data_6B9H
# 
_entry.id   6B9H 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.321 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6B9H         
WWPDB D_1000230239 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6B9H 
_pdbx_database_status.recvd_initial_deposition_date   2017-10-10 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Lee, I.G.'     1 ? 
'Dominguez, R.' 2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            9 
_citation.language                  ? 
_citation.page_first                986 
_citation.page_last                 986 
_citation.title                     
'A conserved interaction of the dynein light intermediate chain with dynein-dynactin effectors necessary for processivity.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41467-018-03412-8 
_citation.pdbx_database_id_PubMed   29515126 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Lee, I.G.'              1 ? 
primary 'Olenick, M.A.'          2 ? 
primary 'Boczkowska, M.'         3 ? 
primary 'Franzini-Armstrong, C.' 4 ? 
primary 'Holzbaur, E.L.F.'       5 ? 
primary 'Dominguez, R.'          6 ? 
# 
_cell.entry_id           6B9H 
_cell.length_a           31.715 
_cell.length_b           35.372 
_cell.length_c           126.149 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         6B9H 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Protein Hook homolog 3'                          18390.109 1   ? ? ? ? 
2 polymer syn 'Cytoplasmic dynein 1 light intermediate chain 1' 2676.032  1   ? ? ? ? 
3 water   nat water                                             18.015    121 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 hHK3                                                                          
2 'LIC1,Dynein light chain A,DLC-A,Dynein light intermediate chain 1,cytosolic' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;SMFSVESLERAELCESLLTWIQTFNVDAPCQTVEDLTNGVVMAQVLQKIDPAYFDENWLNRIKTEVGDNWRLKISNLKKI
LKGILDYNHEILGQQINDFTLPDVNLIGEHSDAAELGRMLQLILGCAVNCEQKQEYIQAIMMMEESVQHVVMTAIQELMS
K
;
;SMFSVESLERAELCESLLTWIQTFNVDAPCQTVEDLTNGVVMAQVLQKIDPAYFDENWLNRIKTEVGDNWRLKISNLKKI
LKGILDYNHEILGQQINDFTLPDVNLIGEHSDAAELGRMLQLILGCAVNCEQKQEYIQAIMMMEESVQHVVMTAIQELMS
K
;
A ? 
2 'polypeptide(L)' no no NMKAGATSEGVLANFFNSLLSKKTGS NMKAGATSEGVLANFFNSLLSKKTGS B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   PHE n 
1 4   SER n 
1 5   VAL n 
1 6   GLU n 
1 7   SER n 
1 8   LEU n 
1 9   GLU n 
1 10  ARG n 
1 11  ALA n 
1 12  GLU n 
1 13  LEU n 
1 14  CYS n 
1 15  GLU n 
1 16  SER n 
1 17  LEU n 
1 18  LEU n 
1 19  THR n 
1 20  TRP n 
1 21  ILE n 
1 22  GLN n 
1 23  THR n 
1 24  PHE n 
1 25  ASN n 
1 26  VAL n 
1 27  ASP n 
1 28  ALA n 
1 29  PRO n 
1 30  CYS n 
1 31  GLN n 
1 32  THR n 
1 33  VAL n 
1 34  GLU n 
1 35  ASP n 
1 36  LEU n 
1 37  THR n 
1 38  ASN n 
1 39  GLY n 
1 40  VAL n 
1 41  VAL n 
1 42  MET n 
1 43  ALA n 
1 44  GLN n 
1 45  VAL n 
1 46  LEU n 
1 47  GLN n 
1 48  LYS n 
1 49  ILE n 
1 50  ASP n 
1 51  PRO n 
1 52  ALA n 
1 53  TYR n 
1 54  PHE n 
1 55  ASP n 
1 56  GLU n 
1 57  ASN n 
1 58  TRP n 
1 59  LEU n 
1 60  ASN n 
1 61  ARG n 
1 62  ILE n 
1 63  LYS n 
1 64  THR n 
1 65  GLU n 
1 66  VAL n 
1 67  GLY n 
1 68  ASP n 
1 69  ASN n 
1 70  TRP n 
1 71  ARG n 
1 72  LEU n 
1 73  LYS n 
1 74  ILE n 
1 75  SER n 
1 76  ASN n 
1 77  LEU n 
1 78  LYS n 
1 79  LYS n 
1 80  ILE n 
1 81  LEU n 
1 82  LYS n 
1 83  GLY n 
1 84  ILE n 
1 85  LEU n 
1 86  ASP n 
1 87  TYR n 
1 88  ASN n 
1 89  HIS n 
1 90  GLU n 
1 91  ILE n 
1 92  LEU n 
1 93  GLY n 
1 94  GLN n 
1 95  GLN n 
1 96  ILE n 
1 97  ASN n 
1 98  ASP n 
1 99  PHE n 
1 100 THR n 
1 101 LEU n 
1 102 PRO n 
1 103 ASP n 
1 104 VAL n 
1 105 ASN n 
1 106 LEU n 
1 107 ILE n 
1 108 GLY n 
1 109 GLU n 
1 110 HIS n 
1 111 SER n 
1 112 ASP n 
1 113 ALA n 
1 114 ALA n 
1 115 GLU n 
1 116 LEU n 
1 117 GLY n 
1 118 ARG n 
1 119 MET n 
1 120 LEU n 
1 121 GLN n 
1 122 LEU n 
1 123 ILE n 
1 124 LEU n 
1 125 GLY n 
1 126 CYS n 
1 127 ALA n 
1 128 VAL n 
1 129 ASN n 
1 130 CYS n 
1 131 GLU n 
1 132 GLN n 
1 133 LYS n 
1 134 GLN n 
1 135 GLU n 
1 136 TYR n 
1 137 ILE n 
1 138 GLN n 
1 139 ALA n 
1 140 ILE n 
1 141 MET n 
1 142 MET n 
1 143 MET n 
1 144 GLU n 
1 145 GLU n 
1 146 SER n 
1 147 VAL n 
1 148 GLN n 
1 149 HIS n 
1 150 VAL n 
1 151 VAL n 
1 152 MET n 
1 153 THR n 
1 154 ALA n 
1 155 ILE n 
1 156 GLN n 
1 157 GLU n 
1 158 LEU n 
1 159 MET n 
1 160 SER n 
1 161 LYS n 
2 1   ASN n 
2 2   MET n 
2 3   LYS n 
2 4   ALA n 
2 5   GLY n 
2 6   ALA n 
2 7   THR n 
2 8   SER n 
2 9   GLU n 
2 10  GLY n 
2 11  VAL n 
2 12  LEU n 
2 13  ALA n 
2 14  ASN n 
2 15  PHE n 
2 16  PHE n 
2 17  ASN n 
2 18  SER n 
2 19  LEU n 
2 20  LEU n 
2 21  SER n 
2 22  LYS n 
2 23  LYS n 
2 24  THR n 
2 25  GLY n 
2 26  SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   161 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 HOOK3 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       26 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   Human 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP HOOK3_HUMAN Q86VS8 ? 1 
;MFSVESLERAELCESLLTWIQTFNVDAPCQTVEDLTNGVVMAQVLQKIDPAYFDENWLNRIKTEVGDNWRLKISNLKKIL
KGILDYNHEILGQQINDFTLPDVNLIGEHSDAAELGRMLQLILGCAVNCEQKQEYIQAIMMMEESVQHVVMTAIQELMSK

;
1   
2 UNP DC1L1_HUMAN Q9Y6G9 ? 2 NMKAGATSEGVLANFFNSLLSKKTGS 433 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6B9H A 2 ? 161 ? Q86VS8 1   ? 160 ? 1   160 
2 2 6B9H B 1 ? 26  ? Q9Y6G9 433 ? 458 ? 433 458 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             6B9H 
_struct_ref_seq_dif.mon_id                       SER 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      1 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q86VS8 
_struct_ref_seq_dif.db_mon_id                    ? 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          ? 
_struct_ref_seq_dif.details                      'expression tag' 
_struct_ref_seq_dif.pdbx_auth_seq_num            0 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6B9H 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            1.72 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         28.69 
_exptl_crystal.description                 Needles 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.25 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '1.44 M Ammonium Citrate Tribasic' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-11-29 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97750 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'CHESS BEAMLINE F1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97750 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   F1 
_diffrn_source.pdbx_synchrotron_site       CHESS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6B9H 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.50 
_reflns.d_resolution_low                 50.00 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       23303 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98.7 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  11.2 
_reflns.pdbx_Rmerge_I_obs                0.053 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            50.7 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.50 
_reflns_shell.d_res_low                   1.55 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         3.8 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           2089 
_reflns_shell.percent_possible_all        90.9 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.373 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             5.6 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 6B9H 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     23303 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.540 
_refine.ls_d_res_high                            1.500 
_refine.ls_percent_reflns_obs                    98.80 
_refine.ls_R_factor_obs                          0.1561 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1549 
_refine.ls_R_factor_R_free                       0.1791 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.00 
_refine.ls_number_reflns_R_free                  1165 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      5j8e 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.12 
_refine.pdbx_overall_phase_error                 16.71 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1309 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             121 
_refine_hist.number_atoms_total               1430 
_refine_hist.d_res_high                       1.500 
_refine_hist.d_res_low                        20.540 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.011 ? ? 1369 'X-RAY DIFFRACTION' ? 
f_angle_d          1.377 ? ? 1856 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 9.187 ? ? 1140 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.256 ? ? 216  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.011 ? ? 239  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 1.5000 1.5536  1986 0.1895 91.00  0.2343 . . 103 . . . . 
'X-RAY DIFFRACTION' . 1.5536 1.6158  2150 0.1662 97.00  0.1909 . . 114 . . . . 
'X-RAY DIFFRACTION' . 1.6158 1.6893  2218 0.1563 100.00 0.1908 . . 117 . . . . 
'X-RAY DIFFRACTION' . 1.6893 1.7783  2198 0.1533 100.00 0.1956 . . 115 . . . . 
'X-RAY DIFFRACTION' . 1.7783 1.8896  2196 0.1514 100.00 0.1817 . . 116 . . . . 
'X-RAY DIFFRACTION' . 1.8896 2.0354  2212 0.1459 100.00 0.1758 . . 116 . . . . 
'X-RAY DIFFRACTION' . 2.0354 2.2400  2251 0.1391 100.00 0.1797 . . 118 . . . . 
'X-RAY DIFFRACTION' . 2.2400 2.5636  2236 0.1491 100.00 0.1350 . . 119 . . . . 
'X-RAY DIFFRACTION' . 2.5636 3.2279  2303 0.1530 100.00 0.1687 . . 121 . . . . 
'X-RAY DIFFRACTION' . 3.2279 20.5421 2388 0.1626 100.00 0.1983 . . 126 . . . . 
# 
_struct.entry_id                     6B9H 
_struct.title                        'Complex of Hook Domain with a Dynein Light Intermediate Chain Peptide' 
_struct.pdbx_descriptor              'Hook3, Cytoplasmic dynein 1 light intermediate chain 1' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6B9H 
_struct_keywords.text            
'Dynein, Dynactin, Effector, Hook, Light Intermediate Chain (LIC), PROTEIN TRANSPORT-Motor protein complex' 
_struct_keywords.pdbx_keywords   'PROTEIN TRANSPORT/Motor protein' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLU A 12  ? THR A 23  ? GLU A 11  THR A 22  1 ? 12 
HELX_P HELX_P2  AA2 VAL A 33  ? THR A 37  ? VAL A 32  THR A 36  5 ? 5  
HELX_P HELX_P3  AA3 GLY A 39  ? ASP A 50  ? GLY A 38  ASP A 49  1 ? 12 
HELX_P HELX_P4  AA4 ASP A 55  ? ASN A 60  ? ASP A 54  ASN A 59  1 ? 6  
HELX_P HELX_P5  AA5 ASN A 69  ? ILE A 91  ? ASN A 68  ILE A 90  1 ? 23 
HELX_P HELX_P6  AA6 ASP A 103 ? SER A 111 ? ASP A 102 SER A 110 1 ? 9  
HELX_P HELX_P7  AA7 ASP A 112 ? VAL A 128 ? ASP A 111 VAL A 127 1 ? 17 
HELX_P HELX_P8  AA8 GLN A 132 ? MET A 141 ? GLN A 131 MET A 140 1 ? 10 
HELX_P HELX_P9  AA9 GLU A 144 ? SER A 160 ? GLU A 143 SER A 159 1 ? 17 
HELX_P HELX_P10 AB1 GLY B 10  ? LYS B 22  ? GLY B 442 LYS B 454 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_atom_sites.entry_id                    6B9H 
_atom_sites.fract_transf_matrix[1][1]   0.031531 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.028271 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007927 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N    . ALA A 1 11  ? 12.826  -12.959 -16.608 1.00 59.27  ? 10  ALA A N    1 
ATOM   2    C CA   . ALA A 1 11  ? 13.594  -11.805 -16.812 1.00 40.01  ? 10  ALA A CA   1 
ATOM   3    C C    . ALA A 1 11  ? 13.538  -11.444 -18.292 1.00 51.84  ? 10  ALA A C    1 
ATOM   4    O O    . ALA A 1 11  ? 13.324  -12.269 -19.149 1.00 57.96  ? 10  ALA A O    1 
ATOM   5    C CB   . ALA A 1 11  ? 14.938  -12.019 -16.155 1.00 35.40  ? 10  ALA A CB   1 
ATOM   6    H H    . ALA A 1 11  ? 13.255  -13.682 -16.724 1.00 71.13  ? 10  ALA A H    1 
ATOM   7    H HA   . ALA A 1 11  ? 13.157  -11.051 -16.391 1.00 48.02  ? 10  ALA A HA   1 
ATOM   8    H HB1  . ALA A 1 11  ? 15.427  -11.201 -16.162 1.00 42.49  ? 10  ALA A HB1  1 
ATOM   9    H HB2  . ALA A 1 11  ? 14.811  -12.303 -15.255 1.00 42.49  ? 10  ALA A HB2  1 
ATOM   10   H HB3  . ALA A 1 11  ? 15.410  -12.689 -16.636 1.00 42.49  ? 10  ALA A HB3  1 
ATOM   11   N N    . GLU A 1 12  ? 13.881  -10.237 -18.545 1.00 55.11  ? 11  GLU A N    1 
ATOM   12   C CA   . GLU A 1 12  ? 13.763  -9.496  -19.777 1.00 40.93  ? 11  GLU A CA   1 
ATOM   13   C C    . GLU A 1 12  ? 12.300  -8.945  -19.869 1.00 25.94  ? 11  GLU A C    1 
ATOM   14   O O    . GLU A 1 12  ? 11.945  -8.220  -20.753 1.00 24.71  ? 11  GLU A O    1 
ATOM   15   C CB   . GLU A 1 12  ? 13.829  -10.379 -20.984 1.00 54.36  ? 11  GLU A CB   1 
ATOM   16   C CG   . GLU A 1 12  ? 14.230  -9.541  -22.185 1.00 50.92  ? 11  GLU A CG   1 
ATOM   17   C CD   . GLU A 1 12  ? 14.537  -10.351 -23.409 1.00 63.98  ? 11  GLU A CD   1 
ATOM   18   O OE1  . GLU A 1 12  ? 14.330  -11.597 -23.338 1.00 68.62  ? 11  GLU A OE1  1 
ATOM   19   O OE2  . GLU A 1 12  ? 14.951  -9.713  -24.406 1.00 60.21  ? 11  GLU A OE2  1 
ATOM   20   H H    . GLU A 1 12  ? 13.947  -9.649  -17.868 1.00 66.14  ? 11  GLU A H    1 
ATOM   21   H HA   . GLU A 1 12  ? 14.466  -8.826  -19.838 1.00 49.12  ? 11  GLU A HA   1 
ATOM   22   H HB2  . GLU A 1 12  ? 14.514  -11.041 -20.866 1.00 65.24  ? 11  GLU A HB2  1 
ATOM   23   H HB3  . GLU A 1 12  ? 12.972  -10.804 -21.123 1.00 65.24  ? 11  GLU A HB3  1 
ATOM   24   H HG2  . GLU A 1 12  ? 13.518  -8.929  -22.394 1.00 61.11  ? 11  GLU A HG2  1 
ATOM   25   H HG3  . GLU A 1 12  ? 15.029  -9.043  -21.974 1.00 61.11  ? 11  GLU A HG3  1 
ATOM   26   N N    . LEU A 1 13  ? 11.490  -9.352  -18.933 1.00 28.32  ? 12  LEU A N    1 
ATOM   27   C CA   . LEU A 1 13  ? 10.137  -8.933  -18.764 1.00 20.15  ? 12  LEU A CA   1 
ATOM   28   C C    . LEU A 1 13  ? 9.994   -7.534  -18.200 1.00 14.99  ? 12  LEU A C    1 
ATOM   29   O O    . LEU A 1 13  ? 9.338   -6.743  -18.739 1.00 15.34  ? 12  LEU A O    1 
ATOM   30   C CB   . LEU A 1 13  ? 9.477   -9.841  -17.771 1.00 35.89  ? 12  LEU A CB   1 
ATOM   31   C CG   . LEU A 1 13  ? 8.033   -10.012 -17.830 1.00 31.17  ? 12  LEU A CG   1 
ATOM   32   C CD1  . LEU A 1 13  ? 7.757   -10.509 -19.209 1.00 32.72  ? 12  LEU A CD1  1 
ATOM   33   C CD2  . LEU A 1 13  ? 7.530   -11.057 -16.851 1.00 38.13  ? 12  LEU A CD2  1 
ATOM   34   H H    . LEU A 1 13  ? 11.582  -10.216 -18.808 1.00 34.00  ? 12  LEU A H    1 
ATOM   35   H HA   . LEU A 1 13  ? 9.621   -8.986  -19.577 1.00 24.19  ? 12  LEU A HA   1 
ATOM   36   H HB2  . LEU A 1 13  ? 9.864   -10.704 -17.923 1.00 43.08  ? 12  LEU A HB2  1 
ATOM   37   H HB3  . LEU A 1 13  ? 9.688   -9.552  -16.878 1.00 43.08  ? 12  LEU A HB3  1 
ATOM   38   H HG   . LEU A 1 13  ? 7.616   -9.169  -17.676 1.00 37.42  ? 12  LEU A HG   1 
ATOM   39   H HD11 . LEU A 1 13  ? 6.820   -10.470 -19.355 1.00 39.27  ? 12  LEU A HD11 1 
ATOM   40   H HD12 . LEU A 1 13  ? 8.207   -9.966  -19.843 1.00 39.27  ? 12  LEU A HD12 1 
ATOM   41   H HD13 . LEU A 1 13  ? 8.055   -11.409 -19.274 1.00 39.27  ? 12  LEU A HD13 1 
ATOM   42   H HD21 . LEU A 1 13  ? 6.649   -10.828 -16.583 1.00 45.77  ? 12  LEU A HD21 1 
ATOM   43   H HD22 . LEU A 1 13  ? 7.524   -11.924 -17.254 1.00 45.77  ? 12  LEU A HD22 1 
ATOM   44   H HD23 . LEU A 1 13  ? 8.111   -11.054 -16.098 1.00 45.77  ? 12  LEU A HD23 1 
ATOM   45   N N    . CYS A 1 14  ? 10.639  -7.291  -17.090 1.00 13.93  ? 13  CYS A N    1 
ATOM   46   C CA   . CYS A 1 14  ? 10.391  -6.043  -16.401 1.00 11.91  ? 13  CYS A CA   1 
ATOM   47   C C    . CYS A 1 14  ? 10.698  -4.843  -17.289 1.00 14.37  ? 13  CYS A C    1 
ATOM   48   O O    . CYS A 1 14  ? 9.912   -3.895  -17.347 1.00 13.09  ? 13  CYS A O    1 
ATOM   49   C CB   . CYS A 1 14  ? 11.215  -5.978  -15.118 1.00 13.56  ? 13  CYS A CB   1 
ATOM   50   S SG   . CYS A 1 14  ? 10.863  -4.548  -14.078 1.00 18.02  ? 13  CYS A SG   1 
ATOM   51   H H    . CYS A 1 14  ? 11.228  -7.796  -16.719 1.00 16.72  ? 13  CYS A H    1 
ATOM   52   H HA   . CYS A 1 14  ? 9.453   -6.001  -16.156 1.00 14.30  ? 13  CYS A HA   1 
ATOM   53   H HB2  . CYS A 1 14  ? 11.036  -6.774  -14.594 1.00 16.28  ? 13  CYS A HB2  1 
ATOM   54   H HB3  . CYS A 1 14  ? 12.155  -5.945  -15.354 1.00 16.28  ? 13  CYS A HB3  1 
ATOM   55   H HG   . CYS A 1 14  ? 11.093  -3.547  -14.699 1.00 21.64  ? 13  CYS A HG   1 
ATOM   56   N N    . GLU A 1 15  ? 11.863  -4.827  -17.943 1.00 12.14  ? 14  GLU A N    1 
ATOM   57   C CA   . GLU A 1 15  ? 12.250  -3.625  -18.670 1.00 12.10  ? 14  GLU A CA   1 
ATOM   58   C C    . GLU A 1 15  ? 11.478  -3.449  -19.968 1.00 9.89   ? 14  GLU A C    1 
ATOM   59   O O    . GLU A 1 15  ? 11.207  -2.310  -20.348 1.00 12.50  ? 14  GLU A O    1 
ATOM   60   C CB   . GLU A 1 15  ? 13.762  -3.605  -18.914 1.00 13.71  ? 14  GLU A CB   1 
ATOM   61   C CG   . GLU A 1 15  ? 14.464  -3.346  -17.603 1.00 13.23  ? 14  GLU A CG   1 
ATOM   62   C CD   . GLU A 1 15  ? 15.954  -3.206  -17.722 1.00 15.75  ? 14  GLU A CD   1 
ATOM   63   O OE1  . GLU A 1 15  ? 16.523  -3.644  -18.731 1.00 17.57  ? 14  GLU A OE1  1 
ATOM   64   O OE2  . GLU A 1 15  ? 16.523  -2.552  -16.808 1.00 15.29  ? 14  GLU A OE2  1 
ATOM   65   H H    . GLU A 1 15  ? 12.426  -5.477  -17.980 1.00 14.57  ? 14  GLU A H    1 
ATOM   66   H HA   . GLU A 1 15  ? 12.043  -2.859  -18.112 1.00 14.53  ? 14  GLU A HA   1 
ATOM   67   H HB2  . GLU A 1 15  ? 14.051  -4.464  -19.258 1.00 16.46  ? 14  GLU A HB2  1 
ATOM   68   H HB3  . GLU A 1 15  ? 13.985  -2.893  -19.533 1.00 16.46  ? 14  GLU A HB3  1 
ATOM   69   H HG2  . GLU A 1 15  ? 14.119  -2.523  -17.223 1.00 15.89  ? 14  GLU A HG2  1 
ATOM   70   H HG3  . GLU A 1 15  ? 14.283  -4.085  -17.002 1.00 15.89  ? 14  GLU A HG3  1 
ATOM   71   N N    . SER A 1 16  ? 11.135  -4.536  -20.655 1.00 11.91  ? 15  SER A N    1 
ATOM   72   C CA   . SER A 1 16  ? 10.280  -4.395  -21.822 1.00 12.23  ? 15  SER A CA   1 
ATOM   73   C C    . SER A 1 16  ? 8.907   -3.912  -21.407 1.00 11.84  ? 15  SER A C    1 
ATOM   74   O O    . SER A 1 16  ? 8.294   -3.080  -22.103 1.00 10.97  ? 15  SER A O    1 
ATOM   75   C CB   . SER A 1 16  ? 10.162  -5.709  -22.571 1.00 13.37  ? 15  SER A CB   1 
ATOM   76   O OG   . SER A 1 16  ? 11.381  -6.059  -23.192 1.00 19.13  ? 15  SER A OG   1 
ATOM   77   H H    . SER A 1 16  ? 11.378  -5.340  -20.472 1.00 14.30  ? 15  SER A H    1 
ATOM   78   H HA   . SER A 1 16  ? 10.664  -3.737  -22.423 1.00 14.69  ? 15  SER A HA   1 
ATOM   79   H HB2  . SER A 1 16  ? 9.918   -6.407  -21.943 1.00 16.05  ? 15  SER A HB2  1 
ATOM   80   H HB3  . SER A 1 16  ? 9.476   -5.622  -23.251 1.00 16.05  ? 15  SER A HB3  1 
ATOM   81   H HG   . SER A 1 16  ? 11.986  -6.139  -22.614 1.00 22.97  ? 15  SER A HG   1 
ATOM   82   N N    . LEU A 1 17  ? 8.393   -4.394  -20.303 1.00 11.09  ? 16  LEU A N    1 
ATOM   83   C CA   . LEU A 1 17  ? 7.087   -3.944  -19.855 1.00 9.77   ? 16  LEU A CA   1 
ATOM   84   C C    . LEU A 1 17  ? 7.145   -2.523  -19.289 1.00 10.14  ? 16  LEU A C    1 
ATOM   85   O O    . LEU A 1 17  ? 6.211   -1.861  -19.344 1.00 10.89  ? 16  LEU A O    1 
ATOM   86   C CB   . LEU A 1 17  ? 6.434   -4.936  -18.945 1.00 11.30  ? 16  LEU A CB   1 
ATOM   87   C CG   . LEU A 1 17  ? 6.098   -6.271  -19.574 1.00 22.87  ? 16  LEU A CG   1 
ATOM   88   C CD1  . LEU A 1 17  ? 5.333   -7.104  -18.626 1.00 17.29  ? 16  LEU A CD1  1 
ATOM   89   C CD2  . LEU A 1 17  ? 5.414   -6.168  -20.896 1.00 21.76  ? 16  LEU A CD2  1 
ATOM   90   H H    . LEU A 1 17  ? 8.747   -4.967  -19.829 1.00 13.32  ? 16  LEU A H    1 
ATOM   91   H HA   . LEU A 1 17  ? 6.524   -3.905  -20.632 1.00 11.74  ? 16  LEU A HA   1 
ATOM   92   H HB2  . LEU A 1 17  ? 7.010   -5.104  -18.213 1.00 13.57  ? 16  LEU A HB2  1 
ATOM   93   H HB3  . LEU A 1 17  ? 5.628   -4.562  -18.635 1.00 13.57  ? 16  LEU A HB3  1 
ATOM   94   H HG   . LEU A 1 17  ? 6.919   -6.728  -19.729 1.00 27.46  ? 16  LEU A HG   1 
ATOM   95   H HD11 . LEU A 1 17  ? 5.547   -8.009  -18.748 1.00 20.76  ? 16  LEU A HD11 1 
ATOM   96   H HD12 . LEU A 1 17  ? 5.539   -6.853  -17.741 1.00 20.76  ? 16  LEU A HD12 1 
ATOM   97   H HD13 . LEU A 1 17  ? 4.423   -6.962  -18.804 1.00 20.76  ? 16  LEU A HD13 1 
ATOM   98   H HD21 . LEU A 1 17  ? 4.761   -6.839  -20.973 1.00 26.12  ? 16  LEU A HD21 1 
ATOM   99   H HD22 . LEU A 1 17  ? 5.002   -5.318  -20.975 1.00 26.12  ? 16  LEU A HD22 1 
ATOM   100  H HD23 . LEU A 1 17  ? 6.056   -6.276  -21.575 1.00 26.12  ? 16  LEU A HD23 1 
ATOM   101  N N    . LEU A 1 18  ? 8.287   -2.099  -18.772 1.00 11.04  ? 17  LEU A N    1 
ATOM   102  C CA   . LEU A 1 18  ? 8.451   -0.687  -18.420 1.00 10.26  ? 17  LEU A CA   1 
ATOM   103  C C    . LEU A 1 18  ? 8.286   0.223   -19.637 1.00 10.12  ? 17  LEU A C    1 
ATOM   104  O O    . LEU A 1 18  ? 7.606   1.243   -19.568 1.00 10.68  ? 17  LEU A O    1 
ATOM   105  C CB   . LEU A 1 18  ? 9.815   -0.471  -17.735 1.00 11.59  ? 17  LEU A CB   1 
ATOM   106  C CG   . LEU A 1 18  ? 10.187  0.966   -17.421 1.00 14.34  ? 17  LEU A CG   1 
ATOM   107  C CD1  . LEU A 1 18  ? 9.203   1.597   -16.430 1.00 17.76  ? 17  LEU A CD1  1 
ATOM   108  C CD2  . LEU A 1 18  ? 11.588  0.987   -16.862 1.00 16.77  ? 17  LEU A CD2  1 
ATOM   109  H H    . LEU A 1 18  ? 8.973   -2.590  -18.605 1.00 13.26  ? 17  LEU A H    1 
ATOM   110  H HA   . LEU A 1 18  ? 7.762   -0.447  -17.781 1.00 12.33  ? 17  LEU A HA   1 
ATOM   111  H HB2  . LEU A 1 18  ? 9.816   -0.959  -16.897 1.00 13.92  ? 17  LEU A HB2  1 
ATOM   112  H HB3  . LEU A 1 18  ? 10.506  -0.828  -18.315 1.00 13.92  ? 17  LEU A HB3  1 
ATOM   113  H HG   . LEU A 1 18  ? 10.176  1.488   -18.238 1.00 17.22  ? 17  LEU A HG   1 
ATOM   114  H HD11 . LEU A 1 18  ? 9.474   2.512   -16.255 1.00 21.32  ? 17  LEU A HD11 1 
ATOM   115  H HD12 . LEU A 1 18  ? 8.314   1.583   -16.817 1.00 21.32  ? 17  LEU A HD12 1 
ATOM   116  H HD13 . LEU A 1 18  ? 9.214   1.085   -15.606 1.00 21.32  ? 17  LEU A HD13 1 
ATOM   117  H HD21 . LEU A 1 18  ? 11.833  1.903   -16.658 1.00 20.14  ? 17  LEU A HD21 1 
ATOM   118  H HD22 . LEU A 1 18  ? 11.614  0.450   -16.054 1.00 20.14  ? 17  LEU A HD22 1 
ATOM   119  H HD23 . LEU A 1 18  ? 12.197  0.621   -17.522 1.00 20.14  ? 17  LEU A HD23 1 
ATOM   120  N N    . THR A 1 19  ? 8.904   -0.144  -20.759 1.00 10.67  ? 18  THR A N    1 
ATOM   121  C CA   . THR A 1 19  ? 8.710   0.609   -21.988 1.00 9.68   ? 18  THR A CA   1 
ATOM   122  C C    . THR A 1 19  ? 7.242   0.684   -22.348 1.00 10.85  ? 18  THR A C    1 
ATOM   123  O O    . THR A 1 19  ? 6.751   1.742   -22.744 1.00 12.53  ? 18  THR A O    1 
ATOM   124  C CB   . THR A 1 19  ? 9.532   -0.037  -23.086 1.00 12.51  ? 18  THR A CB   1 
ATOM   125  O OG1  . THR A 1 19  ? 10.883  -0.027  -22.648 1.00 14.89  ? 18  THR A OG1  1 
ATOM   126  C CG2  . THR A 1 19  ? 9.429   0.746   -24.358 1.00 13.94  ? 18  THR A CG2  1 
ATOM   127  H H    . THR A 1 19  ? 9.435   -0.817  -20.832 1.00 12.81  ? 18  THR A H    1 
ATOM   128  H HA   . THR A 1 19  ? 9.035   1.514   -21.860 1.00 11.63  ? 18  THR A HA   1 
ATOM   129  H HB   . THR A 1 19  ? 9.234   -0.947  -23.241 1.00 15.02  ? 18  THR A HB   1 
ATOM   130  H HG1  . THR A 1 19  ? 11.377  -0.378  -23.231 1.00 17.87  ? 18  THR A HG1  1 
ATOM   131  H HG21 . THR A 1 19  ? 9.959   0.322   -25.052 1.00 16.74  ? 18  THR A HG21 1 
ATOM   132  H HG22 . THR A 1 19  ? 8.504   0.786   -24.648 1.00 16.74  ? 18  THR A HG22 1 
ATOM   133  H HG23 . THR A 1 19  ? 9.755   1.648   -24.219 1.00 16.74  ? 18  THR A HG23 1 
ATOM   134  N N    . TRP A 1 20  ? 6.530   -0.435  -22.218 1.00 11.19  ? 19  TRP A N    1 
ATOM   135  C CA   . TRP A 1 20  ? 5.099   -0.439  -22.489 1.00 9.82   ? 19  TRP A CA   1 
ATOM   136  C C    . TRP A 1 20  ? 4.344   0.477   -21.530 1.00 9.54   ? 19  TRP A C    1 
ATOM   137  O O    . TRP A 1 20  ? 3.483   1.274   -21.935 1.00 10.19  ? 19  TRP A O    1 
ATOM   138  C CB   . TRP A 1 20  ? 4.593   -1.877  -22.410 1.00 9.38   ? 19  TRP A CB   1 
ATOM   139  C CG   . TRP A 1 20  ? 3.125   -1.981  -22.612 1.00 9.94   ? 19  TRP A CG   1 
ATOM   140  C CD1  . TRP A 1 20  ? 2.446   -1.756  -23.766 1.00 10.72  ? 19  TRP A CD1  1 
ATOM   141  C CD2  . TRP A 1 20  ? 2.145   -2.264  -21.609 1.00 10.37  ? 19  TRP A CD2  1 
ATOM   142  N NE1  . TRP A 1 20  ? 1.093   -1.899  -23.541 1.00 10.67  ? 19  TRP A NE1  1 
ATOM   143  C CE2  . TRP A 1 20  ? 0.891   -2.222  -22.231 1.00 9.94   ? 19  TRP A CE2  1 
ATOM   144  C CE3  . TRP A 1 20  ? 2.212   -2.575  -20.253 1.00 10.82  ? 19  TRP A CE3  1 
ATOM   145  C CZ2  . TRP A 1 20  ? -0.291  -2.460  -21.547 1.00 10.36  ? 19  TRP A CZ2  1 
ATOM   146  C CZ3  . TRP A 1 20  ? 1.045   -2.821  -19.580 1.00 12.67  ? 19  TRP A CZ3  1 
ATOM   147  C CH2  . TRP A 1 20  ? -0.195  -2.745  -20.224 1.00 9.91   ? 19  TRP A CH2  1 
ATOM   148  H H    . TRP A 1 20  ? 6.850   -1.196  -21.976 1.00 13.44  ? 19  TRP A H    1 
ATOM   149  H HA   . TRP A 1 20  ? 4.948   -0.117  -23.392 1.00 11.79  ? 19  TRP A HA   1 
ATOM   150  H HB2  . TRP A 1 20  ? 5.028   -2.403  -23.099 1.00 11.27  ? 19  TRP A HB2  1 
ATOM   151  H HB3  . TRP A 1 20  ? 4.801   -2.237  -21.535 1.00 11.27  ? 19  TRP A HB3  1 
ATOM   152  H HD1  . TRP A 1 20  ? 2.833   -1.530  -24.581 1.00 12.88  ? 19  TRP A HD1  1 
ATOM   153  H HE1  . TRP A 1 20  ? 0.476   -1.811  -24.134 1.00 12.81  ? 19  TRP A HE1  1 
ATOM   154  H HE3  . TRP A 1 20  ? 3.031   -2.612  -19.814 1.00 13.00  ? 19  TRP A HE3  1 
ATOM   155  H HZ2  . TRP A 1 20  ? -1.115  -2.427  -21.976 1.00 12.45  ? 19  TRP A HZ2  1 
ATOM   156  H HZ3  . TRP A 1 20  ? 1.076   -3.020  -18.672 1.00 15.22  ? 19  TRP A HZ3  1 
ATOM   157  H HH2  . TRP A 1 20  ? -0.969  -2.927  -19.741 1.00 11.91  ? 19  TRP A HH2  1 
ATOM   158  N N    . ILE A 1 21  ? 4.660   0.381   -20.236 1.00 8.78   ? 20  ILE A N    1 
ATOM   159  C CA   . ILE A 1 21  ? 4.059   1.276   -19.252 1.00 8.85   ? 20  ILE A CA   1 
ATOM   160  C C    . ILE A 1 21  ? 4.272   2.729   -19.648 1.00 11.53  ? 20  ILE A C    1 
ATOM   161  O O    . ILE A 1 21  ? 3.368   3.557   -19.490 1.00 10.96  ? 20  ILE A O    1 
ATOM   162  C CB   . ILE A 1 21  ? 4.622   0.979   -17.847 1.00 9.36   ? 20  ILE A CB   1 
ATOM   163  C CG1  . ILE A 1 21  ? 4.128   -0.376  -17.333 1.00 11.66  ? 20  ILE A CG1  1 
ATOM   164  C CG2  . ILE A 1 21  ? 4.254   2.088   -16.890 1.00 12.88  ? 20  ILE A CG2  1 
ATOM   165  C CD1  . ILE A 1 21  ? 2.611   -0.424  -16.997 1.00 14.32  ? 20  ILE A CD1  1 
ATOM   166  H H    . ILE A 1 21  ? 5.214   -0.188  -19.907 1.00 10.55  ? 20  ILE A H    1 
ATOM   167  H HA   . ILE A 1 21  ? 3.103   1.114   -19.227 1.00 10.63  ? 20  ILE A HA   1 
ATOM   168  H HB   . ILE A 1 21  ? 5.589   0.944   -17.911 1.00 11.25  ? 20  ILE A HB   1 
ATOM   169  H HG12 . ILE A 1 21  ? 4.300   -1.048  -18.011 1.00 14.00  ? 20  ILE A HG12 1 
ATOM   170  H HG13 . ILE A 1 21  ? 4.615   -0.597  -16.524 1.00 14.00  ? 20  ILE A HG13 1 
ATOM   171  H HG21 . ILE A 1 21  ? 4.617   1.882   -16.014 1.00 15.46  ? 20  ILE A HG21 1 
ATOM   172  H HG22 . ILE A 1 21  ? 4.627   2.922   -17.215 1.00 15.46  ? 20  ILE A HG22 1 
ATOM   173  H HG23 . ILE A 1 21  ? 3.288   2.154   -16.840 1.00 15.46  ? 20  ILE A HG23 1 
ATOM   174  H HD11 . ILE A 1 21  ? 2.387   -1.313  -16.680 1.00 17.19  ? 20  ILE A HD11 1 
ATOM   175  H HD12 . ILE A 1 21  ? 2.420   0.231   -16.308 1.00 17.19  ? 20  ILE A HD12 1 
ATOM   176  H HD13 . ILE A 1 21  ? 2.105   -0.220  -17.798 1.00 17.19  ? 20  ILE A HD13 1 
ATOM   177  N N    . GLN A 1 22  ? 5.468   3.060   -20.142 1.00 11.17  ? 21  GLN A N    1 
ATOM   178  C CA   . GLN A 1 22  ? 5.774   4.440   -20.510 1.00 12.09  ? 21  GLN A CA   1 
ATOM   179  C C    . GLN A 1 22  ? 4.892   4.944   -21.640 1.00 15.01  ? 21  GLN A C    1 
ATOM   180  O O    . GLN A 1 22  ? 4.712   6.163   -21.768 1.00 17.27  ? 21  GLN A O    1 
ATOM   181  C CB   . GLN A 1 22  ? 7.253   4.530   -20.861 1.00 11.43  ? 21  GLN A CB   1 
ATOM   182  C CG   . GLN A 1 22  ? 8.112   4.405   -19.621 1.00 11.49  ? 21  GLN A CG   1 
ATOM   183  C CD   . GLN A 1 22  ? 9.561   4.190   -19.924 1.00 16.16  ? 21  GLN A CD   1 
ATOM   184  O OE1  . GLN A 1 22  ? 9.940   3.922   -21.047 1.00 17.76  ? 21  GLN A OE1  1 
ATOM   185  N NE2  . GLN A 1 22  ? 10.397  4.315   -18.896 1.00 21.04  ? 21  GLN A NE2  1 
ATOM   186  H H    . GLN A 1 22  ? 6.113   2.506   -20.272 1.00 13.41  ? 21  GLN A H    1 
ATOM   187  H HA   . GLN A 1 22  ? 5.619   5.009   -19.740 1.00 14.52  ? 21  GLN A HA   1 
ATOM   188  H HB2  . GLN A 1 22  ? 7.484   3.809   -21.468 1.00 13.72  ? 21  GLN A HB2  1 
ATOM   189  H HB3  . GLN A 1 22  ? 7.434   5.389   -21.274 1.00 13.72  ? 21  GLN A HB3  1 
ATOM   190  H HG2  . GLN A 1 22  ? 8.034   5.220   -19.101 1.00 13.80  ? 21  GLN A HG2  1 
ATOM   191  H HG3  . GLN A 1 22  ? 7.801   3.649   -19.099 1.00 13.80  ? 21  GLN A HG3  1 
ATOM   192  H HE21 . GLN A 1 22  ? 10.093  4.506   -18.115 1.00 25.26  ? 21  GLN A HE21 1 
ATOM   193  H HE22 . GLN A 1 22  ? 11.242  4.202   -19.013 1.00 25.26  ? 21  GLN A HE22 1 
ATOM   194  N N    . THR A 1 23  ? 4.288   4.053   -22.415 1.00 10.80  ? 22  THR A N    1 
ATOM   195  C CA   . THR A 1 23  ? 3.417   4.540   -23.481 1.00 10.17  ? 22  THR A CA   1 
ATOM   196  C C    . THR A 1 23  ? 2.093   5.074   -22.951 1.00 12.11  ? 22  THR A C    1 
ATOM   197  O O    . THR A 1 23  ? 1.381   5.731   -23.716 1.00 11.43  ? 22  THR A O    1 
ATOM   198  C CB   . THR A 1 23  ? 3.124   3.478   -24.552 1.00 11.01  ? 22  THR A CB   1 
ATOM   199  O OG1  . THR A 1 23  ? 2.328   2.393   -24.051 1.00 12.22  ? 22  THR A OG1  1 
ATOM   200  C CG2  . THR A 1 23  ? 4.408   2.942   -25.160 1.00 11.81  ? 22  THR A CG2  1 
ATOM   201  H H    . THR A 1 23  ? 4.359   3.198   -22.353 1.00 12.97  ? 22  THR A H    1 
ATOM   202  H HA   . THR A 1 23  ? 3.866   5.276   -23.924 1.00 12.21  ? 22  THR A HA   1 
ATOM   203  H HB   . THR A 1 23  ? 2.630   3.905   -25.268 1.00 13.22  ? 22  THR A HB   1 
ATOM   204  H HG1  . THR A 1 23  ? 2.727   2.012   -23.417 1.00 14.67  ? 22  THR A HG1  1 
ATOM   205  H HG21 . THR A 1 23  ? 4.203   2.274   -25.832 1.00 14.18  ? 22  THR A HG21 1 
ATOM   206  H HG22 . THR A 1 23  ? 4.905   3.665   -25.574 1.00 14.18  ? 22  THR A HG22 1 
ATOM   207  H HG23 . THR A 1 23  ? 4.957   2.538   -24.470 1.00 14.18  ? 22  THR A HG23 1 
ATOM   208  N N    . PHE A 1 24  ? 1.759   4.842   -21.675 1.00 10.51  ? 23  PHE A N    1 
ATOM   209  C CA   . PHE A 1 24  ? 0.550   5.438   -21.137 1.00 10.70  ? 23  PHE A CA   1 
ATOM   210  C C    . PHE A 1 24  ? 0.712   6.906   -20.773 1.00 12.69  ? 23  PHE A C    1 
ATOM   211  O O    . PHE A 1 24  ? -0.284  7.634   -20.714 1.00 19.37  ? 23  PHE A O    1 
ATOM   212  C CB   . PHE A 1 24  ? -0.019  4.776   -19.875 1.00 12.85  ? 23  PHE A CB   1 
ATOM   213  C CG   . PHE A 1 24  ? -0.480  3.340   -20.030 1.00 11.28  ? 23  PHE A CG   1 
ATOM   214  C CD1  . PHE A 1 24  ? 0.337   2.284   -20.416 1.00 10.22  ? 23  PHE A CD1  1 
ATOM   215  C CD2  . PHE A 1 24  ? -1.842  3.167   -20.211 1.00 10.74  ? 23  PHE A CD2  1 
ATOM   216  C CE1  . PHE A 1 24  ? -0.186  1.021   -20.610 1.00 11.34  ? 23  PHE A CE1  1 
ATOM   217  C CE2  . PHE A 1 24  ? -2.378  1.928   -20.461 1.00 11.26  ? 23  PHE A CE2  1 
ATOM   218  C CZ   . PHE A 1 24  ? -1.565  0.856   -20.664 1.00 10.64  ? 23  PHE A CZ   1 
ATOM   219  H H    . PHE A 1 24  ? 2.205   4.357   -21.123 1.00 12.62  ? 23  PHE A H    1 
ATOM   220  H HA   . PHE A 1 24  ? -0.136  5.387   -21.820 1.00 12.85  ? 23  PHE A HA   1 
ATOM   221  H HB2  . PHE A 1 24  ? 0.666   4.787   -19.189 1.00 15.43  ? 23  PHE A HB2  1 
ATOM   222  H HB3  . PHE A 1 24  ? -0.783  5.294   -19.577 1.00 15.43  ? 23  PHE A HB3  1 
ATOM   223  H HD1  . PHE A 1 24  ? 1.259   2.377   -20.335 1.00 12.27  ? 23  PHE A HD1  1 
ATOM   224  H HD2  . PHE A 1 24  ? -2.417  3.876   -20.033 1.00 12.90  ? 23  PHE A HD2  1 
ATOM   225  H HE1  . PHE A 1 24  ? 0.376   0.301   -20.784 1.00 13.62  ? 23  PHE A HE1  1 
ATOM   226  H HE2  . PHE A 1 24  ? -3.301  1.819   -20.483 1.00 13.52  ? 23  PHE A HE2  1 
ATOM   227  H HZ   . PHE A 1 24  ? -1.929  0.019   -20.843 1.00 12.77  ? 23  PHE A HZ   1 
ATOM   228  N N    . ASN A 1 25  ? 1.935   7.253   -20.551 1.00 13.18  ? 24  ASN A N    1 
ATOM   229  C CA   A ASN A 1 25  ? 2.111   8.749   -20.095 0.56 28.17  ? 24  ASN A CA   1 
ATOM   230  C CA   B ASN A 1 25  ? 2.178   8.729   -20.093 0.44 28.14  ? 24  ASN A CA   1 
ATOM   231  C C    . ASN A 1 25  ? 1.019   9.179   -18.935 1.00 31.25  ? 24  ASN A C    1 
ATOM   232  O O    . ASN A 1 25  ? 0.364   10.184  -18.780 1.00 29.39  ? 24  ASN A O    1 
ATOM   233  C CB   A ASN A 1 25  ? 2.078   9.733   -21.297 0.56 31.80  ? 24  ASN A CB   1 
ATOM   234  C CB   B ASN A 1 25  ? 2.028   9.661   -21.298 0.44 31.80  ? 24  ASN A CB   1 
ATOM   235  C CG   A ASN A 1 25  ? 0.687   10.118  -21.833 0.56 40.60  ? 24  ASN A CG   1 
ATOM   236  C CG   B ASN A 1 25  ? 2.649   11.017  -21.057 0.44 37.27  ? 24  ASN A CG   1 
ATOM   237  O OD1  A ASN A 1 25  ? -0.369  9.999   -21.191 0.56 33.54  ? 24  ASN A OD1  1 
ATOM   238  O OD1  B ASN A 1 25  ? 3.584   11.148  -20.274 0.44 28.61  ? 24  ASN A OD1  1 
ATOM   239  N ND2  A ASN A 1 25  ? 0.707   10.626  -23.029 0.56 31.49  ? 24  ASN A ND2  1 
ATOM   240  N ND2  B ASN A 1 25  ? 2.121   12.038  -21.720 0.44 37.53  ? 24  ASN A ND2  1 
ATOM   241  H H    . ASN A 1 25  ? 2.479   6.519   -20.675 1.00 15.83  ? 24  ASN A H    1 
ATOM   242  H HA   . ASN A 1 25  ? 3.165   8.993   -19.896 1.00 33.78  ? 24  ASN A HA   1 
ATOM   243  H HB2  A ASN A 1 25  ? 2.514   10.561  -21.012 0.56 38.17  ? 24  ASN A HB2  1 
ATOM   244  H HB2  B ASN A 1 25  ? 2.466   9.261   -22.065 0.44 38.17  ? 24  ASN A HB2  1 
ATOM   245  H HB3  A ASN A 1 25  ? 2.575   9.354   -22.025 0.56 38.17  ? 24  ASN A HB3  1 
ATOM   246  H HB3  B ASN A 1 25  ? 1.085   9.790   -21.483 0.44 38.17  ? 24  ASN A HB3  1 
ATOM   247  H HD21 A ASN A 1 25  ? -0.100  10.696  -23.566 0.56 37.80  ? 24  ASN A HD21 1 
ATOM   248  H HD21 B ASN A 1 25  ? 2.440   12.830  -21.616 0.44 45.05  ? 24  ASN A HD21 1 
ATOM   249  H HD22 A ASN A 1 25  ? 1.540   10.977  -23.373 0.56 37.80  ? 24  ASN A HD22 1 
ATOM   250  H HD22 B ASN A 1 25  ? 1.464   11.906  -22.260 0.44 45.05  ? 24  ASN A HD22 1 
ATOM   251  N N    . VAL A 1 26  ? 1.318   8.431   -17.857 1.00 24.90  ? 25  VAL A N    1 
ATOM   252  C CA   . VAL A 1 26  ? 0.576   8.793   -16.651 1.00 20.84  ? 25  VAL A CA   1 
ATOM   253  C C    . VAL A 1 26  ? 1.278   9.939   -15.937 1.00 20.86  ? 25  VAL A C    1 
ATOM   254  O O    . VAL A 1 26  ? 2.380   10.344  -16.319 1.00 21.73  ? 25  VAL A O    1 
ATOM   255  C CB   . VAL A 1 26  ? 0.412   7.593   -15.708 1.00 17.85  ? 25  VAL A CB   1 
ATOM   256  C CG1  . VAL A 1 26  ? -0.450  6.506   -16.369 1.00 20.70  ? 25  VAL A CG1  1 
ATOM   257  C CG2  . VAL A 1 26  ? 1.758   7.068   -15.265 1.00 23.45  ? 25  VAL A CG2  1 
ATOM   258  H H    . VAL A 1 26  ? 1.776   7.707   -17.784 1.00 29.89  ? 25  VAL A H    1 
ATOM   259  H HA   . VAL A 1 26  ? -0.309  9.097   -16.905 1.00 25.01  ? 25  VAL A HA   1 
ATOM   260  H HB   . VAL A 1 26  ? -0.057  7.891   -14.914 1.00 21.43  ? 25  VAL A HB   1 
ATOM   261  H HG11 . VAL A 1 26  ? -0.540  5.759   -15.757 1.00 24.85  ? 25  VAL A HG11 1 
ATOM   262  H HG12 . VAL A 1 26  ? -1.324  6.876   -16.571 1.00 24.85  ? 25  VAL A HG12 1 
ATOM   263  H HG13 . VAL A 1 26  ? -0.018  6.214   -17.187 1.00 24.85  ? 25  VAL A HG13 1 
ATOM   264  H HG21 . VAL A 1 26  ? 1.621   6.312   -14.673 1.00 28.15  ? 25  VAL A HG21 1 
ATOM   265  H HG22 . VAL A 1 26  ? 2.260   6.789   -16.047 1.00 28.15  ? 25  VAL A HG22 1 
ATOM   266  H HG23 . VAL A 1 26  ? 2.234   7.773   -14.799 1.00 28.15  ? 25  VAL A HG23 1 
ATOM   267  N N    . ASP A 1 27  ? 0.628   10.465  -14.899 1.00 19.34  ? 26  ASP A N    1 
ATOM   268  C CA   . ASP A 1 27  ? 1.132   11.663  -14.230 1.00 21.23  ? 26  ASP A CA   1 
ATOM   269  C C    . ASP A 1 27  ? 2.384   11.386  -13.408 1.00 22.44  ? 26  ASP A C    1 
ATOM   270  O O    . ASP A 1 27  ? 3.272   12.241  -13.319 1.00 23.39  ? 26  ASP A O    1 
ATOM   271  C CB   . ASP A 1 27  ? 0.055   12.242  -13.327 1.00 21.86  ? 26  ASP A CB   1 
ATOM   272  C CG   . ASP A 1 27  ? -1.123  12.806  -14.103 1.00 27.92  ? 26  ASP A CG   1 
ATOM   273  O OD1  . ASP A 1 27  ? -0.922  13.242  -15.256 1.00 33.73  ? 26  ASP A OD1  1 
ATOM   274  O OD2  . ASP A 1 27  ? -2.242  12.829  -13.544 1.00 33.07  ? 26  ASP A OD2  1 
ATOM   275  H H    . ASP A 1 27  ? -0.099  10.150  -14.565 1.00 23.22  ? 26  ASP A H    1 
ATOM   276  H HA   . ASP A 1 27  ? 1.354   12.329  -14.899 1.00 25.49  ? 26  ASP A HA   1 
ATOM   277  H HB2  . ASP A 1 27  ? -0.277  11.542  -12.744 1.00 26.24  ? 26  ASP A HB2  1 
ATOM   278  H HB3  . ASP A 1 27  ? 0.438   12.960  -12.799 1.00 26.24  ? 26  ASP A HB3  1 
ATOM   279  N N    . ALA A 1 28  ? 2.461   10.227  -12.757 1.00 17.20  ? 27  ALA A N    1 
ATOM   280  C CA   . ALA A 1 28  ? 3.592   9.968   -11.886 1.00 18.59  ? 27  ALA A CA   1 
ATOM   281  C C    . ALA A 1 28  ? 4.835   9.592   -12.696 1.00 18.60  ? 27  ALA A C    1 
ATOM   282  O O    . ALA A 1 28  ? 4.723   9.046   -13.799 1.00 19.32  ? 27  ALA A O    1 
ATOM   283  C CB   . ALA A 1 28  ? 3.251   8.845   -10.905 1.00 15.33  ? 27  ALA A CB   1 
ATOM   284  H H    . ALA A 1 28  ? 1.883   9.592   -12.803 1.00 20.65  ? 27  ALA A H    1 
ATOM   285  H HA   . ALA A 1 28  ? 3.793   10.768  -11.375 1.00 22.32  ? 27  ALA A HA   1 
ATOM   286  H HB1  . ALA A 1 28  ? 4.016   8.684   -10.331 1.00 18.40  ? 27  ALA A HB1  1 
ATOM   287  H HB2  . ALA A 1 28  ? 2.487   9.114   -10.371 1.00 18.40  ? 27  ALA A HB2  1 
ATOM   288  H HB3  . ALA A 1 28  ? 3.039   8.042   -11.406 1.00 18.40  ? 27  ALA A HB3  1 
ATOM   289  N N    . PRO A 1 29  ? 6.033   9.834   -12.150 1.00 18.55  ? 28  PRO A N    1 
ATOM   290  C CA   . PRO A 1 29  ? 7.264   9.513   -12.886 1.00 21.60  ? 28  PRO A CA   1 
ATOM   291  C C    . PRO A 1 29  ? 7.395   8.020   -13.123 1.00 16.74  ? 28  PRO A C    1 
ATOM   292  O O    . PRO A 1 29  ? 7.118   7.208   -12.240 1.00 17.15  ? 28  PRO A O    1 
ATOM   293  C CB   . PRO A 1 29  ? 8.377   10.022  -11.958 1.00 24.56  ? 28  PRO A CB   1 
ATOM   294  C CG   . PRO A 1 29  ? 7.714   11.010  -11.063 1.00 28.78  ? 28  PRO A CG   1 
ATOM   295  C CD   . PRO A 1 29  ? 6.323   10.502  -10.870 1.00 24.27  ? 28  PRO A CD   1 
ATOM   296  H HA   . PRO A 1 29  ? 7.296   9.987   -13.732 1.00 25.93  ? 28  PRO A HA   1 
ATOM   297  H HB2  . PRO A 1 29  ? 8.738   9.283   -11.444 1.00 29.49  ? 28  PRO A HB2  1 
ATOM   298  H HB3  . PRO A 1 29  ? 9.072   10.448  -12.484 1.00 29.49  ? 28  PRO A HB3  1 
ATOM   299  H HG2  . PRO A 1 29  ? 8.185   11.049  -10.216 1.00 34.54  ? 28  PRO A HG2  1 
ATOM   300  H HG3  . PRO A 1 29  ? 7.704   11.881  -11.490 1.00 34.54  ? 28  PRO A HG3  1 
ATOM   301  H HD2  . PRO A 1 29  ? 6.294   9.864   -10.140 1.00 29.13  ? 28  PRO A HD2  1 
ATOM   302  H HD3  . PRO A 1 29  ? 5.710   11.239  -10.726 1.00 29.13  ? 28  PRO A HD3  1 
ATOM   303  N N    . CYS A 1 30  ? 7.837   7.649   -14.323 1.00 15.88  ? 29  CYS A N    1 
ATOM   304  C CA   A CYS A 1 30  ? 7.956   6.240   -14.666 0.30 16.71  ? 29  CYS A CA   1 
ATOM   305  C CA   B CYS A 1 30  ? 7.958   6.233   -14.661 0.70 16.53  ? 29  CYS A CA   1 
ATOM   306  C C    . CYS A 1 30  ? 9.211   5.965   -15.487 1.00 17.65  ? 29  CYS A C    1 
ATOM   307  O O    . CYS A 1 30  ? 9.181   5.197   -16.456 1.00 24.79  ? 29  CYS A O    1 
ATOM   308  C CB   A CYS A 1 30  ? 6.719   5.778   -15.416 0.30 20.42  ? 29  CYS A CB   1 
ATOM   309  C CB   B CYS A 1 30  ? 6.716   5.724   -15.384 0.70 20.55  ? 29  CYS A CB   1 
ATOM   310  S SG   A CYS A 1 30  ? 6.754   4.105   -15.872 0.30 29.63  ? 29  CYS A SG   1 
ATOM   311  S SG   B CYS A 1 30  ? 6.285   6.651   -16.848 0.70 22.18  ? 29  CYS A SG   1 
ATOM   312  H H    B CYS A 1 30  ? 8.069   8.188   -14.951 0.70 19.07  ? 29  CYS A H    1 
ATOM   313  H HA   . CYS A 1 30  ? 8.030   5.725   -13.842 1.00 19.84  ? 29  CYS A HA   1 
ATOM   314  H HB2  A CYS A 1 30  ? 5.943   5.915   -14.850 0.30 24.51  ? 29  CYS A HB2  1 
ATOM   315  H HB2  B CYS A 1 30  ? 6.868   4.805   -15.652 0.70 24.67  ? 29  CYS A HB2  1 
ATOM   316  H HB3  A CYS A 1 30  ? 6.631   6.304   -16.226 0.30 24.51  ? 29  CYS A HB3  1 
ATOM   317  H HB3  B CYS A 1 30  ? 5.962   5.768   -14.776 0.70 24.67  ? 29  CYS A HB3  1 
ATOM   318  H HG   A CYS A 1 30  ? 5.739   3.838   -16.455 0.30 35.56  ? 29  CYS A HG   1 
ATOM   319  H HG   B CYS A 1 30  ? 7.196   6.598   -17.627 0.70 26.62  ? 29  CYS A HG   1 
ATOM   320  N N    . GLN A 1 31  ? 10.336  6.542   -15.091 1.00 14.36  ? 30  GLN A N    1 
ATOM   321  C CA   . GLN A 1 31  ? 11.573  6.350   -15.843 1.00 14.98  ? 30  GLN A CA   1 
ATOM   322  C C    . GLN A 1 31  ? 12.406  5.165   -15.397 1.00 14.06  ? 30  GLN A C    1 
ATOM   323  O O    . GLN A 1 31  ? 13.152  4.601   -16.215 1.00 18.08  ? 30  GLN A O    1 
ATOM   324  C CB   . GLN A 1 31  ? 12.409  7.624   -15.773 1.00 21.13  ? 30  GLN A CB   1 
ATOM   325  C CG   . GLN A 1 31  ? 11.698  8.763   -16.518 1.00 30.51  ? 30  GLN A CG   1 
ATOM   326  C CD   . GLN A 1 31  ? 11.530  8.448   -18.005 1.00 51.01  ? 30  GLN A CD   1 
ATOM   327  O OE1  . GLN A 1 31  ? 12.458  7.959   -18.660 1.00 46.35  ? 30  GLN A OE1  1 
ATOM   328  N NE2  . GLN A 1 31  ? 10.311  8.646   -18.521 1.00 45.20  ? 30  GLN A NE2  1 
ATOM   329  H H    . GLN A 1 31  ? 10.413  7.045   -14.398 1.00 17.24  ? 30  GLN A H    1 
ATOM   330  H HA   . GLN A 1 31  ? 11.343  6.205   -16.774 1.00 17.99  ? 30  GLN A HA   1 
ATOM   331  H HB2  . GLN A 1 31  ? 12.524  7.886   -14.846 1.00 25.37  ? 30  GLN A HB2  1 
ATOM   332  H HB3  . GLN A 1 31  ? 13.270  7.470   -16.192 1.00 25.37  ? 30  GLN A HB3  1 
ATOM   333  H HG2  . GLN A 1 31  ? 10.817  8.895   -16.135 1.00 36.62  ? 30  GLN A HG2  1 
ATOM   334  H HG3  . GLN A 1 31  ? 12.223  9.575   -16.438 1.00 36.62  ? 30  GLN A HG3  1 
ATOM   335  H HE21 . GLN A 1 31  ? 9.686   8.974   -18.030 1.00 54.25  ? 30  GLN A HE21 1 
ATOM   336  H HE22 . GLN A 1 31  ? 10.163  8.477   -19.351 1.00 54.25  ? 30  GLN A HE22 1 
ATOM   337  N N    . THR A 1 32  ? 12.314  4.772   -14.137 1.00 13.41  ? 31  THR A N    1 
ATOM   338  C CA   . THR A 1 32  ? 13.169  3.746   -13.566 1.00 12.61  ? 31  THR A CA   1 
ATOM   339  C C    . THR A 1 32  ? 12.340  2.637   -12.939 1.00 13.90  ? 31  THR A C    1 
ATOM   340  O O    . THR A 1 32  ? 11.136  2.784   -12.691 1.00 13.45  ? 31  THR A O    1 
ATOM   341  C CB   . THR A 1 32  ? 14.072  4.315   -12.463 1.00 13.90  ? 31  THR A CB   1 
ATOM   342  O OG1  . THR A 1 32  ? 13.237  4.752   -11.390 1.00 14.09  ? 31  THR A OG1  1 
ATOM   343  C CG2  . THR A 1 32  ? 14.883  5.517   -12.957 1.00 13.14  ? 31  THR A CG2  1 
ATOM   344  H H    . THR A 1 32  ? 11.747  5.094   -13.577 1.00 16.10  ? 31  THR A H    1 
ATOM   345  H HA   . THR A 1 32  ? 13.729  3.363   -14.260 1.00 15.15  ? 31  THR A HA   1 
ATOM   346  H HB   . THR A 1 32  ? 14.683  3.630   -12.149 1.00 16.69  ? 31  THR A HB   1 
ATOM   347  H HG1  . THR A 1 32  ? 13.708  5.069   -10.771 1.00 16.92  ? 31  THR A HG1  1 
ATOM   348  H HG21 . THR A 1 32  ? 15.443  5.855   -12.241 1.00 15.78  ? 31  THR A HG21 1 
ATOM   349  H HG22 . THR A 1 32  ? 15.447  5.253   -13.700 1.00 15.78  ? 31  THR A HG22 1 
ATOM   350  H HG23 . THR A 1 32  ? 14.285  6.222   -13.249 1.00 15.78  ? 31  THR A HG23 1 
ATOM   351  N N    . VAL A 1 33  ? 12.989  1.508   -12.681 1.00 12.58  ? 32  VAL A N    1 
ATOM   352  C CA   . VAL A 1 33  ? 12.375  0.442   -11.886 1.00 13.17  ? 32  VAL A CA   1 
ATOM   353  C C    . VAL A 1 33  ? 11.887  0.985   -10.552 1.00 14.35  ? 32  VAL A C    1 
ATOM   354  O O    . VAL A 1 33  ? 10.751  0.735   -10.137 1.00 12.28  ? 32  VAL A O    1 
ATOM   355  C CB   . VAL A 1 33  ? 13.366  -0.724  -11.692 1.00 15.57  ? 32  VAL A CB   1 
ATOM   356  C CG1  . VAL A 1 33  ? 12.825  -1.720  -10.670 1.00 19.52  ? 32  VAL A CG1  1 
ATOM   357  C CG2  . VAL A 1 33  ? 13.600  -1.421  -13.025 1.00 21.53  ? 32  VAL A CG2  1 
ATOM   358  H H    . VAL A 1 33  ? 13.785  1.330   -12.953 1.00 15.11  ? 32  VAL A H    1 
ATOM   359  H HA   . VAL A 1 33  ? 11.605  0.099   -12.365 1.00 15.81  ? 32  VAL A HA   1 
ATOM   360  H HB   . VAL A 1 33  ? 14.214  -0.381  -11.370 1.00 18.69  ? 32  VAL A HB   1 
ATOM   361  H HG11 . VAL A 1 33  ? 13.464  -2.442  -10.566 1.00 23.43  ? 32  VAL A HG11 1 
ATOM   362  H HG12 . VAL A 1 33  ? 12.698  -1.265  -9.823  1.00 23.43  ? 32  VAL A HG12 1 
ATOM   363  H HG13 . VAL A 1 33  ? 11.978  -2.070  -10.989 1.00 23.43  ? 32  VAL A HG13 1 
ATOM   364  H HG21 . VAL A 1 33  ? 14.223  -2.152  -12.894 1.00 25.85  ? 32  VAL A HG21 1 
ATOM   365  H HG22 . VAL A 1 33  ? 12.754  -1.762  -13.355 1.00 25.85  ? 32  VAL A HG22 1 
ATOM   366  H HG23 . VAL A 1 33  ? 13.967  -0.781  -13.655 1.00 25.85  ? 32  VAL A HG23 1 
ATOM   367  N N    . GLU A 1 34  ? 12.722  1.766   -9.867  1.00 12.86  ? 33  GLU A N    1 
ATOM   368  C CA   . GLU A 1 34  ? 12.375  2.293   -8.554  1.00 13.78  ? 33  GLU A CA   1 
ATOM   369  C C    . GLU A 1 34  ? 11.110  3.141   -8.616  1.00 11.88  ? 33  GLU A C    1 
ATOM   370  O O    . GLU A 1 34  ? 10.279  3.098   -7.702  1.00 12.28  ? 33  GLU A O    1 
ATOM   371  C CB   . GLU A 1 34  ? 13.562  3.095   -8.016  1.00 16.22  ? 33  GLU A CB   1 
ATOM   372  C CG   . GLU A 1 34  ? 13.460  3.505   -6.589  1.00 20.47  ? 33  GLU A CG   1 
ATOM   373  C CD   . GLU A 1 34  ? 13.520  2.324   -5.644  1.00 27.20  ? 33  GLU A CD   1 
ATOM   374  O OE1  . GLU A 1 34  ? 13.978  1.216   -6.050  1.00 24.13  ? 33  GLU A OE1  1 
ATOM   375  O OE2  . GLU A 1 34  ? 13.209  2.536   -4.457  1.00 29.93  ? 33  GLU A OE2  1 
ATOM   376  H H    . GLU A 1 34  ? 13.500  2.006   -10.146 1.00 15.45  ? 33  GLU A H    1 
ATOM   377  H HA   . GLU A 1 34  ? 12.212  1.553   -7.949  1.00 16.55  ? 33  GLU A HA   1 
ATOM   378  H HB2  . GLU A 1 34  ? 14.364  2.556   -8.107  1.00 19.48  ? 33  GLU A HB2  1 
ATOM   379  H HB3  . GLU A 1 34  ? 13.653  3.903   -8.545  1.00 19.48  ? 33  GLU A HB3  1 
ATOM   380  H HG2  . GLU A 1 34  ? 14.197  4.099   -6.376  1.00 24.57  ? 33  GLU A HG2  1 
ATOM   381  H HG3  . GLU A 1 34  ? 12.615  3.960   -6.450  1.00 24.57  ? 33  GLU A HG3  1 
ATOM   382  N N    . ASP A 1 35  ? 10.917  3.875   -9.720  1.00 11.08  ? 34  ASP A N    1 
ATOM   383  C CA   . ASP A 1 35  ? 9.727   4.706   -9.906  1.00 11.93  ? 34  ASP A CA   1 
ATOM   384  C C    . ASP A 1 35  ? 8.440   3.895   -9.903  1.00 13.84  ? 34  ASP A C    1 
ATOM   385  O O    . ASP A 1 35  ? 7.369   4.476   -9.724  1.00 16.01  ? 34  ASP A O    1 
ATOM   386  C CB   . ASP A 1 35  ? 9.759   5.477   -11.225 1.00 12.37  ? 34  ASP A CB   1 
ATOM   387  C CG   . ASP A 1 35  ? 10.709  6.649   -11.226 1.00 13.96  ? 34  ASP A CG   1 
ATOM   388  O OD1  . ASP A 1 35  ? 11.041  7.176   -10.136 1.00 15.14  ? 34  ASP A OD1  1 
ATOM   389  O OD2  . ASP A 1 35  ? 11.004  7.096   -12.362 1.00 14.81  ? 34  ASP A OD2  1 
ATOM   390  H H    . ASP A 1 35  ? 11.469  3.908   -10.379 1.00 13.31  ? 34  ASP A H    1 
ATOM   391  H HA   . ASP A 1 35  ? 9.677   5.350   -9.183  1.00 14.33  ? 34  ASP A HA   1 
ATOM   392  H HB2  . ASP A 1 35  ? 10.032  4.874   -11.933 1.00 14.85  ? 34  ASP A HB2  1 
ATOM   393  H HB3  . ASP A 1 35  ? 8.869   5.817   -11.409 1.00 14.85  ? 34  ASP A HB3  1 
ATOM   394  N N    . LEU A 1 36  ? 8.513   2.592   -10.113 1.00 10.24  ? 35  LEU A N    1 
ATOM   395  C CA   . LEU A 1 36  ? 7.332   1.721   -10.113 1.00 10.12  ? 35  LEU A CA   1 
ATOM   396  C C    . LEU A 1 36  ? 7.070   1.031   -8.781  1.00 10.78  ? 35  LEU A C    1 
ATOM   397  O O    . LEU A 1 36  ? 6.010   0.424   -8.621  1.00 10.42  ? 35  LEU A O    1 
ATOM   398  C CB   . LEU A 1 36  ? 7.478   0.661   -11.203 1.00 10.95  ? 35  LEU A CB   1 
ATOM   399  C CG   . LEU A 1 36  ? 7.000   1.101   -12.597 1.00 17.30  ? 35  LEU A CG   1 
ATOM   400  C CD1  . LEU A 1 36  ? 7.660   2.346   -13.098 1.00 24.94  ? 35  LEU A CD1  1 
ATOM   401  C CD2  . LEU A 1 36  ? 7.332   -0.043  -13.529 1.00 28.85  ? 35  LEU A CD2  1 
ATOM   402  H H    . LEU A 1 36  ? 9.248   2.172   -10.261 1.00 12.29  ? 35  LEU A H    1 
ATOM   403  H HA   . LEU A 1 36  ? 6.552   2.257   -10.325 1.00 12.16  ? 35  LEU A HA   1 
ATOM   404  H HB2  . LEU A 1 36  ? 8.415   0.421   -11.277 1.00 13.14  ? 35  LEU A HB2  1 
ATOM   405  H HB3  . LEU A 1 36  ? 6.961   -0.118  -10.948 1.00 13.14  ? 35  LEU A HB3  1 
ATOM   406  H HG   . LEU A 1 36  ? 6.039   1.233   -12.591 1.00 20.77  ? 35  LEU A HG   1 
ATOM   407  H HD11 . LEU A 1 36  ? 7.472   3.072   -12.482 1.00 29.94  ? 35  LEU A HD11 1 
ATOM   408  H HD12 . LEU A 1 36  ? 8.617   2.196   -13.151 1.00 29.94  ? 35  LEU A HD12 1 
ATOM   409  H HD13 . LEU A 1 36  ? 7.309   2.558   -13.977 1.00 29.94  ? 35  LEU A HD13 1 
ATOM   410  H HD21 . LEU A 1 36  ? 7.047   0.189   -14.427 1.00 34.63  ? 35  LEU A HD21 1 
ATOM   411  H HD22 . LEU A 1 36  ? 8.290   -0.194  -13.514 1.00 34.63  ? 35  LEU A HD22 1 
ATOM   412  H HD23 . LEU A 1 36  ? 6.866   -0.840  -13.229 1.00 34.63  ? 35  LEU A HD23 1 
ATOM   413  N N    . THR A 1 37  ? 7.959   1.155   -7.815  1.00 9.97   ? 36  THR A N    1 
ATOM   414  C CA   . THR A 1 37  ? 7.880   0.338   -6.611  1.00 10.08  ? 36  THR A CA   1 
ATOM   415  C C    . THR A 1 37  ? 6.806   0.800   -5.634  1.00 10.40  ? 36  THR A C    1 
ATOM   416  O O    . THR A 1 37  ? 6.431   0.024   -4.754  1.00 10.92  ? 36  THR A O    1 
ATOM   417  C CB   . THR A 1 37  ? 9.238   0.295   -5.870  1.00 7.27   ? 36  THR A CB   1 
ATOM   418  O OG1  . THR A 1 37  ? 9.665   1.600   -5.456  1.00 11.57  ? 36  THR A OG1  1 
ATOM   419  C CG2  . THR A 1 37  ? 10.287  -0.376  -6.696  1.00 11.69  ? 36  THR A CG2  1 
ATOM   420  H H    . THR A 1 37  ? 8.621   1.705   -7.827  1.00 11.97  ? 36  THR A H    1 
ATOM   421  H HA   . THR A 1 37  ? 7.663   -0.570  -6.873  1.00 12.11  ? 36  THR A HA   1 
ATOM   422  H HB   . THR A 1 37  ? 9.122   -0.245  -5.073  1.00 8.74   ? 36  THR A HB   1 
ATOM   423  H HG1  . THR A 1 37  ? 9.751   2.100   -6.126  1.00 13.89  ? 36  THR A HG1  1 
ATOM   424  H HG21 . THR A 1 37  ? 11.128  -0.392  -6.213  1.00 14.04  ? 36  THR A HG21 1 
ATOM   425  H HG22 . THR A 1 37  ? 10.020  -1.287  -6.894  1.00 14.04  ? 36  THR A HG22 1 
ATOM   426  H HG23 . THR A 1 37  ? 10.411  0.104   -7.529  1.00 14.04  ? 36  THR A HG23 1 
ATOM   427  N N    . ASN A 1 38  ? 6.299   2.027   -5.736  1.00 9.65   ? 37  ASN A N    1 
ATOM   428  C CA   . ASN A 1 38  ? 5.299   2.464   -4.776  1.00 9.92   ? 37  ASN A CA   1 
ATOM   429  C C    . ASN A 1 38  ? 3.867   2.286   -5.246  1.00 10.21  ? 37  ASN A C    1 
ATOM   430  O O    . ASN A 1 38  ? 2.958   2.625   -4.501  1.00 10.68  ? 37  ASN A O    1 
ATOM   431  C CB   . ASN A 1 38  ? 5.539   3.928   -4.334  1.00 10.37  ? 37  ASN A CB   1 
ATOM   432  C CG   . ASN A 1 38  ? 5.241   4.948   -5.413  1.00 12.47  ? 37  ASN A CG   1 
ATOM   433  O OD1  . ASN A 1 38  ? 4.543   4.674   -6.394  1.00 11.06  ? 37  ASN A OD1  1 
ATOM   434  N ND2  . ASN A 1 38  ? 5.833   6.132   -5.261  1.00 16.73  ? 37  ASN A ND2  1 
ATOM   435  H H    . ASN A 1 38  ? 6.511   2.607   -6.335  1.00 11.60  ? 37  ASN A H    1 
ATOM   436  H HA   . ASN A 1 38  ? 5.398   1.916   -3.982  1.00 11.92  ? 37  ASN A HA   1 
ATOM   437  H HB2  . ASN A 1 38  ? 4.968   4.124   -3.575  1.00 12.45  ? 37  ASN A HB2  1 
ATOM   438  H HB3  . ASN A 1 38  ? 6.470   4.029   -4.080  1.00 12.45  ? 37  ASN A HB3  1 
ATOM   439  H HD21 . ASN A 1 38  ? 5.708   6.754   -5.843  1.00 20.08  ? 37  ASN A HD21 1 
ATOM   440  H HD22 . ASN A 1 38  ? 6.321   6.283   -4.570  1.00 20.08  ? 37  ASN A HD22 1 
ATOM   441  N N    . GLY A 1 39  ? 3.643   1.729   -6.430  1.00 9.74   ? 38  GLY A N    1 
ATOM   442  C CA   . GLY A 1 39  ? 2.314   1.411   -6.912  1.00 9.34   ? 38  GLY A CA   1 
ATOM   443  C C    . GLY A 1 39  ? 1.573   2.520   -7.640  1.00 10.16  ? 38  GLY A C    1 
ATOM   444  O O    . GLY A 1 39  ? 0.583   2.232   -8.326  1.00 10.34  ? 38  GLY A O    1 
ATOM   445  H H    . GLY A 1 39  ? 4.267   1.521   -6.984  1.00 11.69  ? 38  GLY A H    1 
ATOM   446  H HA2  . GLY A 1 39  ? 2.378   0.655   -7.518  1.00 11.22  ? 38  GLY A HA2  1 
ATOM   447  H HA3  . GLY A 1 39  ? 1.768   1.139   -6.158  1.00 11.22  ? 38  GLY A HA3  1 
ATOM   448  N N    . VAL A 1 40  ? 1.979   3.781   -7.490  1.00 9.69   ? 39  VAL A N    1 
ATOM   449  C CA   . VAL A 1 40  ? 1.180   4.879   -8.038  1.00 9.88   ? 39  VAL A CA   1 
ATOM   450  C C    . VAL A 1 40  ? 1.074   4.782   -9.562  1.00 8.77   ? 39  VAL A C    1 
ATOM   451  O O    . VAL A 1 40  ? -0.005  4.920   -10.133 1.00 8.78   ? 39  VAL A O    1 
ATOM   452  C CB   . VAL A 1 40  ? 1.757   6.232   -7.592  1.00 11.27  ? 39  VAL A CB   1 
ATOM   453  C CG1  . VAL A 1 40  ? 1.023   7.379   -8.242  1.00 11.36  ? 39  VAL A CG1  1 
ATOM   454  C CG2  . VAL A 1 40  ? 1.663   6.367   -6.064  1.00 12.39  ? 39  VAL A CG2  1 
ATOM   455  H H    . VAL A 1 40  ? 2.697   4.024   -7.085  1.00 11.64  ? 39  VAL A H    1 
ATOM   456  H HA   . VAL A 1 40  ? 0.282   4.814   -7.679  1.00 11.86  ? 39  VAL A HA   1 
ATOM   457  H HB   . VAL A 1 40  ? 2.692   6.284   -7.846  1.00 13.54  ? 39  VAL A HB   1 
ATOM   458  H HG11 . VAL A 1 40  ? 1.411   8.214   -7.939  1.00 13.65  ? 39  VAL A HG11 1 
ATOM   459  H HG12 . VAL A 1 40  ? 1.110   7.303   -9.205  1.00 13.65  ? 39  VAL A HG12 1 
ATOM   460  H HG13 . VAL A 1 40  ? 0.087   7.338   -7.989  1.00 13.65  ? 39  VAL A HG13 1 
ATOM   461  H HG21 . VAL A 1 40  ? 2.031   7.225   -5.800  1.00 14.88  ? 39  VAL A HG21 1 
ATOM   462  H HG22 . VAL A 1 40  ? 0.732   6.310   -5.799  1.00 14.88  ? 39  VAL A HG22 1 
ATOM   463  H HG23 . VAL A 1 40  ? 2.170   5.649   -5.653  1.00 14.88  ? 39  VAL A HG23 1 
ATOM   464  N N    . VAL A 1 41  ? 2.198   4.592   -10.254 1.00 9.46   ? 40  VAL A N    1 
ATOM   465  C CA   . VAL A 1 41  ? 2.170   4.443   -11.712 1.00 9.98   ? 40  VAL A CA   1 
ATOM   466  C C    . VAL A 1 41  ? 1.253   3.307   -12.125 1.00 7.94   ? 40  VAL A C    1 
ATOM   467  O O    . VAL A 1 41  ? 0.425   3.455   -13.029 1.00 9.23   ? 40  VAL A O    1 
ATOM   468  C CB   . VAL A 1 41  ? 3.593   4.213   -12.245 1.00 11.53  ? 40  VAL A CB   1 
ATOM   469  C CG1  . VAL A 1 41  ? 3.576   3.764   -13.705 1.00 10.65  ? 40  VAL A CG1  1 
ATOM   470  C CG2  . VAL A 1 41  ? 4.468   5.480   -12.076 1.00 12.91  ? 40  VAL A CG2  1 
ATOM   471  H H    . VAL A 1 41  ? 2.984   4.545   -9.908  1.00 11.37  ? 40  VAL A H    1 
ATOM   472  H HA   . VAL A 1 41  ? 1.829   5.261   -12.106 1.00 11.99  ? 40  VAL A HA   1 
ATOM   473  H HB   . VAL A 1 41  ? 4.004   3.504   -11.727 1.00 13.84  ? 40  VAL A HB   1 
ATOM   474  H HG11 . VAL A 1 41  ? 4.489   3.630   -14.004 1.00 12.79  ? 40  VAL A HG11 1 
ATOM   475  H HG12 . VAL A 1 41  ? 3.080   2.934   -13.774 1.00 12.79  ? 40  VAL A HG12 1 
ATOM   476  H HG13 . VAL A 1 41  ? 3.150   4.450   -14.241 1.00 12.79  ? 40  VAL A HG13 1 
ATOM   477  H HG21 . VAL A 1 41  ? 5.355   5.299   -12.422 1.00 15.50  ? 40  VAL A HG21 1 
ATOM   478  H HG22 . VAL A 1 41  ? 4.063   6.211   -12.568 1.00 15.50  ? 40  VAL A HG22 1 
ATOM   479  H HG23 . VAL A 1 41  ? 4.519   5.704   -11.133 1.00 15.50  ? 40  VAL A HG23 1 
ATOM   480  N N    . MET A 1 42  ? 1.377   2.142   -11.473 1.00 8.75   ? 41  MET A N    1 
ATOM   481  C CA   A MET A 1 42  ? 0.532   1.012   -11.820 0.43 8.10   ? 41  MET A CA   1 
ATOM   482  C CA   B MET A 1 42  ? 0.521   1.008   -11.799 0.57 8.06   ? 41  MET A CA   1 
ATOM   483  C C    . MET A 1 42  ? -0.950  1.347   -11.649 1.00 10.42  ? 41  MET A C    1 
ATOM   484  O O    . MET A 1 42  ? -1.779  0.954   -12.485 1.00 9.55   ? 41  MET A O    1 
ATOM   485  C CB   A MET A 1 42  ? 0.948   -0.211  -10.996 0.43 10.74  ? 41  MET A CB   1 
ATOM   486  C CB   B MET A 1 42  ? 0.811   -0.173  -10.880 0.57 10.72  ? 41  MET A CB   1 
ATOM   487  C CG   A MET A 1 42  ? 2.280   -0.764  -11.510 0.43 9.18   ? 41  MET A CG   1 
ATOM   488  C CG   B MET A 1 42  ? 2.124   -0.802  -11.066 0.57 9.91   ? 41  MET A CG   1 
ATOM   489  S SD   A MET A 1 42  ? 2.874   -2.365  -10.899 0.43 11.99  ? 41  MET A SD   1 
ATOM   490  S SD   B MET A 1 42  ? 2.323   -2.014  -9.743  0.57 10.71  ? 41  MET A SD   1 
ATOM   491  C CE   A MET A 1 42  ? 3.386   -1.916  -9.242  0.43 11.18  ? 41  MET A CE   1 
ATOM   492  C CE   B MET A 1 42  ? 4.085   -2.308  -9.786  0.57 10.93  ? 41  MET A CE   1 
ATOM   493  H H    A MET A 1 42  ? 1.936   1.991   -10.837 0.43 10.51  ? 41  MET A H    1 
ATOM   494  H H    B MET A 1 42  ? 1.945   1.990   -10.845 0.57 10.51  ? 41  MET A H    1 
ATOM   495  H HA   . MET A 1 42  ? 0.689   0.762   -12.733 1.00 9.69   ? 41  MET A HA   1 
ATOM   496  H HB2  A MET A 1 42  ? 1.060   0.046   -10.067 0.43 12.90  ? 41  MET A HB2  1 
ATOM   497  H HB2  B MET A 1 42  ? 0.762   0.133   -9.961  0.57 12.88  ? 41  MET A HB2  1 
ATOM   498  H HB3  A MET A 1 42  ? 0.274   -0.903  -11.079 0.43 12.90  ? 41  MET A HB3  1 
ATOM   499  H HB3  B MET A 1 42  ? 0.137   -0.854  -11.032 0.57 12.88  ? 41  MET A HB3  1 
ATOM   500  H HG2  A MET A 1 42  ? 2.211   -0.844  -12.475 0.43 11.02  ? 41  MET A HG2  1 
ATOM   501  H HG2  B MET A 1 42  ? 2.158   -1.258  -11.922 0.57 11.91  ? 41  MET A HG2  1 
ATOM   502  H HG3  A MET A 1 42  ? 2.968   -0.114  -11.299 0.43 11.02  ? 41  MET A HG3  1 
ATOM   503  H HG3  B MET A 1 42  ? 2.827   -0.137  -10.995 0.57 11.91  ? 41  MET A HG3  1 
ATOM   504  H HE1  A MET A 1 42  ? 3.732   -2.704  -8.795  0.43 13.42  ? 41  MET A HE1  1 
ATOM   505  H HE1  B MET A 1 42  ? 4.313   -2.957  -9.102  0.57 13.13  ? 41  MET A HE1  1 
ATOM   506  H HE2  A MET A 1 42  ? 4.075   -1.236  -9.298  0.43 13.42  ? 41  MET A HE2  1 
ATOM   507  H HE2  B MET A 1 42  ? 4.327   -2.649  -10.661 0.57 13.13  ? 41  MET A HE2  1 
ATOM   508  H HE3  A MET A 1 42  ? 2.619   -1.571  -8.758  0.43 13.42  ? 41  MET A HE3  1 
ATOM   509  H HE3  B MET A 1 42  ? 4.548   -1.472  -9.616  0.57 13.13  ? 41  MET A HE3  1 
ATOM   510  N N    . ALA A 1 43  ? -1.293  2.051   -10.566 1.00 9.01   ? 42  ALA A N    1 
ATOM   511  C CA   . ALA A 1 43  ? -2.690  2.395   -10.323 1.00 10.15  ? 42  ALA A CA   1 
ATOM   512  C C    . ALA A 1 43  ? -3.205  3.363   -11.382 1.00 9.12   ? 42  ALA A C    1 
ATOM   513  O O    . ALA A 1 43  ? -4.326  3.205   -11.888 1.00 10.72  ? 42  ALA A O    1 
ATOM   514  C CB   . ALA A 1 43  ? -2.829  2.975   -8.926  1.00 11.84  ? 42  ALA A CB   1 
ATOM   515  H H    . ALA A 1 43  ? -0.744  2.335   -9.968  1.00 10.82  ? 42  ALA A H    1 
ATOM   516  H HA   . ALA A 1 43  ? -3.227  1.588   -10.367 1.00 12.19  ? 42  ALA A HA   1 
ATOM   517  H HB1  . ALA A 1 43  ? -3.759  3.202   -8.769  1.00 14.22  ? 42  ALA A HB1  1 
ATOM   518  H HB2  . ALA A 1 43  ? -2.536  2.315   -8.279  1.00 14.22  ? 42  ALA A HB2  1 
ATOM   519  H HB3  . ALA A 1 43  ? -2.278  3.771   -8.859  1.00 14.22  ? 42  ALA A HB3  1 
ATOM   520  N N    . GLN A 1 44  ? -2.376  4.338   -11.766 1.00 9.43   ? 43  GLN A N    1 
ATOM   521  C CA   . GLN A 1 44  ? -2.758  5.276   -12.816 1.00 10.36  ? 43  GLN A CA   1 
ATOM   522  C C    . GLN A 1 44  ? -2.934  4.563   -14.159 1.00 10.34  ? 43  GLN A C    1 
ATOM   523  O O    . GLN A 1 44  ? -3.824  4.907   -14.949 1.00 10.81  ? 43  GLN A O    1 
ATOM   524  C CB   . GLN A 1 44  ? -1.723  6.403   -12.897 1.00 11.31  ? 43  GLN A CB   1 
ATOM   525  C CG   . GLN A 1 44  ? -1.778  7.304   -11.667 1.00 10.80  ? 43  GLN A CG   1 
ATOM   526  C CD   . GLN A 1 44  ? -0.721  8.350   -11.650 1.00 13.43  ? 43  GLN A CD   1 
ATOM   527  O OE1  . GLN A 1 44  ? 0.179   8.366   -12.478 1.00 14.94  ? 43  GLN A OE1  1 
ATOM   528  N NE2  . GLN A 1 44  ? -0.809  9.248   -10.668 1.00 17.20  ? 43  GLN A NE2  1 
ATOM   529  H H    . GLN A 1 44  ? -1.594  4.475   -11.435 1.00 11.32  ? 43  GLN A H    1 
ATOM   530  H HA   . GLN A 1 44  ? -3.610  5.675   -12.581 1.00 12.44  ? 43  GLN A HA   1 
ATOM   531  H HB2  . GLN A 1 44  ? -0.834  6.019   -12.952 1.00 13.59  ? 43  GLN A HB2  1 
ATOM   532  H HB3  . GLN A 1 44  ? -1.902  6.947   -13.680 1.00 13.59  ? 43  GLN A HB3  1 
ATOM   533  H HG2  . GLN A 1 44  ? -2.639  7.750   -11.643 1.00 12.97  ? 43  GLN A HG2  1 
ATOM   534  H HG3  . GLN A 1 44  ? -1.668  6.757   -10.873 1.00 12.97  ? 43  GLN A HG3  1 
ATOM   535  H HE21 . GLN A 1 44  ? -1.454  9.203   -10.101 1.00 20.65  ? 43  GLN A HE21 1 
ATOM   536  H HE22 . GLN A 1 44  ? -0.225  9.876   -10.606 1.00 20.65  ? 43  GLN A HE22 1 
ATOM   537  N N    . VAL A 1 45  ? -2.054  3.604   -14.471 1.00 10.02  ? 44  VAL A N    1 
ATOM   538  C CA   . VAL A 1 45  ? -2.190  2.834   -15.703 1.00 9.74   ? 44  VAL A CA   1 
ATOM   539  C C    . VAL A 1 45  ? -3.488  2.041   -15.707 1.00 8.23   ? 44  VAL A C    1 
ATOM   540  O O    . VAL A 1 45  ? -4.187  1.988   -16.723 1.00 8.75   ? 44  VAL A O    1 
ATOM   541  C CB   . VAL A 1 45  ? -0.950  1.935   -15.896 1.00 9.54   ? 44  VAL A CB   1 
ATOM   542  C CG1  . VAL A 1 45  ? -1.176  0.897   -16.974 1.00 9.76   ? 44  VAL A CG1  1 
ATOM   543  C CG2  . VAL A 1 45  ? 0.285   2.770   -16.258 1.00 12.49  ? 44  VAL A CG2  1 
ATOM   544  H H    . VAL A 1 45  ? -1.376  3.385   -13.989 1.00 12.03  ? 44  VAL A H    1 
ATOM   545  H HA   . VAL A 1 45  ? -2.223  3.451   -16.450 1.00 11.69  ? 44  VAL A HA   1 
ATOM   546  H HB   . VAL A 1 45  ? -0.764  1.470   -15.065 1.00 11.46  ? 44  VAL A HB   1 
ATOM   547  H HG11 . VAL A 1 45  ? -0.376  0.355   -17.062 1.00 11.73  ? 44  VAL A HG11 1 
ATOM   548  H HG12 . VAL A 1 45  ? -1.928  0.338   -16.721 1.00 11.73  ? 44  VAL A HG12 1 
ATOM   549  H HG13 . VAL A 1 45  ? -1.365  1.348   -17.811 1.00 11.73  ? 44  VAL A HG13 1 
ATOM   550  H HG21 . VAL A 1 45  ? 1.044   2.176   -16.372 1.00 15.00  ? 44  VAL A HG21 1 
ATOM   551  H HG22 . VAL A 1 45  ? 0.112   3.247   -17.084 1.00 15.00  ? 44  VAL A HG22 1 
ATOM   552  H HG23 . VAL A 1 45  ? 0.462   3.399   -15.542 1.00 15.00  ? 44  VAL A HG23 1 
ATOM   553  N N    . LEU A 1 46  ? -3.829  1.398   -14.577 1.00 9.47   ? 45  LEU A N    1 
ATOM   554  C CA   . LEU A 1 46  ? -5.077  0.636   -14.481 1.00 9.92   ? 45  LEU A CA   1 
ATOM   555  C C    . LEU A 1 46  ? -6.302  1.519   -14.692 1.00 9.27   ? 45  LEU A C    1 
ATOM   556  O O    . LEU A 1 46  ? -7.242  1.107   -15.375 1.00 9.85   ? 45  LEU A O    1 
ATOM   557  C CB   . LEU A 1 46  ? -5.108  -0.112  -13.152 1.00 8.85   ? 45  LEU A CB   1 
ATOM   558  C CG   . LEU A 1 46  ? -4.185  -1.333  -13.155 1.00 9.43   ? 45  LEU A CG   1 
ATOM   559  C CD1  . LEU A 1 46  ? -3.960  -1.800  -11.730 1.00 9.86   ? 45  LEU A CD1  1 
ATOM   560  C CD2  . LEU A 1 46  ? -4.749  -2.482  -13.989 1.00 10.36  ? 45  LEU A CD2  1 
ATOM   561  H H    . LEU A 1 46  ? -3.356  1.391   -13.859 1.00 11.37  ? 45  LEU A H    1 
ATOM   562  H HA   . LEU A 1 46  ? -5.081  -0.031  -15.186 1.00 11.91  ? 45  LEU A HA   1 
ATOM   563  H HB2  . LEU A 1 46  ? -4.817  0.484   -12.445 1.00 10.63  ? 45  LEU A HB2  1 
ATOM   564  H HB3  . LEU A 1 46  ? -6.012  -0.418  -12.980 1.00 10.63  ? 45  LEU A HB3  1 
ATOM   565  H HG   . LEU A 1 46  ? -3.326  -1.082  -13.529 1.00 11.33  ? 45  LEU A HG   1 
ATOM   566  H HD11 . LEU A 1 46  ? -3.374  -2.574  -11.741 1.00 11.84  ? 45  LEU A HD11 1 
ATOM   567  H HD12 . LEU A 1 46  ? -3.550  -1.081  -11.224 1.00 11.84  ? 45  LEU A HD12 1 
ATOM   568  H HD13 . LEU A 1 46  ? -4.814  -2.037  -11.337 1.00 11.84  ? 45  LEU A HD13 1 
ATOM   569  H HD21 . LEU A 1 46  ? -4.129  -3.228  -13.958 1.00 12.44  ? 45  LEU A HD21 1 
ATOM   570  H HD22 . LEU A 1 46  ? -5.606  -2.747  -13.621 1.00 12.44  ? 45  LEU A HD22 1 
ATOM   571  H HD23 . LEU A 1 46  ? -4.860  -2.181  -14.904 1.00 12.44  ? 45  LEU A HD23 1 
ATOM   572  N N    . GLN A 1 47  ? -6.279  2.743   -14.175 1.00 9.02   ? 46  GLN A N    1 
ATOM   573  C CA   . GLN A 1 47  ? -7.355  3.690   -14.450 1.00 9.06   ? 46  GLN A CA   1 
ATOM   574  C C    . GLN A 1 47  ? -7.460  3.998   -15.940 1.00 12.45  ? 46  GLN A C    1 
ATOM   575  O O    . GLN A 1 47  ? -8.572  4.135   -16.473 1.00 13.17  ? 46  GLN A O    1 
ATOM   576  C CB   . GLN A 1 47  ? -7.137  4.987   -13.678 1.00 11.03  ? 46  GLN A CB   1 
ATOM   577  C CG   . GLN A 1 47  ? -8.333  5.938   -13.829 1.00 14.02  ? 46  GLN A CG   1 
ATOM   578  C CD   . GLN A 1 47  ? -8.133  7.295   -13.181 1.00 21.84  ? 46  GLN A CD   1 
ATOM   579  O OE1  . GLN A 1 47  ? -7.019  7.708   -12.911 1.00 34.41  ? 46  GLN A OE1  1 
ATOM   580  N NE2  . GLN A 1 47  ? -9.232  7.940   -12.833 1.00 39.45  ? 46  GLN A NE2  1 
ATOM   581  H H    . GLN A 1 47  ? -5.657  3.049   -13.665 1.00 10.84  ? 46  GLN A H    1 
ATOM   582  H HA   . GLN A 1 47  ? -8.198  3.306   -14.161 1.00 10.89  ? 46  GLN A HA   1 
ATOM   583  H HB2  . GLN A 1 47  ? -7.026  4.785   -12.736 1.00 13.25  ? 46  GLN A HB2  1 
ATOM   584  H HB3  . GLN A 1 47  ? -6.348  5.435   -14.021 1.00 13.25  ? 46  GLN A HB3  1 
ATOM   585  H HG2  . GLN A 1 47  ? -8.498  6.083   -14.773 1.00 16.83  ? 46  GLN A HG2  1 
ATOM   586  H HG3  . GLN A 1 47  ? -9.110  5.527   -13.419 1.00 16.83  ? 46  GLN A HG3  1 
ATOM   587  H HE21 . GLN A 1 47  ? -10.002 7.609   -13.024 1.00 47.35  ? 46  GLN A HE21 1 
ATOM   588  H HE22 . GLN A 1 47  ? -9.176  8.710   -12.454 1.00 47.35  ? 46  GLN A HE22 1 
ATOM   589  N N    . LYS A 1 48  ? -6.333  4.113   -16.634 1.00 10.32  ? 47  LYS A N    1 
ATOM   590  C CA   . LYS A 1 48  ? -6.397  4.328   -18.069 1.00 10.44  ? 47  LYS A CA   1 
ATOM   591  C C    . LYS A 1 48  ? -6.946  3.107   -18.787 1.00 11.82  ? 47  LYS A C    1 
ATOM   592  O O    . LYS A 1 48  ? -7.751  3.237   -19.712 1.00 12.88  ? 47  LYS A O    1 
ATOM   593  C CB   . LYS A 1 48  ? -5.029  4.725   -18.619 1.00 11.67  ? 47  LYS A CB   1 
ATOM   594  C CG   . LYS A 1 48  ? -4.618  6.134   -18.178 1.00 15.25  ? 47  LYS A CG   1 
ATOM   595  C CD   . LYS A 1 48  ? -3.396  6.724   -18.840 1.00 26.34  ? 47  LYS A CD   1 
ATOM   596  C CE   . LYS A 1 48  ? -3.255  8.193   -18.403 1.00 31.24  ? 47  LYS A CE   1 
ATOM   597  N NZ   . LYS A 1 48  ? -2.113  8.937   -19.037 1.00 35.56  ? 47  LYS A NZ   1 
ATOM   598  H H    . LYS A 1 48  ? -5.539  4.072   -16.306 1.00 12.39  ? 47  LYS A H    1 
ATOM   599  H HA   . LYS A 1 48  ? -7.005  5.064   -18.242 1.00 12.54  ? 47  LYS A HA   1 
ATOM   600  H HB2  . LYS A 1 48  ? -4.363  4.100   -18.294 1.00 14.02  ? 47  LYS A HB2  1 
ATOM   601  H HB3  . LYS A 1 48  ? -5.059  4.708   -19.588 1.00 14.02  ? 47  LYS A HB3  1 
ATOM   602  H HG2  . LYS A 1 48  ? -5.359  6.734   -18.357 1.00 18.31  ? 47  LYS A HG2  1 
ATOM   603  H HG3  . LYS A 1 48  ? -4.446  6.114   -17.224 1.00 18.31  ? 47  LYS A HG3  1 
ATOM   604  H HD2  . LYS A 1 48  ? -2.604  6.237   -18.561 1.00 31.61  ? 47  LYS A HD2  1 
ATOM   605  H HD3  . LYS A 1 48  ? -3.497  6.692   -19.804 1.00 31.61  ? 47  LYS A HD3  1 
ATOM   606  H HE2  . LYS A 1 48  ? -4.072  8.663   -18.632 1.00 37.50  ? 47  LYS A HE2  1 
ATOM   607  H HE3  . LYS A 1 48  ? -3.123  8.218   -17.443 1.00 37.50  ? 47  LYS A HE3  1 
ATOM   608  H HZ1  . LYS A 1 48  ? -2.094  9.775   -18.739 1.00 42.69  ? 47  LYS A HZ1  1 
ATOM   609  H HZ2  . LYS A 1 48  ? -1.343  8.540   -18.835 1.00 42.69  ? 47  LYS A HZ2  1 
ATOM   610  H HZ3  . LYS A 1 48  ? -2.210  8.946   -19.921 1.00 42.69  ? 47  LYS A HZ3  1 
ATOM   611  N N    . ILE A 1 49  ? -6.565  1.911   -18.347 1.00 9.86   ? 48  ILE A N    1 
ATOM   612  C CA   . ILE A 1 49  ? -7.033  0.675   -18.982 1.00 8.62   ? 48  ILE A CA   1 
ATOM   613  C C    . ILE A 1 49  ? -8.535  0.527   -18.848 1.00 10.54  ? 48  ILE A C    1 
ATOM   614  O O    . ILE A 1 49  ? -9.232  0.189   -19.813 1.00 13.35  ? 48  ILE A O    1 
ATOM   615  C CB   . ILE A 1 49  ? -6.279  -0.536  -18.403 1.00 8.92   ? 48  ILE A CB   1 
ATOM   616  C CG1  . ILE A 1 49  ? -4.837  -0.521  -18.903 1.00 9.58   ? 48  ILE A CG1  1 
ATOM   617  C CG2  . ILE A 1 49  ? -6.965  -1.855  -18.794 1.00 11.07  ? 48  ILE A CG2  1 
ATOM   618  C CD1  . ILE A 1 49  ? -3.938  -1.480  -18.157 1.00 10.18  ? 48  ILE A CD1  1 
ATOM   619  H H    . ILE A 1 49  ? -6.035  1.785   -17.682 1.00 11.84  ? 48  ILE A H    1 
ATOM   620  H HA   . ILE A 1 49  ? -6.828  0.720   -19.929 1.00 10.35  ? 48  ILE A HA   1 
ATOM   621  H HB   . ILE A 1 49  ? -6.273  -0.464  -17.436 1.00 10.72  ? 48  ILE A HB   1 
ATOM   622  H HG12 . ILE A 1 49  ? -4.827  -0.770  -19.840 1.00 11.50  ? 48  ILE A HG12 1 
ATOM   623  H HG13 . ILE A 1 49  ? -4.476  0.373   -18.794 1.00 11.50  ? 48  ILE A HG13 1 
ATOM   624  H HG21 . ILE A 1 49  ? -6.466  -2.595  -18.414 1.00 13.30  ? 48  ILE A HG21 1 
ATOM   625  H HG22 . ILE A 1 49  ? -7.871  -1.854  -18.448 1.00 13.30  ? 48  ILE A HG22 1 
ATOM   626  H HG23 . ILE A 1 49  ? -6.980  -1.927  -19.762 1.00 13.30  ? 48  ILE A HG23 1 
ATOM   627  H HD11 . ILE A 1 49  ? -3.041  -1.420  -18.523 1.00 12.23  ? 48  ILE A HD11 1 
ATOM   628  H HD12 . ILE A 1 49  ? -3.929  -1.238  -17.218 1.00 12.23  ? 48  ILE A HD12 1 
ATOM   629  H HD13 . ILE A 1 49  ? -4.280  -2.381  -18.264 1.00 12.23  ? 48  ILE A HD13 1 
ATOM   630  N N    . ASP A 1 50  ? -9.081  0.765   -17.658 1.00 9.74   ? 49  ASP A N    1 
ATOM   631  C CA   . ASP A 1 50  ? -10.521 0.626   -17.471 1.00 12.50  ? 49  ASP A CA   1 
ATOM   632  C C    . ASP A 1 50  ? -10.980 1.611   -16.419 1.00 11.67  ? 49  ASP A C    1 
ATOM   633  O O    . ASP A 1 50  ? -11.063 1.290   -15.220 1.00 10.53  ? 49  ASP A O    1 
ATOM   634  C CB   . ASP A 1 50  ? -10.898 -0.811  -17.140 1.00 9.31   ? 49  ASP A CB   1 
ATOM   635  C CG   . ASP A 1 50  ? -12.373 -1.010  -17.126 1.00 13.83  ? 49  ASP A CG   1 
ATOM   636  O OD1  . ASP A 1 50  ? -13.098 0.010   -17.148 1.00 14.30  ? 49  ASP A OD1  1 
ATOM   637  O OD2  . ASP A 1 50  ? -12.781 -2.177  -17.185 1.00 14.42  ? 49  ASP A OD2  1 
ATOM   638  H H    . ASP A 1 50  ? -8.647  1.003   -16.954 1.00 11.70  ? 49  ASP A H    1 
ATOM   639  H HA   . ASP A 1 50  ? -10.964 0.860   -18.302 1.00 15.01  ? 49  ASP A HA   1 
ATOM   640  H HB2  . ASP A 1 50  ? -10.519 -1.402  -17.809 1.00 11.18  ? 49  ASP A HB2  1 
ATOM   641  H HB3  . ASP A 1 50  ? -10.555 -1.036  -16.261 1.00 11.18  ? 49  ASP A HB3  1 
ATOM   642  N N    . PRO A 1 51  ? -11.325 2.828   -16.831 1.00 10.93  ? 50  PRO A N    1 
ATOM   643  C CA   . PRO A 1 51  ? -11.748 3.840   -15.857 1.00 14.25  ? 50  PRO A CA   1 
ATOM   644  C C    . PRO A 1 51  ? -13.118 3.582   -15.284 1.00 13.21  ? 50  PRO A C    1 
ATOM   645  O O    . PRO A 1 51  ? -13.437 4.170   -14.249 1.00 13.51  ? 50  PRO A O    1 
ATOM   646  C CB   . PRO A 1 51  ? -11.699 5.144   -16.667 1.00 15.79  ? 50  PRO A CB   1 
ATOM   647  C CG   . PRO A 1 51  ? -11.864 4.727   -18.046 1.00 18.53  ? 50  PRO A CG   1 
ATOM   648  C CD   . PRO A 1 51  ? -11.225 3.386   -18.194 1.00 13.26  ? 50  PRO A CD   1 
ATOM   649  H HA   . PRO A 1 51  ? -11.105 3.892   -15.132 1.00 17.11  ? 50  PRO A HA   1 
ATOM   650  H HB2  . PRO A 1 51  ? -12.425 5.727   -16.394 1.00 18.96  ? 50  PRO A HB2  1 
ATOM   651  H HB3  . PRO A 1 51  ? -10.841 5.579   -16.538 1.00 18.96  ? 50  PRO A HB3  1 
ATOM   652  H HG2  . PRO A 1 51  ? -12.810 4.672   -18.252 1.00 22.24  ? 50  PRO A HG2  1 
ATOM   653  H HG3  . PRO A 1 51  ? -11.430 5.371   -18.628 1.00 22.24  ? 50  PRO A HG3  1 
ATOM   654  H HD2  . PRO A 1 51  ? -11.722 2.840   -18.823 1.00 15.92  ? 50  PRO A HD2  1 
ATOM   655  H HD3  . PRO A 1 51  ? -10.296 3.479   -18.456 1.00 15.92  ? 50  PRO A HD3  1 
ATOM   656  N N    . ALA A 1 52  ? -13.897 2.684   -15.880 1.00 12.34  ? 51  ALA A N    1 
ATOM   657  C CA   . ALA A 1 52  ? -15.171 2.317   -15.272 1.00 13.33  ? 51  ALA A CA   1 
ATOM   658  C C    . ALA A 1 52  ? -14.981 1.435   -14.057 1.00 13.55  ? 51  ALA A C    1 
ATOM   659  O O    . ALA A 1 52  ? -15.823 1.441   -13.166 1.00 13.06  ? 51  ALA A O    1 
ATOM   660  C CB   . ALA A 1 52  ? -16.080 1.598   -16.264 1.00 13.85  ? 51  ALA A CB   1 
ATOM   661  H H    . ALA A 1 52  ? -13.717 2.281   -16.619 1.00 14.82  ? 51  ALA A H    1 
ATOM   662  H HA   . ALA A 1 52  ? -15.624 3.125   -14.985 1.00 16.01  ? 51  ALA A HA   1 
ATOM   663  H HB1  . ALA A 1 52  ? -16.913 1.372   -15.821 1.00 16.63  ? 51  ALA A HB1  1 
ATOM   664  H HB2  . ALA A 1 52  ? -16.253 2.186   -17.016 1.00 16.63  ? 51  ALA A HB2  1 
ATOM   665  H HB3  . ALA A 1 52  ? -15.638 0.791   -16.569 1.00 16.63  ? 51  ALA A HB3  1 
ATOM   666  N N    . TYR A 1 53  ? -13.892 0.674   -13.992 1.00 11.65  ? 52  TYR A N    1 
ATOM   667  C CA   . TYR A 1 53  ? -13.628 -0.221  -12.883 1.00 10.39  ? 52  TYR A CA   1 
ATOM   668  C C    . TYR A 1 53  ? -12.615 0.359   -11.903 1.00 11.31  ? 52  TYR A C    1 
ATOM   669  O O    . TYR A 1 53  ? -12.850 0.412   -10.691 1.00 13.17  ? 52  TYR A O    1 
ATOM   670  C CB   . TYR A 1 53  ? -13.115 -1.562  -13.414 1.00 11.13  ? 52  TYR A CB   1 
ATOM   671  C CG   . TYR A 1 53  ? -13.095 -2.649  -12.382 1.00 11.84  ? 52  TYR A CG   1 
ATOM   672  C CD1  . TYR A 1 53  ? -14.238 -3.372  -12.115 1.00 13.35  ? 52  TYR A CD1  1 
ATOM   673  C CD2  . TYR A 1 53  ? -11.969 -2.902  -11.633 1.00 12.66  ? 52  TYR A CD2  1 
ATOM   674  C CE1  . TYR A 1 53  ? -14.246 -4.375  -11.186 1.00 12.51  ? 52  TYR A CE1  1 
ATOM   675  C CE2  . TYR A 1 53  ? -11.969 -3.884  -10.668 1.00 14.00  ? 52  TYR A CE2  1 
ATOM   676  C CZ   . TYR A 1 53  ? -13.120 -4.626  -10.459 1.00 12.38  ? 52  TYR A CZ   1 
ATOM   677  O OH   . TYR A 1 53  ? -13.187 -5.643  -9.511  1.00 16.48  ? 52  TYR A OH   1 
ATOM   678  H H    . TYR A 1 53  ? -13.280 0.662   -14.596 1.00 13.98  ? 52  TYR A H    1 
ATOM   679  H HA   . TYR A 1 53  ? -14.455 -0.383  -12.402 1.00 12.48  ? 52  TYR A HA   1 
ATOM   680  H HB2  . TYR A 1 53  ? -13.689 -1.852  -14.140 1.00 13.36  ? 52  TYR A HB2  1 
ATOM   681  H HB3  . TYR A 1 53  ? -12.208 -1.444  -13.739 1.00 13.36  ? 52  TYR A HB3  1 
ATOM   682  H HD1  . TYR A 1 53  ? -15.003 -3.213  -12.618 1.00 16.03  ? 52  TYR A HD1  1 
ATOM   683  H HD2  . TYR A 1 53  ? -11.195 -2.409  -11.786 1.00 15.20  ? 52  TYR A HD2  1 
ATOM   684  H HE1  . TYR A 1 53  ? -15.022 -4.863  -11.031 1.00 15.02  ? 52  TYR A HE1  1 
ATOM   685  H HE2  . TYR A 1 53  ? -11.197 -4.065  -10.182 1.00 16.81  ? 52  TYR A HE2  1 
ATOM   686  H HH   . TYR A 1 53  ? -13.953 -5.987  -9.513  1.00 19.78  ? 52  TYR A HH   1 
ATOM   687  N N    . PHE A 1 54  ? -11.472 0.788   -12.425 1.00 10.63  ? 53  PHE A N    1 
ATOM   688  C CA   . PHE A 1 54  ? -10.419 1.415   -11.642 1.00 11.41  ? 53  PHE A CA   1 
ATOM   689  C C    . PHE A 1 54  ? -10.694 2.920   -11.626 1.00 12.69  ? 53  PHE A C    1 
ATOM   690  O O    . PHE A 1 54  ? -10.009 3.719   -12.251 1.00 14.11  ? 53  PHE A O    1 
ATOM   691  C CB   . PHE A 1 54  ? -9.054  1.069   -12.231 1.00 9.16   ? 53  PHE A CB   1 
ATOM   692  C CG   . PHE A 1 54  ? -8.775  -0.424  -12.265 1.00 10.02  ? 53  PHE A CG   1 
ATOM   693  C CD1  . PHE A 1 54  ? -8.425  -1.105  -11.104 1.00 11.72  ? 53  PHE A CD1  1 
ATOM   694  C CD2  . PHE A 1 54  ? -8.868  -1.146  -13.446 1.00 11.88  ? 53  PHE A CD2  1 
ATOM   695  C CE1  . PHE A 1 54  ? -8.182  -2.465  -11.134 1.00 13.29  ? 53  PHE A CE1  1 
ATOM   696  C CE2  . PHE A 1 54  ? -8.629  -2.508  -13.457 1.00 11.06  ? 53  PHE A CE2  1 
ATOM   697  C CZ   . PHE A 1 54  ? -8.280  -3.150  -12.300 1.00 12.24  ? 53  PHE A CZ   1 
ATOM   698  H H    . PHE A 1 54  ? -11.278 0.723   -13.261 1.00 12.77  ? 53  PHE A H    1 
ATOM   699  H HA   . PHE A 1 54  ? -10.453 1.086   -10.730 1.00 13.70  ? 53  PHE A HA   1 
ATOM   700  H HB2  . PHE A 1 54  ? -9.012  1.401   -13.142 1.00 11.00  ? 53  PHE A HB2  1 
ATOM   701  H HB3  . PHE A 1 54  ? -8.364  1.489   -11.695 1.00 11.00  ? 53  PHE A HB3  1 
ATOM   702  H HD1  . PHE A 1 54  ? -8.357  -0.642  -10.301 1.00 14.07  ? 53  PHE A HD1  1 
ATOM   703  H HD2  . PHE A 1 54  ? -9.107  -0.713  -14.234 1.00 14.27  ? 53  PHE A HD2  1 
ATOM   704  H HE1  . PHE A 1 54  ? -7.947  -2.911  -10.352 1.00 15.96  ? 53  PHE A HE1  1 
ATOM   705  H HE2  . PHE A 1 54  ? -8.690  -2.984  -14.253 1.00 13.28  ? 53  PHE A HE2  1 
ATOM   706  H HZ   . PHE A 1 54  ? -8.113  -4.065  -12.313 1.00 14.70  ? 53  PHE A HZ   1 
ATOM   707  N N    . ASP A 1 55  ? -11.739 3.288   -10.895 1.00 12.78  ? 54  ASP A N    1 
ATOM   708  C CA   . ASP A 1 55  ? -12.266 4.642   -10.921 1.00 14.14  ? 54  ASP A CA   1 
ATOM   709  C C    . ASP A 1 55  ? -11.553 5.537   -9.913  1.00 20.06  ? 54  ASP A C    1 
ATOM   710  O O    . ASP A 1 55  ? -10.567 5.150   -9.281  1.00 15.70  ? 54  ASP A O    1 
ATOM   711  C CB   . ASP A 1 55  ? -13.768 4.646   -10.644 1.00 15.41  ? 54  ASP A CB   1 
ATOM   712  C CG   . ASP A 1 55  ? -14.120 4.214   -9.224  1.00 23.75  ? 54  ASP A CG   1 
ATOM   713  O OD1  . ASP A 1 55  ? -13.283 3.645   -8.503  1.00 22.26  ? 54  ASP A OD1  1 
ATOM   714  O OD2  . ASP A 1 55  ? -15.210 4.593   -8.762  1.00 31.85  ? 54  ASP A OD2  1 
ATOM   715  H H    . ASP A 1 55  ? -12.166 2.761   -10.367 1.00 15.35  ? 54  ASP A H    1 
ATOM   716  H HA   . ASP A 1 55  ? -12.125 5.017   -11.804 1.00 16.98  ? 54  ASP A HA   1 
ATOM   717  H HB2  . ASP A 1 55  ? -14.110 5.544   -10.776 1.00 18.50  ? 54  ASP A HB2  1 
ATOM   718  H HB3  . ASP A 1 55  ? -14.202 4.033   -11.258 1.00 18.50  ? 54  ASP A HB3  1 
ATOM   719  N N    . GLU A 1 56  ? -12.075 6.753   -9.731  1.00 20.15  ? 55  GLU A N    1 
ATOM   720  C CA   . GLU A 1 56  ? -11.454 7.684   -8.794  1.00 21.72  ? 55  GLU A CA   1 
ATOM   721  C C    . GLU A 1 56  ? -11.577 7.223   -7.358  1.00 19.71  ? 55  GLU A C    1 
ATOM   722  O O    . GLU A 1 56  ? -10.628 7.376   -6.584  1.00 19.12  ? 55  GLU A O    1 
ATOM   723  C CB   . GLU A 1 56  ? -12.052 9.073   -8.973  1.00 28.91  ? 55  GLU A CB   1 
ATOM   724  C CG   . GLU A 1 56  ? -11.510 9.755   -10.188 1.00 45.44  ? 55  GLU A CG   1 
ATOM   725  C CD   . GLU A 1 56  ? -10.037 10.084  -9.998  1.00 60.97  ? 55  GLU A CD   1 
ATOM   726  O OE1  . GLU A 1 56  ? -9.647  10.372  -8.843  1.00 61.12  ? 55  GLU A OE1  1 
ATOM   727  O OE2  . GLU A 1 56  ? -9.267  10.026  -10.981 1.00 61.01  ? 55  GLU A OE2  1 
ATOM   728  H H    . GLU A 1 56  ? -12.774 7.056   -10.131 1.00 24.19  ? 55  GLU A H    1 
ATOM   729  H HA   . GLU A 1 56  ? -10.508 7.743   -9.001  1.00 26.08  ? 55  GLU A HA   1 
ATOM   730  H HB2  . GLU A 1 56  ? -13.014 8.997   -9.072  1.00 34.71  ? 55  GLU A HB2  1 
ATOM   731  H HB3  . GLU A 1 56  ? -11.837 9.617   -8.199  1.00 34.71  ? 55  GLU A HB3  1 
ATOM   732  H HG2  . GLU A 1 56  ? -11.597 9.167   -10.955 1.00 54.54  ? 55  GLU A HG2  1 
ATOM   733  H HG3  . GLU A 1 56  ? -11.993 10.582  -10.338 1.00 54.54  ? 55  GLU A HG3  1 
ATOM   734  N N    . ASN A 1 57  ? -12.703 6.629   -6.986  1.00 22.45  ? 56  ASN A N    1 
ATOM   735  C CA   . ASN A 1 57  ? -12.845 6.115   -5.631  1.00 20.99  ? 56  ASN A CA   1 
ATOM   736  C C    . ASN A 1 57  ? -11.762 5.092   -5.339  1.00 22.40  ? 56  ASN A C    1 
ATOM   737  O O    . ASN A 1 57  ? -11.177 5.076   -4.249  1.00 23.33  ? 56  ASN A O    1 
ATOM   738  C CB   . ASN A 1 57  ? -14.237 5.523   -5.454  1.00 31.04  ? 56  ASN A CB   1 
ATOM   739  C CG   . ASN A 1 57  ? -15.289 6.594   -5.393  1.00 44.99  ? 56  ASN A CG   1 
ATOM   740  O OD1  . ASN A 1 57  ? -15.132 7.568   -4.666  1.00 47.15  ? 56  ASN A OD1  1 
ATOM   741  N ND2  . ASN A 1 57  ? -16.308 6.484   -6.234  1.00 42.93  ? 56  ASN A ND2  1 
ATOM   742  H H    . ASN A 1 57  ? -13.390 6.513   -7.490  1.00 26.95  ? 56  ASN A H    1 
ATOM   743  H HA   . ASN A 1 57  ? -12.746 6.847   -5.002  1.00 25.20  ? 56  ASN A HA   1 
ATOM   744  H HB2  . ASN A 1 57  ? -14.436 4.944   -6.207  1.00 37.26  ? 56  ASN A HB2  1 
ATOM   745  H HB3  . ASN A 1 57  ? -14.268 5.019   -4.626  1.00 37.26  ? 56  ASN A HB3  1 
ATOM   746  H HD21 . ASN A 1 57  ? -16.927 7.081   -6.238  1.00 51.52  ? 56  ASN A HD21 1 
ATOM   747  H HD22 . ASN A 1 57  ? -16.372 5.794   -6.743  1.00 51.52  ? 56  ASN A HD22 1 
ATOM   748  N N    . TRP A 1 58  ? -11.452 4.265   -6.329  1.00 18.58  ? 57  TRP A N    1 
ATOM   749  C CA   . TRP A 1 58  ? -10.429 3.240   -6.171  1.00 16.23  ? 57  TRP A CA   1 
ATOM   750  C C    . TRP A 1 58  ? -9.027  3.848   -6.116  1.00 15.24  ? 57  TRP A C    1 
ATOM   751  O O    . TRP A 1 58  ? -8.245  3.541   -5.200  1.00 15.76  ? 57  TRP A O    1 
ATOM   752  C CB   . TRP A 1 58  ? -10.547 2.241   -7.322  1.00 13.87  ? 57  TRP A CB   1 
ATOM   753  C CG   . TRP A 1 58  ? -9.553  1.119   -7.234  1.00 13.31  ? 57  TRP A CG   1 
ATOM   754  C CD1  . TRP A 1 58  ? -9.621  0.021   -6.436  1.00 18.49  ? 57  TRP A CD1  1 
ATOM   755  C CD2  . TRP A 1 58  ? -8.282  1.061   -7.889  1.00 11.89  ? 57  TRP A CD2  1 
ATOM   756  N NE1  . TRP A 1 58  ? -8.491  -0.744  -6.588  1.00 16.84  ? 57  TRP A NE1  1 
ATOM   757  C CE2  . TRP A 1 58  ? -7.655  -0.132  -7.489  1.00 11.82  ? 57  TRP A CE2  1 
ATOM   758  C CE3  . TRP A 1 58  ? -7.639  1.893   -8.796  1.00 11.27  ? 57  TRP A CE3  1 
ATOM   759  C CZ2  . TRP A 1 58  ? -6.409  -0.514  -7.965  1.00 14.96  ? 57  TRP A CZ2  1 
ATOM   760  C CZ3  . TRP A 1 58  ? -6.404  1.508   -9.300  1.00 13.38  ? 57  TRP A CZ3  1 
ATOM   761  C CH2  . TRP A 1 58  ? -5.794  0.320   -8.862  1.00 14.73  ? 57  TRP A CH2  1 
ATOM   762  H H    . TRP A 1 58  ? -11.821 4.276   -7.105  1.00 22.31  ? 57  TRP A H    1 
ATOM   763  H HA   . TRP A 1 58  ? -10.583 2.763   -5.340  1.00 19.48  ? 57  TRP A HA   1 
ATOM   764  H HB2  . TRP A 1 58  ? -11.436 1.854   -7.313  1.00 16.65  ? 57  TRP A HB2  1 
ATOM   765  H HB3  . TRP A 1 58  ? -10.397 2.707   -8.160  1.00 16.65  ? 57  TRP A HB3  1 
ATOM   766  H HD1  . TRP A 1 58  ? -10.333 -0.187  -5.875  1.00 22.20  ? 57  TRP A HD1  1 
ATOM   767  H HE1  . TRP A 1 58  ? -8.338  -1.493  -6.194  1.00 20.21  ? 57  TRP A HE1  1 
ATOM   768  H HE3  . TRP A 1 58  ? -8.045  2.677   -9.089  1.00 13.53  ? 57  TRP A HE3  1 
ATOM   769  H HZ2  . TRP A 1 58  ? -6.007  -1.305  -7.685  1.00 17.96  ? 57  TRP A HZ2  1 
ATOM   770  H HZ3  . TRP A 1 58  ? -5.961  2.058   -9.905  1.00 16.06  ? 57  TRP A HZ3  1 
ATOM   771  H HH2  . TRP A 1 58  ? -4.962  0.085   -9.204  1.00 17.69  ? 57  TRP A HH2  1 
ATOM   772  N N    . LEU A 1 59  ? -8.692  4.738   -7.066  1.00 14.42  ? 58  LEU A N    1 
ATOM   773  C CA   . LEU A 1 59  ? -7.402  5.416   -7.036  1.00 14.92  ? 58  LEU A CA   1 
ATOM   774  C C    . LEU A 1 59  ? -7.152  6.186   -5.756  1.00 15.89  ? 58  LEU A C    1 
ATOM   775  O O    . LEU A 1 59  ? -6.000  6.293   -5.331  1.00 15.86  ? 58  LEU A O    1 
ATOM   776  C CB   . LEU A 1 59  ? -7.171  6.397   -8.192  1.00 21.75  ? 58  LEU A CB   1 
ATOM   777  C CG   . LEU A 1 59  ? -6.369  6.039   -9.410  1.00 35.35  ? 58  LEU A CG   1 
ATOM   778  C CD1  . LEU A 1 59  ? -6.333  7.256   -10.294 1.00 28.39  ? 58  LEU A CD1  1 
ATOM   779  C CD2  . LEU A 1 59  ? -4.951  5.728   -8.915  1.00 26.98  ? 58  LEU A CD2  1 
ATOM   780  H H    . LEU A 1 59  ? -9.194  4.958   -7.728  1.00 17.32  ? 58  LEU A H    1 
ATOM   781  H HA   . LEU A 1 59  ? -6.710  4.739   -7.098  1.00 17.92  ? 58  LEU A HA   1 
ATOM   782  H HB2  . LEU A 1 59  ? -8.047  6.657   -8.518  1.00 26.11  ? 58  LEU A HB2  1 
ATOM   783  H HB3  . LEU A 1 59  ? -6.743  7.181   -7.813  1.00 26.11  ? 58  LEU A HB3  1 
ATOM   784  H HG   . LEU A 1 59  ? -6.746  5.279   -9.880  1.00 42.43  ? 58  LEU A HG   1 
ATOM   785  H HD11 . LEU A 1 59  ? -5.819  7.051   -11.091 1.00 34.08  ? 58  LEU A HD11 1 
ATOM   786  H HD12 . LEU A 1 59  ? -7.241  7.496   -10.538 1.00 34.08  ? 58  LEU A HD12 1 
ATOM   787  H HD13 . LEU A 1 59  ? -5.916  7.986   -9.810  1.00 34.08  ? 58  LEU A HD13 1 
ATOM   788  H HD21 . LEU A 1 59  ? -4.397  5.490   -9.675  1.00 32.39  ? 58  LEU A HD21 1 
ATOM   789  H HD22 . LEU A 1 59  ? -4.591  6.514   -8.476  1.00 32.39  ? 58  LEU A HD22 1 
ATOM   790  H HD23 . LEU A 1 59  ? -4.991  4.987   -8.290  1.00 32.39  ? 58  LEU A HD23 1 
ATOM   791  N N    . ASN A 1 60  ? -8.197  6.744   -5.140  1.00 15.91  ? 59  ASN A N    1 
ATOM   792  C CA   . ASN A 1 60  ? -7.993  7.524   -3.920  1.00 15.39  ? 59  ASN A CA   1 
ATOM   793  C C    . ASN A 1 60  ? -7.361  6.702   -2.811  1.00 15.46  ? 59  ASN A C    1 
ATOM   794  O O    . ASN A 1 60  ? -6.762  7.277   -1.895  1.00 19.95  ? 59  ASN A O    1 
ATOM   795  C CB   . ASN A 1 60  ? -9.296  8.088   -3.348  1.00 18.91  ? 59  ASN A CB   1 
ATOM   796  C CG   . ASN A 1 60  ? -9.943  9.129   -4.231  1.00 18.25  ? 59  ASN A CG   1 
ATOM   797  O OD1  . ASN A 1 60  ? -9.294  9.821   -4.996  1.00 18.80  ? 59  ASN A OD1  1 
ATOM   798  N ND2  . ASN A 1 60  ? -11.248 9.321   -4.018  1.00 24.65  ? 59  ASN A ND2  1 
ATOM   799  H H    . ASN A 1 60  ? -9.015  6.687   -5.401  1.00 19.11  ? 59  ASN A H    1 
ATOM   800  H HA   . ASN A 1 60  ? -7.403  8.269   -4.116  1.00 18.48  ? 59  ASN A HA   1 
ATOM   801  H HB2  . ASN A 1 60  ? -9.928  7.361   -3.233  1.00 22.70  ? 59  ASN A HB2  1 
ATOM   802  H HB3  . ASN A 1 60  ? -9.109  8.500   -2.490  1.00 22.70  ? 59  ASN A HB3  1 
ATOM   803  H HD21 . ASN A 1 60  ? -11.676 9.907   -4.480  1.00 29.60  ? 59  ASN A HD21 1 
ATOM   804  H HD22 . ASN A 1 60  ? -11.668 8.828   -3.453  1.00 29.60  ? 59  ASN A HD22 1 
ATOM   805  N N    . ARG A 1 61  ? -7.504  5.376   -2.853  1.00 15.20  ? 60  ARG A N    1 
ATOM   806  C CA   . ARG A 1 61  ? -6.953  4.503   -1.828  1.00 14.80  ? 60  ARG A CA   1 
ATOM   807  C C    . ARG A 1 61  ? -5.446  4.318   -1.953  1.00 13.34  ? 60  ARG A C    1 
ATOM   808  O O    . ARG A 1 61  ? -4.825  3.821   -1.011  1.00 13.96  ? 60  ARG A O    1 
ATOM   809  C CB   . ARG A 1 61  ? -7.639  3.153   -1.909  1.00 17.60  ? 60  ARG A CB   1 
ATOM   810  C CG   . ARG A 1 61  ? -9.120  3.236   -1.610  1.00 25.99  ? 60  ARG A CG   1 
ATOM   811  C CD   . ARG A 1 61  ? -9.818  1.941   -1.923  1.00 48.60  ? 60  ARG A CD   1 
ATOM   812  N NE   . ARG A 1 61  ? -11.232 2.033   -1.583  1.00 59.89  ? 60  ARG A NE   1 
ATOM   813  C CZ   . ARG A 1 61  ? -12.142 1.124   -1.908  1.00 70.78  ? 60  ARG A CZ   1 
ATOM   814  N NH1  . ARG A 1 61  ? -11.801 0.063   -2.632  1.00 64.29  ? 60  ARG A NH1  1 
ATOM   815  N NH2  . ARG A 1 61  ? -13.401 1.301   -1.539  1.00 75.04  ? 60  ARG A NH2  1 
ATOM   816  H H    . ARG A 1 61  ? -7.923  4.957   -3.476  1.00 18.25  ? 60  ARG A H    1 
ATOM   817  H HA   . ARG A 1 61  ? -7.138  4.883   -0.955  1.00 17.77  ? 60  ARG A HA   1 
ATOM   818  H HB2  . ARG A 1 61  ? -7.533  2.797   -2.805  1.00 21.13  ? 60  ARG A HB2  1 
ATOM   819  H HB3  . ARG A 1 61  ? -7.235  2.553   -1.263  1.00 21.13  ? 60  ARG A HB3  1 
ATOM   820  H HG2  . ARG A 1 61  ? -9.246  3.429   -0.668  1.00 31.20  ? 60  ARG A HG2  1 
ATOM   821  H HG3  . ARG A 1 61  ? -9.518  3.935   -2.152  1.00 31.20  ? 60  ARG A HG3  1 
ATOM   822  H HD2  . ARG A 1 61  ? -9.741  1.752   -2.871  1.00 58.33  ? 60  ARG A HD2  1 
ATOM   823  H HD3  . ARG A 1 61  ? -9.422  1.225   -1.401  1.00 58.33  ? 60  ARG A HD3  1 
ATOM   824  H HE   . ARG A 1 61  ? -11.494 2.724   -1.142  1.00 71.87  ? 60  ARG A HE   1 
ATOM   825  H HH11 . ARG A 1 61  ? -10.982 -0.050  -2.871  1.00 77.16  ? 60  ARG A HH11 1 
ATOM   826  H HH12 . ARG A 1 61  ? -12.395 -0.520  -2.847  1.00 77.16  ? 60  ARG A HH12 1 
ATOM   827  H HH21 . ARG A 1 61  ? -13.622 1.993   -1.078  1.00 90.06  ? 60  ARG A HH21 1 
ATOM   828  H HH22 . ARG A 1 61  ? -13.999 0.722   -1.758  1.00 90.06  ? 60  ARG A HH22 1 
ATOM   829  N N    . ILE A 1 62  ? -4.848  4.749   -3.052  1.00 11.57  ? 61  ILE A N    1 
ATOM   830  C CA   . ILE A 1 62  ? -3.424  4.585   -3.295  1.00 12.43  ? 61  ILE A CA   1 
ATOM   831  C C    . ILE A 1 62  ? -2.723  5.853   -2.834  1.00 13.00  ? 61  ILE A C    1 
ATOM   832  O O    . ILE A 1 62  ? -2.986  6.950   -3.351  1.00 17.06  ? 61  ILE A O    1 
ATOM   833  C CB   . ILE A 1 62  ? -3.158  4.313   -4.781  1.00 14.20  ? 61  ILE A CB   1 
ATOM   834  C CG1  . ILE A 1 62  ? -3.966  3.107   -5.263  1.00 13.86  ? 61  ILE A CG1  1 
ATOM   835  C CG2  . ILE A 1 62  ? -1.707  4.088   -5.053  1.00 14.78  ? 61  ILE A CG2  1 
ATOM   836  C CD1  . ILE A 1 62  ? -3.750  1.824   -4.483  1.00 14.72  ? 61  ILE A CD1  1 
ATOM   837  H H    . ILE A 1 62  ? -5.259  5.151   -3.692  1.00 13.89  ? 61  ILE A H    1 
ATOM   838  H HA   . ILE A 1 62  ? -3.088  3.837   -2.776  1.00 14.92  ? 61  ILE A HA   1 
ATOM   839  H HB   . ILE A 1 62  ? -3.444  5.090   -5.287  1.00 17.05  ? 61  ILE A HB   1 
ATOM   840  H HG12 . ILE A 1 62  ? -4.909  3.327   -5.206  1.00 16.64  ? 61  ILE A HG12 1 
ATOM   841  H HG13 . ILE A 1 62  ? -3.730  2.929   -6.187  1.00 16.64  ? 61  ILE A HG13 1 
ATOM   842  H HG21 . ILE A 1 62  ? -1.586  3.921   -6.001  1.00 17.75  ? 61  ILE A HG21 1 
ATOM   843  H HG22 . ILE A 1 62  ? -1.211  4.879   -4.790  1.00 17.75  ? 61  ILE A HG22 1 
ATOM   844  H HG23 . ILE A 1 62  ? -1.405  3.322   -4.540  1.00 17.75  ? 61  ILE A HG23 1 
ATOM   845  H HD11 . ILE A 1 62  ? -4.304  1.125   -4.865  1.00 17.68  ? 61  ILE A HD11 1 
ATOM   846  H HD12 . ILE A 1 62  ? -2.815  1.573   -4.540  1.00 17.68  ? 61  ILE A HD12 1 
ATOM   847  H HD13 . ILE A 1 62  ? -3.997  1.973   -3.557  1.00 17.68  ? 61  ILE A HD13 1 
ATOM   848  N N    . LYS A 1 63  ? -1.855  5.722   -1.858  1.00 12.52  ? 62  LYS A N    1 
ATOM   849  C CA   . LYS A 1 63  ? -1.186  6.876   -1.284  1.00 13.54  ? 62  LYS A CA   1 
ATOM   850  C C    . LYS A 1 63  ? -0.089  7.380   -2.206  1.00 15.33  ? 62  LYS A C    1 
ATOM   851  O O    . LYS A 1 63  ? 0.687   6.596   -2.753  1.00 15.47  ? 62  LYS A O    1 
ATOM   852  C CB   . LYS A 1 63  ? -0.584  6.496   0.056   1.00 16.87  ? 62  LYS A CB   1 
ATOM   853  C CG   . LYS A 1 63  ? 0.089   7.603   0.776   1.00 34.98  ? 62  LYS A CG   1 
ATOM   854  C CD   . LYS A 1 63  ? -0.856  8.526   1.465   1.00 46.89  ? 62  LYS A CD   1 
ATOM   855  C CE   . LYS A 1 63  ? -0.038  9.639   2.095   1.00 41.71  ? 62  LYS A CE   1 
ATOM   856  N NZ   . LYS A 1 63  ? 0.638   10.512  1.085   1.00 38.40  ? 62  LYS A NZ   1 
ATOM   857  H H    . LYS A 1 63  ? -1.630  4.971   -1.503  1.00 15.04  ? 62  LYS A H    1 
ATOM   858  H HA   . LYS A 1 63  ? -1.828  7.590   -1.145  1.00 16.25  ? 62  LYS A HA   1 
ATOM   859  H HB2  . LYS A 1 63  ? -1.292  6.162   0.629   1.00 20.26  ? 62  LYS A HB2  1 
ATOM   860  H HB3  . LYS A 1 63  ? 0.074   5.798   -0.088  1.00 20.26  ? 62  LYS A HB3  1 
ATOM   861  H HG2  . LYS A 1 63  ? 0.679   7.227   1.447   1.00 41.99  ? 62  LYS A HG2  1 
ATOM   862  H HG3  . LYS A 1 63  ? 0.603   8.124   0.140   1.00 41.99  ? 62  LYS A HG3  1 
ATOM   863  H HD2  . LYS A 1 63  ? -1.472  8.912   0.822   1.00 56.27  ? 62  LYS A HD2  1 
ATOM   864  H HD3  . LYS A 1 63  ? -1.334  8.052   2.163   1.00 56.27  ? 62  LYS A HD3  1 
ATOM   865  H HE2  . LYS A 1 63  ? -0.624  10.198  2.629   1.00 50.07  ? 62  LYS A HE2  1 
ATOM   866  H HE3  . LYS A 1 63  ? 0.648   9.246   2.657   1.00 50.07  ? 62  LYS A HE3  1 
ATOM   867  H HZ1  . LYS A 1 63  ? 0.030   10.894  0.559   1.00 46.09  ? 62  LYS A HZ1  1 
ATOM   868  H HZ2  . LYS A 1 63  ? 1.105   11.148  1.497   1.00 46.09  ? 62  LYS A HZ2  1 
ATOM   869  H HZ3  . LYS A 1 63  ? 1.190   10.026  0.584   1.00 46.09  ? 62  LYS A HZ3  1 
ATOM   870  N N    . THR A 1 64  ? 0.015   8.693   -2.342  1.00 15.88  ? 63  THR A N    1 
ATOM   871  C CA   . THR A 1 64  ? 1.023   9.313   -3.182  1.00 16.33  ? 63  THR A CA   1 
ATOM   872  C C    . THR A 1 64  ? 2.081   9.884   -2.234  1.00 17.82  ? 63  THR A C    1 
ATOM   873  O O    . THR A 1 64  ? 1.861   9.992   -1.028  1.00 30.39  ? 63  THR A O    1 
ATOM   874  C CB   . THR A 1 64  ? 0.403   10.401  -4.070  1.00 20.96  ? 63  THR A CB   1 
ATOM   875  O OG1  . THR A 1 64  ? -0.102  11.435  -3.231  1.00 23.62  ? 63  THR A OG1  1 
ATOM   876  C CG2  . THR A 1 64  ? -0.778  9.868   -4.903  1.00 18.00  ? 63  THR A CG2  1 
ATOM   877  H H    . THR A 1 64  ? -0.500  9.258   -1.948  1.00 19.06  ? 63  THR A H    1 
ATOM   878  H HA   . THR A 1 64  ? 1.438   8.644   -3.748  1.00 19.60  ? 63  THR A HA   1 
ATOM   879  H HB   . THR A 1 64  ? 1.075   10.761  -4.670  1.00 25.16  ? 63  THR A HB   1 
ATOM   880  H HG1  . THR A 1 64  ? -0.446  12.042  -3.699  1.00 28.36  ? 63  THR A HG1  1 
ATOM   881  H HG21 . THR A 1 64  ? -1.144  10.580  -5.451  1.00 21.61  ? 63  THR A HG21 1 
ATOM   882  H HG22 . THR A 1 64  ? -0.478  9.149   -5.481  1.00 21.61  ? 63  THR A HG22 1 
ATOM   883  H HG23 . THR A 1 64  ? -1.473  9.533   -4.316  1.00 21.61  ? 63  THR A HG23 1 
ATOM   884  N N    . GLU A 1 65  ? 3.254   10.186  -2.753  1.00 28.43  ? 64  GLU A N    1 
ATOM   885  C CA   . GLU A 1 65  ? 4.304   10.749  -1.895  1.00 23.63  ? 64  GLU A CA   1 
ATOM   886  C C    . GLU A 1 65  ? 4.631   9.767   -0.764  1.00 29.17  ? 64  GLU A C    1 
ATOM   887  O O    . GLU A 1 65  ? 4.422   10.000  0.424   1.00 37.96  ? 64  GLU A O    1 
ATOM   888  C CB   . GLU A 1 65  ? 3.872   12.109  -1.350  1.00 36.86  ? 64  GLU A CB   1 
ATOM   889  C CG   . GLU A 1 65  ? 3.641   13.127  -2.445  1.00 41.59  ? 64  GLU A CG   1 
ATOM   890  C CD   . GLU A 1 65  ? 3.103   14.426  -1.909  1.00 58.09  ? 64  GLU A CD   1 
ATOM   891  O OE1  . GLU A 1 65  ? 2.837   14.497  -0.688  1.00 60.56  ? 64  GLU A OE1  1 
ATOM   892  O OE2  . GLU A 1 65  ? 2.915   15.361  -2.715  1.00 67.86  ? 64  GLU A OE2  1 
ATOM   893  H H    . GLU A 1 65  ? 3.475   10.082  -3.578  1.00 34.13  ? 64  GLU A H    1 
ATOM   894  H HA   . GLU A 1 65  ? 5.108   10.879  -2.422  1.00 28.37  ? 64  GLU A HA   1 
ATOM   895  H HB2  . GLU A 1 65  ? 3.042   12.003  -0.858  1.00 44.25  ? 64  GLU A HB2  1 
ATOM   896  H HB3  . GLU A 1 65  ? 4.565   12.450  -0.763  1.00 44.25  ? 64  GLU A HB3  1 
ATOM   897  H HG2  . GLU A 1 65  ? 4.483   13.309  -2.891  1.00 49.92  ? 64  GLU A HG2  1 
ATOM   898  H HG3  . GLU A 1 65  ? 2.997   12.772  -3.078  1.00 49.92  ? 64  GLU A HG3  1 
ATOM   899  N N    . VAL A 1 66  ? 5.084   8.618   -1.209  1.00 18.62  ? 65  VAL A N    1 
ATOM   900  C CA   . VAL A 1 66  ? 5.501   7.510   -0.389  1.00 21.37  ? 65  VAL A CA   1 
ATOM   901  C C    . VAL A 1 66  ? 6.979   7.606   -0.003  1.00 14.38  ? 65  VAL A C    1 
ATOM   902  O O    . VAL A 1 66  ? 7.396   7.136   1.068   1.00 14.70  ? 65  VAL A O    1 
ATOM   903  C CB   . VAL A 1 66  ? 5.215   6.288   -1.286  1.00 16.06  ? 65  VAL A CB   1 
ATOM   904  C CG1  . VAL A 1 66  ? 5.649   5.067   -0.656  1.00 14.64  ? 65  VAL A CG1  1 
ATOM   905  C CG2  . VAL A 1 66  ? 3.738   6.225   -1.654  1.00 21.13  ? 65  VAL A CG2  1 
ATOM   906  H H    . VAL A 1 66  ? 5.164   8.448   -2.048  1.00 22.35  ? 65  VAL A H    1 
ATOM   907  H HA   . VAL A 1 66  ? 4.958   7.457   0.413   1.00 25.65  ? 65  VAL A HA   1 
ATOM   908  H HB   . VAL A 1 66  ? 5.717   6.386   -2.110  1.00 19.28  ? 65  VAL A HB   1 
ATOM   909  H HG11 . VAL A 1 66  ? 5.454   4.322   -1.245  1.00 17.57  ? 65  VAL A HG11 1 
ATOM   910  H HG12 . VAL A 1 66  ? 6.604   5.120   -0.492  1.00 17.57  ? 65  VAL A HG12 1 
ATOM   911  H HG13 . VAL A 1 66  ? 5.174   4.959   0.183   1.00 17.57  ? 65  VAL A HG13 1 
ATOM   912  H HG21 . VAL A 1 66  ? 3.586   5.449   -2.217  1.00 25.37  ? 65  VAL A HG21 1 
ATOM   913  H HG22 . VAL A 1 66  ? 3.213   6.153   -0.842  1.00 25.37  ? 65  VAL A HG22 1 
ATOM   914  H HG23 . VAL A 1 66  ? 3.498   7.033   -2.133  1.00 25.37  ? 65  VAL A HG23 1 
ATOM   915  N N    . GLY A 1 67  ? 7.793   8.148   -0.891  1.00 16.55  ? 66  GLY A N    1 
ATOM   916  C CA   . GLY A 1 67  ? 9.233   8.188   -0.680  1.00 13.62  ? 66  GLY A CA   1 
ATOM   917  C C    . GLY A 1 67  ? 9.814   6.814   -0.473  1.00 16.16  ? 66  GLY A C    1 
ATOM   918  O O    . GLY A 1 67  ? 9.499   5.856   -1.192  1.00 17.49  ? 66  GLY A O    1 
ATOM   919  H H    . GLY A 1 67  ? 7.537   8.502   -1.631  1.00 19.88  ? 66  GLY A H    1 
ATOM   920  H HA2  . GLY A 1 67  ? 9.662   8.592   -1.451  1.00 16.35  ? 66  GLY A HA2  1 
ATOM   921  H HA3  . GLY A 1 67  ? 9.431   8.728   0.101   1.00 16.35  ? 66  GLY A HA3  1 
ATOM   922  N N    . ASP A 1 68  ? 10.662  6.706   0.527   1.00 15.46  ? 67  ASP A N    1 
ATOM   923  C CA   . ASP A 1 68  ? 11.386  5.483   0.800   1.00 15.65  ? 67  ASP A CA   1 
ATOM   924  C C    . ASP A 1 68  ? 10.668  4.620   1.812   1.00 14.30  ? 67  ASP A C    1 
ATOM   925  O O    . ASP A 1 68  ? 11.252  3.653   2.302   1.00 18.52  ? 67  ASP A O    1 
ATOM   926  C CB   . ASP A 1 68  ? 12.804  5.816   1.283   1.00 16.43  ? 67  ASP A CB   1 
ATOM   927  C CG   . ASP A 1 68  ? 13.632  6.443   0.204   1.00 23.11  ? 67  ASP A CG   1 
ATOM   928  O OD1  . ASP A 1 68  ? 13.428  6.146   -0.993  1.00 22.71  ? 67  ASP A OD1  1 
ATOM   929  O OD2  . ASP A 1 68  ? 14.491  7.281   0.528   1.00 25.02  ? 67  ASP A OD2  1 
ATOM   930  H H    . ASP A 1 68  ? 10.840  7.343   1.077   1.00 18.57  ? 67  ASP A H    1 
ATOM   931  H HA   . ASP A 1 68  ? 11.464  4.975   -0.022  1.00 18.79  ? 67  ASP A HA   1 
ATOM   932  H HB2  . ASP A 1 68  ? 12.750  6.441   2.023   1.00 19.73  ? 67  ASP A HB2  1 
ATOM   933  H HB3  . ASP A 1 68  ? 13.245  5.000   1.566   1.00 19.73  ? 67  ASP A HB3  1 
ATOM   934  N N    . ASN A 1 69  ? 9.402   4.918   2.110   1.00 12.34  ? 68  ASN A N    1 
ATOM   935  C CA   . ASN A 1 69  ? 8.627   4.153   3.089   1.00 14.50  ? 68  ASN A CA   1 
ATOM   936  C C    . ASN A 1 69  ? 8.141   2.861   2.457   1.00 13.09  ? 68  ASN A C    1 
ATOM   937  O O    . ASN A 1 69  ? 7.072   2.798   1.840   1.00 11.67  ? 68  ASN A O    1 
ATOM   938  C CB   . ASN A 1 69  ? 7.482   4.992   3.628   1.00 13.22  ? 68  ASN A CB   1 
ATOM   939  C CG   . ASN A 1 69  ? 6.709   4.301   4.700   1.00 17.37  ? 68  ASN A CG   1 
ATOM   940  O OD1  . ASN A 1 69  ? 6.825   3.091   4.890   1.00 18.59  ? 68  ASN A OD1  1 
ATOM   941  N ND2  . ASN A 1 69  ? 5.969   5.084   5.469   1.00 23.27  ? 68  ASN A ND2  1 
ATOM   942  H H    . ASN A 1 69  ? 8.965   5.568   1.754   1.00 14.81  ? 68  ASN A H    1 
ATOM   943  H HA   . ASN A 1 69  ? 9.203   3.922   3.834   1.00 17.41  ? 68  ASN A HA   1 
ATOM   944  H HB2  . ASN A 1 69  ? 7.840   5.813   4.000   1.00 15.88  ? 68  ASN A HB2  1 
ATOM   945  H HB3  . ASN A 1 69  ? 6.871   5.195   2.902   1.00 15.88  ? 68  ASN A HB3  1 
ATOM   946  H HD21 . ASN A 1 69  ? 5.505   4.744   6.109   1.00 27.93  ? 68  ASN A HD21 1 
ATOM   947  H HD22 . ASN A 1 69  ? 5.927   5.928   5.309   1.00 27.93  ? 68  ASN A HD22 1 
ATOM   948  N N    . TRP A 1 70  ? 8.949   1.822   2.612   1.00 13.11  ? 69  TRP A N    1 
ATOM   949  C CA   . TRP A 1 70  ? 8.649   0.542   1.973   1.00 11.37  ? 69  TRP A CA   1 
ATOM   950  C C    . TRP A 1 70  ? 7.404   -0.106  2.548   1.00 13.26  ? 69  TRP A C    1 
ATOM   951  O O    . TRP A 1 70  ? 6.761   -0.902  1.863   1.00 12.41  ? 69  TRP A O    1 
ATOM   952  C CB   . TRP A 1 70  ? 9.864   -0.399  2.075   1.00 13.75  ? 69  TRP A CB   1 
ATOM   953  C CG   . TRP A 1 70  ? 10.408  -0.579  3.447   1.00 13.08  ? 69  TRP A CG   1 
ATOM   954  C CD1  . TRP A 1 70  ? 11.422  0.122   4.008   1.00 19.21  ? 69  TRP A CD1  1 
ATOM   955  C CD2  . TRP A 1 70  ? 9.946   -1.490  4.436   1.00 11.90  ? 69  TRP A CD2  1 
ATOM   956  N NE1  . TRP A 1 70  ? 11.633  -0.309  5.294   1.00 17.26  ? 69  TRP A NE1  1 
ATOM   957  C CE2  . TRP A 1 70  ? 10.735  -1.295  5.589   1.00 18.63  ? 69  TRP A CE2  1 
ATOM   958  C CE3  . TRP A 1 70  ? 8.951   -2.466  4.467   1.00 14.17  ? 69  TRP A CE3  1 
ATOM   959  C CZ2  . TRP A 1 70  ? 10.545  -2.030  6.758   1.00 18.19  ? 69  TRP A CZ2  1 
ATOM   960  C CZ3  . TRP A 1 70  ? 8.762   -3.191  5.634   1.00 15.88  ? 69  TRP A CZ3  1 
ATOM   961  C CH2  . TRP A 1 70  ? 9.567   -2.981  6.755   1.00 16.72  ? 69  TRP A CH2  1 
ATOM   962  H H    . TRP A 1 70  ? 9.672   1.827   3.077   1.00 15.74  ? 69  TRP A H    1 
ATOM   963  H HA   . TRP A 1 70  ? 8.483   0.701   1.031   1.00 13.65  ? 69  TRP A HA   1 
ATOM   964  H HB2  . TRP A 1 70  ? 9.605   -1.274  1.746   1.00 16.51  ? 69  TRP A HB2  1 
ATOM   965  H HB3  . TRP A 1 70  ? 10.577  -0.043  1.522   1.00 16.51  ? 69  TRP A HB3  1 
ATOM   966  H HD1  . TRP A 1 70  ? 11.906  0.794   3.584   1.00 23.07  ? 69  TRP A HD1  1 
ATOM   967  H HE1  . TRP A 1 70  ? 12.226  0.003   5.833   1.00 20.72  ? 69  TRP A HE1  1 
ATOM   968  H HE3  . TRP A 1 70  ? 8.407   -2.612  3.726   1.00 17.01  ? 69  TRP A HE3  1 
ATOM   969  H HZ2  . TRP A 1 70  ? 11.083  -1.895  7.505   1.00 21.84  ? 69  TRP A HZ2  1 
ATOM   970  H HZ3  . TRP A 1 70  ? 8.100   -3.843  5.663   1.00 19.06  ? 69  TRP A HZ3  1 
ATOM   971  H HH2  . TRP A 1 70  ? 9.421   -3.487  7.522   1.00 20.08  ? 69  TRP A HH2  1 
ATOM   972  N N    . ARG A 1 71  ? 7.050   0.183   3.803   1.00 12.31  ? 70  ARG A N    1 
ATOM   973  C CA   A ARG A 1 71  ? 5.801   -0.343  4.342   0.46 12.66  ? 70  ARG A CA   1 
ATOM   974  C CA   B ARG A 1 71  ? 5.805   -0.342  4.348   0.54 12.62  ? 70  ARG A CA   1 
ATOM   975  C C    . ARG A 1 71  ? 4.602   0.207   3.582   1.00 11.90  ? 70  ARG A C    1 
ATOM   976  O O    . ARG A 1 71  ? 3.664   -0.531  3.240   1.00 12.04  ? 70  ARG A O    1 
ATOM   977  C CB   A ARG A 1 71  ? 5.687   -0.012  5.832   0.46 15.77  ? 70  ARG A CB   1 
ATOM   978  C CB   B ARG A 1 71  ? 5.725   -0.011  5.849   0.54 15.75  ? 70  ARG A CB   1 
ATOM   979  C CG   A ARG A 1 71  ? 4.578   -0.759  6.538   0.46 34.20  ? 70  ARG A CG   1 
ATOM   980  C CG   B ARG A 1 71  ? 7.047   -0.236  6.625   0.54 29.57  ? 70  ARG A CG   1 
ATOM   981  C CD   A ARG A 1 71  ? 4.979   -2.196  6.866   0.46 41.08  ? 70  ARG A CD   1 
ATOM   982  C CD   B ARG A 1 71  ? 7.148   0.622   7.886   0.54 38.86  ? 70  ARG A CD   1 
ATOM   983  N NE   A ARG A 1 71  ? 4.105   -3.178  6.231   0.46 34.29  ? 70  ARG A NE   1 
ATOM   984  N NE   B ARG A 1 71  ? 8.521   0.739   8.381   0.54 28.12  ? 70  ARG A NE   1 
ATOM   985  C CZ   A ARG A 1 71  ? 4.350   -4.483  6.158   0.46 32.43  ? 70  ARG A CZ   1 
ATOM   986  C CZ   B ARG A 1 71  ? 9.498   1.401   7.761   0.54 30.90  ? 70  ARG A CZ   1 
ATOM   987  N NH1  A ARG A 1 71  ? 5.458   -4.985  6.677   0.46 32.01  ? 70  ARG A NH1  1 
ATOM   988  N NH1  B ARG A 1 71  ? 9.273   2.022   6.609   0.54 26.23  ? 70  ARG A NH1  1 
ATOM   989  N NH2  A ARG A 1 71  ? 3.485   -5.286  5.550   0.46 38.36  ? 70  ARG A NH2  1 
ATOM   990  N NH2  B ARG A 1 71  ? 10.712  1.446   8.298   0.54 31.69  ? 70  ARG A NH2  1 
ATOM   991  H H    . ARG A 1 71  ? 7.501   0.670   4.350   1.00 14.78  ? 70  ARG A H    1 
ATOM   992  H HA   . ARG A 1 71  ? 5.801   -1.308  4.252   1.00 15.16  ? 70  ARG A HA   1 
ATOM   993  H HB2  A ARG A 1 71  ? 6.523   -0.241  6.267   0.46 18.93  ? 70  ARG A HB2  1 
ATOM   994  H HB2  B ARG A 1 71  ? 5.480   0.923   5.948   0.54 18.92  ? 70  ARG A HB2  1 
ATOM   995  H HB3  A ARG A 1 71  ? 5.515   0.937   5.929   0.46 18.93  ? 70  ARG A HB3  1 
ATOM   996  H HB3  B ARG A 1 71  ? 5.045   -0.572  6.255   0.54 18.92  ? 70  ARG A HB3  1 
ATOM   997  H HG2  A ARG A 1 71  ? 4.367   -0.306  7.369   0.46 41.05  ? 70  ARG A HG2  1 
ATOM   998  H HG2  B ARG A 1 71  ? 7.102   -1.168  6.891   0.54 35.49  ? 70  ARG A HG2  1 
ATOM   999  H HG3  A ARG A 1 71  ? 3.796   -0.787  5.964   0.46 41.05  ? 70  ARG A HG3  1 
ATOM   1000 H HG3  B ARG A 1 71  ? 7.794   -0.012  6.048   0.54 35.49  ? 70  ARG A HG3  1 
ATOM   1001 H HD2  A ARG A 1 71  ? 5.884   -2.352  6.553   0.46 49.30  ? 70  ARG A HD2  1 
ATOM   1002 H HD2  B ARG A 1 71  ? 6.824   1.514   7.687   0.54 46.65  ? 70  ARG A HD2  1 
ATOM   1003 H HD3  A ARG A 1 71  ? 4.932   -2.327  7.826   0.46 49.30  ? 70  ARG A HD3  1 
ATOM   1004 H HD3  B ARG A 1 71  ? 6.610   0.221   8.586   0.54 46.65  ? 70  ARG A HD3  1 
ATOM   1005 H HE   A ARG A 1 71  ? 3.376   -2.891  5.878   0.46 41.16  ? 70  ARG A HE   1 
ATOM   1006 H HE   B ARG A 1 71  ? 8.711   0.353   9.125   0.54 33.75  ? 70  ARG A HE   1 
ATOM   1007 H HH11 A ARG A 1 71  ? 6.022   -4.468  7.069   0.46 38.43  ? 70  ARG A HH11 1 
ATOM   1008 H HH11 B ARG A 1 71  ? 8.490   1.999   6.253   0.54 31.48  ? 70  ARG A HH11 1 
ATOM   1009 H HH12 A ARG A 1 71  ? 5.612   -5.830  6.625   0.46 38.43  ? 70  ARG A HH12 1 
ATOM   1010 H HH12 B ARG A 1 71  ? 9.911   2.446   6.218   0.54 31.48  ? 70  ARG A HH12 1 
ATOM   1011 H HH21 A ARG A 1 71  ? 2.764   -4.962  5.211   0.46 46.05  ? 70  ARG A HH21 1 
ATOM   1012 H HH21 B ARG A 1 71  ? 10.867  1.047   9.045   0.54 38.04  ? 70  ARG A HH21 1 
ATOM   1013 H HH22 A ARG A 1 71  ? 3.642   -6.130  5.502   0.46 46.05  ? 70  ARG A HH22 1 
ATOM   1014 H HH22 B ARG A 1 71  ? 11.343  1.873   7.900   0.54 38.04  ? 70  ARG A HH22 1 
ATOM   1015 N N    . LEU A 1 72  ? 4.587   1.469   3.258   1.00 10.48  ? 71  LEU A N    1 
ATOM   1016 C CA   . LEU A 1 72  ? 3.535   2.068   2.473   1.00 11.24  ? 71  LEU A CA   1 
ATOM   1017 C C    . LEU A 1 72  ? 3.583   1.621   1.027   1.00 10.37  ? 71  LEU A C    1 
ATOM   1018 O O    . LEU A 1 72  ? 2.580   1.463   0.458   1.00 10.51  ? 71  LEU A O    1 
ATOM   1019 C CB   . LEU A 1 72  ? 3.569   3.589   2.623   1.00 14.79  ? 71  LEU A CB   1 
ATOM   1020 C CG   . LEU A 1 72  ? 2.488   4.427   1.968   1.00 39.89  ? 71  LEU A CG   1 
ATOM   1021 C CD1  . LEU A 1 72  ? 1.160   3.925   2.446   1.00 30.44  ? 71  LEU A CD1  1 
ATOM   1022 C CD2  . LEU A 1 72  ? 2.695   5.863   2.368   1.00 18.93  ? 71  LEU A CD2  1 
ATOM   1023 H H    . LEU A 1 72  ? 5.186   1.992   3.477   1.00 12.58  ? 71  LEU A H    1 
ATOM   1024 H HA   . LEU A 1 72  ? 2.695   1.775   2.837   1.00 13.50  ? 71  LEU A HA   1 
ATOM   1025 H HB2  . LEU A 1 72  ? 3.504   3.784   3.552   1.00 17.76  ? 71  LEU A HB2  1 
ATOM   1026 H HB3  . LEU A 1 72  ? 4.410   3.904   2.311   1.00 17.76  ? 71  LEU A HB3  1 
ATOM   1027 H HG   . LEU A 1 72  ? 2.538   4.342   1.016   1.00 47.88  ? 71  LEU A HG   1 
ATOM   1028 H HD11 . LEU A 1 72  ? 0.482   4.187   1.840   1.00 36.53  ? 71  LEU A HD11 1 
ATOM   1029 H HD12 . LEU A 1 72  ? 1.196   2.979   2.500   1.00 36.53  ? 71  LEU A HD12 1 
ATOM   1030 H HD13 . LEU A 1 72  ? 0.985   4.282   3.308   1.00 36.53  ? 71  LEU A HD13 1 
ATOM   1031 H HD21 . LEU A 1 72  ? 1.908   6.357   2.178   1.00 22.73  ? 71  LEU A HD21 1 
ATOM   1032 H HD22 . LEU A 1 72  ? 2.866   5.884   3.302   1.00 22.73  ? 71  LEU A HD22 1 
ATOM   1033 H HD23 . LEU A 1 72  ? 3.431   6.216   1.892   1.00 22.73  ? 71  LEU A HD23 1 
ATOM   1034 N N    . LYS A 1 73  ? 4.768   1.464   0.483   1.00 9.76   ? 72  LYS A N    1 
ATOM   1035 C CA   . LYS A 1 73  ? 4.858   0.839   -0.832  1.00 9.08   ? 72  LYS A CA   1 
ATOM   1036 C C    . LYS A 1 73  ? 4.086   -0.468  -0.840  1.00 9.53   ? 72  LYS A C    1 
ATOM   1037 O O    . LYS A 1 73  ? 3.281   -0.723  -1.742  1.00 9.77   ? 72  LYS A O    1 
ATOM   1038 C CB   . LYS A 1 73  ? 6.307   0.588   -1.255  1.00 7.87   ? 72  LYS A CB   1 
ATOM   1039 C CG   . LYS A 1 73  ? 7.135   1.817   -1.507  1.00 9.57   ? 72  LYS A CG   1 
ATOM   1040 C CD   . LYS A 1 73  ? 8.511   1.454   -2.009  1.00 11.39  ? 72  LYS A CD   1 
ATOM   1041 C CE   . LYS A 1 73  ? 9.366   2.673   -2.243  1.00 13.12  ? 72  LYS A CE   1 
ATOM   1042 N NZ   . LYS A 1 73  ? 10.689  2.362   -2.806  1.00 15.97  ? 72  LYS A NZ   1 
ATOM   1043 H H    . LYS A 1 73  ? 5.525   1.666   0.838   1.00 11.73  ? 72  LYS A H    1 
ATOM   1044 H HA   . LYS A 1 73  ? 4.454   1.428   -1.488  1.00 10.90  ? 72  LYS A HA   1 
ATOM   1045 H HB2  . LYS A 1 73  ? 6.747   0.080   -0.555  1.00 9.45   ? 72  LYS A HB2  1 
ATOM   1046 H HB3  . LYS A 1 73  ? 6.302   0.069   -2.075  1.00 9.45   ? 72  LYS A HB3  1 
ATOM   1047 H HG2  . LYS A 1 73  ? 6.700   2.365   -2.178  1.00 11.49  ? 72  LYS A HG2  1 
ATOM   1048 H HG3  . LYS A 1 73  ? 7.234   2.312   -0.679  1.00 11.49  ? 72  LYS A HG3  1 
ATOM   1049 H HD2  . LYS A 1 73  ? 8.954   0.896   -1.351  1.00 13.67  ? 72  LYS A HD2  1 
ATOM   1050 H HD3  . LYS A 1 73  ? 8.428   0.977   -2.850  1.00 13.67  ? 72  LYS A HD3  1 
ATOM   1051 H HE2  . LYS A 1 73  ? 8.910   3.262   -2.864  1.00 15.76  ? 72  LYS A HE2  1 
ATOM   1052 H HE3  . LYS A 1 73  ? 9.502   3.128   -1.397  1.00 15.76  ? 72  LYS A HE3  1 
ATOM   1053 H HZ1  . LYS A 1 73  ? 11.138  1.829   -2.252  1.00 19.18  ? 72  LYS A HZ1  1 
ATOM   1054 H HZ2  . LYS A 1 73  ? 10.597  1.952   -3.590  1.00 19.18  ? 72  LYS A HZ2  1 
ATOM   1055 H HZ3  . LYS A 1 73  ? 11.153  3.112   -2.925  1.00 19.18  ? 72  LYS A HZ3  1 
ATOM   1056 N N    . ILE A 1 74  ? 4.341   -1.321  0.145   1.00 9.78   ? 73  ILE A N    1 
ATOM   1057 C CA   . ILE A 1 74  ? 3.700   -2.634  0.174   1.00 9.96   ? 73  ILE A CA   1 
ATOM   1058 C C    . ILE A 1 74  ? 2.195   -2.500  0.349   1.00 11.05  ? 73  ILE A C    1 
ATOM   1059 O O    . ILE A 1 74  ? 1.425   -3.199  -0.305  1.00 9.87   ? 73  ILE A O    1 
ATOM   1060 C CB   . ILE A 1 74  ? 4.321   -3.521  1.264   1.00 9.40   ? 73  ILE A CB   1 
ATOM   1061 C CG1  . ILE A 1 74  ? 5.780   -3.838  0.920   1.00 11.82  ? 73  ILE A CG1  1 
ATOM   1062 C CG2  . ILE A 1 74  ? 3.497   -4.816  1.431   1.00 12.33  ? 73  ILE A CG2  1 
ATOM   1063 C CD1  . ILE A 1 74  ? 6.575   -4.505  2.057   1.00 13.48  ? 73  ILE A CD1  1 
ATOM   1064 H H    . ILE A 1 74  ? 4.875   -1.169  0.802   1.00 11.75  ? 73  ILE A H    1 
ATOM   1065 H HA   . ILE A 1 74  ? 3.856   -3.069  -0.679  1.00 11.96  ? 73  ILE A HA   1 
ATOM   1066 H HB   . ILE A 1 74  ? 4.302   -3.035  2.103   1.00 11.29  ? 73  ILE A HB   1 
ATOM   1067 H HG12 . ILE A 1 74  ? 5.795   -4.438  0.158   1.00 14.20  ? 73  ILE A HG12 1 
ATOM   1068 H HG13 . ILE A 1 74  ? 6.231   -3.010  0.692   1.00 14.20  ? 73  ILE A HG13 1 
ATOM   1069 H HG21 . ILE A 1 74  ? 3.904   -5.362  2.122   1.00 14.80  ? 73  ILE A HG21 1 
ATOM   1070 H HG22 . ILE A 1 74  ? 2.590   -4.583  1.684   1.00 14.80  ? 73  ILE A HG22 1 
ATOM   1071 H HG23 . ILE A 1 74  ? 3.492   -5.297  0.589   1.00 14.80  ? 73  ILE A HG23 1 
ATOM   1072 H HD11 . ILE A 1 74  ? 7.482   -4.669  1.754   1.00 16.19  ? 73  ILE A HD11 1 
ATOM   1073 H HD12 . ILE A 1 74  ? 6.584   -3.913  2.826   1.00 16.19  ? 73  ILE A HD12 1 
ATOM   1074 H HD13 . ILE A 1 74  ? 6.148   -5.344  2.291   1.00 16.19  ? 73  ILE A HD13 1 
ATOM   1075 N N    . SER A 1 75  ? 1.746   -1.598  1.226   1.00 9.76   ? 74  SER A N    1 
ATOM   1076 C CA   . SER A 1 75  ? 0.313   -1.373  1.378   1.00 10.81  ? 74  SER A CA   1 
ATOM   1077 C C    . SER A 1 75  ? -0.335  -0.988  0.042   1.00 11.38  ? 74  SER A C    1 
ATOM   1078 O O    . SER A 1 75  ? -1.367  -1.543  -0.360  1.00 10.38  ? 74  SER A O    1 
ATOM   1079 C CB   . SER A 1 75  ? 0.078   -0.292  2.437   1.00 13.27  ? 74  SER A CB   1 
ATOM   1080 O OG   . SER A 1 75  ? -1.319  -0.011  2.571   1.00 18.65  ? 74  SER A OG   1 
ATOM   1081 H H    . SER A 1 75  ? 2.242   -1.114  1.735   1.00 11.72  ? 74  SER A H    1 
ATOM   1082 H HA   . SER A 1 75  ? -0.104  -2.192  1.688   1.00 12.98  ? 74  SER A HA   1 
ATOM   1083 H HB2  . SER A 1 75  ? 0.421   -0.604  3.289   1.00 15.94  ? 74  SER A HB2  1 
ATOM   1084 H HB3  . SER A 1 75  ? 0.539   0.518   2.169   1.00 15.94  ? 74  SER A HB3  1 
ATOM   1085 H HG   . SER A 1 75  ? -1.630  0.260   1.839   1.00 22.39  ? 74  SER A HG   1 
ATOM   1086 N N    . ASN A 1 76  ? 0.269   -0.037  -0.669  1.00 9.22   ? 75  ASN A N    1 
ATOM   1087 C CA   . ASN A 1 76  ? -0.230  0.330   -1.995  1.00 10.20  ? 75  ASN A CA   1 
ATOM   1088 C C    . ASN A 1 76  ? -0.242  -0.861  -2.937  1.00 9.12   ? 75  ASN A C    1 
ATOM   1089 O O    . ASN A 1 76  ? -1.232  -1.092  -3.635  1.00 9.68   ? 75  ASN A O    1 
ATOM   1090 C CB   . ASN A 1 76  ? 0.601   1.436   -2.629  1.00 8.31   ? 75  ASN A CB   1 
ATOM   1091 C CG   . ASN A 1 76  ? 0.332   2.805   -2.079  1.00 11.40  ? 75  ASN A CG   1 
ATOM   1092 O OD1  . ASN A 1 76  ? -0.684  3.069   -1.436  1.00 12.24  ? 75  ASN A OD1  1 
ATOM   1093 N ND2  . ASN A 1 76  ? 1.135   3.738   -2.565  1.00 11.46  ? 75  ASN A ND2  1 
ATOM   1094 H H    . ASN A 1 76  ? 0.959   0.406   -0.411  1.00 11.07  ? 75  ASN A H    1 
ATOM   1095 H HA   . ASN A 1 76  ? -1.141  0.653   -1.909  1.00 12.24  ? 75  ASN A HA   1 
ATOM   1096 H HB2  . ASN A 1 76  ? 1.540   1.240   -2.486  1.00 9.98   ? 75  ASN A HB2  1 
ATOM   1097 H HB3  . ASN A 1 76  ? 0.413   1.459   -3.581  1.00 9.98   ? 75  ASN A HB3  1 
ATOM   1098 H HD21 . ASN A 1 76  ? 1.040   4.556   -2.318  1.00 13.76  ? 75  ASN A HD21 1 
ATOM   1099 H HD22 . ASN A 1 76  ? 1.809   3.512   -3.050  1.00 13.76  ? 75  ASN A HD22 1 
ATOM   1100 N N    . LEU A 1 77  ? 0.859   -1.607  -2.994  1.00 8.97   ? 76  LEU A N    1 
ATOM   1101 C CA   . LEU A 1 77  ? 0.954   -2.712  -3.941  1.00 8.91   ? 76  LEU A CA   1 
ATOM   1102 C C    . LEU A 1 77  ? -0.077  -3.793  -3.647  1.00 10.50  ? 76  LEU A C    1 
ATOM   1103 O O    . LEU A 1 77  ? -0.604  -4.416  -4.571  1.00 9.30   ? 76  LEU A O    1 
ATOM   1104 C CB   . LEU A 1 77  ? 2.370   -3.292  -3.915  1.00 8.30   ? 76  LEU A CB   1 
ATOM   1105 C CG   . LEU A 1 77  ? 3.476   -2.385  -4.454  1.00 9.51   ? 76  LEU A CG   1 
ATOM   1106 C CD1  . LEU A 1 77  ? 4.858   -2.923  -4.093  1.00 11.46  ? 76  LEU A CD1  1 
ATOM   1107 C CD2  . LEU A 1 77  ? 3.400   -2.265  -5.986  1.00 11.35  ? 76  LEU A CD2  1 
ATOM   1108 H H    . LEU A 1 77  ? 1.556   -1.495  -2.502  1.00 10.77  ? 76  LEU A H    1 
ATOM   1109 H HA   . LEU A 1 77  ? 0.786   -2.376  -4.835  1.00 10.70  ? 76  LEU A HA   1 
ATOM   1110 H HB2  . LEU A 1 77  ? 2.594   -3.506  -2.996  1.00 9.97   ? 76  LEU A HB2  1 
ATOM   1111 H HB3  . LEU A 1 77  ? 2.377   -4.104  -4.445  1.00 9.97   ? 76  LEU A HB3  1 
ATOM   1112 H HG   . LEU A 1 77  ? 3.383   -1.498  -4.072  1.00 11.42  ? 76  LEU A HG   1 
ATOM   1113 H HD11 . LEU A 1 77  ? 5.533   -2.325  -4.451  1.00 13.76  ? 76  LEU A HD11 1 
ATOM   1114 H HD12 . LEU A 1 77  ? 4.936   -2.971  -3.128  1.00 13.76  ? 76  LEU A HD12 1 
ATOM   1115 H HD13 . LEU A 1 77  ? 4.962   -3.807  -4.478  1.00 13.76  ? 76  LEU A HD13 1 
ATOM   1116 H HD21 . LEU A 1 77  ? 4.114   -1.684  -6.293  1.00 13.63  ? 76  LEU A HD21 1 
ATOM   1117 H HD22 . LEU A 1 77  ? 3.499   -3.147  -6.376  1.00 13.63  ? 76  LEU A HD22 1 
ATOM   1118 H HD23 . LEU A 1 77  ? 2.539   -1.889  -6.230  1.00 13.63  ? 76  LEU A HD23 1 
ATOM   1119 N N    . LYS A 1 78  ? -0.371  -4.038  -2.382  1.00 10.32  ? 77  LYS A N    1 
ATOM   1120 C CA   . LYS A 1 78  ? -1.408  -5.010  -2.038  1.00 10.25  ? 77  LYS A CA   1 
ATOM   1121 C C    . LYS A 1 78  ? -2.774  -4.553  -2.525  1.00 11.48  ? 77  LYS A C    1 
ATOM   1122 O O    . LYS A 1 78  ? -3.599  -5.371  -2.959  1.00 10.56  ? 77  LYS A O    1 
ATOM   1123 C CB   . LYS A 1 78  ? -1.409  -5.254  -0.524  1.00 10.28  ? 77  LYS A CB   1 
ATOM   1124 C CG   . LYS A 1 78  ? -0.263  -6.121  -0.058  1.00 11.20  ? 77  LYS A CG   1 
ATOM   1125 C CD   . LYS A 1 78  ? -0.223  -6.306  1.432   1.00 14.74  ? 77  LYS A CD   1 
ATOM   1126 C CE   . LYS A 1 78  ? 0.876   -7.261  1.769   1.00 15.90  ? 77  LYS A CE   1 
ATOM   1127 N NZ   . LYS A 1 78  ? 0.961   -7.352  3.251   1.00 25.38  ? 77  LYS A NZ   1 
ATOM   1128 H H    . LYS A 1 78  ? 0.008   -3.663  -1.707  1.00 12.39  ? 77  LYS A H    1 
ATOM   1129 H HA   . LYS A 1 78  ? -1.204  -5.852  -2.475  1.00 12.31  ? 77  LYS A HA   1 
ATOM   1130 H HB2  . LYS A 1 78  ? -1.342  -4.401  -0.068  1.00 12.34  ? 77  LYS A HB2  1 
ATOM   1131 H HB3  . LYS A 1 78  ? -2.237  -5.696  -0.278  1.00 12.34  ? 77  LYS A HB3  1 
ATOM   1132 H HG2  . LYS A 1 78  ? -0.346  -6.998  -0.465  1.00 13.45  ? 77  LYS A HG2  1 
ATOM   1133 H HG3  . LYS A 1 78  ? 0.573   -5.710  -0.329  1.00 13.45  ? 77  LYS A HG3  1 
ATOM   1134 H HD2  . LYS A 1 78  ? -0.042  -5.457  1.865   1.00 17.70  ? 77  LYS A HD2  1 
ATOM   1135 H HD3  . LYS A 1 78  ? -1.065  -6.677  1.740   1.00 17.70  ? 77  LYS A HD3  1 
ATOM   1136 H HE2  . LYS A 1 78  ? 0.674   -8.139  1.409   1.00 19.10  ? 77  LYS A HE2  1 
ATOM   1137 H HE3  . LYS A 1 78  ? 1.720   -6.930  1.424   1.00 19.10  ? 77  LYS A HE3  1 
ATOM   1138 H HZ1  . LYS A 1 78  ? 1.609   -7.916  3.483   1.00 30.46  ? 77  LYS A HZ1  1 
ATOM   1139 H HZ2  . LYS A 1 78  ? 1.137   -6.551  3.595   1.00 30.46  ? 77  LYS A HZ2  1 
ATOM   1140 H HZ3  . LYS A 1 78  ? 0.189   -7.647  3.582   1.00 30.46  ? 77  LYS A HZ3  1 
ATOM   1141 N N    . LYS A 1 79  ? -3.044  -3.254  -2.455  1.00 9.15   ? 78  LYS A N    1 
ATOM   1142 C CA   . LYS A 1 79  ? -4.313  -2.754  -2.982  1.00 10.32  ? 78  LYS A CA   1 
ATOM   1143 C C    . LYS A 1 79  ? -4.369  -2.892  -4.491  1.00 11.27  ? 78  LYS A C    1 
ATOM   1144 O O    . LYS A 1 79  ? -5.421  -3.224  -5.061  1.00 12.18  ? 78  LYS A O    1 
ATOM   1145 C CB   . LYS A 1 79  ? -4.492  -1.293  -2.583  1.00 13.55  ? 78  LYS A CB   1 
ATOM   1146 C CG   . LYS A 1 79  ? -4.652  -1.094  -1.107  1.00 15.73  ? 78  LYS A CG   1 
ATOM   1147 C CD   . LYS A 1 79  ? -4.721  0.367   -0.744  1.00 17.45  ? 78  LYS A CD   1 
ATOM   1148 C CE   . LYS A 1 79  ? -4.750  0.536   0.778   1.00 23.88  ? 78  LYS A CE   1 
ATOM   1149 N NZ   . LYS A 1 79  ? -4.728  1.972   1.138   1.00 26.57  ? 78  LYS A NZ   1 
ATOM   1150 H H    . LYS A 1 79  ? -2.528  -2.655  -2.117  1.00 10.99  ? 78  LYS A H    1 
ATOM   1151 H HA   . LYS A 1 79  ? -5.043  -3.266  -2.602  1.00 12.39  ? 78  LYS A HA   1 
ATOM   1152 H HB2  . LYS A 1 79  ? -3.711  -0.792  -2.868  1.00 16.27  ? 78  LYS A HB2  1 
ATOM   1153 H HB3  . LYS A 1 79  ? -5.285  -0.944  -3.018  1.00 16.27  ? 78  LYS A HB3  1 
ATOM   1154 H HG2  . LYS A 1 79  ? -5.473  -1.518  -0.815  1.00 18.89  ? 78  LYS A HG2  1 
ATOM   1155 H HG3  . LYS A 1 79  ? -3.891  -1.484  -0.648  1.00 18.89  ? 78  LYS A HG3  1 
ATOM   1156 H HD2  . LYS A 1 79  ? -3.938  0.824   -1.090  1.00 20.95  ? 78  LYS A HD2  1 
ATOM   1157 H HD3  . LYS A 1 79  ? -5.531  0.754   -1.112  1.00 20.95  ? 78  LYS A HD3  1 
ATOM   1158 H HE2  . LYS A 1 79  ? -5.563  0.142   1.132   1.00 28.67  ? 78  LYS A HE2  1 
ATOM   1159 H HE3  . LYS A 1 79  ? -3.969  0.109   1.166   1.00 28.67  ? 78  LYS A HE3  1 
ATOM   1160 H HZ1  . LYS A 1 79  ? -5.437  2.383   0.791   1.00 31.89  ? 78  LYS A HZ1  1 
ATOM   1161 H HZ2  . LYS A 1 79  ? -4.745  2.064   2.024   1.00 31.89  ? 78  LYS A HZ2  1 
ATOM   1162 H HZ3  . LYS A 1 79  ? -3.989  2.354   0.822   1.00 31.89  ? 78  LYS A HZ3  1 
ATOM   1163 N N    . ILE A 1 80  ? -3.255  -2.637  -5.165  1.00 10.79  ? 79  ILE A N    1 
ATOM   1164 C CA   . ILE A 1 80  ? -3.211  -2.780  -6.614  1.00 9.92   ? 79  ILE A CA   1 
ATOM   1165 C C    . ILE A 1 80  ? -3.436  -4.229  -7.001  1.00 10.02  ? 79  ILE A C    1 
ATOM   1166 O O    . ILE A 1 80  ? -4.271  -4.530  -7.864  1.00 10.44  ? 79  ILE A O    1 
ATOM   1167 C CB   . ILE A 1 80  ? -1.896  -2.218  -7.168  1.00 11.64  ? 79  ILE A CB   1 
ATOM   1168 C CG1  . ILE A 1 80  ? -1.908  -0.708  -6.870  1.00 18.87  ? 79  ILE A CG1  1 
ATOM   1169 C CG2  . ILE A 1 80  ? -1.755  -2.536  -8.660  1.00 15.65  ? 79  ILE A CG2  1 
ATOM   1170 C CD1  . ILE A 1 80  ? -0.606  -0.070  -6.925  1.00 22.02  ? 79  ILE A CD1  1 
ATOM   1171 H H    . ILE A 1 80  ? -2.514  -2.381  -4.810  1.00 12.96  ? 79  ILE A H    1 
ATOM   1172 H HA   . ILE A 1 80  ? -3.934  -2.260  -6.997  1.00 11.91  ? 79  ILE A HA   1 
ATOM   1173 H HB   . ILE A 1 80  ? -1.157  -2.625  -6.691  1.00 13.98  ? 79  ILE A HB   1 
ATOM   1174 H HG12 . ILE A 1 80  ? -2.478  -0.269  -7.520  1.00 22.65  ? 79  ILE A HG12 1 
ATOM   1175 H HG13 . ILE A 1 80  ? -2.265  -0.571  -5.978  1.00 22.65  ? 79  ILE A HG13 1 
ATOM   1176 H HG21 . ILE A 1 80  ? -0.917  -2.170  -8.983  1.00 18.79  ? 79  ILE A HG21 1 
ATOM   1177 H HG22 . ILE A 1 80  ? -1.763  -3.499  -8.780  1.00 18.79  ? 79  ILE A HG22 1 
ATOM   1178 H HG23 . ILE A 1 80  ? -2.497  -2.136  -9.140  1.00 18.79  ? 79  ILE A HG23 1 
ATOM   1179 H HD11 . ILE A 1 80  ? -0.708  0.874   -6.725  1.00 26.44  ? 79  ILE A HD11 1 
ATOM   1180 H HD12 . ILE A 1 80  ? -0.023  -0.485  -6.270  1.00 26.44  ? 79  ILE A HD12 1 
ATOM   1181 H HD13 . ILE A 1 80  ? -0.237  -0.182  -7.815  1.00 26.44  ? 79  ILE A HD13 1 
ATOM   1182 N N    . LEU A 1 81  ? -2.694  -5.145  -6.380  1.00 11.66  ? 80  LEU A N    1 
ATOM   1183 C CA   . LEU A 1 81  ? -2.864  -6.559  -6.698  1.00 9.77   ? 80  LEU A CA   1 
ATOM   1184 C C    . LEU A 1 81  ? -4.281  -7.022  -6.398  1.00 9.18   ? 80  LEU A C    1 
ATOM   1185 O O    . LEU A 1 81  ? -4.860  -7.786  -7.178  1.00 9.46   ? 80  LEU A O    1 
ATOM   1186 C CB   . LEU A 1 81  ? -1.847  -7.396  -5.927  1.00 9.25   ? 80  LEU A CB   1 
ATOM   1187 C CG   . LEU A 1 81  ? -1.881  -8.905  -6.150  1.00 9.59   ? 80  LEU A CG   1 
ATOM   1188 C CD1  . LEU A 1 81  ? -1.642  -9.250  -7.597  1.00 13.48  ? 80  LEU A CD1  1 
ATOM   1189 C CD2  . LEU A 1 81  ? -0.816  -9.539  -5.268  1.00 12.23  ? 80  LEU A CD2  1 
ATOM   1190 H H    . LEU A 1 81  ? -2.098  -4.978  -5.783  1.00 14.01  ? 80  LEU A H    1 
ATOM   1191 H HA   . LEU A 1 81  ? -2.701  -6.689  -7.645  1.00 11.73  ? 80  LEU A HA   1 
ATOM   1192 H HB2  . LEU A 1 81  ? -0.959  -7.091  -6.171  1.00 11.11  ? 80  LEU A HB2  1 
ATOM   1193 H HB3  . LEU A 1 81  ? -1.987  -7.244  -4.980  1.00 11.11  ? 80  LEU A HB3  1 
ATOM   1194 H HG   . LEU A 1 81  ? -2.748  -9.254  -5.888  1.00 11.51  ? 80  LEU A HG   1 
ATOM   1195 H HD11 . LEU A 1 81  ? -1.671  -10.214 -7.700  1.00 16.19  ? 80  LEU A HD11 1 
ATOM   1196 H HD12 . LEU A 1 81  ? -2.333  -8.838  -8.138  1.00 16.19  ? 80  LEU A HD12 1 
ATOM   1197 H HD13 . LEU A 1 81  ? -0.771  -8.914  -7.861  1.00 16.19  ? 80  LEU A HD13 1 
ATOM   1198 H HD21 . LEU A 1 81  ? -0.827  -10.500 -5.401  1.00 14.69  ? 80  LEU A HD21 1 
ATOM   1199 H HD22 . LEU A 1 81  ? 0.052   -9.182  -5.515  1.00 14.69  ? 80  LEU A HD22 1 
ATOM   1200 H HD23 . LEU A 1 81  ? -1.009  -9.331  -4.341  1.00 14.69  ? 80  LEU A HD23 1 
ATOM   1201 N N    . LYS A 1 82  ? -4.856  -6.592  -5.271  1.00 9.11   ? 81  LYS A N    1 
ATOM   1202 C CA   . LYS A 1 82  ? -6.251  -6.915  -4.974  1.00 9.35   ? 81  LYS A CA   1 
ATOM   1203 C C    . LYS A 1 82  ? -7.156  -6.488  -6.104  1.00 9.10   ? 81  LYS A C    1 
ATOM   1204 O O    . LYS A 1 82  ? -8.049  -7.237  -6.520  1.00 9.59   ? 81  LYS A O    1 
ATOM   1205 C CB   . LYS A 1 82  ? -6.683  -6.223  -3.671  1.00 12.09  ? 81  LYS A CB   1 
ATOM   1206 C CG   . LYS A 1 82  ? -8.162  -6.337  -3.294  1.00 13.08  ? 81  LYS A CG   1 
ATOM   1207 C CD   . LYS A 1 82  ? -8.404  -5.482  -2.062  1.00 15.16  ? 81  LYS A CD   1 
ATOM   1208 C CE   . LYS A 1 82  ? -9.863  -5.340  -1.797  1.00 19.74  ? 81  LYS A CE   1 
ATOM   1209 N NZ   . LYS A 1 82  ? -10.060 -4.430  -0.633  1.00 25.01  ? 81  LYS A NZ   1 
ATOM   1210 H H    . LYS A 1 82  ? -4.464  -6.118  -4.670  1.00 10.94  ? 81  LYS A H    1 
ATOM   1211 H HA   . LYS A 1 82  ? -6.342  -7.874  -4.855  1.00 11.23  ? 81  LYS A HA   1 
ATOM   1212 H HB2  . LYS A 1 82  ? -6.171  -6.604  -2.941  1.00 14.52  ? 81  LYS A HB2  1 
ATOM   1213 H HB3  . LYS A 1 82  ? -6.478  -5.278  -3.748  1.00 14.52  ? 81  LYS A HB3  1 
ATOM   1214 H HG2  . LYS A 1 82  ? -8.714  -6.006  -4.019  1.00 15.71  ? 81  LYS A HG2  1 
ATOM   1215 H HG3  . LYS A 1 82  ? -8.380  -7.259  -3.084  1.00 15.71  ? 81  LYS A HG3  1 
ATOM   1216 H HD2  . LYS A 1 82  ? -7.992  -5.903  -1.291  1.00 18.21  ? 81  LYS A HD2  1 
ATOM   1217 H HD3  . LYS A 1 82  ? -8.031  -4.598  -2.205  1.00 18.21  ? 81  LYS A HD3  1 
ATOM   1218 H HE2  . LYS A 1 82  ? -10.301 -4.955  -2.572  1.00 23.70  ? 81  LYS A HE2  1 
ATOM   1219 H HE3  . LYS A 1 82  ? -10.243 -6.207  -1.583  1.00 23.70  ? 81  LYS A HE3  1 
ATOM   1220 H HZ1  . LYS A 1 82  ? -10.929 -4.337  -0.464  1.00 30.02  ? 81  LYS A HZ1  1 
ATOM   1221 H HZ2  . LYS A 1 82  ? -9.660  -4.766  0.087   1.00 30.02  ? 81  LYS A HZ2  1 
ATOM   1222 H HZ3  . LYS A 1 82  ? -9.712  -3.630  -0.811  1.00 30.02  ? 81  LYS A HZ3  1 
ATOM   1223 N N    . GLY A 1 83  ? -6.952  -5.265  -6.599  1.00 9.02   ? 82  GLY A N    1 
ATOM   1224 C CA   . GLY A 1 83  ? -7.774  -4.757  -7.681  1.00 9.98   ? 82  GLY A CA   1 
ATOM   1225 C C    . GLY A 1 83  ? -7.642  -5.570  -8.941  1.00 9.78   ? 82  GLY A C    1 
ATOM   1226 O O    . GLY A 1 83  ? -8.644  -5.849  -9.614  1.00 9.81   ? 82  GLY A O    1 
ATOM   1227 H H    . GLY A 1 83  ? -6.347  -4.719  -6.324  1.00 10.83  ? 82  GLY A H    1 
ATOM   1228 H HA2  . GLY A 1 83  ? -8.705  -4.763  -7.409  1.00 11.99  ? 82  GLY A HA2  1 
ATOM   1229 H HA3  . GLY A 1 83  ? -7.518  -3.842  -7.878  1.00 11.99  ? 82  GLY A HA3  1 
ATOM   1230 N N    . ILE A 1 84  ? -6.395  -5.906  -9.317  1.00 8.90   ? 83  ILE A N    1 
ATOM   1231 C CA   . ILE A 1 84  ? -6.161  -6.702  -10.520 1.00 9.52   ? 83  ILE A CA   1 
ATOM   1232 C C    . ILE A 1 84  ? -6.876  -8.028  -10.408 1.00 9.86   ? 83  ILE A C    1 
ATOM   1233 O O    . ILE A 1 84  ? -7.525  -8.488  -11.348 1.00 10.35  ? 83  ILE A O    1 
ATOM   1234 C CB   . ILE A 1 84  ? -4.659  -6.910  -10.750 1.00 10.15  ? 83  ILE A CB   1 
ATOM   1235 C CG1  . ILE A 1 84  ? -3.963  -5.593  -11.064 1.00 11.07  ? 83  ILE A CG1  1 
ATOM   1236 C CG2  . ILE A 1 84  ? -4.446  -7.926  -11.865 1.00 11.23  ? 83  ILE A CG2  1 
ATOM   1237 C CD1  . ILE A 1 84  ? -2.442  -5.680  -11.040 1.00 11.82  ? 83  ILE A CD1  1 
ATOM   1238 H H    . ILE A 1 84  ? -5.680  -5.685  -8.893  1.00 10.69  ? 83  ILE A H    1 
ATOM   1239 H HA   . ILE A 1 84  ? -6.520  -6.230  -11.288 1.00 11.43  ? 83  ILE A HA   1 
ATOM   1240 H HB   . ILE A 1 84  ? -4.274  -7.270  -9.936  1.00 12.20  ? 83  ILE A HB   1 
ATOM   1241 H HG12 . ILE A 1 84  ? -4.230  -5.301  -11.950 1.00 13.29  ? 83  ILE A HG12 1 
ATOM   1242 H HG13 . ILE A 1 84  ? -4.232  -4.933  -10.405 1.00 13.29  ? 83  ILE A HG13 1 
ATOM   1243 H HG21 . ILE A 1 84  ? -3.494  -8.049  -12.001 1.00 13.48  ? 83  ILE A HG21 1 
ATOM   1244 H HG22 . ILE A 1 84  ? -4.855  -8.767  -11.607 1.00 13.48  ? 83  ILE A HG22 1 
ATOM   1245 H HG23 . ILE A 1 84  ? -4.857  -7.592  -12.678 1.00 13.48  ? 83  ILE A HG23 1 
ATOM   1246 H HD11 . ILE A 1 84  ? -2.072  -4.808  -11.248 1.00 14.19  ? 83  ILE A HD11 1 
ATOM   1247 H HD12 . ILE A 1 84  ? -2.155  -5.960  -10.156 1.00 14.19  ? 83  ILE A HD12 1 
ATOM   1248 H HD13 . ILE A 1 84  ? -2.153  -6.328  -11.702 1.00 14.19  ? 83  ILE A HD13 1 
ATOM   1249 N N    . LEU A 1 85  ? -6.747  -8.674  -9.253  1.00 8.49   ? 84  LEU A N    1 
ATOM   1250 C CA   . LEU A 1 85  ? -7.309  -10.009 -9.098  1.00 9.97   ? 84  LEU A CA   1 
ATOM   1251 C C    . LEU A 1 85  ? -8.831  -9.954  -9.081  1.00 11.58  ? 84  LEU A C    1 
ATOM   1252 O O    . LEU A 1 85  ? -9.509  -10.830 -9.648  1.00 11.67  ? 84  LEU A O    1 
ATOM   1253 C CB   . LEU A 1 85  ? -6.746  -10.652 -7.834  1.00 10.86  ? 84  LEU A CB   1 
ATOM   1254 C CG   . LEU A 1 85  ? -5.245  -10.904 -7.865  1.00 12.00  ? 84  LEU A CG   1 
ATOM   1255 C CD1  . LEU A 1 85  ? -4.716  -11.405 -6.502  1.00 9.98   ? 84  LEU A CD1  1 
ATOM   1256 C CD2  . LEU A 1 85  ? -4.777  -11.849 -8.985  1.00 11.83  ? 84  LEU A CD2  1 
ATOM   1257 H H    . LEU A 1 85  ? -6.346  -8.367  -8.556  1.00 10.20  ? 84  LEU A H    1 
ATOM   1258 H HA   . LEU A 1 85  ? -7.039  -10.553 -9.854  1.00 11.97  ? 84  LEU A HA   1 
ATOM   1259 H HB2  . LEU A 1 85  ? -6.931  -10.068 -7.081  1.00 13.04  ? 84  LEU A HB2  1 
ATOM   1260 H HB3  . LEU A 1 85  ? -7.185  -11.506 -7.699  1.00 13.04  ? 84  LEU A HB3  1 
ATOM   1261 H HG   . LEU A 1 85  ? -4.813  -10.051 -8.030  1.00 14.41  ? 84  LEU A HG   1 
ATOM   1262 H HD11 . LEU A 1 85  ? -3.759  -11.551 -6.570  1.00 11.98  ? 84  LEU A HD11 1 
ATOM   1263 H HD12 . LEU A 1 85  ? -4.901  -10.734 -5.826  1.00 11.98  ? 84  LEU A HD12 1 
ATOM   1264 H HD13 . LEU A 1 85  ? -5.162  -12.235 -6.276  1.00 11.98  ? 84  LEU A HD13 1 
ATOM   1265 H HD21 . LEU A 1 85  ? -5.020  -11.467 -9.843  1.00 14.20  ? 84  LEU A HD21 1 
ATOM   1266 H HD22 . LEU A 1 85  ? -3.814  -11.951 -8.929  1.00 14.20  ? 84  LEU A HD22 1 
ATOM   1267 H HD23 . LEU A 1 85  ? -5.209  -12.710 -8.872  1.00 14.20  ? 84  LEU A HD23 1 
ATOM   1268 N N    . ASP A 1 86  ? -9.400  -8.919  -8.470  1.00 10.68  ? 85  ASP A N    1 
ATOM   1269 C CA   . ASP A 1 86  ? -10.849 -8.736  -8.537  1.00 11.28  ? 85  ASP A CA   1 
ATOM   1270 C C    . ASP A 1 86  ? -11.304 -8.464  -9.966  1.00 10.95  ? 85  ASP A C    1 
ATOM   1271 O O    . ASP A 1 86  ? -12.346 -8.966  -10.405 1.00 12.32  ? 85  ASP A O    1 
ATOM   1272 C CB   . ASP A 1 86  ? -11.323 -7.594  -7.628  1.00 11.39  ? 85  ASP A CB   1 
ATOM   1273 C CG   . ASP A 1 86  ? -11.383 -7.961  -6.156  1.00 16.83  ? 85  ASP A CG   1 
ATOM   1274 O OD1  . ASP A 1 86  ? -11.456 -9.147  -5.826  1.00 19.03  ? 85  ASP A OD1  1 
ATOM   1275 O OD2  . ASP A 1 86  ? -11.510 -7.019  -5.346  1.00 22.16  ? 85  ASP A OD2  1 
ATOM   1276 H H    . ASP A 1 86  ? -8.980  -8.319  -8.019  1.00 12.83  ? 85  ASP A H    1 
ATOM   1277 H HA   . ASP A 1 86  ? -11.280 -9.551  -8.238  1.00 13.55  ? 85  ASP A HA   1 
ATOM   1278 H HB2  . ASP A 1 86  ? -10.712 -6.846  -7.722  1.00 13.67  ? 85  ASP A HB2  1 
ATOM   1279 H HB3  . ASP A 1 86  ? -12.214 -7.326  -7.903  1.00 13.67  ? 85  ASP A HB3  1 
ATOM   1280 N N    . TYR A 1 87  ? -10.573 -7.625  -10.698 1.00 9.22   ? 86  TYR A N    1 
ATOM   1281 C CA   . TYR A 1 87  ? -10.905 -7.362  -12.089 1.00 11.16  ? 86  TYR A CA   1 
ATOM   1282 C C    . TYR A 1 87  ? -10.895 -8.649  -12.887 1.00 11.04  ? 86  TYR A C    1 
ATOM   1283 O O    . TYR A 1 87  ? -11.798 -8.912  -13.684 1.00 11.49  ? 86  TYR A O    1 
ATOM   1284 C CB   . TYR A 1 87  ? -9.895  -6.375  -12.653 1.00 8.89   ? 86  TYR A CB   1 
ATOM   1285 C CG   . TYR A 1 87  ? -10.194 -5.855  -14.038 1.00 9.72   ? 86  TYR A CG   1 
ATOM   1286 C CD1  . TYR A 1 87  ? -11.266 -5.007  -14.245 1.00 12.18  ? 86  TYR A CD1  1 
ATOM   1287 C CD2  . TYR A 1 87  ? -9.341  -6.117  -15.090 1.00 11.01  ? 86  TYR A CD2  1 
ATOM   1288 C CE1  . TYR A 1 87  ? -11.526 -4.485  -15.498 1.00 12.73  ? 86  TYR A CE1  1 
ATOM   1289 C CE2  . TYR A 1 87  ? -9.573  -5.596  -16.331 1.00 12.53  ? 86  TYR A CE2  1 
ATOM   1290 C CZ   . TYR A 1 87  ? -10.678 -4.781  -16.524 1.00 10.51  ? 86  TYR A CZ   1 
ATOM   1291 O OH   . TYR A 1 87  ? -10.935 -4.244  -17.773 1.00 14.86  ? 86  TYR A OH   1 
ATOM   1292 H H    . TYR A 1 87  ? -9.883  -7.199  -10.412 1.00 11.07  ? 86  TYR A H    1 
ATOM   1293 H HA   . TYR A 1 87  ? -11.790 -6.968  -12.145 1.00 13.40  ? 86  TYR A HA   1 
ATOM   1294 H HB2  . TYR A 1 87  ? -9.850  -5.610  -12.059 1.00 10.67  ? 86  TYR A HB2  1 
ATOM   1295 H HB3  . TYR A 1 87  ? -9.028  -6.809  -12.687 1.00 10.67  ? 86  TYR A HB3  1 
ATOM   1296 H HD1  . TYR A 1 87  ? -11.839 -4.812  -13.539 1.00 14.63  ? 86  TYR A HD1  1 
ATOM   1297 H HD2  . TYR A 1 87  ? -8.602  -6.665  -14.955 1.00 13.22  ? 86  TYR A HD2  1 
ATOM   1298 H HE1  . TYR A 1 87  ? -12.259 -3.930  -15.636 1.00 15.28  ? 86  TYR A HE1  1 
ATOM   1299 H HE2  . TYR A 1 87  ? -9.005  -5.796  -17.040 1.00 15.05  ? 86  TYR A HE2  1 
ATOM   1300 H HH   . TYR A 1 87  ? -11.628 -3.770  -17.745 1.00 17.85  ? 86  TYR A HH   1 
ATOM   1301 N N    . ASN A 1 88  ? -9.861  -9.459  -12.704 1.00 10.27  ? 87  ASN A N    1 
ATOM   1302 C CA   . ASN A 1 88  ? -9.757  -10.718 -13.434 1.00 12.19  ? 87  ASN A CA   1 
ATOM   1303 C C    . ASN A 1 88  ? -10.981 -11.590 -13.162 1.00 12.89  ? 87  ASN A C    1 
ATOM   1304 O O    . ASN A 1 88  ? -11.568 -12.167 -14.086 1.00 16.17  ? 87  ASN A O    1 
ATOM   1305 C CB   . ASN A 1 88  ? -8.491  -11.458 -13.001 1.00 12.15  ? 87  ASN A CB   1 
ATOM   1306 C CG   . ASN A 1 88  ? -8.100  -12.598 -13.936 1.00 15.89  ? 87  ASN A CG   1 
ATOM   1307 O OD1  . ASN A 1 88  ? -8.470  -12.628 -15.096 1.00 15.97  ? 87  ASN A OD1  1 
ATOM   1308 N ND2  . ASN A 1 88  ? -7.462  -13.623 -13.366 1.00 17.57  ? 87  ASN A ND2  1 
ATOM   1309 H H    . ASN A 1 88  ? -9.209  -9.306  -12.165 1.00 12.34  ? 87  ASN A H    1 
ATOM   1310 H HA   . ASN A 1 88  ? -9.705  -10.542 -14.387 1.00 14.64  ? 87  ASN A HA   1 
ATOM   1311 H HB2  . ASN A 1 88  ? -7.754  -10.828 -12.976 1.00 14.59  ? 87  ASN A HB2  1 
ATOM   1312 H HB3  . ASN A 1 88  ? -8.634  -11.833 -12.118 1.00 14.59  ? 87  ASN A HB3  1 
ATOM   1313 H HD21 . ASN A 1 88  ? -7.227  -14.300 -13.841 1.00 21.09  ? 87  ASN A HD21 1 
ATOM   1314 H HD22 . ASN A 1 88  ? -7.237  -13.581 -12.537 1.00 21.09  ? 87  ASN A HD22 1 
ATOM   1315 N N    . HIS A 1 89  ? -11.408 -11.664 -11.905 1.00 12.13  ? 88  HIS A N    1 
ATOM   1316 C CA   . HIS A 1 89  ? -12.516 -12.525 -11.531 1.00 15.87  ? 88  HIS A CA   1 
ATOM   1317 C C    . HIS A 1 89  ? -13.861 -11.965 -11.987 1.00 15.46  ? 88  HIS A C    1 
ATOM   1318 O O    . HIS A 1 89  ? -14.687 -12.718 -12.518 1.00 19.94  ? 88  HIS A O    1 
ATOM   1319 C CB   . HIS A 1 89  ? -12.497 -12.724 -10.015 1.00 17.66  ? 88  HIS A CB   1 
ATOM   1320 C CG   . HIS A 1 89  ? -13.589 -13.611 -9.499  1.00 27.43  ? 88  HIS A CG   1 
ATOM   1321 N ND1  . HIS A 1 89  ? -13.612 -14.970 -9.731  1.00 30.38  ? 88  HIS A ND1  1 
ATOM   1322 C CD2  . HIS A 1 89  ? -14.666 -13.340 -8.725  1.00 31.80  ? 88  HIS A CD2  1 
ATOM   1323 C CE1  . HIS A 1 89  ? -14.674 -15.495 -9.146  1.00 31.32  ? 88  HIS A CE1  1 
ATOM   1324 N NE2  . HIS A 1 89  ? -15.331 -14.527 -8.531  1.00 34.77  ? 88  HIS A NE2  1 
ATOM   1325 H H    . HIS A 1 89  ? -11.069 -11.222 -11.250 1.00 14.56  ? 88  HIS A H    1 
ATOM   1326 H HA   . HIS A 1 89  ? -12.396 -13.392 -11.948 1.00 19.06  ? 88  HIS A HA   1 
ATOM   1327 H HB2  . HIS A 1 89  ? -11.650 -13.123 -9.763  1.00 21.21  ? 88  HIS A HB2  1 
ATOM   1328 H HB3  . HIS A 1 89  ? -12.592 -11.859 -9.586  1.00 21.21  ? 88  HIS A HB3  1 
ATOM   1329 H HD2  . HIS A 1 89  ? -14.920 -12.506 -8.403  1.00 38.17  ? 88  HIS A HD2  1 
ATOM   1330 H HE1  . HIS A 1 89  ? -14.916 -16.392 -9.163  1.00 37.60  ? 88  HIS A HE1  1 
ATOM   1331 H HE2  . HIS A 1 89  ? -16.055 -14.626 -8.078  1.00 41.74  ? 88  HIS A HE2  1 
ATOM   1332 N N    . GLU A 1 90  ? -14.099 -10.664 -11.799 1.00 12.89  ? 89  GLU A N    1 
ATOM   1333 C CA   . GLU A 1 90  ? -15.418 -10.056 -11.951 1.00 12.46  ? 89  GLU A CA   1 
ATOM   1334 C C    . GLU A 1 90  ? -15.691 -9.589  -13.370 1.00 16.55  ? 89  GLU A C    1 
ATOM   1335 O O    . GLU A 1 90  ? -16.853 -9.567  -13.782 1.00 17.32  ? 89  GLU A O    1 
ATOM   1336 C CB   . GLU A 1 90  ? -15.575 -8.855  -11.013 1.00 12.17  ? 89  GLU A CB   1 
ATOM   1337 C CG   . GLU A 1 90  ? -15.529 -9.225  -9.549  1.00 14.16  ? 89  GLU A CG   1 
ATOM   1338 C CD   . GLU A 1 90  ? -15.582 -8.054  -8.603  1.00 16.06  ? 89  GLU A CD   1 
ATOM   1339 O OE1  . GLU A 1 90  ? -15.700 -6.871  -9.022  1.00 14.62  ? 89  GLU A OE1  1 
ATOM   1340 O OE2  . GLU A 1 90  ? -15.341 -8.326  -7.397  1.00 20.64  ? 89  GLU A OE2  1 
ATOM   1341 H H    . GLU A 1 90  ? -13.490 -10.099 -11.575 1.00 15.48  ? 89  GLU A H    1 
ATOM   1342 H HA   . GLU A 1 90  ? -16.095 -10.710 -11.716 1.00 14.97  ? 89  GLU A HA   1 
ATOM   1343 H HB2  . GLU A 1 90  ? -14.856 -8.227  -11.184 1.00 14.62  ? 89  GLU A HB2  1 
ATOM   1344 H HB3  . GLU A 1 90  ? -16.431 -8.432  -11.186 1.00 14.62  ? 89  GLU A HB3  1 
ATOM   1345 H HG2  . GLU A 1 90  ? -16.287 -9.797  -9.350  1.00 17.00  ? 89  GLU A HG2  1 
ATOM   1346 H HG3  . GLU A 1 90  ? -14.704 -9.704  -9.377  1.00 17.00  ? 89  GLU A HG3  1 
ATOM   1347 N N    . ILE A 1 91  ? -14.659 -9.186  -14.108 1.00 13.85  ? 90  ILE A N    1 
ATOM   1348 C CA   . ILE A 1 91  ? -14.801 -8.609  -15.433 1.00 12.52  ? 90  ILE A CA   1 
ATOM   1349 C C    . ILE A 1 91  ? -14.212 -9.514  -16.512 1.00 16.42  ? 90  ILE A C    1 
ATOM   1350 O O    . ILE A 1 91  ? -14.771 -9.604  -17.610 1.00 16.84  ? 90  ILE A O    1 
ATOM   1351 C CB   . ILE A 1 91  ? -14.142 -7.213  -15.483 1.00 10.65  ? 90  ILE A CB   1 
ATOM   1352 C CG1  . ILE A 1 91  ? -14.712 -6.264  -14.455 1.00 13.97  ? 90  ILE A CG1  1 
ATOM   1353 C CG2  . ILE A 1 91  ? -14.256 -6.636  -16.900 1.00 13.35  ? 90  ILE A CG2  1 
ATOM   1354 C CD1  . ILE A 1 91  ? -16.207 -5.952  -14.599 1.00 14.79  ? 90  ILE A CD1  1 
ATOM   1355 H H    . ILE A 1 91  ? -13.840 -9.241  -13.849 1.00 16.63  ? 90  ILE A H    1 
ATOM   1356 H HA   . ILE A 1 91  ? -15.746 -8.497  -15.624 1.00 15.04  ? 90  ILE A HA   1 
ATOM   1357 H HB   . ILE A 1 91  ? -13.199 -7.326  -15.286 1.00 12.79  ? 90  ILE A HB   1 
ATOM   1358 H HG12 . ILE A 1 91  ? -14.579 -6.650  -13.575 1.00 16.77  ? 90  ILE A HG12 1 
ATOM   1359 H HG13 . ILE A 1 91  ? -14.233 -5.423  -14.515 1.00 16.77  ? 90  ILE A HG13 1 
ATOM   1360 H HG21 . ILE A 1 91  ? -13.839 -5.760  -16.919 1.00 16.03  ? 90  ILE A HG21 1 
ATOM   1361 H HG22 . ILE A 1 91  ? -13.805 -7.230  -17.520 1.00 16.03  ? 90  ILE A HG22 1 
ATOM   1362 H HG23 . ILE A 1 91  ? -15.194 -6.561  -17.136 1.00 16.03  ? 90  ILE A HG23 1 
ATOM   1363 H HD11 . ILE A 1 91  ? -16.363 -5.547  -15.466 1.00 17.75  ? 90  ILE A HD11 1 
ATOM   1364 H HD12 . ILE A 1 91  ? -16.710 -6.777  -14.523 1.00 17.75  ? 90  ILE A HD12 1 
ATOM   1365 H HD13 . ILE A 1 91  ? -16.470 -5.338  -13.895 1.00 17.75  ? 90  ILE A HD13 1 
ATOM   1366 N N    . LEU A 1 92  ? -13.085 -10.168 -16.259 1.00 14.36  ? 91  LEU A N    1 
ATOM   1367 C CA   . LEU A 1 92  ? -12.394 -10.901 -17.313 1.00 14.20  ? 91  LEU A CA   1 
ATOM   1368 C C    . LEU A 1 92  ? -12.668 -12.400 -17.285 1.00 16.53  ? 91  LEU A C    1 
ATOM   1369 O O    . LEU A 1 92  ? -12.050 -13.126 -18.067 1.00 21.77  ? 91  LEU A O    1 
ATOM   1370 C CB   . LEU A 1 92  ? -10.881 -10.697 -17.231 1.00 15.54  ? 91  LEU A CB   1 
ATOM   1371 C CG   . LEU A 1 92  ? -10.395 -9.255  -17.248 1.00 15.02  ? 91  LEU A CG   1 
ATOM   1372 C CD1  . LEU A 1 92  ? -8.868  -9.225  -17.190 1.00 16.07  ? 91  LEU A CD1  1 
ATOM   1373 C CD2  . LEU A 1 92  ? -10.934 -8.463  -18.436 1.00 15.59  ? 91  LEU A CD2  1 
ATOM   1374 H H    . LEU A 1 92  ? -12.701 -10.204 -15.490 1.00 17.24  ? 91  LEU A H    1 
ATOM   1375 H HA   . LEU A 1 92  ? -12.692 -10.562 -18.172 1.00 17.05  ? 91  LEU A HA   1 
ATOM   1376 H HB2  . LEU A 1 92  ? -10.564 -11.098 -16.406 1.00 18.66  ? 91  LEU A HB2  1 
ATOM   1377 H HB3  . LEU A 1 92  ? -10.471 -11.149 -17.985 1.00 18.66  ? 91  LEU A HB3  1 
ATOM   1378 H HG   . LEU A 1 92  ? -10.719 -8.818  -16.445 1.00 18.04  ? 91  LEU A HG   1 
ATOM   1379 H HD11 . LEU A 1 92  ? -8.513  -9.697  -17.959 1.00 19.29  ? 91  LEU A HD11 1 
ATOM   1380 H HD12 . LEU A 1 92  ? -8.570  -8.302  -17.201 1.00 19.29  ? 91  LEU A HD12 1 
ATOM   1381 H HD13 . LEU A 1 92  ? -8.575  -9.657  -16.372 1.00 19.29  ? 91  LEU A HD13 1 
ATOM   1382 H HD21 . LEU A 1 92  ? -10.641 -8.889  -19.257 1.00 18.72  ? 91  LEU A HD21 1 
ATOM   1383 H HD22 . LEU A 1 92  ? -11.903 -8.453  -18.394 1.00 18.72  ? 91  LEU A HD22 1 
ATOM   1384 H HD23 . LEU A 1 92  ? -10.591 -7.557  -18.392 1.00 18.72  ? 91  LEU A HD23 1 
ATOM   1385 N N    . GLY A 1 93  ? -13.523 -12.882 -16.388 1.00 18.00  ? 92  GLY A N    1 
ATOM   1386 C CA   . GLY A 1 93  ? -13.824 -14.304 -16.328 1.00 22.74  ? 92  GLY A CA   1 
ATOM   1387 C C    . GLY A 1 93  ? -12.607 -15.175 -16.116 1.00 20.80  ? 92  GLY A C    1 
ATOM   1388 O O    . GLY A 1 93  ? -12.532 -16.281 -16.662 1.00 22.82  ? 92  GLY A O    1 
ATOM   1389 H H    . GLY A 1 93  ? -13.939 -12.406 -15.805 1.00 21.61  ? 92  GLY A H    1 
ATOM   1390 H HA2  . GLY A 1 93  ? -14.444 -14.468 -15.601 1.00 27.30  ? 92  GLY A HA2  1 
ATOM   1391 H HA3  . GLY A 1 93  ? -14.249 -14.574 -17.157 1.00 27.30  ? 92  GLY A HA3  1 
ATOM   1392 N N    . GLN A 1 94  ? -11.670 -14.724 -15.336 1.00 18.92  ? 93  GLN A N    1 
ATOM   1393 C CA   . GLN A 1 94  ? -10.467 -15.436 -15.035 1.00 21.44  ? 93  GLN A CA   1 
ATOM   1394 C C    . GLN A 1 94  ? -9.578  -15.750 -16.221 1.00 23.97  ? 93  GLN A C    1 
ATOM   1395 O O    . GLN A 1 94  ? -8.892  -16.719 -16.212 1.00 24.02  ? 93  GLN A O    1 
ATOM   1396 C CB   . GLN A 1 94  ? -10.754 -16.715 -14.260 1.00 25.62  ? 93  GLN A CB   1 
ATOM   1397 C CG   . GLN A 1 94  ? -11.253 -16.553 -12.861 1.00 30.72  ? 93  GLN A CG   1 
ATOM   1398 C CD   . GLN A 1 94  ? -10.232 -16.043 -11.922 1.00 40.87  ? 93  GLN A CD   1 
ATOM   1399 O OE1  . GLN A 1 94  ? -10.547 -15.252 -11.145 1.00 46.94  ? 93  GLN A OE1  1 
ATOM   1400 N NE2  . GLN A 1 94  ? -9.017  -16.513 -11.994 1.00 44.82  ? 93  GLN A NE2  1 
ATOM   1401 H H    . GLN A 1 94  ? -11.723 -13.983 -14.953 1.00 22.72  ? 93  GLN A H    1 
ATOM   1402 H HA   . GLN A 1 94  ? -9.932  -14.879 -14.458 1.00 25.74  ? 93  GLN A HA   1 
ATOM   1403 H HB2  . GLN A 1 94  ? -11.411 -17.216 -14.746 1.00 30.76  ? 93  GLN A HB2  1 
ATOM   1404 H HB3  . GLN A 1 94  ? -9.945  -17.226 -14.204 1.00 30.76  ? 93  GLN A HB3  1 
ATOM   1405 H HG2  . GLN A 1 94  ? -11.969 -15.912 -12.851 1.00 36.87  ? 93  GLN A HG2  1 
ATOM   1406 H HG3  . GLN A 1 94  ? -11.552 -17.397 -12.517 1.00 36.87  ? 93  GLN A HG3  1 
ATOM   1407 H HE21 . GLN A 1 94  ? -8.684  -16.735 -12.745 1.00 53.80  ? 93  GLN A HE21 1 
ATOM   1408 H HE22 . GLN A 1 94  ? -8.560  -16.611 -11.280 1.00 53.80  ? 93  GLN A HE22 1 
ATOM   1409 N N    . GLN A 1 95  ? -9.566  -14.906 -17.226 1.00 19.68  ? 94  GLN A N    1 
ATOM   1410 C CA   . GLN A 1 95  ? -8.678  -15.234 -18.338 1.00 18.95  ? 94  GLN A CA   1 
ATOM   1411 C C    . GLN A 1 95  ? -7.198  -15.013 -18.035 1.00 25.22  ? 94  GLN A C    1 
ATOM   1412 O O    . GLN A 1 95  ? -6.358  -15.587 -18.743 1.00 26.43  ? 94  GLN A O    1 
ATOM   1413 C CB   . GLN A 1 95  ? -8.949  -14.470 -19.624 1.00 26.53  ? 94  GLN A CB   1 
ATOM   1414 C CG   . GLN A 1 95  ? -10.247 -14.709 -20.358 1.00 35.52  ? 94  GLN A CG   1 
ATOM   1415 C CD   . GLN A 1 95  ? -10.093 -14.286 -21.812 1.00 42.71  ? 94  GLN A CD   1 
ATOM   1416 O OE1  . GLN A 1 95  ? -8.973  -14.062 -22.264 1.00 55.29  ? 94  GLN A OE1  1 
ATOM   1417 N NE2  . GLN A 1 95  ? -11.202 -14.052 -22.505 1.00 45.73  ? 94  GLN A NE2  1 
ATOM   1418 H H    . GLN A 1 95  ? -10.044 -14.196 -17.313 1.00 23.63  ? 94  GLN A H    1 
ATOM   1419 H HA   . GLN A 1 95  ? -8.790  -16.176 -18.538 1.00 22.75  ? 94  GLN A HA   1 
ATOM   1420 H HB2  . GLN A 1 95  ? -8.918  -13.523 -19.417 1.00 31.84  ? 94  GLN A HB2  1 
ATOM   1421 H HB3  . GLN A 1 95  ? -8.235  -14.678 -20.247 1.00 31.84  ? 94  GLN A HB3  1 
ATOM   1422 H HG2  . GLN A 1 95  ? -10.468 -15.653 -20.332 1.00 42.64  ? 94  GLN A HG2  1 
ATOM   1423 H HG3  . GLN A 1 95  ? -10.953 -14.181 -19.954 1.00 42.64  ? 94  GLN A HG3  1 
ATOM   1424 H HE21 . GLN A 1 95  ? -11.970 -14.200 -22.149 1.00 54.89  ? 94  GLN A HE21 1 
ATOM   1425 H HE22 . GLN A 1 95  ? -11.150 -13.801 -23.326 1.00 54.89  ? 94  GLN A HE22 1 
ATOM   1426 N N    . ILE A 1 96  ? -6.841  -14.188 -17.050 1.00 17.42  ? 95  ILE A N    1 
ATOM   1427 C CA   . ILE A 1 96  ? -5.438  -14.026 -16.689 1.00 19.84  ? 95  ILE A CA   1 
ATOM   1428 C C    . ILE A 1 96  ? -5.038  -15.165 -15.759 1.00 21.03  ? 95  ILE A C    1 
ATOM   1429 O O    . ILE A 1 96  ? -5.723  -15.454 -14.767 1.00 18.86  ? 95  ILE A O    1 
ATOM   1430 C CB   . ILE A 1 96  ? -5.173  -12.661 -16.026 1.00 17.36  ? 95  ILE A CB   1 
ATOM   1431 C CG1  . ILE A 1 96  ? -5.551  -11.502 -16.960 1.00 17.45  ? 95  ILE A CG1  1 
ATOM   1432 C CG2  . ILE A 1 96  ? -3.688  -12.532 -15.686 1.00 20.31  ? 95  ILE A CG2  1 
ATOM   1433 C CD1  . ILE A 1 96  ? -5.505  -10.119 -16.277 1.00 18.21  ? 95  ILE A CD1  1 
ATOM   1434 H H    . ILE A 1 96  ? -7.387  -13.717 -16.581 1.00 20.92  ? 95  ILE A H    1 
ATOM   1435 H HA   . ILE A 1 96  ? -4.894  -14.084 -17.490 1.00 23.81  ? 95  ILE A HA   1 
ATOM   1436 H HB   . ILE A 1 96  ? -5.694  -12.597 -15.211 1.00 20.84  ? 95  ILE A HB   1 
ATOM   1437 H HG12 . ILE A 1 96  ? -4.932  -11.486 -17.706 1.00 20.95  ? 95  ILE A HG12 1 
ATOM   1438 H HG13 . ILE A 1 96  ? -6.455  -11.644 -17.284 1.00 20.95  ? 95  ILE A HG13 1 
ATOM   1439 H HG21 . ILE A 1 96  ? -3.534  -11.670 -15.269 1.00 24.39  ? 95  ILE A HG21 1 
ATOM   1440 H HG22 . ILE A 1 96  ? -3.442  -13.244 -15.074 1.00 24.39  ? 95  ILE A HG22 1 
ATOM   1441 H HG23 . ILE A 1 96  ? -3.170  -12.603 -16.502 1.00 24.39  ? 95  ILE A HG23 1 
ATOM   1442 H HD11 . ILE A 1 96  ? -5.754  -9.440  -16.923 1.00 21.86  ? 95  ILE A HD11 1 
ATOM   1443 H HD12 . ILE A 1 96  ? -6.128  -10.114 -15.533 1.00 21.86  ? 95  ILE A HD12 1 
ATOM   1444 H HD13 . ILE A 1 96  ? -4.604  -9.956  -15.955 1.00 21.86  ? 95  ILE A HD13 1 
ATOM   1445 N N    . ASN A 1 97  ? -3.912  -15.800 -16.063 1.00 18.44  ? 96  ASN A N    1 
ATOM   1446 C CA   . ASN A 1 97  ? -3.362  -16.829 -15.193 1.00 20.43  ? 96  ASN A CA   1 
ATOM   1447 C C    . ASN A 1 97  ? -2.788  -16.211 -13.922 1.00 19.63  ? 96  ASN A C    1 
ATOM   1448 O O    . ASN A 1 97  ? -1.889  -15.362 -13.969 1.00 20.13  ? 96  ASN A O    1 
ATOM   1449 C CB   . ASN A 1 97  ? -2.313  -17.615 -15.970 1.00 21.05  ? 96  ASN A CB   1 
ATOM   1450 C CG   . ASN A 1 97  ? -1.734  -18.751 -15.186 1.00 28.76  ? 96  ASN A CG   1 
ATOM   1451 O OD1  . ASN A 1 97  ? -1.932  -18.848 -13.984 1.00 30.01  ? 96  ASN A OD1  1 
ATOM   1452 N ND2  . ASN A 1 97  ? -1.088  -19.676 -15.883 1.00 44.91  ? 96  ASN A ND2  1 
ATOM   1453 H H    . ASN A 1 97  ? -3.446  -15.652 -16.771 1.00 22.13  ? 96  ASN A H    1 
ATOM   1454 H HA   . ASN A 1 97  ? -4.070  -17.442 -14.937 1.00 24.52  ? 96  ASN A HA   1 
ATOM   1455 H HB2  . ASN A 1 97  ? -2.722  -17.981 -16.770 1.00 25.28  ? 96  ASN A HB2  1 
ATOM   1456 H HB3  . ASN A 1 97  ? -1.588  -17.018 -16.212 1.00 25.28  ? 96  ASN A HB3  1 
ATOM   1457 H HD21 . ASN A 1 97  ? -0.982  -19.580 -16.731 1.00 53.90  ? 96  ASN A HD21 1 
ATOM   1458 H HD22 . ASN A 1 97  ? -0.742  -20.354 -15.481 1.00 53.90  ? 96  ASN A HD22 1 
ATOM   1459 N N    . ASP A 1 98  ? -3.345  -16.606 -12.776 1.00 20.18  ? 97  ASP A N    1 
ATOM   1460 C CA   . ASP A 1 98  ? -2.936  -16.039 -11.498 1.00 19.42  ? 97  ASP A CA   1 
ATOM   1461 C C    . ASP A 1 98  ? -2.482  -17.119 -10.519 1.00 22.35  ? 97  ASP A C    1 
ATOM   1462 O O    . ASP A 1 98  ? -2.596  -16.964 -9.298  1.00 24.37  ? 97  ASP A O    1 
ATOM   1463 C CB   . ASP A 1 98  ? -4.071  -15.189 -10.925 1.00 24.17  ? 97  ASP A CB   1 
ATOM   1464 C CG   . ASP A 1 98  ? -5.336  -15.971 -10.685 1.00 31.83  ? 97  ASP A CG   1 
ATOM   1465 O OD1  . ASP A 1 98  ? -5.345  -17.202 -10.881 1.00 31.41  ? 97  ASP A OD1  1 
ATOM   1466 O OD2  . ASP A 1 98  ? -6.347  -15.325 -10.340 1.00 41.52  ? 97  ASP A OD2  1 
ATOM   1467 H H    . ASP A 1 98  ? -3.962  -17.202 -12.716 1.00 24.22  ? 97  ASP A H    1 
ATOM   1468 H HA   . ASP A 1 98  ? -2.181  -15.450 -11.651 1.00 23.31  ? 97  ASP A HA   1 
ATOM   1469 H HB2  . ASP A 1 98  ? -3.786  -14.815 -10.077 1.00 29.01  ? 97  ASP A HB2  1 
ATOM   1470 H HB3  . ASP A 1 98  ? -4.275  -14.476 -11.550 1.00 29.01  ? 97  ASP A HB3  1 
ATOM   1471 N N    . PHE A 1 99  ? -1.892  -18.172 -11.039 1.00 17.71  ? 98  PHE A N    1 
ATOM   1472 C CA   . PHE A 1 99  ? -1.366  -19.210 -10.191 1.00 19.36  ? 98  PHE A CA   1 
ATOM   1473 C C    . PHE A 1 99  ? -0.186  -18.689 -9.347  1.00 22.05  ? 98  PHE A C    1 
ATOM   1474 O O    . PHE A 1 99  ? -0.102  -18.986 -8.207  1.00 22.92  ? 98  PHE A O    1 
ATOM   1475 C CB   . PHE A 1 99  ? -0.945  -20.415 -11.018 1.00 19.20  ? 98  PHE A CB   1 
ATOM   1476 C CG   . PHE A 1 99  ? -0.319  -21.535 -10.228 1.00 24.06  ? 98  PHE A CG   1 
ATOM   1477 C CD1  . PHE A 1 99  ? -1.074  -22.372 -9.463  1.00 22.97  ? 98  PHE A CD1  1 
ATOM   1478 C CD2  . PHE A 1 99  ? 1.015   -21.742 -10.262 1.00 24.48  ? 98  PHE A CD2  1 
ATOM   1479 C CE1  . PHE A 1 99  ? -0.490  -23.365 -8.736  1.00 24.49  ? 98  PHE A CE1  1 
ATOM   1480 C CE2  . PHE A 1 99  ? 1.599   -22.753 -9.516  1.00 25.62  ? 98  PHE A CE2  1 
ATOM   1481 C CZ   . PHE A 1 99  ? 0.846   -23.571 -8.789  1.00 22.80  ? 98  PHE A CZ   1 
ATOM   1482 H H    . PHE A 1 99  ? -1.774  -18.290 -11.865 1.00 21.26  ? 98  PHE A H    1 
ATOM   1483 H HA   . PHE A 1 99  ? -2.070  -19.487 -9.590  1.00 23.24  ? 98  PHE A HA   1 
ATOM   1484 H HB2  . PHE A 1 99  ? -1.718  -20.750 -11.471 1.00 23.05  ? 98  PHE A HB2  1 
ATOM   1485 H HB3  . PHE A 1 99  ? -0.303  -20.122 -11.665 1.00 23.05  ? 98  PHE A HB3  1 
ATOM   1486 H HD1  . PHE A 1 99  ? -1.986  -22.262 -9.413  1.00 27.58  ? 98  PHE A HD1  1 
ATOM   1487 H HD2  . PHE A 1 99  ? 1.544   -21.188 -10.768 1.00 29.38  ? 98  PHE A HD2  1 
ATOM   1488 H HE1  . PHE A 1 99  ? -1.020  -23.918 -8.231  1.00 29.40  ? 98  PHE A HE1  1 
ATOM   1489 H HE2  . PHE A 1 99  ? 2.509   -22.889 -9.546  1.00 30.75  ? 98  PHE A HE2  1 
ATOM   1490 H HZ   . PHE A 1 99  ? 1.229   -24.229 -8.290  1.00 27.37  ? 98  PHE A HZ   1 
ATOM   1491 N N    . THR A 1 100 ? 0.721   -17.967 -9.959  1.00 21.43  ? 99  THR A N    1 
ATOM   1492 C CA   . THR A 1 100 ? 1.868   -17.397 -9.269  1.00 22.85  ? 99  THR A CA   1 
ATOM   1493 C C    . THR A 1 100 ? 1.604   -15.901 -9.108  1.00 23.44  ? 99  THR A C    1 
ATOM   1494 O O    . THR A 1 100 ? 1.585   -15.163 -10.100 1.00 29.82  ? 99  THR A O    1 
ATOM   1495 C CB   . THR A 1 100 ? 3.149   -17.653 -10.057 1.00 29.96  ? 99  THR A CB   1 
ATOM   1496 O OG1  . THR A 1 100 ? 3.345   -19.067 -10.202 1.00 33.65  ? 99  THR A OG1  1 
ATOM   1497 C CG2  . THR A 1 100 ? 4.336   -17.047 -9.349  1.00 34.91  ? 99  THR A CG2  1 
ATOM   1498 H H    . THR A 1 100 ? 0.701   -17.784 -10.799 1.00 25.73  ? 99  THR A H    1 
ATOM   1499 H HA   . THR A 1 100 ? 1.955   -17.797 -8.389  1.00 27.43  ? 99  THR A HA   1 
ATOM   1500 H HB   . THR A 1 100 ? 3.074   -17.246 -10.934 1.00 35.96  ? 99  THR A HB   1 
ATOM   1501 H HG1  . THR A 1 100 ? 4.049   -19.216 -10.636 1.00 40.39  ? 99  THR A HG1  1 
ATOM   1502 H HG21 . THR A 1 100 ? 5.145   -17.215 -9.857  1.00 41.90  ? 99  THR A HG21 1 
ATOM   1503 H HG22 . THR A 1 100 ? 4.214   -16.089 -9.258  1.00 41.90  ? 99  THR A HG22 1 
ATOM   1504 H HG23 . THR A 1 100 ? 4.431   -17.438 -8.467  1.00 41.90  ? 99  THR A HG23 1 
ATOM   1505 N N    . LEU A 1 101 ? 1.353   -15.465 -7.853  1.00 19.38  ? 100 LEU A N    1 
ATOM   1506 C CA   . LEU A 1 101 ? 1.181   -14.045 -7.570  1.00 19.00  ? 100 LEU A CA   1 
ATOM   1507 C C    . LEU A 1 101 ? 2.542   -13.378 -7.413  1.00 19.80  ? 100 LEU A C    1 
ATOM   1508 O O    . LEU A 1 101 ? 3.460   -13.972 -6.841  1.00 18.81  ? 100 LEU A O    1 
ATOM   1509 C CB   . LEU A 1 101 ? 0.376   -13.821 -6.302  1.00 19.37  ? 100 LEU A CB   1 
ATOM   1510 C CG   . LEU A 1 101 ? -1.053  -14.371 -6.302  1.00 20.18  ? 100 LEU A CG   1 
ATOM   1511 C CD1  . LEU A 1 101 ? -1.750  -14.061 -4.991  1.00 25.48  ? 100 LEU A CD1  1 
ATOM   1512 C CD2  . LEU A 1 101 ? -1.832  -13.840 -7.482  1.00 20.30  ? 100 LEU A CD2  1 
ATOM   1513 H H    . LEU A 1 101 ? 1.281   -15.975 -7.165  1.00 23.26  ? 100 LEU A H    1 
ATOM   1514 H HA   . LEU A 1 101 ? 0.715   -13.623 -8.308  1.00 22.81  ? 100 LEU A HA   1 
ATOM   1515 H HB2  . LEU A 1 101 ? 0.846   -14.240 -5.565  1.00 23.25  ? 100 LEU A HB2  1 
ATOM   1516 H HB3  . LEU A 1 101 ? 0.317   -12.866 -6.144  1.00 23.25  ? 100 LEU A HB3  1 
ATOM   1517 H HG   . LEU A 1 101 ? -1.012  -15.336 -6.390  1.00 24.23  ? 100 LEU A HG   1 
ATOM   1518 H HD11 . LEU A 1 101 ? -2.651  -14.420 -5.020  1.00 30.59  ? 100 LEU A HD11 1 
ATOM   1519 H HD12 . LEU A 1 101 ? -1.253  -14.470 -4.265  1.00 30.59  ? 100 LEU A HD12 1 
ATOM   1520 H HD13 . LEU A 1 101 ? -1.781  -13.099 -4.869  1.00 30.59  ? 100 LEU A HD13 1 
ATOM   1521 H HD21 . LEU A 1 101 ? -2.730  -14.204 -7.456  1.00 24.37  ? 100 LEU A HD21 1 
ATOM   1522 H HD22 . LEU A 1 101 ? -1.864  -12.872 -7.428  1.00 24.37  ? 100 LEU A HD22 1 
ATOM   1523 H HD23 . LEU A 1 101 ? -1.388  -14.112 -8.300  1.00 24.37  ? 100 LEU A HD23 1 
ATOM   1524 N N    . PRO A 1 102 ? 2.705   -12.162 -7.917  1.00 14.40  ? 101 PRO A N    1 
ATOM   1525 C CA   . PRO A 1 102 ? 3.922   -11.406 -7.612  1.00 11.33  ? 101 PRO A CA   1 
ATOM   1526 C C    . PRO A 1 102 ? 4.048   -11.222 -6.116  1.00 12.29  ? 101 PRO A C    1 
ATOM   1527 O O    . PRO A 1 102 ? 3.052   -11.066 -5.404  1.00 12.25  ? 101 PRO A O    1 
ATOM   1528 C CB   . PRO A 1 102 ? 3.718   -10.070 -8.332  1.00 12.70  ? 101 PRO A CB   1 
ATOM   1529 C CG   . PRO A 1 102 ? 2.262   -9.950  -8.479  1.00 22.89  ? 101 PRO A CG   1 
ATOM   1530 C CD   . PRO A 1 102 ? 1.681   -11.332 -8.563  1.00 13.96  ? 101 PRO A CD   1 
ATOM   1531 H HA   . PRO A 1 102 ? 4.707   -11.856 -7.961  1.00 13.61  ? 101 PRO A HA   1 
ATOM   1532 H HB2  . PRO A 1 102 ? 4.071   -9.347  -7.790  1.00 15.25  ? 101 PRO A HB2  1 
ATOM   1533 H HB3  . PRO A 1 102 ? 4.152   -10.094 -9.199  1.00 15.25  ? 101 PRO A HB3  1 
ATOM   1534 H HG2  . PRO A 1 102 ? 1.902   -9.483  -7.709  1.00 27.48  ? 101 PRO A HG2  1 
ATOM   1535 H HG3  . PRO A 1 102 ? 2.064   -9.456  -9.290  1.00 27.48  ? 101 PRO A HG3  1 
ATOM   1536 H HD2  . PRO A 1 102 ? 0.846   -11.380 -8.071  1.00 16.76  ? 101 PRO A HD2  1 
ATOM   1537 H HD3  . PRO A 1 102 ? 1.565   -11.596 -9.489  1.00 16.76  ? 101 PRO A HD3  1 
ATOM   1538 N N    . ASP A 1 103 ? 5.289   -11.242 -5.637  1.00 11.79  ? 102 ASP A N    1 
ATOM   1539 C CA   . ASP A 1 103 ? 5.592   -11.056 -4.212  1.00 10.69  ? 102 ASP A CA   1 
ATOM   1540 C C    . ASP A 1 103 ? 5.815   -9.562  -3.977  1.00 11.56  ? 102 ASP A C    1 
ATOM   1541 O O    . ASP A 1 103 ? 6.907   -9.003  -4.163  1.00 11.71  ? 102 ASP A O    1 
ATOM   1542 C CB   . ASP A 1 103 ? 6.750   -11.945 -3.776  1.00 13.44  ? 102 ASP A CB   1 
ATOM   1543 C CG   . ASP A 1 103 ? 6.968   -11.904 -2.290  1.00 17.30  ? 102 ASP A CG   1 
ATOM   1544 O OD1  . ASP A 1 103 ? 6.515   -10.957 -1.636  1.00 15.83  ? 102 ASP A OD1  1 
ATOM   1545 O OD2  . ASP A 1 103 ? 7.469   -12.906 -1.755  1.00 20.03  ? 102 ASP A OD2  1 
ATOM   1546 H H    . ASP A 1 103 ? 5.988   -11.363 -6.123  1.00 14.15  ? 102 ASP A H    1 
ATOM   1547 H HA   . ASP A 1 103 ? 4.814   -11.319 -3.695  1.00 12.84  ? 102 ASP A HA   1 
ATOM   1548 H HB2  . ASP A 1 103 ? 6.560   -12.862 -4.029  1.00 16.14  ? 102 ASP A HB2  1 
ATOM   1549 H HB3  . ASP A 1 103 ? 7.564   -11.641 -4.209  1.00 16.14  ? 102 ASP A HB3  1 
ATOM   1550 N N    . VAL A 1 104 ? 4.726   -8.896  -3.593  1.00 11.47  ? 103 VAL A N    1 
ATOM   1551 C CA   . VAL A 1 104 ? 4.781   -7.444  -3.457  1.00 11.80  ? 103 VAL A CA   1 
ATOM   1552 C C    . VAL A 1 104 ? 5.675   -7.038  -2.294  1.00 10.76  ? 103 VAL A C    1 
ATOM   1553 O O    . VAL A 1 104 ? 6.229   -5.930  -2.290  1.00 11.34  ? 103 VAL A O    1 
ATOM   1554 C CB   . VAL A 1 104 ? 3.364   -6.852  -3.322  1.00 14.95  ? 103 VAL A CB   1 
ATOM   1555 C CG1  . VAL A 1 104 ? 2.560   -7.123  -4.588  1.00 15.36  ? 103 VAL A CG1  1 
ATOM   1556 C CG2  . VAL A 1 104 ? 2.652   -7.372  -2.102  1.00 14.91  ? 103 VAL A CG2  1 
ATOM   1557 H H    . VAL A 1 104 ? 3.964   -9.251  -3.410  1.00 13.78  ? 103 VAL A H    1 
ATOM   1558 H HA   . VAL A 1 104 ? 5.172   -7.076  -4.265  1.00 14.17  ? 103 VAL A HA   1 
ATOM   1559 H HB   . VAL A 1 104 ? 3.441   -5.890  -3.226  1.00 17.95  ? 103 VAL A HB   1 
ATOM   1560 H HG11 . VAL A 1 104 ? 1.673   -6.744  -4.485  1.00 18.44  ? 103 VAL A HG11 1 
ATOM   1561 H HG12 . VAL A 1 104 ? 3.011   -6.712  -5.342  1.00 18.44  ? 103 VAL A HG12 1 
ATOM   1562 H HG13 . VAL A 1 104 ? 2.498   -8.082  -4.722  1.00 18.44  ? 103 VAL A HG13 1 
ATOM   1563 H HG21 . VAL A 1 104 ? 1.768   -6.974  -2.058  1.00 17.90  ? 103 VAL A HG21 1 
ATOM   1564 H HG22 . VAL A 1 104 ? 2.577   -8.337  -2.167  1.00 17.90  ? 103 VAL A HG22 1 
ATOM   1565 H HG23 . VAL A 1 104 ? 3.162   -7.133  -1.312  1.00 17.90  ? 103 VAL A HG23 1 
ATOM   1566 N N    . ASN A 1 105 ? 5.839   -7.905  -1.296  1.00 11.12  ? 104 ASN A N    1 
ATOM   1567 C CA   . ASN A 1 105 ? 6.751   -7.594  -0.196  1.00 11.19  ? 104 ASN A CA   1 
ATOM   1568 C C    . ASN A 1 105 ? 8.180   -7.457  -0.682  1.00 11.17  ? 104 ASN A C    1 
ATOM   1569 O O    . ASN A 1 105 ? 8.916   -6.590  -0.215  1.00 12.51  ? 104 ASN A O    1 
ATOM   1570 C CB   . ASN A 1 105 ? 6.636   -8.694  0.847   1.00 13.14  ? 104 ASN A CB   1 
ATOM   1571 C CG   . ASN A 1 105 ? 5.288   -8.726  1.467   1.00 15.88  ? 104 ASN A CG   1 
ATOM   1572 O OD1  . ASN A 1 105 ? 4.399   -9.403  0.960   1.00 27.47  ? 104 ASN A OD1  1 
ATOM   1573 N ND2  . ASN A 1 105 ? 5.189   -8.208  2.671   1.00 22.11  ? 104 ASN A ND2  1 
ATOM   1574 H H    . ASN A 1 105 ? 5.443   -8.666  -1.232  1.00 13.36  ? 104 ASN A H    1 
ATOM   1575 H HA   . ASN A 1 105 ? 6.486   -6.756  0.214   1.00 13.44  ? 104 ASN A HA   1 
ATOM   1576 H HB2  . ASN A 1 105 ? 6.796   -9.552  0.425   1.00 15.78  ? 104 ASN A HB2  1 
ATOM   1577 H HB3  . ASN A 1 105 ? 7.288   -8.538  1.548   1.00 15.78  ? 104 ASN A HB3  1 
ATOM   1578 H HD21 . ASN A 1 105 ? 4.434   -8.220  3.082   1.00 26.54  ? 104 ASN A HD21 1 
ATOM   1579 H HD22 . ASN A 1 105 ? 5.853   -7.776  3.007   1.00 26.54  ? 104 ASN A HD22 1 
ATOM   1580 N N    . LEU A 1 106 ? 8.586   -8.288  -1.641  1.00 11.13  ? 105 LEU A N    1 
ATOM   1581 C CA   . LEU A 1 106 ? 9.920   -8.198  -2.200  1.00 10.22  ? 105 LEU A CA   1 
ATOM   1582 C C    . LEU A 1 106 ? 10.066  -6.993  -3.101  1.00 10.16  ? 105 LEU A C    1 
ATOM   1583 O O    . LEU A 1 106 ? 11.164  -6.410  -3.180  1.00 11.73  ? 105 LEU A O    1 
ATOM   1584 C CB   . LEU A 1 106 ? 10.261  -9.467  -2.964  1.00 14.60  ? 105 LEU A CB   1 
ATOM   1585 C CG   . LEU A 1 106 ? 10.279  -10.756 -2.137  1.00 18.14  ? 105 LEU A CG   1 
ATOM   1586 C CD1  . LEU A 1 106 ? 10.660  -11.906 -3.041  1.00 17.29  ? 105 LEU A CD1  1 
ATOM   1587 C CD2  . LEU A 1 106 ? 11.210  -10.643 -0.981  1.00 19.87  ? 105 LEU A CD2  1 
ATOM   1588 H H    . LEU A 1 106 ? 8.102   -8.911  -1.983  1.00 13.37  ? 105 LEU A H    1 
ATOM   1589 H HA   . LEU A 1 106 ? 10.558  -8.107  -1.475  1.00 12.27  ? 105 LEU A HA   1 
ATOM   1590 H HB2  . LEU A 1 106 ? 9.606   -9.585  -3.670  1.00 17.53  ? 105 LEU A HB2  1 
ATOM   1591 H HB3  . LEU A 1 106 ? 11.142  -9.361  -3.356  1.00 17.53  ? 105 LEU A HB3  1 
ATOM   1592 H HG   . LEU A 1 106 ? 9.388   -10.926 -1.792  1.00 21.78  ? 105 LEU A HG   1 
ATOM   1593 H HD11 . LEU A 1 106 ? 10.673  -12.725 -2.521  1.00 20.76  ? 105 LEU A HD11 1 
ATOM   1594 H HD12 . LEU A 1 106 ? 10.007  -11.976 -3.754  1.00 20.76  ? 105 LEU A HD12 1 
ATOM   1595 H HD13 . LEU A 1 106 ? 11.540  -11.736 -3.413  1.00 20.76  ? 105 LEU A HD13 1 
ATOM   1596 H HD21 . LEU A 1 106 ? 11.195  -11.474 -0.481  1.00 23.85  ? 105 LEU A HD21 1 
ATOM   1597 H HD22 . LEU A 1 106 ? 12.105  -10.471 -1.312  1.00 23.85  ? 105 LEU A HD22 1 
ATOM   1598 H HD23 . LEU A 1 106 ? 10.920  -9.911  -0.414  1.00 23.85  ? 105 LEU A HD23 1 
ATOM   1599 N N    . ILE A 1 107 ? 8.986   -6.572  -3.759  1.00 9.86   ? 106 ILE A N    1 
ATOM   1600 C CA   . ILE A 1 107 ? 9.050   -5.320  -4.500  1.00 9.92   ? 106 ILE A CA   1 
ATOM   1601 C C    . ILE A 1 107 ? 9.314   -4.163  -3.549  1.00 12.07  ? 106 ILE A C    1 
ATOM   1602 O O    . ILE A 1 107 ? 10.190  -3.329  -3.794  1.00 11.98  ? 106 ILE A O    1 
ATOM   1603 C CB   . ILE A 1 107 ? 7.764   -5.096  -5.316  1.00 11.07  ? 106 ILE A CB   1 
ATOM   1604 C CG1  . ILE A 1 107 ? 7.543   -6.211  -6.346  1.00 11.04  ? 106 ILE A CG1  1 
ATOM   1605 C CG2  . ILE A 1 107 ? 7.826   -3.714  -6.001  1.00 10.91  ? 106 ILE A CG2  1 
ATOM   1606 C CD1  . ILE A 1 107 ? 6.180   -6.118  -7.056  1.00 11.12  ? 106 ILE A CD1  1 
ATOM   1607 H H    . ILE A 1 107 ? 8.229   -6.980  -3.791  1.00 11.84  ? 106 ILE A H    1 
ATOM   1608 H HA   . ILE A 1 107 ? 9.791   -5.366  -5.124  1.00 11.91  ? 106 ILE A HA   1 
ATOM   1609 H HB   . ILE A 1 107 ? 7.012   -5.097  -4.704  1.00 13.30  ? 106 ILE A HB   1 
ATOM   1610 H HG12 . ILE A 1 107 ? 8.237   -6.157  -7.022  1.00 13.26  ? 106 ILE A HG12 1 
ATOM   1611 H HG13 . ILE A 1 107 ? 7.586   -7.069  -5.895  1.00 13.26  ? 106 ILE A HG13 1 
ATOM   1612 H HG21 . ILE A 1 107 ? 7.014   -3.578  -6.514  1.00 13.10  ? 106 ILE A HG21 1 
ATOM   1613 H HG22 . ILE A 1 107 ? 7.907   -3.028  -5.320  1.00 13.10  ? 106 ILE A HG22 1 
ATOM   1614 H HG23 . ILE A 1 107 ? 8.597   -3.688  -6.590  1.00 13.10  ? 106 ILE A HG23 1 
ATOM   1615 H HD11 . ILE A 1 107 ? 6.105   -6.848  -7.691  1.00 13.36  ? 106 ILE A HD11 1 
ATOM   1616 H HD12 . ILE A 1 107 ? 5.474   -6.180  -6.394  1.00 13.36  ? 106 ILE A HD12 1 
ATOM   1617 H HD13 . ILE A 1 107 ? 6.124   -5.268  -7.521  1.00 13.36  ? 106 ILE A HD13 1 
ATOM   1618 N N    . GLY A 1 108 ? 8.554   -4.082  -2.455  1.00 11.04  ? 107 GLY A N    1 
ATOM   1619 C CA   . GLY A 1 108 ? 8.738   -2.983  -1.516  1.00 11.37  ? 107 GLY A CA   1 
ATOM   1620 C C    . GLY A 1 108 ? 10.074  -3.031  -0.784  1.00 11.46  ? 107 GLY A C    1 
ATOM   1621 O O    . GLY A 1 108 ? 10.755  -2.009  -0.633  1.00 14.62  ? 107 GLY A O    1 
ATOM   1622 H H    . GLY A 1 108 ? 7.937   -4.641  -2.240  1.00 13.26  ? 107 GLY A H    1 
ATOM   1623 H HA2  . GLY A 1 108 ? 8.684   -2.141  -1.994  1.00 13.66  ? 107 GLY A HA2  1 
ATOM   1624 H HA3  . GLY A 1 108 ? 8.028   -3.004  -0.855  1.00 13.66  ? 107 GLY A HA3  1 
ATOM   1625 N N    . GLU A 1 109 ? 10.461  -4.207  -0.308  1.00 11.61  ? 108 GLU A N    1 
ATOM   1626 C CA   . GLU A 1 109 ? 11.626  -4.320  0.570   1.00 10.36  ? 108 GLU A CA   1 
ATOM   1627 C C    . GLU A 1 109 ? 12.942  -4.383  -0.195  1.00 12.98  ? 108 GLU A C    1 
ATOM   1628 O O    . GLU A 1 109 ? 13.995  -4.039  0.361   1.00 15.61  ? 108 GLU A O    1 
ATOM   1629 C CB   . GLU A 1 109 ? 11.496  -5.561  1.476   1.00 12.13  ? 108 GLU A CB   1 
ATOM   1630 C CG   . GLU A 1 109 ? 10.356  -5.368  2.475   1.00 10.91  ? 108 GLU A CG   1 
ATOM   1631 C CD   . GLU A 1 109 ? 9.809   -6.593  3.152   1.00 14.03  ? 108 GLU A CD   1 
ATOM   1632 O OE1  . GLU A 1 109 ? 10.313  -7.716  2.952   1.00 13.47  ? 108 GLU A OE1  1 
ATOM   1633 O OE2  . GLU A 1 109 ? 8.723   -6.441  3.782   1.00 13.29  ? 108 GLU A OE2  1 
ATOM   1634 H H    . GLU A 1 109 ? 10.070  -4.955  -0.476  1.00 13.94  ? 108 GLU A H    1 
ATOM   1635 H HA   . GLU A 1 109 ? 11.658  -3.539  1.144   1.00 12.44  ? 108 GLU A HA   1 
ATOM   1636 H HB2  . GLU A 1 109 ? 11.301  -6.341  0.933   1.00 14.57  ? 108 GLU A HB2  1 
ATOM   1637 H HB3  . GLU A 1 109 ? 12.321  -5.689  1.971   1.00 14.57  ? 108 GLU A HB3  1 
ATOM   1638 H HG2  . GLU A 1 109 ? 10.668  -4.773  3.175   1.00 13.11  ? 108 GLU A HG2  1 
ATOM   1639 H HG3  . GLU A 1 109 ? 9.617   -4.949  2.008   1.00 13.11  ? 108 GLU A HG3  1 
ATOM   1640 N N    . HIS A 1 110 ? 12.930  -4.832  -1.448  1.00 11.19  ? 109 HIS A N    1 
ATOM   1641 C CA   . HIS A 1 110 ? 14.177  -5.038  -2.176  1.00 11.71  ? 109 HIS A CA   1 
ATOM   1642 C C    . HIS A 1 110 ? 14.140  -4.478  -3.593  1.00 12.39  ? 109 HIS A C    1 
ATOM   1643 O O    . HIS A 1 110 ? 15.084  -4.688  -4.356  1.00 13.39  ? 109 HIS A O    1 
ATOM   1644 C CB   . HIS A 1 110 ? 14.499  -6.529  -2.240  1.00 11.46  ? 109 HIS A CB   1 
ATOM   1645 C CG   . HIS A 1 110 ? 14.589  -7.159  -0.899  1.00 9.72   ? 109 HIS A CG   1 
ATOM   1646 N ND1  . HIS A 1 110 ? 15.680  -6.994  -0.074  1.00 12.68  ? 109 HIS A ND1  1 
ATOM   1647 C CD2  . HIS A 1 110 ? 13.718  -7.935  -0.232  1.00 10.41  ? 109 HIS A CD2  1 
ATOM   1648 C CE1  . HIS A 1 110 ? 15.452  -7.628  1.065   1.00 14.26  ? 109 HIS A CE1  1 
ATOM   1649 N NE2  . HIS A 1 110 ? 14.272  -8.207  0.993   1.00 12.08  ? 109 HIS A NE2  1 
ATOM   1650 H H    . HIS A 1 110 ? 12.220  -5.023  -1.895  1.00 13.44  ? 109 HIS A H    1 
ATOM   1651 H HA   . HIS A 1 110 ? 14.896  -4.597  -1.699  1.00 14.06  ? 109 HIS A HA   1 
ATOM   1652 H HB2  . HIS A 1 110 ? 13.799  -6.982  -2.737  1.00 13.77  ? 109 HIS A HB2  1 
ATOM   1653 H HB3  . HIS A 1 110 ? 15.352  -6.649  -2.685  1.00 13.77  ? 109 HIS A HB3  1 
ATOM   1654 H HD2  . HIS A 1 110 ? 12.883  -8.211  -0.532  1.00 12.50  ? 109 HIS A HD2  1 
ATOM   1655 H HE1  . HIS A 1 110 ? 16.039  -7.679  1.785   1.00 17.13  ? 109 HIS A HE1  1 
ATOM   1656 H HE2  . HIS A 1 110 ? 13.917  -8.696  1.605   1.00 14.51  ? 109 HIS A HE2  1 
ATOM   1657 N N    . SER A 1 111 ? 13.060  -3.795  -3.968  1.00 11.40  ? 110 SER A N    1 
ATOM   1658 C CA   . SER A 1 111 ? 12.889  -3.308  -5.335  1.00 11.67  ? 110 SER A CA   1 
ATOM   1659 C C    . SER A 1 111 ? 13.125  -4.425  -6.347  1.00 13.15  ? 110 SER A C    1 
ATOM   1660 O O    . SER A 1 111 ? 13.745  -4.226  -7.390  1.00 13.85  ? 110 SER A O    1 
ATOM   1661 C CB   . SER A 1 111 ? 13.798  -2.118  -5.601  1.00 15.30  ? 110 SER A CB   1 
ATOM   1662 O OG   . SER A 1 111 ? 13.447  -1.061  -4.730  1.00 14.74  ? 110 SER A OG   1 
ATOM   1663 H H    . SER A 1 111 ? 12.406  -3.600  -3.445  1.00 13.69  ? 110 SER A H    1 
ATOM   1664 H HA   . SER A 1 111 ? 11.974  -3.006  -5.442  1.00 14.01  ? 110 SER A HA   1 
ATOM   1665 H HB2  . SER A 1 111 ? 14.719  -2.376  -5.439  1.00 18.37  ? 110 SER A HB2  1 
ATOM   1666 H HB3  . SER A 1 111 ? 13.686  -1.828  -6.520  1.00 18.37  ? 110 SER A HB3  1 
ATOM   1667 H HG   . SER A 1 111 ? 13.943  -0.397  -4.869  1.00 17.70  ? 110 SER A HG   1 
ATOM   1668 N N    . ASP A 1 112 ? 12.585  -5.613  -6.054  1.00 11.05  ? 111 ASP A N    1 
ATOM   1669 C CA   . ASP A 1 112 ? 12.820  -6.811  -6.859  1.00 11.78  ? 111 ASP A CA   1 
ATOM   1670 C C    . ASP A 1 112 ? 12.173  -6.660  -8.234  1.00 13.62  ? 111 ASP A C    1 
ATOM   1671 O O    . ASP A 1 112 ? 10.946  -6.620  -8.359  1.00 12.62  ? 111 ASP A O    1 
ATOM   1672 C CB   . ASP A 1 112 ? 12.298  -8.015  -6.073  1.00 13.60  ? 111 ASP A CB   1 
ATOM   1673 C CG   . ASP A 1 112 ? 12.503  -9.333  -6.767  1.00 17.03  ? 111 ASP A CG   1 
ATOM   1674 O OD1  . ASP A 1 112 ? 12.547  -9.391  -8.006  1.00 16.12  ? 111 ASP A OD1  1 
ATOM   1675 O OD2  . ASP A 1 112 ? 12.830  -10.308 -6.034  1.00 20.07  ? 111 ASP A OD2  1 
ATOM   1676 H H    . ASP A 1 112 ? 12.069  -5.750  -5.380  1.00 13.27  ? 111 ASP A H    1 
ATOM   1677 H HA   . ASP A 1 112 ? 13.775  -6.926  -6.987  1.00 14.15  ? 111 ASP A HA   1 
ATOM   1678 H HB2  . ASP A 1 112 ? 12.759  -8.054  -5.220  1.00 16.33  ? 111 ASP A HB2  1 
ATOM   1679 H HB3  . ASP A 1 112 ? 11.346  -7.902  -5.926  1.00 16.33  ? 111 ASP A HB3  1 
ATOM   1680 N N    . ALA A 1 113 ? 13.007  -6.535  -9.267  1.00 13.08  ? 112 ALA A N    1 
ATOM   1681 C CA   . ALA A 1 113 ? 12.511  -6.222  -10.595 1.00 12.12  ? 112 ALA A CA   1 
ATOM   1682 C C    . ALA A 1 113 ? 11.869  -7.415  -11.242 1.00 12.05  ? 112 ALA A C    1 
ATOM   1683 O O    . ALA A 1 113 ? 11.044  -7.245  -12.144 1.00 12.86  ? 112 ALA A O    1 
ATOM   1684 C CB   . ALA A 1 113 ? 13.641  -5.698  -11.478 1.00 12.92  ? 112 ALA A CB   1 
ATOM   1685 H H    . ALA A 1 113 ? 13.861  -6.628  -9.220  1.00 15.70  ? 112 ALA A H    1 
ATOM   1686 H HA   . ALA A 1 113 ? 11.840  -5.524  -10.523 1.00 14.56  ? 112 ALA A HA   1 
ATOM   1687 H HB1  . ALA A 1 113 ? 13.287  -5.496  -12.357 1.00 15.52  ? 112 ALA A HB1  1 
ATOM   1688 H HB2  . ALA A 1 113 ? 14.009  -4.895  -11.076 1.00 15.52  ? 112 ALA A HB2  1 
ATOM   1689 H HB3  . ALA A 1 113 ? 14.329  -6.379  -11.546 1.00 15.52  ? 112 ALA A HB3  1 
ATOM   1690 N N    . ALA A 1 114 ? 12.203  -8.620  -10.802 1.00 12.59  ? 113 ALA A N    1 
ATOM   1691 C CA   . ALA A 1 114 ? 11.539  -9.800  -11.328 1.00 13.94  ? 113 ALA A CA   1 
ATOM   1692 C C    . ALA A 1 114 ? 10.096  -9.869  -10.854 1.00 13.51  ? 113 ALA A C    1 
ATOM   1693 O O    . ALA A 1 114 ? 9.183   -10.140 -11.648 1.00 15.08  ? 113 ALA A O    1 
ATOM   1694 C CB   . ALA A 1 114 ? 12.319  -11.044 -10.912 1.00 18.02  ? 113 ALA A CB   1 
ATOM   1695 H H    . ALA A 1 114 ? 12.804  -8.780  -10.207 1.00 15.12  ? 113 ALA A H    1 
ATOM   1696 H HA   . ALA A 1 114 ? 11.536  -9.757  -12.297 1.00 16.74  ? 113 ALA A HA   1 
ATOM   1697 H HB1  . ALA A 1 114 ? 11.872  -11.829 -11.265 1.00 21.64  ? 113 ALA A HB1  1 
ATOM   1698 H HB2  . ALA A 1 114 ? 13.219  -10.986 -11.269 1.00 21.64  ? 113 ALA A HB2  1 
ATOM   1699 H HB3  . ALA A 1 114 ? 12.349  -11.088 -9.943  1.00 21.64  ? 113 ALA A HB3  1 
ATOM   1700 N N    . GLU A 1 115 ? 9.869   -9.595  -9.575  1.00 12.57  ? 114 GLU A N    1 
ATOM   1701 C CA   . GLU A 1 115 ? 8.509   -9.566  -9.062  1.00 12.28  ? 114 GLU A CA   1 
ATOM   1702 C C    . GLU A 1 115 ? 7.751   -8.378  -9.635  1.00 11.10  ? 114 GLU A C    1 
ATOM   1703 O O    . GLU A 1 115 ? 6.563   -8.485  -9.968  1.00 11.53  ? 114 GLU A O    1 
ATOM   1704 C CB   . GLU A 1 115 ? 8.509   -9.483  -7.536  1.00 12.24  ? 114 GLU A CB   1 
ATOM   1705 C CG   . GLU A 1 115 ? 9.220   -10.635 -6.863  1.00 13.58  ? 114 GLU A CG   1 
ATOM   1706 C CD   . GLU A 1 115 ? 8.593   -11.981 -7.139  1.00 18.18  ? 114 GLU A CD   1 
ATOM   1707 O OE1  . GLU A 1 115 ? 7.373   -12.101 -7.349  1.00 15.31  ? 114 GLU A OE1  1 
ATOM   1708 O OE2  . GLU A 1 115 ? 9.357   -12.973 -7.146  1.00 24.55  ? 114 GLU A OE2  1 
ATOM   1709 H H    . GLU A 1 115 ? 10.478  -9.425  -8.992  1.00 15.09  ? 114 GLU A H    1 
ATOM   1710 H HA   . GLU A 1 115 ? 8.049   -10.378 -9.324  1.00 14.74  ? 114 GLU A HA   1 
ATOM   1711 H HB2  . GLU A 1 115 ? 8.952   -8.663  -7.267  1.00 14.70  ? 114 GLU A HB2  1 
ATOM   1712 H HB3  . GLU A 1 115 ? 7.590   -9.478  -7.223  1.00 14.70  ? 114 GLU A HB3  1 
ATOM   1713 H HG2  . GLU A 1 115 ? 10.137  -10.665 -7.179  1.00 16.31  ? 114 GLU A HG2  1 
ATOM   1714 H HG3  . GLU A 1 115 ? 9.207   -10.493 -5.903  1.00 16.31  ? 114 GLU A HG3  1 
ATOM   1715 N N    . LEU A 1 116 ? 8.429   -7.285  -9.845  1.00 10.86  ? 115 LEU A N    1 
ATOM   1716 C CA   . LEU A 1 116 ? 7.819   -6.167  -10.509 1.00 11.32  ? 115 LEU A CA   1 
ATOM   1717 C C    . LEU A 1 116 ? 7.397   -6.580  -11.929 1.00 10.36  ? 115 LEU A C    1 
ATOM   1718 O O    . LEU A 1 116 ? 6.381   -6.248  -12.335 1.00 11.16  ? 115 LEU A O    1 
ATOM   1719 C CB   . LEU A 1 116 ? 8.746   -4.944  -10.553 1.00 12.58  ? 115 LEU A CB   1 
ATOM   1720 C CG   . LEU A 1 116 ? 8.216   -3.712  -11.186 1.00 25.88  ? 115 LEU A CG   1 
ATOM   1721 C CD1  . LEU A 1 116 ? 7.054   -3.284  -10.329 1.00 24.70  ? 115 LEU A CD1  1 
ATOM   1722 C CD2  . LEU A 1 116 ? 9.251   -2.583  -11.277 1.00 25.71  ? 115 LEU A CD2  1 
ATOM   1723 H H    . LEU A 1 116 ? 9.203   -7.163  -9.611  1.00 13.05  ? 115 LEU A H    1 
ATOM   1724 H HA   . LEU A 1 116 ? 7.026   -5.907  -10.037 1.00 13.60  ? 115 LEU A HA   1 
ATOM   1725 H HB2  . LEU A 1 116 ? 8.938   -4.697  -9.657  1.00 15.10  ? 115 LEU A HB2  1 
ATOM   1726 H HB3  . LEU A 1 116 ? 9.548   -5.176  -11.000 1.00 15.10  ? 115 LEU A HB3  1 
ATOM   1727 H HG   . LEU A 1 116 ? 7.889   -3.927  -12.058 1.00 31.06  ? 115 LEU A HG   1 
ATOM   1728 H HD11 . LEU A 1 116 ? 6.468   -2.763  -10.863 1.00 30.86  ? 115 LEU A HD11 1 
ATOM   1729 H HD12 . LEU A 1 116 ? 6.573   -4.025  -9.978  1.00 30.86  ? 115 LEU A HD12 1 
ATOM   1730 H HD13 . LEU A 1 116 ? 7.397   -2.777  -9.605  1.00 30.86  ? 115 LEU A HD13 1 
ATOM   1731 H HD21 . LEU A 1 116 ? 8.792   -1.768  -11.422 1.00 29.65  ? 115 LEU A HD21 1 
ATOM   1732 H HD22 . LEU A 1 116 ? 9.722   -2.543  -10.450 1.00 29.65  ? 115 LEU A HD22 1 
ATOM   1733 H HD23 . LEU A 1 116 ? 9.854   -2.741  -11.991 1.00 29.65  ? 115 LEU A HD23 1 
ATOM   1734 N N    . GLY A 1 117 ? 8.250   -7.283  -12.650 1.00 10.45  ? 116 GLY A N    1 
ATOM   1735 C CA   . GLY A 1 117 ? 7.892   -7.754  -13.981 1.00 11.10  ? 116 GLY A CA   1 
ATOM   1736 C C    . GLY A 1 117 ? 6.635   -8.594  -13.982 1.00 11.80  ? 116 GLY A C    1 
ATOM   1737 O O    . GLY A 1 117 ? 5.798   -8.469  -14.882 1.00 11.02  ? 116 GLY A O    1 
ATOM   1738 H H    . GLY A 1 117 ? 9.041   -7.503  -12.394 1.00 12.55  ? 116 GLY A H    1 
ATOM   1739 H HA2  . GLY A 1 117 ? 7.753   -6.993  -14.566 1.00 13.33  ? 116 GLY A HA2  1 
ATOM   1740 H HA3  . GLY A 1 117 ? 8.618   -8.289  -14.339 1.00 13.33  ? 116 GLY A HA3  1 
ATOM   1741 N N    . ARG A 1 118 ? 6.465   -9.446  -12.965 1.00 11.47  ? 117 ARG A N    1 
ATOM   1742 C CA   . ARG A 1 118 ? 5.249   -10.240 -12.830 1.00 9.76   ? 117 ARG A CA   1 
ATOM   1743 C C    . ARG A 1 118 ? 4.018   -9.370  -12.605 1.00 11.52  ? 117 ARG A C    1 
ATOM   1744 O O    . ARG A 1 118 ? 2.937   -9.645  -13.150 1.00 11.78  ? 117 ARG A O    1 
ATOM   1745 C CB   . ARG A 1 118 ? 5.389   -11.255 -11.700 1.00 13.76  ? 117 ARG A CB   1 
ATOM   1746 C CG   . ARG A 1 118 ? 6.303   -12.398 -12.057 1.00 23.88  ? 117 ARG A CG   1 
ATOM   1747 C CD   . ARG A 1 118 ? 6.259   -13.499 -10.999 1.00 35.13  ? 117 ARG A CD   1 
ATOM   1748 N NE   . ARG A 1 118 ? 6.997   -14.663 -11.475 1.00 62.46  ? 117 ARG A NE   1 
ATOM   1749 C CZ   . ARG A 1 118 ? 6.464   -15.590 -12.273 1.00 73.22  ? 117 ARG A CZ   1 
ATOM   1750 N NH1  . ARG A 1 118 ? 5.204   -15.479 -12.686 1.00 60.10  ? 117 ARG A NH1  1 
ATOM   1751 N NH2  . ARG A 1 118 ? 7.187   -16.623 -12.682 1.00 76.41  ? 117 ARG A NH2  1 
ATOM   1752 H H    . ARG A 1 118 ? 7.043   -9.579  -12.342 1.00 13.78  ? 117 ARG A H    1 
ATOM   1753 H HA   . ARG A 1 118 ? 5.111   -10.736 -13.652 1.00 11.73  ? 117 ARG A HA   1 
ATOM   1754 H HB2  . ARG A 1 118 ? 5.754   -10.811 -10.919 1.00 16.52  ? 117 ARG A HB2  1 
ATOM   1755 H HB3  . ARG A 1 118 ? 4.515   -11.622 -11.495 1.00 16.52  ? 117 ARG A HB3  1 
ATOM   1756 H HG2  . ARG A 1 118 ? 6.024   -12.779 -12.904 1.00 28.67  ? 117 ARG A HG2  1 
ATOM   1757 H HG3  . ARG A 1 118 ? 7.214   -12.072 -12.119 1.00 28.67  ? 117 ARG A HG3  1 
ATOM   1758 H HD2  . ARG A 1 118 ? 6.673   -13.183 -10.181 1.00 42.16  ? 117 ARG A HD2  1 
ATOM   1759 H HD3  . ARG A 1 118 ? 5.339   -13.760 -10.838 1.00 42.16  ? 117 ARG A HD3  1 
ATOM   1760 H HE   . ARG A 1 118 ? 7.756   -14.835 -11.109 1.00 74.96  ? 117 ARG A HE   1 
ATOM   1761 H HH11 . ARG A 1 118 ? 4.725   -14.812 -12.431 1.00 72.13  ? 117 ARG A HH11 1 
ATOM   1762 H HH12 . ARG A 1 118 ? 4.866   -16.079 -13.202 1.00 72.13  ? 117 ARG A HH12 1 
ATOM   1763 H HH21 . ARG A 1 118 ? 8.004   -16.706 -12.423 1.00 91.70  ? 117 ARG A HH21 1 
ATOM   1764 H HH22 . ARG A 1 118 ? 6.837   -17.216 -13.197 1.00 91.70  ? 117 ARG A HH22 1 
ATOM   1765 N N    . MET A 1 119 ? 4.136   -8.334  -11.789 1.00 10.62  ? 118 MET A N    1 
ATOM   1766 C CA   A MET A 1 119 ? 3.003   -7.428  -11.622 0.50 10.20  ? 118 MET A CA   1 
ATOM   1767 C CA   B MET A 1 119 ? 2.999   -7.437  -11.626 0.50 10.21  ? 118 MET A CA   1 
ATOM   1768 C C    . MET A 1 119 ? 2.688   -6.695  -12.914 1.00 9.97   ? 118 MET A C    1 
ATOM   1769 O O    . MET A 1 119 ? 1.516   -6.548  -13.276 1.00 10.08  ? 118 MET A O    1 
ATOM   1770 C CB   A MET A 1 119 ? 3.289   -6.431  -10.510 0.50 14.43  ? 118 MET A CB   1 
ATOM   1771 C CB   B MET A 1 119 ? 3.255   -6.448  -10.508 0.50 14.40  ? 118 MET A CB   1 
ATOM   1772 C CG   A MET A 1 119 ? 2.749   -6.863  -9.203  0.50 20.53  ? 118 MET A CG   1 
ATOM   1773 C CG   B MET A 1 119 ? 1.982   -5.907  -10.012 0.50 9.02   ? 118 MET A CG   1 
ATOM   1774 S SD   A MET A 1 119 ? 2.366   -5.479  -8.155  0.50 12.95  ? 118 MET A SD   1 
ATOM   1775 S SD   B MET A 1 119 ? 1.506   -6.850  -8.554  0.50 15.95  ? 118 MET A SD   1 
ATOM   1776 C CE   A MET A 1 119 ? 0.662   -5.118  -8.476  0.50 14.78  ? 118 MET A CE   1 
ATOM   1777 C CE   B MET A 1 119 ? 1.153   -5.392  -7.579  0.50 15.38  ? 118 MET A CE   1 
ATOM   1778 H H    A MET A 1 119 ? 4.836   -8.135  -11.332 0.50 12.75  ? 118 MET A H    1 
ATOM   1779 H HA   . MET A 1 119 ? 2.225   -7.955  -11.370 1.00 12.26  ? 118 MET A HA   1 
ATOM   1780 H HB2  A MET A 1 119 ? 4.249   -6.326  -10.418 0.50 17.32  ? 118 MET A HB2  1 
ATOM   1781 H HB2  B MET A 1 119 ? 3.706   -6.896  -9.776  0.50 17.29  ? 118 MET A HB2  1 
ATOM   1782 H HB3  A MET A 1 119 ? 2.882   -5.580  -10.736 0.50 17.32  ? 118 MET A HB3  1 
ATOM   1783 H HB3  B MET A 1 119 ? 3.794   -5.714  -10.842 0.50 17.29  ? 118 MET A HB3  1 
ATOM   1784 H HG2  A MET A 1 119 ? 1.933   -7.369  -9.346  0.50 24.64  ? 118 MET A HG2  1 
ATOM   1785 H HG2  B MET A 1 119 ? 2.093   -4.976  -9.763  0.50 10.84  ? 118 MET A HG2  1 
ATOM   1786 H HG3  A MET A 1 119 ? 3.408   -7.412  -8.750  0.50 24.64  ? 118 MET A HG3  1 
ATOM   1787 H HG3  B MET A 1 119 ? 1.295   -6.005  -10.689 0.50 10.84  ? 118 MET A HG3  1 
ATOM   1788 H HE1  A MET A 1 119 ? 0.391   -4.365  -7.929  0.50 17.75  ? 118 MET A HE1  1 
ATOM   1789 H HE1  B MET A 1 119 ? 0.859   -5.667  -6.696  0.50 18.47  ? 118 MET A HE1  1 
ATOM   1790 H HE2  A MET A 1 119 ? 0.557   -4.901  -9.415  0.50 17.75  ? 118 MET A HE2  1 
ATOM   1791 H HE2  B MET A 1 119 ? 1.958   -4.857  -7.509  0.50 18.47  ? 118 MET A HE2  1 
ATOM   1792 H HE3  A MET A 1 119 ? 0.128   -5.897  -8.255  0.50 17.75  ? 118 MET A HE3  1 
ATOM   1793 H HE3  B MET A 1 119 ? 0.453   -4.882  -8.017  0.50 18.47  ? 118 MET A HE3  1 
ATOM   1794 N N    . LEU A 1 120 ? 3.719   -6.223  -13.623 1.00 9.13   ? 119 LEU A N    1 
ATOM   1795 C CA   . LEU A 1 120 ? 3.470   -5.558  -14.888 1.00 10.01  ? 119 LEU A CA   1 
ATOM   1796 C C    . LEU A 1 120 ? 2.819   -6.516  -15.875 1.00 9.99   ? 119 LEU A C    1 
ATOM   1797 O O    . LEU A 1 120 ? 1.970   -6.101  -16.658 1.00 9.57   ? 119 LEU A O    1 
ATOM   1798 C CB   . LEU A 1 120 ? 4.744   -4.970  -15.485 1.00 9.38   ? 119 LEU A CB   1 
ATOM   1799 C CG   . LEU A 1 120 ? 5.399   -3.867  -14.633 1.00 10.68  ? 119 LEU A CG   1 
ATOM   1800 C CD1  . LEU A 1 120 ? 6.661   -3.367  -15.355 1.00 10.99  ? 119 LEU A CD1  1 
ATOM   1801 C CD2  . LEU A 1 120 ? 4.487   -2.722  -14.264 1.00 10.85  ? 119 LEU A CD2  1 
ATOM   1802 H H    . LEU A 1 120 ? 4.546   -6.277  -13.395 1.00 10.97  ? 119 LEU A H    1 
ATOM   1803 H HA   . LEU A 1 120 ? 2.852   -4.826  -14.737 1.00 12.02  ? 119 LEU A HA   1 
ATOM   1804 H HB2  . LEU A 1 120 ? 5.394   -5.682  -15.593 1.00 11.26  ? 119 LEU A HB2  1 
ATOM   1805 H HB3  . LEU A 1 120 ? 4.533   -4.586  -16.350 1.00 11.26  ? 119 LEU A HB3  1 
ATOM   1806 H HG   . LEU A 1 120 ? 5.693   -4.271  -13.801 1.00 12.82  ? 119 LEU A HG   1 
ATOM   1807 H HD11 . LEU A 1 120 ? 7.076   -2.672  -14.820 1.00 13.20  ? 119 LEU A HD11 1 
ATOM   1808 H HD12 . LEU A 1 120 ? 7.276   -4.109  -15.467 1.00 13.20  ? 119 LEU A HD12 1 
ATOM   1809 H HD13 . LEU A 1 120 ? 6.409   -3.012  -16.222 1.00 13.20  ? 119 LEU A HD13 1 
ATOM   1810 H HD21 . LEU A 1 120 ? 4.984   -2.082  -13.732 1.00 13.03  ? 119 LEU A HD21 1 
ATOM   1811 H HD22 . LEU A 1 120 ? 4.166   -2.300  -15.076 1.00 13.03  ? 119 LEU A HD22 1 
ATOM   1812 H HD23 . LEU A 1 120 ? 3.738   -3.068  -13.752 1.00 13.03  ? 119 LEU A HD23 1 
ATOM   1813 N N    . GLN A 1 121 ? 3.211   -7.800  -15.859 1.00 10.16  ? 120 GLN A N    1 
ATOM   1814 C CA   . GLN A 1 121 ? 2.576   -8.802  -16.714 1.00 8.97   ? 120 GLN A CA   1 
ATOM   1815 C C    . GLN A 1 121 ? 1.076   -8.923  -16.430 1.00 10.01  ? 120 GLN A C    1 
ATOM   1816 O O    . GLN A 1 121 ? 0.266   -9.041  -17.354 1.00 8.86   ? 120 GLN A O    1 
ATOM   1817 C CB   . GLN A 1 121 ? 3.288   -10.143 -16.514 1.00 10.60  ? 120 GLN A CB   1 
ATOM   1818 C CG   . GLN A 1 121 ? 2.805   -11.247 -17.403 1.00 12.13  ? 120 GLN A CG   1 
ATOM   1819 C CD   . GLN A 1 121 ? 3.523   -12.529 -17.118 1.00 14.97  ? 120 GLN A CD   1 
ATOM   1820 O OE1  . GLN A 1 121 ? 4.157   -12.686 -16.069 1.00 17.16  ? 120 GLN A OE1  1 
ATOM   1821 N NE2  . GLN A 1 121 ? 3.560   -13.409 -18.111 1.00 16.27  ? 120 GLN A NE2  1 
ATOM   1822 H H    . GLN A 1 121 ? 3.841   -8.110  -15.362 1.00 12.20  ? 120 GLN A H    1 
ATOM   1823 H HA   . GLN A 1 121 ? 2.684   -8.540  -17.641 1.00 10.78  ? 120 GLN A HA   1 
ATOM   1824 H HB2  . GLN A 1 121 ? 4.234   -10.019 -16.688 1.00 12.73  ? 120 GLN A HB2  1 
ATOM   1825 H HB3  . GLN A 1 121 ? 3.160   -10.428 -15.596 1.00 12.73  ? 120 GLN A HB3  1 
ATOM   1826 H HG2  . GLN A 1 121 ? 1.858   -11.389 -17.252 1.00 14.57  ? 120 GLN A HG2  1 
ATOM   1827 H HG3  . GLN A 1 121 ? 2.966   -11.008 -18.329 1.00 14.57  ? 120 GLN A HG3  1 
ATOM   1828 H HE21 . GLN A 1 121 ? 3.127   -13.256 -18.838 1.00 19.54  ? 120 GLN A HE21 1 
ATOM   1829 H HE22 . GLN A 1 121 ? 3.970   -14.158 -18.005 1.00 19.54  ? 120 GLN A HE22 1 
ATOM   1830 N N    . LEU A 1 122 ? 0.685   -8.863  -15.168 1.00 9.73   ? 121 LEU A N    1 
ATOM   1831 C CA   . LEU A 1 122 ? -0.747  -8.900  -14.862 1.00 9.92   ? 121 LEU A CA   1 
ATOM   1832 C C    . LEU A 1 122 ? -1.463  -7.680  -15.426 1.00 9.42   ? 121 LEU A C    1 
ATOM   1833 O O    . LEU A 1 122 ? -2.587  -7.786  -15.942 1.00 10.50  ? 121 LEU A O    1 
ATOM   1834 C CB   . LEU A 1 122 ? -0.967  -8.973  -13.362 1.00 10.26  ? 121 LEU A CB   1 
ATOM   1835 C CG   . LEU A 1 122 ? -0.516  -10.234 -12.629 1.00 13.17  ? 121 LEU A CG   1 
ATOM   1836 C CD1  . LEU A 1 122 ? -0.786  -10.111 -11.130 1.00 13.65  ? 121 LEU A CD1  1 
ATOM   1837 C CD2  . LEU A 1 122 ? -1.195  -11.449 -13.201 1.00 14.93  ? 121 LEU A CD2  1 
ATOM   1838 H H    . LEU A 1 122 ? 1.204   -8.801  -14.486 1.00 11.68  ? 121 LEU A H    1 
ATOM   1839 H HA   . LEU A 1 122 ? -1.138  -9.692  -15.263 1.00 11.92  ? 121 LEU A HA   1 
ATOM   1840 H HB2  . LEU A 1 122 ? -0.497  -8.228  -12.956 1.00 12.32  ? 121 LEU A HB2  1 
ATOM   1841 H HB3  . LEU A 1 122 ? -1.918  -8.876  -13.196 1.00 12.32  ? 121 LEU A HB3  1 
ATOM   1842 H HG   . LEU A 1 122 ? 0.440   -10.343 -12.750 1.00 15.81  ? 121 LEU A HG   1 
ATOM   1843 H HD11 . LEU A 1 122 ? -0.491  -10.923 -10.689 1.00 16.39  ? 121 LEU A HD11 1 
ATOM   1844 H HD12 . LEU A 1 122 ? -0.297  -9.349  -10.783 1.00 16.39  ? 121 LEU A HD12 1 
ATOM   1845 H HD13 . LEU A 1 122 ? -1.738  -9.985  -10.991 1.00 16.39  ? 121 LEU A HD13 1 
ATOM   1846 H HD21 . LEU A 1 122 ? -0.893  -12.235 -12.720 1.00 17.93  ? 121 LEU A HD21 1 
ATOM   1847 H HD22 . LEU A 1 122 ? -2.154  -11.349 -13.103 1.00 17.93  ? 121 LEU A HD22 1 
ATOM   1848 H HD23 . LEU A 1 122 ? -0.964  -11.526 -14.140 1.00 17.93  ? 121 LEU A HD23 1 
ATOM   1849 N N    . ILE A 1 123 ? -0.836  -6.510  -15.332 1.00 9.58   ? 122 ILE A N    1 
ATOM   1850 C CA   . ILE A 1 123 ? -1.416  -5.282  -15.877 1.00 10.22  ? 122 ILE A CA   1 
ATOM   1851 C C    . ILE A 1 123 ? -1.534  -5.373  -17.397 1.00 9.84   ? 122 ILE A C    1 
ATOM   1852 O O    . ILE A 1 123 ? -2.587  -5.029  -17.964 1.00 9.28   ? 122 ILE A O    1 
ATOM   1853 C CB   . ILE A 1 123 ? -0.600  -4.056  -15.400 1.00 9.78   ? 122 ILE A CB   1 
ATOM   1854 C CG1  . ILE A 1 123 ? -0.735  -3.897  -13.880 1.00 11.86  ? 122 ILE A CG1  1 
ATOM   1855 C CG2  . ILE A 1 123 ? -1.095  -2.773  -16.081 1.00 10.30  ? 122 ILE A CG2  1 
ATOM   1856 C CD1  . ILE A 1 123 ? 0.204   -2.873  -13.276 1.00 10.87  ? 122 ILE A CD1  1 
ATOM   1857 H H    . ILE A 1 123 ? -0.071  -6.399  -14.956 1.00 11.51  ? 122 ILE A H    1 
ATOM   1858 H HA   . ILE A 1 123 ? -2.314  -5.186  -15.524 1.00 12.27  ? 122 ILE A HA   1 
ATOM   1859 H HB   . ILE A 1 123 ? 0.334   -4.192  -15.622 1.00 11.74  ? 122 ILE A HB   1 
ATOM   1860 H HG12 . ILE A 1 123 ? -1.642  -3.623  -13.675 1.00 14.24  ? 122 ILE A HG12 1 
ATOM   1861 H HG13 . ILE A 1 123 ? -0.548  -4.752  -13.461 1.00 14.24  ? 122 ILE A HG13 1 
ATOM   1862 H HG21 . ILE A 1 123 ? -0.567  -2.024  -15.763 1.00 12.37  ? 122 ILE A HG21 1 
ATOM   1863 H HG22 . ILE A 1 123 ? -0.993  -2.866  -17.041 1.00 12.37  ? 122 ILE A HG22 1 
ATOM   1864 H HG23 . ILE A 1 123 ? -2.029  -2.637  -15.858 1.00 12.37  ? 122 ILE A HG23 1 
ATOM   1865 H HD11 . ILE A 1 123 ? 0.055   -2.835  -12.318 1.00 13.05  ? 122 ILE A HD11 1 
ATOM   1866 H HD12 . ILE A 1 123 ? 1.119   -3.137  -13.459 1.00 13.05  ? 122 ILE A HD12 1 
ATOM   1867 H HD13 . ILE A 1 123 ? 0.024   -2.007  -13.674 1.00 13.05  ? 122 ILE A HD13 1 
ATOM   1868 N N    . LEU A 1 124 ? -0.488  -5.863  -18.077 1.00 8.67   ? 123 LEU A N    1 
ATOM   1869 C CA   . LEU A 1 124 ? -0.580  -6.210  -19.495 1.00 8.51   ? 123 LEU A CA   1 
ATOM   1870 C C    . LEU A 1 124 ? -1.763  -7.128  -19.772 1.00 8.96   ? 123 LEU A C    1 
ATOM   1871 O O    . LEU A 1 124 ? -2.509  -6.911  -20.732 1.00 10.02  ? 123 LEU A O    1 
ATOM   1872 C CB   . LEU A 1 124 ? 0.730   -6.855  -19.942 1.00 8.67   ? 123 LEU A CB   1 
ATOM   1873 C CG   . LEU A 1 124 ? 0.778   -7.297  -21.405 1.00 10.11  ? 123 LEU A CG   1 
ATOM   1874 C CD1  . LEU A 1 124 ? 0.728   -6.121  -22.336 1.00 10.90  ? 123 LEU A CD1  1 
ATOM   1875 C CD2  . LEU A 1 124 ? 1.988   -8.173  -21.653 1.00 12.28  ? 123 LEU A CD2  1 
ATOM   1876 H H    . LEU A 1 124 ? 0.288   -6.002  -17.734 1.00 10.42  ? 123 LEU A H    1 
ATOM   1877 H HA   . LEU A 1 124 ? -0.705  -5.398  -20.011 1.00 10.22  ? 123 LEU A HA   1 
ATOM   1878 H HB2  . LEU A 1 124 ? 1.448   -6.218  -19.807 1.00 10.42  ? 123 LEU A HB2  1 
ATOM   1879 H HB3  . LEU A 1 124 ? 0.887   -7.641  -19.395 1.00 10.42  ? 123 LEU A HB3  1 
ATOM   1880 H HG   . LEU A 1 124 ? -0.007  -7.838  -21.584 1.00 12.14  ? 123 LEU A HG   1 
ATOM   1881 H HD11 . LEU A 1 124 ? 0.761   -6.441  -23.251 1.00 13.09  ? 123 LEU A HD11 1 
ATOM   1882 H HD12 . LEU A 1 124 ? -0.097  -5.634  -22.185 1.00 13.09  ? 123 LEU A HD12 1 
ATOM   1883 H HD13 . LEU A 1 124 ? 1.489   -5.546  -22.159 1.00 13.09  ? 123 LEU A HD13 1 
ATOM   1884 H HD21 . LEU A 1 124 ? 1.998   -8.441  -22.585 1.00 14.74  ? 123 LEU A HD21 1 
ATOM   1885 H HD22 . LEU A 1 124 ? 2.790   -7.669  -21.445 1.00 14.74  ? 123 LEU A HD22 1 
ATOM   1886 H HD23 . LEU A 1 124 ? 1.933   -8.956  -21.084 1.00 14.74  ? 123 LEU A HD23 1 
ATOM   1887 N N    . GLY A 1 125 ? -1.946  -8.148  -18.948 1.00 9.49   ? 124 GLY A N    1 
ATOM   1888 C CA   . GLY A 1 125 ? -3.099  -9.034  -19.113 1.00 10.06  ? 124 GLY A CA   1 
ATOM   1889 C C    . GLY A 1 125 ? -4.430  -8.312  -19.026 1.00 10.74  ? 124 GLY A C    1 
ATOM   1890 O O    . GLY A 1 125 ? -5.386  -8.655  -19.737 1.00 11.75  ? 124 GLY A O    1 
ATOM   1891 H H    . GLY A 1 125 ? -1.428  -8.351  -18.293 1.00 11.40  ? 124 GLY A H    1 
ATOM   1892 H HA2  . GLY A 1 125 ? -3.046  -9.471  -19.978 1.00 12.08  ? 124 GLY A HA2  1 
ATOM   1893 H HA3  . GLY A 1 125 ? -3.078  -9.718  -18.425 1.00 12.08  ? 124 GLY A HA3  1 
ATOM   1894 N N    . CYS A 1 126 ? -4.515  -7.300  -18.172 1.00 9.65   ? 125 CYS A N    1 
ATOM   1895 C CA   . CYS A 1 126 ? -5.722  -6.492  -18.124 1.00 9.68   ? 125 CYS A CA   1 
ATOM   1896 C C    . CYS A 1 126 ? -5.923  -5.749  -19.433 1.00 11.36  ? 125 CYS A C    1 
ATOM   1897 O O    . CYS A 1 126 ? -7.028  -5.707  -19.980 1.00 11.66  ? 125 CYS A O    1 
ATOM   1898 C CB   . CYS A 1 126 ? -5.664  -5.506  -16.952 1.00 9.54   ? 125 CYS A CB   1 
ATOM   1899 S SG   . CYS A 1 126 ? -5.690  -6.272  -15.313 1.00 11.62  ? 125 CYS A SG   1 
ATOM   1900 H H    . CYS A 1 126 ? -3.899  -7.064  -17.619 1.00 11.59  ? 125 CYS A H    1 
ATOM   1901 H HA   . CYS A 1 126 ? -6.486  -7.074  -17.989 1.00 11.62  ? 125 CYS A HA   1 
ATOM   1902 H HB2  . CYS A 1 126 ? -4.844  -4.991  -17.022 1.00 11.46  ? 125 CYS A HB2  1 
ATOM   1903 H HB3  . CYS A 1 126 ? -6.428  -4.911  -17.011 1.00 11.46  ? 125 CYS A HB3  1 
ATOM   1904 H HG   . CYS A 1 126 ? -4.742  -7.000  -15.207 1.00 13.96  ? 125 CYS A HG   1 
ATOM   1905 N N    . ALA A 1 127 ? -4.869  -5.118  -19.933 1.00 9.59   ? 126 ALA A N    1 
ATOM   1906 C CA   . ALA A 1 127 ? -5.013  -4.323  -21.137 1.00 9.64   ? 126 ALA A CA   1 
ATOM   1907 C C    . ALA A 1 127 ? -5.403  -5.183  -22.339 1.00 10.01  ? 126 ALA A C    1 
ATOM   1908 O O    . ALA A 1 127 ? -6.211  -4.751  -23.175 1.00 11.57  ? 126 ALA A O    1 
ATOM   1909 C CB   . ALA A 1 127 ? -3.739  -3.561  -21.434 1.00 8.20   ? 126 ALA A CB   1 
ATOM   1910 H H    . ALA A 1 127 ? -4.076  -5.135  -19.600 1.00 11.52  ? 126 ALA A H    1 
ATOM   1911 H HA   . ALA A 1 127 ? -5.720  -3.674  -20.998 1.00 11.58  ? 126 ALA A HA   1 
ATOM   1912 H HB1  . ALA A 1 127 ? -3.864  -3.040  -22.242 1.00 9.85   ? 126 ALA A HB1  1 
ATOM   1913 H HB2  . ALA A 1 127 ? -3.542  -2.973  -20.688 1.00 9.85   ? 126 ALA A HB2  1 
ATOM   1914 H HB3  . ALA A 1 127 ? -3.014  -4.194  -21.557 1.00 9.85   ? 126 ALA A HB3  1 
ATOM   1915 N N    . VAL A 1 128 ? -4.816  -6.376  -22.489 1.00 9.27   ? 127 VAL A N    1 
ATOM   1916 C CA   . VAL A 1 128 ? -5.107  -7.150  -23.695 1.00 9.95   ? 127 VAL A CA   1 
ATOM   1917 C C    . VAL A 1 128 ? -6.374  -7.980  -23.573 1.00 12.99  ? 127 VAL A C    1 
ATOM   1918 O O    . VAL A 1 128 ? -6.696  -8.720  -24.513 1.00 12.84  ? 127 VAL A O    1 
ATOM   1919 C CB   . VAL A 1 128 ? -3.896  -8.005  -24.112 1.00 12.12  ? 127 VAL A CB   1 
ATOM   1920 C CG1  . VAL A 1 128 ? -2.717  -7.122  -24.344 1.00 15.27  ? 127 VAL A CG1  1 
ATOM   1921 C CG2  . VAL A 1 128 ? -3.600  -9.101  -23.132 1.00 13.45  ? 127 VAL A CG2  1 
ATOM   1922 H H    . VAL A 1 128 ? -4.270  -6.743  -21.935 1.00 11.13  ? 127 VAL A H    1 
ATOM   1923 H HA   . VAL A 1 128 ? -5.260  -6.519  -24.416 1.00 11.96  ? 127 VAL A HA   1 
ATOM   1924 H HB   . VAL A 1 128 ? -4.105  -8.429  -24.958 1.00 14.56  ? 127 VAL A HB   1 
ATOM   1925 H HG11 . VAL A 1 128 ? -1.960  -7.670  -24.606 1.00 18.33  ? 127 VAL A HG11 1 
ATOM   1926 H HG12 . VAL A 1 128 ? -2.930  -6.492  -25.050 1.00 18.33  ? 127 VAL A HG12 1 
ATOM   1927 H HG13 . VAL A 1 128 ? -2.513  -6.646  -23.524 1.00 18.33  ? 127 VAL A HG13 1 
ATOM   1928 H HG21 . VAL A 1 128 ? -2.832  -9.605  -23.444 1.00 16.15  ? 127 VAL A HG21 1 
ATOM   1929 H HG22 . VAL A 1 128 ? -3.409  -8.708  -22.266 1.00 16.15  ? 127 VAL A HG22 1 
ATOM   1930 H HG23 . VAL A 1 128 ? -4.374  -9.683  -23.067 1.00 16.15  ? 127 VAL A HG23 1 
ATOM   1931 N N    . ASN A 1 129 ? -7.111  -7.862  -22.466 1.00 10.38  ? 128 ASN A N    1 
ATOM   1932 C CA   . ASN A 1 129 ? -8.408  -8.522  -22.302 1.00 11.01  ? 128 ASN A CA   1 
ATOM   1933 C C    . ASN A 1 129 ? -9.534  -7.557  -21.995 1.00 15.13  ? 128 ASN A C    1 
ATOM   1934 O O    . ASN A 1 129 ? -10.684 -7.994  -21.923 1.00 15.28  ? 128 ASN A O    1 
ATOM   1935 C CB   . ASN A 1 129 ? -8.307  -9.579  -21.195 1.00 13.84  ? 128 ASN A CB   1 
ATOM   1936 C CG   . ASN A 1 129 ? -7.564  -10.815 -21.631 1.00 14.80  ? 128 ASN A CG   1 
ATOM   1937 O OD1  . ASN A 1 129 ? -7.984  -11.532 -22.550 1.00 18.99  ? 128 ASN A OD1  1 
ATOM   1938 N ND2  . ASN A 1 129 ? -6.356  -10.968 -21.112 1.00 14.46  ? 128 ASN A ND2  1 
ATOM   1939 H H    . ASN A 1 129 ? -6.875  -7.397  -21.782 1.00 12.46  ? 128 ASN A H    1 
ATOM   1940 H HA   . ASN A 1 129 ? -8.630  -8.979  -23.128 1.00 13.22  ? 128 ASN A HA   1 
ATOM   1941 H HB2  . ASN A 1 129 ? -7.837  -9.199  -20.437 1.00 16.62  ? 128 ASN A HB2  1 
ATOM   1942 H HB3  . ASN A 1 129 ? -9.202  -9.846  -20.930 1.00 16.62  ? 128 ASN A HB3  1 
ATOM   1943 H HD21 . ASN A 1 129 ? -5.876  -11.646 -21.334 1.00 17.36  ? 128 ASN A HD21 1 
ATOM   1944 H HD22 . ASN A 1 129 ? -6.082  -10.431 -20.498 1.00 17.36  ? 128 ASN A HD22 1 
ATOM   1945 N N    . CYS A 1 130 ? -9.257  -6.267  -21.869 1.00 11.80  ? 129 CYS A N    1 
ATOM   1946 C CA   . CYS A 1 130 ? -10.293 -5.294  -21.548 1.00 11.95  ? 129 CYS A CA   1 
ATOM   1947 C C    . CYS A 1 130 ? -11.108 -4.955  -22.794 1.00 12.76  ? 129 CYS A C    1 
ATOM   1948 O O    . CYS A 1 130 ? -10.826 -5.396  -23.906 1.00 13.24  ? 129 CYS A O    1 
ATOM   1949 C CB   . CYS A 1 130 ? -9.700  -4.021  -20.941 1.00 13.94  ? 129 CYS A CB   1 
ATOM   1950 S SG   . CYS A 1 130 ? -8.807  -2.924  -22.040 1.00 12.20  ? 129 CYS A SG   1 
ATOM   1951 H H    . CYS A 1 130 ? -8.473  -5.927  -21.964 1.00 14.16  ? 129 CYS A H    1 
ATOM   1952 H HA   . CYS A 1 130 ? -10.896 -5.682  -20.895 1.00 14.35  ? 129 CYS A HA   1 
ATOM   1953 H HB2  . CYS A 1 130 ? -10.426 -3.507  -20.554 1.00 16.74  ? 129 CYS A HB2  1 
ATOM   1954 H HB3  . CYS A 1 130 ? -9.085  -4.282  -20.238 1.00 16.74  ? 129 CYS A HB3  1 
ATOM   1955 H HG   . CYS A 1 130 ? -7.880  -3.519  -22.516 1.00 14.65  ? 129 CYS A HG   1 
ATOM   1956 N N    . GLU A 1 131 ? -12.119 -4.108  -22.596 1.00 14.29  ? 130 GLU A N    1 
ATOM   1957 C CA   . GLU A 1 131 ? -12.951 -3.693  -23.720 1.00 16.20  ? 130 GLU A CA   1 
ATOM   1958 C C    . GLU A 1 131 ? -12.163 -3.001  -24.813 1.00 16.12  ? 130 GLU A C    1 
ATOM   1959 O O    . GLU A 1 131 ? -12.584 -3.034  -25.964 1.00 16.65  ? 130 GLU A O    1 
ATOM   1960 C CB   . GLU A 1 131 ? -14.081 -2.784  -23.258 1.00 19.72  ? 130 GLU A CB   1 
ATOM   1961 C CG   . GLU A 1 131 ? -15.196 -3.574  -22.627 1.00 30.56  ? 130 GLU A CG   1 
ATOM   1962 C CD   . GLU A 1 131 ? -16.352 -2.706  -22.215 1.00 39.66  ? 130 GLU A CD   1 
ATOM   1963 O OE1  . GLU A 1 131 ? -16.190 -1.468  -22.148 1.00 45.65  ? 130 GLU A OE1  1 
ATOM   1964 O OE2  . GLU A 1 131 ? -17.449 -3.268  -22.064 1.00 30.00  ? 130 GLU A OE2  1 
ATOM   1965 H H    . GLU A 1 131 ? -12.339 -3.768  -21.837 1.00 17.16  ? 130 GLU A H    1 
ATOM   1966 H HA   . GLU A 1 131 ? -13.355 -4.484  -24.109 1.00 19.45  ? 130 GLU A HA   1 
ATOM   1967 H HB2  . GLU A 1 131 ? -13.741 -2.158  -22.599 1.00 23.67  ? 130 GLU A HB2  1 
ATOM   1968 H HB3  . GLU A 1 131 ? -14.441 -2.306  -24.021 1.00 23.67  ? 130 GLU A HB3  1 
ATOM   1969 H HG2  . GLU A 1 131 ? -15.523 -4.227  -23.265 1.00 36.69  ? 130 GLU A HG2  1 
ATOM   1970 H HG3  . GLU A 1 131 ? -14.859 -4.021  -21.835 1.00 36.69  ? 130 GLU A HG3  1 
ATOM   1971 N N    . GLN A 1 132 ? -11.031 -2.369  -24.495 1.00 13.00  ? 131 GLN A N    1 
ATOM   1972 C CA   . GLN A 1 132 ? -10.224 -1.675  -25.487 1.00 14.64  ? 131 GLN A CA   1 
ATOM   1973 C C    . GLN A 1 132 ? -9.046  -2.523  -25.961 1.00 13.26  ? 131 GLN A C    1 
ATOM   1974 O O    . GLN A 1 132 ? -8.062  -1.974  -26.453 1.00 13.60  ? 131 GLN A O    1 
ATOM   1975 C CB   . GLN A 1 132 ? -9.681  -0.358  -24.920 1.00 22.23  ? 131 GLN A CB   1 
ATOM   1976 C CG   . GLN A 1 132 ? -10.697 0.587   -24.312 1.00 40.25  ? 131 GLN A CG   1 
ATOM   1977 C CD   . GLN A 1 132 ? -11.836 0.873   -25.231 1.00 45.84  ? 131 GLN A CD   1 
ATOM   1978 O OE1  . GLN A 1 132 ? -12.974 0.514   -24.938 1.00 45.33  ? 131 GLN A OE1  1 
ATOM   1979 N NE2  . GLN A 1 132 ? -11.543 1.458   -26.384 1.00 53.90  ? 131 GLN A NE2  1 
ATOM   1980 H H    . GLN A 1 132 ? -10.709 -2.331  -23.698 1.00 15.62  ? 131 GLN A H    1 
ATOM   1981 H HA   . GLN A 1 132 ? -10.776 -1.468  -26.257 1.00 17.58  ? 131 GLN A HA   1 
ATOM   1982 H HB2  . GLN A 1 132 ? -9.036  -0.569  -24.227 1.00 26.68  ? 131 GLN A HB2  1 
ATOM   1983 H HB3  . GLN A 1 132 ? -9.237  0.120   -25.637 1.00 26.68  ? 131 GLN A HB3  1 
ATOM   1984 H HG2  . GLN A 1 132 ? -11.056 0.189   -23.504 1.00 48.32  ? 131 GLN A HG2  1 
ATOM   1985 H HG3  . GLN A 1 132 ? -10.261 1.428   -24.103 1.00 48.32  ? 131 GLN A HG3  1 
ATOM   1986 H HE21 . GLN A 1 132 ? -10.731 1.684   -26.557 1.00 64.69  ? 131 GLN A HE21 1 
ATOM   1987 H HE22 . GLN A 1 132 ? -12.168 1.636   -26.947 1.00 64.69  ? 131 GLN A HE22 1 
ATOM   1988 N N    . LYS A 1 133 ? -9.119  -3.835  -25.782 1.00 11.78  ? 132 LYS A N    1 
ATOM   1989 C CA   . LYS A 1 133 ? -7.988  -4.699  -26.090 1.00 11.69  ? 132 LYS A CA   1 
ATOM   1990 C C    . LYS A 1 133 ? -7.510  -4.533  -27.530 1.00 12.73  ? 132 LYS A C    1 
ATOM   1991 O O    . LYS A 1 133 ? -6.303  -4.576  -27.788 1.00 13.21  ? 132 LYS A O    1 
ATOM   1992 C CB   . LYS A 1 133 ? -8.355  -6.144  -25.791 1.00 14.18  ? 132 LYS A CB   1 
ATOM   1993 C CG   . LYS A 1 133 ? -9.469  -6.733  -26.607 1.00 13.66  ? 132 LYS A CG   1 
ATOM   1994 C CD   . LYS A 1 133 ? -9.794  -8.089  -26.000 1.00 21.86  ? 132 LYS A CD   1 
ATOM   1995 C CE   . LYS A 1 133 ? -10.912 -8.842  -26.687 1.00 37.41  ? 132 LYS A CE   1 
ATOM   1996 N NZ   . LYS A 1 133 ? -11.112 -10.156 -25.984 1.00 49.76  ? 132 LYS A NZ   1 
ATOM   1997 H H    . LYS A 1 133 ? -9.810  -4.251  -25.483 1.00 14.15  ? 132 LYS A H    1 
ATOM   1998 H HA   . LYS A 1 133 ? -7.249  -4.458  -25.508 1.00 14.03  ? 132 LYS A HA   1 
ATOM   1999 H HB2  . LYS A 1 133 ? -7.569  -6.694  -25.938 1.00 17.03  ? 132 LYS A HB2  1 
ATOM   2000 H HB3  . LYS A 1 133 ? -8.618  -6.204  -24.859 1.00 17.03  ? 132 LYS A HB3  1 
ATOM   2001 H HG2  . LYS A 1 133 ? -10.254 -6.167  -26.558 1.00 16.40  ? 132 LYS A HG2  1 
ATOM   2002 H HG3  . LYS A 1 133 ? -9.181  -6.857  -27.525 1.00 16.40  ? 132 LYS A HG3  1 
ATOM   2003 H HD2  . LYS A 1 133 ? -8.999  -8.643  -26.040 1.00 26.24  ? 132 LYS A HD2  1 
ATOM   2004 H HD3  . LYS A 1 133 ? -10.054 -7.958  -25.075 1.00 26.24  ? 132 LYS A HD3  1 
ATOM   2005 H HE2  . LYS A 1 133 ? -11.734 -8.331  -26.633 1.00 44.90  ? 132 LYS A HE2  1 
ATOM   2006 H HE3  . LYS A 1 133 ? -10.673 -9.015  -27.611 1.00 44.90  ? 132 LYS A HE3  1 
ATOM   2007 H HZ1  . LYS A 1 133 ? -11.327 -10.016 -25.132 1.00 59.72  ? 132 LYS A HZ1  1 
ATOM   2008 H HZ2  . LYS A 1 133 ? -11.768 -10.613 -26.376 1.00 59.72  ? 132 LYS A HZ2  1 
ATOM   2009 H HZ3  . LYS A 1 133 ? -10.364 -10.637 -26.019 1.00 59.72  ? 132 LYS A HZ3  1 
ATOM   2010 N N    . GLN A 1 134 ? -8.421  -4.319  -28.490 1.00 13.12  ? 133 GLN A N    1 
ATOM   2011 C CA   . GLN A 1 134 ? -7.975  -4.145  -29.872 1.00 14.96  ? 133 GLN A CA   1 
ATOM   2012 C C    . GLN A 1 134 ? -7.006  -2.977  -30.003 1.00 12.86  ? 133 GLN A C    1 
ATOM   2013 O O    . GLN A 1 134 ? -5.952  -3.095  -30.641 1.00 14.57  ? 133 GLN A O    1 
ATOM   2014 C CB   . GLN A 1 134 ? -9.171  -3.930  -30.787 1.00 16.47  ? 133 GLN A CB   1 
ATOM   2015 C CG   . GLN A 1 134 ? -8.781  -3.895  -32.254 1.00 33.48  ? 133 GLN A CG   1 
ATOM   2016 C CD   . GLN A 1 134 ? -9.972  -3.691  -33.158 1.00 51.19  ? 133 GLN A CD   1 
ATOM   2017 O OE1  . GLN A 1 134 ? -11.080 -3.421  -32.692 1.00 58.20  ? 133 GLN A OE1  1 
ATOM   2018 N NE2  . GLN A 1 134 ? -9.767  -3.889  -34.456 1.00 63.83  ? 133 GLN A NE2  1 
ATOM   2019 H H    . GLN A 1 134 ? -9.271  -4.273  -28.371 1.00 15.75  ? 133 GLN A H    1 
ATOM   2020 H HA   . GLN A 1 134 ? -7.516  -4.950  -30.161 1.00 17.96  ? 133 GLN A HA   1 
ATOM   2021 H HB2  . GLN A 1 134 ? -9.801  -4.656  -30.661 1.00 19.78  ? 133 GLN A HB2  1 
ATOM   2022 H HB3  . GLN A 1 134 ? -9.590  -3.083  -30.567 1.00 19.78  ? 133 GLN A HB3  1 
ATOM   2023 H HG2  . GLN A 1 134 ? -8.162  -3.162  -32.401 1.00 40.18  ? 133 GLN A HG2  1 
ATOM   2024 H HG3  . GLN A 1 134 ? -8.362  -4.737  -32.492 1.00 40.18  ? 133 GLN A HG3  1 
ATOM   2025 H HE21 . GLN A 1 134 ? -8.980  -4.088  -34.742 1.00 76.61  ? 133 GLN A HE21 1 
ATOM   2026 H HE22 . GLN A 1 134 ? -10.414 -3.791  -35.014 1.00 76.61  ? 133 GLN A HE22 1 
ATOM   2027 N N    . GLU A 1 135 ? -7.315  -1.854  -29.375 1.00 12.62  ? 134 GLU A N    1 
ATOM   2028 C CA   . GLU A 1 135 ? -6.461  -0.690  -29.491 1.00 14.04  ? 134 GLU A CA   1 
ATOM   2029 C C    . GLU A 1 135 ? -5.152  -0.878  -28.733 1.00 15.20  ? 134 GLU A C    1 
ATOM   2030 O O    . GLU A 1 135 ? -4.109  -0.427  -29.202 1.00 12.66  ? 134 GLU A O    1 
ATOM   2031 C CB   . GLU A 1 135 ? -7.214  0.548   -29.028 1.00 17.10  ? 134 GLU A CB   1 
ATOM   2032 C CG   . GLU A 1 135 ? -8.309  0.967   -30.011 1.00 21.25  ? 134 GLU A CG   1 
ATOM   2033 C CD   . GLU A 1 135 ? -9.621  0.208   -29.856 1.00 29.26  ? 134 GLU A CD   1 
ATOM   2034 O OE1  . GLU A 1 135 ? -9.806  -0.562  -28.891 1.00 21.80  ? 134 GLU A OE1  1 
ATOM   2035 O OE2  . GLU A 1 135 ? -10.477 0.352   -30.753 1.00 44.86  ? 134 GLU A OE2  1 
ATOM   2036 H H    . GLU A 1 135 ? -8.008  -1.741  -28.878 1.00 15.16  ? 134 GLU A H    1 
ATOM   2037 H HA   . GLU A 1 135 ? -6.240  -0.563  -30.427 1.00 16.86  ? 134 GLU A HA   1 
ATOM   2038 H HB2  . GLU A 1 135 ? -7.633  0.363   -28.172 1.00 20.53  ? 134 GLU A HB2  1 
ATOM   2039 H HB3  . GLU A 1 135 ? -6.590  1.285   -28.941 1.00 20.53  ? 134 GLU A HB3  1 
ATOM   2040 H HG2  . GLU A 1 135 ? -8.498  1.910   -29.883 1.00 25.51  ? 134 GLU A HG2  1 
ATOM   2041 H HG3  . GLU A 1 135 ? -7.989  0.818   -30.915 1.00 25.51  ? 134 GLU A HG3  1 
ATOM   2042 N N    . TYR A 1 136 ? -5.176  -1.540  -27.568 1.00 12.46  ? 135 TYR A N    1 
ATOM   2043 C CA   . TYR A 1 136 ? -3.919  -1.819  -26.867 1.00 11.33  ? 135 TYR A CA   1 
ATOM   2044 C C    . TYR A 1 136 ? -3.028  -2.743  -27.682 1.00 12.17  ? 135 TYR A C    1 
ATOM   2045 O O    . TYR A 1 136 ? -1.812  -2.544  -27.737 1.00 10.13  ? 135 TYR A O    1 
ATOM   2046 C CB   . TYR A 1 136 ? -4.227  -2.384  -25.464 1.00 10.87  ? 135 TYR A CB   1 
ATOM   2047 C CG   . TYR A 1 136 ? -4.604  -1.315  -24.455 1.00 9.63   ? 135 TYR A CG   1 
ATOM   2048 C CD1  . TYR A 1 136 ? -3.825  -0.195  -24.254 1.00 10.89  ? 135 TYR A CD1  1 
ATOM   2049 C CD2  . TYR A 1 136 ? -5.868  -1.326  -23.886 1.00 11.85  ? 135 TYR A CD2  1 
ATOM   2050 C CE1  . TYR A 1 136 ? -4.209  0.797   -23.379 1.00 14.55  ? 135 TYR A CE1  1 
ATOM   2051 C CE2  . TYR A 1 136 ? -6.289  -0.322  -23.079 1.00 12.24  ? 135 TYR A CE2  1 
ATOM   2052 C CZ   . TYR A 1 136 ? -5.462  0.732   -22.805 1.00 11.36  ? 135 TYR A CZ   1 
ATOM   2053 O OH   . TYR A 1 136 ? -5.879  1.745   -21.979 1.00 15.41  ? 135 TYR A OH   1 
ATOM   2054 H H    . TYR A 1 136 ? -5.884  -1.829  -27.174 1.00 14.97  ? 135 TYR A H    1 
ATOM   2055 H HA   . TYR A 1 136 ? -3.441  -0.983  -26.747 1.00 13.61  ? 135 TYR A HA   1 
ATOM   2056 H HB2  . TYR A 1 136 ? -4.970  -3.005  -25.532 1.00 13.05  ? 135 TYR A HB2  1 
ATOM   2057 H HB3  . TYR A 1 136 ? -3.441  -2.845  -25.131 1.00 13.05  ? 135 TYR A HB3  1 
ATOM   2058 H HD1  . TYR A 1 136 ? -2.977  -0.160  -24.634 1.00 13.08  ? 135 TYR A HD1  1 
ATOM   2059 H HD2  . TYR A 1 136 ? -6.438  -2.040  -24.058 1.00 14.24  ? 135 TYR A HD2  1 
ATOM   2060 H HE1  . TYR A 1 136 ? -3.658  1.531   -23.226 1.00 17.47  ? 135 TYR A HE1  1 
ATOM   2061 H HE2  . TYR A 1 136 ? -7.123  -0.375  -22.671 1.00 14.70  ? 135 TYR A HE2  1 
ATOM   2062 H HH   . TYR A 1 136 ? -5.278  2.329   -21.915 1.00 18.50  ? 135 TYR A HH   1 
ATOM   2063 N N    . ILE A 1 137 ? -3.601  -3.771  -28.300 1.00 11.39  ? 136 ILE A N    1 
ATOM   2064 C CA   . ILE A 1 137 ? -2.810  -4.670  -29.134 1.00 10.58  ? 136 ILE A CA   1 
ATOM   2065 C C    . ILE A 1 137 ? -2.269  -3.933  -30.354 1.00 12.89  ? 136 ILE A C    1 
ATOM   2066 O O    . ILE A 1 137 ? -1.101  -4.081  -30.713 1.00 13.85  ? 136 ILE A O    1 
ATOM   2067 C CB   . ILE A 1 137 ? -3.648  -5.909  -29.497 1.00 12.19  ? 136 ILE A CB   1 
ATOM   2068 C CG1  . ILE A 1 137 ? -3.911  -6.723  -28.230 1.00 14.21  ? 136 ILE A CG1  1 
ATOM   2069 C CG2  . ILE A 1 137 ? -2.983  -6.758  -30.567 1.00 14.57  ? 136 ILE A CG2  1 
ATOM   2070 C CD1  . ILE A 1 137 ? -4.990  -7.766  -28.402 1.00 19.26  ? 136 ILE A CD1  1 
ATOM   2071 H H    . ILE A 1 137 ? -4.437  -3.968  -28.254 1.00 13.67  ? 136 ILE A H    1 
ATOM   2072 H HA   . ILE A 1 137 ? -2.048  -4.976  -28.619 1.00 12.71  ? 136 ILE A HA   1 
ATOM   2073 H HB   . ILE A 1 137 ? -4.502  -5.605  -29.842 1.00 14.63  ? 136 ILE A HB   1 
ATOM   2074 H HG12 . ILE A 1 137 ? -3.094  -7.179  -27.974 1.00 17.06  ? 136 ILE A HG12 1 
ATOM   2075 H HG13 . ILE A 1 137 ? -4.189  -6.121  -27.522 1.00 17.06  ? 136 ILE A HG13 1 
ATOM   2076 H HG21 . ILE A 1 137 ? -3.547  -7.523  -30.759 1.00 17.50  ? 136 ILE A HG21 1 
ATOM   2077 H HG22 . ILE A 1 137 ? -2.867  -6.222  -31.367 1.00 17.50  ? 136 ILE A HG22 1 
ATOM   2078 H HG23 . ILE A 1 137 ? -2.119  -7.057  -30.241 1.00 17.50  ? 136 ILE A HG23 1 
ATOM   2079 H HD11 . ILE A 1 137 ? -5.105  -8.243  -27.565 1.00 23.12  ? 136 ILE A HD11 1 
ATOM   2080 H HD12 . ILE A 1 137 ? -5.819  -7.325  -28.649 1.00 23.12  ? 136 ILE A HD12 1 
ATOM   2081 H HD13 . ILE A 1 137 ? -4.723  -8.384  -29.101 1.00 23.12  ? 136 ILE A HD13 1 
ATOM   2082 N N    . GLN A 1 138 ? -3.088  -3.111  -30.995 1.00 13.72  ? 137 GLN A N    1 
ATOM   2083 C CA   . GLN A 1 138 ? -2.610  -2.355  -32.147 1.00 16.80  ? 137 GLN A CA   1 
ATOM   2084 C C    . GLN A 1 138 ? -1.463  -1.423  -31.784 1.00 12.54  ? 137 GLN A C    1 
ATOM   2085 O O    . GLN A 1 138 ? -0.528  -1.236  -32.581 1.00 14.46  ? 137 GLN A O    1 
ATOM   2086 C CB   . GLN A 1 138 ? -3.783  -1.594  -32.762 1.00 16.19  ? 137 GLN A CB   1 
ATOM   2087 C CG   . GLN A 1 138 ? -4.724  -2.544  -33.503 1.00 19.79  ? 137 GLN A CG   1 
ATOM   2088 C CD   . GLN A 1 138 ? -6.021  -1.917  -33.970 1.00 29.66  ? 137 GLN A CD   1 
ATOM   2089 O OE1  . GLN A 1 138 ? -6.368  -0.798  -33.593 1.00 34.20  ? 137 GLN A OE1  1 
ATOM   2090 N NE2  . GLN A 1 138 ? -6.729  -2.635  -34.829 1.00 37.99  ? 137 GLN A NE2  1 
ATOM   2091 H H    . GLN A 1 138 ? -3.912  -2.973  -30.789 1.00 16.47  ? 137 GLN A H    1 
ATOM   2092 H HA   . GLN A 1 138 ? -2.281  -2.979  -32.813 1.00 20.17  ? 137 GLN A HA   1 
ATOM   2093 H HB2  . GLN A 1 138 ? -4.285  -1.153  -32.059 1.00 19.44  ? 137 GLN A HB2  1 
ATOM   2094 H HB3  . GLN A 1 138 ? -3.446  -0.941  -33.396 1.00 19.44  ? 137 GLN A HB3  1 
ATOM   2095 H HG2  . GLN A 1 138 ? -4.265  -2.885  -34.287 1.00 23.75  ? 137 GLN A HG2  1 
ATOM   2096 H HG3  . GLN A 1 138 ? -4.950  -3.279  -32.912 1.00 23.75  ? 137 GLN A HG3  1 
ATOM   2097 H HE21 . GLN A 1 138 ? -6.450  -3.411  -35.073 1.00 45.59  ? 137 GLN A HE21 1 
ATOM   2098 H HE22 . GLN A 1 138 ? -7.474  -2.330  -35.132 1.00 45.59  ? 137 GLN A HE22 1 
ATOM   2099 N N    . ALA A 1 139 ? -1.492  -0.847  -30.575 1.00 12.90  ? 138 ALA A N    1 
ATOM   2100 C CA   . ALA A 1 139 ? -0.402  0.003   -30.127 1.00 11.13  ? 138 ALA A CA   1 
ATOM   2101 C C    . ALA A 1 139 ? 0.885   -0.796  -29.907 1.00 11.53  ? 138 ALA A C    1 
ATOM   2102 O O    . ALA A 1 139 ? 1.966   -0.371  -30.327 1.00 11.60  ? 138 ALA A O    1 
ATOM   2103 C CB   . ALA A 1 139 ? -0.807  0.751   -28.860 1.00 11.42  ? 138 ALA A CB   1 
ATOM   2104 H H    . ALA A 1 139 ? -2.130  -0.937  -30.005 1.00 15.49  ? 138 ALA A H    1 
ATOM   2105 H HA   . ALA A 1 139 ? -0.223  0.665   -30.814 1.00 13.37  ? 138 ALA A HA   1 
ATOM   2106 H HB1  . ALA A 1 139 ? -0.070  1.312   -28.576 1.00 13.72  ? 138 ALA A HB1  1 
ATOM   2107 H HB2  . ALA A 1 139 ? -1.585  1.297   -29.052 1.00 13.72  ? 138 ALA A HB2  1 
ATOM   2108 H HB3  . ALA A 1 139 ? -1.019  0.105   -28.167 1.00 13.72  ? 138 ALA A HB3  1 
ATOM   2109 N N    . ILE A 1 140 ? 0.777   -1.965  -29.272 1.00 12.37  ? 139 ILE A N    1 
ATOM   2110 C CA   . ILE A 1 140 ? 1.938   -2.847  -29.105 1.00 12.13  ? 139 ILE A CA   1 
ATOM   2111 C C    . ILE A 1 140 ? 2.577   -3.148  -30.448 1.00 13.16  ? 139 ILE A C    1 
ATOM   2112 O O    . ILE A 1 140 ? 3.801   -3.211  -30.568 1.00 12.13  ? 139 ILE A O    1 
ATOM   2113 C CB   . ILE A 1 140 ? 1.516   -4.121  -28.346 1.00 12.35  ? 139 ILE A CB   1 
ATOM   2114 C CG1  . ILE A 1 140 ? 1.272   -3.756  -26.875 1.00 11.25  ? 139 ILE A CG1  1 
ATOM   2115 C CG2  . ILE A 1 140 ? 2.569   -5.212  -28.479 1.00 12.90  ? 139 ILE A CG2  1 
ATOM   2116 C CD1  . ILE A 1 140 ? 0.426   -4.789  -26.131 1.00 13.00  ? 139 ILE A CD1  1 
ATOM   2117 H H    . ILE A 1 140 ? 0.050   -2.270  -28.930 1.00 14.85  ? 139 ILE A H    1 
ATOM   2118 H HA   . ILE A 1 140 ? 2.600   -2.388  -28.562 1.00 14.57  ? 139 ILE A HA   1 
ATOM   2119 H HB   . ILE A 1 140 ? 0.685   -4.446  -28.726 1.00 14.83  ? 139 ILE A HB   1 
ATOM   2120 H HG12 . ILE A 1 140 ? 2.127   -3.687  -26.422 1.00 13.51  ? 139 ILE A HG12 1 
ATOM   2121 H HG13 . ILE A 1 140 ? 0.808   -2.905  -26.835 1.00 13.51  ? 139 ILE A HG13 1 
ATOM   2122 H HG21 . ILE A 1 140 ? 2.273   -5.997  -27.992 1.00 15.49  ? 139 ILE A HG21 1 
ATOM   2123 H HG22 . ILE A 1 140 ? 2.684   -5.428  -29.417 1.00 15.49  ? 139 ILE A HG22 1 
ATOM   2124 H HG23 . ILE A 1 140 ? 3.406   -4.889  -28.109 1.00 15.49  ? 139 ILE A HG23 1 
ATOM   2125 H HD11 . ILE A 1 140 ? 0.311   -4.499  -25.212 1.00 15.61  ? 139 ILE A HD11 1 
ATOM   2126 H HD12 . ILE A 1 140 ? -0.437  -4.862  -26.566 1.00 15.61  ? 139 ILE A HD12 1 
ATOM   2127 H HD13 . ILE A 1 140 ? 0.882   -5.645  -26.153 1.00 15.61  ? 139 ILE A HD13 1 
ATOM   2128 N N    . MET A 1 141 ? 1.763   -3.314  -31.484 1.00 13.42  ? 140 MET A N    1 
ATOM   2129 C CA   . MET A 1 141 ? 2.282   -3.693  -32.792 1.00 12.83  ? 140 MET A CA   1 
ATOM   2130 C C    . MET A 1 141 ? 3.096   -2.572  -33.430 1.00 14.95  ? 140 MET A C    1 
ATOM   2131 O O    . MET A 1 141 ? 3.739   -2.794  -34.466 1.00 15.99  ? 140 MET A O    1 
ATOM   2132 C CB   . MET A 1 141 ? 1.117   -4.092  -33.696 1.00 16.09  ? 140 MET A CB   1 
ATOM   2133 C CG   . MET A 1 141 ? 0.324   -5.310  -33.193 1.00 16.98  ? 140 MET A CG   1 
ATOM   2134 S SD   . MET A 1 141 ? -1.154  -5.752  -34.162 1.00 19.82  ? 140 MET A SD   1 
ATOM   2135 C CE   . MET A 1 141 ? -0.218  -6.551  -35.427 1.00 20.72  ? 140 MET A CE   1 
ATOM   2136 H H    . MET A 1 141 ? 0.910   -3.213  -31.457 1.00 16.12  ? 140 MET A H    1 
ATOM   2137 H HA   . MET A 1 141 ? 2.853   -4.470  -32.686 1.00 15.41  ? 140 MET A HA   1 
ATOM   2138 H HB2  . MET A 1 141 ? 0.502   -3.344  -33.760 1.00 19.32  ? 140 MET A HB2  1 
ATOM   2139 H HB3  . MET A 1 141 ? 1.464   -4.307  -34.576 1.00 19.32  ? 140 MET A HB3  1 
ATOM   2140 H HG2  . MET A 1 141 ? 0.914   -6.080  -33.196 1.00 20.38  ? 140 MET A HG2  1 
ATOM   2141 H HG3  . MET A 1 141 ? 0.033   -5.131  -32.285 1.00 20.38  ? 140 MET A HG3  1 
ATOM   2142 H HE1  . MET A 1 141 ? 0.390   -5.908  -35.824 1.00 24.87  ? 140 MET A HE1  1 
ATOM   2143 H HE2  . MET A 1 141 ? -0.827  -6.891  -36.102 1.00 24.87  ? 140 MET A HE2  1 
ATOM   2144 H HE3  . MET A 1 141 ? 0.283   -7.283  -35.034 1.00 24.87  ? 140 MET A HE3  1 
ATOM   2145 N N    . MET A 1 142 ? 3.095   -1.381  -32.839 1.00 13.41  ? 141 MET A N    1 
ATOM   2146 C CA   . MET A 1 142 ? 3.897   -0.271  -33.313 1.00 12.64  ? 141 MET A CA   1 
ATOM   2147 C C    . MET A 1 142 ? 5.207   -0.154  -32.560 1.00 14.97  ? 141 MET A C    1 
ATOM   2148 O O    . MET A 1 142 ? 6.073   0.648   -32.948 1.00 15.63  ? 141 MET A O    1 
ATOM   2149 C CB   . MET A 1 142 ? 3.121   1.038   -33.175 1.00 12.39  ? 141 MET A CB   1 
ATOM   2150 C CG   . MET A 1 142 ? 1.764   1.011   -33.822 1.00 14.80  ? 141 MET A CG   1 
ATOM   2151 S SD   . MET A 1 142 ? 1.739   0.490   -35.568 1.00 26.35  ? 141 MET A SD   1 
ATOM   2152 C CE   . MET A 1 142 ? 2.534   1.834   -36.238 1.00 22.51  ? 141 MET A CE   1 
ATOM   2153 H H    . MET A 1 142 ? 2.626   -1.192  -32.144 1.00 16.10  ? 141 MET A H    1 
ATOM   2154 H HA   . MET A 1 142 ? 4.089   -0.404  -34.255 1.00 15.18  ? 141 MET A HA   1 
ATOM   2155 H HB2  . MET A 1 142 ? 2.996   1.229   -32.233 1.00 14.88  ? 141 MET A HB2  1 
ATOM   2156 H HB3  . MET A 1 142 ? 3.633   1.750   -33.590 1.00 14.88  ? 141 MET A HB3  1 
ATOM   2157 H HG2  . MET A 1 142 ? 1.200   0.397   -33.326 1.00 17.77  ? 141 MET A HG2  1 
ATOM   2158 H HG3  . MET A 1 142 ? 1.386   1.904   -33.779 1.00 17.77  ? 141 MET A HG3  1 
ATOM   2159 H HE1  . MET A 1 142 ? 2.020   2.633   -36.044 1.00 27.02  ? 141 MET A HE1  1 
ATOM   2160 H HE2  . MET A 1 142 ? 3.418   1.905   -35.846 1.00 27.02  ? 141 MET A HE2  1 
ATOM   2161 H HE3  . MET A 1 142 ? 2.606   1.711   -37.198 1.00 27.02  ? 141 MET A HE3  1 
ATOM   2162 N N    . MET A 1 143 ? 5.394   -0.935  -31.502 1.00 12.46  ? 142 MET A N    1 
ATOM   2163 C CA   . MET A 1 143 ? 6.596   -0.771  -30.708 1.00 10.92  ? 142 MET A CA   1 
ATOM   2164 C C    . MET A 1 143 ? 7.795   -1.448  -31.372 1.00 14.18  ? 142 MET A C    1 
ATOM   2165 O O    . MET A 1 143 ? 7.671   -2.153  -32.377 1.00 15.09  ? 142 MET A O    1 
ATOM   2166 C CB   . MET A 1 143 ? 6.382   -1.328  -29.299 1.00 13.31  ? 142 MET A CB   1 
ATOM   2167 C CG   . MET A 1 143 ? 5.296   -0.608  -28.540 1.00 11.99  ? 142 MET A CG   1 
ATOM   2168 S SD   . MET A 1 143 ? 4.983   -1.166  -26.854 1.00 15.43  ? 142 MET A SD   1 
ATOM   2169 C CE   . MET A 1 143 ? 6.408   -0.424  -26.066 1.00 15.73  ? 142 MET A CE   1 
ATOM   2170 H H    . MET A 1 143 ? 4.855   -1.549  -31.231 1.00 14.97  ? 142 MET A H    1 
ATOM   2171 H HA   . MET A 1 143 ? 6.784   0.177   -30.624 1.00 13.11  ? 142 MET A HA   1 
ATOM   2172 H HB2  . MET A 1 143 ? 6.132   -2.263  -29.364 1.00 15.98  ? 142 MET A HB2  1 
ATOM   2173 H HB3  . MET A 1 143 ? 7.207   -1.240  -28.797 1.00 15.98  ? 142 MET A HB3  1 
ATOM   2174 H HG2  . MET A 1 143 ? 5.532   0.332   -28.493 1.00 14.40  ? 142 MET A HG2  1 
ATOM   2175 H HG3  . MET A 1 143 ? 4.466   -0.705  -29.033 1.00 14.40  ? 142 MET A HG3  1 
ATOM   2176 H HE1  . MET A 1 143 ? 6.390   -0.636  -25.119 1.00 18.89  ? 142 MET A HE1  1 
ATOM   2177 H HE2  . MET A 1 143 ? 7.214   -0.781  -26.471 1.00 18.89  ? 142 MET A HE2  1 
ATOM   2178 H HE3  . MET A 1 143 ? 6.372   0.537   -26.190 1.00 18.89  ? 142 MET A HE3  1 
ATOM   2179 N N    . GLU A 1 144 ? 8.973   -1.248  -30.770 1.00 16.27  ? 143 GLU A N    1 
ATOM   2180 C CA   . GLU A 1 144 ? 10.184  -1.936  -31.223 1.00 19.03  ? 143 GLU A CA   1 
ATOM   2181 C C    . GLU A 1 144 ? 9.979   -3.444  -31.210 1.00 17.59  ? 143 GLU A C    1 
ATOM   2182 O O    . GLU A 1 144 ? 9.301   -3.987  -30.337 1.00 15.72  ? 143 GLU A O    1 
ATOM   2183 C CB   . GLU A 1 144 ? 11.389  -1.580  -30.337 1.00 21.66  ? 143 GLU A CB   1 
ATOM   2184 C CG   . GLU A 1 144 ? 11.865  -0.140  -30.493 1.00 44.00  ? 143 GLU A CG   1 
ATOM   2185 C CD   . GLU A 1 144 ? 13.101  0.179   -29.665 1.00 59.45  ? 143 GLU A CD   1 
ATOM   2186 O OE1  . GLU A 1 144 ? 13.542  -0.689  -28.883 1.00 58.88  ? 143 GLU A OE1  1 
ATOM   2187 O OE2  . GLU A 1 144 ? 13.633  1.305   -29.799 1.00 61.41  ? 143 GLU A OE2  1 
ATOM   2188 H H    . GLU A 1 144 ? 9.096   -0.721  -30.101 1.00 19.54  ? 143 GLU A H    1 
ATOM   2189 H HA   . GLU A 1 144 ? 10.384  -1.665  -32.132 1.00 22.85  ? 143 GLU A HA   1 
ATOM   2190 H HB2  . GLU A 1 144 ? 11.142  -1.711  -29.408 1.00 26.00  ? 143 GLU A HB2  1 
ATOM   2191 H HB3  . GLU A 1 144 ? 12.129  -2.164  -30.566 1.00 26.00  ? 143 GLU A HB3  1 
ATOM   2192 H HG2  . GLU A 1 144 ? 12.082  0.019   -31.425 1.00 52.81  ? 143 GLU A HG2  1 
ATOM   2193 H HG3  . GLU A 1 144 ? 11.155  0.458   -30.212 1.00 52.81  ? 143 GLU A HG3  1 
ATOM   2194 N N    . GLU A 1 145 ? 10.574  -4.125  -32.202 1.00 21.13  ? 144 GLU A N    1 
ATOM   2195 C CA   . GLU A 1 145 ? 10.424  -5.574  -32.327 1.00 19.36  ? 144 GLU A CA   1 
ATOM   2196 C C    . GLU A 1 145 ? 10.870  -6.300  -31.067 1.00 19.28  ? 144 GLU A C    1 
ATOM   2197 O O    . GLU A 1 145 ? 10.245  -7.283  -30.653 1.00 20.94  ? 144 GLU A O    1 
ATOM   2198 C CB   . GLU A 1 145 ? 11.229  -6.081  -33.526 1.00 34.41  ? 144 GLU A CB   1 
ATOM   2199 C CG   . GLU A 1 145 ? 10.679  -5.675  -34.874 1.00 52.52  ? 144 GLU A CG   1 
ATOM   2200 C CD   . GLU A 1 145 ? 11.564  -6.127  -36.020 1.00 71.35  ? 144 GLU A CD   1 
ATOM   2201 O OE1  . GLU A 1 145 ? 12.686  -6.614  -35.759 1.00 73.00  ? 144 GLU A OE1  1 
ATOM   2202 O OE2  . GLU A 1 145 ? 11.128  -6.014  -37.183 1.00 77.97  ? 144 GLU A OE2  1 
ATOM   2203 H H    . GLU A 1 145 ? 11.067  -3.768  -32.810 1.00 25.37  ? 144 GLU A H    1 
ATOM   2204 H HA   . GLU A 1 145 ? 9.490   -5.784  -32.481 1.00 23.25  ? 144 GLU A HA   1 
ATOM   2205 H HB2  . GLU A 1 145 ? 12.132  -5.734  -33.461 1.00 41.30  ? 144 GLU A HB2  1 
ATOM   2206 H HB3  . GLU A 1 145 ? 11.250  -7.050  -33.497 1.00 41.30  ? 144 GLU A HB3  1 
ATOM   2207 H HG2  . GLU A 1 145 ? 9.804   -6.076  -34.994 1.00 63.04  ? 144 GLU A HG2  1 
ATOM   2208 H HG3  . GLU A 1 145 ? 10.609  -4.708  -34.911 1.00 63.04  ? 144 GLU A HG3  1 
ATOM   2209 N N    . SER A 1 146 ? 11.966  -5.857  -30.447 1.00 19.88  ? 145 SER A N    1 
ATOM   2210 C CA   . SER A 1 146 ? 12.458  -6.540  -29.254 1.00 22.96  ? 145 SER A CA   1 
ATOM   2211 C C    . SER A 1 146 ? 11.431  -6.495  -28.136 1.00 19.87  ? 145 SER A C    1 
ATOM   2212 O O    . SER A 1 146 ? 11.231  -7.480  -27.422 1.00 21.86  ? 145 SER A O    1 
ATOM   2213 C CB   . SER A 1 146 ? 13.777  -5.912  -28.803 1.00 28.31  ? 145 SER A CB   1 
ATOM   2214 O OG   . SER A 1 146 ? 13.585  -4.569  -28.387 1.00 30.85  ? 145 SER A OG   1 
ATOM   2215 H H    . SER A 1 146 ? 12.433  -5.177  -30.692 1.00 23.86  ? 145 SER A H    1 
ATOM   2216 H HA   . SER A 1 146 ? 12.627  -7.471  -29.470 1.00 27.56  ? 145 SER A HA   1 
ATOM   2217 H HB2  . SER A 1 146 ? 14.132  -6.424  -28.060 1.00 33.99  ? 145 SER A HB2  1 
ATOM   2218 H HB3  . SER A 1 146 ? 14.403  -5.926  -29.544 1.00 33.99  ? 145 SER A HB3  1 
ATOM   2219 H HG   . SER A 1 146 ? 14.317  -4.237  -28.142 1.00 37.02  ? 145 SER A HG   1 
ATOM   2220 N N    . VAL A 1 147 ? 10.759  -5.355  -27.975 1.00 17.51  ? 146 VAL A N    1 
ATOM   2221 C CA   . VAL A 1 147 ? 9.703   -5.248  -26.989 1.00 16.71  ? 146 VAL A CA   1 
ATOM   2222 C C    . VAL A 1 147 ? 8.536   -6.142  -27.367 1.00 16.04  ? 146 VAL A C    1 
ATOM   2223 O O    . VAL A 1 147 ? 7.959   -6.823  -26.517 1.00 14.93  ? 146 VAL A O    1 
ATOM   2224 C CB   . VAL A 1 147 ? 9.253   -3.786  -26.835 1.00 18.33  ? 146 VAL A CB   1 
ATOM   2225 C CG1  . VAL A 1 147 ? 8.072   -3.696  -25.916 1.00 19.81  ? 146 VAL A CG1  1 
ATOM   2226 C CG2  . VAL A 1 147 ? 10.416  -2.951  -26.308 1.00 24.54  ? 146 VAL A CG2  1 
ATOM   2227 H H    . VAL A 1 147 ? 10.899  -4.636  -28.425 1.00 21.02  ? 146 VAL A H    1 
ATOM   2228 H HA   . VAL A 1 147 ? 10.042  -5.547  -26.131 1.00 20.06  ? 146 VAL A HA   1 
ATOM   2229 H HB   . VAL A 1 147 ? 8.993   -3.436  -27.702 1.00 22.00  ? 146 VAL A HB   1 
ATOM   2230 H HG11 . VAL A 1 147 ? 7.806   -2.767  -25.834 1.00 23.78  ? 146 VAL A HG11 1 
ATOM   2231 H HG12 . VAL A 1 147 ? 7.344   -4.218  -26.286 1.00 23.78  ? 146 VAL A HG12 1 
ATOM   2232 H HG13 . VAL A 1 147 ? 8.323   -4.046  -25.047 1.00 23.78  ? 146 VAL A HG13 1 
ATOM   2233 H HG21 . VAL A 1 147 ? 10.126  -2.030  -26.213 1.00 29.46  ? 146 VAL A HG21 1 
ATOM   2234 H HG22 . VAL A 1 147 ? 10.690  -3.302  -25.446 1.00 29.46  ? 146 VAL A HG22 1 
ATOM   2235 H HG23 . VAL A 1 147 ? 11.152  -3.003  -26.936 1.00 29.46  ? 146 VAL A HG23 1 
ATOM   2236 N N    . GLN A 1 148 ? 8.145   -6.122  -28.644 1.00 15.22  ? 147 GLN A N    1 
ATOM   2237 C CA   . GLN A 1 148 ? 6.995   -6.929  -29.047 1.00 14.29  ? 147 GLN A CA   1 
ATOM   2238 C C    . GLN A 1 148 ? 7.236   -8.396  -28.769 1.00 13.50  ? 147 GLN A C    1 
ATOM   2239 O O    . GLN A 1 148 ? 6.314   -9.118  -28.384 1.00 13.49  ? 147 GLN A O    1 
ATOM   2240 C CB   . GLN A 1 148 ? 6.657   -6.776  -30.527 1.00 14.26  ? 147 GLN A CB   1 
ATOM   2241 C CG   . GLN A 1 148 ? 6.308   -5.398  -30.973 1.00 14.42  ? 147 GLN A CG   1 
ATOM   2242 C CD   . GLN A 1 148 ? 5.690   -5.391  -32.337 1.00 14.81  ? 147 GLN A CD   1 
ATOM   2243 O OE1  . GLN A 1 148 ? 5.083   -6.380  -32.762 1.00 18.46  ? 147 GLN A OE1  1 
ATOM   2244 N NE2  . GLN A 1 148 ? 6.048   -4.394  -33.113 1.00 17.53  ? 147 GLN A NE2  1 
ATOM   2245 H H    . GLN A 1 148 ? 8.514   -5.667  -29.274 1.00 18.27  ? 147 GLN A H    1 
ATOM   2246 H HA   . GLN A 1 148 ? 6.220   -6.650  -28.534 1.00 17.16  ? 147 GLN A HA   1 
ATOM   2247 H HB2  . GLN A 1 148 ? 7.423   -7.064  -31.047 1.00 17.12  ? 147 GLN A HB2  1 
ATOM   2248 H HB3  . GLN A 1 148 ? 5.898   -7.346  -30.727 1.00 17.12  ? 147 GLN A HB3  1 
ATOM   2249 H HG2  . GLN A 1 148 ? 5.672   -5.013  -30.350 1.00 17.32  ? 147 GLN A HG2  1 
ATOM   2250 H HG3  . GLN A 1 148 ? 7.115   -4.860  -31.003 1.00 17.32  ? 147 GLN A HG3  1 
ATOM   2251 H HE21 . GLN A 1 148 ? 6.507   -3.744  -32.790 1.00 21.05  ? 147 GLN A HE21 1 
ATOM   2252 H HE22 . GLN A 1 148 ? 5.741   -4.345  -33.915 1.00 21.05  ? 147 GLN A HE22 1 
ATOM   2253 N N    . HIS A 1 149 ? 8.475   -8.863  -28.937 1.00 15.71  ? 148 HIS A N    1 
ATOM   2254 C CA   . HIS A 1 149 ? 8.706   -10.283 -28.726 1.00 17.77  ? 148 HIS A CA   1 
ATOM   2255 C C    . HIS A 1 149 ? 8.560   -10.650 -27.250 1.00 17.22  ? 148 HIS A C    1 
ATOM   2256 O O    . HIS A 1 149 ? 8.009   -11.709 -26.902 1.00 18.49  ? 148 HIS A O    1 
ATOM   2257 C CB   . HIS A 1 149 ? 10.084  -10.671 -29.253 1.00 23.23  ? 148 HIS A CB   1 
ATOM   2258 C CG   . HIS A 1 149 ? 10.209  -12.144 -29.480 1.00 41.40  ? 148 HIS A CG   1 
ATOM   2259 N ND1  . HIS A 1 149 ? 10.535  -13.034 -28.480 1.00 46.79  ? 148 HIS A ND1  1 
ATOM   2260 C CD2  . HIS A 1 149 ? 9.990   -12.890 -30.591 1.00 45.81  ? 148 HIS A CD2  1 
ATOM   2261 C CE1  . HIS A 1 149 ? 10.533  -14.263 -28.968 1.00 47.24  ? 148 HIS A CE1  1 
ATOM   2262 N NE2  . HIS A 1 149 ? 10.206  -14.203 -30.247 1.00 52.19  ? 148 HIS A NE2  1 
ATOM   2263 H H    . HIS A 1 149 ? 9.164   -8.401  -29.161 1.00 18.87  ? 148 HIS A H    1 
ATOM   2264 H HA   . HIS A 1 149 ? 8.043   -10.786 -29.224 1.00 21.33  ? 148 HIS A HA   1 
ATOM   2265 H HB2  . HIS A 1 149 ? 10.239  -10.221 -30.099 1.00 27.89  ? 148 HIS A HB2  1 
ATOM   2266 H HB3  . HIS A 1 149 ? 10.757  -10.407 -28.607 1.00 27.89  ? 148 HIS A HB3  1 
ATOM   2267 H HD2  . HIS A 1 149 ? 9.747   -12.571 -31.430 1.00 54.98  ? 148 HIS A HD2  1 
ATOM   2268 H HE1  . HIS A 1 149 ? 10.733  -15.037 -28.494 1.00 56.70  ? 148 HIS A HE1  1 
ATOM   2269 H HE2  . HIS A 1 149 ? 10.145  -14.875 -30.779 1.00 62.64  ? 148 HIS A HE2  1 
ATOM   2270 N N    . VAL A 1 150 ? 9.027   -9.781  -26.351 1.00 15.31  ? 149 VAL A N    1 
ATOM   2271 C CA   . VAL A 1 150 ? 8.858   -10.041 -24.928 1.00 16.65  ? 149 VAL A CA   1 
ATOM   2272 C C    . VAL A 1 150 ? 7.386   -9.964  -24.542 1.00 12.45  ? 149 VAL A C    1 
ATOM   2273 O O    . VAL A 1 150 ? 6.888   -10.775 -23.758 1.00 15.22  ? 149 VAL A O    1 
ATOM   2274 C CB   . VAL A 1 150 ? 9.726   -9.070  -24.105 1.00 17.34  ? 149 VAL A CB   1 
ATOM   2275 C CG1  . VAL A 1 150 ? 9.467   -9.247  -22.609 1.00 24.77  ? 149 VAL A CG1  1 
ATOM   2276 C CG2  . VAL A 1 150 ? 11.207  -9.271  -24.471 1.00 18.40  ? 149 VAL A CG2  1 
ATOM   2277 H H    . VAL A 1 150 ? 9.437   -9.048  -26.538 1.00 18.38  ? 149 VAL A H    1 
ATOM   2278 H HA   . VAL A 1 150 ? 9.164   -10.942 -24.739 1.00 19.99  ? 149 VAL A HA   1 
ATOM   2279 H HB   . VAL A 1 150 ? 9.484   -8.160  -24.341 1.00 20.82  ? 149 VAL A HB   1 
ATOM   2280 H HG11 . VAL A 1 150 ? 10.025  -8.625  -22.116 1.00 29.73  ? 149 VAL A HG11 1 
ATOM   2281 H HG12 . VAL A 1 150 ? 8.531   -9.068  -22.427 1.00 29.73  ? 149 VAL A HG12 1 
ATOM   2282 H HG13 . VAL A 1 150 ? 9.685   -10.158 -22.357 1.00 29.73  ? 149 VAL A HG13 1 
ATOM   2283 H HG21 . VAL A 1 150 ? 11.747  -8.656  -23.949 1.00 22.09  ? 149 VAL A HG21 1 
ATOM   2284 H HG22 . VAL A 1 150 ? 11.460  -10.185 -24.271 1.00 22.09  ? 149 VAL A HG22 1 
ATOM   2285 H HG23 . VAL A 1 150 ? 11.325  -9.094  -25.417 1.00 22.09  ? 149 VAL A HG23 1 
ATOM   2286 N N    . VAL A 1 151 ? 6.658   -9.006  -25.119 1.00 14.78  ? 150 VAL A N    1 
ATOM   2287 C CA   . VAL A 1 151 ? 5.234   -8.877  -24.847 1.00 13.06  ? 150 VAL A CA   1 
ATOM   2288 C C    . VAL A 1 151 ? 4.500   -10.113 -25.324 1.00 11.80  ? 150 VAL A C    1 
ATOM   2289 O O    . VAL A 1 151 ? 3.646   -10.648 -24.616 1.00 12.88  ? 150 VAL A O    1 
ATOM   2290 C CB   . VAL A 1 151 ? 4.697   -7.594  -25.502 1.00 14.38  ? 150 VAL A CB   1 
ATOM   2291 C CG1  . VAL A 1 151 ? 3.180   -7.513  -25.398 1.00 14.38  ? 150 VAL A CG1  1 
ATOM   2292 C CG2  . VAL A 1 151 ? 5.320   -6.390  -24.819 1.00 13.78  ? 150 VAL A CG2  1 
ATOM   2293 H H    . VAL A 1 151 ? 6.968   -8.422  -25.669 1.00 17.75  ? 150 VAL A H    1 
ATOM   2294 H HA   . VAL A 1 151 ? 5.101   -8.801  -23.889 1.00 15.68  ? 150 VAL A HA   1 
ATOM   2295 H HB   . VAL A 1 151 ? 4.944   -7.580  -26.440 1.00 17.27  ? 150 VAL A HB   1 
ATOM   2296 H HG11 . VAL A 1 151 ? 2.879   -6.693  -25.821 1.00 17.27  ? 150 VAL A HG11 1 
ATOM   2297 H HG12 . VAL A 1 151 ? 2.792   -8.279  -25.848 1.00 17.27  ? 150 VAL A HG12 1 
ATOM   2298 H HG13 . VAL A 1 151 ? 2.928   -7.514  -24.462 1.00 17.27  ? 150 VAL A HG13 1 
ATOM   2299 H HG21 . VAL A 1 151 ? 4.980   -5.582  -25.234 1.00 16.55  ? 150 VAL A HG21 1 
ATOM   2300 H HG22 . VAL A 1 151 ? 5.084   -6.405  -23.879 1.00 16.55  ? 150 VAL A HG22 1 
ATOM   2301 H HG23 . VAL A 1 151 ? 6.283   -6.434  -24.920 1.00 16.55  ? 150 VAL A HG23 1 
ATOM   2302 N N    . MET A 1 152 ? 4.848   -10.598 -26.522 1.00 13.79  ? 151 MET A N    1 
ATOM   2303 C CA   . MET A 1 152 ? 4.325   -11.873 -27.011 1.00 13.08  ? 151 MET A CA   1 
ATOM   2304 C C    . MET A 1 152 ? 4.518   -12.994 -26.000 1.00 14.20  ? 151 MET A C    1 
ATOM   2305 O O    . MET A 1 152 ? 3.579   -13.721 -25.682 1.00 14.82  ? 151 MET A O    1 
ATOM   2306 C CB   . MET A 1 152 ? 5.001   -12.226 -28.345 1.00 14.17  ? 151 MET A CB   1 
ATOM   2307 C CG   . MET A 1 152 ? 4.630   -13.590 -28.860 1.00 18.20  ? 151 MET A CG   1 
ATOM   2308 S SD   . MET A 1 152 ? 5.276   -13.854 -30.505 1.00 22.03  ? 151 MET A SD   1 
ATOM   2309 C CE   . MET A 1 152 ? 4.985   -15.606 -30.758 1.00 30.50  ? 151 MET A CE   1 
ATOM   2310 H H    . MET A 1 152 ? 5.385   -10.206 -27.068 1.00 16.56  ? 151 MET A H    1 
ATOM   2311 H HA   . MET A 1 152 ? 3.376   -11.772 -27.182 1.00 15.70  ? 151 MET A HA   1 
ATOM   2312 H HB2  . MET A 1 152 ? 4.737   -11.573 -29.012 1.00 17.01  ? 151 MET A HB2  1 
ATOM   2313 H HB3  . MET A 1 152 ? 5.963   -12.204 -28.224 1.00 17.01  ? 151 MET A HB3  1 
ATOM   2314 H HG2  . MET A 1 152 ? 5.003   -14.267 -28.273 1.00 21.85  ? 151 MET A HG2  1 
ATOM   2315 H HG3  . MET A 1 152 ? 3.664   -13.669 -28.895 1.00 21.85  ? 151 MET A HG3  1 
ATOM   2316 H HE1  . MET A 1 152 ? 5.306   -15.855 -31.639 1.00 36.61  ? 151 MET A HE1  1 
ATOM   2317 H HE2  . MET A 1 152 ? 5.462   -16.106 -30.078 1.00 36.61  ? 151 MET A HE2  1 
ATOM   2318 H HE3  . MET A 1 152 ? 4.033   -15.780 -30.691 1.00 36.61  ? 151 MET A HE3  1 
ATOM   2319 N N    . THR A 1 153 ? 5.745   -13.173 -25.496 1.00 14.03  ? 152 THR A N    1 
ATOM   2320 C CA   . THR A 1 153 ? 5.974   -14.260 -24.548 1.00 14.28  ? 152 THR A CA   1 
ATOM   2321 C C    . THR A 1 153 ? 5.155   -14.059 -23.280 1.00 13.98  ? 152 THR A C    1 
ATOM   2322 O O    . THR A 1 153 ? 4.562   -15.004 -22.744 1.00 17.59  ? 152 THR A O    1 
ATOM   2323 C CB   . THR A 1 153 ? 7.462   -14.350 -24.226 1.00 18.96  ? 152 THR A CB   1 
ATOM   2324 O OG1  . THR A 1 153 ? 8.185   -14.547 -25.438 1.00 23.88  ? 152 THR A OG1  1 
ATOM   2325 C CG2  . THR A 1 153 ? 7.724   -15.510 -23.316 1.00 25.81  ? 152 THR A CG2  1 
ATOM   2326 H H    . THR A 1 153 ? 6.436   -12.695 -25.680 1.00 16.85  ? 152 THR A H    1 
ATOM   2327 H HA   . THR A 1 153 ? 5.702   -15.098 -24.954 1.00 17.14  ? 152 THR A HA   1 
ATOM   2328 H HB   . THR A 1 153 ? 7.758   -13.535 -23.792 1.00 22.76  ? 152 THR A HB   1 
ATOM   2329 H HG1  . THR A 1 153 ? 8.050   -13.904 -25.962 1.00 28.67  ? 152 THR A HG1  1 
ATOM   2330 H HG21 . THR A 1 153 ? 8.671   -15.565 -23.113 1.00 30.98  ? 152 THR A HG21 1 
ATOM   2331 H HG22 . THR A 1 153 ? 7.230   -15.401 -22.489 1.00 30.98  ? 152 THR A HG22 1 
ATOM   2332 H HG23 . THR A 1 153 ? 7.445   -16.336 -23.743 1.00 30.98  ? 152 THR A HG23 1 
ATOM   2333 N N    . ALA A 1 154 ? 5.081   -12.819 -22.811 1.00 13.78  ? 153 ALA A N    1 
ATOM   2334 C CA   . ALA A 1 154 ? 4.305   -12.517 -21.613 1.00 13.21  ? 153 ALA A CA   1 
ATOM   2335 C C    . ALA A 1 154 ? 2.830   -12.842 -21.786 1.00 13.18  ? 153 ALA A C    1 
ATOM   2336 O O    . ALA A 1 154 ? 2.183   -13.368 -20.866 1.00 13.20  ? 153 ALA A O    1 
ATOM   2337 C CB   . ALA A 1 154 ? 4.490   -11.037 -21.242 1.00 13.60  ? 153 ALA A CB   1 
ATOM   2338 H H    . ALA A 1 154 ? 5.468   -12.138 -23.165 1.00 16.55  ? 153 ALA A H    1 
ATOM   2339 H HA   . ALA A 1 154 ? 4.642   -13.052 -20.878 1.00 15.86  ? 153 ALA A HA   1 
ATOM   2340 H HB1  . ALA A 1 154 ? 3.971   -10.845 -20.445 1.00 16.33  ? 153 ALA A HB1  1 
ATOM   2341 H HB2  . ALA A 1 154 ? 5.430   -10.870 -21.073 1.00 16.33  ? 153 ALA A HB2  1 
ATOM   2342 H HB3  . ALA A 1 154 ? 4.182   -10.486 -21.979 1.00 16.33  ? 153 ALA A HB3  1 
ATOM   2343 N N    . ILE A 1 155 ? 2.272   -12.517 -22.957 1.00 13.08  ? 154 ILE A N    1 
ATOM   2344 C CA   . ILE A 1 155 ? 0.873   -12.796 -23.225 1.00 13.06  ? 154 ILE A CA   1 
ATOM   2345 C C    . ILE A 1 155 ? 0.638   -14.294 -23.332 1.00 14.25  ? 154 ILE A C    1 
ATOM   2346 O O    . ILE A 1 155 ? -0.321  -14.816 -22.765 1.00 15.05  ? 154 ILE A O    1 
ATOM   2347 C CB   . ILE A 1 155 ? 0.418   -12.032 -24.479 1.00 13.79  ? 154 ILE A CB   1 
ATOM   2348 C CG1  . ILE A 1 155 ? 0.427   -10.515 -24.215 1.00 10.93  ? 154 ILE A CG1  1 
ATOM   2349 C CG2  . ILE A 1 155 ? -0.967  -12.541 -24.913 1.00 15.07  ? 154 ILE A CG2  1 
ATOM   2350 C CD1  . ILE A 1 155 ? 0.190   -9.704  -25.450 1.00 13.69  ? 154 ILE A CD1  1 
ATOM   2351 H H    . ILE A 1 155 ? 2.687   -12.136 -23.606 1.00 15.71  ? 154 ILE A H    1 
ATOM   2352 H HA   . ILE A 1 155 ? 0.346   -12.471 -22.479 1.00 15.68  ? 154 ILE A HA   1 
ATOM   2353 H HB   . ILE A 1 155 ? 1.047   -12.218 -25.193 1.00 16.56  ? 154 ILE A HB   1 
ATOM   2354 H HG12 . ILE A 1 155 ? -0.273  -10.302 -23.578 1.00 13.12  ? 154 ILE A HG12 1 
ATOM   2355 H HG13 . ILE A 1 155 ? 1.292   -10.264 -23.853 1.00 13.12  ? 154 ILE A HG13 1 
ATOM   2356 H HG21 . ILE A 1 155 ? -1.249  -12.055 -25.704 1.00 18.10  ? 154 ILE A HG21 1 
ATOM   2357 H HG22 . ILE A 1 155 ? -0.907  -13.489 -25.110 1.00 18.10  ? 154 ILE A HG22 1 
ATOM   2358 H HG23 . ILE A 1 155 ? -1.598  -12.393 -24.191 1.00 18.10  ? 154 ILE A HG23 1 
ATOM   2359 H HD11 . ILE A 1 155 ? 0.208   -8.762  -25.216 1.00 16.43  ? 154 ILE A HD11 1 
ATOM   2360 H HD12 . ILE A 1 155 ? 0.888   -9.899  -26.094 1.00 16.43  ? 154 ILE A HD12 1 
ATOM   2361 H HD13 . ILE A 1 155 ? -0.677  -9.937  -25.818 1.00 16.43  ? 154 ILE A HD13 1 
ATOM   2362 N N    . GLN A 1 156 ? 1.513   -15.011 -24.026 1.00 16.52  ? 155 GLN A N    1 
ATOM   2363 C CA   . GLN A 1 156 ? 1.384   -16.466 -24.088 1.00 22.77  ? 155 GLN A CA   1 
ATOM   2364 C C    . GLN A 1 156 ? 1.262   -17.050 -22.691 1.00 18.01  ? 155 GLN A C    1 
ATOM   2365 O O    . GLN A 1 156 ? 0.360   -17.854 -22.402 1.00 21.73  ? 155 GLN A O    1 
ATOM   2366 C CB   . GLN A 1 156 ? 2.597   -17.056 -24.811 1.00 21.74  ? 155 GLN A CB   1 
ATOM   2367 C CG   . GLN A 1 156 ? 2.650   -16.753 -26.270 1.00 34.36  ? 155 GLN A CG   1 
ATOM   2368 C CD   . GLN A 1 156 ? 3.968   -17.174 -26.894 1.00 39.38  ? 155 GLN A CD   1 
ATOM   2369 O OE1  . GLN A 1 156 ? 4.152   -17.082 -28.108 1.00 46.06  ? 155 GLN A OE1  1 
ATOM   2370 N NE2  . GLN A 1 156 ? 4.884   -17.656 -26.072 1.00 50.37  ? 155 GLN A NE2  1 
ATOM   2371 H H    . GLN A 1 156 ? 2.180   -14.689 -24.463 1.00 19.83  ? 155 GLN A H    1 
ATOM   2372 H HA   . GLN A 1 156 ? 0.586   -16.698 -24.588 1.00 27.33  ? 155 GLN A HA   1 
ATOM   2373 H HB2  . GLN A 1 156 ? 3.404   -16.699 -24.407 1.00 26.10  ? 155 GLN A HB2  1 
ATOM   2374 H HB3  . GLN A 1 156 ? 2.580   -18.021 -24.711 1.00 26.10  ? 155 GLN A HB3  1 
ATOM   2375 H HG2  . GLN A 1 156 ? 1.936   -17.232 -26.721 1.00 41.25  ? 155 GLN A HG2  1 
ATOM   2376 H HG3  . GLN A 1 156 ? 2.545   -15.798 -26.401 1.00 41.25  ? 155 GLN A HG3  1 
ATOM   2377 H HE21 . GLN A 1 156 ? 4.719   -17.708 -25.229 1.00 60.45  ? 155 GLN A HE21 1 
ATOM   2378 H HE22 . GLN A 1 156 ? 5.646   -17.910 -26.377 1.00 60.45  ? 155 GLN A HE22 1 
ATOM   2379 N N    . GLU A 1 157 ? 2.137   -16.617 -21.787 1.00 16.56  ? 156 GLU A N    1 
ATOM   2380 C CA   . GLU A 1 157 ? 2.145   -17.171 -20.438 1.00 17.85  ? 156 GLU A CA   1 
ATOM   2381 C C    . GLU A 1 157 ? 0.860   -16.820 -19.687 1.00 22.06  ? 156 GLU A C    1 
ATOM   2382 O O    . GLU A 1 157 ? 0.251   -17.669 -19.024 1.00 22.69  ? 156 GLU A O    1 
ATOM   2383 C CB   . GLU A 1 157 ? 3.359   -16.654 -19.667 1.00 22.90  ? 156 GLU A CB   1 
ATOM   2384 C CG   . GLU A 1 157 ? 3.590   -17.403 -18.383 1.00 32.07  ? 156 GLU A CG   1 
ATOM   2385 C CD   . GLU A 1 157 ? 4.741   -16.860 -17.563 1.00 45.10  ? 156 GLU A CD   1 
ATOM   2386 O OE1  . GLU A 1 157 ? 5.283   -15.796 -17.917 1.00 34.72  ? 156 GLU A OE1  1 
ATOM   2387 O OE2  . GLU A 1 157 ? 5.132   -17.530 -16.584 1.00 53.22  ? 156 GLU A OE2  1 
ATOM   2388 H H    . GLU A 1 157 ? 2.730   -16.010 -21.929 1.00 19.88  ? 156 GLU A H    1 
ATOM   2389 H HA   . GLU A 1 157 ? 2.209   -18.137 -20.491 1.00 21.43  ? 156 GLU A HA   1 
ATOM   2390 H HB2  . GLU A 1 157 ? 4.150   -16.753 -20.219 1.00 27.49  ? 156 GLU A HB2  1 
ATOM   2391 H HB3  . GLU A 1 157 ? 3.220   -15.719 -19.449 1.00 27.49  ? 156 GLU A HB3  1 
ATOM   2392 H HG2  . GLU A 1 157 ? 2.787   -17.350 -17.841 1.00 38.50  ? 156 GLU A HG2  1 
ATOM   2393 H HG3  . GLU A 1 157 ? 3.785   -18.330 -18.592 1.00 38.50  ? 156 GLU A HG3  1 
ATOM   2394 N N    . LEU A 1 158 ? 0.448   -15.557 -19.740 1.00 15.43  ? 157 LEU A N    1 
ATOM   2395 C CA   . LEU A 1 158 ? -0.675  -15.140 -18.914 1.00 19.08  ? 157 LEU A CA   1 
ATOM   2396 C C    . LEU A 1 158 ? -2.007  -15.665 -19.444 1.00 16.59  ? 157 LEU A C    1 
ATOM   2397 O O    . LEU A 1 158 ? -2.982  -15.705 -18.689 1.00 17.57  ? 157 LEU A O    1 
ATOM   2398 C CB   . LEU A 1 158 ? -0.693  -13.606 -18.802 1.00 18.19  ? 157 LEU A CB   1 
ATOM   2399 C CG   . LEU A 1 158 ? -1.076  -12.749 -20.002 1.00 16.99  ? 157 LEU A CG   1 
ATOM   2400 C CD1  . LEU A 1 158 ? -2.600  -12.579 -20.043 1.00 17.21  ? 157 LEU A CD1  1 
ATOM   2401 C CD2  . LEU A 1 158 ? -0.416  -11.331 -19.973 1.00 13.87  ? 157 LEU A CD2  1 
ATOM   2402 H H    . LEU A 1 158 ? 0.791   -14.940 -20.231 1.00 18.53  ? 157 LEU A H    1 
ATOM   2403 H HA   . LEU A 1 158 ? -0.552  -15.498 -18.021 1.00 22.90  ? 157 LEU A HA   1 
ATOM   2404 H HB2  . LEU A 1 158 ? -1.313  -13.375 -18.093 1.00 21.83  ? 157 LEU A HB2  1 
ATOM   2405 H HB3  . LEU A 1 158 ? 0.197   -13.325 -18.539 1.00 21.83  ? 157 LEU A HB3  1 
ATOM   2406 H HG   . LEU A 1 158 ? -0.798  -13.197 -20.816 1.00 20.39  ? 157 LEU A HG   1 
ATOM   2407 H HD11 . LEU A 1 158 ? -2.836  -12.033 -20.809 1.00 20.66  ? 157 LEU A HD11 1 
ATOM   2408 H HD12 . LEU A 1 158 ? -3.013  -13.454 -20.121 1.00 20.66  ? 157 LEU A HD12 1 
ATOM   2409 H HD13 . LEU A 1 158 ? -2.891  -12.147 -19.225 1.00 20.66  ? 157 LEU A HD13 1 
ATOM   2410 H HD21 . LEU A 1 158 ? -0.697  -10.836 -20.759 1.00 16.65  ? 157 LEU A HD21 1 
ATOM   2411 H HD22 . LEU A 1 158 ? -0.701  -10.867 -19.170 1.00 16.65  ? 157 LEU A HD22 1 
ATOM   2412 H HD23 . LEU A 1 158 ? 0.548   -11.431 -19.973 1.00 16.65  ? 157 LEU A HD23 1 
ATOM   2413 N N    . MET A 1 159 ? -2.082  -16.075 -20.701 1.00 18.48  ? 158 MET A N    1 
ATOM   2414 C CA   . MET A 1 159 ? -3.319  -16.559 -21.303 1.00 21.87  ? 158 MET A CA   1 
ATOM   2415 C C    . MET A 1 159 ? -3.485  -18.056 -21.341 1.00 30.08  ? 158 MET A C    1 
ATOM   2416 O O    . MET A 1 159 ? -4.498  -18.572 -21.704 1.00 27.53  ? 158 MET A O    1 
ATOM   2417 C CB   . MET A 1 159 ? -3.410  -16.117 -22.744 1.00 19.44  ? 158 MET A CB   1 
ATOM   2418 C CG   . MET A 1 159 ? -3.529  -14.657 -22.997 1.00 20.20  ? 158 MET A CG   1 
ATOM   2419 S SD   . MET A 1 159 ? -5.041  -13.856 -22.517 1.00 24.63  ? 158 MET A SD   1 
ATOM   2420 C CE   . MET A 1 159 ? -6.224  -14.273 -23.803 1.00 29.56  ? 158 MET A CE   1 
ATOM   2421 H H    . MET A 1 159 ? -1.437  -16.068 -21.235 1.00 22.18  ? 158 MET A H    1 
ATOM   2422 H HA   . MET A 1 159 ? -4.072  -16.183 -20.823 1.00 26.25  ? 158 MET A HA   1 
ATOM   2423 H HB2  . MET A 1 159 ? -2.618  -16.395 -23.194 1.00 23.33  ? 158 MET A HB2  1 
ATOM   2424 H HB3  . MET A 1 159 ? -4.160  -16.536 -23.156 1.00 23.33  ? 158 MET A HB3  1 
ATOM   2425 H HG2  . MET A 1 159 ? -2.821  -14.219 -22.536 1.00 24.25  ? 158 MET A HG2  1 
ATOM   2426 H HG3  . MET A 1 159 ? -3.441  -14.517 -23.937 1.00 24.25  ? 158 MET A HG3  1 
ATOM   2427 H HE1  . MET A 1 159 ? -6.987  -13.711 -23.727 1.00 35.48  ? 158 MET A HE1  1 
ATOM   2428 H HE2  . MET A 1 159 ? -5.830  -14.158 -24.660 1.00 35.48  ? 158 MET A HE2  1 
ATOM   2429 H HE3  . MET A 1 159 ? -6.485  -15.179 -23.680 1.00 35.48  ? 158 MET A HE3  1 
ATOM   2430 N N    . SER A 1 160 ? -2.432  -18.712 -20.991 1.00 31.09  ? 159 SER A N    1 
ATOM   2431 C CA   . SER A 1 160 ? -2.438  -20.132 -20.968 1.00 46.56  ? 159 SER A CA   1 
ATOM   2432 C C    . SER A 1 160 ? -3.136  -20.534 -19.663 1.00 47.87  ? 159 SER A C    1 
ATOM   2433 O O    . SER A 1 160 ? -3.271  -19.761 -18.724 1.00 46.22  ? 159 SER A O    1 
ATOM   2434 C CB   . SER A 1 160 ? -1.017  -20.660 -21.050 1.00 41.25  ? 159 SER A CB   1 
ATOM   2435 O OG   . SER A 1 160 ? -0.439  -20.589 -19.799 1.00 46.32  ? 159 SER A OG   1 
ATOM   2436 H H    . SER A 1 160 ? -1.704  -18.350 -20.752 1.00 37.32  ? 159 SER A H    1 
ATOM   2437 H HA   . SER A 1 160 ? -2.953  -20.478 -21.725 1.00 55.89  ? 159 SER A HA   1 
ATOM   2438 H HB2  . SER A 1 160 ? -1.035  -21.577 -21.343 1.00 49.52  ? 159 SER A HB2  1 
ATOM   2439 H HB3  . SER A 1 160 ? -0.505  -20.127 -21.670 1.00 49.52  ? 159 SER A HB3  1 
ATOM   2440 H HG   . SER A 1 160 ? -0.540  -19.851 -19.478 1.00 55.60  ? 159 SER A HG   1 
ATOM   2441 N N    . LYS A 1 161 ? -3.623  -21.734 -19.660 1.00 52.56  ? 160 LYS A N    1 
ATOM   2442 C CA   . LYS A 1 161 ? -4.229  -22.331 -18.505 1.00 50.80  ? 160 LYS A CA   1 
ATOM   2443 C C    . LYS A 1 161 ? -3.267  -23.330 -17.870 1.00 51.78  ? 160 LYS A C    1 
ATOM   2444 O O    . LYS A 1 161 ? -3.544  -23.836 -16.817 1.00 55.85  ? 160 LYS A O    1 
ATOM   2445 C CB   . LYS A 1 161 ? -5.493  -23.048 -18.914 0.00 47.65  ? 160 LYS A CB   1 
ATOM   2446 C CG   . LYS A 1 161 ? -6.056  -23.932 -17.815 0.00 47.97  ? 160 LYS A CG   1 
ATOM   2447 C CD   . LYS A 1 161 ? -6.260  -23.135 -16.529 0.00 48.23  ? 160 LYS A CD   1 
ATOM   2448 C CE   . LYS A 1 161 ? -5.954  -23.979 -15.309 0.00 47.96  ? 160 LYS A CE   1 
ATOM   2449 N NZ   . LYS A 1 161 ? -5.431  -23.254 -14.132 0.00 47.89  ? 160 LYS A NZ   1 
ATOM   2450 H H    . LYS A 1 161 ? -3.638  -22.231 -20.356 1.00 63.08  ? 160 LYS A H    1 
ATOM   2451 H HA   . LYS A 1 161 ? -4.446  -21.659 -17.834 1.00 60.97  ? 160 LYS A HA   1 
ATOM   2452 H HB2  . LYS A 1 161 ? -6.158  -22.378 -19.139 0.00 57.19  ? 160 LYS A HB2  1 
ATOM   2453 H HB3  . LYS A 1 161 ? -5.321  -23.592 -19.692 0.00 57.19  ? 160 LYS A HB3  1 
ATOM   2454 H HG2  . LYS A 1 161 ? -6.922  -24.254 -18.106 0.00 57.58  ? 160 LYS A HG2  1 
ATOM   2455 H HG3  . LYS A 1 161 ? -5.482  -24.688 -17.651 0.00 57.58  ? 160 LYS A HG3  1 
ATOM   2456 H HD2  . LYS A 1 161 ? -5.652  -22.382 -16.528 0.00 57.89  ? 160 LYS A HD2  1 
ATOM   2457 H HD3  . LYS A 1 161 ? -7.176  -22.828 -16.464 0.00 57.89  ? 160 LYS A HD3  1 
ATOM   2458 H HE2  . LYS A 1 161 ? -6.778  -24.407 -15.032 0.00 57.56  ? 160 LYS A HE2  1 
ATOM   2459 H HE3  . LYS A 1 161 ? -5.304  -24.642 -15.564 0.00 57.56  ? 160 LYS A HE3  1 
ATOM   2460 H HZ1  . LYS A 1 161 ? -4.838  -22.552 -14.402 0.00 57.48  ? 160 LYS A HZ1  1 
ATOM   2461 H HZ2  . LYS A 1 161 ? -4.950  -23.864 -13.572 0.00 57.48  ? 160 LYS A HZ2  1 
ATOM   2462 H HZ3  . LYS A 1 161 ? -6.155  -22.878 -13.633 0.00 57.48  ? 160 LYS A HZ3  1 
ATOM   2463 N N    . GLU B 2 9   ? 9.837   -8.208  -36.794 1.00 62.31  ? 441 GLU B N    1 
ATOM   2464 C CA   . GLU B 2 9   ? 9.706   -9.565  -37.314 1.00 55.95  ? 441 GLU B CA   1 
ATOM   2465 C C    . GLU B 2 9   ? 8.244   -9.852  -37.603 1.00 54.58  ? 441 GLU B C    1 
ATOM   2466 O O    . GLU B 2 9   ? 7.585   -10.088 -36.720 1.00 53.66  ? 441 GLU B O    1 
ATOM   2467 C CB   . GLU B 2 9   ? 10.251  -10.546 -36.279 0.00 57.95  ? 441 GLU B CB   1 
ATOM   2468 C CG   . GLU B 2 9   ? 10.499  -11.918 -36.818 0.00 78.05  ? 441 GLU B CG   1 
ATOM   2469 C CD   . GLU B 2 9   ? 11.013  -12.954 -35.812 0.00 79.61  ? 441 GLU B CD   1 
ATOM   2470 O OE1  . GLU B 2 9   ? 10.701  -12.903 -34.593 0.00 69.20  ? 441 GLU B OE1  1 
ATOM   2471 O OE2  . GLU B 2 9   ? 11.737  -13.860 -36.267 0.00 81.09  ? 441 GLU B OE2  1 
ATOM   2472 H HA   . GLU B 2 9   ? 10.208  -9.670  -38.145 0.00 67.16  ? 441 GLU B HA   1 
ATOM   2473 H HB2  . GLU B 2 9   ? 11.070  -10.202 -35.901 0.00 69.55  ? 441 GLU B HB2  1 
ATOM   2474 H HB3  . GLU B 2 9   ? 9.590   -10.628 -35.582 0.00 69.55  ? 441 GLU B HB3  1 
ATOM   2475 H HG2  . GLU B 2 9   ? 9.669   -12.248 -37.189 0.00 93.67  ? 441 GLU B HG2  1 
ATOM   2476 H HG3  . GLU B 2 9   ? 11.159  -11.853 -37.524 0.00 93.67  ? 441 GLU B HG3  1 
ATOM   2477 N N    . GLY B 2 10  ? 7.803   -9.825  -38.886 1.00 58.62  ? 442 GLY B N    1 
ATOM   2478 C CA   . GLY B 2 10  ? 6.416   -10.060 -39.337 1.00 35.30  ? 442 GLY B CA   1 
ATOM   2479 C C    . GLY B 2 10  ? 5.576   -11.161 -38.658 1.00 22.73  ? 442 GLY B C    1 
ATOM   2480 O O    . GLY B 2 10  ? 4.383   -11.066 -38.607 1.00 22.71  ? 442 GLY B O    1 
ATOM   2481 H H    . GLY B 2 10  ? 8.331   -9.675  -39.543 1.00 70.35  ? 442 GLY B H    1 
ATOM   2482 H HA2  . GLY B 2 10  ? 5.931   -9.236  -39.264 1.00 42.37  ? 442 GLY B HA2  1 
ATOM   2483 H HA3  . GLY B 2 10  ? 6.455   -10.282 -40.269 1.00 42.37  ? 442 GLY B HA3  1 
ATOM   2484 N N    . VAL B 2 11  ? 6.220   -12.210 -38.175 1.00 22.14  ? 443 VAL B N    1 
ATOM   2485 C CA   . VAL B 2 11  ? 5.547   -13.284 -37.449 1.00 20.23  ? 443 VAL B CA   1 
ATOM   2486 C C    . VAL B 2 11  ? 4.976   -12.745 -36.158 1.00 17.35  ? 443 VAL B C    1 
ATOM   2487 O O    . VAL B 2 11  ? 3.989   -13.268 -35.625 1.00 17.57  ? 443 VAL B O    1 
ATOM   2488 C CB   . VAL B 2 11  ? 6.502   -14.458 -37.163 1.00 25.74  ? 443 VAL B CB   1 
ATOM   2489 C CG1  . VAL B 2 11  ? 7.160   -14.907 -38.425 1.00 41.92  ? 443 VAL B CG1  1 
ATOM   2490 C CG2  . VAL B 2 11  ? 7.552   -14.100 -36.132 1.00 29.33  ? 443 VAL B CG2  1 
ATOM   2491 H H    . VAL B 2 11  ? 7.070   -12.317 -38.254 1.00 26.58  ? 443 VAL B H    1 
ATOM   2492 H HA   . VAL B 2 11  ? 4.812   -13.618 -37.986 1.00 24.29  ? 443 VAL B HA   1 
ATOM   2493 H HB   . VAL B 2 11  ? 5.987   -15.203 -36.816 1.00 30.90  ? 443 VAL B HB   1 
ATOM   2494 H HG11 . VAL B 2 11  ? 7.757   -15.646 -38.224 1.00 50.31  ? 443 VAL B HG11 1 
ATOM   2495 H HG12 . VAL B 2 11  ? 6.478   -15.194 -39.052 1.00 50.31  ? 443 VAL B HG12 1 
ATOM   2496 H HG13 . VAL B 2 11  ? 7.664   -14.167 -38.799 1.00 50.31  ? 443 VAL B HG13 1 
ATOM   2497 H HG21 . VAL B 2 11  ? 8.127   -14.868 -35.987 1.00 35.21  ? 443 VAL B HG21 1 
ATOM   2498 H HG22 . VAL B 2 11  ? 8.075   -13.352 -36.461 1.00 35.21  ? 443 VAL B HG22 1 
ATOM   2499 H HG23 . VAL B 2 11  ? 7.110   -13.856 -35.304 1.00 35.21  ? 443 VAL B HG23 1 
ATOM   2500 N N    . LEU B 2 12  ? 5.583   -11.693 -35.614 1.00 16.41  ? 444 LEU B N    1 
ATOM   2501 C CA   . LEU B 2 12  ? 4.971   -11.055 -34.456 1.00 19.73  ? 444 LEU B CA   1 
ATOM   2502 C C    . LEU B 2 12  ? 3.575   -10.584 -34.789 1.00 17.77  ? 444 LEU B C    1 
ATOM   2503 O O    . LEU B 2 12  ? 2.654   -10.717 -33.970 1.00 17.92  ? 444 LEU B O    1 
ATOM   2504 C CB   . LEU B 2 12  ? 5.822   -9.880  -33.994 1.00 23.96  ? 444 LEU B CB   1 
ATOM   2505 C CG   . LEU B 2 12  ? 7.142   -10.246 -33.349 1.00 27.64  ? 444 LEU B CG   1 
ATOM   2506 C CD1  . LEU B 2 12  ? 8.018   -9.010  -33.268 1.00 33.70  ? 444 LEU B CD1  1 
ATOM   2507 C CD2  . LEU B 2 12  ? 6.880   -10.803 -31.976 1.00 28.66  ? 444 LEU B CD2  1 
ATOM   2508 H H    . LEU B 2 12  ? 6.320   -11.342 -35.885 1.00 19.70  ? 444 LEU B H    1 
ATOM   2509 H HA   . LEU B 2 12  ? 4.912   -11.695 -33.729 1.00 23.68  ? 444 LEU B HA   1 
ATOM   2510 H HB2  . LEU B 2 12  ? 6.020   -9.323  -34.763 1.00 28.76  ? 444 LEU B HB2  1 
ATOM   2511 H HB3  . LEU B 2 12  ? 5.314   -9.368  -33.346 1.00 28.76  ? 444 LEU B HB3  1 
ATOM   2512 H HG   . LEU B 2 12  ? 7.595   -10.919 -33.880 1.00 33.18  ? 444 LEU B HG   1 
ATOM   2513 H HD11 . LEU B 2 12  ? 8.863   -9.249  -32.854 1.00 40.44  ? 444 LEU B HD11 1 
ATOM   2514 H HD12 . LEU B 2 12  ? 8.172   -8.674  -34.164 1.00 40.44  ? 444 LEU B HD12 1 
ATOM   2515 H HD13 . LEU B 2 12  ? 7.566   -8.338  -32.735 1.00 40.44  ? 444 LEU B HD13 1 
ATOM   2516 H HD21 . LEU B 2 12  ? 7.727   -11.037 -31.564 1.00 34.41  ? 444 LEU B HD21 1 
ATOM   2517 H HD22 . LEU B 2 12  ? 6.428   -10.130 -31.444 1.00 34.41  ? 444 LEU B HD22 1 
ATOM   2518 H HD23 . LEU B 2 12  ? 6.322   -11.592 -32.057 1.00 34.41  ? 444 LEU B HD23 1 
ATOM   2519 N N    . ALA B 2 13  ? 3.386   -10.053 -35.998 1.00 17.76  ? 445 ALA B N    1 
ATOM   2520 C CA   . ALA B 2 13  ? 2.058   -9.613  -36.406 1.00 18.94  ? 445 ALA B CA   1 
ATOM   2521 C C    . ALA B 2 13  ? 1.081   -10.782 -36.456 1.00 17.07  ? 445 ALA B C    1 
ATOM   2522 O O    . ALA B 2 13  ? -0.088  -10.638 -36.082 1.00 15.90  ? 445 ALA B O    1 
ATOM   2523 C CB   . ALA B 2 13  ? 2.132   -8.896  -37.755 1.00 24.98  ? 445 ALA B CB   1 
ATOM   2524 H H    . ALA B 2 13  ? 4.000   -9.939  -36.589 1.00 21.32  ? 445 ALA B H    1 
ATOM   2525 H HA   . ALA B 2 13  ? 1.726   -8.978  -35.753 1.00 22.74  ? 445 ALA B HA   1 
ATOM   2526 H HB1  . ALA B 2 13  ? 1.241   -8.611  -38.010 1.00 29.99  ? 445 ALA B HB1  1 
ATOM   2527 H HB2  . ALA B 2 13  ? 2.715   -8.126  -37.671 1.00 29.99  ? 445 ALA B HB2  1 
ATOM   2528 H HB3  . ALA B 2 13  ? 2.486   -9.509  -38.418 1.00 29.99  ? 445 ALA B HB3  1 
ATOM   2529 N N    . ASN B 2 14  ? 1.534   -11.968 -36.886 1.00 15.68  ? 446 ASN B N    1 
ATOM   2530 C CA   . ASN B 2 14  ? 0.637   -13.119 -36.853 1.00 14.90  ? 446 ASN B CA   1 
ATOM   2531 C C    . ASN B 2 14  ? 0.161   -13.410 -35.434 1.00 11.75  ? 446 ASN B C    1 
ATOM   2532 O O    . ASN B 2 14  ? -1.012  -13.739 -35.220 1.00 12.28  ? 446 ASN B O    1 
ATOM   2533 C CB   . ASN B 2 14  ? 1.327   -14.350 -37.417 1.00 14.13  ? 446 ASN B CB   1 
ATOM   2534 C CG   . ASN B 2 14  ? 1.559   -14.237 -38.863 1.00 14.03  ? 446 ASN B CG   1 
ATOM   2535 O OD1  . ASN B 2 14  ? 2.536   -13.687 -39.280 1.00 17.94  ? 446 ASN B OD1  1 
ATOM   2536 N ND2  . ASN B 2 14  ? 0.707   -14.867 -39.643 1.00 12.88  ? 446 ASN B ND2  1 
ATOM   2537 H H    . ASN B 2 14  ? 2.324   -12.124 -37.188 1.00 18.83  ? 446 ASN B H    1 
ATOM   2538 H HA   . ASN B 2 14  ? -0.141  -12.931 -37.401 1.00 17.89  ? 446 ASN B HA   1 
ATOM   2539 H HB2  . ASN B 2 14  ? 2.186   -14.461 -36.981 1.00 16.96  ? 446 ASN B HB2  1 
ATOM   2540 H HB3  . ASN B 2 14  ? 0.769   -15.127 -37.260 1.00 16.96  ? 446 ASN B HB3  1 
ATOM   2541 H HD21 . ASN B 2 14  ? 0.806   -14.840 -40.497 1.00 15.47  ? 446 ASN B HD21 1 
ATOM   2542 H HD22 . ASN B 2 14  ? 0.028   -15.269 -39.301 1.00 15.47  ? 446 ASN B HD22 1 
ATOM   2543 N N    . PHE B 2 15  ? 1.068   -13.314 -34.455 1.00 12.32  ? 447 PHE B N    1 
ATOM   2544 C CA   . PHE B 2 15  ? 0.681   -13.554 -33.069 1.00 11.18  ? 447 PHE B CA   1 
ATOM   2545 C C    . PHE B 2 15  ? -0.376  -12.555 -32.625 1.00 11.17  ? 447 PHE B C    1 
ATOM   2546 O O    . PHE B 2 15  ? -1.425  -12.929 -32.107 1.00 12.08  ? 447 PHE B O    1 
ATOM   2547 C CB   . PHE B 2 15  ? 1.911   -13.475 -32.149 1.00 11.60  ? 447 PHE B CB   1 
ATOM   2548 C CG   . PHE B 2 15  ? 1.584   -13.713 -30.687 1.00 11.35  ? 447 PHE B CG   1 
ATOM   2549 C CD1  . PHE B 2 15  ? 1.530   -14.999 -30.164 1.00 13.69  ? 447 PHE B CD1  1 
ATOM   2550 C CD2  . PHE B 2 15  ? 1.253   -12.655 -29.857 1.00 13.32  ? 447 PHE B CD2  1 
ATOM   2551 C CE1  . PHE B 2 15  ? 1.207   -15.227 -28.866 1.00 12.89  ? 447 PHE B CE1  1 
ATOM   2552 C CE2  . PHE B 2 15  ? 0.915   -12.909 -28.543 1.00 13.58  ? 447 PHE B CE2  1 
ATOM   2553 C CZ   . PHE B 2 15  ? 0.922   -14.157 -28.051 1.00 12.19  ? 447 PHE B CZ   1 
ATOM   2554 H H    . PHE B 2 15  ? 1.897   -13.114 -34.568 1.00 14.79  ? 447 PHE B H    1 
ATOM   2555 H HA   . PHE B 2 15  ? 0.304   -14.445 -32.993 1.00 13.43  ? 447 PHE B HA   1 
ATOM   2556 H HB2  . PHE B 2 15  ? 2.553   -14.148 -32.424 1.00 13.93  ? 447 PHE B HB2  1 
ATOM   2557 H HB3  . PHE B 2 15  ? 2.305   -12.592 -32.226 1.00 13.93  ? 447 PHE B HB3  1 
ATOM   2558 H HD1  . PHE B 2 15  ? 1.741   -15.720 -30.711 1.00 16.44  ? 447 PHE B HD1  1 
ATOM   2559 H HD2  . PHE B 2 15  ? 1.262   -11.783 -30.180 1.00 16.00  ? 447 PHE B HD2  1 
ATOM   2560 H HE1  . PHE B 2 15  ? 1.199   -16.093 -28.528 1.00 15.48  ? 447 PHE B HE1  1 
ATOM   2561 H HE2  . PHE B 2 15  ? 0.718   -12.197 -27.977 1.00 16.31  ? 447 PHE B HE2  1 
ATOM   2562 H HZ   . PHE B 2 15  ? 0.690   -14.304 -27.162 1.00 14.64  ? 447 PHE B HZ   1 
ATOM   2563 N N    . PHE B 2 16  ? -0.114  -11.270 -32.834 1.00 11.40  ? 448 PHE B N    1 
ATOM   2564 C CA   . PHE B 2 16  ? -1.032  -10.262 -32.324 1.00 10.96  ? 448 PHE B CA   1 
ATOM   2565 C C    . PHE B 2 16  ? -2.340  -10.256 -33.103 1.00 13.12  ? 448 PHE B C    1 
ATOM   2566 O O    . PHE B 2 16  ? -3.408  -10.075 -32.511 1.00 13.71  ? 448 PHE B O    1 
ATOM   2567 C CB   . PHE B 2 16  ? -0.362  -8.880  -32.316 1.00 13.31  ? 448 PHE B CB   1 
ATOM   2568 C CG   . PHE B 2 16  ? 0.760   -8.803  -31.331 1.00 11.62  ? 448 PHE B CG   1 
ATOM   2569 C CD1  . PHE B 2 16  ? 0.462   -8.858  -29.995 1.00 12.02  ? 448 PHE B CD1  1 
ATOM   2570 C CD2  . PHE B 2 16  ? 2.077   -8.707  -31.709 1.00 12.56  ? 448 PHE B CD2  1 
ATOM   2571 C CE1  . PHE B 2 16  ? 1.446   -8.830  -29.060 1.00 12.46  ? 448 PHE B CE1  1 
ATOM   2572 C CE2  . PHE B 2 16  ? 3.083   -8.664  -30.761 1.00 14.55  ? 448 PHE B CE2  1 
ATOM   2573 C CZ   . PHE B 2 16  ? 2.759   -8.729  -29.442 1.00 14.25  ? 448 PHE B CZ   1 
ATOM   2574 H H    . PHE B 2 16  ? 0.569   -10.962 -33.256 1.00 13.69  ? 448 PHE B H    1 
ATOM   2575 H HA   . PHE B 2 16  ? -1.246  -10.483 -31.405 1.00 13.16  ? 448 PHE B HA   1 
ATOM   2576 H HB2  . PHE B 2 16  ? -0.002  -8.696  -33.198 1.00 15.99  ? 448 PHE B HB2  1 
ATOM   2577 H HB3  . PHE B 2 16  ? -1.020  -8.209  -32.078 1.00 15.99  ? 448 PHE B HB3  1 
ATOM   2578 H HD1  . PHE B 2 16  ? -0.425  -8.937  -29.726 1.00 14.43  ? 448 PHE B HD1  1 
ATOM   2579 H HD2  . PHE B 2 16  ? 2.295   -8.672  -32.612 1.00 15.08  ? 448 PHE B HD2  1 
ATOM   2580 H HE1  . PHE B 2 16  ? 1.227   -8.863  -28.156 1.00 14.96  ? 448 PHE B HE1  1 
ATOM   2581 H HE2  . PHE B 2 16  ? 3.972   -8.597  -31.024 1.00 17.47  ? 448 PHE B HE2  1 
ATOM   2582 H HZ   . PHE B 2 16  ? 3.429   -8.694  -28.798 1.00 17.12  ? 448 PHE B HZ   1 
ATOM   2583 N N    . ASN B 2 17  ? -2.286  -10.472 -34.425 1.00 12.27  ? 449 ASN B N    1 
ATOM   2584 C CA   . ASN B 2 17  ? -3.515  -10.597 -35.207 1.00 12.95  ? 449 ASN B CA   1 
ATOM   2585 C C    . ASN B 2 17  ? -4.301  -11.837 -34.810 1.00 16.05  ? 449 ASN B C    1 
ATOM   2586 O O    . ASN B 2 17  ? -5.525  -11.837 -34.876 1.00 15.02  ? 449 ASN B O    1 
ATOM   2587 C CB   . ASN B 2 17  ? -3.205  -10.633 -36.699 1.00 10.75  ? 449 ASN B CB   1 
ATOM   2588 C CG   . ASN B 2 17  ? -2.811  -9.294  -37.232 1.00 17.29  ? 449 ASN B CG   1 
ATOM   2589 O OD1  . ASN B 2 17  ? -3.282  -8.268  -36.760 1.00 17.86  ? 449 ASN B OD1  1 
ATOM   2590 N ND2  . ASN B 2 17  ? -1.992  -9.291  -38.263 1.00 14.91  ? 449 ASN B ND2  1 
ATOM   2591 H H    . ASN B 2 17  ? -1.561  -10.549 -34.882 1.00 14.73  ? 449 ASN B H    1 
ATOM   2592 H HA   . ASN B 2 17  ? -4.075  -9.823  -35.037 1.00 15.56  ? 449 ASN B HA   1 
ATOM   2593 H HB2  . ASN B 2 17  ? -2.470  -11.247 -36.855 1.00 12.91  ? 449 ASN B HB2  1 
ATOM   2594 H HB3  . ASN B 2 17  ? -3.993  -10.929 -37.180 1.00 12.91  ? 449 ASN B HB3  1 
ATOM   2595 H HD21 . ASN B 2 17  ? -1.740  -8.545  -38.610 1.00 17.91  ? 449 ASN B HD21 1 
ATOM   2596 H HD22 . ASN B 2 17  ? -1.690  -10.034 -38.575 1.00 17.91  ? 449 ASN B HD22 1 
ATOM   2597 N N    . SER B 2 18  ? -3.621  -12.899 -34.392 1.00 12.93  ? 450 SER B N    1 
ATOM   2598 C CA   . SER B 2 18  ? -4.332  -14.079 -33.907 1.00 12.07  ? 450 SER B CA   1 
ATOM   2599 C C    . SER B 2 18  ? -5.097  -13.784 -32.627 1.00 16.48  ? 450 SER B C    1 
ATOM   2600 O O    . SER B 2 18  ? -6.199  -14.308 -32.429 1.00 17.52  ? 450 SER B O    1 
ATOM   2601 C CB   . SER B 2 18  ? -3.354  -15.225 -33.673 1.00 13.33  ? 450 SER B CB   1 
ATOM   2602 O OG   . SER B 2 18  ? -2.800  -15.676 -34.889 1.00 14.98  ? 450 SER B OG   1 
ATOM   2603 H H    . SER B 2 18  ? -2.764  -12.963 -34.378 1.00 15.53  ? 450 SER B H    1 
ATOM   2604 H HA   . SER B 2 18  ? -4.971  -14.362 -34.580 1.00 14.50  ? 450 SER B HA   1 
ATOM   2605 H HB2  . SER B 2 18  ? -2.638  -14.916 -33.097 1.00 16.01  ? 450 SER B HB2  1 
ATOM   2606 H HB3  . SER B 2 18  ? -3.825  -15.960 -33.251 1.00 16.01  ? 450 SER B HB3  1 
ATOM   2607 H HG   . SER B 2 18  ? -2.388  -15.049 -35.266 1.00 17.99  ? 450 SER B HG   1 
ATOM   2608 N N    . LEU B 2 19  ? -4.515  -12.980 -31.731 1.00 14.93  ? 451 LEU B N    1 
ATOM   2609 C CA   . LEU B 2 19  ? -5.248  -12.521 -30.553 1.00 18.81  ? 451 LEU B CA   1 
ATOM   2610 C C    . LEU B 2 19  ? -6.472  -11.735 -30.956 1.00 19.53  ? 451 LEU B C    1 
ATOM   2611 O O    . LEU B 2 19  ? -7.537  -11.860 -30.337 1.00 28.02  ? 451 LEU B O    1 
ATOM   2612 C CB   . LEU B 2 19  ? -4.385  -11.614 -29.684 1.00 22.28  ? 451 LEU B CB   1 
ATOM   2613 C CG   . LEU B 2 19  ? -3.255  -12.172 -28.873 1.00 25.19  ? 451 LEU B CG   1 
ATOM   2614 C CD1  . LEU B 2 19  ? -2.523  -11.002 -28.243 1.00 21.17  ? 451 LEU B CD1  1 
ATOM   2615 C CD2  . LEU B 2 19  ? -3.829  -13.064 -27.789 1.00 27.87  ? 451 LEU B CD2  1 
ATOM   2616 H H    . LEU B 2 19  ? -3.707  -12.690 -31.784 1.00 17.92  ? 451 LEU B H    1 
ATOM   2617 H HA   . LEU B 2 19  ? -5.528  -13.284 -30.024 1.00 22.58  ? 451 LEU B HA   1 
ATOM   2618 H HB2  . LEU B 2 19  ? -3.995  -10.944 -30.267 1.00 26.74  ? 451 LEU B HB2  1 
ATOM   2619 H HB3  . LEU B 2 19  ? -4.976  -11.170 -29.056 1.00 26.74  ? 451 LEU B HB3  1 
ATOM   2620 H HG   . LEU B 2 19  ? -2.647  -12.680 -29.432 1.00 30.23  ? 451 LEU B HG   1 
ATOM   2621 H HD11 . LEU B 2 19  ? -1.786  -11.340 -27.712 1.00 25.41  ? 451 LEU B HD11 1 
ATOM   2622 H HD12 . LEU B 2 19  ? -2.188  -10.424 -28.947 1.00 25.41  ? 451 LEU B HD12 1 
ATOM   2623 H HD13 . LEU B 2 19  ? -3.141  -10.511 -27.679 1.00 25.41  ? 451 LEU B HD13 1 
ATOM   2624 H HD21 . LEU B 2 19  ? -3.100  -13.427 -27.262 1.00 33.46  ? 451 LEU B HD21 1 
ATOM   2625 H HD22 . LEU B 2 19  ? -4.415  -12.536 -27.225 1.00 33.46  ? 451 LEU B HD22 1 
ATOM   2626 H HD23 . LEU B 2 19  ? -4.328  -13.784 -28.205 1.00 33.46  ? 451 LEU B HD23 1 
ATOM   2627 N N    . LEU B 2 20  ? -6.315  -10.855 -31.943 1.00 20.79  ? 452 LEU B N    1 
ATOM   2628 C CA   . LEU B 2 20  ? -7.434  -10.042 -32.395 1.00 19.35  ? 452 LEU B CA   1 
ATOM   2629 C C    . LEU B 2 20  ? -8.526  -10.923 -32.992 1.00 27.14  ? 452 LEU B C    1 
ATOM   2630 O O    . LEU B 2 20  ? -9.714  -10.591 -32.902 1.00 30.63  ? 452 LEU B O    1 
ATOM   2631 C CB   . LEU B 2 20  ? -6.935  -9.003  -33.401 1.00 21.87  ? 452 LEU B CB   1 
ATOM   2632 C CG   . LEU B 2 20  ? -5.942  -7.947  -32.897 1.00 21.73  ? 452 LEU B CG   1 
ATOM   2633 C CD1  . LEU B 2 20  ? -5.382  -7.115  -34.039 1.00 23.53  ? 452 LEU B CD1  1 
ATOM   2634 C CD2  . LEU B 2 20  ? -6.621  -7.054  -31.895 1.00 24.67  ? 452 LEU B CD2  1 
ATOM   2635 H H    . LEU B 2 20  ? -5.578  -10.712 -32.362 1.00 24.95  ? 452 LEU B H    1 
ATOM   2636 H HA   . LEU B 2 20  ? -7.810  -9.570  -31.636 1.00 23.23  ? 452 LEU B HA   1 
ATOM   2637 H HB2  . LEU B 2 20  ? -6.502  -9.475  -34.129 1.00 26.26  ? 452 LEU B HB2  1 
ATOM   2638 H HB3  . LEU B 2 20  ? -7.706  -8.526  -33.745 1.00 26.26  ? 452 LEU B HB3  1 
ATOM   2639 H HG   . LEU B 2 20  ? -5.202  -8.391  -32.455 1.00 26.08  ? 452 LEU B HG   1 
ATOM   2640 H HD11 . LEU B 2 20  ? -4.762  -6.462  -33.679 1.00 28.24  ? 452 LEU B HD11 1 
ATOM   2641 H HD12 . LEU B 2 20  ? -4.923  -7.701  -34.660 1.00 28.24  ? 452 LEU B HD12 1 
ATOM   2642 H HD13 . LEU B 2 20  ? -6.114  -6.663  -34.488 1.00 28.24  ? 452 LEU B HD13 1 
ATOM   2643 H HD21 . LEU B 2 20  ? -5.986  -6.390  -31.583 1.00 29.62  ? 452 LEU B HD21 1 
ATOM   2644 H HD22 . LEU B 2 20  ? -7.374  -6.616  -32.321 1.00 29.62  ? 452 LEU B HD22 1 
ATOM   2645 H HD23 . LEU B 2 20  ? -6.929  -7.593  -31.150 1.00 29.62  ? 452 LEU B HD23 1 
ATOM   2646 N N    . SER B 2 21  ? -8.152  -12.067 -33.566 1.00 23.48  ? 453 SER B N    1 
ATOM   2647 C CA   . SER B 2 21  ? -9.115  -12.903 -34.274 1.00 25.02  ? 453 SER B CA   1 
ATOM   2648 C C    . SER B 2 21  ? -10.022 -13.672 -33.327 1.00 34.84  ? 453 SER B C    1 
ATOM   2649 O O    . SER B 2 21  ? -11.078 -14.150 -33.753 1.00 37.91  ? 453 SER B O    1 
ATOM   2650 C CB   . SER B 2 21  ? -8.386  -13.896 -35.184 1.00 21.87  ? 453 SER B CB   1 
ATOM   2651 O OG   . SER B 2 21  ? -7.859  -15.001 -34.455 1.00 22.60  ? 453 SER B OG   1 
ATOM   2652 H H    . SER B 2 21  ? -7.350  -12.379 -33.559 1.00 28.19  ? 453 SER B H    1 
ATOM   2653 H HA   . SER B 2 21  ? -9.673  -12.339 -34.832 1.00 30.03  ? 453 SER B HA   1 
ATOM   2654 H HB2  . SER B 2 21  ? -9.011  -14.230 -35.846 1.00 26.26  ? 453 SER B HB2  1 
ATOM   2655 H HB3  . SER B 2 21  ? -7.655  -13.436 -35.625 1.00 26.26  ? 453 SER B HB3  1 
ATOM   2656 H HG   . SER B 2 21  ? -7.312  -14.730 -33.878 1.00 27.13  ? 453 SER B HG   1 
ATOM   2657 N N    . LYS B 2 22  ? -9.628  -13.803 -32.066 1.00 34.03  ? 454 LYS B N    1 
ATOM   2658 C CA   . LYS B 2 22  ? -10.334 -14.623 -31.087 1.00 38.41  ? 454 LYS B CA   1 
ATOM   2659 C C    . LYS B 2 22  ? -11.485 -13.837 -30.463 1.00 45.60  ? 454 LYS B C    1 
ATOM   2660 O O    . LYS B 2 22  ? -12.653 -14.082 -30.774 1.00 52.65  ? 454 LYS B O    1 
ATOM   2661 C CB   . LYS B 2 22  ? -9.356  -15.097 -30.006 1.00 40.26  ? 454 LYS B CB   1 
ATOM   2662 C CG   . LYS B 2 22  ? -9.934  -16.072 -28.987 1.00 50.42  ? 454 LYS B CG   1 
ATOM   2663 C CD   . LYS B 2 22  ? -8.883  -16.453 -27.940 1.00 59.12  ? 454 LYS B CD   1 
ATOM   2664 C CE   . LYS B 2 22  ? -9.408  -17.450 -26.915 1.00 71.86  ? 454 LYS B CE   1 
ATOM   2665 N NZ   . LYS B 2 22  ? -10.445 -16.854 -26.023 1.00 97.94  ? 454 LYS B NZ   1 
ATOM   2666 H H    . LYS B 2 22  ? -8.932  -13.415 -31.744 1.00 40.85  ? 454 LYS B H    1 
ATOM   2667 H HA   . LYS B 2 22  ? -10.703 -15.404 -31.528 1.00 46.10  ? 454 LYS B HA   1 
ATOM   2668 H HB2  . LYS B 2 22  ? -8.609  -15.538 -30.440 1.00 48.33  ? 454 LYS B HB2  1 
ATOM   2669 H HB3  . LYS B 2 22  ? -9.037  -14.321 -29.519 1.00 48.33  ? 454 LYS B HB3  1 
ATOM   2670 H HG2  . LYS B 2 22  ? -10.682 -15.656 -28.531 1.00 60.51  ? 454 LYS B HG2  1 
ATOM   2671 H HG3  . LYS B 2 22  ? -10.221 -16.880 -29.440 1.00 60.51  ? 454 LYS B HG3  1 
ATOM   2672 H HD2  . LYS B 2 22  ? -8.122  -16.855 -28.388 1.00 70.96  ? 454 LYS B HD2  1 
ATOM   2673 H HD3  . LYS B 2 22  ? -8.604  -15.654 -27.466 1.00 70.96  ? 454 LYS B HD3  1 
ATOM   2674 H HE2  . LYS B 2 22  ? -9.807  -18.202 -27.380 1.00 86.24  ? 454 LYS B HE2  1 
ATOM   2675 H HE3  . LYS B 2 22  ? -8.672  -17.753 -26.361 1.00 86.24  ? 454 LYS B HE3  1 
ATOM   2676 H HZ1  . LYS B 2 22  ? -10.729 -17.462 -25.438 1.00 117.54 ? 454 LYS B HZ1  1 
ATOM   2677 H HZ2  . LYS B 2 22  ? -10.102 -16.163 -25.578 1.00 117.54 ? 454 LYS B HZ2  1 
ATOM   2678 H HZ3  . LYS B 2 22  ? -11.137 -16.572 -26.507 1.00 117.54 ? 454 LYS B HZ3  1 
HETATM 2679 O O    . HOH C 3 .   ? 2.351   -2.234  4.893   1.00 29.90  ? 201 HOH A O    1 
HETATM 2680 O O    . HOH C 3 .   ? -9.945  -11.418 -24.309 1.00 46.50  ? 202 HOH A O    1 
HETATM 2681 O O    . HOH C 3 .   ? -8.034  -13.648 -9.945  1.00 29.20  ? 203 HOH A O    1 
HETATM 2682 O O    . HOH C 3 .   ? -5.314  -18.458 -18.223 1.00 44.54  ? 204 HOH A O    1 
HETATM 2683 O O    . HOH C 3 .   ? -17.215 -5.735  -21.944 1.00 38.20  ? 205 HOH A O    1 
HETATM 2684 O O    . HOH C 3 .   ? -15.764 -7.338  -5.133  1.00 24.50  ? 206 HOH A O    1 
HETATM 2685 O O    . HOH C 3 .   ? -7.267  9.888   -6.527  1.00 41.33  ? 207 HOH A O    1 
HETATM 2686 O O    . HOH C 3 .   ? -16.989 6.193   -9.633  1.00 21.40  ? 208 HOH A O    1 
HETATM 2687 O O    . HOH C 3 .   ? -6.462  -24.939 -12.481 1.00 39.17  ? 209 HOH A O    1 
HETATM 2688 O O    . HOH C 3 .   ? 7.198   -8.220  4.866   1.00 14.85  ? 210 HOH A O    1 
HETATM 2689 O O    . HOH C 3 .   ? 6.245   -14.419 -7.631  1.00 28.33  ? 211 HOH A O    1 
HETATM 2690 O O    . HOH C 3 .   ? 14.309  -9.434  -4.055  1.00 26.90  ? 212 HOH A O    1 
HETATM 2691 O O    . HOH C 3 .   ? 12.435  4.643   -3.082  1.00 26.91  ? 213 HOH A O    1 
HETATM 2692 O O    . HOH C 3 .   ? -0.085  12.898  -17.732 1.00 39.38  ? 214 HOH A O    1 
HETATM 2693 O O    . HOH C 3 .   ? -11.487 -0.963  -20.584 1.00 21.75  ? 215 HOH A O    1 
HETATM 2694 O O    . HOH C 3 .   ? -9.480  -14.724 -8.778  1.00 34.12  ? 216 HOH A O    1 
HETATM 2695 O O    . HOH C 3 .   ? 2.226   -10.766 -2.898  1.00 21.49  ? 217 HOH A O    1 
HETATM 2696 O O    . HOH C 3 .   ? 14.680  1.790   -2.374  1.00 47.19  ? 218 HOH A O    1 
HETATM 2697 O O    . HOH C 3 .   ? 4.834   4.142   -8.989  1.00 11.78  ? 219 HOH A O    1 
HETATM 2698 O O    . HOH C 3 .   ? -14.139 -10.532 -6.518  1.00 34.96  ? 220 HOH A O    1 
HETATM 2699 O O    . HOH C 3 .   ? 12.425  9.361   -12.404 1.00 36.99  ? 221 HOH A O    1 
HETATM 2700 O O    . HOH C 3 .   ? -12.782 6.702   -13.676 1.00 30.59  ? 222 HOH A O    1 
HETATM 2701 O O    . HOH C 3 .   ? 6.754   7.144   -9.582  1.00 19.42  ? 223 HOH A O    1 
HETATM 2702 O O    . HOH C 3 .   ? -2.584  7.125   -22.024 1.00 29.08  ? 224 HOH A O    1 
HETATM 2703 O O    . HOH C 3 .   ? -4.608  4.128   -22.038 1.00 17.74  ? 225 HOH A O    1 
HETATM 2704 O O    . HOH C 3 .   ? -7.111  -17.038 -20.895 1.00 28.90  ? 226 HOH A O    1 
HETATM 2705 O O    . HOH C 3 .   ? 12.998  -4.923  -25.045 1.00 32.59  ? 227 HOH A O    1 
HETATM 2706 O O    . HOH C 3 .   ? 3.810   -6.602  -35.155 1.00 28.24  ? 228 HOH A O    1 
HETATM 2707 O O    . HOH C 3 .   ? 13.246  8.367   -9.068  1.00 46.99  ? 229 HOH A O    1 
HETATM 2708 O O    . HOH C 3 .   ? 12.324  6.392   -7.854  1.00 36.22  ? 230 HOH A O    1 
HETATM 2709 O O    . HOH C 3 .   ? 8.355   6.077   -3.666  1.00 19.63  ? 231 HOH A O    1 
HETATM 2710 O O    . HOH C 3 .   ? 11.993  -12.919 -6.401  1.00 28.63  ? 232 HOH A O    1 
HETATM 2711 O O    . HOH C 3 .   ? 12.570  -9.500  2.716   1.00 12.64  ? 233 HOH A O    1 
HETATM 2712 O O    . HOH C 3 .   ? -19.261 -2.086  -23.755 1.00 26.25  ? 234 HOH A O    1 
HETATM 2713 O O    . HOH C 3 .   ? -7.586  1.045   -4.248  1.00 35.82  ? 235 HOH A O    1 
HETATM 2714 O O    . HOH C 3 .   ? 12.094  2.345   -21.953 1.00 35.81  ? 236 HOH A O    1 
HETATM 2715 O O    . HOH C 3 .   ? 11.355  -0.417  -3.059  1.00 18.89  ? 237 HOH A O    1 
HETATM 2716 O O    . HOH C 3 .   ? 9.407   -11.430 -14.071 1.00 35.10  ? 238 HOH A O    1 
HETATM 2717 O O    . HOH C 3 .   ? -14.417 1.863   -6.734  1.00 25.96  ? 239 HOH A O    1 
HETATM 2718 O O    . HOH C 3 .   ? -9.044  5.306   -20.998 1.00 31.05  ? 240 HOH A O    1 
HETATM 2719 O O    . HOH C 3 .   ? 8.315   -15.163 -3.104  1.00 36.14  ? 241 HOH A O    1 
HETATM 2720 O O    . HOH C 3 .   ? -13.537 -7.688  -3.578  1.00 22.45  ? 242 HOH A O    1 
HETATM 2721 O O    . HOH C 3 .   ? -4.686  9.008   -2.564  1.00 20.03  ? 243 HOH A O    1 
HETATM 2722 O O    . HOH C 3 .   ? 13.457  4.376   -18.974 1.00 32.13  ? 244 HOH A O    1 
HETATM 2723 O O    . HOH C 3 .   ? -11.351 -3.825  -28.333 1.00 20.22  ? 245 HOH A O    1 
HETATM 2724 O O    . HOH C 3 .   ? -8.132  -2.802  -4.579  1.00 18.61  ? 246 HOH A O    1 
HETATM 2725 O O    . HOH C 3 .   ? 18.800  -2.894  -20.158 1.00 27.24  ? 247 HOH A O    1 
HETATM 2726 O O    . HOH C 3 .   ? 5.904   8.072   -20.119 1.00 43.60  ? 248 HOH A O    1 
HETATM 2727 O O    . HOH C 3 .   ? -6.843  -17.813 -13.783 1.00 46.83  ? 249 HOH A O    1 
HETATM 2728 O O    . HOH C 3 .   ? -16.075 1.752   -10.401 1.00 14.25  ? 250 HOH A O    1 
HETATM 2729 O O    . HOH C 3 .   ? -10.476 -4.424  -5.429  1.00 23.20  ? 251 HOH A O    1 
HETATM 2730 O O    . HOH C 3 .   ? 3.749   1.697   -9.673  1.00 10.17  ? 252 HOH A O    1 
HETATM 2731 O O    . HOH C 3 .   ? -4.554  7.620   -14.818 1.00 17.76  ? 253 HOH A O    1 
HETATM 2732 O O    . HOH C 3 .   ? -18.742 -9.099  -15.813 1.00 31.67  ? 254 HOH A O    1 
HETATM 2733 O O    . HOH C 3 .   ? 18.128  -6.343  -1.301  1.00 26.68  ? 255 HOH A O    1 
HETATM 2734 O O    . HOH C 3 .   ? -6.884  -18.806 -23.192 1.00 44.99  ? 256 HOH A O    1 
HETATM 2735 O O    . HOH C 3 .   ? -1.868  2.274   1.001   1.00 18.10  ? 257 HOH A O    1 
HETATM 2736 O O    . HOH C 3 .   ? 3.409   6.077   -18.202 1.00 19.80  ? 258 HOH A O    1 
HETATM 2737 O O    . HOH C 3 .   ? 7.898   4.327   -6.776  1.00 18.58  ? 259 HOH A O    1 
HETATM 2738 O O    . HOH C 3 .   ? 9.306   8.174   -8.127  1.00 34.49  ? 260 HOH A O    1 
HETATM 2739 O O    . HOH C 3 .   ? -0.659  -1.008  -25.586 1.00 11.50  ? 261 HOH A O    1 
HETATM 2740 O O    . HOH C 3 .   ? 16.482  -3.480  -7.639  1.00 33.28  ? 262 HOH A O    1 
HETATM 2741 O O    . HOH C 3 .   ? 6.179   1.826   -35.539 1.00 29.33  ? 263 HOH A O    1 
HETATM 2742 O O    . HOH C 3 .   ? -15.089 -15.495 -13.026 1.00 34.05  ? 264 HOH A O    1 
HETATM 2743 O O    . HOH C 3 .   ? -14.930 -4.501  -26.737 1.00 31.45  ? 265 HOH A O    1 
HETATM 2744 O O    . HOH C 3 .   ? 0.744   -17.683 -12.819 1.00 31.15  ? 266 HOH A O    1 
HETATM 2745 O O    . HOH C 3 .   ? -14.954 -0.662  -9.053  1.00 32.32  ? 267 HOH A O    1 
HETATM 2746 O O    . HOH C 3 .   ? -12.884 -3.884  -0.550  1.00 43.84  ? 268 HOH A O    1 
HETATM 2747 O O    . HOH C 3 .   ? 13.918  -6.841  -17.771 1.00 16.43  ? 269 HOH A O    1 
HETATM 2748 O O    . HOH C 3 .   ? -14.663 -5.774  -6.231  1.00 31.30  ? 270 HOH A O    1 
HETATM 2749 O O    . HOH C 3 .   ? 15.940  -6.187  -19.973 1.00 22.97  ? 271 HOH A O    1 
HETATM 2750 O O    . HOH C 3 .   ? -3.659  7.839   -6.052  1.00 22.56  ? 272 HOH A O    1 
HETATM 2751 O O    . HOH C 3 .   ? 13.232  -0.252  -20.629 1.00 32.66  ? 273 HOH A O    1 
HETATM 2752 O O    . HOH C 3 .   ? 12.067  1.847   -0.305  1.00 28.60  ? 274 HOH A O    1 
HETATM 2753 O O    . HOH C 3 .   ? -8.975  1.860   -22.181 1.00 22.33  ? 275 HOH A O    1 
HETATM 2754 O O    . HOH C 3 .   ? 13.190  -0.550  0.083   1.00 31.97  ? 276 HOH A O    1 
HETATM 2755 O O    . HOH C 3 .   ? 11.630  0.962   -27.374 1.00 29.96  ? 277 HOH A O    1 
HETATM 2756 O O    . HOH C 3 .   ? 1.423   -17.220 -5.492  1.00 30.61  ? 278 HOH A O    1 
HETATM 2757 O O    . HOH C 3 .   ? -13.490 -7.268  -21.410 1.00 32.52  ? 279 HOH A O    1 
HETATM 2758 O O    . HOH C 3 .   ? 13.950  -4.000  -31.581 1.00 31.78  ? 280 HOH A O    1 
HETATM 2759 O O    . HOH C 3 .   ? 1.513   -20.652 -6.384  1.00 39.32  ? 281 HOH A O    1 
HETATM 2760 O O    . HOH C 3 .   ? -8.924  0.675   -33.669 1.00 37.26  ? 282 HOH A O    1 
HETATM 2761 O O    . HOH C 3 .   ? 6.425   -14.586 -15.245 1.00 37.79  ? 283 HOH A O    1 
HETATM 2762 O O    . HOH C 3 .   ? 7.834   3.995   -24.386 1.00 28.74  ? 284 HOH A O    1 
HETATM 2763 O O    . HOH C 3 .   ? 15.068  -1.613  -2.269  1.00 35.84  ? 285 HOH A O    1 
HETATM 2764 O O    . HOH C 3 .   ? 8.438   9.760   -16.377 1.00 34.88  ? 286 HOH A O    1 
HETATM 2765 O O    . HOH C 3 .   ? 5.421   8.224   -7.396  1.00 22.78  ? 287 HOH A O    1 
HETATM 2766 O O    . HOH C 3 .   ? 5.214   9.061   -4.874  1.00 36.45  ? 288 HOH A O    1 
HETATM 2767 O O    . HOH C 3 .   ? -3.182  -2.876  1.657   1.00 21.07  ? 289 HOH A O    1 
HETATM 2768 O O    . HOH C 3 .   ? 16.013  5.298   -16.964 1.00 32.88  ? 290 HOH A O    1 
HETATM 2769 O O    . HOH C 3 .   ? -11.602 12.588  -8.061  1.00 38.58  ? 291 HOH A O    1 
HETATM 2770 O O    . HOH C 3 .   ? -14.027 8.049   -11.717 1.00 26.69  ? 292 HOH A O    1 
HETATM 2771 O O    . HOH C 3 .   ? -2.377  -25.766 -14.705 1.00 27.97  ? 293 HOH A O    1 
HETATM 2772 O O    . HOH C 3 .   ? 6.977   9.200   -3.680  1.00 30.65  ? 294 HOH A O    1 
HETATM 2773 O O    . HOH C 3 .   ? -2.918  9.092   -8.399  1.00 24.74  ? 295 HOH A O    1 
HETATM 2774 O O    . HOH C 3 .   ? 2.193   -12.666 -13.521 1.00 34.88  ? 296 HOH A O    1 
HETATM 2775 O O    . HOH C 3 .   ? 14.070  -1.523  -25.884 1.00 38.20  ? 297 HOH A O    1 
HETATM 2776 O O    . HOH C 3 .   ? 3.235   -4.715  -36.930 1.00 37.05  ? 298 HOH A O    1 
HETATM 2777 O O    . HOH C 3 .   ? 3.795   -14.419 -3.702  1.00 48.16  ? 299 HOH A O    1 
HETATM 2778 O O    . HOH C 3 .   ? -8.481  -1.690  -1.462  1.00 30.44  ? 300 HOH A O    1 
HETATM 2779 O O    . HOH C 3 .   ? -12.930 11.089  -6.285  1.00 43.62  ? 301 HOH A O    1 
HETATM 2780 O O    . HOH C 3 .   ? 0.998   -14.242 -15.242 1.00 38.80  ? 302 HOH A O    1 
HETATM 2781 O O    . HOH C 3 .   ? -12.437 -4.551  1.803   1.00 43.59  ? 303 HOH A O    1 
HETATM 2782 O O    . HOH C 3 .   ? 1.514   -14.525 -13.495 1.00 37.10  ? 304 HOH A O    1 
HETATM 2783 O O    . HOH C 3 .   ? 0.442   -3.928  4.140   1.00 33.82  ? 305 HOH A O    1 
HETATM 2784 O O    . HOH C 3 .   ? 9.730   5.511   -5.116  1.00 42.46  ? 306 HOH A O    1 
HETATM 2785 O O    . HOH C 3 .   ? 11.522  4.715   5.782   1.00 41.55  ? 307 HOH A O    1 
HETATM 2786 O O    . HOH C 3 .   ? -13.031 -1.810  -7.715  1.00 42.68  ? 308 HOH A O    1 
HETATM 2787 O O    . HOH C 3 .   ? 3.286   9.903   -6.475  1.00 30.92  ? 309 HOH A O    1 
HETATM 2788 O O    . HOH C 3 .   ? -2.279  3.820   3.272   1.00 40.82  ? 310 HOH A O    1 
HETATM 2789 O O    . HOH C 3 .   ? 10.625  6.883   5.141   1.00 41.36  ? 311 HOH A O    1 
HETATM 2790 O O    . HOH C 3 .   ? -2.113  -3.471  3.974   1.00 33.48  ? 312 HOH A O    1 
HETATM 2791 O O    . HOH C 3 .   ? -17.148 1.671   -20.148 1.00 38.45  ? 313 HOH A O    1 
HETATM 2792 O O    . HOH C 3 .   ? -8.577  -0.881  0.480   1.00 44.66  ? 314 HOH A O    1 
HETATM 2793 O O    . HOH C 3 .   ? 10.513  -15.562 -2.353  1.00 42.89  ? 315 HOH A O    1 
HETATM 2794 O O    . HOH C 3 .   ? -15.061 7.764   -15.907 1.00 37.85  ? 316 HOH A O    1 
HETATM 2795 O O    . HOH D 3 .   ? -9.218  -17.377 -34.718 1.00 17.73  ? 501 HOH B O    1 
HETATM 2796 O O    . HOH D 3 .   ? -1.477  -17.062 -36.931 1.00 15.26  ? 502 HOH B O    1 
HETATM 2797 O O    . HOH D 3 .   ? -3.674  -5.546  -37.564 1.00 38.61  ? 503 HOH B O    1 
HETATM 2798 O O    . HOH D 3 .   ? 8.946   -12.748 -39.262 1.00 32.67  ? 504 HOH B O    1 
HETATM 2799 O O    . HOH D 3 .   ? -6.650  -11.567 -38.277 1.00 37.50  ? 505 HOH B O    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   0   ?   ?   ?   A . n 
A 1 2   MET 2   1   ?   ?   ?   A . n 
A 1 3   PHE 3   2   ?   ?   ?   A . n 
A 1 4   SER 4   3   ?   ?   ?   A . n 
A 1 5   VAL 5   4   ?   ?   ?   A . n 
A 1 6   GLU 6   5   ?   ?   ?   A . n 
A 1 7   SER 7   6   ?   ?   ?   A . n 
A 1 8   LEU 8   7   ?   ?   ?   A . n 
A 1 9   GLU 9   8   ?   ?   ?   A . n 
A 1 10  ARG 10  9   ?   ?   ?   A . n 
A 1 11  ALA 11  10  10  ALA ALA A . n 
A 1 12  GLU 12  11  11  GLU GLU A . n 
A 1 13  LEU 13  12  12  LEU LEU A . n 
A 1 14  CYS 14  13  13  CYS CYS A . n 
A 1 15  GLU 15  14  14  GLU GLU A . n 
A 1 16  SER 16  15  15  SER SER A . n 
A 1 17  LEU 17  16  16  LEU LEU A . n 
A 1 18  LEU 18  17  17  LEU LEU A . n 
A 1 19  THR 19  18  18  THR THR A . n 
A 1 20  TRP 20  19  19  TRP TRP A . n 
A 1 21  ILE 21  20  20  ILE ILE A . n 
A 1 22  GLN 22  21  21  GLN GLN A . n 
A 1 23  THR 23  22  22  THR THR A . n 
A 1 24  PHE 24  23  23  PHE PHE A . n 
A 1 25  ASN 25  24  24  ASN ASN A . n 
A 1 26  VAL 26  25  25  VAL VAL A . n 
A 1 27  ASP 27  26  26  ASP ASP A . n 
A 1 28  ALA 28  27  27  ALA ALA A . n 
A 1 29  PRO 29  28  28  PRO PRO A . n 
A 1 30  CYS 30  29  29  CYS CYS A . n 
A 1 31  GLN 31  30  30  GLN GLN A . n 
A 1 32  THR 32  31  31  THR THR A . n 
A 1 33  VAL 33  32  32  VAL VAL A . n 
A 1 34  GLU 34  33  33  GLU GLU A . n 
A 1 35  ASP 35  34  34  ASP ASP A . n 
A 1 36  LEU 36  35  35  LEU LEU A . n 
A 1 37  THR 37  36  36  THR THR A . n 
A 1 38  ASN 38  37  37  ASN ASN A . n 
A 1 39  GLY 39  38  38  GLY GLY A . n 
A 1 40  VAL 40  39  39  VAL VAL A . n 
A 1 41  VAL 41  40  40  VAL VAL A . n 
A 1 42  MET 42  41  41  MET MET A . n 
A 1 43  ALA 43  42  42  ALA ALA A . n 
A 1 44  GLN 44  43  43  GLN GLN A . n 
A 1 45  VAL 45  44  44  VAL VAL A . n 
A 1 46  LEU 46  45  45  LEU LEU A . n 
A 1 47  GLN 47  46  46  GLN GLN A . n 
A 1 48  LYS 48  47  47  LYS LYS A . n 
A 1 49  ILE 49  48  48  ILE ILE A . n 
A 1 50  ASP 50  49  49  ASP ASP A . n 
A 1 51  PRO 51  50  50  PRO PRO A . n 
A 1 52  ALA 52  51  51  ALA ALA A . n 
A 1 53  TYR 53  52  52  TYR TYR A . n 
A 1 54  PHE 54  53  53  PHE PHE A . n 
A 1 55  ASP 55  54  54  ASP ASP A . n 
A 1 56  GLU 56  55  55  GLU GLU A . n 
A 1 57  ASN 57  56  56  ASN ASN A . n 
A 1 58  TRP 58  57  57  TRP TRP A . n 
A 1 59  LEU 59  58  58  LEU LEU A . n 
A 1 60  ASN 60  59  59  ASN ASN A . n 
A 1 61  ARG 61  60  60  ARG ARG A . n 
A 1 62  ILE 62  61  61  ILE ILE A . n 
A 1 63  LYS 63  62  62  LYS LYS A . n 
A 1 64  THR 64  63  63  THR THR A . n 
A 1 65  GLU 65  64  64  GLU GLU A . n 
A 1 66  VAL 66  65  65  VAL VAL A . n 
A 1 67  GLY 67  66  66  GLY GLY A . n 
A 1 68  ASP 68  67  67  ASP ASP A . n 
A 1 69  ASN 69  68  68  ASN ASN A . n 
A 1 70  TRP 70  69  69  TRP TRP A . n 
A 1 71  ARG 71  70  70  ARG ARG A . n 
A 1 72  LEU 72  71  71  LEU LEU A . n 
A 1 73  LYS 73  72  72  LYS LYS A . n 
A 1 74  ILE 74  73  73  ILE ILE A . n 
A 1 75  SER 75  74  74  SER SER A . n 
A 1 76  ASN 76  75  75  ASN ASN A . n 
A 1 77  LEU 77  76  76  LEU LEU A . n 
A 1 78  LYS 78  77  77  LYS LYS A . n 
A 1 79  LYS 79  78  78  LYS LYS A . n 
A 1 80  ILE 80  79  79  ILE ILE A . n 
A 1 81  LEU 81  80  80  LEU LEU A . n 
A 1 82  LYS 82  81  81  LYS LYS A . n 
A 1 83  GLY 83  82  82  GLY GLY A . n 
A 1 84  ILE 84  83  83  ILE ILE A . n 
A 1 85  LEU 85  84  84  LEU LEU A . n 
A 1 86  ASP 86  85  85  ASP ASP A . n 
A 1 87  TYR 87  86  86  TYR TYR A . n 
A 1 88  ASN 88  87  87  ASN ASN A . n 
A 1 89  HIS 89  88  88  HIS HIS A . n 
A 1 90  GLU 90  89  89  GLU GLU A . n 
A 1 91  ILE 91  90  90  ILE ILE A . n 
A 1 92  LEU 92  91  91  LEU LEU A . n 
A 1 93  GLY 93  92  92  GLY GLY A . n 
A 1 94  GLN 94  93  93  GLN GLN A . n 
A 1 95  GLN 95  94  94  GLN GLN A . n 
A 1 96  ILE 96  95  95  ILE ILE A . n 
A 1 97  ASN 97  96  96  ASN ASN A . n 
A 1 98  ASP 98  97  97  ASP ASP A . n 
A 1 99  PHE 99  98  98  PHE PHE A . n 
A 1 100 THR 100 99  99  THR THR A . n 
A 1 101 LEU 101 100 100 LEU LEU A . n 
A 1 102 PRO 102 101 101 PRO PRO A . n 
A 1 103 ASP 103 102 102 ASP ASP A . n 
A 1 104 VAL 104 103 103 VAL VAL A . n 
A 1 105 ASN 105 104 104 ASN ASN A . n 
A 1 106 LEU 106 105 105 LEU LEU A . n 
A 1 107 ILE 107 106 106 ILE ILE A . n 
A 1 108 GLY 108 107 107 GLY GLY A . n 
A 1 109 GLU 109 108 108 GLU GLU A . n 
A 1 110 HIS 110 109 109 HIS HIS A . n 
A 1 111 SER 111 110 110 SER SER A . n 
A 1 112 ASP 112 111 111 ASP ASP A . n 
A 1 113 ALA 113 112 112 ALA ALA A . n 
A 1 114 ALA 114 113 113 ALA ALA A . n 
A 1 115 GLU 115 114 114 GLU GLU A . n 
A 1 116 LEU 116 115 115 LEU LEU A . n 
A 1 117 GLY 117 116 116 GLY GLY A . n 
A 1 118 ARG 118 117 117 ARG ARG A . n 
A 1 119 MET 119 118 118 MET MET A . n 
A 1 120 LEU 120 119 119 LEU LEU A . n 
A 1 121 GLN 121 120 120 GLN GLN A . n 
A 1 122 LEU 122 121 121 LEU LEU A . n 
A 1 123 ILE 123 122 122 ILE ILE A . n 
A 1 124 LEU 124 123 123 LEU LEU A . n 
A 1 125 GLY 125 124 124 GLY GLY A . n 
A 1 126 CYS 126 125 125 CYS CYS A . n 
A 1 127 ALA 127 126 126 ALA ALA A . n 
A 1 128 VAL 128 127 127 VAL VAL A . n 
A 1 129 ASN 129 128 128 ASN ASN A . n 
A 1 130 CYS 130 129 129 CYS CYS A . n 
A 1 131 GLU 131 130 130 GLU GLU A . n 
A 1 132 GLN 132 131 131 GLN GLN A . n 
A 1 133 LYS 133 132 132 LYS LYS A . n 
A 1 134 GLN 134 133 133 GLN GLN A . n 
A 1 135 GLU 135 134 134 GLU GLU A . n 
A 1 136 TYR 136 135 135 TYR TYR A . n 
A 1 137 ILE 137 136 136 ILE ILE A . n 
A 1 138 GLN 138 137 137 GLN GLN A . n 
A 1 139 ALA 139 138 138 ALA ALA A . n 
A 1 140 ILE 140 139 139 ILE ILE A . n 
A 1 141 MET 141 140 140 MET MET A . n 
A 1 142 MET 142 141 141 MET MET A . n 
A 1 143 MET 143 142 142 MET MET A . n 
A 1 144 GLU 144 143 143 GLU GLU A . n 
A 1 145 GLU 145 144 144 GLU GLU A . n 
A 1 146 SER 146 145 145 SER SER A . n 
A 1 147 VAL 147 146 146 VAL VAL A . n 
A 1 148 GLN 148 147 147 GLN GLN A . n 
A 1 149 HIS 149 148 148 HIS HIS A . n 
A 1 150 VAL 150 149 149 VAL VAL A . n 
A 1 151 VAL 151 150 150 VAL VAL A . n 
A 1 152 MET 152 151 151 MET MET A . n 
A 1 153 THR 153 152 152 THR THR A . n 
A 1 154 ALA 154 153 153 ALA ALA A . n 
A 1 155 ILE 155 154 154 ILE ILE A . n 
A 1 156 GLN 156 155 155 GLN GLN A . n 
A 1 157 GLU 157 156 156 GLU GLU A . n 
A 1 158 LEU 158 157 157 LEU LEU A . n 
A 1 159 MET 159 158 158 MET MET A . n 
A 1 160 SER 160 159 159 SER SER A . n 
A 1 161 LYS 161 160 160 LYS LYS A . n 
B 2 1   ASN 1   433 ?   ?   ?   B . n 
B 2 2   MET 2   434 ?   ?   ?   B . n 
B 2 3   LYS 3   435 ?   ?   ?   B . n 
B 2 4   ALA 4   436 ?   ?   ?   B . n 
B 2 5   GLY 5   437 ?   ?   ?   B . n 
B 2 6   ALA 6   438 ?   ?   ?   B . n 
B 2 7   THR 7   439 ?   ?   ?   B . n 
B 2 8   SER 8   440 ?   ?   ?   B . n 
B 2 9   GLU 9   441 441 GLU GLU B . n 
B 2 10  GLY 10  442 442 GLY GLY B . n 
B 2 11  VAL 11  443 443 VAL VAL B . n 
B 2 12  LEU 12  444 444 LEU LEU B . n 
B 2 13  ALA 13  445 445 ALA ALA B . n 
B 2 14  ASN 14  446 446 ASN ASN B . n 
B 2 15  PHE 15  447 447 PHE PHE B . n 
B 2 16  PHE 16  448 448 PHE PHE B . n 
B 2 17  ASN 17  449 449 ASN ASN B . n 
B 2 18  SER 18  450 450 SER SER B . n 
B 2 19  LEU 19  451 451 LEU LEU B . n 
B 2 20  LEU 20  452 452 LEU LEU B . n 
B 2 21  SER 21  453 453 SER SER B . n 
B 2 22  LYS 22  454 454 LYS LYS B . n 
B 2 23  LYS 23  455 ?   ?   ?   B . n 
B 2 24  THR 24  456 ?   ?   ?   B . n 
B 2 25  GLY 25  457 ?   ?   ?   B . n 
B 2 26  SER 26  458 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1   201 44  HOH HOH A . 
C 3 HOH 2   202 103 HOH HOH A . 
C 3 HOH 3   203 78  HOH HOH A . 
C 3 HOH 4   204 72  HOH HOH A . 
C 3 HOH 5   205 86  HOH HOH A . 
C 3 HOH 6   206 56  HOH HOH A . 
C 3 HOH 7   207 109 HOH HOH A . 
C 3 HOH 8   208 19  HOH HOH A . 
C 3 HOH 9   209 74  HOH HOH A . 
C 3 HOH 10  210 5   HOH HOH A . 
C 3 HOH 11  211 39  HOH HOH A . 
C 3 HOH 12  212 45  HOH HOH A . 
C 3 HOH 13  213 28  HOH HOH A . 
C 3 HOH 14  214 61  HOH HOH A . 
C 3 HOH 15  215 24  HOH HOH A . 
C 3 HOH 16  216 102 HOH HOH A . 
C 3 HOH 17  217 16  HOH HOH A . 
C 3 HOH 18  218 107 HOH HOH A . 
C 3 HOH 19  219 2   HOH HOH A . 
C 3 HOH 20  220 36  HOH HOH A . 
C 3 HOH 21  221 48  HOH HOH A . 
C 3 HOH 22  222 40  HOH HOH A . 
C 3 HOH 23  223 9   HOH HOH A . 
C 3 HOH 24  224 35  HOH HOH A . 
C 3 HOH 25  225 11  HOH HOH A . 
C 3 HOH 26  226 71  HOH HOH A . 
C 3 HOH 27  227 82  HOH HOH A . 
C 3 HOH 28  228 37  HOH HOH A . 
C 3 HOH 29  229 120 HOH HOH A . 
C 3 HOH 30  230 114 HOH HOH A . 
C 3 HOH 31  231 10  HOH HOH A . 
C 3 HOH 32  232 33  HOH HOH A . 
C 3 HOH 33  233 4   HOH HOH A . 
C 3 HOH 34  234 41  HOH HOH A . 
C 3 HOH 35  235 87  HOH HOH A . 
C 3 HOH 36  236 64  HOH HOH A . 
C 3 HOH 37  237 25  HOH HOH A . 
C 3 HOH 38  238 73  HOH HOH A . 
C 3 HOH 39  239 43  HOH HOH A . 
C 3 HOH 40  240 52  HOH HOH A . 
C 3 HOH 41  241 89  HOH HOH A . 
C 3 HOH 42  242 29  HOH HOH A . 
C 3 HOH 43  243 17  HOH HOH A . 
C 3 HOH 44  244 83  HOH HOH A . 
C 3 HOH 45  245 20  HOH HOH A . 
C 3 HOH 46  246 18  HOH HOH A . 
C 3 HOH 47  247 47  HOH HOH A . 
C 3 HOH 48  248 93  HOH HOH A . 
C 3 HOH 49  249 121 HOH HOH A . 
C 3 HOH 50  250 6   HOH HOH A . 
C 3 HOH 51  251 31  HOH HOH A . 
C 3 HOH 52  252 1   HOH HOH A . 
C 3 HOH 53  253 7   HOH HOH A . 
C 3 HOH 54  254 112 HOH HOH A . 
C 3 HOH 55  255 54  HOH HOH A . 
C 3 HOH 56  256 100 HOH HOH A . 
C 3 HOH 57  257 15  HOH HOH A . 
C 3 HOH 58  258 14  HOH HOH A . 
C 3 HOH 59  259 21  HOH HOH A . 
C 3 HOH 60  260 80  HOH HOH A . 
C 3 HOH 61  261 3   HOH HOH A . 
C 3 HOH 62  262 69  HOH HOH A . 
C 3 HOH 63  263 113 HOH HOH A . 
C 3 HOH 64  264 51  HOH HOH A . 
C 3 HOH 65  265 66  HOH HOH A . 
C 3 HOH 66  266 81  HOH HOH A . 
C 3 HOH 67  267 97  HOH HOH A . 
C 3 HOH 68  268 99  HOH HOH A . 
C 3 HOH 69  269 13  HOH HOH A . 
C 3 HOH 70  270 57  HOH HOH A . 
C 3 HOH 71  271 27  HOH HOH A . 
C 3 HOH 72  272 22  HOH HOH A . 
C 3 HOH 73  273 55  HOH HOH A . 
C 3 HOH 74  274 60  HOH HOH A . 
C 3 HOH 75  275 95  HOH HOH A . 
C 3 HOH 76  276 62  HOH HOH A . 
C 3 HOH 77  277 79  HOH HOH A . 
C 3 HOH 78  278 50  HOH HOH A . 
C 3 HOH 79  279 76  HOH HOH A . 
C 3 HOH 80  280 63  HOH HOH A . 
C 3 HOH 81  281 119 HOH HOH A . 
C 3 HOH 82  282 92  HOH HOH A . 
C 3 HOH 83  283 77  HOH HOH A . 
C 3 HOH 84  284 49  HOH HOH A . 
C 3 HOH 85  285 94  HOH HOH A . 
C 3 HOH 86  286 67  HOH HOH A . 
C 3 HOH 87  287 23  HOH HOH A . 
C 3 HOH 88  288 104 HOH HOH A . 
C 3 HOH 89  289 30  HOH HOH A . 
C 3 HOH 90  290 88  HOH HOH A . 
C 3 HOH 91  291 84  HOH HOH A . 
C 3 HOH 92  292 34  HOH HOH A . 
C 3 HOH 93  293 53  HOH HOH A . 
C 3 HOH 94  294 38  HOH HOH A . 
C 3 HOH 95  295 26  HOH HOH A . 
C 3 HOH 96  296 115 HOH HOH A . 
C 3 HOH 97  297 101 HOH HOH A . 
C 3 HOH 98  298 70  HOH HOH A . 
C 3 HOH 99  299 105 HOH HOH A . 
C 3 HOH 100 300 110 HOH HOH A . 
C 3 HOH 101 301 118 HOH HOH A . 
C 3 HOH 102 302 32  HOH HOH A . 
C 3 HOH 103 303 96  HOH HOH A . 
C 3 HOH 104 304 68  HOH HOH A . 
C 3 HOH 105 305 46  HOH HOH A . 
C 3 HOH 106 306 90  HOH HOH A . 
C 3 HOH 107 307 106 HOH HOH A . 
C 3 HOH 108 308 117 HOH HOH A . 
C 3 HOH 109 309 59  HOH HOH A . 
C 3 HOH 110 310 65  HOH HOH A . 
C 3 HOH 111 311 85  HOH HOH A . 
C 3 HOH 112 312 42  HOH HOH A . 
C 3 HOH 113 313 91  HOH HOH A . 
C 3 HOH 114 314 111 HOH HOH A . 
C 3 HOH 115 315 116 HOH HOH A . 
C 3 HOH 116 316 98  HOH HOH A . 
D 3 HOH 1   501 12  HOH HOH B . 
D 3 HOH 2   502 8   HOH HOH B . 
D 3 HOH 3   503 58  HOH HOH B . 
D 3 HOH 4   504 108 HOH HOH B . 
D 3 HOH 5   505 75  HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1000 ? 
1 MORE         -12  ? 
1 'SSA (A^2)'  8600 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2018-03-21 
2 'Structure model' 1 1 2020-01-01 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Author supporting evidence' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    2 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            pdbx_audit_support 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    2 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_pdbx_audit_support.funding_organization' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? '(1.12_2829)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? v701.c3       2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? v701.c3       3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? 1.12_2829     4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 HE A ARG 70  ? A O A HOH 201 ? ? 1.57 
2 1 O  A HOH 302 ? ? O A HOH 304 ? ? 1.84 
3 1 O  A HOH 296 ? ? O A HOH 304 ? ? 1.98 
4 1 O  A HOH 231 ? ? O A HOH 306 ? ? 2.08 
5 1 O  A HOH 300 ? ? O A HOH 314 ? ? 2.11 
6 1 O  A HOH 288 ? ? O A HOH 294 ? ? 2.13 
7 1 O  A HOH 203 ? ? O A HOH 216 ? ? 2.15 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CA 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            ASN 
_pdbx_validate_rmsd_bond.auth_seq_id_1             24 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            B 
_pdbx_validate_rmsd_bond.auth_atom_id_2            C 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            ASN 
_pdbx_validate_rmsd_bond.auth_seq_id_2             24 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.699 
_pdbx_validate_rmsd_bond.bond_target_value         1.525 
_pdbx_validate_rmsd_bond.bond_deviation            0.174 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.026 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A ALA 10 ? ? CA A ALA 10 ? ? C   A ALA 10 ? ? 119.23 110.10 9.13  1.50 N 
2 1 CB A PHE 23 ? ? CG A PHE 23 ? ? CD2 A PHE 23 ? ? 115.51 120.80 -5.29 0.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLU A 11 ? ? 82.14   -6.12 
2 1 CYS A 29 ? ? -140.91 44.16 
3 1 CYS A 29 ? ? -141.18 44.70 
# 
loop_
_pdbx_validate_main_chain_plane.id 
_pdbx_validate_main_chain_plane.PDB_model_num 
_pdbx_validate_main_chain_plane.auth_comp_id 
_pdbx_validate_main_chain_plane.auth_asym_id 
_pdbx_validate_main_chain_plane.auth_seq_id 
_pdbx_validate_main_chain_plane.PDB_ins_code 
_pdbx_validate_main_chain_plane.label_alt_id 
_pdbx_validate_main_chain_plane.improper_torsion_angle 
1 1 ASN A 24 ? A -10.04 
2 1 ASN A 24 ? B -10.43 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 0   ? A SER 1  
2  1 Y 1 A MET 1   ? A MET 2  
3  1 Y 1 A PHE 2   ? A PHE 3  
4  1 Y 1 A SER 3   ? A SER 4  
5  1 Y 1 A VAL 4   ? A VAL 5  
6  1 Y 1 A GLU 5   ? A GLU 6  
7  1 Y 1 A SER 6   ? A SER 7  
8  1 Y 1 A LEU 7   ? A LEU 8  
9  1 Y 1 A GLU 8   ? A GLU 9  
10 1 Y 1 A ARG 9   ? A ARG 10 
11 1 Y 1 B ASN 433 ? B ASN 1  
12 1 Y 1 B MET 434 ? B MET 2  
13 1 Y 1 B LYS 435 ? B LYS 3  
14 1 Y 1 B ALA 436 ? B ALA 4  
15 1 Y 1 B GLY 437 ? B GLY 5  
16 1 Y 1 B ALA 438 ? B ALA 6  
17 1 Y 1 B THR 439 ? B THR 7  
18 1 Y 1 B SER 440 ? B SER 8  
19 1 Y 1 B LYS 455 ? B LYS 23 
20 1 Y 1 B THR 456 ? B THR 24 
21 1 Y 1 B GLY 457 ? B GLY 25 
22 1 Y 1 B SER 458 ? B SER 26 
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           'P01 GM087253' 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'isothermal titration calorimetry' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#