM   2176  C CG  . TYR A 1 288 ? 21.800 19.074  29.963  1.00 38.87  ? 285 TYR A CG  1 
ATOM   2177  C CD1 . TYR A 1 288 ? 21.290 18.999  31.253  1.00 44.07  ? 285 TYR A CD1 1 
ATOM   2178  C CD2 . TYR A 1 288 ? 21.124 19.854  29.034  1.00 43.28  ? 285 TYR A CD2 1 
ATOM   2179  C CE1 . TYR A 1 288 ? 20.140 19.677  31.606  1.00 43.55  ? 285 TYR A CE1 1 
ATOM   2180  C CE2 . TYR A 1 288 ? 19.974 20.537  29.378  1.00 41.65  ? 285 TYR A CE2 1 
ATOM   2181  C CZ  . TYR A 1 288 ? 19.487 20.444  30.665  1.00 41.14  ? 285 TYR A CZ  1 
ATOM   2182  O OH  . TYR A 1 288 ? 18.342 21.120  31.012  1.00 47.77  ? 285 TYR A OH  1 
ATOM   2183  N N   . GLY A 1 289 ? 22.563 15.642  27.568  1.00 41.66  ? 286 GLY A N   1 
ATOM   2184  C CA  . GLY A 1 289 ? 21.751 15.209  26.447  1.00 32.91  ? 286 GLY A CA  1 
ATOM   2185  C C   . GLY A 1 289 ? 21.405 16.308  25.468  1.00 37.97  ? 286 GLY A C   1 
ATOM   2186  O O   . GLY A 1 289 ? 20.337 16.265  24.849  1.00 42.23  ? 286 GLY A O   1 
ATOM   2187  N N   . SER A 1 290 ? 22.286 17.297  25.303  1.00 35.95  ? 287 SER A N   1 
ATOM   2188  C CA  . SER A 1 290 ? 22.042 18.432  24.419  1.00 39.30  ? 287 SER A CA  1 
ATOM   2189  C C   . SER A 1 290 ? 23.128 18.577  23.357  1.00 36.25  ? 287 SER A C   1 
ATOM   2190  O O   . SER A 1 290 ? 23.319 19.671  22.814  1.00 33.83  ? 287 SER A O   1 
ATOM   2191  C CB  . SER A 1 290 ? 21.922 19.721  25.235  1.00 33.31  ? 287 SER A CB  1 
ATOM   2192  O OG  . SER A 1 290 ? 23.151 20.030  25.878  1.00 36.46  ? 287 SER A OG  1 
ATOM   2193  N N   . LEU A 1 291 ? 23.843 17.491  23.044  1.00 32.78  ? 288 LEU A N   1 
ATOM   2194  C CA  . LEU A 1 291 ? 24.931 17.575  22.071  1.00 36.26  ? 288 LEU A CA  1 
ATOM   2195  C C   . LEU A 1 291 ? 24.415 17.949  20.687  1.00 33.99  ? 288 LEU A C   1 
ATOM   2196  O O   . LEU A 1 291 ? 25.082 18.676  19.941  1.00 35.03  ? 288 LEU A O   1 
ATOM   2197  C CB  . LEU A 1 291 ? 25.691 16.252  22.011  1.00 36.65  ? 288 LEU A CB  1 
ATOM   2198  C CG  . LEU A 1 291 ? 27.080 16.221  22.655  1.00 43.74  ? 288 LEU A CG  1 
ATOM   2199  C CD1 . LEU A 1 291 ? 27.743 14.878  22.401  1.00 40.90  ? 288 LEU A CD1 1 
ATOM   2200  C CD2 . LEU A 1 291 ? 27.944 17.357  22.131  1.00 36.97  ? 288 LEU A CD2 1 
ATOM   2201  N N   . GLY A 1 292 ? 23.230 17.464  20.326  1.00 31.60  ? 289 GLY A N   1 
ATOM   2202  C CA  . GLY A 1 292 ? 22.623 17.810  19.054  1.00 32.83  ? 289 GLY A CA  1 
ATOM   2203  C C   . GLY A 1 292 ? 22.196 19.254  18.916  1.00 33.88  ? 289 GLY A C   1 
ATOM   2204  O O   . GLY A 1 292 ? 21.780 19.657  17.826  1.00 33.65  ? 289 GLY A O   1 
ATOM   2205  N N   . MET A 1 293 ? 22.271 20.040  19.988  1.00 30.28  ? 290 MET A N   1 
ATOM   2206  C CA  . MET A 1 293 ? 21.950 21.460  19.952  1.00 31.44  ? 290 MET A CA  1 
ATOM   2207  C C   . MET A 1 293 ? 23.176 22.333  20.178  1.00 37.85  ? 290 MET A C   1 
ATOM   2208  O O   . MET A 1 293 ? 23.034 23.536  20.425  1.00 37.93  ? 290 MET A O   1 
ATOM   2209  C CB  . MET A 1 293 ? 20.879 21.794  20.994  1.00 32.79  ? 290 MET A CB  1 
ATOM   2210  C CG  . MET A 1 293 ? 19.549 21.100  20.761  1.00 33.81  ? 290 MET A CG  1 
ATOM   2211  S SD  . MET A 1 293 ? 18.744 21.618  19.235  1.00 35.29  ? 290 MET A SD  1 
ATOM   2212  C CE  . MET A 1 293 ? 18.035 23.179  19.747  1.00 32.39  ? 290 MET A CE  1 
ATOM   2213  N N   . MET A 1 294 ? 24.376 21.760  20.105  1.00 35.94  ? 291 MET A N   1 
ATOM   2214  C CA  . MET A 1 294 ? 25.612 22.496  20.338  1.00 36.77  ? 291 MET A CA  1 
ATOM   2215  C C   . MET A 1 294 ? 26.410 22.595  19.047  1.00 34.60  ? 291 MET A C   1 
ATOM   2216  O O   . MET A 1 294 ? 26.836 21.577  18.491  1.00 32.89  ? 291 MET A O   1 
ATOM   2217  C CB  . MET A 1 294 ? 26.457 21.841  21.428  1.00 32.07  ? 291 MET A CB  1 
ATOM   2218  C CG  . MET A 1 294 ? 27.742 22.604  21.704  1.00 38.49  ? 291 MET A CG  1 
ATOM   2219  S SD  . MET A 1 294 ? 28.652 22.003  23.129  1.00 48.67  ? 291 MET A SD  1 
ATOM   2220  C CE  . MET A 1 294 ? 27.724 22.806  24.433  1.00 42.48  ? 291 MET A CE  1 
ATOM   2221  N N   . THR A 1 295 ? 26.619 23.820  18.587  1.00 34.44  ? 292 THR A N   1 
ATOM   2222  C CA  . THR A 1 295 ? 27.418 24.098  17.406  1.00 39.68  ? 292 THR A CA  1 
ATOM   2223  C C   . THR A 1 295 ? 28.838 24.480  17.812  1.00 43.39  ? 292 THR A C   1 
ATOM   2224  O O   . THR A 1 295 ? 29.111 24.832  18.964  1.00 42.70  ? 292 THR A O   1 
ATOM   2225  C CB  . THR A 1 295 ? 26.777 25.216  16.577  1.00 45.09  ? 292 THR A CB  1 
ATOM   2226  O OG1 . THR A 1 295 ? 27.160 25.085  15.201  1.00 52.92  ? 292 THR A OG1 1 
ATOM   2227  C CG2 . THR A 1 295 ? 27.195 26.579  17.103  1.00 36.18  ? 292 THR A CG2 1 
ATOM   2228  N N   . SER A 1 296 ? 29.747 24.389  16.847  1.00 38.90  ? 293 SER A N   1 
ATOM   2229  C CA  . SER A 1 296 ? 31.155 24.681  17.066  1.00 37.13  ? 293 SER A CA  1 
ATOM   2230  C C   . SER A 1 296 ? 31.697 25.435  15.864  1.00 44.66  ? 293 SER A C   1 
ATOM   2231  O O   . SER A 1 296 ? 31.292 25.179  14.726  1.00 40.35  ? 293 SER A O   1 
ATOM   2232  C CB  . SER A 1 296 ? 31.966 23.399  17.293  1.00 31.11  ? 293 SER A CB  1 
ATOM   2233  O OG  . SER A 1 296 ? 33.355 23.656  17.210  1.00 50.04  ? 293 SER A OG  1 
ATOM   2234  N N   . VAL A 1 297 ? 32.612 26.367  16.117  1.00 38.52  ? 294 VAL A N   1 
ATOM   2235  C CA  . VAL A 1 297 ? 33.214 27.167  15.059  1.00 32.52  ? 294 VAL A CA  1 
ATOM   2236  C C   . VAL A 1 297 ? 34.651 27.504  15.439  1.00 33.65  ? 294 VAL A C   1 
ATOM   2237  O O   . VAL A 1 297 ? 34.918 27.994  16.542  1.00 29.42  ? 294 VAL A O   1 
ATOM   2238  C CB  . VAL A 1 297 ? 32.391 28.439  14.764  1.00 34.59  ? 294 VAL A CB  1 
ATOM   2239  C CG1 . VAL A 1 297 ? 32.302 29.339  15.985  1.00 43.42  ? 294 VAL A CG1 1 
ATOM   2240  C CG2 . VAL A 1 297 ? 32.983 29.188  13.590  1.00 34.19  ? 294 VAL A CG2 1 
ATOM   2241  N N   . LEU A 1 298 ? 35.575 27.210  14.530  1.00 34.87  ? 295 LEU A N   1 
ATOM   2242  C CA  . LEU A 1 298 ? 36.984 27.545  14.687  1.00 32.30  ? 295 LEU A CA  1 
ATOM   2243  C C   . LEU A 1 298 ? 37.223 28.925  14.090  1.00 31.91  ? 295 LEU A C   1 
ATOM   2244  O O   . LEU A 1 298 ? 36.954 29.144  12.904  1.00 31.85  ? 295 LEU A O   1 
ATOM   2245  C CB  . LEU A 1 298 ? 37.857 26.499  13.995  1.00 30.77  ? 295 LEU A CB  1 
ATOM   2246  C CG  . LEU A 1 298 ? 39.343 26.806  13.806  1.00 32.15  ? 295 LEU A CG  1 
ATOM   2247  C CD1 . LEU A 1 298 ? 40.110 26.625  15.109  1.00 28.11  ? 295 LEU A CD1 1 
ATOM   2248  C CD2 . LEU A 1 298 ? 39.944 25.958  12.689  1.00 26.92  ? 295 LEU A CD2 1 
ATOM   2249  N N   . VAL A 1 299 ? 37.723 29.852  14.903  1.00 33.78  ? 296 VAL A N   1 
ATOM   2250  C CA  . VAL A 1 299 ? 37.872 31.248  14.508  1.00 33.12  ? 296 VAL A CA  1 
ATOM   2251  C C   . VAL A 1 299 ? 39.356 31.568  14.404  1.00 32.88  ? 296 VAL A C   1 
ATOM   2252  O O   . VAL A 1 299 ? 40.070 31.593  15.415  1.00 34.80  ? 296 VAL A O   1 
ATOM   2253  C CB  . VAL A 1 299 ? 37.168 32.192  15.490  1.00 36.80  ? 296 VAL A CB  1 
ATOM   2254  C CG1 . VAL A 1 299 ? 37.328 33.637  15.041  1.00 24.20  ? 296 VAL A CG1 1 
ATOM   2255  C CG2 . VAL A 1 299 ? 35.694 31.831  15.589  1.00 33.65  ? 296 VAL A CG2 1 
ATOM   2256  N N   . CYS A 1 300 ? 39.815 31.820  13.182  1.00 31.97  ? 297 CYS A N   1 
ATOM   2257  C CA  . CYS A 1 300 ? 41.204 32.179  12.967  1.00 36.98  ? 297 CYS A CA  1 
ATOM   2258  C C   . CYS A 1 300 ? 41.443 33.637  13.360  1.00 35.06  ? 297 CYS A C   1 
ATOM   2259  O O   . CYS A 1 300 ? 40.550 34.479  13.233  1.00 28.97  ? 297 CYS A O   1 
ATOM   2260  C CB  . CYS A 1 300 ? 41.595 31.952  11.510  1.00 32.98  ? 297 CYS A CB  1 
ATOM   2261  S SG  . CYS A 1 300 ? 41.351 30.248  10.949  1.00 34.63  ? 297 CYS A SG  1 
ATOM   2262  N N   . PRO A 1 301 ? 42.647 33.958  13.841  1.00 33.80  ? 298 PRO A N   1 
ATOM   2263  C CA  . PRO A 1 301 ? 42.891 35.314  14.360  1.00 32.16  ? 298 PRO A CA  1 
ATOM   2264  C C   . PRO A 1 301 ? 42.816 36.404  13.306  1.00 40.78  ? 298 PRO A C   1 
ATOM   2265  O O   . PRO A 1 301 ? 42.712 37.583  13.671  1.00 41.03  ? 298 PRO A O   1 
ATOM   2266  C CB  . PRO A 1 301 ? 44.301 35.217  14.961  1.00 33.86  ? 298 PRO A CB  1 
ATOM   2267  C CG  . PRO A 1 301 ? 44.930 34.032  14.299  1.00 33.22  ? 298 PRO A CG  1 
ATOM   2268  C CD  . PRO A 1 301 ? 43.813 33.074  14.013  1.00 30.57  ? 298 PRO A CD  1 
ATOM   2269  N N   . ASP A 1 302 ? 42.856 36.063  12.017  1.00 35.75  ? 299 ASP A N   1 
ATOM   2270  C CA  . ASP A 1 302 ? 42.776 37.094  10.988  1.00 39.49  ? 299 ASP A CA  1 
ATOM   2271  C C   . ASP A 1 302 ? 41.380 37.690  10.851  1.00 38.73  ? 299 ASP A C   1 
ATOM   2272  O O   . ASP A 1 302 ? 41.219 38.687  10.139  1.00 48.15  ? 299 ASP A O   1 
ATOM   2273  C CB  . ASP A 1 302 ? 43.236 36.536  9.637   1.00 34.71  ? 299 ASP A CB  1 
ATOM   2274  C CG  . ASP A 1 302 ? 42.420 35.332  9.184   1.00 40.70  ? 299 ASP A CG  1 
ATOM   2275  O OD1 . ASP A 1 302 ? 41.429 34.978  9.859   1.00 37.79  ? 299 ASP A OD1 1 
ATOM   2276  O OD2 . ASP A 1 302 ? 42.776 34.737  8.144   1.00 40.86  ? 299 ASP A OD2 1 
ATOM   2277  N N   . GLY A 1 303 ? 40.376 37.111  11.506  1.00 37.02  ? 300 GLY A N   1 
ATOM   2278  C CA  . GLY A 1 303 ? 39.012 37.568  11.352  1.00 36.72  ? 300 GLY A CA  1 
ATOM   2279  C C   . GLY A 1 303 ? 38.364 37.241  10.024  1.00 44.98  ? 300 GLY A C   1 
ATOM   2280  O O   . GLY A 1 303 ? 37.204 37.614  9.815   1.00 48.41  ? 300 GLY A O   1 
ATOM   2281  N N   . LYS A 1 304 ? 39.066 36.555  9.123   1.00 39.31  ? 301 LYS A N   1 
ATOM   2282  C CA  . LYS A 1 304 ? 38.552 36.220  7.798   1.00 40.89  ? 301 LYS A CA  1 
ATOM   2283  C C   . LYS A 1 304 ? 38.162 34.759  7.643   1.00 39.30  ? 301 LYS A C   1 
ATOM   2284  O O   . LYS A 1 304 ? 37.181 34.460  6.958   1.00 37.12  ? 301 LYS A O   1 
ATOM   2285  C CB  . LYS A 1 304 ? 39.590 36.565  6.722   1.00 40.87  ? 301 LYS A CB  1 
ATOM   2286  C CG  . LYS A 1 304 ? 39.948 38.038  6.626   1.00 54.80  ? 301 LYS A CG  1 
ATOM   2287  C CD  . LYS A 1 304 ? 40.868 38.296  5.438   1.00 64.86  ? 301 LYS A CD  1 
ATOM   2288  C CE  . LYS A 1 304 ? 41.133 39.782  5.245   1.00 75.12  ? 301 LYS A CE  1 
ATOM   2289  N NZ  . LYS A 1 304 ? 41.647 40.073  3.877   1.00 78.51  ? 301 LYS A NZ  1 
ATOM   2290  N N   . THR A 1 305 ? 38.903 33.837  8.254   1.00 34.07  ? 302 THR A N   1 
ATOM   2291  C CA  . THR A 1 305 ? 38.742 32.411  8.002   1.00 36.97  ? 302 THR A CA  1 
ATOM   2292  C C   . THR A 1 305 ? 37.996 31.738  9.149   1.00 36.41  ? 302 THR A C   1 
ATOM   2293  O O   . THR A 1 305 ? 38.332 31.936  10.322  1.00 37.58  ? 302 THR A O   1 
ATOM   2294  C CB  . THR A 1 305 ? 40.101 31.742  7.788   1.00 39.73  ? 302 THR A CB  1 
ATOM   2295  O OG1 . THR A 1 305 ? 40.799 32.414  6.730   1.00 39.82  ? 302 THR A OG1 1 
ATOM   2296  C CG2 . THR A 1 305 ? 39.926 30.273  7.425   1.00 37.13  ? 302 THR A CG2 1 
ATOM   2297  N N   . VAL A 1 306 ? 36.998 30.931  8.796   1.00 35.16  ? 303 VAL A N   1 
ATOM   2298  C CA  . VAL A 1 306 ? 36.095 30.287  9.742   1.00 30.63  ? 303 VAL A CA  1 
ATOM   2299  C C   . VAL A 1 306 ? 35.854 28.857  9.270   1.00 36.53  ? 303 VAL A C   1 
ATOM   2300  O O   . VAL A 1 306 ? 35.769 28.600  8.065   1.00 31.86  ? 303 VAL A O   1 
ATOM   2301  C CB  . VAL A 1 306 ? 34.770 31.078  9.855   1.00 38.68  ? 303 VAL A CB  1 
ATOM   2302  C CG1 . VAL A 1 306 ? 33.607 30.176  10.230  1.00 40.44  ? 303 VAL A CG1 1 
ATOM   2303  C CG2 . VAL A 1 306 ? 34.910 32.228  10.848  1.00 33.19  ? 303 VAL A CG2 1 
ATOM   2304  N N   . GLU A 1 307 ? 35.770 27.920  10.217  1.00 32.15  ? 304 GLU A N   1 
ATOM   2305  C CA  . GLU A 1 307 ? 35.390 26.541  9.925   1.00 34.17  ? 304 GLU A CA  1 
ATOM   2306  C C   . GLU A 1 307 ? 34.298 26.131  10.902  1.00 34.29  ? 304 GLU A C   1 
ATOM   2307  O O   . GLU A 1 307 ? 34.541 26.051  12.110  1.00 34.99  ? 304 GLU A O   1 
ATOM   2308  C CB  . GLU A 1 307 ? 36.582 25.592  10.022  1.00 33.29  ? 304 GLU A CB  1 
ATOM   2309  C CG  . GLU A 1 307 ? 36.247 24.175  9.575   1.00 34.72  ? 304 GLU A CG  1 
ATOM   2310  C CD  . GLU A 1 307 ? 36.788 23.114  10.511  1.00 43.39  ? 304 GLU A CD  1 
ATOM   2311  O OE1 . GLU A 1 307 ? 37.265 23.468  11.609  1.00 49.82  ? 304 GLU A OE1 1 
ATOM   2312  O OE2 . GLU A 1 307 ? 36.725 21.921  10.150  1.00 45.34  ? 304 GLU A OE2 1 
ATOM   2313  N N   . ALA A 1 308 ? 33.105 25.862  10.379  1.00 30.34  ? 305 ALA A N   1 
ATOM   2314  C CA  . ALA A 1 308 ? 31.935 25.568  11.191  1.00 28.78  ? 305 ALA A CA  1 
ATOM   2315  C C   . ALA A 1 308 ? 31.605 24.082  11.148  1.00 32.28  ? 305 ALA A C   1 
ATOM   2316  O O   . ALA A 1 308 ? 31.773 23.416  10.122  1.00 33.79  ? 305 ALA A O   1 
ATOM   2317  C CB  . ALA A 1 308 ? 30.727 26.378  10.718  1.00 27.97  ? 305 ALA A CB  1 
ATOM   2318  N N   . GLU A 1 309 ? 31.118 23.573  12.276  1.00 28.11  ? 306 GLU A N   1 
ATOM   2319  C CA  . GLU A 1 309 ? 30.790 22.160  12.404  1.00 33.99  ? 306 GLU A CA  1 
ATOM   2320  C C   . GLU A 1 309 ? 29.903 21.976  13.625  1.00 35.35  ? 306 GLU A C   1 
ATOM   2321  O O   . GLU A 1 309 ? 29.740 22.881  14.446  1.00 31.84  ? 306 GLU A O   1 
ATOM   2322  C CB  . GLU A 1 309 ? 32.052 21.299  12.520  1.00 32.01  ? 306 GLU A CB  1 
ATOM   2323  C CG  . GLU A 1 309 ? 32.876 21.580  13.768  1.00 36.17  ? 306 GLU A CG  1 
ATOM   2324  C CD  . GLU A 1 309 ? 34.190 20.823  13.784  1.00 43.32  ? 306 GLU A CD  1 
ATOM   2325  O OE1 . GLU A 1 309 ? 34.314 19.831  13.037  1.00 48.23  ? 306 GLU A OE1 1 
ATOM   2326  O OE2 . GLU A 1 309 ? 35.101 21.222  14.539  1.00 52.12  ? 306 GLU A OE2 1 
ATOM   2327  N N   . ALA A 1 310 ? 29.322 20.787  13.726  1.00 33.20  ? 307 ALA A N   1 
ATOM   2328  C CA  . ALA A 1 310 ? 28.633 20.389  14.939  1.00 32.71  ? 307 ALA A CA  1 
ATOM   2329  C C   . ALA A 1 310 ? 29.654 20.014  16.003  1.00 34.09  ? 307 ALA A C   1 
ATOM   2330  O O   . ALA A 1 310 ? 30.763 19.569  15.699  1.00 35.77  ? 307 ALA A O   1 
ATOM   2331  C CB  . ALA A 1 310 ? 27.698 19.211  14.669  1.00 26.92  ? 307 ALA A CB  1 
ATOM   2332  N N   . ALA A 1 311 ? 29.273 20.201  17.266  1.00 29.70  ? 308 ALA A N   1 
ATOM   2333  C CA  . ALA A 1 311 ? 30.168 19.849  18.361  1.00 37.03  ? 308 ALA A CA  1 
ATOM   2334  C C   . ALA A 1 311 ? 30.244 18.346  18.600  1.00 35.00  ? 308 ALA A C   1 
ATOM   2335  O O   . ALA A 1 311 ? 31.202 17.879  19.225  1.00 33.66  ? 308 ALA A O   1 
ATOM   2336  C CB  . ALA A 1 311 ? 29.734 20.554  19.645  1.00 31.37  ? 308 ALA A CB  1 
ATOM   2337  N N   . HIS A 1 312 ? 29.271 17.583  18.113  1.00 29.77  ? 309 HIS A N   1 
ATOM   2338  C CA  . HIS A 1 312 ? 29.204 16.153  18.363  1.00 33.41  ? 309 HIS A CA  1 
ATOM   2339  C C   . HIS A 1 312 ? 29.891 15.375  17.246  1.00 37.32  ? 309 HIS A C   1 
ATOM   2340  O O   . HIS A 1 312 ? 30.300 15.927  16.222  1.00 33.10  ? 309 HIS A O   1 
ATOM   2341  C CB  . HIS A 1 312 ? 27.750 15.700  18.500  1.00 33.35  ? 309 HIS A CB  1 
ATOM   2342  C CG  . HIS A 1 312 ? 26.902 16.030  17.309  1.00 34.53  ? 309 HIS A CG  1 
ATOM   2343  N ND1 . HIS A 1 312 ? 27.027 15.376  16.102  1.00 29.19  ? 309 HIS A ND1 1 
ATOM   2344  C CD2 . HIS A 1 312 ? 25.916 16.943  17.141  1.00 34.56  ? 309 HIS A CD2 1 
ATOM   2345  C CE1 . HIS A 1 312 ? 26.158 15.873  15.241  1.00 32.37  ? 309 HIS A CE1 1 
ATOM   2346  N NE2 . HIS A 1 312 ? 25.470 16.825  15.847  1.00 38.08  ? 309 HIS A NE2 1 
ATOM   2347  N N   . GLY A 1 313 ? 30.001 14.070  17.452  1.00 35.57  ? 310 GLY A N   1 
ATOM   2348  C CA  . GLY A 1 313 ? 30.614 13.169  16.495  1.00 33.94  ? 310 GLY A CA  1 
ATOM   2349  C C   . GLY A 1 313 ? 29.625 12.601  15.500  1.00 35.44  ? 310 GLY A C   1 
ATOM   2350  O O   . GLY A 1 313 ? 28.568 13.181  15.233  1.00 33.40  ? 310 GLY A O   1 
ATOM   2351  N N   . THR A 1 314 ? 29.978 11.445  14.939  1.00 35.41  ? 311 THR A N   1 
ATOM   2352  C CA  . THR A 1 314 ? 29.182 10.816  13.892  1.00 36.07  ? 311 THR A CA  1 
ATOM   2353  C C   . THR A 1 314 ? 27.960 10.079  14.427  1.00 39.98  ? 311 THR A C   1 
ATOM   2354  O O   . THR A 1 314 ? 27.162 9.580   13.624  1.00 34.45  ? 311 THR A O   1 
ATOM   2355  C CB  . THR A 1 314 ? 30.046 9.842   13.089  1.00 38.27  ? 311 THR A CB  1 
ATOM   2356  O OG1 . THR A 1 314 ? 30.407 8.730   13.918  1.00 34.51  ? 311 THR A OG1 1 
ATOM   2357  C CG2 . THR A 1 314 ? 31.317 10.532  12.605  1.00 35.42  ? 311 THR A CG2 1 
ATOM   2358  N N   . VAL A 1 315 ? 27.792 10.013  15.749  1.00 36.30  ? 312 VAL A N   1 
ATOM   2359  C CA  . VAL A 1 315 ? 26.683 9.318   16.399  1.00 39.37  ? 312 VAL A CA  1 
ATOM   2360  C C   . VAL A 1 315 ? 26.638 7.873   15.914  1.00 41.16  ? 312 VAL A C   1 
ATOM   2361  O O   . VAL A 1 315 ? 25.656 7.437   15.301  1.00 36.57  ? 312 VAL A O   1 
ATOM   2362  C CB  . VAL A 1 315 ? 25.342 10.037  16.159  1.00 41.71  ? 312 VAL A CB  1 
ATOM   2363  C CG1 . VAL A 1 315 ? 24.345 9.645   17.226  1.00 44.47  ? 312 VAL A CG1 1 
ATOM   2364  C CG2 . VAL A 1 315 ? 25.539 11.543  16.163  1.00 34.62  ? 312 VAL A CG2 1 
ATOM   2365  N N   . THR A 1 316 ? 27.706 7.126   16.204  1.00 39.30  ? 313 THR A N   1 
ATOM   2366  C CA  . THR A 1 316 ? 27.812 5.743   15.753  1.00 43.04  ? 313 THR A CA  1 
ATOM   2367  C C   . THR A 1 316 ? 26.664 4.885   16.275  1.00 43.95  ? 313 THR A C   1 
ATOM   2368  O O   . THR A 1 316 ? 26.131 4.039   15.547  1.00 40.12  ? 313 THR A O   1 
ATOM   2369  C CB  . THR A 1 316 ? 29.156 5.163   16.193  1.00 43.78  ? 313 THR A CB  1 
ATOM   2370  O OG1 . THR A 1 316 ? 30.215 6.003   15.721  1.00 38.91  ? 313 THR A OG1 1 
ATOM   2371  C CG2 . THR A 1 316 ? 29.341 3.751   15.651  1.00 41.10  ? 313 THR A CG2 1 
ATOM   2372  N N   . ARG A 1 317 ? 26.262 5.097   17.532  1.00 43.91  ? 314 ARG A N   1 
ATOM   2373  C CA  . ARG A 1 317 ? 25.237 4.245   18.132  1.00 47.99  ? 314 ARG A CA  1 
ATOM   2374  C C   . ARG A 1 317 ? 23.907 4.368   17.399  1.00 50.85  ? 314 ARG A C   1 
ATOM   2375  O O   . ARG A 1 317 ? 23.203 3.369   17.207  1.00 51.58  ? 314 ARG A O   1 
ATOM   2376  C CB  . ARG A 1 317 ? 25.066 4.579   19.614  1.00 44.33  ? 314 ARG A CB  1 
ATOM   2377  C CG  . ARG A 1 317 ? 24.268 3.533   20.379  1.00 56.11  ? 314 ARG A CG  1 
ATOM   2378  C CD  . ARG A 1 317 ? 23.684 4.084   21.673  1.00 57.99  ? 314 ARG A CD  1 
ATOM   2379  N NE  . ARG A 1 317 ? 22.774 5.205   21.449  1.00 59.65  ? 314 ARG A NE  1 
ATOM   2380  C CZ  . ARG A 1 317 ? 21.458 5.148   21.629  1.00 56.95  ? 314 ARG A CZ  1 
ATOM   2381  N NH1 . ARG A 1 317 ? 20.890 4.020   22.028  1.00 60.09  ? 314 ARG A NH1 1 
ATOM   2382  N NH2 . ARG A 1 317 ? 20.708 6.220   21.406  1.00 61.92  ? 314 ARG A NH2 1 
ATOM   2383  N N   . HIS A 1 318 ? 23.543 5.584   16.982  1.00 47.15  ? 315 HIS A N   1 
ATOM   2384  C CA  . HIS A 1 318 ? 22.341 5.743   16.171  1.00 43.56  ? 315 HIS A CA  1 
ATOM   2385  C C   . HIS A 1 318 ? 22.533 5.151   14.784  1.00 46.11  ? 315 HIS A C   1 
ATOM   2386  O O   . HIS A 1 318 ? 21.577 4.645   14.184  1.00 44.47  ? 315 HIS A O   1 
ATOM   2387  C CB  . HIS A 1 318 ? 21.967 7.219   16.049  1.00 39.45  ? 315 HIS A CB  1 
ATOM   2388  C CG  . HIS A 1 318 ? 21.585 7.865   17.345  1.00 42.72  ? 315 HIS A CG  1 
ATOM   2389  N ND1 . HIS A 1 318 ? 20.780 8.982   17.407  1.00 40.91  ? 315 HIS A ND1 1 
ATOM   2390  C CD2 . HIS A 1 318 ? 21.922 7.573   18.624  1.00 38.63  ? 315 HIS A CD2 1 
ATOM   2391  C CE1 . HIS A 1 318 ? 20.624 9.341   18.668  1.00 35.91  ? 315 HIS A CE1 1 
ATOM   2392  N NE2 . HIS A 1 318 ? 21.308 8.503   19.427  1.00 45.21  ? 315 HIS A NE2 1 
ATOM   2393  N N   . TYR A 1 319 ? 23.759 5.211   14.260  1.00 46.90  ? 316 TYR A N   1 
ATOM   2394  C CA  . TYR A 1 319 ? 24.024 4.703   12.919  1.00 45.67  ? 316 TYR A CA  1 
ATOM   2395  C C   . TYR A 1 319 ? 23.883 3.187   12.863  1.00 48.74  ? 316 TYR A C   1 
ATOM   2396  O O   . TYR A 1 319 ? 23.380 2.642   11.872  1.00 46.34  ? 316 TYR A O   1 
ATOM   2397  C CB  . TYR A 1 319 ? 25.419 5.137   12.477  1.00 40.60  ? 316 TYR A CB  1 
ATOM   2398  C CG  . TYR A 1 319 ? 25.807 4.680   11.095  1.00 39.49  ? 316 TYR A CG  1 
ATOM   2399  C CD1 . TYR A 1 319 ? 25.207 5.226   9.968   1.00 38.71  ? 316 TYR A CD1 1 
ATOM   2400  C CD2 . TYR A 1 319 ? 26.782 3.710   10.915  1.00 40.67  ? 316 TYR A CD2 1 
ATOM   2401  C CE1 . TYR A 1 319 ? 25.565 4.814   8.701   1.00 43.13  ? 316 TYR A CE1 1 
ATOM   2402  C CE2 . TYR A 1 319 ? 27.147 3.292   9.654   1.00 45.28  ? 316 TYR A CE2 1 
ATOM   2403  C CZ  . TYR A 1 319 ? 26.535 3.846   8.551   1.00 43.51  ? 316 TYR A CZ  1 
ATOM   2404  O OH  . TYR A 1 319 ? 26.896 3.432   7.291   1.00 47.15  ? 316 TYR A OH  1 
ATOM   2405  N N   . ARG A 1 320 ? 24.322 2.491   13.914  1.00 44.32  ? 317 ARG A N   1 
ATOM   2406  C CA  . ARG A 1 320 ? 24.146 1.043   13.971  1.00 49.21  ? 317 ARG A CA  1 
ATOM   2407  C C   . ARG A 1 320 ? 22.667 0.676   13.984  1.00 53.92  ? 317 ARG A C   1 
ATOM   2408  O O   . ARG A 1 320 ? 22.233 -0.230  13.262  1.00 58.18  ? 317 ARG A O   1 
ATOM   2409  C CB  . ARG A 1 320 ? 24.853 0.475   15.202  1.00 48.82  ? 317 ARG A CB  1 
ATOM   2410  C CG  . ARG A 1 320 ? 26.357 0.702   15.230  1.00 47.99  ? 317 ARG A CG  1 
ATOM   2411  C CD  . ARG A 1 320 ? 27.022 0.283   13.929  1.00 45.10  ? 317 ARG A CD  1 
ATOM   2412  N NE  . ARG A 1 320 ? 28.475 0.396   14.015  1.00 47.82  ? 317 ARG A NE  1 
ATOM   2413  C CZ  . ARG A 1 320 ? 29.274 0.599   12.972  1.00 45.79  ? 317 ARG A CZ  1 
ATOM   2414  N NH1 . ARG A 1 320 ? 28.763 0.712   11.754  1.00 35.22  ? 317 ARG A NH1 1 
ATOM   2415  N NH2 . ARG A 1 320 ? 30.585 0.690   13.149  1.00 44.40  ? 317 ARG A NH2 1 
ATOM   2416  N N   . MET A 1 321 ? 21.875 1.374   14.805  1.00 51.35  ? 318 MET A N   1 
ATOM   2417  C CA  . MET A 1 321 ? 20.432 1.153   14.808  1.00 57.18  ? 318 MET A CA  1 
ATOM   2418  C C   . MET A 1 321 ? 19.839 1.396   13.425  1.00 59.12  ? 318 MET A C   1 
ATOM   2419  O O   . MET A 1 321 ? 18.978 0.636   12.966  1.00 59.87  ? 318 MET A O   1 
ATOM   2420  C CB  . MET A 1 321 ? 19.767 2.058   15.846  1.00 58.81  ? 318 MET A CB  1 
ATOM   2421  C CG  . MET A 1 321 ? 19.930 1.586   17.282  1.00 54.54  ? 318 MET A CG  1 
ATOM   2422  S SD  . MET A 1 321 ? 19.433 2.819   18.503  1.00 73.99  ? 318 MET A SD  1 
ATOM   2423  C CE  . MET A 1 321 ? 17.992 3.533   17.717  1.00 58.03  ? 318 MET A CE  1 
ATOM   2424  N N   . TYR A 1 322 ? 20.299 2.449   12.745  1.00 51.78  ? 319 TYR A N   1 
ATOM   2425  C CA  . TYR A 1 322 ? 19.857 2.710   11.379  1.00 51.23  ? 319 TYR A CA  1 
ATOM   2426  C C   . TYR A 1 322 ? 20.276 1.585   10.441  1.00 58.38  ? 319 TYR A C   1 
ATOM   2427  O O   . TYR A 1 322 ? 19.492 1.154   9.587   1.00 61.55  ? 319 TYR A O   1 
ATOM   2428  C CB  . TYR A 1 322 ? 20.422 4.052   10.913  1.00 50.64  ? 319 TYR A CB  1 
ATOM   2429  C CG  . TYR A 1 322 ? 20.323 4.333   9.430   1.00 49.18  ? 319 TYR A CG  1 
ATOM   2430  C CD1 . TYR A 1 322 ? 19.184 4.910   8.885   1.00 56.21  ? 319 TYR A CD1 1 
ATOM   2431  C CD2 . TYR A 1 322 ? 21.383 4.046   8.580   1.00 57.63  ? 319 TYR A CD2 1 
ATOM   2432  C CE1 . TYR A 1 322 ? 19.098 5.181   7.530   1.00 54.17  ? 319 TYR A CE1 1 
ATOM   2433  C CE2 . TYR A 1 322 ? 21.307 4.311   7.227   1.00 53.60  ? 319 TYR A CE2 1 
ATOM   2434  C CZ  . TYR A 1 322 ? 20.163 4.880   6.707   1.00 55.66  ? 319 TYR A CZ  1 
ATOM   2435  O OH  . TYR A 1 322 ? 20.083 5.147   5.359   1.00 50.10  ? 319 TYR A OH  1 
ATOM   2436  N N   . GLN A 1 323 ? 21.511 1.092   10.589  1.00 54.73  ? 320 GLN A N   1 
ATOM   2437  C CA  . GLN A 1 323 ? 21.992 0.016   9.727   1.00 60.67  ? 320 GLN A CA  1 
ATOM   2438  C C   . GLN A 1 323 ? 21.169 -1.253  9.908   1.00 63.91  ? 320 GLN A C   1 
ATOM   2439  O O   . GLN A 1 323 ? 20.890 -1.967  8.938   1.00 59.75  ? 320 GLN A O   1 
ATOM   2440  C CB  . GLN A 1 323 ? 23.464 -0.271  10.018  1.00 55.63  ? 320 GLN A CB  1 
ATOM   2441  C CG  . GLN A 1 323 ? 24.446 0.594   9.250   1.00 51.83  ? 320 GLN A CG  1 
ATOM   2442  C CD  . GLN A 1 323 ? 25.879 0.172   9.493   1.00 55.21  ? 320 GLN A CD  1 
ATOM   2443  O OE1 . GLN A 1 323 ? 26.281 -0.067  10.632  1.00 51.84  ? 320 GLN A OE1 1 
ATOM   2444  N NE2 . GLN A 1 323 ? 26.657 0.066   8.422   1.00 50.00  ? 320 GLN A NE2 1 
ATOM   2445  N N   . LYS A 1 324 ? 20.772 -1.553  11.144  1.00 64.36  ? 321 LYS A N   1 
ATOM   2446  C CA  . LYS A 1 324 ? 20.004 -2.760  11.420  1.00 64.78  ? 321 LYS A CA  1 
ATOM   2447  C C   . LYS A 1 324 ? 18.531 -2.633  11.048  1.00 65.87  ? 321 LYS A C   1 
ATOM   2448  O O   . LYS A 1 324 ? 17.791 -3.612  11.182  1.00 73.83  ? 321 LYS A O   1 
ATOM   2449  C CB  . LYS A 1 324 ? 20.138 -3.141  12.897  1.00 57.80  ? 321 LYS A CB  1 
ATOM   2450  C CG  . LYS A 1 324 ? 21.472 -3.798  13.240  1.00 59.63  ? 321 LYS A CG  1 
ATOM   2451  C CD  . LYS A 1 324 ? 22.104 -3.194  14.485  1.00 70.02  ? 321 LYS A CD  1 
ATOM   2452  C CE  . LYS A 1 324 ? 23.164 -4.119  15.068  1.00 76.84  ? 321 LYS A CE  1 
ATOM   2453  N NZ  . LYS A 1 324 ? 24.216 -3.376  15.820  1.00 76.84  ? 321 LYS A NZ  1 
ATOM   2454  N N   . GLY A 1 325 ? 18.086 -1.466  10.576  1.00 62.63  ? 322 GLY A N   1 
ATOM   2455  C CA  . GLY A 1 325 ? 16.720 -1.251  10.142  1.00 59.56  ? 322 GLY A CA  1 
ATOM   2456  C C   . GLY A 1 325 ? 15.879 -0.469  11.129  1.00 65.46  ? 322 GLY A C   1 
ATOM   2457  O O   . GLY A 1 325 ? 14.891 0.161   10.727  1.00 71.40  ? 322 GLY A O   1 
ATOM   2458  N N   . GLN A 1 326 ? 16.255 -0.487  12.406  1.00 63.76  ? 323 GLN A N   1 
ATOM   2459  C CA  . GLN A 1 326 ? 15.503 0.202   13.441  1.00 64.88  ? 323 GLN A CA  1 
ATOM   2460  C C   . GLN A 1 326 ? 15.425 1.701   13.144  1.00 67.61  ? 323 GLN A C   1 
ATOM   2461  O O   . GLN A 1 326 ? 16.188 2.245   12.340  1.00 66.89  ? 323 GLN A O   1 
ATOM   2462  C CB  . GLN A 1 326 ? 16.156 -0.049  14.798  1.00 66.70  ? 323 GLN A CB  1 
ATOM   2463  C CG  . GLN A 1 326 ? 16.614 -1.497  14.980  1.00 69.78  ? 323 GLN A CG  1 
ATOM   2464  C CD  . GLN A 1 326 ? 17.343 -1.729  16.289  1.00 80.08  ? 323 GLN A CD  1 
ATOM   2465  O OE1 . GLN A 1 326 ? 17.598 -0.792  17.046  1.00 73.73  ? 323 GLN A OE1 1 
ATOM   2466  N NE2 . GLN A 1 326 ? 17.686 -2.984  16.561  1.00 82.26  ? 323 GLN A NE2 1 
ATOM   2467  N N   . GLU A 1 327 ? 14.484 2.373   13.804  1.00 63.95  ? 324 GLU A N   1 
ATOM   2468  C CA  . GLU A 1 327 ? 14.221 3.780   13.533  1.00 65.46  ? 324 GLU A CA  1 
ATOM   2469  C C   . GLU A 1 327 ? 15.065 4.680   14.428  1.00 64.32  ? 324 GLU A C   1 
ATOM   2470  O O   . GLU A 1 327 ? 15.327 4.359   15.591  1.00 64.59  ? 324 GLU A O   1 
ATOM   2471  C CB  . GLU A 1 327 ? 12.735 4.101   13.705  1.00 74.17  ? 324 GLU A CB  1 
ATOM   2472  C CG  . GLU A 1 327 ? 11.914 3.791   12.459  1.00 68.63  ? 324 GLU A CG  1 
ATOM   2473  C CD  . GLU A 1 327 ? 10.736 4.730   12.276  1.00 72.76  ? 324 GLU A CD  1 
ATOM   2474  O OE1 . GLU A 1 327 ? 9.877  4.440   11.417  1.00 72.87  ? 324 GLU A OE1 1 
ATOM   2475  O OE2 . GLU A 1 327 ? 10.669 5.754   12.989  1.00 74.27  ? 324 GLU A OE2 1 
ATOM   2476  N N   . THR A 1 328 ? 15.475 5.817   13.871  1.00 59.71  ? 325 THR A N   1 
ATOM   2477  C CA  . THR A 1 328 ? 16.436 6.722   14.485  1.00 60.61  ? 325 THR A CA  1 
ATOM   2478  C C   . THR A 1 328 ? 15.823 8.102   14.667  1.00 50.88  ? 325 THR A C   1 
ATOM   2479  O O   . THR A 1 328 ? 15.117 8.601   13.784  1.00 51.66  ? 325 THR A O   1 
ATOM   2480  C CB  . THR A 1 328 ? 17.693 6.852   13.624  1.00 56.84  ? 325 THR A CB  1 
ATOM   2481  O OG1 . THR A 1 328 ? 17.329 7.319   12.318  1.00 54.64  ? 325 THR A OG1 1 
ATOM   2482  C CG2 . THR A 1 328 ? 18.400 5.511   13.497  1.00 58.16  ? 325 THR A CG2 1 
ATOM   2483  N N   . SER A 1 329 ? 16.121 8.727   15.801  1.00 47.76  ? 326 SER A N   1 
ATOM   2484  C CA  . SER A 1 329 ? 15.746 10.114  16.072  1.00 54.05  ? 326 SER A CA  1 
ATOM   2485  C C   . SER A 1 329 ? 17.010 10.890  16.437  1.00 48.11  ? 326 SER A C   1 
ATOM   2486  O O   . SER A 1 329 ? 17.205 11.283  17.591  1.00 48.49  ? 326 SER A O   1 
ATOM   2487  C CB  . SER A 1 329 ? 14.689 10.194  17.179  1.00 50.78  ? 326 SER A CB  1 
ATOM   2488  O OG  . SER A 1 329 ? 14.064 11.467  17.197  1.00 47.12  ? 326 SER A OG  1 
ATOM   2489  N N   . THR A 1 330 ? 17.873 11.104  15.447  1.00 49.02  ? 327 THR A N   1 
ATOM   2490  C CA  . THR A 1 330 ? 19.115 11.839  15.644  1.00 45.15  ? 327 THR A CA  1 
ATOM   2491  C C   . THR A 1 330 ? 18.881 13.319  15.362  1.00 44.63  ? 327 THR A C   1 
ATOM   2492  O O   . THR A 1 330 ? 18.242 13.674  14.365  1.00 40.28  ? 327 THR A O   1 
ATOM   2493  C CB  . THR A 1 330 ? 20.217 11.287  14.739  1.00 49.28  ? 327 THR A CB  1 
ATOM   2494  O OG1 . THR A 1 330 ? 20.391 9.887   14.993  1.00 45.56  ? 327 THR A OG1 1 
ATOM   2495  C CG2 . THR A 1 330 ? 21.532 12.005  15.002  1.00 43.95  ? 327 THR A CG2 1 
ATOM   2496  N N   . ASN A 1 331 ? 19.399 14.174  16.242  1.00 39.74  ? 328 ASN A N   1 
ATOM   2497  C CA  . ASN A 1 331 ? 19.140 15.608  16.154  1.00 39.19  ? 328 ASN A CA  1 
ATOM   2498  C C   . ASN A 1 331 ? 20.001 16.243  15.067  1.00 38.69  ? 328 ASN A C   1 
ATOM   2499  O O   . ASN A 1 331 ? 21.231 16.134  15.129  1.00 39.81  ? 328 ASN A O   1 
ATOM   2500  C CB  . ASN A 1 331 ? 19.409 16.279  17.495  1.00 39.48  ? 328 ASN A CB  1 
ATOM   2501  C CG  . ASN A 1 331 ? 18.805 17.662  17.588  1.00 33.44  ? 328 ASN A CG  1 
ATOM   2502  O OD1 . ASN A 1 331 ? 18.579 18.324  16.578  1.00 35.43  ? 328 ASN A OD1 1 
ATOM   2503  N ND2 . ASN A 1 331 ? 18.528 18.103  18.807  1.00 35.17  ? 328 ASN A ND2 1 
ATOM   2504  N N   . PRO A 1 332 ? 19.411 16.909  14.078  1.00 38.05  ? 329 PRO A N   1 
ATOM   2505  C CA  . PRO A 1 332 ? 20.202 17.516  12.993  1.00 36.00  ? 329 PRO A CA  1 
ATOM   2506  C C   . PRO A 1 332 ? 20.500 19.002  13.153  1.00 36.50  ? 329 PRO A C   1 
ATOM   2507  O O   . PRO A 1 332 ? 21.127 19.572  12.255  1.00 34.52  ? 329 PRO A O   1 
ATOM   2508  C CB  . PRO A 1 332 ? 19.286 17.293  11.785  1.00 41.67  ? 329 PRO A CB  1 
ATOM   2509  C CG  . PRO A 1 332 ? 17.922 17.535  12.364  1.00 37.48  ? 329 PRO A CG  1 
ATOM   2510  C CD  . PRO A 1 332 ? 17.968 16.934  13.765  1.00 37.51  ? 329 PRO A CD  1 
ATOM   2511  N N   . ILE A 1 333 ? 20.073 19.629  14.251  1.00 36.42  ? 330 ILE A N   1 
ATOM   2512  C CA  . ILE A 1 333 ? 20.137 21.085  14.361  1.00 39.14  ? 330 ILE A CA  1 
ATOM   2513  C C   . ILE A 1 333 ? 21.583 21.570  14.348  1.00 31.53  ? 330 ILE A C   1 
ATOM   2514  O O   . ILE A 1 333 ? 21.935 22.505  13.616  1.00 32.49  ? 330 ILE A O   1 
ATOM   2515  C CB  . ILE A 1 333 ? 19.390 21.557  15.621  1.00 38.39  ? 330 ILE A CB  1 
ATOM   2516  C CG1 . ILE A 1 333 ? 17.913 21.194  15.534  1.00 38.01  ? 330 ILE A CG1 1 
ATOM   2517  C CG2 . ILE A 1 333 ? 19.555 23.056  15.806  1.00 37.29  ? 330 ILE A CG2 1 
ATOM   2518  C CD1 . ILE A 1 333 ? 17.212 21.763  14.311  1.00 44.17  ? 330 ILE A CD1 1 
ATOM   2519  N N   . ALA A 1 334 ? 22.443 20.944  15.157  1.00 29.57  ? 331 ALA A N   1 
ATOM   2520  C CA  . ALA A 1 334 ? 23.840 21.361  15.214  1.00 35.55  ? 331 ALA A CA  1 
ATOM   2521  C C   . ALA A 1 334 ? 24.506 21.246  13.848  1.00 37.45  ? 331 ALA A C   1 
ATOM   2522  O O   . ALA A 1 334 ? 25.274 22.129  13.448  1.00 31.94  ? 331 ALA A O   1 
ATOM   2523  C CB  . ALA A 1 334 ? 24.590 20.535  16.261  1.00 30.31  ? 331 ALA A CB  1 
ATOM   2524  N N   . SER A 1 335 ? 24.211 20.171  13.111  1.00 32.83  ? 332 SER A N   1 
ATOM   2525  C CA  . SER A 1 335 ? 24.717 20.053  11.748  1.00 37.22  ? 332 SER A CA  1 
ATOM   2526  C C   . SER A 1 335 ? 24.146 21.147  10.858  1.00 31.42  ? 332 SER A C   1 
ATOM   2527  O O   . SER A 1 335 ? 24.856 21.703  10.010  1.00 29.02  ? 332 SER A O   1 
ATOM   2528  C CB  . SER A 1 335 ? 24.385 18.673  11.181  1.00 31.08  ? 332 SER A CB  1 
ATOM   2529  O OG  . SER A 1 335 ? 24.881 17.643  12.015  1.00 34.95  ? 332 SER A OG  1 
ATOM   2530  N N   . ILE A 1 336 ? 22.865 21.475  11.041  1.00 30.02  ? 333 ILE A N   1 
ATOM   2531  C CA  . ILE A 1 336 ? 22.249 22.536  10.248  1.00 32.60  ? 333 ILE A CA  1 
ATOM   2532  C C   . ILE A 1 336 ? 22.907 23.875  10.553  1.00 33.81  ? 333 ILE A C   1 
ATOM   2533  O O   . ILE A 1 336 ? 23.209 24.660  9.643   1.00 32.95  ? 333 ILE A O   1 
ATOM   2534  C CB  . ILE A 1 336 ? 20.729 22.581  10.498  1.00 38.09  ? 333 ILE A CB  1 
ATOM   2535  C CG1 . ILE A 1 336 ? 20.040 21.399  9.822   1.00 37.41  ? 333 ILE A CG1 1 
ATOM   2536  C CG2 . ILE A 1 336 ? 20.139 23.902  10.007  1.00 36.92  ? 333 ILE A CG2 1 
ATOM   2537  C CD1 . ILE A 1 336 ? 18.628 21.169  10.304  1.00 35.28  ? 333 ILE A CD1 1 
ATOM   2538  N N   . PHE A 1 337 ? 23.149 24.157  11.836  1.00 32.28  ? 334 PHE A N   1 
ATOM   2539  C CA  . PHE A 1 337 ? 23.751 25.431  12.206  1.00 34.50  ? 334 PHE A CA  1 
ATOM   2540  C C   . PHE A 1 337 ? 25.200 25.538  11.753  1.00 32.83  ? 334 PHE A C   1 
ATOM   2541  O O   . PHE A 1 337 ? 25.723 26.652  11.653  1.00 34.50  ? 334 PHE A O   1 
ATOM   2542  C CB  . PHE A 1 337 ? 23.638 25.650  13.714  1.00 34.85  ? 334 PHE A CB  1 
ATOM   2543  C CG  . PHE A 1 337 ? 22.339 26.276  14.135  1.00 36.69  ? 334 PHE A CG  1 
ATOM   2544  C CD1 . PHE A 1 337 ? 21.130 25.672  13.818  1.00 37.70  ? 334 PHE A CD1 1 
ATOM   2545  C CD2 . PHE A 1 337 ? 22.323 27.470  14.838  1.00 38.13  ? 334 PHE A CD2 1 
ATOM   2546  C CE1 . PHE A 1 337 ? 19.931 26.245  14.197  1.00 37.63  ? 334 PHE A CE1 1 
ATOM   2547  C CE2 . PHE A 1 337 ? 21.126 28.048  15.222  1.00 40.90  ? 334 PHE A CE2 1 
ATOM   2548  C CZ  . PHE A 1 337 ? 19.929 27.435  14.902  1.00 41.69  ? 334 PHE A CZ  1 
ATOM   2549  N N   . ALA A 1 338 ? 25.861 24.413  11.470  1.00 31.33  ? 335 ALA A N   1 
ATOM   2550  C CA  . ALA A 1 338 ? 27.163 24.486  10.815  1.00 34.78  ? 335 ALA A CA  1 
ATOM   2551  C C   . ALA A 1 338 ? 27.042 25.151  9.451   1.00 31.41  ? 335 ALA A C   1 
ATOM   2552  O O   . ALA A 1 338 ? 27.903 25.946  9.057   1.00 36.28  ? 335 ALA A O   1 
ATOM   2553  C CB  . ALA A 1 338 ? 27.766 23.089  10.677  1.00 29.23  ? 335 ALA A CB  1 
ATOM   2554  N N   . TRP A 1 339 ? 25.970 24.846  8.719   1.00 35.18  ? 336 TRP A N   1 
ATOM   2555  C CA  . TRP A 1 339 ? 25.767 25.464  7.414   1.00 33.66  ? 336 TRP A CA  1 
ATOM   2556  C C   . TRP A 1 339 ? 25.367 26.928  7.544   1.00 32.66  ? 336 TRP A C   1 
ATOM   2557  O O   . TRP A 1 339 ? 25.897 27.790  6.833   1.00 31.38  ? 336 TRP A O   1 
ATOM   2558  C CB  . TRP A 1 339 ? 24.718 24.684  6.625   1.00 36.91  ? 336 TRP A CB  1 
ATOM   2559  C CG  . TRP A 1 339 ? 25.250 23.427  6.020   1.00 34.26  ? 336 TRP A CG  1 
ATOM   2560  C CD1 . TRP A 1 339 ? 25.280 22.189  6.590   1.00 30.45  ? 336 TRP A CD1 1 
ATOM   2561  C CD2 . TRP A 1 339 ? 25.832 23.285  4.719   1.00 30.88  ? 336 TRP A CD2 1 
ATOM   2562  N NE1 . TRP A 1 339 ? 25.845 21.283  5.724   1.00 32.48  ? 336 TRP A NE1 1 
ATOM   2563  C CE2 . TRP A 1 339 ? 26.192 21.932  4.568   1.00 28.33  ? 336 TRP A CE2 1 
ATOM   2564  C CE3 . TRP A 1 339 ? 26.082 24.171  3.666   1.00 36.46  ? 336 TRP A CE3 1 
ATOM   2565  C CZ2 . TRP A 1 339 ? 26.790 21.443  3.407   1.00 38.10  ? 336 TRP A CZ2 1 
ATOM   2566  C CZ3 . TRP A 1 339 ? 26.675 23.684  2.513   1.00 32.59  ? 336 TRP A CZ3 1 
ATOM   2567  C CH2 . TRP A 1 339 ? 27.023 22.334  2.393   1.00 27.95  ? 336 TRP A CH2 1 
ATOM   2568  N N   . THR A 1 340 ? 24.435 27.233  8.450   1.00 30.02  ? 337 THR A N   1 
ATOM   2569  C CA  . THR A 1 340 ? 23.986 28.615  8.598   1.00 31.23  ? 337 THR A CA  1 
ATOM   2570  C C   . THR A 1 340 ? 25.132 29.526  9.023   1.00 35.39  ? 337 THR A C   1 
ATOM   2571  O O   . THR A 1 340 ? 25.298 30.624  8.479   1.00 32.84  ? 337 THR A O   1 
ATOM   2572  C CB  . THR A 1 340 ? 22.830 28.702  9.598   1.00 30.97  ? 337 THR A CB  1 
ATOM   2573  O OG1 . THR A 1 340 ? 23.278 28.269  10.891  1.00 33.86  ? 337 THR A OG1 1 
ATOM   2574  C CG2 . THR A 1 340 ? 21.661 27.841  9.147   1.00 32.82  ? 337 THR A CG2 1 
ATOM   2575  N N   . ARG A 1 341 ? 25.942 29.086  9.990   1.00 33.09  ? 338 ARG A N   1 
ATOM   2576  C CA  . ARG A 1 341 ? 27.060 29.914  10.434  1.00 36.41  ? 338 ARG A CA  1 
ATOM   2577  C C   . ARG A 1 341 ? 28.095 30.091  9.330   1.00 34.45  ? 338 ARG A C   1 
ATOM   2578  O O   . ARG A 1 341 ? 28.634 31.189  9.144   1.00 32.01  ? 338 ARG A O   1 
ATOM   2579  C CB  . ARG A 1 341 ? 27.708 29.318  11.684  1.00 37.12  ? 338 ARG A CB  1 
ATOM   2580  C CG  . ARG A 1 341 ? 27.153 29.874  12.984  1.00 45.32  ? 338 ARG A CG  1 
ATOM   2581  C CD  . ARG A 1 341 ? 25.825 29.240  13.332  1.00 41.81  ? 338 ARG A CD  1 
ATOM   2582  N NE  . ARG A 1 341 ? 24.976 30.123  14.123  1.00 51.46  ? 338 ARG A NE  1 
ATOM   2583  C CZ  . ARG A 1 341 ? 25.108 30.319  15.430  1.00 48.89  ? 338 ARG A CZ  1 
ATOM   2584  N NH1 . ARG A 1 341 ? 26.064 29.698  16.109  1.00 45.49  ? 338 ARG A NH1 1 
ATOM   2585  N NH2 . ARG A 1 341 ? 24.278 31.138  16.061  1.00 49.57  ? 338 ARG A NH2 1 
ATOM   2586  N N   . GLY A 1 342 ? 28.386 29.023  8.584   1.00 31.34  ? 339 GLY A N   1 
ATOM   2587  C CA  . GLY A 1 342 ? 29.293 29.157  7.456   1.00 29.90  ? 339 GLY A CA  1 
ATOM   2588  C C   . GLY A 1 342 ? 28.758 30.110  6.404   1.00 33.23  ? 339 GLY A C   1 
ATOM   2589  O O   . GLY A 1 342 ? 29.450 31.036  5.973   1.00 34.45  ? 339 GLY A O   1 
ATOM   2590  N N   . LEU A 1 343 ? 27.505 29.903  5.986   1.00 32.88  ? 340 LEU A N   1 
ATOM   2591  C CA  . LEU A 1 343 ? 26.912 30.762  4.966   1.00 31.85  ? 340 LEU A CA  1 
ATOM   2592  C C   . LEU A 1 343 ? 26.769 32.195  5.464   1.00 35.88  ? 340 LEU A C   1 
ATOM   2593  O O   . LEU A 1 343 ? 26.992 33.146  4.706   1.00 38.29  ? 340 LEU A O   1 
ATOM   2594  C CB  . LEU A 1 343 ? 25.559 30.198  4.537   1.00 35.30  ? 340 LEU A CB  1 
ATOM   2595  C CG  . LEU A 1 343 ? 25.634 28.840  3.838   1.00 31.64  ? 340 LEU A CG  1 
ATOM   2596  C CD1 . LEU A 1 343 ? 24.248 28.267  3.611   1.00 32.15  ? 340 LEU A CD1 1 
ATOM   2597  C CD2 . LEU A 1 343 ? 26.395 28.952  2.526   1.00 33.84  ? 340 LEU A CD2 1 
ATOM   2598  N N   . ALA A 1 344 ? 26.405 32.371  6.739   1.00 32.28  ? 341 ALA A N   1 
ATOM   2599  C CA  . ALA A 1 344 ? 26.308 33.718  7.293   1.00 37.23  ? 341 ALA A CA  1 
ATOM   2600  C C   . ALA A 1 344 ? 27.656 34.422  7.254   1.00 31.82  ? 341 ALA A C   1 
ATOM   2601  O O   . ALA A 1 344 ? 27.731 35.620  6.958   1.00 36.00  ? 341 ALA A O   1 
ATOM   2602  C CB  . ALA A 1 344 ? 25.771 33.674  8.725   1.00 28.45  ? 341 ALA A CB  1 
ATOM   2603  N N   . HIS A 1 345 ? 28.736 33.690  7.542   1.00 33.67  ? 342 HIS A N   1 
ATOM   2604  C CA  . HIS A 1 345 ? 30.065 34.286  7.464   1.00 30.69  ? 342 HIS A CA  1 
ATOM   2605  C C   . HIS A 1 345 ? 30.472 34.532  6.017   1.00 32.64  ? 342 HIS A C   1 
ATOM   2606  O O   . HIS A 1 345 ? 31.111 35.545  5.710   1.00 37.32  ? 342 HIS A O   1 
ATOM   2607  C CB  . HIS A 1 345 ? 31.086 33.393  8.163   1.00 32.70  ? 342 HIS A CB  1 
ATOM   2608  C CG  . HIS A 1 345 ? 32.479 33.935  8.127   1.00 30.85  ? 342 HIS A CG  1 
ATOM   2609  N ND1 . HIS A 1 345 ? 32.884 34.999  8.903   1.00 35.79  ? 342 HIS A ND1 1 
ATOM   2610  C CD2 . HIS A 1 345 ? 33.557 33.573  7.393   1.00 34.19  ? 342 HIS A CD2 1 
ATOM   2611  C CE1 . HIS A 1 345 ? 34.155 35.263  8.657   1.00 35.98  ? 342 HIS A CE1 1 
ATOM   2612  N NE2 . HIS A 1 345 ? 34.587 34.413  7.744   1.00 31.36  ? 342 HIS A NE2 1 
ATOM   2613  N N   . ARG A 1 346 ? 30.123 33.608  5.119   1.00 34.75  ? 343 ARG A N   1 
ATOM   2614  C CA  . ARG A 1 346 ? 30.327 33.843  3.694   1.00 37.35  ? 343 ARG A CA  1 
ATOM   2615  C C   . ARG A 1 346 ? 29.608 35.110  3.244   1.00 40.42  ? 343 ARG A C   1 
ATOM   2616  O O   . ARG A 1 346 ? 30.161 35.913  2.481   1.00 36.47  ? 343 ARG A O   1 
ATOM   2617  C CB  . ARG A 1 346 ? 29.836 32.636  2.896   1.00 34.04  ? 343 ARG A CB  1 
ATOM   2618  C CG  . ARG A 1 346 ? 29.776 32.851  1.396   1.00 30.99  ? 343 ARG A CG  1 
ATOM   2619  C CD  . ARG A 1 346 ? 31.108 32.556  0.745   1.00 33.03  ? 343 ARG A CD  1 
ATOM   2620  N NE  . ARG A 1 346 ? 31.978 33.724  0.671   1.00 34.61  ? 343 ARG A NE  1 
ATOM   2621  C CZ  . ARG A 1 346 ? 33.304 33.669  0.746   1.00 38.08  ? 343 ARG A CZ  1 
ATOM   2622  N NH1 . ARG A 1 346 ? 33.913 32.501  0.905   1.00 39.70  ? 343 ARG A NH1 1 
ATOM   2623  N NH2 . ARG A 1 346 ? 34.020 34.781  0.666   1.00 33.00  ? 343 ARG A NH2 1 
ATOM   2624  N N   . ALA A 1 347 ? 28.377 35.312  3.720   1.00 37.01  ? 344 ALA A N   1 
ATOM   2625  C CA  . ALA A 1 347 ? 27.618 36.501  3.343   1.00 41.75  ? 344 ALA A CA  1 
ATOM   2626  C C   . ALA A 1 347 ? 28.272 37.771  3.874   1.00 40.26  ? 344 ALA A C   1 
ATOM   2627  O O   . ALA A 1 347 ? 28.291 38.802  3.189   1.00 41.99  ? 344 ALA A O   1 
ATOM   2628  C CB  . ALA A 1 347 ? 26.181 36.391  3.852   1.00 37.64  ? 344 ALA A CB  1 
ATOM   2629  N N   . LYS A 1 348 ? 28.814 37.718  5.093   1.00 39.13  ? 345 LYS A N   1 
ATOM   2630  C CA  . LYS A 1 348 ? 29.454 38.898  5.668   1.00 41.96  ? 345 LYS A CA  1 
ATOM   2631  C C   . LYS A 1 348 ? 30.694 39.294  4.877   1.00 41.74  ? 345 LYS A C   1 
ATOM   2632  O O   . LYS A 1 348 ? 30.951 40.485  4.664   1.00 46.32  ? 345 LYS A O   1 
ATOM   2633  C CB  . LYS A 1 348 ? 29.808 38.641  7.133   1.00 48.44  ? 345 LYS A CB  1 
ATOM   2634  C CG  . LYS A 1 348 ? 30.255 39.882  7.888   1.00 48.60  ? 345 LYS A CG  1 
ATOM   2635  C CD  . LYS A 1 348 ? 30.395 39.609  9.379   1.00 57.02  ? 345 LYS A CD  1 
ATOM   2636  C CE  . LYS A 1 348 ? 31.790 39.115  9.735   1.00 51.66  ? 345 LYS A CE  1 
ATOM   2637  N NZ  . LYS A 1 348 ? 31.840 38.516  11.100  1.00 51.08  ? 345 LYS A NZ  1 
ATOM   2638  N N   . LEU A 1 349 ? 31.478 38.310  4.432   1.00 41.17  ? 346 LEU A N   1 
ATOM   2639  C CA  . LEU A 1 349 ? 32.659 38.616  3.631   1.00 45.98  ? 346 LEU A CA  1 
ATOM   2640  C C   . LEU A 1 349 ? 32.286 39.178  2.264   1.00 42.68  ? 346 LEU A C   1 
ATOM   2641  O O   . LEU A 1 349 ? 33.063 39.939  1.675   1.00 45.38  ? 346 LEU A O   1 
ATOM   2642  C CB  . LEU A 1 349 ? 33.524 37.366  3.468   1.00 40.13  ? 346 LEU A CB  1 
ATOM   2643  C CG  . LEU A 1 349 ? 34.076 36.698  4.728   1.00 44.68  ? 346 LEU A CG  1 
ATOM   2644  C CD1 . LEU A 1 349 ? 34.796 35.411  4.359   1.00 37.50  ? 346 LEU A CD1 1 
ATOM   2645  C CD2 . LEU A 1 349 ? 35.009 37.640  5.474   1.00 42.73  ? 346 LEU A CD2 1 
ATOM   2646  N N   . ASP A 1 350 ? 31.106 38.830  1.751   1.00 45.19  ? 347 ASP A N   1 
ATOM   2647  C CA  . ASP A 1 350 ? 30.706 39.174  0.392   1.00 52.28  ? 347 ASP A CA  1 
ATOM   2648  C C   . ASP A 1 350 ? 29.639 40.260  0.323   1.00 47.05  ? 347 ASP A C   1 
ATOM   2649  O O   . ASP A 1 350 ? 29.250 40.645  -0.785  1.00 46.89  ? 347 ASP A O   1 
ATOM   2650  C CB  . ASP A 1 350 ? 30.193 37.925  -0.339  1.00 37.56  ? 347 ASP A CB  1 
ATOM   2651  C CG  . ASP A 1 350 ? 31.260 36.858  -0.501  1.00 43.29  ? 347 ASP A CG  1 
ATOM   2652  O OD1 . ASP A 1 350 ? 32.439 37.137  -0.199  1.00 42.01  ? 347 ASP A OD1 1 
ATOM   2653  O OD2 . ASP A 1 350 ? 30.918 35.737  -0.934  1.00 42.59  ? 347 ASP A OD2 1 
ATOM   2654  N N   . ASN A 1 351 ? 29.161 40.764  1.462   1.00 50.82  ? 348 ASN A N   1 
ATOM   2655  C CA  . ASN A 1 351 ? 28.015 41.679  1.512   1.00 53.21  ? 348 ASN A CA  1 
ATOM   2656  C C   . ASN A 1 351 ? 26.815 41.090  0.770   1.00 48.84  ? 348 ASN A C   1 
ATOM   2657  O O   . ASN A 1 351 ? 26.176 41.749  -0.054  1.00 50.34  ? 348 ASN A O   1 
ATOM   2658  C CB  . ASN A 1 351 ? 28.365 43.062  0.950   1.00 50.97  ? 348 ASN A CB  1 
ATOM   2659  C CG  . ASN A 1 351 ? 29.720 43.562  1.403   1.00 60.37  ? 348 ASN A CG  1 
ATOM   2660  O OD1 . ASN A 1 351 ? 30.144 43.316  2.531   1.00 67.46  ? 348 ASN A OD1 1 
ATOM   2661  N ND2 . ASN A 1 351 ? 30.406 44.284  0.522   1.00 68.11  ? 348 ASN A ND2 1 
ATOM   2662  N N   . ASN A 1 352 ? 26.515 39.827  1.060   1.00 46.69  ? 349 ASN A N   1 
ATOM   2663  C CA  . ASN A 1 352 ? 25.430 39.110  0.388   1.00 50.14  ? 349 ASN A CA  1 
ATOM   2664  C C   . ASN A 1 352 ? 24.211 39.147  1.305   1.00 51.06  ? 349 ASN A C   1 
ATOM   2665  O O   . ASN A 1 352 ? 24.033 38.289  2.172   1.00 47.63  ? 349 ASN A O   1 
ATOM   2666  C CB  . ASN A 1 352 ? 25.846 37.682  0.049   1.00 45.70  ? 349 ASN A CB  1 
ATOM   2667  C CG  . ASN A 1 352 ? 24.857 36.987  -0.870  1.00 45.25  ? 349 ASN A CG  1 
ATOM   2668  O OD1 . ASN A 1 352 ? 23.650 37.220  -0.797  1.00 47.78  ? 349 ASN A OD1 1 
ATOM   2669  N ND2 . ASN A 1 352 ? 25.365 36.122  -1.737  1.00 43.19  ? 349 ASN A ND2 1 
ATOM   2670  N N   . LYS A 1 353 ? 23.357 40.152  1.095   1.00 48.84  ? 350 LYS A N   1 
ATOM   2671  C CA  . LYS A 1 353 ? 22.177 40.311  1.939   1.00 49.98  ? 350 LYS A CA  1 
ATOM   2672  C C   . LYS A 1 353 ? 21.206 39.150  1.763   1.00 50.39  ? 350 LYS A C   1 
ATOM   2673  O O   . LYS A 1 353 ? 20.569 38.714  2.729   1.00 50.76  ? 350 LYS A O   1 
ATOM   2674  C CB  . LYS A 1 353 ? 21.488 41.641  1.632   1.00 56.00  ? 350 LYS A CB  1 
ATOM   2675  C CG  . LYS A 1 353 ? 22.294 42.860  2.050   1.00 67.45  ? 350 LYS A CG  1 
ATOM   2676  C CD  . LYS A 1 353 ? 21.605 44.153  1.647   1.00 72.07  ? 350 LYS A CD  1 
ATOM   2677  C CE  . LYS A 1 353 ? 22.439 45.360  2.047   1.00 76.58  ? 350 LYS A CE  1 
ATOM   2678  N NZ  . LYS A 1 353 ? 21.745 46.649  1.773   1.00 85.14  ? 350 LYS A NZ  1 
ATOM   2679  N N   . GLU A 1 354 ? 21.080 38.633  0.538   1.00 47.01  ? 351 GLU A N   1 
ATOM   2680  C CA  . GLU A 1 354 ? 20.168 37.517  0.310   1.00 43.81  ? 351 GLU A CA  1 
ATOM   2681  C C   . GLU A 1 354 ? 20.653 36.254  1.011   1.00 44.79  ? 351 GLU A C   1 
ATOM   2682  O O   . GLU A 1 354 ? 19.851 35.521  1.602   1.00 50.79  ? 351 GLU A O   1 
ATOM   2683  C CB  . GLU A 1 354 ? 19.991 37.271  -1.188  1.00 50.94  ? 351 GLU A CB  1 
ATOM   2684  C CG  . GLU A 1 354 ? 19.176 38.336  -1.912  1.00 56.25  ? 351 GLU A CG  1 
ATOM   2685  C CD  . GLU A 1 354 ? 19.983 39.579  -2.235  1.00 59.95  ? 351 GLU A CD  1 
ATOM   2686  O OE1 . GLU A 1 354 ? 19.369 40.626  -2.529  1.00 65.24  ? 351 GLU A OE1 1 
ATOM   2687  O OE2 . GLU A 1 354 ? 21.230 39.509  -2.196  1.00 60.09  ? 351 GLU A OE2 1 
ATOM   2688  N N   . LEU A 1 355 ? 21.959 35.984  0.959   1.00 43.25  ? 352 LEU A N   1 
ATOM   2689  C CA  . LEU A 1 355 ? 22.497 34.825  1.666   1.00 43.01  ? 352 LEU A CA  1 
ATOM   2690  C C   . LEU A 1 355 ? 22.406 35.018  3.174   1.00 39.60  ? 352 LEU A C   1 
ATOM   2691  O O   . LEU A 1 355 ? 21.992 34.108  3.902   1.00 38.34  ? 352 LEU A O   1 
ATOM   2692  C CB  . LEU A 1 355 ? 23.944 34.571  1.241   1.00 37.64  ? 352 LEU A CB  1 
ATOM   2693  C CG  . LEU A 1 355 ? 24.627 33.347  1.854   1.00 42.75  ? 352 LEU A CG  1 
ATOM   2694  C CD1 . LEU A 1 355 ? 23.797 32.091  1.618   1.00 38.27  ? 352 LEU A CD1 1 
ATOM   2695  C CD2 . LEU A 1 355 ? 26.033 33.188  1.296   1.00 32.54  ? 352 LEU A CD2 1 
ATOM   2696  N N   . ALA A 1 356 ? 22.784 36.204  3.660   1.00 37.13  ? 353 ALA A N   1 
ATOM   2697  C CA  . ALA A 1 356 ? 22.666 36.503  5.084   1.00 42.80  ? 353 ALA A CA  1 
ATOM   2698  C C   . ALA A 1 356 ? 21.237 36.300  5.567   1.00 38.07  ? 353 ALA A C   1 
ATOM   2699  O O   . ALA A 1 356 ? 21.004 35.730  6.639   1.00 41.70  ? 353 ALA A O   1 
ATOM   2700  C CB  . ALA A 1 356 ? 23.129 37.935  5.363   1.00 43.01  ? 353 ALA A CB  1 
ATOM   2701  N N   . PHE A 1 357 ? 20.263 36.748  4.773   1.00 41.93  ? 354 PHE A N   1 
ATOM   2702  C CA  . PHE A 1 357 ? 18.863 36.554  5.132   1.00 40.19  ? 354 PHE A CA  1 
ATOM   2703  C C   . PHE A 1 357 ? 18.517 35.073  5.201   1.00 41.54  ? 354 PHE A C   1 
ATOM   2704  O O   . PHE A 1 357 ? 17.861 34.620  6.146   1.00 44.47  ? 354 PHE A O   1 
ATOM   2705  C CB  . PHE A 1 357 ? 17.964 37.272  4.125   1.00 43.97  ? 354 PHE A CB  1 
ATOM   2706  C CG  . PHE A 1 357 ? 16.506 37.230  4.476   1.00 46.43  ? 354 PHE A CG  1 
ATOM   2707  C CD1 . PHE A 1 357 ? 15.707 36.180  4.048   1.00 41.94  ? 354 PHE A CD1 1 
ATOM   2708  C CD2 . PHE A 1 357 ? 15.932 38.241  5.230   1.00 42.15  ? 354 PHE A CD2 1 
ATOM   2709  C CE1 . PHE A 1 357 ? 14.365 36.135  4.371   1.00 45.49  ? 354 PHE A CE1 1 
ATOM   2710  C CE2 . PHE A 1 357 ? 14.589 38.204  5.555   1.00 40.19  ? 354 PHE A CE2 1 
ATOM   2711  C CZ  . PHE A 1 357 ? 13.805 37.149  5.124   1.00 50.43  ? 354 PHE A CZ  1 
ATOM   2712  N N   . PHE A 1 358 ? 18.951 34.302  4.202   1.00 42.10  ? 355 PHE A N   1 
ATOM   2713  C CA  . PHE A 1 358 ? 18.623 32.880  4.167   1.00 39.42  ? 355 PHE A CA  1 
ATOM   2714  C C   . PHE A 1 358 ? 19.195 32.150  5.376   1.00 42.41  ? 355 PHE A C   1 
ATOM   2715  O O   . PHE A 1 358 ? 18.516 31.323  5.995   1.00 42.43  ? 355 PHE A O   1 
ATOM   2716  C CB  . PHE A 1 358 ? 19.137 32.253  2.872   1.00 42.44  ? 355 PHE A CB  1 
ATOM   2717  C CG  . PHE A 1 358 ? 19.048 30.756  2.856   1.00 43.76  ? 355 PHE A CG  1 
ATOM   2718  C CD1 . PHE A 1 358 ? 17.850 30.124  2.568   1.00 36.02  ? 355 PHE A CD1 1 
ATOM   2719  C CD2 . PHE A 1 358 ? 20.158 29.981  3.148   1.00 45.24  ? 355 PHE A CD2 1 
ATOM   2720  C CE1 . PHE A 1 358 ? 17.764 28.745  2.561   1.00 44.36  ? 355 PHE A CE1 1 
ATOM   2721  C CE2 . PHE A 1 358 ? 20.080 28.604  3.145   1.00 45.87  ? 355 PHE A CE2 1 
ATOM   2722  C CZ  . PHE A 1 358 ? 18.881 27.984  2.850   1.00 46.89  ? 355 PHE A CZ  1 
ATOM   2723  N N   . ALA A 1 359 ? 20.452 32.440  5.723   1.00 42.83  ? 356 ALA A N   1 
ATOM   2724  C CA  . ALA A 1 359 ? 21.095 31.749  6.836   1.00 43.97  ? 356 ALA A CA  1 
ATOM   2725  C C   . ALA A 1 359 ? 20.345 31.990  8.140   1.00 41.26  ? 356 ALA A C   1 
ATOM   2726  O O   . ALA A 1 359 ? 20.063 31.049  8.892   1.00 36.47  ? 356 ALA A O   1 
ATOM   2727  C CB  . ALA A 1 359 ? 22.553 32.195  6.961   1.00 39.97  ? 356 ALA A CB  1 
ATOM   2728  N N   . ASN A 1 360 ? 20.008 33.251  8.422   1.00 41.89  ? 357 ASN A N   1 
ATOM   2729  C CA  . ASN A 1 360 ? 19.265 33.564  9.638   1.00 37.06  ? 357 ASN A CA  1 
ATOM   2730  C C   . ASN A 1 360 ? 17.895 32.898  9.634   1.00 43.04  ? 357 ASN A C   1 
ATOM   2731  O O   . ASN A 1 360 ? 17.460 32.339  10.648  1.00 38.70  ? 357 ASN A O   1 
ATOM   2732  C CB  . ASN A 1 360 ? 19.123 35.078  9.793   1.00 41.50  ? 357 ASN A CB  1 
ATOM   2733  C CG  . ASN A 1 360 ? 18.161 35.458  10.899  1.00 48.07  ? 357 ASN A CG  1 
ATOM   2734  O OD1 . ASN A 1 360 ? 18.503 35.407  12.080  1.00 50.24  ? 357 ASN A OD1 1 
ATOM   2735  N ND2 . ASN A 1 360 ? 16.944 35.828  10.521  1.00 41.98  ? 357 ASN A ND2 1 
ATOM   2736  N N   . ALA A 1 361 ? 17.200 32.944  8.494   1.00 38.44  ? 358 ALA A N   1 
ATOM   2737  C CA  . ALA A 1 361 ? 15.872 32.343  8.413   1.00 38.93  ? 358 ALA A CA  1 
ATOM   2738  C C   . ALA A 1 361 ? 15.917 30.857  8.749   1.00 41.30  ? 358 ALA A C   1 
ATOM   2739  O O   . ALA A 1 361 ? 15.025 30.340  9.432   1.00 42.17  ? 358 ALA A O   1 
ATOM   2740  C CB  . ALA A 1 361 ? 15.277 32.563  7.021   1.00 42.97  ? 358 ALA A CB  1 
ATOM   2741  N N   . LEU A 1 362 ? 16.958 30.157  8.294   1.00 37.73  ? 359 LEU A N   1 
ATOM   2742  C CA  . LEU A 1 362 ? 17.060 28.728  8.570   1.00 37.86  ? 359 LEU A CA  1 
ATOM   2743  C C   . LEU A 1 362 ? 17.262 28.468  10.060  1.00 33.88  ? 359 LEU A C   1 
ATOM   2744  O O   . LEU A 1 362 ? 16.758 27.474  10.599  1.00 32.80  ? 359 LEU A O   1 
ATOM   2745  C CB  . LEU A 1 362 ? 18.195 28.120  7.745   1.00 35.34  ? 359 LEU A CB  1 
ATOM   2746  C CG  . LEU A 1 362 ? 18.420 26.608  7.818   1.00 36.15  ? 359 LEU A CG  1 
ATOM   2747  C CD1 . LEU A 1 362 ? 17.103 25.852  7.806   1.00 35.50  ? 359 LEU A CD1 1 
ATOM   2748  C CD2 . LEU A 1 362 ? 19.296 26.170  6.654   1.00 33.38  ? 359 LEU A CD2 1 
ATOM   2749  N N   . GLU A 1 363 ? 17.983 29.356  10.747  1.00 34.36  ? 360 GLU A N   1 
ATOM   2750  C CA  . GLU A 1 363 ? 18.116 29.228  12.195  1.00 38.93  ? 360 GLU A CA  1 
ATOM   2751  C C   . GLU A 1 363 ? 16.779 29.472  12.888  1.00 39.38  ? 360 GLU A C   1 
ATOM   2752  O O   . GLU A 1 363 ? 16.387 28.714  13.783  1.00 39.61  ? 360 GLU A O   1 
ATOM   2753  C CB  . GLU A 1 363 ? 19.186 30.190  12.718  1.00 34.58  ? 360 GLU A CB  1 
ATOM   2754  C CG  . GLU A 1 363 ? 20.549 30.019  12.061  1.00 37.46  ? 360 GLU A CG  1 
ATOM   2755  C CD  . GLU A 1 363 ? 21.690 30.525  12.927  1.00 40.18  ? 360 GLU A CD  1 
ATOM   2756  O OE1 . GLU A 1 363 ? 21.420 31.061  14.022  1.00 44.23  ? 360 GLU A OE1 1 
ATOM   2757  O OE2 . GLU A 1 363 ? 22.860 30.389  12.511  1.00 38.43  ? 360 GLU A OE2 1 
ATOM   2758  N N   . GLU A 1 364 ? 16.064 30.526  12.483  1.00 39.08  ? 361 GLU A N   1 
ATOM   2759  C CA  . GLU A 1 364 ? 14.749 30.803  13.054  1.00 38.63  ? 361 GLU A CA  1 
ATOM   2760  C C   . GLU A 1 364 ? 13.803 29.628  12.847  1.00 45.39  ? 361 GLU A C   1 
ATOM   2761  O O   . GLU A 1 364 ? 13.126 29.186  13.782  1.00 37.96  ? 361 GLU A O   1 
ATOM   2762  C CB  . GLU A 1 364 ? 14.157 32.066  12.430  1.00 38.75  ? 361 GLU A CB  1 
ATOM   2763  C CG  . GLU A 1 364 ? 14.963 33.332  12.640  1.00 42.36  ? 361 GLU A CG  1 
ATOM   2764  C CD  . GLU A 1 364 ? 14.257 34.549  12.078  1.00 42.75  ? 361 GLU A CD  1 
ATOM   2765  O OE1 . GLU A 1 364 ? 13.296 34.363  11.303  1.00 48.76  ? 361 GLU A OE1 1 
ATOM   2766  O OE2 . GLU A 1 364 ? 14.659 35.685  12.405  1.00 50.96  ? 361 GLU A OE2 1 
ATOM   2767  N N   . VAL A 1 365 ? 13.746 29.113  11.615  1.00 41.00  ? 362 VAL A N   1 
ATOM   2768  C CA  . VAL A 1 365 ? 12.884 27.975  11.303  1.00 37.21  ? 362 VAL A CA  1 
ATOM   2769  C C   . VAL A 1 365 ? 13.192 26.803  12.222  1.00 41.38  ? 362 VAL A C   1 
ATOM   2770  O O   . VAL A 1 365 ? 12.281 26.145  12.742  1.00 43.90  ? 362 VAL A O   1 
ATOM   2771  C CB  . VAL A 1 365 ? 13.037 27.584  9.820   1.00 41.52  ? 362 VAL A CB  1 
ATOM   2772  C CG1 . VAL A 1 365 ? 12.445 26.206  9.563   1.00 41.73  ? 362 VAL A CG1 1 
ATOM   2773  C CG2 . VAL A 1 365 ? 12.381 28.623  8.931   1.00 44.07  ? 362 VAL A CG2 1 
ATOM   2774  N N   . SER A 1 366 ? 14.481 26.535  12.451  1.00 38.80  ? 363 SER A N   1 
ATOM   2775  C CA  . SER A 1 366 ? 14.866 25.418  13.306  1.00 36.41  ? 363 SER A CA  1 
ATOM   2776  C C   . SER A 1 366 ? 14.335 25.599  14.721  1.00 41.46  ? 363 SER A C   1 
ATOM   2777  O O   . SER A 1 366 ? 13.832 24.648  15.332  1.00 37.76  ? 363 SER A O   1 
ATOM   2778  C CB  . SER A 1 366 ? 16.387 25.272  13.317  1.00 42.36  ? 363 SER A CB  1 
ATOM   2779  O OG  . SER A 1 366 ? 16.899 25.208  11.998  1.00 40.08  ? 363 SER A OG  1 
ATOM   2780  N N   . ILE A 1 367 ? 14.424 26.817  15.253  1.00 42.30  ? 364 ILE A N   1 
ATOM   2781  C CA  . ILE A 1 367 ? 14.001 27.064  16.625  1.00 39.22  ? 364 ILE A CA  1 
ATOM   2782  C C   . ILE A 1 367 ? 12.480 27.131  16.725  1.00 43.27  ? 364 ILE A C   1 
ATOM   2783  O O   . ILE A 1 367 ? 11.888 26.609  17.677  1.00 36.91  ? 364 ILE A O   1 
ATOM   2784  C CB  . ILE A 1 367 ? 14.669 28.346  17.152  1.00 45.62  ? 364 ILE A CB  1 
ATOM   2785  C CG1 . ILE A 1 367 ? 16.183 28.259  16.959  1.00 46.27  ? 364 ILE A CG1 1 
ATOM   2786  C CG2 . ILE A 1 367 ? 14.323 28.569  18.616  1.00 44.63  ? 364 ILE A CG2 1 
ATOM   2787  C CD1 . ILE A 1 367 ? 16.937 29.455  17.478  1.00 34.93  ? 364 ILE A CD1 1 
ATOM   2788  N N   . GLU A 1 368 ? 11.825 27.769  15.750  1.00 39.89  ? 365 GLU A N   1 
ATOM   2789  C CA  . GLU A 1 368 ? 10.366 27.834  15.757  1.00 43.67  ? 365 GLU A CA  1 
ATOM   2790  C C   . GLU A 1 368 ? 9.756  26.441  15.686  1.00 45.92  ? 365 GLU A C   1 
ATOM   2791  O O   . GLU A 1 368 ? 8.761  26.153  16.364  1.00 47.64  ? 365 GLU A O   1 
ATOM   2792  C CB  . GLU A 1 368 ? 9.873  28.696  14.593  1.00 40.94  ? 365 GLU A CB  1 
ATOM   2793  C CG  . GLU A 1 368 ? 10.188 30.182  14.724  1.00 41.14  ? 365 GLU A CG  1 
ATOM   2794  C CD  . GLU A 1 368 ? 10.159 30.897  13.387  1.00 49.80  ? 365 GLU A CD  1 
ATOM   2795  O OE1 . GLU A 1 368 ? 9.664  30.301  12.407  1.00 57.83  ? 365 GLU A OE1 1 
ATOM   2796  O OE2 . GLU A 1 368 ? 10.633 32.051  13.311  1.00 51.81  ? 365 GLU A OE2 1 
ATOM   2797  N N   . THR A 1 369 ? 10.348 25.562  14.875  1.00 41.74  ? 366 THR A N   1 
ATOM   2798  C CA  . THR A 1 369 ? 9.840  24.200  14.741  1.00 40.99  ? 366 THR A CA  1 
ATOM   2799  C C   . THR A 1 369 ? 9.869  23.472  16.078  1.00 45.75  ? 366 THR A C   1 
ATOM   2800  O O   . THR A 1 369 ? 8.895  22.814  16.466  1.00 42.46  ? 366 THR A O   1 
ATOM   2801  C CB  . THR A 1 369 ? 10.663 23.442  13.699  1.00 44.73  ? 366 THR A CB  1 
ATOM   2802  O OG1 . THR A 1 369 ? 10.526 24.080  12.425  1.00 43.27  ? 366 THR A OG1 1 
ATOM   2803  C CG2 . THR A 1 369 ? 10.200 21.997  13.593  1.00 45.59  ? 366 THR A CG2 1 
ATOM   2804  N N   . ILE A 1 370 ? 10.982 23.589  16.802  1.00 42.32  ? 367 ILE A N   1 
ATOM   2805  C CA  . ILE A 1 370 ? 11.105 22.939  18.101  1.00 40.51  ? 367 ILE A CA  1 
ATOM   2806  C C   . ILE A 1 370 ? 10.152 23.573  19.106  1.00 42.06  ? 367 ILE A C   1 
ATOM   2807  O O   . ILE A 1 370 ? 9.519  22.878  19.910  1.00 42.78  ? 367 ILE A O   1 
ATOM   2808  C CB  . ILE A 1 370 ? 12.566 23.009  18.581  1.00 42.70  ? 367 ILE A CB  1 
ATOM   2809  C CG1 . ILE A 1 370 ? 13.451 22.114  17.716  1.00 41.92  ? 367 ILE A CG1 1 
ATOM   2810  C CG2 . ILE A 1 370 ? 12.672 22.615  20.051  1.00 35.69  ? 367 ILE A CG2 1 
ATOM   2811  C CD1 . ILE A 1 370 ? 14.924 22.314  17.965  1.00 44.85  ? 367 ILE A CD1 1 
ATOM   2812  N N   . GLU A 1 371 ? 10.028 24.902  19.071  1.00 34.35  ? 368 GLU A N   1 
ATOM   2813  C CA  . GLU A 1 371 ? 9.174  25.601  20.024  1.00 45.46  ? 368 GLU A CA  1 
ATOM   2814  C C   . GLU A 1 371 ? 7.692  25.395  19.733  1.00 48.46  ? 368 GLU A C   1 
ATOM   2815  O O   . GLU A 1 371 ? 6.861  25.648  20.611  1.00 44.86  ? 368 GLU A O   1 
ATOM   2816  C CB  . GLU A 1 371 ? 9.522  27.090  20.036  1.00 36.20  ? 368 GLU A CB  1 
ATOM   2817  C CG  . GLU A 1 371 ? 10.900 27.377  20.623  1.00 42.82  ? 368 GLU A CG  1 
ATOM   2818  C CD  . GLU A 1 371 ? 11.250 28.852  20.630  1.00 42.75  ? 368 GLU A CD  1 
ATOM   2819  O OE1 . GLU A 1 371 ? 10.719 29.603  19.783  1.00 38.96  ? 368 GLU A OE1 1 
ATOM   2820  O OE2 . GLU A 1 371 ? 12.063 29.260  21.487  1.00 41.99  ? 368 GLU A OE2 1 
ATOM   2821  N N   . ALA A 1 372 ? 7.346  24.937  18.531  1.00 44.63  ? 369 ALA A N   1 
ATOM   2822  C CA  . ALA A 1 372 ? 5.983  24.528  18.218  1.00 41.38  ? 369 ALA A CA  1 
ATOM   2823  C C   . ALA A 1 372 ? 5.682  23.095  18.636  1.00 46.25  ? 369 ALA A C   1 
ATOM   2824  O O   . ALA A 1 372 ? 4.561  22.624  18.417  1.00 51.22  ? 369 ALA A O   1 
ATOM   2825  C CB  . ALA A 1 372 ? 5.708  24.694  16.722  1.00 38.12  ? 369 ALA A CB  1 
ATOM   2826  N N   . GLY A 1 373 ? 6.651  22.387  19.214  1.00 42.87  ? 370 GLY A N   1 
ATOM   2827  C CA  . GLY A 1 373 ? 6.433  21.050  19.725  1.00 41.81  ? 370 GLY A CA  1 
ATOM   2828  C C   . GLY A 1 373 ? 6.917  19.915  18.845  1.00 41.29  ? 370 GLY A C   1 
ATOM   2829  O O   . GLY A 1 373 ? 6.706  18.749  19.202  1.00 43.45  ? 370 GLY A O   1 
ATOM   2830  N N   . PHE A 1 374 ? 7.549  20.211  17.709  1.00 43.49  ? 371 PHE A N   1 
ATOM   2831  C CA  . PHE A 1 374 ? 8.076  19.189  16.807  1.00 45.47  ? 371 PHE A CA  1 
ATOM   2832  C C   . PHE A 1 374 ? 9.582  19.081  17.026  1.00 46.02  ? 371 PHE A C   1 
ATOM   2833  O O   . PHE A 1 374 ? 10.326 20.027  16.746  1.00 35.35  ? 371 PHE A O   1 
ATOM   2834  C CB  . PHE A 1 374 ? 7.751  19.524  15.352  1.00 46.00  ? 371 PHE A CB  1 
ATOM   2835  C CG  . PHE A 1 374 ? 6.309  19.897  15.118  1.00 45.95  ? 371 PHE A CG  1 
ATOM   2836  C CD1 . PHE A 1 374 ? 5.316  18.931  15.156  1.00 46.81  ? 371 PHE A CD1 1 
ATOM   2837  C CD2 . PHE A 1 374 ? 5.950  21.210  14.852  1.00 46.83  ? 371 PHE A CD2 1 
ATOM   2838  C CE1 . PHE A 1 374 ? 3.989  19.267  14.939  1.00 48.43  ? 371 PHE A CE1 1 
ATOM   2839  C CE2 . PHE A 1 374 ? 4.625  21.553  14.633  1.00 57.24  ? 371 PHE A CE2 1 
ATOM   2840  C CZ  . PHE A 1 374 ? 3.643  20.581  14.676  1.00 50.27  ? 371 PHE A CZ  1 
ATOM   2841  N N   . MET A 1 375 ? 10.030 17.929  17.522  1.00 46.25  ? 372 MET A N   1 
ATOM   2842  C CA  . MET A 1 375 ? 11.406 17.782  17.970  1.00 44.45  ? 372 MET A CA  1 
ATOM   2843  C C   . MET A 1 375 ? 11.820 16.321  17.887  1.00 54.56  ? 372 MET A C   1 
ATOM   2844  O O   . MET A 1 375 ? 10.990 15.422  17.728  1.00 54.51  ? 372 MET A O   1 
ATOM   2845  C CB  . MET A 1 375 ? 11.572 18.300  19.402  1.00 44.30  ? 372 MET A CB  1 
ATOM   2846  C CG  . MET A 1 375 ? 10.980 17.372  20.454  1.00 41.39  ? 372 MET A CG  1 
ATOM   2847  S SD  . MET A 1 375 ? 10.751 18.185  22.042  1.00 49.36  ? 372 MET A SD  1 
ATOM   2848  C CE  . MET A 1 375 ? 9.761  19.593  21.545  1.00 40.56  ? 372 MET A CE  1 
ATOM   2849  N N   . THR A 1 376 ? 13.125 16.097  18.010  1.00 48.02  ? 373 THR A N   1 
ATOM   2850  C CA  . THR A 1 376 ? 13.672 14.753  18.059  1.00 42.54  ? 373 THR A CA  1 
ATOM   2851  C C   . THR A 1 376 ? 13.649 14.222  19.491  1.00 44.56  ? 373 THR A C   1 
ATOM   2852  O O   . THR A 1 376 ? 13.339 14.940  20.446  1.00 45.99  ? 373 THR A O   1 
ATOM   2853  C CB  . THR A 1 376 ? 15.093 14.729  17.496  1.00 45.63  ? 373 THR A CB  1 
ATOM   2854  O OG1 . THR A 1 376 ? 15.847 15.822  18.043  1.00 42.63  ? 373 THR A OG1 1 
ATOM   2855  C CG2 . THR A 1 376 ? 15.067 14.842  15.982  1.00 41.66  ? 373 THR A CG2 1 
ATOM   2856  N N   . LYS A 1 377 ? 13.999 12.940  19.631  1.00 48.23  ? 374 LYS A N   1 
ATOM   2857  C CA  . LYS A 1 377 ? 13.826 12.251  20.908  1.00 47.30  ? 374 LYS A CA  1 
ATOM   2858  C C   . LYS A 1 377 ? 14.665 12.882  22.014  1.00 49.40  ? 374 LYS A C   1 
ATOM   2859  O O   . LYS A 1 377 ? 14.219 12.974  23.164  1.00 44.68  ? 374 LYS A O   1 
ATOM   2860  C CB  . LYS A 1 377 ? 14.178 10.773  20.756  1.00 47.59  ? 374 LYS A CB  1 
ATOM   2861  C CG  . LYS A 1 377 ? 13.608 9.878   21.846  1.00 54.30  ? 374 LYS A CG  1 
ATOM   2862  C CD  . LYS A 1 377 ? 14.235 8.492   21.791  1.00 56.96  ? 374 LYS A CD  1 
ATOM   2863  C CE  . LYS A 1 377 ? 13.799 7.627   22.965  1.00 64.80  ? 374 LYS A CE  1 
ATOM   2864  N NZ  . LYS A 1 377 ? 14.831 6.611   23.329  1.00 69.17  ? 374 LYS A NZ  1 
ATOM   2865  N N   . ASP A 1 378 ? 15.888 13.308  21.690  1.00 44.42  ? 375 ASP A N   1 
ATOM   2866  C CA  . ASP A 1 378 ? 16.748 13.931  22.692  1.00 47.34  ? 375 ASP A CA  1 
ATOM   2867  C C   . ASP A 1 378 ? 16.076 15.155  23.306  1.00 38.63  ? 375 ASP A C   1 
ATOM   2868  O O   . ASP A 1 378 ? 16.087 15.338  24.529  1.00 41.04  ? 375 ASP A O   1 
ATOM   2869  C CB  . ASP A 1 378 ? 18.089 14.308  22.061  1.00 38.17  ? 375 ASP A CB  1 
ATOM   2870  C CG  . ASP A 1 378 ? 17.927 15.237  20.876  1.00 44.53  ? 375 ASP A CG  1 
ATOM   2871  O OD1 . ASP A 1 378 ? 16.944 15.069  20.125  1.00 45.12  ? 375 ASP A OD1 1 
ATOM   2872  O OD2 . ASP A 1 378 ? 18.770 16.143  20.707  1.00 45.60  ? 375 ASP A OD2 1 
ATOM   2873  N N   . LEU A 1 379 ? 15.470 15.997  22.467  1.00 37.15  ? 376 LEU A N   1 
ATOM   2874  C CA  . LEU A 1 379 ? 14.822 17.204  22.967  1.00 43.27  ? 376 LEU A CA  1 
ATOM   2875  C C   . LEU A 1 379 ? 13.616 16.867  23.835  1.00 46.33  ? 376 LEU A C   1 
ATOM   2876  O O   . LEU A 1 379 ? 13.404 17.487  24.884  1.00 47.75  ? 376 LEU A O   1 
ATOM   2877  C CB  . LEU A 1 379 ? 14.418 18.090  21.792  1.00 42.98  ? 376 LEU A CB  1 
ATOM   2878  C CG  . LEU A 1 379 ? 15.614 18.644  21.020  1.00 46.54  ? 376 LEU A CG  1 
ATOM   2879  C CD1 . LEU A 1 379 ? 15.179 19.211  19.685  1.00 40.44  ? 376 LEU A CD1 1 
ATOM   2880  C CD2 . LEU A 1 379 ? 16.316 19.706  21.849  1.00 38.90  ? 376 LEU A CD2 1 
ATOM   2881  N N   . ALA A 1 380 ? 12.817 15.882  23.417  1.00 44.51  ? 377 ALA A N   1 
ATOM   2882  C CA  . ALA A 1 380 ? 11.673 15.471  24.224  1.00 40.17  ? 377 ALA A CA  1 
ATOM   2883  C C   . ALA A 1 380 ? 12.124 14.914  25.569  1.00 49.63  ? 377 ALA A C   1 
ATOM   2884  O O   . ALA A 1 380 ? 11.502 15.186  26.602  1.00 50.16  ? 377 ALA A O   1 
ATOM   2885  C CB  . ALA A 1 380 ? 10.834 14.444  23.463  1.00 39.37  ? 377 ALA A CB  1 
ATOM   2886  N N   . ALA A 1 381 ? 13.215 14.141  25.579  1.00 43.38  ? 378 ALA A N   1 
ATOM   2887  C CA  . ALA A 1 381 ? 13.748 13.639  26.841  1.00 47.62  ? 378 ALA A CA  1 
ATOM   2888  C C   . ALA A 1 381 ? 14.239 14.773  27.729  1.00 48.49  ? 378 ALA A C   1 
ATOM   2889  O O   . ALA A 1 381 ? 14.166 14.676  28.959  1.00 48.35  ? 378 ALA A O   1 
ATOM   2890  C CB  . ALA A 1 381 ? 14.876 12.640  26.582  1.00 44.37  ? 378 ALA A CB  1 
ATOM   2891  N N   . CYS A 1 382 ? 14.737 15.857  27.129  1.00 47.15  ? 379 CYS A N   1 
ATOM   2892  C CA  . CYS A 1 382 ? 15.187 16.996  27.920  1.00 49.66  ? 379 CYS A CA  1 
ATOM   2893  C C   . CYS A 1 382 ? 14.017 17.687  28.612  1.00 49.11  ? 379 CYS A C   1 
ATOM   2894  O O   . CYS A 1 382 ? 14.181 18.238  29.705  1.00 45.32  ? 379 CYS A O   1 
ATOM   2895  C CB  . CYS A 1 382 ? 15.950 17.978  27.030  1.00 41.28  ? 379 CYS A CB  1 
ATOM   2896  S SG  . CYS A 1 382 ? 16.943 19.201  27.913  1.00 57.95  ? 379 CYS A SG  1 
ATOM   2897  N N   . ILE A 1 383 ? 12.834 17.657  28.000  1.00 47.82  ? 380 ILE A N   1 
ATOM   2898  C CA  . ILE A 1 383 ? 11.646 18.239  28.620  1.00 42.86  ? 380 ILE A CA  1 
ATOM   2899  C C   . ILE A 1 383 ? 11.090 17.312  29.693  1.00 55.11  ? 380 ILE A C   1 
ATOM   2900  O O   . ILE A 1 383 ? 10.945 17.691  30.862  1.00 46.66  ? 380 ILE A O   1 
ATOM   2901  C CB  . ILE A 1 383 ? 10.575 18.540  27.556  1.00 44.44  ? 380 ILE A CB  1 
ATOM   2902  C CG1 . ILE A 1 383 ? 11.112 19.479  26.480  1.00 45.84  ? 380 ILE A CG1 1 
ATOM   2903  C CG2 . ILE A 1 383 ? 9.324  19.122  28.209  1.00 40.76  ? 380 ILE A CG2 1 
ATOM   2904  C CD1 . ILE A 1 383 ? 10.117 19.730  25.363  1.00 39.31  ? 380 ILE A CD1 1 
ATOM   2905  N N   . LYS A 1 384 ? 10.774 16.077  29.304  1.00 50.81  ? 381 LYS A N   1 
ATOM   2906  C CA  . LYS A 1 384 ? 9.997  15.166  30.132  1.00 51.23  ? 381 LYS A CA  1 
ATOM   2907  C C   . LYS A 1 384 ? 10.853 14.228  30.965  1.00 56.71  ? 381 LYS A C   1 
ATOM   2908  O O   . LYS A 1 384 ? 10.420 13.801  32.042  1.00 52.99  ? 381 LYS A O   1 
ATOM   2909  C CB  . LYS A 1 384 ? 9.068  14.329  29.245  1.00 50.10  ? 381 LYS A CB  1 
ATOM   2910  C CG  . LYS A 1 384 ? 8.014  15.126  28.496  1.00 60.14  ? 381 LYS A CG  1 
ATOM   2911  C CD  . LYS A 1 384 ? 7.304  14.257  27.467  1.00 66.73  ? 381 LYS A CD  1 
ATOM   2912  C CE  . LYS A 1 384 ? 6.049  14.933  26.939  1.00 65.34  ? 381 LYS A CE  1 
ATOM   2913  N NZ  . LYS A 1 384 ? 6.243  16.400  26.773  1.00 65.15  ? 381 LYS A NZ  1 
ATOM   2914  N N   . GLY A 1 385 ? 12.051 13.895  30.497  1.00 61.53  ? 382 GLY A N   1 
ATOM   2915  C CA  . GLY A 1 385 ? 12.801 12.798  31.076  1.00 59.24  ? 382 GLY A CA  1 
ATOM   2916  C C   . GLY A 1 385 ? 12.596 11.548  30.245  1.00 61.43  ? 382 GLY A C   1 
ATOM   2917  O O   . GLY A 1 385 ? 11.455 11.190  29.934  1.00 63.47  ? 382 GLY A O   1 
ATOM   2918  N N   . LEU A 1 386 ? 13.687 10.886  29.870  1.00 62.30  ? 383 LEU A N   1 
ATOM   2919  C CA  . LEU A 1 386 ? 13.593 9.731   28.981  1.00 71.50  ? 383 LEU A CA  1 
ATOM   2920  C C   . LEU A 1 386 ? 12.674 8.622   29.489  1.00 67.30  ? 383 LEU A C   1 
ATOM   2921  O O   . LEU A 1 386 ? 11.929 8.061   28.669  1.00 68.30  ? 383 LEU A O   1 
ATOM   2922  C CB  . LEU A 1 386 ? 14.998 9.178   28.701  1.00 65.77  ? 383 LEU A CB  1 
ATOM   2923  C CG  . LEU A 1 386 ? 15.018 8.051   27.663  1.00 67.95  ? 383 LEU A CG  1 
ATOM   2924  C CD1 . LEU A 1 386 ? 14.372 8.520   26.370  1.00 64.22  ? 383 LEU A CD1 1 
ATOM   2925  C CD2 . LEU A 1 386 ? 16.437 7.569   27.417  1.00 66.96  ? 383 LEU A CD2 1 
ATOM   2926  N N   . PRO A 1 387 ? 12.659 8.253   30.777  1.00 69.64  ? 384 PRO A N   1 
ATOM   2927  C CA  . PRO A 1 387 ? 11.705 7.223   31.225  1.00 71.41  ? 384 PRO A CA  1 
ATOM   2928  C C   . PRO A 1 387 ? 10.243 7.630   31.118  1.00 69.89  ? 384 PRO A C   1 
ATOM   2929  O O   . PRO A 1 387 ? 9.372  6.851   31.523  1.00 75.43  ? 384 PRO A O   1 
ATOM   2930  C CB  . PRO A 1 387 ? 12.099 6.992   32.694  1.00 75.84  ? 384 PRO A CB  1 
ATOM   2931  C CG  . PRO A 1 387 ? 13.514 7.422   32.778  1.00 75.80  ? 384 PRO A CG  1 
ATOM   2932  C CD  . PRO A 1 387 ? 13.623 8.585   31.843  1.00 65.68  ? 384 PRO A CD  1 
ATOM   2933  N N   . ASN A 1 388 ? 9.942  8.817   30.593  1.00 71.88  ? 385 ASN A N   1 
ATOM   2934  C CA  . ASN A 1 388 ? 8.569  9.259   30.389  1.00 72.55  ? 385 ASN A CA  1 
ATOM   2935  C C   . ASN A 1 388 ? 8.307  9.627   28.935  1.00 70.82  ? 385 ASN A C   1 
ATOM   2936  O O   . ASN A 1 388 ? 7.238  10.167  28.624  1.00 67.84  ? 385 ASN A O   1 
ATOM   2937  C CB  . ASN A 1 388 ? 8.251  10.447  31.303  1.00 62.36  ? 385 ASN A CB  1 
ATOM   2938  C CG  . ASN A 1 388 ? 8.664  10.196  32.739  1.00 69.68  ? 385 ASN A CG  1 
ATOM   2939  O OD1 . ASN A 1 388 ? 8.367  9.145   33.306  1.00 74.83  ? 385 ASN A OD1 1 
ATOM   2940  N ND2 . ASN A 1 388 ? 9.372  11.152  33.327  1.00 66.81  ? 385 ASN A ND2 1 
ATOM   2941  N N   . VAL A 1 389 ? 9.253  9.348   28.044  1.00 68.93  ? 386 VAL A N   1 
ATOM   2942  C CA  . VAL A 1 389 ? 9.129  9.693   26.634  1.00 70.43  ? 386 VAL A CA  1 
ATOM   2943  C C   . VAL A 1 389 ? 8.426  8.555   25.909  1.00 71.31  ? 386 VAL A C   1 
ATOM   2944  O O   . VAL A 1 389 ? 8.949  7.438   25.825  1.00 73.28  ? 386 VAL A O   1 
ATOM   2945  C CB  . VAL A 1 389 ? 10.504 9.979   26.011  1.00 67.23  ? 386 VAL A CB  1 
ATOM   2946  C CG1 . VAL A 1 389 ? 10.392 10.135  24.501  1.00 59.87  ? 386 VAL A CG1 1 
ATOM   2947  C CG2 . VAL A 1 389 ? 11.103 11.231  26.629  1.00 58.60  ? 386 VAL A CG2 1 
ATOM   2948  N N   . GLN A 1 390 ? 7.232  8.833   25.407  1.00 69.36  ? 387 GLN A N   1 
ATOM   2949  C CA  . GLN A 1 390 ? 6.520  7.930   24.519  1.00 72.37  ? 387 GLN A CA  1 
ATOM   2950  C C   . GLN A 1 390 ? 6.804  8.329   23.076  1.00 70.88  ? 387 GLN A C   1 
ATOM   2951  O O   . GLN A 1 390 ? 7.281  9.432   22.800  1.00 65.11  ? 387 GLN A O   1 
ATOM   2952  C CB  . GLN A 1 390 ? 5.020  7.965   24.814  1.00 70.72  ? 387 GLN A CB  1 
ATOM   2953  C CG  . GLN A 1 390 ? 4.695  7.633   26.266  1.00 75.29  ? 387 GLN A CG  1 
ATOM   2954  C CD  . GLN A 1 390 ? 3.433  8.313   26.755  1.00 77.32  ? 387 GLN A CD  1 
ATOM   2955  O OE1 . GLN A 1 390 ? 3.171  9.471   26.426  1.00 78.83  ? 387 GLN A OE1 1 
ATOM   2956  N NE2 . GLN A 1 390 ? 2.651  7.603   27.560  1.00 61.40  ? 387 GLN A NE2 1 
ATOM   2957  N N   . ARG A 1 391 ? 6.518  7.410   22.151  1.00 71.37  ? 388 ARG A N   1 
ATOM   2958  C CA  . ARG A 1 391 ? 6.948  7.608   20.768  1.00 69.46  ? 388 ARG A CA  1 
ATOM   2959  C C   . ARG A 1 391 ? 6.257  8.807   20.126  1.00 65.54  ? 388 ARG A C   1 
ATOM   2960  O O   . ARG A 1 391 ? 6.855  9.489   19.286  1.00 69.91  ? 388 ARG A O   1 
ATOM   2961  C CB  . ARG A 1 391 ? 6.708  6.329   19.950  1.00 72.90  ? 388 ARG A CB  1 
ATOM   2962  C CG  . ARG A 1 391 ? 7.030  6.435   18.451  1.00 74.85  ? 388 ARG A CG  1 
ATOM   2963  C CD  . ARG A 1 391 ? 8.346  7.175   18.195  1.00 73.39  ? 388 ARG A CD  1 
ATOM   2964  N NE  . ARG A 1 391 ? 8.524  7.620   16.814  1.00 84.76  ? 388 ARG A NE  1 
ATOM   2965  C CZ  . ARG A 1 391 ? 7.806  8.584   16.240  1.00 77.62  ? 388 ARG A CZ  1 
ATOM   2966  N NH1 . ARG A 1 391 ? 8.043  8.934   14.980  1.00 75.07  ? 388 ARG A NH1 1 
ATOM   2967  N NH2 . ARG A 1 391 ? 6.820  9.170   16.907  1.00 71.08  ? 388 ARG A NH2 1 
ATOM   2968  N N   . SER A 1 392 ? 5.027  9.111   20.523  1.00 60.52  ? 389 SER A N   1 
ATOM   2969  C CA  . SER A 1 392 ? 4.381  10.276  19.934  1.00 63.60  ? 389 SER A CA  1 
ATOM   2970  C C   . SER A 1 392 ? 4.921  11.596  20.478  1.00 53.88  ? 389 SER A C   1 
ATOM   2971  O O   . SER A 1 392 ? 4.538  12.659  19.975  1.00 51.37  ? 389 SER A O   1 
ATOM   2972  C CB  . SER A 1 392 ? 2.866  10.209  20.138  1.00 59.22  ? 389 SER A CB  1 
ATOM   2973  O OG  . SER A 1 392 ? 2.533  10.116  21.512  1.00 61.76  ? 389 SER A OG  1 
ATOM   2974  N N   . ASP A 1 393 ? 5.803  11.562  21.481  1.00 55.59  ? 390 ASP A N   1 
ATOM   2975  C CA  . ASP A 1 393 ? 6.393  12.795  21.990  1.00 62.90  ? 390 ASP A CA  1 
ATOM   2976  C C   . ASP A 1 393 ? 7.434  13.373  21.042  1.00 61.92  ? 390 ASP A C   1 
ATOM   2977  O O   . ASP A 1 393 ? 7.792  14.548  21.179  1.00 56.23  ? 390 ASP A O   1 
ATOM   2978  C CB  . ASP A 1 393 ? 7.039  12.558  23.357  1.00 61.19  ? 390 ASP A CB  1 
ATOM   2979  C CG  . ASP A 1 393 ? 6.022  12.307  24.450  1.00 61.44  ? 390 ASP A CG  1 
ATOM   2980  O OD1 . ASP A 1 393 ? 4.916  12.882  24.382  1.00 59.50  ? 390 ASP A OD1 1 
ATOM   2981  O OD2 . ASP A 1 393 ? 6.330  11.529  25.379  1.00 63.52  ? 390 ASP A OD2 1 
ATOM   2982  N N   . TYR A 1 394 ? 7.927  12.582  20.091  1.00 59.75  ? 391 TYR A N   1 
ATOM   2983  C CA  . TYR A 1 394 ? 9.029  13.008  19.243  1.00 57.73  ? 391 TYR A CA  1 
ATOM   2984  C C   . TYR A 1 394 ? 8.839  12.501  17.821  1.00 57.75  ? 391 TYR A C   1 
ATOM   2985  O O   . TYR A 1 394 ? 8.044  11.597  17.554  1.00 57.14  ? 391 TYR A O   1 
ATOM   2986  C CB  . TYR A 1 394 ? 10.382 12.531  19.792  1.00 53.30  ? 391 TYR A CB  1 
ATOM   2987  C CG  . TYR A 1 394 ? 10.560 11.025  19.846  1.00 57.36  ? 391 TYR A CG  1 
ATOM   2988  C CD1 . TYR A 1 394 ? 11.195 10.338  18.816  1.00 57.94  ? 391 TYR A CD1 1 
ATOM   2989  C CD2 . TYR A 1 394 ? 10.109 10.292  20.938  1.00 60.82  ? 391 TYR A CD2 1 
ATOM   2990  C CE1 . TYR A 1 394 ? 11.364 8.961   18.869  1.00 60.05  ? 391 TYR A CE1 1 
ATOM   2991  C CE2 . TYR A 1 394 ? 10.274 8.919   20.999  1.00 64.52  ? 391 TYR A CE2 1 
ATOM   2992  C CZ  . TYR A 1 394 ? 10.905 8.259   19.965  1.00 65.94  ? 391 TYR A CZ  1 
ATOM   2993  O OH  . TYR A 1 394 ? 11.066 6.892   20.024  1.00 62.53  ? 391 TYR A OH  1 
ATOM   2994  N N   . LEU A 1 395 ? 9.588  13.114  16.911  1.00 57.15  ? 392 LEU A N   1 
ATOM   2995  C CA  . LEU A 1 395 ? 9.679  12.700  15.521  1.00 53.50  ? 392 LEU A CA  1 
ATOM   2996  C C   . LEU A 1 395 ? 10.985 11.948  15.307  1.00 57.34  ? 392 LEU A C   1 
ATOM   2997  O O   . LEU A 1 395 ? 11.967 12.162  16.024  1.00 53.82  ? 392 LEU A O   1 
ATOM   2998  C CB  . LEU A 1 395 ? 9.630  13.913  14.587  1.00 51.45  ? 392 LEU A CB  1 
ATOM   2999  C CG  . LEU A 1 395 ? 8.390  14.810  14.622  1.00 58.08  ? 392 LEU A CG  1 
ATOM   3000  C CD1 . LEU A 1 395 ? 8.489  15.907  13.569  1.00 49.03  ? 392 LEU A CD1 1 
ATOM   3001  C CD2 . LEU A 1 395 ? 7.120  13.994  14.433  1.00 50.95  ? 392 LEU A CD2 1 
ATOM   3002  N N   . ASN A 1 396 ? 10.994 11.058  14.319  1.00 56.87  ? 393 ASN A N   1 
ATOM   3003  C CA  . ASN A 1 396 ? 12.262 10.453  13.952  1.00 51.60  ? 393 ASN A CA  1 
ATOM   3004  C C   . ASN A 1 396 ? 13.020 11.388  13.011  1.00 47.32  ? 393 ASN A C   1 
ATOM   3005  O O   . ASN A 1 396 ? 12.485 12.393  12.533  1.00 43.60  ? 393 ASN A O   1 
ATOM   3006  C CB  . ASN A 1 396 ? 12.055 9.065   13.337  1.00 50.79  ? 393 ASN A CB  1 
ATOM   3007  C CG  . ASN A 1 396 ? 11.272 9.096   12.037  1.00 56.65  ? 393 ASN A CG  1 
ATOM   3008  O OD1 . ASN A 1 396 ? 11.700 9.689   11.047  1.00 55.20  ? 393 ASN A OD1 1 
ATOM   3009  N ND2 . ASN A 1 396 ? 10.126 8.425   12.028  1.00 63.27  ? 393 ASN A ND2 1 
ATOM   3010  N N   . THR A 1 397 ? 14.286 11.043  12.756  1.00 49.88  ? 394 THR A N   1 
ATOM   3011  C CA  . THR A 1 397 ? 15.193 11.946  12.051  1.00 50.71  ? 394 THR A CA  1 
ATOM   3012  C C   . THR A 1 397 ? 14.582 12.475  10.760  1.00 48.53  ? 394 THR A C   1 
ATOM   3013  O O   . THR A 1 397 ? 14.659 13.672  10.462  1.00 42.07  ? 394 THR A O   1 
ATOM   3014  C CB  . THR A 1 397 ? 16.511 11.232  11.753  1.00 53.12  ? 394 THR A CB  1 
ATOM   3015  O OG1 . THR A 1 397 ? 17.045 10.675  12.959  1.00 49.75  ? 394 THR A OG1 1 
ATOM   3016  C CG2 . THR A 1 397 ? 17.515 12.205  11.146  1.00 47.40  ? 394 THR A CG2 1 
ATOM   3017  N N   . PHE A 1 398 ? 13.945 11.596  9.991   1.00 48.94  ? 395 PHE A N   1 
ATOM   3018  C CA  . PHE A 1 398 ? 13.485 11.976  8.662   1.00 48.85  ? 395 PHE A CA  1 
ATOM   3019  C C   . PHE A 1 398 ? 12.189 12.777  8.712   1.00 45.65  ? 395 PHE A C   1 
ATOM   3020  O O   . PHE A 1 398 ? 12.002 13.699  7.909   1.00 45.67  ? 395 PHE A O   1 
ATOM   3021  C CB  . PHE A 1 398 ? 13.332 10.724  7.804   1.00 51.09  ? 395 PHE A CB  1 
ATOM   3022  C CG  . PHE A 1 398 ? 14.566 9.871   7.774   1.00 54.85  ? 395 PHE A CG  1 
ATOM   3023  C CD1 . PHE A 1 398 ? 15.559 10.105  6.836   1.00 53.89  ? 395 PHE A CD1 1 
ATOM   3024  C CD2 . PHE A 1 398 ? 14.748 8.854   8.696   1.00 56.67  ? 395 PHE A CD2 1 
ATOM   3025  C CE1 . PHE A 1 398 ? 16.702 9.327   6.807   1.00 57.57  ? 395 PHE A CE1 1 
ATOM   3026  C CE2 . PHE A 1 398 ? 15.888 8.074   8.675   1.00 59.53  ? 395 PHE A CE2 1 
ATOM   3027  C CZ  . PHE A 1 398 ? 16.867 8.311   7.728   1.00 52.08  ? 395 PHE A CZ  1 
ATOM   3028  N N   . GLU A 1 399 ? 11.286 12.443  9.638   1.00 41.02  ? 396 GLU A N   1 
ATOM   3029  C CA  . GLU A 1 399 ? 10.097 13.264  9.841   1.00 46.17  ? 396 GLU A CA  1 
ATOM   3030  C C   . GLU A 1 399 ? 10.485 14.690  10.204  1.00 42.79  ? 396 GLU A C   1 
ATOM   3031  O O   . GLU A 1 399 ? 9.983  15.655  9.616   1.00 47.80  ? 396 GLU A O   1 
ATOM   3032  C CB  . GLU A 1 399 ? 9.222  12.664  10.940  1.00 52.06  ? 396 GLU A CB  1 
ATOM   3033  C CG  . GLU A 1 399 ? 8.321  11.539  10.496  1.00 56.25  ? 396 GLU A CG  1 
ATOM   3034  C CD  . GLU A 1 399 ? 7.953  10.632  11.649  1.00 65.39  ? 396 GLU A CD  1 
ATOM   3035  O OE1 . GLU A 1 399 ? 8.579  10.758  12.723  1.00 66.33  ? 396 GLU A OE1 1 
ATOM   3036  O OE2 . GLU A 1 399 ? 7.047  9.793   11.485  1.00 64.03  ? 396 GLU A OE2 1 
ATOM   3037  N N   . PHE A 1 400 ? 11.389 14.833  11.175  1.00 44.89  ? 397 PHE A N   1 
ATOM   3038  C CA  . PHE A 1 400 ? 11.831 16.151  11.619  1.00 48.58  ? 397 PHE A CA  1 
ATOM   3039  C C   . PHE A 1 400 ? 12.400 16.966  10.461  1.00 43.16  ? 397 PHE A C   1 
ATOM   3040  O O   . PHE A 1 400 ? 12.117 18.162  10.330  1.00 43.18  ? 397 PHE A O   1 
ATOM   3041  C CB  . PHE A 1 400 ? 12.866 15.986  12.732  1.00 46.23  ? 397 PHE A CB  1 
ATOM   3042  C CG  . PHE A 1 400 ? 13.225 17.265  13.430  1.00 45.51  ? 397 PHE A CG  1 
ATOM   3043  C CD1 . PHE A 1 400 ? 12.283 17.957  14.175  1.00 47.45  ? 397 PHE A CD1 1 
ATOM   3044  C CD2 . PHE A 1 400 ? 14.514 17.761  13.360  1.00 46.11  ? 397 PHE A CD2 1 
ATOM   3045  C CE1 . PHE A 1 400 ? 12.622 19.129  14.825  1.00 50.12  ? 397 PHE A CE1 1 
ATOM   3046  C CE2 . PHE A 1 400 ? 14.860 18.929  14.008  1.00 48.45  ? 397 PHE A CE2 1 
ATOM   3047  C CZ  . PHE A 1 400 ? 13.912 19.616  14.741  1.00 45.69  ? 397 PHE A CZ  1 
ATOM   3048  N N   . MET A 1 401 ? 13.200 16.326  9.604   1.00 46.28  ? 398 MET A N   1 
ATOM   3049  C CA  . MET A 1 401 ? 13.772 17.027  8.457   1.00 41.40  ? 398 MET A CA  1 
ATOM   3050  C C   . MET A 1 401 ? 12.684 17.488  7.494   1.00 44.39  ? 398 MET A C   1 
ATOM   3051  O O   . MET A 1 401 ? 12.697 18.635  7.032   1.00 47.13  ? 398 MET A O   1 
ATOM   3052  C CB  . MET A 1 401 ? 14.784 16.130  7.744   1.00 43.95  ? 398 MET A CB  1 
ATOM   3053  C CG  . MET A 1 401 ? 16.036 15.815  8.558   1.00 45.34  ? 398 MET A CG  1 
ATOM   3054  S SD  . MET A 1 401 ? 17.100 17.251  8.833   1.00 52.46  ? 398 MET A SD  1 
ATOM   3055  C CE  . MET A 1 401 ? 17.209 17.920  7.178   1.00 31.23  ? 398 MET A CE  1 
ATOM   3056  N N   . ASP A 1 402 ? 11.737 16.600  7.172   1.00 47.04  ? 399 ASP A N   1 
ATOM   3057  C CA  . ASP A 1 402 ? 10.598 16.985  6.341   1.00 51.09  ? 399 ASP A CA  1 
ATOM   3058  C C   . ASP A 1 402 ? 9.883  18.193  6.929   1.00 44.72  ? 399 ASP A C   1 
ATOM   3059  O O   . ASP A 1 402 ? 9.573  19.159  6.220   1.00 45.58  ? 399 ASP A O   1 
ATOM   3060  C CB  . ASP A 1 402 ? 9.620  15.815  6.207   1.00 54.99  ? 399 ASP A CB  1 
ATOM   3061  C CG  . ASP A 1 402 ? 10.164 14.687  5.357   1.00 62.87  ? 399 ASP A CG  1 
ATOM   3062  O OD1 . ASP A 1 402 ? 10.693 14.963  4.260   1.00 62.52  ? 399 ASP A OD1 1 
ATOM   3063  O OD2 . ASP A 1 402 ? 10.056 13.519  5.788   1.00 56.33  ? 399 ASP A OD2 1 
ATOM   3064  N N   . LYS A 1 403 ? 9.625  18.153  8.239   1.00 44.04  ? 400 LYS A N   1 
ATOM   3065  C CA  . LYS A 1 403 ? 8.920  19.245  8.903   1.00 48.43  ? 400 LYS A CA  1 
ATOM   3066  C C   . LYS A 1 403 ? 9.702  20.548  8.810   1.00 42.61  ? 400 LYS A C   1 
ATOM   3067  O O   . LYS A 1 403 ? 9.127  21.609  8.536   1.00 42.91  ? 400 LYS A O   1 
ATOM   3068  C CB  . LYS A 1 403 ? 8.659  18.874  10.363  1.00 44.99  ? 400 LYS A CB  1 
ATOM   3069  C CG  . LYS A 1 403 ? 7.717  19.808  11.093  1.00 48.79  ? 400 LYS A CG  1 
ATOM   3070  C CD  . LYS A 1 403 ? 6.311  19.741  10.531  1.00 46.67  ? 400 LYS A CD  1 
ATOM   3071  C CE  . LYS A 1 403 ? 5.393  20.676  11.298  1.00 59.75  ? 400 LYS A CE  1 
ATOM   3072  N NZ  . LYS A 1 403 ? 3.967  20.496  10.921  1.00 56.53  ? 400 LYS A NZ  1 
ATOM   3073  N N   . LEU A 1 404 ? 11.017 20.489  9.039   1.00 38.37  ? 401 LEU A N   1 
ATOM   3074  C CA  . LEU A 1 404 ? 11.847 21.676  8.862   1.00 43.06  ? 401 LEU A CA  1 
ATOM   3075  C C   . LEU A 1 404 ? 11.780 22.175  7.425   1.00 43.58  ? 401 LEU A C   1 
ATOM   3076  O O   . LEU A 1 404 ? 11.750 23.388  7.181   1.00 43.22  ? 401 LEU A O   1 
ATOM   3077  C CB  . LEU A 1 404 ? 13.292 21.373  9.255   1.00 43.41  ? 401 LEU A CB  1 
ATOM   3078  C CG  . LEU A 1 404 ? 13.621 21.267  10.745  1.00 47.57  ? 401 LEU A CG  1 
ATOM   3079  C CD1 . LEU A 1 404 ? 15.003 20.663  10.923  1.00 43.51  ? 401 LEU A CD1 1 
ATOM   3080  C CD2 . LEU A 1 404 ? 13.530 22.619  11.433  1.00 42.44  ? 401 LEU A CD2 1 
ATOM   3081  N N   . GLY A 1 405 ? 11.743 21.251  6.460   1.00 45.37  ? 402 GLY A N   1 
ATOM   3082  C CA  . GLY A 1 405 ? 11.652 21.656  5.067   1.00 46.56  ? 402 GLY A CA  1 
ATOM   3083  C C   . GLY A 1 405 ? 10.345 22.362  4.758   1.00 46.68  ? 402 GLY A C   1 
ATOM   3084  O O   . GLY A 1 405 ? 10.327 23.403  4.098   1.00 43.55  ? 402 GLY A O   1 
ATOM   3085  N N   . GLU A 1 406 ? 9.229  21.799  5.228   1.00 38.02  ? 403 GLU A N   1 
ATOM   3086  C CA  . GLU A 1 406 ? 7.935  22.448  5.046   1.00 51.76  ? 403 GLU A CA  1 
ATOM   3087  C C   . GLU A 1 406 ? 7.938  23.846  5.648   1.00 49.92  ? 403 GLU A C   1 
ATOM   3088  O O   . GLU A 1 406 ? 7.528  24.817  5.000   1.00 52.24  ? 403 GLU A O   1 
ATOM   3089  C CB  . GLU A 1 406 ? 6.826  21.594  5.667   1.00 54.01  ? 403 GLU A CB  1 
ATOM   3090  C CG  . GLU A 1 406 ? 5.427  21.867  5.110   1.00 71.60  ? 403 GLU A CG  1 
ATOM   3091  C CD  . GLU A 1 406 ? 5.425  22.152  3.618   1.00 77.69  ? 403 GLU A CD  1 
ATOM   3092  O OE1 . GLU A 1 406 ? 5.171  23.313  3.230   1.00 75.89  ? 403 GLU A OE1 1 
ATOM   3093  O OE2 . GLU A 1 406 ? 5.666  21.211  2.830   1.00 79.36  ? 403 GLU A OE2 1 
ATOM   3094  N N   . ASN A 1 407 ? 8.431  23.966  6.887   1.00 48.41  ? 404 ASN A N   1 
ATOM   3095  C CA  . ASN A 1 407 ? 8.450  25.265  7.550   1.00 48.90  ? 404 ASN A CA  1 
ATOM   3096  C C   . ASN A 1 407 ? 9.457  26.219  6.918   1.00 44.67  ? 404 ASN A C   1 
ATOM   3097  O O   . ASN A 1 407 ? 9.215  27.432  6.881   1.00 46.95  ? 404 ASN A O   1 
ATOM   3098  C CB  . ASN A 1 407 ? 8.745  25.094  9.039   1.00 48.54  ? 404 ASN A CB  1 
ATOM   3099  C CG  . ASN A 1 407 ? 7.599  24.437  9.790   1.00 51.48  ? 404 ASN A CG  1 
ATOM   3100  O OD1 . ASN A 1 407 ? 6.464  24.415  9.314   1.00 54.99  ? 404 ASN A OD1 1 
ATOM   3101  N ND2 . ASN A 1 407 ? 7.888  23.915  10.977  1.00 42.87  ? 404 ASN A ND2 1 
ATOM   3102  N N   . LEU A 1 408 ? 10.586 25.706  6.420   1.00 47.82  ? 405 LEU A N   1 
ATOM   3103  C CA  . LEU A 1 408 ? 11.529 26.578  5.723   1.00 44.97  ? 405 LEU A CA  1 
ATOM   3104  C C   . LEU A 1 408 ? 10.926 27.113  4.431   1.00 46.50  ? 405 LEU A C   1 
ATOM   3105  O O   . LEU A 1 408 ? 11.072 28.300  4.115   1.00 45.94  ? 405 LEU A O   1 
ATOM   3106  C CB  . LEU A 1 408 ? 12.832 25.835  5.429   1.00 37.28  ? 405 LEU A CB  1 
ATOM   3107  C CG  . LEU A 1 408 ? 13.864 26.669  4.660   1.00 37.69  ? 405 LEU A CG  1 
ATOM   3108  C CD1 . LEU A 1 408 ? 14.280 27.897  5.465   1.00 37.54  ? 405 LEU A CD1 1 
ATOM   3109  C CD2 . LEU A 1 408 ? 15.075 25.835  4.265   1.00 39.68  ? 405 LEU A CD2 1 
ATOM   3110  N N   . LYS A 1 409 ? 10.251 26.246  3.672   1.00 43.43  ? 406 LYS A N   1 
ATOM   3111  C CA  . LYS A 1 409 ? 9.592  26.673  2.442   1.00 52.17  ? 406 LYS A CA  1 
ATOM   3112  C C   . LYS A 1 409 ? 8.582  27.781  2.719   1.00 53.07  ? 406 LYS A C   1 
ATOM   3113  O O   . LYS A 1 409 ? 8.507  28.770  1.981   1.00 54.25  ? 406 LYS A O   1 
ATOM   3114  C CB  . LYS A 1 409 ? 8.919  25.467  1.784   1.00 53.54  ? 406 LYS A CB  1 
ATOM   3115  C CG  . LYS A 1 409 ? 8.147  25.752  0.510   1.00 54.01  ? 406 LYS A CG  1 
ATOM   3116  C CD  . LYS A 1 409 ? 7.846  24.445  -0.211  1.00 61.52  ? 406 LYS A CD  1 
ATOM   3117  C CE  . LYS A 1 409 ? 7.132  24.681  -1.530  1.00 61.59  ? 406 LYS A CE  1 
ATOM   3118  N NZ  . LYS A 1 409 ? 7.390  23.589  -2.509  1.00 63.11  ? 406 LYS A NZ  1 
ATOM   3119  N N   . ILE A 1 410 ? 7.809  27.637  3.797   1.00 52.65  ? 407 ILE A N   1 
ATOM   3120  C CA  . ILE A 1 410 ? 6.807  28.641  4.151   1.00 56.08  ? 407 ILE A CA  1 
ATOM   3121  C C   . ILE A 1 410 ? 7.481  29.954  4.531   1.00 53.92  ? 407 ILE A C   1 
ATOM   3122  O O   . ILE A 1 410 ? 7.156  31.021  3.995   1.00 53.53  ? 407 ILE A O   1 
ATOM   3123  C CB  . ILE A 1 410 ? 5.908  28.129  5.290   1.00 52.92  ? 407 ILE A CB  1 
ATOM   3124  C CG1 . ILE A 1 410 ? 5.134  26.890  4.849   1.00 57.14  ? 407 ILE A CG1 1 
ATOM   3125  C CG2 . ILE A 1 410 ? 4.967  29.229  5.766   1.00 54.40  ? 407 ILE A CG2 1 
ATOM   3126  C CD1 . ILE A 1 410 ? 4.424  26.187  5.981   1.00 51.06  ? 407 ILE A CD1 1 
ATOM   3127  N N   . LYS A 1 411 ? 8.425  29.889  5.474   1.00 56.30  ? 408 LYS A N   1 
ATOM   3128  C CA  . LYS A 1 411 ? 9.118  31.085  5.946   1.00 58.97  ? 408 LYS A CA  1 
ATOM   3129  C C   . LYS A 1 411 ? 9.732  31.866  4.790   1.00 49.63  ? 408 LYS A C   1 
ATOM   3130  O O   . LYS A 1 411 ? 9.586  33.090  4.702   1.00 54.39  ? 408 LYS A O   1 
ATOM   3131  C CB  . LYS A 1 411 ? 10.193 30.690  6.960   1.00 53.35  ? 408 LYS A CB  1 
ATOM   3132  C CG  . LYS A 1 411 ? 11.244 31.760  7.211   1.00 51.48  ? 408 LYS A CG  1 
ATOM   3133  C CD  . LYS A 1 411 ? 10.882 32.654  8.383   1.00 55.40  ? 408 LYS A CD  1 
ATOM   3134  C CE  . LYS A 1 411 ? 11.112 31.940  9.704   1.00 52.85  ? 408 LYS A CE  1 
ATOM   3135  N NZ  . LYS A 1 411 ? 10.936 32.846  10.871  1.00 51.61  ? 408 LYS A NZ  1 
ATOM   3136  N N   . LEU A 1 412 ? 10.419 31.168  3.884   1.00 54.33  ? 409 LEU A N   1 
ATOM   3137  C CA  . LEU A 1 412 ? 11.017 31.843  2.737   1.00 52.43  ? 409 LEU A CA  1 
ATOM   3138  C C   . LEU A 1 412 ? 9.954  32.344  1.767   1.00 56.77  ? 409 LEU A C   1 
ATOM   3139  O O   . LEU A 1 412 ? 10.160 33.361  1.095   1.00 55.15  ? 409 LEU A O   1 
ATOM   3140  C CB  . LEU A 1 412 ? 11.992 30.901  2.035   1.00 49.69  ? 409 LEU A CB  1 
ATOM   3141  C CG  . LEU A 1 412 ? 13.206 30.502  2.879   1.00 50.61  ? 409 LEU A CG  1 
ATOM   3142  C CD1 . LEU A 1 412 ? 14.071 29.499  2.139   1.00 50.87  ? 409 LEU A CD1 1 
ATOM   3143  C CD2 . LEU A 1 412 ? 14.023 31.725  3.273   1.00 46.47  ? 409 LEU A CD2 1 
ATOM   3144  N N   . ALA A 1 413 ? 8.813  31.656  1.686   1.00 55.53  ? 410 ALA A N   1 
ATOM   3145  C CA  . ALA A 1 413 ? 7.734  32.129  0.825   1.00 64.38  ? 410 ALA A CA  1 
ATOM   3146  C C   . ALA A 1 413 ? 7.090  33.391  1.388   1.00 64.78  ? 410 ALA A C   1 
ATOM   3147  O O   . ALA A 1 413 ? 6.805  34.336  0.642   1.00 61.77  ? 410 ALA A O   1 
ATOM   3148  C CB  . ALA A 1 413 ? 6.684  31.035  0.638   1.00 55.74  ? 410 ALA A CB  1 
ATOM   3149  N N   . GLN A 1 414 ? 6.870  33.434  2.703   1.00 63.18  ? 411 GLN A N   1 
ATOM   3150  C CA  . GLN A 1 414 ? 6.203  34.565  3.341   1.00 66.72  ? 411 GLN A CA  1 
ATOM   3151  C C   . GLN A 1 414 ? 7.102  35.794  3.411   1.00 71.32  ? 411 GLN A C   1 
ATOM   3152  O O   . GLN A 1 414 ? 7.166  36.458  4.451   1.00 76.13  ? 411 GLN A O   1 
ATOM   3153  C CB  . GLN A 1 414 ? 5.744  34.185  4.752   1.00 62.94  ? 411 GLN A CB  1 
ATOM   3154  C CG  . GLN A 1 414 ? 4.583  33.203  4.805   1.00 74.00  ? 411 GLN A CG  1 
ATOM   3155  C CD  . GLN A 1 414 ? 4.213  32.821  6.229   1.00 82.46  ? 411 GLN A CD  1 
ATOM   3156  O OE1 . GLN A 1 414 ? 4.919  33.161  7.180   1.00 77.01  ? 411 GLN A OE1 1 
ATOM   3157  N NE2 . GLN A 1 414 ? 3.097  32.117  6.382   1.00 80.78  ? 411 GLN A NE2 1 
ATOM   3158  N N   . ALA A 1 415 ? 7.789  36.115  2.318   1.00 72.03  ? 412 ALA A N   1 
ATOM   3159  C CA  . ALA A 1 415 ? 8.687  37.264  2.297   1.00 69.85  ? 412 ALA A CA  1 
ATOM   3160  C C   . ALA A 1 415 ? 8.914  37.759  0.872   1.00 67.74  ? 412 ALA A C   1 
ATOM   3161  O O   . ALA A 1 415 ? 7.991  37.793  0.059   1.00 73.14  ? 412 ALA A O   1 
ATOM   3162  C CB  . ALA A 1 415 ? 10.013 36.910  2.956   1.00 64.80  ? 412 ALA A CB  1 
ATOM   3163  N N   . LYS B 1 6   ? 24.852 8.802   81.827  1.00 74.82  ? 3   LYS C N   1 
ATOM   3164  C CA  . LYS B 1 6   ? 23.411 8.788   81.597  1.00 84.93  ? 3   LYS C CA  1 
ATOM   3165  C C   . LYS B 1 6   ? 23.088 9.336   80.209  1.00 82.48  ? 3   LYS C C   1 
ATOM   3166  O O   . LYS B 1 6   ? 21.968 9.197   79.716  1.00 78.95  ? 3   LYS C O   1 
ATOM   3167  C CB  . LYS B 1 6   ? 22.688 9.592   82.680  1.00 83.64  ? 3   LYS C CB  1 
ATOM   3168  C CG  . LYS B 1 6   ? 21.214 9.250   82.823  1.00 87.91  ? 3   LYS C CG  1 
ATOM   3169  C CD  . LYS B 1 6   ? 20.605 9.933   84.036  1.00 80.06  ? 3   LYS C CD  1 
ATOM   3170  C CE  . LYS B 1 6   ? 20.744 11.443  83.948  1.00 79.89  ? 3   LYS C CE  1 
ATOM   3171  N NZ  . LYS B 1 6   ? 20.013 12.132  85.048  1.00 89.74  ? 3   LYS C NZ  1 
ATOM   3172  N N   . LYS B 1 7   ? 24.080 9.967   79.589  1.00 76.73  ? 4   LYS C N   1 
ATOM   3173  C CA  . LYS B 1 7   ? 24.013 10.364  78.194  1.00 65.62  ? 4   LYS C CA  1 
ATOM   3174  C C   . LYS B 1 7   ? 24.759 9.331   77.352  1.00 62.34  ? 4   LYS C C   1 
ATOM   3175  O O   . LYS B 1 7   ? 25.185 8.283   77.847  1.00 64.80  ? 4   LYS C O   1 
ATOM   3176  C CB  . LYS B 1 7   ? 24.597 11.767  78.006  1.00 61.04  ? 4   LYS C CB  1 
ATOM   3177  C CG  . LYS B 1 7   ? 23.749 12.895  78.564  1.00 63.24  ? 4   LYS C CG  1 
ATOM   3178  C CD  . LYS B 1 7   ? 24.502 14.215  78.489  1.00 57.77  ? 4   LYS C CD  1 
ATOM   3179  C CE  . LYS B 1 7   ? 23.747 15.338  79.182  1.00 51.22  ? 4   LYS C CE  1 
ATOM   3180  N NZ  . LYS B 1 7   ? 24.557 16.589  79.235  1.00 64.48  ? 4   LYS C NZ  1 
ATOM   3181  N N   . ILE B 1 8   ? 24.925 9.622   76.068  1.00 57.73  ? 5   ILE C N   1 
ATOM   3182  C CA  . ILE B 1 8   ? 25.728 8.773   75.197  1.00 56.59  ? 5   ILE C CA  1 
ATOM   3183  C C   . ILE B 1 8   ? 27.196 9.119   75.399  1.00 54.78  ? 5   ILE C C   1 
ATOM   3184  O O   . ILE B 1 8   ? 27.580 10.295  75.374  1.00 57.52  ? 5   ILE C O   1 
ATOM   3185  C CB  . ILE B 1 8   ? 25.314 8.948   73.726  1.00 58.57  ? 5   ILE C CB  1 
ATOM   3186  C CG1 . ILE B 1 8   ? 23.865 8.507   73.516  1.00 55.19  ? 5   ILE C CG1 1 
ATOM   3187  C CG2 . ILE B 1 8   ? 26.249 8.170   72.808  1.00 53.10  ? 5   ILE C CG2 1 
ATOM   3188  C CD1 . ILE B 1 8   ? 23.243 9.057   72.251  1.00 52.96  ? 5   ILE C CD1 1 
ATOM   3189  N N   . SER B 1 9   ? 28.021 8.097   75.613  1.00 49.41  ? 6   SER C N   1 
ATOM   3190  C CA  . SER B 1 9   ? 29.461 8.293   75.751  1.00 64.04  ? 6   SER C CA  1 
ATOM   3191  C C   . SER B 1 9   ? 30.061 8.523   74.369  1.00 58.48  ? 6   SER C C   1 
ATOM   3192  O O   . SER B 1 9   ? 30.065 7.618   73.528  1.00 59.01  ? 6   SER C O   1 
ATOM   3193  C CB  . SER B 1 9   ? 30.103 7.092   76.435  1.00 60.66  ? 6   SER C CB  1 
ATOM   3194  O OG  . SER B 1 9   ? 31.426 7.393   76.849  1.00 67.69  ? 6   SER C OG  1 
ATOM   3195  N N   . GLY B 1 10  ? 30.575 9.728   74.134  1.00 55.59  ? 7   GLY C N   1 
ATOM   3196  C CA  . GLY B 1 10  ? 31.095 10.087  72.830  1.00 56.50  ? 7   GLY C CA  1 
ATOM   3197  C C   . GLY B 1 10  ? 32.536 9.686   72.590  1.00 59.73  ? 7   GLY C C   1 
ATOM   3198  O O   . GLY B 1 10  ? 32.869 9.162   71.523  1.00 58.85  ? 7   GLY C O   1 
ATOM   3199  N N   . GLY B 1 11  ? 33.402 9.933   73.561  1.00 60.36  ? 8   GLY C N   1 
ATOM   3200  C CA  . GLY B 1 11  ? 34.804 9.603   73.422  1.00 59.82  ? 8   GLY C CA  1 
ATOM   3201  C C   . GLY B 1 11  ? 35.669 10.795  73.057  1.00 56.10  ? 8   GLY C C   1 
ATOM   3202  O O   . GLY B 1 11  ? 35.287 11.960  73.196  1.00 57.28  ? 8   GLY C O   1 
ATOM   3203  N N   . SER B 1 12  ? 36.864 10.478  72.559  1.00 52.59  ? 9   SER C N   1 
ATOM   3204  C CA  . SER B 1 12  ? 37.915 11.466  72.326  1.00 60.71  ? 9   SER C CA  1 
ATOM   3205  C C   . SER B 1 12  ? 37.695 12.151  70.982  1.00 52.83  ? 9   SER C C   1 
ATOM   3206  O O   . SER B 1 12  ? 37.834 11.528  69.924  1.00 49.21  ? 9   SER C O   1 
ATOM   3207  C CB  . SER B 1 12  ? 39.288 10.801  72.382  1.00 54.47  ? 9   SER C CB  1 
ATOM   3208  O OG  . SER B 1 12  ? 39.539 10.242  73.659  1.00 57.10  ? 9   SER C OG  1 
ATOM   3209  N N   . VAL B 1 13  ? 37.361 13.439  71.025  1.00 49.74  ? 10  VAL C N   1 
ATOM   3210  C CA  . VAL B 1 13  ? 37.184 14.256  69.831  1.00 56.52  ? 10  VAL C CA  1 
ATOM   3211  C C   . VAL B 1 13  ? 37.926 15.568  70.038  1.00 58.04  ? 10  VAL C C   1 
ATOM   3212  O O   . VAL B 1 13  ? 37.756 16.226  71.071  1.00 56.59  ? 10  VAL C O   1 
ATOM   3213  C CB  . VAL B 1 13  ? 35.698 14.525  69.525  1.00 54.84  ? 10  VAL C CB  1 
ATOM   3214  C CG1 . VAL B 1 13  ? 35.563 15.478  68.343  1.00 47.72  ? 10  VAL C CG1 1 
ATOM   3215  C CG2 . VAL B 1 13  ? 34.961 13.220  69.246  1.00 49.85  ? 10  VAL C CG2 1 
ATOM   3216  N N   . VAL B 1 14  ? 38.750 15.940  69.063  1.00 52.07  ? 11  VAL C N   1 
ATOM   3217  C CA  . VAL B 1 14  ? 39.436 17.227  69.071  1.00 57.89  ? 11  VAL C CA  1 
ATOM   3218  C C   . VAL B 1 14  ? 38.543 18.249  68.379  1.00 58.16  ? 11  VAL C C   1 
ATOM   3219  O O   . VAL B 1 14  ? 38.099 18.036  67.245  1.00 58.04  ? 11  VAL C O   1 
ATOM   3220  C CB  . VAL B 1 14  ? 40.806 17.133  68.382  1.00 55.44  ? 11  VAL C CB  1 
ATOM   3221  C CG1 . VAL B 1 14  ? 41.551 18.460  68.484  1.00 64.67  ? 11  VAL C CG1 1 
ATOM   3222  C CG2 . VAL B 1 14  ? 41.631 16.005  68.988  1.00 57.14  ? 11  VAL C CG2 1 
ATOM   3223  N N   . GLU B 1 15  ? 38.270 19.352  69.063  1.00 56.32  ? 12  GLU C N   1 
ATOM   3224  C CA  . GLU B 1 15  ? 37.469 20.444  68.534  1.00 54.75  ? 12  GLU C CA  1 
ATOM   3225  C C   . GLU B 1 15  ? 38.375 21.590  68.094  1.00 61.72  ? 12  GLU C C   1 
ATOM   3226  O O   . GLU B 1 15  ? 39.513 21.721  68.551  1.00 64.27  ? 12  GLU C O   1 
ATOM   3227  C CB  . GLU B 1 15  ? 36.470 20.930  69.590  1.00 57.42  ? 12  GLU C CB  1 
ATOM   3228  C CG  . GLU B 1 15  ? 35.383 21.858  69.077  1.00 55.40  ? 12  GLU C CG  1 
ATOM   3229  C CD  . GLU B 1 15  ? 34.834 22.752  70.170  1.00 58.01  ? 12  GLU C CD  1 
ATOM   3230  O OE1 . GLU B 1 15  ? 35.336 22.665  71.309  1.00 61.64  ? 12  GLU C OE1 1 
ATOM   3231  O OE2 . GLU B 1 15  ? 33.908 23.542  69.892  1.00 60.48  ? 12  GLU C OE2 1 
ATOM   3232  N N   . MET B 1 16  ? 37.859 22.418  67.186  1.00 54.96  ? 13  MET C N   1 
ATOM   3233  C CA  . MET B 1 16  ? 38.572 23.602  66.713  1.00 53.09  ? 13  MET C CA  1 
ATOM   3234  C C   . MET B 1 16  ? 37.563 24.726  66.529  1.00 57.60  ? 13  MET C C   1 
ATOM   3235  O O   . MET B 1 16  ? 36.784 24.713  65.571  1.00 57.21  ? 13  MET C O   1 
ATOM   3236  C CB  . MET B 1 16  ? 39.323 23.322  65.411  1.00 54.74  ? 13  MET C CB  1 
ATOM   3237  C CG  . MET B 1 16  ? 40.698 22.701  65.611  1.00 55.46  ? 13  MET C CG  1 
ATOM   3238  S SD  . MET B 1 16  ? 41.207 21.674  64.222  1.00 58.50  ? 13  MET C SD  1 
ATOM   3239  C CE  . MET B 1 16  ? 40.009 20.347  64.330  1.00 59.12  ? 13  MET C CE  1 
ATOM   3240  N N   . GLN B 1 17  ? 37.577 25.688  67.446  1.00 55.50  ? 14  GLN C N   1 
ATOM   3241  C CA  . GLN B 1 17  ? 36.695 26.838  67.357  1.00 55.95  ? 14  GLN C CA  1 
ATOM   3242  C C   . GLN B 1 17  ? 37.228 27.835  66.328  1.00 56.19  ? 14  GLN C C   1 
ATOM   3243  O O   . GLN B 1 17  ? 38.423 27.873  66.017  1.00 55.78  ? 14  GLN C O   1 
ATOM   3244  C CB  . GLN B 1 17  ? 36.538 27.495  68.729  1.00 56.16  ? 14  GLN C CB  1 
ATOM   3245  C CG  . GLN B 1 17  ? 35.750 26.637  69.722  1.00 61.17  ? 14  GLN C CG  1 
ATOM   3246  C CD  . GLN B 1 17  ? 36.009 27.004  71.174  1.00 71.13  ? 14  GLN C CD  1 
ATOM   3247  O OE1 . GLN B 1 17  ? 36.684 27.991  71.470  1.00 67.18  ? 14  GLN C OE1 1 
ATOM   3248  N NE2 . GLN B 1 17  ? 35.473 26.203  72.090  1.00 69.72  ? 14  GLN C NE2 1 
ATOM   3249  N N   . GLY B 1 18  ? 36.314 28.644  65.790  1.00 58.51  ? 15  GLY C N   1 
ATOM   3250  C CA  . GLY B 1 18  ? 36.621 29.527  64.677  1.00 60.21  ? 15  GLY C CA  1 
ATOM   3251  C C   . GLY B 1 18  ? 36.119 30.953  64.807  1.00 61.98  ? 15  GLY C C   1 
ATOM   3252  O O   . GLY B 1 18  ? 36.102 31.514  65.905  1.00 63.97  ? 15  GLY C O   1 
ATOM   3253  N N   . ASP B 1 19  ? 35.693 31.547  63.693  1.00 60.81  ? 16  ASP C N   1 
ATOM   3254  C CA  . ASP B 1 19  ? 35.475 32.984  63.613  1.00 57.63  ? 16  ASP C CA  1 
ATOM   3255  C C   . ASP B 1 19  ? 34.077 33.328  63.098  1.00 62.53  ? 16  ASP C C   1 
ATOM   3256  O O   . ASP B 1 19  ? 33.458 32.580  62.331  1.00 59.15  ? 16  ASP C O   1 
ATOM   3257  C CB  . ASP B 1 19  ? 36.519 33.646  62.709  1.00 66.03  ? 16  ASP C CB  1 
ATOM   3258  C CG  . ASP B 1 19  ? 37.946 33.394  63.170  1.00 67.37  ? 16  ASP C CG  1 
ATOM   3259  O OD1 . ASP B 1 19  ? 38.323 33.894  64.253  1.00 66.86  ? 16  ASP C OD1 1 
ATOM   3260  O OD2 . ASP B 1 19  ? 38.699 32.709  62.444  1.00 66.63  ? 16  ASP C OD2 1 
ATOM   3261  N N   . GLU B 1 20  ? 33.602 34.490  63.546  1.00 61.67  ? 17  GLU C N   1 
ATOM   3262  C CA  . GLU B 1 20  ? 32.453 35.234  63.000  1.00 66.53  ? 17  GLU C CA  1 
ATOM   3263  C C   . GLU B 1 20  ? 31.199 34.363  62.968  1.00 60.62  ? 17  GLU C C   1 
ATOM   3264  O O   . GLU B 1 20  ? 30.861 33.763  64.000  1.00 62.82  ? 17  GLU C O   1 
ATOM   3265  C CB  . GLU B 1 20  ? 32.842 35.867  61.665  1.00 65.10  ? 17  GLU C CB  1 
ATOM   3266  C CG  . GLU B 1 20  ? 34.256 36.422  61.616  1.00 68.65  ? 17  GLU C CG  1 
ATOM   3267  C CD  . GLU B 1 20  ? 34.523 37.164  60.322  1.00 68.91  ? 17  GLU C CD  1 
ATOM   3268  O OE1 . GLU B 1 20  ? 34.034 36.714  59.264  1.00 65.01  ? 17  GLU C OE1 1 
ATOM   3269  O OE2 . GLU B 1 20  ? 35.220 38.200  60.364  1.00 77.92  ? 17  GLU C OE2 1 
ATOM   3270  N N   . MET B 1 21  ? 30.480 34.292  61.845  1.00 57.87  ? 18  MET C N   1 
ATOM   3271  C CA  . MET B 1 21  ? 29.136 33.728  61.860  1.00 59.65  ? 18  MET C CA  1 
ATOM   3272  C C   . MET B 1 21  ? 29.156 32.231  62.124  1.00 56.71  ? 18  MET C C   1 
ATOM   3273  O O   . MET B 1 21  ? 28.249 31.698  62.775  1.00 57.24  ? 18  MET C O   1 
ATOM   3274  C CB  . MET B 1 21  ? 28.429 34.024  60.542  1.00 57.29  ? 18  MET C CB  1 
ATOM   3275  C CG  . MET B 1 21  ? 26.913 33.958  60.635  1.00 54.80  ? 18  MET C CG  1 
ATOM   3276  S SD  . MET B 1 21  ? 26.257 35.112  61.855  1.00 64.40  ? 18  MET C SD  1 
ATOM   3277  C CE  . MET B 1 21  ? 24.620 34.443  62.135  1.00 65.35  ? 18  MET C CE  1 
ATOM   3278  N N   . THR B 1 22  ? 30.173 31.533  61.623  1.00 54.41  ? 19  THR C N   1 
ATOM   3279  C CA  . THR B 1 22  ? 30.265 30.100  61.874  1.00 56.92  ? 19  THR C CA  1 
ATOM   3280  C C   . THR B 1 22  ? 30.482 29.817  63.356  1.00 55.22  ? 19  THR C C   1 
ATOM   3281  O O   . THR B 1 22  ? 29.886 28.888  63.914  1.00 55.22  ? 19  THR C O   1 
ATOM   3282  C CB  . THR B 1 22  ? 31.383 29.494  61.028  1.00 56.53  ? 19  THR C CB  1 
ATOM   3283  O OG1 . THR B 1 22  ? 32.498 30.398  60.994  1.00 58.42  ? 19  THR C OG1 1 
ATOM   3284  C CG2 . THR B 1 22  ? 30.886 29.243  59.617  1.00 53.23  ? 19  THR C CG2 1 
ATOM   3285  N N   . ARG B 1 23  ? 31.320 30.623  64.013  1.00 61.71  ? 20  ARG C N   1 
ATOM   3286  C CA  . ARG B 1 23  ? 31.558 30.432  65.441  1.00 62.49  ? 20  ARG C CA  1 
ATOM   3287  C C   . ARG B 1 23  ? 30.270 30.584  66.240  1.00 56.97  ? 20  ARG C C   1 
ATOM   3288  O O   . ARG B 1 23  ? 30.028 29.832  67.192  1.00 55.95  ? 20  ARG C O   1 
ATOM   3289  C CB  . ARG B 1 23  ? 32.620 31.414  65.935  1.00 66.48  ? 20  ARG C CB  1 
ATOM   3290  C CG  . ARG B 1 23  ? 32.820 31.398  67.445  1.00 65.13  ? 20  ARG C CG  1 
ATOM   3291  C CD  . ARG B 1 23  ? 33.762 32.501  67.897  1.00 68.98  ? 20  ARG C CD  1 
ATOM   3292  N NE  . ARG B 1 23  ? 33.422 33.796  67.314  1.00 73.52  ? 20  ARG C NE  1 
ATOM   3293  C CZ  . ARG B 1 23  ? 32.509 34.625  67.810  1.00 74.28  ? 20  ARG C CZ  1 
ATOM   3294  N NH1 . ARG B 1 23  ? 32.270 35.784  67.212  1.00 74.04  ? 20  ARG C NH1 1 
ATOM   3295  N NH2 . ARG B 1 23  ? 31.834 34.297  68.904  1.00 70.52  ? 20  ARG C NH2 1 
ATOM   3296  N N   . ILE B 1 24  ? 29.430 31.548  65.865  1.00 52.39  ? 21  ILE C N   1 
ATOM   3297  C CA  . ILE B 1 24  ? 28.131 31.700  66.513  1.00 57.66  ? 21  ILE C CA  1 
ATOM   3298  C C   . ILE B 1 24  ? 27.280 30.458  66.279  1.00 56.09  ? 21  ILE C C   1 
ATOM   3299  O O   . ILE B 1 24  ? 26.710 29.885  67.216  1.00 57.63  ? 21  ILE C O   1 
ATOM   3300  C CB  . ILE B 1 24  ? 27.427 32.973  66.009  1.00 65.42  ? 21  ILE C CB  1 
ATOM   3301  C CG1 . ILE B 1 24  ? 28.113 34.223  66.565  1.00 70.42  ? 21  ILE C CG1 1 
ATOM   3302  C CG2 . ILE B 1 24  ? 25.951 32.948  66.382  1.00 49.37  ? 21  ILE C CG2 1 
ATOM   3303  C CD1 . ILE B 1 24  ? 27.870 34.456  68.045  1.00 67.49  ? 21  ILE C CD1 1 
ATOM   3304  N N   . ILE B 1 25  ? 27.188 30.025  65.019  1.00 49.98  ? 22  ILE C N   1 
ATOM   3305  C CA  . ILE B 1 25  ? 26.503 28.780  64.683  1.00 54.71  ? 22  ILE C CA  1 
ATOM   3306  C C   . ILE B 1 25  ? 27.085 27.620  65.479  1.00 51.71  ? 22  ILE C C   1 
ATOM   3307  O O   . ILE B 1 25  ? 26.353 26.774  66.010  1.00 50.64  ? 22  ILE C O   1 
ATOM   3308  C CB  . ILE B 1 25  ? 26.612 28.514  63.169  1.00 51.67  ? 22  ILE C CB  1 
ATOM   3309  C CG1 . ILE B 1 25  ? 25.794 29.524  62.372  1.00 54.51  ? 22  ILE C CG1 1 
ATOM   3310  C CG2 . ILE B 1 25  ? 26.183 27.092  62.841  1.00 44.40  ? 22  ILE C CG2 1 
ATOM   3311  C CD1 . ILE B 1 25  ? 25.867 29.285  60.887  1.00 54.65  ? 22  ILE C CD1 1 
ATOM   3312  N N   . TRP B 1 26  ? 28.415 27.573  65.574  1.00 45.48  ? 23  TRP C N   1 
ATOM   3313  C CA  . TRP B 1 26  ? 29.109 26.442  66.180  1.00 53.65  ? 23  TRP C CA  1 
ATOM   3314  C C   . TRP B 1 26  ? 28.650 26.202  67.613  1.00 51.55  ? 23  TRP C C   1 
ATOM   3315  O O   . TRP B 1 26  ? 28.469 25.051  68.029  1.00 45.70  ? 23  TRP C O   1 
ATOM   3316  C CB  . TRP B 1 26  ? 30.610 26.710  66.123  1.00 48.10  ? 23  TRP C CB  1 
ATOM   3317  C CG  . TRP B 1 26  ? 31.500 25.563  66.428  1.00 52.57  ? 23  TRP C CG  1 
ATOM   3318  C CD1 . TRP B 1 26  ? 32.118 25.307  67.614  1.00 47.01  ? 23  TRP C CD1 1 
ATOM   3319  C CD2 . TRP B 1 26  ? 31.924 24.538  65.522  1.00 52.94  ? 23  TRP C CD2 1 
ATOM   3320  N NE1 . TRP B 1 26  ? 32.887 24.175  67.511  1.00 54.76  ? 23  TRP C NE1 1 
ATOM   3321  C CE2 . TRP B 1 26  ? 32.785 23.683  66.236  1.00 53.56  ? 23  TRP C CE2 1 
ATOM   3322  C CE3 . TRP B 1 26  ? 31.650 24.252  64.180  1.00 47.24  ? 23  TRP C CE3 1 
ATOM   3323  C CZ2 . TRP B 1 26  ? 33.376 22.563  65.656  1.00 50.77  ? 23  TRP C CZ2 1 
ATOM   3324  C CZ3 . TRP B 1 26  ? 32.239 23.139  63.605  1.00 48.30  ? 23  TRP C CZ3 1 
ATOM   3325  C CH2 . TRP B 1 26  ? 33.091 22.308  64.343  1.00 47.75  ? 23  TRP C CH2 1 
ATOM   3326  N N   . GLU B 1 27  ? 28.449 27.276  68.382  1.00 45.89  ? 24  GLU C N   1 
ATOM   3327  C CA  . GLU B 1 27  ? 28.067 27.123  69.782  1.00 52.07  ? 24  GLU C CA  1 
ATOM   3328  C C   . GLU B 1 27  ? 26.624 26.653  69.917  1.00 53.59  ? 24  GLU C C   1 
ATOM   3329  O O   . GLU B 1 27  ? 26.315 25.827  70.784  1.00 51.21  ? 24  GLU C O   1 
ATOM   3330  C CB  . GLU B 1 27  ? 28.278 28.439  70.527  1.00 51.71  ? 24  GLU C CB  1 
ATOM   3331  C CG  . GLU B 1 27  ? 29.738 28.777  70.769  1.00 54.20  ? 24  GLU C CG  1 
ATOM   3332  C CD  . GLU B 1 27  ? 30.467 27.686  71.533  1.00 58.11  ? 24  GLU C CD  1 
ATOM   3333  O OE1 . GLU B 1 27  ? 31.602 27.337  71.143  1.00 57.98  ? 24  GLU C OE1 1 
ATOM   3334  O OE2 . GLU B 1 27  ? 29.904 27.178  72.525  1.00 58.78  ? 24  GLU C OE2 1 
ATOM   3335  N N   . LEU B 1 28  ? 25.727 27.175  69.076  1.00 49.53  ? 25  LEU C N   1 
ATOM   3336  C CA  . LEU B 1 28  ? 24.343 26.713  69.093  1.00 54.91  ? 25  LEU C CA  1 
ATOM   3337  C C   . LEU B 1 28  ? 24.264 25.217  68.824  1.00 47.85  ? 25  LEU C C   1 
ATOM   3338  O O   . LEU B 1 28  ? 23.446 24.511  69.425  1.00 50.77  ? 25  LEU C O   1 
ATOM   3339  C CB  . LEU B 1 28  ? 23.519 27.486  68.064  1.00 52.09  ? 25  LEU C CB  1 
ATOM   3340  C CG  . LEU B 1 28  ? 23.274 28.961  68.373  1.00 58.17  ? 25  LEU C CG  1 
ATOM   3341  C CD1 . LEU B 1 28  ? 22.424 29.600  67.288  1.00 49.11  ? 25  LEU C CD1 1 
ATOM   3342  C CD2 . LEU B 1 28  ? 22.619 29.116  69.737  1.00 47.04  ? 25  LEU C CD2 1 
ATOM   3343  N N   . ILE B 1 29  ? 25.116 24.718  67.928  1.00 48.61  ? 26  ILE C N   1 
ATOM   3344  C CA  . ILE B 1 29  ? 25.130 23.292  67.617  1.00 52.76  ? 26  ILE C CA  1 
ATOM   3345  C C   . ILE B 1 29  ? 25.494 22.482  68.856  1.00 51.79  ? 26  ILE C C   1 
ATOM   3346  O O   . ILE B 1 29  ? 24.860 21.466  69.165  1.00 50.21  ? 26  ILE C O   1 
ATOM   3347  C CB  . ILE B 1 29  ? 26.098 23.010  66.453  1.00 38.31  ? 26  ILE C CB  1 
ATOM   3348  C CG1 . ILE B 1 29  ? 25.572 23.638  65.165  1.00 43.54  ? 26  ILE C CG1 1 
ATOM   3349  C CG2 . ILE B 1 29  ? 26.319 21.512  66.283  1.00 37.97  ? 26  ILE C CG2 1 
ATOM   3350  C CD1 . ILE B 1 29  ? 26.581 23.657  64.050  1.00 41.59  ? 26  ILE C CD1 1 
ATOM   3351  N N   . LYS B 1 30  ? 26.515 22.927  69.590  1.00 50.36  ? 27  LYS C N   1 
ATOM   3352  C CA  . LYS B 1 30  ? 26.955 22.178  70.761  1.00 54.44  ? 27  LYS C CA  1 
ATOM   3353  C C   . LYS B 1 30  ? 25.936 22.267  71.889  1.00 54.65  ? 27  LYS C C   1 
ATOM   3354  O O   . LYS B 1 30  ? 25.654 21.267  72.557  1.00 52.79  ? 27  LYS C O   1 
ATOM   3355  C CB  . LYS B 1 30  ? 28.322 22.681  71.221  1.00 54.87  ? 27  LYS C CB  1 
ATOM   3356  C CG  . LYS B 1 30  ? 29.401 22.532  70.165  1.00 50.76  ? 27  LYS C CG  1 
ATOM   3357  C CD  . LYS B 1 30  ? 30.784 22.799  70.733  1.00 58.41  ? 27  LYS C CD  1 
ATOM   3358  C CE  . LYS B 1 30  ? 30.901 24.216  71.258  1.00 56.96  ? 27  LYS C CE  1 
ATOM   3359  N NZ  . LYS B 1 30  ? 32.281 24.517  71.730  1.00 60.18  ? 27  LYS C NZ  1 
ATOM   3360  N N   . GLU B 1 31  ? 25.361 23.451  72.106  1.00 50.88  ? 28  GLU C N   1 
ATOM   3361  C CA  . GLU B 1 31  ? 24.445 23.641  73.227  1.00 54.66  ? 28  GLU C CA  1 
ATOM   3362  C C   . GLU B 1 31  ? 23.118 22.934  72.987  1.00 54.40  ? 28  GLU C C   1 
ATOM   3363  O O   . GLU B 1 31  ? 22.545 22.337  73.909  1.00 55.72  ? 28  GLU C O   1 
ATOM   3364  C CB  . GLU B 1 31  ? 24.222 25.136  73.476  1.00 56.83  ? 28  GLU C CB  1 
ATOM   3365  C CG  . GLU B 1 31  ? 22.883 25.466  74.134  1.00 63.96  ? 28  GLU C CG  1 
ATOM   3366  C CD  . GLU B 1 31  ? 22.447 26.900  73.901  1.00 75.76  ? 28  GLU C CD  1 
ATOM   3367  O OE1 . GLU B 1 31  ? 21.622 27.133  72.993  1.00 74.96  ? 28  GLU C OE1 1 
ATOM   3368  O OE2 . GLU B 1 31  ? 22.922 27.791  74.635  1.00 79.47  ? 28  GLU C OE2 1 
ATOM   3369  N N   . LYS B 1 32  ? 22.624 22.978  71.748  1.00 53.28  ? 29  LYS C N   1 
ATOM   3370  C CA  . LYS B 1 32  ? 21.293 22.475  71.438  1.00 53.20  ? 29  LYS C CA  1 
ATOM   3371  C C   . LYS B 1 32  ? 21.274 21.060  70.878  1.00 50.61  ? 29  LYS C C   1 
ATOM   3372  O O   . LYS B 1 32  ? 20.305 20.330  71.115  1.00 53.38  ? 29  LYS C O   1 
ATOM   3373  C CB  . LYS B 1 32  ? 20.592 23.401  70.444  1.00 51.06  ? 29  LYS C CB  1 
ATOM   3374  C CG  . LYS B 1 32  ? 20.070 24.687  71.054  1.00 59.86  ? 29  LYS C CG  1 
ATOM   3375  C CD  . LYS B 1 32  ? 19.267 25.477  70.041  1.00 62.92  ? 29  LYS C CD  1 
ATOM   3376  C CE  . LYS B 1 32  ? 18.645 26.700  70.681  1.00 70.10  ? 29  LYS C CE  1 
ATOM   3377  N NZ  . LYS B 1 32  ? 17.557 26.343  71.634  1.00 69.47  ? 29  LYS C NZ  1 
ATOM   3378  N N   . LEU B 1 33  ? 22.302 20.644  70.146  1.00 48.04  ? 30  LEU C N   1 
ATOM   3379  C CA  . LEU B 1 33  ? 22.238 19.383  69.415  1.00 49.01  ? 30  LEU C CA  1 
ATOM   3380  C C   . LEU B 1 33  ? 23.190 18.315  69.928  1.00 43.58  ? 30  LEU C C   1 
ATOM   3381  O O   . LEU B 1 33  ? 22.865 17.128  69.851  1.00 48.46  ? 30  LEU C O   1 
ATOM   3382  C CB  . LEU B 1 33  ? 22.507 19.626  67.925  1.00 41.37  ? 30  LEU C CB  1 
ATOM   3383  C CG  . LEU B 1 33  ? 21.587 20.663  67.276  1.00 41.80  ? 30  LEU C CG  1 
ATOM   3384  C CD1 . LEU B 1 33  ? 21.898 20.832  65.794  1.00 42.33  ? 30  LEU C CD1 1 
ATOM   3385  C CD2 . LEU B 1 33  ? 20.122 20.292  67.482  1.00 44.18  ? 30  LEU C CD2 1 
ATOM   3386  N N   . ILE B 1 34  ? 24.356 18.690  70.453  1.00 47.16  ? 31  ILE C N   1 
ATOM   3387  C CA  . ILE B 1 34  ? 25.355 17.710  70.870  1.00 49.71  ? 31  ILE C CA  1 
ATOM   3388  C C   . ILE B 1 34  ? 25.267 17.463  72.371  1.00 51.49  ? 31  ILE C C   1 
ATOM   3389  O O   . ILE B 1 34  ? 24.919 16.363  72.814  1.00 52.86  ? 31  ILE C O   1 
ATOM   3390  C CB  . ILE B 1 34  ? 26.776 18.164  70.483  1.00 49.60  ? 31  ILE C CB  1 
ATOM   3391  C CG1 . ILE B 1 34  ? 26.790 18.751  69.073  1.00 48.73  ? 31  ILE C CG1 1 
ATOM   3392  C CG2 . ILE B 1 34  ? 27.759 17.003  70.607  1.00 45.78  ? 31  ILE C CG2 1 
ATOM   3393  C CD1 . ILE B 1 34  ? 26.449 17.753  67.987  1.00 40.18  ? 31  ILE C CD1 1 
ATOM   3394  N N   . PHE B 1 35  ? 25.580 18.492  73.156  1.00 54.77  ? 32  PHE C N   1 
ATOM   3395  C CA  . PHE B 1 35  ? 25.744 18.330  74.599  1.00 56.36  ? 32  PHE C CA  1 
ATOM   3396  C C   . PHE B 1 35  ? 24.529 17.768  75.331  1.00 53.98  ? 32  PHE C C   1 
ATOM   3397  O O   . PHE B 1 35  ? 24.732 16.968  76.259  1.00 57.80  ? 32  PHE C O   1 
ATOM   3398  C CB  . PHE B 1 35  ? 26.154 19.672  75.221  1.00 53.04  ? 32  PHE C CB  1 
ATOM   3399  C CG  . PHE B 1 35  ? 27.544 20.110  74.857  1.00 49.31  ? 32  PHE C CG  1 
ATOM   3400  C CD1 . PHE B 1 35  ? 28.488 19.193  74.417  1.00 48.92  ? 32  PHE C CD1 1 
ATOM   3401  C CD2 . PHE B 1 35  ? 27.909 21.442  74.959  1.00 53.95  ? 32  PHE C CD2 1 
ATOM   3402  C CE1 . PHE B 1 35  ? 29.772 19.599  74.085  1.00 53.71  ? 32  PHE C CE1 1 
ATOM   3403  C CE2 . PHE B 1 35  ? 29.185 21.856  74.631  1.00 56.83  ? 32  PHE C CE2 1 
ATOM   3404  C CZ  . PHE B 1 35  ? 30.120 20.933  74.193  1.00 56.15  ? 32  PHE C CZ  1 
ATOM   3405  N N   . PRO B 1 36  ? 23.279 18.126  75.010  1.00 50.07  ? 33  PRO C N   1 
ATOM   3406  C CA  . PRO B 1 36  ? 22.149 17.552  75.763  1.00 47.58  ? 33  PRO C CA  1 
ATOM   3407  C C   . PRO B 1 36  ? 22.025 16.042  75.649  1.00 54.73  ? 33  PRO C C   1 
ATOM   3408  O O   . PRO B 1 36  ? 21.293 15.441  76.446  1.00 54.13  ? 33  PRO C O   1 
ATOM   3409  C CB  . PRO B 1 36  ? 20.923 18.244  75.151  1.00 48.03  ? 33  PRO C CB  1 
ATOM   3410  C CG  . PRO B 1 36  ? 21.447 19.493  74.570  1.00 51.01  ? 33  PRO C CG  1 
ATOM   3411  C CD  . PRO B 1 36  ? 22.811 19.149  74.059  1.00 52.92  ? 33  PRO C CD  1 
ATOM   3412  N N   . TYR B 1 37  ? 22.712 15.413  74.699  1.00 53.28  ? 34  TYR C N   1 
ATOM   3413  C CA  . TYR B 1 37  ? 22.588 13.979  74.472  1.00 52.14  ? 34  TYR C CA  1 
ATOM   3414  C C   . TYR B 1 37  ? 23.910 13.234  74.480  1.00 54.37  ? 34  TYR C C   1 
ATOM   3415  O O   . TYR B 1 37  ? 23.901 12.010  74.670  1.00 56.08  ? 34  TYR C O   1 
ATOM   3416  C CB  . TYR B 1 37  ? 21.890 13.711  73.130  1.00 52.80  ? 34  TYR C CB  1 
ATOM   3417  C CG  . TYR B 1 37  ? 20.627 14.512  72.935  1.00 51.69  ? 34  TYR C CG  1 
ATOM   3418  C CD1 . TYR B 1 37  ? 19.423 14.083  73.473  1.00 47.75  ? 34  TYR C CD1 1 
ATOM   3419  C CD2 . TYR B 1 37  ? 20.640 15.704  72.218  1.00 49.93  ? 34  TYR C CD2 1 
ATOM   3420  C CE1 . TYR B 1 37  ? 18.262 14.811  73.297  1.00 54.64  ? 34  TYR C CE1 1 
ATOM   3421  C CE2 . TYR B 1 37  ? 19.483 16.441  72.039  1.00 46.44  ? 34  TYR C CE2 1 
ATOM   3422  C CZ  . TYR B 1 37  ? 18.298 15.989  72.581  1.00 50.87  ? 34  TYR C CZ  1 
ATOM   3423  O OH  . TYR B 1 37  ? 17.144 16.716  72.405  1.00 51.80  ? 34  TYR C OH  1 
ATOM   3424  N N   . VAL B 1 38  ? 25.036 13.917  74.284  1.00 46.32  ? 35  VAL C N   1 
ATOM   3425  C CA  . VAL B 1 38  ? 26.338 13.292  74.102  1.00 50.17  ? 35  VAL C CA  1 
ATOM   3426  C C   . VAL B 1 38  ? 27.324 13.940  75.061  1.00 55.37  ? 35  VAL C C   1 
ATOM   3427  O O   . VAL B 1 38  ? 27.343 15.167  75.203  1.00 51.55  ? 35  VAL C O   1 
ATOM   3428  C CB  . VAL B 1 38  ? 26.835 13.434  72.648  1.00 49.17  ? 35  VAL C CB  1 
ATOM   3429  C CG1 . VAL B 1 38  ? 28.145 12.672  72.436  1.00 44.86  ? 35  VAL C CG1 1 
ATOM   3430  C CG2 . VAL B 1 38  ? 25.768 12.958  71.661  1.00 49.72  ? 35  VAL C CG2 1 
ATOM   3431  N N   . GLU B 1 39  ? 28.133 13.121  75.722  1.00 54.29  ? 36  GLU C N   1 
ATOM   3432  C CA  . GLU B 1 39  ? 29.249 13.604  76.523  1.00 55.88  ? 36  GLU C CA  1 
ATOM   3433  C C   . GLU B 1 39  ? 30.540 13.091  75.904  1.00 48.51  ? 36  GLU C C   1 
ATOM   3434  O O   . GLU B 1 39  ? 30.714 11.881  75.722  1.00 49.64  ? 36  GLU C O   1 
ATOM   3435  C CB  . GLU B 1 39  ? 29.113 13.183  77.986  1.00 62.06  ? 36  GLU C CB  1 
ATOM   3436  C CG  . GLU B 1 39  ? 28.186 14.120  78.749  1.00 74.38  ? 36  GLU C CG  1 
ATOM   3437  C CD  . GLU B 1 39  ? 28.215 13.914  80.247  1.00 75.36  ? 36  GLU C CD  1 
ATOM   3438  O OE1 . GLU B 1 39  ? 28.270 12.748  80.690  1.00 74.54  ? 36  GLU C OE1 1 
ATOM   3439  O OE2 . GLU B 1 39  ? 28.175 14.925  80.980  1.00 75.54  ? 36  GLU C OE2 1 
ATOM   3440  N N   . LEU B 1 40  ? 31.428 14.020  75.564  1.00 50.58  ? 37  LEU C N   1 
ATOM   3441  C CA  . LEU B 1 40  ? 32.620 13.744  74.781  1.00 52.40  ? 37  LEU C CA  1 
ATOM   3442  C C   . LEU B 1 40  ? 33.863 14.020  75.609  1.00 54.04  ? 37  LEU C C   1 
ATOM   3443  O O   . LEU B 1 40  ? 33.878 14.927  76.448  1.00 45.96  ? 37  LEU C O   1 
ATOM   3444  C CB  . LEU B 1 40  ? 32.664 14.619  73.525  1.00 50.75  ? 37  LEU C CB  1 
ATOM   3445  C CG  . LEU B 1 40  ? 31.632 14.409  72.419  1.00 51.87  ? 37  LEU C CG  1 
ATOM   3446  C CD1 . LEU B 1 40  ? 31.466 15.686  71.610  1.00 48.48  ? 37  LEU C CD1 1 
ATOM   3447  C CD2 . LEU B 1 40  ? 32.068 13.273  71.523  1.00 54.91  ? 37  LEU C CD2 1 
ATOM   3448  N N   . ASP B 1 41  ? 34.914 13.242  75.358  1.00 52.62  ? 38  ASP C N   1 
ATOM   3449  C CA  . ASP B 1 41  ? 36.255 13.611  75.800  1.00 57.94  ? 38  ASP C CA  1 
ATOM   3450  C C   . ASP B 1 41  ? 36.743 14.694  74.842  1.00 56.46  ? 38  ASP C C   1 
ATOM   3451  O O   . ASP B 1 41  ? 37.521 14.454  73.915  1.00 56.10  ? 38  ASP C O   1 
ATOM   3452  C CB  . ASP B 1 41  ? 37.184 12.403  75.816  1.00 55.72  ? 38  ASP C CB  1 
ATOM   3453  C CG  . ASP B 1 41  ? 38.595 12.759  76.237  1.00 51.86  ? 38  ASP C CG  1 
ATOM   3454  O OD1 . ASP B 1 41  ? 38.754 13.607  77.141  1.00 56.25  ? 38  ASP C OD1 1 
ATOM   3455  O OD2 . ASP B 1 41  ? 39.548 12.197  75.659  1.00 49.72  ? 38  ASP C OD2 1 
ATOM   3456  N N   . LEU B 1 42  ? 36.240 15.908  75.055  1.00 52.73  ? 39  LEU C N   1 
ATOM   3457  C CA  . LEU B 1 42  ? 36.574 17.027  74.187  1.00 51.49  ? 39  LEU C CA  1 
ATOM   3458  C C   . LEU B 1 42  ? 38.008 17.484  74.424  1.00 61.63  ? 39  LEU C C   1 
ATOM   3459  O O   . LEU B 1 42  ? 38.485 17.535  75.561  1.00 65.17  ? 39  LEU C O   1 
ATOM   3460  C CB  . LEU B 1 42  ? 35.613 18.194  74.427  1.00 51.06  ? 39  LEU C CB  1 
ATOM   3461  C CG  . LEU B 1 42  ? 34.442 18.421  73.468  1.00 63.77  ? 39  LEU C CG  1 
ATOM   3462  C CD1 . LEU B 1 42  ? 33.950 19.855  73.597  1.00 53.47  ? 39  LEU C CD1 1 
ATOM   3463  C CD2 . LEU B 1 42  ? 34.834 18.111  72.031  1.00 58.21  ? 39  LEU C CD2 1 
ATOM   3464  N N   . HIS B 1 43  ? 38.697 17.811  73.334  1.00 60.71  ? 40  HIS C N   1 
ATOM   3465  C CA  . HIS B 1 43  ? 40.021 18.430  73.362  1.00 56.01  ? 40  HIS C CA  1 
ATOM   3466  C C   . HIS B 1 43  ? 39.899 19.695  72.515  1.00 61.01  ? 40  HIS C C   1 
ATOM   3467  O O   . HIS B 1 43  ? 40.094 19.664  71.297  1.00 59.37  ? 40  HIS C O   1 
ATOM   3468  C CB  . HIS B 1 43  ? 41.107 17.479  72.840  1.00 56.09  ? 40  HIS C CB  1 
ATOM   3469  C CG  . HIS B 1 43  ? 41.181 16.180  73.585  1.00 62.51  ? 40  HIS C CG  1 
ATOM   3470  N ND1 . HIS B 1 43  ? 42.170 15.901  74.504  1.00 64.53  ? 40  HIS C ND1 1 
ATOM   3471  C CD2 . HIS B 1 43  ? 40.390 15.082  73.543  1.00 62.62  ? 40  HIS C CD2 1 
ATOM   3472  C CE1 . HIS B 1 43  ? 41.983 14.690  74.997  1.00 64.45  ? 40  HIS C CE1 1 
ATOM   3473  N NE2 . HIS B 1 43  ? 40.909 14.171  74.430  1.00 60.23  ? 40  HIS C NE2 1 
ATOM   3474  N N   . SER B 1 44  ? 39.564 20.806  73.170  1.00 58.72  ? 41  SER C N   1 
ATOM   3475  C CA  . SER B 1 44  ? 39.137 22.019  72.487  1.00 58.48  ? 41  SER C CA  1 
ATOM   3476  C C   . SER B 1 44  ? 40.310 22.966  72.264  1.00 63.48  ? 41  SER C C   1 
ATOM   3477  O O   . SER B 1 44  ? 41.117 23.196  73.171  1.00 62.87  ? 41  SER C O   1 
ATOM   3478  C CB  . SER B 1 44  ? 38.041 22.722  73.288  1.00 53.97  ? 41  SER C CB  1 
ATOM   3479  O OG  . SER B 1 44  ? 37.059 21.802  73.735  1.00 56.78  ? 41  SER C OG  1 
ATOM   3480  N N   . TYR B 1 45  ? 40.388 23.517  71.055  1.00 62.74  ? 42  TYR C N   1 
ATOM   3481  C CA  . TYR B 1 45  ? 41.406 24.489  70.684  1.00 56.61  ? 42  TYR C CA  1 
ATOM   3482  C C   . TYR B 1 45  ? 40.727 25.673  70.015  1.00 65.43  ? 42  TYR C C   1 
ATOM   3483  O O   . TYR B 1 45  ? 39.925 25.493  69.093  1.00 67.40  ? 42  TYR C O   1 
ATOM   3484  C CB  . TYR B 1 45  ? 42.453 23.871  69.752  1.00 62.59  ? 42  TYR C CB  1 
ATOM   3485  C CG  . TYR B 1 45  ? 43.285 22.795  70.413  1.00 63.85  ? 42  TYR C CG  1 
ATOM   3486  C CD1 . TYR B 1 45  ? 42.808 21.496  70.533  1.00 61.53  ? 42  TYR C CD1 1 
ATOM   3487  C CD2 . TYR B 1 45  ? 44.543 23.083  70.928  1.00 64.46  ? 42  TYR C CD2 1 
ATOM   3488  C CE1 . TYR B 1 45  ? 43.562 20.512  71.141  1.00 61.47  ? 42  TYR C CE1 1 
ATOM   3489  C CE2 . TYR B 1 45  ? 45.305 22.104  71.537  1.00 61.11  ? 42  TYR C CE2 1 
ATOM   3490  C CZ  . TYR B 1 45  ? 44.810 20.821  71.641  1.00 65.54  ? 42  TYR C CZ  1 
ATOM   3491  O OH  . TYR B 1 45  ? 45.565 19.845  72.248  1.00 67.39  ? 42  TYR C OH  1 
ATOM   3492  N N   . ASP B 1 46  ? 41.042 26.876  70.489  1.00 63.60  ? 43  ASP C N   1 
ATOM   3493  C CA  . ASP B 1 46  ? 40.461 28.109  69.961  1.00 66.81  ? 43  ASP C CA  1 
ATOM   3494  C C   . ASP B 1 46  ? 41.358 28.628  68.847  1.00 69.84  ? 43  ASP C C   1 
ATOM   3495  O O   . ASP B 1 46  ? 42.390 29.256  69.103  1.00 73.02  ? 43  ASP C O   1 
ATOM   3496  C CB  . ASP B 1 46  ? 40.299 29.147  71.067  1.00 64.16  ? 43  ASP C CB  1 
ATOM   3497  C CG  . ASP B 1 46  ? 39.495 30.360  70.623  1.00 64.69  ? 43  ASP C CG  1 
ATOM   3498  O OD1 . ASP B 1 46  ? 39.245 30.518  69.408  1.00 69.60  ? 43  ASP C OD1 1 
ATOM   3499  O OD2 . ASP B 1 46  ? 39.125 31.173  71.495  1.00 59.34  ? 43  ASP C OD2 1 
ATOM   3500  N N   . LEU B 1 47  ? 40.963 28.369  67.600  1.00 69.02  ? 44  LEU C N   1 
ATOM   3501  C CA  . LEU B 1 47  ? 41.644 28.936  66.446  1.00 70.04  ? 44  LEU C CA  1 
ATOM   3502  C C   . LEU B 1 47  ? 40.955 30.204  65.951  1.00 64.21  ? 44  LEU C C   1 
ATOM   3503  O O   . LEU B 1 47  ? 41.082 30.559  64.773  1.00 70.85  ? 44  LEU C O   1 
ATOM   3504  C CB  . LEU B 1 47  ? 41.766 27.899  65.325  1.00 67.17  ? 44  LEU C CB  1 
ATOM   3505  C CG  . LEU B 1 47  ? 42.170 26.468  65.716  1.00 63.95  ? 44  LEU C CG  1 
ATOM   3506  C CD1 . LEU B 1 47  ? 42.669 25.709  64.495  1.00 61.83  ? 44  LEU C CD1 1 
ATOM   3507  C CD2 . LEU B 1 47  ? 43.221 26.428  66.820  1.00 69.92  ? 44  LEU C CD2 1 
ATOM   3508  N N   . GLY B 1 48  ? 40.211 30.878  66.824  1.00 68.49  ? 45  GLY C N   1 
ATOM   3509  C CA  . GLY B 1 48  ? 39.833 32.250  66.541  1.00 72.23  ? 45  GLY C CA  1 
ATOM   3510  C C   . GLY B 1 48  ? 41.075 33.100  66.342  1.00 76.88  ? 45  GLY C C   1 
ATOM   3511  O O   . GLY B 1 48  ? 42.091 32.919  67.019  1.00 75.18  ? 45  GLY C O   1 
ATOM   3512  N N   . ILE B 1 49  ? 40.990 34.038  65.398  1.00 72.14  ? 46  ILE C N   1 
ATOM   3513  C CA  . ILE B 1 49  ? 42.186 34.750  64.957  1.00 79.09  ? 46  ILE C CA  1 
ATOM   3514  C C   . ILE B 1 49  ? 42.778 35.595  66.078  1.00 78.49  ? 46  ILE C C   1 
ATOM   3515  O O   . ILE B 1 49  ? 43.982 35.884  66.075  1.00 77.15  ? 46  ILE C O   1 
ATOM   3516  C CB  . ILE B 1 49  ? 41.862 35.589  63.704  1.00 72.07  ? 46  ILE C CB  1 
ATOM   3517  C CG1 . ILE B 1 49  ? 43.150 36.065  63.030  1.00 76.36  ? 46  ILE C CG1 1 
ATOM   3518  C CG2 . ILE B 1 49  ? 40.940 36.750  64.056  1.00 72.41  ? 46  ILE C CG2 1 
ATOM   3519  C CD1 . ILE B 1 49  ? 42.922 36.724  61.700  1.00 79.03  ? 46  ILE C CD1 1 
ATOM   3520  N N   . GLU B 1 50  ? 41.959 36.002  67.050  1.00 76.50  ? 47  GLU C N   1 
ATOM   3521  C CA  . GLU B 1 50  ? 42.491 36.626  68.256  1.00 77.37  ? 47  GLU C CA  1 
ATOM   3522  C C   . GLU B 1 50  ? 43.448 35.675  68.964  1.00 78.08  ? 47  GLU C C   1 
ATOM   3523  O O   . GLU B 1 50  ? 44.609 36.010  69.227  1.00 79.44  ? 47  GLU C O   1 
ATOM   3524  C CB  . GLU B 1 50  ? 41.347 37.032  69.191  1.00 77.43  ? 47  GLU C CB  1 
ATOM   3525  C CG  . GLU B 1 50  ? 40.161 37.689  68.504  1.00 84.39  ? 47  GLU C CG  1 
ATOM   3526  C CD  . GLU B 1 50  ? 39.186 36.679  67.925  1.00 84.09  ? 47  GLU C CD  1 
ATOM   3527  O OE1 . GLU B 1 50  ? 38.323 37.080  67.118  1.00 85.19  ? 47  GLU C OE1 1 
ATOM   3528  O OE2 . GLU B 1 50  ? 39.293 35.481  68.267  1.00 84.58  ? 47  GLU C OE2 1 
ATOM   3529  N N   . ASN B 1 51  ? 42.971 34.464  69.258  1.00 74.54  ? 48  ASN C N   1 
ATOM   3530  C CA  . ASN B 1 51  ? 43.784 33.456  69.925  1.00 75.01  ? 48  ASN C CA  1 
ATOM   3531  C C   . ASN B 1 51  ? 44.911 32.936  69.039  1.00 78.52  ? 48  ASN C C   1 
ATOM   3532  O O   . ASN B 1 51  ? 45.887 32.386  69.560  1.00 81.46  ? 48  ASN C O   1 
ATOM   3533  C CB  . ASN B 1 51  ? 42.893 32.299  70.381  1.00 74.51  ? 48  ASN C CB  1 
ATOM   3534  C CG  . ASN B 1 51  ? 43.589 31.373  71.354  1.00 74.96  ? 48  ASN C CG  1 
ATOM   3535  O OD1 . ASN B 1 51  ? 44.197 30.380  70.956  1.00 76.21  ? 48  ASN C OD1 1 
ATOM   3536  N ND2 . ASN B 1 51  ? 43.503 31.691  72.641  1.00 76.68  ? 48  ASN C ND2 1 
ATOM   3537  N N   . ARG B 1 52  ? 44.799 33.084  67.717  1.00 76.31  ? 49  ARG C N   1 
ATOM   3538  C CA  . ARG B 1 52  ? 45.911 32.732  66.839  1.00 76.22  ? 49  ARG C CA  1 
ATOM   3539  C C   . ARG B 1 52  ? 47.000 33.791  66.900  1.00 79.50  ? 49  ARG C C   1 
ATOM   3540  O O   . ARG B 1 52  ? 48.194 33.470  66.907  1.00 75.04  ? 49  ARG C O   1 
ATOM   3541  C CB  . ARG B 1 52  ? 45.415 32.563  65.404  1.00 75.12  ? 49  ARG C CB  1 
ATOM   3542  C CG  . ARG B 1 52  ? 44.465 31.397  65.205  1.00 78.27  ? 49  ARG C CG  1 
ATOM   3543  C CD  . ARG B 1 52  ? 44.057 31.276  63.746  1.00 73.12  ? 49  ARG C CD  1 
ATOM   3544  N NE  . ARG B 1 52  ? 42.713 31.795  63.504  1.00 73.13  ? 49  ARG C NE  1 
ATOM   3545  C CZ  . ARG B 1 52  ? 42.276 32.214  62.320  1.00 71.97  ? 49  ARG C CZ  1 
ATOM   3546  N NH1 . ARG B 1 52  ? 43.077 32.179  61.264  1.00 70.39  ? 49  ARG C NH1 1 
ATOM   3547  N NH2 . ARG B 1 52  ? 41.037 32.668  62.192  1.00 71.37  ? 49  ARG C NH2 1 
ATOM   3548  N N   . ASP B 1 53  ? 46.591 35.057  66.945  1.00 80.51  ? 50  ASP C N   1 
ATOM   3549  C CA  . ASP B 1 53  ? 47.539 36.145  67.132  1.00 83.04  ? 50  ASP C CA  1 
ATOM   3550  C C   . ASP B 1 53  ? 48.188 36.072  68.508  1.00 84.03  ? 50  ASP C C   1 
ATOM   3551  O O   . ASP B 1 53  ? 49.419 36.096  68.631  1.00 85.31  ? 50  ASP C O   1 
ATOM   3552  C CB  . ASP B 1 53  ? 46.819 37.476  66.953  1.00 85.08  ? 50  ASP C CB  1 
ATOM   3553  C CG  . ASP B 1 53  ? 47.740 38.569  66.504  1.00 86.45  ? 50  ASP C CG  1 
ATOM   3554  O OD1 . ASP B 1 53  ? 48.615 38.278  65.664  1.00 81.24  ? 50  ASP C OD1 1 
ATOM   3555  O OD2 . ASP B 1 53  ? 47.585 39.712  66.983  1.00 77.42  ? 50  ASP C OD2 1 
ATOM   3556  N N   . ALA B 1 54  ? 47.366 35.973  69.556  1.00 81.03  ? 51  ALA C N   1 
ATOM   3557  C CA  . ALA B 1 54  ? 47.858 36.037  70.928  1.00 84.99  ? 51  ALA C CA  1 
ATOM   3558  C C   . ALA B 1 54  ? 48.723 34.837  71.295  1.00 84.07  ? 51  ALA C C   1 
ATOM   3559  O O   . ALA B 1 54  ? 49.498 34.916  72.255  1.00 83.15  ? 51  ALA C O   1 
ATOM   3560  C CB  . ALA B 1 54  ? 46.683 36.151  71.899  1.00 75.56  ? 51  ALA C CB  1 
ATOM   3561  N N   . THR B 1 55  ? 48.607 33.728  70.565  1.00 80.34  ? 52  THR C N   1 
ATOM   3562  C CA  . THR B 1 55  ? 49.503 32.592  70.734  1.00 76.45  ? 52  THR C CA  1 
ATOM   3563  C C   . THR B 1 55  ? 50.479 32.451  69.575  1.00 74.31  ? 52  THR C C   1 
ATOM   3564  O O   . THR B 1 55  ? 51.128 31.408  69.449  1.00 73.69  ? 52  THR C O   1 
ATOM   3565  C CB  . THR B 1 55  ? 48.706 31.297  70.909  1.00 81.23  ? 52  THR C CB  1 
ATOM   3566  O OG1 . THR B 1 55  ? 48.085 30.942  69.668  1.00 79.49  ? 52  THR C OG1 1 
ATOM   3567  C CG2 . THR B 1 55  ? 47.637 31.464  71.982  1.00 75.82  ? 52  THR C CG2 1 
ATOM   3568  N N   . ASN B 1 56  ? 50.593 33.475  68.726  1.00 75.75  ? 53  ASN C N   1 
ATOM   3569  C CA  . ASN B 1 56  ? 51.480 33.450  67.562  1.00 85.92  ? 53  ASN C CA  1 
ATOM   3570  C C   . ASN B 1 56  ? 51.204 32.233  66.680  1.00 82.01  ? 53  ASN C C   1 
ATOM   3571  O O   . ASN B 1 56  ? 52.119 31.617  66.128  1.00 79.06  ? 53  ASN C O   1 
ATOM   3572  C CB  . ASN B 1 56  ? 52.951 33.503  67.987  1.00 88.08  ? 53  ASN C CB  1 
ATOM   3573  C CG  . ASN B 1 56  ? 53.310 34.802  68.685  1.00 91.03  ? 53  ASN C CG  1 
ATOM   3574  O OD1 . ASN B 1 56  ? 52.952 35.888  68.225  1.00 91.01  ? 53  ASN C OD1 1 
ATOM   3575  N ND2 . ASN B 1 56  ? 54.028 34.698  69.797  1.00 91.16  ? 53  ASN C ND2 1 
ATOM   3576  N N   . ASP B 1 57  ? 49.920 31.886  66.558  1.00 76.98  ? 54  ASP C N   1 
ATOM   3577  C CA  . ASP B 1 57  ? 49.457 30.789  65.705  1.00 79.51  ? 54  ASP C CA  1 
ATOM   3578  C C   . ASP B 1 57  ? 50.042 29.444  66.132  1.00 76.81  ? 54  ASP C C   1 
ATOM   3579  O O   . ASP B 1 57  ? 50.187 28.529  65.317  1.00 70.07  ? 54  ASP C O   1 
ATOM   3580  C CB  . ASP B 1 57  ? 49.759 31.067  64.229  1.00 79.10  ? 54  ASP C CB  1 
ATOM   3581  C CG  . ASP B 1 57  ? 48.800 30.361  63.296  1.00 77.71  ? 54  ASP C CG  1 
ATOM   3582  O OD1 . ASP B 1 57  ? 47.656 30.841  63.142  1.00 82.85  ? 54  ASP C OD1 1 
ATOM   3583  O OD2 . ASP B 1 57  ? 49.190 29.328  62.710  1.00 72.61  ? 54  ASP C OD2 1 
ATOM   3584  N N   . GLN B 1 58  ? 50.384 29.316  67.416  1.00 77.90  ? 55  GLN C N   1 
ATOM   3585  C CA  . GLN B 1 58  ? 50.827 28.032  67.947  1.00 72.82  ? 55  GLN C CA  1 
ATOM   3586  C C   . GLN B 1 58  ? 49.645 27.129  68.275  1.00 70.18  ? 55  GLN C C   1 
ATOM   3587  O O   . GLN B 1 58  ? 49.744 25.903  68.139  1.00 70.14  ? 55  GLN C O   1 
ATOM   3588  C CB  . GLN B 1 58  ? 51.693 28.250  69.189  1.00 68.17  ? 55  GLN C CB  1 
ATOM   3589  C CG  . GLN B 1 58  ? 52.122 26.975  69.895  1.00 66.31  ? 55  GLN C CG  1 
ATOM   3590  C CD  . GLN B 1 58  ? 52.964 26.075  69.016  1.00 61.24  ? 55  GLN C CD  1 
ATOM   3591  O OE1 . GLN B 1 58  ? 53.881 26.536  68.337  1.00 64.34  ? 55  GLN C OE1 1 
ATOM   3592  N NE2 . GLN B 1 58  ? 52.659 24.782  69.025  1.00 67.37  ? 55  GLN C NE2 1 
ATOM   3593  N N   . VAL B 1 59  ? 48.521 27.720  68.693  1.00 70.65  ? 56  VAL C N   1 
ATOM   3594  C CA  . VAL B 1 59  ? 47.297 26.962  68.937  1.00 73.87  ? 56  VAL C CA  1 
ATOM   3595  C C   . VAL B 1 59  ? 46.888 26.186  67.693  1.00 73.07  ? 56  VAL C C   1 
ATOM   3596  O O   . VAL B 1 59  ? 46.309 25.095  67.789  1.00 69.34  ? 56  VAL C O   1 
ATOM   3597  C CB  . VAL B 1 59  ? 46.182 27.920  69.415  1.00 74.30  ? 56  VAL C CB  1 
ATOM   3598  C CG1 . VAL B 1 59  ? 45.869 28.962  68.339  1.00 70.95  ? 56  VAL C CG1 1 
ATOM   3599  C CG2 . VAL B 1 59  ? 44.937 27.157  69.838  1.00 67.42  ? 56  VAL C CG2 1 
ATOM   3600  N N   . THR B 1 60  ? 47.203 26.719  66.510  1.00 74.29  ? 57  THR C N   1 
ATOM   3601  C CA  . THR B 1 60  ? 46.883 26.035  65.262  1.00 71.01  ? 57  THR C CA  1 
ATOM   3602  C C   . THR B 1 60  ? 47.675 24.740  65.131  1.00 67.68  ? 57  THR C C   1 
ATOM   3603  O O   . THR B 1 60  ? 47.102 23.660  64.937  1.00 67.24  ? 57  THR C O   1 
ATOM   3604  C CB  . THR B 1 60  ? 47.160 26.963  64.078  1.00 68.38  ? 57  THR C CB  1 
ATOM   3605  O OG1 . THR B 1 60  ? 46.213 28.037  64.084  1.00 68.29  ? 57  THR C OG1 1 
ATOM   3606  C CG2 . THR B 1 60  ? 47.057 26.201  62.764  1.00 68.30  ? 57  THR C CG2 1 
ATOM   3607  N N   . LYS B 1 61  ? 49.003 24.831  65.235  1.00 70.22  ? 58  LYS C N   1 
ATOM   3608  C CA  . LYS B 1 61  ? 49.837 23.638  65.127  1.00 73.55  ? 58  LYS C CA  1 
ATOM   3609  C C   . LYS B 1 61  ? 49.574 22.678  66.281  1.00 68.91  ? 58  LYS C C   1 
ATOM   3610  O O   . LYS B 1 61  ? 49.647 21.455  66.110  1.00 65.04  ? 58  LYS C O   1 
ATOM   3611  C CB  . LYS B 1 61  ? 51.313 24.034  65.073  1.00 73.78  ? 58  LYS C CB  1 
ATOM   3612  C CG  . LYS B 1 61  ? 51.721 24.735  63.782  1.00 78.47  ? 58  LYS C CG  1 
ATOM   3613  C CD  . LYS B 1 61  ? 53.207 25.067  63.769  1.00 80.40  ? 58  LYS C CD  1 
ATOM   3614  C CE  . LYS B 1 61  ? 53.608 25.773  62.480  1.00 84.20  ? 58  LYS C CE  1 
ATOM   3615  N NZ  . LYS B 1 61  ? 55.046 26.169  62.468  1.00 82.68  ? 58  LYS C NZ  1 
ATOM   3616  N N   . ASP B 1 62  ? 49.260 23.215  67.463  1.00 69.09  ? 59  ASP C N   1 
ATOM   3617  C CA  . ASP B 1 62  ? 48.887 22.365  68.590  1.00 73.51  ? 59  ASP C CA  1 
ATOM   3618  C C   . ASP B 1 62  ? 47.643 21.550  68.267  1.00 71.06  ? 59  ASP C C   1 
ATOM   3619  O O   . ASP B 1 62  ? 47.596 20.339  68.513  1.00 63.04  ? 59  ASP C O   1 
ATOM   3620  C CB  . ASP B 1 62  ? 48.652 23.217  69.837  1.00 72.15  ? 59  ASP C CB  1 
ATOM   3621  C CG  . ASP B 1 62  ? 49.940 23.649  70.500  1.00 70.09  ? 59  ASP C CG  1 
ATOM   3622  O OD1 . ASP B 1 62  ? 50.948 22.919  70.385  1.00 66.49  ? 59  ASP C OD1 1 
ATOM   3623  O OD2 . ASP B 1 62  ? 49.941 24.723  71.136  1.00 71.53  ? 59  ASP C OD2 1 
ATOM   3624  N N   . ALA B 1 63  ? 46.620 22.205  67.710  1.00 65.84  ? 60  ALA C N   1 
ATOM   3625  C CA  . ALA B 1 63  ? 45.379 21.511  67.389  1.00 69.08  ? 60  ALA C CA  1 
ATOM   3626  C C   . ALA B 1 63  ? 45.607 20.382  66.393  1.00 59.60  ? 60  ALA C C   1 
ATOM   3627  O O   . ALA B 1 63  ? 44.883 19.381  66.415  1.00 61.86  ? 60  ALA C O   1 
ATOM   3628  C CB  . ALA B 1 63  ? 44.350 22.499  66.839  1.00 64.37  ? 60  ALA C CB  1 
ATOM   3629  N N   . ALA B 1 64  ? 46.610 20.515  65.525  1.00 61.60  ? 61  ALA C N   1 
ATOM   3630  C CA  . ALA B 1 64  ? 46.834 19.498  64.502  1.00 66.63  ? 61  ALA C CA  1 
ATOM   3631  C C   . ALA B 1 64  ? 47.386 18.214  65.110  1.00 67.82  ? 61  ALA C C   1 
ATOM   3632  O O   . ALA B 1 64  ? 46.952 17.113  64.754  1.00 65.25  ? 61  ALA C O   1 
ATOM   3633  C CB  . ALA B 1 64  ? 47.776 20.035  63.426  1.00 68.09  ? 61  ALA C CB  1 
ATOM   3634  N N   . GLU B 1 65  ? 48.346 18.334  66.032  1.00 67.54  ? 62  GLU C N   1 
ATOM   3635  C CA  . GLU B 1 65  ? 48.940 17.142  66.629  1.00 68.71  ? 62  GLU C CA  1 
ATOM   3636  C C   . GLU B 1 65  ? 47.928 16.389  67.482  1.00 63.71  ? 62  GLU C C   1 
ATOM   3637  O O   . GLU B 1 65  ? 47.959 15.154  67.543  1.00 64.78  ? 62  GLU C O   1 
ATOM   3638  C CB  . GLU B 1 65  ? 50.166 17.525  67.457  1.00 70.67  ? 62  GLU C CB  1 
ATOM   3639  C CG  . GLU B 1 65  ? 51.217 18.313  66.688  1.00 77.45  ? 62  GLU C CG  1 
ATOM   3640  C CD  . GLU B 1 65  ? 51.911 17.492  65.614  1.00 84.78  ? 62  GLU C CD  1 
ATOM   3641  O OE1 . GLU B 1 65  ? 51.808 16.247  65.645  1.00 87.67  ? 62  GLU C OE1 1 
ATOM   3642  O OE2 . GLU B 1 65  ? 52.571 18.098  64.743  1.00 76.90  ? 62  GLU C OE2 1 
ATOM   3643  N N   . ALA B 1 66  ? 47.025 17.113  68.150  1.00 59.67  ? 63  ALA C N   1 
ATOM   3644  C CA  . ALA B 1 66  ? 45.968 16.450  68.906  1.00 60.43  ? 63  ALA C CA  1 
ATOM   3645  C C   . ALA B 1 66  ? 45.097 15.598  67.993  1.00 63.30  ? 63  ALA C C   1 
ATOM   3646  O O   . ALA B 1 66  ? 44.692 14.490  68.365  1.00 57.39  ? 63  ALA C O   1 
ATOM   3647  C CB  . ALA B 1 66  ? 45.122 17.482  69.652  1.00 56.10  ? 63  ALA C CB  1 
ATOM   3648  N N   . ILE B 1 67  ? 44.810 16.096  66.787  1.00 59.31  ? 64  ILE C N   1 
ATOM   3649  C CA  . ILE B 1 67  ? 44.072 15.301  65.808  1.00 57.61  ? 64  ILE C CA  1 
ATOM   3650  C C   . ILE B 1 67  ? 44.837 14.026  65.487  1.00 60.06  ? 64  ILE C C   1 
ATOM   3651  O O   . ILE B 1 67  ? 44.280 12.923  65.501  1.00 60.18  ? 64  ILE C O   1 
ATOM   3652  C CB  . ILE B 1 67  ? 43.802 16.120  64.533  1.00 55.54  ? 64  ILE C CB  1 
ATOM   3653  C CG1 . ILE B 1 67  ? 42.965 17.357  64.842  1.00 57.28  ? 64  ILE C CG1 1 
ATOM   3654  C CG2 . ILE B 1 67  ? 43.111 15.254  63.487  1.00 52.68  ? 64  ILE C CG2 1 
ATOM   3655  C CD1 . ILE B 1 67  ? 43.002 18.382  63.735  1.00 60.80  ? 64  ILE C CD1 1 
ATOM   3656  N N   . LYS B 1 68  ? 46.134 14.160  65.194  1.00 64.54  ? 65  LYS C N   1 
ATOM   3657  C CA  . LYS B 1 68  ? 46.962 12.992  64.921  1.00 62.02  ? 65  LYS C CA  1 
ATOM   3658  C C   . LYS B 1 68  ? 47.000 12.048  66.116  1.00 63.11  ? 65  LYS C C   1 
ATOM   3659  O O   . LYS B 1 68  ? 47.127 10.831  65.944  1.00 59.40  ? 65  LYS C O   1 
ATOM   3660  C CB  . LYS B 1 68  ? 48.371 13.443  64.543  1.00 67.67  ? 65  LYS C CB  1 
ATOM   3661  C CG  . LYS B 1 68  ? 49.050 12.604  63.475  1.00 73.45  ? 65  LYS C CG  1 
ATOM   3662  C CD  . LYS B 1 68  ? 50.430 13.169  63.167  1.00 79.09  ? 65  LYS C CD  1 
ATOM   3663  C CE  . LYS B 1 68  ? 51.038 12.541  61.924  1.00 83.07  ? 65  LYS C CE  1 
ATOM   3664  N NZ  . LYS B 1 68  ? 50.514 13.144  60.667  1.00 82.76  ? 65  LYS C NZ  1 
ATOM   3665  N N   . LYS B 1 69  ? 46.876 12.588  67.331  1.00 58.12  ? 66  LYS C N   1 
ATOM   3666  C CA  . LYS B 1 69  ? 46.900 11.751  68.527  1.00 62.94  ? 66  LYS C CA  1 
ATOM   3667  C C   . LYS B 1 69  ? 45.572 11.026  68.722  1.00 64.94  ? 66  LYS C C   1 
ATOM   3668  O O   . LYS B 1 69  ? 45.543 9.823   69.011  1.00 64.23  ? 66  LYS C O   1 
ATOM   3669  C CB  . LYS B 1 69  ? 47.230 12.609  69.750  1.00 63.59  ? 66  LYS C CB  1 
ATOM   3670  C CG  . LYS B 1 69  ? 47.262 11.857  71.071  1.00 70.34  ? 66  LYS C CG  1 
ATOM   3671  C CD  . LYS B 1 69  ? 47.406 12.825  72.238  1.00 73.31  ? 66  LYS C CD  1 
ATOM   3672  C CE  . LYS B 1 69  ? 47.550 12.084  73.556  1.00 72.31  ? 66  LYS C CE  1 
ATOM   3673  N NZ  . LYS B 1 69  ? 47.642 13.008  74.720  1.00 73.10  ? 66  LYS C NZ  1 
ATOM   3674  N N   . HIS B 1 70  ? 44.458 11.742  68.557  1.00 66.66  ? 67  HIS C N   1 
ATOM   3675  C CA  . HIS B 1 70  ? 43.137 11.213  68.873  1.00 61.73  ? 67  HIS C CA  1 
ATOM   3676  C C   . HIS B 1 70  ? 42.348 10.758  67.651  1.00 61.45  ? 67  HIS C C   1 
ATOM   3677  O O   . HIS B 1 70  ? 41.323 10.086  67.819  1.00 59.27  ? 67  HIS C O   1 
ATOM   3678  C CB  . HIS B 1 70  ? 42.331 12.260  69.647  1.00 58.00  ? 67  HIS C CB  1 
ATOM   3679  C CG  . HIS B 1 70  ? 42.924 12.608  70.977  1.00 65.52  ? 67  HIS C CG  1 
ATOM   3680  N ND1 . HIS B 1 70  ? 43.068 11.684  71.989  1.00 64.06  ? 67  HIS C ND1 1 
ATOM   3681  C CD2 . HIS B 1 70  ? 43.414 13.774  71.459  1.00 67.41  ? 67  HIS C CD2 1 
ATOM   3682  C CE1 . HIS B 1 70  ? 43.618 12.267  73.039  1.00 67.18  ? 67  HIS C CE1 1 
ATOM   3683  N NE2 . HIS B 1 70  ? 43.839 13.535  72.744  1.00 68.04  ? 67  HIS C NE2 1 
ATOM   3684  N N   . ASN B 1 71  ? 42.783 11.121  66.444  1.00 58.98  ? 68  ASN C N   1 
ATOM   3685  C CA  . ASN B 1 71  ? 42.332 10.621  65.148  1.00 62.51  ? 68  ASN C CA  1 
ATOM   3686  C C   . ASN B 1 71  ? 41.008 11.227  64.673  1.00 61.92  ? 68  ASN C C   1 
ATOM   3687  O O   . ASN B 1 71  ? 40.588 10.920  63.556  1.00 62.76  ? 68  ASN C O   1 
ATOM   3688  C CB  . ASN B 1 71  ? 42.212 9.084   65.098  1.00 61.20  ? 68  ASN C CB  1 
ATOM   3689  C CG  . ASN B 1 71  ? 43.456 8.376   65.606  1.00 63.27  ? 68  ASN C CG  1 
ATOM   3690  O OD1 . ASN B 1 71  ? 44.576 8.862   65.439  1.00 70.66  ? 68  ASN C OD1 1 
ATOM   3691  N ND2 . ASN B 1 71  ? 43.264 7.216   66.217  1.00 57.35  ? 68  ASN C ND2 1 
ATOM   3692  N N   . VAL B 1 72  ? 40.333 12.064  65.461  1.00 52.52  ? 69  VAL C N   1 
ATOM   3693  C CA  . VAL B 1 72  ? 39.063 12.665  65.057  1.00 54.92  ? 69  VAL C CA  1 
ATOM   3694  C C   . VAL B 1 72  ? 39.080 14.142  65.417  1.00 54.73  ? 69  VAL C C   1 
ATOM   3695  O O   . VAL B 1 72  ? 39.254 14.495  66.589  1.00 51.37  ? 69  VAL C O   1 
ATOM   3696  C CB  . VAL B 1 72  ? 37.853 11.975  65.709  1.00 52.94  ? 69  VAL C CB  1 
ATOM   3697  C CG1 . VAL B 1 72  ? 36.564 12.669  65.282  1.00 47.62  ? 69  VAL C CG1 1 
ATOM   3698  C CG2 . VAL B 1 72  ? 37.803 10.497  65.343  1.00 53.43  ? 69  VAL C CG2 1 
ATOM   3699  N N   . GLY B 1 73  ? 38.885 14.993  64.423  1.00 46.36  ? 70  GLY C N   1 
ATOM   3700  C CA  . GLY B 1 73  ? 38.764 16.423  64.655  1.00 49.34  ? 70  GLY C CA  1 
ATOM   3701  C C   . GLY B 1 73  ? 37.609 17.018  63.882  1.00 48.53  ? 70  GLY C C   1 
ATOM   3702  O O   . GLY B 1 73  ? 37.296 16.581  62.775  1.00 44.92  ? 70  GLY C O   1 
ATOM   3703  N N   . VAL B 1 74  ? 36.968 18.018  64.487  1.00 48.34  ? 71  VAL C N   1 
ATOM   3704  C CA  . VAL B 1 74  ? 35.902 18.794  63.862  1.00 47.91  ? 71  VAL C CA  1 
ATOM   3705  C C   . VAL B 1 74  ? 36.263 20.269  63.989  1.00 46.11  ? 71  VAL C C   1 
ATOM   3706  O O   . VAL B 1 74  ? 36.630 20.732  65.076  1.00 48.17  ? 71  VAL C O   1 
ATOM   3707  C CB  . VAL B 1 74  ? 34.525 18.490  64.489  1.00 45.02  ? 71  VAL C CB  1 
ATOM   3708  C CG1 . VAL B 1 74  ? 34.157 17.029  64.275  1.00 39.11  ? 71  VAL C CG1 1 
ATOM   3709  C CG2 . VAL B 1 74  ? 34.511 18.817  65.976  1.00 45.83  ? 71  VAL C CG2 1 
ATOM   3710  N N   . LYS B 1 75  ? 36.177 21.001  62.880  1.00 49.49  ? 72  LYS C N   1 
ATOM   3711  C CA  . LYS B 1 75  ? 36.709 22.356  62.803  1.00 49.67  ? 72  LYS C CA  1 
ATOM   3712  C C   . LYS B 1 75  ? 35.651 23.337  62.320  1.00 53.47  ? 72  LYS C C   1 
ATOM   3713  O O   . LYS B 1 75  ? 34.979 23.094  61.311  1.00 50.36  ? 72  LYS C O   1 
ATOM   3714  C CB  . LYS B 1 75  ? 37.926 22.423  61.877  1.00 54.19  ? 72  LYS C CB  1 
ATOM   3715  C CG  . LYS B 1 75  ? 38.461 23.837  61.699  1.00 48.17  ? 72  LYS C CG  1 
ATOM   3716  C CD  . LYS B 1 75  ? 39.593 23.911  60.693  1.00 54.11  ? 72  LYS C CD  1 
ATOM   3717  C CE  . LYS B 1 75  ? 39.963 25.357  60.389  1.00 56.07  ? 72  LYS C CE  1 
ATOM   3718  N NZ  . LYS B 1 75  ? 38.873 26.084  59.680  1.00 59.97  ? 72  LYS C NZ  1 
ATOM   3719  N N   . CYS B 1 76  ? 35.523 24.444  63.045  1.00 45.52  ? 73  CYS C N   1 
ATOM   3720  C CA  . CYS B 1 76  ? 34.741 25.591  62.616  1.00 46.14  ? 73  CYS C CA  1 
ATOM   3721  C C   . CYS B 1 76  ? 35.536 26.416  61.609  1.00 55.41  ? 73  CYS C C   1 
ATOM   3722  O O   . CYS B 1 76  ? 36.769 26.426  61.624  1.00 53.94  ? 73  CYS C O   1 
ATOM   3723  C CB  . CYS B 1 76  ? 34.372 26.450  63.827  1.00 47.03  ? 73  CYS C CB  1 
ATOM   3724  S SG  . CYS B 1 76  ? 33.234 27.808  63.520  1.00 56.60  ? 73  CYS C SG  1 
ATOM   3725  N N   . ALA B 1 77  ? 34.816 27.115  60.733  1.00 53.05  ? 74  ALA C N   1 
ATOM   3726  C CA  . ALA B 1 77  ? 35.462 27.904  59.691  1.00 58.57  ? 74  ALA C CA  1 
ATOM   3727  C C   . ALA B 1 77  ? 36.326 29.003  60.301  1.00 58.26  ? 74  ALA C C   1 
ATOM   3728  O O   . ALA B 1 77  ? 35.948 29.643  61.287  1.00 53.47  ? 74  ALA C O   1 
ATOM   3729  C CB  . ALA B 1 77  ? 34.413 28.508  58.759  1.00 53.14  ? 74  ALA C CB  1 
ATOM   3730  N N   . THR B 1 78  ? 37.499 29.221  59.709  1.00 62.19  ? 75  THR C N   1 
ATOM   3731  C CA  . THR B 1 78  ? 38.488 30.151  60.238  1.00 63.83  ? 75  THR C CA  1 
ATOM   3732  C C   . THR B 1 78  ? 38.813 31.226  59.213  1.00 66.62  ? 75  THR C C   1 
ATOM   3733  O O   . THR B 1 78  ? 38.868 30.957  58.009  1.00 63.84  ? 75  THR C O   1 
ATOM   3734  C CB  . THR B 1 78  ? 39.781 29.432  60.637  1.00 60.00  ? 75  THR C CB  1 
ATOM   3735  O OG1 . THR B 1 78  ? 40.177 28.537  59.590  1.00 63.04  ? 75  THR C OG1 1 
ATOM   3736  C CG2 . THR B 1 78  ? 39.588 28.654  61.931  1.00 62.40  ? 75  THR C CG2 1 
ATOM   3737  N N   . ILE B 1 79  ? 39.046 32.443  59.710  1.00 67.23  ? 76  ILE C N   1 
ATOM   3738  C CA  . ILE B 1 79  ? 39.460 33.542  58.849  1.00 72.62  ? 76  ILE C CA  1 
ATOM   3739  C C   . ILE B 1 79  ? 40.848 33.265  58.290  1.00 74.67  ? 76  ILE C C   1 
ATOM   3740  O O   . ILE B 1 79  ? 41.769 32.887  59.024  1.00 67.59  ? 76  ILE C O   1 
ATOM   3741  C CB  . ILE B 1 79  ? 39.444 34.863  59.633  1.00 73.41  ? 76  ILE C CB  1 
ATOM   3742  C CG1 . ILE B 1 79  ? 38.016 35.315  59.923  1.00 71.12  ? 76  ILE C CG1 1 
ATOM   3743  C CG2 . ILE B 1 79  ? 40.209 35.942  58.884  1.00 74.49  ? 76  ILE C CG2 1 
ATOM   3744  C CD1 . ILE B 1 79  ? 37.959 36.526  60.829  1.00 68.09  ? 76  ILE C CD1 1 
ATOM   3745  N N   . THR B 1 80  ? 41.005 33.454  56.982  1.00 79.30  ? 77  THR C N   1 
ATOM   3746  C CA  . THR B 1 80  ? 42.347 33.429  56.410  1.00 84.58  ? 77  THR C CA  1 
ATOM   3747  C C   . THR B 1 80  ? 42.911 34.841  56.382  1.00 84.59  ? 77  THR C C   1 
ATOM   3748  O O   . THR B 1 80  ? 42.252 35.752  55.867  1.00 80.11  ? 77  THR C O   1 
ATOM   3749  C CB  . THR B 1 80  ? 42.340 32.854  55.000  1.00 86.63  ? 77  THR C CB  1 
ATOM   3750  O OG1 . THR B 1 80  ? 41.968 31.471  55.051  1.00 88.32  ? 77  THR C OG1 1 
ATOM   3751  C CG2 . THR B 1 80  ? 43.717 32.984  54.367  1.00 79.91  ? 77  THR C CG2 1 
ATOM   3752  N N   . PRO B 1 81  ? 44.110 35.066  56.921  1.00 85.64  ? 78  PRO C N   1 
ATOM   3753  C CA  . PRO B 1 81  ? 44.642 36.434  56.997  1.00 92.65  ? 78  PRO C CA  1 
ATOM   3754  C C   . PRO B 1 81  ? 45.083 36.932  55.629  1.00 93.07  ? 78  PRO C C   1 
ATOM   3755  O O   . PRO B 1 81  ? 45.935 36.325  54.977  1.00 92.02  ? 78  PRO C O   1 
ATOM   3756  C CB  . PRO B 1 81  ? 45.831 36.303  57.958  1.00 91.45  ? 78  PRO C CB  1 
ATOM   3757  C CG  . PRO B 1 81  ? 45.672 34.961  58.618  1.00 87.93  ? 78  PRO C CG  1 
ATOM   3758  C CD  . PRO B 1 81  ? 44.988 34.102  57.602  1.00 84.75  ? 78  PRO C CD  1 
ATOM   3759  N N   . ASP B 1 82  ? 44.487 38.031  55.193  1.00 92.61  ? 79  ASP C N   1 
ATOM   3760  C CA  . ASP B 1 82  ? 44.994 38.797  54.068  1.00 92.40  ? 79  ASP C CA  1 
ATOM   3761  C C   . ASP B 1 82  ? 45.441 40.162  54.582  1.00 94.71  ? 79  ASP C C   1 
ATOM   3762  O O   . ASP B 1 82  ? 45.366 40.453  55.780  1.00 91.46  ? 79  ASP C O   1 
ATOM   3763  C CB  . ASP B 1 82  ? 43.945 38.885  52.950  1.00 88.06  ? 79  ASP C CB  1 
ATOM   3764  C CG  . ASP B 1 82  ? 42.745 39.748  53.313  1.00 90.35  ? 79  ASP C CG  1 
ATOM   3765  O OD1 . ASP B 1 82  ? 42.582 40.115  54.492  1.00 92.27  ? 79  ASP C OD1 1 
ATOM   3766  O OD2 . ASP B 1 82  ? 41.928 40.024  52.410  1.00 86.74  ? 79  ASP C OD2 1 
ATOM   3767  N N   . GLU B 1 83  ? 45.923 41.001  53.664  1.00 97.73  ? 80  GLU C N   1 
ATOM   3768  C CA  . GLU B 1 83  ? 46.443 42.306  54.064  1.00 97.40  ? 80  GLU C CA  1 
ATOM   3769  C C   . GLU B 1 83  ? 45.363 43.171  54.699  1.00 92.15  ? 80  GLU C C   1 
ATOM   3770  O O   . GLU B 1 83  ? 45.673 44.083  55.476  1.00 94.03  ? 80  GLU C O   1 
ATOM   3771  C CB  . GLU B 1 83  ? 47.052 43.020  52.858  1.00 95.78  ? 80  GLU C CB  1 
ATOM   3772  C CG  . GLU B 1 83  ? 48.065 42.187  52.088  1.00 93.60  ? 80  GLU C CG  1 
ATOM   3773  C CD  . GLU B 1 83  ? 47.421 41.289  51.050  1.00 102.38 ? 80  GLU C CD  1 
ATOM   3774  O OE1 . GLU B 1 83  ? 47.270 41.734  49.893  1.00 101.32 ? 80  GLU C OE1 1 
ATOM   3775  O OE2 . GLU B 1 83  ? 47.068 40.140  51.391  1.00 96.76  ? 80  GLU C OE2 1 
ATOM   3776  N N   . LYS B 1 84  ? 44.094 42.894  54.394  1.00 88.99  ? 81  LYS C N   1 
ATOM   3777  C CA  . LYS B 1 84  ? 43.004 43.724  54.898  1.00 88.58  ? 81  LYS C CA  1 
ATOM   3778  C C   . LYS B 1 84  ? 42.570 43.291  56.294  1.00 91.69  ? 81  LYS C C   1 
ATOM   3779  O O   . LYS B 1 84  ? 41.955 44.080  57.022  1.00 91.68  ? 81  LYS C O   1 
ATOM   3780  C CB  . LYS B 1 84  ? 41.819 43.685  53.923  1.00 88.87  ? 81  LYS C CB  1 
ATOM   3781  C CG  . LYS B 1 84  ? 41.955 44.596  52.683  1.00 97.70  ? 81  LYS C CG  1 
ATOM   3782  C CD  . LYS B 1 84  ? 43.105 44.181  51.763  1.00 97.90  ? 81  LYS C CD  1 
ATOM   3783  C CE  . LYS B 1 84  ? 42.990 42.722  51.341  1.00 95.85  ? 81  LYS C CE  1 
ATOM   3784  N NZ  . LYS B 1 84  ? 44.281 42.110  50.903  1.00 90.10  ? 81  LYS C NZ  1 
ATOM   3785  N N   . ARG B 1 85  ? 42.888 42.054  56.685  1.00 91.23  ? 82  ARG C N   1 
ATOM   3786  C CA  . ARG B 1 85  ? 42.536 41.571  58.018  1.00 95.32  ? 82  ARG C CA  1 
ATOM   3787  C C   . ARG B 1 85  ? 43.446 42.166  59.085  1.00 96.47  ? 82  ARG C C   1 
ATOM   3788  O O   . ARG B 1 85  ? 42.969 42.585  60.147  1.00 94.13  ? 82  ARG C O   1 
ATOM   3789  C CB  . ARG B 1 85  ? 42.606 40.044  58.066  1.00 90.93  ? 82  ARG C CB  1 
ATOM   3790  C CG  . ARG B 1 85  ? 41.528 39.335  57.264  1.00 85.02  ? 82  ARG C CG  1 
ATOM   3791  C CD  . ARG B 1 85  ? 40.133 39.643  57.780  1.00 88.64  ? 82  ARG C CD  1 
ATOM   3792  N NE  . ARG B 1 85  ? 39.163 38.663  57.298  1.00 81.85  ? 82  ARG C NE  1 
ATOM   3793  C CZ  . ARG B 1 85  ? 37.893 38.611  57.684  1.00 78.73  ? 82  ARG C CZ  1 
ATOM   3794  N NH1 . ARG B 1 85  ? 37.425 39.491  58.559  1.00 74.86  ? 82  ARG C NH1 1 
ATOM   3795  N NH2 . ARG B 1 85  ? 37.086 37.681  57.191  1.00 77.70  ? 82  ARG C NH2 1 
ATOM   3796  N N   . VAL B 1 86  ? 44.755 42.207  58.820  1.00 99.69  ? 83  VAL C N   1 
ATOM   3797  C CA  . VAL B 1 86  ? 45.693 42.772  59.785  1.00 99.31  ? 83  VAL C CA  1 
ATOM   3798  C C   . VAL B 1 86  ? 45.309 44.201  60.135  1.00 96.12  ? 83  VAL C C   1 
ATOM   3799  O O   . VAL B 1 86  ? 45.565 44.662  61.249  1.00 93.54  ? 83  VAL C O   1 
ATOM   3800  C CB  . VAL B 1 86  ? 47.139 42.689  59.254  1.00 94.95  ? 83  VAL C CB  1 
ATOM   3801  C CG1 . VAL B 1 86  ? 48.116 43.279  60.265  1.00 92.60  ? 83  VAL C CG1 1 
ATOM   3802  C CG2 . VAL B 1 86  ? 47.502 41.246  58.948  1.00 90.54  ? 83  VAL C CG2 1 
ATOM   3803  N N   . GLU B 1 87  ? 44.673 44.924  59.213  1.00 95.22  ? 84  GLU C N   1 
ATOM   3804  C CA  . GLU B 1 87  ? 44.212 46.260  59.572  1.00 96.44  ? 84  GLU C CA  1 
ATOM   3805  C C   . GLU B 1 87  ? 42.974 46.195  60.457  1.00 97.38  ? 84  GLU C C   1 
ATOM   3806  O O   . GLU B 1 87  ? 42.816 47.009  61.376  1.00 95.05  ? 84  GLU C O   1 
ATOM   3807  C CB  . GLU B 1 87  ? 43.935 47.099  58.325  1.00 93.26  ? 84  GLU C CB  1 
ATOM   3808  C CG  . GLU B 1 87  ? 43.568 48.557  58.648  1.00 97.13  ? 84  GLU C CG  1 
ATOM   3809  C CD  . GLU B 1 87  ? 44.682 49.369  59.337  1.00 103.20 ? 84  GLU C CD  1 
ATOM   3810  O OE1 . GLU B 1 87  ? 45.597 48.809  59.983  1.00 101.28 ? 84  GLU C OE1 1 
ATOM   3811  O OE2 . GLU B 1 87  ? 44.608 50.610  59.255  1.00 105.75 ? 84  GLU C OE2 1 
ATOM   3812  N N   . GLU B 1 88  ? 42.094 45.223  60.204  1.00 100.22 ? 85  GLU C N   1 
ATOM   3813  C CA  . GLU B 1 88  ? 40.892 45.094  61.020  1.00 94.70  ? 85  GLU C CA  1 
ATOM   3814  C C   . GLU B 1 88  ? 41.223 44.601  62.424  1.00 90.78  ? 85  GLU C C   1 
ATOM   3815  O O   . GLU B 1 88  ? 40.672 45.100  63.415  1.00 89.71  ? 85  GLU C O   1 
ATOM   3816  C CB  . GLU B 1 88  ? 39.903 44.150  60.344  1.00 95.07  ? 85  GLU C CB  1 
ATOM   3817  C CG  . GLU B 1 88  ? 38.729 43.760  61.220  1.00 91.22  ? 85  GLU C CG  1 
ATOM   3818  C CD  . GLU B 1 88  ? 37.964 42.569  60.681  1.00 84.42  ? 85  GLU C CD  1 
ATOM   3819  O OE1 . GLU B 1 88  ? 38.471 41.900  59.755  1.00 83.98  ? 85  GLU C OE1 1 
ATOM   3820  O OE2 . GLU B 1 88  ? 36.856 42.301  61.190  1.00 67.51  ? 85  GLU C OE2 1 
ATOM   3821  N N   . PHE B 1 89  ? 42.129 43.633  62.529  1.00 93.26  ? 86  PHE C N   1 
ATOM   3822  C CA  . PHE B 1 89  ? 42.441 42.988  63.793  1.00 94.63  ? 86  PHE C CA  1 
ATOM   3823  C C   . PHE B 1 89  ? 43.762 43.467  64.392  1.00 95.57  ? 86  PHE C C   1 
ATOM   3824  O O   . PHE B 1 89  ? 44.205 42.906  65.396  1.00 89.77  ? 86  PHE C O   1 
ATOM   3825  C CB  . PHE B 1 89  ? 42.450 41.463  63.603  1.00 91.04  ? 86  PHE C CB  1 
ATOM   3826  C CG  . PHE B 1 89  ? 41.079 40.870  63.389  1.00 88.31  ? 86  PHE C CG  1 
ATOM   3827  C CD1 . PHE B 1 89  ? 40.118 40.945  64.382  1.00 86.08  ? 86  PHE C CD1 1 
ATOM   3828  C CD2 . PHE B 1 89  ? 40.749 40.246  62.192  1.00 88.95  ? 86  PHE C CD2 1 
ATOM   3829  C CE1 . PHE B 1 89  ? 38.852 40.404  64.196  1.00 79.76  ? 86  PHE C CE1 1 
ATOM   3830  C CE2 . PHE B 1 89  ? 39.481 39.701  61.998  1.00 85.26  ? 86  PHE C CE2 1 
ATOM   3831  C CZ  . PHE B 1 89  ? 38.534 39.782  63.003  1.00 83.77  ? 86  PHE C CZ  1 
ATOM   3832  N N   . LYS B 1 90  ? 44.365 44.519  63.826  1.00 95.70  ? 87  LYS C N   1 
ATOM   3833  C CA  . LYS B 1 90  ? 45.737 44.952  64.141  1.00 96.83  ? 87  LYS C CA  1 
ATOM   3834  C C   . LYS B 1 90  ? 46.640 43.762  64.475  1.00 94.71  ? 87  LYS C C   1 
ATOM   3835  O O   . LYS B 1 90  ? 47.230 43.673  65.555  1.00 93.98  ? 87  LYS C O   1 
ATOM   3836  C CB  . LYS B 1 90  ? 45.752 45.992  65.265  1.00 91.83  ? 87  LYS C CB  1 
ATOM   3837  C CG  . LYS B 1 90  ? 45.126 47.334  64.867  1.00 91.15  ? 87  LYS C CG  1 
ATOM   3838  C CD  . LYS B 1 90  ? 45.677 47.824  63.519  1.00 93.10  ? 87  LYS C CD  1 
ATOM   3839  C CE  . LYS B 1 90  ? 44.891 49.005  62.952  1.00 97.64  ? 87  LYS C CE  1 
ATOM   3840  N NZ  . LYS B 1 90  ? 45.212 50.285  63.613  1.00 94.75  ? 87  LYS C NZ  1 
ATOM   3841  N N   . LEU B 1 91  ? 46.732 42.831  63.532  1.00 90.64  ? 88  LEU C N   1 
ATOM   3842  C CA  . LEU B 1 91  ? 47.462 41.584  63.695  1.00 92.73  ? 88  LEU C CA  1 
ATOM   3843  C C   . LEU B 1 91  ? 48.971 41.826  63.661  1.00 93.37  ? 88  LEU C C   1 
ATOM   3844  O O   . LEU B 1 91  ? 49.449 42.914  63.330  1.00 93.67  ? 88  LEU C O   1 
ATOM   3845  C CB  . LEU B 1 91  ? 47.067 40.600  62.594  1.00 93.88  ? 88  LEU C CB  1 
ATOM   3846  C CG  . LEU B 1 91  ? 45.728 39.899  62.790  1.00 92.00  ? 88  LEU C CG  1 
ATOM   3847  C CD1 . LEU B 1 91  ? 45.060 39.631  61.455  1.00 91.82  ? 88  LEU C CD1 1 
ATOM   3848  C CD2 . LEU B 1 91  ? 45.934 38.605  63.553  1.00 88.47  ? 88  LEU C CD2 1 
ATOM   3849  N N   . LYS B 1 92  ? 49.732 40.780  63.987  1.00 92.32  ? 89  LYS C N   1 
ATOM   3850  C CA  . LYS B 1 92  ? 51.187 40.850  63.996  1.00 91.87  ? 89  LYS C CA  1 
ATOM   3851  C C   . LYS B 1 92  ? 51.828 40.098  62.838  1.00 91.93  ? 89  LYS C C   1 
ATOM   3852  O O   . LYS B 1 92  ? 53.056 40.126  62.708  1.00 91.29  ? 89  LYS C O   1 
ATOM   3853  C CB  . LYS B 1 92  ? 51.736 40.311  65.323  1.00 89.22  ? 89  LYS C CB  1 
ATOM   3854  C CG  . LYS B 1 92  ? 50.724 40.330  66.457  1.00 84.24  ? 89  LYS C CG  1 
ATOM   3855  C CD  . LYS B 1 92  ? 50.707 41.633  67.228  1.00 83.64  ? 89  LYS C CD  1 
ATOM   3856  C CE  . LYS B 1 92  ? 49.791 41.520  68.440  1.00 84.07  ? 89  LYS C CE  1 
ATOM   3857  N NZ  . LYS B 1 92  ? 50.442 40.803  69.570  1.00 78.47  ? 89  LYS C NZ  1 
ATOM   3858  N N   . GLN B 1 93  ? 51.037 39.439  61.994  1.00 91.16  ? 90  GLN C N   1 
ATOM   3859  C CA  . GLN B 1 93  ? 51.538 38.682  60.854  1.00 94.10  ? 90  GLN C CA  1 
ATOM   3860  C C   . GLN B 1 93  ? 50.359 38.285  59.983  1.00 95.55  ? 90  GLN C C   1 
ATOM   3861  O O   . GLN B 1 93  ? 49.262 38.027  60.487  1.00 93.55  ? 90  GLN C O   1 
ATOM   3862  C CB  . GLN B 1 93  ? 52.304 37.426  61.298  1.00 90.47  ? 90  GLN C CB  1 
ATOM   3863  C CG  . GLN B 1 93  ? 53.810 37.497  61.104  1.00 90.92  ? 90  GLN C CG  1 
ATOM   3864  C CD  . GLN B 1 93  ? 54.461 36.127  61.118  1.00 92.97  ? 90  GLN C CD  1 
ATOM   3865  O OE1 . GLN B 1 93  ? 53.951 35.178  60.521  1.00 95.49  ? 90  GLN C OE1 1 
ATOM   3866  N NE2 . GLN B 1 93  ? 55.591 36.016  61.806  1.00 88.91  ? 90  GLN C NE2 1 
ATOM   3867  N N   . MET B 1 94  ? 50.594 38.246  58.673  1.00 93.86  ? 91  MET C N   1 
ATOM   3868  C CA  . MET B 1 94  ? 49.650 37.628  57.748  1.00 93.63  ? 91  MET C CA  1 
ATOM   3869  C C   . MET B 1 94  ? 49.883 36.124  57.828  1.00 90.76  ? 91  MET C C   1 
ATOM   3870  O O   . MET B 1 94  ? 50.503 35.508  56.957  1.00 88.03  ? 91  MET C O   1 
ATOM   3871  C CB  . MET B 1 94  ? 49.834 38.155  56.331  1.00 93.68  ? 91  MET C CB  1 
ATOM   3872  C CG  . MET B 1 94  ? 48.697 37.784  55.388  1.00 91.31  ? 91  MET C CG  1 
ATOM   3873  S SD  . MET B 1 94  ? 49.092 38.048  53.647  1.00 107.21 ? 91  MET C SD  1 
ATOM   3874  C CE  . MET B 1 94  ? 50.529 36.995  53.458  1.00 93.77  ? 91  MET C CE  1 
ATOM   3875  N N   . TRP B 1 95  ? 49.394 35.536  58.919  1.00 89.71  ? 92  TRP C N   1 
ATOM   3876  C CA  . TRP B 1 95  ? 49.597 34.120  59.174  1.00 88.20  ? 92  TRP C CA  1 
ATOM   3877  C C   . TRP B 1 95  ? 49.071 33.283  58.013  1.00 86.28  ? 92  TRP C C   1 
ATOM   3878  O O   . TRP B 1 95  ? 48.244 33.727  57.210  1.00 86.87  ? 92  TRP C O   1 
ATOM   3879  C CB  . TRP B 1 95  ? 48.892 33.687  60.462  1.00 81.65  ? 92  TRP C CB  1 
ATOM   3880  C CG  . TRP B 1 95  ? 49.012 34.646  61.608  1.00 85.52  ? 92  TRP C CG  1 
ATOM   3881  C CD1 . TRP B 1 95  ? 48.113 35.609  61.969  1.00 86.66  ? 92  TRP C CD1 1 
ATOM   3882  C CD2 . TRP B 1 95  ? 50.078 34.715  62.563  1.00 87.92  ? 92  TRP C CD2 1 
ATOM   3883  N NE1 . TRP B 1 95  ? 48.561 36.282  63.081  1.00 89.05  ? 92  TRP C NE1 1 
ATOM   3884  C CE2 . TRP B 1 95  ? 49.765 35.752  63.465  1.00 86.87  ? 92  TRP C CE2 1 
ATOM   3885  C CE3 . TRP B 1 95  ? 51.271 34.006  62.738  1.00 83.80  ? 92  TRP C CE3 1 
ATOM   3886  C CZ2 . TRP B 1 95  ? 50.600 36.096  64.526  1.00 86.13  ? 92  TRP C CZ2 1 
ATOM   3887  C CZ3 . TRP B 1 95  ? 52.099 34.350  63.793  1.00 83.07  ? 92  TRP C CZ3 1 
ATOM   3888  C CH2 . TRP B 1 95  ? 51.760 35.386  64.672  1.00 85.04  ? 92  TRP C CH2 1 
ATOM   3889  N N   . LYS B 1 96  ? 49.578 32.057  57.922  1.00 83.32  ? 93  LYS C N   1 
ATOM   3890  C CA  . LYS B 1 96  ? 48.992 31.092  57.010  1.00 81.20  ? 93  LYS C CA  1 
ATOM   3891  C C   . LYS B 1 96  ? 47.545 30.827  57.405  1.00 82.24  ? 93  LYS C C   1 
ATOM   3892  O O   . LYS B 1 96  ? 47.138 31.029  58.552  1.00 75.43  ? 93  LYS C O   1 
ATOM   3893  C CB  . LYS B 1 96  ? 49.776 29.781  57.025  1.00 79.05  ? 93  LYS C CB  1 
ATOM   3894  C CG  . LYS B 1 96  ? 51.078 29.806  56.258  1.00 82.27  ? 93  LYS C CG  1 
ATOM   3895  C CD  . LYS B 1 96  ? 51.649 28.401  56.140  1.00 89.49  ? 93  LYS C CD  1 
ATOM   3896  C CE  . LYS B 1 96  ? 52.763 28.333  55.109  1.00 88.57  ? 93  LYS C CE  1 
ATOM   3897  N NZ  . LYS B 1 96  ? 53.174 26.928  54.830  1.00 74.88  ? 93  LYS C NZ  1 
ATOM   3898  N N   . SER B 1 97  ? 46.759 30.386  56.437  1.00 80.67  ? 94  SER C N   1 
ATOM   3899  C CA  . SER B 1 97  ? 45.431 29.896  56.763  1.00 75.78  ? 94  SER C CA  1 
ATOM   3900  C C   . SER B 1 97  ? 45.584 28.631  57.597  1.00 71.41  ? 94  SER C C   1 
ATOM   3901  O O   . SER B 1 97  ? 46.388 27.760  57.243  1.00 68.75  ? 94  SER C O   1 
ATOM   3902  C CB  . SER B 1 97  ? 44.624 29.613  55.499  1.00 73.00  ? 94  SER C CB  1 
ATOM   3903  O OG  . SER B 1 97  ? 45.132 28.487  54.804  1.00 74.56  ? 94  SER C OG  1 
ATOM   3904  N N   . PRO B 1 98  ? 44.867 28.502  58.719  1.00 70.60  ? 95  PRO C N   1 
ATOM   3905  C CA  . PRO B 1 98  ? 45.018 27.287  59.537  1.00 73.43  ? 95  PRO C CA  1 
ATOM   3906  C C   . PRO B 1 98  ? 44.774 26.013  58.751  1.00 74.80  ? 95  PRO C C   1 
ATOM   3907  O O   . PRO B 1 98  ? 45.297 24.955  59.120  1.00 71.22  ? 95  PRO C O   1 
ATOM   3908  C CB  . PRO B 1 98  ? 43.972 27.475  60.644  1.00 69.98  ? 95  PRO C CB  1 
ATOM   3909  C CG  . PRO B 1 98  ? 43.769 28.950  60.729  1.00 70.21  ? 95  PRO C CG  1 
ATOM   3910  C CD  . PRO B 1 98  ? 43.917 29.458  59.318  1.00 65.99  ? 95  PRO C CD  1 
ATOM   3911  N N   . ASN B 1 99  ? 44.013 26.092  57.658  1.00 71.01  ? 96  ASN C N   1 
ATOM   3912  C CA  . ASN B 1 99  ? 43.719 24.906  56.863  1.00 70.86  ? 96  ASN C CA  1 
ATOM   3913  C C   . ASN B 1 99  ? 44.983 24.326  56.237  1.00 72.85  ? 96  ASN C C   1 
ATOM   3914  O O   . ASN B 1 99  ? 45.261 23.129  56.376  1.00 72.45  ? 96  ASN C O   1 
ATOM   3915  C CB  . ASN B 1 99  ? 42.686 25.251  55.793  1.00 77.72  ? 96  ASN C CB  1 
ATOM   3916  C CG  . ASN B 1 99  ? 41.489 25.988  56.361  1.00 80.23  ? 96  ASN C CG  1 
ATOM   3917  O OD1 . ASN B 1 99  ? 40.612 25.383  56.981  1.00 76.56  ? 96  ASN C OD1 1 
ATOM   3918  N ND2 . ASN B 1 99  ? 41.458 27.302  56.176  1.00 75.95  ? 96  ASN C ND2 1 
ATOM   3919  N N   . GLY B 1 100 ? 45.767 25.164  55.550  1.00 73.17  ? 97  GLY C N   1 
ATOM   3920  C CA  . GLY B 1 100 ? 46.991 24.677  54.934  1.00 70.21  ? 97  GLY C CA  1 
ATOM   3921  C C   . GLY B 1 100 ? 47.975 24.126  55.949  1.00 75.68  ? 97  GLY C C   1 
ATOM   3922  O O   . GLY B 1 100 ? 48.671 23.142  55.685  1.00 73.29  ? 97  GLY C O   1 
ATOM   3923  N N   . THR B 1 101 ? 48.037 24.748  57.129  1.00 64.11  ? 98  THR C N   1 
ATOM   3924  C CA  . THR B 1 101 ? 48.904 24.257  58.193  1.00 70.68  ? 98  THR C CA  1 
ATOM   3925  C C   . THR B 1 101 ? 48.503 22.851  58.617  1.00 76.18  ? 98  THR C C   1 
ATOM   3926  O O   . THR B 1 101 ? 49.313 21.917  58.574  1.00 72.20  ? 98  THR C O   1 
ATOM   3927  C CB  . THR B 1 101 ? 48.847 25.215  59.382  1.00 72.67  ? 98  THR C CB  1 
ATOM   3928  O OG1 . THR B 1 101 ? 49.220 26.531  58.955  1.00 64.72  ? 98  THR C OG1 1 
ATOM   3929  C CG2 . THR B 1 101 ? 49.787 24.752  60.486  1.00 73.90  ? 98  THR C CG2 1 
ATOM   3930  N N   . ILE B 1 102 ? 47.241 22.684  59.018  1.00 73.41  ? 99  ILE C N   1 
ATOM   3931  C CA  . ILE B 1 102 ? 46.750 21.389  59.483  1.00 71.72  ? 99  ILE C CA  1 
ATOM   3932  C C   . ILE B 1 102 ? 46.937 20.325  58.410  1.00 69.77  ? 99  ILE C C   1 
ATOM   3933  O O   . ILE B 1 102 ? 47.340 19.191  58.699  1.00 68.12  ? 99  ILE C O   1 
ATOM   3934  C CB  . ILE B 1 102 ? 45.272 21.506  59.902  1.00 69.44  ? 99  ILE C CB  1 
ATOM   3935  C CG1 . ILE B 1 102 ? 45.112 22.489  61.058  1.00 68.61  ? 99  ILE C CG1 1 
ATOM   3936  C CG2 . ILE B 1 102 ? 44.706 20.142  60.270  1.00 66.08  ? 99  ILE C CG2 1 
ATOM   3937  C CD1 . ILE B 1 102 ? 43.692 22.972  61.244  1.00 67.01  ? 99  ILE C CD1 1 
ATOM   3938  N N   . ARG B 1 103 ? 46.666 20.679  57.151  1.00 71.97  ? 100 ARG C N   1 
ATOM   3939  C CA  . ARG B 1 103 ? 46.622 19.676  56.092  1.00 73.75  ? 100 ARG C CA  1 
ATOM   3940  C C   . ARG B 1 103 ? 48.006 19.113  55.794  1.00 75.19  ? 100 ARG C C   1 
ATOM   3941  O O   . ARG B 1 103 ? 48.185 17.891  55.736  1.00 76.20  ? 100 ARG C O   1 
ATOM   3942  C CB  . ARG B 1 103 ? 45.993 20.271  54.835  1.00 73.89  ? 100 ARG C CB  1 
ATOM   3943  C CG  . ARG B 1 103 ? 44.491 20.449  54.941  1.00 75.95  ? 100 ARG C CG  1 
ATOM   3944  C CD  . ARG B 1 103 ? 43.841 20.533  53.574  1.00 75.38  ? 100 ARG C CD  1 
ATOM   3945  N NE  . ARG B 1 103 ? 42.572 21.250  53.628  1.00 88.07  ? 100 ARG C NE  1 
ATOM   3946  C CZ  . ARG B 1 103 ? 42.432 22.544  53.356  1.00 85.89  ? 100 ARG C CZ  1 
ATOM   3947  N NH1 . ARG B 1 103 ? 41.236 23.113  53.431  1.00 86.57  ? 100 ARG C NH1 1 
ATOM   3948  N NH2 . ARG B 1 103 ? 43.486 23.268  53.006  1.00 74.54  ? 100 ARG C NH2 1 
ATOM   3949  N N   . ASN B 1 104 ? 49.000 19.983  55.603  1.00 81.09  ? 101 ASN C N   1 
ATOM   3950  C CA  . ASN B 1 104 ? 50.350 19.492  55.353  1.00 87.62  ? 101 ASN C CA  1 
ATOM   3951  C C   . ASN B 1 104 ? 50.911 18.730  56.547  1.00 80.63  ? 101 ASN C C   1 
ATOM   3952  O O   . ASN B 1 104 ? 51.846 17.940  56.383  1.00 86.30  ? 101 ASN C O   1 
ATOM   3953  C CB  . ASN B 1 104 ? 51.273 20.652  54.979  1.00 96.74  ? 101 ASN C CB  1 
ATOM   3954  C CG  . ASN B 1 104 ? 51.633 20.656  53.506  1.00 97.07  ? 101 ASN C CG  1 
ATOM   3955  O OD1 . ASN B 1 104 ? 50.921 20.088  52.678  1.00 95.46  ? 101 ASN C OD1 1 
ATOM   3956  N ND2 . ASN B 1 104 ? 52.743 21.305  53.170  1.00 92.35  ? 101 ASN C ND2 1 
ATOM   3957  N N   . ILE B 1 105 ? 50.358 18.943  57.741  1.00 77.40  ? 102 ILE C N   1 
ATOM   3958  C CA  . ILE B 1 105 ? 50.784 18.177  58.909  1.00 80.10  ? 102 ILE C CA  1 
ATOM   3959  C C   . ILE B 1 105 ? 50.215 16.764  58.848  1.00 77.32  ? 102 ILE C C   1 
ATOM   3960  O O   . ILE B 1 105 ? 50.952 15.773  58.901  1.00 73.20  ? 102 ILE C O   1 
ATOM   3961  C CB  . ILE B 1 105 ? 50.370 18.894  60.208  1.00 75.11  ? 102 ILE C CB  1 
ATOM   3962  C CG1 . ILE B 1 105 ? 51.348 20.018  60.538  1.00 72.79  ? 102 ILE C CG1 1 
ATOM   3963  C CG2 . ILE B 1 105 ? 50.273 17.903  61.366  1.00 73.30  ? 102 ILE C CG2 1 
ATOM   3964  C CD1 . ILE B 1 105 ? 51.037 20.720  61.839  1.00 66.66  ? 102 ILE C CD1 1 
ATOM   3965  N N   . LEU B 1 106 ? 48.891 16.654  58.730  1.00 76.21  ? 103 LEU C N   1 
ATOM   3966  C CA  . LEU B 1 106 ? 48.249 15.347  58.748  1.00 68.55  ? 103 LEU C CA  1 
ATOM   3967  C C   . LEU B 1 106 ? 48.341 14.643  57.402  1.00 73.98  ? 103 LEU C C   1 
ATOM   3968  O O   . LEU B 1 106 ? 48.354 13.407  57.354  1.00 71.98  ? 103 LEU C O   1 
ATOM   3969  C CB  . LEU B 1 106 ? 46.786 15.492  59.167  1.00 70.20  ? 103 LEU C CB  1 
ATOM   3970  C CG  . LEU B 1 106 ? 46.519 16.342  60.412  1.00 67.96  ? 103 LEU C CG  1 
ATOM   3971  C CD1 . LEU B 1 106 ? 45.025 16.523  60.622  1.00 64.52  ? 103 LEU C CD1 1 
ATOM   3972  C CD2 . LEU B 1 106 ? 47.164 15.723  61.645  1.00 66.89  ? 103 LEU C CD2 1 
ATOM   3973  N N   . GLY B 1 107 ? 48.408 15.398  56.311  1.00 70.25  ? 104 GLY C N   1 
ATOM   3974  C CA  . GLY B 1 107 ? 48.360 14.815  54.986  1.00 67.06  ? 104 GLY C CA  1 
ATOM   3975  C C   . GLY B 1 107 ? 47.009 14.180  54.703  1.00 64.40  ? 104 GLY C C   1 
ATOM   3976  O O   . GLY B 1 107 ? 46.078 14.212  55.508  1.00 63.32  ? 104 GLY C O   1 
ATOM   3977  N N   . GLY B 1 108 ? 46.909 13.606  53.516  1.00 56.52  ? 105 GLY C N   1 
ATOM   3978  C CA  . GLY B 1 108 ? 45.743 12.841  53.137  1.00 64.18  ? 105 GLY C CA  1 
ATOM   3979  C C   . GLY B 1 108 ? 44.925 13.512  52.046  1.00 60.44  ? 105 GLY C C   1 
ATOM   3980  O O   . GLY B 1 108 ? 45.307 14.526  51.453  1.00 57.01  ? 105 GLY C O   1 
ATOM   3981  N N   . THR B 1 109 ? 43.762 12.915  51.804  1.00 59.04  ? 106 THR C N   1 
ATOM   3982  C CA  . THR B 1 109 ? 42.876 13.265  50.706  1.00 52.68  ? 106 THR C CA  1 
ATOM   3983  C C   . THR B 1 109 ? 41.613 13.921  51.250  1.00 53.01  ? 106 THR C C   1 
ATOM   3984  O O   . THR B 1 109 ? 41.040 13.458  52.241  1.00 57.02  ? 106 THR C O   1 
ATOM   3985  C CB  . THR B 1 109 ? 42.508 12.014  49.903  1.00 53.17  ? 106 THR C CB  1 
ATOM   3986  O OG1 . THR B 1 109 ? 43.704 11.381  49.429  1.00 57.42  ? 106 THR C OG1 1 
ATOM   3987  C CG2 . THR B 1 109 ? 41.613 12.364  48.725  1.00 49.48  ? 106 THR C CG2 1 
ATOM   3988  N N   . VAL B 1 110 ? 41.182 14.994  50.598  1.00 46.45  ? 107 VAL C N   1 
ATOM   3989  C CA  . VAL B 1 110 ? 39.971 15.707  50.985  1.00 51.92  ? 107 VAL C CA  1 
ATOM   3990  C C   . VAL B 1 110 ? 38.817 15.245  50.106  1.00 50.28  ? 107 VAL C C   1 
ATOM   3991  O O   . VAL B 1 110 ? 38.917 15.253  48.874  1.00 50.62  ? 107 VAL C O   1 
ATOM   3992  C CB  . VAL B 1 110 ? 40.168 17.228  50.880  1.00 48.42  ? 107 VAL C CB  1 
ATOM   3993  C CG1 . VAL B 1 110 ? 39.026 17.954  51.555  1.00 56.65  ? 107 VAL C CG1 1 
ATOM   3994  C CG2 . VAL B 1 110 ? 41.487 17.635  51.510  1.00 50.19  ? 107 VAL C CG2 1 
ATOM   3995  N N   . PHE B 1 111 ? 37.720 14.845  50.743  1.00 49.77  ? 108 PHE C N   1 
ATOM   3996  C CA  . PHE B 1 111 ? 36.515 14.393  50.060  1.00 40.76  ? 108 PHE C CA  1 
ATOM   3997  C C   . PHE B 1 111 ? 35.394 15.391  50.310  1.00 44.40  ? 108 PHE C C   1 
ATOM   3998  O O   . PHE B 1 111 ? 35.173 15.808  51.451  1.00 38.76  ? 108 PHE C O   1 
ATOM   3999  C CB  . PHE B 1 111 ? 36.106 13.000  50.541  1.00 43.27  ? 108 PHE C CB  1 
ATOM   4000  C CG  . PHE B 1 111 ? 37.074 11.919  50.151  1.00 44.57  ? 108 PHE C CG  1 
ATOM   4001  C CD1 . PHE B 1 111 ? 36.953 11.272  48.934  1.00 39.20  ? 108 PHE C CD1 1 
ATOM   4002  C CD2 . PHE B 1 111 ? 38.109 11.557  50.999  1.00 46.69  ? 108 PHE C CD2 1 
ATOM   4003  C CE1 . PHE B 1 111 ? 37.843 10.278  48.568  1.00 46.51  ? 108 PHE C CE1 1 
ATOM   4004  C CE2 . PHE B 1 111 ? 39.002 10.565  50.639  1.00 51.76  ? 108 PHE C CE2 1 
ATOM   4005  C CZ  . PHE B 1 111 ? 38.870 9.925   49.422  1.00 47.47  ? 108 PHE C CZ  1 
ATOM   4006  N N   . ARG B 1 112 ? 34.701 15.780  49.245  1.00 44.92  ? 109 ARG C N   1 
ATOM   4007  C CA  . ARG B 1 112 ? 33.595 16.721  49.321  1.00 46.39  ? 109 ARG C CA  1 
ATOM   4008  C C   . ARG B 1 112 ? 32.284 15.987  49.081  1.00 41.61  ? 109 ARG C C   1 
ATOM   4009  O O   . ARG B 1 112 ? 32.209 15.094  48.231  1.00 36.41  ? 109 ARG C O   1 
ATOM   4010  C CB  . ARG B 1 112 ? 33.761 17.846  48.295  1.00 52.16  ? 109 ARG C CB  1 
ATOM   4011  C CG  . ARG B 1 112 ? 34.867 18.836  48.630  1.00 59.76  ? 109 ARG C CG  1 
ATOM   4012  C CD  . ARG B 1 112 ? 35.068 19.838  47.504  1.00 66.91  ? 109 ARG C CD  1 
ATOM   4013  N NE  . ARG B 1 112 ? 35.474 21.149  48.005  1.00 66.82  ? 109 ARG C NE  1 
ATOM   4014  C CZ  . ARG B 1 112 ? 36.737 21.550  48.111  1.00 66.47  ? 109 ARG C CZ  1 
ATOM   4015  N NH1 . ARG B 1 112 ? 37.723 20.745  47.747  1.00 58.11  ? 109 ARG C NH1 1 
ATOM   4016  N NH2 . ARG B 1 112 ? 37.015 22.759  48.579  1.00 71.04  ? 109 ARG C NH2 1 
ATOM   4017  N N   . GLU B 1 113 ? 31.252 16.366  49.831  1.00 38.14  ? 110 GLU C N   1 
ATOM   4018  C CA  . GLU B 1 113 ? 29.954 15.717  49.713  1.00 43.94  ? 110 GLU C CA  1 
ATOM   4019  C C   . GLU B 1 113 ? 28.856 16.731  49.990  1.00 43.91  ? 110 GLU C C   1 
ATOM   4020  O O   . GLU B 1 113 ? 28.867 17.390  51.034  1.00 49.13  ? 110 GLU C O   1 
ATOM   4021  C CB  . GLU B 1 113 ? 29.837 14.531  50.677  1.00 39.94  ? 110 GLU C CB  1 
ATOM   4022  C CG  . GLU B 1 113 ? 28.651 13.618  50.392  1.00 48.63  ? 110 GLU C CG  1 
ATOM   4023  C CD  . GLU B 1 113 ? 28.594 12.421  51.325  1.00 48.83  ? 110 GLU C CD  1 
ATOM   4024  O OE1 . GLU B 1 113 ? 27.516 11.798  51.429  1.00 48.85  ? 110 GLU C OE1 1 
ATOM   4025  O OE2 . GLU B 1 113 ? 29.625 12.101  51.953  1.00 55.11  ? 110 GLU C OE2 1 
ATOM   4026  N N   . ALA B 1 114 ? 27.919 16.850  49.057  1.00 41.76  ? 111 ALA C N   1 
ATOM   4027  C CA  . ALA B 1 114 ? 26.753 17.691  49.265  1.00 46.09  ? 111 ALA C CA  1 
ATOM   4028  C C   . ALA B 1 114 ? 25.672 16.915  50.007  1.00 43.58  ? 111 ALA C C   1 
ATOM   4029  O O   . ALA B 1 114 ? 25.566 15.690  49.898  1.00 48.77  ? 111 ALA C O   1 
ATOM   4030  C CB  . ALA B 1 114 ? 26.205 18.208  47.935  1.00 36.78  ? 111 ALA C CB  1 
ATOM   4031  N N   . ILE B 1 115 ? 24.876 17.644  50.779  1.00 45.16  ? 112 ILE C N   1 
ATOM   4032  C CA  . ILE B 1 115 ? 23.750 17.070  51.506  1.00 39.51  ? 112 ILE C CA  1 
ATOM   4033  C C   . ILE B 1 115 ? 22.490 17.307  50.682  1.00 38.94  ? 112 ILE C C   1 
ATOM   4034  O O   . ILE B 1 115 ? 22.175 18.448  50.327  1.00 40.89  ? 112 ILE C O   1 
ATOM   4035  C CB  . ILE B 1 115 ? 23.629 17.681  52.910  1.00 41.56  ? 112 ILE C CB  1 
ATOM   4036  C CG1 . ILE B 1 115 ? 24.842 17.292  53.757  1.00 38.39  ? 112 ILE C CG1 1 
ATOM   4037  C CG2 . ILE B 1 115 ? 22.337 17.232  53.581  1.00 38.00  ? 112 ILE C CG2 1 
ATOM   4038  C CD1 . ILE B 1 115 ? 25.439 18.439  54.542  1.00 42.22  ? 112 ILE C CD1 1 
ATOM   4039  N N   . ILE B 1 116 ? 21.773 16.231  50.376  1.00 39.56  ? 113 ILE C N   1 
ATOM   4040  C CA  . ILE B 1 116 ? 20.682 16.251  49.411  1.00 36.98  ? 113 ILE C CA  1 
ATOM   4041  C C   . ILE B 1 116 ? 19.348 16.173  50.142  1.00 41.61  ? 113 ILE C C   1 
ATOM   4042  O O   . ILE B 1 116 ? 19.182 15.374  51.074  1.00 42.51  ? 113 ILE C O   1 
ATOM   4043  C CB  . ILE B 1 116 ? 20.828 15.099  48.401  1.00 41.98  ? 113 ILE C CB  1 
ATOM   4044  C CG1 . ILE B 1 116 ? 21.835 15.467  47.312  1.00 48.33  ? 113 ILE C CG1 1 
ATOM   4045  C CG2 . ILE B 1 116 ? 19.485 14.719  47.797  1.00 45.77  ? 113 ILE C CG2 1 
ATOM   4046  C CD1 . ILE B 1 116 ? 21.967 14.416  46.235  1.00 52.27  ? 113 ILE C CD1 1 
ATOM   4047  N N   . CYS B 1 117 ? 18.399 17.009  49.721  1.00 35.27  ? 114 CYS C N   1 
ATOM   4048  C CA  . CYS B 1 117 ? 17.030 16.986  50.215  1.00 36.99  ? 114 CYS C CA  1 
ATOM   4049  C C   . CYS B 1 117 ? 16.081 16.889  49.028  1.00 43.63  ? 114 CYS C C   1 
ATOM   4050  O O   . CYS B 1 117 ? 16.348 17.460  47.964  1.00 38.31  ? 114 CYS C O   1 
ATOM   4051  C CB  . CYS B 1 117 ? 16.708 18.234  51.043  1.00 31.19  ? 114 CYS C CB  1 
ATOM   4052  S SG  . CYS B 1 117 ? 17.839 18.539  52.421  1.00 33.92  ? 114 CYS C SG  1 
ATOM   4053  N N   . LYS B 1 118 ? 14.970 16.171  49.220  1.00 37.09  ? 115 LYS C N   1 
ATOM   4054  C CA  . LYS B 1 118 ? 14.041 15.913  48.121  1.00 44.28  ? 115 LYS C CA  1 
ATOM   4055  C C   . LYS B 1 118 ? 13.483 17.206  47.539  1.00 42.36  ? 115 LYS C C   1 
ATOM   4056  O O   . LYS B 1 118 ? 13.427 17.380  46.317  1.00 45.50  ? 115 LYS C O   1 
ATOM   4057  C CB  . LYS B 1 118 ? 12.894 15.023  48.598  1.00 44.73  ? 115 LYS C CB  1 
ATOM   4058  C CG  . LYS B 1 118 ? 13.291 13.606  48.970  1.00 57.77  ? 115 LYS C CG  1 
ATOM   4059  C CD  . LYS B 1 118 ? 12.260 12.990  49.906  1.00 57.09  ? 115 LYS C CD  1 
ATOM   4060  C CE  . LYS B 1 118 ? 12.671 11.592  50.336  1.00 59.83  ? 115 LYS C CE  1 
ATOM   4061  N NZ  . LYS B 1 118 ? 11.920 11.130  51.536  1.00 61.34  ? 115 LYS C NZ  1 
ATOM   4062  N N   . ASN B 1 119 ? 13.055 18.123  48.402  1.00 36.84  ? 116 ASN C N   1 
ATOM   4063  C CA  . ASN B 1 119 ? 12.410 19.349  47.950  1.00 39.34  ? 116 ASN C CA  1 
ATOM   4064  C C   . ASN B 1 119 ? 13.396 20.417  47.497  1.00 42.56  ? 116 ASN C C   1 
ATOM   4065  O O   . ASN B 1 119 ? 12.962 21.495  47.081  1.00 38.34  ? 116 ASN C O   1 
ATOM   4066  C CB  . ASN B 1 119 ? 11.522 19.911  49.062  1.00 35.35  ? 116 ASN C CB  1 
ATOM   4067  C CG  . ASN B 1 119 ? 12.284 20.134  50.354  1.00 39.70  ? 116 ASN C CG  1 
ATOM   4068  O OD1 . ASN B 1 119 ? 13.332 19.527  50.586  1.00 34.22  ? 116 ASN C OD1 1 
ATOM   4069  N ND2 . ASN B 1 119 ? 11.761 21.009  51.204  1.00 34.51  ? 116 ASN C ND2 1 
ATOM   4070  N N   . ILE B 1 120 ? 14.696 20.159  47.570  1.00 37.78  ? 117 ILE C N   1 
ATOM   4071  C CA  . ILE B 1 120 ? 15.711 21.131  47.185  1.00 40.00  ? 117 ILE C CA  1 
ATOM   4072  C C   . ILE B 1 120 ? 16.299 20.689  45.846  1.00 39.38  ? 117 ILE C C   1 
ATOM   4073  O O   . ILE B 1 120 ? 16.958 19.640  45.776  1.00 37.38  ? 117 ILE C O   1 
ATOM   4074  C CB  . ILE B 1 120 ? 16.797 21.276  48.258  1.00 39.87  ? 117 ILE C CB  1 
ATOM   4075  C CG1 . ILE B 1 120 ? 16.160 21.593  49.608  1.00 35.57  ? 117 ILE C CG1 1 
ATOM   4076  C CG2 . ILE B 1 120 ? 17.798 22.354  47.858  1.00 34.16  ? 117 ILE C CG2 1 
ATOM   4077  C CD1 . ILE B 1 120 ? 15.543 22.977  49.674  1.00 33.87  ? 117 ILE C CD1 1 
ATOM   4078  N N   . PRO B 1 121 ? 16.098 21.450  44.769  1.00 39.58  ? 118 PRO C N   1 
ATOM   4079  C CA  . PRO B 1 121 ? 16.534 20.992  43.444  1.00 41.47  ? 118 PRO C CA  1 
ATOM   4080  C C   . PRO B 1 121 ? 18.039 20.783  43.391  1.00 39.83  ? 118 PRO C C   1 
ATOM   4081  O O   . PRO B 1 121 ? 18.806 21.461  44.077  1.00 33.52  ? 118 PRO C O   1 
ATOM   4082  C CB  . PRO B 1 121 ? 16.093 22.127  42.510  1.00 44.35  ? 118 PRO C CB  1 
ATOM   4083  C CG  . PRO B 1 121 ? 15.029 22.863  43.262  1.00 45.23  ? 118 PRO C CG  1 
ATOM   4084  C CD  . PRO B 1 121 ? 15.431 22.761  44.706  1.00 39.76  ? 118 PRO C CD  1 
ATOM   4085  N N   . ARG B 1 122 ? 18.453 19.812  42.585  1.00 35.23  ? 119 ARG C N   1 
ATOM   4086  C CA  . ARG B 1 122 ? 19.857 19.573  42.296  1.00 47.19  ? 119 ARG C CA  1 
ATOM   4087  C C   . ARG B 1 122 ? 20.189 20.145  40.925  1.00 39.08  ? 119 ARG C C   1 
ATOM   4088  O O   . ARG B 1 122 ? 19.319 20.254  40.056  1.00 39.73  ? 119 ARG C O   1 
ATOM   4089  C CB  . ARG B 1 122 ? 20.189 18.077  42.329  1.00 41.56  ? 119 ARG C CB  1 
ATOM   4090  C CG  . ARG B 1 122 ? 20.442 17.513  43.719  1.00 40.00  ? 119 ARG C CG  1 
ATOM   4091  C CD  . ARG B 1 122 ? 19.142 17.298  44.478  1.00 45.44  ? 119 ARG C CD  1 
ATOM   4092  N NE  . ARG B 1 122 ? 18.247 16.399  43.756  1.00 45.98  ? 119 ARG C NE  1 
ATOM   4093  C CZ  . ARG B 1 122 ? 16.921 16.478  43.787  1.00 49.78  ? 119 ARG C CZ  1 
ATOM   4094  N NH1 . ARG B 1 122 ? 16.188 15.618  43.092  1.00 46.00  ? 119 ARG C NH1 1 
ATOM   4095  N NH2 . ARG B 1 122 ? 16.326 17.420  44.509  1.00 37.65  ? 119 ARG C NH2 1 
ATOM   4096  N N   . LEU B 1 123 ? 21.459 20.523  40.746  1.00 41.35  ? 120 LEU C N   1 
ATOM   4097  C CA  . LEU B 1 123 ? 21.903 21.054  39.460  1.00 44.28  ? 120 LEU C CA  1 
ATOM   4098  C C   . LEU B 1 123 ? 21.565 20.092  38.328  1.00 38.33  ? 120 LEU C C   1 
ATOM   4099  O O   . LEU B 1 123 ? 21.124 20.512  37.253  1.00 42.36  ? 120 LEU C O   1 
ATOM   4100  C CB  . LEU B 1 123 ? 23.405 21.338  39.502  1.00 47.45  ? 120 LEU C CB  1 
ATOM   4101  C CG  . LEU B 1 123 ? 24.044 21.913  38.236  1.00 44.62  ? 120 LEU C CG  1 
ATOM   4102  C CD1 . LEU B 1 123 ? 23.406 23.244  37.863  1.00 42.39  ? 120 LEU C CD1 1 
ATOM   4103  C CD2 . LEU B 1 123 ? 25.546 22.066  38.421  1.00 40.91  ? 120 LEU C CD2 1 
ATOM   4104  N N   . VAL B 1 124 ? 21.752 18.797  38.559  1.00 46.41  ? 121 VAL C N   1 
ATOM   4105  C CA  . VAL B 1 124 ? 21.252 17.750  37.677  1.00 45.37  ? 121 VAL C CA  1 
ATOM   4106  C C   . VAL B 1 124 ? 20.145 17.025  38.428  1.00 48.20  ? 121 VAL C C   1 
ATOM   4107  O O   . VAL B 1 124 ? 20.389 16.440  39.491  1.00 45.69  ? 121 VAL C O   1 
ATOM   4108  C CB  . VAL B 1 124 ? 22.365 16.783  37.249  1.00 45.51  ? 121 VAL C CB  1 
ATOM   4109  C CG1 . VAL B 1 124 ? 21.793 15.641  36.421  1.00 42.77  ? 121 VAL C CG1 1 
ATOM   4110  C CG2 . VAL B 1 124 ? 23.441 17.530  36.470  1.00 39.76  ? 121 VAL C CG2 1 
ATOM   4111  N N   . SER B 1 125 ? 18.925 17.073  37.882  1.00 52.14  ? 122 SER C N   1 
ATOM   4112  C CA  . SER B 1 125 ? 17.776 16.526  38.599  1.00 52.15  ? 122 SER C CA  1 
ATOM   4113  C C   . SER B 1 125 ? 17.905 15.024  38.816  1.00 47.10  ? 122 SER C C   1 
ATOM   4114  O O   . SER B 1 125 ? 17.389 14.495  39.808  1.00 53.13  ? 122 SER C O   1 
ATOM   4115  C CB  . SER B 1 125 ? 16.486 16.842  37.845  1.00 52.04  ? 122 SER C CB  1 
ATOM   4116  O OG  . SER B 1 125 ? 16.404 18.224  37.539  1.00 59.93  ? 122 SER C OG  1 
ATOM   4117  N N   . GLY B 1 126 ? 18.588 14.320  37.910  1.00 50.99  ? 123 GLY C N   1 
ATOM   4118  C CA  . GLY B 1 126 ? 18.772 12.888  38.074  1.00 48.96  ? 123 GLY C CA  1 
ATOM   4119  C C   . GLY B 1 126 ? 19.574 12.513  39.301  1.00 49.33  ? 123 GLY C C   1 
ATOM   4120  O O   . GLY B 1 126 ? 19.515 11.360  39.742  1.00 51.55  ? 123 GLY C O   1 
ATOM   4121  N N   . TRP B 1 127 ? 20.321 13.459  39.866  1.00 45.67  ? 124 TRP C N   1 
ATOM   4122  C CA  . TRP B 1 127 ? 21.088 13.221  41.085  1.00 42.69  ? 124 TRP C CA  1 
ATOM   4123  C C   . TRP B 1 127 ? 20.131 13.146  42.266  1.00 47.23  ? 124 TRP C C   1 
ATOM   4124  O O   . TRP B 1 127 ? 19.700 14.171  42.800  1.00 46.90  ? 124 TRP C O   1 
ATOM   4125  C CB  . TRP B 1 127 ? 22.120 14.323  41.294  1.00 38.36  ? 124 TRP C CB  1 
ATOM   4126  C CG  . TRP B 1 127 ? 23.215 14.342  40.275  1.00 44.45  ? 124 TRP C CG  1 
ATOM   4127  C CD1 . TRP B 1 127 ? 23.566 13.334  39.426  1.00 45.53  ? 124 TRP C CD1 1 
ATOM   4128  C CD2 . TRP B 1 127 ? 24.108 15.427  40.002  1.00 42.07  ? 124 TRP C CD2 1 
ATOM   4129  N NE1 . TRP B 1 127 ? 24.623 13.725  38.639  1.00 35.99  ? 124 TRP C NE1 1 
ATOM   4130  C CE2 . TRP B 1 127 ? 24.974 15.007  38.974  1.00 43.74  ? 124 TRP C CE2 1 
ATOM   4131  C CE3 . TRP B 1 127 ? 24.258 16.715  40.527  1.00 42.98  ? 124 TRP C CE3 1 
ATOM   4132  C CZ2 . TRP B 1 127 ? 25.975 15.828  38.459  1.00 38.08  ? 124 TRP C CZ2 1 
ATOM   4133  C CZ3 . TRP B 1 127 ? 25.253 17.528  40.016  1.00 41.86  ? 124 TRP C CZ3 1 
ATOM   4134  C CH2 . TRP B 1 127 ? 26.098 17.082  38.992  1.00 46.54  ? 124 TRP C CH2 1 
ATOM   4135  N N   . VAL B 1 128 ? 19.789 11.930  42.679  1.00 46.52  ? 125 VAL C N   1 
ATOM   4136  C CA  . VAL B 1 128 ? 18.994 11.727  43.882  1.00 47.56  ? 125 VAL C CA  1 
ATOM   4137  C C   . VAL B 1 128 ? 19.846 11.296  45.069  1.00 48.93  ? 125 VAL C C   1 
ATOM   4138  O O   . VAL B 1 128 ? 19.374 11.387  46.213  1.00 50.74  ? 125 VAL C O   1 
ATOM   4139  C CB  . VAL B 1 128 ? 17.859 10.709  43.645  1.00 49.69  ? 125 VAL C CB  1 
ATOM   4140  C CG1 . VAL B 1 128 ? 16.920 11.206  42.559  1.00 42.66  ? 125 VAL C CG1 1 
ATOM   4141  C CG2 . VAL B 1 128 ? 18.431 9.347   43.287  1.00 47.17  ? 125 VAL C CG2 1 
ATOM   4142  N N   . LYS B 1 129 ? 21.070 10.831  44.842  1.00 45.41  ? 126 LYS C N   1 
ATOM   4143  C CA  . LYS B 1 129 ? 22.005 10.443  45.882  1.00 48.42  ? 126 LYS C CA  1 
ATOM   4144  C C   . LYS B 1 129 ? 23.266 11.288  45.791  1.00 50.08  ? 126 LYS C C   1 
ATOM   4145  O O   . LYS B 1 129 ? 23.686 11.662  44.690  1.00 45.82  ? 126 LYS C O   1 
ATOM   4146  C CB  . LYS B 1 129 ? 22.375 8.959   45.764  1.00 52.37  ? 126 LYS C CB  1 
ATOM   4147  C CG  . LYS B 1 129 ? 21.168 8.043   45.753  1.00 58.98  ? 126 LYS C CG  1 
ATOM   4148  C CD  . LYS B 1 129 ? 21.554 6.585   45.584  1.00 68.06  ? 126 LYS C CD  1 
ATOM   4149  C CE  . LYS B 1 129 ? 20.307 5.725   45.460  1.00 78.74  ? 126 LYS C CE  1 
ATOM   4150  N NZ  . LYS B 1 129 ? 20.623 4.276   45.343  1.00 75.03  ? 126 LYS C NZ  1 
ATOM   4151  N N   . PRO B 1 130 ? 23.889 11.610  46.925  1.00 50.68  ? 127 PRO C N   1 
ATOM   4152  C CA  . PRO B 1 130 ? 25.076 12.469  46.887  1.00 44.40  ? 127 PRO C CA  1 
ATOM   4153  C C   . PRO B 1 130 ? 26.206 11.836  46.092  1.00 45.57  ? 127 PRO C C   1 
ATOM   4154  O O   . PRO B 1 130 ? 26.311 10.613  45.978  1.00 51.73  ? 127 PRO C O   1 
ATOM   4155  C CB  . PRO B 1 130 ? 25.456 12.624  48.366  1.00 45.69  ? 127 PRO C CB  1 
ATOM   4156  C CG  . PRO B 1 130 ? 24.192 12.351  49.115  1.00 45.46  ? 127 PRO C CG  1 
ATOM   4157  C CD  . PRO B 1 130 ? 23.482 11.298  48.305  1.00 38.44  ? 127 PRO C CD  1 
ATOM   4158  N N   . ILE B 1 131 ? 27.036 12.696  45.511  1.00 42.83  ? 128 ILE C N   1 
ATOM   4159  C CA  . ILE B 1 131 ? 28.271 12.296  44.850  1.00 40.91  ? 128 ILE C CA  1 
ATOM   4160  C C   . ILE B 1 131 ? 29.426 12.846  45.672  1.00 42.04  ? 128 ILE C C   1 
ATOM   4161  O O   . ILE B 1 131 ? 29.397 14.007  46.101  1.00 38.70  ? 128 ILE C O   1 
ATOM   4162  C CB  . ILE B 1 131 ? 28.339 12.811  43.399  1.00 42.10  ? 128 ILE C CB  1 
ATOM   4163  C CG1 . ILE B 1 131 ? 27.113 12.351  42.609  1.00 44.51  ? 128 ILE C CG1 1 
ATOM   4164  C CG2 . ILE B 1 131 ? 29.615 12.333  42.721  1.00 37.46  ? 128 ILE C CG2 1 
ATOM   4165  C CD1 . ILE B 1 131 ? 27.097 12.823  41.167  1.00 35.89  ? 128 ILE C CD1 1 
ATOM   4166  N N   . ILE B 1 132 ? 30.435 12.012  45.904  1.00 35.54  ? 129 ILE C N   1 
ATOM   4167  C CA  . ILE B 1 132 ? 31.612 12.400  46.671  1.00 39.39  ? 129 ILE C CA  1 
ATOM   4168  C C   . ILE B 1 132 ? 32.781 12.562  45.712  1.00 41.63  ? 129 ILE C C   1 
ATOM   4169  O O   . ILE B 1 132 ? 33.127 11.630  44.974  1.00 40.74  ? 129 ILE C O   1 
ATOM   4170  C CB  . ILE B 1 132 ? 31.942 11.379  47.767  1.00 39.45  ? 129 ILE C CB  1 
ATOM   4171  C CG1 . ILE B 1 132 ? 30.772 11.240  48.727  1.00 42.51  ? 129 ILE C CG1 1 
ATOM   4172  C CG2 . ILE B 1 132 ? 33.192 11.795  48.528  1.00 40.67  ? 129 ILE C CG2 1 
ATOM   4173  C CD1 . ILE B 1 132 ? 30.968 10.145  49.722  1.00 48.02  ? 129 ILE C CD1 1 
ATOM   4174  N N   . ILE B 1 133 ? 33.388 13.742  45.727  1.00 38.50  ? 130 ILE C N   1 
ATOM   4175  C CA  . ILE B 1 133 ? 34.560 14.039  44.919  1.00 41.06  ? 130 ILE C CA  1 
ATOM   4176  C C   . ILE B 1 133 ? 35.792 13.934  45.804  1.00 43.04  ? 130 ILE C C   1 
ATOM   4177  O O   . ILE B 1 133 ? 35.846 14.537  46.884  1.00 44.48  ? 130 ILE C O   1 
ATOM   4178  C CB  . ILE B 1 133 ? 34.466 15.435  44.284  1.00 49.28  ? 130 ILE C CB  1 
ATOM   4179  C CG1 . ILE B 1 133 ? 33.156 15.585  43.513  1.00 47.04  ? 130 ILE C CG1 1 
ATOM   4180  C CG2 . ILE B 1 133 ? 35.655 15.671  43.374  1.00 46.61  ? 130 ILE C CG2 1 
ATOM   4181  C CD1 . ILE B 1 133 ? 33.087 14.741  42.265  1.00 48.65  ? 130 ILE C CD1 1 
ATOM   4182  N N   . GLY B 1 134 ? 36.779 13.168  45.350  1.00 39.99  ? 131 GLY C N   1 
ATOM   4183  C CA  . GLY B 1 134 ? 38.050 13.041  46.036  1.00 46.58  ? 131 GLY C CA  1 
ATOM   4184  C C   . GLY B 1 134 ? 39.167 13.645  45.208  1.00 49.69  ? 131 GLY C C   1 
ATOM   4185  O O   . GLY B 1 134 ? 39.138 13.607  43.975  1.00 43.59  ? 131 GLY C O   1 
ATOM   4186  N N   . HIS B 1 135 ? 40.157 14.200  45.900  1.00 52.16  ? 132 HIS C N   1 
ATOM   4187  C CA  . HIS B 1 135 ? 41.300 14.855  45.283  1.00 55.98  ? 132 HIS C CA  1 
ATOM   4188  C C   . HIS B 1 135 ? 42.355 15.017  46.361  1.00 56.39  ? 132 HIS C C   1 
ATOM   4189  O O   . HIS B 1 135 ? 42.028 15.377  47.496  1.00 57.96  ? 132 HIS C O   1 
ATOM   4190  C CB  . HIS B 1 135 ? 40.921 16.222  44.710  1.00 56.06  ? 132 HIS C CB  1 
ATOM   4191  C CG  . HIS B 1 135 ? 40.282 17.129  45.713  1.00 63.84  ? 132 HIS C CG  1 
ATOM   4192  N ND1 . HIS B 1 135 ? 41.012 17.940  46.556  1.00 68.09  ? 132 HIS C ND1 1 
ATOM   4193  C CD2 . HIS B 1 135 ? 38.981 17.330  46.032  1.00 64.80  ? 132 HIS C CD2 1 
ATOM   4194  C CE1 . HIS B 1 135 ? 40.188 18.614  47.338  1.00 65.47  ? 132 HIS C CE1 1 
ATOM   4195  N NE2 . HIS B 1 135 ? 38.951 18.261  47.041  1.00 67.22  ? 132 HIS C NE2 1 
ATOM   4196  N N   . HIS B 1 136 ? 43.610 14.750  46.015  1.00 56.54  ? 133 HIS C N   1 
ATOM   4197  C CA  . HIS B 1 136 ? 44.657 14.822  47.021  1.00 63.41  ? 133 HIS C CA  1 
ATOM   4198  C C   . HIS B 1 136 ? 44.876 16.264  47.461  1.00 64.59  ? 133 HIS C C   1 
ATOM   4199  O O   . HIS B 1 136 ? 44.857 17.193  46.649  1.00 64.93  ? 133 HIS C O   1 
ATOM   4200  C CB  . HIS B 1 136 ? 45.963 14.229  46.502  1.00 60.12  ? 133 HIS C CB  1 
ATOM   4201  C CG  . HIS B 1 136 ? 46.961 13.963  47.586  1.00 65.28  ? 133 HIS C CG  1 
ATOM   4202  N ND1 . HIS B 1 136 ? 46.927 12.825  48.363  1.00 59.63  ? 133 HIS C ND1 1 
ATOM   4203  C CD2 . HIS B 1 136 ? 48.002 14.700  48.041  1.00 55.02  ? 133 HIS C CD2 1 
ATOM   4204  C CE1 . HIS B 1 136 ? 47.912 12.866  49.242  1.00 61.45  ? 133 HIS C CE1 1 
ATOM   4205  N NE2 . HIS B 1 136 ? 48.580 13.993  49.068  1.00 65.02  ? 133 HIS C NE2 1 
ATOM   4206  N N   . ALA B 1 137 ? 45.075 16.444  48.762  1.00 62.69  ? 134 ALA C N   1 
ATOM   4207  C CA  . ALA B 1 137 ? 45.258 17.767  49.340  1.00 68.01  ? 134 ALA C CA  1 
ATOM   4208  C C   . ALA B 1 137 ? 46.650 18.308  49.033  1.00 62.77  ? 134 ALA C C   1 
ATOM   4209  O O   . ALA B 1 137 ? 46.792 19.403  48.490  1.00 67.06  ? 134 ALA C O   1 
ATOM   4210  C CB  . ALA B 1 137 ? 45.024 17.725  50.841  1.00 57.06  ? 134 ALA C CB  1 
ATOM   4211  N N   . ASP B 1 140 ? 47.434 20.778  42.557  1.00 74.00  ? 137 ASP C N   1 
ATOM   4212  C CA  . ASP B 1 140 ? 48.475 20.405  41.605  1.00 81.75  ? 137 ASP C CA  1 
ATOM   4213  C C   . ASP B 1 140 ? 48.931 21.622  40.807  1.00 81.91  ? 137 ASP C C   1 
ATOM   4214  O O   . ASP B 1 140 ? 50.102 21.740  40.445  1.00 75.94  ? 137 ASP C O   1 
ATOM   4215  C CB  . ASP B 1 140 ? 47.978 19.304  40.670  1.00 74.90  ? 137 ASP C CB  1 
ATOM   4216  C CG  . ASP B 1 140 ? 49.108 18.613  39.937  1.00 72.78  ? 137 ASP C CG  1 
ATOM   4217  O OD1 . ASP B 1 140 ? 50.278 18.810  40.331  1.00 69.75  ? 137 ASP C OD1 1 
ATOM   4218  O OD2 . ASP B 1 140 ? 48.828 17.869  38.973  1.00 67.56  ? 137 ASP C OD2 1 
ATOM   4219  N N   . GLN B 1 141 ? 47.989 22.522  40.520  1.00 74.44  ? 138 GLN C N   1 
ATOM   4220  C CA  . GLN B 1 141 ? 48.354 23.851  40.052  1.00 72.02  ? 138 GLN C CA  1 
ATOM   4221  C C   . GLN B 1 141 ? 48.859 24.727  41.192  1.00 67.63  ? 138 GLN C C   1 
ATOM   4222  O O   . GLN B 1 141 ? 49.514 25.743  40.936  1.00 65.92  ? 138 GLN C O   1 
ATOM   4223  C CB  . GLN B 1 141 ? 47.160 24.513  39.359  1.00 69.39  ? 138 GLN C CB  1 
ATOM   4224  C CG  . GLN B 1 141 ? 47.319 24.657  37.851  1.00 77.01  ? 138 GLN C CG  1 
ATOM   4225  C CD  . GLN B 1 141 ? 46.043 25.122  37.174  1.00 76.92  ? 138 GLN C CD  1 
ATOM   4226  O OE1 . GLN B 1 141 ? 45.152 25.677  37.816  1.00 72.59  ? 138 GLN C OE1 1 
ATOM   4227  N NE2 . GLN B 1 141 ? 45.947 24.887  35.870  1.00 75.54  ? 138 GLN C NE2 1 
ATOM   4228  N N   . TYR B 1 142 ? 48.589 24.334  42.441  1.00 68.62  ? 139 TYR C N   1 
ATOM   4229  C CA  . TYR B 1 142 ? 49.039 25.090  43.604  1.00 71.78  ? 139 TYR C CA  1 
ATOM   4230  C C   . TYR B 1 142 ? 50.491 24.793  43.951  1.00 71.03  ? 139 TYR C C   1 
ATOM   4231  O O   . TYR B 1 142 ? 51.165 25.637  44.556  1.00 74.34  ? 139 TYR C O   1 
ATOM   4232  C CB  . TYR B 1 142 ? 48.143 24.784  44.805  1.00 76.28  ? 139 TYR C CB  1 
ATOM   4233  C CG  . TYR B 1 142 ? 46.875 25.603  44.834  1.00 75.43  ? 139 TYR C CG  1 
ATOM   4234  C CD1 . TYR B 1 142 ? 46.629 26.500  45.864  1.00 79.97  ? 139 TYR C CD1 1 
ATOM   4235  C CD2 . TYR B 1 142 ? 45.931 25.490  43.821  1.00 74.86  ? 139 TYR C CD2 1 
ATOM   4236  C CE1 . TYR B 1 142 ? 45.472 27.256  45.890  1.00 81.34  ? 139 TYR C CE1 1 
ATOM   4237  C CE2 . TYR B 1 142 ? 44.773 26.243  43.836  1.00 76.47  ? 139 TYR C CE2 1 
ATOM   4238  C CZ  . TYR B 1 142 ? 44.549 27.125  44.874  1.00 83.56  ? 139 TYR C CZ  1 
ATOM   4239  O OH  . TYR B 1 142 ? 43.399 27.878  44.898  1.00 83.62  ? 139 TYR C OH  1 
ATOM   4240  N N   . ARG B 1 143 ? 50.980 23.603  43.600  1.00 69.58  ? 140 ARG C N   1 
ATOM   4241  C CA  . ARG B 1 143 ? 52.397 23.298  43.739  1.00 68.27  ? 140 ARG C CA  1 
ATOM   4242  C C   . ARG B 1 143 ? 53.028 23.200  42.354  1.00 67.21  ? 140 ARG C C   1 
ATOM   4243  O O   . ARG B 1 143 ? 53.496 22.133  41.938  1.00 71.02  ? 140 ARG C O   1 
ATOM   4244  C CB  . ARG B 1 143 ? 52.603 22.013  44.548  1.00 66.10  ? 140 ARG C CB  1 
ATOM   4245  C CG  . ARG B 1 143 ? 51.792 21.973  45.840  1.00 77.64  ? 140 ARG C CG  1 
ATOM   4246  C CD  . ARG B 1 143 ? 52.515 22.690  46.981  1.00 80.63  ? 140 ARG C CD  1 
ATOM   4247  N NE  . ARG B 1 143 ? 51.747 22.658  48.224  1.00 89.05  ? 140 ARG C NE  1 
ATOM   4248  C CZ  . ARG B 1 143 ? 51.001 23.662  48.677  1.00 92.00  ? 140 ARG C CZ  1 
ATOM   4249  N NH1 . ARG B 1 143 ? 50.338 23.529  49.819  1.00 88.09  ? 140 ARG C NH1 1 
ATOM   4250  N NH2 . ARG B 1 143 ? 50.914 24.797  47.994  1.00 87.53  ? 140 ARG C NH2 1 
ATOM   4251  N N   . ALA B 1 144 ? 53.015 24.319  41.632  1.00 59.69  ? 141 ALA C N   1 
ATOM   4252  C CA  . ALA B 1 144 ? 53.639 24.441  40.325  1.00 54.36  ? 141 ALA C CA  1 
ATOM   4253  C C   . ALA B 1 144 ? 54.583 25.635  40.331  1.00 46.79  ? 141 ALA C C   1 
ATOM   4254  O O   . ALA B 1 144 ? 54.402 26.587  41.095  1.00 44.60  ? 141 ALA C O   1 
ATOM   4255  C CB  . ALA B 1 144 ? 52.591 24.595  39.216  1.00 46.62  ? 141 ALA C CB  1 
ATOM   4256  N N   . THR B 1 145 ? 55.598 25.576  39.473  1.00 44.81  ? 142 THR C N   1 
ATOM   4257  C CA  . THR B 1 145 ? 56.585 26.644  39.341  1.00 40.14  ? 142 THR C CA  1 
ATOM   4258  C C   . THR B 1 145 ? 56.479 27.210  37.932  1.00 34.17  ? 142 THR C C   1 
ATOM   4259  O O   . THR B 1 145 ? 56.837 26.534  36.962  1.00 35.52  ? 142 THR C O   1 
ATOM   4260  C CB  . THR B 1 145 ? 57.998 26.129  39.617  1.00 38.61  ? 142 THR C CB  1 
ATOM   4261  O OG1 . THR B 1 145 ? 58.039 25.492  40.900  1.00 41.63  ? 142 THR C OG1 1 
ATOM   4262  C CG2 . THR B 1 145 ? 58.995 27.280  39.598  1.00 35.55  ? 142 THR C CG2 1 
ATOM   4263  N N   . ASP B 1 146 ? 55.999 28.448  37.819  1.00 33.34  ? 143 ASP C N   1 
ATOM   4264  C CA  . ASP B 1 146 ? 55.769 29.093  36.535  1.00 35.90  ? 143 ASP C CA  1 
ATOM   4265  C C   . ASP B 1 146 ? 56.587 30.374  36.433  1.00 34.71  ? 143 ASP C C   1 
ATOM   4266  O O   . ASP B 1 146 ? 56.912 31.004  37.445  1.00 36.23  ? 143 ASP C O   1 
ATOM   4267  C CB  . ASP B 1 146 ? 54.278 29.402  36.332  1.00 33.90  ? 143 ASP C CB  1 
ATOM   4268  C CG  . ASP B 1 146 ? 53.735 30.375  37.362  1.00 34.76  ? 143 ASP C CG  1 
ATOM   4269  O OD1 . ASP B 1 146 ? 54.182 30.321  38.527  1.00 36.46  ? 143 ASP C OD1 1 
ATOM   4270  O OD2 . ASP B 1 146 ? 52.863 31.195  37.006  1.00 30.04  ? 143 ASP C OD2 1 
ATOM   4271  N N   . PHE B 1 147 ? 56.916 30.763  35.201  1.00 33.22  ? 144 PHE C N   1 
ATOM   4272  C CA  . PHE B 1 147 ? 57.756 31.935  34.994  1.00 31.56  ? 144 PHE C CA  1 
ATOM   4273  C C   . PHE B 1 147 ? 57.580 32.459  33.576  1.00 35.37  ? 144 PHE C C   1 
ATOM   4274  O O   . PHE B 1 147 ? 57.078 31.763  32.688  1.00 33.26  ? 144 PHE C O   1 
ATOM   4275  C CB  . PHE B 1 147 ? 59.234 31.623  35.265  1.00 27.10  ? 144 PHE C CB  1 
ATOM   4276  C CG  . PHE B 1 147 ? 59.778 30.486  34.440  1.00 32.86  ? 144 PHE C CG  1 
ATOM   4277  C CD1 . PHE B 1 147 ? 59.666 29.175  34.882  1.00 30.17  ? 144 PHE C CD1 1 
ATOM   4278  C CD2 . PHE B 1 147 ? 60.413 30.728  33.232  1.00 25.43  ? 144 PHE C CD2 1 
ATOM   4279  C CE1 . PHE B 1 147 ? 60.169 28.127  34.131  1.00 28.11  ? 144 PHE C CE1 1 
ATOM   4280  C CE2 . PHE B 1 147 ? 60.921 29.685  32.476  1.00 32.65  ? 144 PHE C CE2 1 
ATOM   4281  C CZ  . PHE B 1 147 ? 60.799 28.382  32.927  1.00 31.65  ? 144 PHE C CZ  1 
ATOM   4282  N N   . VAL B 1 148 ? 58.016 33.700  33.382  1.00 32.94  ? 145 VAL C N   1 
ATOM   4283  C CA  . VAL B 1 148 ? 57.975 34.353  32.079  1.00 31.95  ? 145 VAL C CA  1 
ATOM   4284  C C   . VAL B 1 148 ? 59.221 33.979  31.290  1.00 34.53  ? 145 VAL C C   1 
ATOM   4285  O O   . VAL B 1 148 ? 60.338 33.998  31.822  1.00 32.68  ? 145 VAL C O   1 
ATOM   4286  C CB  . VAL B 1 148 ? 57.869 35.879  32.246  1.00 36.39  ? 145 VAL C CB  1 
ATOM   4287  C CG1 . VAL B 1 148 ? 58.152 36.587  30.928  1.00 31.52  ? 145 VAL C CG1 1 
ATOM   4288  C CG2 . VAL B 1 148 ? 56.497 36.264  32.776  1.00 39.33  ? 145 VAL C CG2 1 
ATOM   4289  N N   . VAL B 1 149 ? 59.034 33.625  30.024  1.00 30.98  ? 146 VAL C N   1 
ATOM   4290  C CA  . VAL B 1 149 ? 60.151 33.490  29.094  1.00 30.62  ? 146 VAL C CA  1 
ATOM   4291  C C   . VAL B 1 149 ? 60.292 34.831  28.383  1.00 35.20  ? 146 VAL C C   1 
ATOM   4292  O O   . VAL B 1 149 ? 59.474 35.153  27.509  1.00 30.76  ? 146 VAL C O   1 
ATOM   4293  C CB  . VAL B 1 149 ? 59.926 32.333  28.108  1.00 35.86  ? 146 VAL C CB  1 
ATOM   4294  C CG1 . VAL B 1 149 ? 61.047 32.282  27.080  1.00 31.47  ? 146 VAL C CG1 1 
ATOM   4295  C CG2 . VAL B 1 149 ? 59.828 31.015  28.862  1.00 30.03  ? 146 VAL C CG2 1 
ATOM   4296  N N   . PRO B 1 150 ? 61.294 35.648  28.729  1.00 35.28  ? 147 PRO C N   1 
ATOM   4297  C CA  . PRO B 1 150 ? 61.313 37.034  28.234  1.00 33.96  ? 147 PRO C CA  1 
ATOM   4298  C C   . PRO B 1 150 ? 61.700 37.158  26.775  1.00 35.16  ? 147 PRO C C   1 
ATOM   4299  O O   . PRO B 1 150 ? 61.440 38.206  26.171  1.00 39.11  ? 147 PRO C O   1 
ATOM   4300  C CB  . PRO B 1 150 ? 62.346 37.712  29.143  1.00 30.16  ? 147 PRO C CB  1 
ATOM   4301  C CG  . PRO B 1 150 ? 63.302 36.615  29.472  1.00 37.15  ? 147 PRO C CG  1 
ATOM   4302  C CD  . PRO B 1 150 ? 62.470 35.347  29.567  1.00 39.73  ? 147 PRO C CD  1 
ATOM   4303  N N   . GLY B 1 151 ? 62.307 36.135  26.191  1.00 33.13  ? 148 GLY C N   1 
ATOM   4304  C CA  . GLY B 1 151 ? 62.749 36.201  24.824  1.00 31.02  ? 148 GLY C CA  1 
ATOM   4305  C C   . GLY B 1 151 ? 63.270 34.863  24.355  1.00 38.24  ? 148 GLY C C   1 
ATOM   4306  O O   . GLY B 1 151 ? 63.128 33.846  25.040  1.00 41.23  ? 148 GLY C O   1 
ATOM   4307  N N   . PRO B 1 152 ? 63.886 34.840  23.173  1.00 35.50  ? 149 PRO C N   1 
ATOM   4308  C CA  . PRO B 1 152 ? 64.354 33.569  22.611  1.00 37.45  ? 149 PRO C CA  1 
ATOM   4309  C C   . PRO B 1 152 ? 65.322 32.859  23.544  1.00 43.01  ? 149 PRO C C   1 
ATOM   4310  O O   . PRO B 1 152 ? 66.011 33.479  24.358  1.00 39.46  ? 149 PRO C O   1 
ATOM   4311  C CB  . PRO B 1 152 ? 65.036 33.988  21.303  1.00 38.71  ? 149 PRO C CB  1 
ATOM   4312  C CG  . PRO B 1 152 ? 64.351 35.271  20.925  1.00 38.23  ? 149 PRO C CG  1 
ATOM   4313  C CD  . PRO B 1 152 ? 64.078 35.963  22.238  1.00 36.35  ? 149 PRO C CD  1 
ATOM   4314  N N   . GLY B 1 153 ? 65.352 31.536  23.426  1.00 36.44  ? 150 GLY C N   1 
ATOM   4315  C CA  . GLY B 1 153 ? 66.159 30.715  24.302  1.00 36.03  ? 150 GLY C CA  1 
ATOM   4316  C C   . GLY B 1 153 ? 65.501 29.387  24.609  1.00 41.36  ? 150 GLY C C   1 
ATOM   4317  O O   . GLY B 1 153 ? 64.375 29.125  24.175  1.00 39.00  ? 150 GLY C O   1 
ATOM   4318  N N   . LYS B 1 154 ? 66.187 28.549  25.377  1.00 36.42  ? 151 LYS C N   1 
ATOM   4319  C CA  . LYS B 1 154 ? 65.793 27.165  25.585  1.00 37.47  ? 151 LYS C CA  1 
ATOM   4320  C C   . LYS B 1 154 ? 65.286 26.967  27.007  1.00 35.87  ? 151 LYS C C   1 
ATOM   4321  O O   . LYS B 1 154 ? 65.936 27.394  27.968  1.00 39.18  ? 151 LYS C O   1 
ATOM   4322  C CB  . LYS B 1 154 ? 66.975 26.234  25.305  1.00 38.60  ? 151 LYS C CB  1 
ATOM   4323  C CG  . LYS B 1 154 ? 66.726 24.772  25.617  1.00 42.55  ? 151 LYS C CG  1 
ATOM   4324  C CD  . LYS B 1 154 ? 68.025 23.977  25.559  1.00 46.73  ? 151 LYS C CD  1 
ATOM   4325  C CE  . LYS B 1 154 ? 68.532 23.820  24.137  1.00 56.17  ? 151 LYS C CE  1 
ATOM   4326  N NZ  . LYS B 1 154 ? 69.697 22.892  24.080  1.00 64.16  ? 151 LYS C NZ  1 
ATOM   4327  N N   . VAL B 1 155 ? 64.125 26.328  27.134  1.00 33.53  ? 152 VAL C N   1 
ATOM   4328  C CA  . VAL B 1 155 ? 63.594 25.885  28.417  1.00 30.55  ? 152 VAL C CA  1 
ATOM   4329  C C   . VAL B 1 155 ? 63.753 24.373  28.494  1.00 35.51  ? 152 VAL C C   1 
ATOM   4330  O O   . VAL B 1 155 ? 63.298 23.647  27.601  1.00 32.84  ? 152 VAL C O   1 
ATOM   4331  C CB  . VAL B 1 155 ? 62.122 26.292  28.605  1.00 30.30  ? 152 VAL C CB  1 
ATOM   4332  C CG1 . VAL B 1 155 ? 61.545 25.625  29.848  1.00 25.48  ? 152 VAL C CG1 1 
ATOM   4333  C CG2 . VAL B 1 155 ? 61.993 27.805  28.712  1.00 27.44  ? 152 VAL C CG2 1 
ATOM   4334  N N   . GLU B 1 156 ? 64.409 23.905  29.554  1.00 31.00  ? 153 GLU C N   1 
ATOM   4335  C CA  . GLU B 1 156 ? 64.634 22.488  29.793  1.00 34.04  ? 153 GLU C CA  1 
ATOM   4336  C C   . GLU B 1 156 ? 64.148 22.131  31.188  1.00 32.49  ? 153 GLU C C   1 
ATOM   4337  O O   . GLU B 1 156 ? 64.158 22.965  32.098  1.00 29.86  ? 153 GLU C O   1 
ATOM   4338  C CB  . GLU B 1 156 ? 66.118 22.116  29.679  1.00 33.32  ? 153 GLU C CB  1 
ATOM   4339  C CG  . GLU B 1 156 ? 66.700 22.203  28.288  1.00 37.22  ? 153 GLU C CG  1 
ATOM   4340  C CD  . GLU B 1 156 ? 68.196 21.945  28.278  1.00 43.72  ? 153 GLU C CD  1 
ATOM   4341  O OE1 . GLU B 1 156 ? 68.687 21.297  27.330  1.00 43.70  ? 153 GLU C OE1 1 
ATOM   4342  O OE2 . GLU B 1 156 ? 68.881 22.391  29.224  1.00 52.96  ? 153 GLU C OE2 1 
ATOM   4343  N N   . ILE B 1 157 ? 63.738 20.878  31.354  1.00 27.34  ? 154 ILE C N   1 
ATOM   4344  C CA  . ILE B 1 157 ? 63.399 20.317  32.656  1.00 34.75  ? 154 ILE C CA  1 
ATOM   4345  C C   . ILE B 1 157 ? 64.292 19.102  32.877  1.00 35.12  ? 154 ILE C C   1 
ATOM   4346  O O   . ILE B 1 157 ? 64.443 18.263  31.981  1.00 35.58  ? 154 ILE C O   1 
ATOM   4347  C CB  . ILE B 1 157 ? 61.900 19.965  32.759  1.00 33.94  ? 154 ILE C CB  1 
ATOM   4348  C CG1 . ILE B 1 157 ? 61.533 19.573  34.193  1.00 31.21  ? 154 ILE C CG1 1 
ATOM   4349  C CG2 . ILE B 1 157 ? 61.502 18.869  31.772  1.00 32.64  ? 154 ILE C CG2 1 
ATOM   4350  C CD1 . ILE B 1 157 ? 60.049 19.688  34.485  1.00 30.90  ? 154 ILE C CD1 1 
ATOM   4351  N N   . THR B 1 158 ? 64.917 19.032  34.052  1.00 31.59  ? 155 THR C N   1 
ATOM   4352  C CA  . THR B 1 158 ? 65.942 18.035  34.327  1.00 37.81  ? 155 THR C CA  1 
ATOM   4353  C C   . THR B 1 158 ? 65.671 17.325  35.646  1.00 38.38  ? 155 THR C C   1 
ATOM   4354  O O   . THR B 1 158 ? 65.147 17.914  36.595  1.00 33.18  ? 155 THR C O   1 
ATOM   4355  C CB  . THR B 1 158 ? 67.349 18.658  34.388  1.00 38.23  ? 155 THR C CB  1 
ATOM   4356  O OG1 . THR B 1 158 ? 67.405 19.610  35.458  1.00 40.53  ? 155 THR C OG1 1 
ATOM   4357  C CG2 . THR B 1 158 ? 67.707 19.344  33.071  1.00 37.13  ? 155 THR C CG2 1 
ATOM   4358  N N   . TYR B 1 159 ? 66.056 16.053  35.693  1.00 36.77  ? 156 TYR C N   1 
ATOM   4359  C CA  . TYR B 1 159 ? 66.025 15.244  36.905  1.00 33.92  ? 156 TYR C CA  1 
ATOM   4360  C C   . TYR B 1 159 ? 67.456 14.898  37.289  1.00 30.98  ? 156 TYR C C   1 
ATOM   4361  O O   . TYR B 1 159 ? 68.188 14.306  36.489  1.00 32.81  ? 156 TYR C O   1 
ATOM   4362  C CB  . TYR B 1 159 ? 65.210 13.968  36.698  1.00 31.84  ? 156 TYR C CB  1 
ATOM   4363  C CG  . TYR B 1 159 ? 65.405 12.944  37.797  1.00 32.00  ? 156 TYR C CG  1 
ATOM   4364  C CD1 . TYR B 1 159 ? 65.046 13.232  39.108  1.00 31.69  ? 156 TYR C CD1 1 
ATOM   4365  C CD2 . TYR B 1 159 ? 65.955 11.695  37.527  1.00 32.70  ? 156 TYR C CD2 1 
ATOM   4366  C CE1 . TYR B 1 159 ? 65.223 12.307  40.119  1.00 34.10  ? 156 TYR C CE1 1 
ATOM   4367  C CE2 . TYR B 1 159 ? 66.138 10.760  38.535  1.00 33.13  ? 156 TYR C CE2 1 
ATOM   4368  C CZ  . TYR B 1 159 ? 65.768 11.072  39.829  1.00 38.56  ? 156 TYR C CZ  1 
ATOM   4369  O OH  . TYR B 1 159 ? 65.942 10.154  40.839  1.00 34.80  ? 156 TYR C OH  1 
ATOM   4370  N N   . THR B 1 160 ? 67.851 15.261  38.502  1.00 30.97  ? 157 THR C N   1 
ATOM   4371  C CA  . THR B 1 160 ? 69.189 14.955  39.006  1.00 33.31  ? 157 THR C CA  1 
ATOM   4372  C C   . THR B 1 160 ? 69.080 13.984  40.169  1.00 30.93  ? 157 THR C C   1 
ATOM   4373  O O   . THR B 1 160 ? 68.637 14.385  41.263  1.00 36.20  ? 157 THR C O   1 
ATOM   4374  C CB  . THR B 1 160 ? 69.917 16.225  39.445  1.00 36.32  ? 157 THR C CB  1 
ATOM   4375  O OG1 . THR B 1 160 ? 70.052 17.112  38.327  1.00 35.97  ? 157 THR C OG1 1 
ATOM   4376  C CG2 . THR B 1 160 ? 71.300 15.880  39.986  1.00 33.10  ? 157 THR C CG2 1 
ATOM   4377  N N   . PRO B 1 161 ? 69.453 12.715  39.991  1.00 36.83  ? 158 PRO C N   1 
ATOM   4378  C CA  . PRO B 1 161 ? 69.333 11.750  41.090  1.00 35.65  ? 158 PRO C CA  1 
ATOM   4379  C C   . PRO B 1 161 ? 70.156 12.175  42.296  1.00 35.13  ? 158 PRO C C   1 
ATOM   4380  O O   . PRO B 1 161 ? 71.211 12.800  42.168  1.00 31.73  ? 158 PRO C O   1 
ATOM   4381  C CB  . PRO B 1 161 ? 69.870 10.448  40.481  1.00 34.89  ? 158 PRO C CB  1 
ATOM   4382  C CG  . PRO B 1 161 ? 69.696 10.617  39.009  1.00 34.29  ? 158 PRO C CG  1 
ATOM   4383  C CD  . PRO B 1 161 ? 69.942 12.081  38.754  1.00 31.78  ? 158 PRO C CD  1 
ATOM   4384  N N   . SER B 1 162 ? 69.654 11.835  43.482  1.00 35.32  ? 159 SER C N   1 
ATOM   4385  C CA  . SER B 1 162 ? 70.339 12.193  44.716  1.00 38.58  ? 159 SER C CA  1 
ATOM   4386  C C   . SER B 1 162 ? 71.531 11.292  45.020  1.00 35.56  ? 159 SER C C   1 
ATOM   4387  O O   . SER B 1 162 ? 72.287 11.594  45.950  1.00 36.21  ? 159 SER C O   1 
ATOM   4388  C CB  . SER B 1 162 ? 69.361 12.157  45.892  1.00 36.83  ? 159 SER C CB  1 
ATOM   4389  O OG  . SER B 1 162 ? 68.897 10.840  46.132  1.00 40.35  ? 159 SER C OG  1 
ATOM   4390  N N   . ASP B 1 163 ? 71.725 10.210  44.265  1.00 35.21  ? 160 ASP C N   1 
ATOM   4391  C CA  . ASP B 1 163 ? 72.819 9.278   44.510  1.00 41.56  ? 160 ASP C CA  1 
ATOM   4392  C C   . ASP B 1 163 ? 74.033 9.537   43.626  1.00 41.89  ? 160 ASP C C   1 
ATOM   4393  O O   . ASP B 1 163 ? 74.900 8.664   43.512  1.00 39.61  ? 160 ASP C O   1 
ATOM   4394  C CB  . ASP B 1 163 ? 72.342 7.833   44.331  1.00 35.33  ? 160 ASP C CB  1 
ATOM   4395  C CG  . ASP B 1 163 ? 71.841 7.546   42.924  1.00 35.58  ? 160 ASP C CG  1 
ATOM   4396  O OD1 . ASP B 1 163 ? 71.925 8.438   42.054  1.00 33.66  ? 160 ASP C OD1 1 
ATOM   4397  O OD2 . ASP B 1 163 ? 71.359 6.418   42.686  1.00 34.17  ? 160 ASP C OD2 1 
ATOM   4398  N N   . GLY B 1 164 ? 74.108 10.703  42.989  1.00 38.54  ? 161 GLY C N   1 
ATOM   4399  C CA  . GLY B 1 164 ? 75.254 11.058  42.179  1.00 39.56  ? 161 GLY C CA  1 
ATOM   4400  C C   . GLY B 1 164 ? 75.256 10.508  40.768  1.00 35.24  ? 161 GLY C C   1 
ATOM   4401  O O   . GLY B 1 164 ? 76.207 10.773  40.020  1.00 38.04  ? 161 GLY C O   1 
ATOM   4402  N N   . THR B 1 165 ? 74.230 9.758   40.373  1.00 34.19  ? 162 THR C N   1 
ATOM   4403  C CA  . THR B 1 165 ? 74.206 9.214   39.025  1.00 41.17  ? 162 THR C CA  1 
ATOM   4404  C C   . THR B 1 165 ? 73.774 10.281  38.018  1.00 40.00  ? 162 THR C C   1 
ATOM   4405  O O   . THR B 1 165 ? 73.431 11.416  38.366  1.00 31.80  ? 162 THR C O   1 
ATOM   4406  C CB  . THR B 1 165 ? 73.283 8.000   38.952  1.00 38.78  ? 162 THR C CB  1 
ATOM   4407  O OG1 . THR B 1 165 ? 72.072 8.273   39.671  1.00 36.54  ? 162 THR C OG1 1 
ATOM   4408  C CG2 . THR B 1 165 ? 73.964 6.781   39.558  1.00 39.39  ? 162 THR C CG2 1 
ATOM   4409  N N   . GLN B 1 166 ? 73.778 9.881   36.749  1.00 40.40  ? 163 GLN C N   1 
ATOM   4410  C CA  . GLN B 1 166 ? 73.644 10.809  35.632  1.00 44.21  ? 163 GLN C CA  1 
ATOM   4411  C C   . GLN B 1 166 ? 72.280 11.492  35.618  1.00 36.67  ? 163 GLN C C   1 
ATOM   4412  O O   . GLN B 1 166 ? 71.240 10.830  35.679  1.00 40.25  ? 163 GLN C O   1 
ATOM   4413  C CB  . GLN B 1 166 ? 73.871 10.051  34.325  1.00 40.17  ? 163 GLN C CB  1 
ATOM   4414  C CG  . GLN B 1 166 ? 73.665 10.873  33.072  1.00 51.94  ? 163 GLN C CG  1 
ATOM   4415  C CD  . GLN B 1 166 ? 74.792 11.848  32.819  1.00 57.36  ? 163 GLN C CD  1 
ATOM   4416  O OE1 . GLN B 1 166 ? 75.920 11.644  33.269  1.00 65.54  ? 163 GLN C OE1 1 
ATOM   4417  N NE2 . GLN B 1 166 ? 74.495 12.913  32.085  1.00 57.34  ? 163 GLN C NE2 1 
ATOM   4418  N N   . LYS B 1 167 ? 72.291 12.819  35.523  1.00 35.63  ? 164 LYS C N   1 
ATOM   4419  C CA  . LYS B 1 167 ? 71.053 13.570  35.386  1.00 39.89  ? 164 LYS C CA  1 
ATOM   4420  C C   . LYS B 1 167 ? 70.447 13.361  34.001  1.00 37.56  ? 164 LYS C C   1 
ATOM   4421  O O   . LYS B 1 167 ? 71.146 13.084  33.023  1.00 35.80  ? 164 LYS C O   1 
ATOM   4422  C CB  . LYS B 1 167 ? 71.295 15.059  35.628  1.00 34.82  ? 164 LYS C CB  1 
ATOM   4423  C CG  . LYS B 1 167 ? 72.217 15.710  34.612  1.00 43.45  ? 164 LYS C CG  1 
ATOM   4424  C CD  . LYS B 1 167 ? 72.333 17.210  34.840  1.00 51.01  ? 164 LYS C CD  1 
ATOM   4425  C CE  . LYS B 1 167 ? 70.986 17.903  34.695  1.00 50.90  ? 164 LYS C CE  1 
ATOM   4426  N NZ  . LYS B 1 167 ? 71.120 19.388  34.734  1.00 60.77  ? 164 LYS C NZ  1 
ATOM   4427  N N   . VAL B 1 168 ? 69.125 13.498  33.931  1.00 36.14  ? 165 VAL C N   1 
ATOM   4428  C CA  . VAL B 1 168 ? 68.359 13.300  32.706  1.00 32.48  ? 165 VAL C CA  1 
ATOM   4429  C C   . VAL B 1 168 ? 67.724 14.628  32.319  1.00 35.72  ? 165 VAL C C   1 
ATOM   4430  O O   . VAL B 1 168 ? 67.093 15.288  33.154  1.00 35.42  ? 165 VAL C O   1 
ATOM   4431  C CB  . VAL B 1 168 ? 67.287 12.210  32.883  1.00 39.82  ? 165 VAL C CB  1 
ATOM   4432  C CG1 . VAL B 1 168 ? 66.596 11.918  31.558  1.00 36.88  ? 165 VAL C CG1 1 
ATOM   4433  C CG2 . VAL B 1 168 ? 67.908 10.946  33.462  1.00 36.77  ? 165 VAL C CG2 1 
ATOM   4434  N N   . THR B 1 169 ? 67.882 15.012  31.056  1.00 41.48  ? 166 THR C N   1 
ATOM   4435  C CA  . THR B 1 169 ? 67.432 16.304  30.560  1.00 38.86  ? 166 THR C CA  1 
ATOM   4436  C C   . THR B 1 169 ? 66.337 16.110  29.520  1.00 36.90  ? 166 THR C C   1 
ATOM   4437  O O   . THR B 1 169 ? 66.498 15.324  28.580  1.00 34.82  ? 166 THR C O   1 
ATOM   4438  C CB  . THR B 1 169 ? 68.597 17.093  29.958  1.00 37.08  ? 166 THR C CB  1 
ATOM   4439  O OG1 . THR B 1 169 ? 69.582 17.337  30.969  1.00 43.30  ? 166 THR C OG1 1 
ATOM   4440  C CG2 . THR B 1 169 ? 68.112 18.427  29.400  1.00 39.45  ? 166 THR C CG2 1 
ATOM   4441  N N   . TYR B 1 170 ? 65.229 16.827  29.696  1.00 35.96  ? 167 TYR C N   1 
ATOM   4442  C CA  . TYR B 1 170 ? 64.116 16.830  28.757  1.00 39.76  ? 167 TYR C CA  1 
ATOM   4443  C C   . TYR B 1 170 ? 63.953 18.232  28.192  1.00 37.25  ? 167 TYR C C   1 
ATOM   4444  O O   . TYR B 1 170 ? 63.882 19.204  28.952  1.00 36.22  ? 167 TYR C O   1 
ATOM   4445  C CB  . TYR B 1 170 ? 62.808 16.404  29.434  1.00 34.92  ? 167 TYR C CB  1 
ATOM   4446  C CG  . TYR B 1 170 ? 62.832 15.033  30.065  1.00 41.66  ? 167 TYR C CG  1 
ATOM   4447  C CD1 . TYR B 1 170 ? 63.315 14.849  31.353  1.00 40.77  ? 167 TYR C CD1 1 
ATOM   4448  C CD2 . TYR B 1 170 ? 62.353 13.925  29.379  1.00 40.39  ? 167 TYR C CD2 1 
ATOM   4449  C CE1 . TYR B 1 170 ? 63.332 13.599  31.936  1.00 37.60  ? 167 TYR C CE1 1 
ATOM   4450  C CE2 . TYR B 1 170 ? 62.366 12.670  29.954  1.00 39.79  ? 167 TYR C CE2 1 
ATOM   4451  C CZ  . TYR B 1 170 ? 62.858 12.514  31.233  1.00 43.59  ? 167 TYR C CZ  1 
ATOM   4452  O OH  . TYR B 1 170 ? 62.875 11.268  31.815  1.00 38.83  ? 167 TYR C OH  1 
ATOM   4453  N N   . LEU B 1 171 ? 63.886 18.338  26.868  1.00 38.89  ? 168 LEU C N   1 
ATOM   4454  C CA  . LEU B 1 171 ? 63.589 19.622  26.251  1.00 37.30  ? 168 LEU C CA  1 
ATOM   4455  C C   . LEU B 1 171 ? 62.108 19.943  26.406  1.00 36.27  ? 168 LEU C C   1 
ATOM   4456  O O   . LEU B 1 171 ? 61.246 19.116  26.092  1.00 34.38  ? 168 LEU C O   1 
ATOM   4457  C CB  . LEU B 1 171 ? 63.971 19.615  24.772  1.00 35.20  ? 168 LEU C CB  1 
ATOM   4458  C CG  . LEU B 1 171 ? 63.559 20.882  24.014  1.00 42.15  ? 168 LEU C CG  1 
ATOM   4459  C CD1 . LEU B 1 171 ? 64.241 22.115  24.600  1.00 33.11  ? 168 LEU C CD1 1 
ATOM   4460  C CD2 . LEU B 1 171 ? 63.847 20.756  22.523  1.00 36.66  ? 168 LEU C CD2 1 
ATOM   4461  N N   . VAL B 1 172 ? 61.813 21.140  26.905  1.00 29.27  ? 169 VAL C N   1 
ATOM   4462  C CA  . VAL B 1 172 ? 60.437 21.618  26.953  1.00 30.40  ? 169 VAL C CA  1 
ATOM   4463  C C   . VAL B 1 172 ? 60.146 22.359  25.657  1.00 33.45  ? 169 VAL C C   1 
ATOM   4464  O O   . VAL B 1 172 ? 59.213 22.008  24.926  1.00 31.79  ? 169 VAL C O   1 
ATOM   4465  C CB  . VAL B 1 172 ? 60.184 22.517  28.177  1.00 34.48  ? 169 VAL C CB  1 
ATOM   4466  C CG1 . VAL B 1 172 ? 58.743 23.007  28.185  1.00 34.13  ? 169 VAL C CG1 1 
ATOM   4467  C CG2 . VAL B 1 172 ? 60.506 21.767  29.462  1.00 29.26  ? 169 VAL C CG2 1 
ATOM   4468  N N   . HIS B 1 173 ? 60.952 23.376  25.356  1.00 35.43  ? 170 HIS C N   1 
ATOM   4469  C CA  . HIS B 1 173 ? 60.719 24.163  24.155  1.00 36.82  ? 170 HIS C CA  1 
ATOM   4470  C C   . HIS B 1 173 ? 61.931 25.031  23.851  1.00 38.44  ? 170 HIS C C   1 
ATOM   4471  O O   . HIS B 1 173 ? 62.556 25.583  24.761  1.00 32.01  ? 170 HIS C O   1 
ATOM   4472  C CB  . HIS B 1 173 ? 59.473 25.047  24.299  1.00 32.62  ? 170 HIS C CB  1 
ATOM   4473  C CG  . HIS B 1 173 ? 59.042 25.683  23.015  1.00 42.60  ? 170 HIS C CG  1 
ATOM   4474  N ND1 . HIS B 1 173 ? 58.749 24.950  21.884  1.00 40.15  ? 170 HIS C ND1 1 
ATOM   4475  C CD2 . HIS B 1 173 ? 58.867 26.982  22.677  1.00 35.62  ? 170 HIS C CD2 1 
ATOM   4476  C CE1 . HIS B 1 173 ? 58.408 25.770  20.906  1.00 35.90  ? 170 HIS C CE1 1 
ATOM   4477  N NE2 . HIS B 1 173 ? 58.472 27.009  21.361  1.00 36.97  ? 170 HIS C NE2 1 
ATOM   4478  N N   . ASN B 1 174 ? 62.244 25.144  22.566  1.00 35.04  ? 171 ASN C N   1 
ATOM   4479  C CA  . ASN B 1 174 ? 63.189 26.130  22.062  1.00 39.44  ? 171 ASN C CA  1 
ATOM   4480  C C   . ASN B 1 174 ? 62.385 27.318  21.549  1.00 38.50  ? 171 ASN C C   1 
ATOM   4481  O O   . ASN B 1 174 ? 61.728 27.225  20.507  1.00 40.54  ? 171 ASN C O   1 
ATOM   4482  C CB  . ASN B 1 174 ? 64.056 25.546  20.949  1.00 36.53  ? 171 ASN C CB  1 
ATOM   4483  C CG  . ASN B 1 174 ? 65.146 24.636  21.471  1.00 55.66  ? 171 ASN C CG  1 
ATOM   4484  O OD1 . ASN B 1 174 ? 65.850 24.970  22.425  1.00 54.94  ? 171 ASN C OD1 1 
ATOM   4485  N ND2 . ASN B 1 174 ? 65.301 23.479  20.838  1.00 56.20  ? 171 ASN C ND2 1 
ATOM   4486  N N   . PHE B 1 175 ? 62.422 28.426  22.282  1.00 31.04  ? 172 PHE C N   1 
ATOM   4487  C CA  . PHE B 1 175 ? 61.818 29.665  21.808  1.00 37.14  ? 172 PHE C CA  1 
ATOM   4488  C C   . PHE B 1 175 ? 62.765 30.286  20.787  1.00 42.14  ? 172 PHE C C   1 
ATOM   4489  O O   . PHE B 1 175 ? 63.818 30.820  21.153  1.00 35.44  ? 172 PHE C O   1 
ATOM   4490  C CB  . PHE B 1 175 ? 61.547 30.620  22.968  1.00 38.52  ? 172 PHE C CB  1 
ATOM   4491  C CG  . PHE B 1 175 ? 60.510 30.124  23.944  1.00 37.34  ? 172 PHE C CG  1 
ATOM   4492  C CD1 . PHE B 1 175 ? 60.825 29.154  24.884  1.00 31.67  ? 172 PHE C CD1 1 
ATOM   4493  C CD2 . PHE B 1 175 ? 59.221 30.635  23.925  1.00 34.56  ? 172 PHE C CD2 1 
ATOM   4494  C CE1 . PHE B 1 175 ? 59.872 28.699  25.783  1.00 30.77  ? 172 PHE C CE1 1 
ATOM   4495  C CE2 . PHE B 1 175 ? 58.264 30.186  24.822  1.00 33.08  ? 172 PHE C CE2 1 
ATOM   4496  C CZ  . PHE B 1 175 ? 58.592 29.216  25.752  1.00 30.99  ? 172 PHE C CZ  1 
ATOM   4497  N N   . GLU B 1 176 ? 62.409 30.199  19.505  1.00 43.28  ? 173 GLU C N   1 
ATOM   4498  C CA  . GLU B 1 176 ? 63.279 30.704  18.448  1.00 46.71  ? 173 GLU C CA  1 
ATOM   4499  C C   . GLU B 1 176 ? 63.089 32.195  18.197  1.00 47.21  ? 173 GLU C C   1 
ATOM   4500  O O   . GLU B 1 176 ? 64.069 32.911  17.961  1.00 54.77  ? 173 GLU C O   1 
ATOM   4501  C CB  . GLU B 1 176 ? 63.050 29.919  17.155  1.00 48.26  ? 173 GLU C CB  1 
ATOM   4502  C CG  . GLU B 1 176 ? 63.748 28.567  17.135  1.00 54.93  ? 173 GLU C CG  1 
ATOM   4503  C CD  . GLU B 1 176 ? 63.439 27.762  15.888  1.00 64.78  ? 173 GLU C CD  1 
ATOM   4504  O OE1 . GLU B 1 176 ? 62.575 28.196  15.097  1.00 73.67  ? 173 GLU C OE1 1 
ATOM   4505  O OE2 . GLU B 1 176 ? 64.059 26.694  15.701  1.00 67.52  ? 173 GLU C OE2 1 
ATOM   4506  N N   . GLU B 1 177 ? 61.849 32.680  18.234  1.00 43.12  ? 174 GLU C N   1 
ATOM   4507  C CA  . GLU B 1 177 ? 61.569 34.106  18.150  1.00 48.75  ? 174 GLU C CA  1 
ATOM   4508  C C   . GLU B 1 177 ? 60.515 34.463  19.185  1.00 46.34  ? 174 GLU C C   1 
ATOM   4509  O O   . GLU B 1 177 ? 59.561 33.709  19.399  1.00 52.11  ? 174 GLU C O   1 
ATOM   4510  C CB  . GLU B 1 177 ? 61.103 34.523  16.747  1.00 57.62  ? 174 GLU C CB  1 
ATOM   4511  C CG  . GLU B 1 177 ? 59.819 33.864  16.268  1.00 65.96  ? 174 GLU C CG  1 
ATOM   4512  C CD  . GLU B 1 177 ? 60.078 32.779  15.245  1.00 76.09  ? 174 GLU C CD  1 
ATOM   4513  O OE1 . GLU B 1 177 ? 59.130 32.041  14.903  1.00 78.24  ? 174 GLU C OE1 1 
ATOM   4514  O OE2 . GLU B 1 177 ? 61.235 32.665  14.784  1.00 75.30  ? 174 GLU C OE2 1 
ATOM   4515  N N   . GLY B 1 178 ? 60.698 35.604  19.834  1.00 40.20  ? 175 GLY C N   1 
ATOM   4516  C CA  . GLY B 1 178 ? 59.789 36.029  20.878  1.00 43.99  ? 175 GLY C CA  1 
ATOM   4517  C C   . GLY B 1 178 ? 59.934 35.188  22.135  1.00 44.50  ? 175 GLY C C   1 
ATOM   4518  O O   . GLY B 1 178 ? 60.720 34.244  22.220  1.00 41.79  ? 175 GLY C O   1 
ATOM   4519  N N   . GLY B 1 179 ? 59.146 35.558  23.136  1.00 36.05  ? 176 GLY C N   1 
ATOM   4520  C CA  . GLY B 1 179 ? 59.153 34.840  24.390  1.00 38.85  ? 176 GLY C CA  1 
ATOM   4521  C C   . GLY B 1 179 ? 57.839 34.148  24.675  1.00 35.82  ? 176 GLY C C   1 
ATOM   4522  O O   . GLY B 1 179 ? 57.133 33.724  23.754  1.00 35.14  ? 176 GLY C O   1 
ATOM   4523  N N   . GLY B 1 180 ? 57.498 34.036  25.955  1.00 34.37  ? 177 GLY C N   1 
ATOM   4524  C CA  . GLY B 1 180 ? 56.283 33.366  26.362  1.00 31.24  ? 177 GLY C CA  1 
ATOM   4525  C C   . GLY B 1 180 ? 56.301 32.996  27.828  1.00 34.78  ? 177 GLY C C   1 
ATOM   4526  O O   . GLY B 1 180 ? 56.799 33.757  28.663  1.00 38.07  ? 177 GLY C O   1 
ATOM   4527  N N   . VAL B 1 181 ? 55.756 31.823  28.154  1.00 32.06  ? 178 VAL C N   1 
ATOM   4528  C CA  . VAL B 1 181 ? 55.670 31.348  29.527  1.00 27.20  ? 178 VAL C CA  1 
ATOM   4529  C C   . VAL B 1 181 ? 55.954 29.854  29.547  1.00 34.36  ? 178 VAL C C   1 
ATOM   4530  O O   . VAL B 1 181 ? 55.816 29.156  28.540  1.00 34.09  ? 178 VAL C O   1 
ATOM   4531  C CB  . VAL B 1 181 ? 54.290 31.631  30.163  1.00 36.26  ? 178 VAL C CB  1 
ATOM   4532  C CG1 . VAL B 1 181 ? 54.097 33.121  30.373  1.00 34.71  ? 178 VAL C CG1 1 
ATOM   4533  C CG2 . VAL B 1 181 ? 53.171 31.058  29.301  1.00 32.27  ? 178 VAL C CG2 1 
ATOM   4534  N N   . ALA B 1 182 ? 56.357 29.369  30.717  1.00 32.12  ? 179 ALA C N   1 
ATOM   4535  C CA  . ALA B 1 182 ? 56.618 27.952  30.914  1.00 31.36  ? 179 ALA C CA  1 
ATOM   4536  C C   . ALA B 1 182 ? 56.450 27.634  32.390  1.00 37.79  ? 179 ALA C C   1 
ATOM   4537  O O   . ALA B 1 182 ? 56.520 28.520  33.247  1.00 34.17  ? 179 ALA C O   1 
ATOM   4538  C CB  . ALA B 1 182 ? 58.019 27.557  30.432  1.00 30.21  ? 179 ALA C CB  1 
ATOM   4539  N N   . MET B 1 183 ? 56.221 26.357  32.684  1.00 32.01  ? 180 MET C N   1 
ATOM   4540  C CA  . MET B 1 183 ? 56.068 25.954  34.073  1.00 32.69  ? 180 MET C CA  1 
ATOM   4541  C C   . MET B 1 183 ? 56.373 24.473  34.220  1.00 34.18  ? 180 MET C C   1 
ATOM   4542  O O   . MET B 1 183 ? 56.288 23.699  33.261  1.00 29.16  ? 180 MET C O   1 
ATOM   4543  C CB  . MET B 1 183 ? 54.665 26.265  34.607  1.00 35.06  ? 180 MET C CB  1 
ATOM   4544  C CG  . MET B 1 183 ? 53.519 25.702  33.793  1.00 32.95  ? 180 MET C CG  1 
ATOM   4545  S SD  . MET B 1 183 ? 51.953 25.934  34.659  1.00 53.45  ? 180 MET C SD  1 
ATOM   4546  C CE  . MET B 1 183 ? 50.803 26.018  33.290  1.00 47.62  ? 180 MET C CE  1 
ATOM   4547  N N   . GLY B 1 184 ? 56.732 24.100  35.440  1.00 31.35  ? 181 GLY C N   1 
ATOM   4548  C CA  . GLY B 1 184 ? 56.947 22.708  35.798  1.00 32.27  ? 181 GLY C CA  1 
ATOM   4549  C C   . GLY B 1 184 ? 55.990 22.286  36.895  1.00 35.62  ? 181 GLY C C   1 
ATOM   4550  O O   . GLY B 1 184 ? 55.648 23.084  37.770  1.00 35.69  ? 181 GLY C O   1 
ATOM   4551  N N   . MET B 1 185 ? 55.549 21.031  36.831  1.00 37.03  ? 182 MET C N   1 
ATOM   4552  C CA  . MET B 1 185 ? 54.639 20.456  37.811  1.00 36.91  ? 182 MET C CA  1 
ATOM   4553  C C   . MET B 1 185 ? 55.149 19.077  38.206  1.00 33.26  ? 182 MET C C   1 
ATOM   4554  O O   . MET B 1 185 ? 55.982 18.484  37.515  1.00 35.20  ? 182 MET C O   1 
ATOM   4555  C CB  . MET B 1 185 ? 53.208 20.349  37.264  1.00 35.77  ? 182 MET C CB  1 
ATOM   4556  C CG  . MET B 1 185 ? 52.663 21.635  36.667  1.00 48.01  ? 182 MET C CG  1 
ATOM   4557  S SD  . MET B 1 185 ? 51.072 21.388  35.854  1.00 63.46  ? 182 MET C SD  1 
ATOM   4558  C CE  . MET B 1 185 ? 50.006 21.149  37.270  1.00 60.28  ? 182 MET C CE  1 
ATOM   4559  N N   . TYR B 1 186 ? 54.630 18.559  39.318  1.00 36.73  ? 183 TYR C N   1 
ATOM   4560  C CA  . TYR B 1 186 ? 55.108 17.287  39.841  1.00 36.71  ? 183 TYR C CA  1 
ATOM   4561  C C   . TYR B 1 186 ? 54.048 16.666  40.738  1.00 40.98  ? 183 TYR C C   1 
ATOM   4562  O O   . TYR B 1 186 ? 53.146 17.345  41.237  1.00 35.33  ? 183 TYR C O   1 
ATOM   4563  C CB  . TYR B 1 186 ? 56.410 17.461  40.631  1.00 30.30  ? 183 TYR C CB  1 
ATOM   4564  C CG  . TYR B 1 186 ? 56.165 18.031  42.008  1.00 37.91  ? 183 TYR C CG  1 
ATOM   4565  C CD1 . TYR B 1 186 ? 55.987 19.395  42.190  1.00 37.60  ? 183 TYR C CD1 1 
ATOM   4566  C CD2 . TYR B 1 186 ? 56.079 17.202  43.121  1.00 38.05  ? 183 TYR C CD2 1 
ATOM   4567  C CE1 . TYR B 1 186 ? 55.746 19.922  43.444  1.00 32.19  ? 183 TYR C CE1 1 
ATOM   4568  C CE2 . TYR B 1 186 ? 55.832 17.717  44.377  1.00 39.27  ? 183 TYR C CE2 1 
ATOM   4569  C CZ  . TYR B 1 186 ? 55.671 19.078  44.533  1.00 40.39  ? 183 TYR C CZ  1 
ATOM   4570  O OH  . TYR B 1 186 ? 55.431 19.599  45.783  1.00 43.01  ? 183 TYR C OH  1 
ATOM   4571  N N   . ASN B 1 187 ? 54.194 15.359  40.951  1.00 38.98  ? 184 ASN C N   1 
ATOM   4572  C CA  . ASN B 1 187 ? 53.410 14.605  41.917  1.00 43.12  ? 184 ASN C CA  1 
ATOM   4573  C C   . ASN B 1 187 ? 54.269 13.447  42.402  1.00 41.34  ? 184 ASN C C   1 
ATOM   4574  O O   . ASN B 1 187 ? 55.079 12.900  41.648  1.00 35.25  ? 184 ASN C O   1 
ATOM   4575  C CB  . ASN B 1 187 ? 52.099 14.080  41.317  1.00 42.09  ? 184 ASN C CB  1 
ATOM   4576  C CG  . ASN B 1 187 ? 50.888 14.862  41.781  1.00 52.57  ? 184 ASN C CG  1 
ATOM   4577  O OD1 . ASN B 1 187 ? 50.447 14.727  42.922  1.00 53.03  ? 184 ASN C OD1 1 
ATOM   4578  N ND2 . ASN B 1 187 ? 50.340 15.685  40.893  1.00 49.93  ? 184 ASN C ND2 1 
ATOM   4579  N N   . GLN B 1 188 ? 54.095 13.084  43.667  1.00 36.84  ? 185 GLN C N   1 
ATOM   4580  C CA  . GLN B 1 188 ? 54.882 12.027  44.285  1.00 44.26  ? 185 GLN C CA  1 
ATOM   4581  C C   . GLN B 1 188 ? 54.085 10.730  44.334  1.00 43.10  ? 185 GLN C C   1 
ATOM   4582  O O   . GLN B 1 188 ? 52.866 10.747  44.531  1.00 41.79  ? 185 GLN C O   1 
ATOM   4583  C CB  . GLN B 1 188 ? 55.321 12.430  45.695  1.00 45.48  ? 185 GLN C CB  1 
ATOM   4584  C CG  . GLN B 1 188 ? 56.134 13.714  45.734  1.00 42.70  ? 185 GLN C CG  1 
ATOM   4585  C CD  . GLN B 1 188 ? 56.561 14.099  47.135  1.00 46.07  ? 185 GLN C CD  1 
ATOM   4586  O OE1 . GLN B 1 188 ? 55.785 14.677  47.897  1.00 59.49  ? 185 GLN C OE1 1 
ATOM   4587  N NE2 . GLN B 1 188 ? 57.804 13.788  47.481  1.00 46.46  ? 185 GLN C NE2 1 
ATOM   4588  N N   . ASP B 1 189 ? 54.785 9.606   44.138  1.00 41.39  ? 186 ASP C N   1 
ATOM   4589  C CA  . ASP B 1 189 ? 54.154 8.296   44.276  1.00 42.03  ? 186 ASP C CA  1 
ATOM   4590  C C   . ASP B 1 189 ? 53.473 8.156   45.630  1.00 41.19  ? 186 ASP C C   1 
ATOM   4591  O O   . ASP B 1 189 ? 52.346 7.654   45.721  1.00 43.82  ? 186 ASP C O   1 
ATOM   4592  C CB  . ASP B 1 189 ? 55.192 7.187   44.104  1.00 41.11  ? 186 ASP C CB  1 
ATOM   4593  C CG  . ASP B 1 189 ? 55.656 7.029   42.672  1.00 40.73  ? 186 ASP C CG  1 
ATOM   4594  O OD1 . ASP B 1 189 ? 54.962 7.514   41.754  1.00 46.03  ? 186 ASP C OD1 1 
ATOM   4595  O OD2 . ASP B 1 189 ? 56.719 6.408   42.466  1.00 42.37  ? 186 ASP C OD2 1 
ATOM   4596  N N   . LYS B 1 190 ? 54.150 8.594   46.694  1.00 39.38  ? 187 LYS C N   1 
ATOM   4597  C CA  . LYS B 1 190 ? 53.595 8.486   48.038  1.00 50.53  ? 187 LYS C CA  1 
ATOM   4598  C C   . LYS B 1 190 ? 52.253 9.206   48.147  1.00 48.65  ? 187 LYS C C   1 
ATOM   4599  O O   . LYS B 1 190 ? 51.321 8.702   48.786  1.00 44.13  ? 187 LYS C O   1 
ATOM   4600  C CB  . LYS B 1 190 ? 54.603 9.039   49.047  1.00 46.16  ? 187 LYS C CB  1 
ATOM   4601  C CG  . LYS B 1 190 ? 54.002 9.740   50.250  1.00 64.83  ? 187 LYS C CG  1 
ATOM   4602  C CD  . LYS B 1 190 ? 53.693 8.771   51.376  1.00 63.27  ? 187 LYS C CD  1 
ATOM   4603  C CE  . LYS B 1 190 ? 53.415 9.522   52.669  1.00 64.13  ? 187 LYS C CE  1 
ATOM   4604  N NZ  . LYS B 1 190 ? 53.173 8.595   53.807  1.00 72.60  ? 187 LYS C NZ  1 
ATOM   4605  N N   . SER B 1 191 ? 52.130 10.377  47.516  1.00 49.57  ? 188 SER C N   1 
ATOM   4606  C CA  . SER B 1 191 ? 50.863 11.102  47.554  1.00 48.01  ? 188 SER C CA  1 
ATOM   4607  C C   . SER B 1 191 ? 49.807 10.410  46.703  1.00 39.15  ? 188 SER C C   1 
ATOM   4608  O O   . SER B 1 191 ? 48.627 10.382  47.070  1.00 41.22  ? 188 SER C O   1 
ATOM   4609  C CB  . SER B 1 191 ? 51.070 12.545  47.095  1.00 45.57  ? 188 SER C CB  1 
ATOM   4610  O OG  . SER B 1 191 ? 52.048 13.194  47.888  1.00 44.73  ? 188 SER C OG  1 
ATOM   4611  N N   . ILE B 1 192 ? 50.211 9.850   45.562  1.00 40.23  ? 189 ILE C N   1 
ATOM   4612  C CA  . ILE B 1 192 ? 49.280 9.078   44.745  1.00 44.48  ? 189 ILE C CA  1 
ATOM   4613  C C   . ILE B 1 192 ? 48.822 7.833   45.495  1.00 45.07  ? 189 ILE C C   1 
ATOM   4614  O O   . ILE B 1 192 ? 47.649 7.444   45.425  1.00 39.24  ? 189 ILE C O   1 
ATOM   4615  C CB  . ILE B 1 192 ? 49.929 8.714   43.397  1.00 38.96  ? 189 ILE C CB  1 
ATOM   4616  C CG1 . ILE B 1 192 ? 50.340 9.975   42.638  1.00 41.70  ? 189 ILE C CG1 1 
ATOM   4617  C CG2 . ILE B 1 192 ? 48.980 7.875   42.549  1.00 32.74  ? 189 ILE C CG2 1 
ATOM   4618  C CD1 . ILE B 1 192 ? 51.144 9.686   41.388  1.00 36.14  ? 189 ILE C CD1 1 
ATOM   4619  N N   . GLU B 1 193 ? 49.736 7.195   46.231  1.00 41.98  ? 190 GLU C N   1 
ATOM   4620  C CA  . GLU B 1 193 ? 49.393 5.977   46.958  1.00 46.68  ? 190 GLU C CA  1 
ATOM   4621  C C   . GLU B 1 193 ? 48.421 6.273   48.093  1.00 40.85  ? 190 GLU C C   1 
ATOM   4622  O O   . GLU B 1 193 ? 47.442 5.544   48.292  1.00 45.05  ? 190 GLU C O   1 
ATOM   4623  C CB  . GLU B 1 193 ? 50.666 5.311   47.484  1.00 39.65  ? 190 GLU C CB  1 
ATOM   4624  C CG  . GLU B 1 193 ? 51.494 4.622   46.410  1.00 47.11  ? 190 GLU C CG  1 
ATOM   4625  C CD  . GLU B 1 193 ? 52.955 4.483   46.796  1.00 47.04  ? 190 GLU C CD  1 
ATOM   4626  O OE1 . GLU B 1 193 ? 53.295 4.784   47.960  1.00 41.42  ? 190 GLU C OE1 1 
ATOM   4627  O OE2 . GLU B 1 193 ? 53.765 4.077   45.936  1.00 50.36  ? 190 GLU C OE2 1 
ATOM   4628  N N   . ASP B 1 194 ? 48.678 7.341   48.852  1.00 42.37  ? 191 ASP C N   1 
ATOM   4629  C CA  . ASP B 1 194 ? 47.736 7.761   49.885  1.00 45.29  ? 191 ASP C CA  1 
ATOM   4630  C C   . ASP B 1 194 ? 46.384 8.104   49.274  1.00 47.20  ? 191 ASP C C   1 
ATOM   4631  O O   . ASP B 1 194 ? 45.333 7.714   49.797  1.00 49.76  ? 191 ASP C O   1 
ATOM   4632  C CB  . ASP B 1 194 ? 48.299 8.958   50.648  1.00 43.69  ? 191 ASP C CB  1 
ATOM   4633  C CG  . ASP B 1 194 ? 49.567 8.623   51.406  1.00 50.95  ? 191 ASP C CG  1 
ATOM   4634  O OD1 . ASP B 1 194 ? 49.840 7.422   51.610  1.00 56.45  ? 191 ASP C OD1 1 
ATOM   4635  O OD2 . ASP B 1 194 ? 50.289 9.563   51.801  1.00 55.69  ? 191 ASP C OD2 1 
ATOM   4636  N N   . PHE B 1 195 ? 46.401 8.843   48.162  1.00 46.77  ? 192 PHE C N   1 
ATOM   4637  C CA  . PHE B 1 195 ? 45.183 9.148   47.419  1.00 48.88  ? 192 PHE C CA  1 
ATOM   4638  C C   . PHE B 1 195 ? 44.384 7.883   47.129  1.00 42.23  ? 192 PHE C C   1 
ATOM   4639  O O   . PHE B 1 195 ? 43.171 7.831   47.364  1.00 39.92  ? 192 PHE C O   1 
ATOM   4640  C CB  . PHE B 1 195 ? 45.558 9.864   46.120  1.00 44.46  ? 192 PHE C CB  1 
ATOM   4641  C CG  . PHE B 1 195 ? 44.400 10.479  45.389  1.00 43.15  ? 192 PHE C CG  1 
ATOM   4642  C CD1 . PHE B 1 195 ? 43.196 10.735  46.026  1.00 45.59  ? 192 PHE C CD1 1 
ATOM   4643  C CD2 . PHE B 1 195 ? 44.528 10.810  44.049  1.00 39.99  ? 192 PHE C CD2 1 
ATOM   4644  C CE1 . PHE B 1 195 ? 42.141 11.306  45.335  1.00 43.95  ? 192 PHE C CE1 1 
ATOM   4645  C CE2 . PHE B 1 195 ? 43.482 11.378  43.356  1.00 42.75  ? 192 PHE C CE2 1 
ATOM   4646  C CZ  . PHE B 1 195 ? 42.286 11.627  43.998  1.00 45.02  ? 192 PHE C CZ  1 
ATOM   4647  N N   . ALA B 1 196 ? 45.056 6.845   46.628  1.00 34.62  ? 193 ALA C N   1 
ATOM   4648  C CA  . ALA B 1 196 ? 44.367 5.606   46.284  1.00 45.75  ? 193 ALA C CA  1 
ATOM   4649  C C   . ALA B 1 196 ? 43.750 4.958   47.519  1.00 49.56  ? 193 ALA C C   1 
ATOM   4650  O O   . ALA B 1 196 ? 42.544 4.691   47.558  1.00 50.95  ? 193 ALA C O   1 
ATOM   4651  C CB  . ALA B 1 196 ? 45.332 4.643   45.593  1.00 42.97  ? 193 ALA C CB  1 
ATOM   4652  N N   . HIS B 1 197 ? 44.571 4.703   48.544  1.00 44.56  ? 194 HIS C N   1 
ATOM   4653  C CA  . HIS B 1 197 ? 44.083 4.062   49.762  1.00 50.03  ? 194 HIS C CA  1 
ATOM   4654  C C   . HIS B 1 197 ? 42.902 4.820   50.354  1.00 50.46  ? 194 HIS C C   1 
ATOM   4655  O O   . HIS B 1 197 ? 41.862 4.227   50.662  1.00 48.00  ? 194 HIS C O   1 
ATOM   4656  C CB  . HIS B 1 197 ? 45.212 3.958   50.791  1.00 46.53  ? 194 HIS C CB  1 
ATOM   4657  C CG  . HIS B 1 197 ? 46.243 2.925   50.460  1.00 57.07  ? 194 HIS C CG  1 
ATOM   4658  N ND1 . HIS B 1 197 ? 45.962 1.575   50.422  1.00 60.07  ? 194 HIS C ND1 1 
ATOM   4659  C CD2 . HIS B 1 197 ? 47.559 3.043   50.162  1.00 46.24  ? 194 HIS C CD2 1 
ATOM   4660  C CE1 . HIS B 1 197 ? 47.058 0.908   50.108  1.00 59.59  ? 194 HIS C CE1 1 
ATOM   4661  N NE2 . HIS B 1 197 ? 48.041 1.774   49.945  1.00 55.06  ? 194 HIS C NE2 1 
ATOM   4662  N N   . SER B 1 198 ? 43.052 6.137   50.526  1.00 47.68  ? 195 SER C N   1 
ATOM   4663  C CA  . SER B 1 198 ? 41.966 6.947   51.071  1.00 52.36  ? 195 SER C CA  1 
ATOM   4664  C C   . SER B 1 198 ? 40.698 6.799   50.240  1.00 51.89  ? 195 SER C C   1 
ATOM   4665  O O   . SER B 1 198 ? 39.592 6.723   50.787  1.00 50.16  ? 195 SER C O   1 
ATOM   4666  C CB  . SER B 1 198 ? 42.389 8.415   51.140  1.00 55.31  ? 195 SER C CB  1 
ATOM   4667  O OG  . SER B 1 198 ? 43.493 8.591   52.010  1.00 61.16  ? 195 SER C OG  1 
ATOM   4668  N N   . SER B 1 199 ? 40.842 6.742   48.914  1.00 51.49  ? 196 SER C N   1 
ATOM   4669  C CA  . SER B 1 199 ? 39.676 6.606   48.049  1.00 46.52  ? 196 SER C CA  1 
ATOM   4670  C C   . SER B 1 199 ? 39.058 5.219   48.176  1.00 53.17  ? 196 SER C C   1 
ATOM   4671  O O   . SER B 1 199 ? 37.833 5.083   48.283  1.00 49.33  ? 196 SER C O   1 
ATOM   4672  C CB  . SER B 1 199 ? 40.064 6.893   46.599  1.00 41.20  ? 196 SER C CB  1 
ATOM   4673  O OG  . SER B 1 199 ? 40.655 8.175   46.473  1.00 44.55  ? 196 SER C OG  1 
ATOM   4674  N N   . PHE B 1 200 ? 39.892 4.175   48.164  1.00 50.66  ? 197 PHE C N   1 
ATOM   4675  C CA  . PHE B 1 200 ? 39.376 2.817   48.304  1.00 49.40  ? 197 PHE C CA  1 
ATOM   4676  C C   . PHE B 1 200 ? 38.696 2.624   49.654  1.00 54.20  ? 197 PHE C C   1 
ATOM   4677  O O   . PHE B 1 200 ? 37.678 1.928   49.752  1.00 57.82  ? 197 PHE C O   1 
ATOM   4678  C CB  . PHE B 1 200 ? 40.505 1.800   48.126  1.00 48.30  ? 197 PHE C CB  1 
ATOM   4679  C CG  . PHE B 1 200 ? 41.042 1.723   46.723  1.00 47.18  ? 197 PHE C CG  1 
ATOM   4680  C CD1 . PHE B 1 200 ? 40.200 1.473   45.651  1.00 41.54  ? 197 PHE C CD1 1 
ATOM   4681  C CD2 . PHE B 1 200 ? 42.396 1.891   46.479  1.00 48.42  ? 197 PHE C CD2 1 
ATOM   4682  C CE1 . PHE B 1 200 ? 40.698 1.402   44.362  1.00 49.99  ? 197 PHE C CE1 1 
ATOM   4683  C CE2 . PHE B 1 200 ? 42.900 1.822   45.196  1.00 43.55  ? 197 PHE C CE2 1 
ATOM   4684  C CZ  . PHE B 1 200 ? 42.052 1.579   44.135  1.00 43.36  ? 197 PHE C CZ  1 
ATOM   4685  N N   . GLN B 1 201 ? 39.241 3.237   50.708  1.00 52.13  ? 198 GLN C N   1 
ATOM   4686  C CA  . GLN B 1 201 ? 38.659 3.084   52.038  1.00 52.99  ? 198 GLN C CA  1 
ATOM   4687  C C   . GLN B 1 201 ? 37.387 3.906   52.193  1.00 62.60  ? 198 GLN C C   1 
ATOM   4688  O O   . GLN B 1 201 ? 36.488 3.519   52.949  1.00 63.23  ? 198 GLN C O   1 
ATOM   4689  C CB  . GLN B 1 201 ? 39.674 3.481   53.104  1.00 49.17  ? 198 GLN C CB  1 
ATOM   4690  C CG  . GLN B 1 201 ? 40.714 2.416   53.401  1.00 54.51  ? 198 GLN C CG  1 
ATOM   4691  C CD  . GLN B 1 201 ? 41.803 2.929   54.314  1.00 62.93  ? 198 GLN C CD  1 
ATOM   4692  O OE1 . GLN B 1 201 ? 41.809 4.101   54.688  1.00 66.25  ? 198 GLN C OE1 1 
ATOM   4693  N NE2 . GLN B 1 201 ? 42.735 2.056   54.678  1.00 62.22  ? 198 GLN C NE2 1 
ATOM   4694  N N   . MET B 1 202 ? 37.300 5.047   51.506  1.00 57.34  ? 199 MET C N   1 
ATOM   4695  C CA  . MET B 1 202 ? 36.058 5.810   51.509  1.00 54.69  ? 199 MET C CA  1 
ATOM   4696  C C   . MET B 1 202 ? 34.945 5.036   50.815  1.00 50.76  ? 199 MET C C   1 
ATOM   4697  O O   . MET B 1 202 ? 33.786 5.082   51.243  1.00 55.56  ? 199 MET C O   1 
ATOM   4698  C CB  . MET B 1 202 ? 36.275 7.169   50.840  1.00 53.39  ? 199 MET C CB  1 
ATOM   4699  C CG  . MET B 1 202 ? 35.020 8.023   50.738  1.00 49.43  ? 199 MET C CG  1 
ATOM   4700  S SD  . MET B 1 202 ? 34.314 8.367   52.358  1.00 62.65  ? 199 MET C SD  1 
ATOM   4701  C CE  . MET B 1 202 ? 35.439 9.632   52.942  1.00 45.90  ? 199 MET C CE  1 
ATOM   4702  N N   . ALA B 1 203 ? 35.283 4.301   49.752  1.00 46.43  ? 200 ALA C N   1 
ATOM   4703  C CA  . ALA B 1 203 ? 34.263 3.605   48.977  1.00 56.56  ? 200 ALA C CA  1 
ATOM   4704  C C   . ALA B 1 203 ? 33.686 2.426   49.747  1.00 61.18  ? 200 ALA C C   1 
ATOM   4705  O O   . ALA B 1 203 ? 32.482 2.155   49.669  1.00 60.39  ? 200 ALA C O   1 
ATOM   4706  C CB  . ALA B 1 203 ? 34.845 3.135   47.646  1.00 45.88  ? 200 ALA C CB  1 
ATOM   4707  N N   . LEU B 1 204 ? 34.530 1.707   50.489  1.00 60.11  ? 201 LEU C N   1 
ATOM   4708  C CA  . LEU B 1 204 ? 34.048 0.553   51.239  1.00 64.97  ? 201 LEU C CA  1 
ATOM   4709  C C   . LEU B 1 204 ? 33.288 0.998   52.486  1.00 58.44  ? 201 LEU C C   1 
ATOM   4710  O O   . LEU B 1 204 ? 32.281 0.385   52.860  1.00 63.59  ? 201 LEU C O   1 
ATOM   4711  C CB  . LEU B 1 204 ? 35.216 -0.386  51.584  1.00 64.81  ? 201 LEU C CB  1 
ATOM   4712  C CG  . LEU B 1 204 ? 36.470 0.060   52.360  1.00 69.19  ? 201 LEU C CG  1 
ATOM   4713  C CD1 . LEU B 1 204 ? 36.202 0.368   53.839  1.00 67.98  ? 201 LEU C CD1 1 
ATOM   4714  C CD2 . LEU B 1 204 ? 37.654 -0.941  52.189  1.00 68.15  ? 201 LEU C CD2 1 
ATOM   4715  N N   . SER B 1 205 ? 33.725 2.094   53.116  1.00 61.74  ? 202 SER C N   1 
ATOM   4716  C CA  . SER B 1 205 ? 33.003 2.625   54.271  1.00 60.31  ? 202 SER C CA  1 
ATOM   4717  C C   . SER B 1 205 ? 31.592 3.058   53.885  1.00 67.27  ? 202 SER C C   1 
ATOM   4718  O O   . SER B 1 205 ? 30.612 2.722   54.563  1.00 67.12  ? 202 SER C O   1 
ATOM   4719  C CB  . SER B 1 205 ? 33.773 3.800   54.870  1.00 56.71  ? 202 SER C CB  1 
ATOM   4720  O OG  . SER B 1 205 ? 32.898 4.717   55.512  1.00 67.32  ? 202 SER C OG  1 
ATOM   4721  N N   . LYS B 1 206 ? 31.474 3.804   52.789  1.00 65.02  ? 203 LYS C N   1 
ATOM   4722  C CA  . LYS B 1 206 ? 30.179 4.285   52.328  1.00 61.64  ? 203 LYS C CA  1 
ATOM   4723  C C   . LYS B 1 206 ? 29.409 3.220   51.561  1.00 58.39  ? 203 LYS C C   1 
ATOM   4724  O O   . LYS B 1 206 ? 28.184 3.320   51.435  1.00 58.50  ? 203 LYS C O   1 
ATOM   4725  C CB  . LYS B 1 206 ? 30.380 5.530   51.464  1.00 54.66  ? 203 LYS C CB  1 
ATOM   4726  C CG  . LYS B 1 206 ? 30.778 6.729   52.297  1.00 62.86  ? 203 LYS C CG  1 
ATOM   4727  C CD  . LYS B 1 206 ? 29.833 7.877   52.060  1.00 59.12  ? 203 LYS C CD  1 
ATOM   4728  C CE  . LYS B 1 206 ? 28.380 7.444   52.142  1.00 53.94  ? 203 LYS C CE  1 
ATOM   4729  N NZ  . LYS B 1 206 ? 27.466 8.614   52.028  1.00 60.48  ? 203 LYS C NZ  1 
ATOM   4730  N N   . GLY B 1 207 ? 30.098 2.202   51.053  1.00 58.48  ? 204 GLY C N   1 
ATOM   4731  C CA  . GLY B 1 207 ? 29.426 1.161   50.302  1.00 53.24  ? 204 GLY C CA  1 
ATOM   4732  C C   . GLY B 1 207 ? 29.045 1.551   48.893  1.00 56.82  ? 204 GLY C C   1 
ATOM   4733  O O   . GLY B 1 207 ? 28.077 1.011   48.346  1.00 50.41  ? 204 GLY C O   1 
ATOM   4734  N N   . TRP B 1 208 ? 29.773 2.484   48.293  1.00 55.75  ? 205 TRP C N   1 
ATOM   4735  C CA  . TRP B 1 208 ? 29.563 2.940   46.930  1.00 52.20  ? 205 TRP C CA  1 
ATOM   4736  C C   . TRP B 1 208 ? 30.761 2.578   46.060  1.00 47.85  ? 205 TRP C C   1 
ATOM   4737  O O   . TRP B 1 208 ? 31.868 2.367   46.567  1.00 54.81  ? 205 TRP C O   1 
ATOM   4738  C CB  . TRP B 1 208 ? 29.351 4.461   46.891  1.00 52.41  ? 205 TRP C CB  1 
ATOM   4739  C CG  . TRP B 1 208 ? 28.141 4.960   47.627  1.00 57.25  ? 205 TRP C CG  1 
ATOM   4740  C CD1 . TRP B 1 208 ? 27.124 4.213   48.147  1.00 57.69  ? 205 TRP C CD1 1 
ATOM   4741  C CD2 . TRP B 1 208 ? 27.823 6.328   47.919  1.00 60.07  ? 205 TRP C CD2 1 
ATOM   4742  N NE1 . TRP B 1 208 ? 26.195 5.031   48.746  1.00 60.25  ? 205 TRP C NE1 1 
ATOM   4743  C CE2 . TRP B 1 208 ? 26.600 6.333   48.619  1.00 58.29  ? 205 TRP C CE2 1 
ATOM   4744  C CE3 . TRP B 1 208 ? 28.456 7.548   47.655  1.00 52.06  ? 205 TRP C CE3 1 
ATOM   4745  C CZ2 . TRP B 1 208 ? 25.997 7.511   49.059  1.00 51.48  ? 205 TRP C CZ2 1 
ATOM   4746  C CZ3 . TRP B 1 208 ? 27.855 8.716   48.092  1.00 56.16  ? 205 TRP C CZ3 1 
ATOM   4747  C CH2 . TRP B 1 208 ? 26.638 8.690   48.786  1.00 49.18  ? 205 TRP C CH2 1 
ATOM   4748  N N   . PRO B 1 209 ? 30.578 2.487   44.746  1.00 52.39  ? 206 PRO C N   1 
ATOM   4749  C CA  . PRO B 1 209 ? 31.721 2.247   43.858  1.00 51.62  ? 206 PRO C CA  1 
ATOM   4750  C C   . PRO B 1 209 ? 32.593 3.489   43.737  1.00 56.49  ? 206 PRO C C   1 
ATOM   4751  O O   . PRO B 1 209 ? 32.239 4.585   44.178  1.00 49.97  ? 206 PRO C O   1 
ATOM   4752  C CB  . PRO B 1 209 ? 31.067 1.883   42.523  1.00 51.90  ? 206 PRO C CB  1 
ATOM   4753  C CG  . PRO B 1 209 ? 29.739 2.563   42.568  1.00 51.11  ? 206 PRO C CG  1 
ATOM   4754  C CD  . PRO B 1 209 ? 29.303 2.521   44.007  1.00 47.88  ? 206 PRO C CD  1 
ATOM   4755  N N   . LEU B 1 210 ? 33.759 3.301   43.121  1.00 51.59  ? 207 LEU C N   1 
ATOM   4756  C CA  . LEU B 1 210 ? 34.774 4.341   43.033  1.00 47.83  ? 207 LEU C CA  1 
ATOM   4757  C C   . LEU B 1 210 ? 35.264 4.476   41.599  1.00 45.03  ? 207 LEU C C   1 
ATOM   4758  O O   . LEU B 1 210 ? 35.472 3.475   40.906  1.00 40.48  ? 207 LEU C O   1 
ATOM   4759  C CB  . LEU B 1 210 ? 35.959 4.039   43.960  1.00 49.03  ? 207 LEU C CB  1 
ATOM   4760  C CG  . LEU B 1 210 ? 37.220 4.879   43.742  1.00 41.94  ? 207 LEU C CG  1 
ATOM   4761  C CD1 . LEU B 1 210 ? 37.003 6.309   44.208  1.00 38.21  ? 207 LEU C CD1 1 
ATOM   4762  C CD2 . LEU B 1 210 ? 38.421 4.261   44.438  1.00 43.83  ? 207 LEU C CD2 1 
ATOM   4763  N N   . TYR B 1 211 ? 35.452 5.722   41.162  1.00 42.17  ? 208 TYR C N   1 
ATOM   4764  C CA  . TYR B 1 211 ? 36.002 6.025   39.849  1.00 39.26  ? 208 TYR C CA  1 
ATOM   4765  C C   . TYR B 1 211 ? 37.153 7.009   39.980  1.00 39.08  ? 208 TYR C C   1 
ATOM   4766  O O   . TYR B 1 211 ? 37.064 7.994   40.719  1.00 38.95  ? 208 TYR C O   1 
ATOM   4767  C CB  . TYR B 1 211 ? 34.947 6.611   38.911  1.00 40.60  ? 208 TYR C CB  1 
ATOM   4768  C CG  . TYR B 1 211 ? 33.733 5.739   38.730  1.00 46.94  ? 208 TYR C CG  1 
ATOM   4769  C CD1 . TYR B 1 211 ? 33.732 4.704   37.804  1.00 45.01  ? 208 TYR C CD1 1 
ATOM   4770  C CD2 . TYR B 1 211 ? 32.586 5.952   39.480  1.00 43.08  ? 208 TYR C CD2 1 
ATOM   4771  C CE1 . TYR B 1 211 ? 32.622 3.903   37.634  1.00 52.72  ? 208 TYR C CE1 1 
ATOM   4772  C CE2 . TYR B 1 211 ? 31.471 5.156   39.318  1.00 48.20  ? 208 TYR C CE2 1 
ATOM   4773  C CZ  . TYR B 1 211 ? 31.494 4.133   38.394  1.00 51.46  ? 208 TYR C CZ  1 
ATOM   4774  O OH  . TYR B 1 211 ? 30.385 3.339   38.228  1.00 54.95  ? 208 TYR C OH  1 
ATOM   4775  N N   . LEU B 1 212 ? 38.233 6.727   39.261  1.00 41.78  ? 209 LEU C N   1 
ATOM   4776  C CA  . LEU B 1 212 ? 39.348 7.645   39.097  1.00 38.31  ? 209 LEU C CA  1 
ATOM   4777  C C   . LEU B 1 212 ? 39.317 8.178   37.674  1.00 33.51  ? 209 LEU C C   1 
ATOM   4778  O O   . LEU B 1 212 ? 39.143 7.406   36.724  1.00 35.78  ? 209 LEU C O   1 
ATOM   4779  C CB  . LEU B 1 212 ? 40.685 6.952   39.369  1.00 39.01  ? 209 LEU C CB  1 
ATOM   4780  C CG  . LEU B 1 212 ? 41.908 7.661   38.779  1.00 34.56  ? 209 LEU C CG  1 
ATOM   4781  C CD1 . LEU B 1 212 ? 42.213 8.937   39.557  1.00 37.65  ? 209 LEU C CD1 1 
ATOM   4782  C CD2 . LEU B 1 212 ? 43.123 6.746   38.722  1.00 34.66  ? 209 LEU C CD2 1 
ATOM   4783  N N   . SER B 1 213 ? 39.475 9.490   37.529  1.00 35.13  ? 210 SER C N   1 
ATOM   4784  C CA  . SER B 1 213 ? 39.515 10.134  36.223  1.00 36.77  ? 210 SER C CA  1 
ATOM   4785  C C   . SER B 1 213 ? 40.879 10.776  36.002  1.00 31.69  ? 210 SER C C   1 
ATOM   4786  O O   . SER B 1 213 ? 41.373 11.517  36.860  1.00 32.37  ? 210 SER C O   1 
ATOM   4787  C CB  . SER B 1 213 ? 38.399 11.174  36.084  1.00 36.40  ? 210 SER C CB  1 
ATOM   4788  O OG  . SER B 1 213 ? 38.506 12.184  37.070  1.00 39.24  ? 210 SER C OG  1 
ATOM   4789  N N   . THR B 1 214 ? 41.495 10.452  34.865  1.00 34.71  ? 211 THR C N   1 
ATOM   4790  C CA  . THR B 1 214 ? 42.728 11.070  34.397  1.00 37.45  ? 211 THR C CA  1 
ATOM   4791  C C   . THR B 1 214 ? 42.543 11.413  32.925  1.00 42.66  ? 211 THR C C   1 
ATOM   4792  O O   . THR B 1 214 ? 41.473 11.185  32.349  1.00 42.70  ? 211 THR C O   1 
ATOM   4793  C CB  . THR B 1 214 ? 43.941 10.142  34.586  1.00 35.12  ? 211 THR C CB  1 
ATOM   4794  O OG1 . THR B 1 214 ? 43.951 9.149   33.554  1.00 39.01  ? 211 THR C OG1 1 
ATOM   4795  C CG2 . THR B 1 214 ? 43.900 9.443   35.944  1.00 32.79  ? 211 THR C CG2 1 
ATOM   4796  N N   . LYS B 1 215 ? 43.587 11.982  32.315  1.00 40.31  ? 212 LYS C N   1 
ATOM   4797  C CA  . LYS B 1 215 ? 43.669 12.062  30.860  1.00 44.07  ? 212 LYS C CA  1 
ATOM   4798  C C   . LYS B 1 215 ? 44.949 11.373  30.401  1.00 43.65  ? 212 LYS C C   1 
ATOM   4799  O O   . LYS B 1 215 ? 45.786 11.966  29.707  1.00 45.82  ? 212 LYS C O   1 
ATOM   4800  C CB  . LYS B 1 215 ? 43.620 13.513  30.346  1.00 47.94  ? 212 LYS C CB  1 
ATOM   4801  C CG  . LYS B 1 215 ? 44.627 14.508  30.934  1.00 53.45  ? 212 LYS C CG  1 
ATOM   4802  C CD  . LYS B 1 215 ? 44.266 14.980  32.326  1.00 64.50  ? 212 LYS C CD  1 
ATOM   4803  C CE  . LYS B 1 215 ? 45.174 16.093  32.766  1.00 69.12  ? 212 LYS C CE  1 
ATOM   4804  N NZ  . LYS B 1 215 ? 44.816 16.353  34.151  1.00 72.39  ? 212 LYS C NZ  1 
ATOM   4805  N N   . ASN B 1 216 ? 45.104 10.108  30.795  1.00 42.51  ? 213 ASN C N   1 
ATOM   4806  C CA  . ASN B 1 216 ? 46.314 9.353   30.493  1.00 45.50  ? 213 ASN C CA  1 
ATOM   4807  C C   . ASN B 1 216 ? 46.507 9.110   29.001  1.00 46.89  ? 213 ASN C C   1 
ATOM   4808  O O   . ASN B 1 216 ? 47.575 8.630   28.607  1.00 51.34  ? 213 ASN C O   1 
ATOM   4809  C CB  . ASN B 1 216 ? 46.304 8.019   31.242  1.00 46.40  ? 213 ASN C CB  1 
ATOM   4810  C CG  . ASN B 1 216 ? 45.364 7.012   30.615  1.00 50.06  ? 213 ASN C CG  1 
ATOM   4811  O OD1 . ASN B 1 216 ? 44.195 7.309   30.371  1.00 48.18  ? 213 ASN C OD1 1 
ATOM   4812  N ND2 . ASN B 1 216 ? 45.864 5.807   30.365  1.00 51.42  ? 213 ASN C ND2 1 
ATOM   4813  N N   . THR B 1 217 ? 45.514 9.425   28.166  1.00 44.83  ? 214 THR C N   1 
ATOM   4814  C CA  . THR B 1 217 ? 45.737 9.378   26.726  1.00 45.84  ? 214 THR C CA  1 
ATOM   4815  C C   . THR B 1 217 ? 46.662 10.499  26.271  1.00 52.55  ? 214 THR C C   1 
ATOM   4816  O O   . THR B 1 217 ? 47.386 10.340  25.282  1.00 51.71  ? 214 THR C O   1 
ATOM   4817  C CB  . THR B 1 217 ? 44.407 9.463   25.980  1.00 55.08  ? 214 THR C CB  1 
ATOM   4818  O OG1 . THR B 1 217 ? 43.707 10.647  26.389  1.00 53.56  ? 214 THR C OG1 1 
ATOM   4819  C CG2 . THR B 1 217 ? 43.548 8.242   26.282  1.00 44.26  ? 214 THR C CG2 1 
ATOM   4820  N N   . ILE B 1 218 ? 46.657 11.629  26.977  1.00 48.25  ? 215 ILE C N   1 
ATOM   4821  C CA  . ILE B 1 218 ? 47.454 12.789  26.594  1.00 47.63  ? 215 ILE C CA  1 
ATOM   4822  C C   . ILE B 1 218 ? 48.739 12.821  27.410  1.00 43.82  ? 215 ILE C C   1 
ATOM   4823  O O   . ILE B 1 218 ? 49.842 12.886  26.854  1.00 40.31  ? 215 ILE C O   1 
ATOM   4824  C CB  . ILE B 1 218 ? 46.649 14.091  26.766  1.00 48.10  ? 215 ILE C CB  1 
ATOM   4825  C CG1 . ILE B 1 218 ? 45.510 14.148  25.744  1.00 53.49  ? 215 ILE C CG1 1 
ATOM   4826  C CG2 . ILE B 1 218 ? 47.554 15.308  26.646  1.00 44.44  ? 215 ILE C CG2 1 
ATOM   4827  C CD1 . ILE B 1 218 ? 44.703 15.434  25.792  1.00 61.98  ? 215 ILE C CD1 1 
ATOM   4828  N N   . LEU B 1 219 ? 48.606 12.778  28.737  1.00 40.30  ? 216 LEU C N   1 
ATOM   4829  C CA  . LEU B 1 219 ? 49.762 12.741  29.634  1.00 41.31  ? 216 LEU C CA  1 
ATOM   4830  C C   . LEU B 1 219 ? 50.018 11.281  30.000  1.00 38.95  ? 216 LEU C C   1 
ATOM   4831  O O   . LEU B 1 219 ? 49.688 10.809  31.090  1.00 38.53  ? 216 LEU C O   1 
ATOM   4832  C CB  . LEU B 1 219 ? 49.519 13.611  30.862  1.00 39.97  ? 216 LEU C CB  1 
ATOM   4833  C CG  . LEU B 1 219 ? 49.135 15.075  30.629  1.00 45.00  ? 216 LEU C CG  1 
ATOM   4834  C CD1 . LEU B 1 219 ? 48.771 15.751  31.946  1.00 43.59  ? 216 LEU C CD1 1 
ATOM   4835  C CD2 . LEU B 1 219 ? 50.251 15.838  29.926  1.00 41.46  ? 216 LEU C CD2 1 
ATOM   4836  N N   . LYS B 1 220 ? 50.623 10.557  29.052  1.00 43.82  ? 217 LYS C N   1 
ATOM   4837  C CA  . LYS B 1 220 ? 50.736 9.105   29.172  1.00 43.85  ? 217 LYS C CA  1 
ATOM   4838  C C   . LYS B 1 220 ? 51.589 8.688   30.363  1.00 45.61  ? 217 LYS C C   1 
ATOM   4839  O O   . LYS B 1 220 ? 51.318 7.656   30.988  1.00 50.78  ? 217 LYS C O   1 
ATOM   4840  C CB  . LYS B 1 220 ? 51.316 8.512   27.888  1.00 44.28  ? 217 LYS C CB  1 
ATOM   4841  C CG  . LYS B 1 220 ? 50.536 8.841   26.626  1.00 49.74  ? 217 LYS C CG  1 
ATOM   4842  C CD  . LYS B 1 220 ? 50.729 7.744   25.592  1.00 51.01  ? 217 LYS C CD  1 
ATOM   4843  C CE  . LYS B 1 220 ? 50.271 8.182   24.213  1.00 55.91  ? 217 LYS C CE  1 
ATOM   4844  N NZ  . LYS B 1 220 ? 51.238 9.113   23.570  1.00 64.17  ? 217 LYS C NZ  1 
ATOM   4845  N N   . LYS B 1 221 ? 52.620 9.462   30.692  1.00 39.65  ? 218 LYS C N   1 
ATOM   4846  C CA  . LYS B 1 221 ? 53.494 9.100   31.800  1.00 41.78  ? 218 LYS C CA  1 
ATOM   4847  C C   . LYS B 1 221 ? 53.030 9.721   33.113  1.00 42.68  ? 218 LYS C C   1 
ATOM   4848  O O   . LYS B 1 221 ? 53.010 9.050   34.150  1.00 42.21  ? 218 LYS C O   1 
ATOM   4849  C CB  . LYS B 1 221 ? 54.931 9.519   31.484  1.00 38.38  ? 218 LYS C CB  1 
ATOM   4850  C CG  . LYS B 1 221 ? 55.371 9.144   30.077  1.00 42.05  ? 218 LYS C CG  1 
ATOM   4851  C CD  . LYS B 1 221 ? 56.757 9.674   29.763  1.00 43.49  ? 218 LYS C CD  1 
ATOM   4852  C CE  . LYS B 1 221 ? 57.124 9.419   28.311  1.00 47.27  ? 218 LYS C CE  1 
ATOM   4853  N NZ  . LYS B 1 221 ? 57.072 7.969   27.973  1.00 42.81  ? 218 LYS C NZ  1 
ATOM   4854  N N   . TYR B 1 222 ? 52.662 11.002  33.079  1.00 43.20  ? 219 TYR C N   1 
ATOM   4855  C CA  . TYR B 1 222 ? 52.203 11.682  34.283  1.00 37.89  ? 219 TYR C CA  1 
ATOM   4856  C C   . TYR B 1 222 ? 50.923 11.047  34.812  1.00 38.49  ? 219 TYR C C   1 
ATOM   4857  O O   . TYR B 1 222 ? 50.861 10.606  35.965  1.00 38.82  ? 219 TYR C O   1 
ATOM   4858  C CB  . TYR B 1 222 ? 51.988 13.164  33.980  1.00 34.47  ? 219 TYR C CB  1 
ATOM   4859  C CG  . TYR B 1 222 ? 51.968 14.057  35.193  1.00 32.72  ? 219 TYR C CG  1 
ATOM   4860  C CD1 . TYR B 1 222 ? 50.851 14.122  36.016  1.00 33.73  ? 219 TYR C CD1 1 
ATOM   4861  C CD2 . TYR B 1 222 ? 53.066 14.844  35.511  1.00 33.20  ? 219 TYR C CD2 1 
ATOM   4862  C CE1 . TYR B 1 222 ? 50.830 14.944  37.126  1.00 36.13  ? 219 TYR C CE1 1 
ATOM   4863  C CE2 . TYR B 1 222 ? 53.056 15.667  36.617  1.00 32.61  ? 219 TYR C CE2 1 
ATOM   4864  C CZ  . TYR B 1 222 ? 51.935 15.714  37.421  1.00 35.52  ? 219 TYR C CZ  1 
ATOM   4865  O OH  . TYR B 1 222 ? 51.916 16.532  38.525  1.00 40.02  ? 219 TYR C OH  1 
ATOM   4866  N N   . ASP B 1 223 ? 49.889 10.987  33.972  1.00 37.01  ? 220 ASP C N   1 
ATOM   4867  C CA  . ASP B 1 223 ? 48.602 10.465  34.413  1.00 43.19  ? 220 ASP C CA  1 
ATOM   4868  C C   . ASP B 1 223 ? 48.554 8.949   34.389  1.00 44.32  ? 220 ASP C C   1 
ATOM   4869  O O   . ASP B 1 223 ? 47.740 8.353   35.106  1.00 45.26  ? 220 ASP C O   1 
ATOM   4870  C CB  . ASP B 1 223 ? 47.475 11.012  33.548  1.00 39.85  ? 220 ASP C CB  1 
ATOM   4871  C CG  . ASP B 1 223 ? 47.188 12.457  33.836  1.00 45.66  ? 220 ASP C CG  1 
ATOM   4872  O OD1 . ASP B 1 223 ? 48.076 13.131  34.390  1.00 48.43  ? 220 ASP C OD1 1 
ATOM   4873  O OD2 . ASP B 1 223 ? 46.073 12.909  33.534  1.00 46.12  ? 220 ASP C OD2 1 
ATOM   4874  N N   . GLY B 1 224 ? 49.388 8.311   33.565  1.00 40.19  ? 221 GLY C N   1 
ATOM   4875  C CA  . GLY B 1 224 ? 49.471 6.862   33.606  1.00 46.32  ? 221 GLY C CA  1 
ATOM   4876  C C   . GLY B 1 224 ? 49.939 6.361   34.958  1.00 44.92  ? 221 GLY C C   1 
ATOM   4877  O O   . GLY B 1 224 ? 49.516 5.298   35.420  1.00 45.29  ? 221 GLY C O   1 
ATOM   4878  N N   . ARG B 1 225 ? 50.800 7.136   35.623  1.00 44.56  ? 222 ARG C N   1 
ATOM   4879  C CA  . ARG B 1 225 ? 51.279 6.747   36.944  1.00 40.68  ? 222 ARG C CA  1 
ATOM   4880  C C   . ARG B 1 225 ? 50.146 6.751   37.962  1.00 43.68  ? 222 ARG C C   1 
ATOM   4881  O O   . ARG B 1 225 ? 50.066 5.857   38.811  1.00 42.81  ? 222 ARG C O   1 
ATOM   4882  C CB  . ARG B 1 225 ? 52.405 7.677   37.385  1.00 40.15  ? 222 ARG C CB  1 
ATOM   4883  C CG  . ARG B 1 225 ? 53.199 7.174   38.579  1.00 51.68  ? 222 ARG C CG  1 
ATOM   4884  C CD  . ARG B 1 225 ? 54.433 6.402   38.144  1.00 47.53  ? 222 ARG C CD  1 
ATOM   4885  N NE  . ARG B 1 225 ? 55.156 5.857   39.288  1.00 50.77  ? 222 ARG C NE  1 
ATOM   4886  C CZ  . ARG B 1 225 ? 55.030 4.607   39.720  1.00 62.67  ? 222 ARG C CZ  1 
ATOM   4887  N NH1 . ARG B 1 225 ? 54.207 3.770   39.100  1.00 47.50  ? 222 ARG C NH1 1 
ATOM   4888  N NH2 . ARG B 1 225 ? 55.725 4.191   40.771  1.00 42.65  ? 222 ARG C NH2 1 
ATOM   4889  N N   . PHE B 1 226 ? 49.267 7.756   37.896  1.00 43.73  ? 223 PHE C N   1 
ATOM   4890  C CA  . PHE B 1 226 ? 48.065 7.753   38.725  1.00 39.68  ? 223 PHE C CA  1 
ATOM   4891  C C   . PHE B 1 226 ? 47.251 6.488   38.491  1.00 41.80  ? 223 PHE C C   1 
ATOM   4892  O O   . PHE B 1 226 ? 46.845 5.806   39.439  1.00 39.80  ? 223 PHE C O   1 
ATOM   4893  C CB  . PHE B 1 226 ? 47.208 8.981   38.415  1.00 40.51  ? 223 PHE C CB  1 
ATOM   4894  C CG  . PHE B 1 226 ? 47.592 10.211  39.181  1.00 40.05  ? 223 PHE C CG  1 
ATOM   4895  C CD1 . PHE B 1 226 ? 48.648 11.002  38.760  1.00 41.87  ? 223 PHE C CD1 1 
ATOM   4896  C CD2 . PHE B 1 226 ? 46.882 10.591  40.310  1.00 36.60  ? 223 PHE C CD2 1 
ATOM   4897  C CE1 . PHE B 1 226 ? 49.000 12.143  39.456  1.00 43.98  ? 223 PHE C CE1 1 
ATOM   4898  C CE2 . PHE B 1 226 ? 47.230 11.729  41.014  1.00 37.12  ? 223 PHE C CE2 1 
ATOM   4899  C CZ  . PHE B 1 226 ? 48.290 12.508  40.586  1.00 40.03  ? 223 PHE C CZ  1 
ATOM   4900  N N   . LYS B 1 227 ? 47.004 6.164   37.221  1.00 39.89  ? 224 LYS C N   1 
ATOM   4901  C CA  . LYS B 1 227 ? 46.153 5.029   36.884  1.00 37.52  ? 224 LYS C CA  1 
ATOM   4902  C C   . LYS B 1 227 ? 46.800 3.712   37.293  1.00 50.36  ? 224 LYS C C   1 
ATOM   4903  O O   . LYS B 1 227 ? 46.132 2.819   37.827  1.00 45.03  ? 224 LYS C O   1 
ATOM   4904  C CB  . LYS B 1 227 ? 45.850 5.046   35.387  1.00 41.22  ? 224 LYS C CB  1 
ATOM   4905  C CG  . LYS B 1 227 ? 45.071 3.848   34.891  1.00 44.98  ? 224 LYS C CG  1 
ATOM   4906  C CD  . LYS B 1 227 ? 44.993 3.852   33.378  1.00 41.45  ? 224 LYS C CD  1 
ATOM   4907  C CE  . LYS B 1 227 ? 44.407 2.550   32.867  1.00 47.29  ? 224 LYS C CE  1 
ATOM   4908  N NZ  . LYS B 1 227 ? 44.380 2.491   31.381  1.00 59.89  ? 224 LYS C NZ  1 
ATOM   4909  N N   . ASP B 1 228 ? 48.106 3.573   37.051  1.00 48.96  ? 225 ASP C N   1 
ATOM   4910  C CA  . ASP B 1 228 ? 48.787 2.325   37.383  1.00 45.42  ? 225 ASP C CA  1 
ATOM   4911  C C   . ASP B 1 228 ? 48.838 2.103   38.889  1.00 44.52  ? 225 ASP C C   1 
ATOM   4912  O O   . ASP B 1 228 ? 48.731 0.964   39.359  1.00 47.31  ? 225 ASP C O   1 
ATOM   4913  C CB  . ASP B 1 228 ? 50.198 2.321   36.794  1.00 42.09  ? 225 ASP C CB  1 
ATOM   4914  C CG  . ASP B 1 228 ? 50.202 2.388   35.279  1.00 44.99  ? 225 ASP C CG  1 
ATOM   4915  O OD1 . ASP B 1 228 ? 49.195 1.989   34.657  1.00 45.13  ? 225 ASP C OD1 1 
ATOM   4916  O OD2 . ASP B 1 228 ? 51.216 2.845   34.710  1.00 45.60  ? 225 ASP C OD2 1 
ATOM   4917  N N   . ILE B 1 229 ? 48.996 3.178   39.664  1.00 42.77  ? 226 ILE C N   1 
ATOM   4918  C CA  . ILE B 1 229 ? 49.146 3.026   41.109  1.00 46.01  ? 226 ILE C CA  1 
ATOM   4919  C C   . ILE B 1 229 ? 47.812 2.675   41.756  1.00 46.58  ? 226 ILE C C   1 
ATOM   4920  O O   . ILE B 1 229 ? 47.747 1.811   42.640  1.00 45.78  ? 226 ILE C O   1 
ATOM   4921  C CB  . ILE B 1 229 ? 49.765 4.296   41.721  1.00 40.33  ? 226 ILE C CB  1 
ATOM   4922  C CG1 . ILE B 1 229 ? 51.250 4.385   41.373  1.00 45.07  ? 226 ILE C CG1 1 
ATOM   4923  C CG2 . ILE B 1 229 ? 49.574 4.315   43.228  1.00 31.28  ? 226 ILE C CG2 1 
ATOM   4924  C CD1 . ILE B 1 229 ? 51.939 5.590   41.970  1.00 40.94  ? 226 ILE C CD1 1 
ATOM   4925  N N   . PHE B 1 230 ? 46.732 3.339   41.338  1.00 44.30  ? 227 PHE C N   1 
ATOM   4926  C CA  . PHE B 1 230 ? 45.401 2.962   41.805  1.00 46.29  ? 227 PHE C CA  1 
ATOM   4927  C C   . PHE B 1 230 ? 45.110 1.503   41.480  1.00 44.48  ? 227 PHE C C   1 
ATOM   4928  O O   . PHE B 1 230 ? 44.620 0.748   42.327  1.00 44.72  ? 227 PHE C O   1 
ATOM   4929  C CB  . PHE B 1 230 ? 44.345 3.862   41.162  1.00 40.14  ? 227 PHE C CB  1 
ATOM   4930  C CG  . PHE B 1 230 ? 44.007 5.086   41.962  1.00 43.18  ? 227 PHE C CG  1 
ATOM   4931  C CD1 . PHE B 1 230 ? 44.951 6.080   42.171  1.00 40.72  ? 227 PHE C CD1 1 
ATOM   4932  C CD2 . PHE B 1 230 ? 42.735 5.254   42.487  1.00 42.08  ? 227 PHE C CD2 1 
ATOM   4933  C CE1 . PHE B 1 230 ? 44.636 7.214   42.900  1.00 37.81  ? 227 PHE C CE1 1 
ATOM   4934  C CE2 . PHE B 1 230 ? 42.413 6.384   43.216  1.00 40.43  ? 227 PHE C CE2 1 
ATOM   4935  C CZ  . PHE B 1 230 ? 43.364 7.367   43.422  1.00 41.51  ? 227 PHE C CZ  1 
ATOM   4936  N N   . GLN B 1 231 ? 45.426 1.090   40.250  1.00 46.37  ? 228 GLN C N   1 
ATOM   4937  C CA  . GLN B 1 231 ? 45.063 -0.244  39.784  1.00 48.24  ? 228 GLN C CA  1 
ATOM   4938  C C   . GLN B 1 231 ? 45.839 -1.329  40.524  1.00 54.62  ? 228 GLN C C   1 
ATOM   4939  O O   . GLN B 1 231 ? 45.275 -2.373  40.873  1.00 51.25  ? 228 GLN C O   1 
ATOM   4940  C CB  . GLN B 1 231 ? 45.304 -0.348  38.279  1.00 46.07  ? 228 GLN C CB  1 
ATOM   4941  C CG  . GLN B 1 231 ? 44.599 -1.518  37.613  1.00 53.24  ? 228 GLN C CG  1 
ATOM   4942  C CD  . GLN B 1 231 ? 43.095 -1.450  37.767  1.00 58.84  ? 228 GLN C CD  1 
ATOM   4943  O OE1 . GLN B 1 231 ? 42.420 -0.715  37.047  1.00 55.53  ? 228 GLN C OE1 1 
ATOM   4944  N NE2 . GLN B 1 231 ? 42.560 -2.214  38.714  1.00 55.68  ? 228 GLN C NE2 1 
ATOM   4945  N N   . GLU B 1 232 ? 47.131 -1.106  40.770  1.00 50.67  ? 229 GLU C N   1 
ATOM   4946  C CA  . GLU B 1 232 ? 47.946 -2.119  41.429  1.00 53.48  ? 229 GLU C CA  1 
ATOM   4947  C C   . GLU B 1 232 ? 47.702 -2.178  42.932  1.00 62.22  ? 229 GLU C C   1 
ATOM   4948  O O   . GLU B 1 232 ? 48.015 -3.197  43.558  1.00 66.09  ? 229 GLU C O   1 
ATOM   4949  C CB  . GLU B 1 232 ? 49.428 -1.876  41.135  1.00 56.46  ? 229 GLU C CB  1 
ATOM   4950  C CG  . GLU B 1 232 ? 50.019 -0.644  41.798  1.00 60.40  ? 229 GLU C CG  1 
ATOM   4951  C CD  . GLU B 1 232 ? 51.428 -0.356  41.315  1.00 64.67  ? 229 GLU C CD  1 
ATOM   4952  O OE1 . GLU B 1 232 ? 52.286 -0.014  42.156  1.00 62.17  ? 229 GLU C OE1 1 
ATOM   4953  O OE2 . GLU B 1 232 ? 51.675 -0.470  40.095  1.00 54.36  ? 229 GLU C OE2 1 
ATOM   4954  N N   . ILE B 1 233 ? 47.151 -1.116  43.522  1.00 53.77  ? 230 ILE C N   1 
ATOM   4955  C CA  . ILE B 1 233 ? 46.719 -1.186  44.914  1.00 54.74  ? 230 ILE C CA  1 
ATOM   4956  C C   . ILE B 1 233 ? 45.353 -1.855  45.009  1.00 57.37  ? 230 ILE C C   1 
ATOM   4957  O O   . ILE B 1 233 ? 45.095 -2.642  45.927  1.00 57.63  ? 230 ILE C O   1 
ATOM   4958  C CB  . ILE B 1 233 ? 46.713 0.221   45.539  1.00 52.64  ? 230 ILE C CB  1 
ATOM   4959  C CG1 . ILE B 1 233 ? 48.144 0.723   45.733  1.00 52.95  ? 230 ILE C CG1 1 
ATOM   4960  C CG2 . ILE B 1 233 ? 45.968 0.224   46.866  1.00 47.19  ? 230 ILE C CG2 1 
ATOM   4961  C CD1 . ILE B 1 233 ? 48.223 2.132   46.281  1.00 44.90  ? 230 ILE C CD1 1 
ATOM   4962  N N   . TYR B 1 234 ? 44.467 -1.565  44.054  1.00 54.09  ? 231 TYR C N   1 
ATOM   4963  C CA  . TYR B 1 234 ? 43.157 -2.207  44.019  1.00 58.90  ? 231 TYR C CA  1 
ATOM   4964  C C   . TYR B 1 234 ? 43.291 -3.714  43.836  1.00 63.23  ? 231 TYR C C   1 
ATOM   4965  O O   . TYR B 1 234 ? 42.739 -4.501  44.613  1.00 63.16  ? 231 TYR C O   1 
ATOM   4966  C CB  . TYR B 1 234 ? 42.315 -1.606  42.894  1.00 47.93  ? 231 TYR C CB  1 
ATOM   4967  C CG  . TYR B 1 234 ? 40.904 -2.144  42.811  1.00 54.96  ? 231 TYR C CG  1 
ATOM   4968  C CD1 . TYR B 1 234 ? 40.003 -1.955  43.850  1.00 56.63  ? 231 TYR C CD1 1 
ATOM   4969  C CD2 . TYR B 1 234 ? 40.474 -2.842  41.690  1.00 62.29  ? 231 TYR C CD2 1 
ATOM   4970  C CE1 . TYR B 1 234 ? 38.712 -2.441  43.773  1.00 56.99  ? 231 TYR C CE1 1 
ATOM   4971  C CE2 . TYR B 1 234 ? 39.185 -3.334  41.604  1.00 64.08  ? 231 TYR C CE2 1 
ATOM   4972  C CZ  . TYR B 1 234 ? 38.309 -3.130  42.649  1.00 59.71  ? 231 TYR C CZ  1 
ATOM   4973  O OH  . TYR B 1 234 ? 37.024 -3.616  42.573  1.00 64.60  ? 231 TYR C OH  1 
ATOM   4974  N N   . ASP B 1 235 ? 44.037 -4.132  42.809  1.00 61.89  ? 232 ASP C N   1 
ATOM   4975  C CA  . ASP B 1 235 ? 44.159 -5.549  42.481  1.00 58.04  ? 232 ASP C CA  1 
ATOM   4976  C C   . ASP B 1 235 ? 44.766 -6.367  43.613  1.00 62.11  ? 232 ASP C C   1 
ATOM   4977  O O   . ASP B 1 235 ? 44.587 -7.590  43.643  1.00 73.57  ? 232 ASP C O   1 
ATOM   4978  C CB  . ASP B 1 235 ? 45.001 -5.722  41.218  1.00 53.50  ? 232 ASP C CB  1 
ATOM   4979  C CG  . ASP B 1 235 ? 44.245 -5.355  39.960  1.00 58.40  ? 232 ASP C CG  1 
ATOM   4980  O OD1 . ASP B 1 235 ? 43.034 -5.056  40.054  1.00 67.61  ? 232 ASP C OD1 1 
ATOM   4981  O OD2 . ASP B 1 235 ? 44.864 -5.365  38.876  1.00 59.90  ? 232 ASP C OD2 1 
ATOM   4982  N N   . LYS B 1 236 ? 45.470 -5.728  44.546  1.00 64.78  ? 233 LYS C N   1 
ATOM   4983  C CA  . LYS B 1 236 ? 46.148 -6.441  45.622  1.00 61.83  ? 233 LYS C CA  1 
ATOM   4984  C C   . LYS B 1 236 ? 45.451 -6.319  46.969  1.00 67.58  ? 233 LYS C C   1 
ATOM   4985  O O   . LYS B 1 236 ? 45.367 -7.308  47.705  1.00 74.18  ? 233 LYS C O   1 
ATOM   4986  C CB  . LYS B 1 236 ? 47.590 -5.944  45.762  1.00 58.73  ? 233 LYS C CB  1 
ATOM   4987  C CG  . LYS B 1 236 ? 48.625 -6.853  45.118  1.00 67.89  ? 233 LYS C CG  1 
ATOM   4988  C CD  . LYS B 1 236 ? 50.047 -6.467  45.514  1.00 72.55  ? 233 LYS C CD  1 
ATOM   4989  C CE  . LYS B 1 236 ? 50.460 -7.085  46.845  1.00 67.49  ? 233 LYS C CE  1 
ATOM   4990  N NZ  . LYS B 1 236 ? 49.885 -6.367  48.018  1.00 70.38  ? 233 LYS C NZ  1 
ATOM   4991  N N   . GLN B 1 237 ? 44.943 -5.135  47.318  1.00 63.65  ? 234 GLN C N   1 
ATOM   4992  C CA  . GLN B 1 237 ? 44.529 -4.864  48.687  1.00 58.53  ? 234 GLN C CA  1 
ATOM   4993  C C   . GLN B 1 237 ? 43.047 -4.562  48.867  1.00 58.60  ? 234 GLN C C   1 
ATOM   4994  O O   . GLN B 1 237 ? 42.609 -4.389  50.011  1.00 61.10  ? 234 GLN C O   1 
ATOM   4995  C CB  . GLN B 1 237 ? 45.334 -3.692  49.261  1.00 52.06  ? 234 GLN C CB  1 
ATOM   4996  C CG  . GLN B 1 237 ? 46.838 -3.867  49.187  1.00 60.52  ? 234 GLN C CG  1 
ATOM   4997  C CD  . GLN B 1 237 ? 47.576 -2.767  49.921  1.00 70.77  ? 234 GLN C CD  1 
ATOM   4998  O OE1 . GLN B 1 237 ? 47.227 -2.417  51.049  1.00 72.57  ? 234 GLN C OE1 1 
ATOM   4999  N NE2 . GLN B 1 237 ? 48.601 -2.212  49.284  1.00 71.69  ? 234 GLN C NE2 1 
ATOM   5000  N N   . TYR B 1 238 ? 42.257 -4.486  47.793  1.00 56.54  ? 235 TYR C N   1 
ATOM   5001  C CA  . TYR B 1 238 ? 40.872 -4.051  47.961  1.00 59.22  ? 235 TYR C CA  1 
ATOM   5002  C C   . TYR B 1 238 ? 39.862 -4.758  47.068  1.00 55.80  ? 235 TYR C C   1 
ATOM   5003  O O   . TYR B 1 238 ? 38.688 -4.817  47.447  1.00 60.86  ? 235 TYR C O   1 
ATOM   5004  C CB  . TYR B 1 238 ? 40.760 -2.537  47.734  1.00 53.85  ? 235 TYR C CB  1 
ATOM   5005  C CG  . TYR B 1 238 ? 41.543 -1.722  48.735  1.00 45.71  ? 235 TYR C CG  1 
ATOM   5006  C CD1 . TYR B 1 238 ? 41.070 -1.533  50.027  1.00 48.16  ? 235 TYR C CD1 1 
ATOM   5007  C CD2 . TYR B 1 238 ? 42.764 -1.154  48.394  1.00 47.25  ? 235 TYR C CD2 1 
ATOM   5008  C CE1 . TYR B 1 238 ? 41.785 -0.792  50.949  1.00 47.76  ? 235 TYR C CE1 1 
ATOM   5009  C CE2 . TYR B 1 238 ? 43.487 -0.413  49.310  1.00 43.58  ? 235 TYR C CE2 1 
ATOM   5010  C CZ  . TYR B 1 238 ? 42.993 -0.236  50.585  1.00 35.38  ? 235 TYR C CZ  1 
ATOM   5011  O OH  . TYR B 1 238 ? 43.706 0.501   51.500  1.00 44.14  ? 235 TYR C OH  1 
ATOM   5012  N N   . LYS B 1 239 ? 40.258 -5.293  45.911  1.00 56.59  ? 236 LYS C N   1 
ATOM   5013  C CA  . LYS B 1 239 ? 39.294 -5.906  44.999  1.00 61.20  ? 236 LYS C CA  1 
ATOM   5014  C C   . LYS B 1 239 ? 38.500 -7.015  45.680  1.00 68.92  ? 236 LYS C C   1 
ATOM   5015  O O   . LYS B 1 239 ? 37.319 -7.220  45.375  1.00 73.31  ? 236 LYS C O   1 
ATOM   5016  C CB  . LYS B 1 239 ? 40.014 -6.445  43.762  1.00 57.06  ? 236 LYS C CB  1 
ATOM   5017  C CG  . LYS B 1 239 ? 39.087 -6.932  42.665  1.00 63.84  ? 236 LYS C CG  1 
ATOM   5018  C CD  . LYS B 1 239 ? 39.865 -7.639  41.570  1.00 61.12  ? 236 LYS C CD  1 
ATOM   5019  C CE  . LYS B 1 239 ? 38.949 -8.047  40.432  1.00 64.22  ? 236 LYS C CE  1 
ATOM   5020  N NZ  . LYS B 1 239 ? 39.666 -8.806  39.370  1.00 69.22  ? 236 LYS C NZ  1 
ATOM   5021  N N   . SER B 1 240 ? 39.129 -7.739  46.610  1.00 72.56  ? 237 SER C N   1 
ATOM   5022  C CA  . SER B 1 240 ? 38.411 -8.771  47.350  1.00 77.20  ? 237 SER C CA  1 
ATOM   5023  C C   . SER B 1 240 ? 37.309 -8.157  48.204  1.00 72.13  ? 237 SER C C   1 
ATOM   5024  O O   . SER B 1 240 ? 36.167 -8.630  48.201  1.00 70.18  ? 237 SER C O   1 
ATOM   5025  C CB  . SER B 1 240 ? 39.386 -9.569  48.218  1.00 77.49  ? 237 SER C CB  1 
ATOM   5026  O OG  . SER B 1 240 ? 40.431 -10.119 47.434  1.00 84.59  ? 237 SER C OG  1 
ATOM   5027  N N   . GLN B 1 241 ? 37.636 -7.094  48.942  1.00 68.33  ? 238 GLN C N   1 
ATOM   5028  C CA  . GLN B 1 241 ? 36.629 -6.424  49.758  1.00 65.22  ? 238 GLN C CA  1 
ATOM   5029  C C   . GLN B 1 241 ? 35.578 -5.741  48.891  1.00 66.15  ? 238 GLN C C   1 
ATOM   5030  O O   . GLN B 1 241 ? 34.393 -5.715  49.246  1.00 70.35  ? 238 GLN C O   1 
ATOM   5031  C CB  . GLN B 1 241 ? 37.296 -5.403  50.676  1.00 61.08  ? 238 GLN C CB  1 
ATOM   5032  C CG  . GLN B 1 241 ? 38.579 -5.885  51.329  1.00 67.14  ? 238 GLN C CG  1 
ATOM   5033  C CD  . GLN B 1 241 ? 38.946 -5.059  52.546  1.00 75.71  ? 238 GLN C CD  1 
ATOM   5034  O OE1 . GLN B 1 241 ? 38.084 -4.699  53.346  1.00 80.41  ? 238 GLN C OE1 1 
ATOM   5035  N NE2 . GLN B 1 241 ? 40.231 -4.751  52.688  1.00 72.53  ? 238 GLN C NE2 1 
ATOM   5036  N N   . PHE B 1 242 ? 35.995 -5.181  47.752  1.00 68.93  ? 239 PHE C N   1 
ATOM   5037  C CA  . PHE B 1 242 ? 35.065 -4.453  46.893  1.00 70.80  ? 239 PHE C CA  1 
ATOM   5038  C C   . PHE B 1 242 ? 33.984 -5.371  46.340  1.00 70.19  ? 239 PHE C C   1 
ATOM   5039  O O   . PHE B 1 242 ? 32.815 -4.979  46.240  1.00 69.32  ? 239 PHE C O   1 
ATOM   5040  C CB  . PHE B 1 242 ? 35.824 -3.789  45.747  1.00 63.98  ? 239 PHE C CB  1 
ATOM   5041  C CG  . PHE B 1 242 ? 36.093 -2.327  45.956  1.00 65.52  ? 239 PHE C CG  1 
ATOM   5042  C CD1 . PHE B 1 242 ? 36.909 -1.894  46.988  1.00 61.80  ? 239 PHE C CD1 1 
ATOM   5043  C CD2 . PHE B 1 242 ? 35.546 -1.387  45.101  1.00 60.11  ? 239 PHE C CD2 1 
ATOM   5044  C CE1 . PHE B 1 242 ? 37.162 -0.548  47.170  1.00 58.77  ? 239 PHE C CE1 1 
ATOM   5045  C CE2 . PHE B 1 242 ? 35.794 -0.043  45.274  1.00 58.33  ? 239 PHE C CE2 1 
ATOM   5046  C CZ  . PHE B 1 242 ? 36.604 0.379   46.309  1.00 59.11  ? 239 PHE C CZ  1 
ATOM   5047  N N   . GLU B 1 243 ? 34.355 -6.594  45.969  1.00 75.67  ? 240 GLU C N   1 
ATOM   5048  C CA  . GLU B 1 243 ? 33.395 -7.518  45.383  1.00 78.96  ? 240 GLU C CA  1 
ATOM   5049  C C   . GLU B 1 243 ? 32.489 -8.158  46.427  1.00 71.43  ? 240 GLU C C   1 
ATOM   5050  O O   . GLU B 1 243 ? 31.461 -8.739  46.063  1.00 70.94  ? 240 GLU C O   1 
ATOM   5051  C CB  . GLU B 1 243 ? 34.134 -8.588  44.579  1.00 75.67  ? 240 GLU C CB  1 
ATOM   5052  C CG  . GLU B 1 243 ? 34.821 -8.020  43.342  1.00 71.84  ? 240 GLU C CG  1 
ATOM   5053  C CD  . GLU B 1 243 ? 35.762 -9.002  42.672  1.00 73.76  ? 240 GLU C CD  1 
ATOM   5054  O OE1 . GLU B 1 243 ? 36.505 -9.705  43.390  1.00 76.01  ? 240 GLU C OE1 1 
ATOM   5055  O OE2 . GLU B 1 243 ? 35.762 -9.063  41.424  1.00 68.16  ? 240 GLU C OE2 1 
ATOM   5056  N N   . ALA B 1 244 ? 32.836 -8.054  47.712  1.00 73.17  ? 241 ALA C N   1 
ATOM   5057  C CA  . ALA B 1 244 ? 31.937 -8.532  48.758  1.00 76.06  ? 241 ALA C CA  1 
ATOM   5058  C C   . ALA B 1 244 ? 30.709 -7.636  48.870  1.00 78.27  ? 241 ALA C C   1 
ATOM   5059  O O   . ALA B 1 244 ? 29.578 -8.125  48.970  1.00 83.63  ? 241 ALA C O   1 
ATOM   5060  C CB  . ALA B 1 244 ? 32.675 -8.609  50.095  1.00 72.01  ? 241 ALA C CB  1 
ATOM   5061  N N   . GLN B 1 245 ? 30.912 -6.318  48.844  1.00 77.29  ? 242 GLN C N   1 
ATOM   5062  C CA  . GLN B 1 245 ? 29.829 -5.349  48.937  1.00 66.11  ? 242 GLN C CA  1 
ATOM   5063  C C   . GLN B 1 245 ? 29.223 -5.006  47.579  1.00 67.83  ? 242 GLN C C   1 
ATOM   5064  O O   . GLN B 1 245 ? 28.554 -3.973  47.456  1.00 73.20  ? 242 GLN C O   1 
ATOM   5065  C CB  . GLN B 1 245 ? 30.321 -4.075  49.628  1.00 62.24  ? 242 GLN C CB  1 
ATOM   5066  C CG  . GLN B 1 245 ? 31.057 -4.317  50.936  1.00 63.61  ? 242 GLN C CG  1 
ATOM   5067  C CD  . GLN B 1 245 ? 31.176 -3.061  51.776  1.00 68.40  ? 242 GLN C CD  1 
ATOM   5068  O OE1 . GLN B 1 245 ? 30.349 -2.153  51.678  1.00 67.89  ? 242 GLN C OE1 1 
ATOM   5069  N NE2 . GLN B 1 245 ? 32.209 -3.001  52.609  1.00 59.55  ? 242 GLN C NE2 1 
ATOM   5070  N N   . LYS B 1 246 ? 29.453 -5.840  46.562  1.00 59.75  ? 243 LYS C N   1 
ATOM   5071  C CA  . LYS B 1 246 ? 28.850 -5.674  45.236  1.00 71.29  ? 243 LYS C CA  1 
ATOM   5072  C C   . LYS B 1 246 ? 29.212 -4.333  44.598  1.00 74.18  ? 243 LYS C C   1 
ATOM   5073  O O   . LYS B 1 246 ? 28.480 -3.817  43.751  1.00 71.27  ? 243 LYS C O   1 
ATOM   5074  C CB  . LYS B 1 246 ? 27.326 -5.843  45.290  1.00 72.51  ? 243 LYS C CB  1 
ATOM   5075  C CG  . LYS B 1 246 ? 26.826 -7.241  44.937  1.00 80.84  ? 243 LYS C CG  1 
ATOM   5076  C CD  . LYS B 1 246 ? 26.935 -8.203  46.114  1.00 76.32  ? 243 LYS C CD  1 
ATOM   5077  C CE  . LYS B 1 246 ? 26.224 -9.520  45.822  1.00 75.47  ? 243 LYS C CE  1 
ATOM   5078  N NZ  . LYS B 1 246 ? 26.195 -10.408 47.018  1.00 76.25  ? 243 LYS C NZ  1 
ATOM   5079  N N   . ILE B 1 247 ? 30.346 -3.754  44.994  1.00 71.07  ? 244 ILE C N   1 
ATOM   5080  C CA  . ILE B 1 247 ? 30.810 -2.513  44.379  1.00 68.11  ? 244 ILE C CA  1 
ATOM   5081  C C   . ILE B 1 247 ? 32.070 -2.794  43.570  1.00 72.13  ? 244 ILE C C   1 
ATOM   5082  O O   . ILE B 1 247 ? 32.503 -3.946  43.456  1.00 75.70  ? 244 ILE C O   1 
ATOM   5083  C CB  . ILE B 1 247 ? 31.047 -1.407  45.425  1.00 62.05  ? 244 ILE C CB  1 
ATOM   5084  C CG1 . ILE B 1 247 ? 32.104 -1.838  46.444  1.00 63.25  ? 244 ILE C CG1 1 
ATOM   5085  C CG2 . ILE B 1 247 ? 29.738 -1.031  46.114  1.00 61.45  ? 244 ILE C CG2 1 
ATOM   5086  C CD1 . ILE B 1 247 ? 32.304 -0.842  47.565  1.00 55.70  ? 244 ILE C CD1 1 
ATOM   5087  N N   . TRP B 1 248 ? 32.660 -1.745  43.000  1.00 64.51  ? 245 TRP C N   1 
ATOM   5088  C CA  . TRP B 1 248 ? 33.792 -1.903  42.096  1.00 66.15  ? 245 TRP C CA  1 
ATOM   5089  C C   . TRP B 1 248 ? 34.573 -0.599  42.034  1.00 63.51  ? 245 TRP C C   1 
ATOM   5090  O O   . TRP B 1 248 ? 34.113 0.451   42.490  1.00 60.20  ? 245 TRP C O   1 
ATOM   5091  C CB  . TRP B 1 248 ? 33.330 -2.310  40.692  1.00 52.73  ? 245 TRP C CB  1 
ATOM   5092  C CG  . TRP B 1 248 ? 32.378 -1.326  40.086  1.00 63.53  ? 245 TRP C CG  1 
ATOM   5093  C CD1 . TRP B 1 248 ? 32.685 -0.297  39.244  1.00 67.33  ? 245 TRP C CD1 1 
ATOM   5094  C CD2 . TRP B 1 248 ? 30.960 -1.273  40.282  1.00 69.56  ? 245 TRP C CD2 1 
ATOM   5095  N NE1 . TRP B 1 248 ? 31.546 0.392   38.902  1.00 66.05  ? 245 TRP C NE1 1 
ATOM   5096  C CE2 . TRP B 1 248 ? 30.473 -0.188  39.527  1.00 67.36  ? 245 TRP C CE2 1 
ATOM   5097  C CE3 . TRP B 1 248 ? 30.055 -2.041  41.021  1.00 71.55  ? 245 TRP C CE3 1 
ATOM   5098  C CZ2 . TRP B 1 248 ? 29.121 0.148   39.491  1.00 70.41  ? 245 TRP C CZ2 1 
ATOM   5099  C CZ3 . TRP B 1 248 ? 28.716 -1.705  40.986  1.00 70.70  ? 245 TRP C CZ3 1 
ATOM   5100  C CH2 . TRP B 1 248 ? 28.260 -0.621  40.226  1.00 72.23  ? 245 TRP C CH2 1 
ATOM   5101  N N   . TYR B 1 249 ? 35.773 -0.690  41.466  1.00 61.87  ? 246 TYR C N   1 
ATOM   5102  C CA  . TYR B 1 249 ? 36.579 0.464   41.098  1.00 55.96  ? 246 TYR C CA  1 
ATOM   5103  C C   . TYR B 1 249 ? 36.906 0.375   39.616  1.00 58.93  ? 246 TYR C C   1 
ATOM   5104  O O   . TYR B 1 249 ? 37.141 -0.718  39.089  1.00 57.67  ? 246 TYR C O   1 
ATOM   5105  C CB  . TYR B 1 249 ? 37.883 0.542   41.903  1.00 56.46  ? 246 TYR C CB  1 
ATOM   5106  C CG  . TYR B 1 249 ? 38.931 1.397   41.220  1.00 55.86  ? 246 TYR C CG  1 
ATOM   5107  C CD1 . TYR B 1 249 ? 38.824 2.781   41.216  1.00 49.31  ? 246 TYR C CD1 1 
ATOM   5108  C CD2 . TYR B 1 249 ? 40.007 0.821   40.551  1.00 53.72  ? 246 TYR C CD2 1 
ATOM   5109  C CE1 . TYR B 1 249 ? 39.763 3.569   40.584  1.00 49.03  ? 246 TYR C CE1 1 
ATOM   5110  C CE2 . TYR B 1 249 ? 40.953 1.605   39.914  1.00 51.77  ? 246 TYR C CE2 1 
ATOM   5111  C CZ  . TYR B 1 249 ? 40.824 2.978   39.935  1.00 47.66  ? 246 TYR C CZ  1 
ATOM   5112  O OH  . TYR B 1 249 ? 41.758 3.767   39.306  1.00 48.41  ? 246 TYR C OH  1 
ATOM   5113  N N   . GLU B 1 250 ? 36.929 1.524   38.945  1.00 55.89  ? 247 GLU C N   1 
ATOM   5114  C CA  . GLU B 1 250 ? 37.276 1.561   37.533  1.00 52.66  ? 247 GLU C CA  1 
ATOM   5115  C C   . GLU B 1 250 ? 37.837 2.930   37.180  1.00 52.09  ? 247 GLU C C   1 
ATOM   5116  O O   . GLU B 1 250 ? 37.422 3.952   37.734  1.00 48.51  ? 247 GLU C O   1 
ATOM   5117  C CB  . GLU B 1 250 ? 36.068 1.235   36.649  1.00 58.49  ? 247 GLU C CB  1 
ATOM   5118  C CG  . GLU B 1 250 ? 36.202 -0.076  35.893  1.00 64.20  ? 247 GLU C CG  1 
ATOM   5119  C CD  . GLU B 1 250 ? 34.877 -0.580  35.357  1.00 68.67  ? 247 GLU C CD  1 
ATOM   5120  O OE1 . GLU B 1 250 ? 34.681 -1.813  35.327  1.00 78.97  ? 247 GLU C OE1 1 
ATOM   5121  O OE2 . GLU B 1 250 ? 34.034 0.254   34.965  1.00 71.45  ? 247 GLU C OE2 1 
ATOM   5122  N N   . HIS B 1 251 ? 38.792 2.932   36.254  1.00 45.78  ? 248 HIS C N   1 
ATOM   5123  C CA  . HIS B 1 251 ? 39.379 4.162   35.747  1.00 46.72  ? 248 HIS C CA  1 
ATOM   5124  C C   . HIS B 1 251 ? 38.542 4.697   34.594  1.00 43.17  ? 248 HIS C C   1 
ATOM   5125  O O   . HIS B 1 251 ? 38.013 3.930   33.785  1.00 39.28  ? 248 HIS C O   1 
ATOM   5126  C CB  . HIS B 1 251 ? 40.816 3.929   35.276  1.00 38.72  ? 248 HIS C CB  1 
ATOM   5127  C CG  . HIS B 1 251 ? 41.365 5.045   34.442  1.00 38.69  ? 248 HIS C CG  1 
ATOM   5128  N ND1 . HIS B 1 251 ? 41.192 5.109   33.076  1.00 40.42  ? 248 HIS C ND1 1 
ATOM   5129  C CD2 . HIS B 1 251 ? 42.080 6.143   34.783  1.00 36.16  ? 248 HIS C CD2 1 
ATOM   5130  C CE1 . HIS B 1 251 ? 41.777 6.198   32.610  1.00 39.07  ? 248 HIS C CE1 1 
ATOM   5131  N NE2 . HIS B 1 251 ? 42.324 6.843   33.625  1.00 43.52  ? 248 HIS C NE2 1 
ATOM   5132  N N   . ARG B 1 252 ? 38.431 6.021   34.523  1.00 40.15  ? 249 ARG C N   1 
ATOM   5133  C CA  . ARG B 1 252 ? 37.675 6.688   33.474  1.00 46.47  ? 249 ARG C CA  1 
ATOM   5134  C C   . ARG B 1 252 ? 38.498 7.826   32.894  1.00 41.08  ? 249 ARG C C   1 
ATOM   5135  O O   . ARG B 1 252 ? 39.233 8.503   33.619  1.00 42.91  ? 249 ARG C O   1 
ATOM   5136  C CB  . ARG B 1 252 ? 36.343 7.238   34.005  1.00 42.00  ? 249 ARG C CB  1 
ATOM   5137  C CG  . ARG B 1 252 ? 35.295 6.181   34.305  1.00 46.90  ? 249 ARG C CG  1 
ATOM   5138  C CD  . ARG B 1 252 ? 34.771 5.537   33.030  1.00 51.12  ? 249 ARG C CD  1 
ATOM   5139  N NE  . ARG B 1 252 ? 33.640 4.653   33.298  1.00 59.07  ? 249 ARG C NE  1 
ATOM   5140  C CZ  . ARG B 1 252 ? 33.753 3.360   33.582  1.00 56.54  ? 249 ARG C CZ  1 
ATOM   5141  N NH1 . ARG B 1 252 ? 32.667 2.633   33.814  1.00 57.50  ? 249 ARG C NH1 1 
ATOM   5142  N NH2 . ARG B 1 252 ? 34.950 2.792   33.638  1.00 59.34  ? 249 ARG C NH2 1 
ATOM   5143  N N   . LEU B 1 253 ? 38.383 8.021   31.583  1.00 45.48  ? 250 LEU C N   1 
ATOM   5144  C CA  . LEU B 1 253 ? 38.861 9.253   30.977  1.00 45.93  ? 250 LEU C CA  1 
ATOM   5145  C C   . LEU B 1 253 ? 37.983 10.403  31.448  1.00 42.66  ? 250 LEU C C   1 
ATOM   5146  O O   . LEU B 1 253 ? 36.767 10.253  31.589  1.00 40.88  ? 250 LEU C O   1 
ATOM   5147  C CB  . LEU B 1 253 ? 38.837 9.146   29.454  1.00 47.20  ? 250 LEU C CB  1 
ATOM   5148  C CG  . LEU B 1 253 ? 40.092 8.571   28.797  1.00 61.84  ? 250 LEU C CG  1 
ATOM   5149  C CD1 . LEU B 1 253 ? 39.915 8.496   27.289  1.00 57.68  ? 250 LEU C CD1 1 
ATOM   5150  C CD2 . LEU B 1 253 ? 41.320 9.396   29.161  1.00 55.51  ? 250 LEU C CD2 1 
ATOM   5151  N N   . ILE B 1 254 ? 38.609 11.554  31.702  1.00 42.13  ? 251 ILE C N   1 
ATOM   5152  C CA  . ILE B 1 254 ? 37.918 12.641  32.393  1.00 43.05  ? 251 ILE C CA  1 
ATOM   5153  C C   . ILE B 1 254 ? 36.676 13.080  31.628  1.00 42.95  ? 251 ILE C C   1 
ATOM   5154  O O   . ILE B 1 254 ? 35.628 13.354  32.225  1.00 46.86  ? 251 ILE C O   1 
ATOM   5155  C CB  . ILE B 1 254 ? 38.883 13.817  32.638  1.00 42.54  ? 251 ILE C CB  1 
ATOM   5156  C CG1 . ILE B 1 254 ? 38.120 15.047  33.149  1.00 40.89  ? 251 ILE C CG1 1 
ATOM   5157  C CG2 . ILE B 1 254 ? 39.673 14.136  31.380  1.00 43.92  ? 251 ILE C CG2 1 
ATOM   5158  C CD1 . ILE B 1 254 ? 37.497 14.863  34.525  1.00 44.27  ? 251 ILE C CD1 1 
ATOM   5159  N N   . ASP B 1 255 ? 36.756 13.128  30.298  1.00 39.11  ? 252 ASP C N   1 
ATOM   5160  C CA  . ASP B 1 255 ? 35.610 13.608  29.533  1.00 45.54  ? 252 ASP C CA  1 
ATOM   5161  C C   . ASP B 1 255 ? 34.515 12.551  29.427  1.00 50.27  ? 252 ASP C C   1 
ATOM   5162  O O   . ASP B 1 255 ? 33.330 12.899  29.375  1.00 45.49  ? 252 ASP C O   1 
ATOM   5163  C CB  . ASP B 1 255 ? 36.056 14.084  28.153  1.00 51.81  ? 252 ASP C CB  1 
ATOM   5164  C CG  . ASP B 1 255 ? 37.021 13.129  27.491  1.00 58.67  ? 252 ASP C CG  1 
ATOM   5165  O OD1 . ASP B 1 255 ? 37.745 12.411  28.213  1.00 58.26  ? 252 ASP C OD1 1 
ATOM   5166  O OD2 . ASP B 1 255 ? 37.053 13.103  26.243  1.00 61.66  ? 252 ASP C OD2 1 
ATOM   5167  N N   . ASP B 1 256 ? 34.880 11.264  29.402  1.00 50.62  ? 253 ASP C N   1 
ATOM   5168  C CA  . ASP B 1 256 ? 33.873 10.220  29.571  1.00 36.11  ? 253 ASP C CA  1 
ATOM   5169  C C   . ASP B 1 256 ? 33.206 10.338  30.933  1.00 50.12  ? 253 ASP C C   1 
ATOM   5170  O O   . ASP B 1 256 ? 31.992 10.135  31.065  1.00 49.67  ? 253 ASP C O   1 
ATOM   5171  C CB  . ASP B 1 256 ? 34.507 8.835   29.428  1.00 42.84  ? 253 ASP C CB  1 
ATOM   5172  C CG  . ASP B 1 256 ? 35.074 8.585   28.048  1.00 48.78  ? 253 ASP C CG  1 
ATOM   5173  O OD1 . ASP B 1 256 ? 34.579 9.182   27.071  1.00 48.16  ? 253 ASP C OD1 1 
ATOM   5174  O OD2 . ASP B 1 256 ? 36.027 7.784   27.949  1.00 59.81  ? 253 ASP C OD2 1 
ATOM   5175  N N   . MET B 1 257 ? 33.993 10.674  31.959  1.00 41.74  ? 254 MET C N   1 
ATOM   5176  C CA  . MET B 1 257 ? 33.503 10.670  33.332  1.00 43.91  ? 254 MET C CA  1 
ATOM   5177  C C   . MET B 1 257 ? 32.526 11.810  33.582  1.00 43.51  ? 254 MET C C   1 
ATOM   5178  O O   . MET B 1 257 ? 31.544 11.643  34.316  1.00 45.74  ? 254 MET C O   1 
ATOM   5179  C CB  . MET B 1 257 ? 34.685 10.754  34.295  1.00 39.45  ? 254 MET C CB  1 
ATOM   5180  C CG  . MET B 1 257 ? 34.331 10.585  35.755  1.00 41.88  ? 254 MET C CG  1 
ATOM   5181  S SD  . MET B 1 257 ? 33.550 9.007   36.123  1.00 40.78  ? 254 MET C SD  1 
ATOM   5182  C CE  . MET B 1 257 ? 32.897 9.357   37.751  1.00 40.42  ? 254 MET C CE  1 
ATOM   5183  N N   . VAL B 1 258 ? 32.786 12.977  32.992  1.00 45.21  ? 255 VAL C N   1 
ATOM   5184  C CA  . VAL B 1 258 ? 31.866 14.103  33.118  1.00 41.85  ? 255 VAL C CA  1 
ATOM   5185  C C   . VAL B 1 258 ? 30.484 13.712  32.610  1.00 46.53  ? 255 VAL C C   1 
ATOM   5186  O O   . VAL B 1 258 ? 29.473 13.905  33.295  1.00 44.42  ? 255 VAL C O   1 
ATOM   5187  C CB  . VAL B 1 258 ? 32.417 15.332  32.372  1.00 41.66  ? 255 VAL C CB  1 
ATOM   5188  C CG1 . VAL B 1 258 ? 31.317 16.361  32.146  1.00 35.47  ? 255 VAL C CG1 1 
ATOM   5189  C CG2 . VAL B 1 258 ? 33.585 15.936  33.137  1.00 40.06  ? 255 VAL C CG2 1 
ATOM   5190  N N   . ALA B 1 259 ? 30.426 13.135  31.406  1.00 43.92  ? 256 ALA C N   1 
ATOM   5191  C CA  . ALA B 1 259 ? 29.149 12.701  30.850  1.00 45.82  ? 256 ALA C CA  1 
ATOM   5192  C C   . ALA B 1 259 ? 28.525 11.603  31.701  1.00 42.53  ? 256 ALA C C   1 
ATOM   5193  O O   . ALA B 1 259 ? 27.321 11.626  31.982  1.00 44.05  ? 256 ALA C O   1 
ATOM   5194  C CB  . ALA B 1 259 ? 29.339 12.223  29.409  1.00 32.90  ? 256 ALA C CB  1 
ATOM   5195  N N   . GLN B 1 260 ? 29.336 10.630  32.123  1.00 43.34  ? 257 GLN C N   1 
ATOM   5196  C CA  . GLN B 1 260 ? 28.829 9.539   32.948  1.00 47.56  ? 257 GLN C CA  1 
ATOM   5197  C C   . GLN B 1 260 ? 28.224 10.067  34.244  1.00 44.62  ? 257 GLN C C   1 
ATOM   5198  O O   . GLN B 1 260 ? 27.116 9.679   34.629  1.00 40.63  ? 257 GLN C O   1 
ATOM   5199  C CB  . GLN B 1 260 ? 29.954 8.544   33.236  1.00 50.23  ? 257 GLN C CB  1 
ATOM   5200  C CG  . GLN B 1 260 ? 29.678 7.567   34.368  1.00 42.98  ? 257 GLN C CG  1 
ATOM   5201  C CD  . GLN B 1 260 ? 30.781 6.533   34.517  1.00 50.64  ? 257 GLN C CD  1 
ATOM   5202  O OE1 . GLN B 1 260 ? 31.354 6.073   33.528  1.00 43.76  ? 257 GLN C OE1 1 
ATOM   5203  N NE2 . GLN B 1 260 ? 31.086 6.167   35.757  1.00 40.33  ? 257 GLN C NE2 1 
ATOM   5204  N N   . ALA B 1 261 ? 28.934 10.973  34.921  1.00 40.29  ? 258 ALA C N   1 
ATOM   5205  C CA  . ALA B 1 261 ? 28.450 11.489  36.198  1.00 44.38  ? 258 ALA C CA  1 
ATOM   5206  C C   . ALA B 1 261 ? 27.139 12.249  36.031  1.00 44.27  ? 258 ALA C C   1 
ATOM   5207  O O   . ALA B 1 261 ? 26.239 12.142  36.872  1.00 47.86  ? 258 ALA C O   1 
ATOM   5208  C CB  . ALA B 1 261 ? 29.511 12.383  36.840  1.00 35.27  ? 258 ALA C CB  1 
ATOM   5209  N N   . MET B 1 262 ? 27.008 13.019  34.948  1.00 36.76  ? 259 MET C N   1 
ATOM   5210  C CA  . MET B 1 262 ? 25.780 13.773  34.719  1.00 42.91  ? 259 MET C CA  1 
ATOM   5211  C C   . MET B 1 262 ? 24.598 12.874  34.382  1.00 44.35  ? 259 MET C C   1 
ATOM   5212  O O   . MET B 1 262 ? 23.449 13.274  34.595  1.00 46.09  ? 259 MET C O   1 
ATOM   5213  C CB  . MET B 1 262 ? 25.992 14.794  33.605  1.00 39.19  ? 259 MET C CB  1 
ATOM   5214  C CG  . MET B 1 262 ? 26.912 15.937  33.991  1.00 38.84  ? 259 MET C CG  1 
ATOM   5215  S SD  . MET B 1 262 ? 27.115 17.115  32.645  1.00 44.22  ? 259 MET C SD  1 
ATOM   5216  C CE  . MET B 1 262 ? 25.465 17.812  32.554  1.00 43.63  ? 259 MET C CE  1 
ATOM   5217  N N   . LYS B 1 263 ? 24.850 11.676  33.857  1.00 42.77  ? 260 LYS C N   1 
ATOM   5218  C CA  . LYS B 1 263 ? 23.792 10.714  33.583  1.00 46.29  ? 260 LYS C CA  1 
ATOM   5219  C C   . LYS B 1 263 ? 23.533 9.776   34.753  1.00 46.76  ? 260 LYS C C   1 
ATOM   5220  O O   . LYS B 1 263 ? 22.558 9.017   34.716  1.00 50.12  ? 260 LYS C O   1 
ATOM   5221  C CB  . LYS B 1 263 ? 24.136 9.896   32.334  1.00 47.26  ? 260 LYS C CB  1 
ATOM   5222  C CG  . LYS B 1 263 ? 23.889 10.633  31.025  1.00 46.01  ? 260 LYS C CG  1 
ATOM   5223  C CD  . LYS B 1 263 ? 24.547 9.914   29.856  1.00 49.80  ? 260 LYS C CD  1 
ATOM   5224  C CE  . LYS B 1 263 ? 23.585 9.749   28.686  1.00 64.26  ? 260 LYS C CE  1 
ATOM   5225  N NZ  . LYS B 1 263 ? 22.873 11.014  28.340  1.00 58.34  ? 260 LYS C NZ  1 
ATOM   5226  N N   . SER B 1 264 ? 24.373 9.815   35.783  1.00 46.66  ? 261 SER C N   1 
ATOM   5227  C CA  . SER B 1 264 ? 24.223 8.962   36.949  1.00 44.56  ? 261 SER C CA  1 
ATOM   5228  C C   . SER B 1 264 ? 23.143 9.501   37.882  1.00 43.74  ? 261 SER C C   1 
ATOM   5229  O O   . SER B 1 264 ? 22.726 10.659  37.795  1.00 49.18  ? 261 SER C O   1 
ATOM   5230  C CB  . SER B 1 264 ? 25.551 8.855   37.703  1.00 42.94  ? 261 SER C CB  1 
ATOM   5231  O OG  . SER B 1 264 ? 25.377 8.261   38.979  1.00 48.78  ? 261 SER C OG  1 
ATOM   5232  N N   . GLU B 1 265 ? 22.687 8.636   38.782  1.00 41.27  ? 262 GLU C N   1 
ATOM   5233  C CA  . GLU B 1 265 ? 21.802 9.044   39.862  1.00 52.59  ? 262 GLU C CA  1 
ATOM   5234  C C   . GLU B 1 265 ? 22.567 9.460   41.111  1.00 45.48  ? 262 GLU C C   1 
ATOM   5235  O O   . GLU B 1 265 ? 21.942 9.829   42.110  1.00 51.24  ? 262 GLU C O   1 
ATOM   5236  C CB  . GLU B 1 265 ? 20.819 7.908   40.189  1.00 55.45  ? 262 GLU C CB  1 
ATOM   5237  C CG  . GLU B 1 265 ? 21.268 6.936   41.277  1.00 64.66  ? 262 GLU C CG  1 
ATOM   5238  C CD  . GLU B 1 265 ? 20.311 5.771   41.411  1.00 81.09  ? 262 GLU C CD  1 
ATOM   5239  O OE1 . GLU B 1 265 ? 19.672 5.640   42.472  1.00 75.73  ? 262 GLU C OE1 1 
ATOM   5240  O OE2 . GLU B 1 265 ? 20.206 4.981   40.451  1.00 78.36  ? 262 GLU C OE2 1 
ATOM   5241  N N   . GLY B 1 266 ? 23.893 9.433   41.070  1.00 42.64  ? 263 GLY C N   1 
ATOM   5242  C CA  . GLY B 1 266 ? 24.685 9.701   42.246  1.00 45.25  ? 263 GLY C CA  1 
ATOM   5243  C C   . GLY B 1 266 ? 25.034 8.431   42.992  1.00 48.66  ? 263 GLY C C   1 
ATOM   5244  O O   . GLY B 1 266 ? 24.856 7.307   42.510  1.00 43.67  ? 263 GLY C O   1 
ATOM   5245  N N   . GLY B 1 267 ? 25.543 8.623   44.204  1.00 44.46  ? 264 GLY C N   1 
ATOM   5246  C CA  . GLY B 1 267 ? 25.922 7.497   45.037  1.00 53.40  ? 264 GLY C CA  1 
ATOM   5247  C C   . GLY B 1 267 ? 27.191 6.798   44.606  1.00 56.57  ? 264 GLY C C   1 
ATOM   5248  O O   . GLY B 1 267 ? 27.229 5.560   44.556  1.00 53.53  ? 264 GLY C O   1 
ATOM   5249  N N   . PHE B 1 268 ? 28.231 7.558   44.273  1.00 53.93  ? 265 PHE C N   1 
ATOM   5250  C CA  . PHE B 1 268 ? 29.534 6.995   43.959  1.00 49.33  ? 265 PHE C CA  1 
ATOM   5251  C C   . PHE B 1 268 ? 30.600 7.976   44.425  1.00 49.46  ? 265 PHE C C   1 
ATOM   5252  O O   . PHE B 1 268 ? 30.308 9.119   44.786  1.00 49.77  ? 265 PHE C O   1 
ATOM   5253  C CB  . PHE B 1 268 ? 29.674 6.683   42.462  1.00 46.36  ? 265 PHE C CB  1 
ATOM   5254  C CG  . PHE B 1 268 ? 29.492 7.880   41.571  1.00 46.26  ? 265 PHE C CG  1 
ATOM   5255  C CD1 . PHE B 1 268 ? 28.235 8.227   41.101  1.00 46.74  ? 265 PHE C CD1 1 
ATOM   5256  C CD2 . PHE B 1 268 ? 30.579 8.656   41.198  1.00 41.18  ? 265 PHE C CD2 1 
ATOM   5257  C CE1 . PHE B 1 268 ? 28.064 9.328   40.278  1.00 42.94  ? 265 PHE C CE1 1 
ATOM   5258  C CE2 . PHE B 1 268 ? 30.416 9.759   40.375  1.00 45.72  ? 265 PHE C CE2 1 
ATOM   5259  C CZ  . PHE B 1 268 ? 29.155 10.094  39.914  1.00 41.76  ? 265 PHE C CZ  1 
ATOM   5260  N N   . ILE B 1 269 ? 31.845 7.512   44.430  1.00 43.84  ? 266 ILE C N   1 
ATOM   5261  C CA  . ILE B 1 269 ? 32.992 8.338   44.779  1.00 41.36  ? 266 ILE C CA  1 
ATOM   5262  C C   . ILE B 1 269 ? 33.776 8.605   43.504  1.00 44.11  ? 266 ILE C C   1 
ATOM   5263  O O   . ILE B 1 269 ? 34.060 7.679   42.733  1.00 45.03  ? 266 ILE C O   1 
ATOM   5264  C CB  . ILE B 1 269 ? 33.883 7.680   45.848  1.00 45.87  ? 266 ILE C CB  1 
ATOM   5265  C CG1 . ILE B 1 269 ? 33.084 7.388   47.119  1.00 49.96  ? 266 ILE C CG1 1 
ATOM   5266  C CG2 . ILE B 1 269 ? 35.057 8.580   46.192  1.00 44.55  ? 266 ILE C CG2 1 
ATOM   5267  C CD1 . ILE B 1 269 ? 32.488 6.010   47.160  1.00 58.40  ? 266 ILE C CD1 1 
ATOM   5268  N N   . TRP B 1 270 ? 34.109 9.871   43.278  1.00 43.04  ? 267 TRP C N   1 
ATOM   5269  C CA  . TRP B 1 270 ? 34.837 10.312  42.094  1.00 44.85  ? 267 TRP C CA  1 
ATOM   5270  C C   . TRP B 1 270 ? 36.179 10.872  42.550  1.00 41.00  ? 267 TRP C C   1 
ATOM   5271  O O   . TRP B 1 270 ? 36.238 11.948  43.155  1.00 42.58  ? 267 TRP C O   1 
ATOM   5272  C CB  . TRP B 1 270 ? 34.022 11.349  41.323  1.00 36.76  ? 267 TRP C CB  1 
ATOM   5273  C CG  . TRP B 1 270 ? 34.657 11.868  40.063  1.00 44.65  ? 267 TRP C CG  1 
ATOM   5274  C CD1 . TRP B 1 270 ? 35.898 11.569  39.575  1.00 42.54  ? 267 TRP C CD1 1 
ATOM   5275  C CD2 . TRP B 1 270 ? 34.071 12.784  39.130  1.00 44.42  ? 267 TRP C CD2 1 
ATOM   5276  N NE1 . TRP B 1 270 ? 36.120 12.244  38.400  1.00 43.80  ? 267 TRP C NE1 1 
ATOM   5277  C CE2 . TRP B 1 270 ? 35.014 12.997  38.105  1.00 41.00  ? 267 TRP C CE2 1 
ATOM   5278  C CE3 . TRP B 1 270 ? 32.839 13.444  39.062  1.00 44.80  ? 267 TRP C CE3 1 
ATOM   5279  C CZ2 . TRP B 1 270 ? 34.764 13.844  37.026  1.00 42.65  ? 267 TRP C CZ2 1 
ATOM   5280  C CZ3 . TRP B 1 270 ? 32.593 14.284  37.991  1.00 45.68  ? 267 TRP C CZ3 1 
ATOM   5281  C CH2 . TRP B 1 270 ? 33.551 14.476  36.987  1.00 40.70  ? 267 TRP C CH2 1 
ATOM   5282  N N   . ALA B 1 271 ? 37.250 10.137  42.269  1.00 38.85  ? 268 ALA C N   1 
ATOM   5283  C CA  . ALA B 1 271 ? 38.603 10.596  42.551  1.00 46.24  ? 268 ALA C CA  1 
ATOM   5284  C C   . ALA B 1 271 ? 39.115 11.371  41.343  1.00 42.82  ? 268 ALA C C   1 
ATOM   5285  O O   . ALA B 1 271 ? 39.250 10.809  40.250  1.00 43.22  ? 268 ALA C O   1 
ATOM   5286  C CB  . ALA B 1 271 ? 39.522 9.419   42.875  1.00 36.00  ? 268 ALA C CB  1 
ATOM   5287  N N   . CYS B 1 272 ? 39.384 12.658  41.538  1.00 39.42  ? 269 CYS C N   1 
ATOM   5288  C CA  . CYS B 1 272 ? 39.805 13.552  40.467  1.00 51.80  ? 269 CYS C CA  1 
ATOM   5289  C C   . CYS B 1 272 ? 41.287 13.856  40.616  1.00 48.78  ? 269 CYS C C   1 
ATOM   5290  O O   . CYS B 1 272 ? 41.719 14.357  41.660  1.00 42.67  ? 269 CYS C O   1 
ATOM   5291  C CB  . CYS B 1 272 ? 39.002 14.852  40.482  1.00 49.16  ? 269 CYS C CB  1 
ATOM   5292  S SG  . CYS B 1 272 ? 37.237 14.667  40.187  1.00 61.66  ? 269 CYS C SG  1 
ATOM   5293  N N   . LYS B 1 273 ? 42.058 13.563  39.571  1.00 51.78  ? 270 LYS C N   1 
ATOM   5294  C CA  . LYS B 1 273 ? 43.465 13.936  39.561  1.00 51.40  ? 270 LYS C CA  1 
ATOM   5295  C C   . LYS B 1 273 ? 43.584 15.455  39.474  1.00 55.26  ? 270 LYS C C   1 
ATOM   5296  O O   . LYS B 1 273 ? 43.994 16.104  40.442  1.00 69.57  ? 270 LYS C O   1 
ATOM   5297  C CB  . LYS B 1 273 ? 44.197 13.251  38.405  1.00 44.43  ? 270 LYS C CB  1 
ATOM   5298  C CG  . LYS B 1 273 ? 45.699 13.400  38.486  1.00 55.54  ? 270 LYS C CG  1 
ATOM   5299  C CD  . LYS B 1 273 ? 46.337 13.344  37.113  1.00 56.53  ? 270 LYS C CD  1 
ATOM   5300  C CE  . LYS B 1 273 ? 46.307 14.678  36.396  1.00 62.73  ? 270 LYS C CE  1 
ATOM   5301  N NZ  . LYS B 1 273 ? 47.514 15.513  36.598  1.00 58.71  ? 270 LYS C NZ  1 
ATOM   5302  N N   . ASN B 1 274 ? 43.216 16.034  38.329  1.00 64.54  ? 271 ASN C N   1 
ATOM   5303  C CA  . ASN B 1 274 ? 43.144 17.488  38.174  1.00 69.30  ? 271 ASN C CA  1 
ATOM   5304  C C   . ASN B 1 274 ? 41.826 17.972  38.763  1.00 70.33  ? 271 ASN C C   1 
ATOM   5305  O O   . ASN B 1 274 ? 40.773 17.860  38.131  1.00 75.59  ? 271 ASN C O   1 
ATOM   5306  C CB  . ASN B 1 274 ? 43.249 17.893  36.706  1.00 64.69  ? 271 ASN C CB  1 
ATOM   5307  C CG  . ASN B 1 274 ? 44.684 18.084  36.240  1.00 77.30  ? 271 ASN C CG  1 
ATOM   5308  O OD1 . ASN B 1 274 ? 45.361 17.127  35.878  1.00 81.42  ? 271 ASN C OD1 1 
ATOM   5309  N ND2 . ASN B 1 274 ? 45.144 19.328  36.231  1.00 73.34  ? 271 ASN C ND2 1 
ATOM   5310  N N   . TYR B 1 275 ? 41.873 18.519  39.975  1.00 65.31  ? 272 TYR C N   1 
ATOM   5311  C CA  . TYR B 1 275 ? 40.677 19.050  40.622  1.00 65.53  ? 272 TYR C CA  1 
ATOM   5312  C C   . TYR B 1 275 ? 40.993 20.381  41.287  1.00 65.70  ? 272 TYR C C   1 
ATOM   5313  O O   . TYR B 1 275 ? 41.778 20.437  42.239  1.00 64.70  ? 272 TYR C O   1 
ATOM   5314  C CB  . TYR B 1 275 ? 40.102 18.067  41.642  1.00 66.43  ? 272 TYR C CB  1 
ATOM   5315  C CG  . TYR B 1 275 ? 38.642 18.328  41.927  1.00 63.52  ? 272 TYR C CG  1 
ATOM   5316  C CD1 . TYR B 1 275 ? 37.683 18.141  40.940  1.00 64.28  ? 272 TYR C CD1 1 
ATOM   5317  C CD2 . TYR B 1 275 ? 38.224 18.789  43.168  1.00 59.74  ? 272 TYR C CD2 1 
ATOM   5318  C CE1 . TYR B 1 275 ? 36.347 18.390  41.185  1.00 62.83  ? 272 TYR C CE1 1 
ATOM   5319  C CE2 . TYR B 1 275 ? 36.888 19.040  43.425  1.00 61.53  ? 272 TYR C CE2 1 
ATOM   5320  C CZ  . TYR B 1 275 ? 35.954 18.843  42.427  1.00 66.71  ? 272 TYR C CZ  1 
ATOM   5321  O OH  . TYR B 1 275 ? 34.622 19.087  42.670  1.00 64.54  ? 272 TYR C OH  1 
ATOM   5322  N N   . ASP B 1 276 ? 40.382 21.448  40.777  1.00 67.69  ? 273 ASP C N   1 
ATOM   5323  C CA  . ASP B 1 276 ? 40.331 22.732  41.468  1.00 62.38  ? 273 ASP C CA  1 
ATOM   5324  C C   . ASP B 1 276 ? 39.035 22.736  42.267  1.00 63.87  ? 273 ASP C C   1 
ATOM   5325  O O   . ASP B 1 276 ? 37.965 23.069  41.753  1.00 59.42  ? 273 ASP C O   1 
ATOM   5326  C CB  . ASP B 1 276 ? 40.399 23.888  40.478  1.00 66.27  ? 273 ASP C CB  1 
ATOM   5327  C CG  . ASP B 1 276 ? 40.783 25.201  41.135  1.00 62.74  ? 273 ASP C CG  1 
ATOM   5328  O OD1 . ASP B 1 276 ? 40.635 25.319  42.369  1.00 61.79  ? 273 ASP C OD1 1 
ATOM   5329  O OD2 . ASP B 1 276 ? 41.229 26.119  40.415  1.00 59.91  ? 273 ASP C OD2 1 
ATOM   5330  N N   . GLY B 1 277 ? 39.132 22.340  43.540  1.00 55.56  ? 274 GLY C N   1 
ATOM   5331  C CA  . GLY B 1 277 ? 37.937 22.220  44.362  1.00 61.36  ? 274 GLY C CA  1 
ATOM   5332  C C   . GLY B 1 277 ? 37.230 23.546  44.574  1.00 59.53  ? 274 GLY C C   1 
ATOM   5333  O O   . GLY B 1 277 ? 35.998 23.604  44.620  1.00 59.05  ? 274 GLY C O   1 
ATOM   5334  N N   . ASP B 1 278 ? 38.001 24.631  44.703  1.00 61.24  ? 275 ASP C N   1 
ATOM   5335  C CA  . ASP B 1 278 ? 37.404 25.953  44.862  1.00 60.25  ? 275 ASP C CA  1 
ATOM   5336  C C   . ASP B 1 278 ? 36.552 26.328  43.659  1.00 59.61  ? 275 ASP C C   1 
ATOM   5337  O O   . ASP B 1 278 ? 35.632 27.145  43.780  1.00 54.29  ? 275 ASP C O   1 
ATOM   5338  C CB  . ASP B 1 278 ? 38.501 26.995  45.081  1.00 59.68  ? 275 ASP C CB  1 
ATOM   5339  C CG  . ASP B 1 278 ? 38.216 27.903  46.262  1.00 74.48  ? 275 ASP C CG  1 
ATOM   5340  O OD1 . ASP B 1 278 ? 37.059 28.353  46.408  1.00 74.40  ? 275 ASP C OD1 1 
ATOM   5341  O OD2 . ASP B 1 278 ? 39.153 28.168  47.045  1.00 73.08  ? 275 ASP C OD2 1 
ATOM   5342  N N   . VAL B 1 279 ? 36.831 25.734  42.499  1.00 57.06  ? 276 VAL C N   1 
ATOM   5343  C CA  . VAL B 1 279 ? 36.153 26.086  41.257  1.00 54.66  ? 276 VAL C CA  1 
ATOM   5344  C C   . VAL B 1 279 ? 35.078 25.058  40.935  1.00 54.85  ? 276 VAL C C   1 
ATOM   5345  O O   . VAL B 1 279 ? 33.896 25.396  40.805  1.00 57.81  ? 276 VAL C O   1 
ATOM   5346  C CB  . VAL B 1 279 ? 37.156 26.202  40.094  1.00 55.05  ? 276 VAL C CB  1 
ATOM   5347  C CG1 . VAL B 1 279 ? 36.427 26.369  38.766  1.00 53.20  ? 276 VAL C CG1 1 
ATOM   5348  C CG2 . VAL B 1 279 ? 38.116 27.358  40.334  1.00 43.89  ? 276 VAL C CG2 1 
ATOM   5349  N N   . GLN B 1 280 ? 35.485 23.794  40.804  1.00 50.68  ? 277 GLN C N   1 
ATOM   5350  C CA  . GLN B 1 280 ? 34.575 22.761  40.322  1.00 58.68  ? 277 GLN C CA  1 
ATOM   5351  C C   . GLN B 1 280 ? 33.531 22.364  41.356  1.00 58.34  ? 277 GLN C C   1 
ATOM   5352  O O   . GLN B 1 280 ? 32.517 21.760  40.995  1.00 54.40  ? 277 GLN C O   1 
ATOM   5353  C CB  . GLN B 1 280 ? 35.372 21.534  39.887  1.00 57.95  ? 277 GLN C CB  1 
ATOM   5354  C CG  . GLN B 1 280 ? 36.430 21.859  38.858  1.00 64.06  ? 277 GLN C CG  1 
ATOM   5355  C CD  . GLN B 1 280 ? 37.377 20.708  38.591  1.00 69.21  ? 277 GLN C CD  1 
ATOM   5356  O OE1 . GLN B 1 280 ? 38.534 20.736  39.009  1.00 63.92  ? 277 GLN C OE1 1 
ATOM   5357  N NE2 . GLN B 1 280 ? 36.894 19.692  37.885  1.00 65.50  ? 277 GLN C NE2 1 
ATOM   5358  N N   . SER B 1 281 ? 33.748 22.688  42.631  1.00 51.26  ? 278 SER C N   1 
ATOM   5359  C CA  . SER B 1 281 ? 32.797 22.341  43.684  1.00 54.70  ? 278 SER C CA  1 
ATOM   5360  C C   . SER B 1 281 ? 32.267 23.588  44.376  1.00 45.03  ? 278 SER C C   1 
ATOM   5361  O O   . SER B 1 281 ? 31.066 23.860  44.297  1.00 45.17  ? 278 SER C O   1 
ATOM   5362  C CB  . SER B 1 281 ? 33.447 21.378  44.680  1.00 53.96  ? 278 SER C CB  1 
ATOM   5363  O OG  . SER B 1 281 ? 32.492 20.489  45.234  1.00 61.09  ? 278 SER C OG  1 
ATOM   5364  N N   . ASP B 1 282 ? 33.122 24.366  45.043  1.00 45.30  ? 279 ASP C N   1 
ATOM   5365  C CA  . ASP B 1 282 ? 32.635 25.475  45.857  1.00 48.24  ? 279 ASP C CA  1 
ATOM   5366  C C   . ASP B 1 282 ? 32.007 26.569  44.999  1.00 46.88  ? 279 ASP C C   1 
ATOM   5367  O O   . ASP B 1 282 ? 30.913 27.057  45.306  1.00 48.94  ? 279 ASP C O   1 
ATOM   5368  C CB  . ASP B 1 282 ? 33.772 26.042  46.708  1.00 49.65  ? 279 ASP C CB  1 
ATOM   5369  C CG  . ASP B 1 282 ? 34.350 25.019  47.663  1.00 59.76  ? 279 ASP C CG  1 
ATOM   5370  O OD1 . ASP B 1 282 ? 33.671 24.002  47.929  1.00 61.47  ? 279 ASP C OD1 1 
ATOM   5371  O OD2 . ASP B 1 282 ? 35.481 25.228  48.149  1.00 66.63  ? 279 ASP C OD2 1 
ATOM   5372  N N   . SER B 1 283 ? 32.682 26.965  43.915  1.00 44.65  ? 280 SER C N   1 
ATOM   5373  C CA  . SER B 1 283 ? 32.187 28.075  43.103  1.00 50.43  ? 280 SER C CA  1 
ATOM   5374  C C   . SER B 1 283 ? 30.853 27.738  42.452  1.00 44.98  ? 280 SER C C   1 
ATOM   5375  O O   . SER B 1 283 ? 29.948 28.579  42.405  1.00 41.02  ? 280 SER C O   1 
ATOM   5376  C CB  . SER B 1 283 ? 33.222 28.459  42.046  1.00 46.78  ? 280 SER C CB  1 
ATOM   5377  O OG  . SER B 1 283 ? 34.429 28.890  42.650  1.00 58.11  ? 280 SER C OG  1 
ATOM   5378  N N   . VAL B 1 284 ? 30.710 26.511  41.948  1.00 46.54  ? 281 VAL C N   1 
ATOM   5379  C CA  . VAL B 1 284 ? 29.435 26.090  41.374  1.00 48.21  ? 281 VAL C CA  1 
ATOM   5380  C C   . VAL B 1 284 ? 28.352 26.094  42.444  1.00 44.95  ? 281 VAL C C   1 
ATOM   5381  O O   . VAL B 1 284 ? 27.265 26.651  42.249  1.00 45.67  ? 281 VAL C O   1 
ATOM   5382  C CB  . VAL B 1 284 ? 29.571 24.707  40.711  1.00 49.10  ? 281 VAL C CB  1 
ATOM   5383  C CG1 . VAL B 1 284 ? 28.233 24.263  40.134  1.00 40.23  ? 281 VAL C CG1 1 
ATOM   5384  C CG2 . VAL B 1 284 ? 30.642 24.746  39.631  1.00 42.71  ? 281 VAL C CG2 1 
ATOM   5385  N N   . ALA B 1 285 ? 28.639 25.480  43.597  1.00 45.06  ? 282 ALA C N   1 
ATOM   5386  C CA  . ALA B 1 285 ? 27.694 25.512  44.709  1.00 43.56  ? 282 ALA C CA  1 
ATOM   5387  C C   . ALA B 1 285 ? 27.390 26.945  45.126  1.00 46.35  ? 282 ALA C C   1 
ATOM   5388  O O   . ALA B 1 285 ? 26.244 27.278  45.450  1.00 49.50  ? 282 ALA C O   1 
ATOM   5389  C CB  . ALA B 1 285 ? 28.245 24.711  45.889  1.00 42.38  ? 282 ALA C CB  1 
ATOM   5390  N N   . GLN B 1 286 ? 28.406 27.812  45.106  1.00 47.33  ? 283 GLN C N   1 
ATOM   5391  C CA  . GLN B 1 286 ? 28.196 29.224  45.410  1.00 46.86  ? 283 GLN C CA  1 
ATOM   5392  C C   . GLN B 1 286 ? 27.261 29.871  44.394  1.00 52.98  ? 283 GLN C C   1 
ATOM   5393  O O   . GLN B 1 286 ? 26.325 30.592  44.763  1.00 51.55  ? 283 GLN C O   1 
ATOM   5394  C CB  . GLN B 1 286 ? 29.542 29.943  45.442  1.00 52.17  ? 283 GLN C CB  1 
ATOM   5395  C CG  . GLN B 1 286 ? 29.536 31.306  46.102  1.00 61.23  ? 283 GLN C CG  1 
ATOM   5396  C CD  . GLN B 1 286 ? 30.932 31.738  46.494  1.00 67.52  ? 283 GLN C CD  1 
ATOM   5397  O OE1 . GLN B 1 286 ? 31.771 30.907  46.842  1.00 73.43  ? 283 GLN C OE1 1 
ATOM   5398  N NE2 . GLN B 1 286 ? 31.195 33.037  46.424  1.00 68.46  ? 283 GLN C NE2 1 
ATOM   5399  N N   . GLY B 1 287 ? 27.501 29.622  43.105  1.00 45.51  ? 284 GLY C N   1 
ATOM   5400  C CA  . GLY B 1 287 ? 26.614 30.152  42.081  1.00 46.95  ? 284 GLY C CA  1 
ATOM   5401  C C   . GLY B 1 287 ? 25.243 29.504  42.111  1.00 49.67  ? 284 GLY C C   1 
ATOM   5402  O O   . GLY B 1 287 ? 24.224 30.172  41.913  1.00 46.02  ? 284 GLY C O   1 
ATOM   5403  N N   . TYR B 1 288 ? 25.198 28.193  42.360  1.00 51.34  ? 285 TYR C N   1 
ATOM   5404  C CA  . TYR B 1 288 ? 23.924 27.500  42.493  1.00 49.26  ? 285 TYR C CA  1 
ATOM   5405  C C   . TYR B 1 288 ? 23.220 27.838  43.801  1.00 46.94  ? 285 TYR C C   1 
ATOM   5406  O O   . TYR B 1 288 ? 21.993 27.714  43.878  1.00 48.38  ? 285 TYR C O   1 
ATOM   5407  C CB  . TYR B 1 288 ? 24.138 25.990  42.386  1.00 48.18  ? 285 TYR C CB  1 
ATOM   5408  C CG  . TYR B 1 288 ? 22.865 25.198  42.207  1.00 52.06  ? 285 TYR C CG  1 
ATOM   5409  C CD1 . TYR B 1 288 ? 22.106 25.321  41.051  1.00 45.80  ? 285 TYR C CD1 1 
ATOM   5410  C CD2 . TYR B 1 288 ? 22.428 24.319  43.190  1.00 48.14  ? 285 TYR C CD2 1 
ATOM   5411  C CE1 . TYR B 1 288 ? 20.943 24.596  40.880  1.00 48.10  ? 285 TYR C CE1 1 
ATOM   5412  C CE2 . TYR B 1 288 ? 21.267 23.590  43.029  1.00 46.69  ? 285 TYR C CE2 1 
ATOM   5413  C CZ  . TYR B 1 288 ? 20.529 23.731  41.873  1.00 51.12  ? 285 TYR C CZ  1 
ATOM   5414  O OH  . TYR B 1 288 ? 19.372 23.007  41.710  1.00 48.04  ? 285 TYR C OH  1 
ATOM   5415  N N   . GLY B 1 289 ? 23.965 28.255  44.823  1.00 50.81  ? 286 GLY C N   1 
ATOM   5416  C CA  . GLY B 1 289 ? 23.383 28.661  46.089  1.00 51.94  ? 286 GLY C CA  1 
ATOM   5417  C C   . GLY B 1 289 ? 23.234 27.544  47.103  1.00 49.85  ? 286 GLY C C   1 
ATOM   5418  O O   . GLY B 1 289 ? 22.229 27.488  47.816  1.00 54.77  ? 286 GLY C O   1 
ATOM   5419  N N   . SER B 1 290 ? 24.227 26.657  47.195  1.00 42.90  ? 287 SER C N   1 
ATOM   5420  C CA  . SER B 1 290 ? 24.133 25.502  48.080  1.00 46.19  ? 287 SER C CA  1 
ATOM   5421  C C   . SER B 1 290 ? 25.430 25.267  48.848  1.00 51.28  ? 287 SER C C   1 
ATOM   5422  O O   . SER B 1 290 ? 25.734 24.132  49.226  1.00 51.59  ? 287 SER C O   1 
ATOM   5423  C CB  . SER B 1 290 ? 23.742 24.250  47.296  1.00 47.82  ? 287 SER C CB  1 
ATOM   5424  O OG  . SER B 1 290 ? 24.629 24.025  46.213  1.00 52.00  ? 287 SER C OG  1 
ATOM   5425  N N   . LEU B 1 291 ? 26.200 26.330  49.099  1.00 45.91  ? 288 LEU C N   1 
ATOM   5426  C CA  . LEU B 1 291 ? 27.423 26.179  49.884  1.00 48.46  ? 288 LEU C CA  1 
ATOM   5427  C C   . LEU B 1 291 ? 27.125 25.742  51.313  1.00 49.87  ? 288 LEU C C   1 
ATOM   5428  O O   . LEU B 1 291 ? 27.928 25.027  51.927  1.00 44.03  ? 288 LEU C O   1 
ATOM   5429  C CB  . LEU B 1 291 ? 28.217 27.486  49.887  1.00 49.56  ? 288 LEU C CB  1 
ATOM   5430  C CG  . LEU B 1 291 ? 29.331 27.648  48.849  1.00 54.66  ? 288 LEU C CG  1 
ATOM   5431  C CD1 . LEU B 1 291 ? 29.985 29.008  49.015  1.00 47.66  ? 288 LEU C CD1 1 
ATOM   5432  C CD2 . LEU B 1 291 ? 30.363 26.534  48.965  1.00 46.70  ? 288 LEU C CD2 1 
ATOM   5433  N N   . GLY B 1 292 ? 25.980 26.153  51.857  1.00 42.82  ? 289 GLY C N   1 
ATOM   5434  C CA  . GLY B 1 292 ? 25.582 25.706  53.181  1.00 44.49  ? 289 GLY C CA  1 
ATOM   5435  C C   . GLY B 1 292 ? 25.213 24.238  53.263  1.00 42.69  ? 289 GLY C C   1 
ATOM   5436  O O   . GLY B 1 292 ? 24.979 23.740  54.369  1.00 46.14  ? 289 GLY C O   1 
ATOM   5437  N N   . MET B 1 293 ? 25.147 23.543  52.127  1.00 35.77  ? 290 MET C N   1 
ATOM   5438  C CA  . MET B 1 293 ? 24.837 22.119  52.080  1.00 40.96  ? 290 MET C CA  1 
ATOM   5439  C C   . MET B 1 293 ? 26.031 21.291  51.624  1.00 41.74  ? 290 MET C C   1 
ATOM   5440  O O   . MET B 1 293 ? 25.863 20.140  51.207  1.00 39.64  ? 290 MET C O   1 
ATOM   5441  C CB  . MET B 1 293 ? 23.644 21.865  51.160  1.00 37.11  ? 290 MET C CB  1 
ATOM   5442  C CG  . MET B 1 293 ? 22.378 22.569  51.590  1.00 45.53  ? 290 MET C CG  1 
ATOM   5443  S SD  . MET B 1 293 ? 21.909 22.134  53.270  1.00 41.50  ? 290 MET C SD  1 
ATOM   5444  C CE  . MET B 1 293 ? 20.762 20.795  52.954  1.00 38.10  ? 290 MET C CE  1 
ATOM   5445  N N   . MET B 1 294 ? 27.233 21.858  51.694  1.00 39.19  ? 291 MET C N   1 
ATOM   5446  C CA  . MET B 1 294 ? 28.451 21.221  51.208  1.00 45.41  ? 291 MET C CA  1 
ATOM   5447  C C   . MET B 1 294 ? 29.379 20.954  52.386  1.00 46.75  ? 291 MET C C   1 
ATOM   5448  O O   . MET B 1 294 ? 29.761 21.883  53.106  1.00 47.55  ? 291 MET C O   1 
ATOM   5449  C CB  . MET B 1 294 ? 29.139 22.102  50.163  1.00 45.57  ? 291 MET C CB  1 
ATOM   5450  C CG  . MET B 1 294 ? 30.322 21.455  49.462  1.00 53.46  ? 291 MET C CG  1 
ATOM   5451  S SD  . MET B 1 294 ? 29.843 20.197  48.271  1.00 71.84  ? 291 MET C SD  1 
ATOM   5452  C CE  . MET B 1 294 ? 28.631 21.097  47.311  1.00 45.35  ? 291 MET C CE  1 
ATOM   5453  N N   . THR B 1 295 ? 29.740 19.688  52.578  1.00 45.78  ? 292 THR C N   1 
ATOM   5454  C CA  . THR B 1 295 ? 30.615 19.280  53.663  1.00 48.17  ? 292 THR C CA  1 
ATOM   5455  C C   . THR B 1 295 ? 31.897 18.682  53.099  1.00 46.13  ? 292 THR C C   1 
ATOM   5456  O O   . THR B 1 295 ? 31.948 18.211  51.957  1.00 44.15  ? 292 THR C O   1 
ATOM   5457  C CB  . THR B 1 295 ? 29.919 18.272  54.594  1.00 53.79  ? 292 THR C CB  1 
ATOM   5458  O OG1 . THR B 1 295 ? 30.496 18.344  55.906  1.00 55.45  ? 292 THR C OG1 1 
ATOM   5459  C CG2 . THR B 1 295 ? 30.056 16.855  54.057  1.00 37.96  ? 292 THR C CG2 1 
ATOM   5460  N N   . SER B 1 296 ? 32.940 18.712  53.923  1.00 40.14  ? 293 SER C N   1 
ATOM   5461  C CA  . SER B 1 296 ? 34.272 18.281  53.530  1.00 49.13  ? 293 SER C CA  1 
ATOM   5462  C C   . SER B 1 296 ? 34.930 17.566  54.700  1.00 53.22  ? 293 SER C C   1 
ATOM   5463  O O   . SER B 1 296 ? 34.761 17.966  55.855  1.00 56.99  ? 293 SER C O   1 
ATOM   5464  C CB  . SER B 1 296 ? 35.128 19.476  53.087  1.00 46.95  ? 293 SER C CB  1 
ATOM   5465  O OG  . SER B 1 296 ? 36.486 19.108  52.944  1.00 56.07  ? 293 SER C OG  1 
ATOM   5466  N N   . VAL B 1 297 ? 35.677 16.506  54.400  1.00 45.66  ? 294 VAL C N   1 
ATOM   5467  C CA  . VAL B 1 297 ? 36.388 15.748  55.425  1.00 53.18  ? 294 VAL C CA  1 
ATOM   5468  C C   . VAL B 1 297 ? 37.740 15.319  54.874  1.00 47.99  ? 294 VAL C C   1 
ATOM   5469  O O   . VAL B 1 297 ? 37.830 14.797  53.758  1.00 51.40  ? 294 VAL C O   1 
ATOM   5470  C CB  . VAL B 1 297 ? 35.577 14.529  55.914  1.00 47.24  ? 294 VAL C CB  1 
ATOM   5471  C CG1 . VAL B 1 297 ? 35.180 13.632  54.752  1.00 49.23  ? 294 VAL C CG1 1 
ATOM   5472  C CG2 . VAL B 1 297 ? 36.367 13.751  56.958  1.00 56.42  ? 294 VAL C CG2 1 
ATOM   5473  N N   . LEU B 1 298 ? 38.790 15.555  55.655  1.00 51.51  ? 295 LEU C N   1 
ATOM   5474  C CA  . LEU B 1 298 ? 40.147 15.160  55.302  1.00 51.19  ? 295 LEU C CA  1 
ATOM   5475  C C   . LEU B 1 298 ? 40.405 13.750  55.819  1.00 49.12  ? 295 LEU C C   1 
ATOM   5476  O O   . LEU B 1 298 ? 40.337 13.509  57.028  1.00 50.71  ? 295 LEU C O   1 
ATOM   5477  C CB  . LEU B 1 298 ? 41.156 16.142  55.894  1.00 42.44  ? 295 LEU C CB  1 
ATOM   5478  C CG  . LEU B 1 298 ? 42.635 15.769  55.788  1.00 48.09  ? 295 LEU C CG  1 
ATOM   5479  C CD1 . LEU B 1 298 ? 43.108 15.862  54.347  1.00 53.81  ? 295 LEU C CD1 1 
ATOM   5480  C CD2 . LEU B 1 298 ? 43.485 16.640  56.701  1.00 53.77  ? 295 LEU C CD2 1 
ATOM   5481  N N   . VAL B 1 299 ? 40.696 12.826  54.911  1.00 46.88  ? 296 VAL C N   1 
ATOM   5482  C CA  . VAL B 1 299 ? 40.932 11.429  55.253  1.00 51.70  ? 296 VAL C CA  1 
ATOM   5483  C C   . VAL B 1 299 ? 42.420 11.149  55.100  1.00 60.33  ? 296 VAL C C   1 
ATOM   5484  O O   . VAL B 1 299 ? 42.965 11.218  53.993  1.00 64.31  ? 296 VAL C O   1 
ATOM   5485  C CB  . VAL B 1 299 ? 40.096 10.485  54.381  1.00 55.36  ? 296 VAL C CB  1 
ATOM   5486  C CG1 . VAL B 1 299 ? 40.375 9.037   54.752  1.00 49.92  ? 296 VAL C CG1 1 
ATOM   5487  C CG2 . VAL B 1 299 ? 38.614 10.801  54.531  1.00 55.05  ? 296 VAL C CG2 1 
ATOM   5488  N N   . CYS B 1 300 ? 43.078 10.836  56.211  1.00 61.96  ? 297 CYS C N   1 
ATOM   5489  C CA  . CYS B 1 300 ? 44.492 10.509  56.207  1.00 59.89  ? 297 CYS C CA  1 
ATOM   5490  C C   . CYS B 1 300 ? 44.705 9.085   55.702  1.00 61.28  ? 297 CYS C C   1 
ATOM   5491  O O   . CYS B 1 300 ? 43.796 8.252   55.759  1.00 65.55  ? 297 CYS C O   1 
ATOM   5492  C CB  . CYS B 1 300 ? 45.068 10.670  57.611  1.00 58.55  ? 297 CYS C CB  1 
ATOM   5493  S SG  . CYS B 1 300 ? 44.900 12.339  58.287  1.00 58.73  ? 297 CYS C SG  1 
ATOM   5494  N N   . PRO B 1 301 ? 45.903 8.779   55.192  1.00 71.30  ? 298 PRO C N   1 
ATOM   5495  C CA  . PRO B 1 301 ? 46.135 7.435   54.638  1.00 70.00  ? 298 PRO C CA  1 
ATOM   5496  C C   . PRO B 1 301 ? 46.231 6.341   55.685  1.00 76.53  ? 298 PRO C C   1 
ATOM   5497  O O   . PRO B 1 301 ? 46.110 5.162   55.327  1.00 75.22  ? 298 PRO C O   1 
ATOM   5498  C CB  . PRO B 1 301 ? 47.459 7.588   53.882  1.00 61.13  ? 298 PRO C CB  1 
ATOM   5499  C CG  . PRO B 1 301 ? 48.157 8.701   54.585  1.00 64.21  ? 298 PRO C CG  1 
ATOM   5500  C CD  . PRO B 1 301 ? 47.077 9.654   55.018  1.00 60.42  ? 298 PRO C CD  1 
ATOM   5501  N N   . ASP B 1 302 ? 46.439 6.679   56.959  1.00 70.99  ? 299 ASP C N   1 
ATOM   5502  C CA  . ASP B 1 302 ? 46.542 5.646   57.986  1.00 67.95  ? 299 ASP C CA  1 
ATOM   5503  C C   . ASP B 1 302 ? 45.260 4.834   58.123  1.00 70.40  ? 299 ASP C C   1 
ATOM   5504  O O   . ASP B 1 302 ? 45.271 3.780   58.769  1.00 71.38  ? 299 ASP C O   1 
ATOM   5505  C CB  . ASP B 1 302 ? 46.914 6.270   59.333  1.00 60.61  ? 299 ASP C CB  1 
ATOM   5506  C CG  . ASP B 1 302 ? 45.953 7.368   59.764  1.00 66.94  ? 299 ASP C CG  1 
ATOM   5507  O OD1 . ASP B 1 302 ? 44.791 7.377   59.306  1.00 67.64  ? 299 ASP C OD1 1 
ATOM   5508  O OD2 . ASP B 1 302 ? 46.368 8.230   60.567  1.00 56.41  ? 299 ASP C OD2 1 
ATOM   5509  N N   . GLY B 1 303 ? 44.163 5.296   57.526  1.00 67.97  ? 300 GLY C N   1 
ATOM   5510  C CA  . GLY B 1 303 ? 42.873 4.657   57.661  1.00 58.45  ? 300 GLY C CA  1 
ATOM   5511  C C   . GLY B 1 303 ? 42.116 5.003   58.925  1.00 68.37  ? 300 GLY C C   1 
ATOM   5512  O O   . GLY B 1 303 ? 41.004 4.493   59.119  1.00 66.01  ? 300 GLY C O   1 
ATOM   5513  N N   . LYS B 1 304 ? 42.669 5.863   59.781  1.00 61.37  ? 301 LYS C N   1 
ATOM   5514  C CA  . LYS B 1 304 ? 42.098 6.129   61.099  1.00 66.75  ? 301 LYS C CA  1 
ATOM   5515  C C   . LYS B 1 304 ? 41.847 7.604   61.375  1.00 59.65  ? 301 LYS C C   1 
ATOM   5516  O O   . LYS B 1 304 ? 40.858 7.937   62.034  1.00 59.87  ? 301 LYS C O   1 
ATOM   5517  C CB  . LYS B 1 304 ? 43.021 5.555   62.192  1.00 68.94  ? 301 LYS C CB  1 
ATOM   5518  C CG  . LYS B 1 304 ? 43.529 4.143   61.909  1.00 65.40  ? 301 LYS C CG  1 
ATOM   5519  C CD  . LYS B 1 304 ? 44.252 3.558   63.117  1.00 69.13  ? 301 LYS C CD  1 
ATOM   5520  C CE  . LYS B 1 304 ? 45.229 2.463   62.708  1.00 77.02  ? 301 LYS C CE  1 
ATOM   5521  N NZ  . LYS B 1 304 ? 46.408 3.003   61.975  1.00 77.92  ? 301 LYS C NZ  1 
ATOM   5522  N N   . THR B 1 305 ? 42.714 8.496   60.898  1.00 53.01  ? 302 THR C N   1 
ATOM   5523  C CA  . THR B 1 305 ? 42.627 9.912   61.234  1.00 58.82  ? 302 THR C CA  1 
ATOM   5524  C C   . THR B 1 305 ? 41.805 10.668  60.197  1.00 56.66  ? 302 THR C C   1 
ATOM   5525  O O   . THR B 1 305 ? 42.080 10.586  58.995  1.00 55.01  ? 302 THR C O   1 
ATOM   5526  C CB  . THR B 1 305 ? 44.022 10.529  61.339  1.00 60.16  ? 302 THR C CB  1 
ATOM   5527  O OG1 . THR B 1 305 ? 44.859 9.690   62.145  1.00 67.01  ? 302 THR C OG1 1 
ATOM   5528  C CG2 . THR B 1 305 ? 43.945 11.920  61.956  1.00 56.45  ? 302 THR C CG2 1 
ATOM   5529  N N   . VAL B 1 306 ? 40.795 11.401  60.668  1.00 53.04  ? 303 VAL C N   1 
ATOM   5530  C CA  . VAL B 1 306 ? 39.996 12.274  59.819  1.00 50.52  ? 303 VAL C CA  1 
ATOM   5531  C C   . VAL B 1 306 ? 39.813 13.619  60.507  1.00 51.64  ? 303 VAL C C   1 
ATOM   5532  O O   . VAL B 1 306 ? 39.836 13.724  61.738  1.00 50.62  ? 303 VAL C O   1 
ATOM   5533  C CB  . VAL B 1 306 ? 38.611 11.673  59.465  1.00 50.12  ? 303 VAL C CB  1 
ATOM   5534  C CG1 . VAL B 1 306 ? 38.745 10.254  58.922  1.00 50.73  ? 303 VAL C CG1 1 
ATOM   5535  C CG2 . VAL B 1 306 ? 37.680 11.723  60.664  1.00 50.95  ? 303 VAL C CG2 1 
ATOM   5536  N N   . GLU B 1 307 ? 39.641 14.656  59.689  1.00 42.50  ? 304 GLU C N   1 
ATOM   5537  C CA  . GLU B 1 307 ? 39.218 15.975  60.140  1.00 43.98  ? 304 GLU C CA  1 
ATOM   5538  C C   . GLU B 1 307 ? 38.045 16.396  59.272  1.00 50.45  ? 304 GLU C C   1 
ATOM   5539  O O   . GLU B 1 307 ? 38.168 16.446  58.044  1.00 51.55  ? 304 GLU C O   1 
ATOM   5540  C CB  . GLU B 1 307 ? 40.353 17.000  60.042  1.00 38.41  ? 304 GLU C CB  1 
ATOM   5541  C CG  . GLU B 1 307 ? 39.969 18.393  60.528  1.00 45.52  ? 304 GLU C CG  1 
ATOM   5542  C CD  . GLU B 1 307 ? 40.607 19.504  59.710  1.00 61.41  ? 304 GLU C CD  1 
ATOM   5543  O OE1 . GLU B 1 307 ? 41.439 19.200  58.828  1.00 64.26  ? 304 GLU C OE1 1 
ATOM   5544  O OE2 . GLU B 1 307 ? 40.274 20.684  59.950  1.00 58.03  ? 304 GLU C OE2 1 
ATOM   5545  N N   . ALA B 1 308 ? 36.913 16.688  59.903  1.00 46.62  ? 305 ALA C N   1 
ATOM   5546  C CA  . ALA B 1 308 ? 35.694 17.064  59.205  1.00 43.79  ? 305 ALA C CA  1 
ATOM   5547  C C   . ALA B 1 308 ? 35.405 18.543  59.416  1.00 49.20  ? 305 ALA C C   1 
ATOM   5548  O O   . ALA B 1 308 ? 35.728 19.115  60.462  1.00 50.63  ? 305 ALA C O   1 
ATOM   5549  C CB  . ALA B 1 308 ? 34.503 16.231  59.683  1.00 44.53  ? 305 ALA C CB  1 
ATOM   5550  N N   . GLU B 1 309 ? 34.783 19.155  58.413  1.00 47.84  ? 306 GLU C N   1 
ATOM   5551  C CA  . GLU B 1 309 ? 34.477 20.575  58.471  1.00 47.99  ? 306 GLU C CA  1 
ATOM   5552  C C   . GLU B 1 309 ? 33.477 20.911  57.379  1.00 47.95  ? 306 GLU C C   1 
ATOM   5553  O O   . GLU B 1 309 ? 33.272 20.143  56.437  1.00 45.64  ? 306 GLU C O   1 
ATOM   5554  C CB  . GLU B 1 309 ? 35.739 21.429  58.317  1.00 46.52  ? 306 GLU C CB  1 
ATOM   5555  C CG  . GLU B 1 309 ? 36.547 21.109  57.074  1.00 55.04  ? 306 GLU C CG  1 
ATOM   5556  C CD  . GLU B 1 309 ? 37.780 21.980  56.946  1.00 67.69  ? 306 GLU C CD  1 
ATOM   5557  O OE1 . GLU B 1 309 ? 37.703 23.174  57.306  1.00 71.55  ? 306 GLU C OE1 1 
ATOM   5558  O OE2 . GLU B 1 309 ? 38.826 21.470  56.494  1.00 71.23  ? 306 GLU C OE2 1 
ATOM   5559  N N   . ALA B 1 310 ? 32.845 22.068  57.531  1.00 41.54  ? 307 ALA C N   1 
ATOM   5560  C CA  . ALA B 1 310 ? 32.043 22.620  56.456  1.00 41.95  ? 307 ALA C CA  1 
ATOM   5561  C C   . ALA B 1 310 ? 32.950 23.063  55.317  1.00 43.77  ? 307 ALA C C   1 
ATOM   5562  O O   . ALA B 1 310 ? 34.110 23.428  55.523  1.00 43.51  ? 307 ALA C O   1 
ATOM   5563  C CB  . ALA B 1 310 ? 31.213 23.800  56.957  1.00 42.12  ? 307 ALA C CB  1 
ATOM   5564  N N   . ALA B 1 311 ? 32.415 23.025  54.101  1.00 50.97  ? 308 ALA C N   1 
ATOM   5565  C CA  . ALA B 1 311 ? 33.175 23.459  52.938  1.00 50.94  ? 308 ALA C CA  1 
ATOM   5566  C C   . ALA B 1 311 ? 33.121 24.965  52.716  1.00 44.21  ? 308 ALA C C   1 
ATOM   5567  O O   . ALA B 1 311 ? 33.871 25.478  51.880  1.00 59.84  ? 308 ALA C O   1 
ATOM   5568  C CB  . ALA B 1 311 ? 32.686 22.740  51.681  1.00 47.02  ? 308 ALA C CB  1 
ATOM   5569  N N   . HIS B 1 312 ? 32.263 25.681  53.438  1.00 48.31  ? 309 HIS C N   1 
ATOM   5570  C CA  . HIS B 1 312 ? 32.164 27.124  53.295  1.00 53.22  ? 309 HIS C CA  1 
ATOM   5571  C C   . HIS B 1 312 ? 33.046 27.819  54.333  1.00 55.59  ? 309 HIS C C   1 
ATOM   5572  O O   . HIS B 1 312 ? 33.771 27.182  55.098  1.00 56.91  ? 309 HIS C O   1 
ATOM   5573  C CB  . HIS B 1 312 ? 30.705 27.573  53.399  1.00 46.86  ? 309 HIS C CB  1 
ATOM   5574  C CG  . HIS B 1 312 ? 30.040 27.189  54.685  1.00 51.62  ? 309 HIS C CG  1 
ATOM   5575  N ND1 . HIS B 1 312 ? 30.226 27.886  55.859  1.00 48.95  ? 309 HIS C ND1 1 
ATOM   5576  C CD2 . HIS B 1 312 ? 29.171 26.190  54.975  1.00 51.45  ? 309 HIS C CD2 1 
ATOM   5577  C CE1 . HIS B 1 312 ? 29.509 27.329  56.819  1.00 47.89  ? 309 HIS C CE1 1 
ATOM   5578  N NE2 . HIS B 1 312 ? 28.860 26.298  56.309  1.00 51.38  ? 309 HIS C NE2 1 
ATOM   5579  N N   . GLY B 1 313 ? 32.995 29.147  54.352  1.00 53.99  ? 310 GLY C N   1 
ATOM   5580  C CA  . GLY B 1 313 ? 33.811 29.951  55.234  1.00 56.54  ? 310 GLY C CA  1 
ATOM   5581  C C   . GLY B 1 313 ? 33.032 30.518  56.403  1.00 57.47  ? 310 GLY C C   1 
ATOM   5582  O O   . GLY B 1 313 ? 31.937 30.057  56.743  1.00 51.09  ? 310 GLY C O   1 
ATOM   5583  N N   . THR B 1 314 ? 33.609 31.548  57.028  1.00 57.72  ? 311 THR C N   1 
ATOM   5584  C CA  . THR B 1 314 ? 33.000 32.151  58.210  1.00 53.20  ? 311 THR C CA  1 
ATOM   5585  C C   . THR B 1 314 ? 31.735 32.943  57.897  1.00 59.35  ? 311 THR C C   1 
ATOM   5586  O O   . THR B 1 314 ? 31.080 33.412  58.838  1.00 59.35  ? 311 THR C O   1 
ATOM   5587  C CB  . THR B 1 314 ? 33.997 33.069  58.919  1.00 62.47  ? 311 THR C CB  1 
ATOM   5588  O OG1 . THR B 1 314 ? 34.355 34.151  58.051  1.00 57.34  ? 311 THR C OG1 1 
ATOM   5589  C CG2 . THR B 1 314 ? 35.255 32.300  59.308  1.00 57.36  ? 311 THR C CG2 1 
ATOM   5590  N N   . VAL B 1 315 ? 31.374 33.090  56.618  1.00 54.27  ? 312 VAL C N   1 
ATOM   5591  C CA  . VAL B 1 315 ? 30.202 33.849  56.183  1.00 59.90  ? 312 VAL C CA  1 
ATOM   5592  C C   . VAL B 1 315 ? 30.259 35.253  56.769  1.00 59.90  ? 312 VAL C C   1 
ATOM   5593  O O   . VAL B 1 315 ? 29.388 35.649  57.555  1.00 52.18  ? 312 VAL C O   1 
ATOM   5594  C CB  . VAL B 1 315 ? 28.887 33.139  56.559  1.00 58.58  ? 312 VAL C CB  1 
ATOM   5595  C CG1 . VAL B 1 315 ? 27.756 33.628  55.667  1.00 56.28  ? 312 VAL C CG1 1 
ATOM   5596  C CG2 . VAL B 1 315 ? 29.039 31.634  56.429  1.00 52.66  ? 312 VAL C CG2 1 
ATOM   5597  N N   . THR B 1 316 ? 31.280 36.014  56.368  1.00 59.28  ? 313 THR C N   1 
ATOM   5598  C CA  . THR B 1 316 ? 31.503 37.342  56.928  1.00 58.49  ? 313 THR C CA  1 
ATOM   5599  C C   . THR B 1 316 ? 30.295 38.250  56.723  1.00 56.86  ? 313 THR C C   1 
ATOM   5600  O O   . THR B 1 316 ? 29.905 38.996  57.629  1.00 58.92  ? 313 THR C O   1 
ATOM   5601  C CB  . THR B 1 316 ? 32.752 37.961  56.301  1.00 64.67  ? 313 THR C CB  1 
ATOM   5602  O OG1 . THR B 1 316 ? 33.869 37.088  56.502  1.00 58.31  ? 313 THR C OG1 1 
ATOM   5603  C CG2 . THR B 1 316 ? 33.047 39.321  56.921  1.00 58.77  ? 313 THR C CG2 1 
ATOM   5604  N N   . ARG B 1 317 ? 29.683 38.193  55.535  1.00 58.49  ? 314 ARG C N   1 
ATOM   5605  C CA  . ARG B 1 317 ? 28.591 39.111  55.218  1.00 60.63  ? 314 ARG C CA  1 
ATOM   5606  C C   . ARG B 1 317 ? 27.440 38.970  56.203  1.00 65.40  ? 314 ARG C C   1 
ATOM   5607  O O   . ARG B 1 317 ? 26.867 39.973  56.647  1.00 68.88  ? 314 ARG C O   1 
ATOM   5608  C CB  . ARG B 1 317 ? 28.098 38.881  53.788  1.00 59.07  ? 314 ARG C CB  1 
ATOM   5609  C CG  . ARG B 1 317 ? 26.868 39.711  53.433  1.00 64.12  ? 314 ARG C CG  1 
ATOM   5610  C CD  . ARG B 1 317 ? 26.264 39.298  52.102  1.00 69.38  ? 314 ARG C CD  1 
ATOM   5611  N NE  . ARG B 1 317 ? 25.258 38.248  52.252  1.00 66.08  ? 314 ARG C NE  1 
ATOM   5612  C CZ  . ARG B 1 317 ? 23.955 38.471  52.402  1.00 68.26  ? 314 ARG C CZ  1 
ATOM   5613  N NH1 . ARG B 1 317 ? 23.489 39.712  52.418  1.00 62.61  ? 314 ARG C NH1 1 
ATOM   5614  N NH2 . ARG B 1 317 ? 23.117 37.450  52.532  1.00 67.88  ? 314 ARG C NH2 1 
ATOM   5615  N N   . HIS B 1 318 ? 27.092 37.733  56.564  1.00 61.67  ? 315 HIS C N   1 
ATOM   5616  C CA  . HIS B 1 318 ? 26.033 37.528  57.546  1.00 61.19  ? 315 HIS C CA  1 
ATOM   5617  C C   . HIS B 1 318 ? 26.454 38.032  58.922  1.00 61.99  ? 315 HIS C C   1 
ATOM   5618  O O   . HIS B 1 318 ? 25.633 38.579  59.668  1.00 65.63  ? 315 HIS C O   1 
ATOM   5619  C CB  . HIS B 1 318 ? 25.657 36.049  57.617  1.00 63.50  ? 315 HIS C CB  1 
ATOM   5620  C CG  . HIS B 1 318 ? 25.015 35.519  56.371  1.00 61.07  ? 315 HIS C CG  1 
ATOM   5621  N ND1 . HIS B 1 318 ? 24.073 34.513  56.394  1.00 64.07  ? 315 HIS C ND1 1 
ATOM   5622  C CD2 . HIS B 1 318 ? 25.191 35.840  55.067  1.00 61.76  ? 315 HIS C CD2 1 
ATOM   5623  C CE1 . HIS B 1 318 ? 23.689 34.243  55.159  1.00 57.41  ? 315 HIS C CE1 1 
ATOM   5624  N NE2 . HIS B 1 318 ? 24.353 35.033  54.335  1.00 60.53  ? 315 HIS C NE2 1 
ATOM   5625  N N   . TYR B 1 319 ? 27.732 37.856  59.273  1.00 61.54  ? 316 TYR C N   1 
ATOM   5626  C CA  . TYR B 1 319 ? 28.199 38.258  60.597  1.00 68.55  ? 316 TYR C CA  1 
ATOM   5627  C C   . TYR B 1 319 ? 28.102 39.767  60.785  1.00 66.25  ? 316 TYR C C   1 
ATOM   5628  O O   . TYR B 1 319 ? 27.718 40.241  61.861  1.00 64.18  ? 316 TYR C O   1 
ATOM   5629  C CB  . TYR B 1 319 ? 29.634 37.786  60.813  1.00 61.02  ? 316 TYR C CB  1 
ATOM   5630  C CG  . TYR B 1 319 ? 30.164 38.071  62.199  1.00 68.38  ? 316 TYR C CG  1 
ATOM   5631  C CD1 . TYR B 1 319 ? 29.499 37.612  63.329  1.00 64.72  ? 316 TYR C CD1 1 
ATOM   5632  C CD2 . TYR B 1 319 ? 31.324 38.813  62.377  1.00 68.73  ? 316 TYR C CD2 1 
ATOM   5633  C CE1 . TYR B 1 319 ? 29.982 37.875  64.597  1.00 70.14  ? 316 TYR C CE1 1 
ATOM   5634  C CE2 . TYR B 1 319 ? 31.816 39.077  63.637  1.00 63.10  ? 316 TYR C CE2 1 
ATOM   5635  C CZ  . TYR B 1 319 ? 31.141 38.608  64.744  1.00 71.41  ? 316 TYR C CZ  1 
ATOM   5636  O OH  . TYR B 1 319 ? 31.627 38.874  66.003  1.00 66.77  ? 316 TYR C OH  1 
ATOM   5637  N N   . ARG B 1 320 ? 28.458 40.536  59.752  1.00 66.27  ? 317 ARG C N   1 
ATOM   5638  C CA  . ARG B 1 320 ? 28.278 41.983  59.812  1.00 67.54  ? 317 ARG C CA  1 
ATOM   5639  C C   . ARG B 1 320 ? 26.814 42.334  60.039  1.00 70.99  ? 317 ARG C C   1 
ATOM   5640  O O   . ARG B 1 320 ? 26.494 43.207  60.855  1.00 69.96  ? 317 ARG C O   1 
ATOM   5641  C CB  . ARG B 1 320 ? 28.793 42.628  58.525  1.00 60.42  ? 317 ARG C CB  1 
ATOM   5642  C CG  . ARG B 1 320 ? 30.235 42.287  58.180  1.00 60.06  ? 317 ARG C CG  1 
ATOM   5643  C CD  . ARG B 1 320 ? 31.143 42.426  59.386  1.00 64.79  ? 317 ARG C CD  1 
ATOM   5644  N NE  . ARG B 1 320 ? 32.544 42.212  59.041  1.00 63.92  ? 317 ARG C NE  1 
ATOM   5645  C CZ  . ARG B 1 320 ? 33.518 42.093  59.935  1.00 63.75  ? 317 ARG C CZ  1 
ATOM   5646  N NH1 . ARG B 1 320 ? 33.239 42.167  61.229  1.00 62.02  ? 317 ARG C NH1 1 
ATOM   5647  N NH2 . ARG B 1 320 ? 34.769 41.899  59.539  1.00 55.91  ? 317 ARG C NH2 1 
ATOM   5648  N N   . MET B 1 321 ? 25.911 41.650  59.331  1.00 65.74  ? 318 MET C N   1 
ATOM   5649  C CA  . MET B 1 321 ? 24.480 41.857  59.530  1.00 69.92  ? 318 MET C CA  1 
ATOM   5650  C C   . MET B 1 321 ? 24.062 41.522  60.954  1.00 72.98  ? 318 MET C C   1 
ATOM   5651  O O   . MET B 1 321 ? 23.164 42.167  61.510  1.00 75.82  ? 318 MET C O   1 
ATOM   5652  C CB  . MET B 1 321 ? 23.693 41.002  58.540  1.00 73.27  ? 318 MET C CB  1 
ATOM   5653  C CG  . MET B 1 321 ? 22.858 41.783  57.550  1.00 70.56  ? 318 MET C CG  1 
ATOM   5654  S SD  . MET B 1 321 ? 22.031 40.658  56.413  1.00 78.35  ? 318 MET C SD  1 
ATOM   5655  C CE  . MET B 1 321 ? 23.444 39.848  55.668  1.00 63.27  ? 318 MET C CE  1 
ATOM   5656  N N   . TYR B 1 322 ? 24.699 40.517  61.556  1.00 75.36  ? 319 TYR C N   1 
ATOM   5657  C CA  . TYR B 1 322 ? 24.400 40.142  62.933  1.00 75.40  ? 319 TYR C CA  1 
ATOM   5658  C C   . TYR B 1 322 ? 25.008 41.133  63.920  1.00 73.19  ? 319 TYR C C   1 
ATOM   5659  O O   . TYR B 1 322 ? 24.421 41.406  64.974  1.00 65.28  ? 319 TYR C O   1 
ATOM   5660  C CB  . TYR B 1 322 ? 24.909 38.722  63.189  1.00 69.49  ? 319 TYR C CB  1 
ATOM   5661  C CG  . TYR B 1 322 ? 25.059 38.331  64.640  1.00 71.53  ? 319 TYR C CG  1 
ATOM   5662  C CD1 . TYR B 1 322 ? 23.990 37.799  65.348  1.00 71.26  ? 319 TYR C CD1 1 
ATOM   5663  C CD2 . TYR B 1 322 ? 26.278 38.463  65.292  1.00 72.33  ? 319 TYR C CD2 1 
ATOM   5664  C CE1 . TYR B 1 322 ? 24.126 37.427  66.670  1.00 72.46  ? 319 TYR C CE1 1 
ATOM   5665  C CE2 . TYR B 1 322 ? 26.423 38.096  66.614  1.00 74.87  ? 319 TYR C CE2 1 
ATOM   5666  C CZ  . TYR B 1 322 ? 25.343 37.578  67.298  1.00 72.04  ? 319 TYR C CZ  1 
ATOM   5667  O OH  . TYR B 1 322 ? 25.479 37.207  68.615  1.00 72.29  ? 319 TYR C OH  1 
ATOM   5668  N N   . GLN B 1 323 ? 26.183 41.680  63.593  1.00 74.12  ? 320 GLN C N   1 
ATOM   5669  C CA  . GLN B 1 323 ? 26.791 42.704  64.438  1.00 78.50  ? 320 GLN C CA  1 
ATOM   5670  C C   . GLN B 1 323 ? 25.972 43.986  64.427  1.00 78.86  ? 320 GLN C C   1 
ATOM   5671  O O   . GLN B 1 323 ? 25.851 44.665  65.453  1.00 81.34  ? 320 GLN C O   1 
ATOM   5672  C CB  . GLN B 1 323 ? 28.212 42.998  63.969  1.00 68.11  ? 320 GLN C CB  1 
ATOM   5673  C CG  . GLN B 1 323 ? 29.233 41.952  64.336  1.00 66.90  ? 320 GLN C CG  1 
ATOM   5674  C CD  . GLN B 1 323 ? 30.598 42.291  63.785  1.00 66.02  ? 320 GLN C CD  1 
ATOM   5675  O OE1 . GLN B 1 323 ? 30.749 42.542  62.589  1.00 72.60  ? 320 GLN C OE1 1 
ATOM   5676  N NE2 . GLN B 1 323 ? 31.599 42.314  64.655  1.00 59.88  ? 320 GLN C NE2 1 
ATOM   5677  N N   . LYS B 1 324 ? 25.412 44.339  63.275  1.00 79.15  ? 321 LYS C N   1 
ATOM   5678  C CA  . LYS B 1 324 ? 24.674 45.585  63.141  1.00 82.02  ? 321 LYS C CA  1 
ATOM   5679  C C   . LYS B 1 324 ? 23.260 45.499  63.705  1.00 84.38  ? 321 LYS C C   1 
ATOM   5680  O O   . LYS B 1 324 ? 22.518 46.484  63.623  1.00 89.90  ? 321 LYS C O   1 
ATOM   5681  C CB  . LYS B 1 324 ? 24.658 46.008  61.667  1.00 75.69  ? 321 LYS C CB  1 
ATOM   5682  C CG  . LYS B 1 324 ? 26.023 46.511  61.184  1.00 77.79  ? 321 LYS C CG  1 
ATOM   5683  C CD  . LYS B 1 324 ? 26.309 46.207  59.718  1.00 80.32  ? 321 LYS C CD  1 
ATOM   5684  C CE  . LYS B 1 324 ? 27.788 46.436  59.412  1.00 71.32  ? 321 LYS C CE  1 
ATOM   5685  N NZ  . LYS B 1 324 ? 28.152 46.219  57.983  1.00 66.06  ? 321 LYS C NZ  1 
ATOM   5686  N N   . GLY B 1 325 ? 22.865 44.351  64.258  1.00 82.92  ? 322 GLY C N   1 
ATOM   5687  C CA  . GLY B 1 325 ? 21.561 44.185  64.869  1.00 81.97  ? 322 GLY C CA  1 
ATOM   5688  C C   . GLY B 1 325 ? 20.479 43.592  63.987  1.00 82.60  ? 322 GLY C C   1 
ATOM   5689  O O   . GLY B 1 325 ? 19.329 43.492  64.437  1.00 78.88  ? 322 GLY C O   1 
ATOM   5690  N N   . GLN B 1 326 ? 20.796 43.188  62.756  1.00 76.96  ? 323 GLN C N   1 
ATOM   5691  C CA  . GLN B 1 326 ? 19.757 42.694  61.862  1.00 81.55  ? 323 GLN C CA  1 
ATOM   5692  C C   . GLN B 1 326 ? 19.611 41.180  61.954  1.00 80.49  ? 323 GLN C C   1 
ATOM   5693  O O   . GLN B 1 326 ? 20.499 40.455  62.413  1.00 75.17  ? 323 GLN C O   1 
ATOM   5694  C CB  . GLN B 1 326 ? 20.035 43.058  60.399  1.00 83.22  ? 323 GLN C CB  1 
ATOM   5695  C CG  . GLN B 1 326 ? 19.943 44.536  60.025  1.00 89.14  ? 323 GLN C CG  1 
ATOM   5696  C CD  . GLN B 1 326 ? 21.076 45.345  60.596  1.00 92.04  ? 323 GLN C CD  1 
ATOM   5697  O OE1 . GLN B 1 326 ? 21.781 44.885  61.478  1.00 91.15  ? 323 GLN C OE1 1 
ATOM   5698  N NE2 . GLN B 1 326 ? 21.289 46.535  60.061  1.00 93.50  ? 323 GLN C NE2 1 
ATOM   5699  N N   . GLU B 1 327 ? 18.470 40.709  61.469  1.00 75.74  ? 324 GLU C N   1 
ATOM   5700  C CA  . GLU B 1 327 ? 18.166 39.290  61.449  1.00 69.32  ? 324 GLU C CA  1 
ATOM   5701  C C   . GLU B 1 327 ? 18.936 38.609  60.325  1.00 67.00  ? 324 GLU C C   1 
ATOM   5702  O O   . GLU B 1 327 ? 18.972 39.103  59.194  1.00 71.79  ? 324 GLU C O   1 
ATOM   5703  C CB  . GLU B 1 327 ? 16.663 39.094  61.275  1.00 70.08  ? 324 GLU C CB  1 
ATOM   5704  C CG  . GLU B 1 327 ? 16.234 37.677  61.020  1.00 67.14  ? 324 GLU C CG  1 
ATOM   5705  C CD  . GLU B 1 327 ? 14.731 37.547  60.983  1.00 71.52  ? 324 GLU C CD  1 
ATOM   5706  O OE1 . GLU B 1 327 ? 14.041 38.510  61.380  1.00 80.37  ? 324 GLU C OE1 1 
ATOM   5707  O OE2 . GLU B 1 327 ? 14.238 36.487  60.555  1.00 76.05  ? 324 GLU C OE2 1 
ATOM   5708  N N   . THR B 1 328 ? 19.567 37.484  60.646  1.00 62.98  ? 325 THR C N   1 
ATOM   5709  C CA  . THR B 1 328 ? 20.295 36.673  59.684  1.00 61.75  ? 325 THR C CA  1 
ATOM   5710  C C   . THR B 1 328 ? 19.608 35.324  59.535  1.00 61.12  ? 325 THR C C   1 
ATOM   5711  O O   . THR B 1 328 ? 18.902 34.869  60.439  1.00 56.77  ? 325 THR C O   1 
ATOM   5712  C CB  . THR B 1 328 ? 21.745 36.448  60.119  1.00 64.31  ? 325 THR C CB  1 
ATOM   5713  O OG1 . THR B 1 328 ? 21.779 35.444  61.140  1.00 65.97  ? 325 THR C OG1 1 
ATOM   5714  C CG2 . THR B 1 328 ? 22.345 37.734  60.666  1.00 63.87  ? 325 THR C CG2 1 
ATOM   5715  N N   . SER B 1 329 ? 19.828 34.677  58.386  1.00 55.76  ? 326 SER C N   1 
ATOM   5716  C CA  . SER B 1 329 ? 19.313 33.331  58.111  1.00 53.27  ? 326 SER C CA  1 
ATOM   5717  C C   . SER B 1 329 ? 20.462 32.518  57.515  1.00 54.63  ? 326 SER C C   1 
ATOM   5718  O O   . SER B 1 329 ? 20.537 32.319  56.300  1.00 52.08  ? 326 SER C O   1 
ATOM   5719  C CB  . SER B 1 329 ? 18.101 33.377  57.187  1.00 46.73  ? 326 SER C CB  1 
ATOM   5720  O OG  . SER B 1 329 ? 17.541 32.088  57.016  1.00 44.66  ? 326 SER C OG  1 
ATOM   5721  N N   . THR B 1 330 ? 21.353 32.044  58.383  1.00 55.20  ? 327 THR C N   1 
ATOM   5722  C CA  . THR B 1 330 ? 22.563 31.348  57.968  1.00 54.14  ? 327 THR C CA  1 
ATOM   5723  C C   . THR B 1 330 ? 22.375 29.841  58.107  1.00 52.05  ? 327 THR C C   1 
ATOM   5724  O O   . THR B 1 330 ? 21.901 29.361  59.142  1.00 47.86  ? 327 THR C O   1 
ATOM   5725  C CB  . THR B 1 330 ? 23.764 31.812  58.794  1.00 59.30  ? 327 THR C CB  1 
ATOM   5726  O OG1 . THR B 1 330 ? 23.757 33.243  58.889  1.00 61.95  ? 327 THR C OG1 1 
ATOM   5727  C CG2 . THR B 1 330 ? 25.060 31.364  58.136  1.00 54.38  ? 327 THR C CG2 1 
ATOM   5728  N N   . ASN B 1 331 ? 22.759 29.105  57.067  1.00 47.71  ? 328 ASN C N   1 
ATOM   5729  C CA  . ASN B 1 331 ? 22.523 27.666  57.018  1.00 51.71  ? 328 ASN C CA  1 
ATOM   5730  C C   . ASN B 1 331 ? 23.546 26.927  57.873  1.00 46.36  ? 328 ASN C C   1 
ATOM   5731  O O   . ASN B 1 331 ? 24.750 27.043  57.617  1.00 45.03  ? 328 ASN C O   1 
ATOM   5732  C CB  . ASN B 1 331 ? 22.588 27.173  55.578  1.00 44.82  ? 328 ASN C CB  1 
ATOM   5733  C CG  . ASN B 1 331 ? 22.116 25.741  55.424  1.00 48.22  ? 328 ASN C CG  1 
ATOM   5734  O OD1 . ASN B 1 331 ? 22.072 24.978  56.386  1.00 43.65  ? 328 ASN C OD1 1 
ATOM   5735  N ND2 . ASN B 1 331 ? 21.757 25.370  54.201  1.00 41.12  ? 328 ASN C ND2 1 
ATOM   5736  N N   . PRO B 1 332 ? 23.119 26.152  58.875  1.00 37.95  ? 329 PRO C N   1 
ATOM   5737  C CA  . PRO B 1 332 ? 24.077 25.443  59.730  1.00 42.27  ? 329 PRO C CA  1 
ATOM   5738  C C   . PRO B 1 332 ? 24.346 24.000  59.336  1.00 38.86  ? 329 PRO C C   1 
ATOM   5739  O O   . PRO B 1 332 ? 25.173 23.351  59.991  1.00 41.12  ? 329 PRO C O   1 
ATOM   5740  C CB  . PRO B 1 332 ? 23.390 25.499  61.097  1.00 42.36  ? 329 PRO C CB  1 
ATOM   5741  C CG  . PRO B 1 332 ? 21.934 25.368  60.756  1.00 42.65  ? 329 PRO C CG  1 
ATOM   5742  C CD  . PRO B 1 332 ? 21.744 26.055  59.406  1.00 36.45  ? 329 PRO C CD  1 
ATOM   5743  N N   . ILE B 1 333 ? 23.689 23.490  58.289  1.00 37.37  ? 330 ILE C N   1 
ATOM   5744  C CA  . ILE B 1 333 ? 23.708 22.056  58.000  1.00 42.73  ? 330 ILE C CA  1 
ATOM   5745  C C   . ILE B 1 333 ? 25.129 21.561  57.760  1.00 44.87  ? 330 ILE C C   1 
ATOM   5746  O O   . ILE B 1 333 ? 25.531 20.510  58.275  1.00 43.07  ? 330 ILE C O   1 
ATOM   5747  C CB  . ILE B 1 333 ? 22.790 21.745  56.802  1.00 40.44  ? 330 ILE C CB  1 
ATOM   5748  C CG1 . ILE B 1 333 ? 21.335 22.033  57.158  1.00 40.85  ? 330 ILE C CG1 1 
ATOM   5749  C CG2 . ILE B 1 333 ? 22.963 20.305  56.351  1.00 36.30  ? 330 ILE C CG2 1 
ATOM   5750  C CD1 . ILE B 1 333 ? 20.825 21.237  58.335  1.00 40.84  ? 330 ILE C CD1 1 
ATOM   5751  N N   . ALA B 1 334 ? 25.912 22.308  56.977  1.00 44.26  ? 331 ALA C N   1 
ATOM   5752  C CA  . ALA B 1 334 ? 27.281 21.891  56.693  1.00 43.03  ? 331 ALA C CA  1 
ATOM   5753  C C   . ALA B 1 334 ? 28.113 21.833  57.968  1.00 40.11  ? 331 ALA C C   1 
ATOM   5754  O O   . ALA B 1 334 ? 28.962 20.948  58.125  1.00 42.19  ? 331 ALA C O   1 
ATOM   5755  C CB  . ALA B 1 334 ? 27.913 22.835  55.668  1.00 43.93  ? 331 ALA C CB  1 
ATOM   5756  N N   . SER B 1 335 ? 27.876 22.761  58.898  1.00 42.36  ? 332 SER C N   1 
ATOM   5757  C CA  . SER B 1 335 ? 28.579 22.718  60.175  1.00 43.88  ? 332 SER C CA  1 
ATOM   5758  C C   . SER B 1 335 ? 28.118 21.532  61.012  1.00 41.71  ? 332 SER C C   1 
ATOM   5759  O O   . SER B 1 335 ? 28.931 20.874  61.673  1.00 44.66  ? 332 SER C O   1 
ATOM   5760  C CB  . SER B 1 335 ? 28.366 24.027  60.930  1.00 42.41  ? 332 SER C CB  1 
ATOM   5761  O OG  . SER B 1 335 ? 28.787 25.133  60.156  1.00 48.68  ? 332 SER C OG  1 
ATOM   5762  N N   . ILE B 1 336 ? 26.814 21.245  60.994  1.00 38.10  ? 333 ILE C N   1 
ATOM   5763  C CA  . ILE B 1 336 ? 26.291 20.095  61.726  1.00 38.15  ? 333 ILE C CA  1 
ATOM   5764  C C   . ILE B 1 336 ? 26.894 18.805  61.187  1.00 40.70  ? 333 ILE C C   1 
ATOM   5765  O O   . ILE B 1 336 ? 27.277 17.909  61.953  1.00 37.34  ? 333 ILE C O   1 
ATOM   5766  C CB  . ILE B 1 336 ? 24.752 20.075  61.655  1.00 32.60  ? 333 ILE C CB  1 
ATOM   5767  C CG1 . ILE B 1 336 ? 24.164 21.180  62.531  1.00 33.99  ? 333 ILE C CG1 1 
ATOM   5768  C CG2 . ILE B 1 336 ? 24.207 18.706  62.052  1.00 35.54  ? 333 ILE C CG2 1 
ATOM   5769  C CD1 . ILE B 1 336 ? 22.723 21.490  62.215  1.00 32.61  ? 333 ILE C CD1 1 
ATOM   5770  N N   . PHE B 1 337 ? 27.002 18.693  59.861  1.00 38.97  ? 334 PHE C N   1 
ATOM   5771  C CA  . PHE B 1 337 ? 27.521 17.468  59.266  1.00 39.28  ? 334 PHE C CA  1 
ATOM   5772  C C   . PHE B 1 337 ? 29.025 17.327  59.445  1.00 44.32  ? 334 PHE C C   1 
ATOM   5773  O O   . PHE B 1 337 ? 29.552 16.220  59.292  1.00 41.03  ? 334 PHE C O   1 
ATOM   5774  C CB  . PHE B 1 337 ? 27.146 17.402  57.788  1.00 40.96  ? 334 PHE C CB  1 
ATOM   5775  C CG  . PHE B 1 337 ? 25.816 16.752  57.537  1.00 37.28  ? 334 PHE C CG  1 
ATOM   5776  C CD1 . PHE B 1 337 ? 24.646 17.343  57.983  1.00 36.03  ? 334 PHE C CD1 1 
ATOM   5777  C CD2 . PHE B 1 337 ? 25.739 15.545  56.862  1.00 36.95  ? 334 PHE C CD2 1 
ATOM   5778  C CE1 . PHE B 1 337 ? 23.420 16.745  57.756  1.00 37.98  ? 334 PHE C CE1 1 
ATOM   5779  C CE2 . PHE B 1 337 ? 24.517 14.942  56.631  1.00 35.77  ? 334 PHE C CE2 1 
ATOM   5780  C CZ  . PHE B 1 337 ? 23.356 15.544  57.078  1.00 35.74  ? 334 PHE C CZ  1 
ATOM   5781  N N   . ALA B 1 338 ? 29.731 18.416  59.753  1.00 42.11  ? 335 ALA C N   1 
ATOM   5782  C CA  . ALA B 1 338 ? 31.094 18.275  60.248  1.00 45.20  ? 335 ALA C CA  1 
ATOM   5783  C C   . ALA B 1 338 ? 31.101 17.473  61.540  1.00 41.68  ? 335 ALA C C   1 
ATOM   5784  O O   . ALA B 1 338 ? 31.911 16.555  61.718  1.00 32.18  ? 335 ALA C O   1 
ATOM   5785  C CB  . ALA B 1 338 ? 31.723 19.651  60.462  1.00 44.17  ? 335 ALA C CB  1 
ATOM   5786  N N   . TRP B 1 339 ? 30.184 17.803  62.451  1.00 42.00  ? 336 TRP C N   1 
ATOM   5787  C CA  . TRP B 1 339 ? 30.075 17.077  63.710  1.00 42.98  ? 336 TRP C CA  1 
ATOM   5788  C C   . TRP B 1 339 ? 29.670 15.625  63.479  1.00 44.63  ? 336 TRP C C   1 
ATOM   5789  O O   . TRP B 1 339 ? 30.355 14.697  63.927  1.00 42.12  ? 336 TRP C O   1 
ATOM   5790  C CB  . TRP B 1 339 ? 29.074 17.780  64.626  1.00 41.68  ? 336 TRP C CB  1 
ATOM   5791  C CG  . TRP B 1 339 ? 29.626 19.007  65.274  1.00 48.87  ? 336 TRP C CG  1 
ATOM   5792  C CD1 . TRP B 1 339 ? 29.541 20.290  64.816  1.00 49.18  ? 336 TRP C CD1 1 
ATOM   5793  C CD2 . TRP B 1 339 ? 30.352 19.067  66.504  1.00 47.80  ? 336 TRP C CD2 1 
ATOM   5794  N NE1 . TRP B 1 339 ? 30.173 21.145  65.687  1.00 49.58  ? 336 TRP C NE1 1 
ATOM   5795  C CE2 . TRP B 1 339 ? 30.678 20.418  66.732  1.00 51.14  ? 336 TRP C CE2 1 
ATOM   5796  C CE3 . TRP B 1 339 ? 30.760 18.108  67.436  1.00 45.47  ? 336 TRP C CE3 1 
ATOM   5797  C CZ2 . TRP B 1 339 ? 31.393 20.834  67.854  1.00 54.44  ? 336 TRP C CZ2 1 
ATOM   5798  C CZ3 . TRP B 1 339 ? 31.467 18.521  68.548  1.00 49.90  ? 336 TRP C CZ3 1 
ATOM   5799  C CH2 . TRP B 1 339 ? 31.777 19.873  68.749  1.00 50.68  ? 336 TRP C CH2 1 
ATOM   5800  N N   . THR B 1 340 ? 28.559 15.408  62.769  1.00 39.02  ? 337 THR C N   1 
ATOM   5801  C CA  . THR B 1 340 ? 28.047 14.051  62.600  1.00 43.58  ? 337 THR C CA  1 
ATOM   5802  C C   . THR B 1 340 ? 29.058 13.149  61.903  1.00 40.67  ? 337 THR C C   1 
ATOM   5803  O O   . THR B 1 340 ? 29.196 11.973  62.260  1.00 37.31  ? 337 THR C O   1 
ATOM   5804  C CB  . THR B 1 340 ? 26.733 14.067  61.818  1.00 38.13  ? 337 THR C CB  1 
ATOM   5805  O OG1 . THR B 1 340 ? 26.970 14.548  60.485  1.00 37.94  ? 337 THR C OG1 1 
ATOM   5806  C CG2 . THR B 1 340 ? 25.703 14.947  62.507  1.00 34.62  ? 337 THR C CG2 1 
ATOM   5807  N N   . ARG B 1 341 ? 29.777 13.678  60.910  1.00 38.20  ? 338 ARG C N   1 
ATOM   5808  C CA  . ARG B 1 341 ? 30.763 12.857  60.215  1.00 41.41  ? 338 ARG C CA  1 
ATOM   5809  C C   . ARG B 1 341 ? 31.946 12.533  61.120  1.00 42.50  ? 338 ARG C C   1 
ATOM   5810  O O   . ARG B 1 341 ? 32.496 11.427  61.059  1.00 38.91  ? 338 ARG C O   1 
ATOM   5811  C CB  . ARG B 1 341 ? 31.231 13.551  58.937  1.00 43.41  ? 338 ARG C CB  1 
ATOM   5812  C CG  . ARG B 1 341 ? 30.538 13.050  57.676  1.00 49.18  ? 338 ARG C CG  1 
ATOM   5813  C CD  . ARG B 1 341 ? 29.112 13.564  57.591  1.00 47.42  ? 338 ARG C CD  1 
ATOM   5814  N NE  . ARG B 1 341 ? 28.263 12.740  56.734  1.00 59.91  ? 338 ARG C NE  1 
ATOM   5815  C CZ  . ARG B 1 341 ? 27.950 13.040  55.477  1.00 59.68  ? 338 ARG C CZ  1 
ATOM   5816  N NH1 . ARG B 1 341 ? 28.416 14.149  54.920  1.00 58.57  ? 338 ARG C NH1 1 
ATOM   5817  N NH2 . ARG B 1 341 ? 27.166 12.232  54.777  1.00 59.28  ? 338 ARG C NH2 1 
ATOM   5818  N N   . GLY B 1 342 ? 32.347 13.480  61.971  1.00 39.94  ? 339 GLY C N   1 
ATOM   5819  C CA  . GLY B 1 342 ? 33.380 13.182  62.950  1.00 46.50  ? 339 GLY C CA  1 
ATOM   5820  C C   . GLY B 1 342 ? 32.918 12.162  63.973  1.00 44.75  ? 339 GLY C C   1 
ATOM   5821  O O   . GLY B 1 342 ? 33.646 11.225  64.310  1.00 42.78  ? 339 GLY C O   1 
ATOM   5822  N N   . LEU B 1 343 ? 31.692 12.329  64.478  1.00 45.18  ? 340 LEU C N   1 
ATOM   5823  C CA  . LEU B 1 343 ? 31.152 11.387  65.454  1.00 42.16  ? 340 LEU C CA  1 
ATOM   5824  C C   . LEU B 1 343 ? 30.979 10.004  64.840  1.00 44.33  ? 340 LEU C C   1 
ATOM   5825  O O   . LEU B 1 343 ? 31.295 8.988   65.470  1.00 40.77  ? 340 LEU C O   1 
ATOM   5826  C CB  . LEU B 1 343 ? 29.823 11.907  65.998  1.00 36.25  ? 340 LEU C CB  1 
ATOM   5827  C CG  . LEU B 1 343 ? 29.897 13.246  66.729  1.00 37.04  ? 340 LEU C CG  1 
ATOM   5828  C CD1 . LEU B 1 343 ? 28.561 13.588  67.366  1.00 40.89  ? 340 LEU C CD1 1 
ATOM   5829  C CD2 . LEU B 1 343 ? 31.003 13.223  67.772  1.00 42.13  ? 340 LEU C CD2 1 
ATOM   5830  N N   . ALA B 1 344 ? 30.480 9.948   63.601  1.00 42.21  ? 341 ALA C N   1 
ATOM   5831  C CA  . ALA B 1 344 ? 30.315 8.662   62.931  1.00 45.01  ? 341 ALA C CA  1 
ATOM   5832  C C   . ALA B 1 344 ? 31.649 7.942   62.796  1.00 46.97  ? 341 ALA C C   1 
ATOM   5833  O O   . ALA B 1 344 ? 31.718 6.716   62.939  1.00 45.62  ? 341 ALA C O   1 
ATOM   5834  C CB  . ALA B 1 344 ? 29.669 8.858   61.559  1.00 32.03  ? 341 ALA C CB  1 
ATOM   5835  N N   . HIS B 1 345 ? 32.724 8.690   62.532  1.00 46.12  ? 342 HIS C N   1 
ATOM   5836  C CA  . HIS B 1 345 ? 34.044 8.075   62.465  1.00 51.61  ? 342 HIS C CA  1 
ATOM   5837  C C   . HIS B 1 345 ? 34.527 7.660   63.848  1.00 49.82  ? 342 HIS C C   1 
ATOM   5838  O O   . HIS B 1 345 ? 35.127 6.590   64.007  1.00 44.59  ? 342 HIS C O   1 
ATOM   5839  C CB  . HIS B 1 345 ? 35.042 9.033   61.820  1.00 47.99  ? 342 HIS C CB  1 
ATOM   5840  C CG  . HIS B 1 345 ? 36.420 8.467   61.692  1.00 51.67  ? 342 HIS C CG  1 
ATOM   5841  N ND1 . HIS B 1 345 ? 36.708 7.386   60.887  1.00 50.60  ? 342 HIS C ND1 1 
ATOM   5842  C CD2 . HIS B 1 345 ? 37.587 8.816   62.283  1.00 52.91  ? 342 HIS C CD2 1 
ATOM   5843  C CE1 . HIS B 1 345 ? 37.995 7.103   60.976  1.00 54.87  ? 342 HIS C CE1 1 
ATOM   5844  N NE2 . HIS B 1 345 ? 38.552 7.957   61.815  1.00 53.50  ? 342 HIS C NE2 1 
ATOM   5845  N N   . ARG B 1 346 ? 34.286 8.503   64.857  1.00 49.16  ? 343 ARG C N   1 
ATOM   5846  C CA  . ARG B 1 346 ? 34.606 8.133   66.231  1.00 47.32  ? 343 ARG C CA  1 
ATOM   5847  C C   . ARG B 1 346 ? 33.897 6.845   66.634  1.00 50.78  ? 343 ARG C C   1 
ATOM   5848  O O   . ARG B 1 346 ? 34.492 5.974   67.280  1.00 55.08  ? 343 ARG C O   1 
ATOM   5849  C CB  . ARG B 1 346 ? 34.226 9.273   67.176  1.00 46.51  ? 343 ARG C CB  1 
ATOM   5850  C CG  . ARG B 1 346 ? 34.448 8.978   68.650  1.00 47.81  ? 343 ARG C CG  1 
ATOM   5851  C CD  . ARG B 1 346 ? 35.886 9.229   69.058  1.00 51.40  ? 343 ARG C CD  1 
ATOM   5852  N NE  . ARG B 1 346 ? 36.766 8.121   68.706  1.00 42.78  ? 343 ARG C NE  1 
ATOM   5853  C CZ  . ARG B 1 346 ? 38.091 8.205   68.666  1.00 45.99  ? 343 ARG C CZ  1 
ATOM   5854  N NH1 . ARG B 1 346 ? 38.696 9.350   68.955  1.00 45.13  ? 343 ARG C NH1 1 
ATOM   5855  N NH2 . ARG B 1 346 ? 38.811 7.143   68.334  1.00 40.17  ? 343 ARG C NH2 1 
ATOM   5856  N N   . ALA B 1 347 ? 32.627 6.702   66.250  1.00 48.23  ? 344 ALA C N   1 
ATOM   5857  C CA  . ALA B 1 347 ? 31.879 5.499   66.604  1.00 51.54  ? 344 ALA C CA  1 
ATOM   5858  C C   . ALA B 1 347 ? 32.407 4.277   65.862  1.00 54.06  ? 344 ALA C C   1 
ATOM   5859  O O   . ALA B 1 347 ? 32.411 3.167   66.408  1.00 56.78  ? 344 ALA C O   1 
ATOM   5860  C CB  . ALA B 1 347 ? 30.393 5.700   66.312  1.00 46.85  ? 344 ALA C CB  1 
ATOM   5861  N N   . LYS B 1 348 ? 32.848 4.462   64.616  1.00 48.87  ? 345 LYS C N   1 
ATOM   5862  C CA  . LYS B 1 348 ? 33.424 3.357   63.856  1.00 53.28  ? 345 LYS C CA  1 
ATOM   5863  C C   . LYS B 1 348 ? 34.666 2.809   64.551  1.00 60.96  ? 345 LYS C C   1 
ATOM   5864  O O   . LYS B 1 348 ? 34.831 1.591   64.687  1.00 60.04  ? 345 LYS C O   1 
ATOM   5865  C CB  . LYS B 1 348 ? 33.751 3.827   62.438  1.00 53.32  ? 345 LYS C CB  1 
ATOM   5866  C CG  . LYS B 1 348 ? 34.348 2.772   61.523  1.00 57.20  ? 345 LYS C CG  1 
ATOM   5867  C CD  . LYS B 1 348 ? 34.441 3.290   60.091  1.00 66.98  ? 345 LYS C CD  1 
ATOM   5868  C CE  . LYS B 1 348 ? 35.145 4.641   60.029  1.00 68.21  ? 345 LYS C CE  1 
ATOM   5869  N NZ  . LYS B 1 348 ? 34.897 5.361   58.745  1.00 63.12  ? 345 LYS C NZ  1 
ATOM   5870  N N   . LEU B 1 349 ? 35.547 3.702   65.011  1.00 55.49  ? 346 LEU C N   1 
ATOM   5871  C CA  . LEU B 1 349 ? 36.762 3.261   65.691  1.00 58.16  ? 346 LEU C CA  1 
ATOM   5872  C C   . LEU B 1 349 ? 36.440 2.582   67.017  1.00 61.68  ? 346 LEU C C   1 
ATOM   5873  O O   . LEU B 1 349 ? 37.047 1.562   67.365  1.00 61.17  ? 346 LEU C O   1 
ATOM   5874  C CB  . LEU B 1 349 ? 37.698 4.449   65.918  1.00 49.91  ? 346 LEU C CB  1 
ATOM   5875  C CG  . LEU B 1 349 ? 38.107 5.276   64.698  1.00 59.39  ? 346 LEU C CG  1 
ATOM   5876  C CD1 . LEU B 1 349 ? 39.186 6.278   65.079  1.00 48.95  ? 346 LEU C CD1 1 
ATOM   5877  C CD2 . LEU B 1 349 ? 38.581 4.378   63.567  1.00 55.72  ? 346 LEU C CD2 1 
ATOM   5878  N N   . ASP B 1 350 ? 35.484 3.127   67.767  1.00 56.16  ? 347 ASP C N   1 
ATOM   5879  C CA  . ASP B 1 350 ? 35.180 2.654   69.111  1.00 59.54  ? 347 ASP C CA  1 
ATOM   5880  C C   . ASP B 1 350 ? 34.084 1.596   69.149  1.00 60.46  ? 347 ASP C C   1 
ATOM   5881  O O   . ASP B 1 350 ? 33.726 1.144   70.242  1.00 54.78  ? 347 ASP C O   1 
ATOM   5882  C CB  . ASP B 1 350 ? 34.780 3.833   70.004  1.00 48.58  ? 347 ASP C CB  1 
ATOM   5883  C CG  . ASP B 1 350 ? 35.860 4.893   70.085  1.00 55.63  ? 347 ASP C CG  1 
ATOM   5884  O OD1 . ASP B 1 350 ? 37.001 4.614   69.657  1.00 55.61  ? 347 ASP C OD1 1 
ATOM   5885  O OD2 . ASP B 1 350 ? 35.568 6.003   70.581  1.00 56.53  ? 347 ASP C OD2 1 
ATOM   5886  N N   . ASN B 1 351 ? 33.547 1.194   67.994  1.00 57.06  ? 348 ASN C N   1 
ATOM   5887  C CA  . ASN B 1 351 ? 32.460 0.213   67.926  1.00 62.48  ? 348 ASN C CA  1 
ATOM   5888  C C   . ASN B 1 351 ? 31.278 0.651   68.789  1.00 58.04  ? 348 ASN C C   1 
ATOM   5889  O O   . ASN B 1 351 ? 30.595 -0.162  69.415  1.00 62.11  ? 348 ASN C O   1 
ATOM   5890  C CB  . ASN B 1 351 ? 32.952 -1.182  68.324  1.00 62.87  ? 348 ASN C CB  1 
ATOM   5891  C CG  . ASN B 1 351 ? 34.133 -1.643  67.489  1.00 71.65  ? 348 ASN C CG  1 
ATOM   5892  O OD1 . ASN B 1 351 ? 33.962 -2.292  66.457  1.00 82.89  ? 348 ASN C OD1 1 
ATOM   5893  N ND2 . ASN B 1 351 ? 35.340 -1.308  67.933  1.00 73.42  ? 348 ASN C ND2 1 
ATOM   5894  N N   . ASN B 1 352 ? 31.039 1.961   68.813  1.00 57.14  ? 349 ASN C N   1 
ATOM   5895  C CA  . ASN B 1 352 ? 30.028 2.580   69.669  1.00 52.42  ? 349 ASN C CA  1 
ATOM   5896  C C   . ASN B 1 352 ? 28.729 2.671   68.877  1.00 57.68  ? 349 ASN C C   1 
ATOM   5897  O O   . ASN B 1 352 ? 28.495 3.626   68.135  1.00 54.00  ? 349 ASN C O   1 
ATOM   5898  C CB  . ASN B 1 352 ? 30.510 3.949   70.142  1.00 44.90  ? 349 ASN C CB  1 
ATOM   5899  C CG  . ASN B 1 352 ? 29.630 4.550   71.223  1.00 48.54  ? 349 ASN C CG  1 
ATOM   5900  O OD1 . ASN B 1 352 ? 28.452 4.215   71.347  1.00 55.35  ? 349 ASN C OD1 1 
ATOM   5901  N ND2 . ASN B 1 352 ? 30.201 5.458   72.006  1.00 43.70  ? 349 ASN C ND2 1 
ATOM   5902  N N   . LYS B 1 353 ? 27.873 1.657   69.038  1.00 52.69  ? 350 LYS C N   1 
ATOM   5903  C CA  . LYS B 1 353 ? 26.589 1.651   68.342  1.00 56.48  ? 350 LYS C CA  1 
ATOM   5904  C C   . LYS B 1 353 ? 25.744 2.855   68.733  1.00 56.14  ? 350 LYS C C   1 
ATOM   5905  O O   . LYS B 1 353 ? 25.059 3.445   67.888  1.00 53.51  ? 350 LYS C O   1 
ATOM   5906  C CB  . LYS B 1 353 ? 25.827 0.361   68.648  1.00 61.98  ? 350 LYS C CB  1 
ATOM   5907  C CG  . LYS B 1 353 ? 26.541 -0.925  68.274  1.00 68.19  ? 350 LYS C CG  1 
ATOM   5908  C CD  . LYS B 1 353 ? 25.584 -2.101  68.402  1.00 79.45  ? 350 LYS C CD  1 
ATOM   5909  C CE  . LYS B 1 353 ? 26.248 -3.416  68.038  1.00 81.38  ? 350 LYS C CE  1 
ATOM   5910  N NZ  . LYS B 1 353 ? 25.262 -4.532  67.973  1.00 88.81  ? 350 LYS C NZ  1 
ATOM   5911  N N   . GLU B 1 354 ? 25.782 3.234   70.012  1.00 53.19  ? 351 GLU C N   1 
ATOM   5912  C CA  . GLU B 1 354 ? 24.931 4.317   70.494  1.00 55.47  ? 351 GLU C CA  1 
ATOM   5913  C C   . GLU B 1 354 ? 25.334 5.649   69.876  1.00 54.19  ? 351 GLU C C   1 
ATOM   5914  O O   . GLU B 1 354 ? 24.476 6.489   69.574  1.00 48.95  ? 351 GLU C O   1 
ATOM   5915  C CB  . GLU B 1 354 ? 24.991 4.392   72.021  1.00 54.36  ? 351 GLU C CB  1 
ATOM   5916  C CG  . GLU B 1 354 ? 24.432 3.170   72.749  1.00 64.29  ? 351 GLU C CG  1 
ATOM   5917  C CD  . GLU B 1 354 ? 25.317 1.938   72.620  1.00 72.07  ? 351 GLU C CD  1 
ATOM   5918  O OE1 . GLU B 1 354 ? 24.768 0.822   72.504  1.00 66.17  ? 351 GLU C OE1 1 
ATOM   5919  O OE2 . GLU B 1 354 ? 26.558 2.087   72.624  1.00 67.18  ? 351 GLU C OE2 1 
ATOM   5920  N N   . LEU B 1 355 ? 26.636 5.859   69.677  1.00 45.88  ? 352 LEU C N   1 
ATOM   5921  C CA  . LEU B 1 355 ? 27.102 7.085   69.043  1.00 47.40  ? 352 LEU C CA  1 
ATOM   5922  C C   . LEU B 1 355 ? 26.876 7.048   67.537  1.00 42.39  ? 352 LEU C C   1 
ATOM   5923  O O   . LEU B 1 355 ? 26.482 8.058   66.943  1.00 43.88  ? 352 LEU C O   1 
ATOM   5924  C CB  . LEU B 1 355 ? 28.581 7.310   69.353  1.00 47.40  ? 352 LEU C CB  1 
ATOM   5925  C CG  . LEU B 1 355 ? 29.141 8.683   68.985  1.00 52.28  ? 352 LEU C CG  1 
ATOM   5926  C CD1 . LEU B 1 355 ? 28.431 9.775   69.771  1.00 40.16  ? 352 LEU C CD1 1 
ATOM   5927  C CD2 . LEU B 1 355 ? 30.639 8.721   69.229  1.00 50.57  ? 352 LEU C CD2 1 
ATOM   5928  N N   . ALA B 1 356 ? 27.116 5.894   66.907  1.00 43.52  ? 353 ALA C N   1 
ATOM   5929  C CA  . ALA B 1 356 ? 26.830 5.758   65.483  1.00 45.66  ? 353 ALA C CA  1 
ATOM   5930  C C   . ALA B 1 356 ? 25.362 6.037   65.193  1.00 49.43  ? 353 ALA C C   1 
ATOM   5931  O O   . ALA B 1 356 ? 25.026 6.621   64.156  1.00 50.97  ? 353 ALA C O   1 
ATOM   5932  C CB  . ALA B 1 356 ? 27.217 4.362   64.996  1.00 43.73  ? 353 ALA C CB  1 
ATOM   5933  N N   . PHE B 1 357 ? 24.472 5.639   66.105  1.00 44.66  ? 354 PHE C N   1 
ATOM   5934  C CA  . PHE B 1 357 ? 23.057 5.924   65.903  1.00 44.51  ? 354 PHE C CA  1 
ATOM   5935  C C   . PHE B 1 357 ? 22.763 7.411   66.057  1.00 44.06  ? 354 PHE C C   1 
ATOM   5936  O O   . PHE B 1 357 ? 21.926 7.961   65.330  1.00 41.88  ? 354 PHE C O   1 
ATOM   5937  C CB  . PHE B 1 357 ? 22.200 5.115   66.874  1.00 43.32  ? 354 PHE C CB  1 
ATOM   5938  C CG  . PHE B 1 357 ? 20.741 5.450   66.800  1.00 36.53  ? 354 PHE C CG  1 
ATOM   5939  C CD1 . PHE B 1 357 ? 19.937 4.889   65.820  1.00 40.32  ? 354 PHE C CD1 1 
ATOM   5940  C CD2 . PHE B 1 357 ? 20.176 6.347   67.693  1.00 33.87  ? 354 PHE C CD2 1 
ATOM   5941  C CE1 . PHE B 1 357 ? 18.592 5.205   65.742  1.00 37.88  ? 354 PHE C CE1 1 
ATOM   5942  C CE2 . PHE B 1 357 ? 18.835 6.671   67.620  1.00 37.99  ? 354 PHE C CE2 1 
ATOM   5943  C CZ  . PHE B 1 357 ? 18.041 6.098   66.642  1.00 38.05  ? 354 PHE C CZ  1 
ATOM   5944  N N   . PHE B 1 358 ? 23.422 8.077   67.008  1.00 45.55  ? 355 PHE C N   1 
ATOM   5945  C CA  . PHE B 1 358 ? 23.157 9.497   67.209  1.00 47.47  ? 355 PHE C CA  1 
ATOM   5946  C C   . PHE B 1 358 ? 23.580 10.311  65.994  1.00 45.71  ? 355 PHE C C   1 
ATOM   5947  O O   . PHE B 1 358 ? 22.840 11.190  65.537  1.00 45.20  ? 355 PHE C O   1 
ATOM   5948  C CB  . PHE B 1 358 ? 23.866 10.013  68.461  1.00 40.91  ? 355 PHE C CB  1 
ATOM   5949  C CG  . PHE B 1 358 ? 23.731 11.496  68.648  1.00 40.20  ? 355 PHE C CG  1 
ATOM   5950  C CD1 . PHE B 1 358 ? 22.615 12.026  69.273  1.00 38.54  ? 355 PHE C CD1 1 
ATOM   5951  C CD2 . PHE B 1 358 ? 24.704 12.363  68.172  1.00 41.87  ? 355 PHE C CD2 1 
ATOM   5952  C CE1 . PHE B 1 358 ? 22.477 13.392  69.436  1.00 42.03  ? 355 PHE C CE1 1 
ATOM   5953  C CE2 . PHE B 1 358 ? 24.570 13.730  68.327  1.00 41.05  ? 355 PHE C CE2 1 
ATOM   5954  C CZ  . PHE B 1 358 ? 23.457 14.244  68.962  1.00 44.18  ? 355 PHE C CZ  1 
ATOM   5955  N N   . ALA B 1 359 ? 24.779 10.044  65.468  1.00 42.26  ? 356 ALA C N   1 
ATOM   5956  C CA  . ALA B 1 359 ? 25.261 10.772  64.299  1.00 42.14  ? 356 ALA C CA  1 
ATOM   5957  C C   . ALA B 1 359 ? 24.292 10.629  63.134  1.00 44.12  ? 356 ALA C C   1 
ATOM   5958  O O   . ALA B 1 359 ? 23.920 11.621  62.496  1.00 41.62  ? 356 ALA C O   1 
ATOM   5959  C CB  . ALA B 1 359 ? 26.655 10.280  63.906  1.00 35.56  ? 356 ALA C CB  1 
ATOM   5960  N N   . ASN B 1 360 ? 23.860 9.396   62.852  1.00 40.45  ? 357 ASN C N   1 
ATOM   5961  C CA  . ASN B 1 360 ? 22.883 9.174   61.789  1.00 39.60  ? 357 ASN C CA  1 
ATOM   5962  C C   . ASN B 1 360 ? 21.587 9.914   62.078  1.00 41.65  ? 357 ASN C C   1 
ATOM   5963  O O   . ASN B 1 360 ? 21.014 10.557  61.191  1.00 37.88  ? 357 ASN C O   1 
ATOM   5964  C CB  . ASN B 1 360 ? 22.611 7.678   61.622  1.00 38.11  ? 357 ASN C CB  1 
ATOM   5965  C CG  . ASN B 1 360 ? 23.699 6.971   60.844  1.00 44.71  ? 357 ASN C CG  1 
ATOM   5966  O OD1 . ASN B 1 360 ? 24.175 7.471   59.825  1.00 39.63  ? 357 ASN C OD1 1 
ATOM   5967  N ND2 . ASN B 1 360 ? 24.101 5.801   61.323  1.00 38.91  ? 357 ASN C ND2 1 
ATOM   5968  N N   . ALA B 1 361 ? 21.108 9.833   63.321  1.00 38.49  ? 358 ALA C N   1 
ATOM   5969  C CA  . ALA B 1 361 ? 19.847 10.476  63.669  1.00 41.47  ? 358 ALA C CA  1 
ATOM   5970  C C   . ALA B 1 361 ? 19.919 11.980  63.446  1.00 36.84  ? 358 ALA C C   1 
ATOM   5971  O O   . ALA B 1 361 ? 18.976 12.585  62.923  1.00 36.00  ? 358 ALA C O   1 
ATOM   5972  C CB  . ALA B 1 361 ? 19.476 10.160  65.118  1.00 46.14  ? 358 ALA C CB  1 
ATOM   5973  N N   . LEU B 1 362 ? 21.044 12.600  63.818  1.00 33.63  ? 359 LEU C N   1 
ATOM   5974  C CA  . LEU B 1 362 ? 21.181 14.042  63.633  1.00 36.88  ? 359 LEU C CA  1 
ATOM   5975  C C   . LEU B 1 362 ? 21.259 14.407  62.155  1.00 35.30  ? 359 LEU C C   1 
ATOM   5976  O O   . LEU B 1 362 ? 20.803 15.482  61.749  1.00 36.88  ? 359 LEU C O   1 
ATOM   5977  C CB  . LEU B 1 362 ? 22.404 14.569  64.384  1.00 40.84  ? 359 LEU C CB  1 
ATOM   5978  C CG  . LEU B 1 362 ? 22.626 16.086  64.342  1.00 34.19  ? 359 LEU C CG  1 
ATOM   5979  C CD1 . LEU B 1 362 ? 21.339 16.868  64.604  1.00 32.27  ? 359 LEU C CD1 1 
ATOM   5980  C CD2 . LEU B 1 362 ? 23.707 16.486  65.331  1.00 40.38  ? 359 LEU C CD2 1 
ATOM   5981  N N   . GLU B 1 363 ? 21.830 13.529  61.332  1.00 34.38  ? 360 GLU C N   1 
ATOM   5982  C CA  . GLU B 1 363 ? 21.833 13.783  59.897  1.00 37.03  ? 360 GLU C CA  1 
ATOM   5983  C C   . GLU B 1 363 ? 20.419 13.710  59.339  1.00 40.97  ? 360 GLU C C   1 
ATOM   5984  O O   . GLU B 1 363 ? 20.009 14.555  58.535  1.00 39.50  ? 360 GLU C O   1 
ATOM   5985  C CB  . GLU B 1 363 ? 22.764 12.798  59.191  1.00 34.13  ? 360 GLU C CB  1 
ATOM   5986  C CG  . GLU B 1 363 ? 24.215 12.991  59.585  1.00 40.20  ? 360 GLU C CG  1 
ATOM   5987  C CD  . GLU B 1 363 ? 25.183 12.260  58.683  1.00 40.46  ? 360 GLU C CD  1 
ATOM   5988  O OE1 . GLU B 1 363 ? 24.724 11.529  57.781  1.00 44.05  ? 360 GLU C OE1 1 
ATOM   5989  O OE2 . GLU B 1 363 ? 26.406 12.419  58.879  1.00 45.72  ? 360 GLU C OE2 1 
ATOM   5990  N N   . GLU B 1 364 ? 19.638 12.728  59.798  1.00 37.57  ? 361 GLU C N   1 
ATOM   5991  C CA  . GLU B 1 364 ? 18.287 12.564  59.275  1.00 35.67  ? 361 GLU C CA  1 
ATOM   5992  C C   . GLU B 1 364 ? 17.349 13.665  59.763  1.00 37.42  ? 361 GLU C C   1 
ATOM   5993  O O   . GLU B 1 364 ? 16.499 14.132  58.998  1.00 34.53  ? 361 GLU C O   1 
ATOM   5994  C CB  . GLU B 1 364 ? 17.747 11.180  59.639  1.00 34.36  ? 361 GLU C CB  1 
ATOM   5995  C CG  . GLU B 1 364 ? 18.580 10.027  59.087  1.00 39.61  ? 361 GLU C CG  1 
ATOM   5996  C CD  . GLU B 1 364 ? 18.698 10.047  57.571  1.00 43.42  ? 361 GLU C CD  1 
ATOM   5997  O OE1 . GLU B 1 364 ? 17.711 10.415  56.899  1.00 45.27  ? 361 GLU C OE1 1 
ATOM   5998  O OE2 . GLU B 1 364 ? 19.780 9.692   57.052  1.00 42.60  ? 361 GLU C OE2 1 
ATOM   5999  N N   . VAL B 1 365 ? 17.471 14.100  61.023  1.00 33.88  ? 362 VAL C N   1 
ATOM   6000  C CA  . VAL B 1 365 ? 16.602 15.186  61.481  1.00 39.40  ? 362 VAL C CA  1 
ATOM   6001  C C   . VAL B 1 365 ? 16.883 16.455  60.688  1.00 41.31  ? 362 VAL C C   1 
ATOM   6002  O O   . VAL B 1 365 ? 15.961 17.204  60.339  1.00 38.86  ? 362 VAL C O   1 
ATOM   6003  C CB  . VAL B 1 365 ? 16.739 15.429  62.999  1.00 42.25  ? 362 VAL C CB  1 
ATOM   6004  C CG1 . VAL B 1 365 ? 18.173 15.501  63.409  1.00 44.40  ? 362 VAL C CG1 1 
ATOM   6005  C CG2 . VAL B 1 365 ? 16.021 16.715  63.393  1.00 48.87  ? 362 VAL C CG2 1 
ATOM   6006  N N   . SER B 1 366 ? 18.157 16.710  60.385  1.00 37.81  ? 363 SER C N   1 
ATOM   6007  C CA  . SER B 1 366 ? 18.510 17.867  59.573  1.00 38.53  ? 363 SER C CA  1 
ATOM   6008  C C   . SER B 1 366 ? 17.845 17.786  58.207  1.00 37.24  ? 363 SER C C   1 
ATOM   6009  O O   . SER B 1 366 ? 17.250 18.759  57.730  1.00 31.95  ? 363 SER C O   1 
ATOM   6010  C CB  . SER B 1 366 ? 20.029 17.952  59.424  1.00 34.08  ? 363 SER C CB  1 
ATOM   6011  O OG  . SER B 1 366 ? 20.674 17.998  60.685  1.00 33.75  ? 363 SER C OG  1 
ATOM   6012  N N   . ILE B 1 367 ? 17.923 16.617  57.572  1.00 36.25  ? 364 ILE C N   1 
ATOM   6013  C CA  . ILE B 1 367 ? 17.378 16.454  56.229  1.00 35.56  ? 364 ILE C CA  1 
ATOM   6014  C C   . ILE B 1 367 ? 15.854 16.505  56.260  1.00 36.37  ? 364 ILE C C   1 
ATOM   6015  O O   . ILE B 1 367 ? 15.223 17.158  55.421  1.00 39.93  ? 364 ILE C O   1 
ATOM   6016  C CB  . ILE B 1 367 ? 17.899 15.146  55.605  1.00 35.01  ? 364 ILE C CB  1 
ATOM   6017  C CG1 . ILE B 1 367 ? 19.400 15.257  55.342  1.00 36.61  ? 364 ILE C CG1 1 
ATOM   6018  C CG2 . ILE B 1 367 ? 17.130 14.800  54.328  1.00 34.58  ? 364 ILE C CG2 1 
ATOM   6019  C CD1 . ILE B 1 367 ? 20.035 13.986  54.823  1.00 33.97  ? 364 ILE C CD1 1 
ATOM   6020  N N   . GLU B 1 368 ? 15.243 15.834  57.242  1.00 31.67  ? 365 GLU C N   1 
ATOM   6021  C CA  . GLU B 1 368 ? 13.787 15.736  57.281  1.00 39.78  ? 365 GLU C CA  1 
ATOM   6022  C C   . GLU B 1 368 ? 13.143 17.074  57.620  1.00 36.78  ? 365 GLU C C   1 
ATOM   6023  O O   . GLU B 1 368 ? 12.073 17.402  57.093  1.00 33.98  ? 365 GLU C O   1 
ATOM   6024  C CB  . GLU B 1 368 ? 13.358 14.660  58.281  1.00 32.78  ? 365 GLU C CB  1 
ATOM   6025  C CG  . GLU B 1 368 ? 13.700 13.243  57.841  1.00 37.07  ? 365 GLU C CG  1 
ATOM   6026  C CD  . GLU B 1 368 ? 13.911 12.299  59.009  1.00 43.79  ? 365 GLU C CD  1 
ATOM   6027  O OE1 . GLU B 1 368 ? 13.564 12.676  60.149  1.00 39.06  ? 365 GLU C OE1 1 
ATOM   6028  O OE2 . GLU B 1 368 ? 14.425 11.183  58.788  1.00 42.74  ? 365 GLU C OE2 1 
ATOM   6029  N N   . THR B 1 369 ? 13.775 17.856  58.500  1.00 36.95  ? 366 THR C N   1 
ATOM   6030  C CA  . THR B 1 369 ? 13.249 19.177  58.829  1.00 38.39  ? 366 THR C CA  1 
ATOM   6031  C C   . THR B 1 369 ? 13.115 20.033  57.578  1.00 37.31  ? 366 THR C C   1 
ATOM   6032  O O   . THR B 1 369 ? 12.094 20.698  57.368  1.00 40.07  ? 366 THR C O   1 
ATOM   6033  C CB  . THR B 1 369 ? 14.159 19.866  59.848  1.00 47.24  ? 366 THR C CB  1 
ATOM   6034  O OG1 . THR B 1 369 ? 14.264 19.054  61.024  1.00 44.46  ? 366 THR C OG1 1 
ATOM   6035  C CG2 . THR B 1 369 ? 13.602 21.231  60.226  1.00 39.33  ? 366 THR C CG2 1 
ATOM   6036  N N   . ILE B 1 370 ? 14.141 20.014  56.727  1.00 37.29  ? 367 ILE C N   1 
ATOM   6037  C CA  . ILE B 1 370 ? 14.113 20.782  55.487  1.00 35.95  ? 367 ILE C CA  1 
ATOM   6038  C C   . ILE B 1 370 ? 13.041 20.235  54.554  1.00 35.65  ? 367 ILE C C   1 
ATOM   6039  O O   . ILE B 1 370 ? 12.241 20.987  53.984  1.00 36.66  ? 367 ILE C O   1 
ATOM   6040  C CB  . ILE B 1 370 ? 15.503 20.763  54.827  1.00 32.97  ? 367 ILE C CB  1 
ATOM   6041  C CG1 . ILE B 1 370 ? 16.462 21.673  55.593  1.00 35.40  ? 367 ILE C CG1 1 
ATOM   6042  C CG2 . ILE B 1 370 ? 15.405 21.144  53.349  1.00 36.99  ? 367 ILE C CG2 1 
ATOM   6043  C CD1 . ILE B 1 370 ? 17.897 21.209  55.549  1.00 34.29  ? 367 ILE C CD1 1 
ATOM   6044  N N   . GLU B 1 371 ? 13.003 18.910  54.393  1.00 33.67  ? 368 GLU C N   1 
ATOM   6045  C CA  . GLU B 1 371 ? 12.011 18.284  53.527  1.00 33.54  ? 368 GLU C CA  1 
ATOM   6046  C C   . GLU B 1 371 ? 10.590 18.501  54.032  1.00 37.43  ? 368 GLU C C   1 
ATOM   6047  O O   . GLU B 1 371 ? 9.640  18.382  53.250  1.00 38.97  ? 368 GLU C O   1 
ATOM   6048  C CB  . GLU B 1 371 ? 12.310 16.792  53.393  1.00 33.13  ? 368 GLU C CB  1 
ATOM   6049  C CG  . GLU B 1 371 ? 13.609 16.499  52.651  1.00 35.73  ? 368 GLU C CG  1 
ATOM   6050  C CD  . GLU B 1 371 ? 13.919 15.018  52.562  1.00 41.43  ? 368 GLU C CD  1 
ATOM   6051  O OE1 . GLU B 1 371 ? 13.322 14.232  53.328  1.00 41.20  ? 368 GLU C OE1 1 
ATOM   6052  O OE2 . GLU B 1 371 ? 14.765 14.640  51.725  1.00 41.17  ? 368 GLU C OE2 1 
ATOM   6053  N N   . ALA B 1 372 ? 10.422 18.825  55.315  1.00 37.17  ? 369 ALA C N   1 
ATOM   6054  C CA  . ALA B 1 372 ? 9.120  19.183  55.865  1.00 42.07  ? 369 ALA C CA  1 
ATOM   6055  C C   . ALA B 1 372 ? 8.749  20.642  55.631  1.00 37.50  ? 369 ALA C C   1 
ATOM   6056  O O   . ALA B 1 372 ? 7.625  21.037  55.960  1.00 39.70  ? 369 ALA C O   1 
ATOM   6057  C CB  . ALA B 1 372 ? 9.074  18.887  57.367  1.00 29.43  ? 369 ALA C CB  1 
ATOM   6058  N N   . GLY B 1 373 ? 9.657  21.450  55.087  1.00 37.89  ? 370 GLY C N   1 
ATOM   6059  C CA  . GLY B 1 373 ? 9.372  22.835  54.766  1.00 34.52  ? 370 GLY C CA  1 
ATOM   6060  C C   . GLY B 1 373 ? 9.978  23.878  55.688  1.00 38.66  ? 370 GLY C C   1 
ATOM   6061  O O   . GLY B 1 373 ? 9.627  25.058  55.570  1.00 44.04  ? 370 GLY C O   1 
ATOM   6062  N N   . PHE B 1 374 ? 10.871 23.489  56.595  1.00 37.92  ? 371 PHE C N   1 
ATOM   6063  C CA  . PHE B 1 374 ? 11.503 24.405  57.540  1.00 39.41  ? 371 PHE C CA  1 
ATOM   6064  C C   . PHE B 1 374 ? 12.973 24.534  57.154  1.00 44.08  ? 371 PHE C C   1 
ATOM   6065  O O   . PHE B 1 374 ? 13.741 23.576  57.289  1.00 39.78  ? 371 PHE C O   1 
ATOM   6066  C CB  . PHE B 1 374 ? 11.337 23.903  58.974  1.00 37.75  ? 371 PHE C CB  1 
ATOM   6067  C CG  . PHE B 1 374 ? 9.900  23.703  59.383  1.00 43.43  ? 371 PHE C CG  1 
ATOM   6068  C CD1 . PHE B 1 374 ? 9.119  24.784  59.768  1.00 43.33  ? 371 PHE C CD1 1 
ATOM   6069  C CD2 . PHE B 1 374 ? 9.327  22.439  59.373  1.00 40.76  ? 371 PHE C CD2 1 
ATOM   6070  C CE1 . PHE B 1 374 ? 7.792  24.607  60.142  1.00 42.02  ? 371 PHE C CE1 1 
ATOM   6071  C CE2 . PHE B 1 374 ? 8.000  22.253  59.745  1.00 38.33  ? 371 PHE C CE2 1 
ATOM   6072  C CZ  . PHE B 1 374 ? 7.233  23.340  60.130  1.00 39.51  ? 371 PHE C CZ  1 
ATOM   6073  N N   . MET B 1 375 ? 13.358 25.714  56.668  1.00 41.97  ? 372 MET C N   1 
ATOM   6074  C CA  . MET B 1 375 ? 14.667 25.893  56.059  1.00 42.65  ? 372 MET C CA  1 
ATOM   6075  C C   . MET B 1 375 ? 15.100 27.347  56.177  1.00 48.78  ? 372 MET C C   1 
ATOM   6076  O O   . MET B 1 375 ? 14.293 28.239  56.455  1.00 41.38  ? 372 MET C O   1 
ATOM   6077  C CB  . MET B 1 375 ? 14.648 25.466  54.588  1.00 42.47  ? 372 MET C CB  1 
ATOM   6078  C CG  . MET B 1 375 ? 13.702 26.294  53.728  1.00 43.44  ? 372 MET C CG  1 
ATOM   6079  S SD  . MET B 1 375 ? 13.475 25.610  52.078  1.00 40.05  ? 372 MET C SD  1 
ATOM   6080  C CE  . MET B 1 375 ? 12.372 24.240  52.426  1.00 34.67  ? 372 MET C CE  1 
ATOM   6081  N N   . THR B 1 376 ? 16.392 27.573  55.948  1.00 46.64  ? 373 THR C N   1 
ATOM   6082  C CA  . THR B 1 376 ? 16.945 28.916  55.951  1.00 46.36  ? 373 THR C CA  1 
ATOM   6083  C C   . THR B 1 376 ? 16.730 29.586  54.594  1.00 50.84  ? 373 THR C C   1 
ATOM   6084  O O   . THR B 1 376 ? 16.198 28.994  53.650  1.00 48.24  ? 373 THR C O   1 
ATOM   6085  C CB  . THR B 1 376 ? 18.432 28.889  56.301  1.00 43.65  ? 373 THR C CB  1 
ATOM   6086  O OG1 . THR B 1 376 ? 19.097 27.898  55.507  1.00 42.57  ? 373 THR C OG1 1 
ATOM   6087  C CG2 . THR B 1 376 ? 18.628 28.569  57.775  1.00 44.78  ? 373 THR C CG2 1 
ATOM   6088  N N   . LYS B 1 377 ? 17.173 30.844  54.508  1.00 47.75  ? 374 LYS C N   1 
ATOM   6089  C CA  . LYS B 1 377 ? 16.892 31.669  53.335  1.00 48.82  ? 374 LYS C CA  1 
ATOM   6090  C C   . LYS B 1 377 ? 17.473 31.057  52.065  1.00 42.15  ? 374 LYS C C   1 
ATOM   6091  O O   . LYS B 1 377 ? 16.816 31.027  51.018  1.00 40.94  ? 374 LYS C O   1 
ATOM   6092  C CB  . LYS B 1 377 ? 17.446 33.078  53.553  1.00 51.75  ? 374 LYS C CB  1 
ATOM   6093  C CG  . LYS B 1 377 ? 16.980 34.120  52.545  1.00 53.02  ? 374 LYS C CG  1 
ATOM   6094  C CD  . LYS B 1 377 ? 16.903 35.497  53.195  1.00 58.71  ? 374 LYS C CD  1 
ATOM   6095  C CE  . LYS B 1 377 ? 16.661 36.608  52.179  1.00 62.98  ? 374 LYS C CE  1 
ATOM   6096  N NZ  . LYS B 1 377 ? 17.933 37.130  51.599  1.00 51.71  ? 374 LYS C NZ  1 
ATOM   6097  N N   . ASP B 1 378 ? 18.708 30.558  52.142  1.00 36.83  ? 375 ASP C N   1 
ATOM   6098  C CA  . ASP B 1 378 ? 19.383 30.060  50.946  1.00 42.18  ? 375 ASP C CA  1 
ATOM   6099  C C   . ASP B 1 378 ? 18.652 28.864  50.346  1.00 45.10  ? 375 ASP C C   1 
ATOM   6100  O O   . ASP B 1 378 ? 18.541 28.748  49.120  1.00 42.10  ? 375 ASP C O   1 
ATOM   6101  C CB  . ASP B 1 378 ? 20.829 29.701  51.283  1.00 39.84  ? 375 ASP C CB  1 
ATOM   6102  C CG  . ASP B 1 378 ? 20.925 28.639  52.360  1.00 47.35  ? 375 ASP C CG  1 
ATOM   6103  O OD1 . ASP B 1 378 ? 20.125 28.693  53.316  1.00 46.44  ? 375 ASP C OD1 1 
ATOM   6104  O OD2 . ASP B 1 378 ? 21.794 27.750  52.244  1.00 43.68  ? 375 ASP C OD2 1 
ATOM   6105  N N   . LEU B 1 379 ? 18.135 27.970  51.193  1.00 40.81  ? 376 LEU C N   1 
ATOM   6106  C CA  . LEU B 1 379 ? 17.405 26.814  50.685  1.00 41.01  ? 376 LEU C CA  1 
ATOM   6107  C C   . LEU B 1 379 ? 16.075 27.232  50.072  1.00 41.10  ? 376 LEU C C   1 
ATOM   6108  O O   . LEU B 1 379 ? 15.655 26.680  49.048  1.00 34.84  ? 376 LEU C O   1 
ATOM   6109  C CB  . LEU B 1 379 ? 17.190 25.799  51.806  1.00 39.75  ? 376 LEU C CB  1 
ATOM   6110  C CG  . LEU B 1 379 ? 18.458 25.155  52.364  1.00 44.99  ? 376 LEU C CG  1 
ATOM   6111  C CD1 . LEU B 1 379 ? 18.109 24.259  53.535  1.00 48.64  ? 376 LEU C CD1 1 
ATOM   6112  C CD2 . LEU B 1 379 ? 19.184 24.372  51.282  1.00 41.17  ? 376 LEU C CD2 1 
ATOM   6113  N N   . ALA B 1 380 ? 15.398 28.206  50.685  1.00 37.32  ? 377 ALA C N   1 
ATOM   6114  C CA  . ALA B 1 380 ? 14.176 28.734  50.090  1.00 42.20  ? 377 ALA C CA  1 
ATOM   6115  C C   . ALA B 1 380 ? 14.461 29.370  48.736  1.00 43.99  ? 377 ALA C C   1 
ATOM   6116  O O   . ALA B 1 380 ? 13.617 29.334  47.833  1.00 39.54  ? 377 ALA C O   1 
ATOM   6117  C CB  . ALA B 1 380 ? 13.522 29.745  51.033  1.00 35.71  ? 377 ALA C CB  1 
ATOM   6118  N N   . ALA B 1 381 ? 15.654 29.947  48.571  1.00 40.89  ? 378 ALA C N   1 
ATOM   6119  C CA  . ALA B 1 381 ? 16.006 30.559  47.294  1.00 48.14  ? 378 ALA C CA  1 
ATOM   6120  C C   . ALA B 1 381 ? 16.219 29.505  46.215  1.00 49.13  ? 378 ALA C C   1 
ATOM   6121  O O   . ALA B 1 381 ? 15.911 29.743  45.042  1.00 44.75  ? 378 ALA C O   1 
ATOM   6122  C CB  . ALA B 1 381 ? 17.252 31.429  47.449  1.00 43.12  ? 378 ALA C CB  1 
ATOM   6123  N N   . CYS B 1 382 ? 16.746 28.335  46.590  1.00 42.46  ? 379 CYS C N   1 
ATOM   6124  C CA  . CYS B 1 382 ? 16.929 27.265  45.614  1.00 37.92  ? 379 CYS C CA  1 
ATOM   6125  C C   . CYS B 1 382 ? 15.600 26.818  45.022  1.00 41.71  ? 379 CYS C C   1 
ATOM   6126  O O   . CYS B 1 382 ? 15.553 26.364  43.873  1.00 53.62  ? 379 CYS C O   1 
ATOM   6127  C CB  . CYS B 1 382 ? 17.648 26.080  46.259  1.00 39.77  ? 379 CYS C CB  1 
ATOM   6128  S SG  . CYS B 1 382 ? 19.381 26.386  46.666  1.00 53.45  ? 379 CYS C SG  1 
ATOM   6129  N N   . ILE B 1 383 ? 14.513 26.946  45.780  1.00 44.98  ? 380 ILE C N   1 
ATOM   6130  C CA  . ILE B 1 383 ? 13.201 26.558  45.275  1.00 51.95  ? 380 ILE C CA  1 
ATOM   6131  C C   . ILE B 1 383 ? 12.597 27.671  44.428  1.00 48.41  ? 380 ILE C C   1 
ATOM   6132  O O   . ILE B 1 383 ? 12.223 27.461  43.268  1.00 47.47  ? 380 ILE C O   1 
ATOM   6133  C CB  . ILE B 1 383 ? 12.268 26.181  46.442  1.00 48.32  ? 380 ILE C CB  1 
ATOM   6134  C CG1 . ILE B 1 383 ? 12.856 25.029  47.255  1.00 43.20  ? 380 ILE C CG1 1 
ATOM   6135  C CG2 . ILE B 1 383 ? 10.879 25.822  45.920  1.00 42.78  ? 380 ILE C CG2 1 
ATOM   6136  C CD1 . ILE B 1 383 ? 11.991 24.626  48.431  1.00 37.94  ? 380 ILE C CD1 1 
ATOM   6137  N N   . LYS B 1 384 ? 12.494 28.872  44.997  1.00 48.94  ? 381 LYS C N   1 
ATOM   6138  C CA  . LYS B 1 384 ? 11.754 29.962  44.375  1.00 52.61  ? 381 LYS C CA  1 
ATOM   6139  C C   . LYS B 1 384 ? 12.606 30.832  43.460  1.00 47.91  ? 381 LYS C C   1 
ATOM   6140  O O   . LYS B 1 384 ? 12.047 31.599  42.667  1.00 48.97  ? 381 LYS C O   1 
ATOM   6141  C CB  . LYS B 1 384 ? 11.111 30.836  45.457  1.00 48.76  ? 381 LYS C CB  1 
ATOM   6142  C CG  . LYS B 1 384 ? 9.951  30.168  46.184  1.00 50.58  ? 381 LYS C CG  1 
ATOM   6143  C CD  . LYS B 1 384 ? 8.888  31.184  46.584  1.00 65.76  ? 381 LYS C CD  1 
ATOM   6144  C CE  . LYS B 1 384 ? 7.519  30.529  46.727  1.00 62.88  ? 381 LYS C CE  1 
ATOM   6145  N NZ  . LYS B 1 384 ? 6.469  31.502  47.151  1.00 55.59  ? 381 LYS C NZ  1 
ATOM   6146  N N   . GLY B 1 385 ? 13.923 30.729  43.537  1.00 47.39  ? 382 GLY C N   1 
ATOM   6147  C CA  . GLY B 1 385 ? 14.805 31.594  42.767  1.00 40.30  ? 382 GLY C CA  1 
ATOM   6148  C C   . GLY B 1 385 ? 15.478 32.581  43.707  1.00 48.06  ? 382 GLY C C   1 
ATOM   6149  O O   . GLY B 1 385 ? 14.845 33.132  44.617  1.00 52.90  ? 382 GLY C O   1 
ATOM   6150  N N   . LEU B 1 386 ? 16.775 32.809  43.486  1.00 42.83  ? 383 LEU C N   1 
ATOM   6151  C CA  . LEU B 1 386 ? 17.592 33.613  44.401  1.00 50.43  ? 383 LEU C CA  1 
ATOM   6152  C C   . LEU B 1 386 ? 17.000 34.974  44.749  1.00 52.30  ? 383 LEU C C   1 
ATOM   6153  O O   . LEU B 1 386 ? 17.030 35.333  45.935  1.00 50.23  ? 383 LEU C O   1 
ATOM   6154  C CB  . LEU B 1 386 ? 19.005 33.780  43.821  1.00 53.81  ? 383 LEU C CB  1 
ATOM   6155  C CG  . LEU B 1 386 ? 19.970 34.574  44.709  1.00 58.34  ? 383 LEU C CG  1 
ATOM   6156  C CD1 . LEU B 1 386 ? 20.158 33.886  46.057  1.00 54.73  ? 383 LEU C CD1 1 
ATOM   6157  C CD2 . LEU B 1 386 ? 21.309 34.772  44.017  1.00 55.39  ? 383 LEU C CD2 1 
ATOM   6158  N N   . PRO B 1 387 ? 16.463 35.765  43.824  1.00 45.70  ? 384 PRO C N   1 
ATOM   6159  C CA  . PRO B 1 387 ? 15.855 37.044  44.216  1.00 51.22  ? 384 PRO C CA  1 
ATOM   6160  C C   . PRO B 1 387 ? 14.409 36.965  44.683  1.00 48.51  ? 384 PRO C C   1 
ATOM   6161  O O   . PRO B 1 387 ? 13.834 38.014  45.000  1.00 52.38  ? 384 PRO C O   1 
ATOM   6162  C CB  . PRO B 1 387 ? 15.949 37.864  42.921  1.00 49.76  ? 384 PRO C CB  1 
ATOM   6163  C CG  . PRO B 1 387 ? 15.825 36.852  41.845  1.00 43.99  ? 384 PRO C CG  1 
ATOM   6164  C CD  . PRO B 1 387 ? 16.485 35.605  42.356  1.00 44.26  ? 384 PRO C CD  1 
ATOM   6165  N N   . ASN B 1 388 ? 13.812 35.775  44.759  1.00 43.96  ? 385 ASN C N   1 
ATOM   6166  C CA  . ASN B 1 388 ? 12.365 35.622  44.900  1.00 45.56  ? 385 ASN C CA  1 
ATOM   6167  C C   . ASN B 1 388 ? 11.949 34.995  46.230  1.00 51.91  ? 385 ASN C C   1 
ATOM   6168  O O   . ASN B 1 388 ? 11.050 34.154  46.274  1.00 59.56  ? 385 ASN C O   1 
ATOM   6169  C CB  . ASN B 1 388 ? 11.798 34.787  43.753  1.00 41.45  ? 385 ASN C CB  1 
ATOM   6170  C CG  . ASN B 1 388 ? 11.869 35.497  42.415  1.00 40.15  ? 385 ASN C CG  1 
ATOM   6171  O OD1 . ASN B 1 388 ? 11.844 36.726  42.348  1.00 40.71  ? 385 ASN C OD1 1 
ATOM   6172  N ND2 . ASN B 1 388 ? 11.944 34.722  41.341  1.00 30.40  ? 385 ASN C ND2 1 
ATOM   6173  N N   . VAL B 1 389 ? 12.566 35.403  47.334  1.00 52.27  ? 386 VAL C N   1 
ATOM   6174  C CA  . VAL B 1 389 ? 12.253 34.845  48.648  1.00 59.17  ? 386 VAL C CA  1 
ATOM   6175  C C   . VAL B 1 389 ? 11.464 35.864  49.458  1.00 50.32  ? 386 VAL C C   1 
ATOM   6176  O O   . VAL B 1 389 ? 11.840 37.041  49.529  1.00 48.60  ? 386 VAL C O   1 
ATOM   6177  C CB  . VAL B 1 389 ? 13.527 34.421  49.398  1.00 57.00  ? 386 VAL C CB  1 
ATOM   6178  C CG1 . VAL B 1 389 ? 13.171 33.834  50.752  1.00 55.64  ? 386 VAL C CG1 1 
ATOM   6179  C CG2 . VAL B 1 389 ? 14.305 33.414  48.576  1.00 53.81  ? 386 VAL C CG2 1 
ATOM   6180  N N   . GLN B 1 390 ? 10.364 35.413  50.055  1.00 52.70  ? 387 GLN C N   1 
ATOM   6181  C CA  . GLN B 1 390 ? 9.625  36.171  51.053  1.00 56.40  ? 387 GLN C CA  1 
ATOM   6182  C C   . GLN B 1 390 ? 10.050 35.722  52.447  1.00 58.92  ? 387 GLN C C   1 
ATOM   6183  O O   . GLN B 1 390 ? 10.536 34.604  52.642  1.00 60.56  ? 387 GLN C O   1 
ATOM   6184  C CB  . GLN B 1 390 ? 8.113  35.985  50.873  1.00 59.37  ? 387 GLN C CB  1 
ATOM   6185  C CG  . GLN B 1 390 ? 7.579  36.449  49.521  1.00 61.46  ? 387 GLN C CG  1 
ATOM   6186  C CD  . GLN B 1 390 ? 6.066  36.591  49.500  1.00 66.35  ? 387 GLN C CD  1 
ATOM   6187  O OE1 . GLN B 1 390 ? 5.521  37.625  49.890  1.00 67.36  ? 387 GLN C OE1 1 
ATOM   6188  N NE2 . GLN B 1 390 ? 5.379  35.552  49.036  1.00 65.01  ? 387 GLN C NE2 1 
ATOM   6189  N N   . ARG B 1 391 ? 9.868  36.615  53.425  1.00 58.65  ? 388 ARG C N   1 
ATOM   6190  C CA  . ARG B 1 391 ? 10.258 36.289  54.794  1.00 57.60  ? 388 ARG C CA  1 
ATOM   6191  C C   . ARG B 1 391 ? 9.442  35.127  55.348  1.00 60.20  ? 388 ARG C C   1 
ATOM   6192  O O   . ARG B 1 391 ? 9.924  34.380  56.208  1.00 59.00  ? 388 ARG C O   1 
ATOM   6193  C CB  . ARG B 1 391 ? 10.118 37.522  55.687  1.00 63.17  ? 388 ARG C CB  1 
ATOM   6194  C CG  . ARG B 1 391 ? 10.450 37.295  57.163  1.00 55.01  ? 388 ARG C CG  1 
ATOM   6195  C CD  . ARG B 1 391 ? 11.844 36.707  57.353  1.00 59.62  ? 388 ARG C CD  1 
ATOM   6196  N NE  . ARG B 1 391 ? 12.133 36.410  58.754  1.00 61.48  ? 388 ARG C NE  1 
ATOM   6197  C CZ  . ARG B 1 391 ? 11.857 35.251  59.347  1.00 61.88  ? 388 ARG C CZ  1 
ATOM   6198  N NH1 . ARG B 1 391 ? 12.155 35.072  60.628  1.00 60.24  ? 388 ARG C NH1 1 
ATOM   6199  N NH2 . ARG B 1 391 ? 11.285 34.272  58.660  1.00 49.39  ? 388 ARG C NH2 1 
ATOM   6200  N N   . SER B 1 392 ? 8.217  34.944  54.859  1.00 56.60  ? 389 SER C N   1 
ATOM   6201  C CA  . SER B 1 392 ? 7.390  33.814  55.261  1.00 56.67  ? 389 SER C CA  1 
ATOM   6202  C C   . SER B 1 392 ? 7.827  32.497  54.630  1.00 54.96  ? 389 SER C C   1 
ATOM   6203  O O   . SER B 1 392 ? 7.190  31.468  54.884  1.00 58.85  ? 389 SER C O   1 
ATOM   6204  C CB  . SER B 1 392 ? 5.927  34.089  54.912  1.00 57.11  ? 389 SER C CB  1 
ATOM   6205  O OG  . SER B 1 392 ? 5.676  33.834  53.541  1.00 66.09  ? 389 SER C OG  1 
ATOM   6206  N N   . ASP B 1 393 ? 8.887  32.500  53.822  1.00 54.68  ? 390 ASP C N   1 
ATOM   6207  C CA  . ASP B 1 393 ? 9.378  31.286  53.184  1.00 57.68  ? 390 ASP C CA  1 
ATOM   6208  C C   . ASP B 1 393 ? 10.448 30.571  53.996  1.00 53.58  ? 390 ASP C C   1 
ATOM   6209  O O   . ASP B 1 393 ? 10.783 29.426  53.672  1.00 51.99  ? 390 ASP C O   1 
ATOM   6210  C CB  . ASP B 1 393 ? 9.948  31.606  51.795  1.00 51.94  ? 390 ASP C CB  1 
ATOM   6211  C CG  . ASP B 1 393 ? 8.877  31.996  50.794  1.00 59.12  ? 390 ASP C CG  1 
ATOM   6212  O OD1 . ASP B 1 393 ? 7.806  31.353  50.779  1.00 62.85  ? 390 ASP C OD1 1 
ATOM   6213  O OD2 . ASP B 1 393 ? 9.109  32.948  50.017  1.00 61.05  ? 390 ASP C OD2 1 
ATOM   6214  N N   . TYR B 1 394 ? 10.987 31.202  55.038  1.00 51.41  ? 391 TYR C N   1 
ATOM   6215  C CA  . TYR B 1 394 ? 12.143 30.650  55.730  1.00 54.72  ? 391 TYR C CA  1 
ATOM   6216  C C   . TYR B 1 394 ? 12.134 31.060  57.196  1.00 51.85  ? 391 TYR C C   1 
ATOM   6217  O O   . TYR B 1 394 ? 11.326 31.881  57.636  1.00 53.07  ? 391 TYR C O   1 
ATOM   6218  C CB  . TYR B 1 394 ? 13.450 31.096  55.061  1.00 50.05  ? 391 TYR C CB  1 
ATOM   6219  C CG  . TYR B 1 394 ? 13.727 32.583  55.166  1.00 53.44  ? 391 TYR C CG  1 
ATOM   6220  C CD1 . TYR B 1 394 ? 13.217 33.471  54.229  1.00 54.85  ? 391 TYR C CD1 1 
ATOM   6221  C CD2 . TYR B 1 394 ? 14.499 33.099  56.202  1.00 49.58  ? 391 TYR C CD2 1 
ATOM   6222  C CE1 . TYR B 1 394 ? 13.467 34.831  54.317  1.00 54.74  ? 391 TYR C CE1 1 
ATOM   6223  C CE2 . TYR B 1 394 ? 14.753 34.458  56.300  1.00 53.98  ? 391 TYR C CE2 1 
ATOM   6224  C CZ  . TYR B 1 394 ? 14.234 35.319  55.354  1.00 60.45  ? 391 TYR C CZ  1 
ATOM   6225  O OH  . TYR B 1 394 ? 14.482 36.671  55.443  1.00 59.37  ? 391 TYR C OH  1 
ATOM   6226  N N   . LEU B 1 395 ? 13.055 30.463  57.949  1.00 48.62  ? 392 LEU C N   1 
ATOM   6227  C CA  . LEU B 1 395 ? 13.319 30.803  59.338  1.00 50.04  ? 392 LEU C CA  1 
ATOM   6228  C C   . LEU B 1 395 ? 14.701 31.430  59.443  1.00 49.56  ? 392 LEU C C   1 
ATOM   6229  O O   . LEU B 1 395 ? 15.576 31.178  58.609  1.00 47.11  ? 392 LEU C O   1 
ATOM   6230  C CB  . LEU B 1 395 ? 13.262 29.563  60.239  1.00 46.93  ? 392 LEU C CB  1 
ATOM   6231  C CG  . LEU B 1 395 ? 12.180 28.508  60.006  1.00 50.87  ? 392 LEU C CG  1 
ATOM   6232  C CD1 . LEU B 1 395 ? 12.300 27.390  61.033  1.00 46.58  ? 392 LEU C CD1 1 
ATOM   6233  C CD2 . LEU B 1 395 ? 10.791 29.126  60.044  1.00 53.49  ? 392 LEU C CD2 1 
ATOM   6234  N N   . ASN B 1 396 ? 14.902 32.239  60.481  1.00 49.89  ? 393 ASN C N   1 
ATOM   6235  C CA  . ASN B 1 396 ? 16.225 32.797  60.703  1.00 52.43  ? 393 ASN C CA  1 
ATOM   6236  C C   . ASN B 1 396 ? 17.117 31.759  61.388  1.00 52.11  ? 393 ASN C C   1 
ATOM   6237  O O   . ASN B 1 396 ? 16.696 30.639  61.695  1.00 47.25  ? 393 ASN C O   1 
ATOM   6238  C CB  . ASN B 1 396 ? 16.137 34.104  61.493  1.00 59.05  ? 393 ASN C CB  1 
ATOM   6239  C CG  . ASN B 1 396 ? 15.664 33.914  62.922  1.00 60.35  ? 393 ASN C CG  1 
ATOM   6240  O OD1 . ASN B 1 396 ? 16.307 33.238  63.723  1.00 56.38  ? 393 ASN C OD1 1 
ATOM   6241  N ND2 . ASN B 1 396 ? 14.553 34.559  63.261  1.00 59.55  ? 393 ASN C ND2 1 
ATOM   6242  N N   . THR B 1 397 ? 18.373 32.149  61.620  1.00 51.30  ? 394 THR C N   1 
ATOM   6243  C CA  . THR B 1 397 ? 19.376 31.223  62.137  1.00 52.94  ? 394 THR C CA  1 
ATOM   6244  C C   . THR B 1 397 ? 18.910 30.547  63.420  1.00 53.35  ? 394 THR C C   1 
ATOM   6245  O O   . THR B 1 397 ? 18.955 29.318  63.544  1.00 54.82  ? 394 THR C O   1 
ATOM   6246  C CB  . THR B 1 397 ? 20.688 31.968  62.377  1.00 56.99  ? 394 THR C CB  1 
ATOM   6247  O OG1 . THR B 1 397 ? 21.016 32.738  61.216  1.00 57.26  ? 394 THR C OG1 1 
ATOM   6248  C CG2 . THR B 1 397 ? 21.814 30.989  62.676  1.00 56.91  ? 394 THR C CG2 1 
ATOM   6249  N N   . PHE B 1 398 ? 18.443 31.340  64.383  1.00 55.62  ? 395 PHE C N   1 
ATOM   6250  C CA  . PHE B 1 398 ? 18.061 30.795  65.680  1.00 55.47  ? 395 PHE C CA  1 
ATOM   6251  C C   . PHE B 1 398 ? 16.723 30.070  65.611  1.00 53.80  ? 395 PHE C C   1 
ATOM   6252  O O   . PHE B 1 398 ? 16.537 29.046  66.279  1.00 52.15  ? 395 PHE C O   1 
ATOM   6253  C CB  . PHE B 1 398 ? 18.016 31.917  66.717  1.00 50.88  ? 395 PHE C CB  1 
ATOM   6254  C CG  . PHE B 1 398 ? 19.266 32.756  66.755  1.00 56.31  ? 395 PHE C CG  1 
ATOM   6255  C CD1 . PHE B 1 398 ? 19.419 33.837  65.901  1.00 57.22  ? 395 PHE C CD1 1 
ATOM   6256  C CD2 . PHE B 1 398 ? 20.284 32.465  67.650  1.00 53.27  ? 395 PHE C CD2 1 
ATOM   6257  C CE1 . PHE B 1 398 ? 20.565 34.609  65.933  1.00 61.52  ? 395 PHE C CE1 1 
ATOM   6258  C CE2 . PHE B 1 398 ? 21.431 33.235  67.689  1.00 56.71  ? 395 PHE C CE2 1 
ATOM   6259  C CZ  . PHE B 1 398 ? 21.573 34.308  66.829  1.00 62.67  ? 395 PHE C CZ  1 
ATOM   6260  N N   . GLU B 1 399 ? 15.780 30.585  64.814  1.00 50.51  ? 396 GLU C N   1 
ATOM   6261  C CA  . GLU B 1 399 ? 14.506 29.895  64.635  1.00 52.41  ? 396 GLU C CA  1 
ATOM   6262  C C   . GLU B 1 399 ? 14.716 28.506  64.050  1.00 51.43  ? 396 GLU C C   1 
ATOM   6263  O O   . GLU B 1 399 ? 14.033 27.549  64.434  1.00 52.80  ? 396 GLU C O   1 
ATOM   6264  C CB  . GLU B 1 399 ? 13.587 30.716  63.732  1.00 55.16  ? 396 GLU C CB  1 
ATOM   6265  C CG  . GLU B 1 399 ? 13.015 31.967  64.374  1.00 58.86  ? 396 GLU C CG  1 
ATOM   6266  C CD  . GLU B 1 399 ? 12.038 32.685  63.461  1.00 61.68  ? 396 GLU C CD  1 
ATOM   6267  O OE1 . GLU B 1 399 ? 12.234 32.636  62.228  1.00 56.45  ? 396 GLU C OE1 1 
ATOM   6268  O OE2 . GLU B 1 399 ? 11.077 33.298  63.975  1.00 60.78  ? 396 GLU C OE2 1 
ATOM   6269  N N   . PHE B 1 400 ? 15.663 28.378  63.120  1.00 52.43  ? 397 PHE C N   1 
ATOM   6270  C CA  . PHE B 1 400 ? 15.926 27.089  62.489  1.00 48.25  ? 397 PHE C CA  1 
ATOM   6271  C C   . PHE B 1 400 ? 16.593 26.125  63.463  1.00 45.89  ? 397 PHE C C   1 
ATOM   6272  O O   . PHE B 1 400 ? 16.224 24.947  63.536  1.00 44.83  ? 397 PHE C O   1 
ATOM   6273  C CB  . PHE B 1 400 ? 16.791 27.296  61.246  1.00 40.69  ? 397 PHE C CB  1 
ATOM   6274  C CG  . PHE B 1 400 ? 17.020 26.049  60.446  1.00 42.76  ? 397 PHE C CG  1 
ATOM   6275  C CD1 . PHE B 1 400 ? 15.974 25.426  59.787  1.00 40.05  ? 397 PHE C CD1 1 
ATOM   6276  C CD2 . PHE B 1 400 ? 18.289 25.506  60.344  1.00 42.98  ? 397 PHE C CD2 1 
ATOM   6277  C CE1 . PHE B 1 400 ? 16.189 24.282  59.047  1.00 41.60  ? 397 PHE C CE1 1 
ATOM   6278  C CE2 . PHE B 1 400 ? 18.512 24.364  59.606  1.00 43.34  ? 397 PHE C CE2 1 
ATOM   6279  C CZ  . PHE B 1 400 ? 17.461 23.749  58.956  1.00 41.04  ? 397 PHE C CZ  1 
ATOM   6280  N N   . MET B 1 401 ? 17.583 26.610  64.219  1.00 48.48  ? 398 MET C N   1 
ATOM   6281  C CA  . MET B 1 401 ? 18.245 25.765  65.210  1.00 51.65  ? 398 MET C CA  1 
ATOM   6282  C C   . MET B 1 401 ? 17.253 25.247  66.246  1.00 47.66  ? 398 MET C C   1 
ATOM   6283  O O   . MET B 1 401 ? 17.351 24.096  66.687  1.00 47.87  ? 398 MET C O   1 
ATOM   6284  C CB  . MET B 1 401 ? 19.375 26.539  65.888  1.00 45.99  ? 398 MET C CB  1 
ATOM   6285  C CG  . MET B 1 401 ? 20.594 26.780  65.008  1.00 48.49  ? 398 MET C CG  1 
ATOM   6286  S SD  . MET B 1 401 ? 21.485 25.271  64.568  1.00 57.74  ? 398 MET C SD  1 
ATOM   6287  C CE  . MET B 1 401 ? 21.782 24.571  66.187  1.00 47.24  ? 398 MET C CE  1 
ATOM   6288  N N   . ASP B 1 402 ? 16.292 26.084  66.645  1.00 46.64  ? 399 ASP C N   1 
ATOM   6289  C CA  . ASP B 1 402 ? 15.253 25.635  67.568  1.00 53.53  ? 399 ASP C CA  1 
ATOM   6290  C C   . ASP B 1 402 ? 14.428 24.516  66.948  1.00 51.39  ? 399 ASP C C   1 
ATOM   6291  O O   . ASP B 1 402 ? 14.145 23.502  67.597  1.00 51.50  ? 399 ASP C O   1 
ATOM   6292  C CB  . ASP B 1 402 ? 14.349 26.807  67.957  1.00 52.85  ? 399 ASP C CB  1 
ATOM   6293  C CG  . ASP B 1 402 ? 15.062 27.844  68.797  1.00 59.82  ? 399 ASP C CG  1 
ATOM   6294  O OD1 . ASP B 1 402 ? 15.840 27.458  69.691  1.00 58.05  ? 399 ASP C OD1 1 
ATOM   6295  O OD2 . ASP B 1 402 ? 14.840 29.050  68.561  1.00 66.29  ? 399 ASP C OD2 1 
ATOM   6296  N N   . LYS B 1 403 ? 14.033 24.691  65.684  1.00 48.68  ? 400 LYS C N   1 
ATOM   6297  C CA  . LYS B 1 403 ? 13.244 23.675  64.996  1.00 46.42  ? 400 LYS C CA  1 
ATOM   6298  C C   . LYS B 1 403 ? 13.997 22.353  64.920  1.00 44.97  ? 400 LYS C C   1 
ATOM   6299  O O   . LYS B 1 403 ? 13.419 21.285  65.153  1.00 41.65  ? 400 LYS C O   1 
ATOM   6300  C CB  . LYS B 1 403 ? 12.878 24.167  63.596  1.00 45.34  ? 400 LYS C CB  1 
ATOM   6301  C CG  . LYS B 1 403 ? 11.805 23.350  62.908  1.00 40.65  ? 400 LYS C CG  1 
ATOM   6302  C CD  . LYS B 1 403 ? 10.507 23.399  63.687  1.00 46.11  ? 400 LYS C CD  1 
ATOM   6303  C CE  . LYS B 1 403 ? 9.443  22.554  63.021  1.00 43.38  ? 400 LYS C CE  1 
ATOM   6304  N NZ  . LYS B 1 403 ? 8.145  22.652  63.738  1.00 49.94  ? 400 LYS C NZ  1 
ATOM   6305  N N   . LEU B 1 404 ? 15.292 22.408  64.598  1.00 44.77  ? 401 LEU C N   1 
ATOM   6306  C CA  . LEU B 1 404 ? 16.112 21.201  64.600  1.00 44.70  ? 401 LEU C CA  1 
ATOM   6307  C C   . LEU B 1 404 ? 16.129 20.553  65.979  1.00 46.36  ? 401 LEU C C   1 
ATOM   6308  O O   . LEU B 1 404 ? 15.936 19.337  66.112  1.00 44.56  ? 401 LEU C O   1 
ATOM   6309  C CB  . LEU B 1 404 ? 17.535 21.537  64.155  1.00 39.19  ? 401 LEU C CB  1 
ATOM   6310  C CG  . LEU B 1 404 ? 17.778 21.881  62.686  1.00 48.48  ? 401 LEU C CG  1 
ATOM   6311  C CD1 . LEU B 1 404 ? 19.196 22.393  62.517  1.00 42.27  ? 401 LEU C CD1 1 
ATOM   6312  C CD2 . LEU B 1 404 ? 17.530 20.676  61.789  1.00 41.73  ? 401 LEU C CD2 1 
ATOM   6313  N N   . GLY B 1 405 ? 16.358 21.357  67.021  1.00 44.52  ? 402 GLY C N   1 
ATOM   6314  C CA  . GLY B 1 405 ? 16.428 20.810  68.367  1.00 51.67  ? 402 GLY C CA  1 
ATOM   6315  C C   . GLY B 1 405 ? 15.146 20.121  68.785  1.00 50.47  ? 402 GLY C C   1 
ATOM   6316  O O   . GLY B 1 405 ? 15.171 19.054  69.401  1.00 48.32  ? 402 GLY C O   1 
ATOM   6317  N N   . GLU B 1 406 ? 14.000 20.718  68.443  1.00 41.90  ? 403 GLU C N   1 
ATOM   6318  C CA  . GLU B 1 406 ? 12.721 20.102  68.778  1.00 44.04  ? 403 GLU C CA  1 
ATOM   6319  C C   . GLU B 1 406 ? 12.543 18.775  68.053  1.00 51.02  ? 403 GLU C C   1 
ATOM   6320  O O   . GLU B 1 406 ? 12.104 17.786  68.650  1.00 48.40  ? 403 GLU C O   1 
ATOM   6321  C CB  . GLU B 1 406 ? 11.572 21.051  68.440  1.00 45.82  ? 403 GLU C CB  1 
ATOM   6322  C CG  . GLU B 1 406 ? 11.572 22.350  69.223  1.00 52.41  ? 403 GLU C CG  1 
ATOM   6323  C CD  . GLU B 1 406 ? 10.750 23.426  68.543  1.00 65.90  ? 403 GLU C CD  1 
ATOM   6324  O OE1 . GLU B 1 406 ? 9.801  23.073  67.809  1.00 61.71  ? 403 GLU C OE1 1 
ATOM   6325  O OE2 . GLU B 1 406 ? 11.054 24.622  68.736  1.00 66.98  ? 403 GLU C OE2 1 
ATOM   6326  N N   . ASN B 1 407 ? 12.885 18.731  66.762  1.00 44.10  ? 404 ASN C N   1 
ATOM   6327  C CA  . ASN B 1 407 ? 12.708 17.498  66.003  1.00 42.92  ? 404 ASN C CA  1 
ATOM   6328  C C   . ASN B 1 407 ? 13.710 16.430  66.420  1.00 45.58  ? 404 ASN C C   1 
ATOM   6329  O O   . ASN B 1 407 ? 13.417 15.234  66.315  1.00 43.14  ? 404 ASN C O   1 
ATOM   6330  C CB  . ASN B 1 407 ? 12.819 17.779  64.505  1.00 43.11  ? 404 ASN C CB  1 
ATOM   6331  C CG  . ASN B 1 407 ? 11.654 18.594  63.977  1.00 49.53  ? 404 ASN C CG  1 
ATOM   6332  O OD1 . ASN B 1 407 ? 10.620 18.720  64.634  1.00 44.45  ? 404 ASN C OD1 1 
ATOM   6333  N ND2 . ASN B 1 407 ? 11.816 19.153  62.783  1.00 45.80  ? 404 ASN C ND2 1 
ATOM   6334  N N   . LEU B 1 408 ? 14.890 16.836  66.896  1.00 43.03  ? 405 LEU C N   1 
ATOM   6335  C CA  . LEU B 1 408 ? 15.871 15.858  67.356  1.00 47.59  ? 405 LEU C CA  1 
ATOM   6336  C C   . LEU B 1 408 ? 15.424 15.199  68.655  1.00 47.17  ? 405 LEU C C   1 
ATOM   6337  O O   . LEU B 1 408 ? 15.610 13.990  68.841  1.00 44.82  ? 405 LEU C O   1 
ATOM   6338  C CB  . LEU B 1 408 ? 17.234 16.525  67.531  1.00 48.43  ? 405 LEU C CB  1 
ATOM   6339  C CG  . LEU B 1 408 ? 18.351 15.648  68.100  1.00 40.64  ? 405 LEU C CG  1 
ATOM   6340  C CD1 . LEU B 1 408 ? 18.721 14.543  67.123  1.00 32.32  ? 405 LEU C CD1 1 
ATOM   6341  C CD2 . LEU B 1 408 ? 19.566 16.490  68.456  1.00 42.42  ? 405 LEU C CD2 1 
ATOM   6342  N N   . LYS B 1 409 ? 14.832 15.977  69.564  1.00 50.70  ? 406 LYS C N   1 
ATOM   6343  C CA  . LYS B 1 409 ? 14.320 15.416  70.811  1.00 51.09  ? 406 LYS C CA  1 
ATOM   6344  C C   . LYS B 1 409 ? 13.241 14.377  70.537  1.00 46.74  ? 406 LYS C C   1 
ATOM   6345  O O   . LYS B 1 409 ? 13.224 13.302  71.149  1.00 47.36  ? 406 LYS C O   1 
ATOM   6346  C CB  . LYS B 1 409 ? 13.779 16.540  71.697  1.00 50.99  ? 406 LYS C CB  1 
ATOM   6347  C CG  . LYS B 1 409 ? 13.353 16.115  73.092  1.00 57.13  ? 406 LYS C CG  1 
ATOM   6348  C CD  . LYS B 1 409 ? 12.993 17.335  73.929  1.00 54.94  ? 406 LYS C CD  1 
ATOM   6349  C CE  . LYS B 1 409 ? 12.783 16.969  75.387  1.00 54.09  ? 406 LYS C CE  1 
ATOM   6350  N NZ  . LYS B 1 409 ? 12.516 18.166  76.232  1.00 71.43  ? 406 LYS C NZ  1 
ATOM   6351  N N   . ILE B 1 410 ? 12.336 14.680  69.605  1.00 50.71  ? 407 ILE C N   1 
ATOM   6352  C CA  . ILE B 1 410 ? 11.248 13.763  69.282  1.00 43.91  ? 407 ILE C CA  1 
ATOM   6353  C C   . ILE B 1 410 ? 11.786 12.507  68.609  1.00 48.32  ? 407 ILE C C   1 
ATOM   6354  O O   . ILE B 1 410 ? 11.348 11.389  68.907  1.00 49.40  ? 407 ILE C O   1 
ATOM   6355  C CB  . ILE B 1 410 ? 10.208 14.474  68.397  1.00 45.75  ? 407 ILE C CB  1 
ATOM   6356  C CG1 . ILE B 1 410 ? 9.574  15.637  69.155  1.00 42.30  ? 407 ILE C CG1 1 
ATOM   6357  C CG2 . ILE B 1 410 ? 9.150  13.491  67.908  1.00 38.98  ? 407 ILE C CG2 1 
ATOM   6358  C CD1 . ILE B 1 410 ? 8.604  16.437  68.327  1.00 38.57  ? 407 ILE C CD1 1 
ATOM   6359  N N   . LYS B 1 411 ? 12.737 12.672  67.688  1.00 50.01  ? 408 LYS C N   1 
ATOM   6360  C CA  . LYS B 1 411 ? 13.313 11.529  66.989  1.00 47.92  ? 408 LYS C CA  1 
ATOM   6361  C C   . LYS B 1 411 ? 13.960 10.556  67.968  1.00 45.24  ? 408 LYS C C   1 
ATOM   6362  O O   . LYS B 1 411 ? 13.747 9.340   67.890  1.00 46.31  ? 408 LYS C O   1 
ATOM   6363  C CB  . LYS B 1 411 ? 14.329 12.021  65.958  1.00 43.10  ? 408 LYS C CB  1 
ATOM   6364  C CG  . LYS B 1 411 ? 15.371 10.996  65.564  1.00 38.33  ? 408 LYS C CG  1 
ATOM   6365  C CD  . LYS B 1 411 ? 15.015 10.345  64.249  1.00 52.31  ? 408 LYS C CD  1 
ATOM   6366  C CE  . LYS B 1 411 ? 14.920 11.382  63.142  1.00 42.91  ? 408 LYS C CE  1 
ATOM   6367  N NZ  . LYS B 1 411 ? 14.385 10.788  61.887  1.00 38.17  ? 408 LYS C NZ  1 
ATOM   6368  N N   . LEU B 1 412 ? 14.748 11.079  68.911  1.00 42.48  ? 409 LEU C N   1 
ATOM   6369  C CA  . LEU B 1 412 ? 15.433 10.213  69.865  1.00 51.32  ? 409 LEU C CA  1 
ATOM   6370  C C   . LEU B 1 412 ? 14.457 9.559   70.836  1.00 53.19  ? 409 LEU C C   1 
ATOM   6371  O O   . LEU B 1 412 ? 14.706 8.441   71.302  1.00 56.76  ? 409 LEU C O   1 
ATOM   6372  C CB  . LEU B 1 412 ? 16.491 11.011  70.622  1.00 42.96  ? 409 LEU C CB  1 
ATOM   6373  C CG  . LEU B 1 412 ? 17.572 11.610  69.722  1.00 49.44  ? 409 LEU C CG  1 
ATOM   6374  C CD1 . LEU B 1 412 ? 18.501 12.509  70.514  1.00 50.47  ? 409 LEU C CD1 1 
ATOM   6375  C CD2 . LEU B 1 412 ? 18.353 10.511  69.017  1.00 46.65  ? 409 LEU C CD2 1 
ATOM   6376  N N   . ALA B 1 413 ? 13.344 10.229  71.148  1.00 49.96  ? 410 ALA C N   1 
ATOM   6377  C CA  . ALA B 1 413 ? 12.351 9.629   72.035  1.00 54.84  ? 410 ALA C CA  1 
ATOM   6378  C C   . ALA B 1 413 ? 11.673 8.436   71.372  1.00 54.48  ? 410 ALA C C   1 
ATOM   6379  O O   . ALA B 1 413 ? 11.477 7.393   72.007  1.00 59.49  ? 410 ALA C O   1 
ATOM   6380  C CB  . ALA B 1 413 ? 11.318 10.676  72.453  1.00 43.59  ? 410 ALA C CB  1 
ATOM   6381  N N   . GLN B 1 414 ? 11.322 8.564   70.090  1.00 51.47  ? 411 GLN C N   1 
ATOM   6382  C CA  . GLN B 1 414 ? 10.685 7.473   69.360  1.00 52.23  ? 411 GLN C CA  1 
ATOM   6383  C C   . GLN B 1 414 ? 11.632 6.314   69.080  1.00 53.35  ? 411 GLN C C   1 
ATOM   6384  O O   . GLN B 1 414 ? 11.170 5.254   68.645  1.00 58.76  ? 411 GLN C O   1 
ATOM   6385  C CB  . GLN B 1 414 ? 10.114 7.990   68.039  1.00 46.47  ? 411 GLN C CB  1 
ATOM   6386  C CG  . GLN B 1 414 ? 9.005  9.017   68.199  1.00 46.39  ? 411 GLN C CG  1 
ATOM   6387  C CD  . GLN B 1 414 ? 8.739  9.788   66.919  1.00 53.40  ? 411 GLN C CD  1 
ATOM   6388  O OE1 . GLN B 1 414 ? 9.465  9.652   65.933  1.00 46.77  ? 411 GLN C OE1 1 
ATOM   6389  N NE2 . GLN B 1 414 ? 7.693  10.604  66.930  1.00 46.08  ? 411 GLN C NE2 1 
ATOM   6390  N N   . ALA B 1 415 ? 12.935 6.484   69.318  1.00 57.28  ? 412 ALA C N   1 
ATOM   6391  C CA  . ALA B 1 415 ? 13.902 5.426   69.046  1.00 56.82  ? 412 ALA C CA  1 
ATOM   6392  C C   . ALA B 1 415 ? 13.951 4.371   70.144  1.00 55.74  ? 412 ALA C C   1 
ATOM   6393  O O   . ALA B 1 415 ? 14.482 3.279   69.910  1.00 50.25  ? 412 ALA C O   1 
ATOM   6394  C CB  . ALA B 1 415 ? 15.297 6.020   68.855  1.00 50.50  ? 412 ALA C CB  1 
ATOM   6395  N N   . LYS B 1 416 ? 13.409 4.666   71.327  1.00 63.46  ? 413 LYS C N   1 
ATOM   6396  C CA  . LYS B 1 416 ? 13.473 3.741   72.452  1.00 65.12  ? 413 LYS C CA  1 
ATOM   6397  C C   . LYS B 1 416 ? 12.324 2.740   72.416  1.00 70.04  ? 413 LYS C C   1 
ATOM   6398  O O   . LYS B 1 416 ? 11.681 2.494   73.442  1.00 73.97  ? 413 LYS C O   1 
ATOM   6399  C CB  . LYS B 1 416 ? 13.457 4.507   73.778  1.00 66.54  ? 413 LYS C CB  1 
ATOM   6400  C CG  . LYS B 1 416 ? 14.387 5.712   73.824  1.00 65.24  ? 413 LYS C CG  1 
ATOM   6401  C CD  . LYS B 1 416 ? 14.049 6.627   74.995  1.00 76.41  ? 413 LYS C CD  1 
ATOM   6402  C CE  . LYS B 1 416 ? 14.524 8.051   74.744  1.00 72.89  ? 413 LYS C CE  1 
ATOM   6403  N NZ  . LYS B 1 416 ? 13.903 9.023   75.687  1.00 71.78  ? 413 LYS C NZ  1 
ATOM   6404  N N   . LEU B 1 417 ? 12.058 2.159   71.250  1.00 71.90  ? 414 LEU C N   1 
ATOM   6405  C CA  . LEU B 1 417 ? 10.972 1.194   71.107  1.00 66.70  ? 414 LEU C CA  1 
ATOM   6406  C C   . LEU B 1 417 ? 11.447 -0.085  70.423  1.00 57.42  ? 414 LEU C C   1 
ATOM   6407  O O   . LEU B 1 417 ? 12.380 -0.063  69.621  1.00 59.59  ? 414 LEU C O   1 
ATOM   6408  C CB  . LEU B 1 417 ? 9.810  1.805   70.320  1.00 57.30  ? 414 LEU C CB  1 
ATOM   6409  C CG  . LEU B 1 417 ? 9.317  3.194   70.734  1.00 61.40  ? 414 LEU C CG  1 
ATOM   6410  C CD1 . LEU B 1 417 ? 8.181  3.621   69.835  1.00 54.97  ? 414 LEU C CD1 1 
ATOM   6411  C CD2 . LEU B 1 417 ? 8.869  3.213   72.186  1.00 65.88  ? 414 LEU C CD2 1 
ATOM   6412  N N   . LYS C 1 6   ? 55.997 -3.280  2.560   1.00 61.44  ? 3   LYS B N   1 
ATOM   6413  C CA  . LYS C 1 6   ? 56.092 -1.875  2.179   1.00 57.62  ? 3   LYS B CA  1 
ATOM   6414  C C   . LYS C 1 6   ? 55.970 -1.718  0.666   1.00 56.01  ? 3   LYS B C   1 
ATOM   6415  O O   . LYS C 1 6   ? 56.578 -2.468  -0.097  1.00 55.39  ? 3   LYS B O   1 
ATOM   6416  C CB  . LYS C 1 6   ? 57.411 -1.275  2.670   1.00 58.02  ? 3   LYS B CB  1 
ATOM   6417  C CG  . LYS C 1 6   ? 57.347 0.214   2.972   1.00 57.60  ? 3   LYS B CG  1 
ATOM   6418  C CD  . LYS C 1 6   ? 56.260 0.534   3.993   1.00 63.35  ? 3   LYS B CD  1 
ATOM   6419  C CE  . LYS C 1 6   ? 56.805 0.575   5.419   1.00 64.52  ? 3   LYS B CE  1 
ATOM   6420  N NZ  . LYS C 1 6   ? 57.469 -0.695  5.830   1.00 67.70  ? 3   LYS B NZ  1 
ATOM   6421  N N   . LYS C 1 7   ? 55.176 -0.742  0.238   1.00 52.23  ? 4   LYS B N   1 
ATOM   6422  C CA  . LYS C 1 7   ? 54.955 -0.474  -1.173  1.00 43.10  ? 4   LYS B CA  1 
ATOM   6423  C C   . LYS C 1 7   ? 55.825 0.697   -1.623  1.00 41.21  ? 4   LYS B C   1 
ATOM   6424  O O   . LYS C 1 7   ? 56.528 1.329   -0.831  1.00 44.00  ? 4   LYS B O   1 
ATOM   6425  C CB  . LYS C 1 7   ? 53.474 -0.189  -1.440  1.00 42.21  ? 4   LYS B CB  1 
ATOM   6426  C CG  . LYS C 1 7   ? 52.525 -1.260  -0.927  1.00 40.20  ? 4   LYS B CG  1 
ATOM   6427  C CD  . LYS C 1 7   ? 51.075 -0.815  -1.056  1.00 42.82  ? 4   LYS B CD  1 
ATOM   6428  C CE  . LYS C 1 7   ? 50.117 -1.912  -0.617  1.00 39.45  ? 4   LYS B CE  1 
ATOM   6429  N NZ  . LYS C 1 7   ? 48.693 -1.480  -0.701  1.00 43.16  ? 4   LYS B NZ  1 
ATOM   6430  N N   . ILE C 1 8   ? 55.772 0.987   -2.922  1.00 36.27  ? 5   ILE B N   1 
ATOM   6431  C CA  . ILE C 1 8   ? 56.504 2.123   -3.465  1.00 34.29  ? 5   ILE B CA  1 
ATOM   6432  C C   . ILE C 1 8   ? 55.870 3.415   -2.970  1.00 37.59  ? 5   ILE B C   1 
ATOM   6433  O O   . ILE C 1 8   ? 54.644 3.584   -3.018  1.00 40.32  ? 5   ILE B O   1 
ATOM   6434  C CB  . ILE C 1 8   ? 56.525 2.065   -5.000  1.00 40.42  ? 5   ILE B CB  1 
ATOM   6435  C CG1 . ILE C 1 8   ? 57.301 0.837   -5.484  1.00 37.60  ? 5   ILE B CG1 1 
ATOM   6436  C CG2 . ILE C 1 8   ? 57.116 3.345   -5.577  1.00 34.20  ? 5   ILE B CG2 1 
ATOM   6437  C CD1 . ILE C 1 8   ? 57.005 0.461   -6.920  1.00 30.35  ? 5   ILE B CD1 1 
ATOM   6438  N N   . SER C 1 9   ? 56.702 4.331   -2.481  1.00 32.13  ? 6   SER B N   1 
ATOM   6439  C CA  . SER C 1 9   ? 56.243 5.657   -2.083  1.00 36.95  ? 6   SER B CA  1 
ATOM   6440  C C   . SER C 1 9   ? 56.159 6.526   -3.332  1.00 42.67  ? 6   SER B C   1 
ATOM   6441  O O   . SER C 1 9   ? 57.188 6.906   -3.900  1.00 39.24  ? 6   SER B O   1 
ATOM   6442  C CB  . SER C 1 9   ? 57.187 6.256   -1.043  1.00 33.75  ? 6   SER B CB  1 
ATOM   6443  O OG  . SER C 1 9   ? 56.847 7.601   -0.759  1.00 51.43  ? 6   SER B OG  1 
ATOM   6444  N N   . GLY C 1 10  ? 54.937 6.841   -3.761  1.00 38.69  ? 7   GLY B N   1 
ATOM   6445  C CA  . GLY C 1 10  ? 54.714 7.450   -5.060  1.00 31.37  ? 7   GLY B CA  1 
ATOM   6446  C C   . GLY C 1 10  ? 54.680 8.965   -5.102  1.00 35.50  ? 7   GLY B C   1 
ATOM   6447  O O   . GLY C 1 10  ? 54.965 9.562   -6.145  1.00 27.69  ? 7   GLY B O   1 
ATOM   6448  N N   . GLY C 1 11  ? 54.320 9.604   -3.994  1.00 29.61  ? 8   GLY B N   1 
ATOM   6449  C CA  . GLY C 1 11  ? 54.284 11.051  -3.977  1.00 28.86  ? 8   GLY B CA  1 
ATOM   6450  C C   . GLY C 1 11  ? 52.944 11.629  -4.409  1.00 35.17  ? 8   GLY B C   1 
ATOM   6451  O O   . GLY C 1 11  ? 51.891 10.983  -4.355  1.00 29.78  ? 8   GLY B O   1 
ATOM   6452  N N   . SER C 1 12  ? 53.008 12.876  -4.872  1.00 27.22  ? 9   SER B N   1 
ATOM   6453  C CA  . SER C 1 12  ? 51.831 13.709  -5.098  1.00 38.15  ? 9   SER B CA  1 
ATOM   6454  C C   . SER C 1 12  ? 51.299 13.521  -6.516  1.00 32.02  ? 9   SER B C   1 
ATOM   6455  O O   . SER C 1 12  ? 51.994 13.824  -7.493  1.00 31.06  ? 9   SER B O   1 
ATOM   6456  C CB  . SER C 1 12  ? 52.180 15.177  -4.847  1.00 33.58  ? 9   SER B CB  1 
ATOM   6457  O OG  . SER C 1 12  ? 51.018 15.970  -4.707  1.00 41.35  ? 9   SER B OG  1 
ATOM   6458  N N   . VAL C 1 13  ? 50.058 13.045  -6.626  1.00 34.97  ? 10  VAL B N   1 
ATOM   6459  C CA  . VAL C 1 13  ? 49.416 12.787  -7.911  1.00 33.33  ? 10  VAL B CA  1 
ATOM   6460  C C   . VAL C 1 13  ? 47.994 13.329  -7.869  1.00 29.26  ? 10  VAL B C   1 
ATOM   6461  O O   . VAL C 1 13  ? 47.247 13.049  -6.925  1.00 26.33  ? 10  VAL B O   1 
ATOM   6462  C CB  . VAL C 1 13  ? 49.403 11.285  -8.254  1.00 27.31  ? 10  VAL B CB  1 
ATOM   6463  C CG1 . VAL C 1 13  ? 48.537 11.025  -9.481  1.00 24.19  ? 10  VAL B CG1 1 
ATOM   6464  C CG2 . VAL C 1 13  ? 50.820 10.771  -8.477  1.00 26.63  ? 10  VAL B CG2 1 
ATOM   6465  N N   . VAL C 1 14  ? 47.623 14.100  -8.890  1.00 28.12  ? 11  VAL B N   1 
ATOM   6466  C CA  . VAL C 1 14  ? 46.251 14.564  -9.062  1.00 27.89  ? 11  VAL B CA  1 
ATOM   6467  C C   . VAL C 1 14  ? 45.506 13.568  -9.941  1.00 30.75  ? 11  VAL B C   1 
ATOM   6468  O O   . VAL C 1 14  ? 45.978 13.203  -11.026 1.00 30.71  ? 11  VAL B O   1 
ATOM   6469  C CB  . VAL C 1 14  ? 46.217 15.973  -9.677  1.00 32.45  ? 11  VAL B CB  1 
ATOM   6470  C CG1 . VAL C 1 14  ? 44.777 16.443  -9.860  1.00 30.77  ? 11  VAL B CG1 1 
ATOM   6471  C CG2 . VAL C 1 14  ? 47.000 16.954  -8.809  1.00 26.71  ? 11  VAL B CG2 1 
ATOM   6472  N N   . GLU C 1 15  ? 44.343 13.125  -9.471  1.00 23.43  ? 12  GLU B N   1 
ATOM   6473  C CA  . GLU C 1 15  ? 43.516 12.157  -10.176 1.00 30.96  ? 12  GLU B CA  1 
ATOM   6474  C C   . GLU C 1 15  ? 42.130 12.748  -10.387 1.00 30.97  ? 12  GLU B C   1 
ATOM   6475  O O   . GLU C 1 15  ? 41.552 13.326  -9.460  1.00 31.32  ? 12  GLU B O   1 
ATOM   6476  C CB  . GLU C 1 15  ? 43.413 10.845  -9.391  1.00 29.89  ? 12  GLU B CB  1 
ATOM   6477  C CG  . GLU C 1 15  ? 42.494 9.821   -10.029 1.00 38.28  ? 12  GLU B CG  1 
ATOM   6478  C CD  . GLU C 1 15  ? 41.587 9.138   -9.026  1.00 34.79  ? 12  GLU B CD  1 
ATOM   6479  O OE1 . GLU C 1 15  ? 41.450 9.647   -7.894  1.00 34.63  ? 12  GLU B OE1 1 
ATOM   6480  O OE2 . GLU C 1 15  ? 41.002 8.095   -9.377  1.00 42.34  ? 12  GLU B OE2 1 
ATOM   6481  N N   . MET C 1 16  ? 41.601 12.601  -11.601 1.00 34.04  ? 13  MET B N   1 
ATOM   6482  C CA  . MET C 1 16  ? 40.263 13.072  -11.946 1.00 30.96  ? 13  MET B CA  1 
ATOM   6483  C C   . MET C 1 16  ? 39.408 11.879  -12.352 1.00 31.02  ? 13  MET B C   1 
ATOM   6484  O O   . MET C 1 16  ? 39.654 11.256  -13.391 1.00 30.42  ? 13  MET B O   1 
ATOM   6485  C CB  . MET C 1 16  ? 40.311 14.114  -13.063 1.00 27.71  ? 13  MET B CB  1 
ATOM   6486  C CG  . MET C 1 16  ? 40.803 15.478  -12.611 1.00 27.51  ? 13  MET B CG  1 
ATOM   6487  S SD  . MET C 1 16  ? 41.849 16.266  -13.843 1.00 30.33  ? 13  MET B SD  1 
ATOM   6488  C CE  . MET C 1 16  ? 43.273 15.174  -13.815 1.00 26.94  ? 13  MET B CE  1 
ATOM   6489  N N   . GLN C 1 17  ? 38.408 11.569  -11.533 1.00 29.84  ? 14  GLN B N   1 
ATOM   6490  C CA  . GLN C 1 17  ? 37.460 10.511  -11.840 1.00 28.13  ? 14  GLN B CA  1 
ATOM   6491  C C   . GLN C 1 17  ? 36.466 10.992  -12.891 1.00 30.10  ? 14  GLN B C   1 
ATOM   6492  O O   . GLN C 1 17  ? 36.170 12.185  -12.994 1.00 23.34  ? 14  GLN B O   1 
ATOM   6493  C CB  . GLN C 1 17  ? 36.730 10.069  -10.572 1.00 28.37  ? 14  GLN B CB  1 
ATOM   6494  C CG  . GLN C 1 17  ? 37.665 9.553   -9.483  1.00 36.40  ? 14  GLN B CG  1 
ATOM   6495  C CD  . GLN C 1 17  ? 36.973 9.367   -8.144  1.00 44.52  ? 14  GLN B CD  1 
ATOM   6496  O OE1 . GLN C 1 17  ? 35.785 9.652   -8.000  1.00 49.67  ? 14  GLN B OE1 1 
ATOM   6497  N NE2 . GLN C 1 17  ? 37.721 8.893   -7.153  1.00 53.93  ? 14  GLN B NE2 1 
ATOM   6498  N N   . GLY C 1 18  ? 35.952 10.047  -13.676 1.00 25.72  ? 15  GLY B N   1 
ATOM   6499  C CA  . GLY C 1 18  ? 35.161 10.359  -14.852 1.00 26.35  ? 15  GLY B CA  1 
ATOM   6500  C C   . GLY C 1 18  ? 33.820 9.646   -14.844 1.00 34.30  ? 15  GLY B C   1 
ATOM   6501  O O   . GLY C 1 18  ? 33.221 9.396   -13.795 1.00 27.59  ? 15  GLY B O   1 
ATOM   6502  N N   . ASP C 1 19  ? 33.357 9.304   -16.046 1.00 25.88  ? 16  ASP B N   1 
ATOM   6503  C CA  . ASP C 1 19  ? 31.989 8.868   -16.276 1.00 29.54  ? 16  ASP B CA  1 
ATOM   6504  C C   . ASP C 1 19  ? 31.933 7.524   -16.994 1.00 35.18  ? 16  ASP B C   1 
ATOM   6505  O O   . ASP C 1 19  ? 32.880 7.103   -17.668 1.00 29.09  ? 16  ASP B O   1 
ATOM   6506  C CB  . ASP C 1 19  ? 31.213 9.900   -17.108 1.00 29.26  ? 16  ASP B CB  1 
ATOM   6507  C CG  . ASP C 1 19  ? 31.023 11.219  -16.382 1.00 29.07  ? 16  ASP B CG  1 
ATOM   6508  O OD1 . ASP C 1 19  ? 30.424 11.216  -15.287 1.00 25.10  ? 16  ASP B OD1 1 
ATOM   6509  O OD2 . ASP C 1 19  ? 31.463 12.260  -16.914 1.00 28.88  ? 16  ASP B OD2 1 
ATOM   6510  N N   . GLU C 1 20  ? 30.784 6.865   -16.829 1.00 26.94  ? 17  GLU B N   1 
ATOM   6511  C CA  . GLU C 1 20  ? 30.359 5.711   -17.615 1.00 35.34  ? 17  GLU B CA  1 
ATOM   6512  C C   . GLU C 1 20  ? 31.408 4.604   -17.662 1.00 27.71  ? 17  GLU B C   1 
ATOM   6513  O O   . GLU C 1 20  ? 31.975 4.245   -16.624 1.00 32.64  ? 17  GLU B O   1 
ATOM   6514  C CB  . GLU C 1 20  ? 29.944 6.176   -19.014 1.00 31.67  ? 17  GLU B CB  1 
ATOM   6515  C CG  . GLU C 1 20  ? 28.881 7.278   -18.934 1.00 31.06  ? 17  GLU B CG  1 
ATOM   6516  C CD  . GLU C 1 20  ? 28.335 7.720   -20.279 1.00 34.84  ? 17  GLU B CD  1 
ATOM   6517  O OE1 . GLU C 1 20  ? 29.126 7.882   -21.232 1.00 36.76  ? 17  GLU B OE1 1 
ATOM   6518  O OE2 . GLU C 1 20  ? 27.103 7.910   -20.377 1.00 32.34  ? 17  GLU B OE2 1 
ATOM   6519  N N   . MET C 1 21  ? 31.664 4.040   -18.845 1.00 26.14  ? 18  MET B N   1 
ATOM   6520  C CA  . MET C 1 21  ? 32.479 2.829   -18.915 1.00 33.90  ? 18  MET B CA  1 
ATOM   6521  C C   . MET C 1 21  ? 33.901 3.077   -18.420 1.00 30.18  ? 18  MET B C   1 
ATOM   6522  O O   . MET C 1 21  ? 34.464 2.252   -17.692 1.00 30.50  ? 18  MET B O   1 
ATOM   6523  C CB  . MET C 1 21  ? 32.490 2.267   -20.337 1.00 32.80  ? 18  MET B CB  1 
ATOM   6524  C CG  . MET C 1 21  ? 32.793 0.774   -20.387 1.00 36.93  ? 18  MET B CG  1 
ATOM   6525  S SD  . MET C 1 21  ? 31.489 -0.245  -19.661 1.00 42.47  ? 18  MET B SD  1 
ATOM   6526  C CE  . MET C 1 21  ? 32.448 -1.606  -18.995 1.00 38.03  ? 18  MET B CE  1 
ATOM   6527  N N   . THR C 1 22  ? 34.497 4.211   -18.799 1.00 25.86  ? 19  THR B N   1 
ATOM   6528  C CA  . THR C 1 22  ? 35.855 4.502   -18.343 1.00 31.88  ? 19  THR B CA  1 
ATOM   6529  C C   . THR C 1 22  ? 35.920 4.629   -16.825 1.00 33.06  ? 19  THR B C   1 
ATOM   6530  O O   . THR C 1 22  ? 36.928 4.260   -16.209 1.00 30.91  ? 19  THR B O   1 
ATOM   6531  C CB  . THR C 1 22  ? 36.389 5.772   -19.013 1.00 29.18  ? 19  THR B CB  1 
ATOM   6532  O OG1 . THR C 1 22  ? 35.348 6.759   -19.085 1.00 27.69  ? 19  THR B OG1 1 
ATOM   6533  C CG2 . THR C 1 22  ? 36.900 5.462   -20.410 1.00 28.21  ? 19  THR B CG2 1 
ATOM   6534  N N   . ARG C 1 23  ? 34.854 5.142   -16.205 1.00 31.22  ? 20  ARG B N   1 
ATOM   6535  C CA  . ARG C 1 23  ? 34.813 5.228   -14.748 1.00 34.73  ? 20  ARG B CA  1 
ATOM   6536  C C   . ARG C 1 23  ? 34.971 3.854   -14.111 1.00 33.01  ? 20  ARG B C   1 
ATOM   6537  O O   . ARG C 1 23  ? 35.765 3.674   -13.180 1.00 30.16  ? 20  ARG B O   1 
ATOM   6538  C CB  . ARG C 1 23  ? 33.506 5.881   -14.295 1.00 31.34  ? 20  ARG B CB  1 
ATOM   6539  C CG  . ARG C 1 23  ? 33.379 6.019   -12.784 1.00 30.67  ? 20  ARG B CG  1 
ATOM   6540  C CD  . ARG C 1 23  ? 31.965 6.403   -12.373 1.00 35.62  ? 20  ARG B CD  1 
ATOM   6541  N NE  . ARG C 1 23  ? 30.946 5.707   -13.159 1.00 50.21  ? 20  ARG B NE  1 
ATOM   6542  C CZ  . ARG C 1 23  ? 30.506 4.478   -12.900 1.00 52.94  ? 20  ARG B CZ  1 
ATOM   6543  N NH1 . ARG C 1 23  ? 29.576 3.927   -13.670 1.00 47.99  ? 20  ARG B NH1 1 
ATOM   6544  N NH2 . ARG C 1 23  ? 30.994 3.798   -11.870 1.00 47.33  ? 20  ARG B NH2 1 
ATOM   6545  N N   . ILE C 1 24  ? 34.213 2.871   -14.601 1.00 31.04  ? 21  ILE B N   1 
ATOM   6546  C CA  . ILE C 1 24  ? 34.326 1.505   -14.095 1.00 34.83  ? 21  ILE B CA  1 
ATOM   6547  C C   . ILE C 1 24  ? 35.751 0.995   -14.271 1.00 32.61  ? 21  ILE B C   1 
ATOM   6548  O O   . ILE C 1 24  ? 36.344 0.410   -13.356 1.00 28.76  ? 21  ILE B O   1 
ATOM   6549  C CB  . ILE C 1 24  ? 33.313 0.590   -14.806 1.00 39.49  ? 21  ILE B CB  1 
ATOM   6550  C CG1 . ILE C 1 24  ? 31.888 0.912   -14.362 1.00 39.16  ? 21  ILE B CG1 1 
ATOM   6551  C CG2 . ILE C 1 24  ? 33.648 -0.877  -14.557 1.00 34.72  ? 21  ILE B CG2 1 
ATOM   6552  C CD1 . ILE C 1 24  ? 30.838 0.334   -15.274 1.00 40.58  ? 21  ILE B CD1 1 
ATOM   6553  N N   . ILE C 1 25  ? 36.322 1.220   -15.454 1.00 31.41  ? 22  ILE B N   1 
ATOM   6554  C CA  . ILE C 1 25  ? 37.676 0.757   -15.738 1.00 33.20  ? 22  ILE B CA  1 
ATOM   6555  C C   . ILE C 1 25  ? 38.687 1.490   -14.865 1.00 33.08  ? 22  ILE B C   1 
ATOM   6556  O O   . ILE C 1 25  ? 39.641 0.888   -14.355 1.00 33.27  ? 22  ILE B O   1 
ATOM   6557  C CB  . ILE C 1 25  ? 37.977 0.929   -17.239 1.00 33.57  ? 22  ILE B CB  1 
ATOM   6558  C CG1 . ILE C 1 25  ? 37.215 -0.122  -18.048 1.00 36.01  ? 22  ILE B CG1 1 
ATOM   6559  C CG2 . ILE C 1 25  ? 39.474 0.873   -17.507 1.00 34.20  ? 22  ILE B CG2 1 
ATOM   6560  C CD1 . ILE C 1 25  ? 37.214 0.141   -19.529 1.00 38.21  ? 22  ILE B CD1 1 
ATOM   6561  N N   . TRP C 1 26  ? 38.487 2.798   -14.677 1.00 30.64  ? 23  TRP B N   1 
ATOM   6562  C CA  . TRP C 1 26  ? 39.373 3.602   -13.838 1.00 32.67  ? 23  TRP B CA  1 
ATOM   6563  C C   . TRP C 1 26  ? 39.537 2.983   -12.454 1.00 33.13  ? 23  TRP B C   1 
ATOM   6564  O O   . TRP C 1 26  ? 40.656 2.848   -11.946 1.00 33.61  ? 23  TRP B O   1 
ATOM   6565  C CB  . TRP C 1 26  ? 38.812 5.020   -13.730 1.00 30.03  ? 23  TRP B CB  1 
ATOM   6566  C CG  . TRP C 1 26  ? 39.797 6.086   -13.370 1.00 32.71  ? 23  TRP B CG  1 
ATOM   6567  C CD1 . TRP C 1 26  ? 39.873 6.761   -12.186 1.00 29.34  ? 23  TRP B CD1 1 
ATOM   6568  C CD2 . TRP C 1 26  ? 40.815 6.643   -14.214 1.00 33.84  ? 23  TRP B CD2 1 
ATOM   6569  N NE1 . TRP C 1 26  ? 40.888 7.686   -12.231 1.00 33.29  ? 23  TRP B NE1 1 
ATOM   6570  C CE2 . TRP C 1 26  ? 41.481 7.636   -13.466 1.00 31.61  ? 23  TRP B CE2 1 
ATOM   6571  C CE3 . TRP C 1 26  ? 41.234 6.392   -15.526 1.00 29.38  ? 23  TRP B CE3 1 
ATOM   6572  C CZ2 . TRP C 1 26  ? 42.542 8.377   -13.985 1.00 28.55  ? 23  TRP B CZ2 1 
ATOM   6573  C CZ3 . TRP C 1 26  ? 42.291 7.131   -16.040 1.00 27.24  ? 23  TRP B CZ3 1 
ATOM   6574  C CH2 . TRP C 1 26  ? 42.931 8.110   -15.269 1.00 28.79  ? 23  TRP B CH2 1 
ATOM   6575  N N   . GLU C 1 27  ? 38.424 2.588   -11.834 1.00 31.40  ? 24  GLU B N   1 
ATOM   6576  C CA  . GLU C 1 27  ? 38.492 2.036   -10.485 1.00 36.17  ? 24  GLU B CA  1 
ATOM   6577  C C   . GLU C 1 27  ? 39.154 0.665   -10.474 1.00 30.09  ? 24  GLU B C   1 
ATOM   6578  O O   . GLU C 1 27  ? 39.860 0.320   -9.519  1.00 32.92  ? 24  GLU B O   1 
ATOM   6579  C CB  . GLU C 1 27  ? 37.095 1.967   -9.876  1.00 32.42  ? 24  GLU B CB  1 
ATOM   6580  C CG  . GLU C 1 27  ? 36.540 3.329   -9.514  1.00 41.96  ? 24  GLU B CG  1 
ATOM   6581  C CD  . GLU C 1 27  ? 37.482 4.110   -8.619  1.00 50.76  ? 24  GLU B CD  1 
ATOM   6582  O OE1 . GLU C 1 27  ? 37.791 5.278   -8.942  1.00 40.95  ? 24  GLU B OE1 1 
ATOM   6583  O OE2 . GLU C 1 27  ? 37.911 3.549   -7.588  1.00 55.22  ? 24  GLU B OE2 1 
ATOM   6584  N N   . LEU C 1 28  ? 38.931 -0.137  -11.518 1.00 31.51  ? 25  LEU B N   1 
ATOM   6585  C CA  . LEU C 1 28  ? 39.619 -1.421  -11.614 1.00 35.16  ? 25  LEU B CA  1 
ATOM   6586  C C   . LEU C 1 28  ? 41.124 -1.228  -11.752 1.00 37.56  ? 25  LEU B C   1 
ATOM   6587  O O   . LEU C 1 28  ? 41.910 -1.960  -11.139 1.00 40.64  ? 25  LEU B O   1 
ATOM   6588  C CB  . LEU C 1 28  ? 39.069 -2.232  -12.788 1.00 34.61  ? 25  LEU B CB  1 
ATOM   6589  C CG  . LEU C 1 28  ? 37.625 -2.715  -12.667 1.00 37.92  ? 25  LEU B CG  1 
ATOM   6590  C CD1 . LEU C 1 28  ? 37.134 -3.238  -14.004 1.00 40.71  ? 25  LEU B CD1 1 
ATOM   6591  C CD2 . LEU C 1 28  ? 37.505 -3.786  -11.591 1.00 32.97  ? 25  LEU B CD2 1 
ATOM   6592  N N   . ILE C 1 29  ? 41.541 -0.246  -12.553 1.00 33.61  ? 26  ILE B N   1 
ATOM   6593  C CA  . ILE C 1 29  ? 42.964 0.058   -12.688 1.00 36.03  ? 26  ILE B CA  1 
ATOM   6594  C C   . ILE C 1 29  ? 43.567 0.374   -11.325 1.00 37.82  ? 26  ILE B C   1 
ATOM   6595  O O   . ILE C 1 29  ? 44.642 -0.123  -10.969 1.00 34.06  ? 26  ILE B O   1 
ATOM   6596  C CB  . ILE C 1 29  ? 43.174 1.221   -13.675 1.00 28.94  ? 26  ILE B CB  1 
ATOM   6597  C CG1 . ILE C 1 29  ? 42.815 0.796   -15.096 1.00 33.92  ? 26  ILE B CG1 1 
ATOM   6598  C CG2 . ILE C 1 29  ? 44.610 1.718   -13.615 1.00 28.50  ? 26  ILE B CG2 1 
ATOM   6599  C CD1 . ILE C 1 29  ? 42.949 1.912   -16.101 1.00 31.19  ? 26  ILE B CD1 1 
ATOM   6600  N N   . LYS C 1 30  ? 42.875 1.201   -10.538 1.00 36.13  ? 27  LYS B N   1 
ATOM   6601  C CA  . LYS C 1 30  ? 43.403 1.603   -9.239  1.00 35.43  ? 27  LYS B CA  1 
ATOM   6602  C C   . LYS C 1 30  ? 43.482 0.418   -8.284  1.00 36.17  ? 27  LYS B C   1 
ATOM   6603  O O   . LYS C 1 30  ? 44.506 0.207   -7.624  1.00 36.10  ? 27  LYS B O   1 
ATOM   6604  C CB  . LYS C 1 30  ? 42.542 2.721   -8.648  1.00 30.57  ? 27  LYS B CB  1 
ATOM   6605  C CG  . LYS C 1 30  ? 42.493 3.971   -9.511  1.00 38.05  ? 27  LYS B CG  1 
ATOM   6606  C CD  . LYS C 1 30  ? 42.160 5.218   -8.705  1.00 38.79  ? 27  LYS B CD  1 
ATOM   6607  C CE  . LYS C 1 30  ? 40.842 5.085   -7.964  1.00 45.06  ? 27  LYS B CE  1 
ATOM   6608  N NZ  . LYS C 1 30  ? 40.170 6.407   -7.799  1.00 34.08  ? 27  LYS B NZ  1 
ATOM   6609  N N   . GLU C 1 31  ? 42.412 -0.377  -8.206  1.00 37.51  ? 28  GLU B N   1 
ATOM   6610  C CA  . GLU C 1 31  ? 42.366 -1.454  -7.219  1.00 42.52  ? 28  GLU B CA  1 
ATOM   6611  C C   . GLU C 1 31  ? 43.300 -2.603  -7.571  1.00 41.16  ? 28  GLU B C   1 
ATOM   6612  O O   . GLU C 1 31  ? 43.830 -3.264  -6.670  1.00 38.61  ? 28  GLU B O   1 
ATOM   6613  C CB  . GLU C 1 31  ? 40.939 -1.978  -7.071  1.00 36.95  ? 28  GLU B CB  1 
ATOM   6614  C CG  . GLU C 1 31  ? 39.960 -0.975  -6.482  1.00 54.43  ? 28  GLU B CG  1 
ATOM   6615  C CD  . GLU C 1 31  ? 40.458 -0.366  -5.182  1.00 58.49  ? 28  GLU B CD  1 
ATOM   6616  O OE1 . GLU C 1 31  ? 40.976 -1.118  -4.328  1.00 62.79  ? 28  GLU B OE1 1 
ATOM   6617  O OE2 . GLU C 1 31  ? 40.324 0.865   -5.012  1.00 51.31  ? 28  GLU B OE2 1 
ATOM   6618  N N   . LYS C 1 32  ? 43.514 -2.862  -8.858  1.00 35.52  ? 29  LYS B N   1 
ATOM   6619  C CA  . LYS C 1 32  ? 44.245 -4.050  -9.278  1.00 39.58  ? 29  LYS B CA  1 
ATOM   6620  C C   . LYS C 1 32  ? 45.673 -3.774  -9.723  1.00 40.47  ? 29  LYS B C   1 
ATOM   6621  O O   . LYS C 1 32  ? 46.536 -4.641  -9.553  1.00 44.61  ? 29  LYS B O   1 
ATOM   6622  C CB  . LYS C 1 32  ? 43.497 -4.753  -10.415 1.00 35.85  ? 29  LYS B CB  1 
ATOM   6623  C CG  . LYS C 1 32  ? 42.126 -5.263  -10.013 1.00 44.80  ? 29  LYS B CG  1 
ATOM   6624  C CD  . LYS C 1 32  ? 41.283 -5.582  -11.230 1.00 46.44  ? 29  LYS B CD  1 
ATOM   6625  C CE  . LYS C 1 32  ? 40.187 -6.566  -10.879 1.00 51.34  ? 29  LYS B CE  1 
ATOM   6626  N NZ  . LYS C 1 32  ? 40.750 -7.787  -10.240 1.00 59.70  ? 29  LYS B NZ  1 
ATOM   6627  N N   . LEU C 1 33  ? 45.951 -2.597  -10.278 1.00 37.17  ? 30  LEU B N   1 
ATOM   6628  C CA  . LEU C 1 33  ? 47.252 -2.328  -10.873 1.00 31.39  ? 30  LEU B CA  1 
ATOM   6629  C C   . LEU C 1 33  ? 48.081 -1.296  -10.124 1.00 34.37  ? 30  LEU B C   1 
ATOM   6630  O O   . LEU C 1 33  ? 49.309 -1.399  -10.125 1.00 35.02  ? 30  LEU B O   1 
ATOM   6631  C CB  . LEU C 1 33  ? 47.081 -1.868  -12.328 1.00 29.83  ? 30  LEU B CB  1 
ATOM   6632  C CG  . LEU C 1 33  ? 46.305 -2.839  -13.221 1.00 34.79  ? 30  LEU B CG  1 
ATOM   6633  C CD1 . LEU C 1 33  ? 46.297 -2.363  -14.663 1.00 31.74  ? 30  LEU B CD1 1 
ATOM   6634  C CD2 . LEU C 1 33  ? 46.880 -4.247  -13.130 1.00 34.47  ? 30  LEU B CD2 1 
ATOM   6635  N N   . ILE C 1 34  ? 47.452 -0.314  -9.481  1.00 33.52  ? 31  ILE B N   1 
ATOM   6636  C CA  . ILE C 1 34  ? 48.191 0.782   -8.862  1.00 29.16  ? 31  ILE B CA  1 
ATOM   6637  C C   . ILE C 1 34  ? 48.299 0.585   -7.355  1.00 34.18  ? 31  ILE B C   1 
ATOM   6638  O O   . ILE C 1 34  ? 49.403 0.456   -6.816  1.00 33.06  ? 31  ILE B O   1 
ATOM   6639  C CB  . ILE C 1 34  ? 47.546 2.143   -9.187  1.00 36.46  ? 31  ILE B CB  1 
ATOM   6640  C CG1 . ILE C 1 34  ? 47.311 2.278   -10.690 1.00 30.86  ? 31  ILE B CG1 1 
ATOM   6641  C CG2 . ILE C 1 34  ? 48.417 3.285   -8.663  1.00 32.09  ? 31  ILE B CG2 1 
ATOM   6642  C CD1 . ILE C 1 34  ? 48.577 2.184   -11.516 1.00 32.71  ? 31  ILE B CD1 1 
ATOM   6643  N N   . PHE C 1 35  ? 47.158 0.565   -6.669  1.00 32.25  ? 32  PHE B N   1 
ATOM   6644  C CA  . PHE C 1 35  ? 47.154 0.567   -5.207  1.00 35.58  ? 32  PHE B CA  1 
ATOM   6645  C C   . PHE C 1 35  ? 47.902 -0.591  -4.556  1.00 36.07  ? 32  PHE B C   1 
ATOM   6646  O O   . PHE C 1 35  ? 48.537 -0.359  -3.513  1.00 39.13  ? 32  PHE B O   1 
ATOM   6647  C CB  . PHE C 1 35  ? 45.707 0.609   -4.694  1.00 35.75  ? 32  PHE B CB  1 
ATOM   6648  C CG  . PHE C 1 35  ? 45.046 1.949   -4.847  1.00 32.25  ? 32  PHE B CG  1 
ATOM   6649  C CD1 . PHE C 1 35  ? 45.785 3.073   -5.187  1.00 29.47  ? 32  PHE B CD1 1 
ATOM   6650  C CD2 . PHE C 1 35  ? 43.684 2.086   -4.636  1.00 37.03  ? 32  PHE B CD2 1 
ATOM   6651  C CE1 . PHE C 1 35  ? 45.174 4.311   -5.322  1.00 32.67  ? 32  PHE B CE1 1 
ATOM   6652  C CE2 . PHE C 1 35  ? 43.066 3.316   -4.767  1.00 35.63  ? 32  PHE B CE2 1 
ATOM   6653  C CZ  . PHE C 1 35  ? 43.812 4.432   -5.111  1.00 35.65  ? 32  PHE B CZ  1 
ATOM   6654  N N   . PRO C 1 36  ? 47.873 -1.828  -5.068  1.00 35.65  ? 33  PRO B N   1 
ATOM   6655  C CA  . PRO C 1 36  ? 48.631 -2.901  -4.402  1.00 40.86  ? 33  PRO B CA  1 
ATOM   6656  C C   . PRO C 1 36  ? 50.139 -2.698  -4.390  1.00 40.02  ? 33  PRO B C   1 
ATOM   6657  O O   . PRO C 1 36  ? 50.824 -3.386  -3.621  1.00 37.69  ? 33  PRO B O   1 
ATOM   6658  C CB  . PRO C 1 36  ? 48.258 -4.152  -5.210  1.00 34.59  ? 33  PRO B CB  1 
ATOM   6659  C CG  . PRO C 1 36  ? 46.925 -3.832  -5.775  1.00 31.82  ? 33  PRO B CG  1 
ATOM   6660  C CD  . PRO C 1 36  ? 47.004 -2.378  -6.125  1.00 36.39  ? 33  PRO B CD  1 
ATOM   6661  N N   . TYR C 1 37  ? 50.682 -1.784  -5.197  1.00 32.45  ? 34  TYR B N   1 
ATOM   6662  C CA  . TYR C 1 37  ? 52.125 -1.619  -5.292  1.00 32.33  ? 34  TYR B CA  1 
ATOM   6663  C C   . TYR C 1 37  ? 52.621 -0.209  -5.013  1.00 37.82  ? 34  TYR B C   1 
ATOM   6664  O O   . TYR C 1 37  ? 53.819 -0.041  -4.757  1.00 38.36  ? 34  TYR B O   1 
ATOM   6665  C CB  . TYR C 1 37  ? 52.622 -2.054  -6.681  1.00 33.07  ? 34  TYR B CB  1 
ATOM   6666  C CG  . TYR C 1 37  ? 52.077 -3.398  -7.103  1.00 35.69  ? 34  TYR B CG  1 
ATOM   6667  C CD1 . TYR C 1 37  ? 52.662 -4.574  -6.653  1.00 34.81  ? 34  TYR B CD1 1 
ATOM   6668  C CD2 . TYR C 1 37  ? 50.971 -3.493  -7.939  1.00 35.73  ? 34  TYR B CD2 1 
ATOM   6669  C CE1 . TYR C 1 37  ? 52.167 -5.810  -7.027  1.00 34.22  ? 34  TYR B CE1 1 
ATOM   6670  C CE2 . TYR C 1 37  ? 50.469 -4.727  -8.320  1.00 40.56  ? 34  TYR B CE2 1 
ATOM   6671  C CZ  . TYR C 1 37  ? 51.071 -5.880  -7.860  1.00 34.97  ? 34  TYR B CZ  1 
ATOM   6672  O OH  . TYR C 1 37  ? 50.573 -7.108  -8.236  1.00 37.58  ? 34  TYR B OH  1 
ATOM   6673  N N   . VAL C 1 38  ? 51.753 0.800   -5.049  1.00 33.81  ? 35  VAL B N   1 
ATOM   6674  C CA  . VAL C 1 38  ? 52.161 2.190   -4.888  1.00 39.06  ? 35  VAL B CA  1 
ATOM   6675  C C   . VAL C 1 38  ? 51.250 2.871   -3.877  1.00 35.69  ? 35  VAL B C   1 
ATOM   6676  O O   . VAL C 1 38  ? 50.027 2.698   -3.911  1.00 33.15  ? 35  VAL B O   1 
ATOM   6677  C CB  . VAL C 1 38  ? 52.134 2.951   -6.233  1.00 28.98  ? 35  VAL B CB  1 
ATOM   6678  C CG1 . VAL C 1 38  ? 52.681 4.364   -6.068  1.00 32.84  ? 35  VAL B CG1 1 
ATOM   6679  C CG2 . VAL C 1 38  ? 52.925 2.200   -7.297  1.00 33.49  ? 35  VAL B CG2 1 
ATOM   6680  N N   . GLU C 1 39  ? 51.854 3.634   -2.970  1.00 30.99  ? 36  GLU B N   1 
ATOM   6681  C CA  . GLU C 1 39  ? 51.130 4.528   -2.078  1.00 32.45  ? 36  GLU B CA  1 
ATOM   6682  C C   . GLU C 1 39  ? 51.276 5.950   -2.600  1.00 32.04  ? 36  GLU B C   1 
ATOM   6683  O O   . GLU C 1 39  ? 52.395 6.409   -2.855  1.00 33.54  ? 36  GLU B O   1 
ATOM   6684  C CB  . GLU C 1 39  ? 51.662 4.438   -0.645  1.00 37.59  ? 36  GLU B CB  1 
ATOM   6685  C CG  . GLU C 1 39  ? 51.496 3.084   0.036   1.00 32.01  ? 36  GLU B CG  1 
ATOM   6686  C CD  . GLU C 1 39  ? 50.081 2.807   0.519   1.00 38.49  ? 36  GLU B CD  1 
ATOM   6687  O OE1 . GLU C 1 39  ? 49.932 1.972   1.436   1.00 47.94  ? 36  GLU B OE1 1 
ATOM   6688  O OE2 . GLU C 1 39  ? 49.121 3.403   -0.013  1.00 41.36  ? 36  GLU B OE2 1 
ATOM   6689  N N   . LEU C 1 40  ? 50.153 6.643   -2.758  1.00 33.19  ? 37  LEU B N   1 
ATOM   6690  C CA  . LEU C 1 40  ? 50.138 7.977   -3.337  1.00 31.14  ? 37  LEU B CA  1 
ATOM   6691  C C   . LEU C 1 40  ? 49.534 8.980   -2.367  1.00 29.99  ? 37  LEU B C   1 
ATOM   6692  O O   . LEU C 1 40  ? 48.551 8.684   -1.678  1.00 29.82  ? 37  LEU B O   1 
ATOM   6693  C CB  . LEU C 1 40  ? 49.347 8.010   -4.649  1.00 27.68  ? 37  LEU B CB  1 
ATOM   6694  C CG  . LEU C 1 40  ? 49.868 7.155   -5.803  1.00 27.80  ? 37  LEU B CG  1 
ATOM   6695  C CD1 . LEU C 1 40  ? 48.826 7.060   -6.910  1.00 25.21  ? 37  LEU B CD1 1 
ATOM   6696  C CD2 . LEU C 1 40  ? 51.173 7.725   -6.331  1.00 26.86  ? 37  LEU B CD2 1 
ATOM   6697  N N   . ASP C 1 41  ? 50.135 10.166  -2.317  1.00 26.48  ? 38  ASP B N   1 
ATOM   6698  C CA  . ASP C 1 41  ? 49.482 11.344  -1.754  1.00 32.98  ? 38  ASP B CA  1 
ATOM   6699  C C   . ASP C 1 41  ? 48.491 11.807  -2.814  1.00 30.16  ? 38  ASP B C   1 
ATOM   6700  O O   . ASP C 1 41  ? 48.787 12.661  -3.651  1.00 32.27  ? 38  ASP B O   1 
ATOM   6701  C CB  . ASP C 1 41  ? 50.500 12.421  -1.398  1.00 30.83  ? 38  ASP B CB  1 
ATOM   6702  C CG  . ASP C 1 41  ? 51.538 11.935  -0.402  1.00 40.42  ? 38  ASP B CG  1 
ATOM   6703  O OD1 . ASP C 1 41  ? 51.206 11.064  0.429   1.00 36.37  ? 38  ASP B OD1 1 
ATOM   6704  O OD2 . ASP C 1 41  ? 52.686 12.428  -0.444  1.00 41.24  ? 38  ASP B OD2 1 
ATOM   6705  N N   . LEU C 1 42  ? 47.303 11.213  -2.784  1.00 29.78  ? 39  LEU B N   1 
ATOM   6706  C CA  . LEU C 1 42  ? 46.358 11.287  -3.891  1.00 35.39  ? 39  LEU B CA  1 
ATOM   6707  C C   . LEU C 1 42  ? 45.471 12.521  -3.762  1.00 37.35  ? 39  LEU B C   1 
ATOM   6708  O O   . LEU C 1 42  ? 44.706 12.647  -2.798  1.00 32.25  ? 39  LEU B O   1 
ATOM   6709  C CB  . LEU C 1 42  ? 45.513 10.016  -3.939  1.00 30.49  ? 39  LEU B CB  1 
ATOM   6710  C CG  . LEU C 1 42  ? 44.774 9.709   -5.241  1.00 30.61  ? 39  LEU B CG  1 
ATOM   6711  C CD1 . LEU C 1 42  ? 45.726 9.732   -6.425  1.00 28.96  ? 39  LEU B CD1 1 
ATOM   6712  C CD2 . LEU C 1 42  ? 44.068 8.369   -5.140  1.00 23.83  ? 39  LEU B CD2 1 
ATOM   6713  N N   . HIS C 1 43  ? 45.578 13.427  -4.736  1.00 30.80  ? 40  HIS B N   1 
ATOM   6714  C CA  . HIS C 1 43  ? 44.690 14.585  -4.851  1.00 31.50  ? 40  HIS B CA  1 
ATOM   6715  C C   . HIS C 1 43  ? 43.572 14.201  -5.814  1.00 35.38  ? 40  HIS B C   1 
ATOM   6716  O O   . HIS C 1 43  ? 43.670 14.394  -7.027  1.00 34.45  ? 40  HIS B O   1 
ATOM   6717  C CB  . HIS C 1 43  ? 45.453 15.813  -5.333  1.00 34.25  ? 40  HIS B CB  1 
ATOM   6718  C CG  . HIS C 1 43  ? 46.738 16.057  -4.601  1.00 36.44  ? 40  HIS B CG  1 
ATOM   6719  N ND1 . HIS C 1 43  ? 46.798 16.741  -3.405  1.00 31.93  ? 40  HIS B ND1 1 
ATOM   6720  C CD2 . HIS C 1 43  ? 48.014 15.718  -4.903  1.00 35.35  ? 40  HIS B CD2 1 
ATOM   6721  C CE1 . HIS C 1 43  ? 48.053 16.808  -2.999  1.00 27.25  ? 40  HIS B CE1 1 
ATOM   6722  N NE2 . HIS C 1 43  ? 48.812 16.196  -3.891  1.00 30.43  ? 40  HIS B NE2 1 
ATOM   6723  N N   . SER C 1 44  ? 42.490 13.660  -5.260  1.00 31.71  ? 41  SER B N   1 
ATOM   6724  C CA  . SER C 1 44  ? 41.437 13.015  -6.036  1.00 35.57  ? 41  SER B CA  1 
ATOM   6725  C C   . SER C 1 44  ? 40.252 13.961  -6.207  1.00 33.07  ? 41  SER B C   1 
ATOM   6726  O O   . SER C 1 44  ? 39.700 14.460  -5.219  1.00 35.56  ? 41  SER B O   1 
ATOM   6727  C CB  . SER C 1 44  ? 41.001 11.717  -5.356  1.00 26.18  ? 41  SER B CB  1 
ATOM   6728  O OG  . SER C 1 44  ? 40.007 11.047  -6.107  1.00 43.94  ? 41  SER B OG  1 
ATOM   6729  N N   . TYR C 1 45  ? 39.863 14.198  -7.458  1.00 32.13  ? 42  TYR B N   1 
ATOM   6730  C CA  . TYR C 1 45  ? 38.736 15.057  -7.798  1.00 35.22  ? 42  TYR B CA  1 
ATOM   6731  C C   . TYR C 1 45  ? 37.736 14.271  -8.633  1.00 35.44  ? 42  TYR B C   1 
ATOM   6732  O O   . TYR C 1 45  ? 38.115 13.619  -9.612  1.00 35.12  ? 42  TYR B O   1 
ATOM   6733  C CB  . TYR C 1 45  ? 39.201 16.306  -8.553  1.00 25.88  ? 42  TYR B CB  1 
ATOM   6734  C CG  . TYR C 1 45  ? 40.100 17.191  -7.726  1.00 32.74  ? 42  TYR B CG  1 
ATOM   6735  C CD1 . TYR C 1 45  ? 41.459 16.928  -7.622  1.00 26.20  ? 42  TYR B CD1 1 
ATOM   6736  C CD2 . TYR C 1 45  ? 39.586 18.275  -7.026  1.00 26.67  ? 42  TYR B CD2 1 
ATOM   6737  C CE1 . TYR C 1 45  ? 42.283 17.722  -6.858  1.00 29.84  ? 42  TYR B CE1 1 
ATOM   6738  C CE2 . TYR C 1 45  ? 40.405 19.080  -6.257  1.00 33.41  ? 42  TYR B CE2 1 
ATOM   6739  C CZ  . TYR C 1 45  ? 41.753 18.797  -6.177  1.00 33.34  ? 42  TYR B CZ  1 
ATOM   6740  O OH  . TYR C 1 45  ? 42.575 19.592  -5.415  1.00 34.92  ? 42  TYR B OH  1 
ATOM   6741  N N   . ASP C 1 46  ? 36.465 14.336  -8.245  1.00 34.40  ? 43  ASP B N   1 
ATOM   6742  C CA  . ASP C 1 46  ? 35.404 13.574  -8.900  1.00 35.76  ? 43  ASP B CA  1 
ATOM   6743  C C   . ASP C 1 46  ? 34.762 14.447  -9.969  1.00 29.94  ? 43  ASP B C   1 
ATOM   6744  O O   . ASP C 1 46  ? 33.912 15.291  -9.672  1.00 31.18  ? 43  ASP B O   1 
ATOM   6745  C CB  . ASP C 1 46  ? 34.372 13.103  -7.880  1.00 32.04  ? 43  ASP B CB  1 
ATOM   6746  C CG  . ASP C 1 46  ? 33.266 12.266  -8.506  1.00 30.14  ? 43  ASP B CG  1 
ATOM   6747  O OD1 . ASP C 1 46  ? 33.380 11.906  -9.695  1.00 35.69  ? 43  ASP B OD1 1 
ATOM   6748  O OD2 . ASP C 1 46  ? 32.277 11.969  -7.806  1.00 41.54  ? 43  ASP B OD2 1 
ATOM   6749  N N   . LEU C 1 47  ? 35.158 14.235  -11.223 1.00 31.77  ? 44  LEU B N   1 
ATOM   6750  C CA  . LEU C 1 47  ? 34.548 14.925  -12.350 1.00 27.55  ? 44  LEU B CA  1 
ATOM   6751  C C   . LEU C 1 47  ? 33.402 14.131  -12.966 1.00 32.99  ? 44  LEU B C   1 
ATOM   6752  O O   . LEU C 1 47  ? 33.108 14.299  -14.156 1.00 28.39  ? 44  LEU B O   1 
ATOM   6753  C CB  . LEU C 1 47  ? 35.601 15.253  -13.411 1.00 22.88  ? 44  LEU B CB  1 
ATOM   6754  C CG  . LEU C 1 47  ? 36.812 16.083  -12.971 1.00 33.75  ? 44  LEU B CG  1 
ATOM   6755  C CD1 . LEU C 1 47  ? 37.422 16.801  -14.166 1.00 23.02  ? 44  LEU B CD1 1 
ATOM   6756  C CD2 . LEU C 1 47  ? 36.452 17.081  -11.875 1.00 27.80  ? 44  LEU B CD2 1 
ATOM   6757  N N   . GLY C 1 48  ? 32.766 13.256  -12.190 1.00 30.78  ? 45  GLY B N   1 
ATOM   6758  C CA  . GLY C 1 48  ? 31.519 12.658  -12.615 1.00 28.55  ? 45  GLY B CA  1 
ATOM   6759  C C   . GLY C 1 48  ? 30.513 13.746  -12.931 1.00 31.65  ? 45  GLY B C   1 
ATOM   6760  O O   . GLY C 1 48  ? 30.532 14.807  -12.299 1.00 31.24  ? 45  GLY B O   1 
ATOM   6761  N N   . ILE C 1 49  ? 29.637 13.504  -13.909 1.00 30.24  ? 46  ILE B N   1 
ATOM   6762  C CA  . ILE C 1 49  ? 28.759 14.568  -14.391 1.00 30.94  ? 46  ILE B CA  1 
ATOM   6763  C C   . ILE C 1 49  ? 27.846 15.063  -13.275 1.00 28.78  ? 46  ILE B C   1 
ATOM   6764  O O   . ILE C 1 49  ? 27.597 16.268  -13.149 1.00 32.72  ? 46  ILE B O   1 
ATOM   6765  C CB  . ILE C 1 49  ? 27.962 14.089  -15.620 1.00 30.13  ? 46  ILE B CB  1 
ATOM   6766  C CG1 . ILE C 1 49  ? 27.067 15.213  -16.154 1.00 32.77  ? 46  ILE B CG1 1 
ATOM   6767  C CG2 . ILE C 1 49  ? 27.158 12.832  -15.293 1.00 36.26  ? 46  ILE B CG2 1 
ATOM   6768  C CD1 . ILE C 1 49  ? 27.837 16.363  -16.764 1.00 28.33  ? 46  ILE B CD1 1 
ATOM   6769  N N   . GLU C 1 50  ? 27.356 14.149  -12.433 1.00 30.80  ? 47  GLU B N   1 
ATOM   6770  C CA  . GLU C 1 50  ? 26.441 14.544  -11.367 1.00 37.09  ? 47  GLU B CA  1 
ATOM   6771  C C   . GLU C 1 50  ? 27.133 15.425  -10.334 1.00 35.05  ? 47  GLU B C   1 
ATOM   6772  O O   . GLU C 1 50  ? 26.530 16.372  -9.812  1.00 38.94  ? 47  GLU B O   1 
ATOM   6773  C CB  . GLU C 1 50  ? 25.845 13.305  -10.700 1.00 41.28  ? 47  GLU B CB  1 
ATOM   6774  C CG  . GLU C 1 50  ? 24.720 12.654  -11.490 1.00 43.90  ? 47  GLU B CG  1 
ATOM   6775  C CD  . GLU C 1 50  ? 23.414 13.418  -11.380 1.00 58.72  ? 47  GLU B CD  1 
ATOM   6776  O OE1 . GLU C 1 50  ? 23.319 14.319  -10.518 1.00 59.48  ? 47  GLU B OE1 1 
ATOM   6777  O OE2 . GLU C 1 50  ? 22.477 13.109  -12.145 1.00 60.26  ? 47  GLU B OE2 1 
ATOM   6778  N N   . ASN C 1 51  ? 28.400 15.133  -10.027 1.00 30.64  ? 48  ASN B N   1 
ATOM   6779  C CA  . ASN C 1 51  ? 29.116 15.951  -9.056  1.00 33.91  ? 48  ASN B CA  1 
ATOM   6780  C C   . ASN C 1 51  ? 29.566 17.280  -9.649  1.00 31.41  ? 48  ASN B C   1 
ATOM   6781  O O   . ASN C 1 51  ? 29.664 18.274  -8.920  1.00 36.82  ? 48  ASN B O   1 
ATOM   6782  C CB  . ASN C 1 51  ? 30.318 15.193  -8.494  1.00 31.22  ? 48  ASN B CB  1 
ATOM   6783  C CG  . ASN C 1 51  ? 30.998 15.946  -7.369  1.00 28.61  ? 48  ASN B CG  1 
ATOM   6784  O OD1 . ASN C 1 51  ? 32.113 16.445  -7.524  1.00 30.94  ? 48  ASN B OD1 1 
ATOM   6785  N ND2 . ASN C 1 51  ? 30.318 16.052  -6.235  1.00 30.49  ? 48  ASN B ND2 1 
ATOM   6786  N N   . ARG C 1 52  ? 29.848 17.325  -10.953 1.00 32.19  ? 49  ARG B N   1 
ATOM   6787  C CA  . ARG C 1 52  ? 30.083 18.614  -11.593 1.00 28.97  ? 49  ARG B CA  1 
ATOM   6788  C C   . ARG C 1 52  ? 28.832 19.477  -11.525 1.00 29.95  ? 49  ARG B C   1 
ATOM   6789  O O   . ARG C 1 52  ? 28.908 20.682  -11.253 1.00 33.68  ? 49  ARG B O   1 
ATOM   6790  C CB  . ARG C 1 52  ? 30.530 18.415  -13.042 1.00 29.30  ? 49  ARG B CB  1 
ATOM   6791  C CG  . ARG C 1 52  ? 31.991 18.025  -13.183 1.00 29.43  ? 49  ARG B CG  1 
ATOM   6792  C CD  . ARG C 1 52  ? 32.407 17.891  -14.641 1.00 28.54  ? 49  ARG B CD  1 
ATOM   6793  N NE  . ARG C 1 52  ? 32.091 16.577  -15.192 1.00 29.55  ? 49  ARG B NE  1 
ATOM   6794  C CZ  . ARG C 1 52  ? 31.583 16.378  -16.404 1.00 33.47  ? 49  ARG B CZ  1 
ATOM   6795  N NH1 . ARG C 1 52  ? 31.330 17.409  -17.198 1.00 31.11  ? 49  ARG B NH1 1 
ATOM   6796  N NH2 . ARG C 1 52  ? 31.329 15.146  -16.824 1.00 30.60  ? 49  ARG B NH2 1 
ATOM   6797  N N   . ASP C 1 53  ? 27.667 18.868  -11.751 1.00 35.80  ? 50  ASP B N   1 
ATOM   6798  C CA  . ASP C 1 53  ? 26.406 19.592  -11.636 1.00 35.15  ? 50  ASP B CA  1 
ATOM   6799  C C   . ASP C 1 53  ? 26.172 20.064  -10.206 1.00 35.64  ? 50  ASP B C   1 
ATOM   6800  O O   . ASP C 1 53  ? 25.786 21.216  -9.974  1.00 33.21  ? 50  ASP B O   1 
ATOM   6801  C CB  . ASP C 1 53  ? 25.255 18.700  -12.100 1.00 32.31  ? 50  ASP B CB  1 
ATOM   6802  C CG  . ASP C 1 53  ? 24.012 19.488  -12.464 1.00 35.99  ? 50  ASP B CG  1 
ATOM   6803  O OD1 . ASP C 1 53  ? 24.095 20.361  -13.353 1.00 35.69  ? 50  ASP B OD1 1 
ATOM   6804  O OD2 . ASP C 1 53  ? 22.950 19.229  -11.861 1.00 43.44  ? 50  ASP B OD2 1 
ATOM   6805  N N   . ALA C 1 54  ? 26.408 19.183  -9.229  1.00 33.81  ? 51  ALA B N   1 
ATOM   6806  C CA  . ALA C 1 54  ? 26.108 19.524  -7.841  1.00 36.43  ? 51  ALA B CA  1 
ATOM   6807  C C   . ALA C 1 54  ? 27.022 20.633  -7.331  1.00 32.33  ? 51  ALA B C   1 
ATOM   6808  O O   . ALA C 1 54  ? 26.604 21.468  -6.520  1.00 32.98  ? 51  ALA B O   1 
ATOM   6809  C CB  . ALA C 1 54  ? 26.221 18.281  -6.957  1.00 32.40  ? 51  ALA B CB  1 
ATOM   6810  N N   . THR C 1 55  ? 28.268 20.666  -7.802  1.00 27.70  ? 52  THR B N   1 
ATOM   6811  C CA  . THR C 1 55  ? 29.223 21.697  -7.417  1.00 31.83  ? 52  THR B CA  1 
ATOM   6812  C C   . THR C 1 55  ? 29.248 22.870  -8.389  1.00 33.74  ? 52  THR B C   1 
ATOM   6813  O O   . THR C 1 55  ? 30.114 23.742  -8.265  1.00 32.05  ? 52  THR B O   1 
ATOM   6814  C CB  . THR C 1 55  ? 30.628 21.100  -7.296  1.00 32.72  ? 52  THR B CB  1 
ATOM   6815  O OG1 . THR C 1 55  ? 31.093 20.705  -8.592  1.00 28.23  ? 52  THR B OG1 1 
ATOM   6816  C CG2 . THR C 1 55  ? 30.620 19.883  -6.374  1.00 27.53  ? 52  THR B CG2 1 
ATOM   6817  N N   . ASN C 1 56  ? 28.320 22.912  -9.348  1.00 32.69  ? 53  ASN B N   1 
ATOM   6818  C CA  . ASN C 1 56  ? 28.298 23.950  -10.382 1.00 31.89  ? 53  ASN B CA  1 
ATOM   6819  C C   . ASN C 1 56  ? 29.641 24.043  -11.102 1.00 38.23  ? 53  ASN B C   1 
ATOM   6820  O O   . ASN C 1 56  ? 30.154 25.132  -11.369 1.00 34.54  ? 53  ASN B O   1 
ATOM   6821  C CB  . ASN C 1 56  ? 27.895 25.309  -9.798  1.00 37.80  ? 53  ASN B CB  1 
ATOM   6822  C CG  . ASN C 1 56  ? 26.464 25.329  -9.299  1.00 42.98  ? 53  ASN B CG  1 
ATOM   6823  O OD1 . ASN C 1 56  ? 25.570 24.761  -9.925  1.00 42.62  ? 53  ASN B OD1 1 
ATOM   6824  N ND2 . ASN C 1 56  ? 26.239 25.990  -8.170  1.00 41.74  ? 53  ASN B ND2 1 
ATOM   6825  N N   . ASP C 1 57  ? 30.220 22.879  -11.401 1.00 34.40  ? 54  ASP B N   1 
ATOM   6826  C CA  . ASP C 1 57  ? 31.466 22.724  -12.147 1.00 34.35  ? 54  ASP B CA  1 
ATOM   6827  C C   . ASP C 1 57  ? 32.684 23.262  -11.405 1.00 30.07  ? 54  ASP B C   1 
ATOM   6828  O O   . ASP C 1 57  ? 33.772 23.334  -11.992 1.00 33.22  ? 54  ASP B O   1 
ATOM   6829  C CB  . ASP C 1 57  ? 31.380 23.385  -13.530 1.00 30.81  ? 54  ASP B CB  1 
ATOM   6830  C CG  . ASP C 1 57  ? 32.211 22.670  -14.572 1.00 31.06  ? 54  ASP B CG  1 
ATOM   6831  O OD1 . ASP C 1 57  ? 32.360 21.433  -14.472 1.00 34.69  ? 54  ASP B OD1 1 
ATOM   6832  O OD2 . ASP C 1 57  ? 32.706 23.341  -15.501 1.00 34.77  ? 54  ASP B OD2 1 
ATOM   6833  N N   . GLN C 1 58  ? 32.541 23.634  -10.131 1.00 31.05  ? 55  GLN B N   1 
ATOM   6834  C CA  . GLN C 1 58  ? 33.686 24.140  -9.377  1.00 30.57  ? 55  GLN B CA  1 
ATOM   6835  C C   . GLN C 1 58  ? 34.761 23.072  -9.218  1.00 29.66  ? 55  GLN B C   1 
ATOM   6836  O O   . GLN C 1 58  ? 35.958 23.383  -9.194  1.00 29.57  ? 55  GLN B O   1 
ATOM   6837  C CB  . GLN C 1 58  ? 33.232 24.650  -8.008  1.00 32.79  ? 55  GLN B CB  1 
ATOM   6838  C CG  . GLN C 1 58  ? 34.335 25.309  -7.192  1.00 31.80  ? 55  GLN B CG  1 
ATOM   6839  C CD  . GLN C 1 58  ? 34.970 26.489  -7.906  1.00 38.11  ? 55  GLN B CD  1 
ATOM   6840  O OE1 . GLN C 1 58  ? 34.288 27.440  -8.286  1.00 37.41  ? 55  GLN B OE1 1 
ATOM   6841  N NE2 . GLN C 1 58  ? 36.285 26.431  -8.093  1.00 31.01  ? 55  GLN B NE2 1 
ATOM   6842  N N   . VAL C 1 59  ? 34.352 21.805  -9.115  1.00 28.63  ? 56  VAL B N   1 
ATOM   6843  C CA  . VAL C 1 59  ? 35.316 20.718  -8.971  1.00 26.10  ? 56  VAL B CA  1 
ATOM   6844  C C   . VAL C 1 59  ? 36.234 20.645  -10.182 1.00 28.70  ? 56  VAL B C   1 
ATOM   6845  O O   . VAL C 1 59  ? 37.411 20.279  -10.059 1.00 27.55  ? 56  VAL B O   1 
ATOM   6846  C CB  . VAL C 1 59  ? 34.577 19.384  -8.727  1.00 29.89  ? 56  VAL B CB  1 
ATOM   6847  C CG1 . VAL C 1 59  ? 33.670 19.046  -9.905  1.00 27.02  ? 56  VAL B CG1 1 
ATOM   6848  C CG2 . VAL C 1 59  ? 35.570 18.258  -8.460  1.00 28.20  ? 56  VAL B CG2 1 
ATOM   6849  N N   . THR C 1 60  ? 35.728 21.011  -11.364 1.00 28.51  ? 57  THR B N   1 
ATOM   6850  C CA  . THR C 1 60  ? 36.562 20.994  -12.561 1.00 30.74  ? 57  THR B CA  1 
ATOM   6851  C C   . THR C 1 60  ? 37.672 22.033  -12.461 1.00 29.63  ? 57  THR B C   1 
ATOM   6852  O O   . THR C 1 60  ? 38.844 21.732  -12.719 1.00 27.71  ? 57  THR B O   1 
ATOM   6853  C CB  . THR C 1 60  ? 35.704 21.241  -13.804 1.00 27.09  ? 57  THR B CB  1 
ATOM   6854  O OG1 . THR C 1 60  ? 34.623 20.299  -13.840 1.00 24.71  ? 57  THR B OG1 1 
ATOM   6855  C CG2 . THR C 1 60  ? 36.543 21.086  -15.065 1.00 28.49  ? 57  THR B CG2 1 
ATOM   6856  N N   . LYS C 1 61  ? 37.320 23.263  -12.078 1.00 32.97  ? 58  LYS B N   1 
ATOM   6857  C CA  . LYS C 1 61  ? 38.324 24.311  -11.931 1.00 36.97  ? 58  LYS B CA  1 
ATOM   6858  C C   . LYS C 1 61  ? 39.311 23.973  -10.821 1.00 30.37  ? 58  LYS B C   1 
ATOM   6859  O O   . LYS C 1 61  ? 40.517 24.217  -10.955 1.00 30.22  ? 58  LYS B O   1 
ATOM   6860  C CB  . LYS C 1 61  ? 37.645 25.651  -11.652 1.00 34.72  ? 58  LYS B CB  1 
ATOM   6861  C CG  . LYS C 1 61  ? 36.631 26.076  -12.704 1.00 35.18  ? 58  LYS B CG  1 
ATOM   6862  C CD  . LYS C 1 61  ? 35.719 27.165  -12.156 1.00 35.64  ? 58  LYS B CD  1 
ATOM   6863  C CE  . LYS C 1 61  ? 34.556 27.446  -13.093 1.00 48.71  ? 58  LYS B CE  1 
ATOM   6864  N NZ  . LYS C 1 61  ? 33.492 28.251  -12.425 1.00 50.22  ? 58  LYS B NZ  1 
ATOM   6865  N N   . ASP C 1 62  ? 38.815 23.411  -9.715  1.00 27.42  ? 59  ASP B N   1 
ATOM   6866  C CA  . ASP C 1 62  ? 39.696 23.037  -8.614  1.00 30.53  ? 59  ASP B CA  1 
ATOM   6867  C C   . ASP C 1 62  ? 40.695 21.974  -9.050  1.00 31.83  ? 59  ASP B C   1 
ATOM   6868  O O   . ASP C 1 62  ? 41.867 22.011  -8.654  1.00 31.07  ? 59  ASP B O   1 
ATOM   6869  C CB  . ASP C 1 62  ? 38.870 22.540  -7.428  1.00 29.68  ? 59  ASP B CB  1 
ATOM   6870  C CG  . ASP C 1 62  ? 38.196 23.669  -6.671  1.00 36.56  ? 59  ASP B CG  1 
ATOM   6871  O OD1 . ASP C 1 62  ? 38.243 24.825  -7.145  1.00 34.36  ? 59  ASP B OD1 1 
ATOM   6872  O OD2 . ASP C 1 62  ? 37.605 23.397  -5.605  1.00 35.69  ? 59  ASP B OD2 1 
ATOM   6873  N N   . ALA C 1 63  ? 40.248 21.017  -9.867  1.00 30.38  ? 60  ALA B N   1 
ATOM   6874  C CA  . ALA C 1 63  ? 41.150 19.986  -10.368 1.00 27.69  ? 60  ALA B CA  1 
ATOM   6875  C C   . ALA C 1 63  ? 42.263 20.599  -11.210 1.00 28.53  ? 60  ALA B C   1 
ATOM   6876  O O   . ALA C 1 63  ? 43.444 20.285  -11.023 1.00 29.34  ? 60  ALA B O   1 
ATOM   6877  C CB  . ALA C 1 63  ? 40.366 18.950  -11.174 1.00 27.92  ? 60  ALA B CB  1 
ATOM   6878  N N   . ALA C 1 64  ? 41.903 21.489  -12.139 1.00 26.58  ? 61  ALA B N   1 
ATOM   6879  C CA  . ALA C 1 64  ? 42.916 22.163  -12.946 1.00 34.13  ? 61  ALA B CA  1 
ATOM   6880  C C   . ALA C 1 64  ? 43.872 22.964  -12.071 1.00 35.28  ? 61  ALA B C   1 
ATOM   6881  O O   . ALA C 1 64  ? 45.078 23.016  -12.342 1.00 28.98  ? 61  ALA B O   1 
ATOM   6882  C CB  . ALA C 1 64  ? 42.250 23.068  -13.981 1.00 32.19  ? 61  ALA B CB  1 
ATOM   6883  N N   . GLU C 1 65  ? 43.350 23.592  -11.015 1.00 33.52  ? 62  GLU B N   1 
ATOM   6884  C CA  . GLU C 1 65  ? 44.211 24.275  -10.055 1.00 37.83  ? 62  GLU B CA  1 
ATOM   6885  C C   . GLU C 1 65  ? 45.193 23.300  -9.415  1.00 29.98  ? 62  GLU B C   1 
ATOM   6886  O O   . GLU C 1 65  ? 46.381 23.606  -9.262  1.00 27.67  ? 62  GLU B O   1 
ATOM   6887  C CB  . GLU C 1 65  ? 43.353 24.962  -8.991  1.00 35.42  ? 62  GLU B CB  1 
ATOM   6888  C CG  . GLU C 1 65  ? 44.128 25.784  -7.978  1.00 42.90  ? 62  GLU B CG  1 
ATOM   6889  C CD  . GLU C 1 65  ? 43.248 26.277  -6.842  1.00 53.71  ? 62  GLU B CD  1 
ATOM   6890  O OE1 . GLU C 1 65  ? 42.295 25.561  -6.465  1.00 41.29  ? 62  GLU B OE1 1 
ATOM   6891  O OE2 . GLU C 1 65  ? 43.505 27.385  -6.331  1.00 54.48  ? 62  GLU B OE2 1 
ATOM   6892  N N   . ALA C 1 66  ? 44.713 22.109  -9.046  1.00 31.48  ? 63  ALA B N   1 
ATOM   6893  C CA  . ALA C 1 66  ? 45.574 21.138  -8.377  1.00 30.64  ? 63  ALA B CA  1 
ATOM   6894  C C   . ALA C 1 66  ? 46.672 20.629  -9.303  1.00 33.82  ? 63  ALA B C   1 
ATOM   6895  O O   . ALA C 1 66  ? 47.802 20.388  -8.863  1.00 34.24  ? 63  ALA B O   1 
ATOM   6896  C CB  . ALA C 1 66  ? 44.744 19.971  -7.845  1.00 27.89  ? 63  ALA B CB  1 
ATOM   6897  N N   . ILE C 1 67  ? 46.359 20.457  -10.590 1.00 27.51  ? 64  ILE B N   1 
ATOM   6898  C CA  . ILE C 1 67  ? 47.371 20.009  -11.541 1.00 35.06  ? 64  ILE B CA  1 
ATOM   6899  C C   . ILE C 1 67  ? 48.483 21.042  -11.652 1.00 35.15  ? 64  ILE B C   1 
ATOM   6900  O O   . ILE C 1 67  ? 49.672 20.700  -11.686 1.00 31.91  ? 64  ILE B O   1 
ATOM   6901  C CB  . ILE C 1 67  ? 46.734 19.722  -12.914 1.00 33.31  ? 64  ILE B CB  1 
ATOM   6902  C CG1 . ILE C 1 67  ? 45.638 18.664  -12.791 1.00 30.98  ? 64  ILE B CG1 1 
ATOM   6903  C CG2 . ILE C 1 67  ? 47.796 19.260  -13.903 1.00 29.06  ? 64  ILE B CG2 1 
ATOM   6904  C CD1 . ILE C 1 67  ? 44.878 18.442  -14.075 1.00 34.35  ? 64  ILE B CD1 1 
ATOM   6905  N N   . LYS C 1 68  ? 48.113 22.323  -11.703 1.00 27.82  ? 65  LYS B N   1 
ATOM   6906  C CA  . LYS C 1 68  ? 49.107 23.388  -11.782 1.00 35.53  ? 65  LYS B CA  1 
ATOM   6907  C C   . LYS C 1 68  ? 50.021 23.380  -10.562 1.00 35.71  ? 65  LYS B C   1 
ATOM   6908  O O   . LYS C 1 68  ? 51.228 23.622  -10.677 1.00 36.07  ? 65  LYS B O   1 
ATOM   6909  C CB  . LYS C 1 68  ? 48.393 24.732  -11.916 1.00 39.05  ? 65  LYS B CB  1 
ATOM   6910  C CG  . LYS C 1 68  ? 49.224 25.856  -12.497 1.00 47.60  ? 65  LYS B CG  1 
ATOM   6911  C CD  . LYS C 1 68  ? 48.311 26.974  -12.981 1.00 49.16  ? 65  LYS B CD  1 
ATOM   6912  C CE  . LYS C 1 68  ? 49.095 28.093  -13.640 1.00 63.12  ? 65  LYS B CE  1 
ATOM   6913  N NZ  . LYS C 1 68  ? 48.202 29.021  -14.389 1.00 73.25  ? 65  LYS B NZ  1 
ATOM   6914  N N   . LYS C 1 69  ? 49.466 23.083  -9.386  1.00 32.14  ? 66  LYS B N   1 
ATOM   6915  C CA  . LYS C 1 69  ? 50.241 23.148  -8.153  1.00 31.39  ? 66  LYS B CA  1 
ATOM   6916  C C   . LYS C 1 69  ? 51.129 21.920  -7.970  1.00 38.12  ? 66  LYS B C   1 
ATOM   6917  O O   . LYS C 1 69  ? 52.257 22.036  -7.477  1.00 36.23  ? 66  LYS B O   1 
ATOM   6918  C CB  . LYS C 1 69  ? 49.295 23.310  -6.961  1.00 40.19  ? 66  LYS B CB  1 
ATOM   6919  C CG  . LYS C 1 69  ? 49.954 23.235  -5.591  1.00 40.27  ? 66  LYS B CG  1 
ATOM   6920  C CD  . LYS C 1 69  ? 48.902 23.362  -4.493  1.00 45.13  ? 66  LYS B CD  1 
ATOM   6921  C CE  . LYS C 1 69  ? 49.446 22.969  -3.124  1.00 54.45  ? 66  LYS B CE  1 
ATOM   6922  N NZ  . LYS C 1 69  ? 50.589 23.820  -2.693  1.00 59.82  ? 66  LYS B NZ  1 
ATOM   6923  N N   . HIS C 1 70  ? 50.647 20.740  -8.367  1.00 35.61  ? 67  HIS B N   1 
ATOM   6924  C CA  . HIS C 1 70  ? 51.361 19.497  -8.106  1.00 30.94  ? 67  HIS B CA  1 
ATOM   6925  C C   . HIS C 1 70  ? 52.026 18.900  -9.342  1.00 31.37  ? 67  HIS B C   1 
ATOM   6926  O O   . HIS C 1 70  ? 52.744 17.904  -9.213  1.00 35.65  ? 67  HIS B O   1 
ATOM   6927  C CB  . HIS C 1 70  ? 50.411 18.473  -7.480  1.00 29.83  ? 67  HIS B CB  1 
ATOM   6928  C CG  . HIS C 1 70  ? 49.919 18.869  -6.122  1.00 37.69  ? 67  HIS B CG  1 
ATOM   6929  N ND1 . HIS C 1 70  ? 50.759 18.996  -5.036  1.00 40.31  ? 67  HIS B ND1 1 
ATOM   6930  C CD2 . HIS C 1 70  ? 48.678 19.175  -5.675  1.00 37.74  ? 67  HIS B CD2 1 
ATOM   6931  C CE1 . HIS C 1 70  ? 50.056 19.359  -3.978  1.00 34.72  ? 67  HIS B CE1 1 
ATOM   6932  N NE2 . HIS C 1 70  ? 48.790 19.476  -4.339  1.00 34.99  ? 67  HIS B NE2 1 
ATOM   6933  N N   . ASN C 1 71  ? 51.794 19.475  -10.525 1.00 29.21  ? 68  ASN B N   1 
ATOM   6934  C CA  . ASN C 1 71  ? 52.513 19.181  -11.765 1.00 29.98  ? 68  ASN B CA  1 
ATOM   6935  C C   . ASN C 1 71  ? 52.176 17.840  -12.417 1.00 26.99  ? 68  ASN B C   1 
ATOM   6936  O O   . ASN C 1 71  ? 52.650 17.572  -13.526 1.00 29.66  ? 68  ASN B O   1 
ATOM   6937  C CB  . ASN C 1 71  ? 54.034 19.253  -11.554 1.00 27.38  ? 68  ASN B CB  1 
ATOM   6938  C CG  . ASN C 1 71  ? 54.468 20.471  -10.758 1.00 39.10  ? 68  ASN B CG  1 
ATOM   6939  O OD1 . ASN C 1 71  ? 54.985 20.350  -9.647  1.00 39.86  ? 68  ASN B OD1 1 
ATOM   6940  N ND2 . ASN C 1 71  ? 54.262 21.654  -11.326 1.00 30.17  ? 68  ASN B ND2 1 
ATOM   6941  N N   . VAL C 1 72  ? 51.381 16.986  -11.772 1.00 26.72  ? 69  VAL B N   1 
ATOM   6942  C CA  . VAL C 1 72  ? 51.042 15.678  -12.337 1.00 34.19  ? 69  VAL B CA  1 
ATOM   6943  C C   . VAL C 1 72  ? 49.540 15.463  -12.244 1.00 28.22  ? 69  VAL B C   1 
ATOM   6944  O O   . VAL C 1 72  ? 48.982 15.430  -11.140 1.00 26.40  ? 69  VAL B O   1 
ATOM   6945  C CB  . VAL C 1 72  ? 51.785 14.527  -11.639 1.00 30.35  ? 69  VAL B CB  1 
ATOM   6946  C CG1 . VAL C 1 72  ? 51.459 13.205  -12.321 1.00 29.45  ? 69  VAL B CG1 1 
ATOM   6947  C CG2 . VAL C 1 72  ? 53.288 14.766  -11.660 1.00 30.39  ? 69  VAL B CG2 1 
ATOM   6948  N N   . GLY C 1 73  ? 48.895 15.303  -13.391 1.00 29.93  ? 70  GLY B N   1 
ATOM   6949  C CA  . GLY C 1 73  ? 47.474 14.989  -13.451 1.00 26.76  ? 70  GLY B CA  1 
ATOM   6950  C C   . GLY C 1 73  ? 47.217 13.770  -14.315 1.00 30.17  ? 70  GLY B C   1 
ATOM   6951  O O   . GLY C 1 73  ? 47.853 13.593  -15.358 1.00 29.45  ? 70  GLY B O   1 
ATOM   6952  N N   . VAL C 1 74  ? 46.294 12.923  -13.865 1.00 24.68  ? 71  VAL B N   1 
ATOM   6953  C CA  . VAL C 1 74  ? 45.823 11.770  -14.626 1.00 26.35  ? 71  VAL B CA  1 
ATOM   6954  C C   . VAL C 1 74  ? 44.301 11.824  -14.635 1.00 28.40  ? 71  VAL B C   1 
ATOM   6955  O O   . VAL C 1 74  ? 43.670 11.874  -13.572 1.00 27.56  ? 71  VAL B O   1 
ATOM   6956  C CB  . VAL C 1 74  ? 46.339 10.435  -14.052 1.00 29.86  ? 71  VAL B CB  1 
ATOM   6957  C CG1 . VAL C 1 74  ? 47.842 10.333  -14.248 1.00 30.94  ? 71  VAL B CG1 1 
ATOM   6958  C CG2 . VAL C 1 74  ? 46.004 10.300  -12.573 1.00 27.60  ? 71  VAL B CG2 1 
ATOM   6959  N N   . LYS C 1 75  ? 43.714 11.841  -15.828 1.00 26.96  ? 72  LYS B N   1 
ATOM   6960  C CA  . LYS C 1 75  ? 42.301 12.147  -15.991 1.00 30.40  ? 72  LYS B CA  1 
ATOM   6961  C C   . LYS C 1 75  ? 41.551 10.989  -16.633 1.00 31.96  ? 72  LYS B C   1 
ATOM   6962  O O   . LYS C 1 75  ? 42.006 10.403  -17.621 1.00 30.29  ? 72  LYS B O   1 
ATOM   6963  C CB  . LYS C 1 75  ? 42.101 13.412  -16.832 1.00 32.58  ? 72  LYS B CB  1 
ATOM   6964  C CG  . LYS C 1 75  ? 40.635 13.742  -17.061 1.00 31.01  ? 72  LYS B CG  1 
ATOM   6965  C CD  . LYS C 1 75  ? 40.433 15.058  -17.782 1.00 24.13  ? 72  LYS B CD  1 
ATOM   6966  C CE  . LYS C 1 75  ? 38.950 15.310  -18.021 1.00 38.87  ? 72  LYS B CE  1 
ATOM   6967  N NZ  . LYS C 1 75  ? 38.323 14.222  -18.826 1.00 24.79  ? 72  LYS B NZ  1 
ATOM   6968  N N   . CYS C 1 76  ? 40.395 10.675  -16.058 1.00 27.75  ? 73  CYS B N   1 
ATOM   6969  C CA  . CYS C 1 76  ? 39.429 9.762   -16.644 1.00 27.06  ? 73  CYS B CA  1 
ATOM   6970  C C   . CYS C 1 76  ? 38.522 10.520  -17.606 1.00 30.95  ? 73  CYS B C   1 
ATOM   6971  O O   . CYS C 1 76  ? 38.233 11.704  -17.413 1.00 26.45  ? 73  CYS B O   1 
ATOM   6972  C CB  . CYS C 1 76  ? 38.598 9.099   -15.541 1.00 28.42  ? 73  CYS B CB  1 
ATOM   6973  S SG  . CYS C 1 76  ? 37.485 7.772   -16.061 1.00 31.28  ? 73  CYS B SG  1 
ATOM   6974  N N   . ALA C 1 77  ? 38.077 9.824   -18.651 1.00 24.92  ? 74  ALA B N   1 
ATOM   6975  C CA  . ALA C 1 77  ? 37.204 10.438  -19.644 1.00 25.73  ? 74  ALA B CA  1 
ATOM   6976  C C   . ALA C 1 77  ? 35.914 10.931  -18.995 1.00 26.95  ? 74  ALA B C   1 
ATOM   6977  O O   . ALA C 1 77  ? 35.402 10.322  -18.052 1.00 26.59  ? 74  ALA B O   1 
ATOM   6978  C CB  . ALA C 1 77  ? 36.889 9.439   -20.756 1.00 27.34  ? 74  ALA B CB  1 
ATOM   6979  N N   . THR C 1 78  ? 35.386 12.046  -19.503 1.00 27.51  ? 75  THR B N   1 
ATOM   6980  C CA  . THR C 1 78  ? 34.208 12.682  -18.928 1.00 32.25  ? 75  THR B CA  1 
ATOM   6981  C C   . THR C 1 78  ? 33.161 12.944  -20.002 1.00 29.95  ? 75  THR B C   1 
ATOM   6982  O O   . THR C 1 78  ? 33.480 13.134  -21.179 1.00 31.14  ? 75  THR B O   1 
ATOM   6983  C CB  . THR C 1 78  ? 34.554 14.011  -18.235 1.00 30.42  ? 75  THR B CB  1 
ATOM   6984  O OG1 . THR C 1 78  ? 35.462 14.763  -19.053 1.00 25.97  ? 75  THR B OG1 1 
ATOM   6985  C CG2 . THR C 1 78  ? 35.178 13.760  -16.870 1.00 25.98  ? 75  THR B CG2 1 
ATOM   6986  N N   . ILE C 1 79  ? 31.901 12.958  -19.574 1.00 27.23  ? 76  ILE B N   1 
ATOM   6987  C CA  . ILE C 1 79  ? 30.793 13.329  -20.447 1.00 28.15  ? 76  ILE B CA  1 
ATOM   6988  C C   . ILE C 1 79  ? 30.832 14.835  -20.676 1.00 32.17  ? 76  ILE B C   1 
ATOM   6989  O O   . ILE C 1 79  ? 30.746 15.623  -19.726 1.00 35.10  ? 76  ILE B O   1 
ATOM   6990  C CB  . ILE C 1 79  ? 29.450 12.921  -19.830 1.00 32.59  ? 76  ILE B CB  1 
ATOM   6991  C CG1 . ILE C 1 79  ? 29.305 11.406  -19.736 1.00 29.86  ? 76  ILE B CG1 1 
ATOM   6992  C CG2 . ILE C 1 79  ? 28.299 13.533  -20.613 1.00 30.64  ? 76  ILE B CG2 1 
ATOM   6993  C CD1 . ILE C 1 79  ? 28.095 10.976  -18.924 1.00 23.56  ? 76  ILE B CD1 1 
ATOM   6994  N N   . THR C 1 80  ? 30.955 15.247  -21.933 1.00 33.16  ? 77  THR B N   1 
ATOM   6995  C CA  . THR C 1 80  ? 30.752 16.649  -22.262 1.00 31.77  ? 77  THR B CA  1 
ATOM   6996  C C   . THR C 1 80  ? 29.272 16.878  -22.528 1.00 38.57  ? 77  THR B C   1 
ATOM   6997  O O   . THR C 1 80  ? 28.719 16.261  -23.449 1.00 35.76  ? 77  THR B O   1 
ATOM   6998  C CB  . THR C 1 80  ? 31.568 17.061  -23.468 1.00 37.22  ? 77  THR B CB  1 
ATOM   6999  O OG1 . THR C 1 80  ? 32.963 16.977  -23.152 1.00 41.54  ? 77  THR B OG1 1 
ATOM   7000  C CG2 . THR C 1 80  ? 31.223 18.490  -23.862 1.00 33.08  ? 77  THR B CG2 1 
ATOM   7001  N N   . PRO C 1 81  ? 28.595 17.721  -21.752 1.00 36.94  ? 78  PRO B N   1 
ATOM   7002  C CA  . PRO C 1 81  ? 27.142 17.847  -21.902 1.00 41.77  ? 78  PRO B CA  1 
ATOM   7003  C C   . PRO C 1 81  ? 26.741 18.435  -23.247 1.00 41.47  ? 78  PRO B C   1 
ATOM   7004  O O   . PRO C 1 81  ? 27.388 19.345  -23.773 1.00 37.72  ? 78  PRO B O   1 
ATOM   7005  C CB  . PRO C 1 81  ? 26.747 18.776  -20.747 1.00 39.16  ? 78  PRO B CB  1 
ATOM   7006  C CG  . PRO C 1 81  ? 27.832 18.604  -19.737 1.00 41.45  ? 78  PRO B CG  1 
ATOM   7007  C CD  . PRO C 1 81  ? 29.086 18.413  -20.547 1.00 33.82  ? 78  PRO B CD  1 
ATOM   7008  N N   . ASP C 1 82  ? 25.675 17.872  -23.816 1.00 40.68  ? 79  ASP B N   1 
ATOM   7009  C CA  . ASP C 1 82  ? 24.923 18.518  -24.884 1.00 41.42  ? 79  ASP B CA  1 
ATOM   7010  C C   . ASP C 1 82  ? 23.451 18.526  -24.488 1.00 44.19  ? 79  ASP B C   1 
ATOM   7011  O O   . ASP C 1 82  ? 23.124 18.234  -23.333 1.00 39.00  ? 79  ASP B O   1 
ATOM   7012  C CB  . ASP C 1 82  ? 25.140 17.821  -26.235 1.00 39.74  ? 79  ASP B CB  1 
ATOM   7013  C CG  . ASP C 1 82  ? 24.911 16.320  -26.177 1.00 44.84  ? 79  ASP B CG  1 
ATOM   7014  O OD1 . ASP C 1 82  ? 24.104 15.857  -25.343 1.00 41.95  ? 79  ASP B OD1 1 
ATOM   7015  O OD2 . ASP C 1 82  ? 25.545 15.599  -26.976 1.00 52.08  ? 79  ASP B OD2 1 
ATOM   7016  N N   . GLU C 1 83  ? 22.561 18.845  -25.433 1.00 46.16  ? 80  GLU B N   1 
ATOM   7017  C CA  . GLU C 1 83  ? 21.135 18.940  -25.124 1.00 45.62  ? 80  GLU B CA  1 
ATOM   7018  C C   . GLU C 1 83  ? 20.610 17.651  -24.502 1.00 40.98  ? 80  GLU B C   1 
ATOM   7019  O O   . GLU C 1 83  ? 19.836 17.678  -23.540 1.00 45.85  ? 80  GLU B O   1 
ATOM   7020  C CB  . GLU C 1 83  ? 20.349 19.276  -26.394 1.00 56.34  ? 80  GLU B CB  1 
ATOM   7021  C CG  . GLU C 1 83  ? 18.841 19.381  -26.208 1.00 63.53  ? 80  GLU B CG  1 
ATOM   7022  C CD  . GLU C 1 83  ? 18.154 19.974  -27.425 1.00 76.96  ? 80  GLU B CD  1 
ATOM   7023  O OE1 . GLU C 1 83  ? 17.228 19.331  -27.966 1.00 79.69  ? 80  GLU B OE1 1 
ATOM   7024  O OE2 . GLU C 1 83  ? 18.543 21.084  -27.842 1.00 76.06  ? 80  GLU B OE2 1 
ATOM   7025  N N   . LYS C 1 84  ? 21.039 16.506  -25.037 1.00 44.69  ? 81  LYS B N   1 
ATOM   7026  C CA  . LYS C 1 84  ? 20.539 15.216  -24.568 1.00 44.51  ? 81  LYS B CA  1 
ATOM   7027  C C   . LYS C 1 84  ? 21.066 14.903  -23.174 1.00 45.90  ? 81  LYS B C   1 
ATOM   7028  O O   . LYS C 1 84  ? 20.326 14.396  -22.321 1.00 40.33  ? 81  LYS B O   1 
ATOM   7029  C CB  . LYS C 1 84  ? 20.928 14.097  -25.549 1.00 42.96  ? 81  LYS B CB  1 
ATOM   7030  C CG  . LYS C 1 84  ? 20.247 14.073  -26.948 1.00 63.58  ? 81  LYS B CG  1 
ATOM   7031  C CD  . LYS C 1 84  ? 20.771 15.132  -27.909 1.00 69.95  ? 81  LYS B CD  1 
ATOM   7032  C CE  . LYS C 1 84  ? 22.209 14.832  -28.307 1.00 76.10  ? 81  LYS B CE  1 
ATOM   7033  N NZ  . LYS C 1 84  ? 22.875 16.030  -28.886 1.00 78.56  ? 81  LYS B NZ  1 
ATOM   7034  N N   . ARG C 1 85  ? 22.347 15.199  -22.927 1.00 38.81  ? 82  ARG B N   1 
ATOM   7035  C CA  . ARG C 1 85  ? 22.915 15.016  -21.596 1.00 41.35  ? 82  ARG B CA  1 
ATOM   7036  C C   . ARG C 1 85  ? 22.187 15.871  -20.565 1.00 40.95  ? 82  ARG B C   1 
ATOM   7037  O O   . ARG C 1 85  ? 21.978 15.438  -19.425 1.00 36.34  ? 82  ARG B O   1 
ATOM   7038  C CB  . ARG C 1 85  ? 24.407 15.350  -21.620 1.00 39.67  ? 82  ARG B CB  1 
ATOM   7039  C CG  . ARG C 1 85  ? 25.232 14.460  -22.544 1.00 34.92  ? 82  ARG B CG  1 
ATOM   7040  C CD  . ARG C 1 85  ? 25.037 12.986  -22.223 1.00 34.49  ? 82  ARG B CD  1 
ATOM   7041  N NE  . ARG C 1 85  ? 26.161 12.178  -22.690 1.00 36.08  ? 82  ARG B NE  1 
ATOM   7042  C CZ  . ARG C 1 85  ? 26.391 10.926  -22.308 1.00 35.87  ? 82  ARG B CZ  1 
ATOM   7043  N NH1 . ARG C 1 85  ? 25.571 10.331  -21.454 1.00 26.58  ? 82  ARG B NH1 1 
ATOM   7044  N NH2 . ARG C 1 85  ? 27.444 10.268  -22.779 1.00 33.33  ? 82  ARG B NH2 1 
ATOM   7045  N N   . VAL C 1 86  ? 21.789 17.086  -20.951 1.00 42.82  ? 83  VAL B N   1 
ATOM   7046  C CA  . VAL C 1 86  ? 21.013 17.939  -20.053 1.00 37.34  ? 83  VAL B CA  1 
ATOM   7047  C C   . VAL C 1 86  ? 19.719 17.242  -19.654 1.00 44.84  ? 83  VAL B C   1 
ATOM   7048  O O   . VAL C 1 86  ? 19.350 17.203  -18.474 1.00 42.60  ? 83  VAL B O   1 
ATOM   7049  C CB  . VAL C 1 86  ? 20.737 19.306  -20.706 1.00 35.05  ? 83  VAL B CB  1 
ATOM   7050  C CG1 . VAL C 1 86  ? 19.857 20.156  -19.797 1.00 33.15  ? 83  VAL B CG1 1 
ATOM   7051  C CG2 . VAL C 1 86  ? 22.042 20.024  -21.000 1.00 39.13  ? 83  VAL B CG2 1 
ATOM   7052  N N   . GLU C 1 87  ? 19.021 16.664  -20.632 1.00 40.14  ? 84  GLU B N   1 
ATOM   7053  C CA  . GLU C 1 87  ? 17.800 15.925  -20.335 1.00 44.09  ? 84  GLU B CA  1 
ATOM   7054  C C   . GLU C 1 87  ? 18.102 14.666  -19.532 1.00 49.33  ? 84  GLU B C   1 
ATOM   7055  O O   . GLU C 1 87  ? 17.414 14.365  -18.548 1.00 48.47  ? 84  GLU B O   1 
ATOM   7056  C CB  . GLU C 1 87  ? 17.077 15.575  -21.637 1.00 45.07  ? 84  GLU B CB  1 
ATOM   7057  C CG  . GLU C 1 87  ? 15.685 15.003  -21.441 1.00 61.56  ? 84  GLU B CG  1 
ATOM   7058  C CD  . GLU C 1 87  ? 14.744 15.983  -20.770 1.00 63.10  ? 84  GLU B CD  1 
ATOM   7059  O OE1 . GLU C 1 87  ? 14.021 15.570  -19.839 1.00 68.87  ? 84  GLU B OE1 1 
ATOM   7060  O OE2 . GLU C 1 87  ? 14.725 17.164  -21.177 1.00 65.58  ? 84  GLU B OE2 1 
ATOM   7061  N N   . GLU C 1 88  ? 19.138 13.922  -19.934 1.00 44.62  ? 85  GLU B N   1 
ATOM   7062  C CA  . GLU C 1 88  ? 19.430 12.638  -19.301 1.00 39.50  ? 85  GLU B CA  1 
ATOM   7063  C C   . GLU C 1 88  ? 19.687 12.792  -17.806 1.00 41.16  ? 85  GLU B C   1 
ATOM   7064  O O   . GLU C 1 88  ? 19.254 11.955  -17.005 1.00 39.02  ? 85  GLU B O   1 
ATOM   7065  C CB  . GLU C 1 88  ? 20.629 11.977  -19.983 1.00 35.03  ? 85  GLU B CB  1 
ATOM   7066  C CG  . GLU C 1 88  ? 21.147 10.746  -19.251 1.00 36.02  ? 85  GLU B CG  1 
ATOM   7067  C CD  . GLU C 1 88  ? 22.316 10.085  -19.954 1.00 40.53  ? 85  GLU B CD  1 
ATOM   7068  O OE1 . GLU C 1 88  ? 22.883 10.698  -20.883 1.00 33.90  ? 85  GLU B OE1 1 
ATOM   7069  O OE2 . GLU C 1 88  ? 22.672 8.950   -19.571 1.00 38.69  ? 85  GLU B OE2 1 
ATOM   7070  N N   . PHE C 1 89  ? 20.372 13.862  -17.407 1.00 36.92  ? 86  PHE B N   1 
ATOM   7071  C CA  . PHE C 1 89  ? 20.788 14.042  -16.023 1.00 38.72  ? 86  PHE B CA  1 
ATOM   7072  C C   . PHE C 1 89  ? 20.076 15.186  -15.315 1.00 43.60  ? 86  PHE B C   1 
ATOM   7073  O O   . PHE C 1 89  ? 20.370 15.440  -14.142 1.00 41.16  ? 86  PHE B O   1 
ATOM   7074  C CB  . PHE C 1 89  ? 22.303 14.266  -15.955 1.00 39.74  ? 86  PHE B CB  1 
ATOM   7075  C CG  . PHE C 1 89  ? 23.111 13.078  -16.387 1.00 40.69  ? 86  PHE B CG  1 
ATOM   7076  C CD1 . PHE C 1 89  ? 23.292 11.999  -15.537 1.00 39.63  ? 86  PHE B CD1 1 
ATOM   7077  C CD2 . PHE C 1 89  ? 23.693 13.042  -17.642 1.00 34.49  ? 86  PHE B CD2 1 
ATOM   7078  C CE1 . PHE C 1 89  ? 24.037 10.904  -15.934 1.00 38.46  ? 86  PHE B CE1 1 
ATOM   7079  C CE2 . PHE C 1 89  ? 24.440 11.951  -18.044 1.00 35.04  ? 86  PHE B CE2 1 
ATOM   7080  C CZ  . PHE C 1 89  ? 24.612 10.880  -17.190 1.00 35.48  ? 86  PHE B CZ  1 
ATOM   7081  N N   . LYS C 1 90  ? 19.150 15.874  -15.984 1.00 45.11  ? 87  LYS B N   1 
ATOM   7082  C CA  . LYS C 1 90  ? 18.462 17.038  -15.426 1.00 45.29  ? 87  LYS B CA  1 
ATOM   7083  C C   . LYS C 1 90  ? 19.477 18.068  -14.929 1.00 45.78  ? 87  LYS B C   1 
ATOM   7084  O O   . LYS C 1 90  ? 19.482 18.477  -13.766 1.00 43.67  ? 87  LYS B O   1 
ATOM   7085  C CB  . LYS C 1 90  ? 17.499 16.628  -14.307 1.00 52.71  ? 87  LYS B CB  1 
ATOM   7086  C CG  . LYS C 1 90  ? 16.370 15.701  -14.742 1.00 56.07  ? 87  LYS B CG  1 
ATOM   7087  C CD  . LYS C 1 90  ? 15.609 16.250  -15.944 1.00 62.80  ? 87  LYS B CD  1 
ATOM   7088  C CE  . LYS C 1 90  ? 14.295 15.505  -16.157 1.00 73.61  ? 87  LYS B CE  1 
ATOM   7089  N NZ  . LYS C 1 90  ? 13.309 15.786  -15.073 1.00 74.20  ? 87  LYS B NZ  1 
ATOM   7090  N N   . LEU C 1 91  ? 20.355 18.475  -15.841 1.00 41.33  ? 88  LEU B N   1 
ATOM   7091  C CA  . LEU C 1 91  ? 21.466 19.345  -15.490 1.00 41.63  ? 88  LEU B CA  1 
ATOM   7092  C C   . LEU C 1 91  ? 21.018 20.798  -15.387 1.00 47.44  ? 88  LEU B C   1 
ATOM   7093  O O   . LEU C 1 91  ? 20.108 21.245  -16.092 1.00 47.41  ? 88  LEU B O   1 
ATOM   7094  C CB  . LEU C 1 91  ? 22.594 19.220  -16.516 1.00 36.48  ? 88  LEU B CB  1 
ATOM   7095  C CG  . LEU C 1 91  ? 23.260 17.847  -16.619 1.00 43.80  ? 88  LEU B CG  1 
ATOM   7096  C CD1 . LEU C 1 91  ? 24.351 17.858  -17.676 1.00 39.66  ? 88  LEU B CD1 1 
ATOM   7097  C CD2 . LEU C 1 91  ? 23.821 17.423  -15.269 1.00 38.57  ? 88  LEU B CD2 1 
ATOM   7098  N N   . LYS C 1 92  ? 21.679 21.537  -14.489 1.00 43.97  ? 89  LYS B N   1 
ATOM   7099  C CA  . LYS C 1 92  ? 21.349 22.945  -14.298 1.00 50.38  ? 89  LYS B CA  1 
ATOM   7100  C C   . LYS C 1 92  ? 21.630 23.762  -15.552 1.00 46.70  ? 89  LYS B C   1 
ATOM   7101  O O   . LYS C 1 92  ? 20.922 24.736  -15.828 1.00 46.98  ? 89  LYS B O   1 
ATOM   7102  C CB  . LYS C 1 92  ? 22.129 23.511  -13.111 1.00 42.44  ? 89  LYS B CB  1 
ATOM   7103  C CG  . LYS C 1 92  ? 21.904 22.775  -11.797 1.00 46.71  ? 89  LYS B CG  1 
ATOM   7104  C CD  . LYS C 1 92  ? 22.816 23.320  -10.706 1.00 45.74  ? 89  LYS B CD  1 
ATOM   7105  C CE  . LYS C 1 92  ? 22.727 22.499  -9.426  1.00 41.18  ? 89  LYS B CE  1 
ATOM   7106  N NZ  . LYS C 1 92  ? 23.724 22.942  -8.409  1.00 37.15  ? 89  LYS B NZ  1 
ATOM   7107  N N   . GLN C 1 93  ? 22.652 23.384  -16.315 1.00 44.71  ? 90  GLN B N   1 
ATOM   7108  C CA  . GLN C 1 93  ? 22.988 24.059  -17.561 1.00 43.62  ? 90  GLN B CA  1 
ATOM   7109  C C   . GLN C 1 93  ? 23.946 23.171  -18.342 1.00 40.49  ? 90  GLN B C   1 
ATOM   7110  O O   . GLN C 1 93  ? 24.467 22.181  -17.825 1.00 45.48  ? 90  GLN B O   1 
ATOM   7111  C CB  . GLN C 1 93  ? 23.594 25.444  -17.305 1.00 46.46  ? 90  GLN B CB  1 
ATOM   7112  C CG  . GLN C 1 93  ? 24.908 25.417  -16.543 1.00 40.35  ? 90  GLN B CG  1 
ATOM   7113  C CD  . GLN C 1 93  ? 25.391 26.805  -16.168 1.00 47.49  ? 90  GLN B CD  1 
ATOM   7114  O OE1 . GLN C 1 93  ? 24.887 27.416  -15.226 1.00 45.23  ? 90  GLN B OE1 1 
ATOM   7115  N NE2 . GLN C 1 93  ? 26.375 27.311  -16.907 1.00 49.07  ? 90  GLN B NE2 1 
ATOM   7116  N N   . MET C 1 94  ? 24.171 23.539  -19.604 1.00 43.54  ? 91  MET B N   1 
ATOM   7117  C CA  . MET C 1 94  ? 25.047 22.774  -20.493 1.00 44.17  ? 91  MET B CA  1 
ATOM   7118  C C   . MET C 1 94  ? 26.495 23.101  -20.140 1.00 38.22  ? 91  MET B C   1 
ATOM   7119  O O   . MET C 1 94  ? 27.158 23.926  -20.775 1.00 39.18  ? 91  MET B O   1 
ATOM   7120  C CB  . MET C 1 94  ? 24.740 23.081  -21.953 1.00 36.91  ? 91  MET B CB  1 
ATOM   7121  C CG  . MET C 1 94  ? 25.481 22.182  -22.933 1.00 39.94  ? 91  MET B CG  1 
ATOM   7122  S SD  . MET C 1 94  ? 24.951 22.380  -24.644 1.00 50.02  ? 91  MET B SD  1 
ATOM   7123  C CE  . MET C 1 94  ? 23.190 22.084  -24.501 1.00 36.84  ? 91  MET B CE  1 
ATOM   7124  N N   . TRP C 1 95  ? 26.986 22.429  -19.099 1.00 36.24  ? 92  TRP B N   1 
ATOM   7125  C CA  . TRP C 1 95  ? 28.328 22.676  -18.584 1.00 36.64  ? 92  TRP B CA  1 
ATOM   7126  C C   . TRP C 1 95  ? 29.383 22.489  -19.667 1.00 41.53  ? 92  TRP B C   1 
ATOM   7127  O O   . TRP C 1 95  ? 29.320 21.545  -20.459 1.00 40.29  ? 92  TRP B O   1 
ATOM   7128  C CB  . TRP C 1 95  ? 28.619 21.736  -17.411 1.00 36.97  ? 92  TRP B CB  1 
ATOM   7129  C CG  . TRP C 1 95  ? 27.658 21.859  -16.277 1.00 35.42  ? 92  TRP B CG  1 
ATOM   7130  C CD1 . TRP C 1 95  ? 26.761 20.922  -15.854 1.00 36.42  ? 92  TRP B CD1 1 
ATOM   7131  C CD2 . TRP C 1 95  ? 27.509 22.982  -15.403 1.00 31.70  ? 92  TRP B CD2 1 
ATOM   7132  N NE1 . TRP C 1 95  ? 26.056 21.396  -14.773 1.00 36.97  ? 92  TRP B NE1 1 
ATOM   7133  C CE2 . TRP C 1 95  ? 26.498 22.659  -14.476 1.00 36.79  ? 92  TRP B CE2 1 
ATOM   7134  C CE3 . TRP C 1 95  ? 28.133 24.231  -15.314 1.00 34.43  ? 92  TRP B CE3 1 
ATOM   7135  C CZ2 . TRP C 1 95  ? 26.095 23.540  -13.473 1.00 40.21  ? 92  TRP B CZ2 1 
ATOM   7136  C CZ3 . TRP C 1 95  ? 27.731 25.105  -14.318 1.00 36.13  ? 92  TRP B CZ3 1 
ATOM   7137  C CH2 . TRP C 1 95  ? 26.722 24.756  -13.412 1.00 30.18  ? 92  TRP B CH2 1 
ATOM   7138  N N   . LYS C 1 96  ? 30.358 23.395  -19.686 1.00 35.41  ? 93  LYS B N   1 
ATOM   7139  C CA  . LYS C 1 96  ? 31.448 23.305  -20.647 1.00 40.08  ? 93  LYS B CA  1 
ATOM   7140  C C   . LYS C 1 96  ? 32.264 22.039  -20.426 1.00 44.33  ? 93  LYS B C   1 
ATOM   7141  O O   . LYS C 1 96  ? 32.273 21.454  -19.338 1.00 34.77  ? 93  LYS B O   1 
ATOM   7142  C CB  . LYS C 1 96  ? 32.359 24.528  -20.544 1.00 36.57  ? 93  LYS B CB  1 
ATOM   7143  C CG  . LYS C 1 96  ? 31.697 25.837  -20.929 1.00 56.98  ? 93  LYS B CG  1 
ATOM   7144  C CD  . LYS C 1 96  ? 31.317 25.840  -22.400 1.00 59.92  ? 93  LYS B CD  1 
ATOM   7145  C CE  . LYS C 1 96  ? 30.533 27.088  -22.760 1.00 68.00  ? 93  LYS B CE  1 
ATOM   7146  N NZ  . LYS C 1 96  ? 30.400 27.246  -24.234 1.00 65.99  ? 93  LYS B NZ  1 
ATOM   7147  N N   . SER C 1 97  ? 32.955 21.623  -21.481 1.00 40.36  ? 94  SER B N   1 
ATOM   7148  C CA  . SER C 1 97  ? 33.813 20.451  -21.457 1.00 33.95  ? 94  SER B CA  1 
ATOM   7149  C C   . SER C 1 97  ? 34.869 20.578  -20.361 1.00 33.93  ? 94  SER B C   1 
ATOM   7150  O O   . SER C 1 97  ? 35.617 21.570  -20.343 1.00 28.27  ? 94  SER B O   1 
ATOM   7151  C CB  . SER C 1 97  ? 34.491 20.283  -22.815 1.00 35.06  ? 94  SER B CB  1 
ATOM   7152  O OG  . SER C 1 97  ? 35.603 19.413  -22.724 1.00 38.61  ? 94  SER B OG  1 
ATOM   7153  N N   . PRO C 1 98  ? 34.956 19.616  -19.434 1.00 33.20  ? 95  PRO B N   1 
ATOM   7154  C CA  . PRO C 1 98  ? 36.061 19.643  -18.462 1.00 30.85  ? 95  PRO B CA  1 
ATOM   7155  C C   . PRO C 1 98  ? 37.414 19.735  -19.135 1.00 38.19  ? 95  PRO B C   1 
ATOM   7156  O O   . PRO C 1 98  ? 38.302 20.458  -18.664 1.00 32.21  ? 95  PRO B O   1 
ATOM   7157  C CB  . PRO C 1 98  ? 35.900 18.313  -17.710 1.00 29.21  ? 95  PRO B CB  1 
ATOM   7158  C CG  . PRO C 1 98  ? 34.461 17.980  -17.832 1.00 28.55  ? 95  PRO B CG  1 
ATOM   7159  C CD  . PRO C 1 98  ? 34.002 18.524  -19.166 1.00 28.40  ? 95  PRO B CD  1 
ATOM   7160  N N   . ASN C 1 99  ? 37.579 19.017  -20.249 1.00 32.38  ? 96  ASN B N   1 
ATOM   7161  C CA  . ASN C 1 99  ? 38.826 19.062  -21.001 1.00 38.59  ? 96  ASN B CA  1 
ATOM   7162  C C   . ASN C 1 99  ? 39.116 20.475  -21.492 1.00 35.79  ? 96  ASN B C   1 
ATOM   7163  O O   . ASN C 1 99  ? 40.251 20.957  -21.396 1.00 40.00  ? 96  ASN B O   1 
ATOM   7164  C CB  . ASN C 1 99  ? 38.751 18.079  -22.170 1.00 33.96  ? 96  ASN B CB  1 
ATOM   7165  C CG  . ASN C 1 99  ? 38.391 16.675  -21.723 1.00 42.50  ? 96  ASN B CG  1 
ATOM   7166  O OD1 . ASN C 1 99  ? 39.193 15.993  -21.084 1.00 38.63  ? 96  ASN B OD1 1 
ATOM   7167  N ND2 . ASN C 1 99  ? 37.170 16.247  -22.029 1.00 35.73  ? 96  ASN B ND2 1 
ATOM   7168  N N   . GLY C 1 100 ? 38.093 21.161  -22.007 1.00 36.40  ? 97  GLY B N   1 
ATOM   7169  C CA  . GLY C 1 100 ? 38.281 22.538  -22.430 1.00 34.37  ? 97  GLY B CA  1 
ATOM   7170  C C   . GLY C 1 100 ? 38.615 23.462  -21.274 1.00 37.03  ? 97  GLY B C   1 
ATOM   7171  O O   . GLY C 1 100 ? 39.446 24.364  -21.407 1.00 38.40  ? 97  GLY B O   1 
ATOM   7172  N N   . THR C 1 101 ? 37.978 23.246  -20.121 1.00 34.76  ? 98  THR B N   1 
ATOM   7173  C CA  . THR C 1 101 ? 38.269 24.068  -18.950 1.00 40.09  ? 98  THR B CA  1 
ATOM   7174  C C   . THR C 1 101 ? 39.695 23.842  -18.462 1.00 36.41  ? 98  THR B C   1 
ATOM   7175  O O   . THR C 1 101 ? 40.437 24.800  -18.218 1.00 38.77  ? 98  THR B O   1 
ATOM   7176  C CB  . THR C 1 101 ? 37.266 23.767  -17.839 1.00 39.08  ? 98  THR B CB  1 
ATOM   7177  O OG1 . THR C 1 101 ? 35.932 23.837  -18.362 1.00 31.32  ? 98  THR B OG1 1 
ATOM   7178  C CG2 . THR C 1 101 ? 37.415 24.766  -16.702 1.00 33.50  ? 98  THR B CG2 1 
ATOM   7179  N N   . ILE C 1 102 ? 40.097 22.578  -18.326 1.00 36.50  ? 99  ILE B N   1 
ATOM   7180  C CA  . ILE C 1 102 ? 41.445 22.268  -17.857 1.00 38.76  ? 99  ILE B CA  1 
ATOM   7181  C C   . ILE C 1 102 ? 42.486 22.787  -18.843 1.00 36.67  ? 99  ILE B C   1 
ATOM   7182  O O   . ILE C 1 102 ? 43.497 23.383  -18.451 1.00 41.32  ? 99  ILE B O   1 
ATOM   7183  C CB  . ILE C 1 102 ? 41.593 20.753  -17.623 1.00 36.20  ? 99  ILE B CB  1 
ATOM   7184  C CG1 . ILE C 1 102 ? 40.686 20.301  -16.481 1.00 32.72  ? 99  ILE B CG1 1 
ATOM   7185  C CG2 . ILE C 1 102 ? 43.045 20.388  -17.345 1.00 34.30  ? 99  ILE B CG2 1 
ATOM   7186  C CD1 . ILE C 1 102 ? 40.496 18.801  -16.412 1.00 40.06  ? 99  ILE B CD1 1 
ATOM   7187  N N   . ARG C 1 103 ? 42.247 22.572  -20.140 1.00 37.53  ? 100 ARG B N   1 
ATOM   7188  C CA  . ARG C 1 103 ? 43.202 22.997  -21.161 1.00 40.25  ? 100 ARG B CA  1 
ATOM   7189  C C   . ARG C 1 103 ? 43.411 24.506  -21.136 1.00 42.06  ? 100 ARG B C   1 
ATOM   7190  O O   . ARG C 1 103 ? 44.543 24.990  -21.253 1.00 38.49  ? 100 ARG B O   1 
ATOM   7191  C CB  . ARG C 1 103 ? 42.723 22.547  -22.541 1.00 39.13  ? 100 ARG B CB  1 
ATOM   7192  C CG  . ARG C 1 103 ? 43.659 21.584  -23.252 1.00 55.26  ? 100 ARG B CG  1 
ATOM   7193  C CD  . ARG C 1 103 ? 43.146 21.241  -24.647 1.00 55.52  ? 100 ARG B CD  1 
ATOM   7194  N NE  . ARG C 1 103 ? 41.873 20.520  -24.616 1.00 59.18  ? 100 ARG B NE  1 
ATOM   7195  C CZ  . ARG C 1 103 ? 40.763 20.919  -25.234 1.00 59.60  ? 100 ARG B CZ  1 
ATOM   7196  N NH1 . ARG C 1 103 ? 39.657 20.193  -25.146 1.00 64.05  ? 100 ARG B NH1 1 
ATOM   7197  N NH2 . ARG C 1 103 ? 40.755 22.043  -25.940 1.00 64.16  ? 100 ARG B NH2 1 
ATOM   7198  N N   . ASN C 1 104 ? 42.326 25.268  -20.986 1.00 37.36  ? 101 ASN B N   1 
ATOM   7199  C CA  . ASN C 1 104 ? 42.444 26.724  -20.968 1.00 49.15  ? 101 ASN B CA  1 
ATOM   7200  C C   . ASN C 1 104 ? 43.273 27.196  -19.781 1.00 38.98  ? 101 ASN B C   1 
ATOM   7201  O O   . ASN C 1 104 ? 44.120 28.086  -19.915 1.00 46.04  ? 101 ASN B O   1 
ATOM   7202  C CB  . ASN C 1 104 ? 41.057 27.368  -20.946 1.00 43.55  ? 101 ASN B CB  1 
ATOM   7203  C CG  . ASN C 1 104 ? 40.288 27.145  -22.233 1.00 57.92  ? 101 ASN B CG  1 
ATOM   7204  O OD1 . ASN C 1 104 ? 40.807 26.570  -23.189 1.00 61.79  ? 101 ASN B OD1 1 
ATOM   7205  N ND2 . ASN C 1 104 ? 39.039 27.598  -22.261 1.00 59.14  ? 101 ASN B ND2 1 
ATOM   7206  N N   . ILE C 1 105 ? 43.048 26.603  -18.610 1.00 38.33  ? 102 ILE B N   1 
ATOM   7207  C CA  . ILE C 1 105 ? 43.767 27.033  -17.416 1.00 40.99  ? 102 ILE B CA  1 
ATOM   7208  C C   . ILE C 1 105 ? 45.239 26.645  -17.501 1.00 40.90  ? 102 ILE B C   1 
ATOM   7209  O O   . ILE C 1 105 ? 46.124 27.435  -17.150 1.00 50.86  ? 102 ILE B O   1 
ATOM   7210  C CB  . ILE C 1 105 ? 43.096 26.454  -16.156 1.00 39.63  ? 102 ILE B CB  1 
ATOM   7211  C CG1 . ILE C 1 105 ? 41.703 27.057  -15.971 1.00 39.96  ? 102 ILE B CG1 1 
ATOM   7212  C CG2 . ILE C 1 105 ? 43.967 26.680  -14.928 1.00 39.95  ? 102 ILE B CG2 1 
ATOM   7213  C CD1 . ILE C 1 105 ? 40.860 26.336  -14.948 1.00 44.41  ? 102 ILE B CD1 1 
ATOM   7214  N N   . LEU C 1 106 ? 45.528 25.431  -17.975 1.00 41.05  ? 103 LEU B N   1 
ATOM   7215  C CA  . LEU C 1 106 ? 46.904 24.944  -17.974 1.00 41.14  ? 103 LEU B CA  1 
ATOM   7216  C C   . LEU C 1 106 ? 47.686 25.386  -19.204 1.00 36.05  ? 103 LEU B C   1 
ATOM   7217  O O   . LEU C 1 106 ? 48.892 25.636  -19.103 1.00 39.58  ? 103 LEU B O   1 
ATOM   7218  C CB  . LEU C 1 106 ? 46.925 23.419  -17.880 1.00 35.19  ? 103 LEU B CB  1 
ATOM   7219  C CG  . LEU C 1 106 ? 46.381 22.771  -16.608 1.00 39.65  ? 103 LEU B CG  1 
ATOM   7220  C CD1 . LEU C 1 106 ? 46.538 21.265  -16.700 1.00 30.77  ? 103 LEU B CD1 1 
ATOM   7221  C CD2 . LEU C 1 106 ? 47.100 23.314  -15.383 1.00 39.00  ? 103 LEU B CD2 1 
ATOM   7222  N N   . GLY C 1 107 ? 47.036 25.471  -20.362 1.00 35.40  ? 104 GLY B N   1 
ATOM   7223  C CA  . GLY C 1 107 ? 47.742 25.758  -21.598 1.00 38.51  ? 104 GLY B CA  1 
ATOM   7224  C C   . GLY C 1 107 ? 48.719 24.660  -21.976 1.00 36.16  ? 104 GLY B C   1 
ATOM   7225  O O   . GLY C 1 107 ? 48.829 23.649  -21.276 1.00 34.27  ? 104 GLY B O   1 
ATOM   7226  N N   . GLY C 1 108 ? 49.431 24.840  -23.082 1.00 40.34  ? 105 GLY B N   1 
ATOM   7227  C CA  . GLY C 1 108 ? 50.452 23.886  -23.462 1.00 37.79  ? 105 GLY B CA  1 
ATOM   7228  C C   . GLY C 1 108 ? 50.221 23.187  -24.785 1.00 37.03  ? 105 GLY B C   1 
ATOM   7229  O O   . GLY C 1 108 ? 49.479 23.678  -25.643 1.00 37.29  ? 105 GLY B O   1 
ATOM   7230  N N   . THR C 1 109 ? 50.855 22.026  -24.949 1.00 33.39  ? 106 THR B N   1 
ATOM   7231  C CA  . THR C 1 109 ? 50.881 21.296  -26.209 1.00 34.56  ? 106 THR B CA  1 
ATOM   7232  C C   . THR C 1 109 ? 50.409 19.871  -25.969 1.00 30.56  ? 106 THR B C   1 
ATOM   7233  O O   . THR C 1 109 ? 50.853 19.219  -25.016 1.00 31.69  ? 106 THR B O   1 
ATOM   7234  C CB  . THR C 1 109 ? 52.296 21.288  -26.806 1.00 34.20  ? 106 THR B CB  1 
ATOM   7235  O OG1 . THR C 1 109 ? 52.759 22.635  -26.963 1.00 38.44  ? 106 THR B OG1 1 
ATOM   7236  C CG2 . THR C 1 109 ? 52.312 20.591  -28.158 1.00 33.14  ? 106 THR B CG2 1 
ATOM   7237  N N   . VAL C 1 110 ? 49.512 19.391  -26.824 1.00 28.54  ? 107 VAL B N   1 
ATOM   7238  C CA  . VAL C 1 110 ? 49.013 18.025  -26.740 1.00 38.04  ? 107 VAL B CA  1 
ATOM   7239  C C   . VAL C 1 110 ? 49.882 17.128  -27.610 1.00 32.77  ? 107 VAL B C   1 
ATOM   7240  O O   . VAL C 1 110 ? 50.158 17.448  -28.773 1.00 31.01  ? 107 VAL B O   1 
ATOM   7241  C CB  . VAL C 1 110 ? 47.538 17.947  -27.170 1.00 36.33  ? 107 VAL B CB  1 
ATOM   7242  C CG1 . VAL C 1 110 ? 47.049 16.506  -27.131 1.00 31.38  ? 107 VAL B CG1 1 
ATOM   7243  C CG2 . VAL C 1 110 ? 46.676 18.830  -26.280 1.00 27.46  ? 107 VAL B CG2 1 
ATOM   7244  N N   . PHE C 1 111 ? 50.320 16.006  -27.045 1.00 29.75  ? 108 PHE B N   1 
ATOM   7245  C CA  . PHE C 1 111 ? 51.067 14.990  -27.771 1.00 31.00  ? 108 PHE B CA  1 
ATOM   7246  C C   . PHE C 1 111 ? 50.272 13.694  -27.763 1.00 29.68  ? 108 PHE B C   1 
ATOM   7247  O O   . PHE C 1 111 ? 49.844 13.231  -26.701 1.00 33.85  ? 108 PHE B O   1 
ATOM   7248  C CB  . PHE C 1 111 ? 52.453 14.768  -27.156 1.00 32.97  ? 108 PHE B CB  1 
ATOM   7249  C CG  . PHE C 1 111 ? 53.395 15.920  -27.360 1.00 30.08  ? 108 PHE B CG  1 
ATOM   7250  C CD1 . PHE C 1 111 ? 54.126 16.032  -28.530 1.00 27.82  ? 108 PHE B CD1 1 
ATOM   7251  C CD2 . PHE C 1 111 ? 53.550 16.890  -26.382 1.00 29.52  ? 108 PHE B CD2 1 
ATOM   7252  C CE1 . PHE C 1 111 ? 54.996 17.092  -28.726 1.00 32.57  ? 108 PHE B CE1 1 
ATOM   7253  C CE2 . PHE C 1 111 ? 54.420 17.953  -26.571 1.00 34.33  ? 108 PHE B CE2 1 
ATOM   7254  C CZ  . PHE C 1 111 ? 55.143 18.054  -27.744 1.00 31.04  ? 108 PHE B CZ  1 
ATOM   7255  N N   . ARG C 1 112 ? 50.066 13.124  -28.946 1.00 30.85  ? 109 ARG B N   1 
ATOM   7256  C CA  . ARG C 1 112 ? 49.358 11.865  -29.116 1.00 29.40  ? 109 ARG B CA  1 
ATOM   7257  C C   . ARG C 1 112 ? 50.336 10.778  -29.536 1.00 33.01  ? 109 ARG B C   1 
ATOM   7258  O O   . ARG C 1 112 ? 51.307 11.040  -30.252 1.00 32.65  ? 109 ARG B O   1 
ATOM   7259  C CB  . ARG C 1 112 ? 48.255 11.990  -30.171 1.00 33.89  ? 109 ARG B CB  1 
ATOM   7260  C CG  . ARG C 1 112 ? 46.974 12.631  -29.679 1.00 42.40  ? 109 ARG B CG  1 
ATOM   7261  C CD  . ARG C 1 112 ? 46.078 12.972  -30.856 1.00 47.91  ? 109 ARG B CD  1 
ATOM   7262  N NE  . ARG C 1 112 ? 44.666 13.022  -30.491 1.00 48.94  ? 109 ARG B NE  1 
ATOM   7263  C CZ  . ARG C 1 112 ? 44.035 14.127  -30.111 1.00 52.18  ? 109 ARG B CZ  1 
ATOM   7264  N NH1 . ARG C 1 112 ? 42.747 14.088  -29.797 1.00 59.66  ? 109 ARG B NH1 1 
ATOM   7265  N NH2 . ARG C 1 112 ? 44.692 15.273  -30.049 1.00 46.00  ? 109 ARG B NH2 1 
ATOM   7266  N N   . GLU C 1 113 ? 50.069 9.551   -29.097 1.00 29.41  ? 110 GLU B N   1 
ATOM   7267  C CA  . GLU C 1 113 ? 50.952 8.435   -29.409 1.00 35.10  ? 110 GLU B CA  1 
ATOM   7268  C C   . GLU C 1 113 ? 50.158 7.141   -29.358 1.00 34.64  ? 110 GLU B C   1 
ATOM   7269  O O   . GLU C 1 113 ? 49.456 6.882   -28.378 1.00 31.34  ? 110 GLU B O   1 
ATOM   7270  C CB  . GLU C 1 113 ? 52.132 8.376   -28.427 1.00 27.19  ? 110 GLU B CB  1 
ATOM   7271  C CG  . GLU C 1 113 ? 53.105 7.232   -28.681 1.00 31.28  ? 110 GLU B CG  1 
ATOM   7272  C CD  . GLU C 1 113 ? 54.256 7.205   -27.688 1.00 35.16  ? 110 GLU B CD  1 
ATOM   7273  O OE1 . GLU C 1 113 ? 55.130 6.323   -27.819 1.00 37.33  ? 110 GLU B OE1 1 
ATOM   7274  O OE2 . GLU C 1 113 ? 54.291 8.063   -26.779 1.00 38.77  ? 110 GLU B OE2 1 
ATOM   7275  N N   . ALA C 1 114 ? 50.261 6.337   -30.410 1.00 26.59  ? 111 ALA B N   1 
ATOM   7276  C CA  . ALA C 1 114 ? 49.669 5.011   -30.380 1.00 29.94  ? 111 ALA B CA  1 
ATOM   7277  C C   . ALA C 1 114 ? 50.574 4.054   -29.615 1.00 30.07  ? 111 ALA B C   1 
ATOM   7278  O O   . ALA C 1 114 ? 51.796 4.223   -29.564 1.00 32.75  ? 111 ALA B O   1 
ATOM   7279  C CB  . ALA C 1 114 ? 49.424 4.483   -31.792 1.00 30.75  ? 111 ALA B CB  1 
ATOM   7280  N N   . ILE C 1 115 ? 49.957 3.051   -29.002 1.00 27.43  ? 112 ILE B N   1 
ATOM   7281  C CA  . ILE C 1 115 ? 50.673 1.993   -28.300 1.00 30.69  ? 112 ILE B CA  1 
ATOM   7282  C C   . ILE C 1 115 ? 50.781 0.808   -29.250 1.00 32.50  ? 112 ILE B C   1 
ATOM   7283  O O   . ILE C 1 115 ? 49.764 0.261   -29.693 1.00 29.06  ? 112 ILE B O   1 
ATOM   7284  C CB  . ILE C 1 115 ? 49.964 1.608   -26.992 1.00 31.45  ? 112 ILE B CB  1 
ATOM   7285  C CG1 . ILE C 1 115 ? 49.874 2.825   -26.070 1.00 32.19  ? 112 ILE B CG1 1 
ATOM   7286  C CG2 . ILE C 1 115 ? 50.700 0.477   -26.296 1.00 25.63  ? 112 ILE B CG2 1 
ATOM   7287  C CD1 . ILE C 1 115 ? 48.825 2.704   -24.990 1.00 33.14  ? 112 ILE B CD1 1 
ATOM   7288  N N   . ILE C 1 116 ? 52.013 0.419   -29.568 1.00 37.01  ? 113 ILE B N   1 
ATOM   7289  C CA  . ILE C 1 116 ? 52.300 -0.505  -30.659 1.00 34.82  ? 113 ILE B CA  1 
ATOM   7290  C C   . ILE C 1 116 ? 52.583 -1.890  -30.096 1.00 31.95  ? 113 ILE B C   1 
ATOM   7291  O O   . ILE C 1 116 ? 53.415 -2.049  -29.193 1.00 36.23  ? 113 ILE B O   1 
ATOM   7292  C CB  . ILE C 1 116 ? 53.485 -0.005  -31.502 1.00 35.30  ? 113 ILE B CB  1 
ATOM   7293  C CG1 . ILE C 1 116 ? 53.149 1.334   -32.152 1.00 36.10  ? 113 ILE B CG1 1 
ATOM   7294  C CG2 . ILE C 1 116 ? 53.863 -1.035  -32.556 1.00 30.44  ? 113 ILE B CG2 1 
ATOM   7295  C CD1 . ILE C 1 116 ? 52.064 1.237   -33.204 1.00 36.65  ? 113 ILE B CD1 1 
ATOM   7296  N N   . CYS C 1 117 ? 51.896 -2.891  -30.638 1.00 35.28  ? 114 CYS B N   1 
ATOM   7297  C CA  . CYS C 1 117 ? 52.138 -4.290  -30.325 1.00 33.73  ? 114 CYS B CA  1 
ATOM   7298  C C   . CYS C 1 117 ? 52.538 -5.028  -31.596 1.00 39.67  ? 114 CYS B C   1 
ATOM   7299  O O   . CYS C 1 117 ? 52.058 -4.714  -32.691 1.00 33.46  ? 114 CYS B O   1 
ATOM   7300  C CB  . CYS C 1 117 ? 50.901 -4.949  -29.710 1.00 36.23  ? 114 CYS B CB  1 
ATOM   7301  S SG  . CYS C 1 117 ? 50.325 -4.173  -28.190 1.00 35.78  ? 114 CYS B SG  1 
ATOM   7302  N N   . LYS C 1 118 ? 53.421 -6.020  -31.439 1.00 34.88  ? 115 LYS B N   1 
ATOM   7303  C CA  . LYS C 1 118 ? 53.933 -6.746  -32.597 1.00 35.14  ? 115 LYS B CA  1 
ATOM   7304  C C   . LYS C 1 118 ? 52.836 -7.524  -33.313 1.00 36.57  ? 115 LYS B C   1 
ATOM   7305  O O   . LYS C 1 118 ? 52.874 -7.658  -34.541 1.00 32.71  ? 115 LYS B O   1 
ATOM   7306  C CB  . LYS C 1 118 ? 55.051 -7.701  -32.174 1.00 40.85  ? 115 LYS B CB  1 
ATOM   7307  C CG  . LYS C 1 118 ? 56.283 -7.026  -31.591 1.00 39.40  ? 115 LYS B CG  1 
ATOM   7308  C CD  . LYS C 1 118 ? 57.149 -8.048  -30.871 1.00 49.25  ? 115 LYS B CD  1 
ATOM   7309  C CE  . LYS C 1 118 ? 58.096 -7.386  -29.887 1.00 52.47  ? 115 LYS B CE  1 
ATOM   7310  N NZ  . LYS C 1 118 ? 58.626 -8.365  -28.898 1.00 62.90  ? 115 LYS B NZ  1 
ATOM   7311  N N   . ASN C 1 119 ? 51.858 -8.043  -32.572 1.00 35.78  ? 116 ASN B N   1 
ATOM   7312  C CA  . ASN C 1 119 ? 50.807 -8.877  -33.140 1.00 34.66  ? 116 ASN B CA  1 
ATOM   7313  C C   . ASN C 1 119 ? 49.542 -8.096  -33.471 1.00 38.46  ? 116 ASN B C   1 
ATOM   7314  O O   . ASN C 1 119 ? 48.516 -8.706  -33.786 1.00 40.12  ? 116 ASN B O   1 
ATOM   7315  C CB  . ASN C 1 119 ? 50.470 -10.024 -32.186 1.00 35.99  ? 116 ASN B CB  1 
ATOM   7316  C CG  . ASN C 1 119 ? 49.900 -9.535  -30.872 1.00 38.36  ? 116 ASN B CG  1 
ATOM   7317  O OD1 . ASN C 1 119 ? 50.306 -8.492  -30.358 1.00 39.88  ? 116 ASN B OD1 1 
ATOM   7318  N ND2 . ASN C 1 119 ? 48.949 -10.279 -30.324 1.00 32.17  ? 116 ASN B ND2 1 
ATOM   7319  N N   . ILE C 1 120 ? 49.585 -6.774  -33.405 1.00 38.01  ? 117 ILE B N   1 
ATOM   7320  C CA  . ILE C 1 120 ? 48.448 -5.919  -33.741 1.00 33.42  ? 117 ILE B CA  1 
ATOM   7321  C C   . ILE C 1 120 ? 48.813 -5.110  -34.977 1.00 35.91  ? 117 ILE B C   1 
ATOM   7322  O O   . ILE C 1 120 ? 49.846 -4.428  -34.975 1.00 31.76  ? 117 ILE B O   1 
ATOM   7323  C CB  . ILE C 1 120 ? 48.060 -4.988  -32.576 1.00 35.64  ? 117 ILE B CB  1 
ATOM   7324  C CG1 . ILE C 1 120 ? 47.820 -5.802  -31.308 1.00 36.70  ? 117 ILE B CG1 1 
ATOM   7325  C CG2 . ILE C 1 120 ? 46.834 -4.160  -32.937 1.00 26.15  ? 117 ILE B CG2 1 
ATOM   7326  C CD1 . ILE C 1 120 ? 46.714 -6.823  -31.445 1.00 35.06  ? 117 ILE B CD1 1 
ATOM   7327  N N   . PRO C 1 121 ? 48.010 -5.152  -36.039 1.00 36.06  ? 118 PRO B N   1 
ATOM   7328  C CA  . PRO C 1 121 ? 48.392 -4.466  -37.275 1.00 33.13  ? 118 PRO B CA  1 
ATOM   7329  C C   . PRO C 1 121 ? 48.353 -2.958  -37.117 1.00 36.47  ? 118 PRO B C   1 
ATOM   7330  O O   . PRO C 1 121 ? 47.644 -2.411  -36.269 1.00 39.10  ? 118 PRO B O   1 
ATOM   7331  C CB  . PRO C 1 121 ? 47.340 -4.940  -38.284 1.00 35.25  ? 118 PRO B CB  1 
ATOM   7332  C CG  . PRO C 1 121 ? 46.145 -5.260  -37.445 1.00 35.99  ? 118 PRO B CG  1 
ATOM   7333  C CD  . PRO C 1 121 ? 46.700 -5.819  -36.159 1.00 36.22  ? 118 PRO B CD  1 
ATOM   7334  N N   . ARG C 1 122 ? 49.141 -2.290  -37.949 1.00 34.92  ? 119 ARG B N   1 
ATOM   7335  C CA  . ARG C 1 122 ? 49.166 -0.842  -38.041 1.00 36.89  ? 119 ARG B CA  1 
ATOM   7336  C C   . ARG C 1 122 ? 48.580 -0.427  -39.384 1.00 40.24  ? 119 ARG B C   1 
ATOM   7337  O O   . ARG C 1 122 ? 48.604 -1.193  -40.352 1.00 34.27  ? 119 ARG B O   1 
ATOM   7338  C CB  . ARG C 1 122 ? 50.595 -0.303  -37.890 1.00 33.04  ? 119 ARG B CB  1 
ATOM   7339  C CG  . ARG C 1 122 ? 51.153 -0.372  -36.471 1.00 33.61  ? 119 ARG B CG  1 
ATOM   7340  C CD  . ARG C 1 122 ? 51.710 -1.754  -36.129 1.00 35.03  ? 119 ARG B CD  1 
ATOM   7341  N NE  . ARG C 1 122 ? 52.696 -2.206  -37.108 1.00 34.19  ? 119 ARG B NE  1 
ATOM   7342  C CZ  . ARG C 1 122 ? 52.780 -3.452  -37.566 1.00 40.72  ? 119 ARG B CZ  1 
ATOM   7343  N NH1 . ARG C 1 122 ? 53.706 -3.771  -38.462 1.00 38.24  ? 119 ARG B NH1 1 
ATOM   7344  N NH2 . ARG C 1 122 ? 51.940 -4.381  -37.130 1.00 28.03  ? 119 ARG B NH2 1 
ATOM   7345  N N   . LEU C 1 123 ? 48.032 0.792   -39.428 1.00 35.81  ? 120 LEU B N   1 
ATOM   7346  C CA  . LEU C 1 123 ? 47.419 1.284   -40.659 1.00 38.68  ? 120 LEU B CA  1 
ATOM   7347  C C   . LEU C 1 123 ? 48.404 1.216   -41.821 1.00 38.71  ? 120 LEU B C   1 
ATOM   7348  O O   . LEU C 1 123 ? 48.073 0.732   -42.908 1.00 37.12  ? 120 LEU B O   1 
ATOM   7349  C CB  . LEU C 1 123 ? 46.907 2.711   -40.463 1.00 41.71  ? 120 LEU B CB  1 
ATOM   7350  C CG  . LEU C 1 123 ? 46.178 3.292   -41.677 1.00 45.40  ? 120 LEU B CG  1 
ATOM   7351  C CD1 . LEU C 1 123 ? 44.971 2.436   -42.042 1.00 49.02  ? 120 LEU B CD1 1 
ATOM   7352  C CD2 . LEU C 1 123 ? 45.765 4.732   -41.426 1.00 43.71  ? 120 LEU B CD2 1 
ATOM   7353  N N   . VAL C 1 124 ? 49.624 1.692   -41.603 1.00 40.60  ? 121 VAL B N   1 
ATOM   7354  C CA  . VAL C 1 124 ? 50.742 1.453   -42.505 1.00 40.54  ? 121 VAL B CA  1 
ATOM   7355  C C   . VAL C 1 124 ? 51.643 0.437   -41.821 1.00 38.13  ? 121 VAL B C   1 
ATOM   7356  O O   . VAL C 1 124 ? 52.152 0.693   -40.722 1.00 35.32  ? 121 VAL B O   1 
ATOM   7357  C CB  . VAL C 1 124 ? 51.501 2.749   -42.827 1.00 37.76  ? 121 VAL B CB  1 
ATOM   7358  C CG1 . VAL C 1 124 ? 52.762 2.446   -43.625 1.00 37.20  ? 121 VAL B CG1 1 
ATOM   7359  C CG2 . VAL C 1 124 ? 50.598 3.714   -43.578 1.00 35.74  ? 121 VAL B CG2 1 
ATOM   7360  N N   . SER C 1 125 ? 51.825 -0.725  -42.457 1.00 40.30  ? 122 SER B N   1 
ATOM   7361  C CA  . SER C 1 125 ? 52.533 -1.821  -41.804 1.00 41.41  ? 122 SER B CA  1 
ATOM   7362  C C   . SER C 1 125 ? 54.001 -1.501  -41.549 1.00 32.69  ? 122 SER B C   1 
ATOM   7363  O O   . SER C 1 125 ? 54.605 -2.097  -40.650 1.00 39.95  ? 122 SER B O   1 
ATOM   7364  C CB  . SER C 1 125 ? 52.417 -3.100  -42.631 1.00 40.38  ? 122 SER B CB  1 
ATOM   7365  O OG  . SER C 1 125 ? 53.114 -2.981  -43.857 1.00 51.20  ? 122 SER B OG  1 
ATOM   7366  N N   . GLY C 1 126 ? 54.589 -0.577  -42.312 1.00 37.60  ? 123 GLY B N   1 
ATOM   7367  C CA  . GLY C 1 126 ? 55.969 -0.191  -42.065 1.00 36.06  ? 123 GLY B CA  1 
ATOM   7368  C C   . GLY C 1 126 ? 56.185 0.473   -40.721 1.00 38.30  ? 123 GLY B C   1 
ATOM   7369  O O   . GLY C 1 126 ? 57.319 0.513   -40.233 1.00 31.84  ? 123 GLY B O   1 
ATOM   7370  N N   . TRP C 1 127 ? 55.124 0.995   -40.110 1.00 35.13  ? 124 TRP B N   1 
ATOM   7371  C CA  . TRP C 1 127 ? 55.216 1.591   -38.780 1.00 33.06  ? 124 TRP B CA  1 
ATOM   7372  C C   . TRP C 1 127 ? 55.423 0.481   -37.759 1.00 30.89  ? 124 TRP B C   1 
ATOM   7373  O O   . TRP C 1 127 ? 54.478 -0.212  -37.377 1.00 35.03  ? 124 TRP B O   1 
ATOM   7374  C CB  . TRP C 1 127 ? 53.960 2.394   -38.464 1.00 32.28  ? 124 TRP B CB  1 
ATOM   7375  C CG  . TRP C 1 127 ? 53.721 3.545   -39.389 1.00 37.77  ? 124 TRP B CG  1 
ATOM   7376  C CD1 . TRP C 1 127 ? 54.633 4.141   -40.212 1.00 33.18  ? 124 TRP B CD1 1 
ATOM   7377  C CD2 . TRP C 1 127 ? 52.485 4.242   -39.587 1.00 31.06  ? 124 TRP B CD2 1 
ATOM   7378  N NE1 . TRP C 1 127 ? 54.040 5.165   -40.910 1.00 28.09  ? 124 TRP B NE1 1 
ATOM   7379  C CE2 . TRP C 1 127 ? 52.722 5.249   -40.544 1.00 30.70  ? 124 TRP B CE2 1 
ATOM   7380  C CE3 . TRP C 1 127 ? 51.201 4.113   -39.048 1.00 32.13  ? 124 TRP B CE3 1 
ATOM   7381  C CZ2 . TRP C 1 127 ? 51.722 6.122   -40.974 1.00 33.18  ? 124 TRP B CZ2 1 
ATOM   7382  C CZ3 . TRP C 1 127 ? 50.210 4.981   -39.475 1.00 33.96  ? 124 TRP B CZ3 1 
ATOM   7383  C CH2 . TRP C 1 127 ? 50.476 5.972   -40.429 1.00 36.14  ? 124 TRP B CH2 1 
ATOM   7384  N N   . VAL C 1 128 ? 56.667 0.298   -37.320 1.00 32.37  ? 125 VAL B N   1 
ATOM   7385  C CA  . VAL C 1 128 ? 56.981 -0.650  -36.255 1.00 31.56  ? 125 VAL B CA  1 
ATOM   7386  C C   . VAL C 1 128 ? 57.410 0.040   -34.971 1.00 30.42  ? 125 VAL B C   1 
ATOM   7387  O O   . VAL C 1 128 ? 57.625 -0.648  -33.959 1.00 38.34  ? 125 VAL B O   1 
ATOM   7388  C CB  . VAL C 1 128 ? 58.057 -1.664  -36.696 1.00 40.08  ? 125 VAL B CB  1 
ATOM   7389  C CG1 . VAL C 1 128 ? 57.579 -2.451  -37.913 1.00 38.37  ? 125 VAL B CG1 1 
ATOM   7390  C CG2 . VAL C 1 128 ? 59.372 -0.957  -36.987 1.00 30.68  ? 125 VAL B CG2 1 
ATOM   7391  N N   . LYS C 1 129 ? 57.553 1.363   -34.978 1.00 31.68  ? 126 LYS B N   1 
ATOM   7392  C CA  . LYS C 1 129 ? 57.761 2.192   -33.805 1.00 32.36  ? 126 LYS B CA  1 
ATOM   7393  C C   . LYS C 1 129 ? 56.642 3.221   -33.713 1.00 36.98  ? 126 LYS B C   1 
ATOM   7394  O O   . LYS C 1 129 ? 56.128 3.672   -34.742 1.00 34.54  ? 126 LYS B O   1 
ATOM   7395  C CB  . LYS C 1 129 ? 59.109 2.922   -33.860 1.00 34.33  ? 126 LYS B CB  1 
ATOM   7396  C CG  . LYS C 1 129 ? 60.327 2.026   -33.719 1.00 40.58  ? 126 LYS B CG  1 
ATOM   7397  C CD  . LYS C 1 129 ? 61.586 2.758   -34.157 1.00 47.00  ? 126 LYS B CD  1 
ATOM   7398  C CE  . LYS C 1 129 ? 62.834 1.930   -33.899 1.00 57.71  ? 126 LYS B CE  1 
ATOM   7399  N NZ  . LYS C 1 129 ? 64.037 2.585   -34.481 1.00 64.68  ? 126 LYS B NZ  1 
ATOM   7400  N N   . PRO C 1 130 ? 56.241 3.611   -32.502 1.00 36.22  ? 127 PRO B N   1 
ATOM   7401  C CA  . PRO C 1 130 ? 55.169 4.604   -32.377 1.00 28.54  ? 127 PRO B CA  1 
ATOM   7402  C C   . PRO C 1 130 ? 55.575 5.939   -32.981 1.00 32.14  ? 127 PRO B C   1 
ATOM   7403  O O   . PRO C 1 130 ? 56.760 6.260   -33.105 1.00 34.06  ? 127 PRO B O   1 
ATOM   7404  C CB  . PRO C 1 130 ? 54.958 4.719   -30.861 1.00 32.30  ? 127 PRO B CB  1 
ATOM   7405  C CG  . PRO C 1 130 ? 55.524 3.451   -30.294 1.00 36.93  ? 127 PRO B CG  1 
ATOM   7406  C CD  . PRO C 1 130 ? 56.682 3.111   -31.190 1.00 32.29  ? 127 PRO B CD  1 
ATOM   7407  N N   . ILE C 1 131 ? 54.567 6.710   -33.380 1.00 27.66  ? 128 ILE B N   1 
ATOM   7408  C CA  . ILE C 1 131 ? 54.751 8.062   -33.891 1.00 28.98  ? 128 ILE B CA  1 
ATOM   7409  C C   . ILE C 1 131 ? 54.022 9.017   -32.957 1.00 31.92  ? 128 ILE B C   1 
ATOM   7410  O O   . ILE C 1 131 ? 52.853 8.792   -32.617 1.00 24.74  ? 128 ILE B O   1 
ATOM   7411  C CB  . ILE C 1 131 ? 54.235 8.208   -35.334 1.00 29.00  ? 128 ILE B CB  1 
ATOM   7412  C CG1 . ILE C 1 131 ? 55.084 7.372   -36.292 1.00 33.25  ? 128 ILE B CG1 1 
ATOM   7413  C CG2 . ILE C 1 131 ? 54.263 9.665   -35.766 1.00 28.11  ? 128 ILE B CG2 1 
ATOM   7414  C CD1 . ILE C 1 131 ? 54.461 7.200   -37.663 1.00 35.44  ? 128 ILE B CD1 1 
ATOM   7415  N N   . ILE C 1 132 ? 54.713 10.071  -32.535 1.00 26.09  ? 129 ILE B N   1 
ATOM   7416  C CA  . ILE C 1 132 ? 54.148 11.081  -31.650 1.00 25.60  ? 129 ILE B CA  1 
ATOM   7417  C C   . ILE C 1 132 ? 53.790 12.303  -32.481 1.00 31.41  ? 129 ILE B C   1 
ATOM   7418  O O   . ILE C 1 132 ? 54.632 12.835  -33.216 1.00 29.12  ? 129 ILE B O   1 
ATOM   7419  C CB  . ILE C 1 132 ? 55.129 11.451  -30.525 1.00 30.89  ? 129 ILE B CB  1 
ATOM   7420  C CG1 . ILE C 1 132 ? 55.400 10.246  -29.627 1.00 24.63  ? 129 ILE B CG1 1 
ATOM   7421  C CG2 . ILE C 1 132 ? 54.588 12.620  -29.705 1.00 28.28  ? 129 ILE B CG2 1 
ATOM   7422  C CD1 . ILE C 1 132 ? 56.472 10.496  -28.590 1.00 29.14  ? 129 ILE B CD1 1 
ATOM   7423  N N   . ILE C 1 133 ? 52.543 12.750  -32.367 1.00 25.07  ? 130 ILE B N   1 
ATOM   7424  C CA  . ILE C 1 133 ? 52.069 13.946  -33.052 1.00 30.21  ? 130 ILE B CA  1 
ATOM   7425  C C   . ILE C 1 133 ? 51.840 15.035  -32.017 1.00 35.47  ? 130 ILE B C   1 
ATOM   7426  O O   . ILE C 1 133 ? 51.118 14.828  -31.034 1.00 31.63  ? 130 ILE B O   1 
ATOM   7427  C CB  . ILE C 1 133 ? 50.787 13.674  -33.856 1.00 33.98  ? 130 ILE B CB  1 
ATOM   7428  C CG1 . ILE C 1 133 ? 51.120 12.877  -35.114 1.00 39.46  ? 130 ILE B CG1 1 
ATOM   7429  C CG2 . ILE C 1 133 ? 50.094 14.982  -34.212 1.00 40.19  ? 130 ILE B CG2 1 
ATOM   7430  C CD1 . ILE C 1 133 ? 50.064 12.967  -36.185 1.00 42.21  ? 130 ILE B CD1 1 
ATOM   7431  N N   . GLY C 1 134 ? 52.456 16.190  -32.237 1.00 33.90  ? 131 GLY B N   1 
ATOM   7432  C CA  . GLY C 1 134 ? 52.300 17.342  -31.365 1.00 34.51  ? 131 GLY B CA  1 
ATOM   7433  C C   . GLY C 1 134 ? 51.502 18.427  -32.066 1.00 37.26  ? 131 GLY B C   1 
ATOM   7434  O O   . GLY C 1 134 ? 51.706 18.691  -33.254 1.00 36.34  ? 131 GLY B O   1 
ATOM   7435  N N   . HIS C 1 135 ? 50.584 19.036  -31.322 1.00 42.39  ? 132 HIS B N   1 
ATOM   7436  C CA  . HIS C 1 135 ? 49.804 20.167  -31.796 1.00 47.42  ? 132 HIS B CA  1 
ATOM   7437  C C   . HIS C 1 135 ? 49.417 20.996  -30.584 1.00 45.26  ? 132 HIS B C   1 
ATOM   7438  O O   . HIS C 1 135 ? 49.181 20.457  -29.498 1.00 44.14  ? 132 HIS B O   1 
ATOM   7439  C CB  . HIS C 1 135 ? 48.557 19.720  -32.562 1.00 46.72  ? 132 HIS B CB  1 
ATOM   7440  C CG  . HIS C 1 135 ? 47.682 18.786  -31.788 1.00 52.14  ? 132 HIS B CG  1 
ATOM   7441  N ND1 . HIS C 1 135 ? 46.575 19.211  -31.085 1.00 57.66  ? 132 HIS B ND1 1 
ATOM   7442  C CD2 . HIS C 1 135 ? 47.764 17.449  -31.591 1.00 54.95  ? 132 HIS B CD2 1 
ATOM   7443  C CE1 . HIS C 1 135 ? 46.005 18.174  -30.499 1.00 52.29  ? 132 HIS B CE1 1 
ATOM   7444  N NE2 . HIS C 1 135 ? 46.708 17.094  -30.788 1.00 60.71  ? 132 HIS B NE2 1 
ATOM   7445  N N   . HIS C 1 136 ? 49.365 22.309  -30.773 1.00 45.61  ? 133 HIS B N   1 
ATOM   7446  C CA  . HIS C 1 136 ? 49.104 23.186  -29.648 1.00 51.66  ? 133 HIS B CA  1 
ATOM   7447  C C   . HIS C 1 136 ? 47.659 23.052  -29.180 1.00 44.66  ? 133 HIS B C   1 
ATOM   7448  O O   . HIS C 1 136 ? 46.769 22.611  -29.915 1.00 48.85  ? 133 HIS B O   1 
ATOM   7449  C CB  . HIS C 1 136 ? 49.406 24.637  -30.013 1.00 50.31  ? 133 HIS B CB  1 
ATOM   7450  C CG  . HIS C 1 136 ? 49.879 25.459  -28.856 1.00 52.09  ? 133 HIS B CG  1 
ATOM   7451  N ND1 . HIS C 1 136 ? 51.059 25.198  -28.193 1.00 46.87  ? 133 HIS B ND1 1 
ATOM   7452  C CD2 . HIS C 1 136 ? 49.323 26.524  -28.233 1.00 45.92  ? 133 HIS B CD2 1 
ATOM   7453  C CE1 . HIS C 1 136 ? 51.214 26.074  -27.215 1.00 44.66  ? 133 HIS B CE1 1 
ATOM   7454  N NE2 . HIS C 1 136 ? 50.174 26.889  -27.218 1.00 48.61  ? 133 HIS B NE2 1 
ATOM   7455  N N   . ALA C 1 137 ? 47.437 23.435  -27.928 1.00 47.49  ? 134 ALA B N   1 
ATOM   7456  C CA  . ALA C 1 137 ? 46.109 23.394  -27.333 1.00 57.25  ? 134 ALA B CA  1 
ATOM   7457  C C   . ALA C 1 137 ? 45.438 24.761  -27.417 1.00 44.43  ? 134 ALA B C   1 
ATOM   7458  O O   . ALA C 1 137 ? 44.641 25.018  -28.319 1.00 51.65  ? 134 ALA B O   1 
ATOM   7459  C CB  . ALA C 1 137 ? 46.195 22.930  -25.890 1.00 42.95  ? 134 ALA B CB  1 
ATOM   7460  N N   . ASP C 1 140 ? 43.137 26.815  -33.432 1.00 69.46  ? 137 ASP B N   1 
ATOM   7461  C CA  . ASP C 1 140 ? 43.341 27.731  -34.549 1.00 73.74  ? 137 ASP B CA  1 
ATOM   7462  C C   . ASP C 1 140 ? 42.008 28.120  -35.186 1.00 69.37  ? 137 ASP B C   1 
ATOM   7463  O O   . ASP C 1 140 ? 41.575 29.266  -35.071 1.00 63.96  ? 137 ASP B O   1 
ATOM   7464  C CB  . ASP C 1 140 ? 44.271 27.111  -35.590 1.00 70.79  ? 137 ASP B CB  1 
ATOM   7465  C CG  . ASP C 1 140 ? 45.232 28.122  -36.178 1.00 74.29  ? 137 ASP B CG  1 
ATOM   7466  O OD1 . ASP C 1 140 ? 45.306 28.218  -37.421 1.00 70.28  ? 137 ASP B OD1 1 
ATOM   7467  O OD2 . ASP C 1 140 ? 45.902 28.829  -35.394 1.00 62.02  ? 137 ASP B OD2 1 
ATOM   7468  N N   . GLN C 1 141 ? 41.365 27.168  -35.868 1.00 75.83  ? 138 GLN B N   1 
ATOM   7469  C CA  . GLN C 1 141 ? 39.979 27.363  -36.276 1.00 70.18  ? 138 GLN B CA  1 
ATOM   7470  C C   . GLN C 1 141 ? 39.004 27.178  -35.119 1.00 72.55  ? 138 GLN B C   1 
ATOM   7471  O O   . GLN C 1 141 ? 37.813 27.465  -35.281 1.00 72.37  ? 138 GLN B O   1 
ATOM   7472  C CB  . GLN C 1 141 ? 39.624 26.418  -37.439 1.00 67.47  ? 138 GLN B CB  1 
ATOM   7473  C CG  . GLN C 1 141 ? 40.128 24.978  -37.317 1.00 88.74  ? 138 GLN B CG  1 
ATOM   7474  C CD  . GLN C 1 141 ? 39.269 24.073  -36.426 1.00 87.37  ? 138 GLN B CD  1 
ATOM   7475  O OE1 . GLN C 1 141 ? 38.342 24.516  -35.747 1.00 96.10  ? 138 GLN B OE1 1 
ATOM   7476  N NE2 . GLN C 1 141 ? 39.587 22.786  -36.436 1.00 74.12  ? 138 GLN B NE2 1 
ATOM   7477  N N   . TYR C 1 142 ? 39.480 26.700  -33.967 1.00 72.08  ? 139 TYR B N   1 
ATOM   7478  C CA  . TYR C 1 142 ? 38.649 26.545  -32.779 1.00 68.72  ? 139 TYR B CA  1 
ATOM   7479  C C   . TYR C 1 142 ? 38.471 27.849  -32.011 1.00 71.39  ? 139 TYR B C   1 
ATOM   7480  O O   . TYR C 1 142 ? 37.565 27.947  -31.174 1.00 69.81  ? 139 TYR B O   1 
ATOM   7481  C CB  . TYR C 1 142 ? 39.245 25.479  -31.848 1.00 72.79  ? 139 TYR B CB  1 
ATOM   7482  C CG  . TYR C 1 142 ? 38.241 24.808  -30.933 1.00 78.42  ? 139 TYR B CG  1 
ATOM   7483  C CD1 . TYR C 1 142 ? 38.636 23.815  -30.048 1.00 84.42  ? 139 TYR B CD1 1 
ATOM   7484  C CD2 . TYR C 1 142 ? 36.900 25.166  -30.957 1.00 81.32  ? 139 TYR B CD2 1 
ATOM   7485  C CE1 . TYR C 1 142 ? 37.720 23.204  -29.207 1.00 88.14  ? 139 TYR B CE1 1 
ATOM   7486  C CE2 . TYR C 1 142 ? 35.982 24.571  -30.121 1.00 84.79  ? 139 TYR B CE2 1 
ATOM   7487  C CZ  . TYR C 1 142 ? 36.395 23.587  -29.250 1.00 90.82  ? 139 TYR B CZ  1 
ATOM   7488  O OH  . TYR C 1 142 ? 35.478 22.986  -28.420 1.00 86.72  ? 139 TYR B OH  1 
ATOM   7489  N N   . ARG C 1 143 ? 39.319 28.843  -32.262 1.00 70.85  ? 140 ARG B N   1 
ATOM   7490  C CA  . ARG C 1 143 ? 39.129 30.185  -31.729 1.00 59.26  ? 140 ARG B CA  1 
ATOM   7491  C C   . ARG C 1 143 ? 39.032 31.203  -32.863 1.00 58.53  ? 140 ARG B C   1 
ATOM   7492  O O   . ARG C 1 143 ? 39.451 32.355  -32.726 1.00 59.93  ? 140 ARG B O   1 
ATOM   7493  C CB  . ARG C 1 143 ? 40.240 30.540  -30.742 1.00 62.11  ? 140 ARG B CB  1 
ATOM   7494  C CG  . ARG C 1 143 ? 40.542 29.404  -29.766 1.00 78.63  ? 140 ARG B CG  1 
ATOM   7495  C CD  . ARG C 1 143 ? 39.784 29.554  -28.450 1.00 78.58  ? 140 ARG B CD  1 
ATOM   7496  N NE  . ARG C 1 143 ? 39.930 30.884  -27.867 1.00 88.53  ? 140 ARG B NE  1 
ATOM   7497  C CZ  . ARG C 1 143 ? 39.381 31.267  -26.717 1.00 89.21  ? 140 ARG B CZ  1 
ATOM   7498  N NH1 . ARG C 1 143 ? 39.577 32.499  -26.271 1.00 81.29  ? 140 ARG B NH1 1 
ATOM   7499  N NH2 . ARG C 1 143 ? 38.637 30.423  -26.011 1.00 84.58  ? 140 ARG B NH2 1 
ATOM   7500  N N   . ALA C 1 144 ? 38.477 30.771  -33.992 1.00 56.63  ? 141 ALA B N   1 
ATOM   7501  C CA  . ALA C 1 144 ? 38.210 31.620  -35.139 1.00 47.44  ? 141 ALA B CA  1 
ATOM   7502  C C   . ALA C 1 144 ? 36.914 32.404  -34.948 1.00 44.36  ? 141 ALA B C   1 
ATOM   7503  O O   . ALA C 1 144 ? 36.049 32.048  -34.141 1.00 41.50  ? 141 ALA B O   1 
ATOM   7504  C CB  . ALA C 1 144 ? 38.113 30.777  -36.410 1.00 40.18  ? 141 ALA B CB  1 
ATOM   7505  N N   . THR C 1 145 ? 36.783 33.480  -35.717 1.00 39.05  ? 142 THR B N   1 
ATOM   7506  C CA  . THR C 1 145 ? 35.574 34.299  -35.752 1.00 42.60  ? 142 THR B CA  1 
ATOM   7507  C C   . THR C 1 145 ? 35.000 34.199  -37.163 1.00 40.88  ? 142 THR B C   1 
ATOM   7508  O O   . THR C 1 145 ? 35.489 34.856  -38.087 1.00 39.73  ? 142 THR B O   1 
ATOM   7509  C CB  . THR C 1 145 ? 35.874 35.750  -35.377 1.00 38.66  ? 142 THR B CB  1 
ATOM   7510  O OG1 . THR C 1 145 ? 36.437 35.805  -34.060 1.00 35.58  ? 142 THR B OG1 1 
ATOM   7511  C CG2 . THR C 1 145 ? 34.597 36.583  -35.408 1.00 42.83  ? 142 THR B CG2 1 
ATOM   7512  N N   . ASP C 1 146 ? 33.963 33.382  -37.322 1.00 41.61  ? 143 ASP B N   1 
ATOM   7513  C CA  . ASP C 1 146 ? 33.337 33.140  -38.613 1.00 46.50  ? 143 ASP B CA  1 
ATOM   7514  C C   . ASP C 1 146 ? 31.946 33.756  -38.654 1.00 45.71  ? 143 ASP B C   1 
ATOM   7515  O O   . ASP C 1 146 ? 31.257 33.853  -37.633 1.00 46.56  ? 143 ASP B O   1 
ATOM   7516  C CB  . ASP C 1 146 ? 33.253 31.637  -38.913 1.00 36.95  ? 143 ASP B CB  1 
ATOM   7517  C CG  . ASP C 1 146 ? 32.333 30.896  -37.956 1.00 43.89  ? 143 ASP B CG  1 
ATOM   7518  O OD1 . ASP C 1 146 ? 32.343 31.211  -36.747 1.00 39.53  ? 143 ASP B OD1 1 
ATOM   7519  O OD2 . ASP C 1 146 ? 31.597 29.997  -38.416 1.00 42.38  ? 143 ASP B OD2 1 
ATOM   7520  N N   . PHE C 1 147 ? 31.541 34.173  -39.853 1.00 41.87  ? 144 PHE B N   1 
ATOM   7521  C CA  . PHE C 1 147 ? 30.248 34.812  -40.047 1.00 44.91  ? 144 PHE B CA  1 
ATOM   7522  C C   . PHE C 1 147 ? 29.814 34.652  -41.501 1.00 47.28  ? 144 PHE B C   1 
ATOM   7523  O O   . PHE C 1 147 ? 30.622 34.358  -42.389 1.00 41.91  ? 144 PHE B O   1 
ATOM   7524  C CB  . PHE C 1 147 ? 30.284 36.298  -39.641 1.00 37.72  ? 144 PHE B CB  1 
ATOM   7525  C CG  . PHE C 1 147 ? 31.356 37.098  -40.335 1.00 39.61  ? 144 PHE B CG  1 
ATOM   7526  C CD1 . PHE C 1 147 ? 32.637 37.193  -39.805 1.00 35.73  ? 144 PHE B CD1 1 
ATOM   7527  C CD2 . PHE C 1 147 ? 31.077 37.768  -41.514 1.00 36.45  ? 144 PHE B CD2 1 
ATOM   7528  C CE1 . PHE C 1 147 ? 33.620 37.933  -40.449 1.00 38.49  ? 144 PHE B CE1 1 
ATOM   7529  C CE2 . PHE C 1 147 ? 32.048 38.506  -42.161 1.00 42.77  ? 144 PHE B CE2 1 
ATOM   7530  C CZ  . PHE C 1 147 ? 33.323 38.591  -41.630 1.00 40.57  ? 144 PHE B CZ  1 
ATOM   7531  N N   . VAL C 1 148 ? 28.499 34.830  -41.714 1.00 40.91  ? 145 VAL B N   1 
ATOM   7532  C CA  . VAL C 1 148 ? 27.842 34.807  -43.019 1.00 47.95  ? 145 VAL B CA  1 
ATOM   7533  C C   . VAL C 1 148 ? 27.933 36.192  -43.641 1.00 44.02  ? 145 VAL B C   1 
ATOM   7534  O O   . VAL C 1 148 ? 27.776 37.206  -42.952 1.00 45.14  ? 145 VAL B O   1 
ATOM   7535  C CB  . VAL C 1 148 ? 26.366 34.375  -42.875 1.00 48.72  ? 145 VAL B CB  1 
ATOM   7536  C CG1 . VAL C 1 148 ? 25.617 34.456  -44.224 1.00 49.37  ? 145 VAL B CG1 1 
ATOM   7537  C CG2 . VAL C 1 148 ? 26.271 32.985  -42.266 1.00 45.21  ? 145 VAL B CG2 1 
ATOM   7538  N N   . VAL C 1 149 ? 28.173 36.239  -44.948 1.00 43.31  ? 146 VAL B N   1 
ATOM   7539  C CA  . VAL C 1 149 ? 28.111 37.475  -45.724 1.00 44.22  ? 146 VAL B CA  1 
ATOM   7540  C C   . VAL C 1 149 ? 26.775 37.483  -46.459 1.00 52.29  ? 146 VAL B C   1 
ATOM   7541  O O   . VAL C 1 149 ? 26.584 36.676  -47.385 1.00 49.57  ? 146 VAL B O   1 
ATOM   7542  C CB  . VAL C 1 149 ? 29.295 37.582  -46.692 1.00 43.77  ? 146 VAL B CB  1 
ATOM   7543  C CG1 . VAL C 1 149 ? 29.143 38.786  -47.585 1.00 38.99  ? 146 VAL B CG1 1 
ATOM   7544  C CG2 . VAL C 1 149 ? 30.594 37.658  -45.903 1.00 45.93  ? 146 VAL B CG2 1 
ATOM   7545  N N   . PRO C 1 150 ? 25.817 38.338  -46.079 1.00 45.43  ? 147 PRO B N   1 
ATOM   7546  C CA  . PRO C 1 150 ? 24.467 38.208  -46.649 1.00 48.69  ? 147 PRO B CA  1 
ATOM   7547  C C   . PRO C 1 150 ? 24.380 38.622  -48.105 1.00 46.28  ? 147 PRO B C   1 
ATOM   7548  O O   . PRO C 1 150 ? 23.517 38.112  -48.831 1.00 50.47  ? 147 PRO B O   1 
ATOM   7549  C CB  . PRO C 1 150 ? 23.614 39.113  -45.748 1.00 46.30  ? 147 PRO B CB  1 
ATOM   7550  C CG  . PRO C 1 150 ? 24.578 40.122  -45.220 1.00 49.21  ? 147 PRO B CG  1 
ATOM   7551  C CD  . PRO C 1 150 ? 25.879 39.382  -45.039 1.00 46.35  ? 147 PRO B CD  1 
ATOM   7552  N N   . GLY C 1 151 ? 25.246 39.518  -48.559 1.00 49.98  ? 148 GLY B N   1 
ATOM   7553  C CA  . GLY C 1 151 ? 25.191 39.990  -49.919 1.00 46.38  ? 148 GLY B CA  1 
ATOM   7554  C C   . GLY C 1 151 ? 26.429 40.768  -50.297 1.00 50.57  ? 148 GLY B C   1 
ATOM   7555  O O   . GLY C 1 151 ? 27.459 40.706  -49.618 1.00 49.35  ? 148 GLY B O   1 
ATOM   7556  N N   . PRO C 1 152 ? 26.350 41.523  -51.392 1.00 54.26  ? 149 PRO B N   1 
ATOM   7557  C CA  . PRO C 1 152 ? 27.537 42.229  -51.885 1.00 49.60  ? 149 PRO B CA  1 
ATOM   7558  C C   . PRO C 1 152 ? 28.076 43.210  -50.857 1.00 52.47  ? 149 PRO B C   1 
ATOM   7559  O O   . PRO C 1 152 ? 27.333 43.786  -50.059 1.00 49.43  ? 149 PRO B O   1 
ATOM   7560  C CB  . PRO C 1 152 ? 27.029 42.951  -53.139 1.00 49.68  ? 149 PRO B CB  1 
ATOM   7561  C CG  . PRO C 1 152 ? 25.822 42.172  -53.562 1.00 56.99  ? 149 PRO B CG  1 
ATOM   7562  C CD  . PRO C 1 152 ? 25.192 41.696  -52.285 1.00 51.62  ? 149 PRO B CD  1 
ATOM   7563  N N   . GLY C 1 153 ? 29.390 43.374  -50.875 1.00 47.87  ? 150 GLY B N   1 
ATOM   7564  C CA  . GLY C 1 153 ? 30.055 44.242  -49.929 1.00 45.73  ? 150 GLY B CA  1 
ATOM   7565  C C   . GLY C 1 153 ? 31.530 43.902  -49.841 1.00 54.29  ? 150 GLY B C   1 
ATOM   7566  O O   . GLY C 1 153 ? 32.057 43.115  -50.629 1.00 56.16  ? 150 GLY B O   1 
ATOM   7567  N N   . LYS C 1 154 ? 32.177 44.509  -48.851 1.00 49.57  ? 151 LYS B N   1 
ATOM   7568  C CA  . LYS C 1 154 ? 33.616 44.409  -48.665 1.00 47.31  ? 151 LYS B CA  1 
ATOM   7569  C C   . LYS C 1 154 ? 33.915 43.834  -47.288 1.00 50.01  ? 151 LYS B C   1 
ATOM   7570  O O   . LYS C 1 154 ? 33.399 44.326  -46.278 1.00 46.15  ? 151 LYS B O   1 
ATOM   7571  C CB  . LYS C 1 154 ? 34.278 45.782  -48.829 1.00 46.70  ? 151 LYS B CB  1 
ATOM   7572  C CG  . LYS C 1 154 ? 35.783 45.785  -48.625 1.00 56.20  ? 151 LYS B CG  1 
ATOM   7573  C CD  . LYS C 1 154 ? 36.414 47.110  -49.042 1.00 60.68  ? 151 LYS B CD  1 
ATOM   7574  C CE  . LYS C 1 154 ? 36.421 47.273  -50.556 1.00 63.06  ? 151 LYS B CE  1 
ATOM   7575  N NZ  . LYS C 1 154 ? 37.452 48.242  -51.027 1.00 62.68  ? 151 LYS B NZ  1 
ATOM   7576  N N   . VAL C 1 155 ? 34.733 42.786  -47.255 1.00 44.68  ? 152 VAL B N   1 
ATOM   7577  C CA  . VAL C 1 155 ? 35.262 42.227  -46.017 1.00 38.87  ? 152 VAL B CA  1 
ATOM   7578  C C   . VAL C 1 155 ? 36.726 42.631  -45.909 1.00 42.85  ? 152 VAL B C   1 
ATOM   7579  O O   . VAL C 1 155 ? 37.525 42.353  -46.813 1.00 40.68  ? 152 VAL B O   1 
ATOM   7580  C CB  . VAL C 1 155 ? 35.107 40.699  -45.974 1.00 43.70  ? 152 VAL B CB  1 
ATOM   7581  C CG1 . VAL C 1 155 ? 35.847 40.126  -44.771 1.00 39.37  ? 152 VAL B CG1 1 
ATOM   7582  C CG2 . VAL C 1 155 ? 33.635 40.314  -45.927 1.00 42.81  ? 152 VAL B CG2 1 
ATOM   7583  N N   . GLU C 1 156 ? 37.075 43.297  -44.810 1.00 39.69  ? 153 GLU B N   1 
ATOM   7584  C CA  . GLU C 1 156 ? 38.443 43.704  -44.535 1.00 40.21  ? 153 GLU B CA  1 
ATOM   7585  C C   . GLU C 1 156 ? 38.852 43.199  -43.160 1.00 38.67  ? 153 GLU B C   1 
ATOM   7586  O O   . GLU C 1 156 ? 38.013 42.912  -42.302 1.00 41.76  ? 153 GLU B O   1 
ATOM   7587  C CB  . GLU C 1 156 ? 38.611 45.229  -44.581 1.00 41.62  ? 153 GLU B CB  1 
ATOM   7588  C CG  . GLU C 1 156 ? 38.133 45.897  -45.855 1.00 41.29  ? 153 GLU B CG  1 
ATOM   7589  C CD  . GLU C 1 156 ? 38.056 47.404  -45.712 1.00 48.24  ? 153 GLU B CD  1 
ATOM   7590  O OE1 . GLU C 1 156 ? 38.792 48.115  -46.428 1.00 48.71  ? 153 GLU B OE1 1 
ATOM   7591  O OE2 . GLU C 1 156 ? 37.260 47.878  -44.874 1.00 58.43  ? 153 GLU B OE2 1 
ATOM   7592  N N   . ILE C 1 157 ? 40.161 43.105  -42.954 1.00 34.98  ? 154 ILE B N   1 
ATOM   7593  C CA  . ILE C 1 157 ? 40.738 42.762  -41.662 1.00 36.60  ? 154 ILE B CA  1 
ATOM   7594  C C   . ILE C 1 157 ? 41.812 43.796  -41.351 1.00 39.04  ? 154 ILE B C   1 
ATOM   7595  O O   . ILE C 1 157 ? 42.648 44.106  -42.208 1.00 36.74  ? 154 ILE B O   1 
ATOM   7596  C CB  . ILE C 1 157 ? 41.305 41.324  -41.646 1.00 36.95  ? 154 ILE B CB  1 
ATOM   7597  C CG1 . ILE C 1 157 ? 41.823 40.955  -40.255 1.00 32.05  ? 154 ILE B CG1 1 
ATOM   7598  C CG2 . ILE C 1 157 ? 42.392 41.136  -42.701 1.00 36.18  ? 154 ILE B CG2 1 
ATOM   7599  C CD1 . ILE C 1 157 ? 42.127 39.477  -40.104 1.00 33.88  ? 154 ILE B CD1 1 
ATOM   7600  N N   . THR C 1 158 ? 41.765 44.360  -40.145 1.00 35.73  ? 155 THR B N   1 
ATOM   7601  C CA  . THR C 1 158 ? 42.624 45.477  -39.779 1.00 36.83  ? 155 THR B CA  1 
ATOM   7602  C C   . THR C 1 158 ? 43.403 45.177  -38.506 1.00 31.25  ? 155 THR B C   1 
ATOM   7603  O O   . THR C 1 158 ? 42.977 44.381  -37.664 1.00 34.53  ? 155 THR B O   1 
ATOM   7604  C CB  . THR C 1 158 ? 41.818 46.772  -39.580 1.00 40.26  ? 155 THR B CB  1 
ATOM   7605  O OG1 . THR C 1 158 ? 40.991 46.650  -38.414 1.00 41.23  ? 155 THR B OG1 1 
ATOM   7606  C CG2 . THR C 1 158 ? 40.947 47.065  -40.797 1.00 31.09  ? 155 THR B CG2 1 
ATOM   7607  N N   . TYR C 1 159 ? 44.549 45.840  -38.377 1.00 38.31  ? 156 TYR B N   1 
ATOM   7608  C CA  . TYR C 1 159 ? 45.402 45.769  -37.197 1.00 39.00  ? 156 TYR B CA  1 
ATOM   7609  C C   . TYR C 1 159 ? 45.592 47.183  -36.671 1.00 33.77  ? 156 TYR B C   1 
ATOM   7610  O O   . TYR C 1 159 ? 46.114 48.047  -37.384 1.00 37.28  ? 156 TYR B O   1 
ATOM   7611  C CB  . TYR C 1 159 ? 46.752 45.130  -37.533 1.00 34.50  ? 156 TYR B CB  1 
ATOM   7612  C CG  . TYR C 1 159 ? 47.831 45.364  -36.496 1.00 41.88  ? 156 TYR B CG  1 
ATOM   7613  C CD1 . TYR C 1 159 ? 47.685 44.894  -35.197 1.00 35.64  ? 156 TYR B CD1 1 
ATOM   7614  C CD2 . TYR C 1 159 ? 48.998 46.051  -36.817 1.00 35.68  ? 156 TYR B CD2 1 
ATOM   7615  C CE1 . TYR C 1 159 ? 48.666 45.102  -34.247 1.00 35.81  ? 156 TYR B CE1 1 
ATOM   7616  C CE2 . TYR C 1 159 ? 49.988 46.263  -35.871 1.00 33.32  ? 156 TYR B CE2 1 
ATOM   7617  C CZ  . TYR C 1 159 ? 49.816 45.786  -34.587 1.00 36.53  ? 156 TYR B CZ  1 
ATOM   7618  O OH  . TYR C 1 159 ? 50.792 45.993  -33.639 1.00 32.10  ? 156 TYR B OH  1 
ATOM   7619  N N   . THR C 1 160 ? 45.161 47.424  -35.434 1.00 38.38  ? 157 THR B N   1 
ATOM   7620  C CA  . THR C 1 160 ? 45.304 48.741  -34.822 1.00 39.55  ? 157 THR B CA  1 
ATOM   7621  C C   . THR C 1 160 ? 46.318 48.673  -33.690 1.00 37.29  ? 157 THR B C   1 
ATOM   7622  O O   . THR C 1 160 ? 45.988 48.206  -32.588 1.00 42.35  ? 157 THR B O   1 
ATOM   7623  C CB  . THR C 1 160 ? 43.958 49.251  -34.304 1.00 41.30  ? 157 THR B CB  1 
ATOM   7624  O OG1 . THR C 1 160 ? 42.995 49.222  -35.364 1.00 34.71  ? 157 THR B OG1 1 
ATOM   7625  C CG2 . THR C 1 160 ? 44.099 50.678  -33.785 1.00 35.55  ? 157 THR B CG2 1 
ATOM   7626  N N   . PRO C 1 161 ? 47.556 49.119  -33.907 1.00 35.80  ? 158 PRO B N   1 
ATOM   7627  C CA  . PRO C 1 161 ? 48.575 49.020  -32.855 1.00 39.97  ? 158 PRO B CA  1 
ATOM   7628  C C   . PRO C 1 161 ? 48.180 49.798  -31.609 1.00 39.90  ? 158 PRO B C   1 
ATOM   7629  O O   . PRO C 1 161 ? 47.489 50.816  -31.675 1.00 36.03  ? 158 PRO B O   1 
ATOM   7630  C CB  . PRO C 1 161 ? 49.830 49.614  -33.510 1.00 40.26  ? 158 PRO B CB  1 
ATOM   7631  C CG  . PRO C 1 161 ? 49.355 50.325  -34.735 1.00 42.70  ? 158 PRO B CG  1 
ATOM   7632  C CD  . PRO C 1 161 ? 48.101 49.646  -35.169 1.00 37.55  ? 158 PRO B CD  1 
ATOM   7633  N N   . SER C 1 162 ? 48.636 49.297  -30.460 1.00 42.37  ? 159 SER B N   1 
ATOM   7634  C CA  . SER C 1 162 ? 48.286 49.858  -29.162 1.00 38.30  ? 159 SER B CA  1 
ATOM   7635  C C   . SER C 1 162 ? 48.977 51.183  -28.865 1.00 39.40  ? 159 SER B C   1 
ATOM   7636  O O   . SER C 1 162 ? 48.680 51.783  -27.825 1.00 41.08  ? 159 SER B O   1 
ATOM   7637  C CB  . SER C 1 162 ? 48.621 48.856  -28.054 1.00 39.35  ? 159 SER B CB  1 
ATOM   7638  O OG  . SER C 1 162 ? 47.928 47.633  -28.233 1.00 44.73  ? 159 SER B OG  1 
ATOM   7639  N N   . ASP C 1 163 ? 49.878 51.661  -29.726 1.00 38.88  ? 160 ASP B N   1 
ATOM   7640  C CA  . ASP C 1 163 ? 50.658 52.861  -29.444 1.00 47.43  ? 160 ASP B CA  1 
ATOM   7641  C C   . ASP C 1 163 ? 50.247 54.053  -30.303 1.00 45.11  ? 160 ASP B C   1 
ATOM   7642  O O   . ASP C 1 163 ? 51.036 54.986  -30.479 1.00 46.65  ? 160 ASP B O   1 
ATOM   7643  C CB  . ASP C 1 163 ? 52.152 52.575  -29.616 1.00 45.70  ? 160 ASP B CB  1 
ATOM   7644  C CG  . ASP C 1 163 ? 52.501 52.079  -31.010 1.00 43.59  ? 160 ASP B CG  1 
ATOM   7645  O OD1 . ASP C 1 163 ? 51.653 52.180  -31.923 1.00 41.57  ? 160 ASP B OD1 1 
ATOM   7646  O OD2 . ASP C 1 163 ? 53.631 51.582  -31.196 1.00 46.46  ? 160 ASP B OD2 1 
ATOM   7647  N N   . GLY C 1 164 ? 49.032 54.037  -30.851 1.00 47.03  ? 161 GLY B N   1 
ATOM   7648  C CA  . GLY C 1 164 ? 48.532 55.139  -31.645 1.00 41.74  ? 161 GLY B CA  1 
ATOM   7649  C C   . GLY C 1 164 ? 49.046 55.211  -33.068 1.00 48.33  ? 161 GLY B C   1 
ATOM   7650  O O   . GLY C 1 164 ? 48.536 56.025  -33.852 1.00 49.47  ? 161 GLY B O   1 
ATOM   7651  N N   . THR C 1 165 ? 50.025 54.389  -33.440 1.00 44.51  ? 162 THR B N   1 
ATOM   7652  C CA  . THR C 1 165 ? 50.571 54.477  -34.785 1.00 44.11  ? 162 THR B CA  1 
ATOM   7653  C C   . THR C 1 165 ? 49.575 53.947  -35.818 1.00 43.33  ? 162 THR B C   1 
ATOM   7654  O O   . THR C 1 165 ? 48.521 53.393  -35.493 1.00 34.70  ? 162 THR B O   1 
ATOM   7655  C CB  . THR C 1 165 ? 51.896 53.722  -34.880 1.00 42.73  ? 162 THR B CB  1 
ATOM   7656  O OG1 . THR C 1 165 ? 51.731 52.391  -34.367 1.00 47.23  ? 162 THR B OG1 1 
ATOM   7657  C CG2 . THR C 1 165 ? 52.978 54.445  -34.091 1.00 38.49  ? 162 THR B CG2 1 
ATOM   7658  N N   . GLN C 1 166 ? 49.950 54.118  -37.084 1.00 44.98  ? 163 GLN B N   1 
ATOM   7659  C CA  . GLN C 1 166 ? 49.062 53.912  -38.223 1.00 47.36  ? 163 GLN B CA  1 
ATOM   7660  C C   . GLN C 1 166 ? 48.491 52.500  -38.265 1.00 48.43  ? 163 GLN B C   1 
ATOM   7661  O O   . GLN C 1 166 ? 49.236 51.515  -38.265 1.00 40.91  ? 163 GLN B O   1 
ATOM   7662  C CB  . GLN C 1 166 ? 49.836 54.209  -39.510 1.00 42.75  ? 163 GLN B CB  1 
ATOM   7663  C CG  . GLN C 1 166 ? 48.996 54.212  -40.768 1.00 49.44  ? 163 GLN B CG  1 
ATOM   7664  C CD  . GLN C 1 166 ? 47.899 55.252  -40.734 1.00 60.21  ? 163 GLN B CD  1 
ATOM   7665  O OE1 . GLN C 1 166 ? 48.115 56.386  -40.308 1.00 62.81  ? 163 GLN B OE1 1 
ATOM   7666  N NE2 . GLN C 1 166 ? 46.709 54.870  -41.186 1.00 55.40  ? 163 GLN B NE2 1 
ATOM   7667  N N   . LYS C 1 167 ? 47.163 52.408  -38.314 1.00 43.44  ? 164 LYS B N   1 
ATOM   7668  C CA  . LYS C 1 167 ? 46.513 51.117  -38.476 1.00 47.13  ? 164 LYS B CA  1 
ATOM   7669  C C   . LYS C 1 167 ? 46.661 50.626  -39.912 1.00 46.89  ? 164 LYS B C   1 
ATOM   7670  O O   . LYS C 1 167 ? 46.742 51.412  -40.861 1.00 48.99  ? 164 LYS B O   1 
ATOM   7671  C CB  . LYS C 1 167 ? 45.033 51.199  -38.087 1.00 43.69  ? 164 LYS B CB  1 
ATOM   7672  C CG  . LYS C 1 167 ? 44.139 51.907  -39.094 1.00 42.47  ? 164 LYS B CG  1 
ATOM   7673  C CD  . LYS C 1 167 ? 42.687 51.959  -38.621 1.00 55.41  ? 164 LYS B CD  1 
ATOM   7674  C CE  . LYS C 1 167 ? 42.005 50.598  -38.712 1.00 52.62  ? 164 LYS B CE  1 
ATOM   7675  N NZ  . LYS C 1 167 ? 40.559 50.667  -38.342 1.00 60.27  ? 164 LYS B NZ  1 
ATOM   7676  N N   . VAL C 1 168 ? 46.715 49.304  -40.060 1.00 41.06  ? 165 VAL B N   1 
ATOM   7677  C CA  . VAL C 1 168 ? 46.933 48.648  -41.344 1.00 37.96  ? 165 VAL B CA  1 
ATOM   7678  C C   . VAL C 1 168 ? 45.668 47.889  -41.715 1.00 36.71  ? 165 VAL B C   1 
ATOM   7679  O O   . VAL C 1 168 ? 45.115 47.152  -40.890 1.00 41.99  ? 165 VAL B O   1 
ATOM   7680  C CB  . VAL C 1 168 ? 48.145 47.701  -41.292 1.00 38.29  ? 165 VAL B CB  1 
ATOM   7681  C CG1 . VAL C 1 168 ? 48.515 47.228  -42.690 1.00 41.67  ? 165 VAL B CG1 1 
ATOM   7682  C CG2 . VAL C 1 168 ? 49.326 48.389  -40.619 1.00 40.73  ? 165 VAL B CG2 1 
ATOM   7683  N N   . THR C 1 169 ? 45.219 48.063  -42.954 1.00 40.34  ? 166 THR B N   1 
ATOM   7684  C CA  . THR C 1 169 ? 43.995 47.444  -43.445 1.00 42.03  ? 166 THR B CA  1 
ATOM   7685  C C   . THR C 1 169 ? 44.324 46.471  -44.569 1.00 34.79  ? 166 THR B C   1 
ATOM   7686  O O   . THR C 1 169 ? 45.100 46.799  -45.474 1.00 42.01  ? 166 THR B O   1 
ATOM   7687  C CB  . THR C 1 169 ? 43.004 48.503  -43.935 1.00 38.36  ? 166 THR B CB  1 
ATOM   7688  O OG1 . THR C 1 169 ? 42.689 49.397  -42.862 1.00 43.00  ? 166 THR B OG1 1 
ATOM   7689  C CG2 . THR C 1 169 ? 41.721 47.848  -44.434 1.00 38.24  ? 166 THR B CG2 1 
ATOM   7690  N N   . TYR C 1 170 ? 43.734 45.281  -44.503 1.00 36.57  ? 167 TYR B N   1 
ATOM   7691  C CA  . TYR C 1 170 ? 43.895 44.246  -45.513 1.00 36.80  ? 167 TYR B CA  1 
ATOM   7692  C C   . TYR C 1 170 ? 42.525 43.882  -46.064 1.00 39.39  ? 167 TYR B C   1 
ATOM   7693  O O   . TYR C 1 170 ? 41.594 43.620  -45.294 1.00 34.05  ? 167 TYR B O   1 
ATOM   7694  C CB  . TYR C 1 170 ? 44.556 42.992  -44.930 1.00 34.44  ? 167 TYR B CB  1 
ATOM   7695  C CG  . TYR C 1 170 ? 45.900 43.221  -44.284 1.00 35.85  ? 167 TYR B CG  1 
ATOM   7696  C CD1 . TYR C 1 170 ? 47.072 43.109  -45.019 1.00 33.61  ? 167 TYR B CD1 1 
ATOM   7697  C CD2 . TYR C 1 170 ? 45.999 43.534  -42.935 1.00 37.31  ? 167 TYR B CD2 1 
ATOM   7698  C CE1 . TYR C 1 170 ? 48.305 43.310  -44.430 1.00 37.93  ? 167 TYR B CE1 1 
ATOM   7699  C CE2 . TYR C 1 170 ? 47.227 43.738  -42.337 1.00 37.09  ? 167 TYR B CE2 1 
ATOM   7700  C CZ  . TYR C 1 170 ? 48.377 43.624  -43.089 1.00 39.09  ? 167 TYR B CZ  1 
ATOM   7701  O OH  . TYR C 1 170 ? 49.603 43.826  -42.498 1.00 40.09  ? 167 TYR B OH  1 
ATOM   7702  N N   . LEU C 1 171 ? 42.405 43.857  -47.388 1.00 37.36  ? 168 LEU B N   1 
ATOM   7703  C CA  . LEU C 1 171 ? 41.176 43.412  -48.030 1.00 43.27  ? 168 LEU B CA  1 
ATOM   7704  C C   . LEU C 1 171 ? 41.140 41.890  -48.048 1.00 40.45  ? 168 LEU B C   1 
ATOM   7705  O O   . LEU C 1 171 ? 42.008 41.250  -48.650 1.00 43.98  ? 168 LEU B O   1 
ATOM   7706  C CB  . LEU C 1 171 ? 41.079 43.965  -49.451 1.00 48.00  ? 168 LEU B CB  1 
ATOM   7707  C CG  . LEU C 1 171 ? 39.923 43.437  -50.308 1.00 49.93  ? 168 LEU B CG  1 
ATOM   7708  C CD1 . LEU C 1 171 ? 38.587 43.897  -49.755 1.00 42.81  ? 168 LEU B CD1 1 
ATOM   7709  C CD2 . LEU C 1 171 ? 40.082 43.865  -51.761 1.00 48.87  ? 168 LEU B CD2 1 
ATOM   7710  N N   . VAL C 1 172 ? 40.146 41.307  -47.381 1.00 38.92  ? 169 VAL B N   1 
ATOM   7711  C CA  . VAL C 1 172 ? 39.940 39.867  -47.481 1.00 37.99  ? 169 VAL B CA  1 
ATOM   7712  C C   . VAL C 1 172 ? 39.272 39.520  -48.804 1.00 42.34  ? 169 VAL B C   1 
ATOM   7713  O O   . VAL C 1 172 ? 39.783 38.708  -49.585 1.00 41.07  ? 169 VAL B O   1 
ATOM   7714  C CB  . VAL C 1 172 ? 39.121 39.352  -46.284 1.00 41.39  ? 169 VAL B CB  1 
ATOM   7715  C CG1 . VAL C 1 172 ? 38.810 37.870  -46.454 1.00 33.26  ? 169 VAL B CG1 1 
ATOM   7716  C CG2 . VAL C 1 172 ? 39.867 39.600  -44.983 1.00 40.99  ? 169 VAL B CG2 1 
ATOM   7717  N N   . HIS C 1 173 ? 38.130 40.144  -49.085 1.00 41.22  ? 170 HIS B N   1 
ATOM   7718  C CA  . HIS C 1 173 ? 37.429 39.888  -50.333 1.00 47.62  ? 170 HIS B CA  1 
ATOM   7719  C C   . HIS C 1 173 ? 36.442 41.007  -50.621 1.00 52.86  ? 170 HIS B C   1 
ATOM   7720  O O   . HIS C 1 173 ? 35.891 41.627  -49.707 1.00 46.31  ? 170 HIS B O   1 
ATOM   7721  C CB  . HIS C 1 173 ? 36.690 38.546  -50.310 1.00 41.28  ? 170 HIS B CB  1 
ATOM   7722  C CG  . HIS C 1 173 ? 36.106 38.172  -51.636 1.00 55.74  ? 170 HIS B CG  1 
ATOM   7723  N ND1 . HIS C 1 173 ? 36.810 38.289  -52.816 1.00 54.42  ? 170 HIS B ND1 1 
ATOM   7724  C CD2 . HIS C 1 173 ? 34.880 37.705  -51.974 1.00 51.96  ? 170 HIS B CD2 1 
ATOM   7725  C CE1 . HIS C 1 173 ? 36.047 37.902  -53.822 1.00 51.10  ? 170 HIS B CE1 1 
ATOM   7726  N NE2 . HIS C 1 173 ? 34.871 37.541  -53.339 1.00 51.74  ? 170 HIS B NE2 1 
ATOM   7727  N N   . ASN C 1 174 ? 36.224 41.240  -51.910 1.00 53.89  ? 171 ASN B N   1 
ATOM   7728  C CA  . ASN C 1 174 ? 35.228 42.178  -52.415 1.00 51.55  ? 171 ASN B CA  1 
ATOM   7729  C C   . ASN C 1 174 ? 34.106 41.357  -53.041 1.00 46.61  ? 171 ASN B C   1 
ATOM   7730  O O   . ASN C 1 174 ? 34.231 40.886  -54.175 1.00 52.32  ? 171 ASN B O   1 
ATOM   7731  C CB  . ASN C 1 174 ? 35.848 43.134  -53.429 1.00 53.28  ? 171 ASN B CB  1 
ATOM   7732  C CG  . ASN C 1 174 ? 35.405 44.566  -53.227 1.00 63.71  ? 171 ASN B CG  1 
ATOM   7733  O OD1 . ASN C 1 174 ? 36.229 45.473  -53.121 1.00 71.40  ? 171 ASN B OD1 1 
ATOM   7734  N ND2 . ASN C 1 174 ? 34.094 44.778  -53.171 1.00 60.47  ? 171 ASN B ND2 1 
ATOM   7735  N N   . PHE C 1 175 ? 33.017 41.179  -52.299 1.00 49.74  ? 172 PHE B N   1 
ATOM   7736  C CA  . PHE C 1 175 ? 31.844 40.472  -52.807 1.00 47.89  ? 172 PHE B CA  1 
ATOM   7737  C C   . PHE C 1 175 ? 31.119 41.393  -53.779 1.00 54.99  ? 172 PHE B C   1 
ATOM   7738  O O   . PHE C 1 175 ? 30.359 42.273  -53.368 1.00 49.79  ? 172 PHE B O   1 
ATOM   7739  C CB  . PHE C 1 175 ? 30.926 40.049  -51.663 1.00 51.23  ? 172 PHE B CB  1 
ATOM   7740  C CG  . PHE C 1 175 ? 31.449 38.896  -50.851 1.00 50.40  ? 172 PHE B CG  1 
ATOM   7741  C CD1 . PHE C 1 175 ? 32.426 39.092  -49.887 1.00 49.78  ? 172 PHE B CD1 1 
ATOM   7742  C CD2 . PHE C 1 175 ? 30.950 37.617  -51.041 1.00 49.87  ? 172 PHE B CD2 1 
ATOM   7743  C CE1 . PHE C 1 175 ? 32.906 38.030  -49.134 1.00 42.39  ? 172 PHE B CE1 1 
ATOM   7744  C CE2 . PHE C 1 175 ? 31.423 36.551  -50.292 1.00 54.09  ? 172 PHE B CE2 1 
ATOM   7745  C CZ  . PHE C 1 175 ? 32.403 36.759  -49.337 1.00 47.80  ? 172 PHE B CZ  1 
ATOM   7746  N N   . GLU C 1 176 ? 31.359 41.205  -55.079 1.00 61.38  ? 173 GLU B N   1 
ATOM   7747  C CA  . GLU C 1 176 ? 30.689 42.035  -56.075 1.00 62.23  ? 173 GLU B CA  1 
ATOM   7748  C C   . GLU C 1 176 ? 29.279 41.532  -56.363 1.00 57.48  ? 173 GLU B C   1 
ATOM   7749  O O   . GLU C 1 176 ? 28.365 42.332  -56.595 1.00 61.05  ? 173 GLU B O   1 
ATOM   7750  C CB  . GLU C 1 176 ? 31.512 42.085  -57.363 1.00 55.65  ? 173 GLU B CB  1 
ATOM   7751  C CG  . GLU C 1 176 ? 32.725 43.000  -57.290 1.00 59.72  ? 173 GLU B CG  1 
ATOM   7752  C CD  . GLU C 1 176 ? 33.654 42.835  -58.479 1.00 76.17  ? 173 GLU B CD  1 
ATOM   7753  O OE1 . GLU C 1 176 ? 34.339 43.814  -58.844 1.00 84.44  ? 173 GLU B OE1 1 
ATOM   7754  O OE2 . GLU C 1 176 ? 33.700 41.723  -59.046 1.00 75.59  ? 173 GLU B OE2 1 
ATOM   7755  N N   . GLU C 1 177 ? 29.086 40.214  -56.350 1.00 55.79  ? 174 GLU B N   1 
ATOM   7756  C CA  . GLU C 1 177 ? 27.790 39.592  -56.581 1.00 61.47  ? 174 GLU B CA  1 
ATOM   7757  C C   . GLU C 1 177 ? 27.494 38.607  -55.460 1.00 60.28  ? 174 GLU B C   1 
ATOM   7758  O O   . GLU C 1 177 ? 28.371 37.842  -55.049 1.00 67.45  ? 174 GLU B O   1 
ATOM   7759  C CB  . GLU C 1 177 ? 27.747 38.854  -57.925 1.00 70.42  ? 174 GLU B CB  1 
ATOM   7760  C CG  . GLU C 1 177 ? 27.428 39.716  -59.134 1.00 82.88  ? 174 GLU B CG  1 
ATOM   7761  C CD  . GLU C 1 177 ? 27.155 38.879  -60.373 1.00 94.52  ? 174 GLU B CD  1 
ATOM   7762  O OE1 . GLU C 1 177 ? 27.293 37.639  -60.294 1.00 86.54  ? 174 GLU B OE1 1 
ATOM   7763  O OE2 . GLU C 1 177 ? 26.805 39.456  -61.424 1.00 95.53  ? 174 GLU B OE2 1 
ATOM   7764  N N   . GLY C 1 178 ? 26.255 38.625  -54.977 1.00 55.85  ? 175 GLY B N   1 
ATOM   7765  C CA  . GLY C 1 178 ? 25.835 37.696  -53.948 1.00 52.36  ? 175 GLY B CA  1 
ATOM   7766  C C   . GLY C 1 178 ? 26.637 37.811  -52.655 1.00 57.80  ? 175 GLY B C   1 
ATOM   7767  O O   . GLY C 1 178 ? 27.447 38.714  -52.449 1.00 53.53  ? 175 GLY B O   1 
ATOM   7768  N N   . GLY C 1 179 ? 26.382 36.845  -51.777 1.00 51.17  ? 176 GLY B N   1 
ATOM   7769  C CA  . GLY C 1 179 ? 27.049 36.794  -50.492 1.00 51.61  ? 176 GLY B CA  1 
ATOM   7770  C C   . GLY C 1 179 ? 27.905 35.559  -50.303 1.00 49.56  ? 176 GLY B C   1 
ATOM   7771  O O   . GLY C 1 179 ? 28.453 35.019  -51.269 1.00 54.70  ? 176 GLY B O   1 
ATOM   7772  N N   . GLY C 1 180 ? 28.025 35.101  -49.058 1.00 51.15  ? 177 GLY B N   1 
ATOM   7773  C CA  . GLY C 1 180 ? 28.856 33.954  -48.744 1.00 52.63  ? 177 GLY B CA  1 
ATOM   7774  C C   . GLY C 1 180 ? 29.261 33.894  -47.286 1.00 52.14  ? 177 GLY B C   1 
ATOM   7775  O O   . GLY C 1 180 ? 28.448 34.171  -46.398 1.00 48.74  ? 177 GLY B O   1 
ATOM   7776  N N   . VAL C 1 181 ? 30.521 33.531  -47.025 1.00 46.05  ? 178 VAL B N   1 
ATOM   7777  C CA  . VAL C 1 181 ? 31.049 33.438  -45.670 1.00 45.48  ? 178 VAL B CA  1 
ATOM   7778  C C   . VAL C 1 181 ? 32.458 34.012  -45.632 1.00 42.94  ? 178 VAL B C   1 
ATOM   7779  O O   . VAL C 1 181 ? 33.151 34.097  -46.648 1.00 46.28  ? 178 VAL B O   1 
ATOM   7780  C CB  . VAL C 1 181 ? 31.060 31.987  -45.133 1.00 45.39  ? 178 VAL B CB  1 
ATOM   7781  C CG1 . VAL C 1 181 ? 29.645 31.520  -44.827 1.00 42.96  ? 178 VAL B CG1 1 
ATOM   7782  C CG2 . VAL C 1 181 ? 31.740 31.051  -46.125 1.00 39.54  ? 178 VAL B CG2 1 
ATOM   7783  N N   . ALA C 1 182 ? 32.872 34.410  -44.432 1.00 40.72  ? 179 ALA B N   1 
ATOM   7784  C CA  . ALA C 1 182 ? 34.204 34.939  -44.190 1.00 36.45  ? 179 ALA B CA  1 
ATOM   7785  C C   . ALA C 1 182 ? 34.560 34.665  -42.738 1.00 38.40  ? 179 ALA B C   1 
ATOM   7786  O O   . ALA C 1 182 ? 33.683 34.422  -41.904 1.00 35.84  ? 179 ALA B O   1 
ATOM   7787  C CB  . ALA C 1 182 ? 34.287 36.439  -44.496 1.00 33.53  ? 179 ALA B CB  1 
ATOM   7788  N N   . MET C 1 183 ? 35.856 34.708  -42.435 1.00 37.34  ? 180 MET B N   1 
ATOM   7789  C CA  . MET C 1 183 ? 36.277 34.451  -41.064 1.00 42.31  ? 180 MET B CA  1 
ATOM   7790  C C   . MET C 1 183 ? 37.684 34.979  -40.832 1.00 40.40  ? 180 MET B C   1 
ATOM   7791  O O   . MET C 1 183 ? 38.447 35.215  -41.773 1.00 37.22  ? 180 MET B O   1 
ATOM   7792  C CB  . MET C 1 183 ? 36.203 32.958  -40.718 1.00 38.81  ? 180 MET B CB  1 
ATOM   7793  C CG  . MET C 1 183 ? 37.208 32.066  -41.429 1.00 44.35  ? 180 MET B CG  1 
ATOM   7794  S SD  . MET C 1 183 ? 37.250 30.433  -40.654 1.00 54.82  ? 180 MET B SD  1 
ATOM   7795  C CE  . MET C 1 183 ? 37.007 29.351  -42.058 1.00 47.19  ? 180 MET B CE  1 
ATOM   7796  N N   . GLY C 1 184 ? 38.010 35.159  -39.560 1.00 40.75  ? 181 GLY B N   1 
ATOM   7797  C CA  . GLY C 1 184 ? 39.342 35.572  -39.147 1.00 36.04  ? 181 GLY B CA  1 
ATOM   7798  C C   . GLY C 1 184 ? 39.903 34.610  -38.119 1.00 40.12  ? 181 GLY B C   1 
ATOM   7799  O O   . GLY C 1 184 ? 39.167 34.097  -37.272 1.00 37.60  ? 181 GLY B O   1 
ATOM   7800  N N   . MET C 1 185 ? 41.209 34.358  -38.210 1.00 36.08  ? 182 MET B N   1 
ATOM   7801  C CA  . MET C 1 185 ? 41.924 33.499  -37.277 1.00 36.01  ? 182 MET B CA  1 
ATOM   7802  C C   . MET C 1 185 ? 43.206 34.195  -36.842 1.00 32.02  ? 182 MET B C   1 
ATOM   7803  O O   . MET C 1 185 ? 43.697 35.110  -37.508 1.00 34.24  ? 182 MET B O   1 
ATOM   7804  C CB  . MET C 1 185 ? 42.259 32.132  -37.891 1.00 39.46  ? 182 MET B CB  1 
ATOM   7805  C CG  . MET C 1 185 ? 41.049 31.309  -38.299 1.00 57.15  ? 182 MET B CG  1 
ATOM   7806  S SD  . MET C 1 185 ? 41.483 29.622  -38.765 1.00 77.12  ? 182 MET B SD  1 
ATOM   7807  C CE  . MET C 1 185 ? 42.750 29.931  -39.987 1.00 56.14  ? 182 MET B CE  1 
ATOM   7808  N N   . TYR C 1 186 ? 43.755 33.741  -35.718 1.00 34.24  ? 183 TYR B N   1 
ATOM   7809  C CA  . TYR C 1 186 ? 44.932 34.372  -35.143 1.00 34.39  ? 183 TYR B CA  1 
ATOM   7810  C C   . TYR C 1 186 ? 45.765 33.330  -34.412 1.00 38.12  ? 183 TYR B C   1 
ATOM   7811  O O   . TYR C 1 186 ? 45.308 32.219  -34.131 1.00 34.76  ? 183 TYR B O   1 
ATOM   7812  C CB  . TYR C 1 186 ? 44.546 35.501  -34.181 1.00 30.17  ? 183 TYR B CB  1 
ATOM   7813  C CG  . TYR C 1 186 ? 44.035 34.993  -32.851 1.00 40.91  ? 183 TYR B CG  1 
ATOM   7814  C CD1 . TYR C 1 186 ? 42.711 34.599  -32.702 1.00 33.45  ? 183 TYR B CD1 1 
ATOM   7815  C CD2 . TYR C 1 186 ? 44.877 34.899  -31.747 1.00 32.89  ? 183 TYR B CD2 1 
ATOM   7816  C CE1 . TYR C 1 186 ? 42.239 34.128  -31.492 1.00 38.85  ? 183 TYR B CE1 1 
ATOM   7817  C CE2 . TYR C 1 186 ? 44.414 34.428  -30.535 1.00 35.46  ? 183 TYR B CE2 1 
ATOM   7818  C CZ  . TYR C 1 186 ? 43.093 34.046  -30.412 1.00 35.71  ? 183 TYR B CZ  1 
ATOM   7819  O OH  . TYR C 1 186 ? 42.622 33.578  -29.208 1.00 39.58  ? 183 TYR B OH  1 
ATOM   7820  N N   . ASN C 1 187 ? 46.997 33.716  -34.093 1.00 37.44  ? 184 ASN B N   1 
ATOM   7821  C CA  . ASN C 1 187 ? 47.882 32.916  -33.262 1.00 37.66  ? 184 ASN B CA  1 
ATOM   7822  C C   . ASN C 1 187 ? 48.944 33.840  -32.691 1.00 37.55  ? 184 ASN B C   1 
ATOM   7823  O O   . ASN C 1 187 ? 49.359 34.802  -33.342 1.00 39.39  ? 184 ASN B O   1 
ATOM   7824  C CB  . ASN C 1 187 ? 48.522 31.768  -34.050 1.00 40.84  ? 184 ASN B CB  1 
ATOM   7825  C CG  . ASN C 1 187 ? 48.411 30.437  -33.329 1.00 51.73  ? 184 ASN B CG  1 
ATOM   7826  O OD1 . ASN C 1 187 ? 48.783 30.316  -32.162 1.00 48.05  ? 184 ASN B OD1 1 
ATOM   7827  N ND2 . ASN C 1 187 ? 47.882 29.435  -34.020 1.00 54.44  ? 184 ASN B ND2 1 
ATOM   7828  N N   . GLN C 1 188 ? 49.368 33.547  -31.466 1.00 39.02  ? 185 GLN B N   1 
ATOM   7829  C CA  . GLN C 1 188 ? 50.320 34.383  -30.750 1.00 35.45  ? 185 GLN B CA  1 
ATOM   7830  C C   . GLN C 1 188 ? 51.713 33.773  -30.803 1.00 34.47  ? 185 GLN B C   1 
ATOM   7831  O O   . GLN C 1 188 ? 51.868 32.549  -30.736 1.00 32.91  ? 185 GLN B O   1 
ATOM   7832  C CB  . GLN C 1 188 ? 49.897 34.573  -29.292 1.00 39.38  ? 185 GLN B CB  1 
ATOM   7833  C CG  . GLN C 1 188 ? 48.536 35.214  -29.113 1.00 39.98  ? 185 GLN B CG  1 
ATOM   7834  C CD  . GLN C 1 188 ? 47.896 34.842  -27.793 1.00 55.53  ? 185 GLN B CD  1 
ATOM   7835  O OE1 . GLN C 1 188 ? 48.119 35.500  -26.776 1.00 60.90  ? 185 GLN B OE1 1 
ATOM   7836  N NE2 . GLN C 1 188 ? 47.101 33.778  -27.799 1.00 45.51  ? 185 GLN B NE2 1 
ATOM   7837  N N   . ASP C 1 189 ? 52.723 34.642  -30.919 1.00 30.90  ? 186 ASP B N   1 
ATOM   7838  C CA  . ASP C 1 189 ? 54.112 34.194  -30.929 1.00 33.14  ? 186 ASP B CA  1 
ATOM   7839  C C   . ASP C 1 189 ? 54.419 33.292  -29.739 1.00 35.49  ? 186 ASP B C   1 
ATOM   7840  O O   . ASP C 1 189 ? 55.053 32.242  -29.888 1.00 37.30  ? 186 ASP B O   1 
ATOM   7841  C CB  . ASP C 1 189 ? 55.047 35.405  -30.933 1.00 35.71  ? 186 ASP B CB  1 
ATOM   7842  C CG  . ASP C 1 189 ? 55.262 35.972  -32.319 1.00 36.99  ? 186 ASP B CG  1 
ATOM   7843  O OD1 . ASP C 1 189 ? 54.557 35.544  -33.259 1.00 36.46  ? 186 ASP B OD1 1 
ATOM   7844  O OD2 . ASP C 1 189 ? 56.140 36.847  -32.470 1.00 48.75  ? 186 ASP B OD2 1 
ATOM   7845  N N   . LYS C 1 190 ? 53.968 33.689  -28.546 1.00 33.74  ? 187 LYS B N   1 
ATOM   7846  C CA  . LYS C 1 190 ? 54.265 32.918  -27.342 1.00 37.29  ? 187 LYS B CA  1 
ATOM   7847  C C   . LYS C 1 190 ? 53.698 31.510  -27.434 1.00 30.27  ? 187 LYS B C   1 
ATOM   7848  O O   . LYS C 1 190 ? 54.321 30.548  -26.964 1.00 37.50  ? 187 LYS B O   1 
ATOM   7849  C CB  . LYS C 1 190 ? 53.723 33.641  -26.105 1.00 37.14  ? 187 LYS B CB  1 
ATOM   7850  C CG  . LYS C 1 190 ? 53.678 32.774  -24.849 1.00 41.67  ? 187 LYS B CG  1 
ATOM   7851  C CD  . LYS C 1 190 ? 53.852 33.612  -23.593 1.00 58.67  ? 187 LYS B CD  1 
ATOM   7852  C CE  . LYS C 1 190 ? 53.164 32.989  -22.387 1.00 62.41  ? 187 LYS B CE  1 
ATOM   7853  N NZ  . LYS C 1 190 ? 51.711 32.778  -22.623 1.00 64.87  ? 187 LYS B NZ  1 
ATOM   7854  N N   . SER C 1 191 ? 52.521 31.367  -28.051 1.00 33.21  ? 188 SER B N   1 
ATOM   7855  C CA  . SER C 1 191 ? 51.947 30.041  -28.252 1.00 33.42  ? 188 SER B CA  1 
ATOM   7856  C C   . SER C 1 191 ? 52.806 29.210  -29.199 1.00 33.50  ? 188 SER B C   1 
ATOM   7857  O O   . SER C 1 191 ? 53.070 28.029  -28.940 1.00 32.53  ? 188 SER B O   1 
ATOM   7858  C CB  . SER C 1 191 ? 50.520 30.160  -28.782 1.00 35.82  ? 188 SER B CB  1 
ATOM   7859  O OG  . SER C 1 191 ? 49.757 31.068  -28.008 1.00 44.73  ? 188 SER B OG  1 
ATOM   7860  N N   . ILE C 1 192 ? 53.247 29.812  -30.305 1.00 30.40  ? 189 ILE B N   1 
ATOM   7861  C CA  . ILE C 1 192 ? 54.135 29.110  -31.227 1.00 32.79  ? 189 ILE B CA  1 
ATOM   7862  C C   . ILE C 1 192 ? 55.436 28.736  -30.525 1.00 32.80  ? 189 ILE B C   1 
ATOM   7863  O O   . ILE C 1 192 ? 55.959 27.628  -30.695 1.00 29.68  ? 189 ILE B O   1 
ATOM   7864  C CB  . ILE C 1 192 ? 54.396 29.964  -32.481 1.00 31.82  ? 189 ILE B CB  1 
ATOM   7865  C CG1 . ILE C 1 192 ? 53.087 30.240  -33.220 1.00 34.99  ? 189 ILE B CG1 1 
ATOM   7866  C CG2 . ILE C 1 192 ? 55.391 29.268  -33.403 1.00 27.46  ? 189 ILE B CG2 1 
ATOM   7867  C CD1 . ILE C 1 192 ? 53.224 31.236  -34.351 1.00 31.05  ? 189 ILE B CD1 1 
ATOM   7868  N N   . GLU C 1 193 ? 55.968 29.653  -29.711 1.00 25.47  ? 190 GLU B N   1 
ATOM   7869  C CA  . GLU C 1 193 ? 57.222 29.392  -29.010 1.00 32.56  ? 190 GLU B CA  1 
ATOM   7870  C C   . GLU C 1 193 ? 57.080 28.240  -28.020 1.00 29.45  ? 190 GLU B C   1 
ATOM   7871  O O   . GLU C 1 193 ? 57.935 27.347  -27.967 1.00 30.11  ? 190 GLU B O   1 
ATOM   7872  C CB  . GLU C 1 193 ? 57.703 30.662  -28.303 1.00 29.17  ? 190 GLU B CB  1 
ATOM   7873  C CG  . GLU C 1 193 ? 58.126 31.775  -29.253 1.00 35.71  ? 190 GLU B CG  1 
ATOM   7874  C CD  . GLU C 1 193 ? 58.242 33.122  -28.564 1.00 41.09  ? 190 GLU B CD  1 
ATOM   7875  O OE1 . GLU C 1 193 ? 58.005 33.188  -27.340 1.00 40.13  ? 190 GLU B OE1 1 
ATOM   7876  O OE2 . GLU C 1 193 ? 58.576 34.113  -29.246 1.00 47.82  ? 190 GLU B OE2 1 
ATOM   7877  N N   . ASP C 1 194 ? 56.009 28.246  -27.222 1.00 26.99  ? 191 ASP B N   1 
ATOM   7878  C CA  . ASP C 1 194 ? 55.756 27.130  -26.311 1.00 33.33  ? 191 ASP B CA  1 
ATOM   7879  C C   . ASP C 1 194 ? 55.650 25.821  -27.080 1.00 33.83  ? 191 ASP B C   1 
ATOM   7880  O O   . ASP C 1 194 ? 56.239 24.804  -26.694 1.00 30.14  ? 191 ASP B O   1 
ATOM   7881  C CB  . ASP C 1 194 ? 54.476 27.379  -25.512 1.00 32.55  ? 191 ASP B CB  1 
ATOM   7882  C CG  . ASP C 1 194 ? 54.573 28.590  -24.609 1.00 35.19  ? 191 ASP B CG  1 
ATOM   7883  O OD1 . ASP C 1 194 ? 55.688 29.122  -24.429 1.00 39.93  ? 191 ASP B OD1 1 
ATOM   7884  O OD2 . ASP C 1 194 ? 53.524 29.006  -24.075 1.00 39.21  ? 191 ASP B OD2 1 
ATOM   7885  N N   . PHE C 1 195 ? 54.882 25.836  -28.171 1.00 29.38  ? 192 PHE B N   1 
ATOM   7886  C CA  . PHE C 1 195 ? 54.773 24.690  -29.066 1.00 31.83  ? 192 PHE B CA  1 
ATOM   7887  C C   . PHE C 1 195 ? 56.152 24.194  -29.491 1.00 31.29  ? 192 PHE B C   1 
ATOM   7888  O O   . PHE C 1 195 ? 56.445 22.994  -29.429 1.00 27.80  ? 192 PHE B O   1 
ATOM   7889  C CB  . PHE C 1 195 ? 53.934 25.107  -30.276 1.00 29.71  ? 192 PHE B CB  1 
ATOM   7890  C CG  . PHE C 1 195 ? 53.558 23.986  -31.197 1.00 34.24  ? 192 PHE B CG  1 
ATOM   7891  C CD1 . PHE C 1 195 ? 53.589 22.663  -30.787 1.00 36.71  ? 192 PHE B CD1 1 
ATOM   7892  C CD2 . PHE C 1 195 ? 53.155 24.273  -32.491 1.00 31.80  ? 192 PHE B CD2 1 
ATOM   7893  C CE1 . PHE C 1 195 ? 53.230 21.648  -31.658 1.00 38.89  ? 192 PHE B CE1 1 
ATOM   7894  C CE2 . PHE C 1 195 ? 52.798 23.272  -33.361 1.00 37.27  ? 192 PHE B CE2 1 
ATOM   7895  C CZ  . PHE C 1 195 ? 52.835 21.955  -32.947 1.00 39.31  ? 192 PHE B CZ  1 
ATOM   7896  N N   . ALA C 1 196 ? 57.021 25.116  -29.909 1.00 26.18  ? 193 ALA B N   1 
ATOM   7897  C CA  . ALA C 1 196 ? 58.364 24.737  -30.336 1.00 31.49  ? 193 ALA B CA  1 
ATOM   7898  C C   . ALA C 1 196 ? 59.154 24.115  -29.190 1.00 33.62  ? 193 ALA B C   1 
ATOM   7899  O O   . ALA C 1 196 ? 59.685 23.004  -29.314 1.00 29.22  ? 193 ALA B O   1 
ATOM   7900  C CB  . ALA C 1 196 ? 59.098 25.957  -30.895 1.00 29.64  ? 193 ALA B CB  1 
ATOM   7901  N N   . HIS C 1 197 ? 59.232 24.819  -28.055 1.00 27.08  ? 194 HIS B N   1 
ATOM   7902  C CA  . HIS C 1 197 ? 60.045 24.346  -26.937 1.00 31.35  ? 194 HIS B CA  1 
ATOM   7903  C C   . HIS C 1 197 ? 59.583 22.980  -26.446 1.00 30.49  ? 194 HIS B C   1 
ATOM   7904  O O   . HIS C 1 197 ? 60.410 22.103  -26.168 1.00 32.65  ? 194 HIS B O   1 
ATOM   7905  C CB  . HIS C 1 197 ? 60.011 25.363  -25.794 1.00 31.00  ? 194 HIS B CB  1 
ATOM   7906  C CG  . HIS C 1 197 ? 60.931 26.527  -25.993 1.00 33.15  ? 194 HIS B CG  1 
ATOM   7907  N ND1 . HIS C 1 197 ? 62.303 26.403  -25.963 1.00 36.33  ? 194 HIS B ND1 1 
ATOM   7908  C CD2 . HIS C 1 197 ? 60.676 27.837  -26.223 1.00 26.51  ? 194 HIS B CD2 1 
ATOM   7909  C CE1 . HIS C 1 197 ? 62.854 27.586  -26.168 1.00 31.99  ? 194 HIS B CE1 1 
ATOM   7910  N NE2 . HIS C 1 197 ? 61.889 28.474  -26.327 1.00 31.77  ? 194 HIS B NE2 1 
ATOM   7911  N N   . SER C 1 198 ? 58.268 22.779  -26.330 1.00 24.53  ? 195 SER B N   1 
ATOM   7912  C CA  . SER C 1 198 ? 57.760 21.479  -25.905 1.00 33.87  ? 195 SER B CA  1 
ATOM   7913  C C   . SER C 1 198 ? 58.124 20.391  -26.908 1.00 29.78  ? 195 SER B C   1 
ATOM   7914  O O   . SER C 1 198 ? 58.423 19.256  -26.520 1.00 28.48  ? 195 SER B O   1 
ATOM   7915  C CB  . SER C 1 198 ? 56.244 21.542  -25.708 1.00 31.49  ? 195 SER B CB  1 
ATOM   7916  O OG  . SER C 1 198 ? 55.912 22.219  -24.510 1.00 40.43  ? 195 SER B OG  1 
ATOM   7917  N N   . SER C 1 199 ? 58.113 20.721  -28.202 1.00 28.91  ? 196 SER B N   1 
ATOM   7918  C CA  . SER C 1 199 ? 58.400 19.719  -29.223 1.00 28.95  ? 196 SER B CA  1 
ATOM   7919  C C   . SER C 1 199 ? 59.878 19.349  -29.237 1.00 34.30  ? 196 SER B C   1 
ATOM   7920  O O   . SER C 1 199 ? 60.229 18.165  -29.329 1.00 36.73  ? 196 SER B O   1 
ATOM   7921  C CB  . SER C 1 199 ? 57.956 20.226  -30.595 1.00 26.98  ? 196 SER B CB  1 
ATOM   7922  O OG  . SER C 1 199 ? 56.552 20.411  -30.638 1.00 31.97  ? 196 SER B OG  1 
ATOM   7923  N N   . PHE C 1 200 ? 60.763 20.348  -29.153 1.00 25.33  ? 197 PHE B N   1 
ATOM   7924  C CA  . PHE C 1 200 ? 62.193 20.056  -29.105 1.00 31.19  ? 197 PHE B CA  1 
ATOM   7925  C C   . PHE C 1 200 ? 62.545 19.238  -27.870 1.00 33.13  ? 197 PHE B C   1 
ATOM   7926  O O   . PHE C 1 200 ? 63.324 18.281  -27.953 1.00 28.47  ? 197 PHE B O   1 
ATOM   7927  C CB  . PHE C 1 200 ? 63.010 21.350  -29.135 1.00 30.89  ? 197 PHE B CB  1 
ATOM   7928  C CG  . PHE C 1 200 ? 62.912 22.100  -30.430 1.00 29.13  ? 197 PHE B CG  1 
ATOM   7929  C CD1 . PHE C 1 200 ? 63.269 21.498  -31.624 1.00 27.85  ? 197 PHE B CD1 1 
ATOM   7930  C CD2 . PHE C 1 200 ? 62.473 23.413  -30.452 1.00 29.52  ? 197 PHE B CD2 1 
ATOM   7931  C CE1 . PHE C 1 200 ? 63.176 22.187  -32.820 1.00 30.45  ? 197 PHE B CE1 1 
ATOM   7932  C CE2 . PHE C 1 200 ? 62.379 24.108  -31.645 1.00 28.40  ? 197 PHE B CE2 1 
ATOM   7933  C CZ  . PHE C 1 200 ? 62.728 23.495  -32.828 1.00 28.14  ? 197 PHE B CZ  1 
ATOM   7934  N N   . GLN C 1 201 ? 61.977 19.595  -26.715 1.00 30.07  ? 198 GLN B N   1 
ATOM   7935  C CA  . GLN C 1 201 ? 62.295 18.884  -25.481 1.00 34.83  ? 198 GLN B CA  1 
ATOM   7936  C C   . GLN C 1 201 ? 61.785 17.449  -25.528 1.00 35.45  ? 198 GLN B C   1 
ATOM   7937  O O   . GLN C 1 201 ? 62.500 16.511  -25.157 1.00 35.50  ? 198 GLN B O   1 
ATOM   7938  C CB  . GLN C 1 201 ? 61.721 19.638  -24.280 1.00 32.32  ? 198 GLN B CB  1 
ATOM   7939  C CG  . GLN C 1 201 ? 62.542 20.862  -23.891 1.00 34.12  ? 198 GLN B CG  1 
ATOM   7940  C CD  . GLN C 1 201 ? 61.783 21.845  -23.019 1.00 38.98  ? 198 GLN B CD  1 
ATOM   7941  O OE1 . GLN C 1 201 ? 61.029 21.454  -22.128 1.00 34.72  ? 198 GLN B OE1 1 
ATOM   7942  N NE2 . GLN C 1 201 ? 61.987 23.133  -23.270 1.00 34.57  ? 198 GLN B NE2 1 
ATOM   7943  N N   . MET C 1 202 ? 60.545 17.261  -25.989 1.00 34.54  ? 199 MET B N   1 
ATOM   7944  C CA  . MET C 1 202 ? 60.022 15.916  -26.207 1.00 31.79  ? 199 MET B CA  1 
ATOM   7945  C C   . MET C 1 202 ? 60.938 15.111  -27.122 1.00 34.62  ? 199 MET B C   1 
ATOM   7946  O O   . MET C 1 202 ? 61.183 13.923  -26.882 1.00 37.43  ? 199 MET B O   1 
ATOM   7947  C CB  . MET C 1 202 ? 58.612 16.001  -26.796 1.00 33.89  ? 199 MET B CB  1 
ATOM   7948  C CG  . MET C 1 202 ? 57.901 14.665  -26.963 1.00 38.36  ? 199 MET B CG  1 
ATOM   7949  S SD  . MET C 1 202 ? 57.579 13.811  -25.418 1.00 44.24  ? 199 MET B SD  1 
ATOM   7950  C CE  . MET C 1 202 ? 56.174 14.750  -24.823 1.00 37.75  ? 199 MET B CE  1 
ATOM   7951  N N   . ALA C 1 203 ? 61.470 15.750  -28.169 1.00 31.29  ? 200 ALA B N   1 
ATOM   7952  C CA  . ALA C 1 203 ? 62.341 15.046  -29.106 1.00 35.50  ? 200 ALA B CA  1 
ATOM   7953  C C   . ALA C 1 203 ? 63.640 14.611  -28.440 1.00 38.13  ? 200 ALA B C   1 
ATOM   7954  O O   . ALA C 1 203 ? 64.130 13.502  -28.685 1.00 35.47  ? 200 ALA B O   1 
ATOM   7955  C CB  . ALA C 1 203 ? 62.627 15.925  -30.322 1.00 26.94  ? 200 ALA B CB  1 
ATOM   7956  N N   . LEU C 1 204 ? 64.212 15.468  -27.592 1.00 37.02  ? 201 LEU B N   1 
ATOM   7957  C CA  . LEU C 1 204 ? 65.428 15.094  -26.879 1.00 39.87  ? 201 LEU B CA  1 
ATOM   7958  C C   . LEU C 1 204 ? 65.139 14.041  -25.819 1.00 39.38  ? 201 LEU B C   1 
ATOM   7959  O O   . LEU C 1 204 ? 65.969 13.158  -25.569 1.00 44.20  ? 201 LEU B O   1 
ATOM   7960  C CB  . LEU C 1 204 ? 66.063 16.333  -26.250 1.00 32.55  ? 201 LEU B CB  1 
ATOM   7961  C CG  . LEU C 1 204 ? 66.692 17.322  -27.232 1.00 39.78  ? 201 LEU B CG  1 
ATOM   7962  C CD1 . LEU C 1 204 ? 66.926 18.663  -26.556 1.00 31.14  ? 201 LEU B CD1 1 
ATOM   7963  C CD2 . LEU C 1 204 ? 67.990 16.767  -27.800 1.00 36.38  ? 201 LEU B CD2 1 
ATOM   7964  N N   . SER C 1 205 ? 63.966 14.119  -25.186 1.00 33.54  ? 202 SER B N   1 
ATOM   7965  C CA  . SER C 1 205 ? 63.596 13.139  -24.170 1.00 41.76  ? 202 SER B CA  1 
ATOM   7966  C C   . SER C 1 205 ? 63.490 11.741  -24.769 1.00 45.71  ? 202 SER B C   1 
ATOM   7967  O O   . SER C 1 205 ? 64.010 10.769  -24.209 1.00 45.22  ? 202 SER B O   1 
ATOM   7968  C CB  . SER C 1 205 ? 62.279 13.548  -23.510 1.00 44.12  ? 202 SER B CB  1 
ATOM   7969  O OG  . SER C 1 205 ? 61.704 12.466  -22.799 1.00 59.99  ? 202 SER B OG  1 
ATOM   7970  N N   . LYS C 1 206 ? 62.824 11.622  -25.919 1.00 43.93  ? 203 LYS B N   1 
ATOM   7971  C CA  . LYS C 1 206 ? 62.691 10.326  -26.574 1.00 40.29  ? 203 LYS B CA  1 
ATOM   7972  C C   . LYS C 1 206 ? 63.979 9.887   -27.258 1.00 39.97  ? 203 LYS B C   1 
ATOM   7973  O O   . LYS C 1 206 ? 64.205 8.683   -27.429 1.00 36.53  ? 203 LYS B O   1 
ATOM   7974  C CB  . LYS C 1 206 ? 61.563 10.372  -27.607 1.00 37.77  ? 203 LYS B CB  1 
ATOM   7975  C CG  . LYS C 1 206 ? 60.203 10.747  -27.046 1.00 35.53  ? 203 LYS B CG  1 
ATOM   7976  C CD  . LYS C 1 206 ? 59.664 9.659   -26.138 1.00 36.94  ? 203 LYS B CD  1 
ATOM   7977  C CE  . LYS C 1 206 ? 59.506 8.350   -26.896 1.00 38.15  ? 203 LYS B CE  1 
ATOM   7978  N NZ  . LYS C 1 206 ? 58.962 7.274   -26.025 1.00 37.95  ? 203 LYS B NZ  1 
ATOM   7979  N N   . GLY C 1 207 ? 64.829 10.833  -27.650 1.00 38.72  ? 204 GLY B N   1 
ATOM   7980  C CA  . GLY C 1 207 ? 65.919 10.517  -28.550 1.00 32.15  ? 204 GLY B CA  1 
ATOM   7981  C C   . GLY C 1 207 ? 65.468 10.308  -29.977 1.00 40.80  ? 204 GLY B C   1 
ATOM   7982  O O   . GLY C 1 207 ? 66.088 9.532   -30.711 1.00 40.82  ? 204 GLY B O   1 
ATOM   7983  N N   . TRP C 1 208 ? 64.391 10.979  -30.391 1.00 36.59  ? 205 TRP B N   1 
ATOM   7984  C CA  . TRP C 1 208 ? 63.789 10.844  -31.707 1.00 32.29  ? 205 TRP B CA  1 
ATOM   7985  C C   . TRP C 1 208 ? 63.863 12.156  -32.479 1.00 36.66  ? 205 TRP B C   1 
ATOM   7986  O O   . TRP C 1 208 ? 63.756 13.238  -31.890 1.00 30.73  ? 205 TRP B O   1 
ATOM   7987  C CB  . TRP C 1 208 ? 62.319 10.421  -31.606 1.00 31.57  ? 205 TRP B CB  1 
ATOM   7988  C CG  . TRP C 1 208 ? 62.101 9.022   -31.131 1.00 37.91  ? 205 TRP B CG  1 
ATOM   7989  C CD1 . TRP C 1 208 ? 63.054 8.085   -30.862 1.00 36.94  ? 205 TRP B CD1 1 
ATOM   7990  C CD2 . TRP C 1 208 ? 60.838 8.397   -30.879 1.00 34.53  ? 205 TRP B CD2 1 
ATOM   7991  N NE1 . TRP C 1 208 ? 62.461 6.914   -30.451 1.00 38.78  ? 205 TRP B NE1 1 
ATOM   7992  C CE2 . TRP C 1 208 ? 61.101 7.080   -30.454 1.00 37.66  ? 205 TRP B CE2 1 
ATOM   7993  C CE3 . TRP C 1 208 ? 59.510 8.825   -30.969 1.00 31.67  ? 205 TRP B CE3 1 
ATOM   7994  C CZ2 . TRP C 1 208 ? 60.085 6.186   -30.122 1.00 29.59  ? 205 TRP B CZ2 1 
ATOM   7995  C CZ3 . TRP C 1 208 ? 58.501 7.935   -30.639 1.00 37.34  ? 205 TRP B CZ3 1 
ATOM   7996  C CH2 . TRP C 1 208 ? 58.795 6.631   -30.220 1.00 30.43  ? 205 TRP B CH2 1 
ATOM   7997  N N   . PRO C 1 209 ? 64.032 12.090  -33.799 1.00 34.95  ? 206 PRO B N   1 
ATOM   7998  C CA  . PRO C 1 209 ? 64.005 13.311  -34.610 1.00 32.19  ? 206 PRO B CA  1 
ATOM   7999  C C   . PRO C 1 209 ? 62.637 13.980  -34.573 1.00 31.86  ? 206 PRO B C   1 
ATOM   8000  O O   . PRO C 1 209 ? 61.635 13.397  -34.155 1.00 31.14  ? 206 PRO B O   1 
ATOM   8001  C CB  . PRO C 1 209 ? 64.347 12.815  -36.023 1.00 37.56  ? 206 PRO B CB  1 
ATOM   8002  C CG  . PRO C 1 209 ? 64.112 11.332  -35.994 1.00 33.59  ? 206 PRO B CG  1 
ATOM   8003  C CD  . PRO C 1 209 ? 64.385 10.898  -34.588 1.00 30.56  ? 206 PRO B CD  1 
ATOM   8004  N N   . LEU C 1 210 ? 62.611 15.232  -35.024 1.00 34.61  ? 207 LEU B N   1 
ATOM   8005  C CA  . LEU C 1 210 ? 61.417 16.063  -34.973 1.00 33.00  ? 207 LEU B CA  1 
ATOM   8006  C C   . LEU C 1 210 ? 61.172 16.703  -36.331 1.00 33.77  ? 207 LEU B C   1 
ATOM   8007  O O   . LEU C 1 210 ? 62.113 17.139  -37.003 1.00 33.09  ? 207 LEU B O   1 
ATOM   8008  C CB  . LEU C 1 210 ? 61.544 17.156  -33.904 1.00 30.87  ? 207 LEU B CB  1 
ATOM   8009  C CG  . LEU C 1 210 ? 60.485 18.263  -33.933 1.00 37.16  ? 207 LEU B CG  1 
ATOM   8010  C CD1 . LEU C 1 210 ? 59.101 17.702  -33.621 1.00 30.77  ? 207 LEU B CD1 1 
ATOM   8011  C CD2 . LEU C 1 210 ? 60.841 19.399  -32.983 1.00 24.89  ? 207 LEU B CD2 1 
ATOM   8012  N N   . TYR C 1 211 ? 59.902 16.761  -36.726 1.00 30.81  ? 208 TYR B N   1 
ATOM   8013  C CA  . TYR C 1 211 ? 59.484 17.438  -37.944 1.00 32.88  ? 208 TYR B CA  1 
ATOM   8014  C C   . TYR C 1 211 ? 58.323 18.368  -37.638 1.00 28.88  ? 208 TYR B C   1 
ATOM   8015  O O   . TYR C 1 211 ? 57.440 18.040  -36.838 1.00 31.55  ? 208 TYR B O   1 
ATOM   8016  C CB  . TYR C 1 211 ? 59.077 16.444  -39.035 1.00 29.99  ? 208 TYR B CB  1 
ATOM   8017  C CG  . TYR C 1 211 ? 60.144 15.423  -39.331 1.00 36.99  ? 208 TYR B CG  1 
ATOM   8018  C CD1 . TYR C 1 211 ? 61.208 15.726  -40.171 1.00 33.63  ? 208 TYR B CD1 1 
ATOM   8019  C CD2 . TYR C 1 211 ? 60.097 14.158  -38.759 1.00 32.96  ? 208 TYR B CD2 1 
ATOM   8020  C CE1 . TYR C 1 211 ? 62.192 14.797  -40.437 1.00 31.54  ? 208 TYR B CE1 1 
ATOM   8021  C CE2 . TYR C 1 211 ? 61.076 13.223  -39.020 1.00 37.22  ? 208 TYR B CE2 1 
ATOM   8022  C CZ  . TYR C 1 211 ? 62.121 13.547  -39.859 1.00 32.67  ? 208 TYR B CZ  1 
ATOM   8023  O OH  . TYR C 1 211 ? 63.097 12.615  -40.120 1.00 29.89  ? 208 TYR B OH  1 
ATOM   8024  N N   . LEU C 1 212 ? 58.345 19.536  -38.268 1.00 31.11  ? 209 LEU B N   1 
ATOM   8025  C CA  . LEU C 1 212 ? 57.226 20.464  -38.278 1.00 35.41  ? 209 LEU B CA  1 
ATOM   8026  C C   . LEU C 1 212 ? 56.695 20.548  -39.700 1.00 34.91  ? 209 LEU B C   1 
ATOM   8027  O O   . LEU C 1 212 ? 57.475 20.706  -40.646 1.00 35.63  ? 209 LEU B O   1 
ATOM   8028  C CB  . LEU C 1 212 ? 57.653 21.850  -37.789 1.00 28.86  ? 209 LEU B CB  1 
ATOM   8029  C CG  . LEU C 1 212 ? 56.718 23.003  -38.157 1.00 31.22  ? 209 LEU B CG  1 
ATOM   8030  C CD1 . LEU C 1 212 ? 55.429 22.931  -37.349 1.00 33.78  ? 209 LEU B CD1 1 
ATOM   8031  C CD2 . LEU C 1 212 ? 57.400 24.355  -37.983 1.00 29.66  ? 209 LEU B CD2 1 
ATOM   8032  N N   . SER C 1 213 ? 55.381 20.426  -39.853 1.00 30.22  ? 210 SER B N   1 
ATOM   8033  C CA  . SER C 1 213 ? 54.738 20.547  -41.152 1.00 36.38  ? 210 SER B CA  1 
ATOM   8034  C C   . SER C 1 213 ? 53.854 21.787  -41.183 1.00 37.82  ? 210 SER B C   1 
ATOM   8035  O O   . SER C 1 213 ? 53.106 22.055  -40.237 1.00 37.97  ? 210 SER B O   1 
ATOM   8036  C CB  . SER C 1 213 ? 53.916 19.299  -41.490 1.00 27.13  ? 210 SER B CB  1 
ATOM   8037  O OG  . SER C 1 213 ? 52.926 19.046  -40.512 1.00 37.89  ? 210 SER B OG  1 
ATOM   8038  N N   . THR C 1 214 ? 53.980 22.558  -42.261 1.00 33.59  ? 211 THR B N   1 
ATOM   8039  C CA  . THR C 1 214 ? 53.159 23.734  -42.506 1.00 39.20  ? 211 THR B CA  1 
ATOM   8040  C C   . THR C 1 214 ? 52.768 23.749  -43.975 1.00 43.13  ? 211 THR B C   1 
ATOM   8041  O O   . THR C 1 214 ? 53.261 22.956  -44.782 1.00 40.51  ? 211 THR B O   1 
ATOM   8042  C CB  . THR C 1 214 ? 53.887 25.045  -42.171 1.00 42.07  ? 211 THR B CB  1 
ATOM   8043  O OG1 . THR C 1 214 ? 54.872 25.316  -43.176 1.00 34.62  ? 211 THR B OG1 1 
ATOM   8044  C CG2 . THR C 1 214 ? 54.562 24.982  -40.803 1.00 34.84  ? 211 THR B CG2 1 
ATOM   8045  N N   . LYS C 1 215 ? 51.871 24.666  -44.315 1.00 40.30  ? 212 LYS B N   1 
ATOM   8046  C CA  . LYS C 1 215 ? 51.575 25.011  -45.706 1.00 48.48  ? 212 LYS B CA  1 
ATOM   8047  C C   . LYS C 1 215 ? 52.251 26.326  -46.079 1.00 41.18  ? 212 LYS B C   1 
ATOM   8048  O O   . LYS C 1 215 ? 51.653 27.247  -46.639 1.00 43.89  ? 212 LYS B O   1 
ATOM   8049  C CB  . LYS C 1 215 ? 50.066 25.064  -45.922 1.00 51.40  ? 212 LYS B CB  1 
ATOM   8050  C CG  . LYS C 1 215 ? 49.379 23.782  -45.463 1.00 61.23  ? 212 LYS B CG  1 
ATOM   8051  C CD  . LYS C 1 215 ? 47.883 23.765  -45.728 1.00 77.02  ? 212 LYS B CD  1 
ATOM   8052  C CE  . LYS C 1 215 ? 47.283 22.437  -45.270 1.00 70.79  ? 212 LYS B CE  1 
ATOM   8053  N NZ  . LYS C 1 215 ? 45.806 22.370  -45.448 1.00 69.83  ? 212 LYS B NZ  1 
ATOM   8054  N N   . ASN C 1 216 ? 53.540 26.388  -45.735 1.00 45.19  ? 213 ASN B N   1 
ATOM   8055  C CA  . ASN C 1 216 ? 54.432 27.529  -45.915 1.00 44.42  ? 213 ASN B CA  1 
ATOM   8056  C C   . ASN C 1 216 ? 54.335 28.171  -47.294 1.00 48.33  ? 213 ASN B C   1 
ATOM   8057  O O   . ASN C 1 216 ? 54.451 29.395  -47.424 1.00 46.32  ? 213 ASN B O   1 
ATOM   8058  C CB  . ASN C 1 216 ? 55.873 27.074  -45.659 1.00 49.77  ? 213 ASN B CB  1 
ATOM   8059  C CG  . ASN C 1 216 ? 56.877 28.203  -45.754 1.00 57.41  ? 213 ASN B CG  1 
ATOM   8060  O OD1 . ASN C 1 216 ? 56.580 29.350  -45.424 1.00 66.63  ? 213 ASN B OD1 1 
ATOM   8061  N ND2 . ASN C 1 216 ? 58.081 27.878  -46.211 1.00 59.38  ? 213 ASN B ND2 1 
ATOM   8062  N N   . THR C 1 217 ? 54.135 27.356  -48.331 1.00 47.71  ? 214 THR B N   1 
ATOM   8063  C CA  . THR C 1 217 ? 54.080 27.878  -49.690 1.00 51.84  ? 214 THR B CA  1 
ATOM   8064  C C   . THR C 1 217 ? 52.761 28.567  -50.006 1.00 50.89  ? 214 THR B C   1 
ATOM   8065  O O   . THR C 1 217 ? 52.683 29.292  -51.001 1.00 55.80  ? 214 THR B O   1 
ATOM   8066  C CB  . THR C 1 217 ? 54.321 26.749  -50.690 1.00 53.06  ? 214 THR B CB  1 
ATOM   8067  O OG1 . THR C 1 217 ? 53.433 25.661  -50.396 1.00 53.80  ? 214 THR B OG1 1 
ATOM   8068  C CG2 . THR C 1 217 ? 55.755 26.264  -50.597 1.00 47.99  ? 214 THR B CG2 1 
ATOM   8069  N N   . ILE C 1 218 ? 51.729 28.352  -49.198 1.00 47.68  ? 215 ILE B N   1 
ATOM   8070  C CA  . ILE C 1 218 ? 50.414 28.951  -49.408 1.00 43.62  ? 215 ILE B CA  1 
ATOM   8071  C C   . ILE C 1 218 ? 50.173 30.092  -48.425 1.00 48.43  ? 215 ILE B C   1 
ATOM   8072  O O   . ILE C 1 218 ? 49.922 31.230  -48.826 1.00 47.49  ? 215 ILE B O   1 
ATOM   8073  C CB  . ILE C 1 218 ? 49.301 27.884  -49.314 1.00 45.87  ? 215 ILE B CB  1 
ATOM   8074  C CG1 . ILE C 1 218 ? 49.491 26.810  -50.396 1.00 47.77  ? 215 ILE B CG1 1 
ATOM   8075  C CG2 . ILE C 1 218 ? 47.929 28.539  -49.404 1.00 38.08  ? 215 ILE B CG2 1 
ATOM   8076  C CD1 . ILE C 1 218 ? 48.660 27.005  -51.656 1.00 48.98  ? 215 ILE B CD1 1 
ATOM   8077  N N   . LEU C 1 219 ? 50.244 29.805  -47.128 1.00 46.81  ? 216 LEU B N   1 
ATOM   8078  C CA  . LEU C 1 219 ? 50.134 30.831  -46.092 1.00 43.93  ? 216 LEU B CA  1 
ATOM   8079  C C   . LEU C 1 219 ? 51.550 31.288  -45.755 1.00 42.65  ? 216 LEU B C   1 
ATOM   8080  O O   . LEU C 1 219 ? 52.152 30.893  -44.754 1.00 46.69  ? 216 LEU B O   1 
ATOM   8081  C CB  . LEU C 1 219 ? 49.402 30.288  -44.872 1.00 39.33  ? 216 LEU B CB  1 
ATOM   8082  C CG  . LEU C 1 219 ? 48.086 29.580  -45.195 1.00 49.53  ? 216 LEU B CG  1 
ATOM   8083  C CD1 . LEU C 1 219 ? 47.386 29.100  -43.933 1.00 42.05  ? 216 LEU B CD1 1 
ATOM   8084  C CD2 . LEU C 1 219 ? 47.171 30.484  -46.011 1.00 43.06  ? 216 LEU B CD2 1 
ATOM   8085  N N   . LYS C 1 220 ? 52.091 32.140  -46.629 1.00 44.04  ? 217 LYS B N   1 
ATOM   8086  C CA  . LYS C 1 220 ? 53.508 32.480  -46.554 1.00 42.29  ? 217 LYS B CA  1 
ATOM   8087  C C   . LYS C 1 220 ? 53.834 33.290  -45.305 1.00 43.46  ? 217 LYS B C   1 
ATOM   8088  O O   . LYS C 1 220 ? 54.953 33.200  -44.786 1.00 41.87  ? 217 LYS B O   1 
ATOM   8089  C CB  . LYS C 1 220 ? 53.925 33.237  -47.815 1.00 42.79  ? 217 LYS B CB  1 
ATOM   8090  C CG  . LYS C 1 220 ? 53.541 32.527  -49.112 1.00 47.24  ? 217 LYS B CG  1 
ATOM   8091  C CD  . LYS C 1 220 ? 54.267 33.133  -50.303 1.00 62.09  ? 217 LYS B CD  1 
ATOM   8092  C CE  . LYS C 1 220 ? 53.831 32.499  -51.617 1.00 60.65  ? 217 LYS B CE  1 
ATOM   8093  N NZ  . LYS C 1 220 ? 54.147 31.046  -51.676 1.00 62.47  ? 217 LYS B NZ  1 
ATOM   8094  N N   . LYS C 1 221 ? 52.879 34.070  -44.802 1.00 38.30  ? 218 LYS B N   1 
ATOM   8095  C CA  . LYS C 1 221 ? 53.096 34.863  -43.598 1.00 38.42  ? 218 LYS B CA  1 
ATOM   8096  C C   . LYS C 1 221 ? 52.702 34.090  -42.345 1.00 40.59  ? 218 LYS B C   1 
ATOM   8097  O O   . LYS C 1 221 ? 53.462 34.042  -41.372 1.00 40.75  ? 218 LYS B O   1 
ATOM   8098  C CB  . LYS C 1 221 ? 52.300 36.173  -43.665 1.00 39.95  ? 218 LYS B CB  1 
ATOM   8099  C CG  . LYS C 1 221 ? 52.741 37.169  -44.732 1.00 42.79  ? 218 LYS B CG  1 
ATOM   8100  C CD  . LYS C 1 221 ? 52.211 36.804  -46.113 1.00 45.29  ? 218 LYS B CD  1 
ATOM   8101  C CE  . LYS C 1 221 ? 52.073 38.028  -47.007 1.00 47.51  ? 218 LYS B CE  1 
ATOM   8102  N NZ  . LYS C 1 221 ? 53.373 38.709  -47.245 1.00 53.01  ? 218 LYS B NZ  1 
ATOM   8103  N N   . TYR C 1 222 ? 51.517 33.477  -42.370 1.00 35.20  ? 219 TYR B N   1 
ATOM   8104  C CA  . TYR C 1 222 ? 50.980 32.791  -41.201 1.00 37.03  ? 219 TYR B CA  1 
ATOM   8105  C C   . TYR C 1 222 ? 51.798 31.547  -40.867 1.00 42.21  ? 219 TYR B C   1 
ATOM   8106  O O   . TYR C 1 222 ? 52.286 31.390  -39.742 1.00 39.28  ? 219 TYR B O   1 
ATOM   8107  C CB  . TYR C 1 222 ? 49.519 32.429  -41.465 1.00 38.20  ? 219 TYR B CB  1 
ATOM   8108  C CG  . TYR C 1 222 ? 48.677 32.164  -40.243 1.00 35.25  ? 219 TYR B CG  1 
ATOM   8109  C CD1 . TYR C 1 222 ? 48.725 30.939  -39.596 1.00 36.71  ? 219 TYR B CD1 1 
ATOM   8110  C CD2 . TYR C 1 222 ? 47.804 33.130  -39.758 1.00 42.47  ? 219 TYR B CD2 1 
ATOM   8111  C CE1 . TYR C 1 222 ? 47.944 30.688  -38.488 1.00 35.02  ? 219 TYR B CE1 1 
ATOM   8112  C CE2 . TYR C 1 222 ? 47.017 32.889  -38.653 1.00 34.76  ? 219 TYR B CE2 1 
ATOM   8113  C CZ  . TYR C 1 222 ? 47.090 31.666  -38.021 1.00 37.49  ? 219 TYR B CZ  1 
ATOM   8114  O OH  . TYR C 1 222 ? 46.306 31.422  -36.918 1.00 38.85  ? 219 TYR B OH  1 
ATOM   8115  N N   . ASP C 1 223 ? 51.953 30.646  -41.840 1.00 39.41  ? 220 ASP B N   1 
ATOM   8116  C CA  . ASP C 1 223 ? 52.742 29.440  -41.622 1.00 38.34  ? 220 ASP B CA  1 
ATOM   8117  C C   . ASP C 1 223 ? 54.239 29.718  -41.667 1.00 38.07  ? 220 ASP B C   1 
ATOM   8118  O O   . ASP C 1 223 ? 55.012 29.028  -40.991 1.00 36.59  ? 220 ASP B O   1 
ATOM   8119  C CB  . ASP C 1 223 ? 52.374 28.377  -42.656 1.00 40.34  ? 220 ASP B CB  1 
ATOM   8120  C CG  . ASP C 1 223 ? 50.982 27.819  -42.441 1.00 46.42  ? 220 ASP B CG  1 
ATOM   8121  O OD1 . ASP C 1 223 ? 50.171 28.487  -41.759 1.00 43.92  ? 220 ASP B OD1 1 
ATOM   8122  O OD2 . ASP C 1 223 ? 50.699 26.717  -42.955 1.00 41.53  ? 220 ASP B OD2 1 
ATOM   8123  N N   . GLY C 1 224 ? 54.666 30.710  -42.457 1.00 39.26  ? 221 GLY B N   1 
ATOM   8124  C CA  . GLY C 1 224 ? 56.070 31.089  -42.453 1.00 35.34  ? 221 GLY B CA  1 
ATOM   8125  C C   . GLY C 1 224 ? 56.550 31.544  -41.088 1.00 39.17  ? 221 GLY B C   1 
ATOM   8126  O O   . GLY C 1 224 ? 57.726 31.377  -40.751 1.00 35.39  ? 221 GLY B O   1 
ATOM   8127  N N   . ARG C 1 225 ? 55.649 32.109  -40.282 1.00 38.62  ? 222 ARG B N   1 
ATOM   8128  C CA  . ARG C 1 225 ? 56.008 32.531  -38.932 1.00 39.55  ? 222 ARG B CA  1 
ATOM   8129  C C   . ARG C 1 225 ? 56.296 31.331  -38.040 1.00 38.15  ? 222 ARG B C   1 
ATOM   8130  O O   . ARG C 1 225 ? 57.277 31.328  -37.286 1.00 35.09  ? 222 ARG B O   1 
ATOM   8131  C CB  . ARG C 1 225 ? 54.885 33.380  -38.341 1.00 41.87  ? 222 ARG B CB  1 
ATOM   8132  C CG  . ARG C 1 225 ? 55.245 34.083  -37.050 1.00 38.48  ? 222 ARG B CG  1 
ATOM   8133  C CD  . ARG C 1 225 ? 56.046 35.343  -37.308 1.00 41.77  ? 222 ARG B CD  1 
ATOM   8134  N NE  . ARG C 1 225 ? 56.467 35.963  -36.057 1.00 44.37  ? 222 ARG B NE  1 
ATOM   8135  C CZ  . ARG C 1 225 ? 57.727 36.024  -35.645 1.00 40.73  ? 222 ARG B CZ  1 
ATOM   8136  N NH1 . ARG C 1 225 ? 58.021 36.603  -34.489 1.00 40.75  ? 222 ARG B NH1 1 
ATOM   8137  N NH2 . ARG C 1 225 ? 58.695 35.511  -36.393 1.00 41.18  ? 222 ARG B NH2 1 
ATOM   8138  N N   . PHE C 1 226 ? 55.432 30.312  -38.095 1.00 32.82  ? 223 PHE B N   1 
ATOM   8139  C CA  . PHE C 1 226 ? 55.699 29.060  -37.393 1.00 38.49  ? 223 PHE B CA  1 
ATOM   8140  C C   . PHE C 1 226 ? 57.074 28.523  -37.756 1.00 33.54  ? 223 PHE B C   1 
ATOM   8141  O O   . PHE C 1 226 ? 57.882 28.189  -36.880 1.00 32.60  ? 223 PHE B O   1 
ATOM   8142  C CB  . PHE C 1 226 ? 54.637 28.019  -37.752 1.00 41.27  ? 223 PHE B CB  1 
ATOM   8143  C CG  . PHE C 1 226 ? 53.372 28.130  -36.961 1.00 43.24  ? 223 PHE B CG  1 
ATOM   8144  C CD1 . PHE C 1 226 ? 52.418 29.075  -37.294 1.00 36.55  ? 223 PHE B CD1 1 
ATOM   8145  C CD2 . PHE C 1 226 ? 53.127 27.278  -35.895 1.00 40.38  ? 223 PHE B CD2 1 
ATOM   8146  C CE1 . PHE C 1 226 ? 51.242 29.178  -36.576 1.00 48.79  ? 223 PHE B CE1 1 
ATOM   8147  C CE2 . PHE C 1 226 ? 51.953 27.373  -35.170 1.00 39.31  ? 223 PHE B CE2 1 
ATOM   8148  C CZ  . PHE C 1 226 ? 51.008 28.326  -35.511 1.00 51.48  ? 223 PHE B CZ  1 
ATOM   8149  N N   . LYS C 1 227 ? 57.348 28.430  -39.058 1.00 36.62  ? 224 LYS B N   1 
ATOM   8150  C CA  . LYS C 1 227 ? 58.609 27.876  -39.536 1.00 35.83  ? 224 LYS B CA  1 
ATOM   8151  C C   . LYS C 1 227 ? 59.798 28.664  -39.000 1.00 34.03  ? 224 LYS B C   1 
ATOM   8152  O O   . LYS C 1 227 ? 60.776 28.082  -38.517 1.00 36.87  ? 224 LYS B O   1 
ATOM   8153  C CB  . LYS C 1 227 ? 58.603 27.863  -41.065 1.00 34.19  ? 224 LYS B CB  1 
ATOM   8154  C CG  . LYS C 1 227 ? 59.848 27.294  -41.706 1.00 38.26  ? 224 LYS B CG  1 
ATOM   8155  C CD  . LYS C 1 227 ? 59.829 27.544  -43.203 1.00 47.92  ? 224 LYS B CD  1 
ATOM   8156  C CE  . LYS C 1 227 ? 61.074 26.982  -43.859 1.00 45.63  ? 224 LYS B CE  1 
ATOM   8157  N NZ  . LYS C 1 227 ? 61.196 27.394  -45.282 1.00 64.24  ? 224 LYS B NZ  1 
ATOM   8158  N N   . ASP C 1 228 ? 59.723 29.995  -39.062 1.00 33.56  ? 225 ASP B N   1 
ATOM   8159  C CA  . ASP C 1 228 ? 60.850 30.816  -38.630 1.00 36.33  ? 225 ASP B CA  1 
ATOM   8160  C C   . ASP C 1 228 ? 61.068 30.725  -37.124 1.00 33.24  ? 225 ASP B C   1 
ATOM   8161  O O   . ASP C 1 228 ? 62.214 30.685  -36.660 1.00 35.47  ? 225 ASP B O   1 
ATOM   8162  C CB  . ASP C 1 228 ? 60.632 32.268  -39.057 1.00 35.61  ? 225 ASP B CB  1 
ATOM   8163  C CG  . ASP C 1 228 ? 60.555 32.426  -40.560 1.00 35.29  ? 225 ASP B CG  1 
ATOM   8164  O OD1 . ASP C 1 228 ? 61.223 31.650  -41.276 1.00 37.35  ? 225 ASP B OD1 1 
ATOM   8165  O OD2 . ASP C 1 228 ? 59.821 33.321  -41.029 1.00 43.53  ? 225 ASP B OD2 1 
ATOM   8166  N N   . ILE C 1 229 ? 59.986 30.689  -36.345 1.00 33.56  ? 226 ILE B N   1 
ATOM   8167  C CA  . ILE C 1 229 ? 60.124 30.602  -34.893 1.00 31.83  ? 226 ILE B CA  1 
ATOM   8168  C C   . ILE C 1 229 ? 60.716 29.257  -34.497 1.00 32.23  ? 226 ILE B C   1 
ATOM   8169  O O   . ILE C 1 229 ? 61.649 29.186  -33.687 1.00 32.00  ? 226 ILE B O   1 
ATOM   8170  C CB  . ILE C 1 229 ? 58.771 30.850  -34.202 1.00 33.68  ? 226 ILE B CB  1 
ATOM   8171  C CG1 . ILE C 1 229 ? 58.363 32.315  -34.331 1.00 34.04  ? 226 ILE B CG1 1 
ATOM   8172  C CG2 . ILE C 1 229 ? 58.842 30.447  -32.735 1.00 26.29  ? 226 ILE B CG2 1 
ATOM   8173  C CD1 . ILE C 1 229 ? 56.991 32.608  -33.771 1.00 34.80  ? 226 ILE B CD1 1 
ATOM   8174  N N   . PHE C 1 230 ? 60.178 28.169  -35.057 1.00 30.91  ? 227 PHE B N   1 
ATOM   8175  C CA  . PHE C 1 230 ? 60.753 26.850  -34.815 1.00 32.16  ? 227 PHE B CA  1 
ATOM   8176  C C   . PHE C 1 230 ? 62.222 26.814  -35.216 1.00 31.88  ? 227 PHE B C   1 
ATOM   8177  O O   . PHE C 1 230 ? 63.061 26.275  -34.485 1.00 30.50  ? 227 PHE B O   1 
ATOM   8178  C CB  . PHE C 1 230 ? 59.971 25.789  -35.589 1.00 33.80  ? 227 PHE B CB  1 
ATOM   8179  C CG  . PHE C 1 230 ? 58.831 25.184  -34.820 1.00 35.14  ? 227 PHE B CG  1 
ATOM   8180  C CD1 . PHE C 1 230 ? 57.706 25.933  -34.515 1.00 32.92  ? 227 PHE B CD1 1 
ATOM   8181  C CD2 . PHE C 1 230 ? 58.878 23.857  -34.416 1.00 31.24  ? 227 PHE B CD2 1 
ATOM   8182  C CE1 . PHE C 1 230 ? 56.651 25.374  -33.814 1.00 34.52  ? 227 PHE B CE1 1 
ATOM   8183  C CE2 . PHE C 1 230 ? 57.827 23.292  -33.715 1.00 30.29  ? 227 PHE B CE2 1 
ATOM   8184  C CZ  . PHE C 1 230 ? 56.711 24.051  -33.414 1.00 29.45  ? 227 PHE B CZ  1 
ATOM   8185  N N   . GLN C 1 231 ? 62.551 27.399  -36.372 1.00 35.01  ? 228 GLN B N   1 
ATOM   8186  C CA  . GLN C 1 231 ? 63.915 27.326  -36.886 1.00 35.79  ? 228 GLN B CA  1 
ATOM   8187  C C   . GLN C 1 231 ? 64.883 28.133  -36.030 1.00 35.41  ? 228 GLN B C   1 
ATOM   8188  O O   . GLN C 1 231 ? 65.990 27.669  -35.731 1.00 36.98  ? 228 GLN B O   1 
ATOM   8189  C CB  . GLN C 1 231 ? 63.956 27.814  -38.333 1.00 33.53  ? 228 GLN B CB  1 
ATOM   8190  C CG  . GLN C 1 231 ? 65.223 27.424  -39.066 1.00 37.72  ? 228 GLN B CG  1 
ATOM   8191  C CD  . GLN C 1 231 ? 65.332 25.927  -39.260 1.00 35.78  ? 228 GLN B CD  1 
ATOM   8192  O OE1 . GLN C 1 231 ? 64.463 25.306  -39.869 1.00 32.74  ? 228 GLN B OE1 1 
ATOM   8193  N NE2 . GLN C 1 231 ? 66.394 25.335  -38.724 1.00 37.39  ? 228 GLN B NE2 1 
ATOM   8194  N N   . GLU C 1 232 ? 64.491 29.346  -35.633 1.00 35.80  ? 229 GLU B N   1 
ATOM   8195  C CA  . GLU C 1 232 ? 65.379 30.174  -34.824 1.00 36.61  ? 229 GLU B CA  1 
ATOM   8196  C C   . GLU C 1 232 ? 65.597 29.564  -33.447 1.00 33.21  ? 229 GLU B C   1 
ATOM   8197  O O   . GLU C 1 232 ? 66.714 29.593  -32.918 1.00 32.82  ? 229 GLU B O   1 
ATOM   8198  C CB  . GLU C 1 232 ? 64.814 31.591  -34.708 1.00 33.09  ? 229 GLU B CB  1 
ATOM   8199  C CG  . GLU C 1 232 ? 65.627 32.530  -33.825 1.00 53.42  ? 229 GLU B CG  1 
ATOM   8200  C CD  . GLU C 1 232 ? 66.887 33.060  -34.499 1.00 61.81  ? 229 GLU B CD  1 
ATOM   8201  O OE1 . GLU C 1 232 ? 67.297 32.516  -35.548 1.00 52.75  ? 229 GLU B OE1 1 
ATOM   8202  O OE2 . GLU C 1 232 ? 67.466 34.035  -33.973 1.00 59.86  ? 229 GLU B OE2 1 
ATOM   8203  N N   . ILE C 1 233 ? 64.543 29.000  -32.854 1.00 33.88  ? 230 ILE B N   1 
ATOM   8204  C CA  . ILE C 1 233 ? 64.687 28.352  -31.554 1.00 34.85  ? 230 ILE B CA  1 
ATOM   8205  C C   . ILE C 1 233 ? 65.582 27.125  -31.671 1.00 32.01  ? 230 ILE B C   1 
ATOM   8206  O O   . ILE C 1 233 ? 66.454 26.889  -30.824 1.00 35.53  ? 230 ILE B O   1 
ATOM   8207  C CB  . ILE C 1 233 ? 63.303 28.002  -30.975 1.00 34.78  ? 230 ILE B CB  1 
ATOM   8208  C CG1 . ILE C 1 233 ? 62.624 29.261  -30.435 1.00 27.64  ? 230 ILE B CG1 1 
ATOM   8209  C CG2 . ILE C 1 233 ? 63.425 26.947  -29.884 1.00 27.92  ? 230 ILE B CG2 1 
ATOM   8210  C CD1 . ILE C 1 233 ? 61.178 29.056  -30.029 1.00 25.76  ? 230 ILE B CD1 1 
ATOM   8211  N N   . TYR C 1 234 ? 65.394 26.334  -32.730 1.00 32.47  ? 231 TYR B N   1 
ATOM   8212  C CA  . TYR C 1 234 ? 66.242 25.166  -32.948 1.00 34.39  ? 231 TYR B CA  1 
ATOM   8213  C C   . TYR C 1 234 ? 67.696 25.574  -33.137 1.00 36.19  ? 231 TYR B C   1 
ATOM   8214  O O   . TYR C 1 234 ? 68.586 25.097  -32.424 1.00 29.85  ? 231 TYR B O   1 
ATOM   8215  C CB  . TYR C 1 234 ? 65.754 24.376  -34.162 1.00 35.39  ? 231 TYR B CB  1 
ATOM   8216  C CG  . TYR C 1 234 ? 66.602 23.159  -34.462 1.00 34.15  ? 231 TYR B CG  1 
ATOM   8217  C CD1 . TYR C 1 234 ? 66.629 22.076  -33.593 1.00 35.80  ? 231 TYR B CD1 1 
ATOM   8218  C CD2 . TYR C 1 234 ? 67.387 23.100  -35.605 1.00 36.60  ? 231 TYR B CD2 1 
ATOM   8219  C CE1 . TYR C 1 234 ? 67.403 20.964  -33.858 1.00 36.78  ? 231 TYR B CE1 1 
ATOM   8220  C CE2 . TYR C 1 234 ? 68.167 21.991  -35.881 1.00 35.27  ? 231 TYR B CE2 1 
ATOM   8221  C CZ  . TYR C 1 234 ? 68.170 20.926  -35.004 1.00 41.56  ? 231 TYR B CZ  1 
ATOM   8222  O OH  . TYR C 1 234 ? 68.940 19.816  -35.267 1.00 42.96  ? 231 TYR B OH  1 
ATOM   8223  N N   . ASP C 1 235 ? 67.953 26.460  -34.106 1.00 32.28  ? 232 ASP B N   1 
ATOM   8224  C CA  . ASP C 1 235 ? 69.321 26.860  -34.424 1.00 37.58  ? 232 ASP B CA  1 
ATOM   8225  C C   . ASP C 1 235 ? 70.062 27.357  -33.189 1.00 35.80  ? 232 ASP B C   1 
ATOM   8226  O O   . ASP C 1 235 ? 71.217 26.988  -32.952 1.00 37.73  ? 232 ASP B O   1 
ATOM   8227  C CB  . ASP C 1 235 ? 69.311 27.942  -35.508 1.00 39.49  ? 232 ASP B CB  1 
ATOM   8228  C CG  . ASP C 1 235 ? 68.893 27.411  -36.865 1.00 40.41  ? 232 ASP B CG  1 
ATOM   8229  O OD1 . ASP C 1 235 ? 68.777 26.176  -37.017 1.00 40.06  ? 232 ASP B OD1 1 
ATOM   8230  O OD2 . ASP C 1 235 ? 68.679 28.232  -37.783 1.00 41.43  ? 232 ASP B OD2 1 
ATOM   8231  N N   . LYS C 1 236 ? 69.401 28.177  -32.372 1.00 34.57  ? 233 LYS B N   1 
ATOM   8232  C CA  . LYS C 1 236 ? 70.085 28.840  -31.268 1.00 35.45  ? 233 LYS B CA  1 
ATOM   8233  C C   . LYS C 1 236 ? 70.071 28.048  -29.966 1.00 34.01  ? 233 LYS B C   1 
ATOM   8234  O O   . LYS C 1 236 ? 70.990 28.204  -29.154 1.00 36.40  ? 233 LYS B O   1 
ATOM   8235  C CB  . LYS C 1 236 ? 69.468 30.219  -31.013 1.00 33.49  ? 233 LYS B CB  1 
ATOM   8236  C CG  . LYS C 1 236 ? 69.443 31.141  -32.226 1.00 31.77  ? 233 LYS B CG  1 
ATOM   8237  C CD  . LYS C 1 236 ? 70.834 31.350  -32.810 1.00 41.06  ? 233 LYS B CD  1 
ATOM   8238  C CE  . LYS C 1 236 ? 70.813 32.394  -33.921 1.00 39.85  ? 233 LYS B CE  1 
ATOM   8239  N NZ  . LYS C 1 236 ? 72.081 32.402  -34.704 1.00 45.32  ? 233 LYS B NZ  1 
ATOM   8240  N N   . GLN C 1 237 ? 69.063 27.202  -29.731 1.00 36.94  ? 234 GLN B N   1 
ATOM   8241  C CA  . GLN C 1 237 ? 68.847 26.657  -28.397 1.00 35.10  ? 234 GLN B CA  1 
ATOM   8242  C C   . GLN C 1 237 ? 68.799 25.139  -28.302 1.00 33.34  ? 234 GLN B C   1 
ATOM   8243  O O   . GLN C 1 237 ? 68.820 24.616  -27.183 1.00 33.51  ? 234 GLN B O   1 
ATOM   8244  C CB  . GLN C 1 237 ? 67.548 27.223  -27.800 1.00 36.56  ? 234 GLN B CB  1 
ATOM   8245  C CG  . GLN C 1 237 ? 67.479 28.739  -27.800 1.00 37.44  ? 234 GLN B CG  1 
ATOM   8246  C CD  . GLN C 1 237 ? 66.216 29.259  -27.148 1.00 35.98  ? 234 GLN B CD  1 
ATOM   8247  O OE1 . GLN C 1 237 ? 65.872 28.862  -26.036 1.00 46.45  ? 234 GLN B OE1 1 
ATOM   8248  N NE2 . GLN C 1 237 ? 65.518 30.153  -27.836 1.00 35.20  ? 234 GLN B NE2 1 
ATOM   8249  N N   . TYR C 1 238 ? 68.727 24.412  -29.417 1.00 34.25  ? 235 TYR B N   1 
ATOM   8250  C CA  . TYR C 1 238 ? 68.613 22.956  -29.337 1.00 36.31  ? 235 TYR B CA  1 
ATOM   8251  C C   . TYR C 1 238 ? 69.456 22.199  -30.351 1.00 38.52  ? 235 TYR B C   1 
ATOM   8252  O O   . TYR C 1 238 ? 69.625 20.986  -30.187 1.00 39.69  ? 235 TYR B O   1 
ATOM   8253  C CB  . TYR C 1 238 ? 67.149 22.522  -29.502 1.00 32.93  ? 235 TYR B CB  1 
ATOM   8254  C CG  . TYR C 1 238 ? 66.227 22.965  -28.386 1.00 29.03  ? 235 TYR B CG  1 
ATOM   8255  C CD1 . TYR C 1 238 ? 66.121 22.235  -27.208 1.00 30.29  ? 235 TYR B CD1 1 
ATOM   8256  C CD2 . TYR C 1 238 ? 65.462 24.117  -28.514 1.00 28.83  ? 235 TYR B CD2 1 
ATOM   8257  C CE1 . TYR C 1 238 ? 65.275 22.641  -26.188 1.00 36.72  ? 235 TYR B CE1 1 
ATOM   8258  C CE2 . TYR C 1 238 ? 64.615 24.532  -27.500 1.00 30.74  ? 235 TYR B CE2 1 
ATOM   8259  C CZ  . TYR C 1 238 ? 64.525 23.791  -26.340 1.00 35.50  ? 235 TYR B CZ  1 
ATOM   8260  O OH  . TYR C 1 238 ? 63.682 24.201  -25.330 1.00 30.42  ? 235 TYR B OH  1 
ATOM   8261  N N   . LYS C 1 239 ? 70.000 22.857  -31.377 1.00 37.95  ? 236 LYS B N   1 
ATOM   8262  C CA  . LYS C 1 239 ? 70.663 22.152  -32.471 1.00 38.95  ? 236 LYS B CA  1 
ATOM   8263  C C   . LYS C 1 239 ? 71.851 21.328  -31.984 1.00 44.07  ? 236 LYS B C   1 
ATOM   8264  O O   . LYS C 1 239 ? 72.035 20.179  -32.399 1.00 44.30  ? 236 LYS B O   1 
ATOM   8265  C CB  . LYS C 1 239 ? 71.117 23.155  -33.530 1.00 40.17  ? 236 LYS B CB  1 
ATOM   8266  C CG  . LYS C 1 239 ? 71.940 22.545  -34.648 1.00 44.29  ? 236 LYS B CG  1 
ATOM   8267  C CD  . LYS C 1 239 ? 72.038 23.479  -35.834 1.00 41.29  ? 236 LYS B CD  1 
ATOM   8268  C CE  . LYS C 1 239 ? 72.553 22.731  -37.046 1.00 47.24  ? 236 LYS B CE  1 
ATOM   8269  N NZ  . LYS C 1 239 ? 72.286 23.450  -38.317 1.00 55.60  ? 236 LYS B NZ  1 
ATOM   8270  N N   . SER C 1 240 ? 72.679 21.907  -31.110 1.00 40.27  ? 237 SER B N   1 
ATOM   8271  C CA  . SER C 1 240 ? 73.857 21.189  -30.639 1.00 44.16  ? 237 SER B CA  1 
ATOM   8272  C C   . SER C 1 240 ? 73.474 19.978  -29.799 1.00 43.00  ? 237 SER B C   1 
ATOM   8273  O O   . SER C 1 240 ? 74.180 18.965  -29.817 1.00 46.18  ? 237 SER B O   1 
ATOM   8274  C CB  . SER C 1 240 ? 74.758 22.130  -29.847 1.00 41.24  ? 237 SER B CB  1 
ATOM   8275  O OG  . SER C 1 240 ? 75.263 23.159  -30.683 1.00 58.65  ? 237 SER B OG  1 
ATOM   8276  N N   . GLN C 1 241 ? 72.362 20.054  -29.066 1.00 41.61  ? 238 GLN B N   1 
ATOM   8277  C CA  A GLN C 1 241 ? 71.918 18.901  -28.289 0.51 42.79  ? 238 GLN B CA  1 
ATOM   8278  C CA  B GLN C 1 241 ? 71.913 18.903  -28.288 0.49 42.78  ? 238 GLN B CA  1 
ATOM   8279  C C   . GLN C 1 241 ? 71.377 17.803  -29.196 1.00 43.09  ? 238 GLN B C   1 
ATOM   8280  O O   . GLN C 1 241 ? 71.557 16.613  -28.913 1.00 41.98  ? 238 GLN B O   1 
ATOM   8281  C CB  A GLN C 1 241 ? 70.858 19.330  -27.276 0.51 41.01  ? 238 GLN B CB  1 
ATOM   8282  C CB  B GLN C 1 241 ? 70.849 19.337  -27.281 0.49 41.36  ? 238 GLN B CB  1 
ATOM   8283  C CG  A GLN C 1 241 ? 71.301 20.444  -26.346 0.51 43.15  ? 238 GLN B CG  1 
ATOM   8284  C CG  B GLN C 1 241 ? 71.386 20.161  -26.122 0.49 42.52  ? 238 GLN B CG  1 
ATOM   8285  C CD  A GLN C 1 241 ? 70.168 20.939  -25.473 0.51 45.17  ? 238 GLN B CD  1 
ATOM   8286  C CD  B GLN C 1 241 ? 70.787 21.553  -26.081 0.49 48.53  ? 238 GLN B CD  1 
ATOM   8287  O OE1 A GLN C 1 241 ? 69.796 22.112  -25.520 0.51 44.57  ? 238 GLN B OE1 1 
ATOM   8288  O OE1 B GLN C 1 241 ? 71.304 22.485  -26.701 0.49 43.19  ? 238 GLN B OE1 1 
ATOM   8289  N NE2 A GLN C 1 241 ? 69.601 20.040  -24.677 0.51 41.75  ? 238 GLN B NE2 1 
ATOM   8290  N NE2 B GLN C 1 241 ? 69.679 21.698  -25.363 0.49 44.84  ? 238 GLN B NE2 1 
ATOM   8291  N N   . PHE C 1 242 ? 70.718 18.185  -30.293 1.00 38.56  ? 239 PHE B N   1 
ATOM   8292  C CA  . PHE C 1 242 ? 70.199 17.199  -31.234 1.00 44.37  ? 239 PHE B CA  1 
ATOM   8293  C C   . PHE C 1 242 ? 71.333 16.451  -31.924 1.00 40.51  ? 239 PHE B C   1 
ATOM   8294  O O   . PHE C 1 242 ? 71.274 15.226  -32.079 1.00 41.29  ? 239 PHE B O   1 
ATOM   8295  C CB  . PHE C 1 242 ? 69.312 17.887  -32.270 1.00 32.77  ? 239 PHE B CB  1 
ATOM   8296  C CG  . PHE C 1 242 ? 67.871 18.008  -31.862 1.00 35.33  ? 239 PHE B CG  1 
ATOM   8297  C CD1 . PHE C 1 242 ? 67.508 18.764  -30.760 1.00 35.48  ? 239 PHE B CD1 1 
ATOM   8298  C CD2 . PHE C 1 242 ? 66.875 17.386  -32.599 1.00 36.04  ? 239 PHE B CD2 1 
ATOM   8299  C CE1 . PHE C 1 242 ? 66.181 18.888  -30.390 1.00 37.23  ? 239 PHE B CE1 1 
ATOM   8300  C CE2 . PHE C 1 242 ? 65.546 17.503  -32.234 1.00 33.64  ? 239 PHE B CE2 1 
ATOM   8301  C CZ  . PHE C 1 242 ? 65.199 18.255  -31.128 1.00 34.74  ? 239 PHE B CZ  1 
ATOM   8302  N N   . GLU C 1 243 ? 72.371 17.177  -32.349 1.00 41.76  ? 240 GLU B N   1 
ATOM   8303  C CA  . GLU C 1 243 ? 73.509 16.539  -32.999 1.00 46.70  ? 240 GLU B CA  1 
ATOM   8304  C C   . GLU C 1 243 ? 74.254 15.630  -32.031 1.00 44.88  ? 240 GLU B C   1 
ATOM   8305  O O   . GLU C 1 243 ? 74.781 14.584  -32.429 1.00 44.21  ? 240 GLU B O   1 
ATOM   8306  C CB  . GLU C 1 243 ? 74.443 17.606  -33.567 1.00 41.51  ? 240 GLU B CB  1 
ATOM   8307  C CG  . GLU C 1 243 ? 73.817 18.437  -34.675 1.00 41.26  ? 240 GLU B CG  1 
ATOM   8308  C CD  . GLU C 1 243 ? 74.713 19.567  -35.136 1.00 53.50  ? 240 GLU B CD  1 
ATOM   8309  O OE1 . GLU C 1 243 ? 75.653 19.921  -34.393 1.00 57.48  ? 240 GLU B OE1 1 
ATOM   8310  O OE2 . GLU C 1 243 ? 74.476 20.101  -36.241 1.00 51.11  ? 240 GLU B OE2 1 
ATOM   8311  N N   . ALA C 1 244 ? 74.302 16.010  -30.751 1.00 39.19  ? 241 ALA B N   1 
ATOM   8312  C CA  . ALA C 1 244 ? 74.965 15.173  -29.758 1.00 42.80  ? 241 ALA B CA  1 
ATOM   8313  C C   . ALA C 1 244 ? 74.252 13.835  -29.602 1.00 46.95  ? 241 ALA B C   1 
ATOM   8314  O O   . ALA C 1 244 ? 74.900 12.793  -29.451 1.00 53.15  ? 241 ALA B O   1 
ATOM   8315  C CB  . ALA C 1 244 ? 75.040 15.905  -28.418 1.00 32.03  ? 241 ALA B CB  1 
ATOM   8316  N N   . GLN C 1 245 ? 72.920 13.842  -29.641 1.00 47.70  ? 242 GLN B N   1 
ATOM   8317  C CA  . GLN C 1 245 ? 72.125 12.623  -29.579 1.00 43.98  ? 242 GLN B CA  1 
ATOM   8318  C C   . GLN C 1 245 ? 71.843 12.025  -30.951 1.00 41.32  ? 242 GLN B C   1 
ATOM   8319  O O   . GLN C 1 245 ? 71.010 11.119  -31.055 1.00 48.86  ? 242 GLN B O   1 
ATOM   8320  C CB  . GLN C 1 245 ? 70.802 12.884  -28.859 1.00 39.51  ? 242 GLN B CB  1 
ATOM   8321  C CG  . GLN C 1 245 ? 70.940 13.226  -27.393 1.00 46.11  ? 242 GLN B CG  1 
ATOM   8322  C CD  . GLN C 1 245 ? 69.627 13.093  -26.650 1.00 52.21  ? 242 GLN B CD  1 
ATOM   8323  O OE1 . GLN C 1 245 ? 68.798 12.244  -26.979 1.00 50.50  ? 242 GLN B OE1 1 
ATOM   8324  N NE2 . GLN C 1 245 ? 69.423 13.941  -25.649 1.00 50.90  ? 242 GLN B NE2 1 
ATOM   8325  N N   . LYS C 1 246 ? 72.496 12.526  -32.000 1.00 42.44  ? 243 LYS B N   1 
ATOM   8326  C CA  . LYS C 1 246 ? 72.416 11.987  -33.356 1.00 42.85  ? 243 LYS B CA  1 
ATOM   8327  C C   . LYS C 1 246 ? 71.033 12.136  -33.983 1.00 46.48  ? 243 LYS B C   1 
ATOM   8328  O O   . LYS C 1 246 ? 70.724 11.452  -34.963 1.00 45.29  ? 243 LYS B O   1 
ATOM   8329  C CB  . LYS C 1 246 ? 72.849 10.516  -33.397 1.00 52.92  ? 243 LYS B CB  1 
ATOM   8330  C CG  . LYS C 1 246 ? 74.343 10.308  -33.212 1.00 60.33  ? 243 LYS B CG  1 
ATOM   8331  C CD  . LYS C 1 246 ? 75.117 10.949  -34.350 1.00 65.02  ? 243 LYS B CD  1 
ATOM   8332  C CE  . LYS C 1 246 ? 76.557 10.464  -34.394 1.00 69.61  ? 243 LYS B CE  1 
ATOM   8333  N NZ  . LYS C 1 246 ? 77.334 11.168  -35.453 1.00 72.84  ? 243 LYS B NZ  1 
ATOM   8334  N N   . ILE C 1 247 ? 70.187 13.019  -33.453 1.00 41.75  ? 244 ILE B N   1 
ATOM   8335  C CA  . ILE C 1 247 ? 68.887 13.285  -34.063 1.00 37.07  ? 244 ILE B CA  1 
ATOM   8336  C C   . ILE C 1 247 ? 68.919 14.654  -34.729 1.00 41.83  ? 244 ILE B C   1 
ATOM   8337  O O   . ILE C 1 247 ? 69.955 15.328  -34.737 1.00 40.21  ? 244 ILE B O   1 
ATOM   8338  C CB  . ILE C 1 247 ? 67.743 13.196  -33.036 1.00 38.39  ? 244 ILE B CB  1 
ATOM   8339  C CG1 . ILE C 1 247 ? 68.015 14.124  -31.849 1.00 39.68  ? 244 ILE B CG1 1 
ATOM   8340  C CG2 . ILE C 1 247 ? 67.543 11.754  -32.579 1.00 33.30  ? 244 ILE B CG2 1 
ATOM   8341  C CD1 . ILE C 1 247 ? 66.989 14.012  -30.740 1.00 35.91  ? 244 ILE B CD1 1 
ATOM   8342  N N   . TRP C 1 248 ? 67.780 15.078  -35.275 1.00 37.78  ? 245 TRP B N   1 
ATOM   8343  C CA  . TRP C 1 248 ? 67.725 16.289  -36.080 1.00 32.53  ? 245 TRP B CA  1 
ATOM   8344  C C   . TRP C 1 248 ? 66.316 16.863  -36.042 1.00 39.41  ? 245 TRP B C   1 
ATOM   8345  O O   . TRP C 1 248 ? 65.358 16.191  -35.648 1.00 39.39  ? 245 TRP B O   1 
ATOM   8346  C CB  . TRP C 1 248 ? 68.134 16.005  -37.531 1.00 32.99  ? 245 TRP B CB  1 
ATOM   8347  C CG  . TRP C 1 248 ? 67.280 14.944  -38.170 1.00 30.50  ? 245 TRP B CG  1 
ATOM   8348  C CD1 . TRP C 1 248 ? 66.099 15.127  -38.831 1.00 36.61  ? 245 TRP B CD1 1 
ATOM   8349  C CD2 . TRP C 1 248 ? 67.535 13.535  -38.189 1.00 34.95  ? 245 TRP B CD2 1 
ATOM   8350  N NE1 . TRP C 1 248 ? 65.607 13.920  -39.266 1.00 32.17  ? 245 TRP B NE1 1 
ATOM   8351  C CE2 . TRP C 1 248 ? 66.470 12.926  -38.885 1.00 37.27  ? 245 TRP B CE2 1 
ATOM   8352  C CE3 . TRP C 1 248 ? 68.561 12.728  -37.688 1.00 39.80  ? 245 TRP B CE3 1 
ATOM   8353  C CZ2 . TRP C 1 248 ? 66.404 11.548  -39.093 1.00 37.29  ? 245 TRP B CZ2 1 
ATOM   8354  C CZ3 . TRP C 1 248 ? 68.495 11.362  -37.896 1.00 38.17  ? 245 TRP B CZ3 1 
ATOM   8355  C CH2 . TRP C 1 248 ? 67.424 10.786  -38.592 1.00 31.98  ? 245 TRP B CH2 1 
ATOM   8356  N N   . TYR C 1 249 ? 66.206 18.123  -36.458 1.00 37.75  ? 246 TYR B N   1 
ATOM   8357  C CA  . TYR C 1 249 ? 64.928 18.772  -36.710 1.00 32.96  ? 246 TYR B CA  1 
ATOM   8358  C C   . TYR C 1 249 ? 64.913 19.281  -38.143 1.00 37.31  ? 246 TYR B C   1 
ATOM   8359  O O   . TYR C 1 249 ? 65.930 19.771  -38.646 1.00 40.77  ? 246 TYR B O   1 
ATOM   8360  C CB  . TYR C 1 249 ? 64.670 19.951  -35.762 1.00 38.60  ? 246 TYR B CB  1 
ATOM   8361  C CG  . TYR C 1 249 ? 63.599 20.880  -36.295 1.00 35.97  ? 246 TYR B CG  1 
ATOM   8362  C CD1 . TYR C 1 249 ? 62.258 20.527  -36.224 1.00 33.57  ? 246 TYR B CD1 1 
ATOM   8363  C CD2 . TYR C 1 249 ? 63.927 22.083  -36.917 1.00 35.85  ? 246 TYR B CD2 1 
ATOM   8364  C CE1 . TYR C 1 249 ? 61.272 21.351  -36.725 1.00 33.87  ? 246 TYR B CE1 1 
ATOM   8365  C CE2 . TYR C 1 249 ? 62.943 22.915  -37.427 1.00 36.20  ? 246 TYR B CE2 1 
ATOM   8366  C CZ  . TYR C 1 249 ? 61.616 22.542  -37.325 1.00 34.10  ? 246 TYR B CZ  1 
ATOM   8367  O OH  . TYR C 1 249 ? 60.625 23.356  -37.823 1.00 35.57  ? 246 TYR B OH  1 
ATOM   8368  N N   . GLU C 1 250 ? 63.758 19.183  -38.796 1.00 39.86  ? 247 GLU B N   1 
ATOM   8369  C CA  . GLU C 1 250 ? 63.624 19.738  -40.133 1.00 40.65  ? 247 GLU B CA  1 
ATOM   8370  C C   . GLU C 1 250 ? 62.174 20.103  -40.406 1.00 38.08  ? 247 GLU B C   1 
ATOM   8371  O O   . GLU C 1 250 ? 61.252 19.408  -39.970 1.00 39.42  ? 247 GLU B O   1 
ATOM   8372  C CB  . GLU C 1 250 ? 64.135 18.765  -41.200 1.00 47.73  ? 247 GLU B CB  1 
ATOM   8373  C CG  . GLU C 1 250 ? 65.159 19.393  -42.129 1.00 62.82  ? 247 GLU B CG  1 
ATOM   8374  C CD  . GLU C 1 250 ? 66.150 18.388  -42.672 1.00 65.52  ? 247 GLU B CD  1 
ATOM   8375  O OE1 . GLU C 1 250 ? 65.764 17.582  -43.546 1.00 74.49  ? 247 GLU B OE1 1 
ATOM   8376  O OE2 . GLU C 1 250 ? 67.316 18.405  -42.223 1.00 59.99  ? 247 GLU B OE2 1 
ATOM   8377  N N   . HIS C 1 251 ? 61.991 21.208  -41.123 1.00 39.53  ? 248 HIS B N   1 
ATOM   8378  C CA  . HIS C 1 251 ? 60.675 21.602  -41.596 1.00 38.38  ? 248 HIS B CA  1 
ATOM   8379  C C   . HIS C 1 251 ? 60.313 20.816  -42.848 1.00 41.38  ? 248 HIS B C   1 
ATOM   8380  O O   . HIS C 1 251 ? 61.178 20.486  -43.664 1.00 42.94  ? 248 HIS B O   1 
ATOM   8381  C CB  . HIS C 1 251 ? 60.636 23.099  -41.899 1.00 38.61  ? 248 HIS B CB  1 
ATOM   8382  C CG  . HIS C 1 251 ? 59.356 23.553  -42.528 1.00 40.02  ? 248 HIS B CG  1 
ATOM   8383  N ND1 . HIS C 1 251 ? 59.177 23.608  -43.893 1.00 42.75  ? 248 HIS B ND1 1 
ATOM   8384  C CD2 . HIS C 1 251 ? 58.190 23.969  -41.978 1.00 34.88  ? 248 HIS B CD2 1 
ATOM   8385  C CE1 . HIS C 1 251 ? 57.956 24.038  -44.158 1.00 43.11  ? 248 HIS B CE1 1 
ATOM   8386  N NE2 . HIS C 1 251 ? 57.337 24.266  -43.014 1.00 44.12  ? 248 HIS B NE2 1 
ATOM   8387  N N   . ARG C 1 252 ? 59.025 20.520  -42.994 1.00 37.33  ? 249 ARG B N   1 
ATOM   8388  C CA  . ARG C 1 252 ? 58.515 19.810  -44.155 1.00 36.52  ? 249 ARG B CA  1 
ATOM   8389  C C   . ARG C 1 252 ? 57.207 20.447  -44.589 1.00 42.86  ? 249 ARG B C   1 
ATOM   8390  O O   . ARG C 1 252 ? 56.391 20.836  -43.748 1.00 41.60  ? 249 ARG B O   1 
ATOM   8391  C CB  . ARG C 1 252 ? 58.282 18.326  -43.852 1.00 36.26  ? 249 ARG B CB  1 
ATOM   8392  C CG  . ARG C 1 252 ? 59.544 17.521  -43.625 1.00 38.48  ? 249 ARG B CG  1 
ATOM   8393  C CD  . ARG C 1 252 ? 60.308 17.315  -44.917 1.00 38.70  ? 249 ARG B CD  1 
ATOM   8394  N NE  . ARG C 1 252 ? 61.401 16.363  -44.743 1.00 41.79  ? 249 ARG B NE  1 
ATOM   8395  C CZ  . ARG C 1 252 ? 62.649 16.706  -44.442 1.00 45.50  ? 249 ARG B CZ  1 
ATOM   8396  N NH1 . ARG C 1 252 ? 62.967 17.983  -44.279 1.00 40.68  ? 249 ARG B NH1 1 
ATOM   8397  N NH2 . ARG C 1 252 ? 63.581 15.771  -44.301 1.00 45.40  ? 249 ARG B NH2 1 
ATOM   8398  N N   . LEU C 1 253 ? 57.013 20.563  -45.901 1.00 39.14  ? 250 LEU B N   1 
ATOM   8399  C CA  . LEU C 1 253 ? 55.686 20.876  -46.408 1.00 42.34  ? 250 LEU B CA  1 
ATOM   8400  C C   . LEU C 1 253 ? 54.745 19.727  -46.078 1.00 36.52  ? 250 LEU B C   1 
ATOM   8401  O O   . LEU C 1 253 ? 55.138 18.557  -46.106 1.00 36.41  ? 250 LEU B O   1 
ATOM   8402  C CB  . LEU C 1 253 ? 55.726 21.119  -47.917 1.00 41.26  ? 250 LEU B CB  1 
ATOM   8403  C CG  . LEU C 1 253 ? 56.031 22.545  -48.376 1.00 44.42  ? 250 LEU B CG  1 
ATOM   8404  C CD1 . LEU C 1 253 ? 55.969 22.634  -49.892 1.00 48.08  ? 250 LEU B CD1 1 
ATOM   8405  C CD2 . LEU C 1 253 ? 55.076 23.543  -47.732 1.00 49.95  ? 250 LEU B CD2 1 
ATOM   8406  N N   . ILE C 1 254 ? 53.497 20.068  -45.749 1.00 38.21  ? 251 ILE B N   1 
ATOM   8407  C CA  . ILE C 1 254 ? 52.533 19.058  -45.314 1.00 40.78  ? 251 ILE B CA  1 
ATOM   8408  C C   . ILE C 1 254 ? 52.360 17.977  -46.374 1.00 40.64  ? 251 ILE B C   1 
ATOM   8409  O O   . ILE C 1 254 ? 52.201 16.793  -46.053 1.00 39.73  ? 251 ILE B O   1 
ATOM   8410  C CB  . ILE C 1 254 ? 51.192 19.724  -44.947 1.00 40.50  ? 251 ILE B CB  1 
ATOM   8411  C CG1 . ILE C 1 254 ? 50.192 18.688  -44.423 1.00 46.36  ? 251 ILE B CG1 1 
ATOM   8412  C CG2 . ILE C 1 254 ? 50.620 20.476  -46.138 1.00 47.58  ? 251 ILE B CG2 1 
ATOM   8413  C CD1 . ILE C 1 254 ? 50.691 17.895  -43.229 1.00 44.16  ? 251 ILE B CD1 1 
ATOM   8414  N N   . ASP C 1 255 ? 52.403 18.365  -47.653 1.00 47.11  ? 252 ASP B N   1 
ATOM   8415  C CA  . ASP C 1 255 ? 52.293 17.392  -48.736 1.00 50.75  ? 252 ASP B CA  1 
ATOM   8416  C C   . ASP C 1 255 ? 53.417 16.368  -48.664 1.00 45.88  ? 252 ASP B C   1 
ATOM   8417  O O   . ASP C 1 255 ? 53.174 15.156  -48.695 1.00 41.54  ? 252 ASP B O   1 
ATOM   8418  C CB  . ASP C 1 255 ? 52.310 18.107  -50.088 1.00 58.29  ? 252 ASP B CB  1 
ATOM   8419  C CG  . ASP C 1 255 ? 51.182 19.108  -50.238 1.00 72.64  ? 252 ASP B CG  1 
ATOM   8420  O OD1 . ASP C 1 255 ? 50.098 18.720  -50.721 1.00 73.77  ? 252 ASP B OD1 1 
ATOM   8421  O OD2 . ASP C 1 255 ? 51.381 20.282  -49.864 1.00 69.77  ? 252 ASP B OD2 1 
ATOM   8422  N N   . ASP C 1 256 ? 54.661 16.842  -48.558 1.00 39.50  ? 253 ASP B N   1 
ATOM   8423  C CA  . ASP C 1 256 ? 55.796 15.928  -48.476 1.00 35.96  ? 253 ASP B CA  1 
ATOM   8424  C C   . ASP C 1 256 ? 55.775 15.138  -47.174 1.00 39.02  ? 253 ASP B C   1 
ATOM   8425  O O   . ASP C 1 256 ? 56.149 13.959  -47.150 1.00 37.83  ? 253 ASP B O   1 
ATOM   8426  C CB  . ASP C 1 256 ? 57.107 16.703  -48.605 1.00 38.85  ? 253 ASP B CB  1 
ATOM   8427  C CG  . ASP C 1 256 ? 57.179 17.524  -49.877 1.00 47.34  ? 253 ASP B CG  1 
ATOM   8428  O OD1 . ASP C 1 256 ? 56.664 17.065  -50.918 1.00 47.11  ? 253 ASP B OD1 1 
ATOM   8429  O OD2 . ASP C 1 256 ? 57.749 18.635  -49.834 1.00 43.37  ? 253 ASP B OD2 1 
ATOM   8430  N N   . MET C 1 257 ? 55.336 15.770  -46.083 1.00 37.70  ? 254 MET B N   1 
ATOM   8431  C CA  . MET C 1 257 ? 55.385 15.111  -44.782 1.00 39.26  ? 254 MET B CA  1 
ATOM   8432  C C   . MET C 1 257 ? 54.437 13.921  -44.726 1.00 35.03  ? 254 MET B C   1 
ATOM   8433  O O   . MET C 1 257 ? 54.757 12.893  -44.118 1.00 33.59  ? 254 MET B O   1 
ATOM   8434  C CB  . MET C 1 257 ? 55.064 16.110  -43.671 1.00 32.02  ? 254 MET B CB  1 
ATOM   8435  C CG  . MET C 1 257 ? 55.277 15.541  -42.283 1.00 33.71  ? 254 MET B CG  1 
ATOM   8436  S SD  . MET C 1 257 ? 56.993 15.075  -41.985 1.00 34.08  ? 254 MET B SD  1 
ATOM   8437  C CE  . MET C 1 257 ? 56.792 13.923  -40.628 1.00 26.43  ? 254 MET B CE  1 
ATOM   8438  N N   . VAL C 1 258 ? 53.265 14.044  -45.351 1.00 39.48  ? 255 VAL B N   1 
ATOM   8439  C CA  . VAL C 1 258 ? 52.349 12.911  -45.452 1.00 36.54  ? 255 VAL B CA  1 
ATOM   8440  C C   . VAL C 1 258 ? 53.049 11.729  -46.110 1.00 39.89  ? 255 VAL B C   1 
ATOM   8441  O O   . VAL C 1 258 ? 53.007 10.600  -45.609 1.00 40.00  ? 255 VAL B O   1 
ATOM   8442  C CB  . VAL C 1 258 ? 51.077 13.311  -46.222 1.00 39.88  ? 255 VAL B CB  1 
ATOM   8443  C CG1 . VAL C 1 258 ? 50.275 12.073  -46.613 1.00 39.25  ? 255 VAL B CG1 1 
ATOM   8444  C CG2 . VAL C 1 258 ? 50.229 14.268  -45.395 1.00 36.00  ? 255 VAL B CG2 1 
ATOM   8445  N N   . ALA C 1 259 ? 53.727 11.980  -47.233 1.00 33.81  ? 256 ALA B N   1 
ATOM   8446  C CA  . ALA C 1 259 ? 54.415 10.906  -47.942 1.00 37.57  ? 256 ALA B CA  1 
ATOM   8447  C C   . ALA C 1 259 ? 55.578 10.361  -47.123 1.00 40.28  ? 256 ALA B C   1 
ATOM   8448  O O   . ALA C 1 259 ? 55.772 9.142   -47.040 1.00 40.26  ? 256 ALA B O   1 
ATOM   8449  C CB  . ALA C 1 259 ? 54.902 11.401  -49.305 1.00 42.33  ? 256 ALA B CB  1 
ATOM   8450  N N   . GLN C 1 260 ? 56.365 11.250  -46.510 1.00 39.88  ? 257 GLN B N   1 
ATOM   8451  C CA  . GLN C 1 260 ? 57.511 10.806  -45.721 1.00 38.20  ? 257 GLN B CA  1 
ATOM   8452  C C   . GLN C 1 260 ? 57.066 9.944   -44.545 1.00 38.57  ? 257 GLN B C   1 
ATOM   8453  O O   . GLN C 1 260 ? 57.648 8.887   -44.278 1.00 39.00  ? 257 GLN B O   1 
ATOM   8454  C CB  . GLN C 1 260 ? 58.312 12.014  -45.232 1.00 36.06  ? 257 GLN B CB  1 
ATOM   8455  C CG  . GLN C 1 260 ? 59.338 11.682  -44.159 1.00 41.57  ? 257 GLN B CG  1 
ATOM   8456  C CD  . GLN C 1 260 ? 60.080 12.908  -43.665 1.00 43.84  ? 257 GLN B CD  1 
ATOM   8457  O OE1 . GLN C 1 260 ? 60.473 13.768  -44.453 1.00 38.23  ? 257 GLN B OE1 1 
ATOM   8458  N NE2 . GLN C 1 260 ? 60.271 12.997  -42.354 1.00 34.11  ? 257 GLN B NE2 1 
ATOM   8459  N N   . ALA C 1 261 ? 56.022 10.378  -43.835 1.00 35.03  ? 258 ALA B N   1 
ATOM   8460  C CA  . ALA C 1 261 ? 55.540 9.614   -42.688 1.00 33.59  ? 258 ALA B CA  1 
ATOM   8461  C C   . ALA C 1 261 ? 55.072 8.224   -43.103 1.00 37.94  ? 258 ALA B C   1 
ATOM   8462  O O   . ALA C 1 261 ? 55.324 7.239   -42.398 1.00 37.84  ? 258 ALA B O   1 
ATOM   8463  C CB  . ALA C 1 261 ? 54.411 10.372  -41.988 1.00 31.54  ? 258 ALA B CB  1 
ATOM   8464  N N   . MET C 1 262 ? 54.402 8.119   -44.254 1.00 33.24  ? 259 MET B N   1 
ATOM   8465  C CA  . MET C 1 262 ? 53.895 6.827   -44.705 1.00 41.69  ? 259 MET B CA  1 
ATOM   8466  C C   . MET C 1 262 ? 55.009 5.888   -45.147 1.00 39.63  ? 259 MET B C   1 
ATOM   8467  O O   . MET C 1 262 ? 54.815 4.668   -45.136 1.00 45.02  ? 259 MET B O   1 
ATOM   8468  C CB  . MET C 1 262 ? 52.894 7.028   -45.842 1.00 36.75  ? 259 MET B CB  1 
ATOM   8469  C CG  . MET C 1 262 ? 51.593 7.667   -45.389 1.00 39.84  ? 259 MET B CG  1 
ATOM   8470  S SD  . MET C 1 262 ? 50.354 7.758   -46.692 1.00 45.05  ? 259 MET B SD  1 
ATOM   8471  C CE  . MET C 1 262 ? 49.813 6.051   -46.772 1.00 38.96  ? 259 MET B CE  1 
ATOM   8472  N N   . LYS C 1 263 ? 56.167 6.423   -45.529 1.00 39.92  ? 260 LYS B N   1 
ATOM   8473  C CA  . LYS C 1 263 ? 57.316 5.611   -45.906 1.00 41.47  ? 260 LYS B CA  1 
ATOM   8474  C C   . LYS C 1 263 ? 58.278 5.382   -44.749 1.00 40.78  ? 260 LYS B C   1 
ATOM   8475  O O   . LYS C 1 263 ? 59.284 4.686   -44.926 1.00 41.44  ? 260 LYS B O   1 
ATOM   8476  C CB  . LYS C 1 263 ? 58.058 6.264   -47.076 1.00 40.14  ? 260 LYS B CB  1 
ATOM   8477  C CG  . LYS C 1 263 ? 57.224 6.365   -48.346 1.00 48.22  ? 260 LYS B CG  1 
ATOM   8478  C CD  . LYS C 1 263 ? 58.036 6.897   -49.515 1.00 47.12  ? 260 LYS B CD  1 
ATOM   8479  C CE  . LYS C 1 263 ? 57.350 6.590   -50.837 1.00 51.75  ? 260 LYS B CE  1 
ATOM   8480  N NZ  . LYS C 1 263 ? 58.213 6.927   -52.002 1.00 58.35  ? 260 LYS B NZ  1 
ATOM   8481  N N   . SER C 1 264 ? 57.995 5.946   -43.580 1.00 39.17  ? 261 SER B N   1 
ATOM   8482  C CA  . SER C 1 264 ? 58.851 5.829   -42.410 1.00 39.00  ? 261 SER B CA  1 
ATOM   8483  C C   . SER C 1 264 ? 58.534 4.559   -41.629 1.00 34.26  ? 261 SER B C   1 
ATOM   8484  O O   . SER C 1 264 ? 57.485 3.934   -41.805 1.00 41.35  ? 261 SER B O   1 
ATOM   8485  C CB  . SER C 1 264 ? 58.680 7.050   -41.503 1.00 40.22  ? 261 SER B CB  1 
ATOM   8486  O OG  . SER C 1 264 ? 59.223 6.818   -40.214 1.00 40.56  ? 261 SER B OG  1 
ATOM   8487  N N   . GLU C 1 265 ? 59.463 4.181   -40.757 1.00 38.38  ? 262 GLU B N   1 
ATOM   8488  C CA  . GLU C 1 265 ? 59.246 3.086   -39.824 1.00 41.11  ? 262 GLU B CA  1 
ATOM   8489  C C   . GLU C 1 265 ? 58.666 3.553   -38.497 1.00 33.79  ? 262 GLU B C   1 
ATOM   8490  O O   . GLU C 1 265 ? 58.451 2.725   -37.607 1.00 37.27  ? 262 GLU B O   1 
ATOM   8491  C CB  . GLU C 1 265 ? 60.559 2.335   -39.568 1.00 42.27  ? 262 GLU B CB  1 
ATOM   8492  C CG  . GLU C 1 265 ? 61.720 3.225   -39.142 1.00 53.03  ? 262 GLU B CG  1 
ATOM   8493  C CD  . GLU C 1 265 ? 62.775 2.471   -38.349 1.00 57.33  ? 262 GLU B CD  1 
ATOM   8494  O OE1 . GLU C 1 265 ? 63.777 3.096   -37.939 1.00 56.89  ? 262 GLU B OE1 1 
ATOM   8495  O OE2 . GLU C 1 265 ? 62.603 1.252   -38.139 1.00 57.64  ? 262 GLU B OE2 1 
ATOM   8496  N N   . GLY C 1 266 ? 58.403 4.844   -38.348 1.00 32.12  ? 263 GLY B N   1 
ATOM   8497  C CA  . GLY C 1 266 ? 57.993 5.405   -37.082 1.00 30.28  ? 263 GLY B CA  1 
ATOM   8498  C C   . GLY C 1 266 ? 59.171 5.927   -36.285 1.00 32.19  ? 263 GLY B C   1 
ATOM   8499  O O   . GLY C 1 266 ? 60.268 6.151   -36.803 1.00 38.43  ? 263 GLY B O   1 
ATOM   8500  N N   . GLY C 1 267 ? 58.934 6.113   -34.991 1.00 31.03  ? 264 GLY B N   1 
ATOM   8501  C CA  . GLY C 1 267 ? 59.984 6.589   -34.106 1.00 35.03  ? 264 GLY B CA  1 
ATOM   8502  C C   . GLY C 1 267 ? 60.427 8.012   -34.371 1.00 32.32  ? 264 GLY B C   1 
ATOM   8503  O O   . GLY C 1 267 ? 61.630 8.301   -34.326 1.00 35.91  ? 264 GLY B O   1 
ATOM   8504  N N   . PHE C 1 268 ? 59.487 8.904   -34.666 1.00 30.56  ? 265 PHE B N   1 
ATOM   8505  C CA  . PHE C 1 268 ? 59.780 10.319  -34.817 1.00 32.38  ? 265 PHE B CA  1 
ATOM   8506  C C   . PHE C 1 268 ? 58.645 11.115  -34.191 1.00 31.59  ? 265 PHE B C   1 
ATOM   8507  O O   . PHE C 1 268 ? 57.582 10.581  -33.865 1.00 33.68  ? 265 PHE B O   1 
ATOM   8508  C CB  . PHE C 1 268 ? 59.985 10.709  -36.290 1.00 29.95  ? 265 PHE B CB  1 
ATOM   8509  C CG  . PHE C 1 268 ? 58.774 10.493  -37.155 1.00 30.74  ? 265 PHE B CG  1 
ATOM   8510  C CD1 . PHE C 1 268 ? 57.879 11.526  -37.390 1.00 27.82  ? 265 PHE B CD1 1 
ATOM   8511  C CD2 . PHE C 1 268 ? 58.539 9.261   -37.749 1.00 31.14  ? 265 PHE B CD2 1 
ATOM   8512  C CE1 . PHE C 1 268 ? 56.767 11.334  -38.188 1.00 34.50  ? 265 PHE B CE1 1 
ATOM   8513  C CE2 . PHE C 1 268 ? 57.428 9.061   -38.549 1.00 29.03  ? 265 PHE B CE2 1 
ATOM   8514  C CZ  . PHE C 1 268 ? 56.540 10.098  -38.769 1.00 36.97  ? 265 PHE B CZ  1 
ATOM   8515  N N   . ILE C 1 269 ? 58.888 12.406  -34.017 1.00 32.22  ? 266 ILE B N   1 
ATOM   8516  C CA  . ILE C 1 269 ? 57.903 13.331  -33.478 1.00 29.86  ? 266 ILE B CA  1 
ATOM   8517  C C   . ILE C 1 269 ? 57.499 14.296  -34.581 1.00 30.91  ? 266 ILE B C   1 
ATOM   8518  O O   . ILE C 1 269 ? 58.348 14.795  -35.332 1.00 32.40  ? 266 ILE B O   1 
ATOM   8519  C CB  . ILE C 1 269 ? 58.449 14.070  -32.244 1.00 31.45  ? 266 ILE B CB  1 
ATOM   8520  C CG1 . ILE C 1 269 ? 58.791 13.045  -31.163 1.00 31.94  ? 266 ILE B CG1 1 
ATOM   8521  C CG2 . ILE C 1 269 ? 57.439 15.086  -31.719 1.00 27.31  ? 266 ILE B CG2 1 
ATOM   8522  C CD1 . ILE C 1 269 ? 59.326 13.644  -29.922 1.00 31.18  ? 266 ILE B CD1 1 
ATOM   8523  N N   . TRP C 1 270 ? 56.195 14.541  -34.689 1.00 29.52  ? 267 TRP B N   1 
ATOM   8524  C CA  . TRP C 1 270 ? 55.620 15.314  -35.782 1.00 31.76  ? 267 TRP B CA  1 
ATOM   8525  C C   . TRP C 1 270 ? 54.783 16.437  -35.187 1.00 33.00  ? 267 TRP B C   1 
ATOM   8526  O O   . TRP C 1 270 ? 53.700 16.192  -34.646 1.00 32.93  ? 267 TRP B O   1 
ATOM   8527  C CB  . TRP C 1 270 ? 54.781 14.416  -36.693 1.00 26.77  ? 267 TRP B CB  1 
ATOM   8528  C CG  . TRP C 1 270 ? 54.150 15.113  -37.864 1.00 36.93  ? 267 TRP B CG  1 
ATOM   8529  C CD1 . TRP C 1 270 ? 54.258 16.433  -38.199 1.00 32.27  ? 267 TRP B CD1 1 
ATOM   8530  C CD2 . TRP C 1 270 ? 53.314 14.514  -38.860 1.00 33.38  ? 267 TRP B CD2 1 
ATOM   8531  N NE1 . TRP C 1 270 ? 53.535 16.693  -39.336 1.00 33.24  ? 267 TRP B NE1 1 
ATOM   8532  C CE2 . TRP C 1 270 ? 52.946 15.531  -39.763 1.00 33.65  ? 267 TRP B CE2 1 
ATOM   8533  C CE3 . TRP C 1 270 ? 52.839 13.217  -39.075 1.00 34.51  ? 267 TRP B CE3 1 
ATOM   8534  C CZ2 . TRP C 1 270 ? 52.126 15.292  -40.862 1.00 30.38  ? 267 TRP B CZ2 1 
ATOM   8535  C CZ3 . TRP C 1 270 ? 52.025 12.981  -40.168 1.00 32.90  ? 267 TRP B CZ3 1 
ATOM   8536  C CH2 . TRP C 1 270 ? 51.677 14.014  -41.048 1.00 28.38  ? 267 TRP B CH2 1 
ATOM   8537  N N   . ALA C 1 271 ? 55.286 17.662  -35.286 1.00 26.58  ? 268 ALA B N   1 
ATOM   8538  C CA  . ALA C 1 271 ? 54.537 18.845  -34.890 1.00 35.68  ? 268 ALA B CA  1 
ATOM   8539  C C   . ALA C 1 271 ? 53.701 19.308  -36.075 1.00 35.69  ? 268 ALA B C   1 
ATOM   8540  O O   . ALA C 1 271 ? 54.241 19.583  -37.153 1.00 38.62  ? 268 ALA B O   1 
ATOM   8541  C CB  . ALA C 1 271 ? 55.476 19.956  -34.421 1.00 27.65  ? 268 ALA B CB  1 
ATOM   8542  N N   . CYS C 1 272 ? 52.388 19.381  -35.882 1.00 36.41  ? 269 CYS B N   1 
ATOM   8543  C CA  . CYS C 1 272 ? 51.454 19.762  -36.934 1.00 42.82  ? 269 CYS B CA  1 
ATOM   8544  C C   . CYS C 1 272 ? 50.847 21.117  -36.600 1.00 46.84  ? 269 CYS B C   1 
ATOM   8545  O O   . CYS C 1 272 ? 50.188 21.267  -35.564 1.00 48.21  ? 269 CYS B O   1 
ATOM   8546  C CB  . CYS C 1 272 ? 50.356 18.712  -37.102 1.00 44.16  ? 269 CYS B CB  1 
ATOM   8547  S SG  . CYS C 1 272 ? 50.942 17.036  -37.426 1.00 53.97  ? 269 CYS B SG  1 
ATOM   8548  N N   . LYS C 1 273 ? 51.081 22.098  -37.470 1.00 48.31  ? 270 LYS B N   1 
ATOM   8549  C CA  . LYS C 1 273 ? 50.434 23.399  -37.365 1.00 52.20  ? 270 LYS B CA  1 
ATOM   8550  C C   . LYS C 1 273 ? 48.936 23.234  -37.579 1.00 59.51  ? 270 LYS B C   1 
ATOM   8551  O O   . LYS C 1 273 ? 48.138 23.413  -36.654 1.00 57.24  ? 270 LYS B O   1 
ATOM   8552  C CB  . LYS C 1 273 ? 51.019 24.370  -38.393 1.00 48.08  ? 270 LYS B CB  1 
ATOM   8553  C CG  . LYS C 1 273 ? 50.849 25.831  -38.037 1.00 46.43  ? 270 LYS B CG  1 
ATOM   8554  C CD  . LYS C 1 273 ? 50.267 26.629  -39.187 1.00 50.20  ? 270 LYS B CD  1 
ATOM   8555  C CE  . LYS C 1 273 ? 48.758 26.469  -39.267 1.00 52.16  ? 270 LYS B CE  1 
ATOM   8556  N NZ  . LYS C 1 273 ? 48.172 27.349  -40.316 1.00 43.38  ? 270 LYS B NZ  1 
ATOM   8557  N N   . ASN C 1 274 ? 48.557 22.895  -38.808 1.00 67.36  ? 271 ASN B N   1 
ATOM   8558  C CA  . ASN C 1 274 ? 47.187 22.523  -39.151 1.00 71.30  ? 271 ASN B CA  1 
ATOM   8559  C C   . ASN C 1 274 ? 46.921 21.145  -38.567 1.00 68.23  ? 271 ASN B C   1 
ATOM   8560  O O   . ASN C 1 274 ? 47.340 20.136  -39.140 1.00 66.83  ? 271 ASN B O   1 
ATOM   8561  C CB  . ASN C 1 274 ? 47.011 22.485  -40.666 1.00 64.20  ? 271 ASN B CB  1 
ATOM   8562  C CG  . ASN C 1 274 ? 47.535 23.730  -41.351 1.00 75.22  ? 271 ASN B CG  1 
ATOM   8563  O OD1 . ASN C 1 274 ? 46.867 24.762  -41.395 1.00 76.42  ? 271 ASN B OD1 1 
ATOM   8564  N ND2 . ASN C 1 274 ? 48.758 23.645  -41.869 1.00 70.94  ? 271 ASN B ND2 1 
ATOM   8565  N N   . TYR C 1 275 ? 46.240 21.070  -37.423 1.00 64.12  ? 272 TYR B N   1 
ATOM   8566  C CA  . TYR C 1 275 ? 45.940 19.758  -36.861 1.00 62.02  ? 272 TYR B CA  1 
ATOM   8567  C C   . TYR C 1 275 ? 44.626 19.740  -36.102 1.00 60.39  ? 272 TYR B C   1 
ATOM   8568  O O   . TYR C 1 275 ? 44.417 20.530  -35.177 1.00 60.31  ? 272 TYR B O   1 
ATOM   8569  C CB  . TYR C 1 275 ? 47.064 19.251  -35.958 1.00 61.66  ? 272 TYR B CB  1 
ATOM   8570  C CG  . TYR C 1 275 ? 47.040 17.746  -35.904 1.00 54.89  ? 272 TYR B CG  1 
ATOM   8571  C CD1 . TYR C 1 275 ? 47.276 17.000  -37.050 1.00 59.40  ? 272 TYR B CD1 1 
ATOM   8572  C CD2 . TYR C 1 275 ? 46.742 17.070  -34.730 1.00 53.54  ? 272 TYR B CD2 1 
ATOM   8573  C CE1 . TYR C 1 275 ? 47.237 15.625  -37.028 1.00 58.86  ? 272 TYR B CE1 1 
ATOM   8574  C CE2 . TYR C 1 275 ? 46.703 15.689  -34.696 1.00 57.65  ? 272 TYR B CE2 1 
ATOM   8575  C CZ  . TYR C 1 275 ? 46.950 14.972  -35.851 1.00 62.21  ? 272 TYR B CZ  1 
ATOM   8576  O OH  . TYR C 1 275 ? 46.913 13.597  -35.832 1.00 57.61  ? 272 TYR B OH  1 
ATOM   8577  N N   . ASP C 1 276 ? 43.770 18.801  -36.488 1.00 62.20  ? 273 ASP B N   1 
ATOM   8578  C CA  . ASP C 1 276 ? 42.568 18.415  -35.761 1.00 58.91  ? 273 ASP B CA  1 
ATOM   8579  C C   . ASP C 1 276 ? 42.837 17.024  -35.195 1.00 54.07  ? 273 ASP B C   1 
ATOM   8580  O O   . ASP C 1 276 ? 42.660 16.020  -35.894 1.00 48.69  ? 273 ASP B O   1 
ATOM   8581  C CB  . ASP C 1 276 ? 41.357 18.420  -36.691 1.00 55.65  ? 273 ASP B CB  1 
ATOM   8582  C CG  . ASP C 1 276 ? 40.044 18.369  -35.946 1.00 54.04  ? 273 ASP B CG  1 
ATOM   8583  O OD1 . ASP C 1 276 ? 39.987 17.766  -34.852 1.00 56.93  ? 273 ASP B OD1 1 
ATOM   8584  O OD2 . ASP C 1 276 ? 39.062 18.933  -36.465 1.00 48.19  ? 273 ASP B OD2 1 
ATOM   8585  N N   . GLY C 1 277 ? 43.278 16.969  -33.933 1.00 48.72  ? 274 GLY B N   1 
ATOM   8586  C CA  . GLY C 1 277 ? 43.573 15.684  -33.317 1.00 49.69  ? 274 GLY B CA  1 
ATOM   8587  C C   . GLY C 1 277 ? 42.385 14.741  -33.315 1.00 52.14  ? 274 GLY B C   1 
ATOM   8588  O O   . GLY C 1 277 ? 42.545 13.522  -33.418 1.00 49.68  ? 274 GLY B O   1 
ATOM   8589  N N   . ASP C 1 278 ? 41.173 15.291  -33.210 1.00 51.64  ? 275 ASP B N   1 
ATOM   8590  C CA  . ASP C 1 278 ? 39.981 14.453  -33.209 1.00 49.90  ? 275 ASP B CA  1 
ATOM   8591  C C   . ASP C 1 278 ? 39.808 13.740  -34.544 1.00 48.65  ? 275 ASP B C   1 
ATOM   8592  O O   . ASP C 1 278 ? 39.319 12.606  -34.592 1.00 48.66  ? 275 ASP B O   1 
ATOM   8593  C CB  . ASP C 1 278 ? 38.750 15.303  -32.891 1.00 52.32  ? 275 ASP B CB  1 
ATOM   8594  C CG  . ASP C 1 278 ? 38.778 15.868  -31.485 1.00 62.06  ? 275 ASP B CG  1 
ATOM   8595  O OD1 . ASP C 1 278 ? 39.538 15.344  -30.643 1.00 63.82  ? 275 ASP B OD1 1 
ATOM   8596  O OD2 . ASP C 1 278 ? 38.046 16.846  -31.223 1.00 72.89  ? 275 ASP B OD2 1 
ATOM   8597  N N   . VAL C 1 279 ? 40.217 14.380  -35.638 1.00 44.38  ? 276 VAL B N   1 
ATOM   8598  C CA  . VAL C 1 279 ? 39.985 13.844  -36.975 1.00 45.80  ? 276 VAL B CA  1 
ATOM   8599  C C   . VAL C 1 279 ? 41.157 12.982  -37.423 1.00 46.56  ? 276 VAL B C   1 
ATOM   8600  O O   . VAL C 1 279 ? 40.984 11.802  -37.750 1.00 46.76  ? 276 VAL B O   1 
ATOM   8601  C CB  . VAL C 1 279 ? 39.728 14.977  -37.986 1.00 45.11  ? 276 VAL B CB  1 
ATOM   8602  C CG1 . VAL C 1 279 ? 39.586 14.414  -39.388 1.00 45.57  ? 276 VAL B CG1 1 
ATOM   8603  C CG2 . VAL C 1 279 ? 38.477 15.752  -37.599 1.00 46.49  ? 276 VAL B CG2 1 
ATOM   8604  N N   . GLN C 1 280 ? 42.356 13.562  -37.443 1.00 43.57  ? 277 GLN B N   1 
ATOM   8605  C CA  . GLN C 1 280 ? 43.497 12.890  -38.052 1.00 51.15  ? 277 GLN B CA  1 
ATOM   8606  C C   . GLN C 1 280 ? 44.095 11.802  -37.170 1.00 45.57  ? 277 GLN B C   1 
ATOM   8607  O O   . GLN C 1 280 ? 44.848 10.963  -37.672 1.00 41.10  ? 277 GLN B O   1 
ATOM   8608  C CB  . GLN C 1 280 ? 44.565 13.916  -38.422 1.00 47.87  ? 277 GLN B CB  1 
ATOM   8609  C CG  . GLN C 1 280 ? 44.026 15.027  -39.304 1.00 61.01  ? 277 GLN B CG  1 
ATOM   8610  C CD  . GLN C 1 280 ? 44.969 16.208  -39.441 1.00 66.81  ? 277 GLN B CD  1 
ATOM   8611  O OE1 . GLN C 1 280 ? 44.737 17.270  -38.864 1.00 67.80  ? 277 GLN B OE1 1 
ATOM   8612  N NE2 . GLN C 1 280 ? 46.033 16.032  -40.218 1.00 57.22  ? 277 GLN B NE2 1 
ATOM   8613  N N   . SER C 1 281 ? 43.779 11.788  -35.877 1.00 37.53  ? 278 SER B N   1 
ATOM   8614  C CA  . SER C 1 281 ? 44.255 10.745  -34.972 1.00 41.18  ? 278 SER B CA  1 
ATOM   8615  C C   . SER C 1 281 ? 43.095 9.924   -34.427 1.00 37.95  ? 278 SER B C   1 
ATOM   8616  O O   . SER C 1 281 ? 42.991 8.733   -34.727 1.00 31.77  ? 278 SER B O   1 
ATOM   8617  C CB  . SER C 1 281 ? 45.081 11.348  -33.831 1.00 41.01  ? 278 SER B CB  1 
ATOM   8618  O OG  . SER C 1 281 ? 46.445 11.471  -34.182 1.00 38.89  ? 278 SER B OG  1 
ATOM   8619  N N   . ASP C 1 282 ? 42.206 10.532  -33.639 1.00 36.15  ? 279 ASP B N   1 
ATOM   8620  C CA  . ASP C 1 282 ? 41.214 9.757   -32.904 1.00 38.99  ? 279 ASP B CA  1 
ATOM   8621  C C   . ASP C 1 282 ? 40.224 9.070   -33.841 1.00 34.91  ? 279 ASP B C   1 
ATOM   8622  O O   . ASP C 1 282 ? 39.939 7.876   -33.687 1.00 34.36  ? 279 ASP B O   1 
ATOM   8623  C CB  . ASP C 1 282 ? 40.488 10.656  -31.902 1.00 36.17  ? 279 ASP B CB  1 
ATOM   8624  C CG  . ASP C 1 282 ? 41.414 11.195  -30.827 1.00 45.25  ? 279 ASP B CG  1 
ATOM   8625  O OD1 . ASP C 1 282 ? 42.485 10.590  -30.609 1.00 45.11  ? 279 ASP B OD1 1 
ATOM   8626  O OD2 . ASP C 1 282 ? 41.081 12.225  -30.206 1.00 47.88  ? 279 ASP B OD2 1 
ATOM   8627  N N   . SER C 1 283 ? 39.690 9.804   -34.822 1.00 34.27  ? 280 SER B N   1 
ATOM   8628  C CA  . SER C 1 283 ? 38.686 9.221   -35.709 1.00 38.38  ? 280 SER B CA  1 
ATOM   8629  C C   . SER C 1 283 ? 39.289 8.143   -36.600 1.00 36.31  ? 280 SER B C   1 
ATOM   8630  O O   . SER C 1 283 ? 38.651 7.115   -36.859 1.00 36.67  ? 280 SER B O   1 
ATOM   8631  C CB  . SER C 1 283 ? 38.026 10.314  -36.550 1.00 44.72  ? 280 SER B CB  1 
ATOM   8632  O OG  . SER C 1 283 ? 37.426 11.296  -35.724 1.00 43.76  ? 280 SER B OG  1 
ATOM   8633  N N   . VAL C 1 284 ? 40.517 8.356   -37.077 1.00 38.32  ? 281 VAL B N   1 
ATOM   8634  C CA  . VAL C 1 284 ? 41.200 7.324   -37.854 1.00 37.38  ? 281 VAL B CA  1 
ATOM   8635  C C   . VAL C 1 284 ? 41.386 6.071   -37.009 1.00 41.24  ? 281 VAL B C   1 
ATOM   8636  O O   . VAL C 1 284 ? 41.085 4.953   -37.445 1.00 39.10  ? 281 VAL B O   1 
ATOM   8637  C CB  . VAL C 1 284 ? 42.547 7.847   -38.385 1.00 37.98  ? 281 VAL B CB  1 
ATOM   8638  C CG1 . VAL C 1 284 ? 43.313 6.727   -39.078 1.00 37.80  ? 281 VAL B CG1 1 
ATOM   8639  C CG2 . VAL C 1 284 ? 42.328 9.015   -39.329 1.00 31.93  ? 281 VAL B CG2 1 
ATOM   8640  N N   . ALA C 1 285 ? 41.871 6.242   -35.775 1.00 34.44  ? 282 ALA B N   1 
ATOM   8641  C CA  . ALA C 1 285 ? 42.089 5.098   -34.897 1.00 37.79  ? 282 ALA B CA  1 
ATOM   8642  C C   . ALA C 1 285 ? 40.773 4.414   -34.545 1.00 39.10  ? 282 ALA B C   1 
ATOM   8643  O O   . ALA C 1 285 ? 40.712 3.181   -34.455 1.00 37.27  ? 282 ALA B O   1 
ATOM   8644  C CB  . ALA C 1 285 ? 42.827 5.539   -33.633 1.00 32.95  ? 282 ALA B CB  1 
ATOM   8645  N N   . GLN C 1 286 ? 39.710 5.196   -34.347 1.00 37.46  ? 283 GLN B N   1 
ATOM   8646  C CA  . GLN C 1 286 ? 38.396 4.611   -34.099 1.00 39.48  ? 283 GLN B CA  1 
ATOM   8647  C C   . GLN C 1 286 ? 37.921 3.808   -35.305 1.00 37.64  ? 283 GLN B C   1 
ATOM   8648  O O   . GLN C 1 286 ? 37.489 2.657   -35.169 1.00 41.55  ? 283 GLN B O   1 
ATOM   8649  C CB  . GLN C 1 286 ? 37.393 5.710   -33.753 1.00 39.55  ? 283 GLN B CB  1 
ATOM   8650  C CG  . GLN C 1 286 ? 35.971 5.215   -33.556 1.00 40.56  ? 283 GLN B CG  1 
ATOM   8651  C CD  . GLN C 1 286 ? 35.040 6.318   -33.094 1.00 45.09  ? 283 GLN B CD  1 
ATOM   8652  O OE1 . GLN C 1 286 ? 35.485 7.357   -32.606 1.00 45.39  ? 283 GLN B OE1 1 
ATOM   8653  N NE2 . GLN C 1 286 ? 33.740 6.099   -33.246 1.00 35.94  ? 283 GLN B NE2 1 
ATOM   8654  N N   . GLY C 1 287 ? 37.997 4.402   -36.498 1.00 38.69  ? 284 GLY B N   1 
ATOM   8655  C CA  . GLY C 1 287 ? 37.631 3.670   -37.699 1.00 43.43  ? 284 GLY B CA  1 
ATOM   8656  C C   . GLY C 1 287 ? 38.478 2.427   -37.897 1.00 45.73  ? 284 GLY B C   1 
ATOM   8657  O O   . GLY C 1 287 ? 37.975 1.378   -38.309 1.00 42.98  ? 284 GLY B O   1 
ATOM   8658  N N   . TYR C 1 288 ? 39.772 2.523   -37.589 1.00 41.39  ? 285 TYR B N   1 
ATOM   8659  C CA  . TYR C 1 288 ? 40.669 1.380   -37.713 1.00 39.32  ? 285 TYR B CA  1 
ATOM   8660  C C   . TYR C 1 288 ? 40.477 0.378   -36.581 1.00 35.47  ? 285 TYR B C   1 
ATOM   8661  O O   . TYR C 1 288 ? 40.810 -0.801  -36.739 1.00 41.56  ? 285 TYR B O   1 
ATOM   8662  C CB  . TYR C 1 288 ? 42.118 1.871   -37.754 1.00 40.83  ? 285 TYR B CB  1 
ATOM   8663  C CG  . TYR C 1 288 ? 43.139 0.836   -38.172 1.00 44.05  ? 285 TYR B CG  1 
ATOM   8664  C CD1 . TYR C 1 288 ? 43.198 0.375   -39.482 1.00 38.50  ? 285 TYR B CD1 1 
ATOM   8665  C CD2 . TYR C 1 288 ? 44.067 0.344   -37.262 1.00 41.15  ? 285 TYR B CD2 1 
ATOM   8666  C CE1 . TYR C 1 288 ? 44.140 -0.562  -39.867 1.00 40.55  ? 285 TYR B CE1 1 
ATOM   8667  C CE2 . TYR C 1 288 ? 45.011 -0.590  -37.637 1.00 41.70  ? 285 TYR B CE2 1 
ATOM   8668  C CZ  . TYR C 1 288 ? 45.044 -1.039  -38.940 1.00 45.09  ? 285 TYR B CZ  1 
ATOM   8669  O OH  . TYR C 1 288 ? 45.984 -1.971  -39.314 1.00 46.07  ? 285 TYR B OH  1 
ATOM   8670  N N   . GLY C 1 289 ? 39.943 0.816   -35.446 1.00 36.83  ? 286 GLY B N   1 
ATOM   8671  C CA  . GLY C 1 289 ? 39.753 -0.051  -34.302 1.00 38.49  ? 286 GLY B CA  1 
ATOM   8672  C C   . GLY C 1 289 ? 40.877 -0.052  -33.288 1.00 39.53  ? 286 GLY B C   1 
ATOM   8673  O O   . GLY C 1 289 ? 40.983 -1.012  -32.514 1.00 43.15  ? 286 GLY B O   1 
ATOM   8674  N N   . SER C 1 290 ? 41.711 0.988   -33.261 1.00 35.16  ? 287 SER B N   1 
ATOM   8675  C CA  . SER C 1 290 ? 42.839 1.077   -32.341 1.00 36.02  ? 287 SER B CA  1 
ATOM   8676  C C   . SER C 1 290 ? 42.694 2.224   -31.348 1.00 40.31  ? 287 SER B C   1 
ATOM   8677  O O   . SER C 1 290 ? 43.676 2.588   -30.688 1.00 36.13  ? 287 SER B O   1 
ATOM   8678  C CB  . SER C 1 290 ? 44.145 1.228   -33.126 1.00 33.34  ? 287 SER B CB  1 
ATOM   8679  O OG  . SER C 1 290 ? 44.040 2.279   -34.069 1.00 36.85  ? 287 SER B OG  1 
ATOM   8680  N N   . LEU C 1 291 ? 41.494 2.798   -31.222 1.00 35.39  ? 288 LEU B N   1 
ATOM   8681  C CA  . LEU C 1 291 ? 41.303 3.951   -30.348 1.00 38.45  ? 288 LEU B CA  1 
ATOM   8682  C C   . LEU C 1 291 ? 41.541 3.599   -28.884 1.00 39.37  ? 288 LEU B C   1 
ATOM   8683  O O   . LEU C 1 291 ? 41.914 4.470   -28.085 1.00 32.42  ? 288 LEU B O   1 
ATOM   8684  C CB  . LEU C 1 291 ? 39.898 4.516   -30.544 1.00 37.66  ? 288 LEU B CB  1 
ATOM   8685  C CG  . LEU C 1 291 ? 39.576 5.854   -29.876 1.00 38.56  ? 288 LEU B CG  1 
ATOM   8686  C CD1 . LEU C 1 291 ? 40.589 6.918   -30.267 1.00 38.48  ? 288 LEU B CD1 1 
ATOM   8687  C CD2 . LEU C 1 291 ? 38.166 6.290   -30.229 1.00 39.82  ? 288 LEU B CD2 1 
ATOM   8688  N N   . GLY C 1 292 ? 41.338 2.335   -28.512 1.00 31.63  ? 289 GLY B N   1 
ATOM   8689  C CA  . GLY C 1 292 ? 41.663 1.898   -27.166 1.00 33.48  ? 289 GLY B CA  1 
ATOM   8690  C C   . GLY C 1 292 ? 43.147 1.868   -26.860 1.00 37.83  ? 289 GLY B C   1 
ATOM   8691  O O   . GLY C 1 292 ? 43.517 1.647   -25.702 1.00 31.09  ? 289 GLY B O   1 
ATOM   8692  N N   . MET C 1 293 ? 43.997 2.076   -27.866 1.00 33.53  ? 290 MET B N   1 
ATOM   8693  C CA  . MET C 1 293 ? 45.444 2.104   -27.699 1.00 30.76  ? 290 MET B CA  1 
ATOM   8694  C C   . MET C 1 293 ? 46.025 3.495   -27.928 1.00 32.53  ? 290 MET B C   1 
ATOM   8695  O O   . MET C 1 293 ? 47.249 3.636   -28.027 1.00 34.04  ? 290 MET B O   1 
ATOM   8696  C CB  . MET C 1 293 ? 46.112 1.110   -28.654 1.00 31.93  ? 290 MET B CB  1 
ATOM   8697  C CG  . MET C 1 293 ? 45.608 -0.323  -28.545 1.00 29.31  ? 290 MET B CG  1 
ATOM   8698  S SD  . MET C 1 293 ? 45.956 -1.094  -26.958 1.00 33.87  ? 290 MET B SD  1 
ATOM   8699  C CE  . MET C 1 293 ? 47.610 -1.715  -27.253 1.00 28.81  ? 290 MET B CE  1 
ATOM   8700  N N   . MET C 1 294 ? 45.183 4.522   -28.019 1.00 27.51  ? 291 MET B N   1 
ATOM   8701  C CA  . MET C 1 294 ? 45.637 5.874   -28.338 1.00 32.92  ? 291 MET B CA  1 
ATOM   8702  C C   . MET C 1 294 ? 45.844 6.662   -27.046 1.00 35.34  ? 291 MET B C   1 
ATOM   8703  O O   . MET C 1 294 ? 44.890 6.920   -26.303 1.00 33.48  ? 291 MET B O   1 
ATOM   8704  C CB  . MET C 1 294 ? 44.638 6.564   -29.263 1.00 28.65  ? 291 MET B CB  1 
ATOM   8705  C CG  . MET C 1 294 ? 45.115 7.893   -29.823 1.00 43.35  ? 291 MET B CG  1 
ATOM   8706  S SD  . MET C 1 294 ? 46.574 7.773   -30.873 1.00 50.31  ? 291 MET B SD  1 
ATOM   8707  C CE  . MET C 1 294 ? 46.062 6.498   -32.018 1.00 38.56  ? 291 MET B CE  1 
ATOM   8708  N N   . THR C 1 295 ? 47.091 7.042   -26.780 1.00 32.01  ? 292 THR B N   1 
ATOM   8709  C CA  . THR C 1 295 ? 47.463 7.779   -25.582 1.00 38.38  ? 292 THR B CA  1 
ATOM   8710  C C   . THR C 1 295 ? 47.555 9.267   -25.903 1.00 39.69  ? 292 THR B C   1 
ATOM   8711  O O   . THR C 1 295 ? 47.733 9.662   -27.059 1.00 36.13  ? 292 THR B O   1 
ATOM   8712  C CB  . THR C 1 295 ? 48.801 7.273   -25.021 1.00 32.61  ? 292 THR B CB  1 
ATOM   8713  O OG1 . THR C 1 295 ? 48.861 7.534   -23.615 1.00 51.67  ? 292 THR B OG1 1 
ATOM   8714  C CG2 . THR C 1 295 ? 49.972 7.979   -25.681 1.00 24.81  ? 292 THR B CG2 1 
ATOM   8715  N N   . SER C 1 296 ? 47.416 10.093  -24.868 1.00 32.92  ? 293 SER B N   1 
ATOM   8716  C CA  . SER C 1 296 ? 47.483 11.538  -25.024 1.00 35.29  ? 293 SER B CA  1 
ATOM   8717  C C   . SER C 1 296 ? 48.049 12.165  -23.760 1.00 37.32  ? 293 SER B C   1 
ATOM   8718  O O   . SER C 1 296 ? 47.846 11.664  -22.651 1.00 32.10  ? 293 SER B O   1 
ATOM   8719  C CB  . SER C 1 296 ? 46.108 12.143  -25.334 1.00 32.07  ? 293 SER B CB  1 
ATOM   8720  O OG  . SER C 1 296 ? 46.120 13.545  -25.129 1.00 43.17  ? 293 SER B OG  1 
ATOM   8721  N N   . VAL C 1 297 ? 48.756 13.277  -23.938 1.00 32.95  ? 294 VAL B N   1 
ATOM   8722  C CA  . VAL C 1 297 ? 49.384 13.974  -22.820 1.00 30.16  ? 294 VAL B CA  1 
ATOM   8723  C C   . VAL C 1 297 ? 49.489 15.455  -23.160 1.00 33.97  ? 294 VAL B C   1 
ATOM   8724  O O   . VAL C 1 297 ? 49.850 15.824  -24.282 1.00 32.33  ? 294 VAL B O   1 
ATOM   8725  C CB  . VAL C 1 297 ? 50.763 13.371  -22.476 1.00 32.83  ? 294 VAL B CB  1 
ATOM   8726  C CG1 . VAL C 1 297 ? 51.746 13.535  -23.629 1.00 34.02  ? 294 VAL B CG1 1 
ATOM   8727  C CG2 . VAL C 1 297 ? 51.307 13.998  -21.221 1.00 32.24  ? 294 VAL B CG2 1 
ATOM   8728  N N   . LEU C 1 298 ? 49.149 16.301  -22.189 1.00 33.57  ? 295 LEU B N   1 
ATOM   8729  C CA  . LEU C 1 298 ? 49.241 17.749  -22.319 1.00 30.24  ? 295 LEU B CA  1 
ATOM   8730  C C   . LEU C 1 298 ? 50.475 18.229  -21.565 1.00 34.01  ? 295 LEU B C   1 
ATOM   8731  O O   . LEU C 1 298 ? 50.595 18.002  -20.356 1.00 27.72  ? 295 LEU B O   1 
ATOM   8732  C CB  . LEU C 1 298 ? 47.984 18.429  -21.778 1.00 28.88  ? 295 LEU B CB  1 
ATOM   8733  C CG  . LEU C 1 298 ? 48.014 19.957  -21.693 1.00 38.11  ? 295 LEU B CG  1 
ATOM   8734  C CD1 . LEU C 1 298 ? 47.949 20.579  -23.082 1.00 24.16  ? 295 LEU B CD1 1 
ATOM   8735  C CD2 . LEU C 1 298 ? 46.896 20.490  -20.800 1.00 27.88  ? 295 LEU B CD2 1 
ATOM   8736  N N   . VAL C 1 299 ? 51.386 18.886  -22.278 1.00 30.14  ? 296 VAL B N   1 
ATOM   8737  C CA  . VAL C 1 299 ? 52.664 19.330  -21.731 1.00 32.41  ? 296 VAL B CA  1 
ATOM   8738  C C   . VAL C 1 299 ? 52.609 20.845  -21.586 1.00 36.45  ? 296 VAL B C   1 
ATOM   8739  O O   . VAL C 1 299 ? 52.535 21.572  -22.584 1.00 33.98  ? 296 VAL B O   1 
ATOM   8740  C CB  . VAL C 1 299 ? 53.840 18.894  -22.615 1.00 34.73  ? 296 VAL B CB  1 
ATOM   8741  C CG1 . VAL C 1 299 ? 55.134 19.528  -22.126 1.00 36.86  ? 296 VAL B CG1 1 
ATOM   8742  C CG2 . VAL C 1 299 ? 53.956 17.375  -22.622 1.00 29.87  ? 296 VAL B CG2 1 
ATOM   8743  N N   . CYS C 1 300 ? 52.654 21.320  -20.342 1.00 32.56  ? 297 CYS B N   1 
ATOM   8744  C CA  . CYS C 1 300 ? 52.454 22.734  -20.072 1.00 35.80  ? 297 CYS B CA  1 
ATOM   8745  C C   . CYS C 1 300 ? 53.713 23.540  -20.393 1.00 35.31  ? 297 CYS B C   1 
ATOM   8746  O O   . CYS C 1 300 ? 54.821 22.996  -20.416 1.00 35.92  ? 297 CYS B O   1 
ATOM   8747  C CB  . CYS C 1 300 ? 52.050 22.945  -18.615 1.00 31.61  ? 297 CYS B CB  1 
ATOM   8748  S SG  . CYS C 1 300 ? 50.439 22.237  -18.196 1.00 40.41  ? 297 CYS B SG  1 
ATOM   8749  N N   . PRO C 1 301 ? 53.563 24.845  -20.647 1.00 38.48  ? 298 PRO B N   1 
ATOM   8750  C CA  . PRO C 1 301 ? 54.731 25.658  -21.028 1.00 42.67  ? 298 PRO B CA  1 
ATOM   8751  C C   . PRO C 1 301 ? 55.814 25.726  -19.967 1.00 38.75  ? 298 PRO B C   1 
ATOM   8752  O O   . PRO C 1 301 ? 56.974 25.986  -20.311 1.00 42.16  ? 298 PRO B O   1 
ATOM   8753  C CB  . PRO C 1 301 ? 54.126 27.045  -21.288 1.00 33.59  ? 298 PRO B CB  1 
ATOM   8754  C CG  . PRO C 1 301 ? 52.695 26.787  -21.600 1.00 39.86  ? 298 PRO B CG  1 
ATOM   8755  C CD  . PRO C 1 301 ? 52.305 25.604  -20.762 1.00 35.10  ? 298 PRO B CD  1 
ATOM   8756  N N   . ASP C 1 302 ? 55.488 25.495  -18.695 1.00 36.66  ? 299 ASP B N   1 
ATOM   8757  C CA  . ASP C 1 302 ? 56.506 25.586  -17.654 1.00 41.54  ? 299 ASP B CA  1 
ATOM   8758  C C   . ASP C 1 302 ? 57.568 24.499  -17.775 1.00 43.25  ? 299 ASP B C   1 
ATOM   8759  O O   . ASP C 1 302 ? 58.597 24.579  -17.096 1.00 42.40  ? 299 ASP B O   1 
ATOM   8760  C CB  . ASP C 1 302 ? 55.856 25.532  -16.269 1.00 36.13  ? 299 ASP B CB  1 
ATOM   8761  C CG  . ASP C 1 302 ? 55.023 24.278  -16.055 1.00 39.32  ? 299 ASP B CG  1 
ATOM   8762  O OD1 . ASP C 1 302 ? 55.082 23.354  -16.894 1.00 36.06  ? 299 ASP B OD1 1 
ATOM   8763  O OD2 . ASP C 1 302 ? 54.302 24.218  -15.037 1.00 42.22  ? 299 ASP B OD2 1 
ATOM   8764  N N   . GLY C 1 303 ? 57.346 23.497  -18.624 1.00 39.12  ? 300 GLY B N   1 
ATOM   8765  C CA  . GLY C 1 303 ? 58.260 22.376  -18.705 1.00 35.70  ? 300 GLY B CA  1 
ATOM   8766  C C   . GLY C 1 303 ? 58.249 21.472  -17.495 1.00 39.40  ? 300 GLY B C   1 
ATOM   8767  O O   . GLY C 1 303 ? 59.169 20.668  -17.326 1.00 44.67  ? 300 GLY B O   1 
ATOM   8768  N N   . LYS C 1 304 ? 57.222 21.570  -16.649 1.00 37.43  ? 301 LYS B N   1 
ATOM   8769  C CA  . LYS C 1 304 ? 57.198 20.837  -15.389 1.00 41.19  ? 301 LYS B CA  1 
ATOM   8770  C C   . LYS C 1 304 ? 55.865 20.131  -15.160 1.00 37.11  ? 301 LYS B C   1 
ATOM   8771  O O   . LYS C 1 304 ? 55.819 19.079  -14.513 1.00 33.78  ? 301 LYS B O   1 
ATOM   8772  C CB  . LYS C 1 304 ? 57.491 21.788  -14.225 1.00 40.51  ? 301 LYS B CB  1 
ATOM   8773  C CG  . LYS C 1 304 ? 58.370 21.199  -13.134 1.00 53.32  ? 301 LYS B CG  1 
ATOM   8774  C CD  . LYS C 1 304 ? 58.368 22.067  -11.880 1.00 51.44  ? 301 LYS B CD  1 
ATOM   8775  C CE  . LYS C 1 304 ? 59.276 21.484  -10.804 1.00 60.93  ? 301 LYS B CE  1 
ATOM   8776  N NZ  . LYS C 1 304 ? 59.106 22.171  -9.493  1.00 65.16  ? 301 LYS B NZ  1 
ATOM   8777  N N   . THR C 1 305 ? 54.779 20.701  -15.681 1.00 31.56  ? 302 THR B N   1 
ATOM   8778  C CA  . THR C 1 305 ? 53.429 20.224  -15.404 1.00 36.38  ? 302 THR B CA  1 
ATOM   8779  C C   . THR C 1 305 ? 52.892 19.431  -16.590 1.00 32.63  ? 302 THR B C   1 
ATOM   8780  O O   . THR C 1 305 ? 52.997 19.873  -17.740 1.00 29.46  ? 302 THR B O   1 
ATOM   8781  C CB  . THR C 1 305 ? 52.496 21.393  -15.080 1.00 31.66  ? 302 THR B CB  1 
ATOM   8782  O OG1 . THR C 1 305 ? 52.955 22.045  -13.891 1.00 33.84  ? 302 THR B OG1 1 
ATOM   8783  C CG2 . THR C 1 305 ? 51.071 20.902  -14.863 1.00 30.65  ? 302 THR B CG2 1 
ATOM   8784  N N   . VAL C 1 306 ? 52.303 18.271  -16.299 1.00 30.94  ? 303 VAL B N   1 
ATOM   8785  C CA  . VAL C 1 306 ? 51.849 17.318  -17.304 1.00 33.72  ? 303 VAL B CA  1 
ATOM   8786  C C   . VAL C 1 306 ? 50.480 16.782  -16.903 1.00 34.59  ? 303 VAL B C   1 
ATOM   8787  O O   . VAL C 1 306 ? 50.240 16.492  -15.726 1.00 31.19  ? 303 VAL B O   1 
ATOM   8788  C CB  . VAL C 1 306 ? 52.869 16.167  -17.466 1.00 29.89  ? 303 VAL B CB  1 
ATOM   8789  C CG1 . VAL C 1 306 ? 52.214 14.929  -18.024 1.00 37.42  ? 303 VAL B CG1 1 
ATOM   8790  C CG2 . VAL C 1 306 ? 54.030 16.603  -18.357 1.00 35.84  ? 303 VAL B CG2 1 
ATOM   8791  N N   . GLU C 1 307 ? 49.577 16.664  -17.880 1.00 34.10  ? 304 GLU B N   1 
ATOM   8792  C CA  . GLU C 1 307 ? 48.282 16.018  -17.693 1.00 29.90  ? 304 GLU B CA  1 
ATOM   8793  C C   . GLU C 1 307 ? 48.137 14.897  -18.713 1.00 33.76  ? 304 GLU B C   1 
ATOM   8794  O O   . GLU C 1 307 ? 48.173 15.147  -19.922 1.00 29.30  ? 304 GLU B O   1 
ATOM   8795  C CB  . GLU C 1 307 ? 47.124 17.005  -17.841 1.00 32.63  ? 304 GLU B CB  1 
ATOM   8796  C CG  . GLU C 1 307 ? 45.776 16.376  -17.501 1.00 35.94  ? 304 GLU B CG  1 
ATOM   8797  C CD  . GLU C 1 307 ? 44.641 16.876  -18.373 1.00 45.92  ? 304 GLU B CD  1 
ATOM   8798  O OE1 . GLU C 1 307 ? 44.916 17.456  -19.445 1.00 44.26  ? 304 GLU B OE1 1 
ATOM   8799  O OE2 . GLU C 1 307 ? 43.470 16.674  -17.988 1.00 43.31  ? 304 GLU B OE2 1 
ATOM   8800  N N   . ALA C 1 308 ? 47.949 13.674  -18.224 1.00 29.55  ? 305 ALA B N   1 
ATOM   8801  C CA  . ALA C 1 308 ? 47.891 12.481  -19.056 1.00 25.18  ? 305 ALA B CA  1 
ATOM   8802  C C   . ALA C 1 308 ? 46.483 11.905  -19.051 1.00 29.53  ? 305 ALA B C   1 
ATOM   8803  O O   . ALA C 1 308 ? 45.791 11.940  -18.028 1.00 29.89  ? 305 ALA B O   1 
ATOM   8804  C CB  . ALA C 1 308 ? 48.886 11.425  -18.567 1.00 24.38  ? 305 ALA B CB  1 
ATOM   8805  N N   . GLU C 1 309 ? 46.072 11.360  -20.195 1.00 31.95  ? 306 GLU B N   1 
ATOM   8806  C CA  . GLU C 1 309 ? 44.726 10.829  -20.345 1.00 32.80  ? 306 GLU B CA  1 
ATOM   8807  C C   . GLU C 1 309 ? 44.678 9.934   -21.572 1.00 38.87  ? 306 GLU B C   1 
ATOM   8808  O O   . GLU C 1 309 ? 45.524 10.024  -22.466 1.00 27.26  ? 306 GLU B O   1 
ATOM   8809  C CB  . GLU C 1 309 ? 43.692 11.951  -20.478 1.00 30.02  ? 306 GLU B CB  1 
ATOM   8810  C CG  . GLU C 1 309 ? 43.864 12.781  -21.739 1.00 37.49  ? 306 GLU B CG  1 
ATOM   8811  C CD  . GLU C 1 309 ? 42.996 14.022  -21.749 1.00 42.72  ? 306 GLU B CD  1 
ATOM   8812  O OE1 . GLU C 1 309 ? 41.857 13.954  -21.248 1.00 44.16  ? 306 GLU B OE1 1 
ATOM   8813  O OE2 . GLU C 1 309 ? 43.456 15.067  -22.254 1.00 56.06  ? 306 GLU B OE2 1 
ATOM   8814  N N   . ALA C 1 310 ? 43.673 9.065   -21.599 1.00 32.74  ? 307 ALA B N   1 
ATOM   8815  C CA  . ALA C 1 310 ? 43.339 8.354   -22.821 1.00 33.56  ? 307 ALA B CA  1 
ATOM   8816  C C   . ALA C 1 310 ? 42.786 9.333   -23.849 1.00 33.31  ? 307 ALA B C   1 
ATOM   8817  O O   . ALA C 1 310 ? 42.133 10.323  -23.510 1.00 28.13  ? 307 ALA B O   1 
ATOM   8818  C CB  . ALA C 1 310 ? 42.318 7.251   -22.545 1.00 26.34  ? 307 ALA B CB  1 
ATOM   8819  N N   . ALA C 1 311 ? 43.064 9.057   -25.121 1.00 32.82  ? 308 ALA B N   1 
ATOM   8820  C CA  . ALA C 1 311 ? 42.533 9.900   -26.184 1.00 33.22  ? 308 ALA B CA  1 
ATOM   8821  C C   . ALA C 1 311 ? 41.056 9.648   -26.450 1.00 31.05  ? 308 ALA B C   1 
ATOM   8822  O O   . ALA C 1 311 ? 40.386 10.516  -27.019 1.00 37.65  ? 308 ALA B O   1 
ATOM   8823  C CB  . ALA C 1 311 ? 43.327 9.699   -27.472 1.00 34.25  ? 308 ALA B CB  1 
ATOM   8824  N N   . HIS C 1 312 ? 40.533 8.493   -26.047 1.00 29.73  ? 309 HIS B N   1 
ATOM   8825  C CA  . HIS C 1 312 ? 39.145 8.153   -26.316 1.00 33.83  ? 309 HIS B CA  1 
ATOM   8826  C C   . HIS C 1 312 ? 38.230 8.716   -25.229 1.00 31.99  ? 309 HIS B C   1 
ATOM   8827  O O   . HIS C 1 312 ? 38.678 9.249   -24.210 1.00 31.22  ? 309 HIS B O   1 
ATOM   8828  C CB  . HIS C 1 312 ? 38.977 6.637   -26.430 1.00 33.40  ? 309 HIS B CB  1 
ATOM   8829  C CG  . HIS C 1 312 ? 39.355 5.889   -25.189 1.00 30.01  ? 309 HIS B CG  1 
ATOM   8830  N ND1 . HIS C 1 312 ? 38.613 5.947   -24.029 1.00 28.64  ? 309 HIS B ND1 1 
ATOM   8831  C CD2 . HIS C 1 312 ? 40.392 5.056   -24.931 1.00 31.68  ? 309 HIS B CD2 1 
ATOM   8832  C CE1 . HIS C 1 312 ? 39.180 5.188   -23.107 1.00 30.17  ? 309 HIS B CE1 1 
ATOM   8833  N NE2 . HIS C 1 312 ? 40.261 4.636   -23.629 1.00 32.42  ? 309 HIS B NE2 1 
ATOM   8834  N N   . GLY C 1 313 ? 36.931 8.586   -25.458 1.00 28.61  ? 310 GLY B N   1 
ATOM   8835  C CA  . GLY C 1 313 ? 35.916 9.093   -24.554 1.00 23.32  ? 310 GLY B CA  1 
ATOM   8836  C C   . GLY C 1 313 ? 35.502 8.084   -23.504 1.00 27.26  ? 310 GLY B C   1 
ATOM   8837  O O   . GLY C 1 313 ? 36.253 7.168   -23.155 1.00 28.85  ? 310 GLY B O   1 
ATOM   8838  N N   . THR C 1 314 ? 34.285 8.259   -22.985 1.00 22.37  ? 311 THR B N   1 
ATOM   8839  C CA  . THR C 1 314 ? 33.770 7.390   -21.934 1.00 23.99  ? 311 THR B CA  1 
ATOM   8840  C C   . THR C 1 314 ? 33.246 6.061   -22.464 1.00 30.57  ? 311 THR B C   1 
ATOM   8841  O O   . THR C 1 314 ? 32.838 5.215   -21.660 1.00 33.36  ? 311 THR B O   1 
ATOM   8842  C CB  . THR C 1 314 ? 32.651 8.090   -21.156 1.00 31.22  ? 311 THR B CB  1 
ATOM   8843  O OG1 . THR C 1 314 ? 31.521 8.290   -22.014 1.00 30.44  ? 311 THR B OG1 1 
ATOM   8844  C CG2 . THR C 1 314 ? 33.122 9.444   -20.628 1.00 28.48  ? 311 THR B CG2 1 
ATOM   8845  N N   . VAL C 1 315 ? 33.258 5.857   -23.784 1.00 28.16  ? 312 VAL B N   1 
ATOM   8846  C CA  . VAL C 1 315 ? 32.778 4.634   -24.425 1.00 33.49  ? 312 VAL B CA  1 
ATOM   8847  C C   . VAL C 1 315 ? 31.333 4.383   -24.016 1.00 31.03  ? 312 VAL B C   1 
ATOM   8848  O O   . VAL C 1 315 ? 31.010 3.339   -23.435 1.00 29.84  ? 312 VAL B O   1 
ATOM   8849  C CB  . VAL C 1 315 ? 33.676 3.426   -24.092 1.00 32.73  ? 312 VAL B CB  1 
ATOM   8850  C CG1 . VAL C 1 315 ? 33.487 2.326   -25.119 1.00 35.49  ? 312 VAL B CG1 1 
ATOM   8851  C CG2 . VAL C 1 315 ? 35.141 3.845   -24.041 1.00 29.39  ? 312 VAL B CG2 1 
ATOM   8852  N N   . THR C 1 316 ? 30.455 5.338   -24.336 1.00 33.49  ? 313 THR B N   1 
ATOM   8853  C CA  . THR C 1 316 ? 29.057 5.261   -23.922 1.00 32.88  ? 313 THR B CA  1 
ATOM   8854  C C   . THR C 1 316 ? 28.387 3.984   -24.416 1.00 37.37  ? 313 THR B C   1 
ATOM   8855  O O   . THR C 1 316 ? 27.651 3.328   -23.669 1.00 32.72  ? 313 THR B O   1 
ATOM   8856  C CB  . THR C 1 316 ? 28.297 6.488   -24.429 1.00 36.15  ? 313 THR B CB  1 
ATOM   8857  O OG1 . THR C 1 316 ? 28.997 7.677   -24.050 1.00 33.48  ? 313 THR B OG1 1 
ATOM   8858  C CG2 . THR C 1 316 ? 26.884 6.522   -23.856 1.00 33.38  ? 313 THR B CG2 1 
ATOM   8859  N N   . ARG C 1 317 ? 28.636 3.612   -25.677 1.00 41.25  ? 314 ARG B N   1 
ATOM   8860  C CA  . ARG C 1 317 ? 27.925 2.478   -26.264 1.00 34.70  ? 314 ARG B CA  1 
ATOM   8861  C C   . ARG C 1 317 ? 28.186 1.194   -25.486 1.00 34.24  ? 314 ARG B C   1 
ATOM   8862  O O   . ARG C 1 317 ? 27.270 0.389   -25.281 1.00 46.48  ? 314 ARG B O   1 
ATOM   8863  C CB  . ARG C 1 317 ? 28.308 2.304   -27.736 1.00 35.00  ? 314 ARG B CB  1 
ATOM   8864  C CG  . ARG C 1 317 ? 27.902 0.945   -28.295 1.00 57.62  ? 314 ARG B CG  1 
ATOM   8865  C CD  . ARG C 1 317 ? 28.265 0.770   -29.760 1.00 58.34  ? 314 ARG B CD  1 
ATOM   8866  N NE  . ARG C 1 317 ? 29.357 -0.185  -29.948 1.00 54.65  ? 314 ARG B NE  1 
ATOM   8867  C CZ  . ARG C 1 317 ? 29.256 -1.500  -29.768 1.00 59.14  ? 314 ARG B CZ  1 
ATOM   8868  N NH1 . ARG C 1 317 ? 28.105 -2.041  -29.390 1.00 63.71  ? 314 ARG B NH1 1 
ATOM   8869  N NH2 . ARG C 1 317 ? 30.313 -2.278  -29.968 1.00 62.11  ? 314 ARG B NH2 1 
ATOM   8870  N N   . HIS C 1 318 ? 29.425 0.994   -25.029 1.00 36.71  ? 315 HIS B N   1 
ATOM   8871  C CA  . HIS C 1 318 ? 29.718 -0.167  -24.196 1.00 34.28  ? 315 HIS B CA  1 
ATOM   8872  C C   . HIS C 1 318 ? 29.020 -0.061  -22.847 1.00 34.64  ? 315 HIS B C   1 
ATOM   8873  O O   . HIS C 1 318 ? 28.546 -1.067  -22.304 1.00 37.16  ? 315 HIS B O   1 
ATOM   8874  C CB  . HIS C 1 318 ? 31.226 -0.312  -23.997 1.00 31.41  ? 315 HIS B CB  1 
ATOM   8875  C CG  . HIS C 1 318 ? 31.984 -0.600  -25.256 1.00 34.71  ? 315 HIS B CG  1 
ATOM   8876  N ND1 . HIS C 1 318 ? 33.221 -1.209  -25.255 1.00 39.90  ? 315 HIS B ND1 1 
ATOM   8877  C CD2 . HIS C 1 318 ? 31.695 -0.341  -26.554 1.00 33.05  ? 315 HIS B CD2 1 
ATOM   8878  C CE1 . HIS C 1 318 ? 33.655 -1.325  -26.498 1.00 39.85  ? 315 HIS B CE1 1 
ATOM   8879  N NE2 . HIS C 1 318 ? 32.748 -0.805  -27.305 1.00 38.24  ? 315 HIS B NE2 1 
ATOM   8880  N N   . TYR C 1 319 ? 28.953 1.151   -22.290 1.00 35.65  ? 316 TYR B N   1 
ATOM   8881  C CA  . TYR C 1 319 ? 28.289 1.341   -21.005 1.00 35.55  ? 316 TYR B CA  1 
ATOM   8882  C C   . TYR C 1 319 ? 26.811 0.983   -21.097 1.00 32.33  ? 316 TYR B C   1 
ATOM   8883  O O   . TYR C 1 319 ? 26.260 0.344   -20.191 1.00 33.18  ? 316 TYR B O   1 
ATOM   8884  C CB  . TYR C 1 319 ? 28.472 2.785   -20.539 1.00 34.78  ? 316 TYR B CB  1 
ATOM   8885  C CG  . TYR C 1 319 ? 27.941 3.062   -19.154 1.00 30.99  ? 316 TYR B CG  1 
ATOM   8886  C CD1 . TYR C 1 319 ? 28.540 2.498   -18.035 1.00 29.33  ? 316 TYR B CD1 1 
ATOM   8887  C CD2 . TYR C 1 319 ? 26.842 3.888   -18.964 1.00 31.01  ? 316 TYR B CD2 1 
ATOM   8888  C CE1 . TYR C 1 319 ? 28.061 2.750   -16.764 1.00 32.73  ? 316 TYR B CE1 1 
ATOM   8889  C CE2 . TYR C 1 319 ? 26.354 4.146   -17.698 1.00 33.62  ? 316 TYR B CE2 1 
ATOM   8890  C CZ  . TYR C 1 319 ? 26.968 3.574   -16.602 1.00 35.37  ? 316 TYR B CZ  1 
ATOM   8891  O OH  . TYR C 1 319 ? 26.488 3.826   -15.339 1.00 45.04  ? 316 TYR B OH  1 
ATOM   8892  N N   . ARG C 1 320 ? 26.154 1.381   -22.192 1.00 33.39  ? 317 ARG B N   1 
ATOM   8893  C CA  . ARG C 1 320 ? 24.761 0.999   -22.407 1.00 35.35  ? 317 ARG B CA  1 
ATOM   8894  C C   . ARG C 1 320 ? 24.609 -0.516  -22.457 1.00 41.57  ? 317 ARG B C   1 
ATOM   8895  O O   . ARG C 1 320 ? 23.665 -1.074  -21.883 1.00 38.78  ? 317 ARG B O   1 
ATOM   8896  C CB  . ARG C 1 320 ? 24.238 1.626   -23.698 1.00 29.40  ? 317 ARG B CB  1 
ATOM   8897  C CG  . ARG C 1 320 ? 24.257 3.145   -23.714 1.00 36.53  ? 317 ARG B CG  1 
ATOM   8898  C CD  . ARG C 1 320 ? 23.569 3.738   -22.496 1.00 30.15  ? 317 ARG B CD  1 
ATOM   8899  N NE  . ARG C 1 320 ? 23.526 5.194   -22.573 1.00 38.72  ? 317 ARG B NE  1 
ATOM   8900  C CZ  . ARG C 1 320 ? 23.477 5.998   -21.516 1.00 38.29  ? 317 ARG B CZ  1 
ATOM   8901  N NH1 . ARG C 1 320 ? 23.457 5.485   -20.293 1.00 35.47  ? 317 ARG B NH1 1 
ATOM   8902  N NH2 . ARG C 1 320 ? 23.444 7.313   -21.683 1.00 31.32  ? 317 ARG B NH2 1 
ATOM   8903  N N   . MET C 1 321 ? 25.532 -1.197  -23.142 1.00 35.77  ? 318 MET B N   1 
ATOM   8904  C CA  . MET C 1 321 ? 25.516 -2.656  -23.168 1.00 38.01  ? 318 MET B CA  1 
ATOM   8905  C C   . MET C 1 321 ? 25.643 -3.219  -21.760 1.00 40.46  ? 318 MET B C   1 
ATOM   8906  O O   . MET C 1 321 ? 24.890 -4.117  -21.364 1.00 37.94  ? 318 MET B O   1 
ATOM   8907  C CB  . MET C 1 321 ? 26.647 -3.173  -24.058 1.00 39.17  ? 318 MET B CB  1 
ATOM   8908  C CG  . MET C 1 321 ? 26.464 -2.877  -25.537 1.00 42.43  ? 318 MET B CG  1 
ATOM   8909  S SD  . MET C 1 321 ? 27.959 -3.192  -26.497 1.00 50.38  ? 318 MET B SD  1 
ATOM   8910  C CE  . MET C 1 321 ? 28.285 -4.902  -26.076 1.00 34.30  ? 318 MET B CE  1 
ATOM   8911  N N   . TYR C 1 322 ? 26.594 -2.688  -20.987 1.00 40.59  ? 319 TYR B N   1 
ATOM   8912  C CA  . TYR C 1 322 ? 26.754 -3.093  -19.595 1.00 37.99  ? 319 TYR B CA  1 
ATOM   8913  C C   . TYR C 1 322 ? 25.471 -2.866  -18.803 1.00 37.35  ? 319 TYR B C   1 
ATOM   8914  O O   . TYR C 1 322 ? 25.069 -3.717  -18.000 1.00 37.64  ? 319 TYR B O   1 
ATOM   8915  C CB  . TYR C 1 322 ? 27.924 -2.320  -18.982 1.00 38.91  ? 319 TYR B CB  1 
ATOM   8916  C CG  . TYR C 1 322 ? 28.181 -2.552  -17.510 1.00 39.12  ? 319 TYR B CG  1 
ATOM   8917  C CD1 . TYR C 1 322 ? 28.805 -3.710  -17.065 1.00 39.88  ? 319 TYR B CD1 1 
ATOM   8918  C CD2 . TYR C 1 322 ? 27.830 -1.593  -16.568 1.00 41.47  ? 319 TYR B CD2 1 
ATOM   8919  C CE1 . TYR C 1 322 ? 29.056 -3.913  -15.723 1.00 42.68  ? 319 TYR B CE1 1 
ATOM   8920  C CE2 . TYR C 1 322 ? 28.075 -1.788  -15.224 1.00 40.36  ? 319 TYR B CE2 1 
ATOM   8921  C CZ  . TYR C 1 322 ? 28.689 -2.948  -14.807 1.00 47.12  ? 319 TYR B CZ  1 
ATOM   8922  O OH  . TYR C 1 322 ? 28.937 -3.146  -13.470 1.00 52.17  ? 319 TYR B OH  1 
ATOM   8923  N N   . GLN C 1 323 ? 24.800 -1.730  -19.031 1.00 33.63  ? 320 GLN B N   1 
ATOM   8924  C CA  . GLN C 1 323 ? 23.574 -1.434  -18.294 1.00 39.03  ? 320 GLN B CA  1 
ATOM   8925  C C   . GLN C 1 323 ? 22.451 -2.405  -18.640 1.00 44.97  ? 320 GLN B C   1 
ATOM   8926  O O   . GLN C 1 323 ? 21.558 -2.637  -17.816 1.00 45.15  ? 320 GLN B O   1 
ATOM   8927  C CB  . GLN C 1 323 ? 23.122 0.001   -18.563 1.00 38.25  ? 320 GLN B CB  1 
ATOM   8928  C CG  . GLN C 1 323 ? 24.022 1.067   -17.960 1.00 36.49  ? 320 GLN B CG  1 
ATOM   8929  C CD  . GLN C 1 323 ? 23.483 2.464   -18.184 1.00 35.75  ? 320 GLN B CD  1 
ATOM   8930  O OE1 . GLN C 1 323 ? 23.508 2.979   -19.301 1.00 37.55  ? 320 GLN B OE1 1 
ATOM   8931  N NE2 . GLN C 1 323 ? 22.982 3.083   -17.122 1.00 35.54  ? 320 GLN B NE2 1 
ATOM   8932  N N   . LYS C 1 324 ? 22.469 -2.975  -19.845 1.00 39.87  ? 321 LYS B N   1 
ATOM   8933  C CA  . LYS C 1 324 ? 21.469 -3.956  -20.250 1.00 38.39  ? 321 LYS B CA  1 
ATOM   8934  C C   . LYS C 1 324 ? 21.903 -5.394  -19.984 1.00 43.79  ? 321 LYS B C   1 
ATOM   8935  O O   . LYS C 1 324 ? 21.227 -6.325  -20.433 1.00 43.92  ? 321 LYS B O   1 
ATOM   8936  C CB  . LYS C 1 324 ? 21.120 -3.785  -21.733 1.00 41.53  ? 321 LYS B CB  1 
ATOM   8937  C CG  . LYS C 1 324 ? 20.607 -2.395  -22.096 1.00 49.83  ? 321 LYS B CG  1 
ATOM   8938  C CD  . LYS C 1 324 ? 20.874 -2.049  -23.553 1.00 54.52  ? 321 LYS B CD  1 
ATOM   8939  C CE  . LYS C 1 324 ? 20.390 -0.638  -23.876 1.00 71.23  ? 321 LYS B CE  1 
ATOM   8940  N NZ  . LYS C 1 324 ? 19.301 -0.616  -24.894 1.00 67.73  ? 321 LYS B NZ  1 
ATOM   8941  N N   . GLY C 1 325 ? 23.004 -5.597  -19.266 1.00 41.68  ? 322 GLY B N   1 
ATOM   8942  C CA  . GLY C 1 325 ? 23.443 -6.937  -18.935 1.00 40.33  ? 322 GLY B CA  1 
ATOM   8943  C C   . GLY C 1 325 ? 24.246 -7.643  -20.004 1.00 44.12  ? 322 GLY B C   1 
ATOM   8944  O O   . GLY C 1 325 ? 24.565 -8.827  -19.838 1.00 40.24  ? 322 GLY B O   1 
ATOM   8945  N N   . GLN C 1 326 ? 24.582 -6.966  -21.097 1.00 38.93  ? 323 GLN B N   1 
ATOM   8946  C CA  . GLN C 1 326 ? 25.400 -7.578  -22.132 1.00 45.57  ? 323 GLN B CA  1 
ATOM   8947  C C   . GLN C 1 326 ? 26.866 -7.579  -21.717 1.00 42.90  ? 323 GLN B C   1 
ATOM   8948  O O   . GLN C 1 326 ? 27.337 -6.677  -21.018 1.00 48.56  ? 323 GLN B O   1 
ATOM   8949  C CB  . GLN C 1 326 ? 25.232 -6.836  -23.459 1.00 38.53  ? 323 GLN B CB  1 
ATOM   8950  C CG  . GLN C 1 326 ? 23.840 -6.950  -24.056 1.00 42.80  ? 323 GLN B CG  1 
ATOM   8951  C CD  . GLN C 1 326 ? 23.593 -5.941  -25.162 1.00 48.31  ? 323 GLN B CD  1 
ATOM   8952  O OE1 . GLN C 1 326 ? 24.509 -5.565  -25.894 1.00 56.08  ? 323 GLN B OE1 1 
ATOM   8953  N NE2 . GLN C 1 326 ? 22.348 -5.496  -25.287 1.00 50.01  ? 323 GLN B NE2 1 
ATOM   8954  N N   . GLU C 1 327 ? 27.586 -8.611  -22.148 1.00 41.73  ? 324 GLU B N   1 
ATOM   8955  C CA  . GLU C 1 327 ? 29.015 -8.683  -21.878 1.00 45.92  ? 324 GLU B CA  1 
ATOM   8956  C C   . GLU C 1 327 ? 29.746 -7.578  -22.631 1.00 44.25  ? 324 GLU B C   1 
ATOM   8957  O O   . GLU C 1 327 ? 29.436 -7.283  -23.789 1.00 42.60  ? 324 GLU B O   1 
ATOM   8958  C CB  . GLU C 1 327 ? 29.563 -10.052 -22.280 1.00 43.35  ? 324 GLU B CB  1 
ATOM   8959  C CG  . GLU C 1 327 ? 30.933 -10.374 -21.704 1.00 42.11  ? 324 GLU B CG  1 
ATOM   8960  C CD  . GLU C 1 327 ? 31.471 -11.705 -22.191 1.00 43.96  ? 324 GLU B CD  1 
ATOM   8961  O OE1 . GLU C 1 327 ? 31.424 -11.954 -23.415 1.00 41.15  ? 324 GLU B OE1 1 
ATOM   8962  O OE2 . GLU C 1 327 ? 31.936 -12.501 -21.349 1.00 35.64  ? 324 GLU B OE2 1 
ATOM   8963  N N   . THR C 1 328 ? 30.715 -6.956  -21.964 1.00 42.32  ? 325 THR B N   1 
ATOM   8964  C CA  . THR C 1 328 ? 31.518 -5.902  -22.561 1.00 42.79  ? 325 THR B CA  1 
ATOM   8965  C C   . THR C 1 328 ? 32.965 -6.353  -22.673 1.00 39.56  ? 325 THR B C   1 
ATOM   8966  O O   . THR C 1 328 ? 33.437 -7.189  -21.896 1.00 39.71  ? 325 THR B O   1 
ATOM   8967  C CB  . THR C 1 328 ? 31.459 -4.601  -21.746 1.00 42.02  ? 325 THR B CB  1 
ATOM   8968  O OG1 . THR C 1 328 ? 32.058 -4.811  -20.461 1.00 41.77  ? 325 THR B OG1 1 
ATOM   8969  C CG2 . THR C 1 328 ? 30.021 -4.145  -21.564 1.00 39.05  ? 325 THR B CG2 1 
ATOM   8970  N N   . SER C 1 329 ? 33.670 -5.782  -23.656 1.00 41.79  ? 326 SER B N   1 
ATOM   8971  C CA  . SER C 1 329 ? 35.107 -5.996  -23.843 1.00 44.33  ? 326 SER B CA  1 
ATOM   8972  C C   . SER C 1 329 ? 35.699 -4.628  -24.188 1.00 39.37  ? 326 SER B C   1 
ATOM   8973  O O   . SER C 1 329 ? 35.934 -4.298  -25.353 1.00 41.56  ? 326 SER B O   1 
ATOM   8974  C CB  . SER C 1 329 ? 35.389 -7.037  -24.926 1.00 35.71  ? 326 SER B CB  1 
ATOM   8975  O OG  . SER C 1 329 ? 36.753 -7.418  -24.929 1.00 40.16  ? 326 SER B OG  1 
ATOM   8976  N N   . THR C 1 330 ? 35.927 -3.821  -23.157 1.00 37.27  ? 327 THR B N   1 
ATOM   8977  C CA  . THR C 1 330 ? 36.402 -2.455  -23.325 1.00 40.63  ? 327 THR B CA  1 
ATOM   8978  C C   . THR C 1 330 ? 37.890 -2.387  -23.008 1.00 35.22  ? 327 THR B C   1 
ATOM   8979  O O   . THR C 1 330 ? 38.335 -2.892  -21.971 1.00 32.34  ? 327 THR B O   1 
ATOM   8980  C CB  . THR C 1 330 ? 35.621 -1.487  -22.435 1.00 36.85  ? 327 THR B CB  1 
ATOM   8981  O OG1 . THR C 1 330 ? 34.219 -1.750  -22.565 1.00 37.40  ? 327 THR B OG1 1 
ATOM   8982  C CG2 . THR C 1 330 ? 35.894 -0.054  -22.857 1.00 36.72  ? 327 THR B CG2 1 
ATOM   8983  N N   . ASN C 1 331 ? 38.644 -1.756  -23.899 1.00 33.00  ? 328 ASN B N   1 
ATOM   8984  C CA  . ASN C 1 331 ? 40.099 -1.769  -23.824 1.00 34.65  ? 328 ASN B CA  1 
ATOM   8985  C C   . ASN C 1 331 ? 40.591 -0.790  -22.763 1.00 29.57  ? 328 ASN B C   1 
ATOM   8986  O O   . ASN C 1 331 ? 40.353 0.416   -22.895 1.00 31.57  ? 328 ASN B O   1 
ATOM   8987  C CB  . ASN C 1 331 ? 40.689 -1.418  -25.183 1.00 28.25  ? 328 ASN B CB  1 
ATOM   8988  C CG  . ASN C 1 331 ? 42.157 -1.749  -25.283 1.00 34.12  ? 328 ASN B CG  1 
ATOM   8989  O OD1 . ASN C 1 331 ? 42.870 -1.753  -24.284 1.00 31.08  ? 328 ASN B OD1 1 
ATOM   8990  N ND2 . ASN C 1 331 ? 42.617 -2.037  -26.492 1.00 28.66  ? 328 ASN B ND2 1 
ATOM   8991  N N   . PRO C 1 332 ? 41.282 -1.253  -21.724 1.00 30.78  ? 329 PRO B N   1 
ATOM   8992  C CA  . PRO C 1 332 ? 41.759 -0.352  -20.667 1.00 31.81  ? 329 PRO B CA  1 
ATOM   8993  C C   . PRO C 1 332 ? 43.171 0.175   -20.862 1.00 33.70  ? 329 PRO B C   1 
ATOM   8994  O O   . PRO C 1 332 ? 43.664 0.892   -19.985 1.00 33.27  ? 329 PRO B O   1 
ATOM   8995  C CB  . PRO C 1 332 ? 41.702 -1.262  -19.436 1.00 27.86  ? 329 PRO B CB  1 
ATOM   8996  C CG  . PRO C 1 332 ? 42.144 -2.590  -19.985 1.00 29.48  ? 329 PRO B CG  1 
ATOM   8997  C CD  . PRO C 1 332 ? 41.568 -2.664  -21.398 1.00 30.16  ? 329 PRO B CD  1 
ATOM   8998  N N   . ILE C 1 333 ? 43.825 -0.163  -21.975 1.00 34.33  ? 330 ILE B N   1 
ATOM   8999  C CA  . ILE C 1 333 ? 45.258 0.092   -22.116 1.00 33.50  ? 330 ILE B CA  1 
ATOM   9000  C C   . ILE C 1 333 ? 45.550 1.589   -22.119 1.00 31.27  ? 330 ILE B C   1 
ATOM   9001  O O   . ILE C 1 333 ? 46.455 2.061   -21.421 1.00 28.96  ? 330 ILE B O   1 
ATOM   9002  C CB  . ILE C 1 333 ? 45.801 -0.597  -23.381 1.00 35.59  ? 330 ILE B CB  1 
ATOM   9003  C CG1 . ILE C 1 333 ? 45.708 -2.114  -23.248 1.00 29.75  ? 330 ILE B CG1 1 
ATOM   9004  C CG2 . ILE C 1 333 ? 47.235 -0.172  -23.646 1.00 30.84  ? 330 ILE B CG2 1 
ATOM   9005  C CD1 . ILE C 1 333 ? 46.451 -2.669  -22.052 1.00 36.65  ? 330 ILE B CD1 1 
ATOM   9006  N N   . ALA C 1 334 ? 44.795 2.356   -22.909 1.00 24.55  ? 331 ALA B N   1 
ATOM   9007  C CA  . ALA C 1 334 ? 45.022 3.797   -22.967 1.00 32.13  ? 331 ALA B CA  1 
ATOM   9008  C C   . ALA C 1 334 ? 44.797 4.445   -21.604 1.00 33.85  ? 331 ALA B C   1 
ATOM   9009  O O   . ALA C 1 334 ? 45.556 5.335   -21.199 1.00 31.29  ? 331 ALA B O   1 
ATOM   9010  C CB  . ALA C 1 334 ? 44.122 4.429   -24.030 1.00 25.65  ? 331 ALA B CB  1 
ATOM   9011  N N   . SER C 1 335 ? 43.768 4.004   -20.877 1.00 25.77  ? 332 SER B N   1 
ATOM   9012  C CA  . SER C 1 335 ? 43.560 4.487   -19.516 1.00 31.53  ? 332 SER B CA  1 
ATOM   9013  C C   . SER C 1 335 ? 44.734 4.113   -18.621 1.00 29.67  ? 332 SER B C   1 
ATOM   9014  O O   . SER C 1 335 ? 45.202 4.927   -17.815 1.00 27.90  ? 332 SER B O   1 
ATOM   9015  C CB  . SER C 1 335 ? 42.256 3.920   -18.954 1.00 26.31  ? 332 SER B CB  1 
ATOM   9016  O OG  . SER C 1 335 ? 41.149 4.267   -19.765 1.00 24.95  ? 332 SER B OG  1 
ATOM   9017  N N   . ILE C 1 336 ? 45.223 2.878   -18.754 1.00 28.65  ? 333 ILE B N   1 
ATOM   9018  C CA  . ILE C 1 336 ? 46.380 2.441   -17.980 1.00 30.02  ? 333 ILE B CA  1 
ATOM   9019  C C   . ILE C 1 336 ? 47.585 3.318   -18.291 1.00 32.53  ? 333 ILE B C   1 
ATOM   9020  O O   . ILE C 1 336 ? 48.304 3.762   -17.388 1.00 32.66  ? 333 ILE B O   1 
ATOM   9021  C CB  . ILE C 1 336 ? 46.683 0.957   -18.257 1.00 32.64  ? 333 ILE B CB  1 
ATOM   9022  C CG1 . ILE C 1 336 ? 45.657 0.061   -17.567 1.00 33.32  ? 333 ILE B CG1 1 
ATOM   9023  C CG2 . ILE C 1 336 ? 48.103 0.606   -17.810 1.00 27.10  ? 333 ILE B CG2 1 
ATOM   9024  C CD1 . ILE C 1 336 ? 45.662 -1.352  -18.087 1.00 31.00  ? 333 ILE B CD1 1 
ATOM   9025  N N   . PHE C 1 337 ? 47.817 3.588   -19.578 1.00 28.03  ? 334 PHE B N   1 
ATOM   9026  C CA  . PHE C 1 337 ? 48.966 4.398   -19.959 1.00 29.80  ? 334 PHE B CA  1 
ATOM   9027  C C   . PHE C 1 337 ? 48.816 5.852   -19.532 1.00 29.85  ? 334 PHE B C   1 
ATOM   9028  O O   . PHE C 1 337 ? 49.820 6.565   -19.458 1.00 28.60  ? 334 PHE B O   1 
ATOM   9029  C CB  . PHE C 1 337 ? 49.205 4.302   -21.464 1.00 31.41  ? 334 PHE B CB  1 
ATOM   9030  C CG  . PHE C 1 337 ? 50.097 3.159   -21.858 1.00 37.57  ? 334 PHE B CG  1 
ATOM   9031  C CD1 . PHE C 1 337 ? 49.733 1.849   -21.582 1.00 31.94  ? 334 PHE B CD1 1 
ATOM   9032  C CD2 . PHE C 1 337 ? 51.300 3.394   -22.506 1.00 38.13  ? 334 PHE B CD2 1 
ATOM   9033  C CE1 . PHE C 1 337 ? 50.552 0.796   -21.944 1.00 30.83  ? 334 PHE B CE1 1 
ATOM   9034  C CE2 . PHE C 1 337 ? 52.122 2.345   -22.873 1.00 33.37  ? 334 PHE B CE2 1 
ATOM   9035  C CZ  . PHE C 1 337 ? 51.748 1.045   -22.591 1.00 29.81  ? 334 PHE B CZ  1 
ATOM   9036  N N   . ALA C 1 338 ? 47.597 6.311   -19.249 1.00 30.46  ? 335 ALA B N   1 
ATOM   9037  C CA  . ALA C 1 338 ? 47.458 7.605   -18.594 1.00 33.31  ? 335 ALA B CA  1 
ATOM   9038  C C   . ALA C 1 338 ? 48.095 7.571   -17.212 1.00 30.37  ? 335 ALA B C   1 
ATOM   9039  O O   . ALA C 1 338 ? 48.764 8.528   -16.802 1.00 29.64  ? 335 ALA B O   1 
ATOM   9040  C CB  . ALA C 1 338 ? 45.986 8.002   -18.502 1.00 29.70  ? 335 ALA B CB  1 
ATOM   9041  N N   . TRP C 1 339 ? 47.914 6.467   -16.487 1.00 27.71  ? 336 TRP B N   1 
ATOM   9042  C CA  . TRP C 1 339 ? 48.537 6.334   -15.175 1.00 29.48  ? 336 TRP B CA  1 
ATOM   9043  C C   . TRP C 1 339 ? 50.048 6.170   -15.289 1.00 29.21  ? 336 TRP B C   1 
ATOM   9044  O O   . TRP C 1 339 ? 50.807 6.794   -14.537 1.00 29.70  ? 336 TRP B O   1 
ATOM   9045  C CB  . TRP C 1 339 ? 47.916 5.161   -14.419 1.00 27.49  ? 336 TRP B CB  1 
ATOM   9046  C CG  . TRP C 1 339 ? 46.571 5.481   -13.843 1.00 29.67  ? 336 TRP B CG  1 
ATOM   9047  C CD1 . TRP C 1 339 ? 45.359 5.346   -14.457 1.00 31.53  ? 336 TRP B CD1 1 
ATOM   9048  C CD2 . TRP C 1 339 ? 46.302 6.001   -12.536 1.00 30.39  ? 336 TRP B CD2 1 
ATOM   9049  N NE1 . TRP C 1 339 ? 44.353 5.746   -13.610 1.00 31.10  ? 336 TRP B NE1 1 
ATOM   9050  C CE2 . TRP C 1 339 ? 44.906 6.154   -12.425 1.00 30.07  ? 336 TRP B CE2 1 
ATOM   9051  C CE3 . TRP C 1 339 ? 47.107 6.351   -11.447 1.00 30.58  ? 336 TRP B CE3 1 
ATOM   9052  C CZ2 . TRP C 1 339 ? 44.298 6.640   -11.270 1.00 34.94  ? 336 TRP B CZ2 1 
ATOM   9053  C CZ3 . TRP C 1 339 ? 46.502 6.834   -10.303 1.00 32.87  ? 336 TRP B CZ3 1 
ATOM   9054  C CH2 . TRP C 1 339 ? 45.111 6.974   -10.223 1.00 30.69  ? 336 TRP B CH2 1 
ATOM   9055  N N   . THR C 1 340 ? 50.511 5.345   -16.231 1.00 31.51  ? 337 THR B N   1 
ATOM   9056  C CA  . THR C 1 340 ? 51.947 5.097   -16.331 1.00 30.80  ? 337 THR B CA  1 
ATOM   9057  C C   . THR C 1 340 ? 52.700 6.336   -16.799 1.00 32.15  ? 337 THR B C   1 
ATOM   9058  O O   . THR C 1 340 ? 53.818 6.593   -16.338 1.00 36.16  ? 337 THR B O   1 
ATOM   9059  C CB  . THR C 1 340 ? 52.234 3.918   -17.262 1.00 31.88  ? 337 THR B CB  1 
ATOM   9060  O OG1 . THR C 1 340 ? 51.752 4.212   -18.582 1.00 31.54  ? 337 THR B OG1 1 
ATOM   9061  C CG2 . THR C 1 340 ? 51.589 2.641   -16.737 1.00 32.03  ? 337 THR B CG2 1 
ATOM   9062  N N   . ARG C 1 341 ? 52.115 7.115   -17.713 1.00 29.34  ? 338 ARG B N   1 
ATOM   9063  C CA  . ARG C 1 341 ? 52.778 8.350   -18.124 1.00 34.23  ? 338 ARG B CA  1 
ATOM   9064  C C   . ARG C 1 341 ? 52.809 9.364   -16.986 1.00 31.20  ? 338 ARG B C   1 
ATOM   9065  O O   . ARG C 1 341 ? 53.820 10.047  -16.786 1.00 32.06  ? 338 ARG B O   1 
ATOM   9066  C CB  . ARG C 1 341 ? 52.100 8.948   -19.357 1.00 30.17  ? 338 ARG B CB  1 
ATOM   9067  C CG  . ARG C 1 341 ? 52.769 8.570   -20.672 1.00 42.39  ? 338 ARG B CG  1 
ATOM   9068  C CD  . ARG C 1 341 ? 52.240 7.246   -21.190 1.00 42.18  ? 338 ARG B CD  1 
ATOM   9069  N NE  . ARG C 1 341 ? 53.199 6.527   -22.022 1.00 46.74  ? 338 ARG B NE  1 
ATOM   9070  C CZ  . ARG C 1 341 ? 53.416 6.778   -23.309 1.00 49.30  ? 338 ARG B CZ  1 
ATOM   9071  N NH1 . ARG C 1 341 ? 52.747 7.743   -23.926 1.00 43.63  ? 338 ARG B NH1 1 
ATOM   9072  N NH2 . ARG C 1 341 ? 54.305 6.060   -23.981 1.00 52.16  ? 338 ARG B NH2 1 
ATOM   9073  N N   . GLY C 1 342 ? 51.718 9.465   -16.224 1.00 32.58  ? 339 GLY B N   1 
ATOM   9074  C CA  . GLY C 1 342 ? 51.708 10.374  -15.089 1.00 26.65  ? 339 GLY B CA  1 
ATOM   9075  C C   . GLY C 1 342 ? 52.711 9.974   -14.023 1.00 30.29  ? 339 GLY B C   1 
ATOM   9076  O O   . GLY C 1 342 ? 53.498 10.797  -13.550 1.00 28.75  ? 339 GLY B O   1 
ATOM   9077  N N   . LEU C 1 343 ? 52.696 8.696   -13.631 1.00 26.81  ? 340 LEU B N   1 
ATOM   9078  C CA  . LEU C 1 343 ? 53.635 8.222   -12.619 1.00 28.49  ? 340 LEU B CA  1 
ATOM   9079  C C   . LEU C 1 343 ? 55.075 8.360   -13.097 1.00 33.24  ? 340 LEU B C   1 
ATOM   9080  O O   . LEU C 1 343 ? 55.962 8.724   -12.316 1.00 30.36  ? 340 LEU B O   1 
ATOM   9081  C CB  . LEU C 1 343 ? 53.320 6.773   -12.254 1.00 28.88  ? 340 LEU B CB  1 
ATOM   9082  C CG  . LEU C 1 343 ? 51.951 6.555   -11.605 1.00 33.46  ? 340 LEU B CG  1 
ATOM   9083  C CD1 . LEU C 1 343 ? 51.709 5.079   -11.327 1.00 31.17  ? 340 LEU B CD1 1 
ATOM   9084  C CD2 . LEU C 1 343 ? 51.822 7.375   -10.329 1.00 31.16  ? 340 LEU B CD2 1 
ATOM   9085  N N   . ALA C 1 344 ? 55.325 8.085   -14.381 1.00 26.42  ? 341 ALA B N   1 
ATOM   9086  C CA  . ALA C 1 344 ? 56.672 8.241   -14.921 1.00 31.15  ? 341 ALA B CA  1 
ATOM   9087  C C   . ALA C 1 344 ? 57.143 9.684   -14.810 1.00 33.15  ? 341 ALA B C   1 
ATOM   9088  O O   . ALA C 1 344 ? 58.308 9.941   -14.481 1.00 32.48  ? 341 ALA B O   1 
ATOM   9089  C CB  . ALA C 1 344 ? 56.721 7.777   -16.377 1.00 25.71  ? 341 ALA B CB  1 
ATOM   9090  N N   . HIS C 1 345 ? 56.250 10.642  -15.074 1.00 29.99  ? 342 HIS B N   1 
ATOM   9091  C CA  . HIS C 1 345 ? 56.628 12.043  -14.932 1.00 32.48  ? 342 HIS B CA  1 
ATOM   9092  C C   . HIS C 1 345 ? 56.826 12.410  -13.468 1.00 32.65  ? 342 HIS B C   1 
ATOM   9093  O O   . HIS C 1 345 ? 57.767 13.138  -13.126 1.00 32.23  ? 342 HIS B O   1 
ATOM   9094  C CB  . HIS C 1 345 ? 55.578 12.946  -15.573 1.00 28.86  ? 342 HIS B CB  1 
ATOM   9095  C CG  . HIS C 1 345 ? 55.962 14.392  -15.593 1.00 29.85  ? 342 HIS B CG  1 
ATOM   9096  N ND1 . HIS C 1 345 ? 56.920 14.892  -16.447 1.00 34.01  ? 342 HIS B ND1 1 
ATOM   9097  C CD2 . HIS C 1 345 ? 55.524 15.443  -14.860 1.00 32.86  ? 342 HIS B CD2 1 
ATOM   9098  C CE1 . HIS C 1 345 ? 57.055 16.190  -16.242 1.00 36.88  ? 342 HIS B CE1 1 
ATOM   9099  N NE2 . HIS C 1 345 ? 56.218 16.549  -15.284 1.00 36.10  ? 342 HIS B NE2 1 
ATOM   9100  N N   . ARG C 1 346 ? 55.943 11.921  -12.593 1.00 30.44  ? 343 ARG B N   1 
ATOM   9101  C CA  . ARG C 1 346 ? 56.132 12.097  -11.158 1.00 33.94  ? 343 ARG B CA  1 
ATOM   9102  C C   . ARG C 1 346 ? 57.502 11.588  -10.724 1.00 34.02  ? 343 ARG B C   1 
ATOM   9103  O O   . ARG C 1 346 ? 58.223 12.260  -9.977  1.00 31.44  ? 343 ARG B O   1 
ATOM   9104  C CB  . ARG C 1 346 ? 55.023 11.366  -10.397 1.00 28.60  ? 343 ARG B CB  1 
ATOM   9105  C CG  . ARG C 1 346 ? 55.214 11.323  -8.891  1.00 28.29  ? 343 ARG B CG  1 
ATOM   9106  C CD  . ARG C 1 346 ? 54.738 12.608  -8.246  1.00 30.31  ? 343 ARG B CD  1 
ATOM   9107  N NE  . ARG C 1 346 ? 55.759 13.649  -8.242  1.00 33.64  ? 343 ARG B NE  1 
ATOM   9108  C CZ  . ARG C 1 346 ? 55.494 14.949  -8.168  1.00 36.44  ? 343 ARG B CZ  1 
ATOM   9109  N NH1 . ARG C 1 346 ? 54.237 15.368  -8.102  1.00 33.69  ? 343 ARG B NH1 1 
ATOM   9110  N NH2 . ARG C 1 346 ? 56.484 15.831  -8.165  1.00 33.91  ? 343 ARG B NH2 1 
ATOM   9111  N N   . ALA C 1 347 ? 57.882 10.401  -11.203 1.00 30.14  ? 344 ALA B N   1 
ATOM   9112  C CA  . ALA C 1 347 ? 59.163 9.819   -10.814 1.00 38.99  ? 344 ALA B CA  1 
ATOM   9113  C C   . ALA C 1 347 ? 60.332 10.626  -11.364 1.00 35.05  ? 344 ALA B C   1 
ATOM   9114  O O   . ALA C 1 347 ? 61.367 10.754  -10.699 1.00 31.94  ? 344 ALA B O   1 
ATOM   9115  C CB  . ALA C 1 347 ? 59.249 8.366   -11.280 1.00 34.10  ? 344 ALA B CB  1 
ATOM   9116  N N   . LYS C 1 348 ? 60.193 11.173  -12.575 1.00 35.61  ? 345 LYS B N   1 
ATOM   9117  C CA  . LYS C 1 348 ? 61.241 12.033  -13.117 1.00 39.47  ? 345 LYS B CA  1 
ATOM   9118  C C   . LYS C 1 348 ? 61.429 13.272  -12.250 1.00 40.45  ? 345 LYS B C   1 
ATOM   9119  O O   . LYS C 1 348 ? 62.555 13.617  -11.874 1.00 43.53  ? 345 LYS B O   1 
ATOM   9120  C CB  . LYS C 1 348 ? 60.910 12.432  -14.557 1.00 35.98  ? 345 LYS B CB  1 
ATOM   9121  C CG  . LYS C 1 348 ? 62.017 13.231  -15.239 1.00 39.12  ? 345 LYS B CG  1 
ATOM   9122  C CD  . LYS C 1 348 ? 61.600 13.737  -16.614 1.00 40.14  ? 345 LYS B CD  1 
ATOM   9123  C CE  . LYS C 1 348 ? 60.742 14.993  -16.515 1.00 46.13  ? 345 LYS B CE  1 
ATOM   9124  N NZ  . LYS C 1 348 ? 60.378 15.525  -17.861 1.00 55.99  ? 345 LYS B NZ  1 
ATOM   9125  N N   . LEU C 1 349 ? 60.326 13.948  -11.915 1.00 35.63  ? 346 LEU B N   1 
ATOM   9126  C CA  . LEU C 1 349 ? 60.412 15.174  -11.128 1.00 32.63  ? 346 LEU B CA  1 
ATOM   9127  C C   . LEU C 1 349 ? 61.052 14.921  -9.768  1.00 39.61  ? 346 LEU B C   1 
ATOM   9128  O O   . LEU C 1 349 ? 61.820 15.754  -9.271  1.00 38.35  ? 346 LEU B O   1 
ATOM   9129  C CB  . LEU C 1 349 ? 59.020 15.780  -10.955 1.00 34.82  ? 346 LEU B CB  1 
ATOM   9130  C CG  . LEU C 1 349 ? 58.328 16.303  -12.213 1.00 37.05  ? 346 LEU B CG  1 
ATOM   9131  C CD1 . LEU C 1 349 ? 56.895 16.690  -11.900 1.00 32.80  ? 346 LEU B CD1 1 
ATOM   9132  C CD2 . LEU C 1 349 ? 59.089 17.490  -12.782 1.00 38.47  ? 346 LEU B CD2 1 
ATOM   9133  N N   . ASP C 1 350 ? 60.754 13.777  -9.153  1.00 36.75  ? 347 ASP B N   1 
ATOM   9134  C CA  . ASP C 1 350 ? 61.242 13.457  -7.818  1.00 37.20  ? 347 ASP B CA  1 
ATOM   9135  C C   . ASP C 1 350 ? 62.456 12.538  -7.823  1.00 40.34  ? 347 ASP B C   1 
ATOM   9136  O O   . ASP C 1 350 ? 62.950 12.190  -6.747  1.00 37.41  ? 347 ASP B O   1 
ATOM   9137  C CB  . ASP C 1 350 ? 60.125 12.815  -6.988  1.00 35.73  ? 347 ASP B CB  1 
ATOM   9138  C CG  . ASP C 1 350 ? 58.854 13.641  -6.977  1.00 38.23  ? 347 ASP B CG  1 
ATOM   9139  O OD1 . ASP C 1 350 ? 58.879 14.789  -7.471  1.00 35.47  ? 347 ASP B OD1 1 
ATOM   9140  O OD2 . ASP C 1 350 ? 57.828 13.140  -6.468  1.00 40.91  ? 347 ASP B OD2 1 
ATOM   9141  N N   . ASN C 1 351 ? 62.955 12.150  -8.996  1.00 40.78  ? 348 ASN B N   1 
ATOM   9142  C CA  . ASN C 1 351 ? 64.023 11.156  -9.112  1.00 44.99  ? 348 ASN B CA  1 
ATOM   9143  C C   . ASN C 1 351 ? 63.685 9.902   -8.307  1.00 41.53  ? 348 ASN B C   1 
ATOM   9144  O O   . ASN C 1 351 ? 64.477 9.413   -7.499  1.00 39.12  ? 348 ASN B O   1 
ATOM   9145  C CB  . ASN C 1 351 ? 65.374 11.741  -8.692  1.00 45.79  ? 348 ASN B CB  1 
ATOM   9146  C CG  . ASN C 1 351 ? 66.049 12.508  -9.814  1.00 61.67  ? 348 ASN B CG  1 
ATOM   9147  O OD1 . ASN C 1 351 ? 66.476 11.921  -10.810 1.00 66.57  ? 348 ASN B OD1 1 
ATOM   9148  N ND2 . ASN C 1 351 ? 66.153 13.823  -9.657  1.00 55.78  ? 348 ASN B ND2 1 
ATOM   9149  N N   . ASN C 1 352 ? 62.477 9.389   -8.530  1.00 41.63  ? 349 ASN B N   1 
ATOM   9150  C CA  . ASN C 1 352 ? 61.996 8.193   -7.842  1.00 42.78  ? 349 ASN B CA  1 
ATOM   9151  C C   . ASN C 1 352 ? 62.327 6.986   -8.710  1.00 41.50  ? 349 ASN B C   1 
ATOM   9152  O O   . ASN C 1 352 ? 61.590 6.649   -9.641  1.00 41.29  ? 349 ASN B O   1 
ATOM   9153  C CB  . ASN C 1 352 ? 60.501 8.296   -7.553  1.00 36.16  ? 349 ASN B CB  1 
ATOM   9154  C CG  . ASN C 1 352 ? 60.035 7.284   -6.527  1.00 36.53  ? 349 ASN B CG  1 
ATOM   9155  O OD1 . ASN C 1 352 ? 60.570 6.178   -6.442  1.00 40.22  ? 349 ASN B OD1 1 
ATOM   9156  N ND2 . ASN C 1 352 ? 59.034 7.657   -5.741  1.00 29.77  ? 349 ASN B ND2 1 
ATOM   9157  N N   . LYS C 1 353 ? 63.454 6.341   -8.397  1.00 43.09  ? 350 LYS B N   1 
ATOM   9158  C CA  . LYS C 1 353 ? 63.902 5.173   -9.147  1.00 40.97  ? 350 LYS B CA  1 
ATOM   9159  C C   . LYS C 1 353 ? 62.860 4.063   -9.108  1.00 38.17  ? 350 LYS B C   1 
ATOM   9160  O O   . LYS C 1 353 ? 62.517 3.474   -10.140 1.00 40.34  ? 350 LYS B O   1 
ATOM   9161  C CB  . LYS C 1 353 ? 65.225 4.681   -8.562  1.00 46.26  ? 350 LYS B CB  1 
ATOM   9162  C CG  . LYS C 1 353 ? 66.262 4.210   -9.555  1.00 59.44  ? 350 LYS B CG  1 
ATOM   9163  C CD  . LYS C 1 353 ? 67.606 4.114   -8.845  1.00 68.14  ? 350 LYS B CD  1 
ATOM   9164  C CE  . LYS C 1 353 ? 68.758 3.923   -9.812  1.00 69.31  ? 350 LYS B CE  1 
ATOM   9165  N NZ  . LYS C 1 353 ? 70.070 4.009   -9.109  1.00 74.42  ? 350 LYS B NZ  1 
ATOM   9166  N N   . GLU C 1 354 ? 62.345 3.766   -7.914  1.00 35.56  ? 351 GLU B N   1 
ATOM   9167  C CA  . GLU C 1 354 ? 61.397 2.669   -7.755  1.00 37.36  ? 351 GLU B CA  1 
ATOM   9168  C C   . GLU C 1 354 ? 60.106 2.939   -8.519  1.00 36.65  ? 351 GLU B C   1 
ATOM   9169  O O   . GLU C 1 354 ? 59.576 2.053   -9.200  1.00 36.54  ? 351 GLU B O   1 
ATOM   9170  C CB  . GLU C 1 354 ? 61.115 2.441   -6.269  1.00 39.72  ? 351 GLU B CB  1 
ATOM   9171  C CG  . GLU C 1 354 ? 62.339 2.021   -5.448  1.00 52.44  ? 351 GLU B CG  1 
ATOM   9172  C CD  . GLU C 1 354 ? 63.257 3.184   -5.079  1.00 51.67  ? 351 GLU B CD  1 
ATOM   9173  O OE1 . GLU C 1 354 ? 64.311 2.930   -4.461  1.00 68.05  ? 351 GLU B OE1 1 
ATOM   9174  O OE2 . GLU C 1 354 ? 62.939 4.346   -5.413  1.00 47.74  ? 351 GLU B OE2 1 
ATOM   9175  N N   . LEU C 1 355 ? 59.591 4.168   -8.427  1.00 35.73  ? 352 LEU B N   1 
ATOM   9176  C CA  . LEU C 1 355 ? 58.362 4.506   -9.138  1.00 38.20  ? 352 LEU B CA  1 
ATOM   9177  C C   . LEU C 1 355 ? 58.566 4.461   -10.648 1.00 37.60  ? 352 LEU B C   1 
ATOM   9178  O O   . LEU C 1 355 ? 57.682 4.006   -11.385 1.00 34.34  ? 352 LEU B O   1 
ATOM   9179  C CB  . LEU C 1 355 ? 57.866 5.884   -8.706  1.00 31.47  ? 352 LEU B CB  1 
ATOM   9180  C CG  . LEU C 1 355 ? 56.581 6.356   -9.386  1.00 35.08  ? 352 LEU B CG  1 
ATOM   9181  C CD1 . LEU C 1 355 ? 55.444 5.376   -9.120  1.00 31.02  ? 352 LEU B CD1 1 
ATOM   9182  C CD2 . LEU C 1 355 ? 56.215 7.761   -8.935  1.00 34.87  ? 352 LEU B CD2 1 
ATOM   9183  N N   . ALA C 1 356 ? 59.723 4.926   -11.128 1.00 33.02  ? 353 ALA B N   1 
ATOM   9184  C CA  . ALA C 1 356 ? 59.994 4.884   -12.561 1.00 33.97  ? 353 ALA B CA  1 
ATOM   9185  C C   . ALA C 1 356 ? 60.051 3.448   -13.067 1.00 37.52  ? 353 ALA B C   1 
ATOM   9186  O O   . ALA C 1 356 ? 59.525 3.140   -14.143 1.00 34.28  ? 353 ALA B O   1 
ATOM   9187  C CB  . ALA C 1 356 ? 61.297 5.619   -12.876 1.00 34.19  ? 353 ALA B CB  1 
ATOM   9188  N N   . PHE C 1 357 ? 60.682 2.553   -12.301 1.00 38.79  ? 354 PHE B N   1 
ATOM   9189  C CA  . PHE C 1 357 ? 60.711 1.147   -12.688 1.00 32.28  ? 354 PHE B CA  1 
ATOM   9190  C C   . PHE C 1 357 ? 59.303 0.570   -12.751 1.00 37.87  ? 354 PHE B C   1 
ATOM   9191  O O   . PHE C 1 357 ? 58.977 -0.192  -13.669 1.00 35.26  ? 354 PHE B O   1 
ATOM   9192  C CB  . PHE C 1 357 ? 61.575 0.347   -11.711 1.00 33.35  ? 354 PHE B CB  1 
ATOM   9193  C CG  . PHE C 1 357 ? 61.704 -1.110  -12.066 1.00 35.69  ? 354 PHE B CG  1 
ATOM   9194  C CD1 . PHE C 1 357 ? 62.741 -1.553  -12.875 1.00 40.65  ? 354 PHE B CD1 1 
ATOM   9195  C CD2 . PHE C 1 357 ? 60.783 -2.034  -11.602 1.00 31.77  ? 354 PHE B CD2 1 
ATOM   9196  C CE1 . PHE C 1 357 ? 62.858 -2.891  -13.206 1.00 34.21  ? 354 PHE B CE1 1 
ATOM   9197  C CE2 . PHE C 1 357 ? 60.892 -3.370  -11.932 1.00 33.81  ? 354 PHE B CE2 1 
ATOM   9198  C CZ  . PHE C 1 357 ? 61.932 -3.800  -12.735 1.00 35.72  ? 354 PHE B CZ  1 
ATOM   9199  N N   . PHE C 1 358 ? 58.454 0.921   -11.781 1.00 31.41  ? 355 PHE B N   1 
ATOM   9200  C CA  . PHE C 1 358 ? 57.087 0.412   -11.778 1.00 32.25  ? 355 PHE B CA  1 
ATOM   9201  C C   . PHE C 1 358 ? 56.318 0.892   -13.002 1.00 32.75  ? 355 PHE B C   1 
ATOM   9202  O O   . PHE C 1 358 ? 55.632 0.105   -13.665 1.00 31.59  ? 355 PHE B O   1 
ATOM   9203  C CB  . PHE C 1 358 ? 56.363 0.837   -10.501 1.00 33.22  ? 355 PHE B CB  1 
ATOM   9204  C CG  . PHE C 1 358 ? 54.893 0.522   -10.515 1.00 31.34  ? 355 PHE B CG  1 
ATOM   9205  C CD1 . PHE C 1 358 ? 54.434 -0.726  -10.127 1.00 32.35  ? 355 PHE B CD1 1 
ATOM   9206  C CD2 . PHE C 1 358 ? 53.973 1.467   -10.940 1.00 32.14  ? 355 PHE B CD2 1 
ATOM   9207  C CE1 . PHE C 1 358 ? 53.086 -1.022  -10.149 1.00 34.80  ? 355 PHE B CE1 1 
ATOM   9208  C CE2 . PHE C 1 358 ? 52.625 1.179   -10.969 1.00 32.74  ? 355 PHE B CE2 1 
ATOM   9209  C CZ  . PHE C 1 358 ? 52.179 -0.067  -10.571 1.00 37.50  ? 355 PHE B CZ  1 
ATOM   9210  N N   . ALA C 1 359 ? 56.410 2.189   -13.306 1.00 34.15  ? 356 ALA B N   1 
ATOM   9211  C CA  . ALA C 1 359 ? 55.641 2.752   -14.413 1.00 36.43  ? 356 ALA B CA  1 
ATOM   9212  C C   . ALA C 1 359 ? 55.978 2.054   -15.723 1.00 31.70  ? 356 ALA B C   1 
ATOM   9213  O O   . ALA C 1 359 ? 55.083 1.643   -16.471 1.00 33.40  ? 356 ALA B O   1 
ATOM   9214  C CB  . ALA C 1 359 ? 55.897 4.257   -14.521 1.00 31.83  ? 356 ALA B CB  1 
ATOM   9215  N N   . ASN C 1 360 ? 57.272 1.904   -16.013 1.00 33.04  ? 357 ASN B N   1 
ATOM   9216  C CA  . ASN C 1 360 ? 57.683 1.238   -17.243 1.00 34.31  ? 357 ASN B CA  1 
ATOM   9217  C C   . ASN C 1 360 ? 57.308 -0.240  -17.228 1.00 35.81  ? 357 ASN B C   1 
ATOM   9218  O O   . ASN C 1 360 ? 56.925 -0.798  -18.263 1.00 36.00  ? 357 ASN B O   1 
ATOM   9219  C CB  . ASN C 1 360 ? 59.188 1.415   -17.447 1.00 37.94  ? 357 ASN B CB  1 
ATOM   9220  C CG  . ASN C 1 360 ? 59.718 0.606   -18.612 1.00 38.69  ? 357 ASN B CG  1 
ATOM   9221  O OD1 . ASN C 1 360 ? 59.679 1.050   -19.760 1.00 33.80  ? 357 ASN B OD1 1 
ATOM   9222  N ND2 . ASN C 1 360 ? 60.222 -0.587  -18.322 1.00 31.97  ? 357 ASN B ND2 1 
ATOM   9223  N N   . ALA C 1 361 ? 57.400 -0.888  -16.063 1.00 30.20  ? 358 ALA B N   1 
ATOM   9224  C CA  . ALA C 1 361 ? 57.070 -2.308  -15.983 1.00 34.44  ? 358 ALA B CA  1 
ATOM   9225  C C   . ALA C 1 361 ? 55.596 -2.553  -16.281 1.00 37.56  ? 358 ALA B C   1 
ATOM   9226  O O   . ALA C 1 361 ? 55.236 -3.582  -16.866 1.00 39.05  ? 358 ALA B O   1 
ATOM   9227  C CB  . ALA C 1 361 ? 57.437 -2.861  -14.605 1.00 29.59  ? 358 ALA B CB  1 
ATOM   9228  N N   . LEU C 1 362 ? 54.725 -1.616  -15.895 1.00 32.81  ? 359 LEU B N   1 
ATOM   9229  C CA  . LEU C 1 362 ? 53.301 -1.790  -16.163 1.00 37.09  ? 359 LEU B CA  1 
ATOM   9230  C C   . LEU C 1 362 ? 52.981 -1.569  -17.636 1.00 31.02  ? 359 LEU B C   1 
ATOM   9231  O O   . LEU C 1 362 ? 52.059 -2.199  -18.168 1.00 33.97  ? 359 LEU B O   1 
ATOM   9232  C CB  . LEU C 1 362 ? 52.479 -0.852  -15.280 1.00 35.03  ? 359 LEU B CB  1 
ATOM   9233  C CG  . LEU C 1 362 ? 50.957 -0.906  -15.433 1.00 32.35  ? 359 LEU B CG  1 
ATOM   9234  C CD1 . LEU C 1 362 ? 50.445 -2.341  -15.410 1.00 30.17  ? 359 LEU B CD1 1 
ATOM   9235  C CD2 . LEU C 1 362 ? 50.292 -0.083  -14.341 1.00 32.61  ? 359 LEU B CD2 1 
ATOM   9236  N N   . GLU C 1 363 ? 53.726 -0.691  -18.313 1.00 31.98  ? 360 GLU B N   1 
ATOM   9237  C CA  . GLU C 1 363 ? 53.586 -0.583  -19.761 1.00 35.98  ? 360 GLU B CA  1 
ATOM   9238  C C   . GLU C 1 363 ? 54.063 -1.859  -20.440 1.00 31.27  ? 360 GLU B C   1 
ATOM   9239  O O   . GLU C 1 363 ? 53.398 -2.381  -21.344 1.00 37.72  ? 360 GLU B O   1 
ATOM   9240  C CB  . GLU C 1 363 ? 54.357 0.631   -20.281 1.00 33.90  ? 360 GLU B CB  1 
ATOM   9241  C CG  . GLU C 1 363 ? 53.912 1.942   -19.666 1.00 29.43  ? 360 GLU B CG  1 
ATOM   9242  C CD  . GLU C 1 363 ? 54.462 3.153   -20.393 1.00 32.24  ? 360 GLU B CD  1 
ATOM   9243  O OE1 . GLU C 1 363 ? 55.300 2.974   -21.299 1.00 39.60  ? 360 GLU B OE1 1 
ATOM   9244  O OE2 . GLU C 1 363 ? 54.057 4.287   -20.054 1.00 34.23  ? 360 GLU B OE2 1 
ATOM   9245  N N   . GLU C 1 364 ? 55.212 -2.382  -20.003 1.00 36.40  ? 361 GLU B N   1 
ATOM   9246  C CA  . GLU C 1 364 ? 55.726 -3.631  -20.554 1.00 39.01  ? 361 GLU B CA  1 
ATOM   9247  C C   . GLU C 1 364 ? 54.725 -4.764  -20.366 1.00 35.25  ? 361 GLU B C   1 
ATOM   9248  O O   . GLU C 1 364 ? 54.445 -5.524  -21.299 1.00 39.74  ? 361 GLU B O   1 
ATOM   9249  C CB  . GLU C 1 364 ? 57.067 -3.973  -19.900 1.00 35.09  ? 361 GLU B CB  1 
ATOM   9250  C CG  . GLU C 1 364 ? 58.231 -3.129  -20.405 1.00 36.94  ? 361 GLU B CG  1 
ATOM   9251  C CD  . GLU C 1 364 ? 59.527 -3.378  -19.646 1.00 42.73  ? 361 GLU B CD  1 
ATOM   9252  O OE1 . GLU C 1 364 ? 59.525 -4.179  -18.686 1.00 42.04  ? 361 GLU B OE1 1 
ATOM   9253  O OE2 . GLU C 1 364 ? 60.553 -2.767  -20.015 1.00 32.74  ? 361 GLU B OE2 1 
ATOM   9254  N N   . VAL C 1 365 ? 54.161 -4.879  -19.161 1.00 32.96  ? 362 VAL B N   1 
ATOM   9255  C CA  . VAL C 1 365 ? 53.161 -5.909  -18.889 1.00 31.72  ? 362 VAL B CA  1 
ATOM   9256  C C   . VAL C 1 365 ? 51.980 -5.774  -19.843 1.00 41.03  ? 362 VAL B C   1 
ATOM   9257  O O   . VAL C 1 365 ? 51.516 -6.761  -20.427 1.00 40.43  ? 362 VAL B O   1 
ATOM   9258  C CB  . VAL C 1 365 ? 52.705 -5.840  -17.421 1.00 35.42  ? 362 VAL B CB  1 
ATOM   9259  C CG1 . VAL C 1 365 ? 51.367 -6.546  -17.240 1.00 36.53  ? 362 VAL B CG1 1 
ATOM   9260  C CG2 . VAL C 1 365 ? 53.743 -6.458  -16.527 1.00 38.03  ? 362 VAL B CG2 1 
ATOM   9261  N N   . SER C 1 366 ? 51.479 -4.548  -20.012 1.00 37.96  ? 363 SER B N   1 
ATOM   9262  C CA  . SER C 1 366 ? 50.324 -4.326  -20.875 1.00 35.46  ? 363 SER B CA  1 
ATOM   9263  C C   . SER C 1 366 ? 50.605 -4.791  -22.298 1.00 33.48  ? 363 SER B C   1 
ATOM   9264  O O   . SER C 1 366 ? 49.769 -5.449  -22.928 1.00 33.29  ? 363 SER B O   1 
ATOM   9265  C CB  . SER C 1 366 ? 49.938 -2.848  -20.855 1.00 32.76  ? 363 SER B CB  1 
ATOM   9266  O OG  . SER C 1 366 ? 49.672 -2.414  -19.533 1.00 31.65  ? 363 SER B OG  1 
ATOM   9267  N N   . ILE C 1 367 ? 51.790 -4.471  -22.812 1.00 37.02  ? 364 ILE B N   1 
ATOM   9268  C CA  . ILE C 1 367 ? 52.134 -4.838  -24.180 1.00 40.55  ? 364 ILE B CA  1 
ATOM   9269  C C   . ILE C 1 367 ? 52.374 -6.340  -24.289 1.00 36.58  ? 364 ILE B C   1 
ATOM   9270  O O   . ILE C 1 367 ? 51.909 -6.989  -25.233 1.00 36.36  ? 364 ILE B O   1 
ATOM   9271  C CB  . ILE C 1 367 ? 53.351 -4.024  -24.657 1.00 33.75  ? 364 ILE B CB  1 
ATOM   9272  C CG1 . ILE C 1 367 ? 52.976 -2.549  -24.787 1.00 34.74  ? 364 ILE B CG1 1 
ATOM   9273  C CG2 . ILE C 1 367 ? 53.887 -4.575  -25.975 1.00 32.34  ? 364 ILE B CG2 1 
ATOM   9274  C CD1 . ILE C 1 367 ? 54.139 -1.638  -25.125 1.00 29.63  ? 364 ILE B CD1 1 
ATOM   9275  N N   . GLU C 1 368 ? 53.095 -6.914  -23.319 1.00 35.12  ? 365 GLU B N   1 
ATOM   9276  C CA  . GLU C 1 368 ? 53.386 -8.346  -23.351 1.00 34.81  ? 365 GLU B CA  1 
ATOM   9277  C C   . GLU C 1 368 ? 52.111 -9.177  -23.343 1.00 40.75  ? 365 GLU B C   1 
ATOM   9278  O O   . GLU C 1 368 ? 52.011 -10.182 -24.059 1.00 35.75  ? 365 GLU B O   1 
ATOM   9279  C CB  . GLU C 1 368 ? 54.261 -8.735  -22.161 1.00 36.21  ? 365 GLU B CB  1 
ATOM   9280  C CG  . GLU C 1 368 ? 55.704 -8.280  -22.244 1.00 40.80  ? 365 GLU B CG  1 
ATOM   9281  C CD  . GLU C 1 368 ? 56.365 -8.249  -20.882 1.00 39.34  ? 365 GLU B CD  1 
ATOM   9282  O OE1 . GLU C 1 368 ? 55.821 -8.874  -19.947 1.00 42.92  ? 365 GLU B OE1 1 
ATOM   9283  O OE2 . GLU C 1 368 ? 57.422 -7.601  -20.744 1.00 39.06  ? 365 GLU B OE2 1 
ATOM   9284  N N   . THR C 1 369 ? 51.129 -8.776  -22.531 1.00 34.83  ? 366 THR B N   1 
ATOM   9285  C CA  . THR C 1 369 ? 49.894 -9.543  -22.416 1.00 33.76  ? 366 THR B CA  1 
ATOM   9286  C C   . THR C 1 369 ? 49.189 -9.655  -23.760 1.00 37.06  ? 366 THR B C   1 
ATOM   9287  O O   . THR C 1 369 ? 48.715 -10.734 -24.138 1.00 39.71  ? 366 THR B O   1 
ATOM   9288  C CB  . THR C 1 369 ? 48.977 -8.893  -21.381 1.00 38.64  ? 366 THR B CB  1 
ATOM   9289  O OG1 . THR C 1 369 ? 49.593 -8.960  -20.089 1.00 36.26  ? 366 THR B OG1 1 
ATOM   9290  C CG2 . THR C 1 369 ? 47.631 -9.599  -21.336 1.00 38.09  ? 366 THR B CG2 1 
ATOM   9291  N N   . ILE C 1 370 ? 49.130 -8.552  -24.505 1.00 33.99  ? 367 ILE B N   1 
ATOM   9292  C CA  . ILE C 1 370 ? 48.463 -8.561  -25.801 1.00 34.04  ? 367 ILE B CA  1 
ATOM   9293  C C   . ILE C 1 370 ? 49.282 -9.346  -26.818 1.00 38.21  ? 367 ILE B C   1 
ATOM   9294  O O   . ILE C 1 370 ? 48.733 -10.098 -27.633 1.00 37.98  ? 367 ILE B O   1 
ATOM   9295  C CB  . ILE C 1 370 ? 48.205 -7.114  -26.255 1.00 32.32  ? 367 ILE B CB  1 
ATOM   9296  C CG1 . ILE C 1 370 ? 47.220 -6.442  -25.296 1.00 37.37  ? 367 ILE B CG1 1 
ATOM   9297  C CG2 . ILE C 1 370 ? 47.690 -7.076  -27.691 1.00 32.74  ? 367 ILE B CG2 1 
ATOM   9298  C CD1 . ILE C 1 370 ? 47.084 -4.956  -25.497 1.00 37.31  ? 367 ILE B CD1 1 
ATOM   9299  N N   . GLU C 1 371 ? 50.608 -9.202  -26.776 1.00 36.80  ? 368 GLU B N   1 
ATOM   9300  C CA  . GLU C 1 371 ? 51.466 -9.924  -27.707 1.00 35.30  ? 368 GLU B CA  1 
ATOM   9301  C C   . GLU C 1 371 ? 51.532 -11.414 -27.396 1.00 37.54  ? 368 GLU B C   1 
ATOM   9302  O O   . GLU C 1 371 ? 51.916 -12.200 -28.268 1.00 42.28  ? 368 GLU B O   1 
ATOM   9303  C CB  . GLU C 1 371 ? 52.865 -9.313  -27.706 1.00 37.09  ? 368 GLU B CB  1 
ATOM   9304  C CG  . GLU C 1 371 ? 52.897 -7.893  -28.255 1.00 35.25  ? 368 GLU B CG  1 
ATOM   9305  C CD  . GLU C 1 371 ? 54.286 -7.287  -28.255 1.00 36.20  ? 368 GLU B CD  1 
ATOM   9306  O OE1 . GLU C 1 371 ? 55.139 -7.739  -27.461 1.00 33.11  ? 368 GLU B OE1 1 
ATOM   9307  O OE2 . GLU C 1 371 ? 54.520 -6.351  -29.047 1.00 34.04  ? 368 GLU B OE2 1 
ATOM   9308  N N   . ALA C 1 372 ? 51.163 -11.822 -26.181 1.00 37.40  ? 369 ALA B N   1 
ATOM   9309  C CA  . ALA C 1 372 ? 51.044 -13.238 -25.860 1.00 39.32  ? 369 ALA B CA  1 
ATOM   9310  C C   . ALA C 1 372 ? 49.720 -13.841 -26.316 1.00 44.30  ? 369 ALA B C   1 
ATOM   9311  O O   . ALA C 1 372 ? 49.554 -15.062 -26.219 1.00 46.47  ? 369 ALA B O   1 
ATOM   9312  C CB  . ALA C 1 372 ? 51.214 -13.460 -24.357 1.00 36.64  ? 369 ALA B CB  1 
ATOM   9313  N N   . GLY C 1 373 ? 48.780 -13.026 -26.796 1.00 36.34  ? 370 GLY B N   1 
ATOM   9314  C CA  . GLY C 1 373 ? 47.522 -13.505 -27.338 1.00 39.61  ? 370 GLY B CA  1 
ATOM   9315  C C   . GLY C 1 373 ? 46.284 -13.099 -26.564 1.00 41.69  ? 370 GLY B C   1 
ATOM   9316  O O   . GLY C 1 373 ? 45.170 -13.377 -27.028 1.00 42.49  ? 370 GLY B O   1 
ATOM   9317  N N   . PHE C 1 374 ? 46.431 -12.452 -25.410 1.00 40.11  ? 371 PHE B N   1 
ATOM   9318  C CA  . PHE C 1 374 ? 45.304 -12.092 -24.556 1.00 39.82  ? 371 PHE B CA  1 
ATOM   9319  C C   . PHE C 1 374 ? 44.949 -10.626 -24.778 1.00 41.94  ? 371 PHE B C   1 
ATOM   9320  O O   . PHE C 1 374 ? 45.769 -9.740  -24.512 1.00 40.37  ? 371 PHE B O   1 
ATOM   9321  C CB  . PHE C 1 374 ? 45.645 -12.350 -23.088 1.00 41.77  ? 371 PHE B CB  1 
ATOM   9322  C CG  . PHE C 1 374 ? 46.095 -13.759 -22.805 1.00 42.12  ? 371 PHE B CG  1 
ATOM   9323  C CD1 . PHE C 1 374 ? 45.167 -14.768 -22.588 1.00 46.54  ? 371 PHE B CD1 1 
ATOM   9324  C CD2 . PHE C 1 374 ? 47.445 -14.076 -22.753 1.00 45.05  ? 371 PHE B CD2 1 
ATOM   9325  C CE1 . PHE C 1 374 ? 45.576 -16.068 -22.324 1.00 47.74  ? 371 PHE B CE1 1 
ATOM   9326  C CE2 . PHE C 1 374 ? 47.862 -15.375 -22.490 1.00 44.08  ? 371 PHE B CE2 1 
ATOM   9327  C CZ  . PHE C 1 374 ? 46.927 -16.371 -22.275 1.00 46.61  ? 371 PHE B CZ  1 
ATOM   9328  N N   . MET C 1 375 ? 43.731 -10.371 -25.256 1.00 34.39  ? 372 MET B N   1 
ATOM   9329  C CA  . MET C 1 375 ? 43.339 -9.026  -25.657 1.00 38.28  ? 372 MET B CA  1 
ATOM   9330  C C   . MET C 1 375 ? 41.827 -8.879  -25.567 1.00 40.41  ? 372 MET B C   1 
ATOM   9331  O O   . MET C 1 375 ? 41.089 -9.862  -25.469 1.00 39.97  ? 372 MET B O   1 
ATOM   9332  C CB  . MET C 1 375 ? 43.815 -8.716  -27.079 1.00 34.52  ? 372 MET B CB  1 
ATOM   9333  C CG  . MET C 1 375 ? 43.108 -9.537  -28.149 1.00 38.25  ? 372 MET B CG  1 
ATOM   9334  S SD  . MET C 1 375 ? 43.947 -9.458  -29.740 1.00 36.35  ? 372 MET B SD  1 
ATOM   9335  C CE  . MET C 1 375 ? 45.384 -10.474 -29.400 1.00 36.09  ? 372 MET B CE  1 
ATOM   9336  N N   . THR C 1 376 ? 41.372 -7.628  -25.614 1.00 37.85  ? 373 THR B N   1 
ATOM   9337  C CA  . THR C 1 376 ? 39.948 -7.342  -25.659 1.00 37.62  ? 373 THR B CA  1 
ATOM   9338  C C   . THR C 1 376 ? 39.447 -7.368  -27.101 1.00 35.69  ? 373 THR B C   1 
ATOM   9339  O O   . THR C 1 376 ? 40.222 -7.440  -28.059 1.00 38.83  ? 373 THR B O   1 
ATOM   9340  C CB  . THR C 1 376 ? 39.639 -5.993  -25.008 1.00 38.37  ? 373 THR B CB  1 
ATOM   9341  O OG1 . THR C 1 376 ? 40.362 -4.950  -25.679 1.00 34.42  ? 373 THR B OG1 1 
ATOM   9342  C CG2 . THR C 1 376 ? 40.012 -6.012  -23.535 1.00 34.41  ? 373 THR B CG2 1 
ATOM   9343  N N   . LYS C 1 377 ? 38.120 -7.286  -27.242 1.00 39.03  ? 374 LYS B N   1 
ATOM   9344  C CA  . LYS C 1 377 ? 37.477 -7.562  -28.526 1.00 35.93  ? 374 LYS B CA  1 
ATOM   9345  C C   . LYS C 1 377 ? 37.929 -6.599  -29.617 1.00 34.10  ? 374 LYS B C   1 
ATOM   9346  O O   . LYS C 1 377 ? 38.059 -6.993  -30.783 1.00 39.17  ? 374 LYS B O   1 
ATOM   9347  C CB  . LYS C 1 377 ? 35.959 -7.502  -28.373 1.00 40.72  ? 374 LYS B CB  1 
ATOM   9348  C CG  . LYS C 1 377 ? 35.186 -8.009  -29.576 1.00 46.29  ? 374 LYS B CG  1 
ATOM   9349  C CD  . LYS C 1 377 ? 33.690 -7.843  -29.371 1.00 40.80  ? 374 LYS B CD  1 
ATOM   9350  C CE  . LYS C 1 377 ? 32.900 -8.326  -30.579 1.00 46.72  ? 374 LYS B CE  1 
ATOM   9351  N NZ  . LYS C 1 377 ? 31.476 -7.879  -30.526 1.00 58.25  ? 374 LYS B NZ  1 
ATOM   9352  N N   . ASP C 1 378 ? 38.158 -5.330  -29.268 1.00 36.77  ? 375 ASP B N   1 
ATOM   9353  C CA  . ASP C 1 378 ? 38.527 -4.349  -30.283 1.00 35.84  ? 375 ASP B CA  1 
ATOM   9354  C C   . ASP C 1 378 ? 39.808 -4.758  -31.000 1.00 40.80  ? 375 ASP B C   1 
ATOM   9355  O O   . ASP C 1 378 ? 39.913 -4.624  -32.225 1.00 34.48  ? 375 ASP B O   1 
ATOM   9356  C CB  . ASP C 1 378 ? 38.680 -2.966  -29.651 1.00 29.82  ? 375 ASP B CB  1 
ATOM   9357  C CG  . ASP C 1 378 ? 39.651 -2.964  -28.486 1.00 35.26  ? 375 ASP B CG  1 
ATOM   9358  O OD1 . ASP C 1 378 ? 39.515 -3.822  -27.589 1.00 32.27  ? 375 ASP B OD1 1 
ATOM   9359  O OD2 . ASP C 1 378 ? 40.555 -2.101  -28.475 1.00 26.87  ? 375 ASP B OD2 1 
ATOM   9360  N N   . LEU C 1 379 ? 40.783 -5.281  -30.255 1.00 30.10  ? 376 LEU B N   1 
ATOM   9361  C CA  . LEU C 1 379 ? 42.045 -5.685  -30.865 1.00 36.11  ? 376 LEU B CA  1 
ATOM   9362  C C   . LEU C 1 379 ? 41.868 -6.940  -31.709 1.00 39.92  ? 376 LEU B C   1 
ATOM   9363  O O   . LEU C 1 379 ? 42.394 -7.028  -32.825 1.00 38.21  ? 376 LEU B O   1 
ATOM   9364  C CB  . LEU C 1 379 ? 43.096 -5.901  -29.778 1.00 31.83  ? 376 LEU B CB  1 
ATOM   9365  C CG  . LEU C 1 379 ? 43.296 -4.674  -28.886 1.00 40.54  ? 376 LEU B CG  1 
ATOM   9366  C CD1 . LEU C 1 379 ? 44.417 -4.898  -27.894 1.00 35.88  ? 376 LEU B CD1 1 
ATOM   9367  C CD2 . LEU C 1 379 ? 43.564 -3.434  -29.730 1.00 32.73  ? 376 LEU B CD2 1 
ATOM   9368  N N   . ALA C 1 380 ? 41.131 -7.925  -31.188 1.00 39.49  ? 377 ALA B N   1 
ATOM   9369  C CA  . ALA C 1 380 ? 40.835 -9.127  -31.963 1.00 38.38  ? 377 ALA B CA  1 
ATOM   9370  C C   . ALA C 1 380 ? 40.175 -8.769  -33.288 1.00 40.29  ? 377 ALA B C   1 
ATOM   9371  O O   . ALA C 1 380 ? 40.555 -9.285  -34.345 1.00 38.11  ? 377 ALA B O   1 
ATOM   9372  C CB  . ALA C 1 380 ? 39.946 -10.071 -31.152 1.00 35.67  ? 377 ALA B CB  1 
ATOM   9373  N N   . ALA C 1 381 ? 39.192 -7.863  -33.250 1.00 38.00  ? 378 ALA B N   1 
ATOM   9374  C CA  . ALA C 1 381 ? 38.566 -7.399  -34.484 1.00 39.90  ? 378 ALA B CA  1 
ATOM   9375  C C   . ALA C 1 381 ? 39.584 -6.732  -35.399 1.00 41.21  ? 378 ALA B C   1 
ATOM   9376  O O   . ALA C 1 381 ? 39.547 -6.917  -36.621 1.00 44.59  ? 378 ALA B O   1 
ATOM   9377  C CB  . ALA C 1 381 ? 37.419 -6.439  -34.166 1.00 26.95  ? 378 ALA B CB  1 
ATOM   9378  N N   . CYS C 1 382 ? 40.510 -5.960  -34.824 1.00 36.75  ? 379 CYS B N   1 
ATOM   9379  C CA  . CYS C 1 382 ? 41.533 -5.304  -35.630 1.00 41.26  ? 379 CYS B CA  1 
ATOM   9380  C C   . CYS C 1 382 ? 42.427 -6.319  -36.331 1.00 41.64  ? 379 CYS B C   1 
ATOM   9381  O O   . CYS C 1 382 ? 42.898 -6.068  -37.445 1.00 45.61  ? 379 CYS B O   1 
ATOM   9382  C CB  . CYS C 1 382 ? 42.362 -4.367  -34.747 1.00 41.60  ? 379 CYS B CB  1 
ATOM   9383  S SG  . CYS C 1 382 ? 43.305 -3.103  -35.628 1.00 52.43  ? 379 CYS B SG  1 
ATOM   9384  N N   . ILE C 1 383 ? 42.656 -7.475  -35.705 1.00 43.97  ? 380 ILE B N   1 
ATOM   9385  C CA  . ILE C 1 383 ? 43.515 -8.496  -36.302 1.00 43.16  ? 380 ILE B CA  1 
ATOM   9386  C C   . ILE C 1 383 ? 42.774 -9.235  -37.411 1.00 44.88  ? 380 ILE B C   1 
ATOM   9387  O O   . ILE C 1 383 ? 43.234 -9.303  -38.557 1.00 44.80  ? 380 ILE B O   1 
ATOM   9388  C CB  . ILE C 1 383 ? 44.012 -9.481  -35.228 1.00 42.14  ? 380 ILE B CB  1 
ATOM   9389  C CG1 . ILE C 1 383 ? 45.003 -8.816  -34.279 1.00 41.65  ? 380 ILE B CG1 1 
ATOM   9390  C CG2 . ILE C 1 383 ? 44.639 -10.710 -35.880 1.00 41.43  ? 380 ILE B CG2 1 
ATOM   9391  C CD1 . ILE C 1 383 ? 45.524 -9.766  -33.216 1.00 33.31  ? 380 ILE B CD1 1 
ATOM   9392  N N   . LYS C 1 384 ? 41.614 -9.800  -37.082 1.00 47.44  ? 381 LYS B N   1 
ATOM   9393  C CA  . LYS C 1 384 ? 40.932 -10.768 -37.929 1.00 43.89  ? 381 LYS B CA  1 
ATOM   9394  C C   . LYS C 1 384 ? 39.733 -10.194 -38.669 1.00 46.00  ? 381 LYS B C   1 
ATOM   9395  O O   . LYS C 1 384 ? 39.131 -10.903 -39.480 1.00 50.75  ? 381 LYS B O   1 
ATOM   9396  C CB  . LYS C 1 384 ? 40.472 -11.964 -37.084 1.00 44.21  ? 381 LYS B CB  1 
ATOM   9397  C CG  . LYS C 1 384 ? 41.549 -12.571 -36.199 1.00 45.23  ? 381 LYS B CG  1 
ATOM   9398  C CD  . LYS C 1 384 ? 41.066 -13.866 -35.560 1.00 55.31  ? 381 LYS B CD  1 
ATOM   9399  C CE  . LYS C 1 384 ? 42.196 -14.595 -34.848 1.00 59.88  ? 381 LYS B CE  1 
ATOM   9400  N NZ  . LYS C 1 384 ? 41.776 -15.942 -34.369 1.00 64.81  ? 381 LYS B NZ  1 
ATOM   9401  N N   . GLY C 1 385 ? 39.367 -8.942  -38.415 1.00 48.50  ? 382 GLY B N   1 
ATOM   9402  C CA  . GLY C 1 385 ? 38.099 -8.438  -38.908 1.00 41.62  ? 382 GLY B CA  1 
ATOM   9403  C C   . GLY C 1 385 ? 36.970 -8.899  -38.008 1.00 43.19  ? 382 GLY B C   1 
ATOM   9404  O O   . GLY C 1 385 ? 36.961 -10.051 -37.562 1.00 47.40  ? 382 GLY B O   1 
ATOM   9405  N N   . LEU C 1 386 ? 36.018 -8.011  -37.723 1.00 46.84  ? 383 LEU B N   1 
ATOM   9406  C CA  . LEU C 1 386 ? 34.939 -8.336  -36.792 1.00 45.63  ? 383 LEU B CA  1 
ATOM   9407  C C   . LEU C 1 386 ? 34.144 -9.578  -37.180 1.00 50.04  ? 383 LEU B C   1 
ATOM   9408  O O   . LEU C 1 386 ? 33.850 -10.389 -36.288 1.00 51.20  ? 383 LEU B O   1 
ATOM   9409  C CB  . LEU C 1 386 ? 34.022 -7.114  -36.638 1.00 47.37  ? 383 LEU B CB  1 
ATOM   9410  C CG  . LEU C 1 386 ? 32.772 -7.286  -35.764 1.00 50.50  ? 383 LEU B CG  1 
ATOM   9411  C CD1 . LEU C 1 386 ? 33.129 -7.790  -34.371 1.00 51.46  ? 383 LEU B CD1 1 
ATOM   9412  C CD2 . LEU C 1 386 ? 32.009 -5.973  -35.682 1.00 50.18  ? 383 LEU B CD2 1 
ATOM   9413  N N   . PRO C 1 387 ? 33.765 -9.800  -38.448 1.00 49.53  ? 384 PRO B N   1 
ATOM   9414  C CA  . PRO C 1 387 ? 33.020 -11.033 -38.766 1.00 45.59  ? 384 PRO B CA  1 
ATOM   9415  C C   . PRO C 1 387 ? 33.733 -12.313 -38.365 1.00 49.58  ? 384 PRO B C   1 
ATOM   9416  O O   . PRO C 1 387 ? 33.067 -13.316 -38.071 1.00 49.59  ? 384 PRO B O   1 
ATOM   9417  C CB  . PRO C 1 387 ? 32.839 -10.948 -40.288 1.00 43.57  ? 384 PRO B CB  1 
ATOM   9418  C CG  . PRO C 1 387 ? 32.810 -9.497  -40.570 1.00 44.66  ? 384 PRO B CG  1 
ATOM   9419  C CD  . PRO C 1 387 ? 33.798 -8.887  -39.607 1.00 49.26  ? 384 PRO B CD  1 
ATOM   9420  N N   . ASN C 1 388 ? 35.063 -12.310 -38.324 1.00 49.30  ? 385 ASN B N   1 
ATOM   9421  C CA  . ASN C 1 388 ? 35.830 -13.517 -38.046 1.00 39.24  ? 385 ASN B CA  1 
ATOM   9422  C C   . ASN C 1 388 ? 36.119 -13.719 -36.565 1.00 45.31  ? 385 ASN B C   1 
ATOM   9423  O O   . ASN C 1 388 ? 36.724 -14.733 -36.202 1.00 48.07  ? 385 ASN B O   1 
ATOM   9424  C CB  . ASN C 1 388 ? 37.146 -13.489 -38.828 1.00 46.46  ? 385 ASN B CB  1 
ATOM   9425  C CG  . ASN C 1 388 ? 36.932 -13.458 -40.330 1.00 50.88  ? 385 ASN B CG  1 
ATOM   9426  O OD1 . ASN C 1 388 ? 36.889 -14.500 -40.983 1.00 61.78  ? 385 ASN B OD1 1 
ATOM   9427  N ND2 . ASN C 1 388 ? 36.791 -12.260 -40.884 1.00 44.01  ? 385 ASN B ND2 1 
ATOM   9428  N N   . VAL C 1 389 ? 35.697 -12.800 -35.704 1.00 51.57  ? 386 VAL B N   1 
ATOM   9429  C CA  . VAL C 1 389 ? 36.022 -12.878 -34.283 1.00 51.44  ? 386 VAL B CA  1 
ATOM   9430  C C   . VAL C 1 389 ? 35.123 -13.905 -33.608 1.00 49.26  ? 386 VAL B C   1 
ATOM   9431  O O   . VAL C 1 389 ? 33.893 -13.825 -33.695 1.00 48.02  ? 386 VAL B O   1 
ATOM   9432  C CB  . VAL C 1 389 ? 35.892 -11.506 -33.608 1.00 48.47  ? 386 VAL B CB  1 
ATOM   9433  C CG1 . VAL C 1 389 ? 36.165 -11.621 -32.117 1.00 43.00  ? 386 VAL B CG1 1 
ATOM   9434  C CG2 . VAL C 1 389 ? 36.853 -10.522 -34.247 1.00 42.48  ? 386 VAL B CG2 1 
ATOM   9435  N N   . GLN C 1 390 ? 35.740 -14.877 -32.948 1.00 51.64  ? 387 GLN B N   1 
ATOM   9436  C CA  . GLN C 1 390 ? 35.057 -15.798 -32.054 1.00 49.44  ? 387 GLN B CA  1 
ATOM   9437  C C   . GLN C 1 390 ? 35.235 -15.322 -30.619 1.00 49.51  ? 387 GLN B C   1 
ATOM   9438  O O   . GLN C 1 390 ? 36.151 -14.557 -30.308 1.00 52.06  ? 387 GLN B O   1 
ATOM   9439  C CB  . GLN C 1 390 ? 35.609 -17.218 -32.200 1.00 51.80  ? 387 GLN B CB  1 
ATOM   9440  C CG  . GLN C 1 390 ? 35.261 -17.911 -33.500 1.00 61.23  ? 387 GLN B CG  1 
ATOM   9441  C CD  . GLN C 1 390 ? 35.985 -19.234 -33.644 1.00 70.82  ? 387 GLN B CD  1 
ATOM   9442  O OE1 . GLN C 1 390 ? 35.904 -20.099 -32.770 1.00 65.65  ? 387 GLN B OE1 1 
ATOM   9443  N NE2 . GLN C 1 390 ? 36.712 -19.394 -34.744 1.00 67.48  ? 387 GLN B NE2 1 
ATOM   9444  N N   . ARG C 1 391 ? 34.348 -15.792 -29.738 1.00 46.13  ? 388 ARG B N   1 
ATOM   9445  C CA  . ARG C 1 391 ? 34.454 -15.423 -28.329 1.00 51.74  ? 388 ARG B CA  1 
ATOM   9446  C C   . ARG C 1 391 ? 35.789 -15.857 -27.733 1.00 48.01  ? 388 ARG B C   1 
ATOM   9447  O O   . ARG C 1 391 ? 36.320 -15.183 -26.842 1.00 49.94  ? 388 ARG B O   1 
ATOM   9448  C CB  . ARG C 1 391 ? 33.299 -16.030 -27.535 1.00 40.39  ? 388 ARG B CB  1 
ATOM   9449  C CG  . ARG C 1 391 ? 33.311 -15.682 -26.052 1.00 46.76  ? 388 ARG B CG  1 
ATOM   9450  C CD  . ARG C 1 391 ? 33.395 -14.174 -25.828 1.00 45.38  ? 388 ARG B CD  1 
ATOM   9451  N NE  . ARG C 1 391 ? 33.412 -13.830 -24.407 1.00 39.52  ? 388 ARG B NE  1 
ATOM   9452  C CZ  . ARG C 1 391 ? 34.482 -13.933 -23.623 1.00 45.67  ? 388 ARG B CZ  1 
ATOM   9453  N NH1 . ARG C 1 391 ? 34.402 -13.600 -22.341 1.00 42.42  ? 388 ARG B NH1 1 
ATOM   9454  N NH2 . ARG C 1 391 ? 35.633 -14.366 -24.120 1.00 40.66  ? 388 ARG B NH2 1 
ATOM   9455  N N   . SER C 1 392 ? 36.354 -16.963 -28.214 1.00 46.47  ? 389 SER B N   1 
ATOM   9456  C CA  . SER C 1 392 ? 37.644 -17.419 -27.712 1.00 49.47  ? 389 SER B CA  1 
ATOM   9457  C C   . SER C 1 392 ? 38.811 -16.570 -28.206 1.00 39.11  ? 389 SER B C   1 
ATOM   9458  O O   . SER C 1 392 ? 39.936 -16.763 -27.733 1.00 43.73  ? 389 SER B O   1 
ATOM   9459  C CB  . SER C 1 392 ? 37.871 -18.882 -28.095 1.00 39.00  ? 389 SER B CB  1 
ATOM   9460  O OG  . SER C 1 392 ? 38.154 -19.016 -29.477 1.00 43.26  ? 389 SER B OG  1 
ATOM   9461  N N   . ASP C 1 393 ? 38.573 -15.634 -29.130 1.00 39.36  ? 390 ASP B N   1 
ATOM   9462  C CA  . ASP C 1 393 ? 39.640 -14.770 -29.624 1.00 42.11  ? 390 ASP B CA  1 
ATOM   9463  C C   . ASP C 1 393 ? 39.989 -13.642 -28.661 1.00 48.28  ? 390 ASP B C   1 
ATOM   9464  O O   . ASP C 1 393 ? 41.048 -13.022 -28.818 1.00 43.31  ? 390 ASP B O   1 
ATOM   9465  C CB  . ASP C 1 393 ? 39.253 -14.159 -30.973 1.00 43.24  ? 390 ASP B CB  1 
ATOM   9466  C CG  . ASP C 1 393 ? 39.280 -15.166 -32.104 1.00 51.75  ? 390 ASP B CG  1 
ATOM   9467  O OD1 . ASP C 1 393 ? 40.151 -16.062 -32.089 1.00 48.75  ? 390 ASP B OD1 1 
ATOM   9468  O OD2 . ASP C 1 393 ? 38.430 -15.058 -33.014 1.00 52.80  ? 390 ASP B OD2 1 
ATOM   9469  N N   . TYR C 1 394 ? 39.134 -13.354 -27.681 1.00 40.88  ? 391 TYR B N   1 
ATOM   9470  C CA  . TYR C 1 394 ? 39.341 -12.209 -26.807 1.00 44.40  ? 391 TYR B CA  1 
ATOM   9471  C C   . TYR C 1 394 ? 38.885 -12.541 -25.392 1.00 42.98  ? 391 TYR B C   1 
ATOM   9472  O O   . TYR C 1 394 ? 38.427 -13.650 -25.100 1.00 44.71  ? 391 TYR B O   1 
ATOM   9473  C CB  . TYR C 1 394 ? 38.617 -10.966 -27.341 1.00 40.60  ? 391 TYR B CB  1 
ATOM   9474  C CG  . TYR C 1 394 ? 37.108 -11.091 -27.404 1.00 42.74  ? 391 TYR B CG  1 
ATOM   9475  C CD1 . TYR C 1 394 ? 36.315 -10.745 -26.318 1.00 36.48  ? 391 TYR B CD1 1 
ATOM   9476  C CD2 . TYR C 1 394 ? 36.477 -11.539 -28.558 1.00 43.90  ? 391 TYR B CD2 1 
ATOM   9477  C CE1 . TYR C 1 394 ? 34.936 -10.854 -26.373 1.00 39.43  ? 391 TYR B CE1 1 
ATOM   9478  C CE2 . TYR C 1 394 ? 35.099 -11.650 -28.624 1.00 41.91  ? 391 TYR B CE2 1 
ATOM   9479  C CZ  . TYR C 1 394 ? 34.334 -11.305 -27.530 1.00 44.27  ? 391 TYR B CZ  1 
ATOM   9480  O OH  . TYR C 1 394 ? 32.962 -11.413 -27.592 1.00 45.01  ? 391 TYR B OH  1 
ATOM   9481  N N   . LEU C 1 395 ? 39.031 -11.555 -24.508 1.00 41.67  ? 392 LEU B N   1 
ATOM   9482  C CA  . LEU C 1 395 ? 38.572 -11.617 -23.131 1.00 39.63  ? 392 LEU B CA  1 
ATOM   9483  C C   . LEU C 1 395 ? 37.608 -10.464 -22.892 1.00 39.46  ? 392 LEU B C   1 
ATOM   9484  O O   . LEU C 1 395 ? 37.674 -9.436  -23.573 1.00 36.87  ? 392 LEU B O   1 
ATOM   9485  C CB  . LEU C 1 395 ? 39.747 -11.520 -22.147 1.00 41.58  ? 392 LEU B CB  1 
ATOM   9486  C CG  . LEU C 1 395 ? 40.796 -12.636 -22.173 1.00 41.21  ? 392 LEU B CG  1 
ATOM   9487  C CD1 . LEU C 1 395 ? 41.905 -12.366 -21.165 1.00 40.04  ? 392 LEU B CD1 1 
ATOM   9488  C CD2 . LEU C 1 395 ? 40.157 -13.992 -21.918 1.00 41.55  ? 392 LEU B CD2 1 
ATOM   9489  N N   . ASN C 1 396 ? 36.709 -10.630 -21.925 1.00 39.65  ? 393 ASN B N   1 
ATOM   9490  C CA  . ASN C 1 396 ? 35.845 -9.505  -21.610 1.00 39.45  ? 393 ASN B CA  1 
ATOM   9491  C C   . ASN C 1 396 ? 36.587 -8.520  -20.706 1.00 38.71  ? 393 ASN B C   1 
ATOM   9492  O O   . ASN C 1 396 ? 37.721 -8.762  -20.278 1.00 37.28  ? 393 ASN B O   1 
ATOM   9493  C CB  . ASN C 1 396 ? 34.514 -9.981  -21.010 1.00 30.77  ? 393 ASN B CB  1 
ATOM   9494  C CG  . ASN C 1 396 ? 34.635 -10.547 -19.596 1.00 40.09  ? 393 ASN B CG  1 
ATOM   9495  O OD1 . ASN C 1 396 ? 35.514 -10.183 -18.818 1.00 36.81  ? 393 ASN B OD1 1 
ATOM   9496  N ND2 . ASN C 1 396 ? 33.716 -11.447 -19.258 1.00 37.72  ? 393 ASN B ND2 1 
ATOM   9497  N N   . THR C 1 397 ? 35.929 -7.391  -20.423 1.00 40.64  ? 394 THR B N   1 
ATOM   9498  C CA  . THR C 1 397 ? 36.594 -6.289  -19.731 1.00 37.25  ? 394 THR B CA  1 
ATOM   9499  C C   . THR C 1 397 ? 37.233 -6.741  -18.424 1.00 37.02  ? 394 THR B C   1 
ATOM   9500  O O   . THR C 1 397 ? 38.375 -6.376  -18.121 1.00 39.72  ? 394 THR B O   1 
ATOM   9501  C CB  . THR C 1 397 ? 35.598 -5.159  -19.468 1.00 38.26  ? 394 THR B CB  1 
ATOM   9502  O OG1 . THR C 1 397 ? 35.066 -4.689  -20.711 1.00 34.51  ? 394 THR B OG1 1 
ATOM   9503  C CG2 . THR C 1 397 ? 36.279 -4.009  -18.740 1.00 32.18  ? 394 THR B CG2 1 
ATOM   9504  N N   . PHE C 1 398 ? 36.520 -7.555  -17.647 1.00 38.23  ? 395 PHE B N   1 
ATOM   9505  C CA  . PHE C 1 398 ? 37.013 -7.930  -16.327 1.00 38.31  ? 395 PHE B CA  1 
ATOM   9506  C C   . PHE C 1 398 ? 38.039 -9.054  -16.399 1.00 42.44  ? 395 PHE B C   1 
ATOM   9507  O O   . PHE C 1 398 ? 38.983 -9.085  -15.600 1.00 39.49  ? 395 PHE B O   1 
ATOM   9508  C CB  . PHE C 1 398 ? 35.837 -8.317  -15.434 1.00 38.13  ? 395 PHE B CB  1 
ATOM   9509  C CG  . PHE C 1 398 ? 34.789 -7.250  -15.336 1.00 39.11  ? 395 PHE B CG  1 
ATOM   9510  C CD1 . PHE C 1 398 ? 33.700 -7.246  -16.191 1.00 37.42  ? 395 PHE B CD1 1 
ATOM   9511  C CD2 . PHE C 1 398 ? 34.907 -6.236  -14.401 1.00 40.57  ? 395 PHE B CD2 1 
ATOM   9512  C CE1 . PHE C 1 398 ? 32.740 -6.258  -16.107 1.00 43.83  ? 395 PHE B CE1 1 
ATOM   9513  C CE2 . PHE C 1 398 ? 33.955 -5.246  -14.313 1.00 39.62  ? 395 PHE B CE2 1 
ATOM   9514  C CZ  . PHE C 1 398 ? 32.868 -5.255  -15.164 1.00 47.69  ? 395 PHE B CZ  1 
ATOM   9515  N N   . GLU C 1 399 ? 37.875 -9.985  -17.343 1.00 41.85  ? 396 GLU B N   1 
ATOM   9516  C CA  . GLU C 1 399 ? 38.883 -11.023 -17.531 1.00 39.77  ? 396 GLU B CA  1 
ATOM   9517  C C   . GLU C 1 399 ? 40.224 -10.416 -17.920 1.00 39.19  ? 396 GLU B C   1 
ATOM   9518  O O   . GLU C 1 399 ? 41.274 -10.834 -17.418 1.00 42.61  ? 396 GLU B O   1 
ATOM   9519  C CB  . GLU C 1 399 ? 38.422 -12.020 -18.594 1.00 45.64  ? 396 GLU B CB  1 
ATOM   9520  C CG  . GLU C 1 399 ? 37.179 -12.812 -18.226 1.00 46.89  ? 396 GLU B CG  1 
ATOM   9521  C CD  . GLU C 1 399 ? 36.592 -13.543 -19.419 1.00 47.09  ? 396 GLU B CD  1 
ATOM   9522  O OE1 . GLU C 1 399 ? 36.354 -12.892 -20.458 1.00 42.07  ? 396 GLU B OE1 1 
ATOM   9523  O OE2 . GLU C 1 399 ? 36.372 -14.768 -19.319 1.00 55.50  ? 396 GLU B OE2 1 
ATOM   9524  N N   . PHE C 1 400 ? 40.206 -9.419  -18.808 1.00 39.39  ? 397 PHE B N   1 
ATOM   9525  C CA  . PHE C 1 400 ? 41.448 -8.788  -19.244 1.00 40.05  ? 397 PHE B CA  1 
ATOM   9526  C C   . PHE C 1 400 ? 42.139 -8.074  -18.089 1.00 41.93  ? 397 PHE B C   1 
ATOM   9527  O O   . PHE C 1 400 ? 43.357 -8.192  -17.911 1.00 40.11  ? 397 PHE B O   1 
ATOM   9528  C CB  . PHE C 1 400 ? 41.167 -7.819  -20.390 1.00 37.26  ? 397 PHE B CB  1 
ATOM   9529  C CG  . PHE C 1 400 ? 42.404 -7.309  -21.068 1.00 39.21  ? 397 PHE B CG  1 
ATOM   9530  C CD1 . PHE C 1 400 ? 43.237 -8.169  -21.766 1.00 38.22  ? 397 PHE B CD1 1 
ATOM   9531  C CD2 . PHE C 1 400 ? 42.733 -5.965  -21.009 1.00 37.95  ? 397 PHE B CD2 1 
ATOM   9532  C CE1 . PHE C 1 400 ? 44.377 -7.696  -22.391 1.00 39.13  ? 397 PHE B CE1 1 
ATOM   9533  C CE2 . PHE C 1 400 ? 43.868 -5.484  -21.633 1.00 32.39  ? 397 PHE B CE2 1 
ATOM   9534  C CZ  . PHE C 1 400 ? 44.693 -6.350  -22.324 1.00 31.82  ? 397 PHE B CZ  1 
ATOM   9535  N N   . MET C 1 401 ? 41.374 -7.319  -17.293 1.00 35.92  ? 398 MET B N   1 
ATOM   9536  C CA  . MET C 1 401 ? 41.951 -6.684  -16.113 1.00 38.25  ? 398 MET B CA  1 
ATOM   9537  C C   . MET C 1 401 ? 42.530 -7.724  -15.163 1.00 39.61  ? 398 MET B C   1 
ATOM   9538  O O   . MET C 1 401 ? 43.630 -7.540  -14.628 1.00 39.61  ? 398 MET B O   1 
ATOM   9539  C CB  . MET C 1 401 ? 40.903 -5.828  -15.402 1.00 35.53  ? 398 MET B CB  1 
ATOM   9540  C CG  . MET C 1 401 ? 40.532 -4.543  -16.135 1.00 34.99  ? 398 MET B CG  1 
ATOM   9541  S SD  . MET C 1 401 ? 41.926 -3.422  -16.394 1.00 42.15  ? 398 MET B SD  1 
ATOM   9542  C CE  . MET C 1 401 ? 42.610 -3.319  -14.741 1.00 35.63  ? 398 MET B CE  1 
ATOM   9543  N N   . ASP C 1 402 ? 41.804 -8.824  -14.946 1.00 34.95  ? 399 ASP B N   1 
ATOM   9544  C CA  . ASP C 1 402 ? 42.340 -9.928  -14.155 1.00 43.47  ? 399 ASP B CA  1 
ATOM   9545  C C   . ASP C 1 402 ? 43.658 -10.421 -14.736 1.00 43.37  ? 399 ASP B C   1 
ATOM   9546  O O   . ASP C 1 402 ? 44.641 -10.613 -14.010 1.00 39.48  ? 399 ASP B O   1 
ATOM   9547  C CB  . ASP C 1 402 ? 41.330 -11.075 -14.097 1.00 52.57  ? 399 ASP B CB  1 
ATOM   9548  C CG  . ASP C 1 402 ? 40.207 -10.819 -13.116 1.00 50.01  ? 399 ASP B CG  1 
ATOM   9549  O OD1 . ASP C 1 402 ? 40.360 -9.938  -12.243 1.00 46.88  ? 399 ASP B OD1 1 
ATOM   9550  O OD2 . ASP C 1 402 ? 39.168 -11.506 -13.220 1.00 49.68  ? 399 ASP B OD2 1 
ATOM   9551  N N   . LYS C 1 403 ? 43.691 -10.628 -16.054 1.00 38.53  ? 400 LYS B N   1 
ATOM   9552  C CA  . LYS C 1 403 ? 44.901 -11.114 -16.709 1.00 45.40  ? 400 LYS B CA  1 
ATOM   9553  C C   . LYS C 1 403 ? 46.068 -10.158 -16.494 1.00 43.06  ? 400 LYS B C   1 
ATOM   9554  O O   . LYS C 1 403 ? 47.178 -10.582 -16.153 1.00 37.16  ? 400 LYS B O   1 
ATOM   9555  C CB  . LYS C 1 403 ? 44.637 -11.315 -18.201 1.00 36.55  ? 400 LYS B CB  1 
ATOM   9556  C CG  . LYS C 1 403 ? 45.767 -12.000 -18.939 1.00 41.96  ? 400 LYS B CG  1 
ATOM   9557  C CD  . LYS C 1 403 ? 46.239 -13.230 -18.191 1.00 48.18  ? 400 LYS B CD  1 
ATOM   9558  C CE  . LYS C 1 403 ? 47.145 -14.082 -19.057 1.00 49.30  ? 400 LYS B CE  1 
ATOM   9559  N NZ  . LYS C 1 403 ? 47.651 -15.260 -18.306 1.00 57.28  ? 400 LYS B NZ  1 
ATOM   9560  N N   . LEU C 1 404 ? 45.831 -8.857  -16.688 1.00 37.10  ? 401 LEU B N   1 
ATOM   9561  C CA  . LEU C 1 404 ? 46.890 -7.875  -16.476 1.00 37.93  ? 401 LEU B CA  1 
ATOM   9562  C C   . LEU C 1 404 ? 47.359 -7.871  -15.026 1.00 35.89  ? 401 LEU B C   1 
ATOM   9563  O O   . LEU C 1 404 ? 48.559 -7.747  -14.755 1.00 39.29  ? 401 LEU B O   1 
ATOM   9564  C CB  . LEU C 1 404 ? 46.407 -6.486  -16.889 1.00 37.46  ? 401 LEU B CB  1 
ATOM   9565  C CG  . LEU C 1 404 ? 46.256 -6.251  -18.391 1.00 40.35  ? 401 LEU B CG  1 
ATOM   9566  C CD1 . LEU C 1 404 ? 45.606 -4.906  -18.637 1.00 39.74  ? 401 LEU B CD1 1 
ATOM   9567  C CD2 . LEU C 1 404 ? 47.609 -6.331  -19.083 1.00 31.23  ? 401 LEU B CD2 1 
ATOM   9568  N N   . GLY C 1 405 ? 46.426 -8.011  -14.080 1.00 36.83  ? 402 GLY B N   1 
ATOM   9569  C CA  . GLY C 1 405 ? 46.807 -8.064  -12.679 1.00 39.36  ? 402 GLY B CA  1 
ATOM   9570  C C   . GLY C 1 405 ? 47.598 -9.307  -12.326 1.00 43.52  ? 402 GLY B C   1 
ATOM   9571  O O   . GLY C 1 405 ? 48.471 -9.265  -11.454 1.00 43.50  ? 402 GLY B O   1 
ATOM   9572  N N   . GLU C 1 406 ? 47.312 -10.427 -12.995 1.00 41.46  ? 403 GLU B N   1 
ATOM   9573  C CA  . GLU C 1 406 ? 48.075 -11.645 -12.747 1.00 48.55  ? 403 GLU B CA  1 
ATOM   9574  C C   . GLU C 1 406 ? 49.492 -11.526 -13.294 1.00 40.79  ? 403 GLU B C   1 
ATOM   9575  O O   . GLU C 1 406 ? 50.451 -11.972 -12.653 1.00 44.32  ? 403 GLU B O   1 
ATOM   9576  C CB  . GLU C 1 406 ? 47.356 -12.848 -13.358 1.00 44.18  ? 403 GLU B CB  1 
ATOM   9577  C CG  . GLU C 1 406 ? 46.043 -13.201 -12.666 1.00 52.11  ? 403 GLU B CG  1 
ATOM   9578  C CD  . GLU C 1 406 ? 45.140 -14.069 -13.526 1.00 60.44  ? 403 GLU B CD  1 
ATOM   9579  O OE1 . GLU C 1 406 ? 45.612 -14.581 -14.565 1.00 63.25  ? 403 GLU B OE1 1 
ATOM   9580  O OE2 . GLU C 1 406 ? 43.957 -14.235 -13.162 1.00 67.31  ? 403 GLU B OE2 1 
ATOM   9581  N N   . ASN C 1 407 ? 49.647 -10.916 -14.471 1.00 39.34  ? 404 ASN B N   1 
ATOM   9582  C CA  . ASN C 1 407 ? 50.977 -10.793 -15.061 1.00 45.86  ? 404 ASN B CA  1 
ATOM   9583  C C   . ASN C 1 407 ? 51.797 -9.705  -14.379 1.00 45.99  ? 404 ASN B C   1 
ATOM   9584  O O   . ASN C 1 407 ? 53.017 -9.846  -14.228 1.00 40.86  ? 404 ASN B O   1 
ATOM   9585  C CB  . ASN C 1 407 ? 50.871 -10.521 -16.560 1.00 44.03  ? 404 ASN B CB  1 
ATOM   9586  C CG  . ASN C 1 407 ? 50.410 -11.735 -17.340 1.00 42.67  ? 404 ASN B CG  1 
ATOM   9587  O OD1 . ASN C 1 407 ? 50.504 -12.864 -16.861 1.00 50.30  ? 404 ASN B OD1 1 
ATOM   9588  N ND2 . ASN C 1 407 ? 49.917 -11.510 -18.553 1.00 33.25  ? 404 ASN B ND2 1 
ATOM   9589  N N   . LEU C 1 408 ? 51.151 -8.611  -13.966 1.00 42.85  ? 405 LEU B N   1 
ATOM   9590  C CA  . LEU C 1 408 ? 51.868 -7.558  -13.255 1.00 38.57  ? 405 LEU B CA  1 
ATOM   9591  C C   . LEU C 1 408 ? 52.461 -8.090  -11.958 1.00 43.37  ? 405 LEU B C   1 
ATOM   9592  O O   . LEU C 1 408 ? 53.613 -7.792  -11.618 1.00 45.86  ? 405 LEU B O   1 
ATOM   9593  C CB  . LEU C 1 408 ? 50.937 -6.376  -12.980 1.00 40.80  ? 405 LEU B CB  1 
ATOM   9594  C CG  . LEU C 1 408 ? 51.543 -5.216  -12.188 1.00 35.58  ? 405 LEU B CG  1 
ATOM   9595  C CD1 . LEU C 1 408 ? 52.732 -4.616  -12.930 1.00 35.03  ? 405 LEU B CD1 1 
ATOM   9596  C CD2 . LEU C 1 408 ? 50.492 -4.158  -11.895 1.00 32.50  ? 405 LEU B CD2 1 
ATOM   9597  N N   . LYS C 1 409 ? 51.683 -8.890  -11.221 1.00 41.80  ? 406 LYS B N   1 
ATOM   9598  C CA  . LYS C 1 409 ? 52.187 -9.487  -9.988  1.00 42.55  ? 406 LYS B CA  1 
ATOM   9599  C C   . LYS C 1 409 ? 53.395 -10.374 -10.257 1.00 46.85  ? 406 LYS B C   1 
ATOM   9600  O O   . LYS C 1 409 ? 54.372 -10.354 -9.500  1.00 47.83  ? 406 LYS B O   1 
ATOM   9601  C CB  . LYS C 1 409 ? 51.081 -10.285 -9.300  1.00 45.85  ? 406 LYS B CB  1 
ATOM   9602  C CG  . LYS C 1 409 ? 51.482 -10.888 -7.960  1.00 46.38  ? 406 LYS B CG  1 
ATOM   9603  C CD  . LYS C 1 409 ? 50.414 -11.850 -7.463  1.00 52.58  ? 406 LYS B CD  1 
ATOM   9604  C CE  . LYS C 1 409 ? 50.770 -12.438 -6.106  1.00 62.21  ? 406 LYS B CE  1 
ATOM   9605  N NZ  . LYS C 1 409 ? 50.844 -11.400 -5.039  1.00 60.40  ? 406 LYS B NZ  1 
ATOM   9606  N N   . ILE C 1 410 ? 53.349 -11.159 -11.333 1.00 46.82  ? 407 ILE B N   1 
ATOM   9607  C CA  . ILE C 1 410 ? 54.508 -11.964 -11.690 1.00 45.95  ? 407 ILE B CA  1 
ATOM   9608  C C   . ILE C 1 410 ? 55.673 -11.065 -12.086 1.00 47.00  ? 407 ILE B C   1 
ATOM   9609  O O   . ILE C 1 410 ? 56.787 -11.212 -11.571 1.00 50.78  ? 407 ILE B O   1 
ATOM   9610  C CB  . ILE C 1 410 ? 54.136 -12.963 -12.803 1.00 47.74  ? 407 ILE B CB  1 
ATOM   9611  C CG1 . ILE C 1 410 ? 53.217 -14.046 -12.239 1.00 39.39  ? 407 ILE B CG1 1 
ATOM   9612  C CG2 . ILE C 1 410 ? 55.381 -13.585 -13.402 1.00 43.29  ? 407 ILE B CG2 1 
ATOM   9613  C CD1 . ILE C 1 410 ? 52.511 -14.867 -13.290 1.00 44.31  ? 407 ILE B CD1 1 
ATOM   9614  N N   . LYS C 1 411 ? 55.419 -10.083 -12.956 1.00 44.36  ? 408 LYS B N   1 
ATOM   9615  C CA  . LYS C 1 411 ? 56.480 -9.217  -13.469 1.00 45.52  ? 408 LYS B CA  1 
ATOM   9616  C C   . LYS C 1 411 ? 57.259 -8.541  -12.346 1.00 47.69  ? 408 LYS B C   1 
ATOM   9617  O O   . LYS C 1 411 ? 58.494 -8.565  -12.331 1.00 48.66  ? 408 LYS B O   1 
ATOM   9618  C CB  . LYS C 1 411 ? 55.879 -8.164  -14.397 1.00 40.70  ? 408 LYS B CB  1 
ATOM   9619  C CG  . LYS C 1 411 ? 56.879 -7.179  -14.978 1.00 45.59  ? 408 LYS B CG  1 
ATOM   9620  C CD  . LYS C 1 411 ? 57.565 -7.741  -16.205 1.00 46.78  ? 408 LYS B CD  1 
ATOM   9621  C CE  . LYS C 1 411 ? 58.128 -6.620  -17.055 1.00 43.86  ? 408 LYS B CE  1 
ATOM   9622  N NZ  . LYS C 1 411 ? 58.500 -7.102  -18.410 1.00 41.04  ? 408 LYS B NZ  1 
ATOM   9623  N N   . LEU C 1 412 ? 56.552 -7.921  -11.398 1.00 48.75  ? 409 LEU B N   1 
ATOM   9624  C CA  . LEU C 1 412 ? 57.235 -7.174  -10.347 1.00 52.01  ? 409 LEU B CA  1 
ATOM   9625  C C   . LEU C 1 412 ? 57.928 -8.101  -9.356  1.00 52.50  ? 409 LEU B C   1 
ATOM   9626  O O   . LEU C 1 412 ? 58.868 -7.682  -8.672  1.00 55.48  ? 409 LEU B O   1 
ATOM   9627  C CB  . LEU C 1 412 ? 56.243 -6.263  -9.628  1.00 45.03  ? 409 LEU B CB  1 
ATOM   9628  C CG  . LEU C 1 412 ? 55.619 -5.166  -10.495 1.00 48.70  ? 409 LEU B CG  1 
ATOM   9629  C CD1 . LEU C 1 412 ? 54.619 -4.359  -9.687  1.00 41.52  ? 409 LEU B CD1 1 
ATOM   9630  C CD2 . LEU C 1 412 ? 56.694 -4.263  -11.080 1.00 29.11  ? 409 LEU B CD2 1 
ATOM   9631  N N   . ALA C 1 413 ? 57.487 -9.357  -9.267  1.00 56.09  ? 410 ALA B N   1 
ATOM   9632  C CA  . ALA C 1 413 ? 58.135 -10.307 -8.369  1.00 58.74  ? 410 ALA B CA  1 
ATOM   9633  C C   . ALA C 1 413 ? 59.465 -10.781 -8.944  1.00 61.82  ? 410 ALA B C   1 
ATOM   9634  O O   . ALA C 1 413 ? 60.481 -10.807 -8.239  1.00 65.70  ? 410 ALA B O   1 
ATOM   9635  C CB  . ALA C 1 413 ? 57.212 -11.494 -8.095  1.00 51.77  ? 410 ALA B CB  1 
ATOM   9636  N N   . GLN C 1 414 ? 59.486 -11.154 -10.231 1.00 67.12  ? 411 GLN B N   1 
ATOM   9637  C CA  . GLN C 1 414 ? 60.733 -11.638 -10.824 1.00 71.38  ? 411 GLN B CA  1 
ATOM   9638  C C   . GLN C 1 414 ? 61.822 -10.578 -10.833 1.00 73.37  ? 411 GLN B C   1 
ATOM   9639  O O   . GLN C 1 414 ? 62.988 -10.905 -11.076 1.00 77.33  ? 411 GLN B O   1 
ATOM   9640  C CB  . GLN C 1 414 ? 60.542 -12.122 -12.270 1.00 70.07  ? 411 GLN B CB  1 
ATOM   9641  C CG  . GLN C 1 414 ? 59.357 -13.019 -12.512 1.00 72.73  ? 411 GLN B CG  1 
ATOM   9642  C CD  . GLN C 1 414 ? 59.338 -14.206 -11.594 1.00 82.27  ? 411 GLN B CD  1 
ATOM   9643  O OE1 . GLN C 1 414 ? 60.240 -15.040 -11.618 1.00 105.03 ? 411 GLN B OE1 1 
ATOM   9644  N NE2 . GLN C 1 414 ? 58.304 -14.288 -10.765 1.00 70.98  ? 411 GLN B NE2 1 
ATOM   9645  N N   . ALA C 1 415 ? 61.468 -9.314  -10.596 1.00 77.45  ? 412 ALA B N   1 
ATOM   9646  C CA  . ALA C 1 415 ? 62.480 -8.271  -10.483 1.00 79.15  ? 412 ALA B CA  1 
ATOM   9647  C C   . ALA C 1 415 ? 63.595 -8.655  -9.512  1.00 86.53  ? 412 ALA B C   1 
ATOM   9648  O O   . ALA C 1 415 ? 64.742 -8.242  -9.712  1.00 93.26  ? 412 ALA B O   1 
ATOM   9649  C CB  . ALA C 1 415 ? 61.825 -6.953  -10.072 1.00 67.18  ? 412 ALA B CB  1 
ATOM   9650  N N   . LYS C 1 416 ? 63.294 -9.466  -8.499  1.00 81.19  ? 413 LYS B N   1 
ATOM   9651  C CA  . LYS C 1 416 ? 64.301 -10.068 -7.619  1.00 83.08  ? 413 LYS B CA  1 
ATOM   9652  C C   . LYS C 1 416 ? 63.880 -11.474 -7.177  1.00 78.43  ? 413 LYS B C   1 
ATOM   9653  O O   . LYS C 1 416 ? 64.089 -12.464 -7.885  1.00 79.65  ? 413 LYS B O   1 
ATOM   9654  C CB  . LYS C 1 416 ? 64.539 -9.197  -6.376  1.00 82.74  ? 413 LYS B CB  1 
ATOM   9655  C CG  . LYS C 1 416 ? 65.424 -7.963  -6.559  1.00 83.11  ? 413 LYS B CG  1 
ATOM   9656  C CD  . LYS C 1 416 ? 66.668 -8.207  -7.404  1.00 87.07  ? 413 LYS B CD  1 
ATOM   9657  C CE  . LYS C 1 416 ? 67.064 -6.940  -8.156  1.00 89.29  ? 413 LYS B CE  1 
ATOM   9658  N NZ  . LYS C 1 416 ? 65.876 -6.361  -8.856  1.00 80.02  ? 413 LYS B NZ  1 
ATOM   9659  N N   . LYS D 1 6   ? 34.461 -3.349  -88.138 1.00 77.80  ? 3   LYS D N   1 
ATOM   9660  C CA  . LYS D 1 6   ? 33.722 -2.137  -87.807 1.00 72.60  ? 3   LYS D CA  1 
ATOM   9661  C C   . LYS D 1 6   ? 34.110 -1.625  -86.425 1.00 85.17  ? 3   LYS D C   1 
ATOM   9662  O O   . LYS D 1 6   ? 33.740 -2.211  -85.407 1.00 81.87  ? 3   LYS D O   1 
ATOM   9663  C CB  . LYS D 1 6   ? 32.215 -2.388  -87.873 1.00 71.69  ? 3   LYS D CB  1 
ATOM   9664  C CG  . LYS D 1 6   ? 31.372 -1.146  -87.633 1.00 79.90  ? 3   LYS D CG  1 
ATOM   9665  C CD  . LYS D 1 6   ? 29.886 -1.451  -87.725 1.00 77.44  ? 3   LYS D CD  1 
ATOM   9666  C CE  . LYS D 1 6   ? 29.063 -0.174  -87.680 1.00 83.75  ? 3   LYS D CE  1 
ATOM   9667  N NZ  . LYS D 1 6   ? 27.602 -0.447  -87.572 1.00 80.83  ? 3   LYS D NZ  1 
ATOM   9668  N N   . LYS D 1 7   ? 34.861 -0.526  -86.399 1.00 78.93  ? 4   LYS D N   1 
ATOM   9669  C CA  . LYS D 1 7   ? 35.299 0.052   -85.137 1.00 76.85  ? 4   LYS D CA  1 
ATOM   9670  C C   . LYS D 1 7   ? 34.110 0.585   -84.348 1.00 74.72  ? 4   LYS D C   1 
ATOM   9671  O O   . LYS D 1 7   ? 33.089 0.990   -84.912 1.00 68.21  ? 4   LYS D O   1 
ATOM   9672  C CB  . LYS D 1 7   ? 36.298 1.184   -85.384 1.00 75.21  ? 4   LYS D CB  1 
ATOM   9673  C CG  . LYS D 1 7   ? 37.676 0.725   -85.821 1.00 73.79  ? 4   LYS D CG  1 
ATOM   9674  C CD  . LYS D 1 7   ? 38.638 1.899   -85.927 1.00 69.60  ? 4   LYS D CD  1 
ATOM   9675  C CE  . LYS D 1 7   ? 40.019 1.435   -86.369 1.00 63.65  ? 4   LYS D CE  1 
ATOM   9676  N NZ  . LYS D 1 7   ? 40.990 2.560   -86.473 1.00 68.81  ? 4   LYS D NZ  1 
ATOM   9677  N N   . ILE D 1 8   ? 34.248 0.573   -83.023 1.00 74.12  ? 5   ILE D N   1 
ATOM   9678  C CA  . ILE D 1 8   ? 33.299 1.275   -82.172 1.00 71.39  ? 5   ILE D CA  1 
ATOM   9679  C C   . ILE D 1 8   ? 33.473 2.772   -82.384 1.00 69.21  ? 5   ILE D C   1 
ATOM   9680  O O   . ILE D 1 8   ? 34.585 3.304   -82.267 1.00 72.87  ? 5   ILE D O   1 
ATOM   9681  C CB  . ILE D 1 8   ? 33.507 0.897   -80.699 1.00 70.55  ? 5   ILE D CB  1 
ATOM   9682  C CG1 . ILE D 1 8   ? 32.947 -0.496  -80.412 1.00 68.56  ? 5   ILE D CG1 1 
ATOM   9683  C CG2 . ILE D 1 8   ? 32.853 1.926   -79.790 1.00 72.46  ? 5   ILE D CG2 1 
ATOM   9684  C CD1 . ILE D 1 8   ? 33.013 -0.881  -78.952 1.00 59.10  ? 5   ILE D CD1 1 
ATOM   9685  N N   . SER D 1 9   ? 32.384 3.457   -82.714 1.00 68.11  ? 6   SER D N   1 
ATOM   9686  C CA  . SER D 1 9   ? 32.452 4.904   -82.851 1.00 73.85  ? 6   SER D CA  1 
ATOM   9687  C C   . SER D 1 9   ? 32.530 5.558   -81.479 1.00 78.95  ? 6   SER D C   1 
ATOM   9688  O O   . SER D 1 9   ? 31.840 5.153   -80.539 1.00 76.34  ? 6   SER D O   1 
ATOM   9689  C CB  . SER D 1 9   ? 31.243 5.434   -83.614 1.00 74.78  ? 6   SER D CB  1 
ATOM   9690  O OG  . SER D 1 9   ? 31.325 6.844   -83.745 1.00 83.51  ? 6   SER D OG  1 
ATOM   9691  N N   . GLY D 1 10  ? 33.373 6.580   -81.369 1.00 75.71  ? 7   GLY D N   1 
ATOM   9692  C CA  . GLY D 1 10  ? 33.582 7.233   -80.093 1.00 77.42  ? 7   GLY D CA  1 
ATOM   9693  C C   . GLY D 1 10  ? 32.806 8.519   -79.903 1.00 77.38  ? 7   GLY D C   1 
ATOM   9694  O O   . GLY D 1 10  ? 32.114 8.693   -78.894 1.00 72.38  ? 7   GLY D O   1 
ATOM   9695  N N   . GLY D 1 11  ? 32.912 9.424   -80.865 1.00 69.43  ? 8   GLY D N   1 
ATOM   9696  C CA  . GLY D 1 11  ? 32.401 10.767  -80.726 1.00 69.30  ? 8   GLY D CA  1 
ATOM   9697  C C   . GLY D 1 11  ? 33.511 11.799  -80.653 1.00 70.00  ? 8   GLY D C   1 
ATOM   9698  O O   . GLY D 1 11  ? 34.649 11.574  -81.071 1.00 69.73  ? 8   GLY D O   1 
ATOM   9699  N N   . SER D 1 12  ? 33.160 12.958  -80.098 1.00 71.47  ? 9   SER D N   1 
ATOM   9700  C CA  . SER D 1 12  ? 34.056 14.109  -80.011 1.00 67.27  ? 9   SER D CA  1 
ATOM   9701  C C   . SER D 1 12  ? 34.714 14.134  -78.634 1.00 67.18  ? 9   SER D C   1 
ATOM   9702  O O   . SER D 1 12  ? 34.036 14.281  -77.611 1.00 68.48  ? 9   SER D O   1 
ATOM   9703  C CB  . SER D 1 12  ? 33.288 15.400  -80.296 1.00 70.42  ? 9   SER D CB  1 
ATOM   9704  O OG  . SER D 1 12  ? 32.339 15.207  -81.340 1.00 73.65  ? 9   SER D OG  1 
ATOM   9705  N N   . VAL D 1 13  ? 36.038 13.973  -78.614 1.00 70.43  ? 10  VAL D N   1 
ATOM   9706  C CA  . VAL D 1 13  ? 36.834 13.896  -77.392 1.00 63.64  ? 10  VAL D CA  1 
ATOM   9707  C C   . VAL D 1 13  ? 38.084 14.745  -77.581 1.00 68.55  ? 10  VAL D C   1 
ATOM   9708  O O   . VAL D 1 13  ? 38.725 14.691  -78.637 1.00 72.73  ? 10  VAL D O   1 
ATOM   9709  C CB  . VAL D 1 13  ? 37.221 12.442  -77.041 1.00 70.22  ? 10  VAL D CB  1 
ATOM   9710  C CG1 . VAL D 1 13  ? 37.987 12.384  -75.724 1.00 70.21  ? 10  VAL D CG1 1 
ATOM   9711  C CG2 . VAL D 1 13  ? 35.981 11.549  -76.972 1.00 70.02  ? 10  VAL D CG2 1 
ATOM   9712  N N   . VAL D 1 14  ? 38.431 15.529  -76.560 1.00 67.06  ? 11  VAL D N   1 
ATOM   9713  C CA  . VAL D 1 14  ? 39.581 16.429  -76.595 1.00 63.88  ? 11  VAL D CA  1 
ATOM   9714  C C   . VAL D 1 14  ? 40.751 15.762  -75.887 1.00 70.13  ? 11  VAL D C   1 
ATOM   9715  O O   . VAL D 1 14  ? 40.613 15.298  -74.749 1.00 68.48  ? 11  VAL D O   1 
ATOM   9716  C CB  . VAL D 1 14  ? 39.247 17.780  -75.939 1.00 66.94  ? 11  VAL D CB  1 
ATOM   9717  C CG1 . VAL D 1 14  ? 40.448 18.718  -75.990 1.00 64.71  ? 11  VAL D CG1 1 
ATOM   9718  C CG2 . VAL D 1 14  ? 38.031 18.414  -76.608 1.00 68.57  ? 11  VAL D CG2 1 
ATOM   9719  N N   . GLU D 1 15  ? 41.904 15.718  -76.551 1.00 69.67  ? 12  GLU D N   1 
ATOM   9720  C CA  . GLU D 1 15  ? 43.108 15.124  -75.987 1.00 67.90  ? 12  GLU D CA  1 
ATOM   9721  C C   . GLU D 1 15  ? 44.204 16.175  -75.861 1.00 67.09  ? 12  GLU D C   1 
ATOM   9722  O O   . GLU D 1 15  ? 44.302 17.091  -76.685 1.00 73.31  ? 12  GLU D O   1 
ATOM   9723  C CB  . GLU D 1 15  ? 43.600 13.943  -76.834 1.00 70.39  ? 12  GLU D CB  1 
ATOM   9724  C CG  . GLU D 1 15  ? 44.779 14.245  -77.754 1.00 70.89  ? 12  GLU D CG  1 
ATOM   9725  C CD  . GLU D 1 15  ? 45.797 13.120  -77.778 1.00 63.31  ? 12  GLU D CD  1 
ATOM   9726  O OE1 . GLU D 1 15  ? 46.719 13.164  -78.620 1.00 73.36  ? 12  GLU D OE1 1 
ATOM   9727  O OE2 . GLU D 1 15  ? 45.681 12.199  -76.944 1.00 66.20  ? 12  GLU D OE2 1 
ATOM   9728  N N   . MET D 1 16  ? 45.019 16.037  -74.816 1.00 67.87  ? 13  MET D N   1 
ATOM   9729  C CA  . MET D 1 16  ? 46.102 16.969  -74.528 1.00 67.72  ? 13  MET D CA  1 
ATOM   9730  C C   . MET D 1 16  ? 47.375 16.178  -74.274 1.00 65.86  ? 13  MET D C   1 
ATOM   9731  O O   . MET D 1 16  ? 47.452 15.418  -73.303 1.00 62.32  ? 13  MET D O   1 
ATOM   9732  C CB  . MET D 1 16  ? 45.769 17.855  -73.323 1.00 63.55  ? 13  MET D CB  1 
ATOM   9733  C CG  . MET D 1 16  ? 44.839 19.016  -73.646 1.00 67.67  ? 13  MET D CG  1 
ATOM   9734  S SD  . MET D 1 16  ? 43.948 19.649  -72.213 1.00 80.86  ? 13  MET D SD  1 
ATOM   9735  C CE  . MET D 1 16  ? 42.791 18.318  -71.920 1.00 58.25  ? 13  MET D CE  1 
ATOM   9736  N N   . GLN D 1 17  ? 48.366 16.357  -75.143 1.00 63.81  ? 14  GLN D N   1 
ATOM   9737  C CA  . GLN D 1 17  ? 49.637 15.666  -74.999 1.00 64.57  ? 14  GLN D CA  1 
ATOM   9738  C C   . GLN D 1 17  ? 50.494 16.340  -73.934 1.00 66.99  ? 14  GLN D C   1 
ATOM   9739  O O   . GLN D 1 17  ? 50.354 17.536  -73.655 1.00 64.15  ? 14  GLN D O   1 
ATOM   9740  C CB  . GLN D 1 17  ? 50.377 15.625  -76.337 1.00 66.52  ? 14  GLN D CB  1 
ATOM   9741  C CG  . GLN D 1 17  ? 49.762 14.661  -77.345 1.00 71.02  ? 14  GLN D CG  1 
ATOM   9742  C CD  . GLN D 1 17  ? 50.045 15.047  -78.786 1.00 73.62  ? 14  GLN D CD  1 
ATOM   9743  O OE1 . GLN D 1 17  ? 51.071 15.656  -79.089 1.00 70.16  ? 14  GLN D OE1 1 
ATOM   9744  N NE2 . GLN D 1 17  ? 49.129 14.696  -79.683 1.00 71.22  ? 14  GLN D NE2 1 
ATOM   9745  N N   . GLY D 1 18  ? 51.391 15.555  -73.337 1.00 64.96  ? 15  GLY D N   1 
ATOM   9746  C CA  . GLY D 1 18  ? 52.156 15.976  -72.178 1.00 65.11  ? 15  GLY D CA  1 
ATOM   9747  C C   . GLY D 1 18  ? 53.647 15.772  -72.377 1.00 63.06  ? 15  GLY D C   1 
ATOM   9748  O O   . GLY D 1 18  ? 54.172 15.859  -73.486 1.00 66.72  ? 15  GLY D O   1 
ATOM   9749  N N   . ASP D 1 19  ? 54.330 15.482  -71.270 1.00 63.53  ? 16  ASP D N   1 
ATOM   9750  C CA  . ASP D 1 19  ? 55.783 15.507  -71.200 1.00 65.33  ? 16  ASP D CA  1 
ATOM   9751  C C   . ASP D 1 19  ? 56.343 14.177  -70.707 1.00 60.08  ? 16  ASP D C   1 
ATOM   9752  O O   . ASP D 1 19  ? 55.655 13.383  -70.061 1.00 51.37  ? 16  ASP D O   1 
ATOM   9753  C CB  . ASP D 1 19  ? 56.268 16.625  -70.266 1.00 64.78  ? 16  ASP D CB  1 
ATOM   9754  C CG  . ASP D 1 19  ? 55.819 17.996  -70.717 1.00 70.55  ? 16  ASP D CG  1 
ATOM   9755  O OD1 . ASP D 1 19  ? 55.892 18.269  -71.931 1.00 71.20  ? 16  ASP D OD1 1 
ATOM   9756  O OD2 . ASP D 1 19  ? 55.391 18.801  -69.863 1.00 68.44  ? 16  ASP D OD2 1 
ATOM   9757  N N   . GLU D 1 20  ? 57.618 13.957  -71.034 1.00 58.46  ? 17  GLU D N   1 
ATOM   9758  C CA  . GLU D 1 20  ? 58.466 12.915  -70.457 1.00 62.64  ? 17  GLU D CA  1 
ATOM   9759  C C   . GLU D 1 20  ? 57.841 11.523  -70.441 1.00 56.81  ? 17  GLU D C   1 
ATOM   9760  O O   . GLU D 1 20  ? 57.272 11.077  -71.444 1.00 56.34  ? 17  GLU D O   1 
ATOM   9761  C CB  . GLU D 1 20  ? 58.894 13.321  -69.045 1.00 57.86  ? 17  GLU D CB  1 
ATOM   9762  C CG  . GLU D 1 20  ? 59.768 14.572  -69.028 1.00 57.54  ? 17  GLU D CG  1 
ATOM   9763  C CD  . GLU D 1 20  ? 60.121 15.035  -67.629 1.00 61.68  ? 17  GLU D CD  1 
ATOM   9764  O OE1 . GLU D 1 20  ? 59.231 15.028  -66.752 1.00 59.79  ? 17  GLU D OE1 1 
ATOM   9765  O OE2 . GLU D 1 20  ? 61.294 15.403  -67.407 1.00 58.21  ? 17  GLU D OE2 1 
ATOM   9766  N N   . MET D 1 21  ? 57.963 10.822  -69.309 1.00 53.36  ? 18  MET D N   1 
ATOM   9767  C CA  . MET D 1 21  ? 57.628 9.400   -69.275 1.00 50.05  ? 18  MET D CA  1 
ATOM   9768  C C   . MET D 1 21  ? 56.154 9.162   -69.569 1.00 56.85  ? 18  MET D C   1 
ATOM   9769  O O   . MET D 1 21  ? 55.803 8.238   -70.313 1.00 51.79  ? 18  MET D O   1 
ATOM   9770  C CB  . MET D 1 21  ? 58.000 8.799   -67.921 1.00 54.14  ? 18  MET D CB  1 
ATOM   9771  C CG  . MET D 1 21  ? 58.157 7.290   -67.964 1.00 56.54  ? 18  MET D CG  1 
ATOM   9772  S SD  . MET D 1 21  ? 59.478 6.780   -69.078 1.00 56.50  ? 18  MET D SD  1 
ATOM   9773  C CE  . MET D 1 21  ? 58.955 5.121   -69.506 1.00 52.49  ? 18  MET D CE  1 
ATOM   9774  N N   . THR D 1 22  ? 55.273 9.982   -68.996 1.00 50.04  ? 19  THR D N   1 
ATOM   9775  C CA  . THR D 1 22  ? 53.855 9.813   -69.275 1.00 54.62  ? 19  THR D CA  1 
ATOM   9776  C C   . THR D 1 22  ? 53.519 10.126  -70.729 1.00 58.70  ? 19  THR D C   1 
ATOM   9777  O O   . THR D 1 22  ? 52.471 9.687   -71.215 1.00 55.26  ? 19  THR D O   1 
ATOM   9778  C CB  . THR D 1 22  ? 53.023 10.678  -68.325 1.00 52.78  ? 19  THR D CB  1 
ATOM   9779  O OG1 . THR D 1 22  ? 51.635 10.544  -68.638 1.00 67.65  ? 19  THR D OG1 1 
ATOM   9780  C CG2 . THR D 1 22  ? 53.422 12.128  -68.439 1.00 52.04  ? 19  THR D CG2 1 
ATOM   9781  N N   . ARG D 1 23  ? 54.391 10.850  -71.440 1.00 56.99  ? 20  ARG D N   1 
ATOM   9782  C CA  . ARG D 1 23  ? 54.167 11.095  -72.863 1.00 60.71  ? 20  ARG D CA  1 
ATOM   9783  C C   . ARG D 1 23  ? 54.392 9.830   -73.685 1.00 56.66  ? 20  ARG D C   1 
ATOM   9784  O O   . ARG D 1 23  ? 53.600 9.508   -74.577 1.00 52.64  ? 20  ARG D O   1 
ATOM   9785  C CB  . ARG D 1 23  ? 55.074 12.225  -73.355 1.00 57.15  ? 20  ARG D CB  1 
ATOM   9786  C CG  . ARG D 1 23  ? 54.960 12.504  -74.846 1.00 61.29  ? 20  ARG D CG  1 
ATOM   9787  C CD  . ARG D 1 23  ? 55.882 13.636  -75.283 1.00 67.04  ? 20  ARG D CD  1 
ATOM   9788  N NE  . ARG D 1 23  ? 57.260 13.448  -74.833 1.00 73.17  ? 20  ARG D NE  1 
ATOM   9789  C CZ  . ARG D 1 23  ? 58.153 12.677  -75.446 1.00 72.74  ? 20  ARG D CZ  1 
ATOM   9790  N NH1 . ARG D 1 23  ? 59.384 12.573  -74.962 1.00 69.14  ? 20  ARG D NH1 1 
ATOM   9791  N NH2 . ARG D 1 23  ? 57.819 12.011  -76.543 1.00 73.49  ? 20  ARG D NH2 1 
ATOM   9792  N N   . ILE D 1 24  ? 55.478 9.108   -73.406 1.00 51.33  ? 21  ILE D N   1 
ATOM   9793  C CA  . ILE D 1 24  ? 55.740 7.840   -74.089 1.00 55.53  ? 21  ILE D CA  1 
ATOM   9794  C C   . ILE D 1 24  ? 54.580 6.879   -73.880 1.00 55.52  ? 21  ILE D C   1 
ATOM   9795  O O   . ILE D 1 24  ? 54.119 6.205   -74.810 1.00 58.01  ? 21  ILE D O   1 
ATOM   9796  C CB  . ILE D 1 24  ? 57.050 7.223   -73.574 1.00 56.23  ? 21  ILE D CB  1 
ATOM   9797  C CG1 . ILE D 1 24  ? 58.169 8.248   -73.630 1.00 53.52  ? 21  ILE D CG1 1 
ATOM   9798  C CG2 . ILE D 1 24  ? 57.410 5.978   -74.374 1.00 56.84  ? 21  ILE D CG2 1 
ATOM   9799  C CD1 . ILE D 1 24  ? 59.389 7.775   -72.947 1.00 62.91  ? 21  ILE D CD1 1 
ATOM   9800  N N   . ILE D 1 25  ? 54.102 6.799   -72.639 1.00 55.65  ? 22  ILE D N   1 
ATOM   9801  C CA  . ILE D 1 25  ? 53.023 5.882   -72.305 1.00 54.32  ? 22  ILE D CA  1 
ATOM   9802  C C   . ILE D 1 25  ? 51.729 6.313   -72.980 1.00 54.62  ? 22  ILE D C   1 
ATOM   9803  O O   . ILE D 1 25  ? 50.958 5.477   -73.466 1.00 52.88  ? 22  ILE D O   1 
ATOM   9804  C CB  . ILE D 1 25  ? 52.877 5.809   -70.776 1.00 51.72  ? 22  ILE D CB  1 
ATOM   9805  C CG1 . ILE D 1 25  ? 54.055 5.056   -70.166 1.00 54.56  ? 22  ILE D CG1 1 
ATOM   9806  C CG2 . ILE D 1 25  ? 51.552 5.179   -70.387 1.00 52.08  ? 22  ILE D CG2 1 
ATOM   9807  C CD1 . ILE D 1 25  ? 54.013 4.992   -68.664 1.00 56.95  ? 22  ILE D CD1 1 
ATOM   9808  N N   . TRP D 1 26  ? 51.483 7.625   -73.031 1.00 54.19  ? 23  TRP D N   1 
ATOM   9809  C CA  . TRP D 1 26  ? 50.241 8.151   -73.587 1.00 57.44  ? 23  TRP D CA  1 
ATOM   9810  C C   . TRP D 1 26  ? 50.008 7.662   -75.012 1.00 58.63  ? 23  TRP D C   1 
ATOM   9811  O O   . TRP D 1 26  ? 48.892 7.266   -75.368 1.00 54.57  ? 23  TRP D O   1 
ATOM   9812  C CB  . TRP D 1 26  ? 50.282 9.678   -73.540 1.00 54.89  ? 23  TRP D CB  1 
ATOM   9813  C CG  . TRP D 1 26  ? 48.987 10.366  -73.809 1.00 59.60  ? 23  TRP D CG  1 
ATOM   9814  C CD1 . TRP D 1 26  ? 48.606 10.960  -74.975 1.00 61.10  ? 23  TRP D CD1 1 
ATOM   9815  C CD2 . TRP D 1 26  ? 47.914 10.571  -72.883 1.00 60.98  ? 23  TRP D CD2 1 
ATOM   9816  N NE1 . TRP D 1 26  ? 47.356 11.510  -74.839 1.00 63.90  ? 23  TRP D NE1 1 
ATOM   9817  C CE2 . TRP D 1 26  ? 46.908 11.286  -73.563 1.00 64.52  ? 23  TRP D CE2 1 
ATOM   9818  C CE3 . TRP D 1 26  ? 47.702 10.215  -71.546 1.00 56.70  ? 23  TRP D CE3 1 
ATOM   9819  C CZ2 . TRP D 1 26  ? 45.707 11.650  -72.955 1.00 60.80  ? 23  TRP D CZ2 1 
ATOM   9820  C CZ3 . TRP D 1 26  ? 46.508 10.577  -70.943 1.00 56.31  ? 23  TRP D CZ3 1 
ATOM   9821  C CH2 . TRP D 1 26  ? 45.527 11.288  -71.648 1.00 56.69  ? 23  TRP D CH2 1 
ATOM   9822  N N   . GLU D 1 27  ? 51.057 7.669   -75.838 1.00 57.22  ? 24  GLU D N   1 
ATOM   9823  C CA  . GLU D 1 27  ? 50.903 7.255   -77.229 1.00 60.12  ? 24  GLU D CA  1 
ATOM   9824  C C   . GLU D 1 27  ? 50.730 5.747   -77.356 1.00 57.88  ? 24  GLU D C   1 
ATOM   9825  O O   . GLU D 1 27  ? 50.025 5.280   -78.259 1.00 58.14  ? 24  GLU D O   1 
ATOM   9826  C CB  . GLU D 1 27  ? 52.105 7.721   -78.047 1.00 59.17  ? 24  GLU D CB  1 
ATOM   9827  C CG  . GLU D 1 27  ? 52.176 9.228   -78.232 1.00 57.49  ? 24  GLU D CG  1 
ATOM   9828  C CD  . GLU D 1 27  ? 50.987 9.774   -78.996 1.00 64.36  ? 24  GLU D CD  1 
ATOM   9829  O OE1 . GLU D 1 27  ? 50.546 10.901  -78.688 1.00 69.00  ? 24  GLU D OE1 1 
ATOM   9830  O OE2 . GLU D 1 27  ? 50.495 9.076   -79.907 1.00 69.81  ? 24  GLU D OE2 1 
ATOM   9831  N N   . LEU D 1 28  ? 51.367 4.973   -76.474 1.00 53.67  ? 25  LEU D N   1 
ATOM   9832  C CA  . LEU D 1 28  ? 51.181 3.526   -76.496 1.00 51.67  ? 25  LEU D CA  1 
ATOM   9833  C C   . LEU D 1 28  ? 49.740 3.158   -76.169 1.00 56.02  ? 25  LEU D C   1 
ATOM   9834  O O   . LEU D 1 28  ? 49.197 2.191   -76.715 1.00 50.46  ? 25  LEU D O   1 
ATOM   9835  C CB  . LEU D 1 28  ? 52.147 2.862   -75.516 1.00 56.40  ? 25  LEU D CB  1 
ATOM   9836  C CG  . LEU D 1 28  ? 53.600 2.731   -75.973 1.00 61.15  ? 25  LEU D CG  1 
ATOM   9837  C CD1 . LEU D 1 28  ? 54.481 2.310   -74.809 1.00 54.54  ? 25  LEU D CD1 1 
ATOM   9838  C CD2 . LEU D 1 28  ? 53.722 1.744   -77.125 1.00 58.38  ? 25  LEU D CD2 1 
ATOM   9839  N N   . ILE D 1 29  ? 49.103 3.927   -75.285 1.00 55.92  ? 26  ILE D N   1 
ATOM   9840  C CA  . ILE D 1 29  ? 47.703 3.682   -74.951 1.00 58.67  ? 26  ILE D CA  1 
ATOM   9841  C C   . ILE D 1 29  ? 46.821 3.915   -76.170 1.00 53.20  ? 26  ILE D C   1 
ATOM   9842  O O   . ILE D 1 29  ? 45.931 3.114   -76.481 1.00 49.23  ? 26  ILE D O   1 
ATOM   9843  C CB  . ILE D 1 29  ? 47.270 4.567   -73.767 1.00 56.09  ? 26  ILE D CB  1 
ATOM   9844  C CG1 . ILE D 1 29  ? 47.981 4.136   -72.487 1.00 51.56  ? 26  ILE D CG1 1 
ATOM   9845  C CG2 . ILE D 1 29  ? 45.756 4.515   -73.586 1.00 45.61  ? 26  ILE D CG2 1 
ATOM   9846  C CD1 . ILE D 1 29  ? 47.919 5.156   -71.386 1.00 47.61  ? 26  ILE D CD1 1 
ATOM   9847  N N   . LYS D 1 30  ? 47.062 5.017   -76.883 1.00 51.53  ? 27  LYS D N   1 
ATOM   9848  C CA  . LYS D 1 30  ? 46.213 5.357   -78.018 1.00 60.99  ? 27  LYS D CA  1 
ATOM   9849  C C   . LYS D 1 30  ? 46.379 4.357   -79.156 1.00 57.71  ? 27  LYS D C   1 
ATOM   9850  O O   . LYS D 1 30  ? 45.403 4.002   -79.826 1.00 59.02  ? 27  LYS D O   1 
ATOM   9851  C CB  . LYS D 1 30  ? 46.523 6.776   -78.493 1.00 56.55  ? 27  LYS D CB  1 
ATOM   9852  C CG  . LYS D 1 30  ? 46.058 7.847   -77.523 1.00 61.06  ? 27  LYS D CG  1 
ATOM   9853  C CD  . LYS D 1 30  ? 46.194 9.241   -78.108 1.00 60.92  ? 27  LYS D CD  1 
ATOM   9854  C CE  . LYS D 1 30  ? 47.633 9.551   -78.470 1.00 63.77  ? 27  LYS D CE  1 
ATOM   9855  N NZ  . LYS D 1 30  ? 47.812 10.958  -78.928 1.00 57.99  ? 27  LYS D NZ  1 
ATOM   9856  N N   . GLU D 1 31  ? 47.603 3.875   -79.377 1.00 57.08  ? 28  GLU D N   1 
ATOM   9857  C CA  . GLU D 1 31  ? 47.848 3.013   -80.527 1.00 62.55  ? 28  GLU D CA  1 
ATOM   9858  C C   . GLU D 1 31  ? 47.560 1.545   -80.233 1.00 64.16  ? 28  GLU D C   1 
ATOM   9859  O O   . GLU D 1 31  ? 47.157 0.809   -81.140 1.00 58.92  ? 28  GLU D O   1 
ATOM   9860  C CB  . GLU D 1 31  ? 49.286 3.185   -81.022 1.00 62.62  ? 28  GLU D CB  1 
ATOM   9861  C CG  . GLU D 1 31  ? 50.330 2.372   -80.271 1.00 70.25  ? 28  GLU D CG  1 
ATOM   9862  C CD  . GLU D 1 31  ? 51.676 2.366   -80.971 1.00 83.31  ? 28  GLU D CD  1 
ATOM   9863  O OE1 . GLU D 1 31  ? 52.224 3.461   -81.217 1.00 85.59  ? 28  GLU D OE1 1 
ATOM   9864  O OE2 . GLU D 1 31  ? 52.186 1.264   -81.270 1.00 81.06  ? 28  GLU D OE2 1 
ATOM   9865  N N   . LYS D 1 32  ? 47.740 1.099   -78.989 1.00 59.35  ? 29  LYS D N   1 
ATOM   9866  C CA  . LYS D 1 32  ? 47.559 -0.310  -78.657 1.00 57.27  ? 29  LYS D CA  1 
ATOM   9867  C C   . LYS D 1 32  ? 46.198 -0.628  -78.058 1.00 57.72  ? 29  LYS D C   1 
ATOM   9868  O O   . LYS D 1 32  ? 45.719 -1.758  -78.208 1.00 57.44  ? 29  LYS D O   1 
ATOM   9869  C CB  . LYS D 1 32  ? 48.647 -0.779  -77.682 1.00 58.00  ? 29  LYS D CB  1 
ATOM   9870  C CG  . LYS D 1 32  ? 50.038 -0.877  -78.284 1.00 61.65  ? 29  LYS D CG  1 
ATOM   9871  C CD  . LYS D 1 32  ? 51.021 -1.450  -77.273 1.00 58.27  ? 29  LYS D CD  1 
ATOM   9872  C CE  . LYS D 1 32  ? 52.367 -1.752  -77.912 1.00 64.52  ? 29  LYS D CE  1 
ATOM   9873  N NZ  . LYS D 1 32  ? 52.257 -2.722  -79.038 1.00 67.68  ? 29  LYS D NZ  1 
ATOM   9874  N N   . LEU D 1 33  ? 45.558 0.330   -77.389 1.00 53.74  ? 30  LEU D N   1 
ATOM   9875  C CA  . LEU D 1 33  ? 44.326 0.058   -76.661 1.00 54.80  ? 30  LEU D CA  1 
ATOM   9876  C C   . LEU D 1 33  ? 43.107 0.795   -77.192 1.00 51.69  ? 30  LEU D C   1 
ATOM   9877  O O   . LEU D 1 33  ? 41.991 0.299   -77.034 1.00 54.21  ? 30  LEU D O   1 
ATOM   9878  C CB  . LEU D 1 33  ? 44.496 0.406   -75.176 1.00 53.04  ? 30  LEU D CB  1 
ATOM   9879  C CG  . LEU D 1 33  ? 45.674 -0.243  -74.448 1.00 54.60  ? 30  LEU D CG  1 
ATOM   9880  C CD1 . LEU D 1 33  ? 45.755 0.264   -73.019 1.00 43.98  ? 30  LEU D CD1 1 
ATOM   9881  C CD2 . LEU D 1 33  ? 45.566 -1.762  -74.472 1.00 53.93  ? 30  LEU D CD2 1 
ATOM   9882  N N   . ILE D 1 34  ? 43.285 1.959   -77.813 1.00 50.65  ? 31  ILE D N   1 
ATOM   9883  C CA  . ILE D 1 34  ? 42.153 2.804   -78.181 1.00 52.43  ? 31  ILE D CA  1 
ATOM   9884  C C   . ILE D 1 34  ? 41.863 2.711   -79.674 1.00 61.90  ? 31  ILE D C   1 
ATOM   9885  O O   . ILE D 1 34  ? 40.799 2.231   -80.080 1.00 56.02  ? 31  ILE D O   1 
ATOM   9886  C CB  . ILE D 1 34  ? 42.401 4.266   -77.764 1.00 46.52  ? 31  ILE D CB  1 
ATOM   9887  C CG1 . ILE D 1 34  ? 42.776 4.343   -76.286 1.00 57.34  ? 31  ILE D CG1 1 
ATOM   9888  C CG2 . ILE D 1 34  ? 41.173 5.121   -78.063 1.00 46.94  ? 31  ILE D CG2 1 
ATOM   9889  C CD1 . ILE D 1 34  ? 41.672 3.897   -75.343 1.00 44.47  ? 31  ILE D CD1 1 
ATOM   9890  N N   . PHE D 1 35  ? 42.802 3.177   -80.494 1.00 60.92  ? 32  PHE D N   1 
ATOM   9891  C CA  . PHE D 1 35  ? 42.575 3.257   -81.936 1.00 61.49  ? 32  PHE D CA  1 
ATOM   9892  C C   . PHE D 1 35  ? 42.226 1.929   -82.604 1.00 61.60  ? 32  PHE D C   1 
ATOM   9893  O O   . PHE D 1 35  ? 41.365 1.939   -83.500 1.00 60.62  ? 32  PHE D O   1 
ATOM   9894  C CB  . PHE D 1 35  ? 43.798 3.886   -82.619 1.00 57.99  ? 32  PHE D CB  1 
ATOM   9895  C CG  . PHE D 1 35  ? 44.039 5.322   -82.240 1.00 59.22  ? 32  PHE D CG  1 
ATOM   9896  C CD1 . PHE D 1 35  ? 43.023 6.102   -81.704 1.00 63.68  ? 32  PHE D CD1 1 
ATOM   9897  C CD2 . PHE D 1 35  ? 45.285 5.895   -82.431 1.00 55.41  ? 32  PHE D CD2 1 
ATOM   9898  C CE1 . PHE D 1 35  ? 43.251 7.427   -81.359 1.00 62.59  ? 32  PHE D CE1 1 
ATOM   9899  C CE2 . PHE D 1 35  ? 45.520 7.215   -82.090 1.00 58.38  ? 32  PHE D CE2 1 
ATOM   9900  C CZ  . PHE D 1 35  ? 44.503 7.983   -81.554 1.00 56.68  ? 32  PHE D CZ  1 
ATOM   9901  N N   . PRO D 1 36  ? 42.824 0.783   -82.255 1.00 63.84  ? 33  PRO D N   1 
ATOM   9902  C CA  . PRO D 1 36  ? 42.451 -0.463  -82.952 1.00 67.66  ? 33  PRO D CA  1 
ATOM   9903  C C   . PRO D 1 36  ? 40.982 -0.833  -82.830 1.00 67.75  ? 33  PRO D C   1 
ATOM   9904  O O   . PRO D 1 36  ? 40.506 -1.670  -83.608 1.00 67.12  ? 33  PRO D O   1 
ATOM   9905  C CB  . PRO D 1 36  ? 43.340 -1.522  -82.285 1.00 58.14  ? 33  PRO D CB  1 
ATOM   9906  C CG  . PRO D 1 36  ? 44.503 -0.769  -81.789 1.00 61.68  ? 33  PRO D CG  1 
ATOM   9907  C CD  . PRO D 1 36  ? 43.966 0.560   -81.350 1.00 63.85  ? 33  PRO D CD  1 
ATOM   9908  N N   . TYR D 1 37  ? 40.246 -0.242  -81.890 1.00 65.54  ? 34  TYR D N   1 
ATOM   9909  C CA  . TYR D 1 37  ? 38.847 -0.592  -81.672 1.00 65.33  ? 34  TYR D CA  1 
ATOM   9910  C C   . TYR D 1 37  ? 37.908 0.595   -81.706 1.00 67.43  ? 34  TYR D C   1 
ATOM   9911  O O   . TYR D 1 37  ? 36.692 0.389   -81.814 1.00 71.33  ? 34  TYR D O   1 
ATOM   9912  C CB  . TYR D 1 37  ? 38.669 -1.292  -80.319 1.00 60.26  ? 34  TYR D CB  1 
ATOM   9913  C CG  . TYR D 1 37  ? 39.754 -2.293  -80.033 1.00 63.49  ? 34  TYR D CG  1 
ATOM   9914  C CD1 . TYR D 1 37  ? 39.649 -3.620  -80.441 1.00 60.29  ? 34  TYR D CD1 1 
ATOM   9915  C CD2 . TYR D 1 37  ? 40.914 -1.895  -79.387 1.00 65.65  ? 34  TYR D CD2 1 
ATOM   9916  C CE1 . TYR D 1 37  ? 40.670 -4.526  -80.178 1.00 60.77  ? 34  TYR D CE1 1 
ATOM   9917  C CE2 . TYR D 1 37  ? 41.924 -2.778  -79.133 1.00 64.16  ? 34  TYR D CE2 1 
ATOM   9918  C CZ  . TYR D 1 37  ? 41.806 -4.084  -79.521 1.00 69.10  ? 34  TYR D CZ  1 
ATOM   9919  O OH  . TYR D 1 37  ? 42.855 -4.912  -79.221 1.00 75.83  ? 34  TYR D OH  1 
ATOM   9920  N N   . VAL D 1 38  ? 38.419 1.818   -81.603 1.00 64.99  ? 35  VAL D N   1 
ATOM   9921  C CA  . VAL D 1 38  ? 37.605 3.018   -81.471 1.00 69.68  ? 35  VAL D CA  1 
ATOM   9922  C C   . VAL D 1 38  ? 38.225 4.104   -82.330 1.00 69.43  ? 35  VAL D C   1 
ATOM   9923  O O   . VAL D 1 38  ? 39.447 4.284   -82.319 1.00 67.91  ? 35  VAL D O   1 
ATOM   9924  C CB  . VAL D 1 38  ? 37.514 3.491   -80.004 1.00 64.56  ? 35  VAL D CB  1 
ATOM   9925  C CG1 . VAL D 1 38  ? 36.788 4.828   -79.900 1.00 59.42  ? 35  VAL D CG1 1 
ATOM   9926  C CG2 . VAL D 1 38  ? 36.828 2.447   -79.134 1.00 63.51  ? 35  VAL D CG2 1 
ATOM   9927  N N   . GLU D 1 39  ? 37.397 4.817   -83.083 1.00 69.39  ? 36  GLU D N   1 
ATOM   9928  C CA  . GLU D 1 39  ? 37.822 6.078   -83.663 1.00 77.57  ? 36  GLU D CA  1 
ATOM   9929  C C   . GLU D 1 39  ? 36.891 7.192   -83.217 1.00 74.26  ? 36  GLU D C   1 
ATOM   9930  O O   . GLU D 1 39  ? 35.689 6.989   -83.015 1.00 69.58  ? 36  GLU D O   1 
ATOM   9931  C CB  . GLU D 1 39  ? 37.912 6.034   -85.187 1.00 74.36  ? 36  GLU D CB  1 
ATOM   9932  C CG  . GLU D 1 39  ? 38.912 7.059   -85.717 1.00 78.63  ? 36  GLU D CG  1 
ATOM   9933  C CD  . GLU D 1 39  ? 40.103 7.254   -84.781 1.00 78.76  ? 36  GLU D CD  1 
ATOM   9934  O OE1 . GLU D 1 39  ? 40.787 6.259   -84.453 1.00 76.46  ? 36  GLU D OE1 1 
ATOM   9935  O OE2 . GLU D 1 39  ? 40.342 8.406   -84.357 1.00 62.95  ? 36  GLU D OE2 1 
ATOM   9936  N N   . LEU D 1 40  ? 37.480 8.371   -83.060 1.00 73.02  ? 37  LEU D N   1 
ATOM   9937  C CA  . LEU D 1 40  ? 36.855 9.490   -82.385 1.00 68.11  ? 37  LEU D CA  1 
ATOM   9938  C C   . LEU D 1 40  ? 36.909 10.711  -83.287 1.00 71.17  ? 37  LEU D C   1 
ATOM   9939  O O   . LEU D 1 40  ? 37.708 10.783  -84.226 1.00 71.04  ? 37  LEU D O   1 
ATOM   9940  C CB  . LEU D 1 40  ? 37.577 9.810   -81.067 1.00 66.07  ? 37  LEU D CB  1 
ATOM   9941  C CG  . LEU D 1 40  ? 37.910 8.646   -80.133 1.00 76.13  ? 37  LEU D CG  1 
ATOM   9942  C CD1 . LEU D 1 40  ? 39.109 8.993   -79.265 1.00 72.61  ? 37  LEU D CD1 1 
ATOM   9943  C CD2 . LEU D 1 40  ? 36.716 8.308   -79.263 1.00 71.47  ? 37  LEU D CD2 1 
ATOM   9944  N N   . ASP D 1 41  ? 36.045 11.677  -82.986 1.00 69.02  ? 38  ASP D N   1 
ATOM   9945  C CA  . ASP D 1 41  ? 36.242 13.048  -83.443 1.00 64.52  ? 38  ASP D CA  1 
ATOM   9946  C C   . ASP D 1 41  ? 37.248 13.670  -82.479 1.00 64.60  ? 38  ASP D C   1 
ATOM   9947  O O   . ASP D 1 41  ? 36.903 14.364  -81.518 1.00 68.53  ? 38  ASP D O   1 
ATOM   9948  C CB  . ASP D 1 41  ? 34.923 13.807  -83.479 1.00 63.74  ? 38  ASP D CB  1 
ATOM   9949  C CG  . ASP D 1 41  ? 35.103 15.273  -83.798 1.00 60.43  ? 38  ASP D CG  1 
ATOM   9950  O OD1 . ASP D 1 41  ? 36.106 15.626  -84.456 1.00 60.96  ? 38  ASP D OD1 1 
ATOM   9951  O OD2 . ASP D 1 41  ? 34.246 16.076  -83.377 1.00 70.05  ? 38  ASP D OD2 1 
ATOM   9952  N N   . LEU D 1 42  ? 38.520 13.378  -82.729 1.00 64.52  ? 39  LEU D N   1 
ATOM   9953  C CA  . LEU D 1 42  ? 39.594 13.721  -81.809 1.00 68.17  ? 39  LEU D CA  1 
ATOM   9954  C C   . LEU D 1 42  ? 40.087 15.140  -82.061 1.00 67.64  ? 39  LEU D C   1 
ATOM   9955  O O   . LEU D 1 42  ? 40.449 15.492  -83.189 1.00 68.16  ? 39  LEU D O   1 
ATOM   9956  C CB  . LEU D 1 42  ? 40.750 12.729  -81.941 1.00 69.63  ? 39  LEU D CB  1 
ATOM   9957  C CG  . LEU D 1 42  ? 41.751 12.750  -80.784 1.00 73.28  ? 39  LEU D CG  1 
ATOM   9958  C CD1 . LEU D 1 42  ? 41.108 12.230  -79.505 1.00 71.92  ? 39  LEU D CD1 1 
ATOM   9959  C CD2 . LEU D 1 42  ? 43.001 11.955  -81.128 1.00 69.37  ? 39  LEU D CD2 1 
ATOM   9960  N N   . HIS D 1 43  ? 40.092 15.949  -81.004 1.00 72.03  ? 40  HIS D N   1 
ATOM   9961  C CA  . HIS D 1 43  ? 40.626 17.310  -81.021 1.00 74.53  ? 40  HIS D CA  1 
ATOM   9962  C C   . HIS D 1 43  ? 41.924 17.293  -80.221 1.00 71.35  ? 40  HIS D C   1 
ATOM   9963  O O   . HIS D 1 43  ? 41.903 17.281  -78.987 1.00 72.38  ? 40  HIS D O   1 
ATOM   9964  C CB  . HIS D 1 43  ? 39.627 18.307  -80.437 1.00 72.45  ? 40  HIS D CB  1 
ATOM   9965  C CG  . HIS D 1 43  ? 38.343 18.404  -81.203 1.00 75.69  ? 40  HIS D CG  1 
ATOM   9966  N ND1 . HIS D 1 43  ? 37.498 17.331  -81.389 1.00 74.15  ? 40  HIS D ND1 1 
ATOM   9967  C CD2 . HIS D 1 43  ? 37.761 19.453  -81.832 1.00 77.11  ? 40  HIS D CD2 1 
ATOM   9968  C CE1 . HIS D 1 43  ? 36.449 17.715  -82.095 1.00 67.77  ? 40  HIS D CE1 1 
ATOM   9969  N NE2 . HIS D 1 43  ? 36.585 18.997  -82.379 1.00 73.06  ? 40  HIS D NE2 1 
ATOM   9970  N N   . SER D 1 44  ? 43.050 17.295  -80.928 1.00 67.42  ? 41  SER D N   1 
ATOM   9971  C CA  . SER D 1 44  ? 44.355 17.149  -80.300 1.00 70.03  ? 41  SER D CA  1 
ATOM   9972  C C   . SER D 1 44  ? 44.989 18.511  -80.053 1.00 69.97  ? 41  SER D C   1 
ATOM   9973  O O   . SER D 1 44  ? 44.976 19.385  -80.927 1.00 68.30  ? 41  SER D O   1 
ATOM   9974  C CB  . SER D 1 44  ? 45.277 16.288  -81.164 1.00 65.49  ? 41  SER D CB  1 
ATOM   9975  O OG  . SER D 1 44  ? 44.694 15.025  -81.436 1.00 68.58  ? 41  SER D OG  1 
ATOM   9976  N N   . TYR D 1 45  ? 45.533 18.682  -78.853 1.00 68.01  ? 42  TYR D N   1 
ATOM   9977  C CA  . TYR D 1 45  ? 46.342 19.832  -78.488 1.00 69.97  ? 42  TYR D CA  1 
ATOM   9978  C C   . TYR D 1 45  ? 47.587 19.319  -77.788 1.00 69.53  ? 42  TYR D C   1 
ATOM   9979  O O   . TYR D 1 45  ? 47.514 18.398  -76.970 1.00 70.46  ? 42  TYR D O   1 
ATOM   9980  C CB  . TYR D 1 45  ? 45.583 20.800  -77.577 1.00 67.34  ? 42  TYR D CB  1 
ATOM   9981  C CG  . TYR D 1 45  ? 44.344 21.379  -78.211 1.00 69.74  ? 42  TYR D CG  1 
ATOM   9982  C CD1 . TYR D 1 45  ? 43.122 20.729  -78.104 1.00 72.25  ? 42  TYR D CD1 1 
ATOM   9983  C CD2 . TYR D 1 45  ? 44.393 22.573  -78.920 1.00 71.30  ? 42  TYR D CD2 1 
ATOM   9984  C CE1 . TYR D 1 45  ? 41.983 21.250  -78.685 1.00 69.74  ? 42  TYR D CE1 1 
ATOM   9985  C CE2 . TYR D 1 45  ? 43.257 23.103  -79.504 1.00 65.30  ? 42  TYR D CE2 1 
ATOM   9986  C CZ  . TYR D 1 45  ? 42.056 22.437  -79.383 1.00 68.85  ? 42  TYR D CZ  1 
ATOM   9987  O OH  . TYR D 1 45  ? 40.923 22.960  -79.962 1.00 68.78  ? 42  TYR D OH  1 
ATOM   9988  N N   . ASP D 1 46  ? 48.727 19.905  -78.122 1.00 68.23  ? 43  ASP D N   1 
ATOM   9989  C CA  . ASP D 1 46  ? 50.015 19.457  -77.606 1.00 71.52  ? 43  ASP D CA  1 
ATOM   9990  C C   . ASP D 1 46  ? 50.514 20.468  -76.580 1.00 74.65  ? 43  ASP D C   1 
ATOM   9991  O O   . ASP D 1 46  ? 51.106 21.493  -76.935 1.00 76.33  ? 43  ASP D O   1 
ATOM   9992  C CB  . ASP D 1 46  ? 51.007 19.277  -78.748 1.00 69.26  ? 43  ASP D CB  1 
ATOM   9993  C CG  . ASP D 1 46  ? 52.413 19.032  -78.257 1.00 74.90  ? 43  ASP D CG  1 
ATOM   9994  O OD1 . ASP D 1 46  ? 53.351 19.571  -78.878 1.00 76.71  ? 43  ASP D OD1 1 
ATOM   9995  O OD2 . ASP D 1 46  ? 52.581 18.312  -77.250 1.00 79.44  ? 43  ASP D OD2 1 
ATOM   9996  N N   . LEU D 1 47  ? 50.265 20.173  -75.302 1.00 69.86  ? 44  LEU D N   1 
ATOM   9997  C CA  . LEU D 1 47  ? 50.746 20.977  -74.187 1.00 72.66  ? 44  LEU D CA  1 
ATOM   9998  C C   . LEU D 1 47  ? 52.060 20.459  -73.629 1.00 69.34  ? 44  LEU D C   1 
ATOM   9999  O O   . LEU D 1 47  ? 52.343 20.648  -72.439 1.00 68.70  ? 44  LEU D O   1 
ATOM   10000 C CB  . LEU D 1 47  ? 49.696 21.057  -73.073 1.00 65.12  ? 44  LEU D CB  1 
ATOM   10001 C CG  . LEU D 1 47  ? 48.406 21.786  -73.458 1.00 65.81  ? 44  LEU D CG  1 
ATOM   10002 C CD1 . LEU D 1 47  ? 47.513 20.967  -74.367 1.00 68.19  ? 44  LEU D CD1 1 
ATOM   10003 C CD2 . LEU D 1 47  ? 47.653 22.241  -72.219 1.00 72.12  ? 44  LEU D CD2 1 
ATOM   10004 N N   . GLY D 1 48  ? 52.849 19.777  -74.450 1.00 68.63  ? 45  GLY D N   1 
ATOM   10005 C CA  . GLY D 1 48  ? 54.237 19.581  -74.111 1.00 71.04  ? 45  GLY D CA  1 
ATOM   10006 C C   . GLY D 1 48  ? 54.925 20.902  -73.831 1.00 76.30  ? 45  GLY D C   1 
ATOM   10007 O O   . GLY D 1 48  ? 54.495 21.971  -74.267 1.00 76.33  ? 45  GLY D O   1 
ATOM   10008 N N   . ILE D 1 49  ? 56.021 20.820  -73.079 1.00 74.02  ? 46  ILE D N   1 
ATOM   10009 C CA  . ILE D 1 49  ? 56.705 22.031  -72.641 1.00 75.47  ? 46  ILE D CA  1 
ATOM   10010 C C   . ILE D 1 49  ? 57.285 22.782  -73.834 1.00 77.85  ? 46  ILE D C   1 
ATOM   10011 O O   . ILE D 1 49  ? 57.340 24.021  -73.839 1.00 81.16  ? 46  ILE D O   1 
ATOM   10012 C CB  . ILE D 1 49  ? 57.778 21.677  -71.593 1.00 74.52  ? 46  ILE D CB  1 
ATOM   10013 C CG1 . ILE D 1 49  ? 58.211 22.922  -70.817 1.00 74.76  ? 46  ILE D CG1 1 
ATOM   10014 C CG2 . ILE D 1 49  ? 58.963 20.968  -72.244 1.00 70.85  ? 46  ILE D CG2 1 
ATOM   10015 C CD1 . ILE D 1 49  ? 57.043 23.651  -70.185 1.00 67.14  ? 46  ILE D CD1 1 
ATOM   10016 N N   . GLU D 1 50  ? 57.703 22.044  -74.870 1.00 78.75  ? 47  GLU D N   1 
ATOM   10017 C CA  . GLU D 1 50  ? 58.214 22.665  -76.085 1.00 80.29  ? 47  GLU D CA  1 
ATOM   10018 C C   . GLU D 1 50  ? 57.179 23.625  -76.670 1.00 78.73  ? 47  GLU D C   1 
ATOM   10019 O O   . GLU D 1 50  ? 57.462 24.804  -76.905 1.00 75.28  ? 47  GLU D O   1 
ATOM   10020 C CB  . GLU D 1 50  ? 58.600 21.552  -77.072 1.00 76.92  ? 47  GLU D CB  1 
ATOM   10021 C CG  . GLU D 1 50  ? 57.410 20.970  -77.832 1.00 84.47  ? 47  GLU D CG  1 
ATOM   10022 C CD  . GLU D 1 50  ? 56.567 20.066  -76.947 1.00 84.34  ? 47  GLU D CD  1 
ATOM   10023 O OE1 . GLU D 1 50  ? 55.589 19.477  -77.443 1.00 84.57  ? 47  GLU D OE1 1 
ATOM   10024 O OE2 . GLU D 1 50  ? 56.897 19.922  -75.753 1.00 84.61  ? 47  GLU D OE2 1 
ATOM   10025 N N   . ASN D 1 51  ? 55.949 23.146  -76.848 1.00 77.43  ? 48  ASN D N   1 
ATOM   10026 C CA  . ASN D 1 51  ? 54.938 23.866  -77.603 1.00 78.86  ? 48  ASN D CA  1 
ATOM   10027 C C   . ASN D 1 51  ? 54.255 24.914  -76.755 1.00 85.39  ? 48  ASN D C   1 
ATOM   10028 O O   . ASN D 1 51  ? 53.614 25.804  -77.311 1.00 84.06  ? 48  ASN D O   1 
ATOM   10029 C CB  . ASN D 1 51  ? 53.913 22.870  -78.156 1.00 77.71  ? 48  ASN D CB  1 
ATOM   10030 C CG  . ASN D 1 51  ? 52.968 23.491  -79.155 1.00 76.94  ? 48  ASN D CG  1 
ATOM   10031 O OD1 . ASN D 1 51  ? 53.356 24.355  -79.952 1.00 80.42  ? 48  ASN D OD1 1 
ATOM   10032 N ND2 . ASN D 1 51  ? 51.728 23.041  -79.138 1.00 78.80  ? 48  ASN D ND2 1 
ATOM   10033 N N   . ARG D 1 52  ? 54.397 24.818  -75.427 1.00 84.02  ? 49  ARG D N   1 
ATOM   10034 C CA  . ARG D 1 52  ? 53.949 25.837  -74.483 1.00 88.58  ? 49  ARG D CA  1 
ATOM   10035 C C   . ARG D 1 52  ? 54.892 27.033  -74.404 1.00 88.57  ? 49  ARG D C   1 
ATOM   10036 O O   . ARG D 1 52  ? 54.454 28.130  -74.030 1.00 85.07  ? 49  ARG D O   1 
ATOM   10037 C CB  . ARG D 1 52  ? 53.764 25.215  -73.094 1.00 81.05  ? 49  ARG D CB  1 
ATOM   10038 C CG  . ARG D 1 52  ? 52.484 24.407  -72.978 1.00 78.08  ? 49  ARG D CG  1 
ATOM   10039 C CD  . ARG D 1 52  ? 52.273 23.883  -71.574 1.00 75.92  ? 49  ARG D CD  1 
ATOM   10040 N NE  . ARG D 1 52  ? 53.051 22.681  -71.304 1.00 73.80  ? 49  ARG D NE  1 
ATOM   10041 C CZ  . ARG D 1 52  ? 53.727 22.475  -70.181 1.00 72.82  ? 49  ARG D CZ  1 
ATOM   10042 N NH1 . ARG D 1 52  ? 53.722 23.395  -69.227 1.00 68.98  ? 49  ARG D NH1 1 
ATOM   10043 N NH2 . ARG D 1 52  ? 54.408 21.351  -70.012 1.00 71.06  ? 49  ARG D NH2 1 
ATOM   10044 N N   . ASP D 1 53  ? 56.164 26.850  -74.752 1.00 87.60  ? 50  ASP D N   1 
ATOM   10045 C CA  . ASP D 1 53  ? 57.130 27.939  -74.812 1.00 86.35  ? 50  ASP D CA  1 
ATOM   10046 C C   . ASP D 1 53  ? 57.233 28.542  -76.210 1.00 89.70  ? 50  ASP D C   1 
ATOM   10047 O O   . ASP D 1 53  ? 58.136 29.345  -76.465 1.00 95.72  ? 50  ASP D O   1 
ATOM   10048 C CB  . ASP D 1 53  ? 58.506 27.455  -74.345 1.00 82.91  ? 50  ASP D CB  1 
ATOM   10049 C CG  . ASP D 1 53  ? 59.404 28.594  -73.885 1.00 82.81  ? 50  ASP D CG  1 
ATOM   10050 O OD1 . ASP D 1 53  ? 58.899 29.492  -73.182 1.00 85.29  ? 50  ASP D OD1 1 
ATOM   10051 O OD2 . ASP D 1 53  ? 60.615 28.585  -74.205 1.00 86.83  ? 50  ASP D OD2 1 
ATOM   10052 N N   . ALA D 1 54  ? 56.320 28.182  -77.116 1.00 88.17  ? 51  ALA D N   1 
ATOM   10053 C CA  . ALA D 1 54  ? 56.310 28.718  -78.472 1.00 87.74  ? 51  ALA D CA  1 
ATOM   10054 C C   . ALA D 1 54  ? 54.919 29.242  -78.793 1.00 89.63  ? 51  ALA D C   1 
ATOM   10055 O O   . ALA D 1 54  ? 54.746 30.095  -79.667 1.00 93.43  ? 51  ALA D O   1 
ATOM   10056 C CB  . ALA D 1 54  ? 56.734 27.652  -79.477 1.00 81.98  ? 51  ALA D CB  1 
ATOM   10057 N N   . THR D 1 55  ? 53.923 28.722  -78.087 1.00 84.77  ? 52  THR D N   1 
ATOM   10058 C CA  . THR D 1 55  ? 52.567 29.240  -78.152 1.00 80.94  ? 52  THR D CA  1 
ATOM   10059 C C   . THR D 1 55  ? 52.352 30.413  -77.204 1.00 82.72  ? 52  THR D C   1 
ATOM   10060 O O   . THR D 1 55  ? 51.263 30.991  -77.203 1.00 87.10  ? 52  THR D O   1 
ATOM   10061 C CB  . THR D 1 55  ? 51.572 28.136  -77.804 1.00 85.14  ? 52  THR D CB  1 
ATOM   10062 O OG1 . THR D 1 55  ? 50.240 28.646  -77.835 1.00 89.35  ? 52  THR D OG1 1 
ATOM   10063 C CG2 . THR D 1 55  ? 51.821 27.705  -76.408 1.00 83.63  ? 52  THR D CG2 1 
ATOM   10064 N N   . ASN D 1 56  ? 53.361 30.772  -76.400 1.00 85.56  ? 53  ASN D N   1 
ATOM   10065 C CA  . ASN D 1 56  ? 53.179 31.651  -75.239 1.00 88.48  ? 53  ASN D CA  1 
ATOM   10066 C C   . ASN D 1 56  ? 52.080 31.114  -74.328 1.00 88.41  ? 53  ASN D C   1 
ATOM   10067 O O   . ASN D 1 56  ? 51.275 31.866  -73.775 1.00 85.49  ? 53  ASN D O   1 
ATOM   10068 C CB  . ASN D 1 56  ? 52.890 33.094  -75.658 1.00 91.33  ? 53  ASN D CB  1 
ATOM   10069 C CG  . ASN D 1 56  ? 54.050 33.734  -76.393 1.00 90.70  ? 53  ASN D CG  1 
ATOM   10070 O OD1 . ASN D 1 56  ? 55.215 33.522  -76.051 1.00 85.96  ? 53  ASN D OD1 1 
ATOM   10071 N ND2 . ASN D 1 56  ? 53.735 34.544  -77.397 1.00 85.02  ? 53  ASN D ND2 1 
ATOM   10072 N N   . ASP D 1 57  ? 52.057 29.788  -74.184 1.00 84.72  ? 54  ASP D N   1 
ATOM   10073 C CA  . ASP D 1 57  ? 51.099 29.021  -73.391 1.00 78.48  ? 54  ASP D CA  1 
ATOM   10074 C C   . ASP D 1 57  ? 49.669 29.131  -73.911 1.00 78.01  ? 54  ASP D C   1 
ATOM   10075 O O   . ASP D 1 57  ? 48.724 28.755  -73.209 1.00 79.18  ? 54  ASP D O   1 
ATOM   10076 C CB  . ASP D 1 57  ? 51.158 29.405  -71.912 1.00 82.24  ? 54  ASP D CB  1 
ATOM   10077 C CG  . ASP D 1 57  ? 50.709 28.282  -71.016 1.00 85.34  ? 54  ASP D CG  1 
ATOM   10078 O OD1 . ASP D 1 57  ? 50.468 27.169  -71.533 1.00 84.06  ? 54  ASP D OD1 1 
ATOM   10079 O OD2 . ASP D 1 57  ? 50.624 28.500  -69.792 1.00 87.31  ? 54  ASP D OD2 1 
ATOM   10080 N N   . GLN D 1 58  ? 49.492 29.609  -75.146 1.00 79.30  ? 55  GLN D N   1 
ATOM   10081 C CA  . GLN D 1 58  ? 48.152 29.775  -75.705 1.00 74.85  ? 55  GLN D CA  1 
ATOM   10082 C C   . GLN D 1 58  ? 47.466 28.431  -75.937 1.00 78.55  ? 55  GLN D C   1 
ATOM   10083 O O   . GLN D 1 58  ? 46.244 28.319  -75.782 1.00 74.46  ? 55  GLN D O   1 
ATOM   10084 C CB  . GLN D 1 58  ? 48.240 30.587  -77.002 1.00 77.97  ? 55  GLN D CB  1 
ATOM   10085 C CG  . GLN D 1 58  ? 46.958 30.789  -77.764 1.00 77.36  ? 55  GLN D CG  1 
ATOM   10086 C CD  . GLN D 1 58  ? 45.893 31.448  -76.941 1.00 83.83  ? 55  GLN D CD  1 
ATOM   10087 O OE1 . GLN D 1 58  ? 46.178 32.289  -76.089 1.00 80.28  ? 55  GLN D OE1 1 
ATOM   10088 N NE2 . GLN D 1 58  ? 44.647 31.078  -77.195 1.00 81.06  ? 55  GLN D NE2 1 
ATOM   10089 N N   . VAL D 1 59  ? 48.237 27.395  -76.288 1.00 74.49  ? 56  VAL D N   1 
ATOM   10090 C CA  . VAL D 1 59  ? 47.672 26.065  -76.525 1.00 72.80  ? 56  VAL D CA  1 
ATOM   10091 C C   . VAL D 1 59  ? 46.898 25.571  -75.311 1.00 70.11  ? 56  VAL D C   1 
ATOM   10092 O O   . VAL D 1 59  ? 45.920 24.822  -75.446 1.00 67.89  ? 56  VAL D O   1 
ATOM   10093 C CB  . VAL D 1 59  ? 48.793 25.076  -76.924 1.00 69.17  ? 56  VAL D CB  1 
ATOM   10094 C CG1 . VAL D 1 59  ? 49.801 24.926  -75.792 1.00 72.91  ? 56  VAL D CG1 1 
ATOM   10095 C CG2 . VAL D 1 59  ? 48.216 23.724  -77.314 1.00 70.60  ? 56  VAL D CG2 1 
ATOM   10096 N N   . THR D 1 60  ? 47.305 25.992  -74.113 1.00 68.97  ? 57  THR D N   1 
ATOM   10097 C CA  . THR D 1 60  ? 46.588 25.599  -72.907 1.00 73.56  ? 57  THR D CA  1 
ATOM   10098 C C   . THR D 1 60  ? 45.165 26.145  -72.913 1.00 74.13  ? 57  THR D C   1 
ATOM   10099 O O   . THR D 1 60  ? 44.201 25.399  -72.697 1.00 70.77  ? 57  THR D O   1 
ATOM   10100 C CB  . THR D 1 60  ? 47.346 26.077  -71.670 1.00 75.10  ? 57  THR D CB  1 
ATOM   10101 O OG1 . THR D 1 60  ? 48.741 25.781  -71.820 1.00 69.95  ? 57  THR D OG1 1 
ATOM   10102 C CG2 . THR D 1 60  ? 46.813 25.390  -70.423 1.00 72.16  ? 57  THR D CG2 1 
ATOM   10103 N N   . LYS D 1 61  ? 45.010 27.448  -73.172 1.00 76.84  ? 58  LYS D N   1 
ATOM   10104 C CA  . LYS D 1 61  ? 43.682 28.052  -73.119 1.00 73.59  ? 58  LYS D CA  1 
ATOM   10105 C C   . LYS D 1 61  ? 42.837 27.602  -74.305 1.00 74.96  ? 58  LYS D C   1 
ATOM   10106 O O   . LYS D 1 61  ? 41.624 27.387  -74.166 1.00 72.60  ? 58  LYS D O   1 
ATOM   10107 C CB  . LYS D 1 61  ? 43.791 29.582  -73.056 1.00 76.72  ? 58  LYS D CB  1 
ATOM   10108 C CG  . LYS D 1 61  ? 43.436 30.354  -74.324 1.00 84.44  ? 58  LYS D CG  1 
ATOM   10109 C CD  . LYS D 1 61  ? 43.454 31.859  -74.071 1.00 82.85  ? 58  LYS D CD  1 
ATOM   10110 C CE  . LYS D 1 61  ? 42.986 32.635  -75.292 1.00 86.02  ? 58  LYS D CE  1 
ATOM   10111 N NZ  . LYS D 1 61  ? 43.778 33.881  -75.470 1.00 79.20  ? 58  LYS D NZ  1 
ATOM   10112 N N   . ASP D 1 62  ? 43.468 27.432  -75.476 1.00 72.44  ? 59  ASP D N   1 
ATOM   10113 C CA  . ASP D 1 62  ? 42.773 26.824  -76.604 1.00 68.53  ? 59  ASP D CA  1 
ATOM   10114 C C   . ASP D 1 62  ? 42.248 25.443  -76.234 1.00 72.01  ? 59  ASP D C   1 
ATOM   10115 O O   . ASP D 1 62  ? 41.103 25.097  -76.549 1.00 71.40  ? 59  ASP D O   1 
ATOM   10116 C CB  . ASP D 1 62  ? 43.702 26.722  -77.811 1.00 76.23  ? 59  ASP D CB  1 
ATOM   10117 C CG  . ASP D 1 62  ? 44.377 28.036  -78.150 1.00 81.99  ? 59  ASP D CG  1 
ATOM   10118 O OD1 . ASP D 1 62  ? 43.879 29.092  -77.714 1.00 80.71  ? 59  ASP D OD1 1 
ATOM   10119 O OD2 . ASP D 1 62  ? 45.410 28.010  -78.855 1.00 83.41  ? 59  ASP D OD2 1 
ATOM   10120 N N   . ALA D 1 63  ? 43.079 24.638  -75.568 1.00 72.59  ? 60  ALA D N   1 
ATOM   10121 C CA  . ALA D 1 63  ? 42.635 23.322  -75.124 1.00 70.10  ? 60  ALA D CA  1 
ATOM   10122 C C   . ALA D 1 63  ? 41.498 23.436  -74.117 1.00 62.25  ? 60  ALA D C   1 
ATOM   10123 O O   . ALA D 1 63  ? 40.576 22.613  -74.114 1.00 63.60  ? 60  ALA D O   1 
ATOM   10124 C CB  . ALA D 1 63  ? 43.806 22.547  -74.521 1.00 64.47  ? 60  ALA D CB  1 
ATOM   10125 N N   . ALA D 1 64  ? 41.542 24.456  -73.257 1.00 60.09  ? 61  ALA D N   1 
ATOM   10126 C CA  . ALA D 1 64  ? 40.509 24.608  -72.238 1.00 72.15  ? 61  ALA D CA  1 
ATOM   10127 C C   . ALA D 1 64  ? 39.164 24.949  -72.868 1.00 71.91  ? 61  ALA D C   1 
ATOM   10128 O O   . ALA D 1 64  ? 38.146 24.313  -72.569 1.00 68.76  ? 61  ALA D O   1 
ATOM   10129 C CB  . ALA D 1 64  ? 40.922 25.679  -71.228 1.00 69.57  ? 61  ALA D CB  1 
ATOM   10130 N N   . GLU D 1 65  ? 39.142 25.954  -73.748 1.00 74.37  ? 62  GLU D N   1 
ATOM   10131 C CA  . GLU D 1 65  ? 37.901 26.328  -74.418 1.00 71.25  ? 62  GLU D CA  1 
ATOM   10132 C C   . GLU D 1 65  ? 37.362 25.188  -75.269 1.00 69.73  ? 62  GLU D C   1 
ATOM   10133 O O   . GLU D 1 65  ? 36.142 25.040  -75.407 1.00 63.80  ? 62  GLU D O   1 
ATOM   10134 C CB  . GLU D 1 65  ? 38.127 27.571  -75.277 1.00 70.90  ? 62  GLU D CB  1 
ATOM   10135 C CG  . GLU D 1 65  ? 38.585 28.794  -74.498 1.00 70.44  ? 62  GLU D CG  1 
ATOM   10136 C CD  . GLU D 1 65  ? 37.513 29.350  -73.580 1.00 78.86  ? 62  GLU D CD  1 
ATOM   10137 O OE1 . GLU D 1 65  ? 36.323 29.025  -73.779 1.00 77.28  ? 62  GLU D OE1 1 
ATOM   10138 O OE2 . GLU D 1 65  ? 37.864 30.122  -72.662 1.00 74.48  ? 62  GLU D OE2 1 
ATOM   10139 N N   . ALA D 1 66  ? 38.250 24.374  -75.845 1.00 69.55  ? 63  ALA D N   1 
ATOM   10140 C CA  . ALA D 1 66  ? 37.798 23.215  -76.605 1.00 65.53  ? 63  ALA D CA  1 
ATOM   10141 C C   . ALA D 1 66  ? 37.017 22.253  -75.722 1.00 72.29  ? 63  ALA D C   1 
ATOM   10142 O O   . ALA D 1 66  ? 36.039 21.642  -76.169 1.00 70.93  ? 63  ALA D O   1 
ATOM   10143 C CB  . ALA D 1 66  ? 38.989 22.504  -77.247 1.00 62.88  ? 63  ALA D CB  1 
ATOM   10144 N N   . ILE D 1 67  ? 37.427 22.111  -74.461 1.00 71.33  ? 64  ILE D N   1 
ATOM   10145 C CA  . ILE D 1 67  ? 36.734 21.195  -73.559 1.00 73.29  ? 64  ILE D CA  1 
ATOM   10146 C C   . ILE D 1 67  ? 35.312 21.677  -73.307 1.00 72.33  ? 64  ILE D C   1 
ATOM   10147 O O   . ILE D 1 67  ? 34.355 20.896  -73.372 1.00 71.60  ? 64  ILE D O   1 
ATOM   10148 C CB  . ILE D 1 67  ? 37.514 21.033  -72.243 1.00 73.47  ? 64  ILE D CB  1 
ATOM   10149 C CG1 . ILE D 1 67  ? 38.818 20.276  -72.483 1.00 68.39  ? 64  ILE D CG1 1 
ATOM   10150 C CG2 . ILE D 1 67  ? 36.654 20.311  -71.214 1.00 65.62  ? 64  ILE D CG2 1 
ATOM   10151 C CD1 . ILE D 1 67  ? 39.770 20.329  -71.313 1.00 71.48  ? 64  ILE D CD1 1 
ATOM   10152 N N   . LYS D 1 68  ? 35.155 22.972  -73.011 1.00 72.51  ? 65  LYS D N   1 
ATOM   10153 C CA  . LYS D 1 68  ? 33.825 23.541  -72.816 1.00 72.98  ? 65  LYS D CA  1 
ATOM   10154 C C   . LYS D 1 68  ? 32.932 23.268  -74.017 1.00 68.76  ? 65  LYS D C   1 
ATOM   10155 O O   . LYS D 1 68  ? 31.758 22.913  -73.865 1.00 67.38  ? 65  LYS D O   1 
ATOM   10156 C CB  . LYS D 1 68  ? 33.926 25.048  -72.578 1.00 76.74  ? 65  LYS D CB  1 
ATOM   10157 C CG  . LYS D 1 68  ? 34.731 25.457  -71.362 1.00 72.90  ? 65  LYS D CG  1 
ATOM   10158 C CD  . LYS D 1 68  ? 35.062 26.941  -71.421 1.00 77.37  ? 65  LYS D CD  1 
ATOM   10159 C CE  . LYS D 1 68  ? 33.806 27.790  -71.587 1.00 73.76  ? 65  LYS D CE  1 
ATOM   10160 N NZ  . LYS D 1 68  ? 34.122 29.246  -71.646 1.00 77.22  ? 65  LYS D NZ  1 
ATOM   10161 N N   . LYS D 1 69  ? 33.481 23.421  -75.223 1.00 73.22  ? 66  LYS D N   1 
ATOM   10162 C CA  . LYS D 1 69  ? 32.696 23.189  -76.429 1.00 74.87  ? 66  LYS D CA  1 
ATOM   10163 C C   . LYS D 1 69  ? 32.317 21.719  -76.579 1.00 73.76  ? 66  LYS D C   1 
ATOM   10164 O O   . LYS D 1 69  ? 31.175 21.404  -76.936 1.00 71.29  ? 66  LYS D O   1 
ATOM   10165 C CB  . LYS D 1 69  ? 33.475 23.673  -77.653 1.00 70.23  ? 66  LYS D CB  1 
ATOM   10166 C CG  . LYS D 1 69  ? 32.624 23.881  -78.896 1.00 74.93  ? 66  LYS D CG  1 
ATOM   10167 C CD  . LYS D 1 69  ? 33.496 24.182  -80.103 1.00 75.88  ? 66  LYS D CD  1 
ATOM   10168 C CE  . LYS D 1 69  ? 32.651 24.442  -81.336 1.00 76.38  ? 66  LYS D CE  1 
ATOM   10169 N NZ  . LYS D 1 69  ? 33.388 24.158  -82.598 1.00 69.31  ? 66  LYS D NZ  1 
ATOM   10170 N N   . HIS D 1 70  ? 33.250 20.804  -76.295 1.00 73.52  ? 67  HIS D N   1 
ATOM   10171 C CA  . HIS D 1 70  ? 33.060 19.397  -76.633 1.00 73.68  ? 67  HIS D CA  1 
ATOM   10172 C C   . HIS D 1 70  ? 32.745 18.502  -75.436 1.00 74.46  ? 67  HIS D C   1 
ATOM   10173 O O   . HIS D 1 70  ? 32.394 17.333  -75.640 1.00 70.13  ? 67  HIS D O   1 
ATOM   10174 C CB  . HIS D 1 70  ? 34.298 18.865  -77.366 1.00 75.79  ? 67  HIS D CB  1 
ATOM   10175 C CG  . HIS D 1 70  ? 34.645 19.643  -78.597 1.00 78.46  ? 67  HIS D CG  1 
ATOM   10176 N ND1 . HIS D 1 70  ? 33.864 19.619  -79.731 1.00 73.45  ? 67  HIS D ND1 1 
ATOM   10177 C CD2 . HIS D 1 70  ? 35.682 20.469  -78.872 1.00 75.80  ? 67  HIS D CD2 1 
ATOM   10178 C CE1 . HIS D 1 70  ? 34.403 20.398  -80.652 1.00 74.64  ? 67  HIS D CE1 1 
ATOM   10179 N NE2 . HIS D 1 70  ? 35.508 20.925  -80.156 1.00 76.14  ? 67  HIS D NE2 1 
ATOM   10180 N N   . ASN D 1 71  ? 32.897 19.015  -74.208 1.00 75.29  ? 68  ASN D N   1 
ATOM   10181 C CA  . ASN D 1 71  ? 32.404 18.425  -72.960 1.00 71.75  ? 68  ASN D CA  1 
ATOM   10182 C C   . ASN D 1 71  ? 33.265 17.304  -72.381 1.00 71.25  ? 68  ASN D C   1 
ATOM   10183 O O   . ASN D 1 71  ? 33.083 16.938  -71.215 1.00 71.09  ? 68  ASN D O   1 
ATOM   10184 C CB  . ASN D 1 71  ? 30.968 17.908  -73.123 1.00 73.70  ? 68  ASN D CB  1 
ATOM   10185 C CG  . ASN D 1 71  ? 29.997 18.985  -73.572 1.00 77.44  ? 68  ASN D CG  1 
ATOM   10186 O OD1 . ASN D 1 71  ? 30.213 20.174  -73.336 1.00 76.38  ? 68  ASN D OD1 1 
ATOM   10187 N ND2 . ASN D 1 71  ? 28.902 18.566  -74.196 1.00 77.74  ? 68  ASN D ND2 1 
ATOM   10188 N N   . VAL D 1 72  ? 34.186 16.733  -73.156 1.00 67.70  ? 69  VAL D N   1 
ATOM   10189 C CA  . VAL D 1 72  ? 35.018 15.631  -72.675 1.00 63.32  ? 69  VAL D CA  1 
ATOM   10190 C C   . VAL D 1 72  ? 36.461 15.887  -73.076 1.00 65.72  ? 69  VAL D C   1 
ATOM   10191 O O   . VAL D 1 72  ? 36.769 15.979  -74.269 1.00 63.41  ? 69  VAL D O   1 
ATOM   10192 C CB  . VAL D 1 72  ? 34.549 14.265  -73.209 1.00 66.54  ? 69  VAL D CB  1 
ATOM   10193 C CG1 . VAL D 1 72  ? 35.386 13.157  -72.600 1.00 62.68  ? 69  VAL D CG1 1 
ATOM   10194 C CG2 . VAL D 1 72  ? 33.071 14.038  -72.898 1.00 64.78  ? 69  VAL D CG2 1 
ATOM   10195 N N   . GLY D 1 73  ? 37.336 15.994  -72.087 1.00 66.93  ? 70  GLY D N   1 
ATOM   10196 C CA  . GLY D 1 73  ? 38.762 16.161  -72.322 1.00 64.67  ? 70  GLY D CA  1 
ATOM   10197 C C   . GLY D 1 73  ? 39.563 15.159  -71.515 1.00 62.65  ? 70  GLY D C   1 
ATOM   10198 O O   . GLY D 1 73  ? 39.189 14.816  -70.392 1.00 62.66  ? 70  GLY D O   1 
ATOM   10199 N N   . VAL D 1 74  ? 40.658 14.682  -72.103 1.00 61.58  ? 71  VAL D N   1 
ATOM   10200 C CA  . VAL D 1 74  ? 41.587 13.767  -71.452 1.00 54.66  ? 71  VAL D CA  1 
ATOM   10201 C C   . VAL D 1 74  ? 42.994 14.317  -71.640 1.00 54.99  ? 71  VAL D C   1 
ATOM   10202 O O   . VAL D 1 74  ? 43.348 14.781  -72.730 1.00 55.86  ? 71  VAL D O   1 
ATOM   10203 C CB  . VAL D 1 74  ? 41.464 12.331  -72.008 1.00 54.47  ? 71  VAL D CB  1 
ATOM   10204 C CG1 . VAL D 1 74  ? 40.114 11.734  -71.635 1.00 52.30  ? 71  VAL D CG1 1 
ATOM   10205 C CG2 . VAL D 1 74  ? 41.645 12.320  -73.520 1.00 61.51  ? 71  VAL D CG2 1 
ATOM   10206 N N   . LYS D 1 75  ? 43.794 14.274  -70.574 1.00 52.55  ? 72  LYS D N   1 
ATOM   10207 C CA  . LYS D 1 75  ? 45.044 15.019  -70.517 1.00 58.20  ? 72  LYS D CA  1 
ATOM   10208 C C   . LYS D 1 75  ? 46.184 14.153  -70.003 1.00 57.92  ? 72  LYS D C   1 
ATOM   10209 O O   . LYS D 1 75  ? 46.059 13.499  -68.963 1.00 55.09  ? 72  LYS D O   1 
ATOM   10210 C CB  . LYS D 1 75  ? 44.902 16.259  -69.628 1.00 58.42  ? 72  LYS D CB  1 
ATOM   10211 C CG  . LYS D 1 75  ? 46.194 17.038  -69.453 1.00 58.48  ? 72  LYS D CG  1 
ATOM   10212 C CD  . LYS D 1 75  ? 46.057 18.128  -68.405 1.00 54.92  ? 72  LYS D CD  1 
ATOM   10213 C CE  . LYS D 1 75  ? 47.322 18.970  -68.310 1.00 59.34  ? 72  LYS D CE  1 
ATOM   10214 N NZ  . LYS D 1 75  ? 48.513 18.160  -67.931 1.00 64.51  ? 72  LYS D NZ  1 
ATOM   10215 N N   . CYS D 1 76  ? 47.290 14.164  -70.740 1.00 59.63  ? 73  CYS D N   1 
ATOM   10216 C CA  . CYS D 1 76  ? 48.556 13.612  -70.285 1.00 53.74  ? 73  CYS D CA  1 
ATOM   10217 C C   . CYS D 1 76  ? 49.219 14.578  -69.310 1.00 62.12  ? 73  CYS D C   1 
ATOM   10218 O O   . CYS D 1 76  ? 49.082 15.798  -69.429 1.00 62.00  ? 73  CYS D O   1 
ATOM   10219 C CB  . CYS D 1 76  ? 49.469 13.355  -71.487 1.00 54.09  ? 73  CYS D CB  1 
ATOM   10220 S SG  . CYS D 1 76  ? 51.012 12.484  -71.162 1.00 50.48  ? 73  CYS D SG  1 
ATOM   10221 N N   . ALA D 1 77  ? 49.940 14.022  -68.338 1.00 60.18  ? 74  ALA D N   1 
ATOM   10222 C CA  . ALA D 1 77  ? 50.596 14.848  -67.332 1.00 60.90  ? 74  ALA D CA  1 
ATOM   10223 C C   . ALA D 1 77  ? 51.653 15.743  -67.975 1.00 61.43  ? 74  ALA D C   1 
ATOM   10224 O O   . ALA D 1 77  ? 52.294 15.378  -68.965 1.00 60.99  ? 74  ALA D O   1 
ATOM   10225 C CB  . ALA D 1 77  ? 51.228 13.975  -66.248 1.00 58.53  ? 74  ALA D CB  1 
ATOM   10226 N N   . THR D 1 78  ? 51.831 16.932  -67.400 1.00 57.75  ? 75  THR D N   1 
ATOM   10227 C CA  . THR D 1 78  ? 52.679 17.962  -67.982 1.00 59.99  ? 75  THR D CA  1 
ATOM   10228 C C   . THR D 1 78  ? 53.647 18.509  -66.943 1.00 62.26  ? 75  THR D C   1 
ATOM   10229 O O   . THR D 1 78  ? 53.354 18.534  -65.744 1.00 67.31  ? 75  THR D O   1 
ATOM   10230 C CB  . THR D 1 78  ? 51.850 19.122  -68.557 1.00 65.17  ? 75  THR D CB  1 
ATOM   10231 O OG1 . THR D 1 78  ? 50.868 19.534  -67.598 1.00 66.33  ? 75  THR D OG1 1 
ATOM   10232 C CG2 . THR D 1 78  ? 51.156 18.703  -69.848 1.00 60.19  ? 75  THR D CG2 1 
ATOM   10233 N N   . ILE D 1 79  ? 54.805 18.956  -67.428 1.00 60.36  ? 76  ILE D N   1 
ATOM   10234 C CA  . ILE D 1 79  ? 55.788 19.623  -66.584 1.00 64.41  ? 76  ILE D CA  1 
ATOM   10235 C C   . ILE D 1 79  ? 55.248 20.982  -66.158 1.00 73.78  ? 76  ILE D C   1 
ATOM   10236 O O   . ILE D 1 79  ? 54.778 21.768  -66.991 1.00 69.96  ? 76  ILE D O   1 
ATOM   10237 C CB  . ILE D 1 79  ? 57.114 19.792  -67.341 1.00 64.08  ? 76  ILE D CB  1 
ATOM   10238 C CG1 . ILE D 1 79  ? 57.848 18.463  -67.505 1.00 63.80  ? 76  ILE D CG1 1 
ATOM   10239 C CG2 . ILE D 1 79  ? 57.992 20.831  -66.661 1.00 65.23  ? 76  ILE D CG2 1 
ATOM   10240 C CD1 . ILE D 1 79  ? 58.996 18.544  -68.496 1.00 60.83  ? 76  ILE D CD1 1 
ATOM   10241 N N   . THR D 1 80  ? 55.329 21.280  -64.862 1.00 74.90  ? 77  THR D N   1 
ATOM   10242 C CA  . THR D 1 80  ? 55.043 22.632  -64.404 1.00 73.91  ? 77  THR D CA  1 
ATOM   10243 C C   . THR D 1 80  ? 56.349 23.348  -64.108 1.00 75.37  ? 77  THR D C   1 
ATOM   10244 O O   . THR D 1 80  ? 57.133 22.872  -63.270 1.00 67.95  ? 77  THR D O   1 
ATOM   10245 C CB  . THR D 1 80  ? 54.146 22.629  -63.173 1.00 72.76  ? 77  THR D CB  1 
ATOM   10246 O OG1 . THR D 1 80  ? 52.860 22.098  -63.516 1.00 75.94  ? 77  THR D OG1 1 
ATOM   10247 C CG2 . THR D 1 80  ? 53.987 24.044  -62.646 1.00 73.25  ? 77  THR D CG2 1 
ATOM   10248 N N   . PRO D 1 81  ? 56.607 24.488  -64.747 1.00 82.44  ? 78  PRO D N   1 
ATOM   10249 C CA  . PRO D 1 81  ? 57.966 25.052  -64.755 1.00 77.79  ? 78  PRO D CA  1 
ATOM   10250 C C   . PRO D 1 81  ? 58.420 25.536  -63.384 1.00 80.75  ? 78  PRO D C   1 
ATOM   10251 O O   . PRO D 1 81  ? 57.631 26.059  -62.595 1.00 80.96  ? 78  PRO D O   1 
ATOM   10252 C CB  . PRO D 1 81  ? 57.855 26.212  -65.753 1.00 77.84  ? 78  PRO D CB  1 
ATOM   10253 C CG  . PRO D 1 81  ? 56.700 25.843  -66.636 1.00 74.11  ? 78  PRO D CG  1 
ATOM   10254 C CD  . PRO D 1 81  ? 55.726 25.158  -65.719 1.00 72.97  ? 78  PRO D CD  1 
ATOM   10255 N N   . ASP D 1 82  ? 59.708 25.338  -63.101 1.00 80.17  ? 79  ASP D N   1 
ATOM   10256 C CA  . ASP D 1 82  ? 60.360 25.932  -61.939 1.00 81.29  ? 79  ASP D CA  1 
ATOM   10257 C C   . ASP D 1 82  ? 61.743 26.421  -62.370 1.00 82.24  ? 79  ASP D C   1 
ATOM   10258 O O   . ASP D 1 82  ? 62.049 26.498  -63.564 1.00 85.36  ? 79  ASP D O   1 
ATOM   10259 C CB  . ASP D 1 82  ? 60.426 24.949  -60.760 1.00 82.74  ? 79  ASP D CB  1 
ATOM   10260 C CG  . ASP D 1 82  ? 60.975 23.593  -61.151 1.00 81.15  ? 79  ASP D CG  1 
ATOM   10261 O OD1 . ASP D 1 82  ? 61.884 23.529  -62.004 1.00 83.73  ? 79  ASP D OD1 1 
ATOM   10262 O OD2 . ASP D 1 82  ? 60.502 22.585  -60.586 1.00 79.51  ? 79  ASP D OD2 1 
ATOM   10263 N N   . GLU D 1 83  ? 62.576 26.773  -61.382 1.00 79.80  ? 80  GLU D N   1 
ATOM   10264 C CA  . GLU D 1 83  ? 63.914 27.284  -61.671 1.00 83.59  ? 80  GLU D CA  1 
ATOM   10265 C C   . GLU D 1 83  ? 64.743 26.281  -62.461 1.00 85.96  ? 80  GLU D C   1 
ATOM   10266 O O   . GLU D 1 83  ? 65.577 26.673  -63.285 1.00 87.30  ? 80  GLU D O   1 
ATOM   10267 C CB  . GLU D 1 83  ? 64.643 27.634  -60.373 1.00 83.13  ? 80  GLU D CB  1 
ATOM   10268 C CG  . GLU D 1 83  ? 63.940 28.641  -59.487 1.00 87.04  ? 80  GLU D CG  1 
ATOM   10269 C CD  . GLU D 1 83  ? 64.703 28.912  -58.204 1.00 95.54  ? 80  GLU D CD  1 
ATOM   10270 O OE1 . GLU D 1 83  ? 65.943 28.757  -58.205 1.00 97.35  ? 80  GLU D OE1 1 
ATOM   10271 O OE2 . GLU D 1 83  ? 64.064 29.273  -57.193 1.00 95.78  ? 80  GLU D OE2 1 
ATOM   10272 N N   . LYS D 1 84  ? 64.541 24.988  -62.209 1.00 86.68  ? 81  LYS D N   1 
ATOM   10273 C CA  . LYS D 1 84  ? 65.276 23.964  -62.940 1.00 81.23  ? 81  LYS D CA  1 
ATOM   10274 C C   . LYS D 1 84  ? 64.756 23.838  -64.366 1.00 78.92  ? 81  LYS D C   1 
ATOM   10275 O O   . LYS D 1 84  ? 65.537 23.812  -65.325 1.00 79.48  ? 81  LYS D O   1 
ATOM   10276 C CB  . LYS D 1 84  ? 65.164 22.631  -62.201 1.00 79.71  ? 81  LYS D CB  1 
ATOM   10277 C CG  . LYS D 1 84  ? 66.472 21.890  -62.004 1.00 84.35  ? 81  LYS D CG  1 
ATOM   10278 C CD  . LYS D 1 84  ? 66.209 20.522  -61.395 1.00 94.20  ? 81  LYS D CD  1 
ATOM   10279 C CE  . LYS D 1 84  ? 67.490 19.723  -61.237 1.00 87.68  ? 81  LYS D CE  1 
ATOM   10280 N NZ  . LYS D 1 84  ? 67.220 18.309  -60.854 1.00 81.09  ? 81  LYS D NZ  1 
ATOM   10281 N N   . ARG D 1 85  ? 63.431 23.770  -64.522 1.00 76.87  ? 82  ARG D N   1 
ATOM   10282 C CA  . ARG D 1 85  ? 62.842 23.547  -65.839 1.00 80.62  ? 82  ARG D CA  1 
ATOM   10283 C C   . ARG D 1 85  ? 63.178 24.679  -66.801 1.00 86.37  ? 82  ARG D C   1 
ATOM   10284 O O   . ARG D 1 85  ? 63.495 24.435  -67.972 1.00 85.27  ? 82  ARG D O   1 
ATOM   10285 C CB  . ARG D 1 85  ? 61.328 23.385  -65.714 1.00 76.42  ? 82  ARG D CB  1 
ATOM   10286 C CG  . ARG D 1 85  ? 60.888 22.244  -64.808 1.00 71.55  ? 82  ARG D CG  1 
ATOM   10287 C CD  . ARG D 1 85  ? 61.472 20.914  -65.251 1.00 72.73  ? 82  ARG D CD  1 
ATOM   10288 N NE  . ARG D 1 85  ? 60.564 19.811  -64.951 1.00 75.01  ? 82  ARG D NE  1 
ATOM   10289 C CZ  . ARG D 1 85  ? 60.802 18.541  -65.259 1.00 69.35  ? 82  ARG D CZ  1 
ATOM   10290 N NH1 . ARG D 1 85  ? 61.923 18.209  -65.883 1.00 72.36  ? 82  ARG D NH1 1 
ATOM   10291 N NH2 . ARG D 1 85  ? 59.916 17.603  -64.950 1.00 64.67  ? 82  ARG D NH2 1 
ATOM   10292 N N   . VAL D 1 86  ? 63.116 25.925  -66.327 1.00 85.69  ? 83  VAL D N   1 
ATOM   10293 C CA  . VAL D 1 86  ? 63.451 27.053  -67.190 1.00 85.66  ? 83  VAL D CA  1 
ATOM   10294 C C   . VAL D 1 86  ? 64.920 27.001  -67.589 1.00 84.48  ? 83  VAL D C   1 
ATOM   10295 O O   . VAL D 1 86  ? 65.279 27.357  -68.718 1.00 81.11  ? 83  VAL D O   1 
ATOM   10296 C CB  . VAL D 1 86  ? 63.087 28.385  -66.501 1.00 83.04  ? 83  VAL D CB  1 
ATOM   10297 C CG1 . VAL D 1 86  ? 63.841 28.536  -65.196 1.00 82.74  ? 83  VAL D CG1 1 
ATOM   10298 C CG2 . VAL D 1 86  ? 63.374 29.557  -67.420 1.00 83.41  ? 83  VAL D CG2 1 
ATOM   10299 N N   . GLU D 1 87  ? 65.786 26.540  -66.688 1.00 84.81  ? 84  GLU D N   1 
ATOM   10300 C CA  . GLU D 1 87  ? 67.198 26.345  -66.993 1.00 82.42  ? 84  GLU D CA  1 
ATOM   10301 C C   . GLU D 1 87  ? 67.458 25.040  -67.737 1.00 84.38  ? 84  GLU D C   1 
ATOM   10302 O O   . GLU D 1 87  ? 68.613 24.742  -68.059 1.00 87.59  ? 84  GLU D O   1 
ATOM   10303 C CB  . GLU D 1 87  ? 68.017 26.394  -65.699 1.00 86.77  ? 84  GLU D CB  1 
ATOM   10304 C CG  . GLU D 1 87  ? 69.492 26.724  -65.890 1.00 90.97  ? 84  GLU D CG  1 
ATOM   10305 C CD  . GLU D 1 87  ? 69.701 28.027  -66.638 1.00 96.40  ? 84  GLU D CD  1 
ATOM   10306 O OE1 . GLU D 1 87  ? 69.594 29.097  -66.003 1.00 94.37  ? 84  GLU D OE1 1 
ATOM   10307 O OE2 . GLU D 1 87  ? 69.970 27.981  -67.858 1.00 100.37 ? 84  GLU D OE2 1 
ATOM   10308 N N   . GLU D 1 88  ? 66.412 24.265  -68.020 1.00 84.58  ? 85  GLU D N   1 
ATOM   10309 C CA  . GLU D 1 88  ? 66.501 23.041  -68.806 1.00 83.88  ? 85  GLU D CA  1 
ATOM   10310 C C   . GLU D 1 88  ? 66.059 23.243  -70.249 1.00 79.43  ? 85  GLU D C   1 
ATOM   10311 O O   . GLU D 1 88  ? 66.652 22.663  -71.164 1.00 77.21  ? 85  GLU D O   1 
ATOM   10312 C CB  . GLU D 1 88  ? 65.654 21.940  -68.156 1.00 84.08  ? 85  GLU D CB  1 
ATOM   10313 C CG  . GLU D 1 88  ? 65.497 20.670  -68.974 1.00 78.10  ? 85  GLU D CG  1 
ATOM   10314 C CD  . GLU D 1 88  ? 64.802 19.573  -68.193 1.00 77.22  ? 85  GLU D CD  1 
ATOM   10315 O OE1 . GLU D 1 88  ? 64.660 19.726  -66.961 1.00 73.53  ? 85  GLU D OE1 1 
ATOM   10316 O OE2 . GLU D 1 88  ? 64.406 18.558  -68.804 1.00 75.52  ? 85  GLU D OE2 1 
ATOM   10317 N N   . PHE D 1 89  ? 65.036 24.070  -70.468 1.00 83.94  ? 86  PHE D N   1 
ATOM   10318 C CA  . PHE D 1 89  ? 64.497 24.328  -71.798 1.00 90.52  ? 86  PHE D CA  1 
ATOM   10319 C C   . PHE D 1 89  ? 64.715 25.768  -72.247 1.00 92.79  ? 86  PHE D C   1 
ATOM   10320 O O   . PHE D 1 89  ? 64.195 26.161  -73.298 1.00 95.11  ? 86  PHE D O   1 
ATOM   10321 C CB  . PHE D 1 89  ? 63.003 23.989  -71.830 1.00 90.47  ? 86  PHE D CB  1 
ATOM   10322 C CG  . PHE D 1 89  ? 62.694 22.595  -71.368 1.00 86.39  ? 86  PHE D CG  1 
ATOM   10323 C CD1 . PHE D 1 89  ? 62.876 21.515  -72.215 1.00 83.36  ? 86  PHE D CD1 1 
ATOM   10324 C CD2 . PHE D 1 89  ? 62.243 22.363  -70.078 1.00 82.69  ? 86  PHE D CD2 1 
ATOM   10325 C CE1 . PHE D 1 89  ? 62.602 20.227  -71.788 1.00 79.99  ? 86  PHE D CE1 1 
ATOM   10326 C CE2 . PHE D 1 89  ? 61.968 21.078  -69.645 1.00 80.35  ? 86  PHE D CE2 1 
ATOM   10327 C CZ  . PHE D 1 89  ? 62.147 20.009  -70.501 1.00 77.25  ? 86  PHE D CZ  1 
ATOM   10328 N N   . LYS D 1 90  ? 65.474 26.559  -71.483 1.00 91.36  ? 87  LYS D N   1 
ATOM   10329 C CA  . LYS D 1 90  ? 65.707 27.974  -71.784 1.00 94.13  ? 87  LYS D CA  1 
ATOM   10330 C C   . LYS D 1 90  ? 64.384 28.715  -71.964 1.00 94.90  ? 87  LYS D C   1 
ATOM   10331 O O   . LYS D 1 90  ? 64.215 29.514  -72.888 1.00 93.47  ? 87  LYS D O   1 
ATOM   10332 C CB  . LYS D 1 90  ? 66.597 28.137  -73.020 1.00 93.14  ? 87  LYS D CB  1 
ATOM   10333 C CG  . LYS D 1 90  ? 67.880 27.317  -72.982 1.00 90.08  ? 87  LYS D CG  1 
ATOM   10334 C CD  . LYS D 1 90  ? 69.002 28.041  -72.249 1.00 94.08  ? 87  LYS D CD  1 
ATOM   10335 C CE  . LYS D 1 90  ? 70.334 27.325  -72.437 1.00 95.64  ? 87  LYS D CE  1 
ATOM   10336 N NZ  . LYS D 1 90  ? 71.496 28.204  -72.126 1.00 96.90  ? 87  LYS D NZ  1 
ATOM   10337 N N   . LEU D 1 91  ? 63.436 28.439  -71.068 1.00 88.70  ? 88  LEU D N   1 
ATOM   10338 C CA  . LEU D 1 91  ? 62.090 28.981  -71.203 1.00 89.90  ? 88  LEU D CA  1 
ATOM   10339 C C   . LEU D 1 91  ? 62.118 30.504  -71.218 1.00 92.22  ? 88  LEU D C   1 
ATOM   10340 O O   . LEU D 1 91  ? 62.855 31.137  -70.456 1.00 83.87  ? 88  LEU D O   1 
ATOM   10341 C CB  . LEU D 1 91  ? 61.197 28.478  -70.062 1.00 87.16  ? 88  LEU D CB  1 
ATOM   10342 C CG  . LEU D 1 91  ? 60.910 26.975  -69.969 1.00 86.79  ? 88  LEU D CG  1 
ATOM   10343 C CD1 . LEU D 1 91  ? 59.944 26.677  -68.829 1.00 79.38  ? 88  LEU D CD1 1 
ATOM   10344 C CD2 . LEU D 1 91  ? 60.359 26.444  -71.282 1.00 81.47  ? 88  LEU D CD2 1 
ATOM   10345 N N   . LYS D 1 92  ? 61.328 31.090  -72.124 1.00 94.20  ? 89  LYS D N   1 
ATOM   10346 C CA  . LYS D 1 92  ? 61.161 32.540  -72.147 1.00 94.29  ? 89  LYS D CA  1 
ATOM   10347 C C   . LYS D 1 92  ? 60.717 33.056  -70.789 1.00 93.09  ? 89  LYS D C   1 
ATOM   10348 O O   . LYS D 1 92  ? 61.220 34.073  -70.300 1.00 93.60  ? 89  LYS D O   1 
ATOM   10349 C CB  . LYS D 1 92  ? 60.117 32.933  -73.188 1.00 86.01  ? 89  LYS D CB  1 
ATOM   10350 C CG  . LYS D 1 92  ? 60.347 32.443  -74.591 1.00 83.97  ? 89  LYS D CG  1 
ATOM   10351 C CD  . LYS D 1 92  ? 59.148 32.820  -75.440 1.00 82.44  ? 89  LYS D CD  1 
ATOM   10352 C CE  . LYS D 1 92  ? 59.253 32.247  -76.833 1.00 75.07  ? 89  LYS D CE  1 
ATOM   10353 N NZ  . LYS D 1 92  ? 57.950 32.295  -77.550 1.00 74.98  ? 89  LYS D NZ  1 
ATOM   10354 N N   . GLN D 1 93  ? 59.775 32.357  -70.171 1.00 89.79  ? 90  GLN D N   1 
ATOM   10355 C CA  . GLN D 1 93  ? 59.052 32.796  -68.994 1.00 88.93  ? 90  GLN D CA  1 
ATOM   10356 C C   . GLN D 1 93  ? 58.761 31.550  -68.172 1.00 91.98  ? 90  GLN D C   1 
ATOM   10357 O O   . GLN D 1 93  ? 58.598 30.458  -68.726 1.00 88.46  ? 90  GLN D O   1 
ATOM   10358 C CB  . GLN D 1 93  ? 57.759 33.536  -69.437 1.00 89.69  ? 90  GLN D CB  1 
ATOM   10359 C CG  . GLN D 1 93  ? 56.765 34.024  -68.373 1.00 93.49  ? 90  GLN D CG  1 
ATOM   10360 C CD  . GLN D 1 93  ? 55.822 35.072  -68.966 1.00 88.51  ? 90  GLN D CD  1 
ATOM   10361 O OE1 . GLN D 1 93  ? 54.924 35.589  -68.302 1.00 92.23  ? 90  GLN D OE1 1 
ATOM   10362 N NE2 . GLN D 1 93  ? 56.048 35.398  -70.233 1.00 87.99  ? 90  GLN D NE2 1 
ATOM   10363 N N   . MET D 1 94  ? 58.768 31.687  -66.850 1.00 93.48  ? 91  MET D N   1 
ATOM   10364 C CA  . MET D 1 94  ? 58.343 30.545  -66.046 1.00 85.89  ? 91  MET D CA  1 
ATOM   10365 C C   . MET D 1 94  ? 56.829 30.474  -66.115 1.00 84.18  ? 91  MET D C   1 
ATOM   10366 O O   . MET D 1 94  ? 56.113 31.139  -65.362 1.00 84.54  ? 91  MET D O   1 
ATOM   10367 C CB  . MET D 1 94  ? 58.821 30.641  -64.610 1.00 82.76  ? 91  MET D CB  1 
ATOM   10368 C CG  . MET D 1 94  ? 58.212 29.544  -63.760 1.00 83.86  ? 91  MET D CG  1 
ATOM   10369 S SD  . MET D 1 94  ? 58.655 29.688  -62.035 1.00 82.64  ? 91  MET D SD  1 
ATOM   10370 C CE  . MET D 1 94  ? 60.412 29.406  -62.166 1.00 77.55  ? 91  MET D CE  1 
ATOM   10371 N N   . TRP D 1 95  ? 56.333 29.660  -67.039 1.00 87.97  ? 92  TRP D N   1 
ATOM   10372 C CA  . TRP D 1 95  ? 54.898 29.494  -67.164 1.00 81.50  ? 92  TRP D CA  1 
ATOM   10373 C C   . TRP D 1 95  ? 54.342 28.871  -65.891 1.00 81.68  ? 92  TRP D C   1 
ATOM   10374 O O   . TRP D 1 95  ? 55.064 28.266  -65.093 1.00 80.39  ? 92  TRP D O   1 
ATOM   10375 C CB  . TRP D 1 95  ? 54.565 28.631  -68.379 1.00 77.91  ? 92  TRP D CB  1 
ATOM   10376 C CG  . TRP D 1 95  ? 55.315 29.047  -69.600 1.00 86.53  ? 92  TRP D CG  1 
ATOM   10377 C CD1 . TRP D 1 95  ? 56.393 28.418  -70.151 1.00 85.60  ? 92  TRP D CD1 1 
ATOM   10378 C CD2 . TRP D 1 95  ? 55.057 30.194  -70.419 1.00 91.15  ? 92  TRP D CD2 1 
ATOM   10379 N NE1 . TRP D 1 95  ? 56.818 29.098  -71.266 1.00 91.20  ? 92  TRP D NE1 1 
ATOM   10380 C CE2 . TRP D 1 95  ? 56.015 30.192  -71.453 1.00 93.58  ? 92  TRP D CE2 1 
ATOM   10381 C CE3 . TRP D 1 95  ? 54.107 31.220  -70.381 1.00 85.75  ? 92  TRP D CE3 1 
ATOM   10382 C CZ2 . TRP D 1 95  ? 56.050 31.175  -72.440 1.00 88.77  ? 92  TRP D CZ2 1 
ATOM   10383 C CZ3 . TRP D 1 95  ? 54.144 32.195  -71.363 1.00 88.56  ? 92  TRP D CZ3 1 
ATOM   10384 C CH2 . TRP D 1 95  ? 55.109 32.166  -72.377 1.00 90.05  ? 92  TRP D CH2 1 
ATOM   10385 N N   . LYS D 1 96  ? 53.047 29.055  -65.688 1.00 78.82  ? 93  LYS D N   1 
ATOM   10386 C CA  . LYS D 1 96  ? 52.370 28.507  -64.526 1.00 83.61  ? 93  LYS D CA  1 
ATOM   10387 C C   . LYS D 1 96  ? 51.715 27.182  -64.890 1.00 79.38  ? 93  LYS D C   1 
ATOM   10388 O O   . LYS D 1 96  ? 51.586 26.831  -66.066 1.00 76.94  ? 93  LYS D O   1 
ATOM   10389 C CB  . LYS D 1 96  ? 51.337 29.496  -63.982 1.00 78.06  ? 93  LYS D CB  1 
ATOM   10390 C CG  . LYS D 1 96  ? 51.972 30.770  -63.448 1.00 80.73  ? 93  LYS D CG  1 
ATOM   10391 C CD  . LYS D 1 96  ? 51.004 31.587  -62.613 1.00 87.46  ? 93  LYS D CD  1 
ATOM   10392 C CE  . LYS D 1 96  ? 50.925 31.061  -61.188 1.00 80.56  ? 93  LYS D CE  1 
ATOM   10393 N NZ  . LYS D 1 96  ? 51.497 32.027  -60.207 1.00 84.70  ? 93  LYS D NZ  1 
ATOM   10394 N N   . SER D 1 97  ? 51.317 26.443  -63.859 1.00 76.17  ? 94  SER D N   1 
ATOM   10395 C CA  . SER D 1 97  ? 50.818 25.088  -64.026 1.00 74.30  ? 94  SER D CA  1 
ATOM   10396 C C   . SER D 1 97  ? 49.701 25.057  -65.065 1.00 74.98  ? 94  SER D C   1 
ATOM   10397 O O   . SER D 1 97  ? 48.667 25.719  -64.874 1.00 70.94  ? 94  SER D O   1 
ATOM   10398 C CB  . SER D 1 97  ? 50.306 24.536  -62.699 1.00 74.89  ? 94  SER D CB  1 
ATOM   10399 O OG  . SER D 1 97  ? 49.783 23.231  -62.878 1.00 81.08  ? 94  SER D OG  1 
ATOM   10400 N N   . PRO D 1 98  ? 49.871 24.325  -66.173 1.00 71.78  ? 95  PRO D N   1 
ATOM   10401 C CA  . PRO D 1 98  ? 48.779 24.230  -67.153 1.00 68.24  ? 95  PRO D CA  1 
ATOM   10402 C C   . PRO D 1 98  ? 47.476 23.810  -66.510 1.00 69.76  ? 95  PRO D C   1 
ATOM   10403 O O   . PRO D 1 98  ? 46.405 24.297  -66.891 1.00 71.48  ? 95  PRO D O   1 
ATOM   10404 C CB  . PRO D 1 98  ? 49.283 23.173  -68.145 1.00 68.65  ? 95  PRO D CB  1 
ATOM   10405 C CG  . PRO D 1 98  ? 50.756 23.193  -68.014 1.00 68.69  ? 95  PRO D CG  1 
ATOM   10406 C CD  . PRO D 1 98  ? 51.054 23.545  -66.579 1.00 72.29  ? 95  PRO D CD  1 
ATOM   10407 N N   . ASN D 1 99  ? 47.555 22.935  -65.505 1.00 73.46  ? 96  ASN D N   1 
ATOM   10408 C CA  . ASN D 1 99  ? 46.357 22.457  -64.828 1.00 72.33  ? 96  ASN D CA  1 
ATOM   10409 C C   . ASN D 1 99  ? 45.644 23.585  -64.094 1.00 71.57  ? 96  ASN D C   1 
ATOM   10410 O O   . ASN D 1 99  ? 44.409 23.623  -64.055 1.00 74.41  ? 96  ASN D O   1 
ATOM   10411 C CB  . ASN D 1 99  ? 46.732 21.331  -63.868 1.00 75.38  ? 96  ASN D CB  1 
ATOM   10412 C CG  . ASN D 1 99  ? 47.615 20.284  -64.522 1.00 73.75  ? 96  ASN D CG  1 
ATOM   10413 O OD1 . ASN D 1 99  ? 47.123 19.325  -65.116 1.00 68.14  ? 96  ASN D OD1 1 
ATOM   10414 N ND2 . ASN D 1 99  ? 48.927 20.484  -64.445 1.00 72.47  ? 96  ASN D ND2 1 
ATOM   10415 N N   . GLY D 1 100 ? 46.404 24.519  -63.514 1.00 71.99  ? 97  GLY D N   1 
ATOM   10416 C CA  . GLY D 1 100 ? 45.781 25.673  -62.890 1.00 74.21  ? 97  GLY D CA  1 
ATOM   10417 C C   . GLY D 1 100 ? 45.052 26.546  -63.894 1.00 76.57  ? 97  GLY D C   1 
ATOM   10418 O O   . GLY D 1 100 ? 43.982 27.088  -63.602 1.00 76.68  ? 97  GLY D O   1 
ATOM   10419 N N   . THR D 1 101 ? 45.616 26.682  -65.096 1.00 72.01  ? 98  THR D N   1 
ATOM   10420 C CA  . THR D 1 101 ? 44.961 27.453  -66.146 1.00 71.06  ? 98  THR D CA  1 
ATOM   10421 C C   . THR D 1 101 ? 43.636 26.818  -66.546 1.00 72.23  ? 98  THR D C   1 
ATOM   10422 O O   . THR D 1 101 ? 42.596 27.484  -66.565 1.00 74.66  ? 98  THR D O   1 
ATOM   10423 C CB  . THR D 1 101 ? 45.892 27.575  -67.351 1.00 66.83  ? 98  THR D CB  1 
ATOM   10424 O OG1 . THR D 1 101 ? 47.071 28.295  -66.971 1.00 65.97  ? 98  THR D OG1 1 
ATOM   10425 C CG2 . THR D 1 101 ? 45.200 28.304  -68.492 1.00 70.01  ? 98  THR D CG2 1 
ATOM   10426 N N   . ILE D 1 102 ? 43.655 25.519  -66.852 1.00 72.03  ? 99  ILE D N   1 
ATOM   10427 C CA  . ILE D 1 102 ? 42.435 24.829  -67.263 1.00 71.15  ? 99  ILE D CA  1 
ATOM   10428 C C   . ILE D 1 102 ? 41.422 24.808  -66.127 1.00 76.96  ? 99  ILE D C   1 
ATOM   10429 O O   . ILE D 1 102 ? 40.228 25.060  -66.335 1.00 76.81  ? 99  ILE D O   1 
ATOM   10430 C CB  . ILE D 1 102 ? 42.758 23.403  -67.745 1.00 72.93  ? 99  ILE D CB  1 
ATOM   10431 C CG1 . ILE D 1 102 ? 43.998 23.393  -68.633 1.00 73.78  ? 99  ILE D CG1 1 
ATOM   10432 C CG2 . ILE D 1 102 ? 41.575 22.813  -68.490 1.00 67.11  ? 99  ILE D CG2 1 
ATOM   10433 C CD1 . ILE D 1 102 ? 44.708 22.063  -68.644 1.00 72.04  ? 99  ILE D CD1 1 
ATOM   10434 N N   . ARG D 1 103 ? 41.881 24.501  -64.909 1.00 75.44  ? 100 ARG D N   1 
ATOM   10435 C CA  . ARG D 1 103 ? 40.978 24.434  -63.764 1.00 76.20  ? 100 ARG D CA  1 
ATOM   10436 C C   . ARG D 1 103 ? 40.272 25.767  -63.546 1.00 80.65  ? 100 ARG D C   1 
ATOM   10437 O O   . ARG D 1 103 ? 39.099 25.803  -63.156 1.00 79.29  ? 100 ARG D O   1 
ATOM   10438 C CB  . ARG D 1 103 ? 41.759 24.016  -62.518 1.00 73.59  ? 100 ARG D CB  1 
ATOM   10439 C CG  . ARG D 1 103 ? 40.921 23.774  -61.280 1.00 77.75  ? 100 ARG D CG  1 
ATOM   10440 C CD  . ARG D 1 103 ? 41.798 23.391  -60.090 1.00 76.30  ? 100 ARG D CD  1 
ATOM   10441 N NE  . ARG D 1 103 ? 42.576 22.171  -60.314 1.00 79.02  ? 100 ARG D NE  1 
ATOM   10442 C CZ  . ARG D 1 103 ? 43.900 22.132  -60.456 1.00 73.30  ? 100 ARG D CZ  1 
ATOM   10443 N NH1 . ARG D 1 103 ? 44.515 20.972  -60.649 1.00 64.43  ? 100 ARG D NH1 1 
ATOM   10444 N NH2 . ARG D 1 103 ? 44.611 23.250  -60.402 1.00 66.75  ? 100 ARG D NH2 1 
ATOM   10445 N N   . ASN D 1 104 ? 40.966 26.874  -63.814 1.00 80.05  ? 101 ASN D N   1 
ATOM   10446 C CA  . ASN D 1 104 ? 40.346 28.188  -63.695 1.00 81.62  ? 101 ASN D CA  1 
ATOM   10447 C C   . ASN D 1 104 ? 39.328 28.424  -64.805 1.00 82.20  ? 101 ASN D C   1 
ATOM   10448 O O   . ASN D 1 104 ? 38.210 28.888  -64.550 1.00 86.35  ? 101 ASN D O   1 
ATOM   10449 C CB  . ASN D 1 104 ? 41.423 29.272  -63.716 1.00 79.96  ? 101 ASN D CB  1 
ATOM   10450 C CG  . ASN D 1 104 ? 40.897 30.601  -64.217 1.00 83.60  ? 101 ASN D CG  1 
ATOM   10451 O OD1 . ASN D 1 104 ? 41.001 30.915  -65.403 1.00 83.81  ? 101 ASN D OD1 1 
ATOM   10452 N ND2 . ASN D 1 104 ? 40.337 31.396  -63.312 1.00 83.86  ? 101 ASN D ND2 1 
ATOM   10453 N N   . ILE D 1 105 ? 39.699 28.109  -66.045 1.00 81.70  ? 102 ILE D N   1 
ATOM   10454 C CA  . ILE D 1 105 ? 38.858 28.462  -67.184 1.00 72.20  ? 102 ILE D CA  1 
ATOM   10455 C C   . ILE D 1 105 ? 37.574 27.643  -67.183 1.00 75.18  ? 102 ILE D C   1 
ATOM   10456 O O   . ILE D 1 105 ? 36.501 28.145  -67.541 1.00 78.00  ? 102 ILE D O   1 
ATOM   10457 C CB  . ILE D 1 105 ? 39.649 28.294  -68.494 1.00 78.63  ? 102 ILE D CB  1 
ATOM   10458 C CG1 . ILE D 1 105 ? 40.826 29.269  -68.517 1.00 73.73  ? 102 ILE D CG1 1 
ATOM   10459 C CG2 . ILE D 1 105 ? 38.746 28.489  -69.701 1.00 72.32  ? 102 ILE D CG2 1 
ATOM   10460 C CD1 . ILE D 1 105 ? 41.735 29.093  -69.701 1.00 69.49  ? 102 ILE D CD1 1 
ATOM   10461 N N   . LEU D 1 106 ? 37.652 26.383  -66.771 1.00 73.00  ? 103 LEU D N   1 
ATOM   10462 C CA  . LEU D 1 106 ? 36.467 25.537  -66.749 1.00 72.45  ? 103 LEU D CA  1 
ATOM   10463 C C   . LEU D 1 106 ? 35.721 25.621  -65.425 1.00 70.97  ? 103 LEU D C   1 
ATOM   10464 O O   . LEU D 1 106 ? 34.487 25.573  -65.407 1.00 68.99  ? 103 LEU D O   1 
ATOM   10465 C CB  . LEU D 1 106 ? 36.846 24.079  -67.035 1.00 69.86  ? 103 LEU D CB  1 
ATOM   10466 C CG  . LEU D 1 106 ? 37.273 23.612  -68.431 1.00 77.27  ? 103 LEU D CG  1 
ATOM   10467 C CD1 . LEU D 1 106 ? 38.415 24.414  -69.050 1.00 75.44  ? 103 LEU D CD1 1 
ATOM   10468 C CD2 . LEU D 1 106 ? 37.641 22.140  -68.349 1.00 70.47  ? 103 LEU D CD2 1 
ATOM   10469 N N   . GLY D 1 107 ? 36.443 25.749  -64.320 1.00 74.17  ? 104 GLY D N   1 
ATOM   10470 C CA  . GLY D 1 107 ? 35.813 25.636  -63.028 1.00 65.86  ? 104 GLY D CA  1 
ATOM   10471 C C   . GLY D 1 107 ? 35.450 24.189  -62.729 1.00 66.25  ? 104 GLY D C   1 
ATOM   10472 O O   . GLY D 1 107 ? 35.812 23.252  -63.445 1.00 71.11  ? 104 GLY D O   1 
ATOM   10473 N N   . GLY D 1 108 ? 34.714 24.024  -61.643 1.00 67.29  ? 105 GLY D N   1 
ATOM   10474 C CA  . GLY D 1 108 ? 34.296 22.710  -61.212 1.00 63.69  ? 105 GLY D CA  1 
ATOM   10475 C C   . GLY D 1 108 ? 35.161 22.165  -60.094 1.00 58.63  ? 105 GLY D C   1 
ATOM   10476 O O   . GLY D 1 108 ? 36.013 22.847  -59.515 1.00 57.64  ? 105 GLY D O   1 
ATOM   10477 N N   . THR D 1 109 ? 34.935 20.885  -59.806 1.00 60.56  ? 106 THR D N   1 
ATOM   10478 C CA  . THR D 1 109 ? 35.511 20.219  -58.648 1.00 57.20  ? 106 THR D CA  1 
ATOM   10479 C C   . THR D 1 109 ? 36.277 18.979  -59.085 1.00 59.11  ? 106 THR D C   1 
ATOM   10480 O O   . THR D 1 109 ? 35.766 18.168  -59.865 1.00 57.27  ? 106 THR D O   1 
ATOM   10481 C CB  . THR D 1 109 ? 34.417 19.840  -57.646 1.00 49.51  ? 106 THR D CB  1 
ATOM   10482 O OG1 . THR D 1 109 ? 33.764 21.027  -57.181 1.00 56.34  ? 106 THR D OG1 1 
ATOM   10483 C CG2 . THR D 1 109 ? 35.009 19.097  -56.462 1.00 52.57  ? 106 THR D CG2 1 
ATOM   10484 N N   . VAL D 1 110 ? 37.493 18.835  -58.570 1.00 52.67  ? 107 VAL D N   1 
ATOM   10485 C CA  . VAL D 1 110 ? 38.346 17.692  -58.875 1.00 57.57  ? 107 VAL D CA  1 
ATOM   10486 C C   . VAL D 1 110 ? 37.971 16.525  -57.969 1.00 55.70  ? 107 VAL D C   1 
ATOM   10487 O O   . VAL D 1 110 ? 37.976 16.652  -56.740 1.00 53.39  ? 107 VAL D O   1 
ATOM   10488 C CB  . VAL D 1 110 ? 39.828 18.057  -58.714 1.00 53.28  ? 107 VAL D CB  1 
ATOM   10489 C CG1 . VAL D 1 110 ? 40.694 16.823  -58.872 1.00 49.91  ? 107 VAL D CG1 1 
ATOM   10490 C CG2 . VAL D 1 110 ? 40.225 19.128  -59.724 1.00 54.92  ? 107 VAL D CG2 1 
ATOM   10491 N N   . PHE D 1 111 ? 37.650 15.387  -58.576 1.00 50.59  ? 108 PHE D N   1 
ATOM   10492 C CA  . PHE D 1 111 ? 37.377 14.149  -57.863 1.00 47.53  ? 108 PHE D CA  1 
ATOM   10493 C C   . PHE D 1 111 ? 38.472 13.137  -58.166 1.00 54.10  ? 108 PHE D C   1 
ATOM   10494 O O   . PHE D 1 111 ? 38.929 13.028  -59.309 1.00 55.62  ? 108 PHE D O   1 
ATOM   10495 C CB  . PHE D 1 111 ? 36.018 13.568  -58.258 1.00 49.03  ? 108 PHE D CB  1 
ATOM   10496 C CG  . PHE D 1 111 ? 34.848 14.348  -57.737 1.00 47.58  ? 108 PHE D CG  1 
ATOM   10497 C CD1 . PHE D 1 111 ? 34.459 15.530  -58.346 1.00 53.62  ? 108 PHE D CD1 1 
ATOM   10498 C CD2 . PHE D 1 111 ? 34.132 13.897  -56.641 1.00 53.74  ? 108 PHE D CD2 1 
ATOM   10499 C CE1 . PHE D 1 111 ? 33.379 16.249  -57.870 1.00 50.97  ? 108 PHE D CE1 1 
ATOM   10500 C CE2 . PHE D 1 111 ? 33.052 14.611  -56.159 1.00 53.42  ? 108 PHE D CE2 1 
ATOM   10501 C CZ  . PHE D 1 111 ? 32.674 15.789  -56.774 1.00 53.22  ? 108 PHE D CZ  1 
ATOM   10502 N N   . ARG D 1 112 ? 38.889 12.397  -57.143 1.00 51.81  ? 109 ARG D N   1 
ATOM   10503 C CA  . ARG D 1 112 ? 39.911 11.370  -57.283 1.00 48.14  ? 109 ARG D CA  1 
ATOM   10504 C C   . ARG D 1 112 ? 39.330 10.003  -56.952 1.00 46.99  ? 109 ARG D C   1 
ATOM   10505 O O   . ARG D 1 112 ? 38.480 9.873   -56.065 1.00 44.37  ? 109 ARG D O   1 
ATOM   10506 C CB  . ARG D 1 112 ? 41.121 11.663  -56.393 1.00 48.15  ? 109 ARG D CB  1 
ATOM   10507 C CG  . ARG D 1 112 ? 41.924 12.865  -56.860 1.00 53.95  ? 109 ARG D CG  1 
ATOM   10508 C CD  . ARG D 1 112 ? 43.140 13.123  -55.990 1.00 60.75  ? 109 ARG D CD  1 
ATOM   10509 N NE  . ARG D 1 112 ? 43.945 14.213  -56.533 1.00 64.06  ? 109 ARG D NE  1 
ATOM   10510 C CZ  . ARG D 1 112 ? 43.797 15.489  -56.196 1.00 61.69  ? 109 ARG D CZ  1 
ATOM   10511 N NH1 . ARG D 1 112 ? 42.876 15.837  -55.307 1.00 55.00  ? 109 ARG D NH1 1 
ATOM   10512 N NH2 . ARG D 1 112 ? 44.569 16.416  -56.744 1.00 61.93  ? 109 ARG D NH2 1 
ATOM   10513 N N   . GLU D 1 113 ? 39.795 8.990   -57.680 1.00 47.92  ? 110 GLU D N   1 
ATOM   10514 C CA  . GLU D 1 113 ? 39.314 7.624   -57.536 1.00 51.08  ? 110 GLU D CA  1 
ATOM   10515 C C   . GLU D 1 113 ? 40.484 6.678   -57.749 1.00 46.06  ? 110 GLU D C   1 
ATOM   10516 O O   . GLU D 1 113 ? 41.208 6.798   -58.742 1.00 48.14  ? 110 GLU D O   1 
ATOM   10517 C CB  . GLU D 1 113 ? 38.190 7.327   -58.540 1.00 49.32  ? 110 GLU D CB  1 
ATOM   10518 C CG  . GLU D 1 113 ? 37.488 5.991   -58.336 1.00 52.54  ? 110 GLU D CG  1 
ATOM   10519 C CD  . GLU D 1 113 ? 36.338 5.782   -59.310 1.00 52.98  ? 110 GLU D CD  1 
ATOM   10520 O OE1 . GLU D 1 113 ? 35.738 4.687   -59.298 1.00 53.74  ? 110 GLU D OE1 1 
ATOM   10521 O OE2 . GLU D 1 113 ? 36.036 6.713   -60.088 1.00 44.77  ? 110 GLU D OE2 1 
ATOM   10522 N N   . ALA D 1 114 ? 40.674 5.756   -56.816 1.00 45.82  ? 111 ALA D N   1 
ATOM   10523 C CA  . ALA D 1 114 ? 41.718 4.754   -56.943 1.00 53.19  ? 111 ALA D CA  1 
ATOM   10524 C C   . ALA D 1 114 ? 41.209 3.557   -57.736 1.00 46.51  ? 111 ALA D C   1 
ATOM   10525 O O   . ALA D 1 114 ? 40.005 3.299   -57.820 1.00 49.82  ? 111 ALA D O   1 
ATOM   10526 C CB  . ALA D 1 114 ? 42.212 4.299   -55.571 1.00 41.09  ? 111 ALA D CB  1 
ATOM   10527 N N   . ILE D 1 115 ? 42.148 2.826   -58.328 1.00 46.89  ? 112 ILE D N   1 
ATOM   10528 C CA  . ILE D 1 115 ? 41.850 1.594   -59.047 1.00 51.14  ? 112 ILE D CA  1 
ATOM   10529 C C   . ILE D 1 115 ? 42.204 0.429   -58.133 1.00 51.85  ? 112 ILE D C   1 
ATOM   10530 O O   . ILE D 1 115 ? 43.365 0.268   -57.735 1.00 54.12  ? 112 ILE D O   1 
ATOM   10531 C CB  . ILE D 1 115 ? 42.610 1.508   -60.381 1.00 48.94  ? 112 ILE D CB  1 
ATOM   10532 C CG1 . ILE D 1 115 ? 42.110 2.560   -61.373 1.00 48.27  ? 112 ILE D CG1 1 
ATOM   10533 C CG2 . ILE D 1 115 ? 42.452 0.124   -60.989 1.00 48.47  ? 112 ILE D CG2 1 
ATOM   10534 C CD1 . ILE D 1 115 ? 42.820 3.894   -61.292 1.00 48.53  ? 112 ILE D CD1 1 
ATOM   10535 N N   . ILE D 1 116 ? 41.204 -0.378  -57.797 1.00 54.22  ? 113 ILE D N   1 
ATOM   10536 C CA  . ILE D 1 116 ? 41.347 -1.463  -56.836 1.00 48.27  ? 113 ILE D CA  1 
ATOM   10537 C C   . ILE D 1 116 ? 41.499 -2.777  -57.586 1.00 44.81  ? 113 ILE D C   1 
ATOM   10538 O O   . ILE D 1 116 ? 40.711 -3.084  -58.489 1.00 52.56  ? 113 ILE D O   1 
ATOM   10539 C CB  . ILE D 1 116 ? 40.143 -1.514  -55.879 1.00 53.66  ? 113 ILE D CB  1 
ATOM   10540 C CG1 . ILE D 1 116 ? 40.086 -0.244  -55.032 1.00 58.54  ? 113 ILE D CG1 1 
ATOM   10541 C CG2 . ILE D 1 116 ? 40.203 -2.758  -55.011 1.00 57.08  ? 113 ILE D CG2 1 
ATOM   10542 C CD1 . ILE D 1 116 ? 41.424 0.154   -54.443 1.00 50.97  ? 113 ILE D CD1 1 
ATOM   10543 N N   . CYS D 1 117 ? 42.517 -3.548  -57.216 1.00 48.22  ? 114 CYS D N   1 
ATOM   10544 C CA  . CYS D 1 117 ? 42.710 -4.899  -57.713 1.00 45.98  ? 114 CYS D CA  1 
ATOM   10545 C C   . CYS D 1 117 ? 42.660 -5.870  -56.543 1.00 51.10  ? 114 CYS D C   1 
ATOM   10546 O O   . CYS D 1 117 ? 43.070 -5.540  -55.425 1.00 52.28  ? 114 CYS D O   1 
ATOM   10547 C CB  . CYS D 1 117 ? 44.037 -5.041  -58.462 1.00 36.26  ? 114 CYS D CB  1 
ATOM   10548 S SG  . CYS D 1 117 ? 44.264 -3.835  -59.778 1.00 43.34  ? 114 CYS D SG  1 
ATOM   10549 N N   . LYS D 1 118 ? 42.149 -7.074  -56.816 1.00 54.90  ? 115 LYS D N   1 
ATOM   10550 C CA  . LYS D 1 118 ? 41.948 -8.061  -55.758 1.00 54.18  ? 115 LYS D CA  1 
ATOM   10551 C C   . LYS D 1 118 ? 43.260 -8.430  -55.077 1.00 52.11  ? 115 LYS D C   1 
ATOM   10552 O O   . LYS D 1 118 ? 43.313 -8.576  -53.850 1.00 45.48  ? 115 LYS D O   1 
ATOM   10553 C CB  . LYS D 1 118 ? 41.278 -9.305  -56.338 1.00 61.20  ? 115 LYS D CB  1 
ATOM   10554 C CG  . LYS D 1 118 ? 40.890 -10.352 -55.311 1.00 59.97  ? 115 LYS D CG  1 
ATOM   10555 C CD  . LYS D 1 118 ? 40.185 -11.519 -55.981 1.00 67.30  ? 115 LYS D CD  1 
ATOM   10556 C CE  . LYS D 1 118 ? 39.510 -12.422 -54.962 1.00 72.89  ? 115 LYS D CE  1 
ATOM   10557 N NZ  . LYS D 1 118 ? 38.669 -13.462 -55.620 1.00 60.45  ? 115 LYS D NZ  1 
ATOM   10558 N N   . ASN D 1 119 ? 44.331 -8.579  -55.850 1.00 52.06  ? 116 ASN D N   1 
ATOM   10559 C CA  . ASN D 1 119 ? 45.611 -9.027  -55.317 1.00 49.88  ? 116 ASN D CA  1 
ATOM   10560 C C   . ASN D 1 119 ? 46.504 -7.888  -54.842 1.00 50.52  ? 116 ASN D C   1 
ATOM   10561 O O   . ASN D 1 119 ? 47.629 -8.150  -54.409 1.00 44.63  ? 116 ASN D O   1 
ATOM   10562 C CB  . ASN D 1 119 ? 46.355 -9.853  -56.369 1.00 45.99  ? 116 ASN D CB  1 
ATOM   10563 C CG  . ASN D 1 119 ? 46.579 -9.085  -57.655 1.00 46.74  ? 116 ASN D CG  1 
ATOM   10564 O OD1 . ASN D 1 119 ? 45.812 -8.184  -57.994 1.00 49.27  ? 116 ASN D OD1 1 
ATOM   10565 N ND2 . ASN D 1 119 ? 47.629 -9.443  -58.383 1.00 42.18  ? 116 ASN D ND2 1 
ATOM   10566 N N   . ILE D 1 120 ? 46.046 -6.645  -54.907 1.00 45.20  ? 117 ILE D N   1 
ATOM   10567 C CA  . ILE D 1 120 ? 46.838 -5.490  -54.488 1.00 49.96  ? 117 ILE D CA  1 
ATOM   10568 C C   . ILE D 1 120 ? 46.326 -5.025  -53.131 1.00 51.92  ? 117 ILE D C   1 
ATOM   10569 O O   . ILE D 1 120 ? 45.147 -4.649  -53.021 1.00 53.57  ? 117 ILE D O   1 
ATOM   10570 C CB  . ILE D 1 120 ? 46.782 -4.357  -55.523 1.00 47.73  ? 117 ILE D CB  1 
ATOM   10571 C CG1 . ILE D 1 120 ? 47.253 -4.869  -56.880 1.00 45.05  ? 117 ILE D CG1 1 
ATOM   10572 C CG2 . ILE D 1 120 ? 47.625 -3.179  -55.061 1.00 33.87  ? 117 ILE D CG2 1 
ATOM   10573 C CD1 . ILE D 1 120 ? 48.670 -5.407  -56.860 1.00 40.30  ? 117 ILE D CD1 1 
ATOM   10574 N N   . PRO D 1 121 ? 47.153 -5.036  -52.084 1.00 52.13  ? 118 PRO D N   1 
ATOM   10575 C CA  . PRO D 1 121 ? 46.665 -4.653  -50.754 1.00 49.51  ? 118 PRO D CA  1 
ATOM   10576 C C   . PRO D 1 121 ? 46.179 -3.213  -50.736 1.00 53.43  ? 118 PRO D C   1 
ATOM   10577 O O   . PRO D 1 121 ? 46.663 -2.360  -51.483 1.00 47.20  ? 118 PRO D O   1 
ATOM   10578 C CB  . PRO D 1 121 ? 47.893 -4.842  -49.855 1.00 48.98  ? 118 PRO D CB  1 
ATOM   10579 C CG  . PRO D 1 121 ? 48.751 -5.823  -50.583 1.00 50.92  ? 118 PRO D CG  1 
ATOM   10580 C CD  . PRO D 1 121 ? 48.547 -5.513  -52.043 1.00 49.35  ? 118 PRO D CD  1 
ATOM   10581 N N   . ARG D 1 122 ? 45.200 -2.955  -49.879 1.00 53.76  ? 119 ARG D N   1 
ATOM   10582 C CA  . ARG D 1 122 ? 44.619 -1.634  -49.722 1.00 53.20  ? 119 ARG D CA  1 
ATOM   10583 C C   . ARG D 1 122 ? 44.860 -1.120  -48.309 1.00 52.97  ? 119 ARG D C   1 
ATOM   10584 O O   . ARG D 1 122 ? 45.180 -1.883  -47.392 1.00 45.63  ? 119 ARG D O   1 
ATOM   10585 C CB  . ARG D 1 122 ? 43.120 -1.660  -50.033 1.00 56.58  ? 119 ARG D CB  1 
ATOM   10586 C CG  . ARG D 1 122 ? 42.824 -1.957  -51.489 1.00 56.23  ? 119 ARG D CG  1 
ATOM   10587 C CD  . ARG D 1 122 ? 41.466 -2.594  -51.663 1.00 52.31  ? 119 ARG D CD  1 
ATOM   10588 N NE  . ARG D 1 122 ? 41.239 -3.688  -50.724 1.00 62.26  ? 119 ARG D NE  1 
ATOM   10589 C CZ  . ARG D 1 122 ? 41.721 -4.918  -50.874 1.00 60.42  ? 119 ARG D CZ  1 
ATOM   10590 N NH1 . ARG D 1 122 ? 41.459 -5.847  -49.965 1.00 64.60  ? 119 ARG D NH1 1 
ATOM   10591 N NH2 . ARG D 1 122 ? 42.463 -5.222  -51.930 1.00 59.63  ? 119 ARG D NH2 1 
ATOM   10592 N N   . LEU D 1 123 ? 44.716 0.199   -48.154 1.00 50.88  ? 120 LEU D N   1 
ATOM   10593 C CA  . LEU D 1 123 ? 44.862 0.818   -46.842 1.00 57.82  ? 120 LEU D CA  1 
ATOM   10594 C C   . LEU D 1 123 ? 43.899 0.191   -45.841 1.00 58.29  ? 120 LEU D C   1 
ATOM   10595 O O   . LEU D 1 123 ? 44.282 -0.147  -44.715 1.00 52.32  ? 120 LEU D O   1 
ATOM   10596 C CB  . LEU D 1 123 ? 44.629 2.325   -46.954 1.00 54.97  ? 120 LEU D CB  1 
ATOM   10597 C CG  . LEU D 1 123 ? 45.473 3.256   -46.082 1.00 49.59  ? 120 LEU D CG  1 
ATOM   10598 C CD1 . LEU D 1 123 ? 46.940 2.860   -46.121 1.00 51.16  ? 120 LEU D CD1 1 
ATOM   10599 C CD2 . LEU D 1 123 ? 45.293 4.698   -46.533 1.00 53.18  ? 120 LEU D CD2 1 
ATOM   10600 N N   . VAL D 1 124 ? 42.643 0.018   -46.244 1.00 55.67  ? 121 VAL D N   1 
ATOM   10601 C CA  . VAL D 1 124 ? 41.634 -0.673  -45.450 1.00 56.13  ? 121 VAL D CA  1 
ATOM   10602 C C   . VAL D 1 124 ? 41.119 -1.837  -46.284 1.00 61.14  ? 121 VAL D C   1 
ATOM   10603 O O   . VAL D 1 124 ? 40.567 -1.629  -47.373 1.00 58.40  ? 121 VAL D O   1 
ATOM   10604 C CB  . VAL D 1 124 ? 40.487 0.263   -45.038 1.00 59.80  ? 121 VAL D CB  1 
ATOM   10605 C CG1 . VAL D 1 124 ? 39.409 -0.508  -44.291 1.00 61.37  ? 121 VAL D CG1 1 
ATOM   10606 C CG2 . VAL D 1 124 ? 41.021 1.405   -44.181 1.00 59.68  ? 121 VAL D CG2 1 
ATOM   10607 N N   . SER D 1 125 ? 41.305 -3.060  -45.776 1.00 57.27  ? 122 SER D N   1 
ATOM   10608 C CA  . SER D 1 125 ? 40.937 -4.244  -46.545 1.00 57.65  ? 122 SER D CA  1 
ATOM   10609 C C   . SER D 1 125 ? 39.451 -4.267  -46.876 1.00 59.92  ? 122 SER D C   1 
ATOM   10610 O O   . SER D 1 125 ? 39.060 -4.767  -47.937 1.00 60.62  ? 122 SER D O   1 
ATOM   10611 C CB  . SER D 1 125 ? 41.324 -5.508  -45.781 1.00 62.37  ? 122 SER D CB  1 
ATOM   10612 O OG  . SER D 1 125 ? 42.587 -5.360  -45.155 1.00 71.03  ? 122 SER D OG  1 
ATOM   10613 N N   . GLY D 1 126 ? 38.609 -3.724  -45.993 1.00 60.29  ? 123 GLY D N   1 
ATOM   10614 C CA  . GLY D 1 126 ? 37.175 -3.737  -46.228 1.00 56.26  ? 123 GLY D CA  1 
ATOM   10615 C C   . GLY D 1 126 ? 36.740 -2.931  -47.434 1.00 60.17  ? 123 GLY D C   1 
ATOM   10616 O O   . GLY D 1 126 ? 35.600 -3.077  -47.888 1.00 56.18  ? 123 GLY D O   1 
ATOM   10617 N N   . TRP D 1 127 ? 37.618 -2.082  -47.962 1.00 57.25  ? 124 TRP D N   1 
ATOM   10618 C CA  . TRP D 1 127 ? 37.320 -1.297  -49.156 1.00 61.78  ? 124 TRP D CA  1 
ATOM   10619 C C   . TRP D 1 127 ? 37.436 -2.203  -50.374 1.00 65.01  ? 124 TRP D C   1 
ATOM   10620 O O   . TRP D 1 127 ? 38.523 -2.394  -50.918 1.00 67.59  ? 124 TRP D O   1 
ATOM   10621 C CB  . TRP D 1 127 ? 38.269 -0.110  -49.271 1.00 57.01  ? 124 TRP D CB  1 
ATOM   10622 C CG  . TRP D 1 127 ? 38.122 0.912   -48.189 1.00 56.82  ? 124 TRP D CG  1 
ATOM   10623 C CD1 . TRP D 1 127 ? 37.109 1.008   -47.278 1.00 57.00  ? 124 TRP D CD1 1 
ATOM   10624 C CD2 . TRP D 1 127 ? 39.024 1.987   -47.900 1.00 56.16  ? 124 TRP D CD2 1 
ATOM   10625 N NE1 . TRP D 1 127 ? 37.324 2.079   -46.444 1.00 51.11  ? 124 TRP D NE1 1 
ATOM   10626 C CE2 . TRP D 1 127 ? 38.494 2.696   -46.804 1.00 50.80  ? 124 TRP D CE2 1 
ATOM   10627 C CE3 . TRP D 1 127 ? 40.230 2.418   -48.463 1.00 53.48  ? 124 TRP D CE3 1 
ATOM   10628 C CZ2 . TRP D 1 127 ? 39.126 3.812   -46.260 1.00 57.37  ? 124 TRP D CZ2 1 
ATOM   10629 C CZ3 . TRP D 1 127 ? 40.857 3.527   -47.922 1.00 53.63  ? 124 TRP D CZ3 1 
ATOM   10630 C CH2 . TRP D 1 127 ? 40.304 4.211   -46.832 1.00 58.60  ? 124 TRP D CH2 1 
ATOM   10631 N N   . VAL D 1 128 ? 36.315 -2.773  -50.809 1.00 62.07  ? 125 VAL D N   1 
ATOM   10632 C CA  . VAL D 1 128 ? 36.302 -3.557  -52.038 1.00 66.47  ? 125 VAL D CA  1 
ATOM   10633 C C   . VAL D 1 128 ? 35.881 -2.724  -53.243 1.00 72.36  ? 125 VAL D C   1 
ATOM   10634 O O   . VAL D 1 128 ? 36.201 -3.100  -54.381 1.00 64.26  ? 125 VAL D O   1 
ATOM   10635 C CB  . VAL D 1 128 ? 35.395 -4.798  -51.898 1.00 69.93  ? 125 VAL D CB  1 
ATOM   10636 C CG1 . VAL D 1 128 ? 36.034 -5.816  -50.969 1.00 74.32  ? 125 VAL D CG1 1 
ATOM   10637 C CG2 . VAL D 1 128 ? 34.016 -4.394  -51.401 1.00 59.62  ? 125 VAL D CG2 1 
ATOM   10638 N N   . LYS D 1 129 ? 35.169 -1.616  -53.031 1.00 64.37  ? 126 LYS D N   1 
ATOM   10639 C CA  . LYS D 1 129 ? 34.834 -0.627  -54.038 1.00 61.72  ? 126 LYS D CA  1 
ATOM   10640 C C   . LYS D 1 129 ? 35.675 0.627   -53.825 1.00 62.77  ? 126 LYS D C   1 
ATOM   10641 O O   . LYS D 1 129 ? 36.015 0.965   -52.686 1.00 56.54  ? 126 LYS D O   1 
ATOM   10642 C CB  . LYS D 1 129 ? 33.351 -0.244  -53.979 1.00 65.88  ? 126 LYS D CB  1 
ATOM   10643 C CG  . LYS D 1 129 ? 32.384 -1.372  -54.291 1.00 70.23  ? 126 LYS D CG  1 
ATOM   10644 C CD  . LYS D 1 129 ? 31.087 -1.197  -53.512 1.00 75.02  ? 126 LYS D CD  1 
ATOM   10645 C CE  . LYS D 1 129 ? 29.995 -2.125  -54.022 1.00 86.69  ? 126 LYS D CE  1 
ATOM   10646 N NZ  . LYS D 1 129 ? 29.381 -1.618  -55.280 1.00 90.14  ? 126 LYS D NZ  1 
ATOM   10647 N N   . PRO D 1 130 ? 36.041 1.330   -54.894 1.00 58.76  ? 127 PRO D N   1 
ATOM   10648 C CA  . PRO D 1 130 ? 36.785 2.582   -54.723 1.00 56.24  ? 127 PRO D CA  1 
ATOM   10649 C C   . PRO D 1 130 ? 35.954 3.629   -53.995 1.00 52.34  ? 127 PRO D C   1 
ATOM   10650 O O   . PRO D 1 130 ? 34.726 3.549   -53.908 1.00 51.22  ? 127 PRO D O   1 
ATOM   10651 C CB  . PRO D 1 130 ? 37.093 3.018   -56.162 1.00 58.16  ? 127 PRO D CB  1 
ATOM   10652 C CG  . PRO D 1 130 ? 37.035 1.752   -56.959 1.00 55.46  ? 127 PRO D CG  1 
ATOM   10653 C CD  . PRO D 1 130 ? 35.952 0.933   -56.309 1.00 56.98  ? 127 PRO D CD  1 
ATOM   10654 N N   . ILE D 1 131 ? 36.655 4.619   -53.449 1.00 50.67  ? 128 ILE D N   1 
ATOM   10655 C CA  . ILE D 1 131 ? 36.042 5.767   -52.795 1.00 49.92  ? 128 ILE D CA  1 
ATOM   10656 C C   . ILE D 1 131 ? 36.471 7.013   -53.557 1.00 47.96  ? 128 ILE D C   1 
ATOM   10657 O O   . ILE D 1 131 ? 37.667 7.220   -53.794 1.00 44.67  ? 128 ILE D O   1 
ATOM   10658 C CB  . ILE D 1 131 ? 36.443 5.865   -51.311 1.00 44.52  ? 128 ILE D CB  1 
ATOM   10659 C CG1 . ILE D 1 131 ? 36.002 4.611   -50.553 1.00 49.91  ? 128 ILE D CG1 1 
ATOM   10660 C CG2 . ILE D 1 131 ? 35.835 7.107   -50.675 1.00 42.04  ? 128 ILE D CG2 1 
ATOM   10661 C CD1 . ILE D 1 131 ? 36.549 4.528   -49.140 1.00 56.21  ? 128 ILE D CD1 1 
ATOM   10662 N N   . ILE D 1 132 ? 35.499 7.830   -53.947 1.00 45.11  ? 129 ILE D N   1 
ATOM   10663 C CA  . ILE D 1 132 ? 35.746 9.029   -54.739 1.00 51.39  ? 129 ILE D CA  1 
ATOM   10664 C C   . ILE D 1 132 ? 35.685 10.237  -53.815 1.00 51.21  ? 129 ILE D C   1 
ATOM   10665 O O   . ILE D 1 132 ? 34.665 10.480  -53.158 1.00 51.75  ? 129 ILE D O   1 
ATOM   10666 C CB  . ILE D 1 132 ? 34.736 9.157   -55.891 1.00 53.09  ? 129 ILE D CB  1 
ATOM   10667 C CG1 . ILE D 1 132 ? 34.800 7.928   -56.797 1.00 54.21  ? 129 ILE D CG1 1 
ATOM   10668 C CG2 . ILE D 1 132 ? 34.993 10.423  -56.689 1.00 49.34  ? 129 ILE D CG2 1 
ATOM   10669 C CD1 . ILE D 1 132 ? 33.695 7.875   -57.834 1.00 57.92  ? 129 ILE D CD1 1 
ATOM   10670 N N   . ILE D 1 133 ? 36.776 10.998  -53.771 1.00 46.75  ? 130 ILE D N   1 
ATOM   10671 C CA  . ILE D 1 133 ? 36.911 12.151  -52.888 1.00 47.75  ? 130 ILE D CA  1 
ATOM   10672 C C   . ILE D 1 133 ? 37.030 13.410  -53.733 1.00 51.46  ? 130 ILE D C   1 
ATOM   10673 O O   . ILE D 1 133 ? 37.840 13.468  -54.667 1.00 45.78  ? 130 ILE D O   1 
ATOM   10674 C CB  . ILE D 1 133 ? 38.128 12.007  -51.958 1.00 51.88  ? 130 ILE D CB  1 
ATOM   10675 C CG1 . ILE D 1 133 ? 37.882 10.927  -50.912 1.00 53.92  ? 130 ILE D CG1 1 
ATOM   10676 C CG2 . ILE D 1 133 ? 38.465 13.335  -51.296 1.00 53.44  ? 130 ILE D CG2 1 
ATOM   10677 C CD1 . ILE D 1 133 ? 38.941 10.893  -49.848 1.00 59.03  ? 130 ILE D CD1 1 
ATOM   10678 N N   . GLY D 1 134 ? 36.223 14.416  -53.402 1.00 46.90  ? 131 GLY D N   1 
ATOM   10679 C CA  . GLY D 1 134 ? 36.334 15.721  -54.020 1.00 51.70  ? 131 GLY D CA  1 
ATOM   10680 C C   . GLY D 1 134 ? 36.510 16.821  -52.994 1.00 48.46  ? 131 GLY D C   1 
ATOM   10681 O O   . GLY D 1 134 ? 35.800 16.854  -51.984 1.00 52.10  ? 131 GLY D O   1 
ATOM   10682 N N   . HIS D 1 135 ? 37.456 17.722  -53.238 1.00 52.96  ? 132 HIS D N   1 
ATOM   10683 C CA  . HIS D 1 135 ? 37.726 18.844  -52.353 1.00 54.26  ? 132 HIS D CA  1 
ATOM   10684 C C   . HIS D 1 135 ? 37.267 20.147  -52.993 1.00 59.26  ? 132 HIS D C   1 
ATOM   10685 O O   . HIS D 1 135 ? 37.321 20.316  -54.215 1.00 55.86  ? 132 HIS D O   1 
ATOM   10686 C CB  . HIS D 1 135 ? 39.218 18.941  -52.017 1.00 53.49  ? 132 HIS D CB  1 
ATOM   10687 C CG  . HIS D 1 135 ? 39.708 17.856  -51.109 1.00 63.31  ? 132 HIS D CG  1 
ATOM   10688 N ND1 . HIS D 1 135 ? 39.702 17.977  -49.736 1.00 67.91  ? 132 HIS D ND1 1 
ATOM   10689 C CD2 . HIS D 1 135 ? 40.228 16.635  -51.376 1.00 57.19  ? 132 HIS D CD2 1 
ATOM   10690 C CE1 . HIS D 1 135 ? 40.192 16.875  -49.196 1.00 67.44  ? 132 HIS D CE1 1 
ATOM   10691 N NE2 . HIS D 1 135 ? 40.519 16.045  -50.170 1.00 67.79  ? 132 HIS D NE2 1 
ATOM   10692 N N   . HIS D 1 136 ? 36.816 21.070  -52.149 1.00 62.87  ? 133 HIS D N   1 
ATOM   10693 C CA  . HIS D 1 136 ? 36.452 22.410  -52.594 1.00 66.05  ? 133 HIS D CA  1 
ATOM   10694 C C   . HIS D 1 136 ? 37.711 23.265  -52.649 1.00 69.04  ? 133 HIS D C   1 
ATOM   10695 O O   . HIS D 1 136 ? 38.258 23.646  -51.608 1.00 75.38  ? 133 HIS D O   1 
ATOM   10696 C CB  . HIS D 1 136 ? 35.415 23.020  -51.657 1.00 64.85  ? 133 HIS D CB  1 
ATOM   10697 C CG  . HIS D 1 136 ? 35.011 24.411  -52.031 1.00 65.33  ? 133 HIS D CG  1 
ATOM   10698 N ND1 . HIS D 1 136 ? 34.243 24.690  -53.142 1.00 64.10  ? 133 HIS D ND1 1 
ATOM   10699 C CD2 . HIS D 1 136 ? 35.275 25.604  -51.447 1.00 65.05  ? 133 HIS D CD2 1 
ATOM   10700 C CE1 . HIS D 1 136 ? 34.048 25.994  -53.222 1.00 60.48  ? 133 HIS D CE1 1 
ATOM   10701 N NE2 . HIS D 1 136 ? 34.664 26.572  -52.206 1.00 68.77  ? 133 HIS D NE2 1 
ATOM   10702 N N   . ALA D 1 137 ? 38.177 23.564  -53.856 1.00 73.57  ? 134 ALA D N   1 
ATOM   10703 C CA  . ALA D 1 137 ? 39.375 24.374  -54.027 1.00 71.02  ? 134 ALA D CA  1 
ATOM   10704 C C   . ALA D 1 137 ? 39.088 25.584  -54.909 1.00 74.64  ? 134 ALA D C   1 
ATOM   10705 O O   . ALA D 1 137 ? 38.605 25.443  -56.032 1.00 78.15  ? 134 ALA D O   1 
ATOM   10706 C CB  . ALA D 1 137 ? 40.503 23.540  -54.616 1.00 66.77  ? 134 ALA D CB  1 
ATOM   10707 N N   . ARG D 1 143 ? 43.224 31.363  -51.370 1.00 64.67  ? 140 ARG D N   1 
ATOM   10708 C CA  . ARG D 1 143 ? 42.451 32.598  -51.285 1.00 67.63  ? 140 ARG D CA  1 
ATOM   10709 C C   . ARG D 1 143 ? 42.255 33.039  -49.840 1.00 71.38  ? 140 ARG D C   1 
ATOM   10710 O O   . ARG D 1 143 ? 41.150 32.969  -49.295 1.00 68.00  ? 140 ARG D O   1 
ATOM   10711 C CB  . ARG D 1 143 ? 41.094 32.430  -51.969 1.00 67.35  ? 140 ARG D CB  1 
ATOM   10712 C CG  . ARG D 1 143 ? 41.029 33.040  -53.355 1.00 72.00  ? 140 ARG D CG  1 
ATOM   10713 C CD  . ARG D 1 143 ? 41.997 32.370  -54.312 1.00 76.93  ? 140 ARG D CD  1 
ATOM   10714 N NE  . ARG D 1 143 ? 41.884 32.914  -55.662 1.00 86.42  ? 140 ARG D NE  1 
ATOM   10715 C CZ  . ARG D 1 143 ? 40.886 32.643  -56.498 1.00 89.92  ? 140 ARG D CZ  1 
ATOM   10716 N NH1 . ARG D 1 143 ? 39.905 31.829  -56.128 1.00 88.05  ? 140 ARG D NH1 1 
ATOM   10717 N NH2 . ARG D 1 143 ? 40.868 33.187  -57.707 1.00 90.85  ? 140 ARG D NH2 1 
ATOM   10718 N N   . ALA D 1 144 ? 43.343 33.499  -49.228 1.00 59.35  ? 141 ALA D N   1 
ATOM   10719 C CA  . ALA D 1 144 ? 43.322 34.013  -47.869 1.00 49.47  ? 141 ALA D CA  1 
ATOM   10720 C C   . ALA D 1 144 ? 44.321 35.153  -47.763 1.00 39.21  ? 141 ALA D C   1 
ATOM   10721 O O   . ALA D 1 144 ? 45.311 35.201  -48.498 1.00 42.28  ? 141 ALA D O   1 
ATOM   10722 C CB  . ALA D 1 144 ? 43.653 32.923  -46.845 1.00 43.74  ? 141 ALA D CB  1 
ATOM   10723 N N   . THR D 1 145 ? 44.054 36.073  -46.841 1.00 42.37  ? 142 THR D N   1 
ATOM   10724 C CA  . THR D 1 145 ? 44.919 37.224  -46.596 1.00 39.09  ? 142 THR D CA  1 
ATOM   10725 C C   . THR D 1 145 ? 45.524 37.064  -45.205 1.00 38.21  ? 142 THR D C   1 
ATOM   10726 O O   . THR D 1 145 ? 44.874 37.365  -44.199 1.00 37.39  ? 142 THR D O   1 
ATOM   10727 C CB  . THR D 1 145 ? 44.143 38.534  -46.714 1.00 50.40  ? 142 THR D CB  1 
ATOM   10728 O OG1 . THR D 1 145 ? 43.531 38.616  -48.007 1.00 46.94  ? 142 THR D OG1 1 
ATOM   10729 C CG2 . THR D 1 145 ? 45.073 39.724  -46.527 1.00 43.55  ? 142 THR D CG2 1 
ATOM   10730 N N   . ASP D 1 146 ? 46.763 36.585  -45.151 1.00 37.02  ? 143 ASP D N   1 
ATOM   10731 C CA  . ASP D 1 146 ? 47.480 36.420  -43.896 1.00 33.72  ? 143 ASP D CA  1 
ATOM   10732 C C   . ASP D 1 146 ? 48.540 37.504  -43.751 1.00 31.11  ? 143 ASP D C   1 
ATOM   10733 O O   . ASP D 1 146 ? 49.021 38.066  -44.739 1.00 36.09  ? 143 ASP D O   1 
ATOM   10734 C CB  . ASP D 1 146 ? 48.126 35.032  -43.805 1.00 33.07  ? 143 ASP D CB  1 
ATOM   10735 C CG  . ASP D 1 146 ? 49.073 34.743  -44.959 1.00 43.79  ? 143 ASP D CG  1 
ATOM   10736 O OD1 . ASP D 1 146 ? 48.860 35.284  -46.065 1.00 40.22  ? 143 ASP D OD1 1 
ATOM   10737 O OD2 . ASP D 1 146 ? 50.033 33.968  -44.760 1.00 44.21  ? 143 ASP D OD2 1 
ATOM   10738 N N   . PHE D 1 147 ? 48.893 37.801  -42.502 1.00 32.96  ? 144 PHE D N   1 
ATOM   10739 C CA  . PHE D 1 147 ? 49.883 38.829  -42.213 1.00 31.59  ? 144 PHE D CA  1 
ATOM   10740 C C   . PHE D 1 147 ? 50.432 38.602  -40.811 1.00 32.94  ? 144 PHE D C   1 
ATOM   10741 O O   . PHE D 1 147 ? 49.895 37.815  -40.028 1.00 30.80  ? 144 PHE D O   1 
ATOM   10742 C CB  . PHE D 1 147 ? 49.290 40.236  -42.354 1.00 35.48  ? 144 PHE D CB  1 
ATOM   10743 C CG  . PHE D 1 147 ? 48.103 40.493  -41.466 1.00 37.01  ? 144 PHE D CG  1 
ATOM   10744 C CD1 . PHE D 1 147 ? 48.267 41.063  -40.214 1.00 30.00  ? 144 PHE D CD1 1 
ATOM   10745 C CD2 . PHE D 1 147 ? 46.821 40.181  -41.892 1.00 37.28  ? 144 PHE D CD2 1 
ATOM   10746 C CE1 . PHE D 1 147 ? 47.178 41.310  -39.398 1.00 35.77  ? 144 PHE D CE1 1 
ATOM   10747 C CE2 . PHE D 1 147 ? 45.726 40.424  -41.082 1.00 36.95  ? 144 PHE D CE2 1 
ATOM   10748 C CZ  . PHE D 1 147 ? 45.905 40.990  -39.832 1.00 38.34  ? 144 PHE D CZ  1 
ATOM   10749 N N   . VAL D 1 148 ? 51.516 39.311  -40.509 1.00 31.87  ? 145 VAL D N   1 
ATOM   10750 C CA  . VAL D 1 148 ? 52.219 39.201  -39.238 1.00 32.51  ? 145 VAL D CA  1 
ATOM   10751 C C   . VAL D 1 148 ? 51.823 40.373  -38.354 1.00 35.60  ? 145 VAL D C   1 
ATOM   10752 O O   . VAL D 1 148 ? 51.813 41.527  -38.804 1.00 34.74  ? 145 VAL D O   1 
ATOM   10753 C CB  . VAL D 1 148 ? 53.743 39.169  -39.450 1.00 37.87  ? 145 VAL D CB  1 
ATOM   10754 C CG1 . VAL D 1 148 ? 54.468 39.153  -38.116 1.00 29.09  ? 145 VAL D CG1 1 
ATOM   10755 C CG2 . VAL D 1 148 ? 54.135 37.960  -40.287 1.00 35.36  ? 145 VAL D CG2 1 
ATOM   10756 N N   . VAL D 1 149 ? 51.499 40.086  -37.097 1.00 34.63  ? 146 VAL D N   1 
ATOM   10757 C CA  . VAL D 1 149 ? 51.197 41.110  -36.106 1.00 33.47  ? 146 VAL D CA  1 
ATOM   10758 C C   . VAL D 1 149 ? 52.500 41.439  -35.375 1.00 33.33  ? 146 VAL D C   1 
ATOM   10759 O O   . VAL D 1 149 ? 52.955 40.613  -34.563 1.00 36.58  ? 146 VAL D O   1 
ATOM   10760 C CB  . VAL D 1 149 ? 50.108 40.649  -35.132 1.00 35.19  ? 146 VAL D CB  1 
ATOM   10761 C CG1 . VAL D 1 149 ? 49.812 41.732  -34.117 1.00 31.81  ? 146 VAL D CG1 1 
ATOM   10762 C CG2 . VAL D 1 149 ? 48.843 40.276  -35.900 1.00 29.52  ? 146 VAL D CG2 1 
ATOM   10763 N N   . PRO D 1 150 ? 53.121 42.592  -35.624 1.00 37.12  ? 147 PRO D N   1 
ATOM   10764 C CA  . PRO D 1 150 ? 54.468 42.822  -35.081 1.00 36.88  ? 147 PRO D CA  1 
ATOM   10765 C C   . PRO D 1 150 ? 54.490 43.109  -33.593 1.00 33.73  ? 147 PRO D C   1 
ATOM   10766 O O   . PRO D 1 150 ? 55.565 43.039  -32.988 1.00 37.68  ? 147 PRO D O   1 
ATOM   10767 C CB  . PRO D 1 150 ? 54.968 44.026  -35.889 1.00 32.20  ? 147 PRO D CB  1 
ATOM   10768 C CG  . PRO D 1 150 ? 53.725 44.779  -36.206 1.00 37.29  ? 147 PRO D CG  1 
ATOM   10769 C CD  . PRO D 1 150 ? 52.664 43.727  -36.448 1.00 34.79  ? 147 PRO D CD  1 
ATOM   10770 N N   . GLY D 1 151 ? 53.353 43.423  -32.984 1.00 36.98  ? 148 GLY D N   1 
ATOM   10771 C CA  . GLY D 1 151 ? 53.325 43.754  -31.582 1.00 35.40  ? 148 GLY D CA  1 
ATOM   10772 C C   . GLY D 1 151 ? 51.919 43.998  -31.082 1.00 38.95  ? 148 GLY D C   1 
ATOM   10773 O O   . GLY D 1 151 ? 50.936 43.756  -31.789 1.00 39.40  ? 148 GLY D O   1 
ATOM   10774 N N   . PRO D 1 152 ? 51.803 44.484  -29.845 1.00 37.11  ? 149 PRO D N   1 
ATOM   10775 C CA  . PRO D 1 152 ? 50.480 44.656  -29.231 1.00 43.66  ? 149 PRO D CA  1 
ATOM   10776 C C   . PRO D 1 152 ? 49.542 45.484  -30.097 1.00 39.44  ? 149 PRO D C   1 
ATOM   10777 O O   . PRO D 1 152 ? 49.944 46.463  -30.730 1.00 39.35  ? 149 PRO D O   1 
ATOM   10778 C CB  . PRO D 1 152 ? 50.799 45.357  -27.907 1.00 38.35  ? 149 PRO D CB  1 
ATOM   10779 C CG  . PRO D 1 152 ? 52.165 44.856  -27.560 1.00 44.85  ? 149 PRO D CG  1 
ATOM   10780 C CD  . PRO D 1 152 ? 52.891 44.720  -28.880 1.00 42.40  ? 149 PRO D CD  1 
ATOM   10781 N N   . GLY D 1 153 ? 48.288 45.062  -30.135 1.00 37.30  ? 150 GLY D N   1 
ATOM   10782 C CA  . GLY D 1 153 ? 47.287 45.739  -30.932 1.00 39.05  ? 150 GLY D CA  1 
ATOM   10783 C C   . GLY D 1 153 ? 46.068 44.866  -31.134 1.00 38.84  ? 150 GLY D C   1 
ATOM   10784 O O   . GLY D 1 153 ? 46.017 43.708  -30.713 1.00 37.66  ? 150 GLY D O   1 
ATOM   10785 N N   . LYS D 1 154 ? 45.087 45.453  -31.809 1.00 38.35  ? 151 LYS D N   1 
ATOM   10786 C CA  . LYS D 1 154 ? 43.776 44.853  -32.013 1.00 33.96  ? 151 LYS D CA  1 
ATOM   10787 C C   . LYS D 1 154 ? 43.626 44.417  -33.464 1.00 37.70  ? 151 LYS D C   1 
ATOM   10788 O O   . LYS D 1 154 ? 43.892 45.202  -34.382 1.00 38.31  ? 151 LYS D O   1 
ATOM   10789 C CB  . LYS D 1 154 ? 42.673 45.851  -31.653 1.00 39.42  ? 151 LYS D CB  1 
ATOM   10790 C CG  . LYS D 1 154 ? 41.271 45.277  -31.593 1.00 47.24  ? 151 LYS D CG  1 
ATOM   10791 C CD  . LYS D 1 154 ? 40.261 46.376  -31.282 1.00 49.29  ? 151 LYS D CD  1 
ATOM   10792 C CE  . LYS D 1 154 ? 40.489 47.024  -29.925 1.00 63.67  ? 151 LYS D CE  1 
ATOM   10793 N NZ  . LYS D 1 154 ? 40.092 46.122  -28.815 1.00 61.92  ? 151 LYS D NZ  1 
ATOM   10794 N N   . VAL D 1 155 ? 43.199 43.174  -33.665 1.00 29.63  ? 152 VAL D N   1 
ATOM   10795 C CA  . VAL D 1 155 ? 42.875 42.648  -34.986 1.00 32.44  ? 152 VAL D CA  1 
ATOM   10796 C C   . VAL D 1 155 ? 41.362 42.507  -35.076 1.00 35.04  ? 152 VAL D C   1 
ATOM   10797 O O   . VAL D 1 155 ? 40.743 41.810  -34.261 1.00 31.41  ? 152 VAL D O   1 
ATOM   10798 C CB  . VAL D 1 155 ? 43.577 41.310  -35.261 1.00 35.73  ? 152 VAL D CB  1 
ATOM   10799 C CG1 . VAL D 1 155 ? 43.052 40.695  -36.551 1.00 29.23  ? 152 VAL D CG1 1 
ATOM   10800 C CG2 . VAL D 1 155 ? 45.083 41.515  -35.352 1.00 33.32  ? 152 VAL D CG2 1 
ATOM   10801 N N   . GLU D 1 156 ? 40.772 43.169  -36.069 1.00 29.32  ? 153 GLU D N   1 
ATOM   10802 C CA  . GLU D 1 156 ? 39.334 43.169  -36.282 1.00 32.18  ? 153 GLU D CA  1 
ATOM   10803 C C   . GLU D 1 156 ? 39.041 42.812  -37.731 1.00 33.93  ? 153 GLU D C   1 
ATOM   10804 O O   . GLU D 1 156 ? 39.848 43.073  -38.627 1.00 31.36  ? 153 GLU D O   1 
ATOM   10805 C CB  . GLU D 1 156 ? 38.716 44.534  -35.966 1.00 33.95  ? 153 GLU D CB  1 
ATOM   10806 C CG  . GLU D 1 156 ? 38.673 44.894  -34.495 1.00 41.75  ? 153 GLU D CG  1 
ATOM   10807 C CD  . GLU D 1 156 ? 38.240 46.330  -34.276 1.00 42.84  ? 153 GLU D CD  1 
ATOM   10808 O OE1 . GLU D 1 156 ? 37.434 46.581  -33.355 1.00 39.34  ? 153 GLU D OE1 1 
ATOM   10809 O OE2 . GLU D 1 156 ? 38.705 47.209  -35.032 1.00 44.46  ? 153 GLU D OE2 1 
ATOM   10810 N N   . ILE D 1 157 ? 37.869 42.227  -37.955 1.00 35.07  ? 154 ILE D N   1 
ATOM   10811 C CA  . ILE D 1 157 ? 37.390 41.892  -39.290 1.00 38.69  ? 154 ILE D CA  1 
ATOM   10812 C C   . ILE D 1 157 ? 36.025 42.545  -39.477 1.00 38.38  ? 154 ILE D C   1 
ATOM   10813 O O   . ILE D 1 157 ? 35.124 42.373  -38.646 1.00 34.90  ? 154 ILE D O   1 
ATOM   10814 C CB  . ILE D 1 157 ? 37.346 40.365  -39.512 1.00 33.84  ? 154 ILE D CB  1 
ATOM   10815 C CG1 . ILE D 1 157 ? 36.930 40.033  -40.947 1.00 36.94  ? 154 ILE D CG1 1 
ATOM   10816 C CG2 . ILE D 1 157 ? 36.458 39.670  -38.483 1.00 37.07  ? 154 ILE D CG2 1 
ATOM   10817 C CD1 . ILE D 1 157 ? 37.242 38.602  -41.348 1.00 33.96  ? 154 ILE D CD1 1 
ATOM   10818 N N   . THR D 1 158 ? 35.889 43.316  -40.553 1.00 36.07  ? 155 THR D N   1 
ATOM   10819 C CA  . THR D 1 158 ? 34.743 44.189  -40.769 1.00 39.56  ? 155 THR D CA  1 
ATOM   10820 C C   . THR D 1 158 ? 34.067 43.839  -42.086 1.00 47.16  ? 155 THR D C   1 
ATOM   10821 O O   . THR D 1 158 ? 34.744 43.631  -43.099 1.00 44.16  ? 155 THR D O   1 
ATOM   10822 C CB  . THR D 1 158 ? 35.175 45.661  -40.781 1.00 39.37  ? 155 THR D CB  1 
ATOM   10823 O OG1 . THR D 1 158 ? 35.663 46.035  -39.487 1.00 38.16  ? 155 THR D OG1 1 
ATOM   10824 C CG2 . THR D 1 158 ? 34.011 46.559  -41.157 1.00 45.75  ? 155 THR D CG2 1 
ATOM   10825 N N   . TYR D 1 159 ? 32.737 43.776  -42.071 1.00 44.49  ? 156 TYR D N   1 
ATOM   10826 C CA  . TYR D 1 159 ? 31.935 43.595  -43.276 1.00 46.23  ? 156 TYR D CA  1 
ATOM   10827 C C   . TYR D 1 159 ? 31.146 44.870  -43.544 1.00 41.04  ? 156 TYR D C   1 
ATOM   10828 O O   . TYR D 1 159 ? 30.378 45.320  -42.687 1.00 40.42  ? 156 TYR D O   1 
ATOM   10829 C CB  . TYR D 1 159 ? 30.992 42.400  -43.138 1.00 38.78  ? 156 TYR D CB  1 
ATOM   10830 C CG  . TYR D 1 159 ? 29.936 42.351  -44.219 1.00 50.85  ? 156 TYR D CG  1 
ATOM   10831 C CD1 . TYR D 1 159 ? 30.289 42.154  -45.548 1.00 41.96  ? 156 TYR D CD1 1 
ATOM   10832 C CD2 . TYR D 1 159 ? 28.588 42.500  -43.914 1.00 47.38  ? 156 TYR D CD2 1 
ATOM   10833 C CE1 . TYR D 1 159 ? 29.332 42.114  -46.544 1.00 43.54  ? 156 TYR D CE1 1 
ATOM   10834 C CE2 . TYR D 1 159 ? 27.622 42.457  -44.905 1.00 42.93  ? 156 TYR D CE2 1 
ATOM   10835 C CZ  . TYR D 1 159 ? 28.000 42.262  -46.218 1.00 50.02  ? 156 TYR D CZ  1 
ATOM   10836 O OH  . TYR D 1 159 ? 27.044 42.218  -47.208 1.00 51.69  ? 156 TYR D OH  1 
ATOM   10837 N N   . THR D 1 160 ? 31.332 45.444  -44.729 1.00 39.40  ? 157 THR D N   1 
ATOM   10838 C CA  . THR D 1 160 ? 30.643 46.673  -45.127 1.00 44.87  ? 157 THR D CA  1 
ATOM   10839 C C   . THR D 1 160 ? 29.822 46.417  -46.381 1.00 46.71  ? 157 THR D C   1 
ATOM   10840 O O   . THR D 1 160 ? 30.385 46.331  -47.488 1.00 50.30  ? 157 THR D O   1 
ATOM   10841 C CB  . THR D 1 160 ? 31.643 47.803  -45.363 1.00 46.28  ? 157 THR D CB  1 
ATOM   10842 O OG1 . THR D 1 160 ? 32.498 47.936  -44.221 1.00 42.45  ? 157 THR D OG1 1 
ATOM   10843 C CG2 . THR D 1 160 ? 30.914 49.115  -45.610 1.00 43.09  ? 157 THR D CG2 1 
ATOM   10844 N N   . PRO D 1 161 ? 28.498 46.290  -46.266 1.00 47.02  ? 158 PRO D N   1 
ATOM   10845 C CA  . PRO D 1 161 ? 27.677 45.981  -47.443 1.00 45.91  ? 158 PRO D CA  1 
ATOM   10846 C C   . PRO D 1 161 ? 27.729 47.090  -48.483 1.00 50.31  ? 158 PRO D C   1 
ATOM   10847 O O   . PRO D 1 161 ? 28.002 48.253  -48.174 1.00 43.46  ? 158 PRO D O   1 
ATOM   10848 C CB  . PRO D 1 161 ? 26.264 45.820  -46.864 1.00 52.24  ? 158 PRO D CB  1 
ATOM   10849 C CG  . PRO D 1 161 ? 26.300 46.490  -45.530 1.00 48.98  ? 158 PRO D CG  1 
ATOM   10850 C CD  . PRO D 1 161 ? 27.703 46.318  -45.028 1.00 48.23  ? 158 PRO D CD  1 
ATOM   10851 N N   . SER D 1 162 ? 27.473 46.703  -49.738 1.00 53.49  ? 159 SER D N   1 
ATOM   10852 C CA  . SER D 1 162 ? 27.540 47.654  -50.844 1.00 49.12  ? 159 SER D CA  1 
ATOM   10853 C C   . SER D 1 162 ? 26.493 48.751  -50.700 1.00 57.70  ? 159 SER D C   1 
ATOM   10854 O O   . SER D 1 162 ? 26.744 49.910  -51.044 1.00 60.94  ? 159 SER D O   1 
ATOM   10855 C CB  . SER D 1 162 ? 27.364 46.923  -52.175 1.00 52.30  ? 159 SER D CB  1 
ATOM   10856 O OG  . SER D 1 162 ? 28.403 45.985  -52.385 1.00 56.53  ? 159 SER D OG  1 
ATOM   10857 N N   . ASP D 1 163 ? 25.311 48.407  -50.194 1.00 55.74  ? 160 ASP D N   1 
ATOM   10858 C CA  . ASP D 1 163 ? 24.276 49.416  -50.018 1.00 64.87  ? 160 ASP D CA  1 
ATOM   10859 C C   . ASP D 1 163 ? 24.523 50.304  -48.801 1.00 68.80  ? 160 ASP D C   1 
ATOM   10860 O O   . ASP D 1 163 ? 23.916 51.375  -48.703 1.00 74.50  ? 160 ASP D O   1 
ATOM   10861 C CB  . ASP D 1 163 ? 22.912 48.737  -49.923 1.00 63.05  ? 160 ASP D CB  1 
ATOM   10862 C CG  . ASP D 1 163 ? 22.912 47.580  -48.954 1.00 66.60  ? 160 ASP D CG  1 
ATOM   10863 O OD1 . ASP D 1 163 ? 23.734 47.593  -48.014 1.00 67.88  ? 160 ASP D OD1 1 
ATOM   10864 O OD2 . ASP D 1 163 ? 22.081 46.660  -49.113 1.00 68.36  ? 160 ASP D OD2 1 
ATOM   10865 N N   . GLY D 1 164 ? 25.403 49.896  -47.883 1.00 67.49  ? 161 GLY D N   1 
ATOM   10866 C CA  . GLY D 1 164 ? 25.672 50.656  -46.679 1.00 60.56  ? 161 GLY D CA  1 
ATOM   10867 C C   . GLY D 1 164 ? 24.762 50.338  -45.506 1.00 60.96  ? 161 GLY D C   1 
ATOM   10868 O O   . GLY D 1 164 ? 24.988 50.879  -44.415 1.00 59.60  ? 161 GLY D O   1 
ATOM   10869 N N   . THR D 1 165 ? 23.750 49.479  -45.706 1.00 65.49  ? 162 THR D N   1 
ATOM   10870 C CA  . THR D 1 165 ? 22.786 49.101  -44.672 1.00 62.97  ? 162 THR D CA  1 
ATOM   10871 C C   . THR D 1 165 ? 23.410 49.016  -43.288 1.00 66.96  ? 162 THR D C   1 
ATOM   10872 O O   . THR D 1 165 ? 23.083 49.795  -42.387 1.00 55.41  ? 162 THR D O   1 
ATOM   10873 C CB  . THR D 1 165 ? 22.171 47.749  -45.038 1.00 62.57  ? 162 THR D CB  1 
ATOM   10874 O OG1 . THR D 1 165 ? 21.834 47.745  -46.423 1.00 77.00  ? 162 THR D OG1 1 
ATOM   10875 C CG2 . THR D 1 165 ? 20.934 47.466  -44.228 1.00 76.25  ? 162 THR D CG2 1 
ATOM   10876 N N   . GLN D 1 166 ? 24.319 48.065  -43.106 1.00 63.15  ? 163 GLN D N   1 
ATOM   10877 C CA  . GLN D 1 166 ? 24.583 47.478  -41.795 1.00 53.65  ? 163 GLN D CA  1 
ATOM   10878 C C   . GLN D 1 166 ? 26.022 46.976  -41.785 1.00 50.50  ? 163 GLN D C   1 
ATOM   10879 O O   . GLN D 1 166 ? 26.316 45.891  -42.301 1.00 50.80  ? 163 GLN D O   1 
ATOM   10880 C CB  . GLN D 1 166 ? 23.594 46.349  -41.523 1.00 53.37  ? 163 GLN D CB  1 
ATOM   10881 C CG  . GLN D 1 166 ? 23.860 45.560  -40.259 1.00 47.45  ? 163 GLN D CG  1 
ATOM   10882 C CD  . GLN D 1 166 ? 22.956 44.347  -40.114 1.00 59.43  ? 163 GLN D CD  1 
ATOM   10883 O OE1 . GLN D 1 166 ? 21.921 44.240  -40.777 1.00 60.71  ? 163 GLN D OE1 1 
ATOM   10884 N NE2 . GLN D 1 166 ? 23.352 43.417  -39.250 1.00 54.86  ? 163 GLN D NE2 1 
ATOM   10885 N N   . LYS D 1 167 ? 26.909 47.778  -41.207 1.00 47.84  ? 164 LYS D N   1 
ATOM   10886 C CA  . LYS D 1 167 ? 28.321 47.450  -41.104 1.00 44.87  ? 164 LYS D CA  1 
ATOM   10887 C C   . LYS D 1 167 ? 28.568 46.690  -39.808 1.00 44.81  ? 164 LYS D C   1 
ATOM   10888 O O   . LYS D 1 167 ? 28.089 47.096  -38.743 1.00 40.94  ? 164 LYS D O   1 
ATOM   10889 C CB  . LYS D 1 167 ? 29.149 48.732  -41.149 1.00 34.97  ? 164 LYS D CB  1 
ATOM   10890 C CG  . LYS D 1 167 ? 30.648 48.544  -41.201 1.00 49.75  ? 164 LYS D CG  1 
ATOM   10891 C CD  . LYS D 1 167 ? 31.343 49.833  -40.789 1.00 46.95  ? 164 LYS D CD  1 
ATOM   10892 C CE  . LYS D 1 167 ? 32.805 49.835  -41.190 1.00 54.03  ? 164 LYS D CE  1 
ATOM   10893 N NZ  . LYS D 1 167 ? 33.618 50.808  -40.409 1.00 60.51  ? 164 LYS D NZ  1 
ATOM   10894 N N   . VAL D 1 168 ? 29.299 45.580  -39.902 1.00 40.90  ? 165 VAL D N   1 
ATOM   10895 C CA  . VAL D 1 168 ? 29.569 44.713  -38.761 1.00 38.48  ? 165 VAL D CA  1 
ATOM   10896 C C   . VAL D 1 168 ? 31.074 44.578  -38.589 1.00 42.00  ? 165 VAL D C   1 
ATOM   10897 O O   . VAL D 1 168 ? 31.784 44.220  -39.536 1.00 38.65  ? 165 VAL D O   1 
ATOM   10898 C CB  . VAL D 1 168 ? 28.922 43.325  -38.925 1.00 42.13  ? 165 VAL D CB  1 
ATOM   10899 C CG1 . VAL D 1 168 ? 28.816 42.634  -37.574 1.00 42.65  ? 165 VAL D CG1 1 
ATOM   10900 C CG2 . VAL D 1 168 ? 27.547 43.443  -39.576 1.00 42.32  ? 165 VAL D CG2 1 
ATOM   10901 N N   . THR D 1 169 ? 31.551 44.857  -37.379 1.00 36.98  ? 166 THR D N   1 
ATOM   10902 C CA  . THR D 1 169 ? 32.955 44.720  -37.014 1.00 40.77  ? 166 THR D CA  1 
ATOM   10903 C C   . THR D 1 169 ? 33.072 43.631  -35.958 1.00 40.48  ? 166 THR D C   1 
ATOM   10904 O O   . THR D 1 169 ? 32.445 43.729  -34.901 1.00 35.45  ? 166 THR D O   1 
ATOM   10905 C CB  . THR D 1 169 ? 33.511 46.037  -36.473 1.00 34.25  ? 166 THR D CB  1 
ATOM   10906 O OG1 . THR D 1 169 ? 33.612 46.992  -37.535 1.00 40.44  ? 166 THR D OG1 1 
ATOM   10907 C CG2 . THR D 1 169 ? 34.887 45.825  -35.848 1.00 35.44  ? 166 THR D CG2 1 
ATOM   10908 N N   . TYR D 1 170 ? 33.866 42.602  -36.240 1.00 42.45  ? 167 TYR D N   1 
ATOM   10909 C CA  . TYR D 1 170 ? 34.121 41.525  -35.293 1.00 35.32  ? 167 TYR D CA  1 
ATOM   10910 C C   . TYR D 1 170 ? 35.547 41.628  -34.770 1.00 35.97  ? 167 TYR D C   1 
ATOM   10911 O O   . TYR D 1 170 ? 36.482 41.879  -35.537 1.00 33.53  ? 167 TYR D O   1 
ATOM   10912 C CB  . TYR D 1 170 ? 33.928 40.147  -35.932 1.00 29.79  ? 167 TYR D CB  1 
ATOM   10913 C CG  . TYR D 1 170 ? 32.603 39.923  -36.625 1.00 35.97  ? 167 TYR D CG  1 
ATOM   10914 C CD1 . TYR D 1 170 ? 32.398 40.354  -37.929 1.00 42.82  ? 167 TYR D CD1 1 
ATOM   10915 C CD2 . TYR D 1 170 ? 31.566 39.256  -35.985 1.00 36.37  ? 167 TYR D CD2 1 
ATOM   10916 C CE1 . TYR D 1 170 ? 31.192 40.142  -38.572 1.00 42.44  ? 167 TYR D CE1 1 
ATOM   10917 C CE2 . TYR D 1 170 ? 30.355 39.039  -36.620 1.00 39.64  ? 167 TYR D CE2 1 
ATOM   10918 C CZ  . TYR D 1 170 ? 30.176 39.484  -37.914 1.00 35.76  ? 167 TYR D CZ  1 
ATOM   10919 O OH  . TYR D 1 170 ? 28.976 39.274  -38.554 1.00 47.14  ? 167 TYR D OH  1 
ATOM   10920 N N   . LEU D 1 171 ? 35.711 41.425  -33.466 1.00 31.27  ? 168 LEU D N   1 
ATOM   10921 C CA  . LEU D 1 171 ? 37.041 41.335  -32.878 1.00 36.98  ? 168 LEU D CA  1 
ATOM   10922 C C   . LEU D 1 171 ? 37.612 39.951  -33.153 1.00 34.70  ? 168 LEU D C   1 
ATOM   10923 O O   . LEU D 1 171 ? 37.015 38.940  -32.767 1.00 33.66  ? 168 LEU D O   1 
ATOM   10924 C CB  . LEU D 1 171 ? 36.991 41.605  -31.376 1.00 39.74  ? 168 LEU D CB  1 
ATOM   10925 C CG  . LEU D 1 171 ? 38.267 41.273  -30.594 1.00 42.63  ? 168 LEU D CG  1 
ATOM   10926 C CD1 . LEU D 1 171 ? 39.377 42.254  -30.933 1.00 35.87  ? 168 LEU D CD1 1 
ATOM   10927 C CD2 . LEU D 1 171 ? 38.002 41.252  -29.095 1.00 43.55  ? 168 LEU D CD2 1 
ATOM   10928 N N   . VAL D 1 172 ? 38.754 39.899  -33.838 1.00 37.38  ? 169 VAL D N   1 
ATOM   10929 C CA  . VAL D 1 172 ? 39.433 38.623  -34.021 1.00 36.13  ? 169 VAL D CA  1 
ATOM   10930 C C   . VAL D 1 172 ? 40.243 38.274  -32.782 1.00 33.90  ? 169 VAL D C   1 
ATOM   10931 O O   . VAL D 1 172 ? 40.069 37.203  -32.188 1.00 28.77  ? 169 VAL D O   1 
ATOM   10932 C CB  . VAL D 1 172 ? 40.313 38.659  -35.283 1.00 33.80  ? 169 VAL D CB  1 
ATOM   10933 C CG1 . VAL D 1 172 ? 41.235 37.446  -35.322 1.00 32.97  ? 169 VAL D CG1 1 
ATOM   10934 C CG2 . VAL D 1 172 ? 39.449 38.722  -36.531 1.00 27.54  ? 169 VAL D CG2 1 
ATOM   10935 N N   . HIS D 1 173 ? 41.125 39.180  -32.364 1.00 27.39  ? 170 HIS D N   1 
ATOM   10936 C CA  . HIS D 1 173 ? 41.916 38.975  -31.161 1.00 35.90  ? 170 HIS D CA  1 
ATOM   10937 C C   . HIS D 1 173 ? 42.567 40.285  -30.755 1.00 35.93  ? 170 HIS D C   1 
ATOM   10938 O O   . HIS D 1 173 ? 42.963 41.082  -31.609 1.00 34.38  ? 170 HIS D O   1 
ATOM   10939 C CB  . HIS D 1 173 ? 42.997 37.907  -31.363 1.00 32.28  ? 170 HIS D CB  1 
ATOM   10940 C CG  . HIS D 1 173 ? 43.812 37.647  -30.135 1.00 38.19  ? 170 HIS D CG  1 
ATOM   10941 N ND1 . HIS D 1 173 ? 43.272 37.117  -28.982 1.00 39.11  ? 170 HIS D ND1 1 
ATOM   10942 C CD2 . HIS D 1 173 ? 45.124 37.857  -29.872 1.00 34.30  ? 170 HIS D CD2 1 
ATOM   10943 C CE1 . HIS D 1 173 ? 44.217 37.007  -28.065 1.00 38.51  ? 170 HIS D CE1 1 
ATOM   10944 N NE2 . HIS D 1 173 ? 45.350 37.449  -28.580 1.00 34.96  ? 170 HIS D NE2 1 
ATOM   10945 N N   . ASN D 1 174 ? 42.681 40.490  -29.448 1.00 37.96  ? 171 ASN D N   1 
ATOM   10946 C CA  . ASN D 1 174 ? 43.451 41.590  -28.886 1.00 39.48  ? 171 ASN D CA  1 
ATOM   10947 C C   . ASN D 1 174 ? 44.802 41.050  -28.435 1.00 37.44  ? 171 ASN D C   1 
ATOM   10948 O O   . ASN D 1 174 ? 44.883 40.307  -27.451 1.00 41.51  ? 171 ASN D O   1 
ATOM   10949 C CB  . ASN D 1 174 ? 42.719 42.243  -27.719 1.00 35.52  ? 171 ASN D CB  1 
ATOM   10950 C CG  . ASN D 1 174 ? 43.002 43.726  -27.622 1.00 58.00  ? 171 ASN D CG  1 
ATOM   10951 O OD1 . ASN D 1 174 ? 44.157 44.153  -27.632 1.00 57.87  ? 171 ASN D OD1 1 
ATOM   10952 N ND2 . ASN D 1 174 ? 41.954 44.519  -27.498 1.00 57.16  ? 171 ASN D ND2 1 
ATOM   10953 N N   . PHE D 1 175 ? 45.855 41.418  -29.156 1.00 35.41  ? 172 PHE D N   1 
ATOM   10954 C CA  . PHE D 1 175 ? 47.218 41.065  -28.767 1.00 39.50  ? 172 PHE D CA  1 
ATOM   10955 C C   . PHE D 1 175 ? 47.643 42.023  -27.663 1.00 38.14  ? 172 PHE D C   1 
ATOM   10956 O O   . PHE D 1 175 ? 47.997 43.174  -27.927 1.00 42.14  ? 172 PHE D O   1 
ATOM   10957 C CB  . PHE D 1 175 ? 48.156 41.140  -29.966 1.00 31.94  ? 172 PHE D CB  1 
ATOM   10958 C CG  . PHE D 1 175 ? 47.854 40.131  -31.037 1.00 36.05  ? 172 PHE D CG  1 
ATOM   10959 C CD1 . PHE D 1 175 ? 46.822 40.341  -31.939 1.00 34.81  ? 172 PHE D CD1 1 
ATOM   10960 C CD2 . PHE D 1 175 ? 48.603 38.972  -31.144 1.00 32.23  ? 172 PHE D CD2 1 
ATOM   10961 C CE1 . PHE D 1 175 ? 46.541 39.412  -32.923 1.00 32.02  ? 172 PHE D CE1 1 
ATOM   10962 C CE2 . PHE D 1 175 ? 48.329 38.040  -32.126 1.00 34.81  ? 172 PHE D CE2 1 
ATOM   10963 C CZ  . PHE D 1 175 ? 47.297 38.259  -33.017 1.00 32.17  ? 172 PHE D CZ  1 
ATOM   10964 N N   . GLU D 1 176 ? 47.595 41.559  -26.415 1.00 42.33  ? 173 GLU D N   1 
ATOM   10965 C CA  . GLU D 1 176 ? 47.874 42.439  -25.286 1.00 46.87  ? 173 GLU D CA  1 
ATOM   10966 C C   . GLU D 1 176 ? 49.330 42.400  -24.837 1.00 48.57  ? 173 GLU D C   1 
ATOM   10967 O O   . GLU D 1 176 ? 49.807 43.372  -24.239 1.00 57.77  ? 173 GLU D O   1 
ATOM   10968 C CB  . GLU D 1 176 ? 46.959 42.096  -24.105 1.00 39.26  ? 173 GLU D CB  1 
ATOM   10969 C CG  . GLU D 1 176 ? 45.649 42.880  -24.107 1.00 54.32  ? 173 GLU D CG  1 
ATOM   10970 C CD  . GLU D 1 176 ? 44.546 42.212  -23.307 1.00 67.69  ? 173 GLU D CD  1 
ATOM   10971 O OE1 . GLU D 1 176 ? 44.860 41.494  -22.334 1.00 77.63  ? 173 GLU D OE1 1 
ATOM   10972 O OE2 . GLU D 1 176 ? 43.360 42.408  -23.652 1.00 67.40  ? 173 GLU D OE2 1 
ATOM   10973 N N   . GLU D 1 177 ? 50.057 41.319  -25.120 1.00 50.87  ? 174 GLU D N   1 
ATOM   10974 C CA  . GLU D 1 177 ? 51.427 41.177  -24.641 1.00 51.77  ? 174 GLU D CA  1 
ATOM   10975 C C   . GLU D 1 177 ? 52.455 41.239  -25.764 1.00 54.81  ? 174 GLU D C   1 
ATOM   10976 O O   . GLU D 1 177 ? 53.347 42.091  -25.733 1.00 60.12  ? 174 GLU D O   1 
ATOM   10977 C CB  . GLU D 1 177 ? 51.577 39.874  -23.841 1.00 66.76  ? 174 GLU D CB  1 
ATOM   10978 C CG  . GLU D 1 177 ? 50.477 39.629  -22.805 1.00 74.65  ? 174 GLU D CG  1 
ATOM   10979 C CD  . GLU D 1 177 ? 50.507 40.615  -21.641 1.00 76.83  ? 174 GLU D CD  1 
ATOM   10980 O OE1 . GLU D 1 177 ? 49.548 40.615  -20.840 1.00 67.57  ? 174 GLU D OE1 1 
ATOM   10981 O OE2 . GLU D 1 177 ? 51.484 41.387  -21.520 1.00 79.60  ? 174 GLU D OE2 1 
ATOM   10982 N N   . GLY D 1 178 ? 52.365 40.360  -26.762 1.00 47.45  ? 175 GLY D N   1 
ATOM   10983 C CA  . GLY D 1 178 ? 53.363 40.282  -27.804 1.00 37.88  ? 175 GLY D CA  1 
ATOM   10984 C C   . GLY D 1 178 ? 52.745 40.374  -29.187 1.00 42.28  ? 175 GLY D C   1 
ATOM   10985 O O   . GLY D 1 178 ? 51.699 40.994  -29.392 1.00 44.01  ? 175 GLY D O   1 
ATOM   10986 N N   . GLY D 1 179 ? 53.426 39.747  -30.149 1.00 39.39  ? 176 GLY D N   1 
ATOM   10987 C CA  . GLY D 1 179 ? 52.986 39.702  -31.520 1.00 36.61  ? 176 GLY D CA  1 
ATOM   10988 C C   . GLY D 1 179 ? 52.455 38.340  -31.920 1.00 35.23  ? 176 GLY D C   1 
ATOM   10989 O O   . GLY D 1 179 ? 52.195 37.468  -31.081 1.00 36.06  ? 176 GLY D O   1 
ATOM   10990 N N   . GLY D 1 180 ? 52.295 38.151  -33.223 1.00 31.96  ? 177 GLY D N   1 
ATOM   10991 C CA  . GLY D 1 180 ? 51.761 36.896  -33.730 1.00 29.72  ? 177 GLY D CA  1 
ATOM   10992 C C   . GLY D 1 180 ? 51.386 37.013  -35.200 1.00 31.32  ? 177 GLY D C   1 
ATOM   10993 O O   . GLY D 1 180 ? 52.004 37.769  -35.951 1.00 35.08  ? 177 GLY D O   1 
ATOM   10994 N N   . VAL D 1 181 ? 50.365 36.241  -35.583 1.00 30.31  ? 178 VAL D N   1 
ATOM   10995 C CA  . VAL D 1 181 ? 49.869 36.203  -36.952 1.00 32.15  ? 178 VAL D CA  1 
ATOM   10996 C C   . VAL D 1 181 ? 48.347 36.217  -36.937 1.00 34.85  ? 178 VAL D C   1 
ATOM   10997 O O   . VAL D 1 181 ? 47.705 35.826  -35.961 1.00 36.87  ? 178 VAL D O   1 
ATOM   10998 C CB  . VAL D 1 181 ? 50.378 34.970  -37.733 1.00 33.41  ? 178 VAL D CB  1 
ATOM   10999 C CG1 . VAL D 1 181 ? 51.839 35.138  -38.093 1.00 33.34  ? 178 VAL D CG1 1 
ATOM   11000 C CG2 . VAL D 1 181 ? 50.157 33.692  -36.931 1.00 28.57  ? 178 VAL D CG2 1 
ATOM   11001 N N   . ALA D 1 182 ? 47.778 36.673  -38.051 1.00 33.88  ? 179 ALA D N   1 
ATOM   11002 C CA  . ALA D 1 182 ? 46.337 36.733  -38.242 1.00 30.30  ? 179 ALA D CA  1 
ATOM   11003 C C   . ALA D 1 182 ? 46.042 36.539  -39.720 1.00 35.70  ? 179 ALA D C   1 
ATOM   11004 O O   . ALA D 1 182 ? 46.906 36.755  -40.576 1.00 34.25  ? 179 ALA D O   1 
ATOM   11005 C CB  . ALA D 1 182 ? 45.754 38.062  -37.746 1.00 25.65  ? 179 ALA D CB  1 
ATOM   11006 N N   . MET D 1 183 ? 44.810 36.131  -40.019 1.00 30.96  ? 180 MET D N   1 
ATOM   11007 C CA  . MET D 1 183 ? 44.431 35.898  -41.404 1.00 38.52  ? 180 MET D CA  1 
ATOM   11008 C C   . MET D 1 183 ? 42.918 35.961  -41.554 1.00 40.10  ? 180 MET D C   1 
ATOM   11009 O O   . MET D 1 183 ? 42.169 35.654  -40.622 1.00 35.35  ? 180 MET D O   1 
ATOM   11010 C CB  . MET D 1 183 ? 44.953 34.549  -41.916 1.00 34.47  ? 180 MET D CB  1 
ATOM   11011 C CG  . MET D 1 183 ? 44.200 33.336  -41.396 1.00 40.93  ? 180 MET D CG  1 
ATOM   11012 S SD  . MET D 1 183 ? 44.958 31.799  -41.958 1.00 52