data_6BAA
# 
_entry.id   6BAA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6BAA         
WWPDB D_1000229471 
EMDB  EMD-7073     
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        'Cryo-EM structure of the pancreatic beta-cell KATP channel bound to ATP and glibenclamide' 
_pdbx_database_related.db_id          EMD-7073 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6BAA 
_pdbx_database_status.recvd_initial_deposition_date   2017-10-12 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Martin, G.M.' 1 ? 
'Yoshioka, C.' 2 ? 
'Shyng, S.L.'  3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Elife 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2050-084X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            6 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'Anti-diabetic drug binding site in a mammalian KATPchannel revealed by Cryo-EM.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.7554/eLife.31054 
_citation.pdbx_database_id_PubMed   29035201 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Martin, G.M.'  1 ? 
primary 'Kandasamy, B.' 2 ? 
primary 'DiMaio, F.'    3 ? 
primary 'Yoshioka, C.'  4 ? 
primary 'Shyng, S.L.'   5 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'ATP-sensitive inward rectifier potassium channel 11'                               43645.719  4 ? ? ? ? 
2 polymer     man 'ATP-binding cassette sub-family C member 8'                                        177333.578 4 ? ? ? ? 
3 non-polymer syn "ADENOSINE-5'-TRIPHOSPHATE"                                                         507.181    4 ? ? ? ? 
4 non-polymer syn '5-chloro-N-(2-{4-[(cyclohexylcarbamoyl)sulfamoyl]phenyl}ethyl)-2-methoxybenzamide' 494.004    4 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'BIR,Inward rectifier K(+) channel Kir6.2,Potassium channel,inwardly rectifying subfamily J member 11' 
2 'Sulfonylurea receptor 1'                                                                              
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MLSRKGIIPEEYVLTRLAEDPTEPRYRTRERRARFVSKKGNCNVAHKNIREQGRFLQDVFTTLVDLKWPHTLLIFTMSFL
CSWLLFAMVWWLIAFAHGDLAPGEGTNVPCVTSIHSFSSAFLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMIN
AIMLGCIFMKTAQAHRRAETLIFSKHAVITPRHGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPM
ENGVGGNSIFLVAPLIIYHVIDSNSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQARTSYLADEILWGQRFVPIVA
EEDGRYSVDYSKFGNTVKVPTPLCTARQLDEDRSLLDALTLASSRGPLRKRSVAVAKAKPKFSISPDSLS
;
;MLSRKGIIPEEYVLTRLAEDPTEPRYRTRERRARFVSKKGNCNVAHKNIREQGRFLQDVFTTLVDLKWPHTLLIFTMSFL
CSWLLFAMVWWLIAFAHGDLAPGEGTNVPCVTSIHSFSSAFLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMIN
AIMLGCIFMKTAQAHRRAETLIFSKHAVITPRHGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPM
ENGVGGNSIFLVAPLIIYHVIDSNSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQARTSYLADEILWGQRFVPIVA
EEDGRYSVDYSKFGNTVKVPTPLCTARQLDEDRSLLDALTLASSRGPLRKRSVAVAKAKPKFSISPDSLS
;
A,B,C,D ? 
2 'polypeptide(L)' no no 
;MPLAFCGTENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGWGSQSSKVHIHHSTWLHFPGHNLRWILTFI
LLFVLVCEIAEGILSDGVTESRHLHLYMPAGMAFMAAITSVVYYHNIETSNFPKLLIALLIYWTLAFITKTIKFVKFYDH
AIGFSQLRFCLTGLLVILYGMLLLVEVNVIRVRRYIFFKTPREVKPPEDLQDLGVRFLQPFVNLLSKGTYWWMNAFIKTA
HKKPIDLRAIAKLPIAMRALTNYQRLCVAFDAQARKDTQSPQGARAIWRALCHAFGRRLILSSTFRILADLLGFAGPLCI
FGIVDHLGKENHVFQPKTQFLGVYFVSSQEFLGNAYVLAVLLFLALLLQRTFLQASYYVAIETGINLRGAIQTKIYNKIM
HMSTSNLSMGEMTAGQICNLVAIDTNQLMWFFFLCPNLWTMPVQIIVGVILLYYILGVSALIGAAVIILLAPVQYFVATK
LSQAQRTTLEHSNERLKQTNEMLRGMKLLKLYAWESIFCSRVEVTRRKEMTSLRAFAVYTSISIFMNTAIPIAAVLITFV
GHVSFFKESDLSPSVAFASLSLFHILVTPLFLLSSVVRSTVKALVSVQKLSEFLSSAEIREEQCAPREPAPQGQAGKYQA
VPLKVVNRKRPAREEVRDLLGPLQRLAPSMDGDADNFCVQIIGGFFTWTPDGIPTLSNITIRIPRGQLTMIVGQVGCGKS
SLLLATLGEMQKVSGAVFWNSNLPDSEGEDPSSPERETAAGSDIRSRGPVAYASQKPWLLNATVEENITFESPFNKQRYK
MVIEACSLQPDIDILPHGDQTQIGERGINLSGGQRQRISVARALYQQTNVVFLDDPFSALDVHLSDHLMQAGILELLRDD
KRTVVLVTHKLQYLPHADWIIAMKDGTIQREGTLKDFQRSECQLFEHWKTLMNRQDQELEKETVMERKASEPSQGLPRAM
SSRDGLLLDEEEEEEEAAESEEDDNLSSVLHQRAKIPWRACTKYLSSAGILLLSLLVFSQLLKHMVLVAIDYWLAKWTDS
ALVLSPAARNCSLSQECDLDQSVYAMVFTLLCSLGIVLCLVTSVTVEWTGLKVAKRLHRSLLNRIILAPMRFFETTPLGS
ILNRFSSDCNTIDQHIPSTLECLSRSTLLCVSALTVISYVTPVFLVALLPLAVVCYFIQKYFRVASRDLQQLDDTTQLPL
VSHFAETVEGLTTIRAFRYEARFQQKLLEYTDSNNIASLFLTAANRWLEVCMEYIGACVVLIAAATSISNSLHRELSAGL
VGLGLTYALMVSNYLNWMVRNLADMEIQLGAVKRIHALLKTEAESYEGLLAPSLIPKNWPDQGKIQIQNLSVRYDSSLKP
VLKHVNTLISPGQKIGICGRTGSGKSSFSLAFFRMVDMFEGRIIIDGIDIAKLPLHTLRSRLSIILQDPVLFSGTIRFNL
DPEKKCSDSTLWEALEIAQLKLVVKALPGGLDAIITEGGENFSQGQRQLFCLARAFVRKTSIFIMDEATASIDMATENIL
QKVVMTAFADRTVVTIAHRVHTILSADLVMVLKRGAILEFDKPETLLSQKDSVFASFVRADK
;
;MPLAFCGTENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGWGSQSSKVHIHHSTWLHFPGHNLRWILTFI
LLFVLVCEIAEGILSDGVTESRHLHLYMPAGMAFMAAITSVVYYHNIETSNFPKLLIALLIYWTLAFITKTIKFVKFYDH
AIGFSQLRFCLTGLLVILYGMLLLVEVNVIRVRRYIFFKTPREVKPPEDLQDLGVRFLQPFVNLLSKGTYWWMNAFIKTA
HKKPIDLRAIAKLPIAMRALTNYQRLCVAFDAQARKDTQSPQGARAIWRALCHAFGRRLILSSTFRILADLLGFAGPLCI
FGIVDHLGKENHVFQPKTQFLGVYFVSSQEFLGNAYVLAVLLFLALLLQRTFLQASYYVAIETGINLRGAIQTKIYNKIM
HMSTSNLSMGEMTAGQICNLVAIDTNQLMWFFFLCPNLWTMPVQIIVGVILLYYILGVSALIGAAVIILLAPVQYFVATK
LSQAQRTTLEHSNERLKQTNEMLRGMKLLKLYAWESIFCSRVEVTRRKEMTSLRAFAVYTSISIFMNTAIPIAAVLITFV
GHVSFFKESDLSPSVAFASLSLFHILVTPLFLLSSVVRSTVKALVSVQKLSEFLSSAEIREEQCAPREPAPQGQAGKYQA
VPLKVVNRKRPAREEVRDLLGPLQRLAPSMDGDADNFCVQIIGGFFTWTPDGIPTLSNITIRIPRGQLTMIVGQVGCGKS
SLLLATLGEMQKVSGAVFWNSNLPDSEGEDPSSPERETAAGSDIRSRGPVAYASQKPWLLNATVEENITFESPFNKQRYK
MVIEACSLQPDIDILPHGDQTQIGERGINLSGGQRQRISVARALYQQTNVVFLDDPFSALDVHLSDHLMQAGILELLRDD
KRTVVLVTHKLQYLPHADWIIAMKDGTIQREGTLKDFQRSECQLFEHWKTLMNRQDQELEKETVMERKASEPSQGLPRAM
SSRDGLLLDEEEEEEEAAESEEDDNLSSVLHQRAKIPWRACTKYLSSAGILLLSLLVFSQLLKHMVLVAIDYWLAKWTDS
ALVLSPAARNCSLSQECDLDQSVYAMVFTLLCSLGIVLCLVTSVTVEWTGLKVAKRLHRSLLNRIILAPMRFFETTPLGS
ILNRFSSDCNTIDQHIPSTLECLSRSTLLCVSALTVISYVTPVFLVALLPLAVVCYFIQKYFRVASRDLQQLDDTTQLPL
VSHFAETVEGLTTIRAFRYEARFQQKLLEYTDSNNIASLFLTAANRWLEVCMEYIGACVVLIAAATSISNSLHRELSAGL
VGLGLTYALMVSNYLNWMVRNLADMEIQLGAVKRIHALLKTEAESYEGLLAPSLIPKNWPDQGKIQIQNLSVRYDSSLKP
VLKHVNTLISPGQKIGICGRTGSGKSSFSLAFFRMVDMFEGRIIIDGIDIAKLPLHTLRSRLSIILQDPVLFSGTIRFNL
DPEKKCSDSTLWEALEIAQLKLVVKALPGGLDAIITEGGENFSQGQRQLFCLARAFVRKTSIFIMDEATASIDMATENIL
QKVVMTAFADRTVVTIAHRVHTILSADLVMVLKRGAILEFDKPETLLSQKDSVFASFVRADK
;
E,F,G,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    LEU n 
1 3    SER n 
1 4    ARG n 
1 5    LYS n 
1 6    GLY n 
1 7    ILE n 
1 8    ILE n 
1 9    PRO n 
1 10   GLU n 
1 11   GLU n 
1 12   TYR n 
1 13   VAL n 
1 14   LEU n 
1 15   THR n 
1 16   ARG n 
1 17   LEU n 
1 18   ALA n 
1 19   GLU n 
1 20   ASP n 
1 21   PRO n 
1 22   THR n 
1 23   GLU n 
1 24   PRO n 
1 25   ARG n 
1 26   TYR n 
1 27   ARG n 
1 28   THR n 
1 29   ARG n 
1 30   GLU n 
1 31   ARG n 
1 32   ARG n 
1 33   ALA n 
1 34   ARG n 
1 35   PHE n 
1 36   VAL n 
1 37   SER n 
1 38   LYS n 
1 39   LYS n 
1 40   GLY n 
1 41   ASN n 
1 42   CYS n 
1 43   ASN n 
1 44   VAL n 
1 45   ALA n 
1 46   HIS n 
1 47   LYS n 
1 48   ASN n 
1 49   ILE n 
1 50   ARG n 
1 51   GLU n 
1 52   GLN n 
1 53   GLY n 
1 54   ARG n 
1 55   PHE n 
1 56   LEU n 
1 57   GLN n 
1 58   ASP n 
1 59   VAL n 
1 60   PHE n 
1 61   THR n 
1 62   THR n 
1 63   LEU n 
1 64   VAL n 
1 65   ASP n 
1 66   LEU n 
1 67   LYS n 
1 68   TRP n 
1 69   PRO n 
1 70   HIS n 
1 71   THR n 
1 72   LEU n 
1 73   LEU n 
1 74   ILE n 
1 75   PHE n 
1 76   THR n 
1 77   MET n 
1 78   SER n 
1 79   PHE n 
1 80   LEU n 
1 81   CYS n 
1 82   SER n 
1 83   TRP n 
1 84   LEU n 
1 85   LEU n 
1 86   PHE n 
1 87   ALA n 
1 88   MET n 
1 89   VAL n 
1 90   TRP n 
1 91   TRP n 
1 92   LEU n 
1 93   ILE n 
1 94   ALA n 
1 95   PHE n 
1 96   ALA n 
1 97   HIS n 
1 98   GLY n 
1 99   ASP n 
1 100  LEU n 
1 101  ALA n 
1 102  PRO n 
1 103  GLY n 
1 104  GLU n 
1 105  GLY n 
1 106  THR n 
1 107  ASN n 
1 108  VAL n 
1 109  PRO n 
1 110  CYS n 
1 111  VAL n 
1 112  THR n 
1 113  SER n 
1 114  ILE n 
1 115  HIS n 
1 116  SER n 
1 117  PHE n 
1 118  SER n 
1 119  SER n 
1 120  ALA n 
1 121  PHE n 
1 122  LEU n 
1 123  PHE n 
1 124  SER n 
1 125  ILE n 
1 126  GLU n 
1 127  VAL n 
1 128  GLN n 
1 129  VAL n 
1 130  THR n 
1 131  ILE n 
1 132  GLY n 
1 133  PHE n 
1 134  GLY n 
1 135  GLY n 
1 136  ARG n 
1 137  MET n 
1 138  VAL n 
1 139  THR n 
1 140  GLU n 
1 141  GLU n 
1 142  CYS n 
1 143  PRO n 
1 144  LEU n 
1 145  ALA n 
1 146  ILE n 
1 147  LEU n 
1 148  ILE n 
1 149  LEU n 
1 150  ILE n 
1 151  VAL n 
1 152  GLN n 
1 153  ASN n 
1 154  ILE n 
1 155  VAL n 
1 156  GLY n 
1 157  LEU n 
1 158  MET n 
1 159  ILE n 
1 160  ASN n 
1 161  ALA n 
1 162  ILE n 
1 163  MET n 
1 164  LEU n 
1 165  GLY n 
1 166  CYS n 
1 167  ILE n 
1 168  PHE n 
1 169  MET n 
1 170  LYS n 
1 171  THR n 
1 172  ALA n 
1 173  GLN n 
1 174  ALA n 
1 175  HIS n 
1 176  ARG n 
1 177  ARG n 
1 178  ALA n 
1 179  GLU n 
1 180  THR n 
1 181  LEU n 
1 182  ILE n 
1 183  PHE n 
1 184  SER n 
1 185  LYS n 
1 186  HIS n 
1 187  ALA n 
1 188  VAL n 
1 189  ILE n 
1 190  THR n 
1 191  PRO n 
1 192  ARG n 
1 193  HIS n 
1 194  GLY n 
1 195  ARG n 
1 196  LEU n 
1 197  CYS n 
1 198  PHE n 
1 199  MET n 
1 200  LEU n 
1 201  ARG n 
1 202  VAL n 
1 203  GLY n 
1 204  ASP n 
1 205  LEU n 
1 206  ARG n 
1 207  LYS n 
1 208  SER n 
1 209  MET n 
1 210  ILE n 
1 211  ILE n 
1 212  SER n 
1 213  ALA n 
1 214  THR n 
1 215  ILE n 
1 216  HIS n 
1 217  MET n 
1 218  GLN n 
1 219  VAL n 
1 220  VAL n 
1 221  ARG n 
1 222  LYS n 
1 223  THR n 
1 224  THR n 
1 225  SER n 
1 226  PRO n 
1 227  GLU n 
1 228  GLY n 
1 229  GLU n 
1 230  VAL n 
1 231  VAL n 
1 232  PRO n 
1 233  LEU n 
1 234  HIS n 
1 235  GLN n 
1 236  VAL n 
1 237  ASP n 
1 238  ILE n 
1 239  PRO n 
1 240  MET n 
1 241  GLU n 
1 242  ASN n 
1 243  GLY n 
1 244  VAL n 
1 245  GLY n 
1 246  GLY n 
1 247  ASN n 
1 248  SER n 
1 249  ILE n 
1 250  PHE n 
1 251  LEU n 
1 252  VAL n 
1 253  ALA n 
1 254  PRO n 
1 255  LEU n 
1 256  ILE n 
1 257  ILE n 
1 258  TYR n 
1 259  HIS n 
1 260  VAL n 
1 261  ILE n 
1 262  ASP n 
1 263  SER n 
1 264  ASN n 
1 265  SER n 
1 266  PRO n 
1 267  LEU n 
1 268  TYR n 
1 269  ASP n 
1 270  LEU n 
1 271  ALA n 
1 272  PRO n 
1 273  SER n 
1 274  ASP n 
1 275  LEU n 
1 276  HIS n 
1 277  HIS n 
1 278  HIS n 
1 279  GLN n 
1 280  ASP n 
1 281  LEU n 
1 282  GLU n 
1 283  ILE n 
1 284  ILE n 
1 285  VAL n 
1 286  ILE n 
1 287  LEU n 
1 288  GLU n 
1 289  GLY n 
1 290  VAL n 
1 291  VAL n 
1 292  GLU n 
1 293  THR n 
1 294  THR n 
1 295  GLY n 
1 296  ILE n 
1 297  THR n 
1 298  THR n 
1 299  GLN n 
1 300  ALA n 
1 301  ARG n 
1 302  THR n 
1 303  SER n 
1 304  TYR n 
1 305  LEU n 
1 306  ALA n 
1 307  ASP n 
1 308  GLU n 
1 309  ILE n 
1 310  LEU n 
1 311  TRP n 
1 312  GLY n 
1 313  GLN n 
1 314  ARG n 
1 315  PHE n 
1 316  VAL n 
1 317  PRO n 
1 318  ILE n 
1 319  VAL n 
1 320  ALA n 
1 321  GLU n 
1 322  GLU n 
1 323  ASP n 
1 324  GLY n 
1 325  ARG n 
1 326  TYR n 
1 327  SER n 
1 328  VAL n 
1 329  ASP n 
1 330  TYR n 
1 331  SER n 
1 332  LYS n 
1 333  PHE n 
1 334  GLY n 
1 335  ASN n 
1 336  THR n 
1 337  VAL n 
1 338  LYS n 
1 339  VAL n 
1 340  PRO n 
1 341  THR n 
1 342  PRO n 
1 343  LEU n 
1 344  CYS n 
1 345  THR n 
1 346  ALA n 
1 347  ARG n 
1 348  GLN n 
1 349  LEU n 
1 350  ASP n 
1 351  GLU n 
1 352  ASP n 
1 353  ARG n 
1 354  SER n 
1 355  LEU n 
1 356  LEU n 
1 357  ASP n 
1 358  ALA n 
1 359  LEU n 
1 360  THR n 
1 361  LEU n 
1 362  ALA n 
1 363  SER n 
1 364  SER n 
1 365  ARG n 
1 366  GLY n 
1 367  PRO n 
1 368  LEU n 
1 369  ARG n 
1 370  LYS n 
1 371  ARG n 
1 372  SER n 
1 373  VAL n 
1 374  ALA n 
1 375  VAL n 
1 376  ALA n 
1 377  LYS n 
1 378  ALA n 
1 379  LYS n 
1 380  PRO n 
1 381  LYS n 
1 382  PHE n 
1 383  SER n 
1 384  ILE n 
1 385  SER n 
1 386  PRO n 
1 387  ASP n 
1 388  SER n 
1 389  LEU n 
1 390  SER n 
2 1    MET n 
2 2    PRO n 
2 3    LEU n 
2 4    ALA n 
2 5    PHE n 
2 6    CYS n 
2 7    GLY n 
2 8    THR n 
2 9    GLU n 
2 10   ASN n 
2 11   HIS n 
2 12   SER n 
2 13   ALA n 
2 14   ALA n 
2 15   TYR n 
2 16   ARG n 
2 17   VAL n 
2 18   ASP n 
2 19   GLN n 
2 20   GLY n 
2 21   VAL n 
2 22   LEU n 
2 23   ASN n 
2 24   ASN n 
2 25   GLY n 
2 26   CYS n 
2 27   PHE n 
2 28   VAL n 
2 29   ASP n 
2 30   ALA n 
2 31   LEU n 
2 32   ASN n 
2 33   VAL n 
2 34   VAL n 
2 35   PRO n 
2 36   HIS n 
2 37   VAL n 
2 38   PHE n 
2 39   LEU n 
2 40   LEU n 
2 41   PHE n 
2 42   ILE n 
2 43   THR n 
2 44   PHE n 
2 45   PRO n 
2 46   ILE n 
2 47   LEU n 
2 48   PHE n 
2 49   ILE n 
2 50   GLY n 
2 51   TRP n 
2 52   GLY n 
2 53   SER n 
2 54   GLN n 
2 55   SER n 
2 56   SER n 
2 57   LYS n 
2 58   VAL n 
2 59   HIS n 
2 60   ILE n 
2 61   HIS n 
2 62   HIS n 
2 63   SER n 
2 64   THR n 
2 65   TRP n 
2 66   LEU n 
2 67   HIS n 
2 68   PHE n 
2 69   PRO n 
2 70   GLY n 
2 71   HIS n 
2 72   ASN n 
2 73   LEU n 
2 74   ARG n 
2 75   TRP n 
2 76   ILE n 
2 77   LEU n 
2 78   THR n 
2 79   PHE n 
2 80   ILE n 
2 81   LEU n 
2 82   LEU n 
2 83   PHE n 
2 84   VAL n 
2 85   LEU n 
2 86   VAL n 
2 87   CYS n 
2 88   GLU n 
2 89   ILE n 
2 90   ALA n 
2 91   GLU n 
2 92   GLY n 
2 93   ILE n 
2 94   LEU n 
2 95   SER n 
2 96   ASP n 
2 97   GLY n 
2 98   VAL n 
2 99   THR n 
2 100  GLU n 
2 101  SER n 
2 102  ARG n 
2 103  HIS n 
2 104  LEU n 
2 105  HIS n 
2 106  LEU n 
2 107  TYR n 
2 108  MET n 
2 109  PRO n 
2 110  ALA n 
2 111  GLY n 
2 112  MET n 
2 113  ALA n 
2 114  PHE n 
2 115  MET n 
2 116  ALA n 
2 117  ALA n 
2 118  ILE n 
2 119  THR n 
2 120  SER n 
2 121  VAL n 
2 122  VAL n 
2 123  TYR n 
2 124  TYR n 
2 125  HIS n 
2 126  ASN n 
2 127  ILE n 
2 128  GLU n 
2 129  THR n 
2 130  SER n 
2 131  ASN n 
2 132  PHE n 
2 133  PRO n 
2 134  LYS n 
2 135  LEU n 
2 136  LEU n 
2 137  ILE n 
2 138  ALA n 
2 139  LEU n 
2 140  LEU n 
2 141  ILE n 
2 142  TYR n 
2 143  TRP n 
2 144  THR n 
2 145  LEU n 
2 146  ALA n 
2 147  PHE n 
2 148  ILE n 
2 149  THR n 
2 150  LYS n 
2 151  THR n 
2 152  ILE n 
2 153  LYS n 
2 154  PHE n 
2 155  VAL n 
2 156  LYS n 
2 157  PHE n 
2 158  TYR n 
2 159  ASP n 
2 160  HIS n 
2 161  ALA n 
2 162  ILE n 
2 163  GLY n 
2 164  PHE n 
2 165  SER n 
2 166  GLN n 
2 167  LEU n 
2 168  ARG n 
2 169  PHE n 
2 170  CYS n 
2 171  LEU n 
2 172  THR n 
2 173  GLY n 
2 174  LEU n 
2 175  LEU n 
2 176  VAL n 
2 177  ILE n 
2 178  LEU n 
2 179  TYR n 
2 180  GLY n 
2 181  MET n 
2 182  LEU n 
2 183  LEU n 
2 184  LEU n 
2 185  VAL n 
2 186  GLU n 
2 187  VAL n 
2 188  ASN n 
2 189  VAL n 
2 190  ILE n 
2 191  ARG n 
2 192  VAL n 
2 193  ARG n 
2 194  ARG n 
2 195  TYR n 
2 196  ILE n 
2 197  PHE n 
2 198  PHE n 
2 199  LYS n 
2 200  THR n 
2 201  PRO n 
2 202  ARG n 
2 203  GLU n 
2 204  VAL n 
2 205  LYS n 
2 206  PRO n 
2 207  PRO n 
2 208  GLU n 
2 209  ASP n 
2 210  LEU n 
2 211  GLN n 
2 212  ASP n 
2 213  LEU n 
2 214  GLY n 
2 215  VAL n 
2 216  ARG n 
2 217  PHE n 
2 218  LEU n 
2 219  GLN n 
2 220  PRO n 
2 221  PHE n 
2 222  VAL n 
2 223  ASN n 
2 224  LEU n 
2 225  LEU n 
2 226  SER n 
2 227  LYS n 
2 228  GLY n 
2 229  THR n 
2 230  TYR n 
2 231  TRP n 
2 232  TRP n 
2 233  MET n 
2 234  ASN n 
2 235  ALA n 
2 236  PHE n 
2 237  ILE n 
2 238  LYS n 
2 239  THR n 
2 240  ALA n 
2 241  HIS n 
2 242  LYS n 
2 243  LYS n 
2 244  PRO n 
2 245  ILE n 
2 246  ASP n 
2 247  LEU n 
2 248  ARG n 
2 249  ALA n 
2 250  ILE n 
2 251  ALA n 
2 252  LYS n 
2 253  LEU n 
2 254  PRO n 
2 255  ILE n 
2 256  ALA n 
2 257  MET n 
2 258  ARG n 
2 259  ALA n 
2 260  LEU n 
2 261  THR n 
2 262  ASN n 
2 263  TYR n 
2 264  GLN n 
2 265  ARG n 
2 266  LEU n 
2 267  CYS n 
2 268  VAL n 
2 269  ALA n 
2 270  PHE n 
2 271  ASP n 
2 272  ALA n 
2 273  GLN n 
2 274  ALA n 
2 275  ARG n 
2 276  LYS n 
2 277  ASP n 
2 278  THR n 
2 279  GLN n 
2 280  SER n 
2 281  PRO n 
2 282  GLN n 
2 283  GLY n 
2 284  ALA n 
2 285  ARG n 
2 286  ALA n 
2 287  ILE n 
2 288  TRP n 
2 289  ARG n 
2 290  ALA n 
2 291  LEU n 
2 292  CYS n 
2 293  HIS n 
2 294  ALA n 
2 295  PHE n 
2 296  GLY n 
2 297  ARG n 
2 298  ARG n 
2 299  LEU n 
2 300  ILE n 
2 301  LEU n 
2 302  SER n 
2 303  SER n 
2 304  THR n 
2 305  PHE n 
2 306  ARG n 
2 307  ILE n 
2 308  LEU n 
2 309  ALA n 
2 310  ASP n 
2 311  LEU n 
2 312  LEU n 
2 313  GLY n 
2 314  PHE n 
2 315  ALA n 
2 316  GLY n 
2 317  PRO n 
2 318  LEU n 
2 319  CYS n 
2 320  ILE n 
2 321  PHE n 
2 322  GLY n 
2 323  ILE n 
2 324  VAL n 
2 325  ASP n 
2 326  HIS n 
2 327  LEU n 
2 328  GLY n 
2 329  LYS n 
2 330  GLU n 
2 331  ASN n 
2 332  HIS n 
2 333  VAL n 
2 334  PHE n 
2 335  GLN n 
2 336  PRO n 
2 337  LYS n 
2 338  THR n 
2 339  GLN n 
2 340  PHE n 
2 341  LEU n 
2 342  GLY n 
2 343  VAL n 
2 344  TYR n 
2 345  PHE n 
2 346  VAL n 
2 347  SER n 
2 348  SER n 
2 349  GLN n 
2 350  GLU n 
2 351  PHE n 
2 352  LEU n 
2 353  GLY n 
2 354  ASN n 
2 355  ALA n 
2 356  TYR n 
2 357  VAL n 
2 358  LEU n 
2 359  ALA n 
2 360  VAL n 
2 361  LEU n 
2 362  LEU n 
2 363  PHE n 
2 364  LEU n 
2 365  ALA n 
2 366  LEU n 
2 367  LEU n 
2 368  LEU n 
2 369  GLN n 
2 370  ARG n 
2 371  THR n 
2 372  PHE n 
2 373  LEU n 
2 374  GLN n 
2 375  ALA n 
2 376  SER n 
2 377  TYR n 
2 378  TYR n 
2 379  VAL n 
2 380  ALA n 
2 381  ILE n 
2 382  GLU n 
2 383  THR n 
2 384  GLY n 
2 385  ILE n 
2 386  ASN n 
2 387  LEU n 
2 388  ARG n 
2 389  GLY n 
2 390  ALA n 
2 391  ILE n 
2 392  GLN n 
2 393  THR n 
2 394  LYS n 
2 395  ILE n 
2 396  TYR n 
2 397  ASN n 
2 398  LYS n 
2 399  ILE n 
2 400  MET n 
2 401  HIS n 
2 402  MET n 
2 403  SER n 
2 404  THR n 
2 405  SER n 
2 406  ASN n 
2 407  LEU n 
2 408  SER n 
2 409  MET n 
2 410  GLY n 
2 411  GLU n 
2 412  MET n 
2 413  THR n 
2 414  ALA n 
2 415  GLY n 
2 416  GLN n 
2 417  ILE n 
2 418  CYS n 
2 419  ASN n 
2 420  LEU n 
2 421  VAL n 
2 422  ALA n 
2 423  ILE n 
2 424  ASP n 
2 425  THR n 
2 426  ASN n 
2 427  GLN n 
2 428  LEU n 
2 429  MET n 
2 430  TRP n 
2 431  PHE n 
2 432  PHE n 
2 433  PHE n 
2 434  LEU n 
2 435  CYS n 
2 436  PRO n 
2 437  ASN n 
2 438  LEU n 
2 439  TRP n 
2 440  THR n 
2 441  MET n 
2 442  PRO n 
2 443  VAL n 
2 444  GLN n 
2 445  ILE n 
2 446  ILE n 
2 447  VAL n 
2 448  GLY n 
2 449  VAL n 
2 450  ILE n 
2 451  LEU n 
2 452  LEU n 
2 453  TYR n 
2 454  TYR n 
2 455  ILE n 
2 456  LEU n 
2 457  GLY n 
2 458  VAL n 
2 459  SER n 
2 460  ALA n 
2 461  LEU n 
2 462  ILE n 
2 463  GLY n 
2 464  ALA n 
2 465  ALA n 
2 466  VAL n 
2 467  ILE n 
2 468  ILE n 
2 469  LEU n 
2 470  LEU n 
2 471  ALA n 
2 472  PRO n 
2 473  VAL n 
2 474  GLN n 
2 475  TYR n 
2 476  PHE n 
2 477  VAL n 
2 478  ALA n 
2 479  THR n 
2 480  LYS n 
2 481  LEU n 
2 482  SER n 
2 483  GLN n 
2 484  ALA n 
2 485  GLN n 
2 486  ARG n 
2 487  THR n 
2 488  THR n 
2 489  LEU n 
2 490  GLU n 
2 491  HIS n 
2 492  SER n 
2 493  ASN n 
2 494  GLU n 
2 495  ARG n 
2 496  LEU n 
2 497  LYS n 
2 498  GLN n 
2 499  THR n 
2 500  ASN n 
2 501  GLU n 
2 502  MET n 
2 503  LEU n 
2 504  ARG n 
2 505  GLY n 
2 506  MET n 
2 507  LYS n 
2 508  LEU n 
2 509  LEU n 
2 510  LYS n 
2 511  LEU n 
2 512  TYR n 
2 513  ALA n 
2 514  TRP n 
2 515  GLU n 
2 516  SER n 
2 517  ILE n 
2 518  PHE n 
2 519  CYS n 
2 520  SER n 
2 521  ARG n 
2 522  VAL n 
2 523  GLU n 
2 524  VAL n 
2 525  THR n 
2 526  ARG n 
2 527  ARG n 
2 528  LYS n 
2 529  GLU n 
2 530  MET n 
2 531  THR n 
2 532  SER n 
2 533  LEU n 
2 534  ARG n 
2 535  ALA n 
2 536  PHE n 
2 537  ALA n 
2 538  VAL n 
2 539  TYR n 
2 540  THR n 
2 541  SER n 
2 542  ILE n 
2 543  SER n 
2 544  ILE n 
2 545  PHE n 
2 546  MET n 
2 547  ASN n 
2 548  THR n 
2 549  ALA n 
2 550  ILE n 
2 551  PRO n 
2 552  ILE n 
2 553  ALA n 
2 554  ALA n 
2 555  VAL n 
2 556  LEU n 
2 557  ILE n 
2 558  THR n 
2 559  PHE n 
2 560  VAL n 
2 561  GLY n 
2 562  HIS n 
2 563  VAL n 
2 564  SER n 
2 565  PHE n 
2 566  PHE n 
2 567  LYS n 
2 568  GLU n 
2 569  SER n 
2 570  ASP n 
2 571  LEU n 
2 572  SER n 
2 573  PRO n 
2 574  SER n 
2 575  VAL n 
2 576  ALA n 
2 577  PHE n 
2 578  ALA n 
2 579  SER n 
2 580  LEU n 
2 581  SER n 
2 582  LEU n 
2 583  PHE n 
2 584  HIS n 
2 585  ILE n 
2 586  LEU n 
2 587  VAL n 
2 588  THR n 
2 589  PRO n 
2 590  LEU n 
2 591  PHE n 
2 592  LEU n 
2 593  LEU n 
2 594  SER n 
2 595  SER n 
2 596  VAL n 
2 597  VAL n 
2 598  ARG n 
2 599  SER n 
2 600  THR n 
2 601  VAL n 
2 602  LYS n 
2 603  ALA n 
2 604  LEU n 
2 605  VAL n 
2 606  SER n 
2 607  VAL n 
2 608  GLN n 
2 609  LYS n 
2 610  LEU n 
2 611  SER n 
2 612  GLU n 
2 613  PHE n 
2 614  LEU n 
2 615  SER n 
2 616  SER n 
2 617  ALA n 
2 618  GLU n 
2 619  ILE n 
2 620  ARG n 
2 621  GLU n 
2 622  GLU n 
2 623  GLN n 
2 624  CYS n 
2 625  ALA n 
2 626  PRO n 
2 627  ARG n 
2 628  GLU n 
2 629  PRO n 
2 630  ALA n 
2 631  PRO n 
2 632  GLN n 
2 633  GLY n 
2 634  GLN n 
2 635  ALA n 
2 636  GLY n 
2 637  LYS n 
2 638  TYR n 
2 639  GLN n 
2 640  ALA n 
2 641  VAL n 
2 642  PRO n 
2 643  LEU n 
2 644  LYS n 
2 645  VAL n 
2 646  VAL n 
2 647  ASN n 
2 648  ARG n 
2 649  LYS n 
2 650  ARG n 
2 651  PRO n 
2 652  ALA n 
2 653  ARG n 
2 654  GLU n 
2 655  GLU n 
2 656  VAL n 
2 657  ARG n 
2 658  ASP n 
2 659  LEU n 
2 660  LEU n 
2 661  GLY n 
2 662  PRO n 
2 663  LEU n 
2 664  GLN n 
2 665  ARG n 
2 666  LEU n 
2 667  ALA n 
2 668  PRO n 
2 669  SER n 
2 670  MET n 
2 671  ASP n 
2 672  GLY n 
2 673  ASP n 
2 674  ALA n 
2 675  ASP n 
2 676  ASN n 
2 677  PHE n 
2 678  CYS n 
2 679  VAL n 
2 680  GLN n 
2 681  ILE n 
2 682  ILE n 
2 683  GLY n 
2 684  GLY n 
2 685  PHE n 
2 686  PHE n 
2 687  THR n 
2 688  TRP n 
2 689  THR n 
2 690  PRO n 
2 691  ASP n 
2 692  GLY n 
2 693  ILE n 
2 694  PRO n 
2 695  THR n 
2 696  LEU n 
2 697  SER n 
2 698  ASN n 
2 699  ILE n 
2 700  THR n 
2 701  ILE n 
2 702  ARG n 
2 703  ILE n 
2 704  PRO n 
2 705  ARG n 
2 706  GLY n 
2 707  GLN n 
2 708  LEU n 
2 709  THR n 
2 710  MET n 
2 711  ILE n 
2 712  VAL n 
2 713  GLY n 
2 714  GLN n 
2 715  VAL n 
2 716  GLY n 
2 717  CYS n 
2 718  GLY n 
2 719  LYS n 
2 720  SER n 
2 721  SER n 
2 722  LEU n 
2 723  LEU n 
2 724  LEU n 
2 725  ALA n 
2 726  THR n 
2 727  LEU n 
2 728  GLY n 
2 729  GLU n 
2 730  MET n 
2 731  GLN n 
2 732  LYS n 
2 733  VAL n 
2 734  SER n 
2 735  GLY n 
2 736  ALA n 
2 737  VAL n 
2 738  PHE n 
2 739  TRP n 
2 740  ASN n 
2 741  SER n 
2 742  ASN n 
2 743  LEU n 
2 744  PRO n 
2 745  ASP n 
2 746  SER n 
2 747  GLU n 
2 748  GLY n 
2 749  GLU n 
2 750  ASP n 
2 751  PRO n 
2 752  SER n 
2 753  SER n 
2 754  PRO n 
2 755  GLU n 
2 756  ARG n 
2 757  GLU n 
2 758  THR n 
2 759  ALA n 
2 760  ALA n 
2 761  GLY n 
2 762  SER n 
2 763  ASP n 
2 764  ILE n 
2 765  ARG n 
2 766  SER n 
2 767  ARG n 
2 768  GLY n 
2 769  PRO n 
2 770  VAL n 
2 771  ALA n 
2 772  TYR n 
2 773  ALA n 
2 774  SER n 
2 775  GLN n 
2 776  LYS n 
2 777  PRO n 
2 778  TRP n 
2 779  LEU n 
2 780  LEU n 
2 781  ASN n 
2 782  ALA n 
2 783  THR n 
2 784  VAL n 
2 785  GLU n 
2 786  GLU n 
2 787  ASN n 
2 788  ILE n 
2 789  THR n 
2 790  PHE n 
2 791  GLU n 
2 792  SER n 
2 793  PRO n 
2 794  PHE n 
2 795  ASN n 
2 796  LYS n 
2 797  GLN n 
2 798  ARG n 
2 799  TYR n 
2 800  LYS n 
2 801  MET n 
2 802  VAL n 
2 803  ILE n 
2 804  GLU n 
2 805  ALA n 
2 806  CYS n 
2 807  SER n 
2 808  LEU n 
2 809  GLN n 
2 810  PRO n 
2 811  ASP n 
2 812  ILE n 
2 813  ASP n 
2 814  ILE n 
2 815  LEU n 
2 816  PRO n 
2 817  HIS n 
2 818  GLY n 
2 819  ASP n 
2 820  GLN n 
2 821  THR n 
2 822  GLN n 
2 823  ILE n 
2 824  GLY n 
2 825  GLU n 
2 826  ARG n 
2 827  GLY n 
2 828  ILE n 
2 829  ASN n 
2 830  LEU n 
2 831  SER n 
2 832  GLY n 
2 833  GLY n 
2 834  GLN n 
2 835  ARG n 
2 836  GLN n 
2 837  ARG n 
2 838  ILE n 
2 839  SER n 
2 840  VAL n 
2 841  ALA n 
2 842  ARG n 
2 843  ALA n 
2 844  LEU n 
2 845  TYR n 
2 846  GLN n 
2 847  GLN n 
2 848  THR n 
2 849  ASN n 
2 850  VAL n 
2 851  VAL n 
2 852  PHE n 
2 853  LEU n 
2 854  ASP n 
2 855  ASP n 
2 856  PRO n 
2 857  PHE n 
2 858  SER n 
2 859  ALA n 
2 860  LEU n 
2 861  ASP n 
2 862  VAL n 
2 863  HIS n 
2 864  LEU n 
2 865  SER n 
2 866  ASP n 
2 867  HIS n 
2 868  LEU n 
2 869  MET n 
2 870  GLN n 
2 871  ALA n 
2 872  GLY n 
2 873  ILE n 
2 874  LEU n 
2 875  GLU n 
2 876  LEU n 
2 877  LEU n 
2 878  ARG n 
2 879  ASP n 
2 880  ASP n 
2 881  LYS n 
2 882  ARG n 
2 883  THR n 
2 884  VAL n 
2 885  VAL n 
2 886  LEU n 
2 887  VAL n 
2 888  THR n 
2 889  HIS n 
2 890  LYS n 
2 891  LEU n 
2 892  GLN n 
2 893  TYR n 
2 894  LEU n 
2 895  PRO n 
2 896  HIS n 
2 897  ALA n 
2 898  ASP n 
2 899  TRP n 
2 900  ILE n 
2 901  ILE n 
2 902  ALA n 
2 903  MET n 
2 904  LYS n 
2 905  ASP n 
2 906  GLY n 
2 907  THR n 
2 908  ILE n 
2 909  GLN n 
2 910  ARG n 
2 911  GLU n 
2 912  GLY n 
2 913  THR n 
2 914  LEU n 
2 915  LYS n 
2 916  ASP n 
2 917  PHE n 
2 918  GLN n 
2 919  ARG n 
2 920  SER n 
2 921  GLU n 
2 922  CYS n 
2 923  GLN n 
2 924  LEU n 
2 925  PHE n 
2 926  GLU n 
2 927  HIS n 
2 928  TRP n 
2 929  LYS n 
2 930  THR n 
2 931  LEU n 
2 932  MET n 
2 933  ASN n 
2 934  ARG n 
2 935  GLN n 
2 936  ASP n 
2 937  GLN n 
2 938  GLU n 
2 939  LEU n 
2 940  GLU n 
2 941  LYS n 
2 942  GLU n 
2 943  THR n 
2 944  VAL n 
2 945  MET n 
2 946  GLU n 
2 947  ARG n 
2 948  LYS n 
2 949  ALA n 
2 950  SER n 
2 951  GLU n 
2 952  PRO n 
2 953  SER n 
2 954  GLN n 
2 955  GLY n 
2 956  LEU n 
2 957  PRO n 
2 958  ARG n 
2 959  ALA n 
2 960  MET n 
2 961  SER n 
2 962  SER n 
2 963  ARG n 
2 964  ASP n 
2 965  GLY n 
2 966  LEU n 
2 967  LEU n 
2 968  LEU n 
2 969  ASP n 
2 970  GLU n 
2 971  GLU n 
2 972  GLU n 
2 973  GLU n 
2 974  GLU n 
2 975  GLU n 
2 976  GLU n 
2 977  ALA n 
2 978  ALA n 
2 979  GLU n 
2 980  SER n 
2 981  GLU n 
2 982  GLU n 
2 983  ASP n 
2 984  ASP n 
2 985  ASN n 
2 986  LEU n 
2 987  SER n 
2 988  SER n 
2 989  VAL n 
2 990  LEU n 
2 991  HIS n 
2 992  GLN n 
2 993  ARG n 
2 994  ALA n 
2 995  LYS n 
2 996  ILE n 
2 997  PRO n 
2 998  TRP n 
2 999  ARG n 
2 1000 ALA n 
2 1001 CYS n 
2 1002 THR n 
2 1003 LYS n 
2 1004 TYR n 
2 1005 LEU n 
2 1006 SER n 
2 1007 SER n 
2 1008 ALA n 
2 1009 GLY n 
2 1010 ILE n 
2 1011 LEU n 
2 1012 LEU n 
2 1013 LEU n 
2 1014 SER n 
2 1015 LEU n 
2 1016 LEU n 
2 1017 VAL n 
2 1018 PHE n 
2 1019 SER n 
2 1020 GLN n 
2 1021 LEU n 
2 1022 LEU n 
2 1023 LYS n 
2 1024 HIS n 
2 1025 MET n 
2 1026 VAL n 
2 1027 LEU n 
2 1028 VAL n 
2 1029 ALA n 
2 1030 ILE n 
2 1031 ASP n 
2 1032 TYR n 
2 1033 TRP n 
2 1034 LEU n 
2 1035 ALA n 
2 1036 LYS n 
2 1037 TRP n 
2 1038 THR n 
2 1039 ASP n 
2 1040 SER n 
2 1041 ALA n 
2 1042 LEU n 
2 1043 VAL n 
2 1044 LEU n 
2 1045 SER n 
2 1046 PRO n 
2 1047 ALA n 
2 1048 ALA n 
2 1049 ARG n 
2 1050 ASN n 
2 1051 CYS n 
2 1052 SER n 
2 1053 LEU n 
2 1054 SER n 
2 1055 GLN n 
2 1056 GLU n 
2 1057 CYS n 
2 1058 ASP n 
2 1059 LEU n 
2 1060 ASP n 
2 1061 GLN n 
2 1062 SER n 
2 1063 VAL n 
2 1064 TYR n 
2 1065 ALA n 
2 1066 MET n 
2 1067 VAL n 
2 1068 PHE n 
2 1069 THR n 
2 1070 LEU n 
2 1071 LEU n 
2 1072 CYS n 
2 1073 SER n 
2 1074 LEU n 
2 1075 GLY n 
2 1076 ILE n 
2 1077 VAL n 
2 1078 LEU n 
2 1079 CYS n 
2 1080 LEU n 
2 1081 VAL n 
2 1082 THR n 
2 1083 SER n 
2 1084 VAL n 
2 1085 THR n 
2 1086 VAL n 
2 1087 GLU n 
2 1088 TRP n 
2 1089 THR n 
2 1090 GLY n 
2 1091 LEU n 
2 1092 LYS n 
2 1093 VAL n 
2 1094 ALA n 
2 1095 LYS n 
2 1096 ARG n 
2 1097 LEU n 
2 1098 HIS n 
2 1099 ARG n 
2 1100 SER n 
2 1101 LEU n 
2 1102 LEU n 
2 1103 ASN n 
2 1104 ARG n 
2 1105 ILE n 
2 1106 ILE n 
2 1107 LEU n 
2 1108 ALA n 
2 1109 PRO n 
2 1110 MET n 
2 1111 ARG n 
2 1112 PHE n 
2 1113 PHE n 
2 1114 GLU n 
2 1115 THR n 
2 1116 THR n 
2 1117 PRO n 
2 1118 LEU n 
2 1119 GLY n 
2 1120 SER n 
2 1121 ILE n 
2 1122 LEU n 
2 1123 ASN n 
2 1124 ARG n 
2 1125 PHE n 
2 1126 SER n 
2 1127 SER n 
2 1128 ASP n 
2 1129 CYS n 
2 1130 ASN n 
2 1131 THR n 
2 1132 ILE n 
2 1133 ASP n 
2 1134 GLN n 
2 1135 HIS n 
2 1136 ILE n 
2 1137 PRO n 
2 1138 SER n 
2 1139 THR n 
2 1140 LEU n 
2 1141 GLU n 
2 1142 CYS n 
2 1143 LEU n 
2 1144 SER n 
2 1145 ARG n 
2 1146 SER n 
2 1147 THR n 
2 1148 LEU n 
2 1149 LEU n 
2 1150 CYS n 
2 1151 VAL n 
2 1152 SER n 
2 1153 ALA n 
2 1154 LEU n 
2 1155 THR n 
2 1156 VAL n 
2 1157 ILE n 
2 1158 SER n 
2 1159 TYR n 
2 1160 VAL n 
2 1161 THR n 
2 1162 PRO n 
2 1163 VAL n 
2 1164 PHE n 
2 1165 LEU n 
2 1166 VAL n 
2 1167 ALA n 
2 1168 LEU n 
2 1169 LEU n 
2 1170 PRO n 
2 1171 LEU n 
2 1172 ALA n 
2 1173 VAL n 
2 1174 VAL n 
2 1175 CYS n 
2 1176 TYR n 
2 1177 PHE n 
2 1178 ILE n 
2 1179 GLN n 
2 1180 LYS n 
2 1181 TYR n 
2 1182 PHE n 
2 1183 ARG n 
2 1184 VAL n 
2 1185 ALA n 
2 1186 SER n 
2 1187 ARG n 
2 1188 ASP n 
2 1189 LEU n 
2 1190 GLN n 
2 1191 GLN n 
2 1192 LEU n 
2 1193 ASP n 
2 1194 ASP n 
2 1195 THR n 
2 1196 THR n 
2 1197 GLN n 
2 1198 LEU n 
2 1199 PRO n 
2 1200 LEU n 
2 1201 VAL n 
2 1202 SER n 
2 1203 HIS n 
2 1204 PHE n 
2 1205 ALA n 
2 1206 GLU n 
2 1207 THR n 
2 1208 VAL n 
2 1209 GLU n 
2 1210 GLY n 
2 1211 LEU n 
2 1212 THR n 
2 1213 THR n 
2 1214 ILE n 
2 1215 ARG n 
2 1216 ALA n 
2 1217 PHE n 
2 1218 ARG n 
2 1219 TYR n 
2 1220 GLU n 
2 1221 ALA n 
2 1222 ARG n 
2 1223 PHE n 
2 1224 GLN n 
2 1225 GLN n 
2 1226 LYS n 
2 1227 LEU n 
2 1228 LEU n 
2 1229 GLU n 
2 1230 TYR n 
2 1231 THR n 
2 1232 ASP n 
2 1233 SER n 
2 1234 ASN n 
2 1235 ASN n 
2 1236 ILE n 
2 1237 ALA n 
2 1238 SER n 
2 1239 LEU n 
2 1240 PHE n 
2 1241 LEU n 
2 1242 THR n 
2 1243 ALA n 
2 1244 ALA n 
2 1245 ASN n 
2 1246 ARG n 
2 1247 TRP n 
2 1248 LEU n 
2 1249 GLU n 
2 1250 VAL n 
2 1251 CYS n 
2 1252 MET n 
2 1253 GLU n 
2 1254 TYR n 
2 1255 ILE n 
2 1256 GLY n 
2 1257 ALA n 
2 1258 CYS n 
2 1259 VAL n 
2 1260 VAL n 
2 1261 LEU n 
2 1262 ILE n 
2 1263 ALA n 
2 1264 ALA n 
2 1265 ALA n 
2 1266 THR n 
2 1267 SER n 
2 1268 ILE n 
2 1269 SER n 
2 1270 ASN n 
2 1271 SER n 
2 1272 LEU n 
2 1273 HIS n 
2 1274 ARG n 
2 1275 GLU n 
2 1276 LEU n 
2 1277 SER n 
2 1278 ALA n 
2 1279 GLY n 
2 1280 LEU n 
2 1281 VAL n 
2 1282 GLY n 
2 1283 LEU n 
2 1284 GLY n 
2 1285 LEU n 
2 1286 THR n 
2 1287 TYR n 
2 1288 ALA n 
2 1289 LEU n 
2 1290 MET n 
2 1291 VAL n 
2 1292 SER n 
2 1293 ASN n 
2 1294 TYR n 
2 1295 LEU n 
2 1296 ASN n 
2 1297 TRP n 
2 1298 MET n 
2 1299 VAL n 
2 1300 ARG n 
2 1301 ASN n 
2 1302 LEU n 
2 1303 ALA n 
2 1304 ASP n 
2 1305 MET n 
2 1306 GLU n 
2 1307 ILE n 
2 1308 GLN n 
2 1309 LEU n 
2 1310 GLY n 
2 1311 ALA n 
2 1312 VAL n 
2 1313 LYS n 
2 1314 ARG n 
2 1315 ILE n 
2 1316 HIS n 
2 1317 ALA n 
2 1318 LEU n 
2 1319 LEU n 
2 1320 LYS n 
2 1321 THR n 
2 1322 GLU n 
2 1323 ALA n 
2 1324 GLU n 
2 1325 SER n 
2 1326 TYR n 
2 1327 GLU n 
2 1328 GLY n 
2 1329 LEU n 
2 1330 LEU n 
2 1331 ALA n 
2 1332 PRO n 
2 1333 SER n 
2 1334 LEU n 
2 1335 ILE n 
2 1336 PRO n 
2 1337 LYS n 
2 1338 ASN n 
2 1339 TRP n 
2 1340 PRO n 
2 1341 ASP n 
2 1342 GLN n 
2 1343 GLY n 
2 1344 LYS n 
2 1345 ILE n 
2 1346 GLN n 
2 1347 ILE n 
2 1348 GLN n 
2 1349 ASN n 
2 1350 LEU n 
2 1351 SER n 
2 1352 VAL n 
2 1353 ARG n 
2 1354 TYR n 
2 1355 ASP n 
2 1356 SER n 
2 1357 SER n 
2 1358 LEU n 
2 1359 LYS n 
2 1360 PRO n 
2 1361 VAL n 
2 1362 LEU n 
2 1363 LYS n 
2 1364 HIS n 
2 1365 VAL n 
2 1366 ASN n 
2 1367 THR n 
2 1368 LEU n 
2 1369 ILE n 
2 1370 SER n 
2 1371 PRO n 
2 1372 GLY n 
2 1373 GLN n 
2 1374 LYS n 
2 1375 ILE n 
2 1376 GLY n 
2 1377 ILE n 
2 1378 CYS n 
2 1379 GLY n 
2 1380 ARG n 
2 1381 THR n 
2 1382 GLY n 
2 1383 SER n 
2 1384 GLY n 
2 1385 LYS n 
2 1386 SER n 
2 1387 SER n 
2 1388 PHE n 
2 1389 SER n 
2 1390 LEU n 
2 1391 ALA n 
2 1392 PHE n 
2 1393 PHE n 
2 1394 ARG n 
2 1395 MET n 
2 1396 VAL n 
2 1397 ASP n 
2 1398 MET n 
2 1399 PHE n 
2 1400 GLU n 
2 1401 GLY n 
2 1402 ARG n 
2 1403 ILE n 
2 1404 ILE n 
2 1405 ILE n 
2 1406 ASP n 
2 1407 GLY n 
2 1408 ILE n 
2 1409 ASP n 
2 1410 ILE n 
2 1411 ALA n 
2 1412 LYS n 
2 1413 LEU n 
2 1414 PRO n 
2 1415 LEU n 
2 1416 HIS n 
2 1417 THR n 
2 1418 LEU n 
2 1419 ARG n 
2 1420 SER n 
2 1421 ARG n 
2 1422 LEU n 
2 1423 SER n 
2 1424 ILE n 
2 1425 ILE n 
2 1426 LEU n 
2 1427 GLN n 
2 1428 ASP n 
2 1429 PRO n 
2 1430 VAL n 
2 1431 LEU n 
2 1432 PHE n 
2 1433 SER n 
2 1434 GLY n 
2 1435 THR n 
2 1436 ILE n 
2 1437 ARG n 
2 1438 PHE n 
2 1439 ASN n 
2 1440 LEU n 
2 1441 ASP n 
2 1442 PRO n 
2 1443 GLU n 
2 1444 LYS n 
2 1445 LYS n 
2 1446 CYS n 
2 1447 SER n 
2 1448 ASP n 
2 1449 SER n 
2 1450 THR n 
2 1451 LEU n 
2 1452 TRP n 
2 1453 GLU n 
2 1454 ALA n 
2 1455 LEU n 
2 1456 GLU n 
2 1457 ILE n 
2 1458 ALA n 
2 1459 GLN n 
2 1460 LEU n 
2 1461 LYS n 
2 1462 LEU n 
2 1463 VAL n 
2 1464 VAL n 
2 1465 LYS n 
2 1466 ALA n 
2 1467 LEU n 
2 1468 PRO n 
2 1469 GLY n 
2 1470 GLY n 
2 1471 LEU n 
2 1472 ASP n 
2 1473 ALA n 
2 1474 ILE n 
2 1475 ILE n 
2 1476 THR n 
2 1477 GLU n 
2 1478 GLY n 
2 1479 GLY n 
2 1480 GLU n 
2 1481 ASN n 
2 1482 PHE n 
2 1483 SER n 
2 1484 GLN n 
2 1485 GLY n 
2 1486 GLN n 
2 1487 ARG n 
2 1488 GLN n 
2 1489 LEU n 
2 1490 PHE n 
2 1491 CYS n 
2 1492 LEU n 
2 1493 ALA n 
2 1494 ARG n 
2 1495 ALA n 
2 1496 PHE n 
2 1497 VAL n 
2 1498 ARG n 
2 1499 LYS n 
2 1500 THR n 
2 1501 SER n 
2 1502 ILE n 
2 1503 PHE n 
2 1504 ILE n 
2 1505 MET n 
2 1506 ASP n 
2 1507 GLU n 
2 1508 ALA n 
2 1509 THR n 
2 1510 ALA n 
2 1511 SER n 
2 1512 ILE n 
2 1513 ASP n 
2 1514 MET n 
2 1515 ALA n 
2 1516 THR n 
2 1517 GLU n 
2 1518 ASN n 
2 1519 ILE n 
2 1520 LEU n 
2 1521 GLN n 
2 1522 LYS n 
2 1523 VAL n 
2 1524 VAL n 
2 1525 MET n 
2 1526 THR n 
2 1527 ALA n 
2 1528 PHE n 
2 1529 ALA n 
2 1530 ASP n 
2 1531 ARG n 
2 1532 THR n 
2 1533 VAL n 
2 1534 VAL n 
2 1535 THR n 
2 1536 ILE n 
2 1537 ALA n 
2 1538 HIS n 
2 1539 ARG n 
2 1540 VAL n 
2 1541 HIS n 
2 1542 THR n 
2 1543 ILE n 
2 1544 LEU n 
2 1545 SER n 
2 1546 ALA n 
2 1547 ASP n 
2 1548 LEU n 
2 1549 VAL n 
2 1550 MET n 
2 1551 VAL n 
2 1552 LEU n 
2 1553 LYS n 
2 1554 ARG n 
2 1555 GLY n 
2 1556 ALA n 
2 1557 ILE n 
2 1558 LEU n 
2 1559 GLU n 
2 1560 PHE n 
2 1561 ASP n 
2 1562 LYS n 
2 1563 PRO n 
2 1564 GLU n 
2 1565 THR n 
2 1566 LEU n 
2 1567 LEU n 
2 1568 SER n 
2 1569 GLN n 
2 1570 LYS n 
2 1571 ASP n 
2 1572 SER n 
2 1573 VAL n 
2 1574 PHE n 
2 1575 ALA n 
2 1576 SER n 
2 1577 PHE n 
2 1578 VAL n 
2 1579 ARG n 
2 1580 ALA n 
2 1581 ASP n 
2 1582 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 390  Rat                     ? Kcnj11       ? ? ? ? ? ? 'Rattus norvegicus' 10116 ? ? ? ? ? ? ? 
Rat 'Rattus norvegicus' 10116 ? ? ? ? ? ? ? ? INS-1 ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 1582 'Black-bellied hamster' ? 'ABCC8, SUR' ? ? ? ? ? ? 'Cricetus cricetus' 10034 ? ? ? ? ? ? ? 
Rat 'Rattus norvegicus' 10116 ? ? ? ? ? ? ? ? ?     ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP KCJ11_RAT   P70673 ? 1 
;MLSRKGIIPEEYVLTRLAEDPTEPRYRTRERRARFVSKKGNCNVAHKNIREQGRFLQDVFTTLVDLKWPHTLLIFTMSFL
CSWLLFAMVWWLIAFAHGDLAPGEGTNVPCVTSIHSFSSAFLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMIN
AIMLGCIFMKTAQAHRRAETLIFSKHAVITLRHGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPM
ENGVGGNSIFLVAPLIIYHVIDSNSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQARTSYLADEILWGQRFVPIVA
EEDGRYSVDYSKFGNTVKVPTPLCTARQLDEDRSLLDALTLASSRGPLRKRSVAVAKAKPKFSISPDSLS
;
1 
2 UNP ABCC8_CRICR Q09427 ? 2 
;MPLAFCGTENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGWGSQSSKVHIHHSTWLHFPGHNLRWILTFI
LLFVLVCEIAEGILSDGVTESRHLHLYMPAGMAFMAAITSVVYYHNIETSNFPKLLIALLIYWTLAFITKTIKFVKFYDH
AIGFSQLRFCLTGLLVILYGMLLLVEVNVIRVRRYIFFKTPREVKPPEDLQDLGVRFLQPFVNLLSKGTYWWMNAFIKTA
HKKPIDLRAIAKLPIAMRALTNYQRLCVAFDAQARKDTQSPQGARAIWRALCHAFGRRLILSSTFRILADLLGFAGPLCI
FGIVDHLGKENHVFQPKTQFLGVYFVSSQEFLGNAYVLAVLLFLALLLQRTFLQASYYVAIETGINLRGAIQTKIYNKIM
HMSTSNLSMGEMTAGQICNLVAIDTNQLMWFFFLCPNLWTMPVQIIVGVILLYYILGVSALIGAAVIILLAPVQYFVATK
LSQAQRTTLEHSNERLKQTNEMLRGMKLLKLYAWESIFCSRVEVTRRKEMTSLRAFAVYTSISIFMNTAIPIAAVLITFV
GHVSFFKESDLSPSVAFASLSLFHILVTPLFLLSSVVRSTVKALVSVQKLSEFLSSAEIREEQCAPREPAPQGQAGKYQA
VPLKVVNRKRPAREEVRDLLGPLQRLAPSMDGDADNFCVQIIGGFFTWTPDGIPTLSNITIRIPRGQLTMIVGQVGCGKS
SLLLATLGEMQKVSGAVFWNSNLPDSEGEDPSSPERETAAGSDIRSRGPVAYASQKPWLLNATVEENITFESPFNKQRYK
MVIEACSLQPDIDILPHGDQTQIGERGINLSGGQRQRISVARALYQQTNVVFLDDPFSALDVHLSDHLMQAGILELLRDD
KRTVVLVTHKLQYLPHADWIIAMKDGTIQREGTLKDFQRSECQLFEHWKTLMNRQDQELEKETVMERKASEPSQGLPRAM
SSRDGLLLDEEEEEEEAAESEEDDNLSSVLHQRAKIPWRACTKYLSSAGILLLSLLVFSQLLKHMVLVAIDYWLAKWTDS
ALVLSPAARNCSLSQECDLDQSVYAMVFTLLCSLGIVLCLVTSVTVEWTGLKVAKRLHRSLLNRIILAPMRFFETTPLGS
ILNRFSSDCNTIDQHIPSTLECLSRSTLLCVSALTVISYVTPVFLVALLPLAVVCYFIQKYFRVASRDLQQLDDTTQLPL
VSHFAETVEGLTTIRAFRYEARFQQKLLEYTDSNNIASLFLTAANRWLEVCMEYIGACVVLIAAATSISNSLHRELSAGL
VGLGLTYALMVSNYLNWMVRNLADMEIQLGAVKRIHALLKTEAESYEGLLAPSLIPKNWPDQGKIQIQNLSVRYDSSLKP
VLKHVNTLISPGQKIGICGRTGSGKSSFSLAFFRMVDMFEGRIIIDGIDIAKLPLHTLRSRLSIILQDPVLFSGTIRFNL
DPEKKCSDSTLWEALEIAQLKLVVKALPGGLDAIITEGGENFSQGQRQLFCLARAFVRKTSIFIMDEATASIDMATENIL
QKVVMTAFADRTVVTIAHRVHTILSADLVMVLKRGAILEFDKPETLLSQKDSVFASFVRADK
;
1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6BAA A 1 ? 390  ? P70673 1 ? 390  ? 1 390  
2 1 6BAA B 1 ? 390  ? P70673 1 ? 390  ? 1 390  
3 1 6BAA C 1 ? 390  ? P70673 1 ? 390  ? 1 390  
4 1 6BAA D 1 ? 390  ? P70673 1 ? 390  ? 1 390  
5 2 6BAA E 1 ? 1582 ? Q09427 1 ? 1582 ? 1 1582 
6 2 6BAA F 1 ? 1582 ? Q09427 1 ? 1582 ? 1 1582 
7 2 6BAA G 1 ? 1582 ? Q09427 1 ? 1582 ? 1 1582 
8 2 6BAA H 1 ? 1582 ? Q09427 1 ? 1582 ? 1 1582 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6BAA PRO A 191 ? UNP P70673 LEU 191 conflict 191 1 
2 6BAA PRO B 191 ? UNP P70673 LEU 191 conflict 191 2 
3 6BAA PRO C 191 ? UNP P70673 LEU 191 conflict 191 3 
4 6BAA PRO D 191 ? UNP P70673 LEU 191 conflict 191 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                             ? 'C3 H7 N O2' 
89.093  
ARG 'L-peptide linking' y ARGININE                                                                            ? 'C6 H15 N4 O2 1' 
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                          ? 'C4 H8 N2 O3' 
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                     ? 'C4 H7 N O4' 
133.103 
ATP non-polymer         . "ADENOSINE-5'-TRIPHOSPHATE"                                                         ? 
'C10 H16 N5 O13 P3'  507.181 
CYS 'L-peptide linking' y CYSTEINE                                                                            ? 'C3 H7 N O2 S' 
121.158 
GBM non-polymer         . '5-chloro-N-(2-{4-[(cyclohexylcarbamoyl)sulfamoyl]phenyl}ethyl)-2-methoxybenzamide' 
'Glibenclamide, Glyburide' 'C23 H28 Cl N3 O5 S' 494.004 
GLN 'L-peptide linking' y GLUTAMINE                                                                           ? 'C5 H10 N2 O3' 
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                     ? 'C5 H9 N O4' 
147.129 
GLY 'peptide linking'   y GLYCINE                                                                             ? 'C2 H5 N O2' 
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                           ? 'C6 H10 N3 O2 1' 
156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                                                          ? 'C6 H13 N O2' 
131.173 
LEU 'L-peptide linking' y LEUCINE                                                                             ? 'C6 H13 N O2' 
131.173 
LYS 'L-peptide linking' y LYSINE                                                                              ? 'C6 H15 N2 O2 1' 
147.195 
MET 'L-peptide linking' y METHIONINE                                                                          ? 'C5 H11 N O2 S' 
149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                       ? 'C9 H11 N O2' 
165.189 
PRO 'L-peptide linking' y PROLINE                                                                             ? 'C5 H9 N O2' 
115.130 
SER 'L-peptide linking' y SERINE                                                                              ? 'C3 H7 N O3' 
105.093 
THR 'L-peptide linking' y THREONINE                                                                           ? 'C4 H9 N O3' 
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                          ? 'C11 H12 N2 O2' 
204.225 
TYR 'L-peptide linking' y TYROSINE                                                                            ? 'C9 H11 N O3' 
181.189 
VAL 'L-peptide linking' y VALINE                                                                              ? 'C5 H11 N O2' 
117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6BAA 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_struct.entry_id                     6BAA 
_struct.title                        'Cryo-EM structure of the pancreatic beta-cell KATP channel bound to ATP and glibenclamide' 
_struct.pdbx_descriptor              
'ATP-sensitive inward rectifier potassium channel 11, ATP-binding cassette sub-family C member 8' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6BAA 
_struct_keywords.text            'KATP, SUR1, Kir6.2, sulfonylurea receptor, METAL TRANSPORT' 
_struct_keywords.pdbx_keywords   'METAL TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
M N N 4 ? 
N N N 4 ? 
O N N 4 ? 
P N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 GLY A 53   ? ASP A 58   ? GLY A 53   ASP A 58   1 ? 6  
HELX_P HELX_P2   AA2 ASP A 58   ? LEU A 66   ? ASP A 58   LEU A 66   1 ? 9  
HELX_P HELX_P3   AA3 LYS A 67   ? GLY A 98   ? LYS A 67   GLY A 98   1 ? 32 
HELX_P HELX_P4   AA4 SER A 116  ? VAL A 129  ? SER A 116  VAL A 129  1 ? 14 
HELX_P HELX_P5   AA5 CYS A 142  ? THR A 171  ? CYS A 142  THR A 171  1 ? 30 
HELX_P HELX_P6   AA6 ALA A 174  ? GLU A 179  ? ALA A 174  GLU A 179  1 ? 6  
HELX_P HELX_P7   AA7 SER A 273  ? HIS A 278  ? SER A 273  HIS A 278  1 ? 6  
HELX_P HELX_P8   AA8 SER A 331  ? PHE A 333  ? SER A 331  PHE A 333  5 ? 3  
HELX_P HELX_P9   AA9 THR A 345  ? ASP A 352  ? THR A 345  ASP A 352  1 ? 8  
HELX_P HELX_P10  AB1 GLY B 53   ? ASP B 58   ? GLY B 53   ASP B 58   1 ? 6  
HELX_P HELX_P11  AB2 ASP B 58   ? LEU B 66   ? ASP B 58   LEU B 66   1 ? 9  
HELX_P HELX_P12  AB3 LYS B 67   ? GLY B 98   ? LYS B 67   GLY B 98   1 ? 32 
HELX_P HELX_P13  AB4 SER B 116  ? VAL B 129  ? SER B 116  VAL B 129  1 ? 14 
HELX_P HELX_P14  AB5 CYS B 142  ? THR B 171  ? CYS B 142  THR B 171  1 ? 30 
HELX_P HELX_P15  AB6 ALA B 174  ? GLU B 179  ? ALA B 174  GLU B 179  1 ? 6  
HELX_P HELX_P16  AB7 SER B 273  ? HIS B 278  ? SER B 273  HIS B 278  1 ? 6  
HELX_P HELX_P17  AB8 SER B 331  ? PHE B 333  ? SER B 331  PHE B 333  5 ? 3  
HELX_P HELX_P18  AB9 THR B 345  ? ASP B 352  ? THR B 345  ASP B 352  1 ? 8  
HELX_P HELX_P19  AC1 GLY C 53   ? ASP C 58   ? GLY C 53   ASP C 58   1 ? 6  
HELX_P HELX_P20  AC2 ASP C 58   ? LEU C 66   ? ASP C 58   LEU C 66   1 ? 9  
HELX_P HELX_P21  AC3 LYS C 67   ? GLY C 98   ? LYS C 67   GLY C 98   1 ? 32 
HELX_P HELX_P22  AC4 SER C 116  ? VAL C 129  ? SER C 116  VAL C 129  1 ? 14 
HELX_P HELX_P23  AC5 CYS C 142  ? THR C 171  ? CYS C 142  THR C 171  1 ? 30 
HELX_P HELX_P24  AC6 ALA C 174  ? GLU C 179  ? ALA C 174  GLU C 179  1 ? 6  
HELX_P HELX_P25  AC7 SER C 273  ? HIS C 278  ? SER C 273  HIS C 278  1 ? 6  
HELX_P HELX_P26  AC8 SER C 331  ? PHE C 333  ? SER C 331  PHE C 333  5 ? 3  
HELX_P HELX_P27  AC9 THR C 345  ? ASP C 352  ? THR C 345  ASP C 352  1 ? 8  
HELX_P HELX_P28  AD1 GLY D 53   ? ASP D 58   ? GLY D 53   ASP D 58   1 ? 6  
HELX_P HELX_P29  AD2 ASP D 58   ? LEU D 66   ? ASP D 58   LEU D 66   1 ? 9  
HELX_P HELX_P30  AD3 LYS D 67   ? GLY D 98   ? LYS D 67   GLY D 98   1 ? 32 
HELX_P HELX_P31  AD4 SER D 116  ? VAL D 129  ? SER D 116  VAL D 129  1 ? 14 
HELX_P HELX_P32  AD5 CYS D 142  ? THR D 171  ? CYS D 142  THR D 171  1 ? 30 
HELX_P HELX_P33  AD6 ALA D 174  ? GLU D 179  ? ALA D 174  GLU D 179  1 ? 6  
HELX_P HELX_P34  AD7 SER D 273  ? HIS D 278  ? SER D 273  HIS D 278  1 ? 6  
HELX_P HELX_P35  AD8 SER D 331  ? PHE D 333  ? SER D 331  PHE D 333  5 ? 3  
HELX_P HELX_P36  AD9 THR D 345  ? ASP D 352  ? THR D 345  ASP D 352  1 ? 8  
HELX_P HELX_P37  AE1 ALA E 13   ? ASP E 18   ? ALA E 13   ASP E 18   1 ? 6  
HELX_P HELX_P38  AE2 CYS E 26   ? LYS E 57   ? CYS E 26   LYS E 57   1 ? 32 
HELX_P HELX_P39  AE3 ILE E 60   ? THR E 64   ? ILE E 60   THR E 64   5 ? 5  
HELX_P HELX_P40  AE4 HIS E 71   ? GLY E 97   ? HIS E 71   GLY E 97   1 ? 27 
HELX_P HELX_P41  AE5 HIS E 103  ? LEU E 106  ? HIS E 103  LEU E 106  5 ? 4  
HELX_P HELX_P42  AE6 TYR E 107  ? SER E 130  ? TYR E 107  SER E 130  1 ? 24 
HELX_P HELX_P43  AE7 LEU E 136  ? HIS E 160  ? LEU E 136  HIS E 160  1 ? 25 
HELX_P HELX_P44  AE8 GLN E 166  ? ARG E 194  ? GLN E 166  ARG E 194  1 ? 29 
HELX_P HELX_P45  AE9 LYS E 205  ? GLN E 211  ? LYS E 205  GLN E 211  1 ? 7  
HELX_P HELX_P46  AF1 ASP E 212  ? GLY E 214  ? ASP E 212  GLY E 214  5 ? 3  
HELX_P HELX_P47  AF2 ASN E 223  ? TYR E 230  ? ASN E 223  TYR E 230  1 ? 8  
HELX_P HELX_P48  AF3 TYR E 230  ? LYS E 243  ? TYR E 230  LYS E 243  1 ? 14 
HELX_P HELX_P49  AF4 ARG E 258  ? ALA E 272  ? ARG E 258  ALA E 272  1 ? 15 
HELX_P HELX_P50  AF5 ALA E 286  ? LEU E 327  ? ALA E 286  LEU E 327  1 ? 42 
HELX_P HELX_P51  AF6 ALA E 355  ? HIS E 401  ? ALA E 355  HIS E 401  1 ? 47 
HELX_P HELX_P52  AF7 GLY E 415  ? LEU E 434  ? GLY E 415  LEU E 434  1 ? 20 
HELX_P HELX_P53  AF8 PRO E 436  ? GLY E 457  ? PRO E 436  GLY E 457  1 ? 22 
HELX_P HELX_P54  AF9 SER E 459  ? GLY E 505  ? SER E 459  GLY E 505  1 ? 47 
HELX_P HELX_P55  AG1 GLY E 505  ? ALA E 513  ? GLY E 505  ALA E 513  1 ? 9  
HELX_P HELX_P56  AG2 TRP E 514  ? PHE E 566  ? TRP E 514  PHE E 566  1 ? 53 
HELX_P HELX_P57  AG3 SER E 572  ? LEU E 586  ? SER E 572  LEU E 586  1 ? 15 
HELX_P HELX_P58  AG4 VAL E 587  ? SER E 615  ? VAL E 587  SER E 615  1 ? 29 
HELX_P HELX_P59  AG5 GLY E 718  ? LEU E 727  ? GLY E 718  LEU E 727  1 ? 10 
HELX_P HELX_P60  AG6 VAL E 784  ? PHE E 790  ? VAL E 784  PHE E 790  1 ? 7  
HELX_P HELX_P61  AG7 ASN E 795  ? CYS E 806  ? ASN E 795  CYS E 806  1 ? 12 
HELX_P HELX_P62  AG8 LEU E 808  ? ILE E 814  ? LEU E 808  ILE E 814  1 ? 7  
HELX_P HELX_P63  AG9 HIS E 817  ? GLN E 820  ? HIS E 817  GLN E 820  5 ? 4  
HELX_P HELX_P64  AH1 SER E 831  ? GLN E 847  ? SER E 831  GLN E 847  1 ? 17 
HELX_P HELX_P65  AH2 ASP E 861  ? LEU E 874  ? ASP E 861  LEU E 874  1 ? 14 
HELX_P HELX_P66  AH3 TYR E 893  ? ALA E 897  ? TYR E 893  ALA E 897  5 ? 5  
HELX_P HELX_P67  AH4 THR E 913  ? SER E 920  ? THR E 913  SER E 920  1 ? 8  
HELX_P HELX_P68  AH5 CYS E 922  ? TRP E 928  ? CYS E 922  TRP E 928  1 ? 7  
HELX_P HELX_P69  AH6 CYS E 1001 ? GLY E 1009 ? CYS E 1001 GLY E 1009 1 ? 9  
HELX_P HELX_P70  AH7 GLY E 1009 ? ASP E 1039 ? GLY E 1009 ASP E 1039 1 ? 31 
HELX_P HELX_P71  AH8 ALA E 1065 ? LEU E 1078 ? ALA E 1065 LEU E 1078 1 ? 14 
HELX_P HELX_P72  AH9 LEU E 1080 ? ALA E 1108 ? LEU E 1080 ALA E 1108 1 ? 29 
HELX_P HELX_P73  AI1 PRO E 1109 ? THR E 1116 ? PRO E 1109 THR E 1116 1 ? 8  
HELX_P HELX_P74  AI2 LEU E 1118 ? HIS E 1135 ? LEU E 1118 HIS E 1135 1 ? 18 
HELX_P HELX_P75  AI3 HIS E 1135 ? THR E 1161 ? HIS E 1135 THR E 1161 1 ? 27 
HELX_P HELX_P76  AI4 VAL E 1163 ? GLY E 1210 ? VAL E 1163 GLY E 1210 1 ? 48 
HELX_P HELX_P77  AI5 GLY E 1210 ? ARG E 1218 ? GLY E 1210 ARG E 1218 1 ? 9  
HELX_P HELX_P78  AI6 TYR E 1219 ? LEU E 1272 ? TYR E 1219 LEU E 1272 1 ? 54 
HELX_P HELX_P79  AI7 ALA E 1278 ? ALA E 1317 ? ALA E 1278 ALA E 1317 1 ? 40 
HELX_P HELX_P80  AI8 GLY E 1384 ? PHE E 1393 ? GLY E 1384 PHE E 1393 1 ? 10 
HELX_P HELX_P81  AI9 ALA E 1411 ? LEU E 1413 ? ALA E 1411 LEU E 1413 5 ? 3  
HELX_P HELX_P82  AJ1 PRO E 1414 ? ARG E 1421 ? PRO E 1414 ARG E 1421 1 ? 8  
HELX_P HELX_P83  AJ2 THR E 1435 ? LEU E 1440 ? THR E 1435 LEU E 1440 1 ? 6  
HELX_P HELX_P84  AJ3 SER E 1447 ? ALA E 1458 ? SER E 1447 ALA E 1458 1 ? 12 
HELX_P HELX_P85  AJ4 LEU E 1460 ? ALA E 1466 ? LEU E 1460 ALA E 1466 1 ? 7  
HELX_P HELX_P86  AJ5 GLY E 1469 ? ALA E 1473 ? GLY E 1469 ALA E 1473 5 ? 5  
HELX_P HELX_P87  AJ6 ILE E 1475 ? GLY E 1479 ? ILE E 1475 GLY E 1479 5 ? 5  
HELX_P HELX_P88  AJ7 SER E 1483 ? LYS E 1499 ? SER E 1483 LYS E 1499 1 ? 17 
HELX_P HELX_P89  AJ8 ASP E 1513 ? ALA E 1529 ? ASP E 1513 ALA E 1529 1 ? 17 
HELX_P HELX_P90  AJ9 THR E 1542 ? ALA E 1546 ? THR E 1542 ALA E 1546 5 ? 5  
HELX_P HELX_P91  AK1 THR E 1565 ? LYS E 1570 ? THR E 1565 LYS E 1570 1 ? 6  
HELX_P HELX_P92  AK2 ASP E 1571 ? PHE E 1577 ? ASP E 1571 PHE E 1577 1 ? 7  
HELX_P HELX_P93  AK3 ALA F 13   ? ASP F 18   ? ALA F 13   ASP F 18   1 ? 6  
HELX_P HELX_P94  AK4 CYS F 26   ? LYS F 57   ? CYS F 26   LYS F 57   1 ? 32 
HELX_P HELX_P95  AK5 ILE F 60   ? THR F 64   ? ILE F 60   THR F 64   5 ? 5  
HELX_P HELX_P96  AK6 HIS F 71   ? GLY F 97   ? HIS F 71   GLY F 97   1 ? 27 
HELX_P HELX_P97  AK7 HIS F 103  ? LEU F 106  ? HIS F 103  LEU F 106  5 ? 4  
HELX_P HELX_P98  AK8 TYR F 107  ? SER F 130  ? TYR F 107  SER F 130  1 ? 24 
HELX_P HELX_P99  AK9 LEU F 136  ? HIS F 160  ? LEU F 136  HIS F 160  1 ? 25 
HELX_P HELX_P100 AL1 GLN F 166  ? ARG F 194  ? GLN F 166  ARG F 194  1 ? 29 
HELX_P HELX_P101 AL2 LYS F 205  ? GLN F 211  ? LYS F 205  GLN F 211  1 ? 7  
HELX_P HELX_P102 AL3 ASP F 212  ? GLY F 214  ? ASP F 212  GLY F 214  5 ? 3  
HELX_P HELX_P103 AL4 ASN F 223  ? TYR F 230  ? ASN F 223  TYR F 230  1 ? 8  
HELX_P HELX_P104 AL5 TYR F 230  ? LYS F 243  ? TYR F 230  LYS F 243  1 ? 14 
HELX_P HELX_P105 AL6 ARG F 258  ? ALA F 272  ? ARG F 258  ALA F 272  1 ? 15 
HELX_P HELX_P106 AL7 ALA F 286  ? LEU F 327  ? ALA F 286  LEU F 327  1 ? 42 
HELX_P HELX_P107 AL8 ALA F 355  ? HIS F 401  ? ALA F 355  HIS F 401  1 ? 47 
HELX_P HELX_P108 AL9 GLY F 415  ? LEU F 434  ? GLY F 415  LEU F 434  1 ? 20 
HELX_P HELX_P109 AM1 PRO F 436  ? GLY F 457  ? PRO F 436  GLY F 457  1 ? 22 
HELX_P HELX_P110 AM2 SER F 459  ? GLY F 505  ? SER F 459  GLY F 505  1 ? 47 
HELX_P HELX_P111 AM3 GLY F 505  ? ALA F 513  ? GLY F 505  ALA F 513  1 ? 9  
HELX_P HELX_P112 AM4 TRP F 514  ? PHE F 566  ? TRP F 514  PHE F 566  1 ? 53 
HELX_P HELX_P113 AM5 SER F 572  ? LEU F 586  ? SER F 572  LEU F 586  1 ? 15 
HELX_P HELX_P114 AM6 VAL F 587  ? SER F 615  ? VAL F 587  SER F 615  1 ? 29 
HELX_P HELX_P115 AM7 GLY F 718  ? LEU F 727  ? GLY F 718  LEU F 727  1 ? 10 
HELX_P HELX_P116 AM8 VAL F 784  ? PHE F 790  ? VAL F 784  PHE F 790  1 ? 7  
HELX_P HELX_P117 AM9 ASN F 795  ? CYS F 806  ? ASN F 795  CYS F 806  1 ? 12 
HELX_P HELX_P118 AN1 LEU F 808  ? ILE F 814  ? LEU F 808  ILE F 814  1 ? 7  
HELX_P HELX_P119 AN2 HIS F 817  ? GLN F 820  ? HIS F 817  GLN F 820  5 ? 4  
HELX_P HELX_P120 AN3 SER F 831  ? GLN F 847  ? SER F 831  GLN F 847  1 ? 17 
HELX_P HELX_P121 AN4 ASP F 861  ? LEU F 874  ? ASP F 861  LEU F 874  1 ? 14 
HELX_P HELX_P122 AN5 TYR F 893  ? ALA F 897  ? TYR F 893  ALA F 897  5 ? 5  
HELX_P HELX_P123 AN6 THR F 913  ? SER F 920  ? THR F 913  SER F 920  1 ? 8  
HELX_P HELX_P124 AN7 CYS F 922  ? TRP F 928  ? CYS F 922  TRP F 928  1 ? 7  
HELX_P HELX_P125 AN8 CYS F 1001 ? GLY F 1009 ? CYS F 1001 GLY F 1009 1 ? 9  
HELX_P HELX_P126 AN9 GLY F 1009 ? ASP F 1039 ? GLY F 1009 ASP F 1039 1 ? 31 
HELX_P HELX_P127 AO1 ALA F 1065 ? LEU F 1078 ? ALA F 1065 LEU F 1078 1 ? 14 
HELX_P HELX_P128 AO2 LEU F 1080 ? ALA F 1108 ? LEU F 1080 ALA F 1108 1 ? 29 
HELX_P HELX_P129 AO3 PRO F 1109 ? THR F 1116 ? PRO F 1109 THR F 1116 1 ? 8  
HELX_P HELX_P130 AO4 LEU F 1118 ? HIS F 1135 ? LEU F 1118 HIS F 1135 1 ? 18 
HELX_P HELX_P131 AO5 HIS F 1135 ? THR F 1161 ? HIS F 1135 THR F 1161 1 ? 27 
HELX_P HELX_P132 AO6 VAL F 1163 ? GLY F 1210 ? VAL F 1163 GLY F 1210 1 ? 48 
HELX_P HELX_P133 AO7 GLY F 1210 ? ARG F 1218 ? GLY F 1210 ARG F 1218 1 ? 9  
HELX_P HELX_P134 AO8 TYR F 1219 ? LEU F 1272 ? TYR F 1219 LEU F 1272 1 ? 54 
HELX_P HELX_P135 AO9 ALA F 1278 ? ALA F 1317 ? ALA F 1278 ALA F 1317 1 ? 40 
HELX_P HELX_P136 AP1 GLY F 1384 ? PHE F 1393 ? GLY F 1384 PHE F 1393 1 ? 10 
HELX_P HELX_P137 AP2 ALA F 1411 ? LEU F 1413 ? ALA F 1411 LEU F 1413 5 ? 3  
HELX_P HELX_P138 AP3 PRO F 1414 ? ARG F 1421 ? PRO F 1414 ARG F 1421 1 ? 8  
HELX_P HELX_P139 AP4 THR F 1435 ? LEU F 1440 ? THR F 1435 LEU F 1440 1 ? 6  
HELX_P HELX_P140 AP5 SER F 1447 ? ALA F 1458 ? SER F 1447 ALA F 1458 1 ? 12 
HELX_P HELX_P141 AP6 LEU F 1460 ? ALA F 1466 ? LEU F 1460 ALA F 1466 1 ? 7  
HELX_P HELX_P142 AP7 GLY F 1469 ? ALA F 1473 ? GLY F 1469 ALA F 1473 5 ? 5  
HELX_P HELX_P143 AP8 ILE F 1475 ? GLY F 1479 ? ILE F 1475 GLY F 1479 5 ? 5  
HELX_P HELX_P144 AP9 SER F 1483 ? LYS F 1499 ? SER F 1483 LYS F 1499 1 ? 17 
HELX_P HELX_P145 AQ1 ASP F 1513 ? ALA F 1529 ? ASP F 1513 ALA F 1529 1 ? 17 
HELX_P HELX_P146 AQ2 THR F 1542 ? ALA F 1546 ? THR F 1542 ALA F 1546 5 ? 5  
HELX_P HELX_P147 AQ3 THR F 1565 ? LYS F 1570 ? THR F 1565 LYS F 1570 1 ? 6  
HELX_P HELX_P148 AQ4 ASP F 1571 ? PHE F 1577 ? ASP F 1571 PHE F 1577 1 ? 7  
HELX_P HELX_P149 AQ5 ALA G 13   ? ASP G 18   ? ALA G 13   ASP G 18   1 ? 6  
HELX_P HELX_P150 AQ6 CYS G 26   ? LYS G 57   ? CYS G 26   LYS G 57   1 ? 32 
HELX_P HELX_P151 AQ7 ILE G 60   ? THR G 64   ? ILE G 60   THR G 64   5 ? 5  
HELX_P HELX_P152 AQ8 HIS G 71   ? GLY G 97   ? HIS G 71   GLY G 97   1 ? 27 
HELX_P HELX_P153 AQ9 HIS G 103  ? LEU G 106  ? HIS G 103  LEU G 106  5 ? 4  
HELX_P HELX_P154 AR1 TYR G 107  ? SER G 130  ? TYR G 107  SER G 130  1 ? 24 
HELX_P HELX_P155 AR2 LEU G 136  ? HIS G 160  ? LEU G 136  HIS G 160  1 ? 25 
HELX_P HELX_P156 AR3 GLN G 166  ? ARG G 194  ? GLN G 166  ARG G 194  1 ? 29 
HELX_P HELX_P157 AR4 LYS G 205  ? GLN G 211  ? LYS G 205  GLN G 211  1 ? 7  
HELX_P HELX_P158 AR5 ASP G 212  ? GLY G 214  ? ASP G 212  GLY G 214  5 ? 3  
HELX_P HELX_P159 AR6 ASN G 223  ? TYR G 230  ? ASN G 223  TYR G 230  1 ? 8  
HELX_P HELX_P160 AR7 TYR G 230  ? LYS G 243  ? TYR G 230  LYS G 243  1 ? 14 
HELX_P HELX_P161 AR8 ARG G 258  ? ALA G 272  ? ARG G 258  ALA G 272  1 ? 15 
HELX_P HELX_P162 AR9 ALA G 286  ? LEU G 327  ? ALA G 286  LEU G 327  1 ? 42 
HELX_P HELX_P163 AS1 ALA G 355  ? HIS G 401  ? ALA G 355  HIS G 401  1 ? 47 
HELX_P HELX_P164 AS2 GLY G 415  ? LEU G 434  ? GLY G 415  LEU G 434  1 ? 20 
HELX_P HELX_P165 AS3 PRO G 436  ? GLY G 457  ? PRO G 436  GLY G 457  1 ? 22 
HELX_P HELX_P166 AS4 SER G 459  ? GLY G 505  ? SER G 459  GLY G 505  1 ? 47 
HELX_P HELX_P167 AS5 GLY G 505  ? ALA G 513  ? GLY G 505  ALA G 513  1 ? 9  
HELX_P HELX_P168 AS6 TRP G 514  ? PHE G 566  ? TRP G 514  PHE G 566  1 ? 53 
HELX_P HELX_P169 AS7 SER G 572  ? LEU G 586  ? SER G 572  LEU G 586  1 ? 15 
HELX_P HELX_P170 AS8 VAL G 587  ? SER G 615  ? VAL G 587  SER G 615  1 ? 29 
HELX_P HELX_P171 AS9 GLY G 718  ? LEU G 727  ? GLY G 718  LEU G 727  1 ? 10 
HELX_P HELX_P172 AT1 VAL G 784  ? PHE G 790  ? VAL G 784  PHE G 790  1 ? 7  
HELX_P HELX_P173 AT2 ASN G 795  ? CYS G 806  ? ASN G 795  CYS G 806  1 ? 12 
HELX_P HELX_P174 AT3 LEU G 808  ? ILE G 814  ? LEU G 808  ILE G 814  1 ? 7  
HELX_P HELX_P175 AT4 HIS G 817  ? GLN G 820  ? HIS G 817  GLN G 820  5 ? 4  
HELX_P HELX_P176 AT5 SER G 831  ? GLN G 847  ? SER G 831  GLN G 847  1 ? 17 
HELX_P HELX_P177 AT6 ASP G 861  ? LEU G 874  ? ASP G 861  LEU G 874  1 ? 14 
HELX_P HELX_P178 AT7 TYR G 893  ? ALA G 897  ? TYR G 893  ALA G 897  5 ? 5  
HELX_P HELX_P179 AT8 THR G 913  ? SER G 920  ? THR G 913  SER G 920  1 ? 8  
HELX_P HELX_P180 AT9 CYS G 922  ? TRP G 928  ? CYS G 922  TRP G 928  1 ? 7  
HELX_P HELX_P181 AU1 CYS G 1001 ? GLY G 1009 ? CYS G 1001 GLY G 1009 1 ? 9  
HELX_P HELX_P182 AU2 GLY G 1009 ? ASP G 1039 ? GLY G 1009 ASP G 1039 1 ? 31 
HELX_P HELX_P183 AU3 ALA G 1065 ? LEU G 1078 ? ALA G 1065 LEU G 1078 1 ? 14 
HELX_P HELX_P184 AU4 LEU G 1080 ? ALA G 1108 ? LEU G 1080 ALA G 1108 1 ? 29 
HELX_P HELX_P185 AU5 PRO G 1109 ? THR G 1116 ? PRO G 1109 THR G 1116 1 ? 8  
HELX_P HELX_P186 AU6 LEU G 1118 ? HIS G 1135 ? LEU G 1118 HIS G 1135 1 ? 18 
HELX_P HELX_P187 AU7 HIS G 1135 ? THR G 1161 ? HIS G 1135 THR G 1161 1 ? 27 
HELX_P HELX_P188 AU8 VAL G 1163 ? GLY G 1210 ? VAL G 1163 GLY G 1210 1 ? 48 
HELX_P HELX_P189 AU9 GLY G 1210 ? ARG G 1218 ? GLY G 1210 ARG G 1218 1 ? 9  
HELX_P HELX_P190 AV1 TYR G 1219 ? LEU G 1272 ? TYR G 1219 LEU G 1272 1 ? 54 
HELX_P HELX_P191 AV2 ALA G 1278 ? ALA G 1317 ? ALA G 1278 ALA G 1317 1 ? 40 
HELX_P HELX_P192 AV3 GLY G 1384 ? PHE G 1393 ? GLY G 1384 PHE G 1393 1 ? 10 
HELX_P HELX_P193 AV4 ALA G 1411 ? LEU G 1413 ? ALA G 1411 LEU G 1413 5 ? 3  
HELX_P HELX_P194 AV5 PRO G 1414 ? ARG G 1421 ? PRO G 1414 ARG G 1421 1 ? 8  
HELX_P HELX_P195 AV6 THR G 1435 ? LEU G 1440 ? THR G 1435 LEU G 1440 1 ? 6  
HELX_P HELX_P196 AV7 SER G 1447 ? ALA G 1458 ? SER G 1447 ALA G 1458 1 ? 12 
HELX_P HELX_P197 AV8 LEU G 1460 ? ALA G 1466 ? LEU G 1460 ALA G 1466 1 ? 7  
HELX_P HELX_P198 AV9 GLY G 1469 ? ALA G 1473 ? GLY G 1469 ALA G 1473 5 ? 5  
HELX_P HELX_P199 AW1 ILE G 1475 ? GLY G 1479 ? ILE G 1475 GLY G 1479 5 ? 5  
HELX_P HELX_P200 AW2 SER G 1483 ? LYS G 1499 ? SER G 1483 LYS G 1499 1 ? 17 
HELX_P HELX_P201 AW3 ASP G 1513 ? ALA G 1529 ? ASP G 1513 ALA G 1529 1 ? 17 
HELX_P HELX_P202 AW4 THR G 1542 ? ALA G 1546 ? THR G 1542 ALA G 1546 5 ? 5  
HELX_P HELX_P203 AW5 THR G 1565 ? LYS G 1570 ? THR G 1565 LYS G 1570 1 ? 6  
HELX_P HELX_P204 AW6 ASP G 1571 ? PHE G 1577 ? ASP G 1571 PHE G 1577 1 ? 7  
HELX_P HELX_P205 AW7 ALA H 13   ? ASP H 18   ? ALA H 13   ASP H 18   1 ? 6  
HELX_P HELX_P206 AW8 CYS H 26   ? LYS H 57   ? CYS H 26   LYS H 57   1 ? 32 
HELX_P HELX_P207 AW9 ILE H 60   ? THR H 64   ? ILE H 60   THR H 64   5 ? 5  
HELX_P HELX_P208 AX1 HIS H 71   ? GLY H 97   ? HIS H 71   GLY H 97   1 ? 27 
HELX_P HELX_P209 AX2 HIS H 103  ? LEU H 106  ? HIS H 103  LEU H 106  5 ? 4  
HELX_P HELX_P210 AX3 TYR H 107  ? SER H 130  ? TYR H 107  SER H 130  1 ? 24 
HELX_P HELX_P211 AX4 LEU H 136  ? HIS H 160  ? LEU H 136  HIS H 160  1 ? 25 
HELX_P HELX_P212 AX5 GLN H 166  ? ARG H 194  ? GLN H 166  ARG H 194  1 ? 29 
HELX_P HELX_P213 AX6 LYS H 205  ? GLN H 211  ? LYS H 205  GLN H 211  1 ? 7  
HELX_P HELX_P214 AX7 ASP H 212  ? GLY H 214  ? ASP H 212  GLY H 214  5 ? 3  
HELX_P HELX_P215 AX8 ASN H 223  ? TYR H 230  ? ASN H 223  TYR H 230  1 ? 8  
HELX_P HELX_P216 AX9 TYR H 230  ? LYS H 243  ? TYR H 230  LYS H 243  1 ? 14 
HELX_P HELX_P217 AY1 ARG H 258  ? ALA H 272  ? ARG H 258  ALA H 272  1 ? 15 
HELX_P HELX_P218 AY2 ALA H 286  ? LEU H 327  ? ALA H 286  LEU H 327  1 ? 42 
HELX_P HELX_P219 AY3 ALA H 355  ? HIS H 401  ? ALA H 355  HIS H 401  1 ? 47 
HELX_P HELX_P220 AY4 GLY H 415  ? LEU H 434  ? GLY H 415  LEU H 434  1 ? 20 
HELX_P HELX_P221 AY5 PRO H 436  ? GLY H 457  ? PRO H 436  GLY H 457  1 ? 22 
HELX_P HELX_P222 AY6 SER H 459  ? GLY H 505  ? SER H 459  GLY H 505  1 ? 47 
HELX_P HELX_P223 AY7 GLY H 505  ? ALA H 513  ? GLY H 505  ALA H 513  1 ? 9  
HELX_P HELX_P224 AY8 TRP H 514  ? PHE H 566  ? TRP H 514  PHE H 566  1 ? 53 
HELX_P HELX_P225 AY9 SER H 572  ? LEU H 586  ? SER H 572  LEU H 586  1 ? 15 
HELX_P HELX_P226 AZ1 VAL H 587  ? SER H 615  ? VAL H 587  SER H 615  1 ? 29 
HELX_P HELX_P227 AZ2 GLY H 718  ? LEU H 727  ? GLY H 718  LEU H 727  1 ? 10 
HELX_P HELX_P228 AZ3 VAL H 784  ? PHE H 790  ? VAL H 784  PHE H 790  1 ? 7  
HELX_P HELX_P229 AZ4 ASN H 795  ? CYS H 806  ? ASN H 795  CYS H 806  1 ? 12 
HELX_P HELX_P230 AZ5 LEU H 808  ? ILE H 814  ? LEU H 808  ILE H 814  1 ? 7  
HELX_P HELX_P231 AZ6 HIS H 817  ? GLN H 820  ? HIS H 817  GLN H 820  5 ? 4  
HELX_P HELX_P232 AZ7 SER H 831  ? GLN H 847  ? SER H 831  GLN H 847  1 ? 17 
HELX_P HELX_P233 AZ8 ASP H 861  ? LEU H 874  ? ASP H 861  LEU H 874  1 ? 14 
HELX_P HELX_P234 AZ9 TYR H 893  ? ALA H 897  ? TYR H 893  ALA H 897  5 ? 5  
HELX_P HELX_P235 BA1 THR H 913  ? SER H 920  ? THR H 913  SER H 920  1 ? 8  
HELX_P HELX_P236 BA2 CYS H 922  ? TRP H 928  ? CYS H 922  TRP H 928  1 ? 7  
HELX_P HELX_P237 BA3 CYS H 1001 ? GLY H 1009 ? CYS H 1001 GLY H 1009 1 ? 9  
HELX_P HELX_P238 BA4 GLY H 1009 ? ASP H 1039 ? GLY H 1009 ASP H 1039 1 ? 31 
HELX_P HELX_P239 BA5 ALA H 1065 ? LEU H 1078 ? ALA H 1065 LEU H 1078 1 ? 14 
HELX_P HELX_P240 BA6 LEU H 1080 ? ALA H 1108 ? LEU H 1080 ALA H 1108 1 ? 29 
HELX_P HELX_P241 BA7 PRO H 1109 ? THR H 1116 ? PRO H 1109 THR H 1116 1 ? 8  
HELX_P HELX_P242 BA8 LEU H 1118 ? HIS H 1135 ? LEU H 1118 HIS H 1135 1 ? 18 
HELX_P HELX_P243 BA9 HIS H 1135 ? THR H 1161 ? HIS H 1135 THR H 1161 1 ? 27 
HELX_P HELX_P244 BB1 VAL H 1163 ? GLY H 1210 ? VAL H 1163 GLY H 1210 1 ? 48 
HELX_P HELX_P245 BB2 GLY H 1210 ? ARG H 1218 ? GLY H 1210 ARG H 1218 1 ? 9  
HELX_P HELX_P246 BB3 TYR H 1219 ? LEU H 1272 ? TYR H 1219 LEU H 1272 1 ? 54 
HELX_P HELX_P247 BB4 ALA H 1278 ? ALA H 1317 ? ALA H 1278 ALA H 1317 1 ? 40 
HELX_P HELX_P248 BB5 GLY H 1384 ? PHE H 1393 ? GLY H 1384 PHE H 1393 1 ? 10 
HELX_P HELX_P249 BB6 ALA H 1411 ? LEU H 1413 ? ALA H 1411 LEU H 1413 5 ? 3  
HELX_P HELX_P250 BB7 PRO H 1414 ? ARG H 1421 ? PRO H 1414 ARG H 1421 1 ? 8  
HELX_P HELX_P251 BB8 THR H 1435 ? LEU H 1440 ? THR H 1435 LEU H 1440 1 ? 6  
HELX_P HELX_P252 BB9 SER H 1447 ? ALA H 1458 ? SER H 1447 ALA H 1458 1 ? 12 
HELX_P HELX_P253 BC1 LEU H 1460 ? ALA H 1466 ? LEU H 1460 ALA H 1466 1 ? 7  
HELX_P HELX_P254 BC2 GLY H 1469 ? ALA H 1473 ? GLY H 1469 ALA H 1473 5 ? 5  
HELX_P HELX_P255 BC3 ILE H 1475 ? GLY H 1479 ? ILE H 1475 GLY H 1479 5 ? 5  
HELX_P HELX_P256 BC4 SER H 1483 ? LYS H 1499 ? SER H 1483 LYS H 1499 1 ? 17 
HELX_P HELX_P257 BC5 ASP H 1513 ? ALA H 1529 ? ASP H 1513 ALA H 1529 1 ? 17 
HELX_P HELX_P258 BC6 THR H 1542 ? ALA H 1546 ? THR H 1542 ALA H 1546 5 ? 5  
HELX_P HELX_P259 BC7 THR H 1565 ? LYS H 1570 ? THR H 1565 LYS H 1570 1 ? 6  
HELX_P HELX_P260 BC8 ASP H 1571 ? PHE H 1577 ? ASP H 1571 PHE H 1577 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 110 SG ? ? ? 1_555 A CYS 142 SG ? ? A CYS 110 A CYS 142 1_555 ? ? ? ? ? ? ? 2.022 ? 
disulf2 disulf ? ? B CYS 110 SG ? ? ? 1_555 B CYS 142 SG ? ? B CYS 110 B CYS 142 1_555 ? ? ? ? ? ? ? 2.022 ? 
disulf3 disulf ? ? C CYS 110 SG ? ? ? 1_555 C CYS 142 SG ? ? C CYS 110 C CYS 142 1_555 ? ? ? ? ? ? ? 2.022 ? 
disulf4 disulf ? ? D CYS 110 SG ? ? ? 1_555 D CYS 142 SG ? ? D CYS 110 D CYS 142 1_555 ? ? ? ? ? ? ? 2.023 ? 
disulf5 disulf ? ? E CYS 6   SG ? ? ? 1_555 E CYS 26  SG ? ? E CYS 6   E CYS 26  1_555 ? ? ? ? ? ? ? 2.044 ? 
disulf6 disulf ? ? F CYS 6   SG ? ? ? 1_555 F CYS 26  SG ? ? F CYS 6   F CYS 26  1_555 ? ? ? ? ? ? ? 2.044 ? 
disulf7 disulf ? ? G CYS 6   SG ? ? ? 1_555 G CYS 26  SG ? ? G CYS 6   G CYS 26  1_555 ? ? ? ? ? ? ? 2.044 ? 
disulf8 disulf ? ? H CYS 6   SG ? ? ? 1_555 H CYS 26  SG ? ? H CYS 6   H CYS 26  1_555 ? ? ? ? ? ? ? 2.044 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 3 ? 
AA3 ? 4 ? 
AA4 ? 4 ? 
AA5 ? 2 ? 
AA6 ? 3 ? 
AA7 ? 3 ? 
AA8 ? 3 ? 
AA9 ? 4 ? 
AB1 ? 4 ? 
AB2 ? 2 ? 
AB3 ? 3 ? 
AB4 ? 3 ? 
AB5 ? 4 ? 
AB6 ? 4 ? 
AB7 ? 2 ? 
AB8 ? 3 ? 
AB9 ? 4 ? 
AC1 ? 4 ? 
AC2 ? 2 ? 
AC3 ? 3 ? 
AC4 ? 6 ? 
AC5 ? 2 ? 
AC6 ? 4 ? 
AC7 ? 5 ? 
AC8 ? 3 ? 
AC9 ? 6 ? 
AD1 ? 2 ? 
AD2 ? 4 ? 
AD3 ? 5 ? 
AD4 ? 3 ? 
AD5 ? 6 ? 
AD6 ? 2 ? 
AD7 ? 4 ? 
AD8 ? 5 ? 
AD9 ? 3 ? 
AE1 ? 6 ? 
AE2 ? 2 ? 
AE3 ? 4 ? 
AE4 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? parallel      
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? parallel      
AA7 1 2 ? parallel      
AA7 2 3 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AA9 3 4 ? parallel      
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB3 1 2 ? parallel      
AB3 2 3 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB5 3 4 ? parallel      
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? parallel      
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC1 3 4 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC4 1 2 ? parallel      
AC4 2 3 ? parallel      
AC4 3 4 ? parallel      
AC4 4 5 ? parallel      
AC4 5 6 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? anti-parallel 
AC7 1 2 ? parallel      
AC7 2 3 ? parallel      
AC7 3 4 ? parallel      
AC7 4 5 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC9 1 2 ? parallel      
AC9 2 3 ? parallel      
AC9 3 4 ? parallel      
AC9 4 5 ? parallel      
AC9 5 6 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD2 2 3 ? anti-parallel 
AD2 3 4 ? anti-parallel 
AD3 1 2 ? parallel      
AD3 2 3 ? parallel      
AD3 3 4 ? parallel      
AD3 4 5 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD4 2 3 ? anti-parallel 
AD5 1 2 ? parallel      
AD5 2 3 ? parallel      
AD5 3 4 ? parallel      
AD5 4 5 ? parallel      
AD5 5 6 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD7 2 3 ? anti-parallel 
AD7 3 4 ? anti-parallel 
AD8 1 2 ? parallel      
AD8 2 3 ? parallel      
AD8 3 4 ? parallel      
AD8 4 5 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AD9 2 3 ? anti-parallel 
AE1 1 2 ? parallel      
AE1 2 3 ? parallel      
AE1 3 4 ? parallel      
AE1 4 5 ? parallel      
AE1 5 6 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE3 2 3 ? anti-parallel 
AE3 3 4 ? anti-parallel 
AE4 1 2 ? parallel      
AE4 2 3 ? parallel      
AE4 3 4 ? parallel      
AE4 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 44   ? LYS A 47   ? VAL A 44   LYS A 47   
AA1 2 TYR B 326  ? ASP B 329  ? TYR B 326  ASP B 329  
AA1 3 VAL B 319  ? GLU B 321  ? VAL B 319  GLU B 321  
AA2 1 LEU A 181  ? PHE A 183  ? LEU A 181  PHE A 183  
AA2 2 ARG A 195  ? ASP A 204  ? ARG A 195  ASP A 204  
AA2 3 LEU A 255  ? VAL A 260  ? LEU A 255  VAL A 260  
AA3 1 LEU A 181  ? PHE A 183  ? LEU A 181  PHE A 183  
AA3 2 ARG A 195  ? ASP A 204  ? ARG A 195  ASP A 204  
AA3 3 ALA A 187  ? ARG A 192  ? ALA A 187  ARG A 192  
AA3 4 ILE A 309  ? TRP A 311  ? ILE A 309  TRP A 311  
AA4 1 VAL A 230  ? ILE A 238  ? VAL A 230  ILE A 238  
AA4 2 ILE A 210  ? THR A 224  ? ILE A 210  THR A 224  
AA4 3 GLU A 282  ? VAL A 291  ? GLU A 282  VAL A 291  
AA4 4 THR A 297  ? LEU A 305  ? THR A 297  LEU A 305  
AA5 1 GLN A 313  ? PHE A 315  ? GLN A 313  PHE A 315  
AA5 2 THR A 336  ? LYS A 338  ? THR A 336  LYS A 338  
AA6 1 VAL A 319  ? GLU A 321  ? VAL A 319  GLU A 321  
AA6 2 TYR A 326  ? ASP A 329  ? TYR A 326  ASP A 329  
AA6 3 VAL D 44   ? LYS D 47   ? VAL D 44   LYS D 47   
AA7 1 VAL B 44   ? LYS B 47   ? VAL B 44   LYS B 47   
AA7 2 TYR C 326  ? ASP C 329  ? TYR C 326  ASP C 329  
AA7 3 VAL C 319  ? GLU C 321  ? VAL C 319  GLU C 321  
AA8 1 LEU B 181  ? PHE B 183  ? LEU B 181  PHE B 183  
AA8 2 ARG B 195  ? ASP B 204  ? ARG B 195  ASP B 204  
AA8 3 LEU B 255  ? VAL B 260  ? LEU B 255  VAL B 260  
AA9 1 LEU B 181  ? PHE B 183  ? LEU B 181  PHE B 183  
AA9 2 ARG B 195  ? ASP B 204  ? ARG B 195  ASP B 204  
AA9 3 ALA B 187  ? ARG B 192  ? ALA B 187  ARG B 192  
AA9 4 ILE B 309  ? TRP B 311  ? ILE B 309  TRP B 311  
AB1 1 VAL B 230  ? ILE B 238  ? VAL B 230  ILE B 238  
AB1 2 ILE B 210  ? THR B 224  ? ILE B 210  THR B 224  
AB1 3 GLU B 282  ? VAL B 291  ? GLU B 282  VAL B 291  
AB1 4 THR B 297  ? LEU B 305  ? THR B 297  LEU B 305  
AB2 1 GLN B 313  ? PHE B 315  ? GLN B 313  PHE B 315  
AB2 2 THR B 336  ? LYS B 338  ? THR B 336  LYS B 338  
AB3 1 VAL C 44   ? LYS C 47   ? VAL C 44   LYS C 47   
AB3 2 TYR D 326  ? ASP D 329  ? TYR D 326  ASP D 329  
AB3 3 VAL D 319  ? GLU D 321  ? VAL D 319  GLU D 321  
AB4 1 LEU C 181  ? PHE C 183  ? LEU C 181  PHE C 183  
AB4 2 ARG C 195  ? ASP C 204  ? ARG C 195  ASP C 204  
AB4 3 LEU C 255  ? VAL C 260  ? LEU C 255  VAL C 260  
AB5 1 LEU C 181  ? PHE C 183  ? LEU C 181  PHE C 183  
AB5 2 ARG C 195  ? ASP C 204  ? ARG C 195  ASP C 204  
AB5 3 ALA C 187  ? ARG C 192  ? ALA C 187  ARG C 192  
AB5 4 ILE C 309  ? TRP C 311  ? ILE C 309  TRP C 311  
AB6 1 VAL C 230  ? ILE C 238  ? VAL C 230  ILE C 238  
AB6 2 ILE C 210  ? THR C 224  ? ILE C 210  THR C 224  
AB6 3 GLU C 282  ? VAL C 291  ? GLU C 282  VAL C 291  
AB6 4 THR C 297  ? LEU C 305  ? THR C 297  LEU C 305  
AB7 1 GLN C 313  ? PHE C 315  ? GLN C 313  PHE C 315  
AB7 2 THR C 336  ? LYS C 338  ? THR C 336  LYS C 338  
AB8 1 LEU D 181  ? PHE D 183  ? LEU D 181  PHE D 183  
AB8 2 ARG D 195  ? ASP D 204  ? ARG D 195  ASP D 204  
AB8 3 LEU D 255  ? VAL D 260  ? LEU D 255  VAL D 260  
AB9 1 LEU D 181  ? PHE D 183  ? LEU D 181  PHE D 183  
AB9 2 ARG D 195  ? ASP D 204  ? ARG D 195  ASP D 204  
AB9 3 ALA D 187  ? ARG D 192  ? ALA D 187  ARG D 192  
AB9 4 ILE D 309  ? TRP D 311  ? ILE D 309  TRP D 311  
AC1 1 VAL D 230  ? ILE D 238  ? VAL D 230  ILE D 238  
AC1 2 ILE D 210  ? THR D 224  ? ILE D 210  THR D 224  
AC1 3 GLU D 282  ? VAL D 291  ? GLU D 282  VAL D 291  
AC1 4 THR D 297  ? LEU D 305  ? THR D 297  LEU D 305  
AC2 1 GLN D 313  ? PHE D 315  ? GLN D 313  PHE D 315  
AC2 2 THR D 336  ? LYS D 338  ? THR D 336  LYS D 338  
AC3 1 LEU E 696  ? ILE E 703  ? LEU E 696  ILE E 703  
AC3 2 VAL E 679  ? PHE E 686  ? VAL E 679  PHE E 686  
AC3 3 ALA E 736  ? PHE E 738  ? ALA E 736  PHE E 738  
AC4 1 ALA E 771  ? ALA E 773  ? ALA E 771  ALA E 773  
AC4 2 VAL E 850  ? ASP E 854  ? VAL E 850  ASP E 854  
AC4 3 THR E 883  ? VAL E 887  ? THR E 883  VAL E 887  
AC4 4 LEU E 708  ? GLY E 713  ? LEU E 708  GLY E 713  
AC4 5 TRP E 899  ? LYS E 904  ? TRP E 899  LYS E 904  
AC4 6 THR E 907  ? GLY E 912  ? THR E 907  GLY E 912  
AC5 1 ALA E 782  ? THR E 783  ? ALA E 782  THR E 783  
AC5 2 GLN E 822  ? ILE E 823  ? GLN E 822  ILE E 823  
AC6 1 LEU E 1362 ? ILE E 1369 ? LEU E 1362 ILE E 1369 
AC6 2 ILE E 1345 ? VAL E 1352 ? ILE E 1345 VAL E 1352 
AC6 3 GLU E 1400 ? ILE E 1405 ? GLU E 1400 ILE E 1405 
AC6 4 ILE E 1408 ? ASP E 1409 ? ILE E 1408 ASP E 1409 
AC7 1 ILE E 1502 ? ASP E 1506 ? ILE E 1502 ASP E 1506 
AC7 2 THR E 1532 ? ILE E 1536 ? THR E 1532 ILE E 1536 
AC7 3 LYS E 1374 ? CYS E 1378 ? LYS E 1374 CYS E 1378 
AC7 4 LEU E 1548 ? LYS E 1553 ? LEU E 1548 LYS E 1553 
AC7 5 ALA E 1556 ? ASP E 1561 ? ALA E 1556 ASP E 1561 
AC8 1 LEU F 696  ? ILE F 703  ? LEU F 696  ILE F 703  
AC8 2 VAL F 679  ? PHE F 686  ? VAL F 679  PHE F 686  
AC8 3 ALA F 736  ? PHE F 738  ? ALA F 736  PHE F 738  
AC9 1 ALA F 771  ? ALA F 773  ? ALA F 771  ALA F 773  
AC9 2 VAL F 850  ? ASP F 854  ? VAL F 850  ASP F 854  
AC9 3 THR F 883  ? VAL F 887  ? THR F 883  VAL F 887  
AC9 4 LEU F 708  ? GLY F 713  ? LEU F 708  GLY F 713  
AC9 5 TRP F 899  ? LYS F 904  ? TRP F 899  LYS F 904  
AC9 6 THR F 907  ? GLY F 912  ? THR F 907  GLY F 912  
AD1 1 ALA F 782  ? THR F 783  ? ALA F 782  THR F 783  
AD1 2 GLN F 822  ? ILE F 823  ? GLN F 822  ILE F 823  
AD2 1 LEU F 1362 ? ILE F 1369 ? LEU F 1362 ILE F 1369 
AD2 2 ILE F 1345 ? VAL F 1352 ? ILE F 1345 VAL F 1352 
AD2 3 GLU F 1400 ? ILE F 1405 ? GLU F 1400 ILE F 1405 
AD2 4 ILE F 1408 ? ASP F 1409 ? ILE F 1408 ASP F 1409 
AD3 1 ILE F 1502 ? ASP F 1506 ? ILE F 1502 ASP F 1506 
AD3 2 THR F 1532 ? ILE F 1536 ? THR F 1532 ILE F 1536 
AD3 3 LYS F 1374 ? CYS F 1378 ? LYS F 1374 CYS F 1378 
AD3 4 LEU F 1548 ? LYS F 1553 ? LEU F 1548 LYS F 1553 
AD3 5 ALA F 1556 ? ASP F 1561 ? ALA F 1556 ASP F 1561 
AD4 1 LEU G 696  ? ILE G 703  ? LEU G 696  ILE G 703  
AD4 2 VAL G 679  ? PHE G 686  ? VAL G 679  PHE G 686  
AD4 3 ALA G 736  ? PHE G 738  ? ALA G 736  PHE G 738  
AD5 1 ALA G 771  ? ALA G 773  ? ALA G 771  ALA G 773  
AD5 2 VAL G 850  ? ASP G 854  ? VAL G 850  ASP G 854  
AD5 3 THR G 883  ? VAL G 887  ? THR G 883  VAL G 887  
AD5 4 LEU G 708  ? GLY G 713  ? LEU G 708  GLY G 713  
AD5 5 TRP G 899  ? LYS G 904  ? TRP G 899  LYS G 904  
AD5 6 THR G 907  ? GLY G 912  ? THR G 907  GLY G 912  
AD6 1 ALA G 782  ? THR G 783  ? ALA G 782  THR G 783  
AD6 2 GLN G 822  ? ILE G 823  ? GLN G 822  ILE G 823  
AD7 1 LEU G 1362 ? ILE G 1369 ? LEU G 1362 ILE G 1369 
AD7 2 ILE G 1345 ? VAL G 1352 ? ILE G 1345 VAL G 1352 
AD7 3 GLU G 1400 ? ILE G 1405 ? GLU G 1400 ILE G 1405 
AD7 4 ILE G 1408 ? ASP G 1409 ? ILE G 1408 ASP G 1409 
AD8 1 ILE G 1502 ? ASP G 1506 ? ILE G 1502 ASP G 1506 
AD8 2 THR G 1532 ? ILE G 1536 ? THR G 1532 ILE G 1536 
AD8 3 LYS G 1374 ? CYS G 1378 ? LYS G 1374 CYS G 1378 
AD8 4 LEU G 1548 ? LYS G 1553 ? LEU G 1548 LYS G 1553 
AD8 5 ALA G 1556 ? ASP G 1561 ? ALA G 1556 ASP G 1561 
AD9 1 LEU H 696  ? ILE H 703  ? LEU H 696  ILE H 703  
AD9 2 VAL H 679  ? PHE H 686  ? VAL H 679  PHE H 686  
AD9 3 ALA H 736  ? PHE H 738  ? ALA H 736  PHE H 738  
AE1 1 ALA H 771  ? ALA H 773  ? ALA H 771  ALA H 773  
AE1 2 VAL H 850  ? ASP H 854  ? VAL H 850  ASP H 854  
AE1 3 THR H 883  ? VAL H 887  ? THR H 883  VAL H 887  
AE1 4 LEU H 708  ? GLY H 713  ? LEU H 708  GLY H 713  
AE1 5 TRP H 899  ? LYS H 904  ? TRP H 899  LYS H 904  
AE1 6 THR H 907  ? GLY H 912  ? THR H 907  GLY H 912  
AE2 1 ALA H 782  ? THR H 783  ? ALA H 782  THR H 783  
AE2 2 GLN H 822  ? ILE H 823  ? GLN H 822  ILE H 823  
AE3 1 LEU H 1362 ? ILE H 1369 ? LEU H 1362 ILE H 1369 
AE3 2 ILE H 1345 ? VAL H 1352 ? ILE H 1345 VAL H 1352 
AE3 3 GLU H 1400 ? ILE H 1405 ? GLU H 1400 ILE H 1405 
AE3 4 ILE H 1408 ? ASP H 1409 ? ILE H 1408 ASP H 1409 
AE4 1 ILE H 1502 ? ASP H 1506 ? ILE H 1502 ASP H 1506 
AE4 2 THR H 1532 ? ILE H 1536 ? THR H 1532 ILE H 1536 
AE4 3 LYS H 1374 ? CYS H 1378 ? LYS H 1374 CYS H 1378 
AE4 4 LEU H 1548 ? LYS H 1553 ? LEU H 1548 LYS H 1553 
AE4 5 ALA H 1556 ? ASP H 1561 ? ALA H 1556 ASP H 1561 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LYS A 47   ? N LYS A 47   O VAL B 328  ? O VAL B 328  
AA1 2 3 O SER B 327  ? O SER B 327  N ALA B 320  ? N ALA B 320  
AA2 1 2 N ILE A 182  ? N ILE A 182  O GLY A 203  ? O GLY A 203  
AA2 2 3 N LEU A 200  ? N LEU A 200  O ILE A 257  ? O ILE A 257  
AA3 1 2 N ILE A 182  ? N ILE A 182  O GLY A 203  ? O GLY A 203  
AA3 2 3 O MET A 199  ? O MET A 199  N VAL A 188  ? N VAL A 188  
AA3 3 4 N ILE A 189  ? N ILE A 189  O LEU A 310  ? O LEU A 310  
AA4 1 2 O VAL A 231  ? O VAL A 231  N THR A 223  ? N THR A 223  
AA4 2 3 N GLN A 218  ? N GLN A 218  O ILE A 284  ? O ILE A 284  
AA4 3 4 N GLY A 289  ? N GLY A 289  O THR A 298  ? O THR A 298  
AA5 1 2 N ARG A 314  ? N ARG A 314  O VAL A 337  ? O VAL A 337  
AA6 1 2 N ALA A 320  ? N ALA A 320  O SER A 327  ? O SER A 327  
AA6 2 3 N VAL A 328  ? N VAL A 328  O LYS D 47   ? O LYS D 47   
AA7 1 2 N LYS B 47   ? N LYS B 47   O VAL C 328  ? O VAL C 328  
AA7 2 3 O SER C 327  ? O SER C 327  N ALA C 320  ? N ALA C 320  
AA8 1 2 N ILE B 182  ? N ILE B 182  O GLY B 203  ? O GLY B 203  
AA8 2 3 N LEU B 200  ? N LEU B 200  O ILE B 257  ? O ILE B 257  
AA9 1 2 N ILE B 182  ? N ILE B 182  O GLY B 203  ? O GLY B 203  
AA9 2 3 O MET B 199  ? O MET B 199  N VAL B 188  ? N VAL B 188  
AA9 3 4 N ILE B 189  ? N ILE B 189  O LEU B 310  ? O LEU B 310  
AB1 1 2 O VAL B 231  ? O VAL B 231  N THR B 223  ? N THR B 223  
AB1 2 3 N GLN B 218  ? N GLN B 218  O ILE B 284  ? O ILE B 284  
AB1 3 4 N GLY B 289  ? N GLY B 289  O THR B 298  ? O THR B 298  
AB2 1 2 N ARG B 314  ? N ARG B 314  O VAL B 337  ? O VAL B 337  
AB3 1 2 N LYS C 47   ? N LYS C 47   O VAL D 328  ? O VAL D 328  
AB3 2 3 O SER D 327  ? O SER D 327  N ALA D 320  ? N ALA D 320  
AB4 1 2 N ILE C 182  ? N ILE C 182  O GLY C 203  ? O GLY C 203  
AB4 2 3 N LEU C 200  ? N LEU C 200  O ILE C 257  ? O ILE C 257  
AB5 1 2 N ILE C 182  ? N ILE C 182  O GLY C 203  ? O GLY C 203  
AB5 2 3 O MET C 199  ? O MET C 199  N VAL C 188  ? N VAL C 188  
AB5 3 4 N ILE C 189  ? N ILE C 189  O LEU C 310  ? O LEU C 310  
AB6 1 2 O VAL C 231  ? O VAL C 231  N THR C 223  ? N THR C 223  
AB6 2 3 N GLN C 218  ? N GLN C 218  O ILE C 284  ? O ILE C 284  
AB6 3 4 N GLY C 289  ? N GLY C 289  O THR C 298  ? O THR C 298  
AB7 1 2 N ARG C 314  ? N ARG C 314  O VAL C 337  ? O VAL C 337  
AB8 1 2 N ILE D 182  ? N ILE D 182  O GLY D 203  ? O GLY D 203  
AB8 2 3 N LEU D 200  ? N LEU D 200  O ILE D 257  ? O ILE D 257  
AB9 1 2 N ILE D 182  ? N ILE D 182  O GLY D 203  ? O GLY D 203  
AB9 2 3 O MET D 199  ? O MET D 199  N VAL D 188  ? N VAL D 188  
AB9 3 4 N ILE D 189  ? N ILE D 189  O LEU D 310  ? O LEU D 310  
AC1 1 2 O VAL D 231  ? O VAL D 231  N THR D 223  ? N THR D 223  
AC1 2 3 N GLN D 218  ? N GLN D 218  O ILE D 284  ? O ILE D 284  
AC1 3 4 N GLY D 289  ? N GLY D 289  O THR D 298  ? O THR D 298  
AC2 1 2 N ARG D 314  ? N ARG D 314  O VAL D 337  ? O VAL D 337  
AC3 1 2 O ILE E 699  ? O ILE E 699  N GLY E 684  ? N GLY E 684  
AC3 2 3 N ILE E 682  ? N ILE E 682  O ALA E 736  ? O ALA E 736  
AC4 1 2 N ALA E 771  ? N ALA E 771  O VAL E 850  ? O VAL E 850  
AC4 2 3 N VAL E 851  ? N VAL E 851  O VAL E 885  ? O VAL E 885  
AC4 3 4 O LEU E 886  ? O LEU E 886  N THR E 709  ? N THR E 709  
AC4 4 5 N VAL E 712  ? N VAL E 712  O ILE E 901  ? O ILE E 901  
AC4 5 6 N ALA E 902  ? N ALA E 902  O GLN E 909  ? O GLN E 909  
AC5 1 2 N ALA E 782  ? N ALA E 782  O ILE E 823  ? O ILE E 823  
AC6 1 2 O ILE E 1369 ? O ILE E 1369 N ILE E 1345 ? N ILE E 1345 
AC6 2 3 N SER E 1351 ? N SER E 1351 O GLU E 1400 ? O GLU E 1400 
AC6 3 4 N ILE E 1405 ? N ILE E 1405 O ILE E 1408 ? O ILE E 1408 
AC7 1 2 N MET E 1505 ? N MET E 1505 O ILE E 1536 ? O ILE E 1536 
AC7 2 3 O THR E 1535 ? O THR E 1535 N ILE E 1375 ? N ILE E 1375 
AC7 3 4 N GLY E 1376 ? N GLY E 1376 O MET E 1550 ? O MET E 1550 
AC7 4 5 N LYS E 1553 ? N LYS E 1553 O ALA E 1556 ? O ALA E 1556 
AC8 1 2 O ILE F 699  ? O ILE F 699  N GLY F 684  ? N GLY F 684  
AC8 2 3 N ILE F 682  ? N ILE F 682  O ALA F 736  ? O ALA F 736  
AC9 1 2 N ALA F 771  ? N ALA F 771  O VAL F 850  ? O VAL F 850  
AC9 2 3 N VAL F 851  ? N VAL F 851  O VAL F 885  ? O VAL F 885  
AC9 3 4 O LEU F 886  ? O LEU F 886  N THR F 709  ? N THR F 709  
AC9 4 5 N VAL F 712  ? N VAL F 712  O ILE F 901  ? O ILE F 901  
AC9 5 6 N ALA F 902  ? N ALA F 902  O GLN F 909  ? O GLN F 909  
AD1 1 2 N ALA F 782  ? N ALA F 782  O ILE F 823  ? O ILE F 823  
AD2 1 2 O ILE F 1369 ? O ILE F 1369 N ILE F 1345 ? N ILE F 1345 
AD2 2 3 N SER F 1351 ? N SER F 1351 O GLU F 1400 ? O GLU F 1400 
AD2 3 4 N ILE F 1405 ? N ILE F 1405 O ILE F 1408 ? O ILE F 1408 
AD3 1 2 N MET F 1505 ? N MET F 1505 O ILE F 1536 ? O ILE F 1536 
AD3 2 3 O THR F 1535 ? O THR F 1535 N ILE F 1375 ? N ILE F 1375 
AD3 3 4 N GLY F 1376 ? N GLY F 1376 O MET F 1550 ? O MET F 1550 
AD3 4 5 N LYS F 1553 ? N LYS F 1553 O ALA F 1556 ? O ALA F 1556 
AD4 1 2 O ILE G 699  ? O ILE G 699  N GLY G 684  ? N GLY G 684  
AD4 2 3 N ILE G 682  ? N ILE G 682  O ALA G 736  ? O ALA G 736  
AD5 1 2 N ALA G 771  ? N ALA G 771  O VAL G 850  ? O VAL G 850  
AD5 2 3 N VAL G 851  ? N VAL G 851  O VAL G 885  ? O VAL G 885  
AD5 3 4 O LEU G 886  ? O LEU G 886  N THR G 709  ? N THR G 709  
AD5 4 5 N VAL G 712  ? N VAL G 712  O ILE G 901  ? O ILE G 901  
AD5 5 6 N ALA G 902  ? N ALA G 902  O GLN G 909  ? O GLN G 909  
AD6 1 2 N ALA G 782  ? N ALA G 782  O ILE G 823  ? O ILE G 823  
AD7 1 2 O ILE G 1369 ? O ILE G 1369 N ILE G 1345 ? N ILE G 1345 
AD7 2 3 N SER G 1351 ? N SER G 1351 O GLU G 1400 ? O GLU G 1400 
AD7 3 4 N ILE G 1405 ? N ILE G 1405 O ILE G 1408 ? O ILE G 1408 
AD8 1 2 N MET G 1505 ? N MET G 1505 O ILE G 1536 ? O ILE G 1536 
AD8 2 3 O THR G 1535 ? O THR G 1535 N ILE G 1375 ? N ILE G 1375 
AD8 3 4 N GLY G 1376 ? N GLY G 1376 O MET G 1550 ? O MET G 1550 
AD8 4 5 N LYS G 1553 ? N LYS G 1553 O ALA G 1556 ? O ALA G 1556 
AD9 1 2 O ILE H 699  ? O ILE H 699  N GLY H 684  ? N GLY H 684  
AD9 2 3 N ILE H 682  ? N ILE H 682  O ALA H 736  ? O ALA H 736  
AE1 1 2 N ALA H 771  ? N ALA H 771  O VAL H 850  ? O VAL H 850  
AE1 2 3 N VAL H 851  ? N VAL H 851  O VAL H 885  ? O VAL H 885  
AE1 3 4 O LEU H 886  ? O LEU H 886  N THR H 709  ? N THR H 709  
AE1 4 5 N VAL H 712  ? N VAL H 712  O ILE H 901  ? O ILE H 901  
AE1 5 6 N ALA H 902  ? N ALA H 902  O GLN H 909  ? O GLN H 909  
AE2 1 2 N ALA H 782  ? N ALA H 782  O ILE H 823  ? O ILE H 823  
AE3 1 2 O ILE H 1369 ? O ILE H 1369 N ILE H 1345 ? N ILE H 1345 
AE3 2 3 N SER H 1351 ? N SER H 1351 O GLU H 1400 ? O GLU H 1400 
AE3 3 4 N ILE H 1405 ? N ILE H 1405 O ILE H 1408 ? O ILE H 1408 
AE4 1 2 N MET H 1505 ? N MET H 1505 O ILE H 1536 ? O ILE H 1536 
AE4 2 3 O THR H 1535 ? O THR H 1535 N ILE H 1375 ? N ILE H 1375 
AE4 3 4 N GLY H 1376 ? N GLY H 1376 O MET H 1550 ? O MET H 1550 
AE4 4 5 N LYS H 1553 ? N LYS H 1553 O ALA H 1556 ? O ALA H 1556 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ATP 401  ? 12 'binding site for residue ATP A 401'  
AC2 Software B ATP 401  ? 12 'binding site for residue ATP B 401'  
AC3 Software C ATP 401  ? 12 'binding site for residue ATP C 401'  
AC4 Software D ATP 401  ? 12 'binding site for residue ATP D 401'  
AC5 Software E GBM 2001 ? 12 'binding site for residue GBM E 2001' 
AC6 Software F GBM 2001 ? 12 'binding site for residue GBM F 2001' 
AC7 Software G GBM 2001 ? 12 'binding site for residue GBM G 2001' 
AC8 Software H GBM 2001 ? 12 'binding site for residue GBM H 2001' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 ILE A 182  ? ILE A 182  . ? 1_555 ? 
2  AC1 12 PHE A 183  ? PHE A 183  . ? 1_555 ? 
3  AC1 12 SER A 184  ? SER A 184  . ? 1_555 ? 
4  AC1 12 LYS A 185  ? LYS A 185  . ? 1_555 ? 
5  AC1 12 LEU A 205  ? LEU A 205  . ? 1_555 ? 
6  AC1 12 TYR A 330  ? TYR A 330  . ? 1_555 ? 
7  AC1 12 SER A 331  ? SER A 331  . ? 1_555 ? 
8  AC1 12 PHE A 333  ? PHE A 333  . ? 1_555 ? 
9  AC1 12 GLY A 334  ? GLY A 334  . ? 1_555 ? 
10 AC1 12 ASN D 48   ? ASN D 48   . ? 1_555 ? 
11 AC1 12 ILE D 49   ? ILE D 49   . ? 1_555 ? 
12 AC1 12 ARG D 50   ? ARG D 50   . ? 1_555 ? 
13 AC2 12 ASN A 48   ? ASN A 48   . ? 1_555 ? 
14 AC2 12 ILE A 49   ? ILE A 49   . ? 1_555 ? 
15 AC2 12 ARG A 50   ? ARG A 50   . ? 1_555 ? 
16 AC2 12 ILE B 182  ? ILE B 182  . ? 1_555 ? 
17 AC2 12 PHE B 183  ? PHE B 183  . ? 1_555 ? 
18 AC2 12 SER B 184  ? SER B 184  . ? 1_555 ? 
19 AC2 12 LYS B 185  ? LYS B 185  . ? 1_555 ? 
20 AC2 12 LEU B 205  ? LEU B 205  . ? 1_555 ? 
21 AC2 12 TYR B 330  ? TYR B 330  . ? 1_555 ? 
22 AC2 12 SER B 331  ? SER B 331  . ? 1_555 ? 
23 AC2 12 PHE B 333  ? PHE B 333  . ? 1_555 ? 
24 AC2 12 GLY B 334  ? GLY B 334  . ? 1_555 ? 
25 AC3 12 ASN B 48   ? ASN B 48   . ? 1_555 ? 
26 AC3 12 ILE B 49   ? ILE B 49   . ? 1_555 ? 
27 AC3 12 ARG B 50   ? ARG B 50   . ? 1_555 ? 
28 AC3 12 ILE C 182  ? ILE C 182  . ? 1_555 ? 
29 AC3 12 PHE C 183  ? PHE C 183  . ? 1_555 ? 
30 AC3 12 SER C 184  ? SER C 184  . ? 1_555 ? 
31 AC3 12 LYS C 185  ? LYS C 185  . ? 1_555 ? 
32 AC3 12 LEU C 205  ? LEU C 205  . ? 1_555 ? 
33 AC3 12 TYR C 330  ? TYR C 330  . ? 1_555 ? 
34 AC3 12 SER C 331  ? SER C 331  . ? 1_555 ? 
35 AC3 12 PHE C 333  ? PHE C 333  . ? 1_555 ? 
36 AC3 12 GLY C 334  ? GLY C 334  . ? 1_555 ? 
37 AC4 12 ASN C 48   ? ASN C 48   . ? 1_555 ? 
38 AC4 12 ILE C 49   ? ILE C 49   . ? 1_555 ? 
39 AC4 12 ARG C 50   ? ARG C 50   . ? 1_555 ? 
40 AC4 12 ILE D 182  ? ILE D 182  . ? 1_555 ? 
41 AC4 12 PHE D 183  ? PHE D 183  . ? 1_555 ? 
42 AC4 12 SER D 184  ? SER D 184  . ? 1_555 ? 
43 AC4 12 LYS D 185  ? LYS D 185  . ? 1_555 ? 
44 AC4 12 LEU D 205  ? LEU D 205  . ? 1_555 ? 
45 AC4 12 TYR D 330  ? TYR D 330  . ? 1_555 ? 
46 AC4 12 SER D 331  ? SER D 331  . ? 1_555 ? 
47 AC4 12 PHE D 333  ? PHE D 333  . ? 1_555 ? 
48 AC4 12 GLY D 334  ? GLY D 334  . ? 1_555 ? 
49 AC5 12 ARG E 306  ? ARG E 306  . ? 1_555 ? 
50 AC5 12 TYR E 377  ? TYR E 377  . ? 1_555 ? 
51 AC5 12 PHE E 433  ? PHE E 433  . ? 1_555 ? 
52 AC5 12 LEU E 434  ? LEU E 434  . ? 1_555 ? 
53 AC5 12 ASN E 437  ? ASN E 437  . ? 1_555 ? 
54 AC5 12 MET E 441  ? MET E 441  . ? 1_555 ? 
55 AC5 12 THR E 588  ? THR E 588  . ? 1_555 ? 
56 AC5 12 LEU E 592  ? LEU E 592  . ? 1_555 ? 
57 AC5 12 SER E 1238 ? SER E 1238 . ? 1_555 ? 
58 AC5 12 THR E 1242 ? THR E 1242 . ? 1_555 ? 
59 AC5 12 ASN E 1245 ? ASN E 1245 . ? 1_555 ? 
60 AC5 12 ARG E 1246 ? ARG E 1246 . ? 1_555 ? 
61 AC6 12 ARG F 306  ? ARG F 306  . ? 1_555 ? 
62 AC6 12 TYR F 377  ? TYR F 377  . ? 1_555 ? 
63 AC6 12 PHE F 433  ? PHE F 433  . ? 1_555 ? 
64 AC6 12 LEU F 434  ? LEU F 434  . ? 1_555 ? 
65 AC6 12 ASN F 437  ? ASN F 437  . ? 1_555 ? 
66 AC6 12 MET F 441  ? MET F 441  . ? 1_555 ? 
67 AC6 12 THR F 588  ? THR F 588  . ? 1_555 ? 
68 AC6 12 LEU F 592  ? LEU F 592  . ? 1_555 ? 
69 AC6 12 SER F 1238 ? SER F 1238 . ? 1_555 ? 
70 AC6 12 THR F 1242 ? THR F 1242 . ? 1_555 ? 
71 AC6 12 ASN F 1245 ? ASN F 1245 . ? 1_555 ? 
72 AC6 12 ARG F 1246 ? ARG F 1246 . ? 1_555 ? 
73 AC7 12 ARG G 306  ? ARG G 306  . ? 1_555 ? 
74 AC7 12 TYR G 377  ? TYR G 377  . ? 1_555 ? 
75 AC7 12 PHE G 433  ? PHE G 433  . ? 1_555 ? 
76 AC7 12 LEU G 434  ? LEU G 434  . ? 1_555 ? 
77 AC7 12 ASN G 437  ? ASN G 437  . ? 1_555 ? 
78 AC7 12 MET G 441  ? MET G 441  . ? 1_555 ? 
79 AC7 12 THR G 588  ? THR G 588  . ? 1_555 ? 
80 AC7 12 LEU G 592  ? LEU G 592  . ? 1_555 ? 
81 AC7 12 SER G 1238 ? SER G 1238 . ? 1_555 ? 
82 AC7 12 THR G 1242 ? THR G 1242 . ? 1_555 ? 
83 AC7 12 ASN G 1245 ? ASN G 1245 . ? 1_555 ? 
84 AC7 12 ARG G 1246 ? ARG G 1246 . ? 1_555 ? 
85 AC8 12 ARG H 306  ? ARG H 306  . ? 1_555 ? 
86 AC8 12 TYR H 377  ? TYR H 377  . ? 1_555 ? 
87 AC8 12 PHE H 433  ? PHE H 433  . ? 1_555 ? 
88 AC8 12 LEU H 434  ? LEU H 434  . ? 1_555 ? 
89 AC8 12 ASN H 437  ? ASN H 437  . ? 1_555 ? 
90 AC8 12 MET H 441  ? MET H 441  . ? 1_555 ? 
91 AC8 12 THR H 588  ? THR H 588  . ? 1_555 ? 
92 AC8 12 LEU H 592  ? LEU H 592  . ? 1_555 ? 
93 AC8 12 SER H 1238 ? SER H 1238 . ? 1_555 ? 
94 AC8 12 THR H 1242 ? THR H 1242 . ? 1_555 ? 
95 AC8 12 ASN H 1245 ? ASN H 1245 . ? 1_555 ? 
96 AC8 12 ARG H 1246 ? ARG H 1246 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6BAA 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . ARG A 1 32   ? 163.991 122.936 103.128 1.00 0.00   ? 32   ARG A N     1 
ATOM   2     C  CA    . ARG A 1 32   ? 163.056 121.772 103.173 1.00 0.00   ? 32   ARG A CA    1 
ATOM   3     C  C     . ARG A 1 32   ? 162.168 121.847 104.412 1.00 0.00   ? 32   ARG A C     1 
ATOM   4     O  O     . ARG A 1 32   ? 161.718 120.827 104.929 1.00 0.00   ? 32   ARG A O     1 
ATOM   5     C  CB    . ARG A 1 32   ? 163.855 120.467 103.185 1.00 0.00   ? 32   ARG A CB    1 
ATOM   6     C  CG    . ARG A 1 32   ? 164.816 120.325 102.014 1.00 0.00   ? 32   ARG A CG    1 
ATOM   7     C  CD    . ARG A 1 32   ? 164.110 119.884 100.742 1.00 0.00   ? 32   ARG A CD    1 
ATOM   8     N  NE    . ARG A 1 32   ? 163.682 118.492 100.822 1.00 0.00   ? 32   ARG A NE    1 
ATOM   9     C  CZ    . ARG A 1 32   ? 163.283 117.768 99.779  1.00 0.00   ? 32   ARG A CZ    1 
ATOM   10    N  NH1   . ARG A 1 32   ? 163.252 118.303 98.568  1.00 0.00   ? 32   ARG A NH1   1 
ATOM   11    N  NH2   . ARG A 1 32   ? 162.927 116.500 99.955  1.00 0.00   ? 32   ARG A NH2   1 
ATOM   12    N  N     . ALA A 1 33   ? 161.929 123.071 104.883 1.00 0.00   ? 33   ALA A N     1 
ATOM   13    C  CA    . ALA A 1 33   ? 161.097 123.311 106.060 1.00 0.00   ? 33   ALA A CA    1 
ATOM   14    C  C     . ALA A 1 33   ? 159.617 123.118 105.732 1.00 0.00   ? 33   ALA A C     1 
ATOM   15    O  O     . ALA A 1 33   ? 159.133 123.598 104.707 1.00 0.00   ? 33   ALA A O     1 
ATOM   16    C  CB    . ALA A 1 33   ? 161.337 124.728 106.587 1.00 0.00   ? 33   ALA A CB    1 
ATOM   17    N  N     . ARG A 1 34   ? 158.900 122.415 106.603 1.00 0.00   ? 34   ARG A N     1 
ATOM   18    C  CA    . ARG A 1 34   ? 157.475 122.175 106.400 1.00 0.00   ? 34   ARG A CA    1 
ATOM   19    C  C     . ARG A 1 34   ? 156.633 123.331 106.933 1.00 0.00   ? 34   ARG A C     1 
ATOM   20    O  O     . ARG A 1 34   ? 156.949 123.915 107.972 1.00 0.00   ? 34   ARG A O     1 
ATOM   21    C  CB    . ARG A 1 34   ? 157.043 120.872 107.086 1.00 0.00   ? 34   ARG A CB    1 
ATOM   22    C  CG    . ARG A 1 34   ? 157.574 119.595 106.440 1.00 0.00   ? 34   ARG A CG    1 
ATOM   23    C  CD    . ARG A 1 34   ? 156.990 118.349 107.102 1.00 0.00   ? 34   ARG A CD    1 
ATOM   24    N  NE    . ARG A 1 34   ? 157.294 118.277 108.528 1.00 0.00   ? 34   ARG A NE    1 
ATOM   25    C  CZ    . ARG A 1 34   ? 156.949 117.264 109.319 1.00 0.00   ? 34   ARG A CZ    1 
ATOM   26    N  NH1   . ARG A 1 34   ? 156.281 116.231 108.829 1.00 0.00   ? 34   ARG A NH1   1 
ATOM   27    N  NH2   . ARG A 1 34   ? 157.276 117.288 110.605 1.00 0.00   ? 34   ARG A NH2   1 
ATOM   28    N  N     . PHE A 1 35   ? 155.564 123.664 106.215 1.00 0.00   ? 35   PHE A N     1 
ATOM   29    C  CA    . PHE A 1 35   ? 154.674 124.742 106.630 1.00 0.00   ? 35   PHE A CA    1 
ATOM   30    C  C     . PHE A 1 35   ? 153.975 124.326 107.913 1.00 0.00   ? 35   PHE A C     1 
ATOM   31    O  O     . PHE A 1 35   ? 153.943 125.071 108.892 1.00 0.00   ? 35   PHE A O     1 
ATOM   32    C  CB    . PHE A 1 35   ? 153.630 125.020 105.543 1.00 0.00   ? 35   PHE A CB    1 
ATOM   33    C  CG    . PHE A 1 35   ? 152.757 126.210 105.831 1.00 0.00   ? 35   PHE A CG    1 
ATOM   34    C  CD1   . PHE A 1 35   ? 153.317 127.464 106.051 1.00 0.00   ? 35   PHE A CD1   1 
ATOM   35    C  CD2   . PHE A 1 35   ? 151.372 126.086 105.858 1.00 0.00   ? 35   PHE A CD2   1 
ATOM   36    C  CE1   . PHE A 1 35   ? 152.517 128.574 106.300 1.00 0.00   ? 35   PHE A CE1   1 
ATOM   37    C  CE2   . PHE A 1 35   ? 150.558 127.192 106.106 1.00 0.00   ? 35   PHE A CE2   1 
ATOM   38    C  CZ    . PHE A 1 35   ? 151.131 128.441 106.326 1.00 0.00   ? 35   PHE A CZ    1 
ATOM   39    N  N     . VAL A 1 36   ? 153.411 123.122 107.888 1.00 0.00   ? 36   VAL A N     1 
ATOM   40    C  CA    . VAL A 1 36   ? 152.712 122.549 109.028 1.00 0.00   ? 36   VAL A CA    1 
ATOM   41    C  C     . VAL A 1 36   ? 153.167 121.096 109.152 1.00 0.00   ? 36   VAL A C     1 
ATOM   42    O  O     . VAL A 1 36   ? 153.480 120.450 108.152 1.00 0.00   ? 36   VAL A O     1 
ATOM   43    C  CB    . VAL A 1 36   ? 151.183 122.603 108.821 1.00 0.00   ? 36   VAL A CB    1 
ATOM   44    C  CG1   . VAL A 1 36   ? 150.724 124.051 108.753 1.00 0.00   ? 36   VAL A CG1   1 
ATOM   45    C  CG2   . VAL A 1 36   ? 150.806 121.888 107.548 1.00 0.00   ? 36   VAL A CG2   1 
ATOM   46    N  N     . SER A 1 37   ? 153.210 120.588 110.377 1.00 0.00   ? 37   SER A N     1 
ATOM   47    C  CA    . SER A 1 37   ? 153.650 119.218 110.625 1.00 0.00   ? 37   SER A CA    1 
ATOM   48    C  C     . SER A 1 37   ? 152.632 118.188 110.148 1.00 0.00   ? 37   SER A C     1 
ATOM   49    O  O     . SER A 1 37   ? 151.548 118.544 109.674 1.00 0.00   ? 37   SER A O     1 
ATOM   50    C  CB    . SER A 1 37   ? 153.921 119.027 112.118 1.00 0.00   ? 37   SER A CB    1 
ATOM   51    O  OG    . SER A 1 37   ? 154.272 117.687 112.416 1.00 0.00   ? 37   SER A OG    1 
ATOM   52    N  N     . LYS A 1 38   ? 152.989 116.911 110.266 1.00 0.00   ? 38   LYS A N     1 
ATOM   53    C  CA    . LYS A 1 38   ? 152.101 115.832 109.858 1.00 0.00   ? 38   LYS A CA    1 
ATOM   54    C  C     . LYS A 1 38   ? 150.852 115.919 110.731 1.00 0.00   ? 38   LYS A C     1 
ATOM   55    O  O     . LYS A 1 38   ? 149.755 115.545 110.315 1.00 0.00   ? 38   LYS A O     1 
ATOM   56    C  CB    . LYS A 1 38   ? 152.773 114.478 110.065 1.00 0.00   ? 38   LYS A CB    1 
ATOM   57    C  CG    . LYS A 1 38   ? 154.077 114.299 109.297 1.00 0.00   ? 38   LYS A CG    1 
ATOM   58    C  CD    . LYS A 1 38   ? 153.837 114.459 107.805 1.00 0.00   ? 38   LYS A CD    1 
ATOM   59    C  CE    . LYS A 1 38   ? 153.039 113.296 107.237 1.00 0.00   ? 38   LYS A CE    1 
ATOM   60    N  NZ    . LYS A 1 38   ? 152.950 113.373 105.752 1.00 0.00   ? 38   LYS A NZ    1 
ATOM   61    N  N     . LYS A 1 39   ? 151.038 116.428 111.943 1.00 0.00   ? 39   LYS A N     1 
ATOM   62    C  CA    . LYS A 1 39   ? 149.961 116.583 112.918 1.00 0.00   ? 39   LYS A CA    1 
ATOM   63    C  C     . LYS A 1 39   ? 149.526 118.045 113.006 1.00 0.00   ? 39   LYS A C     1 
ATOM   64    O  O     . LYS A 1 39   ? 149.137 118.519 114.076 1.00 0.00   ? 39   LYS A O     1 
ATOM   65    C  CB    . LYS A 1 39   ? 150.436 116.118 114.299 1.00 0.00   ? 39   LYS A CB    1 
ATOM   66    C  CG    . LYS A 1 39   ? 151.137 114.768 114.304 1.00 0.00   ? 39   LYS A CG    1 
ATOM   67    C  CD    . LYS A 1 39   ? 151.776 114.480 115.655 1.00 0.00   ? 39   LYS A CD    1 
ATOM   68    C  CE    . LYS A 1 39   ? 152.466 113.125 115.648 1.00 0.00   ? 39   LYS A CE    1 
ATOM   69    N  NZ    . LYS A 1 39   ? 153.102 112.803 116.957 1.00 0.00   ? 39   LYS A NZ    1 
ATOM   70    N  N     . GLY A 1 40   ? 149.610 118.761 111.890 1.00 0.00   ? 40   GLY A N     1 
ATOM   71    C  CA    . GLY A 1 40   ? 149.237 120.164 111.902 1.00 0.00   ? 40   GLY A CA    1 
ATOM   72    C  C     . GLY A 1 40   ? 150.265 120.886 112.744 1.00 0.00   ? 40   GLY A C     1 
ATOM   73    O  O     . GLY A 1 40   ? 151.453 120.858 112.420 1.00 0.00   ? 40   GLY A O     1 
ATOM   74    N  N     . ASN A 1 41   ? 149.825 121.526 113.824 1.00 0.00   ? 41   ASN A N     1 
ATOM   75    C  CA    . ASN A 1 41   ? 150.766 122.209 114.695 1.00 0.00   ? 41   ASN A CA    1 
ATOM   76    C  C     . ASN A 1 41   ? 151.667 123.076 113.834 1.00 0.00   ? 41   ASN A C     1 
ATOM   77    O  O     . ASN A 1 41   ? 152.883 122.887 113.800 1.00 0.00   ? 41   ASN A O     1 
ATOM   78    C  CB    . ASN A 1 41   ? 151.591 121.189 115.478 1.00 0.00   ? 41   ASN A CB    1 
ATOM   79    C  CG    . ASN A 1 41   ? 152.429 121.833 116.556 1.00 0.00   ? 41   ASN A CG    1 
ATOM   80    O  OD1   . ASN A 1 41   ? 151.946 122.676 117.311 1.00 0.00   ? 41   ASN A OD1   1 
ATOM   81    N  ND2   . ASN A 1 41   ? 153.695 121.432 116.640 1.00 0.00   ? 41   ASN A ND2   1 
ATOM   82    N  N     . CYS A 1 42   ? 151.057 124.026 113.133 1.00 0.00   ? 42   CYS A N     1 
ATOM   83    C  CA    . CYS A 1 42   ? 151.788 124.885 112.213 1.00 0.00   ? 42   CYS A CA    1 
ATOM   84    C  C     . CYS A 1 42   ? 153.050 125.457 112.836 1.00 0.00   ? 42   CYS A C     1 
ATOM   85    O  O     . CYS A 1 42   ? 153.043 126.009 113.933 1.00 0.00   ? 42   CYS A O     1 
ATOM   86    C  CB    . CYS A 1 42   ? 150.883 126.034 111.761 1.00 0.00   ? 42   CYS A CB    1 
ATOM   87    S  SG    . CYS A 1 42   ? 150.172 126.999 113.109 1.00 0.00   ? 42   CYS A SG    1 
ATOM   88    N  N     . ASN A 1 43   ? 154.142 125.291 112.094 1.00 0.00   ? 43   ASN A N     1 
ATOM   89    C  CA    . ASN A 1 43   ? 155.468 125.729 112.506 1.00 0.00   ? 43   ASN A CA    1 
ATOM   90    C  C     . ASN A 1 43   ? 155.942 126.979 111.767 1.00 0.00   ? 43   ASN A C     1 
ATOM   91    O  O     . ASN A 1 43   ? 156.682 126.896 110.786 1.00 0.00   ? 43   ASN A O     1 
ATOM   92    C  CB    . ASN A 1 43   ? 156.446 124.566 112.294 1.00 0.00   ? 43   ASN A CB    1 
ATOM   93    C  CG    . ASN A 1 43   ? 157.889 124.954 112.510 1.00 0.00   ? 43   ASN A CG    1 
ATOM   94    O  OD1   . ASN A 1 43   ? 158.213 125.704 113.429 1.00 0.00   ? 43   ASN A OD1   1 
ATOM   95    N  ND2   . ASN A 1 43   ? 158.775 124.423 111.673 1.00 0.00   ? 43   ASN A ND2   1 
ATOM   96    N  N     . VAL A 1 44   ? 155.503 128.138 112.256 1.00 0.00   ? 44   VAL A N     1 
ATOM   97    C  CA    . VAL A 1 44   ? 155.866 129.426 111.666 1.00 0.00   ? 44   VAL A CA    1 
ATOM   98    C  C     . VAL A 1 44   ? 156.262 130.450 112.729 1.00 0.00   ? 44   VAL A C     1 
ATOM   99    O  O     . VAL A 1 44   ? 155.526 130.669 113.694 1.00 0.00   ? 44   VAL A O     1 
ATOM   100   C  CB    . VAL A 1 44   ? 154.703 130.026 110.850 1.00 0.00   ? 44   VAL A CB    1 
ATOM   101   C  CG1   . VAL A 1 44   ? 155.081 131.416 110.348 1.00 0.00   ? 44   VAL A CG1   1 
ATOM   102   C  CG2   . VAL A 1 44   ? 154.368 129.121 109.682 1.00 0.00   ? 44   VAL A CG2   1 
ATOM   103   N  N     . ALA A 1 45   ? 157.416 131.074 112.547 1.00 0.00   ? 45   ALA A N     1 
ATOM   104   C  CA    . ALA A 1 45   ? 157.885 132.092 113.481 1.00 0.00   ? 45   ALA A CA    1 
ATOM   105   C  C     . ALA A 1 45   ? 157.289 133.432 113.043 1.00 0.00   ? 45   ALA A C     1 
ATOM   106   O  O     . ALA A 1 45   ? 157.001 133.632 111.863 1.00 0.00   ? 45   ALA A O     1 
ATOM   107   C  CB    . ALA A 1 45   ? 159.411 132.155 113.472 1.00 0.00   ? 45   ALA A CB    1 
ATOM   108   N  N     . HIS A 1 46   ? 157.108 134.352 113.989 1.00 0.00   ? 46   HIS A N     1 
ATOM   109   C  CA    . HIS A 1 46   ? 156.520 135.665 113.695 1.00 0.00   ? 46   HIS A CA    1 
ATOM   110   C  C     . HIS A 1 46   ? 157.411 136.805 114.198 1.00 0.00   ? 46   HIS A C     1 
ATOM   111   O  O     . HIS A 1 46   ? 157.353 137.179 115.370 1.00 0.00   ? 46   HIS A O     1 
ATOM   112   C  CB    . HIS A 1 46   ? 155.148 135.754 114.359 1.00 0.00   ? 46   HIS A CB    1 
ATOM   113   C  CG    . HIS A 1 46   ? 154.201 134.663 113.940 1.00 0.00   ? 46   HIS A CG    1 
ATOM   114   N  ND1   . HIS A 1 46   ? 153.362 134.773 112.853 1.00 0.00   ? 46   HIS A ND1   1 
ATOM   115   C  CD2   . HIS A 1 46   ? 153.972 133.436 114.464 1.00 0.00   ? 46   HIS A CD2   1 
ATOM   116   C  CE1   . HIS A 1 46   ? 152.654 133.665 112.728 1.00 0.00   ? 46   HIS A CE1   1 
ATOM   117   N  NE2   . HIS A 1 46   ? 153.003 132.837 113.694 1.00 0.00   ? 46   HIS A NE2   1 
ATOM   118   N  N     . LYS A 1 47   ? 158.220 137.370 113.307 1.00 0.00   ? 47   LYS A N     1 
ATOM   119   C  CA    . LYS A 1 47   ? 159.151 138.434 113.683 1.00 0.00   ? 47   LYS A CA    1 
ATOM   120   C  C     . LYS A 1 47   ? 158.651 139.880 113.672 1.00 0.00   ? 47   LYS A C     1 
ATOM   121   O  O     . LYS A 1 47   ? 157.835 140.274 112.835 1.00 0.00   ? 47   LYS A O     1 
ATOM   122   C  CB    . LYS A 1 47   ? 160.436 138.308 112.847 1.00 0.00   ? 47   LYS A CB    1 
ATOM   123   C  CG    . LYS A 1 47   ? 161.123 136.954 113.055 1.00 0.00   ? 47   LYS A CG    1 
ATOM   124   C  CD    . LYS A 1 47   ? 162.550 136.879 112.514 1.00 0.00   ? 47   LYS A CD    1 
ATOM   125   C  CE    . LYS A 1 47   ? 163.212 135.572 112.944 1.00 0.00   ? 47   LYS A CE    1 
ATOM   126   N  NZ    . LYS A 1 47   ? 164.604 135.400 112.436 1.00 0.00   ? 47   LYS A NZ    1 
ATOM   127   N  N     . ASN A 1 48   ? 159.181 140.658 114.618 1.00 0.00   ? 48   ASN A N     1 
ATOM   128   C  CA    . ASN A 1 48   ? 158.851 142.068 114.814 1.00 0.00   ? 48   ASN A CA    1 
ATOM   129   C  C     . ASN A 1 48   ? 157.408 142.332 115.168 1.00 0.00   ? 48   ASN A C     1 
ATOM   130   O  O     . ASN A 1 48   ? 156.797 143.244 114.613 1.00 0.00   ? 48   ASN A O     1 
ATOM   131   C  CB    . ASN A 1 48   ? 159.158 142.886 113.565 1.00 0.00   ? 48   ASN A CB    1 
ATOM   132   C  CG    . ASN A 1 48   ? 160.543 142.676 113.066 1.00 0.00   ? 48   ASN A CG    1 
ATOM   133   O  OD1   . ASN A 1 48   ? 161.509 143.243 113.581 1.00 0.00   ? 48   ASN A OD1   1 
ATOM   134   N  ND2   . ASN A 1 48   ? 160.662 141.839 112.051 1.00 0.00   ? 48   ASN A ND2   1 
ATOM   135   N  N     . ILE A 1 49   ? 156.813 141.543 116.042 1.00 0.00   ? 49   ILE A N     1 
ATOM   136   C  CA    . ILE A 1 49   ? 155.442 141.861 116.346 1.00 0.00   ? 49   ILE A CA    1 
ATOM   137   C  C     . ILE A 1 49   ? 155.497 143.180 117.085 1.00 0.00   ? 49   ILE A C     1 
ATOM   138   O  O     . ILE A 1 49   ? 156.237 143.319 118.053 1.00 0.00   ? 49   ILE A O     1 
ATOM   139   C  CB    . ILE A 1 49   ? 154.801 140.800 117.237 1.00 0.00   ? 49   ILE A CB    1 
ATOM   140   C  CG1   . ILE A 1 49   ? 154.883 139.435 116.566 1.00 0.00   ? 49   ILE A CG1   1 
ATOM   141   C  CG2   . ILE A 1 49   ? 153.353 141.153 117.510 1.00 0.00   ? 49   ILE A CG2   1 
ATOM   142   C  CD1   . ILE A 1 49   ? 154.275 138.326 117.394 1.00 0.00   ? 49   ILE A CD1   1 
ATOM   143   N  N     . ARG A 1 50   ? 154.720 144.152 116.632 1.00 0.00   ? 50   ARG A N     1 
ATOM   144   C  CA    . ARG A 1 50   ? 154.681 145.441 117.300 1.00 0.00   ? 50   ARG A CA    1 
ATOM   145   C  C     . ARG A 1 50   ? 153.648 145.287 118.388 1.00 0.00   ? 50   ARG A C     1 
ATOM   146   O  O     . ARG A 1 50   ? 152.552 145.830 118.298 1.00 0.00   ? 50   ARG A O     1 
ATOM   147   C  CB    . ARG A 1 50   ? 154.256 146.537 116.329 1.00 0.00   ? 50   ARG A CB    1 
ATOM   148   C  CG    . ARG A 1 50   ? 155.400 147.276 115.662 1.00 0.00   ? 50   ARG A CG    1 
ATOM   149   C  CD    . ARG A 1 50   ? 154.856 148.427 114.836 1.00 0.00   ? 50   ARG A CD    1 
ATOM   150   N  NE    . ARG A 1 50   ? 153.707 149.042 115.492 1.00 0.00   ? 50   ARG A NE    1 
ATOM   151   C  CZ    . ARG A 1 50   ? 152.945 149.981 114.945 1.00 0.00   ? 50   ARG A CZ    1 
ATOM   152   N  NH1   . ARG A 1 50   ? 153.209 150.428 113.723 1.00 0.00   ? 50   ARG A NH1   1 
ATOM   153   N  NH2   . ARG A 1 50   ? 151.918 150.476 115.620 1.00 0.00   ? 50   ARG A NH2   1 
ATOM   154   N  N     . GLU A 1 51   ? 153.982 144.554 119.443 1.00 0.00   ? 51   GLU A N     1 
ATOM   155   C  CA    . GLU A 1 51   ? 152.987 144.319 120.480 1.00 0.00   ? 51   GLU A CA    1 
ATOM   156   C  C     . GLU A 1 51   ? 152.504 145.617 121.099 1.00 0.00   ? 51   GLU A C     1 
ATOM   157   O  O     . GLU A 1 51   ? 153.294 146.463 121.506 1.00 0.00   ? 51   GLU A O     1 
ATOM   158   C  CB    . GLU A 1 51   ? 153.559 143.412 121.573 1.00 0.00   ? 51   GLU A CB    1 
ATOM   159   C  CG    . GLU A 1 51   ? 153.842 141.989 121.112 1.00 0.00   ? 51   GLU A CG    1 
ATOM   160   C  CD    . GLU A 1 51   ? 154.473 141.133 122.193 1.00 0.00   ? 51   GLU A CD    1 
ATOM   161   O  OE1   . GLU A 1 51   ? 154.867 141.691 123.238 1.00 0.00   ? 51   GLU A OE1   1 
ATOM   162   O  OE2   . GLU A 1 51   ? 154.582 139.902 121.993 1.00 0.00   ? 51   GLU A OE2   1 
ATOM   163   N  N     . GLN A 1 52   ? 151.183 145.754 121.163 1.00 0.00   ? 52   GLN A N     1 
ATOM   164   C  CA    . GLN A 1 52   ? 150.549 146.917 121.754 1.00 0.00   ? 52   GLN A CA    1 
ATOM   165   C  C     . GLN A 1 52   ? 150.002 146.544 123.117 1.00 0.00   ? 52   GLN A C     1 
ATOM   166   O  O     . GLN A 1 52   ? 149.368 147.357 123.786 1.00 0.00   ? 52   GLN A O     1 
ATOM   167   C  CB    . GLN A 1 52   ? 149.421 147.430 120.860 1.00 0.00   ? 52   GLN A CB    1 
ATOM   168   C  CG    . GLN A 1 52   ? 149.835 147.696 119.424 1.00 0.00   ? 52   GLN A CG    1 
ATOM   169   C  CD    . GLN A 1 52   ? 150.986 148.674 119.319 1.00 0.00   ? 52   GLN A CD    1 
ATOM   170   O  OE1   . GLN A 1 52   ? 151.659 148.964 120.308 1.00 0.00   ? 52   GLN A OE1   1 
ATOM   171   N  NE2   . GLN A 1 52   ? 151.222 149.188 118.117 1.00 0.00   ? 52   GLN A NE2   1 
ATOM   172   N  N     . GLY A 1 53   ? 150.242 145.302 123.525 1.00 0.00   ? 53   GLY A N     1 
ATOM   173   C  CA    . GLY A 1 53   ? 149.750 144.835 124.809 1.00 0.00   ? 53   GLY A CA    1 
ATOM   174   C  C     . GLY A 1 53   ? 148.446 144.070 124.674 1.00 0.00   ? 53   GLY A C     1 
ATOM   175   O  O     . GLY A 1 53   ? 147.910 143.556 125.656 1.00 0.00   ? 53   GLY A O     1 
ATOM   176   N  N     . ARG A 1 54   ? 147.934 144.005 123.449 1.00 0.00   ? 54   ARG A N     1 
ATOM   177   C  CA    . ARG A 1 54   ? 146.690 143.305 123.163 1.00 0.00   ? 54   ARG A CA    1 
ATOM   178   C  C     . ARG A 1 54   ? 146.846 141.824 123.489 1.00 0.00   ? 54   ARG A C     1 
ATOM   179   O  O     . ARG A 1 54   ? 145.864 141.105 123.664 1.00 0.00   ? 54   ARG A O     1 
ATOM   180   C  CB    . ARG A 1 54   ? 146.322 143.483 121.687 1.00 0.00   ? 54   ARG A CB    1 
ATOM   181   C  CG    . ARG A 1 54   ? 145.914 144.903 121.333 1.00 0.00   ? 54   ARG A CG    1 
ATOM   182   C  CD    . ARG A 1 54   ? 145.259 144.983 119.965 1.00 0.00   ? 54   ARG A CD    1 
ATOM   183   N  NE    . ARG A 1 54   ? 146.169 144.587 118.889 1.00 0.00   ? 54   ARG A NE    1 
ATOM   184   C  CZ    . ARG A 1 54   ? 147.023 145.416 118.295 1.00 0.00   ? 54   ARG A CZ    1 
ATOM   185   N  NH1   . ARG A 1 54   ? 147.082 146.686 118.670 1.00 0.00   ? 54   ARG A NH1   1 
ATOM   186   N  NH2   . ARG A 1 54   ? 147.815 144.977 117.324 1.00 0.00   ? 54   ARG A NH2   1 
ATOM   187   N  N     . PHE A 1 55   ? 148.097 141.377 123.561 1.00 0.00   ? 55   PHE A N     1 
ATOM   188   C  CA    . PHE A 1 55   ? 148.402 139.990 123.864 1.00 0.00   ? 55   PHE A CA    1 
ATOM   189   C  C     . PHE A 1 55   ? 147.866 139.614 125.241 1.00 0.00   ? 55   PHE A C     1 
ATOM   190   O  O     . PHE A 1 55   ? 147.339 138.516 125.437 1.00 0.00   ? 55   PHE A O     1 
ATOM   191   C  CB    . PHE A 1 55   ? 149.914 139.762 123.839 1.00 0.00   ? 55   PHE A CB    1 
ATOM   192   C  CG    . PHE A 1 55   ? 150.311 138.336 124.082 1.00 0.00   ? 55   PHE A CG    1 
ATOM   193   C  CD1   . PHE A 1 55   ? 150.148 137.379 123.092 1.00 0.00   ? 55   PHE A CD1   1 
ATOM   194   C  CD2   . PHE A 1 55   ? 150.829 137.944 125.313 1.00 0.00   ? 55   PHE A CD2   1 
ATOM   195   C  CE1   . PHE A 1 55   ? 150.488 136.053 123.315 1.00 0.00   ? 55   PHE A CE1   1 
ATOM   196   C  CE2   . PHE A 1 55   ? 151.174 136.615 125.552 1.00 0.00   ? 55   PHE A CE2   1 
ATOM   197   C  CZ    . PHE A 1 55   ? 151.002 135.667 124.550 1.00 0.00   ? 55   PHE A CZ    1 
ATOM   198   N  N     . LEU A 1 56   ? 148.006 140.529 126.192 1.00 0.00   ? 56   LEU A N     1 
ATOM   199   C  CA    . LEU A 1 56   ? 147.547 140.288 127.550 1.00 0.00   ? 56   LEU A CA    1 
ATOM   200   C  C     . LEU A 1 56   ? 146.150 140.831 127.835 1.00 0.00   ? 56   LEU A C     1 
ATOM   201   O  O     . LEU A 1 56   ? 145.493 140.378 128.773 1.00 0.00   ? 56   LEU A O     1 
ATOM   202   C  CB    . LEU A 1 56   ? 148.547 140.869 128.554 1.00 0.00   ? 56   LEU A CB    1 
ATOM   203   C  CG    . LEU A 1 56   ? 149.923 140.202 128.556 1.00 0.00   ? 56   LEU A CG    1 
ATOM   204   C  CD1   . LEU A 1 56   ? 150.797 140.847 129.619 1.00 0.00   ? 56   LEU A CD1   1 
ATOM   205   C  CD2   . LEU A 1 56   ? 149.776 138.710 128.819 1.00 0.00   ? 56   LEU A CD2   1 
ATOM   206   N  N     . GLN A 1 57   ? 145.696 141.791 127.037 1.00 0.00   ? 57   GLN A N     1 
ATOM   207   C  CA    . GLN A 1 57   ? 144.361 142.355 127.233 1.00 0.00   ? 57   GLN A CA    1 
ATOM   208   C  C     . GLN A 1 57   ? 143.362 141.218 127.111 1.00 0.00   ? 57   GLN A C     1 
ATOM   209   O  O     . GLN A 1 57   ? 142.376 141.152 127.842 1.00 0.00   ? 57   GLN A O     1 
ATOM   210   C  CB    . GLN A 1 57   ? 144.044 143.413 126.173 1.00 0.00   ? 57   GLN A CB    1 
ATOM   211   C  CG    . GLN A 1 57   ? 144.990 144.585 126.176 1.00 0.00   ? 57   GLN A CG    1 
ATOM   212   C  CD    . GLN A 1 57   ? 144.459 145.759 125.379 1.00 0.00   ? 57   GLN A CD    1 
ATOM   213   O  OE1   . GLN A 1 57   ? 144.347 145.695 124.154 1.00 0.00   ? 57   GLN A OE1   1 
ATOM   214   N  NE2   . GLN A 1 57   ? 144.123 146.841 126.073 1.00 0.00   ? 57   GLN A NE2   1 
ATOM   215   N  N     . ASP A 1 58   ? 143.641 140.330 126.161 1.00 0.00   ? 58   ASP A N     1 
ATOM   216   C  CA    . ASP A 1 58   ? 142.812 139.158 125.913 1.00 0.00   ? 58   ASP A CA    1 
ATOM   217   C  C     . ASP A 1 58   ? 143.218 138.141 126.971 1.00 0.00   ? 58   ASP A C     1 
ATOM   218   O  O     . ASP A 1 58   ? 143.826 137.110 126.679 1.00 0.00   ? 58   ASP A O     1 
ATOM   219   C  CB    . ASP A 1 58   ? 143.091 138.618 124.507 1.00 0.00   ? 58   ASP A CB    1 
ATOM   220   C  CG    . ASP A 1 58   ? 142.194 137.454 124.136 1.00 0.00   ? 58   ASP A CG    1 
ATOM   221   O  OD1   . ASP A 1 58   ? 141.339 137.065 124.959 1.00 0.00   ? 58   ASP A OD1   1 
ATOM   222   O  OD2   . ASP A 1 58   ? 142.342 136.937 123.005 1.00 0.00   ? 58   ASP A OD2   1 
ATOM   223   N  N     . VAL A 1 59   ? 142.873 138.459 128.211 1.00 0.00   ? 59   VAL A N     1 
ATOM   224   C  CA    . VAL A 1 59   ? 143.195 137.625 129.357 1.00 0.00   ? 59   VAL A CA    1 
ATOM   225   C  C     . VAL A 1 59   ? 142.522 136.257 129.329 1.00 0.00   ? 59   VAL A C     1 
ATOM   226   O  O     . VAL A 1 59   ? 143.163 135.240 129.593 1.00 0.00   ? 59   VAL A O     1 
ATOM   227   C  CB    . VAL A 1 59   ? 142.780 138.326 130.669 1.00 0.00   ? 59   VAL A CB    1 
ATOM   228   C  CG1   . VAL A 1 59   ? 142.935 137.382 131.848 1.00 0.00   ? 59   VAL A CG1   1 
ATOM   229   C  CG2   . VAL A 1 59   ? 143.621 139.575 130.871 1.00 0.00   ? 59   VAL A CG2   1 
ATOM   230   N  N     . PHE A 1 60   ? 141.235 136.237 129.005 1.00 0.00   ? 60   PHE A N     1 
ATOM   231   C  CA    . PHE A 1 60   ? 140.473 134.999 129.000 1.00 0.00   ? 60   PHE A CA    1 
ATOM   232   C  C     . PHE A 1 60   ? 140.733 133.992 127.875 1.00 0.00   ? 60   PHE A C     1 
ATOM   233   O  O     . PHE A 1 60   ? 140.591 132.791 128.086 1.00 0.00   ? 60   PHE A O     1 
ATOM   234   C  CB    . PHE A 1 60   ? 138.983 135.330 129.110 1.00 0.00   ? 60   PHE A CB    1 
ATOM   235   C  CG    . PHE A 1 60   ? 138.652 136.189 130.304 1.00 0.00   ? 60   PHE A CG    1 
ATOM   236   C  CD1   . PHE A 1 60   ? 138.468 137.563 130.166 1.00 0.00   ? 60   PHE A CD1   1 
ATOM   237   C  CD2   . PHE A 1 60   ? 138.567 135.631 131.579 1.00 0.00   ? 60   PHE A CD2   1 
ATOM   238   C  CE1   . PHE A 1 60   ? 138.209 138.368 131.275 1.00 0.00   ? 60   PHE A CE1   1 
ATOM   239   C  CE2   . PHE A 1 60   ? 138.307 136.431 132.694 1.00 0.00   ? 60   PHE A CE2   1 
ATOM   240   C  CZ    . PHE A 1 60   ? 138.127 137.799 132.543 1.00 0.00   ? 60   PHE A CZ    1 
ATOM   241   N  N     . THR A 1 61   ? 141.110 134.461 126.690 1.00 0.00   ? 61   THR A N     1 
ATOM   242   C  CA    . THR A 1 61   ? 141.407 133.519 125.618 1.00 0.00   ? 61   THR A CA    1 
ATOM   243   C  C     . THR A 1 61   ? 142.727 132.876 126.018 1.00 0.00   ? 61   THR A C     1 
ATOM   244   O  O     . THR A 1 61   ? 142.973 131.691 125.770 1.00 0.00   ? 61   THR A O     1 
ATOM   245   C  CB    . THR A 1 61   ? 141.607 134.226 124.273 1.00 0.00   ? 61   THR A CB    1 
ATOM   246   O  OG1   . THR A 1 61   ? 140.403 134.900 123.907 1.00 0.00   ? 61   THR A OG1   1 
ATOM   247   C  CG2   . THR A 1 61   ? 141.976 133.224 123.195 1.00 0.00   ? 61   THR A CG2   1 
ATOM   248   N  N     . THR A 1 62   ? 143.564 133.690 126.648 1.00 0.00   ? 62   THR A N     1 
ATOM   249   C  CA    . THR A 1 62   ? 144.877 133.284 127.121 1.00 0.00   ? 62   THR A CA    1 
ATOM   250   C  C     . THR A 1 62   ? 144.760 132.256 128.238 1.00 0.00   ? 62   THR A C     1 
ATOM   251   O  O     . THR A 1 62   ? 145.425 131.220 128.214 1.00 0.00   ? 62   THR A O     1 
ATOM   252   C  CB    . THR A 1 62   ? 145.659 134.498 127.650 1.00 0.00   ? 62   THR A CB    1 
ATOM   253   O  OG1   . THR A 1 62   ? 145.913 135.407 126.571 1.00 0.00   ? 62   THR A OG1   1 
ATOM   254   C  CG2   . THR A 1 62   ? 146.978 134.064 128.264 1.00 0.00   ? 62   THR A CG2   1 
ATOM   255   N  N     . LEU A 1 63   ? 143.906 132.546 129.217 1.00 0.00   ? 63   LEU A N     1 
ATOM   256   C  CA    . LEU A 1 63   ? 143.712 131.635 130.337 1.00 0.00   ? 63   LEU A CA    1 
ATOM   257   C  C     . LEU A 1 63   ? 143.232 130.282 129.838 1.00 0.00   ? 63   LEU A C     1 
ATOM   258   O  O     . LEU A 1 63   ? 143.723 129.241 130.277 1.00 0.00   ? 63   LEU A O     1 
ATOM   259   C  CB    . LEU A 1 63   ? 142.696 132.208 131.326 1.00 0.00   ? 63   LEU A CB    1 
ATOM   260   C  CG    . LEU A 1 63   ? 143.184 133.317 132.253 1.00 0.00   ? 63   LEU A CG    1 
ATOM   261   C  CD1   . LEU A 1 63   ? 142.032 133.766 133.134 1.00 0.00   ? 63   LEU A CD1   1 
ATOM   262   C  CD2   . LEU A 1 63   ? 144.342 132.815 133.108 1.00 0.00   ? 63   LEU A CD2   1 
ATOM   263   N  N     . VAL A 1 64   ? 142.278 130.297 128.914 1.00 0.00   ? 64   VAL A N     1 
ATOM   264   C  CA    . VAL A 1 64   ? 141.752 129.061 128.355 1.00 0.00   ? 64   VAL A CA    1 
ATOM   265   C  C     . VAL A 1 64   ? 142.835 128.345 127.556 1.00 0.00   ? 64   VAL A C     1 
ATOM   266   O  O     . VAL A 1 64   ? 142.870 127.117 127.508 1.00 0.00   ? 64   VAL A O     1 
ATOM   267   C  CB    . VAL A 1 64   ? 140.570 129.331 127.412 1.00 0.00   ? 64   VAL A CB    1 
ATOM   268   C  CG1   . VAL A 1 64   ? 140.063 128.023 126.837 1.00 0.00   ? 64   VAL A CG1   1 
ATOM   269   C  CG2   . VAL A 1 64   ? 139.459 130.050 128.152 1.00 0.00   ? 64   VAL A CG2   1 
ATOM   270   N  N     . ASP A 1 65   ? 143.712 129.123 126.926 1.00 0.00   ? 65   ASP A N     1 
ATOM   271   C  CA    . ASP A 1 65   ? 144.795 128.566 126.122 1.00 0.00   ? 65   ASP A CA    1 
ATOM   272   C  C     . ASP A 1 65   ? 145.847 127.850 126.966 1.00 0.00   ? 65   ASP A C     1 
ATOM   273   O  O     . ASP A 1 65   ? 146.537 126.950 126.486 1.00 0.00   ? 65   ASP A O     1 
ATOM   274   C  CB    . ASP A 1 65   ? 145.474 129.663 125.294 1.00 0.00   ? 65   ASP A CB    1 
ATOM   275   C  CG    . ASP A 1 65   ? 144.614 130.137 124.138 1.00 0.00   ? 65   ASP A CG    1 
ATOM   276   O  OD1   . ASP A 1 65   ? 143.787 129.332 123.663 1.00 0.00   ? 65   ASP A OD1   1 
ATOM   277   O  OD2   . ASP A 1 65   ? 144.772 131.297 123.691 1.00 0.00   ? 65   ASP A OD2   1 
ATOM   278   N  N     . LEU A 1 66   ? 145.963 128.251 128.227 1.00 0.00   ? 66   LEU A N     1 
ATOM   279   C  CA    . LEU A 1 66   ? 146.944 127.655 129.126 1.00 0.00   ? 66   LEU A CA    1 
ATOM   280   C  C     . LEU A 1 66   ? 146.730 126.177 129.397 1.00 0.00   ? 66   LEU A C     1 
ATOM   281   O  O     . LEU A 1 66   ? 145.599 125.686 129.378 1.00 0.00   ? 66   LEU A O     1 
ATOM   282   C  CB    . LEU A 1 66   ? 146.955 128.401 130.459 1.00 0.00   ? 66   LEU A CB    1 
ATOM   283   C  CG    . LEU A 1 66   ? 147.346 129.873 130.372 1.00 0.00   ? 66   LEU A CG    1 
ATOM   284   C  CD1   . LEU A 1 66   ? 147.334 130.477 131.760 1.00 0.00   ? 66   LEU A CD1   1 
ATOM   285   C  CD2   . LEU A 1 66   ? 148.721 130.003 129.742 1.00 0.00   ? 66   LEU A CD2   1 
ATOM   286   N  N     . LYS A 1 67   ? 147.829 125.471 129.650 1.00 0.00   ? 67   LYS A N     1 
ATOM   287   C  CA    . LYS A 1 67   ? 147.780 124.049 129.958 1.00 0.00   ? 67   LYS A CA    1 
ATOM   288   C  C     . LYS A 1 67   ? 147.057 123.943 131.298 1.00 0.00   ? 67   LYS A C     1 
ATOM   289   O  O     . LYS A 1 67   ? 146.982 124.923 132.039 1.00 0.00   ? 67   LYS A O     1 
ATOM   290   C  CB    . LYS A 1 67   ? 149.204 123.486 130.056 1.00 0.00   ? 67   LYS A CB    1 
ATOM   291   C  CG    . LYS A 1 67   ? 150.030 123.699 128.786 1.00 0.00   ? 67   LYS A CG    1 
ATOM   292   C  CD    . LYS A 1 67   ? 151.465 123.193 128.921 1.00 0.00   ? 67   LYS A CD    1 
ATOM   293   C  CE    . LYS A 1 67   ? 152.246 123.425 127.629 1.00 0.00   ? 67   LYS A CE    1 
ATOM   294   N  NZ    . LYS A 1 67   ? 153.660 122.955 127.722 1.00 0.00   ? 67   LYS A NZ    1 
ATOM   295   N  N     . TRP A 1 68   ? 146.529 122.765 131.617 1.00 0.00   ? 68   TRP A N     1 
ATOM   296   C  CA    . TRP A 1 68   ? 145.795 122.580 132.870 1.00 0.00   ? 68   TRP A CA    1 
ATOM   297   C  C     . TRP A 1 68   ? 146.591 122.865 134.141 1.00 0.00   ? 68   TRP A C     1 
ATOM   298   O  O     . TRP A 1 68   ? 146.068 123.457 135.082 1.00 0.00   ? 68   TRP A O     1 
ATOM   299   C  CB    . TRP A 1 68   ? 145.206 121.169 132.947 1.00 0.00   ? 68   TRP A CB    1 
ATOM   300   C  CG    . TRP A 1 68   ? 143.841 121.054 132.337 1.00 0.00   ? 68   TRP A CG    1 
ATOM   301   C  CD1   . TRP A 1 68   ? 143.506 120.399 131.188 1.00 0.00   ? 68   TRP A CD1   1 
ATOM   302   C  CD2   . TRP A 1 68   ? 142.617 121.592 132.862 1.00 0.00   ? 68   TRP A CD2   1 
ATOM   303   N  NE1   . TRP A 1 68   ? 142.151 120.488 130.965 1.00 0.00   ? 68   TRP A NE1   1 
ATOM   304   C  CE2   . TRP A 1 68   ? 141.582 121.216 131.975 1.00 0.00   ? 68   TRP A CE2   1 
ATOM   305   C  CE3   . TRP A 1 68   ? 142.298 122.354 133.992 1.00 0.00   ? 68   TRP A CE3   1 
ATOM   306   C  CZ2   . TRP A 1 68   ? 140.243 121.575 132.184 1.00 0.00   ? 68   TRP A CZ2   1 
ATOM   307   C  CZ3   . TRP A 1 68   ? 140.963 122.713 134.202 1.00 0.00   ? 68   TRP A CZ3   1 
ATOM   308   C  CH2   . TRP A 1 68   ? 139.956 122.321 133.301 1.00 0.00   ? 68   TRP A CH2   1 
ATOM   309   N  N     . PRO A 1 69   ? 147.862 122.433 134.189 1.00 0.00   ? 69   PRO A N     1 
ATOM   310   C  CA    . PRO A 1 69   ? 148.684 122.671 135.379 1.00 0.00   ? 69   PRO A CA    1 
ATOM   311   C  C     . PRO A 1 69   ? 148.854 124.151 135.709 1.00 0.00   ? 69   PRO A C     1 
ATOM   312   O  O     . PRO A 1 69   ? 148.978 124.519 136.878 1.00 0.00   ? 69   PRO A O     1 
ATOM   313   C  CB    . PRO A 1 69   ? 150.008 122.009 135.016 1.00 0.00   ? 69   PRO A CB    1 
ATOM   314   C  CG    . PRO A 1 69   ? 149.578 120.874 134.154 1.00 0.00   ? 69   PRO A CG    1 
ATOM   315   C  CD    . PRO A 1 69   ? 148.564 121.536 133.255 1.00 0.00   ? 69   PRO A CD    1 
ATOM   316   N  N     . HIS A 1 70   ? 148.855 124.997 134.685 1.00 0.00   ? 70   HIS A N     1 
ATOM   317   C  CA    . HIS A 1 70   ? 149.009 126.437 134.881 1.00 0.00   ? 70   HIS A CA    1 
ATOM   318   C  C     . HIS A 1 70   ? 147.692 127.114 135.217 1.00 0.00   ? 70   HIS A C     1 
ATOM   319   O  O     . HIS A 1 70   ? 147.663 128.119 135.921 1.00 0.00   ? 70   HIS A O     1 
ATOM   320   C  CB    . HIS A 1 70   ? 149.621 127.083 133.637 1.00 0.00   ? 70   HIS A CB    1 
ATOM   321   C  CG    . HIS A 1 70   ? 151.034 126.663 133.374 1.00 0.00   ? 70   HIS A CG    1 
ATOM   322   N  ND1   . HIS A 1 70   ? 151.703 127.002 132.219 1.00 0.00   ? 70   HIS A ND1   1 
ATOM   323   C  CD2   . HIS A 1 70   ? 151.902 125.932 134.110 1.00 0.00   ? 70   HIS A CD2   1 
ATOM   324   C  CE1   . HIS A 1 70   ? 152.925 126.500 132.256 1.00 0.00   ? 70   HIS A CE1   1 
ATOM   325   N  NE2   . HIS A 1 70   ? 153.071 125.847 133.395 1.00 0.00   ? 70   HIS A NE2   1 
ATOM   326   N  N     . THR A 1 71   ? 146.599 126.573 134.698 1.00 0.00   ? 71   THR A N     1 
ATOM   327   C  CA    . THR A 1 71   ? 145.284 127.127 134.989 1.00 0.00   ? 71   THR A CA    1 
ATOM   328   C  C     . THR A 1 71   ? 145.041 126.909 136.473 1.00 0.00   ? 71   THR A C     1 
ATOM   329   O  O     . THR A 1 71   ? 144.515 127.774 137.174 1.00 0.00   ? 71   THR A O     1 
ATOM   330   C  CB    . THR A 1 71   ? 144.175 126.390 134.226 1.00 0.00   ? 71   THR A CB    1 
ATOM   331   O  OG1   . THR A 1 71   ? 144.338 126.601 132.820 1.00 0.00   ? 71   THR A OG1   1 
ATOM   332   C  CG2   . THR A 1 71   ? 142.816 126.887 134.674 1.00 0.00   ? 71   THR A CG2   1 
ATOM   333   N  N     . LEU A 1 72   ? 145.450 125.734 136.937 1.00 0.00   ? 72   LEU A N     1 
ATOM   334   C  CA    . LEU A 1 72   ? 145.295 125.352 138.332 1.00 0.00   ? 72   LEU A CA    1 
ATOM   335   C  C     . LEU A 1 72   ? 146.183 126.189 139.247 1.00 0.00   ? 72   LEU A C     1 
ATOM   336   O  O     . LEU A 1 72   ? 145.755 126.589 140.334 1.00 0.00   ? 72   LEU A O     1 
ATOM   337   C  CB    . LEU A 1 72   ? 145.627 123.868 138.501 1.00 0.00   ? 72   LEU A CB    1 
ATOM   338   C  CG    . LEU A 1 72   ? 144.742 122.885 137.729 1.00 0.00   ? 72   LEU A CG    1 
ATOM   339   C  CD1   . LEU A 1 72   ? 145.301 121.474 137.851 1.00 0.00   ? 72   LEU A CD1   1 
ATOM   340   C  CD2   . LEU A 1 72   ? 143.323 122.951 138.270 1.00 0.00   ? 72   LEU A CD2   1 
ATOM   341   N  N     . LEU A 1 73   ? 147.415 126.443 138.819 1.00 0.00   ? 73   LEU A N     1 
ATOM   342   C  CA    . LEU A 1 73   ? 148.332 127.243 139.623 1.00 0.00   ? 73   LEU A CA    1 
ATOM   343   C  C     . LEU A 1 73   ? 147.822 128.668 139.741 1.00 0.00   ? 73   LEU A C     1 
ATOM   344   O  O     . LEU A 1 73   ? 147.861 129.263 140.816 1.00 0.00   ? 73   LEU A O     1 
ATOM   345   C  CB    . LEU A 1 73   ? 149.728 127.266 138.999 1.00 0.00   ? 73   LEU A CB    1 
ATOM   346   C  CG    . LEU A 1 73   ? 150.639 126.052 139.175 1.00 0.00   ? 73   LEU A CG    1 
ATOM   347   C  CD1   . LEU A 1 73   ? 151.961 126.333 138.481 1.00 0.00   ? 73   LEU A CD1   1 
ATOM   348   C  CD2   . LEU A 1 73   ? 150.865 125.774 140.654 1.00 0.00   ? 73   LEU A CD2   1 
ATOM   349   N  N     . ILE A 1 74   ? 147.341 129.234 138.641 1.00 0.00   ? 74   ILE A N     1 
ATOM   350   C  CA    . ILE A 1 74   ? 146.842 130.604 138.685 1.00 0.00   ? 74   ILE A CA    1 
ATOM   351   C  C     . ILE A 1 74   ? 145.676 130.757 139.643 1.00 0.00   ? 74   ILE A C     1 
ATOM   352   O  O     . ILE A 1 74   ? 145.639 131.683 140.447 1.00 0.00   ? 74   ILE A O     1 
ATOM   353   C  CB    . ILE A 1 74   ? 146.380 131.121 137.316 1.00 0.00   ? 74   ILE A CB    1 
ATOM   354   C  CG1   . ILE A 1 74   ? 147.556 131.240 136.352 1.00 0.00   ? 74   ILE A CG1   1 
ATOM   355   C  CG2   . ILE A 1 74   ? 145.687 132.460 137.476 1.00 0.00   ? 74   ILE A CG2   1 
ATOM   356   C  CD1   . ILE A 1 74   ? 147.154 131.490 134.916 1.00 0.00   ? 74   ILE A CD1   1 
ATOM   357   N  N     . PHE A 1 75   ? 144.715 129.855 139.556 1.00 0.00   ? 75   PHE A N     1 
ATOM   358   C  CA    . PHE A 1 75   ? 143.556 129.958 140.433 1.00 0.00   ? 75   PHE A CA    1 
ATOM   359   C  C     . PHE A 1 75   ? 143.913 129.562 141.859 1.00 0.00   ? 75   PHE A C     1 
ATOM   360   O  O     . PHE A 1 75   ? 143.326 130.071 142.814 1.00 0.00   ? 75   PHE A O     1 
ATOM   361   C  CB    . PHE A 1 75   ? 142.406 129.083 139.928 1.00 0.00   ? 75   PHE A CB    1 
ATOM   362   C  CG    . PHE A 1 75   ? 141.778 129.563 138.638 1.00 0.00   ? 75   PHE A CG    1 
ATOM   363   C  CD1   . PHE A 1 75   ? 141.434 130.901 138.456 1.00 0.00   ? 75   PHE A CD1   1 
ATOM   364   C  CD2   . PHE A 1 75   ? 141.464 128.649 137.634 1.00 0.00   ? 75   PHE A CD2   1 
ATOM   365   C  CE1   . PHE A 1 75   ? 140.787 131.320 137.289 1.00 0.00   ? 75   PHE A CE1   1 
ATOM   366   C  CE2   . PHE A 1 75   ? 140.817 129.057 136.471 1.00 0.00   ? 75   PHE A CE2   1 
ATOM   367   C  CZ    . PHE A 1 75   ? 140.475 130.392 136.297 1.00 0.00   ? 75   PHE A CZ    1 
ATOM   368   N  N     . THR A 1 76   ? 144.900 128.691 142.023 1.00 0.00   ? 76   THR A N     1 
ATOM   369   C  CA    . THR A 1 76   ? 145.318 128.353 143.375 1.00 0.00   ? 76   THR A CA    1 
ATOM   370   C  C     . THR A 1 76   ? 145.935 129.623 143.931 1.00 0.00   ? 76   THR A C     1 
ATOM   371   O  O     . THR A 1 76   ? 145.626 130.044 145.039 1.00 0.00   ? 76   THR A O     1 
ATOM   372   C  CB    . THR A 1 76   ? 146.340 127.215 143.432 1.00 0.00   ? 76   THR A CB    1 
ATOM   373   O  OG1   . THR A 1 76   ? 145.758 126.034 142.872 1.00 0.00   ? 76   THR A OG1   1 
ATOM   374   C  CG2   . THR A 1 76   ? 146.728 126.937 144.873 1.00 0.00   ? 76   THR A CG2   1 
ATOM   375   N  N     . MET A 1 77   ? 146.805 130.241 143.142 1.00 0.00   ? 77   MET A N     1 
ATOM   376   C  CA    . MET A 1 77   ? 147.455 131.471 143.563 1.00 0.00   ? 77   MET A CA    1 
ATOM   377   C  C     . MET A 1 77   ? 146.465 132.604 143.769 1.00 0.00   ? 77   MET A C     1 
ATOM   378   O  O     . MET A 1 77   ? 146.562 133.349 144.740 1.00 0.00   ? 77   MET A O     1 
ATOM   379   C  CB    . MET A 1 77   ? 148.501 131.906 142.538 1.00 0.00   ? 77   MET A CB    1 
ATOM   380   C  CG    . MET A 1 77   ? 149.798 131.124 142.588 1.00 0.00   ? 77   MET A CG    1 
ATOM   381   S  SD    . MET A 1 77   ? 150.585 131.211 144.205 1.00 0.00   ? 77   MET A SD    1 
ATOM   382   C  CE    . MET A 1 77   ? 150.431 132.958 144.557 1.00 0.00   ? 77   MET A CE    1 
ATOM   383   N  N     . SER A 1 78   ? 145.497 132.733 142.873 1.00 0.00   ? 78   SER A N     1 
ATOM   384   C  CA    . SER A 1 78   ? 144.549 133.823 143.004 1.00 0.00   ? 78   SER A CA    1 
ATOM   385   C  C     . SER A 1 78   ? 143.774 133.698 144.296 1.00 0.00   ? 78   SER A C     1 
ATOM   386   O  O     . SER A 1 78   ? 143.622 134.670 145.031 1.00 0.00   ? 78   SER A O     1 
ATOM   387   C  CB    . SER A 1 78   ? 143.563 133.816 141.840 1.00 0.00   ? 78   SER A CB    1 
ATOM   388   O  OG    . SER A 1 78   ? 144.238 133.896 140.601 1.00 0.00   ? 78   SER A OG    1 
ATOM   389   N  N     . PHE A 1 79   ? 143.303 132.496 144.594 1.00 0.00   ? 79   PHE A N     1 
ATOM   390   C  CA    . PHE A 1 79   ? 142.560 132.312 145.821 1.00 0.00   ? 79   PHE A CA    1 
ATOM   391   C  C     . PHE A 1 79   ? 143.451 132.560 147.017 1.00 0.00   ? 79   PHE A C     1 
ATOM   392   O  O     . PHE A 1 79   ? 143.077 133.269 147.939 1.00 0.00   ? 79   PHE A O     1 
ATOM   393   C  CB    . PHE A 1 79   ? 141.969 130.910 145.897 1.00 0.00   ? 79   PHE A CB    1 
ATOM   394   C  CG    . PHE A 1 79   ? 140.958 130.628 144.834 1.00 0.00   ? 79   PHE A CG    1 
ATOM   395   C  CD1   . PHE A 1 79   ? 140.343 131.659 144.156 1.00 0.00   ? 79   PHE A CD1   1 
ATOM   396   C  CD2   . PHE A 1 79   ? 140.616 129.330 144.524 1.00 0.00   ? 79   PHE A CD2   1 
ATOM   397   C  CE1   . PHE A 1 79   ? 139.407 131.403 143.179 1.00 0.00   ? 79   PHE A CE1   1 
ATOM   398   C  CE2   . PHE A 1 79   ? 139.683 129.063 143.543 1.00 0.00   ? 79   PHE A CE2   1 
ATOM   399   C  CZ    . PHE A 1 79   ? 139.076 130.100 142.871 1.00 0.00   ? 79   PHE A CZ    1 
ATOM   400   N  N     . LEU A 1 80   ? 144.622 131.934 147.006 1.00 0.00   ? 80   LEU A N     1 
ATOM   401   C  CA    . LEU A 1 80   ? 145.557 132.070 148.104 1.00 0.00   ? 80   LEU A CA    1 
ATOM   402   C  C     . LEU A 1 80   ? 145.867 133.531 148.350 1.00 0.00   ? 80   LEU A C     1 
ATOM   403   O  O     . LEU A 1 80   ? 145.787 134.004 149.477 1.00 0.00   ? 80   LEU A O     1 
ATOM   404   C  CB    . LEU A 1 80   ? 146.843 131.309 147.818 1.00 0.00   ? 80   LEU A CB    1 
ATOM   405   C  CG    . LEU A 1 80   ? 147.747 131.169 149.038 1.00 0.00   ? 80   LEU A CG    1 
ATOM   406   C  CD1   . LEU A 1 80   ? 147.047 130.320 150.082 1.00 0.00   ? 80   LEU A CD1   1 
ATOM   407   C  CD2   . LEU A 1 80   ? 149.079 130.554 148.656 1.00 0.00   ? 80   LEU A CD2   1 
ATOM   408   N  N     . CYS A 1 81   ? 146.196 134.252 147.291 1.00 0.00   ? 81   CYS A N     1 
ATOM   409   C  CA    . CYS A 1 81   ? 146.507 135.663 147.434 1.00 0.00   ? 81   CYS A CA    1 
ATOM   410   C  C     . CYS A 1 81   ? 145.311 136.434 147.954 1.00 0.00   ? 81   CYS A C     1 
ATOM   411   O  O     . CYS A 1 81   ? 145.426 137.202 148.906 1.00 0.00   ? 81   CYS A O     1 
ATOM   412   C  CB    . CYS A 1 81   ? 146.967 136.256 146.106 1.00 0.00   ? 81   CYS A CB    1 
ATOM   413   S  SG    . CYS A 1 81   ? 148.679 135.862 145.698 1.00 0.00   ? 81   CYS A SG    1 
ATOM   414   N  N     . SER A 1 82   ? 144.155 136.221 147.340 1.00 0.00   ? 82   SER A N     1 
ATOM   415   C  CA    . SER A 1 82   ? 142.968 136.941 147.750 1.00 0.00   ? 82   SER A CA    1 
ATOM   416   C  C     . SER A 1 82   ? 142.660 136.651 149.205 1.00 0.00   ? 82   SER A C     1 
ATOM   417   O  O     . SER A 1 82   ? 142.358 137.557 149.968 1.00 0.00   ? 82   SER A O     1 
ATOM   418   C  CB    . SER A 1 82   ? 141.781 136.555 146.883 1.00 0.00   ? 82   SER A CB    1 
ATOM   419   O  OG    . SER A 1 82   ? 141.560 135.162 146.954 1.00 0.00   ? 82   SER A OG    1 
ATOM   420   N  N     . TRP A 1 83   ? 142.762 135.386 149.602 1.00 0.00   ? 83   TRP A N     1 
ATOM   421   C  CA    . TRP A 1 83   ? 142.496 135.049 150.989 1.00 0.00   ? 83   TRP A CA    1 
ATOM   422   C  C     . TRP A 1 83   ? 143.529 135.732 151.874 1.00 0.00   ? 83   TRP A C     1 
ATOM   423   O  O     . TRP A 1 83   ? 143.199 136.301 152.907 1.00 0.00   ? 83   TRP A O     1 
ATOM   424   C  CB    . TRP A 1 83   ? 142.525 133.536 151.209 1.00 0.00   ? 83   TRP A CB    1 
ATOM   425   C  CG    . TRP A 1 83   ? 141.360 132.796 150.606 1.00 0.00   ? 83   TRP A CG    1 
ATOM   426   C  CD1   . TRP A 1 83   ? 140.076 133.212 150.540 1.00 0.00   ? 83   TRP A CD1   1 
ATOM   427   C  CD2   . TRP A 1 83   ? 141.389 131.494 150.011 1.00 0.00   ? 83   TRP A CD2   1 
ATOM   428   N  NE1   . TRP A 1 83   ? 139.296 132.263 149.929 1.00 0.00   ? 83   TRP A NE1   1 
ATOM   429   C  CE2   . TRP A 1 83   ? 140.085 131.193 149.600 1.00 0.00   ? 83   TRP A CE2   1 
ATOM   430   C  CE3   . TRP A 1 83   ? 142.396 130.552 149.796 1.00 0.00   ? 83   TRP A CE3   1 
ATOM   431   C  CZ2   . TRP A 1 83   ? 139.759 129.997 148.977 1.00 0.00   ? 83   TRP A CZ2   1 
ATOM   432   C  CZ3   . TRP A 1 83   ? 142.074 129.368 149.178 1.00 0.00   ? 83   TRP A CZ3   1 
ATOM   433   C  CH2   . TRP A 1 83   ? 140.767 129.099 148.775 1.00 0.00   ? 83   TRP A CH2   1 
ATOM   434   N  N     . LEU A 1 84   ? 144.789 135.669 151.464 1.00 0.00   ? 84   LEU A N     1 
ATOM   435   C  CA    . LEU A 1 84   ? 145.875 136.260 152.239 1.00 0.00   ? 84   LEU A CA    1 
ATOM   436   C  C     . LEU A 1 84   ? 145.885 137.776 152.287 1.00 0.00   ? 84   LEU A C     1 
ATOM   437   O  O     . LEU A 1 84   ? 146.089 138.354 153.347 1.00 0.00   ? 84   LEU A O     1 
ATOM   438   C  CB    . LEU A 1 84   ? 147.231 135.772 151.739 1.00 0.00   ? 84   LEU A CB    1 
ATOM   439   C  CG    . LEU A 1 84   ? 148.044 134.951 152.735 1.00 0.00   ? 84   LEU A CG    1 
ATOM   440   C  CD1   . LEU A 1 84   ? 149.036 134.047 152.024 1.00 0.00   ? 84   LEU A CD1   1 
ATOM   441   C  CD2   . LEU A 1 84   ? 148.760 135.893 153.687 1.00 0.00   ? 84   LEU A CD2   1 
ATOM   442   N  N     . LEU A 1 85   ? 145.646 138.425 151.155 1.00 0.00   ? 85   LEU A N     1 
ATOM   443   C  CA    . LEU A 1 85   ? 145.695 139.878 151.134 1.00 0.00   ? 85   LEU A CA    1 
ATOM   444   C  C     . LEU A 1 85   ? 144.668 140.459 152.075 1.00 0.00   ? 85   LEU A C     1 
ATOM   445   O  O     . LEU A 1 85   ? 144.958 141.374 152.837 1.00 0.00   ? 85   LEU A O     1 
ATOM   446   C  CB    . LEU A 1 85   ? 145.426 140.386 149.724 1.00 0.00   ? 85   LEU A CB    1 
ATOM   447   C  CG    . LEU A 1 85   ? 145.383 141.907 149.600 1.00 0.00   ? 85   LEU A CG    1 
ATOM   448   C  CD1   . LEU A 1 85   ? 146.733 142.505 149.954 1.00 0.00   ? 85   LEU A CD1   1 
ATOM   449   C  CD2   . LEU A 1 85   ? 144.946 142.323 148.203 1.00 0.00   ? 85   LEU A CD2   1 
ATOM   450   N  N     . PHE A 1 86   ? 143.462 139.924 152.017 1.00 0.00   ? 86   PHE A N     1 
ATOM   451   C  CA    . PHE A 1 86   ? 142.391 140.361 152.893 1.00 0.00   ? 86   PHE A CA    1 
ATOM   452   C  C     . PHE A 1 86   ? 142.649 140.011 154.348 1.00 0.00   ? 86   PHE A C     1 
ATOM   453   O  O     . PHE A 1 86   ? 142.326 140.777 155.250 1.00 0.00   ? 86   PHE A O     1 
ATOM   454   C  CB    . PHE A 1 86   ? 141.063 139.817 152.436 1.00 0.00   ? 86   PHE A CB    1 
ATOM   455   C  CG    . PHE A 1 86   ? 140.342 140.713 151.490 1.00 0.00   ? 86   PHE A CG    1 
ATOM   456   C  CD1   . PHE A 1 86   ? 139.744 140.202 150.359 1.00 0.00   ? 86   PHE A CD1   1 
ATOM   457   C  CD2   . PHE A 1 86   ? 140.270 142.067 151.730 1.00 0.00   ? 86   PHE A CD2   1 
ATOM   458   C  CE1   . PHE A 1 86   ? 139.078 141.027 149.481 1.00 0.00   ? 86   PHE A CE1   1 
ATOM   459   C  CE2   . PHE A 1 86   ? 139.608 142.900 150.858 1.00 0.00   ? 86   PHE A CE2   1 
ATOM   460   C  CZ    . PHE A 1 86   ? 139.012 142.380 149.732 1.00 0.00   ? 86   PHE A CZ    1 
ATOM   461   N  N     . ALA A 1 87   ? 143.268 138.853 154.575 1.00 0.00   ? 87   ALA A N     1 
ATOM   462   C  CA    . ALA A 1 87   ? 143.550 138.370 155.926 1.00 0.00   ? 87   ALA A CA    1 
ATOM   463   C  C     . ALA A 1 87   ? 144.423 139.342 156.694 1.00 0.00   ? 87   ALA A C     1 
ATOM   464   O  O     . ALA A 1 87   ? 144.198 139.577 157.876 1.00 0.00   ? 87   ALA A O     1 
ATOM   465   C  CB    . ALA A 1 87   ? 144.207 137.006 155.880 1.00 0.00   ? 87   ALA A CB    1 
ATOM   466   N  N     . MET A 1 88   ? 145.408 139.933 156.024 1.00 0.00   ? 88   MET A N     1 
ATOM   467   C  CA    . MET A 1 88   ? 146.267 140.924 156.641 1.00 0.00   ? 88   MET A CA    1 
ATOM   468   C  C     . MET A 1 88   ? 145.423 142.115 157.084 1.00 0.00   ? 88   MET A C     1 
ATOM   469   O  O     . MET A 1 88   ? 145.597 142.619 158.189 1.00 0.00   ? 88   MET A O     1 
ATOM   470   C  CB    . MET A 1 88   ? 147.300 141.400 155.626 1.00 0.00   ? 88   MET A CB    1 
ATOM   471   C  CG    . MET A 1 88   ? 148.151 142.557 156.101 1.00 0.00   ? 88   MET A CG    1 
ATOM   472   S  SD    . MET A 1 88   ? 149.411 141.999 157.255 1.00 0.00   ? 88   MET A SD    1 
ATOM   473   C  CE    . MET A 1 88   ? 150.181 140.698 156.295 1.00 0.00   ? 88   MET A CE    1 
ATOM   474   N  N     . VAL A 1 89   ? 144.482 142.542 156.246 1.00 0.00   ? 89   VAL A N     1 
ATOM   475   C  CA    . VAL A 1 89   ? 143.618 143.655 156.587 1.00 0.00   ? 89   VAL A CA    1 
ATOM   476   C  C     . VAL A 1 89   ? 142.793 143.333 157.822 1.00 0.00   ? 89   VAL A C     1 
ATOM   477   O  O     . VAL A 1 89   ? 142.627 144.178 158.696 1.00 0.00   ? 89   VAL A O     1 
ATOM   478   C  CB    . VAL A 1 89   ? 142.640 143.974 155.453 1.00 0.00   ? 89   VAL A CB    1 
ATOM   479   C  CG1   . VAL A 1 89   ? 141.567 144.925 155.944 1.00 0.00   ? 89   VAL A CG1   1 
ATOM   480   C  CG2   . VAL A 1 89   ? 143.380 144.558 154.265 1.00 0.00   ? 89   VAL A CG2   1 
ATOM   481   N  N     . TRP A 1 90   ? 142.280 142.109 157.900 1.00 0.00   ? 90   TRP A N     1 
ATOM   482   C  CA    . TRP A 1 90   ? 141.482 141.708 159.053 1.00 0.00   ? 90   TRP A CA    1 
ATOM   483   C  C     . TRP A 1 90   ? 142.315 141.745 160.315 1.00 0.00   ? 90   TRP A C     1 
ATOM   484   O  O     . TRP A 1 90   ? 141.854 142.188 161.358 1.00 0.00   ? 90   TRP A O     1 
ATOM   485   C  CB    . TRP A 1 90   ? 140.919 140.307 158.863 1.00 0.00   ? 90   TRP A CB    1 
ATOM   486   C  CG    . TRP A 1 90   ? 139.658 140.287 158.099 1.00 0.00   ? 90   TRP A CG    1 
ATOM   487   C  CD1   . TRP A 1 90   ? 139.419 139.631 156.935 1.00 0.00   ? 90   TRP A CD1   1 
ATOM   488   C  CD2   . TRP A 1 90   ? 138.453 140.966 158.435 1.00 0.00   ? 90   TRP A CD2   1 
ATOM   489   N  NE1   . TRP A 1 90   ? 138.132 139.853 156.524 1.00 0.00   ? 90   TRP A NE1   1 
ATOM   490   C  CE2   . TRP A 1 90   ? 137.518 140.673 157.431 1.00 0.00   ? 90   TRP A CE2   1 
ATOM   491   C  CE3   . TRP A 1 90   ? 138.071 141.792 159.489 1.00 0.00   ? 90   TRP A CE3   1 
ATOM   492   C  CZ2   . TRP A 1 90   ? 136.227 141.176 157.448 1.00 0.00   ? 90   TRP A CZ2   1 
ATOM   493   C  CZ3   . TRP A 1 90   ? 136.790 142.290 159.506 1.00 0.00   ? 90   TRP A CZ3   1 
ATOM   494   C  CH2   . TRP A 1 90   ? 135.881 141.981 158.492 1.00 0.00   ? 90   TRP A CH2   1 
ATOM   495   N  N     . TRP A 1 91   ? 143.552 141.284 160.217 1.00 0.00   ? 91   TRP A N     1 
ATOM   496   C  CA    . TRP A 1 91   ? 144.431 141.275 161.367 1.00 0.00   ? 91   TRP A CA    1 
ATOM   497   C  C     . TRP A 1 91   ? 144.697 142.691 161.840 1.00 0.00   ? 91   TRP A C     1 
ATOM   498   O  O     . TRP A 1 91   ? 144.667 142.974 163.032 1.00 0.00   ? 91   TRP A O     1 
ATOM   499   C  CB    . TRP A 1 91   ? 145.745 140.600 161.002 1.00 0.00   ? 91   TRP A CB    1 
ATOM   500   C  CG    . TRP A 1 91   ? 146.790 140.704 162.049 1.00 0.00   ? 91   TRP A CG    1 
ATOM   501   C  CD1   . TRP A 1 91   ? 146.720 140.239 163.324 1.00 0.00   ? 91   TRP A CD1   1 
ATOM   502   C  CD2   . TRP A 1 91   ? 148.078 141.296 161.906 1.00 0.00   ? 91   TRP A CD2   1 
ATOM   503   N  NE1   . TRP A 1 91   ? 147.885 140.514 163.990 1.00 0.00   ? 91   TRP A NE1   1 
ATOM   504   C  CE2   . TRP A 1 91   ? 148.735 141.163 163.138 1.00 0.00   ? 91   TRP A CE2   1 
ATOM   505   C  CE3   . TRP A 1 91   ? 148.741 141.928 160.854 1.00 0.00   ? 91   TRP A CE3   1 
ATOM   506   C  CZ2   . TRP A 1 91   ? 150.019 141.641 163.351 1.00 0.00   ? 91   TRP A CZ2   1 
ATOM   507   C  CZ3   . TRP A 1 91   ? 150.013 142.400 161.065 1.00 0.00   ? 91   TRP A CZ3   1 
ATOM   508   C  CH2   . TRP A 1 91   ? 150.642 142.254 162.303 1.00 0.00   ? 91   TRP A CH2   1 
ATOM   509   N  N     . LEU A 1 92   ? 144.921 143.587 160.892 1.00 0.00   ? 92   LEU A N     1 
ATOM   510   C  CA    . LEU A 1 92   ? 145.200 144.975 161.210 1.00 0.00   ? 92   LEU A CA    1 
ATOM   511   C  C     . LEU A 1 92   ? 144.012 145.667 161.877 1.00 0.00   ? 92   LEU A C     1 
ATOM   512   O  O     . LEU A 1 92   ? 144.180 146.424 162.822 1.00 0.00   ? 92   LEU A O     1 
ATOM   513   C  CB    . LEU A 1 92   ? 145.596 145.718 159.942 1.00 0.00   ? 92   LEU A CB    1 
ATOM   514   C  CG    . LEU A 1 92   ? 146.104 147.139 160.139 1.00 0.00   ? 92   LEU A CG    1 
ATOM   515   C  CD1   . LEU A 1 92   ? 147.153 147.450 159.089 1.00 0.00   ? 92   LEU A CD1   1 
ATOM   516   C  CD2   . LEU A 1 92   ? 144.947 148.117 160.046 1.00 0.00   ? 92   LEU A CD2   1 
ATOM   517   N  N     . ILE A 1 93   ? 142.809 145.411 161.386 1.00 0.00   ? 93   ILE A N     1 
ATOM   518   C  CA    . ILE A 1 93   ? 141.631 146.039 161.958 1.00 0.00   ? 93   ILE A CA    1 
ATOM   519   C  C     . ILE A 1 93   ? 141.472 145.570 163.393 1.00 0.00   ? 93   ILE A C     1 
ATOM   520   O  O     . ILE A 1 93   ? 140.990 146.309 164.239 1.00 0.00   ? 93   ILE A O     1 
ATOM   521   C  CB    . ILE A 1 93   ? 140.364 145.860 161.089 1.00 0.00   ? 93   ILE A CB    1 
ATOM   522   C  CG1   . ILE A 1 93   ? 139.402 147.019 161.323 1.00 0.00   ? 93   ILE A CG1   1 
ATOM   523   C  CG2   . ILE A 1 93   ? 139.660 144.538 161.343 1.00 0.00   ? 93   ILE A CG2   1 
ATOM   524   C  CD1   . ILE A 1 93   ? 138.153 146.923 160.484 1.00 0.00   ? 93   ILE A CD1   1 
ATOM   525   N  N     . ALA A 1 94   ? 141.889 144.338 163.679 1.00 0.00   ? 94   ALA A N     1 
ATOM   526   C  CA    . ALA A 1 94   ? 141.836 143.837 165.033 1.00 0.00   ? 94   ALA A CA    1 
ATOM   527   C  C     . ALA A 1 94   ? 142.808 144.646 165.862 1.00 0.00   ? 94   ALA A C     1 
ATOM   528   O  O     . ALA A 1 94   ? 142.498 145.070 166.968 1.00 0.00   ? 94   ALA A O     1 
ATOM   529   C  CB    . ALA A 1 94   ? 142.219 142.375 165.064 1.00 0.00   ? 94   ALA A CB    1 
ATOM   530   N  N     . PHE A 1 95   ? 143.985 144.871 165.298 1.00 0.00   ? 95   PHE A N     1 
ATOM   531   C  CA    . PHE A 1 95   ? 145.036 145.628 165.946 1.00 0.00   ? 95   PHE A CA    1 
ATOM   532   C  C     . PHE A 1 95   ? 144.668 147.084 166.200 1.00 0.00   ? 95   PHE A C     1 
ATOM   533   O  O     . PHE A 1 95   ? 144.948 147.617 167.270 1.00 0.00   ? 95   PHE A O     1 
ATOM   534   C  CB    . PHE A 1 95   ? 146.292 145.580 165.088 1.00 0.00   ? 95   PHE A CB    1 
ATOM   535   C  CG    . PHE A 1 95   ? 147.551 145.739 165.867 1.00 0.00   ? 95   PHE A CG    1 
ATOM   536   C  CD1   . PHE A 1 95   ? 148.667 145.001 165.543 1.00 0.00   ? 95   PHE A CD1   1 
ATOM   537   C  CD2   . PHE A 1 95   ? 147.605 146.608 166.932 1.00 0.00   ? 95   PHE A CD2   1 
ATOM   538   C  CE1   . PHE A 1 95   ? 149.831 145.138 166.266 1.00 0.00   ? 95   PHE A CE1   1 
ATOM   539   C  CE2   . PHE A 1 95   ? 148.764 146.755 167.660 1.00 0.00   ? 95   PHE A CE2   1 
ATOM   540   C  CZ    . PHE A 1 95   ? 149.880 146.015 167.328 1.00 0.00   ? 95   PHE A CZ    1 
ATOM   541   N  N     . ALA A 1 96   ? 144.038 147.730 165.224 1.00 0.00   ? 96   ALA A N     1 
ATOM   542   C  CA    . ALA A 1 96   ? 143.688 149.133 165.390 1.00 0.00   ? 96   ALA A CA    1 
ATOM   543   C  C     . ALA A 1 96   ? 142.729 149.274 166.550 1.00 0.00   ? 96   ALA A C     1 
ATOM   544   O  O     . ALA A 1 96   ? 142.900 150.132 167.410 1.00 0.00   ? 96   ALA A O     1 
ATOM   545   C  CB    . ALA A 1 96   ? 143.068 149.679 164.119 1.00 0.00   ? 96   ALA A CB    1 
ATOM   546   N  N     . HIS A 1 97   ? 141.739 148.395 166.573 1.00 0.00   ? 97   HIS A N     1 
ATOM   547   C  CA    . HIS A 1 97   ? 140.768 148.379 167.648 1.00 0.00   ? 97   HIS A CA    1 
ATOM   548   C  C     . HIS A 1 97   ? 141.508 148.088 168.949 1.00 0.00   ? 97   HIS A C     1 
ATOM   549   O  O     . HIS A 1 97   ? 141.123 148.572 170.010 1.00 0.00   ? 97   HIS A O     1 
ATOM   550   C  CB    . HIS A 1 97   ? 139.697 147.328 167.396 1.00 0.00   ? 97   HIS A CB    1 
ATOM   551   C  CG    . HIS A 1 97   ? 138.576 147.374 168.382 1.00 0.00   ? 97   HIS A CG    1 
ATOM   552   N  ND1   . HIS A 1 97   ? 138.664 146.795 169.630 1.00 0.00   ? 97   HIS A ND1   1 
ATOM   553   C  CD2   . HIS A 1 97   ? 137.345 147.927 168.311 1.00 0.00   ? 97   HIS A CD2   1 
ATOM   554   C  CE1   . HIS A 1 97   ? 137.533 146.993 170.284 1.00 0.00   ? 97   HIS A CE1   1 
ATOM   555   N  NE2   . HIS A 1 97   ? 136.715 147.675 169.505 1.00 0.00   ? 97   HIS A NE2   1 
ATOM   556   N  N     . GLY A 1 98   ? 142.596 147.332 168.838 1.00 0.00   ? 98   GLY A N     1 
ATOM   557   C  CA    . GLY A 1 98   ? 143.418 146.978 169.980 1.00 0.00   ? 98   GLY A CA    1 
ATOM   558   C  C     . GLY A 1 98   ? 142.860 145.836 170.801 1.00 0.00   ? 98   GLY A C     1 
ATOM   559   O  O     . GLY A 1 98   ? 143.307 145.585 171.910 1.00 0.00   ? 98   GLY A O     1 
ATOM   560   N  N     . ASP A 1 99   ? 141.882 145.141 170.240 1.00 0.00   ? 99   ASP A N     1 
ATOM   561   C  CA    . ASP A 1 99   ? 141.219 144.027 170.903 1.00 0.00   ? 99   ASP A CA    1 
ATOM   562   C  C     . ASP A 1 99   ? 142.015 142.738 171.115 1.00 0.00   ? 99   ASP A C     1 
ATOM   563   O  O     . ASP A 1 99   ? 141.630 141.910 171.937 1.00 0.00   ? 99   ASP A O     1 
ATOM   564   C  CB    . ASP A 1 99   ? 139.911 143.694 170.186 1.00 0.00   ? 99   ASP A CB    1 
ATOM   565   C  CG    . ASP A 1 99   ? 140.133 143.010 168.860 1.00 0.00   ? 99   ASP A CG    1 
ATOM   566   O  OD1   . ASP A 1 99   ? 141.297 142.750 168.510 1.00 0.00   ? 99   ASP A OD1   1 
ATOM   567   O  OD2   . ASP A 1 99   ? 139.134 142.730 168.166 1.00 0.00   ? 99   ASP A OD2   1 
ATOM   568   N  N     . LEU A 1 100  ? 143.076 142.530 170.347 1.00 0.00   ? 100  LEU A N     1 
ATOM   569   C  CA    . LEU A 1 100  ? 143.810 141.267 170.448 1.00 0.00   ? 100  LEU A CA    1 
ATOM   570   C  C     . LEU A 1 100  ? 144.527 140.844 171.743 1.00 0.00   ? 100  LEU A C     1 
ATOM   571   O  O     . LEU A 1 100  ? 144.396 139.687 172.140 1.00 0.00   ? 100  LEU A O     1 
ATOM   572   C  CB    . LEU A 1 100  ? 144.744 141.087 169.246 1.00 0.00   ? 100  LEU A CB    1 
ATOM   573   C  CG    . LEU A 1 100  ? 145.593 142.273 168.816 1.00 0.00   ? 100  LEU A CG    1 
ATOM   574   C  CD1   . LEU A 1 100  ? 146.852 142.334 169.659 1.00 0.00   ? 100  LEU A CD1   1 
ATOM   575   C  CD2   . LEU A 1 100  ? 145.954 142.103 167.353 1.00 0.00   ? 100  LEU A CD2   1 
ATOM   576   N  N     . ALA A 1 101  ? 145.251 141.735 172.420 1.00 0.00   ? 101  ALA A N     1 
ATOM   577   C  CA    . ALA A 1 101  ? 145.964 141.295 173.628 1.00 0.00   ? 101  ALA A CA    1 
ATOM   578   C  C     . ALA A 1 101  ? 145.324 141.507 175.003 1.00 0.00   ? 101  ALA A C     1 
ATOM   579   O  O     . ALA A 1 101  ? 145.754 140.890 175.973 1.00 0.00   ? 101  ALA A O     1 
ATOM   580   C  CB    . ALA A 1 101  ? 147.415 141.759 173.622 1.00 0.00   ? 101  ALA A CB    1 
ATOM   581   N  N     . PRO A 1 102  ? 144.318 142.368 175.106 1.00 0.00   ? 102  PRO A N     1 
ATOM   582   C  CA    . PRO A 1 102  ? 143.658 142.569 176.399 1.00 0.00   ? 102  PRO A CA    1 
ATOM   583   C  C     . PRO A 1 102  ? 142.955 141.296 176.830 1.00 0.00   ? 102  PRO A C     1 
ATOM   584   O  O     . PRO A 1 102  ? 142.990 140.933 178.005 1.00 0.00   ? 102  PRO A O     1 
ATOM   585   C  CB    . PRO A 1 102  ? 142.623 143.655 176.106 1.00 0.00   ? 102  PRO A CB    1 
ATOM   586   C  CG    . PRO A 1 102  ? 143.080 144.298 174.848 1.00 0.00   ? 102  PRO A CG    1 
ATOM   587   C  CD    . PRO A 1 102  ? 143.686 143.178 174.061 1.00 0.00   ? 102  PRO A CD    1 
ATOM   588   N  N     . GLY A 1 103  ? 142.322 140.637 175.862 1.00 0.00   ? 103  GLY A N     1 
ATOM   589   C  CA    . GLY A 1 103  ? 141.592 139.409 176.092 1.00 0.00   ? 103  GLY A CA    1 
ATOM   590   C  C     . GLY A 1 103  ? 140.609 139.622 177.214 1.00 0.00   ? 103  GLY A C     1 
ATOM   591   O  O     . GLY A 1 103  ? 140.153 138.672 177.845 1.00 0.00   ? 103  GLY A O     1 
ATOM   592   N  N     . GLU A 1 104  ? 140.276 140.884 177.462 1.00 0.00   ? 104  GLU A N     1 
ATOM   593   C  CA    . GLU A 1 104  ? 139.364 141.185 178.560 1.00 0.00   ? 104  GLU A CA    1 
ATOM   594   C  C     . GLU A 1 104  ? 137.897 141.233 178.138 1.00 0.00   ? 104  GLU A C     1 
ATOM   595   O  O     . GLU A 1 104  ? 137.563 141.657 177.034 1.00 0.00   ? 104  GLU A O     1 
ATOM   596   C  CB    . GLU A 1 104  ? 139.774 142.507 179.219 1.00 0.00   ? 104  GLU A CB    1 
ATOM   597   C  CG    . GLU A 1 104  ? 139.092 142.791 180.546 1.00 0.00   ? 104  GLU A CG    1 
ATOM   598   C  CD    . GLU A 1 104  ? 139.910 143.716 181.419 1.00 0.00   ? 104  GLU A CD    1 
ATOM   599   O  OE1   . GLU A 1 104  ? 141.128 143.845 181.172 1.00 0.00   ? 104  GLU A OE1   1 
ATOM   600   O  OE2   . GLU A 1 104  ? 139.339 144.309 182.356 1.00 0.00   ? 104  GLU A OE2   1 
ATOM   601   N  N     . GLY A 1 105  ? 137.029 140.787 179.037 1.00 0.00   ? 105  GLY A N     1 
ATOM   602   C  CA    . GLY A 1 105  ? 135.600 140.748 178.791 1.00 0.00   ? 105  GLY A CA    1 
ATOM   603   C  C     . GLY A 1 105  ? 134.904 142.075 178.558 1.00 0.00   ? 105  GLY A C     1 
ATOM   604   O  O     . GLY A 1 105  ? 134.023 142.163 177.707 1.00 0.00   ? 105  GLY A O     1 
ATOM   605   N  N     . THR A 1 106  ? 135.303 143.113 179.291 1.00 0.00   ? 106  THR A N     1 
ATOM   606   C  CA    . THR A 1 106  ? 134.648 144.413 179.178 1.00 0.00   ? 106  THR A CA    1 
ATOM   607   C  C     . THR A 1 106  ? 134.748 144.973 177.771 1.00 0.00   ? 106  THR A C     1 
ATOM   608   O  O     . THR A 1 106  ? 133.778 145.496 177.228 1.00 0.00   ? 106  THR A O     1 
ATOM   609   C  CB    . THR A 1 106  ? 135.293 145.443 180.120 1.00 0.00   ? 106  THR A CB    1 
ATOM   610   O  OG1   . THR A 1 106  ? 136.567 145.835 179.597 1.00 0.00   ? 106  THR A OG1   1 
ATOM   611   C  CG2   . THR A 1 106  ? 135.480 144.858 181.511 1.00 0.00   ? 106  THR A CG2   1 
ATOM   612   N  N     . ASN A 1 107  ? 135.929 144.868 177.180 1.00 0.00   ? 107  ASN A N     1 
ATOM   613   C  CA    . ASN A 1 107  ? 136.120 145.343 175.823 1.00 0.00   ? 107  ASN A CA    1 
ATOM   614   C  C     . ASN A 1 107  ? 135.397 144.391 174.884 1.00 0.00   ? 107  ASN A C     1 
ATOM   615   O  O     . ASN A 1 107  ? 135.330 143.194 175.150 1.00 0.00   ? 107  ASN A O     1 
ATOM   616   C  CB    . ASN A 1 107  ? 137.608 145.405 175.487 1.00 0.00   ? 107  ASN A CB    1 
ATOM   617   C  CG    . ASN A 1 107  ? 137.869 146.022 174.132 1.00 0.00   ? 107  ASN A CG    1 
ATOM   618   O  OD1   . ASN A 1 107  ? 136.941 146.328 173.388 1.00 0.00   ? 107  ASN A OD1   1 
ATOM   619   N  ND2   . ASN A 1 107  ? 139.140 146.209 173.800 1.00 0.00   ? 107  ASN A ND2   1 
ATOM   620   N  N     . VAL A 1 108  ? 134.838 144.913 173.801 1.00 0.00   ? 108  VAL A N     1 
ATOM   621   C  CA    . VAL A 1 108  ? 134.162 144.052 172.845 1.00 0.00   ? 108  VAL A CA    1 
ATOM   622   C  C     . VAL A 1 108  ? 134.920 144.094 171.529 1.00 0.00   ? 108  VAL A C     1 
ATOM   623   O  O     . VAL A 1 108  ? 135.122 145.157 170.956 1.00 0.00   ? 108  VAL A O     1 
ATOM   624   C  CB    . VAL A 1 108  ? 132.716 144.497 172.612 1.00 0.00   ? 108  VAL A CB    1 
ATOM   625   C  CG1   . VAL A 1 108  ? 131.967 143.443 171.820 1.00 0.00   ? 108  VAL A CG1   1 
ATOM   626   C  CG2   . VAL A 1 108  ? 132.031 144.748 173.944 1.00 0.00   ? 108  VAL A CG2   1 
ATOM   627   N  N     . PRO A 1 109  ? 135.325 142.932 171.038 1.00 0.00   ? 109  PRO A N     1 
ATOM   628   C  CA    . PRO A 1 109  ? 136.072 142.878 169.782 1.00 0.00   ? 109  PRO A CA    1 
ATOM   629   C  C     . PRO A 1 109  ? 135.192 143.111 168.567 1.00 0.00   ? 109  PRO A C     1 
ATOM   630   O  O     . PRO A 1 109  ? 133.967 143.019 168.642 1.00 0.00   ? 109  PRO A O     1 
ATOM   631   C  CB    . PRO A 1 109  ? 136.660 141.475 169.798 1.00 0.00   ? 109  PRO A CB    1 
ATOM   632   C  CG    . PRO A 1 109  ? 135.581 140.690 170.464 1.00 0.00   ? 109  PRO A CG    1 
ATOM   633   C  CD    . PRO A 1 109  ? 135.191 141.585 171.626 1.00 0.00   ? 109  PRO A CD    1 
ATOM   634   N  N     . CYS A 1 110  ? 135.833 143.429 167.447 1.00 0.00   ? 110  CYS A N     1 
ATOM   635   C  CA    . CYS A 1 110  ? 135.115 143.645 166.201 1.00 0.00   ? 110  CYS A CA    1 
ATOM   636   C  C     . CYS A 1 110  ? 134.931 142.301 165.530 1.00 0.00   ? 110  CYS A C     1 
ATOM   637   O  O     . CYS A 1 110  ? 133.902 142.023 164.917 1.00 0.00   ? 110  CYS A O     1 
ATOM   638   C  CB    . CYS A 1 110  ? 135.855 144.627 165.300 1.00 0.00   ? 110  CYS A CB    1 
ATOM   639   S  SG    . CYS A 1 110  ? 135.762 146.307 165.945 1.00 0.00   ? 110  CYS A SG    1 
ATOM   640   N  N     . VAL A 1 111  ? 135.945 141.462 165.680 1.00 0.00   ? 111  VAL A N     1 
ATOM   641   C  CA    . VAL A 1 111  ? 135.943 140.117 165.127 1.00 0.00   ? 111  VAL A CA    1 
ATOM   642   C  C     . VAL A 1 111  ? 136.309 139.224 166.303 1.00 0.00   ? 111  VAL A C     1 
ATOM   643   O  O     . VAL A 1 111  ? 137.423 139.286 166.817 1.00 0.00   ? 111  VAL A O     1 
ATOM   644   C  CB    . VAL A 1 111  ? 136.997 139.954 164.022 1.00 0.00   ? 111  VAL A CB    1 
ATOM   645   C  CG1   . VAL A 1 111  ? 136.965 138.530 163.493 1.00 0.00   ? 111  VAL A CG1   1 
ATOM   646   C  CG2   . VAL A 1 111  ? 136.735 140.940 162.898 1.00 0.00   ? 111  VAL A CG2   1 
ATOM   647   N  N     . THR A 1 112  ? 135.363 138.400 166.732 1.00 0.00   ? 112  THR A N     1 
ATOM   648   C  CA    . THR A 1 112  ? 135.587 137.521 167.873 1.00 0.00   ? 112  THR A CA    1 
ATOM   649   C  C     . THR A 1 112  ? 136.667 136.464 167.646 1.00 0.00   ? 112  THR A C     1 
ATOM   650   O  O     . THR A 1 112  ? 136.950 136.080 166.513 1.00 0.00   ? 112  THR A O     1 
ATOM   651   C  CB    . THR A 1 112  ? 134.292 136.796 168.285 1.00 0.00   ? 112  THR A CB    1 
ATOM   652   O  OG1   . THR A 1 112  ? 133.905 135.887 167.247 1.00 0.00   ? 112  THR A OG1   1 
ATOM   653   C  CG2   . THR A 1 112  ? 133.173 137.797 168.507 1.00 0.00   ? 112  THR A CG2   1 
ATOM   654   N  N     . SER A 1 113  ? 137.268 136.014 168.746 1.00 0.00   ? 113  SER A N     1 
ATOM   655   C  CA    . SER A 1 113  ? 138.298 134.984 168.722 1.00 0.00   ? 113  SER A CA    1 
ATOM   656   C  C     . SER A 1 113  ? 139.527 135.273 167.866 1.00 0.00   ? 113  SER A C     1 
ATOM   657   O  O     . SER A 1 113  ? 140.051 134.379 167.195 1.00 0.00   ? 113  SER A O     1 
ATOM   658   C  CB    . SER A 1 113  ? 137.679 133.653 168.283 1.00 0.00   ? 113  SER A CB    1 
ATOM   659   O  OG    . SER A 1 113  ? 136.664 133.247 169.187 1.00 0.00   ? 113  SER A OG    1 
ATOM   660   N  N     . ILE A 1 114  ? 139.999 136.514 167.895 1.00 0.00   ? 114  ILE A N     1 
ATOM   661   C  CA    . ILE A 1 114  ? 141.183 136.888 167.124 1.00 0.00   ? 114  ILE A CA    1 
ATOM   662   C  C     . ILE A 1 114  ? 142.377 137.086 168.048 1.00 0.00   ? 114  ILE A C     1 
ATOM   663   O  O     . ILE A 1 114  ? 142.514 138.126 168.695 1.00 0.00   ? 114  ILE A O     1 
ATOM   664   C  CB    . ILE A 1 114  ? 140.939 138.188 166.341 1.00 0.00   ? 114  ILE A CB    1 
ATOM   665   C  CG1   . ILE A 1 114  ? 139.810 137.978 165.330 1.00 0.00   ? 114  ILE A CG1   1 
ATOM   666   C  CG2   . ILE A 1 114  ? 142.211 138.620 165.629 1.00 0.00   ? 114  ILE A CG2   1 
ATOM   667   C  CD1   . ILE A 1 114  ? 140.111 136.916 164.293 1.00 0.00   ? 114  ILE A CD1   1 
ATOM   668   N  N     . HIS A 1 115  ? 143.250 136.086 168.100 1.00 0.00   ? 115  HIS A N     1 
ATOM   669   C  CA    . HIS A 1 115  ? 144.418 136.141 168.968 1.00 0.00   ? 115  HIS A CA    1 
ATOM   670   C  C     . HIS A 1 115  ? 145.736 136.331 168.216 1.00 0.00   ? 115  HIS A C     1 
ATOM   671   O  O     . HIS A 1 115  ? 146.657 136.966 168.727 1.00 0.00   ? 115  HIS A O     1 
ATOM   672   C  CB    . HIS A 1 115  ? 144.462 134.872 169.819 1.00 0.00   ? 115  HIS A CB    1 
ATOM   673   C  CG    . HIS A 1 115  ? 143.138 134.517 170.440 1.00 0.00   ? 115  HIS A CG    1 
ATOM   674   N  ND1   . HIS A 1 115  ? 142.561 135.256 171.452 1.00 0.00   ? 115  HIS A ND1   1 
ATOM   675   C  CD2   . HIS A 1 115  ? 142.270 133.508 170.179 1.00 0.00   ? 115  HIS A CD2   1 
ATOM   676   C  CE1   . HIS A 1 115  ? 141.401 134.720 171.786 1.00 0.00   ? 115  HIS A CE1   1 
ATOM   677   N  NE2   . HIS A 1 115  ? 141.200 133.658 171.028 1.00 0.00   ? 115  HIS A NE2   1 
ATOM   678   N  N     . SER A 1 116  ? 145.829 135.796 167.004 1.00 0.00   ? 116  SER A N     1 
ATOM   679   C  CA    . SER A 1 116  ? 147.051 135.937 166.211 1.00 0.00   ? 116  SER A CA    1 
ATOM   680   C  C     . SER A 1 116  ? 146.718 136.166 164.733 1.00 0.00   ? 116  SER A C     1 
ATOM   681   O  O     . SER A 1 116  ? 145.543 136.217 164.372 1.00 0.00   ? 116  SER A O     1 
ATOM   682   C  CB    . SER A 1 116  ? 147.928 134.684 166.350 1.00 0.00   ? 116  SER A CB    1 
ATOM   683   O  OG    . SER A 1 116  ? 147.252 133.526 165.904 1.00 0.00   ? 116  SER A OG    1 
ATOM   684   N  N     . PHE A 1 117  ? 147.733 136.330 163.905 1.00 0.00   ? 117  PHE A N     1 
ATOM   685   C  CA    . PHE A 1 117  ? 147.476 136.529 162.498 1.00 0.00   ? 117  PHE A CA    1 
ATOM   686   C  C     . PHE A 1 117  ? 146.788 135.280 161.973 1.00 0.00   ? 117  PHE A C     1 
ATOM   687   O  O     . PHE A 1 117  ? 145.830 135.351 161.210 1.00 0.00   ? 117  PHE A O     1 
ATOM   688   C  CB    . PHE A 1 117  ? 148.788 136.762 161.764 1.00 0.00   ? 117  PHE A CB    1 
ATOM   689   C  CG    . PHE A 1 117  ? 148.662 136.718 160.278 1.00 0.00   ? 117  PHE A CG    1 
ATOM   690   C  CD1   . PHE A 1 117  ? 148.226 137.822 159.580 1.00 0.00   ? 117  PHE A CD1   1 
ATOM   691   C  CD2   . PHE A 1 117  ? 148.976 135.571 159.583 1.00 0.00   ? 117  PHE A CD2   1 
ATOM   692   C  CE1   . PHE A 1 117  ? 148.107 137.785 158.209 1.00 0.00   ? 117  PHE A CE1   1 
ATOM   693   C  CE2   . PHE A 1 117  ? 148.862 135.525 158.213 1.00 0.00   ? 117  PHE A CE2   1 
ATOM   694   C  CZ    . PHE A 1 117  ? 148.426 136.635 157.523 1.00 0.00   ? 117  PHE A CZ    1 
ATOM   695   N  N     . SER A 1 118  ? 147.268 134.131 162.431 1.00 0.00   ? 118  SER A N     1 
ATOM   696   C  CA    . SER A 1 118  ? 146.751 132.836 162.003 1.00 0.00   ? 118  SER A CA    1 
ATOM   697   C  C     . SER A 1 118  ? 145.242 132.759 162.204 1.00 0.00   ? 118  SER A C     1 
ATOM   698   O  O     . SER A 1 118  ? 144.515 132.262 161.342 1.00 0.00   ? 118  SER A O     1 
ATOM   699   C  CB    . SER A 1 118  ? 147.430 131.716 162.791 1.00 0.00   ? 118  SER A CB    1 
ATOM   700   O  OG    . SER A 1 118  ? 148.824 131.695 162.535 1.00 0.00   ? 118  SER A OG    1 
ATOM   701   N  N     . SER A 1 119  ? 144.779 133.245 163.350 1.00 0.00   ? 119  SER A N     1 
ATOM   702   C  CA    . SER A 1 119  ? 143.354 133.238 163.646 1.00 0.00   ? 119  SER A CA    1 
ATOM   703   C  C     . SER A 1 119  ? 142.665 134.149 162.635 1.00 0.00   ? 119  SER A C     1 
ATOM   704   O  O     . SER A 1 119  ? 141.566 133.857 162.166 1.00 0.00   ? 119  SER A O     1 
ATOM   705   C  CB    . SER A 1 119  ? 143.099 133.758 165.064 1.00 0.00   ? 119  SER A CB    1 
ATOM   706   O  OG    . SER A 1 119  ? 143.468 135.121 165.180 1.00 0.00   ? 119  SER A OG    1 
ATOM   707   N  N     . ALA A 1 120  ? 143.328 135.252 162.303 1.00 0.00   ? 120  ALA A N     1 
ATOM   708   C  CA    . ALA A 1 120  ? 142.792 136.215 161.347 1.00 0.00   ? 120  ALA A CA    1 
ATOM   709   C  C     . ALA A 1 120  ? 142.744 135.608 159.950 1.00 0.00   ? 120  ALA A C     1 
ATOM   710   O  O     . ALA A 1 120  ? 141.781 135.822 159.211 1.00 0.00   ? 120  ALA A O     1 
ATOM   711   C  CB    . ALA A 1 120  ? 143.645 137.478 161.339 1.00 0.00   ? 120  ALA A CB    1 
ATOM   712   N  N     . PHE A 1 121  ? 143.772 134.848 159.609 1.00 0.00   ? 121  PHE A N     1 
ATOM   713   C  CA    . PHE A 1 121  ? 143.846 134.215 158.306 1.00 0.00   ? 121  PHE A CA    1 
ATOM   714   C  C     . PHE A 1 121  ? 142.702 133.236 158.127 1.00 0.00   ? 121  PHE A C     1 
ATOM   715   O  O     . PHE A 1 121  ? 142.011 133.245 157.122 1.00 0.00   ? 121  PHE A O     1 
ATOM   716   C  CB    . PHE A 1 121  ? 145.171 133.484 158.158 1.00 0.00   ? 121  PHE A CB    1 
ATOM   717   C  CG    . PHE A 1 121  ? 145.330 132.793 156.846 1.00 0.00   ? 121  PHE A CG    1 
ATOM   718   C  CD1   . PHE A 1 121  ? 146.162 133.310 155.879 1.00 0.00   ? 121  PHE A CD1   1 
ATOM   719   C  CD2   . PHE A 1 121  ? 144.642 131.631 156.581 1.00 0.00   ? 121  PHE A CD2   1 
ATOM   720   C  CE1   . PHE A 1 121  ? 146.312 132.678 154.666 1.00 0.00   ? 121  PHE A CE1   1 
ATOM   721   C  CE2   . PHE A 1 121  ? 144.787 130.990 155.372 1.00 0.00   ? 121  PHE A CE2   1 
ATOM   722   C  CZ    . PHE A 1 121  ? 145.622 131.515 154.411 1.00 0.00   ? 121  PHE A CZ    1 
ATOM   723   N  N     . LEU A 1 122  ? 142.503 132.378 159.110 1.00 0.00   ? 122  LEU A N     1 
ATOM   724   C  CA    . LEU A 1 122  ? 141.428 131.389 159.045 1.00 0.00   ? 122  LEU A CA    1 
ATOM   725   C  C     . LEU A 1 122  ? 140.084 132.085 158.887 1.00 0.00   ? 122  LEU A C     1 
ATOM   726   O  O     . LEU A 1 122  ? 139.179 131.552 158.240 1.00 0.00   ? 122  LEU A O     1 
ATOM   727   C  CB    . LEU A 1 122  ? 141.417 130.513 160.306 1.00 0.00   ? 122  LEU A CB    1 
ATOM   728   C  CG    . LEU A 1 122  ? 142.521 129.466 160.470 1.00 0.00   ? 122  LEU A CG    1 
ATOM   729   C  CD1   . LEU A 1 122  ? 142.383 128.810 161.835 1.00 0.00   ? 122  LEU A CD1   1 
ATOM   730   C  CD2   . LEU A 1 122  ? 142.432 128.417 159.369 1.00 0.00   ? 122  LEU A CD2   1 
ATOM   731   N  N     . PHE A 1 123  ? 139.955 133.270 159.475 1.00 0.00   ? 123  PHE A N     1 
ATOM   732   C  CA    . PHE A 1 123  ? 138.714 134.033 159.370 1.00 0.00   ? 123  PHE A CA    1 
ATOM   733   C  C     . PHE A 1 123  ? 138.506 134.447 157.921 1.00 0.00   ? 123  PHE A C     1 
ATOM   734   O  O     . PHE A 1 123  ? 137.389 134.399 157.411 1.00 0.00   ? 123  PHE A O     1 
ATOM   735   C  CB    . PHE A 1 123  ? 138.766 135.293 160.236 1.00 0.00   ? 123  PHE A CB    1 
ATOM   736   C  CG    . PHE A 1 123  ? 137.532 136.142 160.128 1.00 0.00   ? 123  PHE A CG    1 
ATOM   737   C  CD1   . PHE A 1 123  ? 136.356 135.765 160.763 1.00 0.00   ? 123  PHE A CD1   1 
ATOM   738   C  CD2   . PHE A 1 123  ? 137.543 137.309 159.375 1.00 0.00   ? 123  PHE A CD2   1 
ATOM   739   C  CE1   . PHE A 1 123  ? 135.207 136.541 160.654 1.00 0.00   ? 123  PHE A CE1   1 
ATOM   740   C  CE2   . PHE A 1 123  ? 136.398 138.093 159.259 1.00 0.00   ? 123  PHE A CE2   1 
ATOM   741   C  CZ    . PHE A 1 123  ? 135.225 137.708 159.899 1.00 0.00   ? 123  PHE A CZ    1 
ATOM   742   N  N     . SER A 1 124  ? 139.586 134.863 157.266 1.00 0.00   ? 124  SER A N     1 
ATOM   743   C  CA    . SER A 1 124  ? 139.534 135.289 155.869 1.00 0.00   ? 124  SER A CA    1 
ATOM   744   C  C     . SER A 1 124  ? 139.041 134.150 154.990 1.00 0.00   ? 124  SER A C     1 
ATOM   745   O  O     . SER A 1 124  ? 138.220 134.347 154.093 1.00 0.00   ? 124  SER A O     1 
ATOM   746   C  CB    . SER A 1 124  ? 140.926 135.727 155.394 1.00 0.00   ? 124  SER A CB    1 
ATOM   747   O  OG    . SER A 1 124  ? 140.893 136.190 154.056 1.00 0.00   ? 124  SER A OG    1 
ATOM   748   N  N     . ILE A 1 125  ? 139.559 132.957 155.254 1.00 0.00   ? 125  ILE A N     1 
ATOM   749   C  CA    . ILE A 1 125  ? 139.179 131.769 154.498 1.00 0.00   ? 125  ILE A CA    1 
ATOM   750   C  C     . ILE A 1 125  ? 137.688 131.502 154.648 1.00 0.00   ? 125  ILE A C     1 
ATOM   751   O  O     . ILE A 1 125  ? 136.977 131.319 153.666 1.00 0.00   ? 125  ILE A O     1 
ATOM   752   C  CB    . ILE A 1 125  ? 139.960 130.530 154.994 1.00 0.00   ? 125  ILE A CB    1 
ATOM   753   C  CG1   . ILE A 1 125  ? 141.460 130.724 154.739 1.00 0.00   ? 125  ILE A CG1   1 
ATOM   754   C  CG2   . ILE A 1 125  ? 139.456 129.287 154.285 1.00 0.00   ? 125  ILE A CG2   1 
ATOM   755   C  CD1   . ILE A 1 125  ? 141.833 130.771 153.286 1.00 0.00   ? 125  ILE A CD1   1 
ATOM   756   N  N     . GLU A 1 126  ? 137.224 131.502 155.892 1.00 0.00   ? 126  GLU A N     1 
ATOM   757   C  CA    . GLU A 1 126  ? 135.820 131.246 156.208 1.00 0.00   ? 126  GLU A CA    1 
ATOM   758   C  C     . GLU A 1 126  ? 134.854 132.229 155.554 1.00 0.00   ? 126  GLU A C     1 
ATOM   759   O  O     . GLU A 1 126  ? 133.673 131.919 155.384 1.00 0.00   ? 126  GLU A O     1 
ATOM   760   C  CB    . GLU A 1 126  ? 135.616 131.278 157.726 1.00 0.00   ? 126  GLU A CB    1 
ATOM   761   C  CG    . GLU A 1 126  ? 136.362 130.194 158.476 1.00 0.00   ? 126  GLU A CG    1 
ATOM   762   C  CD    . GLU A 1 126  ? 136.221 130.320 159.982 1.00 0.00   ? 126  GLU A CD    1 
ATOM   763   O  OE1   . GLU A 1 126  ? 135.074 130.373 160.477 1.00 0.00   ? 126  GLU A OE1   1 
ATOM   764   O  OE2   . GLU A 1 126  ? 137.264 130.360 160.673 1.00 0.00   ? 126  GLU A OE2   1 
ATOM   765   N  N     . VAL A 1 127  ? 135.349 133.409 155.185 1.00 0.00   ? 127  VAL A N     1 
ATOM   766   C  CA    . VAL A 1 127  ? 134.512 134.437 154.568 1.00 0.00   ? 127  VAL A CA    1 
ATOM   767   C  C     . VAL A 1 127  ? 134.362 134.319 153.052 1.00 0.00   ? 127  VAL A C     1 
ATOM   768   O  O     . VAL A 1 127  ? 133.242 134.356 152.532 1.00 0.00   ? 127  VAL A O     1 
ATOM   769   C  CB    . VAL A 1 127  ? 135.047 135.858 154.895 1.00 0.00   ? 127  VAL A CB    1 
ATOM   770   C  CG1   . VAL A 1 127  ? 134.256 136.904 154.128 1.00 0.00   ? 127  VAL A CG1   1 
ATOM   771   C  CG2   . VAL A 1 127  ? 134.939 136.122 156.385 1.00 0.00   ? 127  VAL A CG2   1 
ATOM   772   N  N     . GLN A 1 128  ? 135.476 134.179 152.341 1.00 0.00   ? 128  GLN A N     1 
ATOM   773   C  CA    . GLN A 1 128  ? 135.425 134.082 150.887 1.00 0.00   ? 128  GLN A CA    1 
ATOM   774   C  C     . GLN A 1 128  ? 134.835 132.772 150.359 1.00 0.00   ? 128  GLN A C     1 
ATOM   775   O  O     . GLN A 1 128  ? 134.116 132.783 149.360 1.00 0.00   ? 128  GLN A O     1 
ATOM   776   C  CB    . GLN A 1 128  ? 136.813 134.327 150.278 1.00 0.00   ? 128  GLN A CB    1 
ATOM   777   C  CG    . GLN A 1 128  ? 137.290 135.773 150.378 1.00 0.00   ? 128  GLN A CG    1 
ATOM   778   C  CD    . GLN A 1 128  ? 138.516 136.048 149.528 1.00 0.00   ? 128  GLN A CD    1 
ATOM   779   O  OE1   . GLN A 1 128  ? 139.423 136.773 149.938 1.00 0.00   ? 128  GLN A OE1   1 
ATOM   780   N  NE2   . GLN A 1 128  ? 138.548 135.471 148.333 1.00 0.00   ? 128  GLN A NE2   1 
ATOM   781   N  N     . VAL A 1 129  ? 135.130 131.650 151.015 1.00 0.00   ? 129  VAL A N     1 
ATOM   782   C  CA    . VAL A 1 129  ? 134.582 130.366 150.584 1.00 0.00   ? 129  VAL A CA    1 
ATOM   783   C  C     . VAL A 1 129  ? 133.300 130.046 151.352 1.00 0.00   ? 129  VAL A C     1 
ATOM   784   O  O     . VAL A 1 129  ? 132.841 128.906 151.372 1.00 0.00   ? 129  VAL A O     1 
ATOM   785   C  CB    . VAL A 1 129  ? 135.587 129.204 150.781 1.00 0.00   ? 129  VAL A CB    1 
ATOM   786   C  CG1   . VAL A 1 129  ? 134.931 127.885 150.437 1.00 0.00   ? 129  VAL A CG1   1 
ATOM   787   C  CG2   . VAL A 1 129  ? 136.810 129.424 149.926 1.00 0.00   ? 129  VAL A CG2   1 
ATOM   788   N  N     . THR A 1 130  ? 132.747 131.077 151.979 1.00 0.00   ? 130  THR A N     1 
ATOM   789   C  CA    . THR A 1 130  ? 131.509 131.014 152.754 1.00 0.00   ? 130  THR A CA    1 
ATOM   790   C  C     . THR A 1 130  ? 131.330 129.858 153.730 1.00 0.00   ? 130  THR A C     1 
ATOM   791   O  O     . THR A 1 130  ? 130.292 129.189 153.721 1.00 0.00   ? 130  THR A O     1 
ATOM   792   C  CB    . THR A 1 130  ? 130.269 131.049 151.828 1.00 0.00   ? 130  THR A CB    1 
ATOM   793   O  OG1   . THR A 1 130  ? 130.215 129.855 151.041 1.00 0.00   ? 130  THR A OG1   1 
ATOM   794   C  CG2   . THR A 1 130  ? 130.338 132.251 150.905 1.00 0.00   ? 130  THR A CG2   1 
ATOM   795   N  N     . ILE A 1 131  ? 132.323 129.617 154.582 1.00 0.00   ? 131  ILE A N     1 
ATOM   796   C  CA    . ILE A 1 131  ? 132.213 128.528 155.551 1.00 0.00   ? 131  ILE A CA    1 
ATOM   797   C  C     . ILE A 1 131  ? 131.520 129.022 156.821 1.00 0.00   ? 131  ILE A C     1 
ATOM   798   O  O     . ILE A 1 131  ? 130.549 128.418 157.282 1.00 0.00   ? 131  ILE A O     1 
ATOM   799   C  CB    . ILE A 1 131  ? 133.592 127.957 155.914 1.00 0.00   ? 131  ILE A CB    1 
ATOM   800   C  CG1   . ILE A 1 131  ? 134.236 127.344 154.659 1.00 0.00   ? 131  ILE A CG1   1 
ATOM   801   C  CG2   . ILE A 1 131  ? 133.449 126.906 156.997 1.00 0.00   ? 131  ILE A CG2   1 
ATOM   802   C  CD1   . ILE A 1 131  ? 135.586 126.689 154.902 1.00 0.00   ? 131  ILE A CD1   1 
ATOM   803   N  N     . GLY A 1 132  ? 132.018 130.115 157.392 1.00 0.00   ? 132  GLY A N     1 
ATOM   804   C  CA    . GLY A 1 132  ? 131.393 130.664 158.582 1.00 0.00   ? 132  GLY A CA    1 
ATOM   805   C  C     . GLY A 1 132  ? 131.311 129.726 159.772 1.00 0.00   ? 132  GLY A C     1 
ATOM   806   O  O     . GLY A 1 132  ? 130.221 129.516 160.301 1.00 0.00   ? 132  GLY A O     1 
ATOM   807   N  N     . PHE A 1 133  ? 132.439 129.179 160.216 1.00 0.00   ? 133  PHE A N     1 
ATOM   808   C  CA    . PHE A 1 133  ? 132.412 128.249 161.339 1.00 0.00   ? 133  PHE A CA    1 
ATOM   809   C  C     . PHE A 1 133  ? 131.699 128.840 162.555 1.00 0.00   ? 133  PHE A C     1 
ATOM   810   O  O     . PHE A 1 133  ? 131.031 128.121 163.288 1.00 0.00   ? 133  PHE A O     1 
ATOM   811   C  CB    . PHE A 1 133  ? 133.834 127.840 161.746 1.00 0.00   ? 133  PHE A CB    1 
ATOM   812   C  CG    . PHE A 1 133  ? 134.461 126.816 160.840 1.00 0.00   ? 133  PHE A CG    1 
ATOM   813   C  CD1   . PHE A 1 133  ? 133.802 125.627 160.540 1.00 0.00   ? 133  PHE A CD1   1 
ATOM   814   C  CD2   . PHE A 1 133  ? 135.728 127.031 160.312 1.00 0.00   ? 133  PHE A CD2   1 
ATOM   815   C  CE1   . PHE A 1 133  ? 134.401 124.664 159.729 1.00 0.00   ? 133  PHE A CE1   1 
ATOM   816   C  CE2   . PHE A 1 133  ? 136.335 126.074 159.500 1.00 0.00   ? 133  PHE A CE2   1 
ATOM   817   C  CZ    . PHE A 1 133  ? 135.670 124.888 159.208 1.00 0.00   ? 133  PHE A CZ    1 
ATOM   818   N  N     . GLY A 1 134  ? 131.836 130.143 162.774 1.00 0.00   ? 134  GLY A N     1 
ATOM   819   C  CA    . GLY A 1 134  ? 131.157 130.760 163.901 1.00 0.00   ? 134  GLY A CA    1 
ATOM   820   C  C     . GLY A 1 134  ? 131.971 131.053 165.146 1.00 0.00   ? 134  GLY A C     1 
ATOM   821   O  O     . GLY A 1 134  ? 131.539 131.835 165.996 1.00 0.00   ? 134  GLY A O     1 
ATOM   822   N  N     . GLY A 1 135  ? 133.127 130.413 165.273 1.00 0.00   ? 135  GLY A N     1 
ATOM   823   C  CA    . GLY A 1 135  ? 133.970 130.650 166.431 1.00 0.00   ? 135  GLY A CA    1 
ATOM   824   C  C     . GLY A 1 135  ? 134.520 132.054 166.305 1.00 0.00   ? 135  GLY A C     1 
ATOM   825   O  O     . GLY A 1 135  ? 134.926 132.684 167.282 1.00 0.00   ? 135  GLY A O     1 
ATOM   826   N  N     . ARG A 1 136  ? 134.524 132.537 165.066 1.00 0.00   ? 136  ARG A N     1 
ATOM   827   C  CA    . ARG A 1 136  ? 135.006 133.870 164.739 1.00 0.00   ? 136  ARG A CA    1 
ATOM   828   C  C     . ARG A 1 136  ? 133.869 134.614 164.030 1.00 0.00   ? 136  ARG A C     1 
ATOM   829   O  O     . ARG A 1 136  ? 133.571 134.355 162.859 1.00 0.00   ? 136  ARG A O     1 
ATOM   830   C  CB    . ARG A 1 136  ? 136.234 133.766 163.829 1.00 0.00   ? 136  ARG A CB    1 
ATOM   831   C  CG    . ARG A 1 136  ? 137.261 132.734 164.298 1.00 0.00   ? 136  ARG A CG    1 
ATOM   832   C  CD    . ARG A 1 136  ? 138.532 132.788 163.458 1.00 0.00   ? 136  ARG A CD    1 
ATOM   833   N  NE    . ARG A 1 136  ? 139.576 131.885 163.949 1.00 0.00   ? 136  ARG A NE    1 
ATOM   834   C  CZ    . ARG A 1 136  ? 139.538 130.557 163.859 1.00 0.00   ? 136  ARG A CZ    1 
ATOM   835   N  NH1   . ARG A 1 136  ? 138.499 129.954 163.292 1.00 0.00   ? 136  ARG A NH1   1 
ATOM   836   N  NH2   . ARG A 1 136  ? 140.544 129.831 164.331 1.00 0.00   ? 136  ARG A NH2   1 
ATOM   837   N  N     . MET A 1 137  ? 133.236 135.536 164.748 1.00 0.00   ? 137  MET A N     1 
ATOM   838   C  CA    . MET A 1 137  ? 132.115 136.306 164.215 1.00 0.00   ? 137  MET A CA    1 
ATOM   839   C  C     . MET A 1 137  ? 132.403 137.804 164.132 1.00 0.00   ? 137  MET A C     1 
ATOM   840   O  O     . MET A 1 137  ? 133.277 138.323 164.828 1.00 0.00   ? 137  MET A O     1 
ATOM   841   C  CB    . MET A 1 137  ? 130.881 136.076 165.087 1.00 0.00   ? 137  MET A CB    1 
ATOM   842   C  CG    . MET A 1 137  ? 130.542 134.608 165.306 1.00 0.00   ? 137  MET A CG    1 
ATOM   843   S  SD    . MET A 1 137  ? 129.389 134.362 166.662 1.00 0.00   ? 137  MET A SD    1 
ATOM   844   C  CE    . MET A 1 137  ? 130.516 134.407 168.059 1.00 0.00   ? 137  MET A CE    1 
ATOM   845   N  N     . VAL A 1 138  ? 131.654 138.493 163.275 1.00 0.00   ? 138  VAL A N     1 
ATOM   846   C  CA    . VAL A 1 138  ? 131.807 139.933 163.099 1.00 0.00   ? 138  VAL A CA    1 
ATOM   847   C  C     . VAL A 1 138  ? 130.778 140.659 163.959 1.00 0.00   ? 138  VAL A C     1 
ATOM   848   O  O     . VAL A 1 138  ? 129.586 140.371 163.880 1.00 0.00   ? 138  VAL A O     1 
ATOM   849   C  CB    . VAL A 1 138  ? 131.580 140.342 161.628 1.00 0.00   ? 138  VAL A CB    1 
ATOM   850   C  CG1   . VAL A 1 138  ? 131.666 141.853 161.489 1.00 0.00   ? 138  VAL A CG1   1 
ATOM   851   C  CG2   . VAL A 1 138  ? 132.604 139.674 160.734 1.00 0.00   ? 138  VAL A CG2   1 
ATOM   852   N  N     . THR A 1 139  ? 131.232 141.603 164.781 1.00 0.00   ? 139  THR A N     1 
ATOM   853   C  CA    . THR A 1 139  ? 130.310 142.342 165.632 1.00 0.00   ? 139  THR A CA    1 
ATOM   854   C  C     . THR A 1 139  ? 129.945 143.675 165.000 1.00 0.00   ? 139  THR A C     1 
ATOM   855   O  O     . THR A 1 139  ? 130.342 143.968 163.869 1.00 0.00   ? 139  THR A O     1 
ATOM   856   C  CB    . THR A 1 139  ? 130.903 142.603 167.031 1.00 0.00   ? 139  THR A CB    1 
ATOM   857   O  OG1   . THR A 1 139  ? 131.992 143.529 166.928 1.00 0.00   ? 139  THR A OG1   1 
ATOM   858   C  CG2   . THR A 1 139  ? 131.403 141.303 167.646 1.00 0.00   ? 139  THR A CG2   1 
ATOM   859   N  N     . GLU A 1 140  ? 129.194 144.488 165.735 1.00 0.00   ? 140  GLU A N     1 
ATOM   860   C  CA    . GLU A 1 140  ? 128.775 145.789 165.227 1.00 0.00   ? 140  GLU A CA    1 
ATOM   861   C  C     . GLU A 1 140  ? 129.705 146.895 165.705 1.00 0.00   ? 140  GLU A C     1 
ATOM   862   O  O     . GLU A 1 140  ? 129.452 148.074 165.453 1.00 0.00   ? 140  GLU A O     1 
ATOM   863   C  CB    . GLU A 1 140  ? 127.346 146.111 165.679 1.00 0.00   ? 140  GLU A CB    1 
ATOM   864   C  CG    . GLU A 1 140  ? 126.311 145.039 165.375 1.00 0.00   ? 140  GLU A CG    1 
ATOM   865   C  CD    . GLU A 1 140  ? 126.490 143.798 166.225 1.00 0.00   ? 140  GLU A CD    1 
ATOM   866   O  OE1   . GLU A 1 140  ? 127.216 143.864 167.240 1.00 0.00   ? 140  GLU A OE1   1 
ATOM   867   O  OE2   . GLU A 1 140  ? 125.897 142.756 165.885 1.00 0.00   ? 140  GLU A OE2   1 
ATOM   868   N  N     . GLU A 1 141  ? 130.792 146.540 166.367 1.00 0.00   ? 141  GLU A N     1 
ATOM   869   C  CA    . GLU A 1 141  ? 131.702 147.564 166.854 1.00 0.00   ? 141  GLU A CA    1 
ATOM   870   C  C     . GLU A 1 141  ? 132.379 148.359 165.741 1.00 0.00   ? 141  GLU A C     1 
ATOM   871   O  O     . GLU A 1 141  ? 132.407 149.585 165.771 1.00 0.00   ? 141  GLU A O     1 
ATOM   872   C  CB    . GLU A 1 141  ? 132.752 146.947 167.774 1.00 0.00   ? 141  GLU A CB    1 
ATOM   873   C  CG    . GLU A 1 141  ? 132.174 146.369 169.050 1.00 0.00   ? 141  GLU A CG    1 
ATOM   874   C  CD    . GLU A 1 141  ? 131.420 147.401 169.857 1.00 0.00   ? 141  GLU A CD    1 
ATOM   875   O  OE1   . GLU A 1 141  ? 131.888 148.554 169.938 1.00 0.00   ? 141  GLU A OE1   1 
ATOM   876   O  OE2   . GLU A 1 141  ? 130.353 147.061 170.411 1.00 0.00   ? 141  GLU A OE2   1 
ATOM   877   N  N     . CYS A 1 142  ? 132.918 147.655 164.754 1.00 0.00   ? 142  CYS A N     1 
ATOM   878   C  CA    . CYS A 1 142  ? 133.628 148.286 163.652 1.00 0.00   ? 142  CYS A CA    1 
ATOM   879   C  C     . CYS A 1 142  ? 132.775 148.490 162.408 1.00 0.00   ? 142  CYS A C     1 
ATOM   880   O  O     . CYS A 1 142  ? 132.555 147.539 161.663 1.00 0.00   ? 142  CYS A O     1 
ATOM   881   C  CB    . CYS A 1 142  ? 134.828 147.414 163.272 1.00 0.00   ? 142  CYS A CB    1 
ATOM   882   S  SG    . CYS A 1 142  ? 136.250 147.496 164.384 1.00 0.00   ? 142  CYS A SG    1 
ATOM   883   N  N     . PRO A 1 143  ? 132.304 149.711 162.156 1.00 0.00   ? 143  PRO A N     1 
ATOM   884   C  CA    . PRO A 1 143  ? 131.499 149.920 160.954 1.00 0.00   ? 143  PRO A CA    1 
ATOM   885   C  C     . PRO A 1 143  ? 132.395 149.632 159.751 1.00 0.00   ? 143  PRO A C     1 
ATOM   886   O  O     . PRO A 1 143  ? 131.917 149.354 158.651 1.00 0.00   ? 143  PRO A O     1 
ATOM   887   C  CB    . PRO A 1 143  ? 131.090 151.392 161.059 1.00 0.00   ? 143  PRO A CB    1 
ATOM   888   C  CG    . PRO A 1 143  ? 132.239 152.002 161.806 1.00 0.00   ? 143  PRO A CG    1 
ATOM   889   C  CD    . PRO A 1 143  ? 132.528 150.976 162.872 1.00 0.00   ? 143  PRO A CD    1 
ATOM   890   N  N     . LEU A 1 144  ? 133.704 149.679 159.992 1.00 0.00   ? 144  LEU A N     1 
ATOM   891   C  CA    . LEU A 1 144  ? 134.704 149.411 158.966 1.00 0.00   ? 144  LEU A CA    1 
ATOM   892   C  C     . LEU A 1 144  ? 134.791 147.917 158.678 1.00 0.00   ? 144  LEU A C     1 
ATOM   893   O  O     . LEU A 1 144  ? 134.905 147.505 157.523 1.00 0.00   ? 144  LEU A O     1 
ATOM   894   C  CB    . LEU A 1 144  ? 136.079 149.920 159.414 1.00 0.00   ? 144  LEU A CB    1 
ATOM   895   C  CG    . LEU A 1 144  ? 137.262 149.550 158.520 1.00 0.00   ? 144  LEU A CG    1 
ATOM   896   C  CD1   . LEU A 1 144  ? 137.092 150.154 157.131 1.00 0.00   ? 144  LEU A CD1   1 
ATOM   897   C  CD2   . LEU A 1 144  ? 138.544 150.046 159.163 1.00 0.00   ? 144  LEU A CD2   1 
ATOM   898   N  N     . ALA A 1 145  ? 134.743 147.106 159.734 1.00 0.00   ? 145  ALA A N     1 
ATOM   899   C  CA    . ALA A 1 145  ? 134.802 145.658 159.582 1.00 0.00   ? 145  ALA A CA    1 
ATOM   900   C  C     . ALA A 1 145  ? 133.634 145.236 158.707 1.00 0.00   ? 145  ALA A C     1 
ATOM   901   O  O     . ALA A 1 145  ? 133.771 144.367 157.847 1.00 0.00   ? 145  ALA A O     1 
ATOM   902   C  CB    . ALA A 1 145  ? 134.717 144.972 160.947 1.00 0.00   ? 145  ALA A CB    1 
ATOM   903   N  N     . ILE A 1 146  ? 132.482 145.866 158.923 1.00 0.00   ? 146  ILE A N     1 
ATOM   904   C  CA    . ILE A 1 146  ? 131.295 145.556 158.137 1.00 0.00   ? 146  ILE A CA    1 
ATOM   905   C  C     . ILE A 1 146  ? 131.549 145.847 156.666 1.00 0.00   ? 146  ILE A C     1 
ATOM   906   O  O     . ILE A 1 146  ? 131.156 145.074 155.793 1.00 0.00   ? 146  ILE A O     1 
ATOM   907   C  CB    . ILE A 1 146  ? 130.087 146.379 158.608 1.00 0.00   ? 146  ILE A CB    1 
ATOM   908   C  CG1   . ILE A 1 146  ? 129.763 146.020 160.060 1.00 0.00   ? 146  ILE A CG1   1 
ATOM   909   C  CG2   . ILE A 1 146  ? 128.892 146.117 157.698 1.00 0.00   ? 146  ILE A CG2   1 
ATOM   910   C  CD1   . ILE A 1 146  ? 128.576 146.758 160.630 1.00 0.00   ? 146  ILE A CD1   1 
ATOM   911   N  N     . LEU A 1 147  ? 132.202 146.972 156.401 1.00 0.00   ? 147  LEU A N     1 
ATOM   912   C  CA    . LEU A 1 147  ? 132.523 147.366 155.037 1.00 0.00   ? 147  LEU A CA    1 
ATOM   913   C  C     . LEU A 1 147  ? 133.508 146.381 154.427 1.00 0.00   ? 147  LEU A C     1 
ATOM   914   O  O     . LEU A 1 147  ? 133.346 145.949 153.287 1.00 0.00   ? 147  LEU A O     1 
ATOM   915   C  CB    . LEU A 1 147  ? 133.123 148.771 155.006 1.00 0.00   ? 147  LEU A CB    1 
ATOM   916   C  CG    . LEU A 1 147  ? 133.640 149.228 153.639 1.00 0.00   ? 147  LEU A CG    1 
ATOM   917   C  CD1   . LEU A 1 147  ? 132.498 149.257 152.631 1.00 0.00   ? 147  LEU A CD1   1 
ATOM   918   C  CD2   . LEU A 1 147  ? 134.269 150.602 153.769 1.00 0.00   ? 147  LEU A CD2   1 
ATOM   919   N  N     . ILE A 1 148  ? 134.533 146.027 155.195 1.00 0.00   ? 148  ILE A N     1 
ATOM   920   C  CA    . ILE A 1 148  ? 135.543 145.090 154.718 1.00 0.00   ? 148  ILE A CA    1 
ATOM   921   C  C     . ILE A 1 148  ? 134.887 143.761 154.359 1.00 0.00   ? 148  ILE A C     1 
ATOM   922   O  O     . ILE A 1 148  ? 135.225 143.141 153.353 1.00 0.00   ? 148  ILE A O     1 
ATOM   923   C  CB    . ILE A 1 148  ? 136.623 144.844 155.786 1.00 0.00   ? 148  ILE A CB    1 
ATOM   924   C  CG1   . ILE A 1 148  ? 137.328 146.168 156.118 1.00 0.00   ? 148  ILE A CG1   1 
ATOM   925   C  CG2   . ILE A 1 148  ? 137.616 143.803 155.289 1.00 0.00   ? 148  ILE A CG2   1 
ATOM   926   C  CD1   . ILE A 1 148  ? 138.436 146.036 157.143 1.00 0.00   ? 148  ILE A CD1   1 
ATOM   927   N  N     . LEU A 1 149  ? 133.944 143.329 155.194 1.00 0.00   ? 149  LEU A N     1 
ATOM   928   C  CA    . LEU A 1 149  ? 133.228 142.082 154.963 1.00 0.00   ? 149  LEU A CA    1 
ATOM   929   C  C     . LEU A 1 149  ? 132.495 142.143 153.632 1.00 0.00   ? 149  LEU A C     1 
ATOM   930   O  O     . LEU A 1 149  ? 132.519 141.192 152.853 1.00 0.00   ? 149  LEU A O     1 
ATOM   931   C  CB    . LEU A 1 149  ? 132.223 141.829 156.089 1.00 0.00   ? 149  LEU A CB    1 
ATOM   932   C  CG    . LEU A 1 149  ? 131.361 140.573 155.953 1.00 0.00   ? 149  LEU A CG    1 
ATOM   933   C  CD1   . LEU A 1 149  ? 132.244 139.330 155.912 1.00 0.00   ? 149  LEU A CD1   1 
ATOM   934   C  CD2   . LEU A 1 149  ? 130.392 140.503 157.117 1.00 0.00   ? 149  LEU A CD2   1 
ATOM   935   N  N     . ILE A 1 150  ? 131.833 143.268 153.379 1.00 0.00   ? 150  ILE A N     1 
ATOM   936   C  CA    . ILE A 1 150  ? 131.099 143.445 152.134 1.00 0.00   ? 150  ILE A CA    1 
ATOM   937   C  C     . ILE A 1 150  ? 132.051 143.349 150.947 1.00 0.00   ? 150  ILE A C     1 
ATOM   938   O  O     . ILE A 1 150  ? 131.790 142.628 149.984 1.00 0.00   ? 150  ILE A O     1 
ATOM   939   C  CB    . ILE A 1 150  ? 130.388 144.811 152.091 1.00 0.00   ? 150  ILE A CB    1 
ATOM   940   C  CG1   . ILE A 1 150  ? 129.343 144.872 153.216 1.00 0.00   ? 150  ILE A CG1   1 
ATOM   941   C  CG2   . ILE A 1 150  ? 129.750 145.028 150.726 1.00 0.00   ? 150  ILE A CG2   1 
ATOM   942   C  CD1   . ILE A 1 150  ? 128.553 146.165 153.260 1.00 0.00   ? 150  ILE A CD1   1 
ATOM   943   N  N     . VAL A 1 151  ? 133.157 144.082 151.023 1.00 0.00   ? 151  VAL A N     1 
ATOM   944   C  CA    . VAL A 1 151  ? 134.150 144.091 149.957 1.00 0.00   ? 151  VAL A CA    1 
ATOM   945   C  C     . VAL A 1 151  ? 134.755 142.712 149.698 1.00 0.00   ? 151  VAL A C     1 
ATOM   946   O  O     . VAL A 1 151  ? 134.823 142.266 148.555 1.00 0.00   ? 151  VAL A O     1 
ATOM   947   C  CB    . VAL A 1 151  ? 135.280 145.085 150.280 1.00 0.00   ? 151  VAL A CB    1 
ATOM   948   C  CG1   . VAL A 1 151  ? 136.369 145.007 149.219 1.00 0.00   ? 151  VAL A CG1   1 
ATOM   949   C  CG2   . VAL A 1 151  ? 134.713 146.492 150.348 1.00 0.00   ? 151  VAL A CG2   1 
ATOM   950   N  N     . GLN A 1 152  ? 135.193 142.044 150.759 1.00 0.00   ? 152  GLN A N     1 
ATOM   951   C  CA    . GLN A 1 152  ? 135.786 140.720 150.629 1.00 0.00   ? 152  GLN A CA    1 
ATOM   952   C  C     . GLN A 1 152  ? 134.814 139.708 150.025 1.00 0.00   ? 152  GLN A C     1 
ATOM   953   O  O     . GLN A 1 152  ? 135.205 138.900 149.183 1.00 0.00   ? 152  GLN A O     1 
ATOM   954   C  CB    . GLN A 1 152  ? 136.282 140.220 151.990 1.00 0.00   ? 152  GLN A CB    1 
ATOM   955   C  CG    . GLN A 1 152  ? 136.706 138.758 152.005 1.00 0.00   ? 152  GLN A CG    1 
ATOM   956   C  CD    . GLN A 1 152  ? 137.547 138.407 153.216 1.00 0.00   ? 152  GLN A CD    1 
ATOM   957   O  OE1   . GLN A 1 152  ? 137.197 138.744 154.347 1.00 0.00   ? 152  GLN A OE1   1 
ATOM   958   N  NE2   . GLN A 1 152  ? 138.664 137.727 152.985 1.00 0.00   ? 152  GLN A NE2   1 
ATOM   959   N  N     . ASN A 1 153  ? 133.557 139.744 150.451 1.00 0.00   ? 153  ASN A N     1 
ATOM   960   C  CA    . ASN A 1 153  ? 132.570 138.818 149.911 1.00 0.00   ? 153  ASN A CA    1 
ATOM   961   C  C     . ASN A 1 153  ? 132.410 139.025 148.413 1.00 0.00   ? 153  ASN A C     1 
ATOM   962   O  O     . ASN A 1 153  ? 132.439 138.074 147.636 1.00 0.00   ? 153  ASN A O     1 
ATOM   963   C  CB    . ASN A 1 153  ? 131.204 138.993 150.585 1.00 0.00   ? 153  ASN A CB    1 
ATOM   964   C  CG    . ASN A 1 153  ? 131.157 138.377 151.969 1.00 0.00   ? 153  ASN A CG    1 
ATOM   965   O  OD1   . ASN A 1 153  ? 131.865 137.412 152.263 1.00 0.00   ? 153  ASN A OD1   1 
ATOM   966   N  ND2   . ASN A 1 153  ? 130.293 138.918 152.822 1.00 0.00   ? 153  ASN A ND2   1 
ATOM   967   N  N     . ILE A 1 154  ? 132.247 140.279 148.016 1.00 0.00   ? 154  ILE A N     1 
ATOM   968   C  CA    . ILE A 1 154  ? 132.071 140.620 146.612 1.00 0.00   ? 154  ILE A CA    1 
ATOM   969   C  C     . ILE A 1 154  ? 133.286 140.273 145.755 1.00 0.00   ? 154  ILE A C     1 
ATOM   970   O  O     . ILE A 1 154  ? 133.142 139.699 144.678 1.00 0.00   ? 154  ILE A O     1 
ATOM   971   C  CB    . ILE A 1 154  ? 131.760 142.112 146.442 1.00 0.00   ? 154  ILE A CB    1 
ATOM   972   C  CG1   . ILE A 1 154  ? 130.424 142.429 147.123 1.00 0.00   ? 154  ILE A CG1   1 
ATOM   973   C  CG2   . ILE A 1 154  ? 131.720 142.469 144.965 1.00 0.00   ? 154  ILE A CG2   1 
ATOM   974   C  CD1   . ILE A 1 154  ? 129.979 143.866 146.975 1.00 0.00   ? 154  ILE A CD1   1 
ATOM   975   N  N     . VAL A 1 155  ? 134.476 140.633 146.226 1.00 0.00   ? 155  VAL A N     1 
ATOM   976   C  CA    . VAL A 1 155  ? 135.701 140.346 145.487 1.00 0.00   ? 155  VAL A CA    1 
ATOM   977   C  C     . VAL A 1 155  ? 135.852 138.843 145.294 1.00 0.00   ? 155  VAL A C     1 
ATOM   978   O  O     . VAL A 1 155  ? 136.097 138.363 144.183 1.00 0.00   ? 155  VAL A O     1 
ATOM   979   C  CB    . VAL A 1 155  ? 136.940 140.870 146.237 1.00 0.00   ? 155  VAL A CB    1 
ATOM   980   C  CG1   . VAL A 1 155  ? 138.202 140.401 145.537 1.00 0.00   ? 155  VAL A CG1   1 
ATOM   981   C  CG2   . VAL A 1 155  ? 136.906 142.384 146.305 1.00 0.00   ? 155  VAL A CG2   1 
ATOM   982   N  N     . GLY A 1 156  ? 135.726 138.104 146.392 1.00 0.00   ? 156  GLY A N     1 
ATOM   983   C  CA    . GLY A 1 156  ? 135.835 136.659 146.334 1.00 0.00   ? 156  GLY A CA    1 
ATOM   984   C  C     . GLY A 1 156  ? 134.748 136.093 145.444 1.00 0.00   ? 156  GLY A C     1 
ATOM   985   O  O     . GLY A 1 156  ? 134.956 135.119 144.723 1.00 0.00   ? 156  GLY A O     1 
ATOM   986   N  N     . LEU A 1 157  ? 133.577 136.717 145.507 1.00 0.00   ? 157  LEU A N     1 
ATOM   987   C  CA    . LEU A 1 157  ? 132.438 136.300 144.712 1.00 0.00   ? 157  LEU A CA    1 
ATOM   988   C  C     . LEU A 1 157  ? 132.742 136.458 143.226 1.00 0.00   ? 157  LEU A C     1 
ATOM   989   O  O     . LEU A 1 157  ? 132.515 135.544 142.437 1.00 0.00   ? 157  LEU A O     1 
ATOM   990   C  CB    . LEU A 1 157  ? 131.206 137.122 145.081 1.00 0.00   ? 157  LEU A CB    1 
ATOM   991   C  CG    . LEU A 1 157  ? 129.861 136.704 144.483 1.00 0.00   ? 157  LEU A CG    1 
ATOM   992   C  CD1   . LEU A 1 157  ? 128.725 136.993 145.454 1.00 0.00   ? 157  LEU A CD1   1 
ATOM   993   C  CD2   . LEU A 1 157  ? 129.663 137.454 143.186 1.00 0.00   ? 157  LEU A CD2   1 
ATOM   994   N  N     . MET A 1 158  ? 133.257 137.623 142.847 1.00 0.00   ? 158  MET A N     1 
ATOM   995   C  CA    . MET A 1 158  ? 133.598 137.884 141.453 1.00 0.00   ? 158  MET A CA    1 
ATOM   996   C  C     . MET A 1 158  ? 134.681 136.936 140.964 1.00 0.00   ? 158  MET A C     1 
ATOM   997   O  O     . MET A 1 158  ? 134.662 136.498 139.814 1.00 0.00   ? 158  MET A O     1 
ATOM   998   C  CB    . MET A 1 158  ? 134.062 139.332 141.267 1.00 0.00   ? 158  MET A CB    1 
ATOM   999   C  CG    . MET A 1 158  ? 132.941 140.351 141.239 1.00 0.00   ? 158  MET A CG    1 
ATOM   1000  S  SD    . MET A 1 158  ? 131.765 140.026 139.913 1.00 0.00   ? 158  MET A SD    1 
ATOM   1001  C  CE    . MET A 1 158  ? 130.273 140.712 140.608 1.00 0.00   ? 158  MET A CE    1 
ATOM   1002  N  N     . ILE A 1 159  ? 135.632 136.624 141.838 1.00 0.00   ? 159  ILE A N     1 
ATOM   1003  C  CA    . ILE A 1 159  ? 136.711 135.718 141.481 1.00 0.00   ? 159  ILE A CA    1 
ATOM   1004  C  C     . ILE A 1 159  ? 136.142 134.353 141.109 1.00 0.00   ? 159  ILE A C     1 
ATOM   1005  O  O     . ILE A 1 159  ? 136.526 133.775 140.090 1.00 0.00   ? 159  ILE A O     1 
ATOM   1006  C  CB    . ILE A 1 159  ? 137.703 135.545 142.644 1.00 0.00   ? 159  ILE A CB    1 
ATOM   1007  C  CG1   . ILE A 1 159  ? 138.390 136.888 142.928 1.00 0.00   ? 159  ILE A CG1   1 
ATOM   1008  C  CG2   . ILE A 1 159  ? 138.725 134.474 142.303 1.00 0.00   ? 159  ILE A CG2   1 
ATOM   1009  C  CD1   . ILE A 1 159  ? 139.446 136.826 144.005 1.00 0.00   ? 159  ILE A CD1   1 
ATOM   1010  N  N     . ASN A 1 160  ? 135.230 133.842 141.929 1.00 0.00   ? 160  ASN A N     1 
ATOM   1011  C  CA    . ASN A 1 160  ? 134.617 132.545 141.656 1.00 0.00   ? 160  ASN A CA    1 
ATOM   1012  C  C     . ASN A 1 160  ? 133.865 132.565 140.337 1.00 0.00   ? 160  ASN A C     1 
ATOM   1013  O  O     . ASN A 1 160  ? 133.865 131.580 139.594 1.00 0.00   ? 160  ASN A O     1 
ATOM   1014  C  CB    . ASN A 1 160  ? 133.646 132.154 142.772 1.00 0.00   ? 160  ASN A CB    1 
ATOM   1015  C  CG    . ASN A 1 160  ? 134.349 131.808 144.061 1.00 0.00   ? 160  ASN A CG    1 
ATOM   1016  O  OD1   . ASN A 1 160  ? 135.487 131.343 144.050 1.00 0.00   ? 160  ASN A OD1   1 
ATOM   1017  N  ND2   . ASN A 1 160  ? 133.669 132.019 145.185 1.00 0.00   ? 160  ASN A ND2   1 
ATOM   1018  N  N     . ALA A 1 161  ? 133.219 133.692 140.056 1.00 0.00   ? 161  ALA A N     1 
ATOM   1019  C  CA    . ALA A 1 161  ? 132.458 133.856 138.827 1.00 0.00   ? 161  ALA A CA    1 
ATOM   1020  C  C     . ALA A 1 161  ? 133.389 133.757 137.623 1.00 0.00   ? 161  ALA A C     1 
ATOM   1021  O  O     . ALA A 1 161  ? 133.129 133.012 136.679 1.00 0.00   ? 161  ALA A O     1 
ATOM   1022  C  CB    . ALA A 1 161  ? 131.741 135.198 138.837 1.00 0.00   ? 161  ALA A CB    1 
ATOM   1023  N  N     . ILE A 1 162  ? 134.484 134.512 137.666 1.00 0.00   ? 162  ILE A N     1 
ATOM   1024  C  CA    . ILE A 1 162  ? 135.463 134.512 136.586 1.00 0.00   ? 162  ILE A CA    1 
ATOM   1025  C  C     . ILE A 1 162  ? 136.131 133.149 136.457 1.00 0.00   ? 162  ILE A C     1 
ATOM   1026  O  O     . ILE A 1 162  ? 136.328 132.644 135.350 1.00 0.00   ? 162  ILE A O     1 
ATOM   1027  C  CB    . ILE A 1 162  ? 136.550 135.565 136.834 1.00 0.00   ? 162  ILE A CB    1 
ATOM   1028  C  CG1   . ILE A 1 162  ? 135.914 136.959 136.828 1.00 0.00   ? 162  ILE A CG1   1 
ATOM   1029  C  CG2   . ILE A 1 162  ? 137.648 135.441 135.789 1.00 0.00   ? 162  ILE A CG2   1 
ATOM   1030  C  CD1   . ILE A 1 162  ? 136.901 138.081 137.032 1.00 0.00   ? 162  ILE A CD1   1 
ATOM   1031  N  N     . MET A 1 163  ? 136.488 132.564 137.599 1.00 0.00   ? 163  MET A N     1 
ATOM   1032  C  CA    . MET A 1 163  ? 137.143 131.264 137.634 1.00 0.00   ? 163  MET A CA    1 
ATOM   1033  C  C     . MET A 1 163  ? 136.267 130.198 136.987 1.00 0.00   ? 163  MET A C     1 
ATOM   1034  O  O     . MET A 1 163  ? 136.757 129.355 136.238 1.00 0.00   ? 163  MET A O     1 
ATOM   1035  C  CB    . MET A 1 163  ? 137.457 130.884 139.086 1.00 0.00   ? 163  MET A CB    1 
ATOM   1036  C  CG    . MET A 1 163  ? 138.060 129.496 139.286 1.00 0.00   ? 163  MET A CG    1 
ATOM   1037  S  SD    . MET A 1 163  ? 136.856 128.157 139.154 1.00 0.00   ? 163  MET A SD    1 
ATOM   1038  C  CE    . MET A 1 163  ? 136.057 128.259 140.755 1.00 0.00   ? 163  MET A CE    1 
ATOM   1039  N  N     . LEU A 1 164  ? 134.971 130.235 137.282 1.00 0.00   ? 164  LEU A N     1 
ATOM   1040  C  CA    . LEU A 1 164  ? 134.050 129.268 136.702 1.00 0.00   ? 164  LEU A CA    1 
ATOM   1041  C  C     . LEU A 1 164  ? 134.000 129.457 135.194 1.00 0.00   ? 164  LEU A C     1 
ATOM   1042  O  O     . LEU A 1 164  ? 134.120 128.496 134.434 1.00 0.00   ? 164  LEU A O     1 
ATOM   1043  C  CB    . LEU A 1 164  ? 132.654 129.434 137.300 1.00 0.00   ? 164  LEU A CB    1 
ATOM   1044  C  CG    . LEU A 1 164  ? 132.465 128.920 138.724 1.00 0.00   ? 164  LEU A CG    1 
ATOM   1045  C  CD1   . LEU A 1 164  ? 131.042 129.202 139.165 1.00 0.00   ? 164  LEU A CD1   1 
ATOM   1046  C  CD2   . LEU A 1 164  ? 132.753 127.423 138.786 1.00 0.00   ? 164  LEU A CD2   1 
ATOM   1047  N  N     . GLY A 1 165  ? 133.823 130.705 134.772 1.00 0.00   ? 165  GLY A N     1 
ATOM   1048  C  CA    . GLY A 1 165  ? 133.763 131.006 133.355 1.00 0.00   ? 165  GLY A CA    1 
ATOM   1049  C  C     . GLY A 1 165  ? 134.958 130.438 132.613 1.00 0.00   ? 165  GLY A C     1 
ATOM   1050  O  O     . GLY A 1 165  ? 134.811 129.844 131.547 1.00 0.00   ? 165  GLY A O     1 
ATOM   1051  N  N     . CYS A 1 166  ? 136.146 130.617 133.181 1.00 0.00   ? 166  CYS A N     1 
ATOM   1052  C  CA    . CYS A 1 166  ? 137.377 130.120 132.579 1.00 0.00   ? 166  CYS A CA    1 
ATOM   1053  C  C     . CYS A 1 166  ? 137.405 128.601 132.489 1.00 0.00   ? 166  CYS A C     1 
ATOM   1054  O  O     . CYS A 1 166  ? 137.787 128.033 131.467 1.00 0.00   ? 166  CYS A O     1 
ATOM   1055  C  CB    . CYS A 1 166  ? 138.585 130.601 133.384 1.00 0.00   ? 166  CYS A CB    1 
ATOM   1056  S  SG    . CYS A 1 166  ? 138.804 132.386 133.373 1.00 0.00   ? 166  CYS A SG    1 
ATOM   1057  N  N     . ILE A 1 167  ? 137.004 127.945 133.574 1.00 0.00   ? 167  ILE A N     1 
ATOM   1058  C  CA    . ILE A 1 167  ? 136.978 126.489 133.627 1.00 0.00   ? 167  ILE A CA    1 
ATOM   1059  C  C     . ILE A 1 167  ? 136.019 125.897 132.604 1.00 0.00   ? 167  ILE A C     1 
ATOM   1060  O  O     . ILE A 1 167  ? 136.313 124.875 131.982 1.00 0.00   ? 167  ILE A O     1 
ATOM   1061  C  CB    . ILE A 1 167  ? 136.570 126.008 135.027 1.00 0.00   ? 167  ILE A CB    1 
ATOM   1062  C  CG1   . ILE A 1 167  ? 137.668 126.370 136.030 1.00 0.00   ? 167  ILE A CG1   1 
ATOM   1063  C  CG2   . ILE A 1 167  ? 136.314 124.510 135.011 1.00 0.00   ? 167  ILE A CG2   1 
ATOM   1064  C  CD1   . ILE A 1 167  ? 138.999 125.715 135.738 1.00 0.00   ? 167  ILE A CD1   1 
ATOM   1065  N  N     . PHE A 1 168  ? 134.864 126.539 132.443 1.00 0.00   ? 168  PHE A N     1 
ATOM   1066  C  CA    . PHE A 1 168  ? 133.864 126.072 131.487 1.00 0.00   ? 168  PHE A CA    1 
ATOM   1067  C  C     . PHE A 1 168  ? 134.417 126.064 130.066 1.00 0.00   ? 168  PHE A C     1 
ATOM   1068  O  O     . PHE A 1 168  ? 134.264 125.085 129.341 1.00 0.00   ? 168  PHE A O     1 
ATOM   1069  C  CB    . PHE A 1 168  ? 132.623 126.958 131.547 1.00 0.00   ? 168  PHE A CB    1 
ATOM   1070  C  CG    . PHE A 1 168  ? 131.702 126.648 132.697 1.00 0.00   ? 168  PHE A CG    1 
ATOM   1071  C  CD1   . PHE A 1 168  ? 132.185 126.545 134.001 1.00 0.00   ? 168  PHE A CD1   1 
ATOM   1072  C  CD2   . PHE A 1 168  ? 130.335 126.509 132.483 1.00 0.00   ? 168  PHE A CD2   1 
ATOM   1073  C  CE1   . PHE A 1 168  ? 131.319 126.313 135.070 1.00 0.00   ? 168  PHE A CE1   1 
ATOM   1074  C  CE2   . PHE A 1 168  ? 129.465 126.279 133.544 1.00 0.00   ? 168  PHE A CE2   1 
ATOM   1075  C  CZ    . PHE A 1 168  ? 129.954 126.181 134.839 1.00 0.00   ? 168  PHE A CZ    1 
ATOM   1076  N  N     . MET A 1 169  ? 135.054 127.159 129.667 1.00 0.00   ? 169  MET A N     1 
ATOM   1077  C  CA    . MET A 1 169  ? 135.620 127.256 128.325 1.00 0.00   ? 169  MET A CA    1 
ATOM   1078  C  C     . MET A 1 169  ? 136.735 126.236 128.120 1.00 0.00   ? 169  MET A C     1 
ATOM   1079  O  O     . MET A 1 169  ? 136.970 125.779 127.001 1.00 0.00   ? 169  MET A O     1 
ATOM   1080  C  CB    . MET A 1 169  ? 136.161 128.665 128.066 1.00 0.00   ? 169  MET A CB    1 
ATOM   1081  C  CG    . MET A 1 169  ? 135.113 129.767 128.146 1.00 0.00   ? 169  MET A CG    1 
ATOM   1082  S  SD    . MET A 1 169  ? 135.758 131.382 127.645 1.00 0.00   ? 169  MET A SD    1 
ATOM   1083  C  CE    . MET A 1 169  ? 136.213 132.093 129.234 1.00 0.00   ? 169  MET A CE    1 
ATOM   1084  N  N     . LYS A 1 170  ? 137.430 125.887 129.199 1.00 0.00   ? 170  LYS A N     1 
ATOM   1085  C  CA    . LYS A 1 170  ? 138.511 124.911 129.100 1.00 0.00   ? 170  LYS A CA    1 
ATOM   1086  C  C     . LYS A 1 170  ? 137.929 123.524 128.868 1.00 0.00   ? 170  LYS A C     1 
ATOM   1087  O  O     . LYS A 1 170  ? 138.492 122.721 128.123 1.00 0.00   ? 170  LYS A O     1 
ATOM   1088  C  CB    . LYS A 1 170  ? 139.372 124.897 130.369 1.00 0.00   ? 170  LYS A CB    1 
ATOM   1089  C  CG    . LYS A 1 170  ? 140.276 126.111 130.532 1.00 0.00   ? 170  LYS A CG    1 
ATOM   1090  C  CD    . LYS A 1 170  ? 141.378 125.840 131.552 1.00 0.00   ? 170  LYS A CD    1 
ATOM   1091  C  CE    . LYS A 1 170  ? 142.379 124.824 131.020 1.00 0.00   ? 170  LYS A CE    1 
ATOM   1092  N  NZ    . LYS A 1 170  ? 143.027 125.295 129.767 1.00 0.00   ? 170  LYS A NZ    1 
ATOM   1093  N  N     . THR A 1 171  ? 136.798 123.248 129.511 1.00 0.00   ? 171  THR A N     1 
ATOM   1094  C  CA    . THR A 1 171  ? 136.135 121.958 129.365 1.00 0.00   ? 171  THR A CA    1 
ATOM   1095  C  C     . THR A 1 171  ? 135.498 121.866 127.984 1.00 0.00   ? 171  THR A C     1 
ATOM   1096  O  O     . THR A 1 171  ? 134.970 120.821 127.601 1.00 0.00   ? 171  THR A O     1 
ATOM   1097  C  CB    . THR A 1 171  ? 135.033 121.779 130.423 1.00 0.00   ? 171  THR A CB    1 
ATOM   1098  O  OG1   . THR A 1 171  ? 134.076 122.838 130.300 1.00 0.00   ? 171  THR A OG1   1 
ATOM   1099  C  CG2   . THR A 1 171  ? 135.627 121.804 131.820 1.00 0.00   ? 171  THR A CG2   1 
ATOM   1100  N  N     . ALA A 1 172  ? 135.549 122.965 127.244 1.00 0.00   ? 172  ALA A N     1 
ATOM   1101  C  CA    . ALA A 1 172  ? 134.971 123.014 125.911 1.00 0.00   ? 172  ALA A CA    1 
ATOM   1102  C  C     . ALA A 1 172  ? 136.060 122.983 124.847 1.00 0.00   ? 172  ALA A C     1 
ATOM   1103  O  O     . ALA A 1 172  ? 135.780 123.139 123.657 1.00 0.00   ? 172  ALA A O     1 
ATOM   1104  C  CB    . ALA A 1 172  ? 134.125 124.271 125.762 1.00 0.00   ? 172  ALA A CB    1 
ATOM   1105  N  N     . GLN A 1 173  ? 137.304 122.779 125.280 1.00 0.00   ? 173  GLN A N     1 
ATOM   1106  C  CA    . GLN A 1 173  ? 138.431 122.717 124.360 1.00 0.00   ? 173  GLN A CA    1 
ATOM   1107  C  C     . GLN A 1 173  ? 138.306 121.465 123.501 1.00 0.00   ? 173  GLN A C     1 
ATOM   1108  O  O     . GLN A 1 173  ? 138.885 120.418 123.804 1.00 0.00   ? 173  GLN A O     1 
ATOM   1109  C  CB    . GLN A 1 173  ? 139.754 122.716 125.139 1.00 0.00   ? 173  GLN A CB    1 
ATOM   1110  C  CG    . GLN A 1 173  ? 140.081 124.064 125.766 1.00 0.00   ? 173  GLN A CG    1 
ATOM   1111  C  CD    . GLN A 1 173  ? 140.097 125.173 124.736 1.00 0.00   ? 173  GLN A CD    1 
ATOM   1112  O  OE1   . GLN A 1 173  ? 140.964 125.217 123.865 1.00 0.00   ? 173  GLN A OE1   1 
ATOM   1113  N  NE2   . GLN A 1 173  ? 139.120 126.070 124.820 1.00 0.00   ? 173  GLN A NE2   1 
ATOM   1114  N  N     . ALA A 1 174  ? 137.540 121.587 122.426 1.00 0.00   ? 174  ALA A N     1 
ATOM   1115  C  CA    . ALA A 1 174  ? 137.297 120.473 121.526 1.00 0.00   ? 174  ALA A CA    1 
ATOM   1116  C  C     . ALA A 1 174  ? 138.480 120.086 120.646 1.00 0.00   ? 174  ALA A C     1 
ATOM   1117  O  O     . ALA A 1 174  ? 138.353 119.181 119.813 1.00 0.00   ? 174  ALA A O     1 
ATOM   1118  C  CB    . ALA A 1 174  ? 136.082 120.779 120.660 1.00 0.00   ? 174  ALA A CB    1 
ATOM   1119  N  N     . HIS A 1 175  ? 139.630 120.739 120.815 1.00 0.00   ? 175  HIS A N     1 
ATOM   1120  C  CA    . HIS A 1 175  ? 140.773 120.387 119.982 1.00 0.00   ? 175  HIS A CA    1 
ATOM   1121  C  C     . HIS A 1 175  ? 141.166 118.942 120.269 1.00 0.00   ? 175  HIS A C     1 
ATOM   1122  O  O     . HIS A 1 175  ? 141.823 118.295 119.456 1.00 0.00   ? 175  HIS A O     1 
ATOM   1123  C  CB    . HIS A 1 175  ? 141.973 121.305 120.243 1.00 0.00   ? 175  HIS A CB    1 
ATOM   1124  C  CG    . HIS A 1 175  ? 142.630 121.094 121.573 1.00 0.00   ? 175  HIS A CG    1 
ATOM   1125  N  ND1   . HIS A 1 175  ? 142.121 121.604 122.748 1.00 0.00   ? 175  HIS A ND1   1 
ATOM   1126  C  CD2   . HIS A 1 175  ? 143.753 120.418 121.919 1.00 0.00   ? 175  HIS A CD2   1 
ATOM   1127  C  CE1   . HIS A 1 175  ? 142.897 121.252 123.756 1.00 0.00   ? 175  HIS A CE1   1 
ATOM   1128  N  NE2   . HIS A 1 175  ? 143.894 120.529 123.282 1.00 0.00   ? 175  HIS A NE2   1 
ATOM   1129  N  N     . ARG A 1 176  ? 140.745 118.440 121.422 1.00 0.00   ? 176  ARG A N     1 
ATOM   1130  C  CA    . ARG A 1 176  ? 141.033 117.065 121.801 1.00 0.00   ? 176  ARG A CA    1 
ATOM   1131  C  C     . ARG A 1 176  ? 140.360 116.110 120.819 1.00 0.00   ? 176  ARG A C     1 
ATOM   1132  O  O     . ARG A 1 176  ? 140.815 114.977 120.631 1.00 0.00   ? 176  ARG A O     1 
ATOM   1133  C  CB    . ARG A 1 176  ? 140.541 116.795 123.219 1.00 0.00   ? 176  ARG A CB    1 
ATOM   1134  C  CG    . ARG A 1 176  ? 141.411 117.451 124.282 1.00 0.00   ? 176  ARG A CG    1 
ATOM   1135  C  CD    . ARG A 1 176  ? 142.819 116.874 124.238 1.00 0.00   ? 176  ARG A CD    1 
ATOM   1136  N  NE    . ARG A 1 176  ? 143.713 117.487 125.215 1.00 0.00   ? 176  ARG A NE    1 
ATOM   1137  C  CZ    . ARG A 1 176  ? 145.012 117.222 125.303 1.00 0.00   ? 176  ARG A CZ    1 
ATOM   1138  N  NH1   . ARG A 1 176  ? 145.570 116.350 124.469 1.00 0.00   ? 176  ARG A NH1   1 
ATOM   1139  N  NH2   . ARG A 1 176  ? 145.756 117.827 126.218 1.00 0.00   ? 176  ARG A NH2   1 
ATOM   1140  N  N     . ARG A 1 177  ? 139.277 116.572 120.199 1.00 0.00   ? 177  ARG A N     1 
ATOM   1141  C  CA    . ARG A 1 177  ? 138.556 115.772 119.217 1.00 0.00   ? 177  ARG A CA    1 
ATOM   1142  C  C     . ARG A 1 177  ? 139.300 115.851 117.893 1.00 0.00   ? 177  ARG A C     1 
ATOM   1143  O  O     . ARG A 1 177  ? 139.216 114.946 117.069 1.00 0.00   ? 177  ARG A O     1 
ATOM   1144  C  CB    . ARG A 1 177  ? 137.122 116.283 119.036 1.00 0.00   ? 177  ARG A CB    1 
ATOM   1145  C  CG    . ARG A 1 177  ? 136.114 115.690 120.017 1.00 0.00   ? 177  ARG A CG    1 
ATOM   1146  C  CD    . ARG A 1 177  ? 136.162 114.155 120.018 1.00 0.00   ? 177  ARG A CD    1 
ATOM   1147  N  NE    . ARG A 1 177  ? 135.944 113.580 118.691 1.00 0.00   ? 177  ARG A NE    1 
ATOM   1148  C  CZ    . ARG A 1 177  ? 134.757 113.495 118.092 1.00 0.00   ? 177  ARG A CZ    1 
ATOM   1149  N  NH1   . ARG A 1 177  ? 133.667 113.947 118.698 1.00 0.00   ? 177  ARG A NH1   1 
ATOM   1150  N  NH2   . ARG A 1 177  ? 134.664 112.972 116.876 1.00 0.00   ? 177  ARG A NH2   1 
ATOM   1151  N  N     . ALA A 1 178  ? 140.029 116.945 117.698 1.00 0.00   ? 178  ALA A N     1 
ATOM   1152  C  CA    . ALA A 1 178  ? 140.799 117.134 116.484 1.00 0.00   ? 178  ALA A CA    1 
ATOM   1153  C  C     . ALA A 1 178  ? 141.868 116.040 116.411 1.00 0.00   ? 178  ALA A C     1 
ATOM   1154  O  O     . ALA A 1 178  ? 142.256 115.608 115.326 1.00 0.00   ? 178  ALA A O     1 
ATOM   1155  C  CB    . ALA A 1 178  ? 141.446 118.509 116.481 1.00 0.00   ? 178  ALA A CB    1 
ATOM   1156  N  N     . GLU A 1 179  ? 142.335 115.597 117.577 1.00 0.00   ? 179  GLU A N     1 
ATOM   1157  C  CA    . GLU A 1 179  ? 143.352 114.558 117.651 1.00 0.00   ? 179  GLU A CA    1 
ATOM   1158  C  C     . GLU A 1 179  ? 142.774 113.190 117.295 1.00 0.00   ? 179  GLU A C     1 
ATOM   1159  O  O     . GLU A 1 179  ? 143.517 112.247 117.022 1.00 0.00   ? 179  GLU A O     1 
ATOM   1160  C  CB    . GLU A 1 179  ? 143.949 114.501 119.060 1.00 0.00   ? 179  GLU A CB    1 
ATOM   1161  C  CG    . GLU A 1 179  ? 144.495 115.822 119.569 1.00 0.00   ? 179  GLU A CG    1 
ATOM   1162  C  CD    . GLU A 1 179  ? 145.189 115.679 120.911 1.00 0.00   ? 179  GLU A CD    1 
ATOM   1163  O  OE1   . GLU A 1 179  ? 144.543 115.213 121.876 1.00 0.00   ? 179  GLU A OE1   1 
ATOM   1164  O  OE2   . GLU A 1 179  ? 146.385 116.036 121.009 1.00 0.00   ? 179  GLU A OE2   1 
ATOM   1165  N  N     . THR A 1 180  ? 141.450 113.080 117.302 1.00 0.00   ? 180  THR A N     1 
ATOM   1166  C  CA    . THR A 1 180  ? 140.800 111.812 116.984 1.00 0.00   ? 180  THR A CA    1 
ATOM   1167  C  C     . THR A 1 180  ? 140.591 111.654 115.482 1.00 0.00   ? 180  THR A C     1 
ATOM   1168  O  O     . THR A 1 180  ? 140.153 110.600 115.017 1.00 0.00   ? 180  THR A O     1 
ATOM   1169  C  CB    . THR A 1 180  ? 139.438 111.681 117.687 1.00 0.00   ? 180  THR A CB    1 
ATOM   1170  O  OG1   . THR A 1 180  ? 138.519 112.642 117.148 1.00 0.00   ? 180  THR A OG1   1 
ATOM   1171  C  CG2   . THR A 1 180  ? 139.584 111.918 119.181 1.00 0.00   ? 180  THR A CG2   1 
ATOM   1172  N  N     . LEU A 1 181  ? 140.901 112.701 114.724 1.00 0.00   ? 181  LEU A N     1 
ATOM   1173  C  CA    . LEU A 1 181  ? 140.739 112.666 113.274 1.00 0.00   ? 181  LEU A CA    1 
ATOM   1174  C  C     . LEU A 1 181  ? 141.992 112.115 112.607 1.00 0.00   ? 181  LEU A C     1 
ATOM   1175  O  O     . LEU A 1 181  ? 143.112 112.487 112.955 1.00 0.00   ? 181  LEU A O     1 
ATOM   1176  C  CB    . LEU A 1 181  ? 140.430 114.066 112.747 1.00 0.00   ? 181  LEU A CB    1 
ATOM   1177  C  CG    . LEU A 1 181  ? 139.118 114.629 113.306 1.00 0.00   ? 181  LEU A CG    1 
ATOM   1178  C  CD1   . LEU A 1 181  ? 138.899 116.036 112.792 1.00 0.00   ? 181  LEU A CD1   1 
ATOM   1179  C  CD2   . LEU A 1 181  ? 137.963 113.726 112.908 1.00 0.00   ? 181  LEU A CD2   1 
ATOM   1180  N  N     . ILE A 1 182  ? 141.793 111.228 111.641 1.00 0.00   ? 182  ILE A N     1 
ATOM   1181  C  CA    . ILE A 1 182  ? 142.907 110.588 110.957 1.00 0.00   ? 182  ILE A CA    1 
ATOM   1182  C  C     . ILE A 1 182  ? 143.103 110.976 109.498 1.00 0.00   ? 182  ILE A C     1 
ATOM   1183  O  O     . ILE A 1 182  ? 142.144 111.123 108.740 1.00 0.00   ? 182  ILE A O     1 
ATOM   1184  C  CB    . ILE A 1 182  ? 142.766 109.059 111.014 1.00 0.00   ? 182  ILE A CB    1 
ATOM   1185  C  CG1   . ILE A 1 182  ? 142.674 108.613 112.478 1.00 0.00   ? 182  ILE A CG1   1 
ATOM   1186  C  CG2   . ILE A 1 182  ? 143.946 108.399 110.313 1.00 0.00   ? 182  ILE A CG2   1 
ATOM   1187  C  CD1   . ILE A 1 182  ? 143.870 109.002 113.318 1.00 0.00   ? 182  ILE A CD1   1 
ATOM   1188  N  N     . PHE A 1 183  ? 144.372 111.133 109.131 1.00 0.00   ? 183  PHE A N     1 
ATOM   1189  C  CA    . PHE A 1 183  ? 144.773 111.459 107.770 1.00 0.00   ? 183  PHE A CA    1 
ATOM   1190  C  C     . PHE A 1 183  ? 145.875 110.470 107.423 1.00 0.00   ? 183  PHE A C     1 
ATOM   1191  O  O     . PHE A 1 183  ? 146.874 110.370 108.136 1.00 0.00   ? 183  PHE A O     1 
ATOM   1192  C  CB    . PHE A 1 183  ? 145.325 112.883 107.682 1.00 0.00   ? 183  PHE A CB    1 
ATOM   1193  C  CG    . PHE A 1 183  ? 144.277 113.947 107.807 1.00 0.00   ? 183  PHE A CG    1 
ATOM   1194  C  CD1   . PHE A 1 183  ? 143.920 114.452 109.055 1.00 0.00   ? 183  PHE A CD1   1 
ATOM   1195  C  CD2   . PHE A 1 183  ? 143.650 114.458 106.676 1.00 0.00   ? 183  PHE A CD2   1 
ATOM   1196  C  CE1   . PHE A 1 183  ? 142.954 115.451 109.169 1.00 0.00   ? 183  PHE A CE1   1 
ATOM   1197  C  CE2   . PHE A 1 183  ? 142.684 115.452 106.782 1.00 0.00   ? 183  PHE A CE2   1 
ATOM   1198  C  CZ    . PHE A 1 183  ? 142.334 115.953 108.028 1.00 0.00   ? 183  PHE A CZ    1 
ATOM   1199  N  N     . SER A 1 184  ? 145.749 109.825 106.274 1.00 0.00   ? 184  SER A N     1 
ATOM   1200  C  CA    . SER A 1 184  ? 146.753 108.870 105.860 1.00 0.00   ? 184  SER A CA    1 
ATOM   1201  C  C     . SER A 1 184  ? 148.063 109.615 105.749 1.00 0.00   ? 184  SER A C     1 
ATOM   1202  O  O     . SER A 1 184  ? 148.103 110.781 105.367 1.00 0.00   ? 184  SER A O     1 
ATOM   1203  C  CB    . SER A 1 184  ? 146.400 108.282 104.502 1.00 0.00   ? 184  SER A CB    1 
ATOM   1204  O  OG    . SER A 1 184  ? 146.670 109.213 103.474 1.00 0.00   ? 184  SER A OG    1 
ATOM   1205  N  N     . LYS A 1 185  ? 149.153 108.934 106.073 1.00 0.00   ? 185  LYS A N     1 
ATOM   1206  C  CA    . LYS A 1 185  ? 150.456 109.569 106.046 1.00 0.00   ? 185  LYS A CA    1 
ATOM   1207  C  C     . LYS A 1 185  ? 150.811 110.082 104.657 1.00 0.00   ? 185  LYS A C     1 
ATOM   1208  O  O     . LYS A 1 185  ? 151.355 111.171 104.528 1.00 0.00   ? 185  LYS A O     1 
ATOM   1209  C  CB    . LYS A 1 185  ? 151.527 108.599 106.538 1.00 0.00   ? 185  LYS A CB    1 
ATOM   1210  C  CG    . LYS A 1 185  ? 152.900 109.230 106.677 1.00 0.00   ? 185  LYS A CG    1 
ATOM   1211  C  CD    . LYS A 1 185  ? 154.003 108.189 106.688 1.00 0.00   ? 185  LYS A CD    1 
ATOM   1212  C  CE    . LYS A 1 185  ? 153.742 107.141 107.753 1.00 0.00   ? 185  LYS A CE    1 
ATOM   1213  N  NZ    . LYS A 1 185  ? 154.873 106.186 107.889 1.00 0.00   ? 185  LYS A NZ    1 
ATOM   1214  N  N     . HIS A 1 186  ? 150.493 109.318 103.618 1.00 0.00   ? 186  HIS A N     1 
ATOM   1215  C  CA    . HIS A 1 186  ? 150.796 109.760 102.261 1.00 0.00   ? 186  HIS A CA    1 
ATOM   1216  C  C     . HIS A 1 186  ? 149.590 109.712 101.325 1.00 0.00   ? 186  HIS A C     1 
ATOM   1217  O  O     . HIS A 1 186  ? 148.729 108.845 101.446 1.00 0.00   ? 186  HIS A O     1 
ATOM   1218  C  CB    . HIS A 1 186  ? 151.960 108.970 101.680 1.00 0.00   ? 186  HIS A CB    1 
ATOM   1219  C  CG    . HIS A 1 186  ? 151.700 107.502 101.578 1.00 0.00   ? 186  HIS A CG    1 
ATOM   1220  N  ND1   . HIS A 1 186  ? 150.929 106.954 100.579 1.00 0.00   ? 186  HIS A ND1   1 
ATOM   1221  C  CD2   . HIS A 1 186  ? 152.100 106.470 102.359 1.00 0.00   ? 186  HIS A CD2   1 
ATOM   1222  C  CE1   . HIS A 1 186  ? 150.868 105.645 100.745 1.00 0.00   ? 186  HIS A CE1   1 
ATOM   1223  N  NE2   . HIS A 1 186  ? 151.568 105.325 101.815 1.00 0.00   ? 186  HIS A NE2   1 
ATOM   1224  N  N     . ALA A 1 187  ? 149.551 110.655 100.393 1.00 0.00   ? 187  ALA A N     1 
ATOM   1225  C  CA    . ALA A 1 187  ? 148.472 110.767 99.419  1.00 0.00   ? 187  ALA A CA    1 
ATOM   1226  C  C     . ALA A 1 187  ? 148.994 110.321 98.070  1.00 0.00   ? 187  ALA A C     1 
ATOM   1227  O  O     . ALA A 1 187  ? 150.141 110.594 97.718  1.00 0.00   ? 187  ALA A O     1 
ATOM   1228  C  CB    . ALA A 1 187  ? 147.957 112.192 99.351  1.00 0.00   ? 187  ALA A CB    1 
ATOM   1229  N  N     . VAL A 1 188  ? 148.151 109.638 97.310  1.00 0.00   ? 188  VAL A N     1 
ATOM   1230  C  CA    . VAL A 1 188  ? 148.564 109.088 96.029  1.00 0.00   ? 188  VAL A CA    1 
ATOM   1231  C  C     . VAL A 1 188  ? 148.005 109.822 94.823  1.00 0.00   ? 188  VAL A C     1 
ATOM   1232  O  O     . VAL A 1 188  ? 147.048 110.593 94.925  1.00 0.00   ? 188  VAL A O     1 
ATOM   1233  C  CB    . VAL A 1 188  ? 148.187 107.589 95.906  1.00 0.00   ? 188  VAL A CB    1 
ATOM   1234  C  CG1   . VAL A 1 188  ? 148.788 106.818 97.064  1.00 0.00   ? 188  VAL A CG1   1 
ATOM   1235  C  CG2   . VAL A 1 188  ? 146.674 107.424 95.864  1.00 0.00   ? 188  VAL A CG2   1 
ATOM   1236  N  N     . ILE A 1 189  ? 148.635 109.572 93.682  1.00 0.00   ? 189  ILE A N     1 
ATOM   1237  C  CA    . ILE A 1 189  ? 148.236 110.159 92.413  1.00 0.00   ? 189  ILE A CA    1 
ATOM   1238  C  C     . ILE A 1 189  ? 147.927 109.007 91.476  1.00 0.00   ? 189  ILE A C     1 
ATOM   1239  O  O     . ILE A 1 189  ? 148.824 108.260 91.075  1.00 0.00   ? 189  ILE A O     1 
ATOM   1240  C  CB    . ILE A 1 189  ? 149.367 111.010 91.792  1.00 0.00   ? 189  ILE A CB    1 
ATOM   1241  C  CG1   . ILE A 1 189  ? 149.619 112.258 92.646  1.00 0.00   ? 189  ILE A CG1   1 
ATOM   1242  C  CG2   . ILE A 1 189  ? 148.995 111.401 90.367  1.00 0.00   ? 189  ILE A CG2   1 
ATOM   1243  C  CD1   . ILE A 1 189  ? 150.643 113.213 92.054  1.00 0.00   ? 189  ILE A CD1   1 
ATOM   1244  N  N     . THR A 1 190  ? 146.652 108.853 91.132  1.00 0.00   ? 190  THR A N     1 
ATOM   1245  C  CA    . THR A 1 190  ? 146.225 107.776 90.245  1.00 0.00   ? 190  THR A CA    1 
ATOM   1246  C  C     . THR A 1 190  ? 145.080 108.241 89.357  1.00 0.00   ? 190  THR A C     1 
ATOM   1247  O  O     . THR A 1 190  ? 144.373 109.200 89.690  1.00 0.00   ? 190  THR A O     1 
ATOM   1248  C  CB    . THR A 1 190  ? 145.766 106.556 91.067  1.00 0.00   ? 190  THR A CB    1 
ATOM   1249  O  OG1   . THR A 1 190  ? 145.309 105.526 90.185  1.00 0.00   ? 190  THR A OG1   1 
ATOM   1250  C  CG2   . THR A 1 190  ? 144.636 106.940 92.017  1.00 0.00   ? 190  THR A CG2   1 
ATOM   1251  N  N     . PRO A 1 191  ? 144.887 107.586 88.203  1.00 0.00   ? 191  PRO A N     1 
ATOM   1252  C  CA    . PRO A 1 191  ? 143.790 108.005 87.335  1.00 0.00   ? 191  PRO A CA    1 
ATOM   1253  C  C     . PRO A 1 191  ? 142.497 107.317 87.749  1.00 0.00   ? 191  PRO A C     1 
ATOM   1254  O  O     . PRO A 1 191  ? 142.505 106.150 88.143  1.00 0.00   ? 191  PRO A O     1 
ATOM   1255  C  CB    . PRO A 1 191  ? 144.261 107.555 85.963  1.00 0.00   ? 191  PRO A CB    1 
ATOM   1256  C  CG    . PRO A 1 191  ? 144.880 106.237 86.289  1.00 0.00   ? 191  PRO A CG    1 
ATOM   1257  C  CD    . PRO A 1 191  ? 145.698 106.553 87.539  1.00 0.00   ? 191  PRO A CD    1 
ATOM   1258  N  N     . ARG A 1 192  ? 141.394 108.052 87.680  1.00 0.00   ? 192  ARG A N     1 
ATOM   1259  C  CA    . ARG A 1 192  ? 140.093 107.514 88.029  1.00 0.00   ? 192  ARG A CA    1 
ATOM   1260  C  C     . ARG A 1 192  ? 139.150 108.001 86.945  1.00 0.00   ? 192  ARG A C     1 
ATOM   1261  O  O     . ARG A 1 192  ? 139.075 109.198 86.675  1.00 0.00   ? 192  ARG A O     1 
ATOM   1262  C  CB    . ARG A 1 192  ? 139.636 108.029 89.392  1.00 0.00   ? 192  ARG A CB    1 
ATOM   1263  C  CG    . ARG A 1 192  ? 138.277 107.496 89.810  1.00 0.00   ? 192  ARG A CG    1 
ATOM   1264  C  CD    . ARG A 1 192  ? 137.753 108.151 91.077  1.00 0.00   ? 192  ARG A CD    1 
ATOM   1265  N  NE    . ARG A 1 192  ? 138.208 107.499 92.302  1.00 0.00   ? 192  ARG A NE    1 
ATOM   1266  C  CZ    . ARG A 1 192  ? 137.647 107.688 93.493  1.00 0.00   ? 192  ARG A CZ    1 
ATOM   1267  N  NH1   . ARG A 1 192  ? 136.612 108.511 93.612  1.00 0.00   ? 192  ARG A NH1   1 
ATOM   1268  N  NH2   . ARG A 1 192  ? 138.110 107.055 94.562  1.00 0.00   ? 192  ARG A NH2   1 
ATOM   1269  N  N     . HIS A 1 193  ? 138.433 107.074 86.322  1.00 0.00   ? 193  HIS A N     1 
ATOM   1270  C  CA    . HIS A 1 193  ? 137.520 107.419 85.236  1.00 0.00   ? 193  HIS A CA    1 
ATOM   1271  C  C     . HIS A 1 193  ? 138.324 108.057 84.112  1.00 0.00   ? 193  HIS A C     1 
ATOM   1272  O  O     . HIS A 1 193  ? 137.836 108.938 83.405  1.00 0.00   ? 193  HIS A O     1 
ATOM   1273  C  CB    . HIS A 1 193  ? 136.441 108.380 85.731  1.00 0.00   ? 193  HIS A CB    1 
ATOM   1274  C  CG    . HIS A 1 193  ? 135.560 107.796 86.794  1.00 0.00   ? 193  HIS A CG    1 
ATOM   1275  N  ND1   . HIS A 1 193  ? 134.851 106.626 86.614  1.00 0.00   ? 193  HIS A ND1   1 
ATOM   1276  C  CD2   . HIS A 1 193  ? 135.280 108.208 88.054  1.00 0.00   ? 193  HIS A CD2   1 
ATOM   1277  C  CE1   . HIS A 1 193  ? 134.180 106.342 87.712  1.00 0.00   ? 193  HIS A CE1   1 
ATOM   1278  N  NE2   . HIS A 1 193  ? 134.424 107.286 88.607  1.00 0.00   ? 193  HIS A NE2   1 
ATOM   1279  N  N     . GLY A 1 194  ? 139.565 107.606 83.960  1.00 0.00   ? 194  GLY A N     1 
ATOM   1280  C  CA    . GLY A 1 194  ? 140.423 108.125 82.913  1.00 0.00   ? 194  GLY A CA    1 
ATOM   1281  C  C     . GLY A 1 194  ? 141.126 109.433 83.223  1.00 0.00   ? 194  GLY A C     1 
ATOM   1282  O  O     . GLY A 1 194  ? 142.005 109.851 82.474  1.00 0.00   ? 194  GLY A O     1 
ATOM   1283  N  N     . ARG A 1 195  ? 140.744 110.083 84.318  1.00 0.00   ? 195  ARG A N     1 
ATOM   1284  C  CA    . ARG A 1 195  ? 141.352 111.354 84.705  1.00 0.00   ? 195  ARG A CA    1 
ATOM   1285  C  C     . ARG A 1 195  ? 142.339 111.217 85.859  1.00 0.00   ? 195  ARG A C     1 
ATOM   1286  O  O     . ARG A 1 195  ? 142.031 110.615 86.889  1.00 0.00   ? 195  ARG A O     1 
ATOM   1287  C  CB    . ARG A 1 195  ? 140.270 112.372 85.090  1.00 0.00   ? 195  ARG A CB    1 
ATOM   1288  C  CG    . ARG A 1 195  ? 139.354 112.774 83.943  1.00 0.00   ? 195  ARG A CG    1 
ATOM   1289  C  CD    . ARG A 1 195  ? 140.153 113.360 82.786  1.00 0.00   ? 195  ARG A CD    1 
ATOM   1290  N  NE    . ARG A 1 195  ? 140.820 114.607 83.148  1.00 0.00   ? 195  ARG A NE    1 
ATOM   1291  C  CZ    . ARG A 1 195  ? 140.194 115.770 83.301  1.00 0.00   ? 195  ARG A CZ    1 
ATOM   1292  N  NH1   . ARG A 1 195  ? 138.881 115.857 83.123  1.00 0.00   ? 195  ARG A NH1   1 
ATOM   1293  N  NH2   . ARG A 1 195  ? 140.885 116.854 83.633  1.00 0.00   ? 195  ARG A NH2   1 
ATOM   1294  N  N     . LEU A 1 196  ? 143.527 111.785 85.681  1.00 0.00   ? 196  LEU A N     1 
ATOM   1295  C  CA    . LEU A 1 196  ? 144.555 111.737 86.708  1.00 0.00   ? 196  LEU A CA    1 
ATOM   1296  C  C     . LEU A 1 196  ? 144.069 112.530 87.918  1.00 0.00   ? 196  LEU A C     1 
ATOM   1297  O  O     . LEU A 1 196  ? 143.666 113.685 87.784  1.00 0.00   ? 196  LEU A O     1 
ATOM   1298  C  CB    . LEU A 1 196  ? 145.853 112.345 86.179  1.00 0.00   ? 196  LEU A CB    1 
ATOM   1299  C  CG    . LEU A 1 196  ? 147.091 112.128 87.051  1.00 0.00   ? 196  LEU A CG    1 
ATOM   1300  C  CD1   . LEU A 1 196  ? 147.412 110.641 87.114  1.00 0.00   ? 196  LEU A CD1   1 
ATOM   1301  C  CD2   . LEU A 1 196  ? 148.264 112.903 86.476  1.00 0.00   ? 196  LEU A CD2   1 
ATOM   1302  N  N     . CYS A 1 197  ? 144.103 111.914 89.094  1.00 0.00   ? 197  CYS A N     1 
ATOM   1303  C  CA    . CYS A 1 197  ? 143.640 112.582 90.307  1.00 0.00   ? 197  CYS A CA    1 
ATOM   1304  C  C     . CYS A 1 197  ? 144.542 112.401 91.523  1.00 0.00   ? 197  CYS A C     1 
ATOM   1305  O  O     . CYS A 1 197  ? 145.403 111.521 91.561  1.00 0.00   ? 197  CYS A O     1 
ATOM   1306  C  CB    . CYS A 1 197  ? 142.225 112.113 90.655  1.00 0.00   ? 197  CYS A CB    1 
ATOM   1307  S  SG    . CYS A 1 197  ? 142.067 110.334 90.961  1.00 0.00   ? 197  CYS A SG    1 
ATOM   1308  N  N     . PHE A 1 198  ? 144.326 113.262 92.518  1.00 0.00   ? 198  PHE A N     1 
ATOM   1309  C  CA    . PHE A 1 198  ? 145.069 113.256 93.776  1.00 0.00   ? 198  PHE A CA    1 
ATOM   1310  C  C     . PHE A 1 198  ? 144.162 112.624 94.837  1.00 0.00   ? 198  PHE A C     1 
ATOM   1311  O  O     . PHE A 1 198  ? 143.059 113.114 95.069  1.00 0.00   ? 198  PHE A O     1 
ATOM   1312  C  CB    . PHE A 1 198  ? 145.409 114.700 94.168  1.00 0.00   ? 198  PHE A CB    1 
ATOM   1313  C  CG    . PHE A 1 198  ? 146.187 114.825 95.455  1.00 0.00   ? 198  PHE A CG    1 
ATOM   1314  C  CD1   . PHE A 1 198  ? 147.573 114.699 95.467  1.00 0.00   ? 198  PHE A CD1   1 
ATOM   1315  C  CD2   . PHE A 1 198  ? 145.532 115.090 96.652  1.00 0.00   ? 198  PHE A CD2   1 
ATOM   1316  C  CE1   . PHE A 1 198  ? 148.294 114.838 96.654  1.00 0.00   ? 198  PHE A CE1   1 
ATOM   1317  C  CE2   . PHE A 1 198  ? 146.242 115.227 97.846  1.00 0.00   ? 198  PHE A CE2   1 
ATOM   1318  C  CZ    . PHE A 1 198  ? 147.628 115.102 97.848  1.00 0.00   ? 198  PHE A CZ    1 
ATOM   1319  N  N     . MET A 1 199  ? 144.617 111.545 95.474  1.00 0.00   ? 199  MET A N     1 
ATOM   1320  C  CA    . MET A 1 199  ? 143.806 110.888 96.499  1.00 0.00   ? 199  MET A CA    1 
ATOM   1321  C  C     . MET A 1 199  ? 144.408 110.921 97.907  1.00 0.00   ? 199  MET A C     1 
ATOM   1322  O  O     . MET A 1 199  ? 145.627 110.908 98.082  1.00 0.00   ? 199  MET A O     1 
ATOM   1323  C  CB    . MET A 1 199  ? 143.515 109.437 96.098  1.00 0.00   ? 199  MET A CB    1 
ATOM   1324  C  CG    . MET A 1 199  ? 142.575 109.298 94.903  1.00 0.00   ? 199  MET A CG    1 
ATOM   1325  S  SD    . MET A 1 199  ? 142.083 107.590 94.570  1.00 0.00   ? 199  MET A SD    1 
ATOM   1326  C  CE    . MET A 1 199  ? 141.041 107.808 93.117  1.00 0.00   ? 199  MET A CE    1 
ATOM   1327  N  N     . LEU A 1 200  ? 143.524 110.979 98.900  1.00 0.00   ? 200  LEU A N     1 
ATOM   1328  C  CA    . LEU A 1 200  ? 143.892 111.030 100.314 1.00 0.00   ? 200  LEU A CA    1 
ATOM   1329  C  C     . LEU A 1 200  ? 142.791 110.392 101.166 1.00 0.00   ? 200  LEU A C     1 
ATOM   1330  O  O     . LEU A 1 200  ? 141.609 110.627 100.932 1.00 0.00   ? 200  LEU A O     1 
ATOM   1331  C  CB    . LEU A 1 200  ? 144.096 112.488 100.739 1.00 0.00   ? 200  LEU A CB    1 
ATOM   1332  C  CG    . LEU A 1 200  ? 144.175 112.867 102.222 1.00 0.00   ? 200  LEU A CG    1 
ATOM   1333  C  CD1   . LEU A 1 200  ? 144.717 114.277 102.338 1.00 0.00   ? 200  LEU A CD1   1 
ATOM   1334  C  CD2   . LEU A 1 200  ? 142.803 112.783 102.872 1.00 0.00   ? 200  LEU A CD2   1 
ATOM   1335  N  N     . ARG A 1 201  ? 143.183 109.593 102.152 1.00 0.00   ? 201  ARG A N     1 
ATOM   1336  C  CA    . ARG A 1 201  ? 142.218 108.942 103.031 1.00 0.00   ? 201  ARG A CA    1 
ATOM   1337  C  C     . ARG A 1 201  ? 142.091 109.706 104.346 1.00 0.00   ? 201  ARG A C     1 
ATOM   1338  O  O     . ARG A 1 201  ? 143.082 110.178 104.903 1.00 0.00   ? 201  ARG A O     1 
ATOM   1339  C  CB    . ARG A 1 201  ? 142.645 107.491 103.304 1.00 0.00   ? 201  ARG A CB    1 
ATOM   1340  C  CG    . ARG A 1 201  ? 141.675 106.719 104.203 1.00 0.00   ? 201  ARG A CG    1 
ATOM   1341  C  CD    . ARG A 1 201  ? 142.214 105.349 104.616 1.00 0.00   ? 201  ARG A CD    1 
ATOM   1342  N  NE    . ARG A 1 201  ? 142.413 104.444 103.487 1.00 0.00   ? 201  ARG A NE    1 
ATOM   1343  C  CZ    . ARG A 1 201  ? 141.444 104.050 102.665 1.00 0.00   ? 201  ARG A CZ    1 
ATOM   1344  N  NH1   . ARG A 1 201  ? 140.204 104.486 102.843 1.00 0.00   ? 201  ARG A NH1   1 
ATOM   1345  N  NH2   . ARG A 1 201  ? 141.715 103.213 101.673 1.00 0.00   ? 201  ARG A NH2   1 
ATOM   1346  N  N     . VAL A 1 202  ? 140.860 109.838 104.831 1.00 0.00   ? 202  VAL A N     1 
ATOM   1347  C  CA    . VAL A 1 202  ? 140.592 110.539 106.085 1.00 0.00   ? 202  VAL A CA    1 
ATOM   1348  C  C     . VAL A 1 202  ? 139.551 109.776 106.900 1.00 0.00   ? 202  VAL A C     1 
ATOM   1349  O  O     . VAL A 1 202  ? 138.645 109.166 106.339 1.00 0.00   ? 202  VAL A O     1 
ATOM   1350  C  CB    . VAL A 1 202  ? 140.076 111.972 105.828 1.00 0.00   ? 202  VAL A CB    1 
ATOM   1351  C  CG1   . VAL A 1 202  ? 138.827 111.925 104.975 1.00 0.00   ? 202  VAL A CG1   1 
ATOM   1352  C  CG2   . VAL A 1 202  ? 139.788 112.665 107.151 1.00 0.00   ? 202  VAL A CG2   1 
ATOM   1353  N  N     . GLY A 1 203  ? 139.688 109.811 108.221 1.00 0.00   ? 203  GLY A N     1 
ATOM   1354  C  CA    . GLY A 1 203  ? 138.748 109.104 109.068 1.00 0.00   ? 203  GLY A CA    1 
ATOM   1355  C  C     . GLY A 1 203  ? 138.483 109.757 110.410 1.00 0.00   ? 203  GLY A C     1 
ATOM   1356  O  O     . GLY A 1 203  ? 139.030 110.819 110.714 1.00 0.00   ? 203  GLY A O     1 
ATOM   1357  N  N     . ASP A 1 204  ? 137.634 109.118 111.206 1.00 0.00   ? 204  ASP A N     1 
ATOM   1358  C  CA    . ASP A 1 204  ? 137.281 109.605 112.538 1.00 0.00   ? 204  ASP A CA    1 
ATOM   1359  C  C     . ASP A 1 204  ? 137.195 108.392 113.461 1.00 0.00   ? 204  ASP A C     1 
ATOM   1360  O  O     . ASP A 1 204  ? 136.442 107.455 113.192 1.00 0.00   ? 204  ASP A O     1 
ATOM   1361  C  CB    . ASP A 1 204  ? 135.926 110.316 112.502 1.00 0.00   ? 204  ASP A CB    1 
ATOM   1362  C  CG    . ASP A 1 204  ? 135.654 111.100 113.765 1.00 0.00   ? 204  ASP A CG    1 
ATOM   1363  O  OD1   . ASP A 1 204  ? 135.984 110.599 114.860 1.00 0.00   ? 204  ASP A OD1   1 
ATOM   1364  O  OD2   . ASP A 1 204  ? 135.104 112.221 113.670 1.00 0.00   ? 204  ASP A OD2   1 
ATOM   1365  N  N     . LEU A 1 205  ? 137.951 108.408 114.554 1.00 0.00   ? 205  LEU A N     1 
ATOM   1366  C  CA    . LEU A 1 205  ? 137.966 107.287 115.493 1.00 0.00   ? 205  LEU A CA    1 
ATOM   1367  C  C     . LEU A 1 205  ? 136.837 107.230 116.521 1.00 0.00   ? 205  LEU A C     1 
ATOM   1368  O  O     . LEU A 1 205  ? 136.599 106.183 117.127 1.00 0.00   ? 205  LEU A O     1 
ATOM   1369  C  CB    . LEU A 1 205  ? 139.309 107.247 116.227 1.00 0.00   ? 205  LEU A CB    1 
ATOM   1370  C  CG    . LEU A 1 205  ? 140.541 106.907 115.393 1.00 0.00   ? 205  LEU A CG    1 
ATOM   1371  C  CD1   . LEU A 1 205  ? 141.785 107.011 116.259 1.00 0.00   ? 205  LEU A CD1   1 
ATOM   1372  C  CD2   . LEU A 1 205  ? 140.402 105.509 114.813 1.00 0.00   ? 205  LEU A CD2   1 
ATOM   1373  N  N     . ARG A 1 206  ? 136.139 108.344 116.727 1.00 0.00   ? 206  ARG A N     1 
ATOM   1374  C  CA    . ARG A 1 206  ? 135.055 108.378 117.708 1.00 0.00   ? 206  ARG A CA    1 
ATOM   1375  C  C     . ARG A 1 206  ? 133.671 108.058 117.136 1.00 0.00   ? 206  ARG A C     1 
ATOM   1376  O  O     . ARG A 1 206  ? 133.386 108.331 115.967 1.00 0.00   ? 206  ARG A O     1 
ATOM   1377  C  CB    . ARG A 1 206  ? 135.014 109.752 118.393 1.00 0.00   ? 206  ARG A CB    1 
ATOM   1378  C  CG    . ARG A 1 206  ? 136.191 110.050 119.321 1.00 0.00   ? 206  ARG A CG    1 
ATOM   1379  C  CD    . ARG A 1 206  ? 136.188 109.152 120.554 1.00 0.00   ? 206  ARG A CD    1 
ATOM   1380  N  NE    . ARG A 1 206  ? 136.799 107.854 120.293 1.00 0.00   ? 206  ARG A NE    1 
ATOM   1381  C  CZ    . ARG A 1 206  ? 138.111 107.638 120.253 1.00 0.00   ? 206  ARG A CZ    1 
ATOM   1382  N  NH1   . ARG A 1 206  ? 138.960 108.637 120.466 1.00 0.00   ? 206  ARG A NH1   1 
ATOM   1383  N  NH2   . ARG A 1 206  ? 138.580 106.425 119.994 1.00 0.00   ? 206  ARG A NH2   1 
ATOM   1384  N  N     . LYS A 1 207  ? 132.815 107.477 117.977 1.00 0.00   ? 207  LYS A N     1 
ATOM   1385  C  CA    . LYS A 1 207  ? 131.451 107.122 117.596 1.00 0.00   ? 207  LYS A CA    1 
ATOM   1386  C  C     . LYS A 1 207  ? 130.669 108.397 117.293 1.00 0.00   ? 207  LYS A C     1 
ATOM   1387  O  O     . LYS A 1 207  ? 129.859 108.434 116.367 1.00 0.00   ? 207  LYS A O     1 
ATOM   1388  C  CB    . LYS A 1 207  ? 130.767 106.351 118.733 1.00 0.00   ? 207  LYS A CB    1 
ATOM   1389  C  CG    . LYS A 1 207  ? 129.309 105.962 118.473 1.00 0.00   ? 207  LYS A CG    1 
ATOM   1390  C  CD    . LYS A 1 207  ? 128.716 105.218 119.672 1.00 0.00   ? 207  LYS A CD    1 
ATOM   1391  C  CE    . LYS A 1 207  ? 127.268 104.794 119.440 1.00 0.00   ? 207  LYS A CE    1 
ATOM   1392  N  NZ    . LYS A 1 207  ? 126.725 104.043 120.614 1.00 0.00   ? 207  LYS A NZ    1 
ATOM   1393  N  N     . SER A 1 208  ? 130.918 109.438 118.083 1.00 0.00   ? 208  SER A N     1 
ATOM   1394  C  CA    . SER A 1 208  ? 130.248 110.724 117.902 1.00 0.00   ? 208  SER A CA    1 
ATOM   1395  C  C     . SER A 1 208  ? 130.642 111.347 116.563 1.00 0.00   ? 208  SER A C     1 
ATOM   1396  O  O     . SER A 1 208  ? 131.762 111.164 116.087 1.00 0.00   ? 208  SER A O     1 
ATOM   1397  C  CB    . SER A 1 208  ? 130.612 111.679 119.044 1.00 0.00   ? 208  SER A CB    1 
ATOM   1398  O  OG    . SER A 1 208  ? 132.001 111.988 119.040 1.00 0.00   ? 208  SER A OG    1 
ATOM   1399  N  N     . MET A 1 209  ? 129.714 112.085 115.962 1.00 0.00   ? 209  MET A N     1 
ATOM   1400  C  CA    . MET A 1 209  ? 129.945 112.717 114.669 1.00 0.00   ? 209  MET A CA    1 
ATOM   1401  C  C     . MET A 1 209  ? 130.409 114.168 114.743 1.00 0.00   ? 209  MET A C     1 
ATOM   1402  O  O     . MET A 1 209  ? 130.346 114.807 115.796 1.00 0.00   ? 209  MET A O     1 
ATOM   1403  C  CB    . MET A 1 209  ? 128.666 112.668 113.827 1.00 0.00   ? 209  MET A CB    1 
ATOM   1404  C  CG    . MET A 1 209  ? 128.165 111.273 113.510 1.00 0.00   ? 209  MET A CG    1 
ATOM   1405  S  SD    . MET A 1 209  ? 129.296 110.365 112.449 1.00 0.00   ? 209  MET A SD    1 
ATOM   1406  C  CE    . MET A 1 209  ? 129.077 111.254 110.893 1.00 0.00   ? 209  MET A CE    1 
ATOM   1407  N  N     . ILE A 1 210  ? 130.876 114.658 113.599 1.00 0.00   ? 210  ILE A N     1 
ATOM   1408  C  CA    . ILE A 1 210  ? 131.328 116.035 113.437 1.00 0.00   ? 210  ILE A CA    1 
ATOM   1409  C  C     . ILE A 1 210  ? 130.366 116.603 112.397 1.00 0.00   ? 210  ILE A C     1 
ATOM   1410  O  O     . ILE A 1 210  ? 130.411 116.223 111.227 1.00 0.00   ? 210  ILE A O     1 
ATOM   1411  C  CB    . ILE A 1 210  ? 132.757 116.107 112.877 1.00 0.00   ? 210  ILE A CB    1 
ATOM   1412  C  CG1   . ILE A 1 210  ? 133.764 115.542 113.895 1.00 0.00   ? 210  ILE A CG1   1 
ATOM   1413  C  CG2   . ILE A 1 210  ? 133.098 117.546 112.532 1.00 0.00   ? 210  ILE A CG2   1 
ATOM   1414  C  CD1   . ILE A 1 210  ? 135.216 115.648 113.457 1.00 0.00   ? 210  ILE A CD1   1 
ATOM   1415  N  N     . ILE A 1 211  ? 129.486 117.501 112.828 1.00 0.00   ? 211  ILE A N     1 
ATOM   1416  C  CA    . ILE A 1 211  ? 128.489 118.083 111.931 1.00 0.00   ? 211  ILE A CA    1 
ATOM   1417  C  C     . ILE A 1 211  ? 129.025 119.160 110.998 1.00 0.00   ? 211  ILE A C     1 
ATOM   1418  O  O     . ILE A 1 211  ? 129.901 119.943 111.367 1.00 0.00   ? 211  ILE A O     1 
ATOM   1419  C  CB    . ILE A 1 211  ? 127.304 118.670 112.728 1.00 0.00   ? 211  ILE A CB    1 
ATOM   1420  C  CG1   . ILE A 1 211  ? 126.746 117.601 113.675 1.00 0.00   ? 211  ILE A CG1   1 
ATOM   1421  C  CG2   . ILE A 1 211  ? 126.228 119.152 111.766 1.00 0.00   ? 211  ILE A CG2   1 
ATOM   1422  C  CD1   . ILE A 1 211  ? 125.681 118.107 114.644 1.00 0.00   ? 211  ILE A CD1   1 
ATOM   1423  N  N     . SER A 1 212  ? 128.471 119.192 109.791 1.00 0.00   ? 212  SER A N     1 
ATOM   1424  C  CA    . SER A 1 212  ? 128.871 120.154 108.774 1.00 0.00   ? 212  SER A CA    1 
ATOM   1425  C  C     . SER A 1 212  ? 130.366 120.016 108.516 1.00 0.00   ? 212  SER A C     1 
ATOM   1426  O  O     . SER A 1 212  ? 131.066 121.008 108.311 1.00 0.00   ? 212  SER A O     1 
ATOM   1427  C  CB    . SER A 1 212  ? 128.549 121.581 109.225 1.00 0.00   ? 212  SER A CB    1 
ATOM   1428  O  OG    . SER A 1 212  ? 127.156 121.753 109.425 1.00 0.00   ? 212  SER A OG    1 
ATOM   1429  N  N     . ALA A 1 213  ? 130.846 118.779 108.525 1.00 0.00   ? 213  ALA A N     1 
ATOM   1430  C  CA    . ALA A 1 213  ? 132.257 118.511 108.280 1.00 0.00   ? 213  ALA A CA    1 
ATOM   1431  C  C     . ALA A 1 213  ? 132.607 119.049 106.899 1.00 0.00   ? 213  ALA A C     1 
ATOM   1432  O  O     . ALA A 1 213  ? 132.052 118.610 105.893 1.00 0.00   ? 213  ALA A O     1 
ATOM   1433  C  CB    . ALA A 1 213  ? 132.531 117.014 108.341 1.00 0.00   ? 213  ALA A CB    1 
ATOM   1434  N  N     . THR A 1 214  ? 133.516 120.017 106.861 1.00 0.00   ? 214  THR A N     1 
ATOM   1435  C  CA    . THR A 1 214  ? 133.925 120.620 105.608 1.00 0.00   ? 214  THR A CA    1 
ATOM   1436  C  C     . THR A 1 214  ? 135.410 120.442 105.370 1.00 0.00   ? 214  THR A C     1 
ATOM   1437  O  O     . THR A 1 214  ? 136.222 120.604 106.282 1.00 0.00   ? 214  THR A O     1 
ATOM   1438  C  CB    . THR A 1 214  ? 133.599 122.126 105.586 1.00 0.00   ? 214  THR A CB    1 
ATOM   1439  O  OG1   . THR A 1 214  ? 132.206 122.316 105.855 1.00 0.00   ? 214  THR A OG1   1 
ATOM   1440  C  CG2   . THR A 1 214  ? 133.924 122.722 104.223 1.00 0.00   ? 214  THR A CG2   1 
ATOM   1441  N  N     . ILE A 1 215  ? 135.764 120.106 104.133 1.00 0.00   ? 215  ILE A N     1 
ATOM   1442  C  CA    . ILE A 1 215  ? 137.156 119.903 103.775 1.00 0.00   ? 215  ILE A CA    1 
ATOM   1443  C  C     . ILE A 1 215  ? 137.654 120.945 102.790 1.00 0.00   ? 215  ILE A C     1 
ATOM   1444  O  O     . ILE A 1 215  ? 137.025 121.208 101.764 1.00 0.00   ? 215  ILE A O     1 
ATOM   1445  C  CB    . ILE A 1 215  ? 137.377 118.509 103.156 1.00 0.00   ? 215  ILE A CB    1 
ATOM   1446  C  CG1   . ILE A 1 215  ? 137.097 117.418 104.203 1.00 0.00   ? 215  ILE A CG1   1 
ATOM   1447  C  CG2   . ILE A 1 215  ? 138.802 118.397 102.626 1.00 0.00   ? 215  ILE A CG2   1 
ATOM   1448  C  CD1   . ILE A 1 215  ? 137.386 116.008 103.724 1.00 0.00   ? 215  ILE A CD1   1 
ATOM   1449  N  N     . HIS A 1 216  ? 138.796 121.533 103.119 1.00 0.00   ? 216  HIS A N     1 
ATOM   1450  C  CA    . HIS A 1 216  ? 139.436 122.536 102.277 1.00 0.00   ? 216  HIS A CA    1 
ATOM   1451  C  C     . HIS A 1 216  ? 140.835 122.019 101.969 1.00 0.00   ? 216  HIS A C     1 
ATOM   1452  O  O     . HIS A 1 216  ? 141.477 121.398 102.822 1.00 0.00   ? 216  HIS A O     1 
ATOM   1453  C  CB    . HIS A 1 216  ? 139.529 123.870 103.010 1.00 0.00   ? 216  HIS A CB    1 
ATOM   1454  C  CG    . HIS A 1 216  ? 138.203 124.515 103.274 1.00 0.00   ? 216  HIS A CG    1 
ATOM   1455  N  ND1   . HIS A 1 216  ? 137.367 124.944 102.263 1.00 0.00   ? 216  HIS A ND1   1 
ATOM   1456  C  CD2   . HIS A 1 216  ? 137.571 124.821 104.434 1.00 0.00   ? 216  HIS A CD2   1 
ATOM   1457  C  CE1   . HIS A 1 216  ? 136.283 125.486 102.787 1.00 0.00   ? 216  HIS A CE1   1 
ATOM   1458  N  NE2   . HIS A 1 216  ? 136.381 125.426 104.102 1.00 0.00   ? 216  HIS A NE2   1 
ATOM   1459  N  N     . MET A 1 217  ? 141.307 122.258 100.754 1.00 0.00   ? 217  MET A N     1 
ATOM   1460  C  CA    . MET A 1 217  ? 142.629 121.795 100.361 1.00 0.00   ? 217  MET A CA    1 
ATOM   1461  C  C     . MET A 1 217  ? 143.389 122.913 99.667  1.00 0.00   ? 217  MET A C     1 
ATOM   1462  O  O     . MET A 1 217  ? 142.923 123.473 98.674  1.00 0.00   ? 217  MET A O     1 
ATOM   1463  C  CB    . MET A 1 217  ? 142.507 120.583 99.431  1.00 0.00   ? 217  MET A CB    1 
ATOM   1464  C  CG    . MET A 1 217  ? 143.813 119.859 99.174  1.00 0.00   ? 217  MET A CG    1 
ATOM   1465  S  SD    . MET A 1 217  ? 143.597 118.350 98.200  1.00 0.00   ? 217  MET A SD    1 
ATOM   1466  C  CE    . MET A 1 217  ? 142.967 117.217 99.447  1.00 0.00   ? 217  MET A CE    1 
ATOM   1467  N  N     . GLN A 1 218  ? 144.563 123.244 100.200 1.00 0.00   ? 218  GLN A N     1 
ATOM   1468  C  CA    . GLN A 1 218  ? 145.378 124.303 99.621  1.00 0.00   ? 218  GLN A CA    1 
ATOM   1469  C  C     . GLN A 1 218  ? 146.773 123.818 99.260  1.00 0.00   ? 218  GLN A C     1 
ATOM   1470  O  O     . GLN A 1 218  ? 147.332 122.938 99.922  1.00 0.00   ? 218  GLN A O     1 
ATOM   1471  C  CB    . GLN A 1 218  ? 145.492 125.481 100.591 1.00 0.00   ? 218  GLN A CB    1 
ATOM   1472  C  CG    . GLN A 1 218  ? 144.159 126.096 100.991 1.00 0.00   ? 218  GLN A CG    1 
ATOM   1473  C  CD    . GLN A 1 218  ? 144.316 127.314 101.887 1.00 0.00   ? 218  GLN A CD    1 
ATOM   1474  O  OE1   . GLN A 1 218  ? 143.329 127.894 102.342 1.00 0.00   ? 218  GLN A OE1   1 
ATOM   1475  N  NE2   . GLN A 1 218  ? 145.560 127.706 102.143 1.00 0.00   ? 218  GLN A NE2   1 
ATOM   1476  N  N     . VAL A 1 219  ? 147.324 124.390 98.199  1.00 0.00   ? 219  VAL A N     1 
ATOM   1477  C  CA    . VAL A 1 219  ? 148.661 124.037 97.743  1.00 0.00   ? 219  VAL A CA    1 
ATOM   1478  C  C     . VAL A 1 219  ? 149.625 125.179 98.047  1.00 0.00   ? 219  VAL A C     1 
ATOM   1479  O  O     . VAL A 1 219  ? 149.457 126.297 97.550  1.00 0.00   ? 219  VAL A O     1 
ATOM   1480  C  CB    . VAL A 1 219  ? 148.682 123.752 96.221  1.00 0.00   ? 219  VAL A CB    1 
ATOM   1481  C  CG1   . VAL A 1 219  ? 150.097 123.412 95.774  1.00 0.00   ? 219  VAL A CG1   1 
ATOM   1482  C  CG2   . VAL A 1 219  ? 147.748 122.602 95.888  1.00 0.00   ? 219  VAL A CG2   1 
ATOM   1483  N  N     . VAL A 1 220  ? 150.619 124.900 98.881  1.00 0.00   ? 220  VAL A N     1 
ATOM   1484  C  CA    . VAL A 1 220  ? 151.618 125.901 99.227  1.00 0.00   ? 220  VAL A CA    1 
ATOM   1485  C  C     . VAL A 1 220  ? 152.755 125.751 98.232  1.00 0.00   ? 220  VAL A C     1 
ATOM   1486  O  O     . VAL A 1 220  ? 153.365 124.686 98.125  1.00 0.00   ? 220  VAL A O     1 
ATOM   1487  C  CB    . VAL A 1 220  ? 152.167 125.696 100.646 1.00 0.00   ? 220  VAL A CB    1 
ATOM   1488  C  CG1   . VAL A 1 220  ? 153.220 126.750 100.947 1.00 0.00   ? 220  VAL A CG1   1 
ATOM   1489  C  CG2   . VAL A 1 220  ? 151.040 125.778 101.657 1.00 0.00   ? 220  VAL A CG2   1 
ATOM   1490  N  N     . ARG A 1 221  ? 153.035 126.824 97.501  1.00 0.00   ? 221  ARG A N     1 
ATOM   1491  C  CA    . ARG A 1 221  ? 154.082 126.807 96.492  1.00 0.00   ? 221  ARG A CA    1 
ATOM   1492  C  C     . ARG A 1 221  ? 154.724 128.172 96.290  1.00 0.00   ? 221  ARG A C     1 
ATOM   1493  O  O     . ARG A 1 221  ? 154.022 129.159 96.067  1.00 0.00   ? 221  ARG A O     1 
ATOM   1494  C  CB    . ARG A 1 221  ? 153.489 126.347 95.159  1.00 0.00   ? 221  ARG A CB    1 
ATOM   1495  C  CG    . ARG A 1 221  ? 154.355 126.641 93.941  1.00 0.00   ? 221  ARG A CG    1 
ATOM   1496  C  CD    . ARG A 1 221  ? 153.514 126.719 92.679  1.00 0.00   ? 221  ARG A CD    1 
ATOM   1497  N  NE    . ARG A 1 221  ? 152.794 125.473 92.424  1.00 0.00   ? 221  ARG A NE    1 
ATOM   1498  C  CZ    . ARG A 1 221  ? 153.360 124.360 91.973  1.00 0.00   ? 221  ARG A CZ    1 
ATOM   1499  N  NH1   . ARG A 1 221  ? 154.663 124.326 91.720  1.00 0.00   ? 221  ARG A NH1   1 
ATOM   1500  N  NH2   . ARG A 1 221  ? 152.624 123.274 91.776  1.00 0.00   ? 221  ARG A NH2   1 
ATOM   1501  N  N     . LYS A 1 222  ? 156.051 128.242 96.380  1.00 0.00   ? 222  LYS A N     1 
ATOM   1502  C  CA    . LYS A 1 222  ? 156.713 129.514 96.134  1.00 0.00   ? 222  LYS A CA    1 
ATOM   1503  C  C     . LYS A 1 222  ? 156.495 129.719 94.644  1.00 0.00   ? 222  LYS A C     1 
ATOM   1504  O  O     . LYS A 1 222  ? 156.940 128.909 93.832  1.00 0.00   ? 222  LYS A O     1 
ATOM   1505  C  CB    . LYS A 1 222  ? 158.217 129.460 96.427  1.00 0.00   ? 222  LYS A CB    1 
ATOM   1506  C  CG    . LYS A 1 222  ? 158.925 130.774 96.068  1.00 0.00   ? 222  LYS A CG    1 
ATOM   1507  C  CD    . LYS A 1 222  ? 160.412 130.785 96.391  1.00 0.00   ? 222  LYS A CD    1 
ATOM   1508  C  CE    . LYS A 1 222  ? 161.012 132.148 96.050  1.00 0.00   ? 222  LYS A CE    1 
ATOM   1509  N  NZ    . LYS A 1 222  ? 162.451 132.272 96.425  1.00 0.00   ? 222  LYS A NZ    1 
ATOM   1510  N  N     . THR A 1 223  ? 155.736 130.748 94.300  1.00 0.00   ? 223  THR A N     1 
ATOM   1511  C  CA    . THR A 1 223  ? 155.393 130.988 92.910  1.00 0.00   ? 223  THR A CA    1 
ATOM   1512  C  C     . THR A 1 223  ? 155.765 132.358 92.390  1.00 0.00   ? 223  THR A C     1 
ATOM   1513  O  O     . THR A 1 223  ? 155.837 133.333 93.137  1.00 0.00   ? 223  THR A O     1 
ATOM   1514  C  CB    . THR A 1 223  ? 153.880 130.796 92.689  1.00 0.00   ? 223  THR A CB    1 
ATOM   1515  O  OG1   . THR A 1 223  ? 153.511 129.448 93.010  1.00 0.00   ? 223  THR A OG1   1 
ATOM   1516  C  CG2   . THR A 1 223  ? 153.520 131.070 91.241  1.00 0.00   ? 223  THR A CG2   1 
ATOM   1517  N  N     . THR A 1 224  ? 156.000 132.411 91.085  1.00 0.00   ? 224  THR A N     1 
ATOM   1518  C  CA    . THR A 1 224  ? 156.347 133.649 90.416  1.00 0.00   ? 224  THR A CA    1 
ATOM   1519  C  C     . THR A 1 224  ? 155.386 133.922 89.270  1.00 0.00   ? 224  THR A C     1 
ATOM   1520  O  O     . THR A 1 224  ? 155.111 133.040 88.459  1.00 0.00   ? 224  THR A O     1 
ATOM   1521  C  CB    . THR A 1 224  ? 157.769 133.596 89.838  1.00 0.00   ? 224  THR A CB    1 
ATOM   1522  O  OG1   . THR A 1 224  ? 157.767 132.824 88.633  1.00 0.00   ? 224  THR A OG1   1 
ATOM   1523  C  CG2   . THR A 1 224  ? 158.726 132.971 90.834  1.00 0.00   ? 224  THR A CG2   1 
ATOM   1524  N  N     . SER A 1 225  ? 154.880 135.148 89.205  1.00 0.00   ? 225  SER A N     1 
ATOM   1525  C  CA    . SER A 1 225  ? 153.985 135.556 88.121  1.00 0.00   ? 225  SER A CA    1 
ATOM   1526  C  C     . SER A 1 225  ? 154.798 136.024 86.912  1.00 0.00   ? 225  SER A C     1 
ATOM   1527  O  O     . SER A 1 225  ? 156.038 136.047 86.954  1.00 0.00   ? 225  SER A O     1 
ATOM   1528  C  CB    . SER A 1 225  ? 153.097 136.702 88.588  1.00 0.00   ? 225  SER A CB    1 
ATOM   1529  O  OG    . SER A 1 225  ? 153.883 137.842 88.888  1.00 0.00   ? 225  SER A OG    1 
ATOM   1530  N  N     . PRO A 1 226  ? 154.124 136.428 85.831  1.00 0.00   ? 226  PRO A N     1 
ATOM   1531  C  CA    . PRO A 1 226  ? 154.897 136.893 84.677  1.00 0.00   ? 226  PRO A CA    1 
ATOM   1532  C  C     . PRO A 1 226  ? 155.400 138.315 84.884  1.00 0.00   ? 226  PRO A C     1 
ATOM   1533  O  O     . PRO A 1 226  ? 156.331 138.762 84.209  1.00 0.00   ? 226  PRO A O     1 
ATOM   1534  C  CB    . PRO A 1 226  ? 153.894 136.795 83.529  1.00 0.00   ? 226  PRO A CB    1 
ATOM   1535  C  CG    . PRO A 1 226  ? 153.022 135.647 83.942  1.00 0.00   ? 226  PRO A CG    1 
ATOM   1536  C  CD    . PRO A 1 226  ? 152.801 135.936 85.410  1.00 0.00   ? 226  PRO A CD    1 
ATOM   1537  N  N     . GLU A 1 227  ? 154.736 139.058 85.765  1.00 0.00   ? 227  GLU A N     1 
ATOM   1538  C  CA    . GLU A 1 227  ? 155.154 140.420 86.066  1.00 0.00   ? 227  GLU A CA    1 
ATOM   1539  C  C     . GLU A 1 227  ? 156.422 140.467 86.919  1.00 0.00   ? 227  GLU A C     1 
ATOM   1540  O  O     . GLU A 1 227  ? 156.859 141.538 87.334  1.00 0.00   ? 227  GLU A O     1 
ATOM   1541  C  CB    . GLU A 1 227  ? 154.027 141.175 86.770  1.00 0.00   ? 227  GLU A CB    1 
ATOM   1542  C  CG    . GLU A 1 227  ? 152.785 141.390 85.924  1.00 0.00   ? 227  GLU A CG    1 
ATOM   1543  C  CD    . GLU A 1 227  ? 153.066 142.144 84.643  1.00 0.00   ? 227  GLU A CD    1 
ATOM   1544  O  OE1   . GLU A 1 227  ? 153.870 143.100 84.678  1.00 0.00   ? 227  GLU A OE1   1 
ATOM   1545  O  OE2   . GLU A 1 227  ? 152.484 141.779 83.601  1.00 0.00   ? 227  GLU A OE2   1 
ATOM   1546  N  N     . GLY A 1 228  ? 157.005 139.300 87.183  1.00 0.00   ? 228  GLY A N     1 
ATOM   1547  C  CA    . GLY A 1 228  ? 158.208 139.192 87.987  1.00 0.00   ? 228  GLY A CA    1 
ATOM   1548  C  C     . GLY A 1 228  ? 157.949 139.164 89.484  1.00 0.00   ? 228  GLY A C     1 
ATOM   1549  O  O     . GLY A 1 228  ? 158.887 139.151 90.277  1.00 0.00   ? 228  GLY A O     1 
ATOM   1550  N  N     . GLU A 1 229  ? 156.681 139.159 89.876  1.00 0.00   ? 229  GLU A N     1 
ATOM   1551  C  CA    . GLU A 1 229  ? 156.332 139.129 91.284  1.00 0.00   ? 229  GLU A CA    1 
ATOM   1552  C  C     . GLU A 1 229  ? 156.651 137.774 91.886  1.00 0.00   ? 229  GLU A C     1 
ATOM   1553  O  O     . GLU A 1 229  ? 156.388 136.744 91.277  1.00 0.00   ? 229  GLU A O     1 
ATOM   1554  C  CB    . GLU A 1 229  ? 154.861 139.471 91.485  1.00 0.00   ? 229  GLU A CB    1 
ATOM   1555  C  CG    . GLU A 1 229  ? 154.610 140.239 92.767  1.00 0.00   ? 229  GLU A CG    1 
ATOM   1556  C  CD    . GLU A 1 229  ? 155.575 141.398 92.932  1.00 0.00   ? 229  GLU A CD    1 
ATOM   1557  O  OE1   . GLU A 1 229  ? 156.260 141.745 91.948  1.00 0.00   ? 229  GLU A OE1   1 
ATOM   1558  O  OE2   . GLU A 1 229  ? 155.642 141.967 94.040  1.00 0.00   ? 229  GLU A OE2   1 
ATOM   1559  N  N     . VAL A 1 230  ? 157.199 137.783 93.095  1.00 0.00   ? 230  VAL A N     1 
ATOM   1560  C  CA    . VAL A 1 230  ? 157.567 136.549 93.773  1.00 0.00   ? 230  VAL A CA    1 
ATOM   1561  C  C     . VAL A 1 230  ? 156.829 136.390 95.091  1.00 0.00   ? 230  VAL A C     1 
ATOM   1562  O  O     . VAL A 1 230  ? 156.785 137.312 95.900  1.00 0.00   ? 230  VAL A O     1 
ATOM   1563  C  CB    . VAL A 1 230  ? 159.078 136.503 94.056  1.00 0.00   ? 230  VAL A CB    1 
ATOM   1564  C  CG1   . VAL A 1 230  ? 159.448 135.221 94.782  1.00 0.00   ? 230  VAL A CG1   1 
ATOM   1565  C  CG2   . VAL A 1 230  ? 159.863 136.630 92.764  1.00 0.00   ? 230  VAL A CG2   1 
ATOM   1566  N  N     . VAL A 1 231  ? 156.241 135.220 95.298  1.00 0.00   ? 231  VAL A N     1 
ATOM   1567  C  CA    . VAL A 1 231  ? 155.528 134.918 96.531  1.00 0.00   ? 231  VAL A CA    1 
ATOM   1568  C  C     . VAL A 1 231  ? 156.193 133.703 97.150  1.00 0.00   ? 231  VAL A C     1 
ATOM   1569  O  O     . VAL A 1 231  ? 156.374 132.691 96.485  1.00 0.00   ? 231  VAL A O     1 
ATOM   1570  C  CB    . VAL A 1 231  ? 154.049 134.613 96.272  1.00 0.00   ? 231  VAL A CB    1 
ATOM   1571  C  CG1   . VAL A 1 231  ? 153.458 133.855 97.449  1.00 0.00   ? 231  VAL A CG1   1 
ATOM   1572  C  CG2   . VAL A 1 231  ? 153.285 135.899 96.009  1.00 0.00   ? 231  VAL A CG2   1 
ATOM   1573  N  N     . PRO A 1 232  ? 156.558 133.808 98.420  1.00 0.00   ? 232  PRO A N     1 
ATOM   1574  C  CA    . PRO A 1 232  ? 157.245 132.722 99.126  1.00 0.00   ? 232  PRO A CA    1 
ATOM   1575  C  C     . PRO A 1 232  ? 156.339 131.560 99.529  1.00 0.00   ? 232  PRO A C     1 
ATOM   1576  O  O     . PRO A 1 232  ? 156.768 130.410 99.543  1.00 0.00   ? 232  PRO A O     1 
ATOM   1577  C  CB    . PRO A 1 232  ? 157.853 133.430 100.331 1.00 0.00   ? 232  PRO A CB    1 
ATOM   1578  C  CG    . PRO A 1 232  ? 156.855 134.515 100.604 1.00 0.00   ? 232  PRO A CG    1 
ATOM   1579  C  CD    . PRO A 1 232  ? 156.582 135.045 99.221  1.00 0.00   ? 232  PRO A CD    1 
ATOM   1580  N  N     . LEU A 1 233  ? 155.089 131.869 99.861  1.00 0.00   ? 233  LEU A N     1 
ATOM   1581  C  CA    . LEU A 1 233  ? 154.123 130.849 100.261 1.00 0.00   ? 233  LEU A CA    1 
ATOM   1582  C  C     . LEU A 1 233  ? 152.763 131.133 99.645  1.00 0.00   ? 233  LEU A C     1 
ATOM   1583  O  O     . LEU A 1 233  ? 151.823 131.502 100.356 1.00 0.00   ? 233  LEU A O     1 
ATOM   1584  C  CB    . LEU A 1 233  ? 153.970 130.821 101.785 1.00 0.00   ? 233  LEU A CB    1 
ATOM   1585  C  CG    . LEU A 1 233  ? 155.174 130.460 102.654 1.00 0.00   ? 233  LEU A CG    1 
ATOM   1586  C  CD1   . LEU A 1 233  ? 154.827 130.707 104.113 1.00 0.00   ? 233  LEU A CD1   1 
ATOM   1587  C  CD2   . LEU A 1 233  ? 155.559 129.007 102.431 1.00 0.00   ? 233  LEU A CD2   1 
ATOM   1588  N  N     . HIS A 1 234  ? 152.643 130.975 98.330  1.00 0.00   ? 234  HIS A N     1 
ATOM   1589  C  CA    . HIS A 1 234  ? 151.366 131.225 97.675  1.00 0.00   ? 234  HIS A CA    1 
ATOM   1590  C  C     . HIS A 1 234  ? 150.440 130.045 97.939  1.00 0.00   ? 234  HIS A C     1 
ATOM   1591  O  O     . HIS A 1 234  ? 150.830 128.886 97.785  1.00 0.00   ? 234  HIS A O     1 
ATOM   1592  C  CB    . HIS A 1 234  ? 151.554 131.425 96.167  1.00 0.00   ? 234  HIS A CB    1 
ATOM   1593  C  CG    . HIS A 1 234  ? 150.323 131.914 95.467  1.00 0.00   ? 234  HIS A CG    1 
ATOM   1594  N  ND1   . HIS A 1 234  ? 149.186 131.148 95.336  1.00 0.00   ? 234  HIS A ND1   1 
ATOM   1595  C  CD2   . HIS A 1 234  ? 150.047 133.102 94.878  1.00 0.00   ? 234  HIS A CD2   1 
ATOM   1596  C  CE1   . HIS A 1 234  ? 148.262 131.843 94.698  1.00 0.00   ? 234  HIS A CE1   1 
ATOM   1597  N  NE2   . HIS A 1 234  ? 148.758 133.033 94.410  1.00 0.00   ? 234  HIS A NE2   1 
ATOM   1598  N  N     . GLN A 1 235  ? 149.215 130.344 98.350  1.00 0.00   ? 235  GLN A N     1 
ATOM   1599  C  CA    . GLN A 1 235  ? 148.244 129.302 98.641  1.00 0.00   ? 235  GLN A CA    1 
ATOM   1600  C  C     . GLN A 1 235  ? 147.198 129.229 97.543  1.00 0.00   ? 235  GLN A C     1 
ATOM   1601  O  O     . GLN A 1 235  ? 146.537 130.224 97.228  1.00 0.00   ? 235  GLN A O     1 
ATOM   1602  C  CB    . GLN A 1 235  ? 147.576 129.562 99.995  1.00 0.00   ? 235  GLN A CB    1 
ATOM   1603  C  CG    . GLN A 1 235  ? 148.569 129.859 101.110 1.00 0.00   ? 235  GLN A CG    1 
ATOM   1604  C  CD    . GLN A 1 235  ? 147.915 129.933 102.477 1.00 0.00   ? 235  GLN A CD    1 
ATOM   1605  O  OE1   . GLN A 1 235  ? 146.715 130.179 102.588 1.00 0.00   ? 235  GLN A OE1   1 
ATOM   1606  N  NE2   . GLN A 1 235  ? 148.706 129.731 103.524 1.00 0.00   ? 235  GLN A NE2   1 
ATOM   1607  N  N     . VAL A 1 236  ? 147.058 128.044 96.953  1.00 0.00   ? 236  VAL A N     1 
ATOM   1608  C  CA    . VAL A 1 236  ? 146.102 127.818 95.882  1.00 0.00   ? 236  VAL A CA    1 
ATOM   1609  C  C     . VAL A 1 236  ? 144.938 126.959 96.362  1.00 0.00   ? 236  VAL A C     1 
ATOM   1610  O  O     . VAL A 1 236  ? 145.133 125.949 97.041  1.00 0.00   ? 236  VAL A O     1 
ATOM   1611  C  CB    . VAL A 1 236  ? 146.766 127.119 94.678  1.00 0.00   ? 236  VAL A CB    1 
ATOM   1612  C  CG1   . VAL A 1 236  ? 145.763 126.979 93.543  1.00 0.00   ? 236  VAL A CG1   1 
ATOM   1613  C  CG2   . VAL A 1 236  ? 147.981 127.911 94.216  1.00 0.00   ? 236  VAL A CG2   1 
ATOM   1614  N  N     . ASP A 1 237  ? 143.729 127.366 95.992  1.00 0.00   ? 237  ASP A N     1 
ATOM   1615  C  CA    . ASP A 1 237  ? 142.525 126.638 96.375  1.00 0.00   ? 237  ASP A CA    1 
ATOM   1616  C  C     . ASP A 1 237  ? 142.351 125.403 95.498  1.00 0.00   ? 237  ASP A C     1 
ATOM   1617  O  O     . ASP A 1 237  ? 142.478 125.476 94.275  1.00 0.00   ? 237  ASP A O     1 
ATOM   1618  C  CB    . ASP A 1 237  ? 141.299 127.546 96.245  1.00 0.00   ? 237  ASP A CB    1 
ATOM   1619  C  CG    . ASP A 1 237  ? 141.450 128.837 97.029  1.00 0.00   ? 237  ASP A CG    1 
ATOM   1620  O  OD1   . ASP A 1 237  ? 141.607 128.779 98.270  1.00 0.00   ? 237  ASP A OD1   1 
ATOM   1621  O  OD2   . ASP A 1 237  ? 141.406 129.920 96.406  1.00 0.00   ? 237  ASP A OD2   1 
ATOM   1622  N  N     . ILE A 1 238  ? 142.048 124.279 96.132  1.00 0.00   ? 238  ILE A N     1 
ATOM   1623  C  CA    . ILE A 1 238  ? 141.858 123.011 95.430  1.00 0.00   ? 238  ILE A CA    1 
ATOM   1624  C  C     . ILE A 1 238  ? 140.445 122.456 95.601  1.00 0.00   ? 238  ILE A C     1 
ATOM   1625  O  O     . ILE A 1 238  ? 139.985 122.205 96.715  1.00 0.00   ? 238  ILE A O     1 
ATOM   1626  C  CB    . ILE A 1 238  ? 142.862 121.951 95.939  1.00 0.00   ? 238  ILE A CB    1 
ATOM   1627  C  CG1   . ILE A 1 238  ? 144.302 122.445 95.753  1.00 0.00   ? 238  ILE A CG1   1 
ATOM   1628  C  CG2   . ILE A 1 238  ? 142.667 120.652 95.197  1.00 0.00   ? 238  ILE A CG2   1 
ATOM   1629  C  CD1   . ILE A 1 238  ? 144.682 122.741 94.312  1.00 0.00   ? 238  ILE A CD1   1 
ATOM   1630  N  N     . PRO A 1 239  ? 139.733 122.256 94.483  1.00 0.00   ? 239  PRO A N     1 
ATOM   1631  C  CA    . PRO A 1 239  ? 138.365 121.727 94.496  1.00 0.00   ? 239  PRO A CA    1 
ATOM   1632  C  C     . PRO A 1 239  ? 138.315 120.270 94.977  1.00 0.00   ? 239  PRO A C     1 
ATOM   1633  O  O     . PRO A 1 239  ? 139.236 119.497 94.716  1.00 0.00   ? 239  PRO A O     1 
ATOM   1634  C  CB    . PRO A 1 239  ? 137.930 121.879 93.042  1.00 0.00   ? 239  PRO A CB    1 
ATOM   1635  C  CG    . PRO A 1 239  ? 139.225 121.688 92.296  1.00 0.00   ? 239  PRO A CG    1 
ATOM   1636  C  CD    . PRO A 1 239  ? 140.182 122.516 93.105  1.00 0.00   ? 239  PRO A CD    1 
ATOM   1637  N  N     . MET A 1 240  ? 137.242 119.908 95.674  1.00 0.00   ? 240  MET A N     1 
ATOM   1638  C  CA    . MET A 1 240  ? 137.080 118.562 96.223  1.00 0.00   ? 240  MET A CA    1 
ATOM   1639  C  C     . MET A 1 240  ? 136.353 117.556 95.324  1.00 0.00   ? 240  MET A C     1 
ATOM   1640  O  O     . MET A 1 240  ? 136.038 116.442 95.752  1.00 0.00   ? 240  MET A O     1 
ATOM   1641  C  CB    . MET A 1 240  ? 136.355 118.640 97.571  1.00 0.00   ? 240  MET A CB    1 
ATOM   1642  C  CG    . MET A 1 240  ? 137.201 119.201 98.700  1.00 0.00   ? 240  MET A CG    1 
ATOM   1643  S  SD    . MET A 1 240  ? 138.603 118.141 99.084  1.00 0.00   ? 240  MET A SD    1 
ATOM   1644  C  CE    . MET A 1 240  ? 139.835 118.798 97.981  1.00 0.00   ? 240  MET A CE    1 
ATOM   1645  N  N     . GLU A 1 241  ? 136.102 117.942 94.079  1.00 0.00   ? 241  GLU A N     1 
ATOM   1646  C  CA    . GLU A 1 241  ? 135.403 117.073 93.134  1.00 0.00   ? 241  GLU A CA    1 
ATOM   1647  C  C     . GLU A 1 241  ? 134.046 116.661 93.689  1.00 0.00   ? 241  GLU A C     1 
ATOM   1648  O  O     . GLU A 1 241  ? 133.526 115.590 93.357  1.00 0.00   ? 241  GLU A O     1 
ATOM   1649  C  CB    . GLU A 1 241  ? 136.222 115.812 92.832  1.00 0.00   ? 241  GLU A CB    1 
ATOM   1650  N  N     . ASN A 1 242  ? 133.482 117.505 94.545  1.00 0.00   ? 242  ASN A N     1 
ATOM   1651  C  CA    . ASN A 1 242  ? 132.181 117.220 95.132  1.00 0.00   ? 242  ASN A CA    1 
ATOM   1652  C  C     . ASN A 1 242  ? 131.153 117.207 94.008  1.00 0.00   ? 242  ASN A C     1 
ATOM   1653  O  O     . ASN A 1 242  ? 131.180 118.064 93.124  1.00 0.00   ? 242  ASN A O     1 
ATOM   1654  C  CB    . ASN A 1 242  ? 131.846 118.289 96.164  1.00 0.00   ? 242  ASN A CB    1 
ATOM   1655  C  CG    . ASN A 1 242  ? 130.581 117.982 96.932  1.00 0.00   ? 242  ASN A CG    1 
ATOM   1656  O  OD1   . ASN A 1 242  ? 129.481 118.059 96.390  1.00 0.00   ? 242  ASN A OD1   1 
ATOM   1657  N  ND2   . ASN A 1 242  ? 130.735 117.618 98.202  1.00 0.00   ? 242  ASN A ND2   1 
ATOM   1658  N  N     . GLY A 1 243  ? 130.245 116.242 94.050  1.00 0.00   ? 243  GLY A N     1 
ATOM   1659  C  CA    . GLY A 1 243  ? 129.250 116.137 92.998  1.00 0.00   ? 243  GLY A CA    1 
ATOM   1660  C  C     . GLY A 1 243  ? 128.390 117.373 92.814  1.00 0.00   ? 243  GLY A C     1 
ATOM   1661  O  O     . GLY A 1 243  ? 127.955 117.661 91.698  1.00 0.00   ? 243  GLY A O     1 
ATOM   1662  N  N     . VAL A 1 244  ? 128.150 118.114 93.891  1.00 0.00   ? 244  VAL A N     1 
ATOM   1663  C  CA    . VAL A 1 244  ? 127.328 119.314 93.810  1.00 0.00   ? 244  VAL A CA    1 
ATOM   1664  C  C     . VAL A 1 244  ? 128.142 120.592 93.971  1.00 0.00   ? 244  VAL A C     1 
ATOM   1665  O  O     . VAL A 1 244  ? 127.587 121.676 94.131  1.00 0.00   ? 244  VAL A O     1 
ATOM   1666  C  CB    . VAL A 1 244  ? 126.211 119.305 94.877  1.00 0.00   ? 244  VAL A CB    1 
ATOM   1667  C  CG1   . VAL A 1 244  ? 125.298 118.110 94.665  1.00 0.00   ? 244  VAL A CG1   1 
ATOM   1668  C  CG2   . VAL A 1 244  ? 126.818 119.262 96.267  1.00 0.00   ? 244  VAL A CG2   1 
ATOM   1669  N  N     . GLY A 1 245  ? 129.464 120.449 93.921  1.00 0.00   ? 245  GLY A N     1 
ATOM   1670  C  CA    . GLY A 1 245  ? 130.340 121.597 94.066  1.00 0.00   ? 245  GLY A CA    1 
ATOM   1671  C  C     . GLY A 1 245  ? 130.483 122.045 95.507  1.00 0.00   ? 245  GLY A C     1 
ATOM   1672  O  O     . GLY A 1 245  ? 131.021 123.123 95.779  1.00 0.00   ? 245  GLY A O     1 
ATOM   1673  N  N     . GLY A 1 246  ? 130.006 121.218 96.436  1.00 0.00   ? 246  GLY A N     1 
ATOM   1674  C  CA    . GLY A 1 246  ? 130.090 121.550 97.849  1.00 0.00   ? 246  GLY A CA    1 
ATOM   1675  C  C     . GLY A 1 246  ? 131.370 121.068 98.509  1.00 0.00   ? 246  GLY A C     1 
ATOM   1676  O  O     . GLY A 1 246  ? 132.114 120.285 97.932  1.00 0.00   ? 246  GLY A O     1 
ATOM   1677  N  N     . ASN A 1 247  ? 131.630 121.545 99.721  1.00 0.00   ? 247  ASN A N     1 
ATOM   1678  C  CA    . ASN A 1 247  ? 132.838 121.160 100.444 1.00 0.00   ? 247  ASN A CA    1 
ATOM   1679  C  C     . ASN A 1 247  ? 132.543 120.281 101.657 1.00 0.00   ? 247  ASN A C     1 
ATOM   1680  O  O     . ASN A 1 247  ? 133.451 119.902 102.400 1.00 0.00   ? 247  ASN A O     1 
ATOM   1681  C  CB    . ASN A 1 247  ? 133.592 122.419 100.881 1.00 0.00   ? 247  ASN A CB    1 
ATOM   1682  C  CG    . ASN A 1 247  ? 134.033 123.265 99.702  1.00 0.00   ? 247  ASN A CG    1 
ATOM   1683  O  OD1   . ASN A 1 247  ? 134.936 122.886 98.954  1.00 0.00   ? 247  ASN A OD1   1 
ATOM   1684  N  ND2   . ASN A 1 247  ? 133.391 124.415 99.524  1.00 0.00   ? 247  ASN A ND2   1 
ATOM   1685  N  N     . SER A 1 248  ? 131.271 119.958 101.850 1.00 0.00   ? 248  SER A N     1 
ATOM   1686  C  CA    . SER A 1 248  ? 130.846 119.139 102.982 1.00 0.00   ? 248  SER A CA    1 
ATOM   1687  C  C     . SER A 1 248  ? 130.989 117.645 102.723 1.00 0.00   ? 248  SER A C     1 
ATOM   1688  O  O     . SER A 1 248  ? 130.980 117.200 101.574 1.00 0.00   ? 248  SER A O     1 
ATOM   1689  C  CB    . SER A 1 248  ? 129.389 119.445 103.336 1.00 0.00   ? 248  SER A CB    1 
ATOM   1690  O  OG    . SER A 1 248  ? 128.512 119.030 102.307 1.00 0.00   ? 248  SER A OG    1 
ATOM   1691  N  N     . ILE A 1 249  ? 131.130 116.872 103.800 1.00 0.00   ? 249  ILE A N     1 
ATOM   1692  C  CA    . ILE A 1 249  ? 131.262 115.422 103.690 1.00 0.00   ? 249  ILE A CA    1 
ATOM   1693  C  C     . ILE A 1 249  ? 130.737 114.688 104.932 1.00 0.00   ? 249  ILE A C     1 
ATOM   1694  O  O     . ILE A 1 249  ? 131.129 115.001 106.057 1.00 0.00   ? 249  ILE A O     1 
ATOM   1695  C  CB    . ILE A 1 249  ? 132.731 115.025 103.480 1.00 0.00   ? 249  ILE A CB    1 
ATOM   1696  C  CG1   . ILE A 1 249  ? 132.839 113.522 103.195 1.00 0.00   ? 249  ILE A CG1   1 
ATOM   1697  C  CG2   . ILE A 1 249  ? 133.552 115.380 104.711 1.00 0.00   ? 249  ILE A CG2   1 
ATOM   1698  C  CD1   . ILE A 1 249  ? 132.094 113.062 101.950 1.00 0.00   ? 249  ILE A CD1   1 
ATOM   1699  N  N     . PHE A 1 250  ? 129.854 113.713 104.734 1.00 0.00   ? 250  PHE A N     1 
ATOM   1700  C  CA    . PHE A 1 250  ? 129.306 112.922 105.838 1.00 0.00   ? 250  PHE A CA    1 
ATOM   1701  C  C     . PHE A 1 250  ? 130.284 111.780 106.103 1.00 0.00   ? 250  PHE A C     1 
ATOM   1702  O  O     . PHE A 1 250  ? 130.137 110.684 105.564 1.00 0.00   ? 250  PHE A O     1 
ATOM   1703  C  CB    . PHE A 1 250  ? 127.932 112.360 105.468 1.00 0.00   ? 250  PHE A CB    1 
ATOM   1704  C  CG    . PHE A 1 250  ? 127.296 111.524 106.550 1.00 0.00   ? 250  PHE A CG    1 
ATOM   1705  C  CD1   . PHE A 1 250  ? 126.956 112.085 107.783 1.00 0.00   ? 250  PHE A CD1   1 
ATOM   1706  C  CD2   . PHE A 1 250  ? 127.004 110.183 106.329 1.00 0.00   ? 250  PHE A CD2   1 
ATOM   1707  C  CE1   . PHE A 1 250  ? 126.337 111.319 108.769 1.00 0.00   ? 250  PHE A CE1   1 
ATOM   1708  C  CE2   . PHE A 1 250  ? 126.383 109.407 107.311 1.00 0.00   ? 250  PHE A CE2   1 
ATOM   1709  C  CZ    . PHE A 1 250  ? 126.046 109.980 108.530 1.00 0.00   ? 250  PHE A CZ    1 
ATOM   1710  N  N     . LEU A 1 251  ? 131.280 112.047 106.942 1.00 0.00   ? 251  LEU A N     1 
ATOM   1711  C  CA    . LEU A 1 251  ? 132.304 111.065 107.249 1.00 0.00   ? 251  LEU A CA    1 
ATOM   1712  C  C     . LEU A 1 251  ? 132.030 110.163 108.448 1.00 0.00   ? 251  LEU A C     1 
ATOM   1713  O  O     . LEU A 1 251  ? 132.182 110.577 109.601 1.00 0.00   ? 251  LEU A O     1 
ATOM   1714  C  CB    . LEU A 1 251  ? 133.645 111.776 107.434 1.00 0.00   ? 251  LEU A CB    1 
ATOM   1715  C  CG    . LEU A 1 251  ? 134.920 110.957 107.687 1.00 0.00   ? 251  LEU A CG    1 
ATOM   1716  C  CD1   . LEU A 1 251  ? 136.129 111.842 107.450 1.00 0.00   ? 251  LEU A CD1   1 
ATOM   1717  C  CD2   . LEU A 1 251  ? 134.934 110.413 109.104 1.00 0.00   ? 251  LEU A CD2   1 
ATOM   1718  N  N     . VAL A 1 252  ? 131.614 108.931 108.167 1.00 0.00   ? 252  VAL A N     1 
ATOM   1719  C  CA    . VAL A 1 252  ? 131.360 107.937 109.209 1.00 0.00   ? 252  VAL A CA    1 
ATOM   1720  C  C     . VAL A 1 252  ? 132.445 106.881 109.067 1.00 0.00   ? 252  VAL A C     1 
ATOM   1721  O  O     . VAL A 1 252  ? 133.096 106.499 110.034 1.00 0.00   ? 252  VAL A O     1 
ATOM   1722  C  CB    . VAL A 1 252  ? 130.000 107.252 109.035 1.00 0.00   ? 252  VAL A CB    1 
ATOM   1723  C  CG1   . VAL A 1 252  ? 129.879 106.116 110.034 1.00 0.00   ? 252  VAL A CG1   1 
ATOM   1724  C  CG2   . VAL A 1 252  ? 128.881 108.251 109.245 1.00 0.00   ? 252  VAL A CG2   1 
ATOM   1725  N  N     . ALA A 1 253  ? 132.623 106.411 107.837 1.00 0.00   ? 253  ALA A N     1 
ATOM   1726  C  CA    . ALA A 1 253  ? 133.630 105.406 107.528 1.00 0.00   ? 253  ALA A CA    1 
ATOM   1727  C  C     . ALA A 1 253  ? 134.796 106.143 106.872 1.00 0.00   ? 253  ALA A C     1 
ATOM   1728  O  O     . ALA A 1 253  ? 134.628 107.257 106.371 1.00 0.00   ? 253  ALA A O     1 
ATOM   1729  C  CB    . ALA A 1 253  ? 133.063 104.367 106.575 1.00 0.00   ? 253  ALA A CB    1 
ATOM   1730  N  N     . PRO A 1 254  ? 135.989 105.533 106.859 1.00 0.00   ? 254  PRO A N     1 
ATOM   1731  C  CA    . PRO A 1 254  ? 137.108 106.236 106.230 1.00 0.00   ? 254  PRO A CA    1 
ATOM   1732  C  C     . PRO A 1 254  ? 136.739 106.546 104.789 1.00 0.00   ? 254  PRO A C     1 
ATOM   1733  O  O     . PRO A 1 254  ? 136.188 105.702 104.086 1.00 0.00   ? 254  PRO A O     1 
ATOM   1734  C  CB    . PRO A 1 254  ? 138.245 105.230 106.327 1.00 0.00   ? 254  PRO A CB    1 
ATOM   1735  C  CG    . PRO A 1 254  ? 137.942 104.527 107.606 1.00 0.00   ? 254  PRO A CG    1 
ATOM   1736  C  CD    . PRO A 1 254  ? 136.453 104.295 107.505 1.00 0.00   ? 254  PRO A CD    1 
ATOM   1737  N  N     . LEU A 1 255  ? 137.031 107.769 104.364 1.00 0.00   ? 255  LEU A N     1 
ATOM   1738  C  CA    . LEU A 1 255  ? 136.717 108.199 103.011 1.00 0.00   ? 255  LEU A CA    1 
ATOM   1739  C  C     . LEU A 1 255  ? 137.958 108.550 102.223 1.00 0.00   ? 255  LEU A C     1 
ATOM   1740  O  O     . LEU A 1 255  ? 139.007 108.872 102.786 1.00 0.00   ? 255  LEU A O     1 
ATOM   1741  C  CB    . LEU A 1 255  ? 135.803 109.421 103.049 1.00 0.00   ? 255  LEU A CB    1 
ATOM   1742  C  CG    . LEU A 1 255  ? 134.533 109.297 103.883 1.00 0.00   ? 255  LEU A CG    1 
ATOM   1743  C  CD1   . LEU A 1 255  ? 133.918 110.663 104.076 1.00 0.00   ? 255  LEU A CD1   1 
ATOM   1744  C  CD2   . LEU A 1 255  ? 133.561 108.350 103.207 1.00 0.00   ? 255  LEU A CD2   1 
ATOM   1745  N  N     . ILE A 1 256  ? 137.813 108.490 100.908 1.00 0.00   ? 256  ILE A N     1 
ATOM   1746  C  CA    . ILE A 1 256  ? 138.890 108.824 99.991  1.00 0.00   ? 256  ILE A CA    1 
ATOM   1747  C  C     . ILE A 1 256  ? 138.600 110.196 99.398  1.00 0.00   ? 256  ILE A C     1 
ATOM   1748  O  O     . ILE A 1 256  ? 137.751 110.337 98.511  1.00 0.00   ? 256  ILE A O     1 
ATOM   1749  C  CB    . ILE A 1 256  ? 138.988 107.803 98.841  1.00 0.00   ? 256  ILE A CB    1 
ATOM   1750  C  CG1   . ILE A 1 256  ? 139.457 106.439 99.380  1.00 0.00   ? 256  ILE A CG1   1 
ATOM   1751  C  CG2   . ILE A 1 256  ? 139.929 108.314 97.761  1.00 0.00   ? 256  ILE A CG2   1 
ATOM   1752  C  CD1   . ILE A 1 256  ? 140.805 106.486 100.074 1.00 0.00   ? 256  ILE A CD1   1 
ATOM   1753  N  N     . ILE A 1 257  ? 139.291 111.211 99.900  1.00 0.00   ? 257  ILE A N     1 
ATOM   1754  C  CA    . ILE A 1 257  ? 139.111 112.570 99.397  1.00 0.00   ? 257  ILE A CA    1 
ATOM   1755  C  C     . ILE A 1 257  ? 140.061 112.711 98.212  1.00 0.00   ? 257  ILE A C     1 
ATOM   1756  O  O     . ILE A 1 257  ? 141.225 112.318 98.300  1.00 0.00   ? 257  ILE A O     1 
ATOM   1757  C  CB    . ILE A 1 257  ? 139.460 113.625 100.466 1.00 0.00   ? 257  ILE A CB    1 
ATOM   1758  C  CG1   . ILE A 1 257  ? 138.683 113.336 101.759 1.00 0.00   ? 257  ILE A CG1   1 
ATOM   1759  C  CG2   . ILE A 1 257  ? 139.111 115.006 99.962  1.00 0.00   ? 257  ILE A CG2   1 
ATOM   1760  C  CD1   . ILE A 1 257  ? 137.180 113.267 101.580 1.00 0.00   ? 257  ILE A CD1   1 
ATOM   1761  N  N     . TYR A 1 258  ? 139.570 113.265 97.107  1.00 0.00   ? 258  TYR A N     1 
ATOM   1762  C  CA    . TYR A 1 258  ? 140.401 113.406 95.920  1.00 0.00   ? 258  TYR A CA    1 
ATOM   1763  C  C     . TYR A 1 258  ? 140.180 114.696 95.132  1.00 0.00   ? 258  TYR A C     1 
ATOM   1764  O  O     . TYR A 1 258  ? 139.147 115.356 95.269  1.00 0.00   ? 258  TYR A O     1 
ATOM   1765  C  CB    . TYR A 1 258  ? 140.184 112.201 95.000  1.00 0.00   ? 258  TYR A CB    1 
ATOM   1766  C  CG    . TYR A 1 258  ? 138.826 112.145 94.332  1.00 0.00   ? 258  TYR A CG    1 
ATOM   1767  C  CD1   . TYR A 1 258  ? 138.631 112.697 93.066  1.00 0.00   ? 258  TYR A CD1   1 
ATOM   1768  C  CD2   . TYR A 1 258  ? 137.735 111.548 94.966  1.00 0.00   ? 258  TYR A CD2   1 
ATOM   1769  C  CE1   . TYR A 1 258  ? 137.385 112.650 92.447  1.00 0.00   ? 258  TYR A CE1   1 
ATOM   1770  C  CE2   . TYR A 1 258  ? 136.485 111.502 94.352  1.00 0.00   ? 258  TYR A CE2   1 
ATOM   1771  C  CZ    . TYR A 1 258  ? 136.317 112.053 93.094  1.00 0.00   ? 258  TYR A CZ    1 
ATOM   1772  O  OH    . TYR A 1 258  ? 135.088 112.003 92.481  1.00 0.00   ? 258  TYR A OH    1 
ATOM   1773  N  N     . HIS A 1 259  ? 141.171 115.046 94.315  1.00 0.00   ? 259  HIS A N     1 
ATOM   1774  C  CA    . HIS A 1 259  ? 141.127 116.234 93.467  1.00 0.00   ? 259  HIS A CA    1 
ATOM   1775  C  C     . HIS A 1 259  ? 141.501 115.829 92.042  1.00 0.00   ? 259  HIS A C     1 
ATOM   1776  O  O     . HIS A 1 259  ? 142.594 115.312 91.799  1.00 0.00   ? 259  HIS A O     1 
ATOM   1777  C  CB    . HIS A 1 259  ? 142.119 117.289 93.964  1.00 0.00   ? 259  HIS A CB    1 
ATOM   1778  C  CG    . HIS A 1 259  ? 142.509 118.302 92.930  1.00 0.00   ? 259  HIS A CG    1 
ATOM   1779  N  ND1   . HIS A 1 259  ? 141.626 119.230 92.426  1.00 0.00   ? 259  HIS A ND1   1 
ATOM   1780  C  CD2   . HIS A 1 259  ? 143.693 118.539 92.320  1.00 0.00   ? 259  HIS A CD2   1 
ATOM   1781  C  CE1   . HIS A 1 259  ? 142.250 119.997 91.550  1.00 0.00   ? 259  HIS A CE1   1 
ATOM   1782  N  NE2   . HIS A 1 259  ? 143.506 119.601 91.469  1.00 0.00   ? 259  HIS A NE2   1 
ATOM   1783  N  N     . VAL A 1 260  ? 140.589 116.051 91.102  1.00 0.00   ? 260  VAL A N     1 
ATOM   1784  C  CA    . VAL A 1 260  ? 140.854 115.715 89.711  1.00 0.00   ? 260  VAL A CA    1 
ATOM   1785  C  C     . VAL A 1 260  ? 141.676 116.842 89.102  1.00 0.00   ? 260  VAL A C     1 
ATOM   1786  O  O     . VAL A 1 260  ? 141.264 117.996 89.138  1.00 0.00   ? 260  VAL A O     1 
ATOM   1787  C  CB    . VAL A 1 260  ? 139.545 115.550 88.915  1.00 0.00   ? 260  VAL A CB    1 
ATOM   1788  C  CG1   . VAL A 1 260  ? 139.856 115.314 87.452  1.00 0.00   ? 260  VAL A CG1   1 
ATOM   1789  C  CG2   . VAL A 1 260  ? 138.734 114.383 89.473  1.00 0.00   ? 260  VAL A CG2   1 
ATOM   1790  N  N     . ILE A 1 261  ? 142.837 116.503 88.547  1.00 0.00   ? 261  ILE A N     1 
ATOM   1791  C  CA    . ILE A 1 261  ? 143.724 117.501 87.948  1.00 0.00   ? 261  ILE A CA    1 
ATOM   1792  C  C     . ILE A 1 261  ? 143.285 117.913 86.547  1.00 0.00   ? 261  ILE A C     1 
ATOM   1793  O  O     . ILE A 1 261  ? 143.205 117.082 85.641  1.00 0.00   ? 261  ILE A O     1 
ATOM   1794  C  CB    . ILE A 1 261  ? 145.173 116.972 87.863  1.00 0.00   ? 261  ILE A CB    1 
ATOM   1795  C  CG1   . ILE A 1 261  ? 145.655 116.554 89.257  1.00 0.00   ? 261  ILE A CG1   1 
ATOM   1796  C  CG2   . ILE A 1 261  ? 146.083 118.044 87.277  1.00 0.00   ? 261  ILE A CG2   1 
ATOM   1797  C  CD1   . ILE A 1 261  ? 147.031 115.903 89.276  1.00 0.00   ? 261  ILE A CD1   1 
ATOM   1798  N  N     . ASP A 1 262  ? 143.004 119.202 86.376  1.00 0.00   ? 262  ASP A N     1 
ATOM   1799  C  CA    . ASP A 1 262  ? 142.579 119.731 85.083  1.00 0.00   ? 262  ASP A CA    1 
ATOM   1800  C  C     . ASP A 1 262  ? 143.367 120.984 84.703  1.00 0.00   ? 262  ASP A C     1 
ATOM   1801  O  O     . ASP A 1 262  ? 144.365 121.316 85.337  1.00 0.00   ? 262  ASP A O     1 
ATOM   1802  C  CB    . ASP A 1 262  ? 141.078 120.041 85.088  1.00 0.00   ? 262  ASP A CB    1 
ATOM   1803  C  CG    . ASP A 1 262  ? 140.700 121.114 86.091  1.00 0.00   ? 262  ASP A CG    1 
ATOM   1804  O  OD1   . ASP A 1 262  ? 141.585 121.880 86.526  1.00 0.00   ? 262  ASP A OD1   1 
ATOM   1805  O  OD2   . ASP A 1 262  ? 139.500 121.210 86.431  1.00 0.00   ? 262  ASP A OD2   1 
ATOM   1806  N  N     . SER A 1 263  ? 142.903 121.672 83.660  1.00 0.00   ? 263  SER A N     1 
ATOM   1807  C  CA    . SER A 1 263  ? 143.559 122.884 83.176  1.00 0.00   ? 263  SER A CA    1 
ATOM   1808  C  C     . SER A 1 263  ? 143.639 124.001 84.214  1.00 0.00   ? 263  SER A C     1 
ATOM   1809  O  O     . SER A 1 263  ? 144.443 124.923 84.076  1.00 0.00   ? 263  SER A O     1 
ATOM   1810  C  CB    . SER A 1 263  ? 142.851 123.400 81.919  1.00 0.00   ? 263  SER A CB    1 
ATOM   1811  O  OG    . SER A 1 263  ? 141.487 123.699 82.169  1.00 0.00   ? 263  SER A OG    1 
ATOM   1812  N  N     . ASN A 1 264  ? 142.815 123.923 85.255  1.00 0.00   ? 264  ASN A N     1 
ATOM   1813  C  CA    . ASN A 1 264  ? 142.817 124.952 86.291  1.00 0.00   ? 264  ASN A CA    1 
ATOM   1814  C  C     . ASN A 1 264  ? 143.518 124.523 87.578  1.00 0.00   ? 264  ASN A C     1 
ATOM   1815  O  O     . ASN A 1 264  ? 143.608 125.294 88.533  1.00 0.00   ? 264  ASN A O     1 
ATOM   1816  C  CB    . ASN A 1 264  ? 141.384 125.388 86.612  1.00 0.00   ? 264  ASN A CB    1 
ATOM   1817  C  CG    . ASN A 1 264  ? 140.682 126.011 85.419  1.00 0.00   ? 264  ASN A CG    1 
ATOM   1818  O  OD1   . ASN A 1 264  ? 141.215 126.912 84.773  1.00 0.00   ? 264  ASN A OD1   1 
ATOM   1819  N  ND2   . ASN A 1 264  ? 139.473 125.541 85.133  1.00 0.00   ? 264  ASN A ND2   1 
ATOM   1820  N  N     . SER A 1 265  ? 144.016 123.291 87.601  1.00 0.00   ? 265  SER A N     1 
ATOM   1821  C  CA    . SER A 1 265  ? 144.701 122.768 88.774  1.00 0.00   ? 265  SER A CA    1 
ATOM   1822  C  C     . SER A 1 265  ? 146.194 123.062 88.699  1.00 0.00   ? 265  SER A C     1 
ATOM   1823  O  O     . SER A 1 265  ? 146.808 122.925 87.643  1.00 0.00   ? 265  SER A O     1 
ATOM   1824  C  CB    . SER A 1 265  ? 144.478 121.260 88.876  1.00 0.00   ? 265  SER A CB    1 
ATOM   1825  O  OG    . SER A 1 265  ? 145.207 120.702 89.954  1.00 0.00   ? 265  SER A OG    1 
ATOM   1826  N  N     . PRO A 1 266  ? 146.797 123.468 89.827  1.00 0.00   ? 266  PRO A N     1 
ATOM   1827  C  CA    . PRO A 1 266  ? 148.228 123.776 89.857  1.00 0.00   ? 266  PRO A CA    1 
ATOM   1828  C  C     . PRO A 1 266  ? 149.095 122.529 89.709  1.00 0.00   ? 266  PRO A C     1 
ATOM   1829  O  O     . PRO A 1 266  ? 150.312 122.624 89.574  1.00 0.00   ? 266  PRO A O     1 
ATOM   1830  C  CB    . PRO A 1 266  ? 148.399 124.445 91.215  1.00 0.00   ? 266  PRO A CB    1 
ATOM   1831  C  CG    . PRO A 1 266  ? 147.418 123.693 92.056  1.00 0.00   ? 266  PRO A CG    1 
ATOM   1832  C  CD    . PRO A 1 266  ? 146.199 123.641 91.161  1.00 0.00   ? 266  PRO A CD    1 
ATOM   1833  N  N     . LEU A 1 267  ? 148.465 121.359 89.735  1.00 0.00   ? 267  LEU A N     1 
ATOM   1834  C  CA    . LEU A 1 267  ? 149.183 120.095 89.606  1.00 0.00   ? 267  LEU A CA    1 
ATOM   1835  C  C     . LEU A 1 267  ? 149.103 119.572 88.172  1.00 0.00   ? 267  LEU A C     1 
ATOM   1836  O  O     . LEU A 1 267  ? 149.475 118.430 87.893  1.00 0.00   ? 267  LEU A O     1 
ATOM   1837  C  CB    . LEU A 1 267  ? 148.591 119.057 90.570  1.00 0.00   ? 267  LEU A CB    1 
ATOM   1838  C  CG    . LEU A 1 267  ? 148.380 119.505 92.020  1.00 0.00   ? 267  LEU A CG    1 
ATOM   1839  C  CD1   . LEU A 1 267  ? 147.731 118.374 92.801  1.00 0.00   ? 267  LEU A CD1   1 
ATOM   1840  C  CD2   . LEU A 1 267  ? 149.705 119.905 92.656  1.00 0.00   ? 267  LEU A CD2   1 
ATOM   1841  N  N     . TYR A 1 268  ? 148.628 120.420 87.265  1.00 0.00   ? 268  TYR A N     1 
ATOM   1842  C  CA    . TYR A 1 268  ? 148.485 120.053 85.858  1.00 0.00   ? 268  TYR A CA    1 
ATOM   1843  C  C     . TYR A 1 268  ? 149.831 119.736 85.211  1.00 0.00   ? 268  TYR A C     1 
ATOM   1844  O  O     . TYR A 1 268  ? 149.885 119.046 84.196  1.00 0.00   ? 268  TYR A O     1 
ATOM   1845  C  CB    . TYR A 1 268  ? 147.799 121.185 85.089  1.00 0.00   ? 268  TYR A CB    1 
ATOM   1846  C  CG    . TYR A 1 268  ? 147.163 120.767 83.776  1.00 0.00   ? 268  TYR A CG    1 
ATOM   1847  C  CD1   . TYR A 1 268  ? 146.210 119.745 83.727  1.00 0.00   ? 268  TYR A CD1   1 
ATOM   1848  C  CD2   . TYR A 1 268  ? 147.487 121.414 82.583  1.00 0.00   ? 268  TYR A CD2   1 
ATOM   1849  C  CE1   . TYR A 1 268  ? 145.598 119.386 82.528  1.00 0.00   ? 268  TYR A CE1   1 
ATOM   1850  C  CE2   . TYR A 1 268  ? 146.880 121.063 81.382  1.00 0.00   ? 268  TYR A CE2   1 
ATOM   1851  C  CZ    . TYR A 1 268  ? 145.941 120.050 81.359  1.00 0.00   ? 268  TYR A CZ    1 
ATOM   1852  O  OH    . TYR A 1 268  ? 145.353 119.713 80.166  1.00 0.00   ? 268  TYR A OH    1 
ATOM   1853  N  N     . ASP A 1 269  ? 150.914 120.255 85.787  1.00 0.00   ? 269  ASP A N     1 
ATOM   1854  C  CA    . ASP A 1 269  ? 152.259 120.020 85.252  1.00 0.00   ? 269  ASP A CA    1 
ATOM   1855  C  C     . ASP A 1 269  ? 153.177 119.187 86.147  1.00 0.00   ? 269  ASP A C     1 
ATOM   1856  O  O     . ASP A 1 269  ? 154.400 119.320 86.074  1.00 0.00   ? 269  ASP A O     1 
ATOM   1857  C  CB    . ASP A 1 269  ? 152.950 121.352 84.955  1.00 0.00   ? 269  ASP A CB    1 
ATOM   1858  C  CG    . ASP A 1 269  ? 152.233 122.158 83.894  1.00 0.00   ? 269  ASP A CG    1 
ATOM   1859  O  OD1   . ASP A 1 269  ? 152.075 121.651 82.760  1.00 0.00   ? 269  ASP A OD1   1 
ATOM   1860  O  OD2   . ASP A 1 269  ? 151.829 123.303 84.185  1.00 0.00   ? 269  ASP A OD2   1 
ATOM   1861  N  N     . LEU A 1 270  ? 152.598 118.339 86.989  1.00 0.00   ? 270  LEU A N     1 
ATOM   1862  C  CA    . LEU A 1 270  ? 153.398 117.512 87.884  1.00 0.00   ? 270  LEU A CA    1 
ATOM   1863  C  C     . LEU A 1 270  ? 154.230 116.467 87.153  1.00 0.00   ? 270  LEU A C     1 
ATOM   1864  O  O     . LEU A 1 270  ? 153.735 115.766 86.274  1.00 0.00   ? 270  LEU A O     1 
ATOM   1865  C  CB    . LEU A 1 270  ? 152.500 116.813 88.907  1.00 0.00   ? 270  LEU A CB    1 
ATOM   1866  C  CG    . LEU A 1 270  ? 151.966 117.653 90.064  1.00 0.00   ? 270  LEU A CG    1 
ATOM   1867  C  CD1   . LEU A 1 270  ? 151.076 116.774 90.920  1.00 0.00   ? 270  LEU A CD1   1 
ATOM   1868  C  CD2   . LEU A 1 270  ? 153.112 118.214 90.894  1.00 0.00   ? 270  LEU A CD2   1 
ATOM   1869  N  N     . ALA A 1 271  ? 155.502 116.381 87.527  1.00 0.00   ? 271  ALA A N     1 
ATOM   1870  C  CA    . ALA A 1 271  ? 156.407 115.414 86.935  1.00 0.00   ? 271  ALA A CA    1 
ATOM   1871  C  C     . ALA A 1 271  ? 156.311 114.164 87.806  1.00 0.00   ? 271  ALA A C     1 
ATOM   1872  O  O     . ALA A 1 271  ? 156.470 114.242 89.017  1.00 0.00   ? 271  ALA A O     1 
ATOM   1873  C  CB    . ALA A 1 271  ? 157.824 115.965 86.942  1.00 0.00   ? 271  ALA A CB    1 
ATOM   1874  N  N     . PRO A 1 272  ? 156.058 112.992 87.202  1.00 0.00   ? 272  PRO A N     1 
ATOM   1875  C  CA    . PRO A 1 272  ? 155.944 111.769 88.000  1.00 0.00   ? 272  PRO A CA    1 
ATOM   1876  C  C     . PRO A 1 272  ? 157.159 111.379 88.845  1.00 0.00   ? 272  PRO A C     1 
ATOM   1877  O  O     . PRO A 1 272  ? 157.036 110.591 89.783  1.00 0.00   ? 272  PRO A O     1 
ATOM   1878  C  CB    . PRO A 1 272  ? 155.606 110.706 86.957  1.00 0.00   ? 272  PRO A CB    1 
ATOM   1879  C  CG    . PRO A 1 272  ? 154.844 111.482 85.926  1.00 0.00   ? 272  PRO A CG    1 
ATOM   1880  C  CD    . PRO A 1 272  ? 155.666 112.742 85.802  1.00 0.00   ? 272  PRO A CD    1 
ATOM   1881  N  N     . SER A 1 273  ? 158.336 111.905 88.503  1.00 0.00   ? 273  SER A N     1 
ATOM   1882  C  CA    . SER A 1 273  ? 159.547 111.582 89.253  1.00 0.00   ? 273  SER A CA    1 
ATOM   1883  C  C     . SER A 1 273  ? 160.184 112.726 90.041  1.00 0.00   ? 273  SER A C     1 
ATOM   1884  O  O     . SER A 1 273  ? 160.555 112.552 91.201  1.00 0.00   ? 273  SER A O     1 
ATOM   1885  C  CB    . SER A 1 273  ? 160.598 110.969 88.326  1.00 0.00   ? 273  SER A CB    1 
ATOM   1886  O  OG    . SER A 1 273  ? 161.039 111.901 87.361  1.00 0.00   ? 273  SER A OG    1 
ATOM   1887  N  N     . ASP A 1 274  ? 160.329 113.890 89.412  1.00 0.00   ? 274  ASP A N     1 
ATOM   1888  C  CA    . ASP A 1 274  ? 160.960 115.042 90.064  1.00 0.00   ? 274  ASP A CA    1 
ATOM   1889  C  C     . ASP A 1 274  ? 160.055 115.839 91.003  1.00 0.00   ? 274  ASP A C     1 
ATOM   1890  O  O     . ASP A 1 274  ? 160.536 116.569 91.872  1.00 0.00   ? 274  ASP A O     1 
ATOM   1891  C  CB    . ASP A 1 274  ? 161.539 115.995 89.015  1.00 0.00   ? 274  ASP A CB    1 
ATOM   1892  C  CG    . ASP A 1 274  ? 162.452 115.293 88.029  1.00 0.00   ? 274  ASP A CG    1 
ATOM   1893  O  OD1   . ASP A 1 274  ? 163.043 114.250 88.396  1.00 0.00   ? 274  ASP A OD1   1 
ATOM   1894  O  OD2   . ASP A 1 274  ? 162.593 115.786 86.889  1.00 0.00   ? 274  ASP A OD2   1 
ATOM   1895  N  N     . LEU A 1 275  ? 158.745 115.696 90.830  1.00 0.00   ? 275  LEU A N     1 
ATOM   1896  C  CA    . LEU A 1 275  ? 157.784 116.413 91.659  1.00 0.00   ? 275  LEU A CA    1 
ATOM   1897  C  C     . LEU A 1 275  ? 157.966 116.025 93.114  1.00 0.00   ? 275  LEU A C     1 
ATOM   1898  O  O     . LEU A 1 275  ? 157.734 116.830 94.018  1.00 0.00   ? 275  LEU A O     1 
ATOM   1899  C  CB    . LEU A 1 275  ? 156.346 116.090 91.228  1.00 0.00   ? 275  LEU A CB    1 
ATOM   1900  N  N     . HIS A 1 276  ? 158.384 114.785 93.331  1.00 0.00   ? 276  HIS A N     1 
ATOM   1901  C  CA    . HIS A 1 276  ? 158.560 114.253 94.673  1.00 0.00   ? 276  HIS A CA    1 
ATOM   1902  C  C     . HIS A 1 276  ? 159.770 114.748 95.454  1.00 0.00   ? 276  HIS A C     1 
ATOM   1903  O  O     . HIS A 1 276  ? 159.659 115.055 96.635  1.00 0.00   ? 276  HIS A O     1 
ATOM   1904  C  CB    . HIS A 1 276  ? 158.600 112.725 94.609  1.00 0.00   ? 276  HIS A CB    1 
ATOM   1905  C  CG    . HIS A 1 276  ? 157.354 112.120 94.039  1.00 0.00   ? 276  HIS A CG    1 
ATOM   1906  N  ND1   . HIS A 1 276  ? 156.122 112.239 94.643  1.00 0.00   ? 276  HIS A ND1   1 
ATOM   1907  C  CD2   . HIS A 1 276  ? 157.152 111.402 92.911  1.00 0.00   ? 276  HIS A CD2   1 
ATOM   1908  C  CE1   . HIS A 1 276  ? 155.212 111.618 93.911  1.00 0.00   ? 276  HIS A CE1   1 
ATOM   1909  N  NE2   . HIS A 1 276  ? 155.813 111.101 92.854  1.00 0.00   ? 276  HIS A NE2   1 
ATOM   1910  N  N     . HIS A 1 277  ? 160.928 114.820 94.812  1.00 0.00   ? 277  HIS A N     1 
ATOM   1911  C  CA    . HIS A 1 277  ? 162.131 115.239 95.528  1.00 0.00   ? 277  HIS A CA    1 
ATOM   1912  C  C     . HIS A 1 277  ? 162.802 116.570 95.198  1.00 0.00   ? 277  HIS A C     1 
ATOM   1913  O  O     . HIS A 1 277  ? 163.191 117.300 96.101  1.00 0.00   ? 277  HIS A O     1 
ATOM   1914  C  CB    . HIS A 1 277  ? 163.149 114.102 95.448  1.00 0.00   ? 277  HIS A CB    1 
ATOM   1915  C  CG    . HIS A 1 277  ? 162.570 112.759 95.786  1.00 0.00   ? 277  HIS A CG    1 
ATOM   1916  N  ND1   . HIS A 1 277  ? 162.158 112.424 97.060  1.00 0.00   ? 277  HIS A ND1   1 
ATOM   1917  C  CD2   . HIS A 1 277  ? 162.287 111.690 95.009  1.00 0.00   ? 277  HIS A CD2   1 
ATOM   1918  C  CE1   . HIS A 1 277  ? 161.646 111.207 97.050  1.00 0.00   ? 277  HIS A CE1   1 
ATOM   1919  N  NE2   . HIS A 1 277  ? 161.712 110.736 95.817  1.00 0.00   ? 277  HIS A NE2   1 
ATOM   1920  N  N     . HIS A 1 278  ? 162.935 116.896 93.918  1.00 0.00   ? 278  HIS A N     1 
ATOM   1921  C  CA    . HIS A 1 278  ? 163.593 118.148 93.530  1.00 0.00   ? 278  HIS A CA    1 
ATOM   1922  C  C     . HIS A 1 278  ? 162.707 119.379 93.676  1.00 0.00   ? 278  HIS A C     1 
ATOM   1923  O  O     . HIS A 1 278  ? 163.199 120.489 93.885  1.00 0.00   ? 278  HIS A O     1 
ATOM   1924  C  CB    . HIS A 1 278  ? 164.125 118.038 92.105  1.00 0.00   ? 278  HIS A CB    1 
ATOM   1925  C  CG    . HIS A 1 278  ? 165.021 116.858 91.896  1.00 0.00   ? 278  HIS A CG    1 
ATOM   1926  N  ND1   . HIS A 1 278  ? 166.232 116.720 92.534  1.00 0.00   ? 278  HIS A ND1   1 
ATOM   1927  C  CD2   . HIS A 1 278  ? 164.861 115.740 91.147  1.00 0.00   ? 278  HIS A CD2   1 
ATOM   1928  C  CE1   . HIS A 1 278  ? 166.780 115.570 92.195  1.00 0.00   ? 278  HIS A CE1   1 
ATOM   1929  N  NE2   . HIS A 1 278  ? 165.968 114.954 91.354  1.00 0.00   ? 278  HIS A NE2   1 
ATOM   1930  N  N     . GLN A 1 279  ? 161.400 119.185 93.562  1.00 0.00   ? 279  GLN A N     1 
ATOM   1931  C  CA    . GLN A 1 279  ? 160.457 120.276 93.745  1.00 0.00   ? 279  GLN A CA    1 
ATOM   1932  C  C     . GLN A 1 279  ? 160.137 120.207 95.234  1.00 0.00   ? 279  GLN A C     1 
ATOM   1933  O  O     . GLN A 1 279  ? 160.159 119.124 95.820  1.00 0.00   ? 279  GLN A O     1 
ATOM   1934  C  CB    . GLN A 1 279  ? 159.181 120.062 92.924  1.00 0.00   ? 279  GLN A CB    1 
ATOM   1935  C  CG    . GLN A 1 279  ? 159.371 120.024 91.407  1.00 0.00   ? 279  GLN A CG    1 
ATOM   1936  C  CD    . GLN A 1 279  ? 158.047 120.004 90.660  1.00 0.00   ? 279  GLN A CD    1 
ATOM   1937  O  OE1   . GLN A 1 279  ? 156.985 119.845 91.264  1.00 0.00   ? 279  GLN A OE1   1 
ATOM   1938  N  NE2   . GLN A 1 279  ? 158.104 120.161 89.341  1.00 0.00   ? 279  GLN A NE2   1 
ATOM   1939  N  N     . ASP A 1 280  ? 159.862 121.347 95.857  1.00 0.00   ? 280  ASP A N     1 
ATOM   1940  C  CA    . ASP A 1 280  ? 159.567 121.346 97.285  1.00 0.00   ? 280  ASP A CA    1 
ATOM   1941  C  C     . ASP A 1 280  ? 158.213 121.981 97.579  1.00 0.00   ? 280  ASP A C     1 
ATOM   1942  O  O     . ASP A 1 280  ? 158.132 123.062 98.170  1.00 0.00   ? 280  ASP A O     1 
ATOM   1943  C  CB    . ASP A 1 280  ? 160.685 122.070 98.046  1.00 0.00   ? 280  ASP A CB    1 
ATOM   1944  C  CG    . ASP A 1 280  ? 160.666 121.779 99.532  1.00 0.00   ? 280  ASP A CG    1 
ATOM   1945  O  OD1   . ASP A 1 280  ? 160.080 120.748 99.923  1.00 0.00   ? 280  ASP A OD1   1 
ATOM   1946  O  OD2   . ASP A 1 280  ? 161.247 122.567 100.314 1.00 0.00   ? 280  ASP A OD2   1 
ATOM   1947  N  N     . LEU A 1 281  ? 157.146 121.294 97.171  1.00 0.00   ? 281  LEU A N     1 
ATOM   1948  C  CA    . LEU A 1 281  ? 155.785 121.781 97.373  1.00 0.00   ? 281  LEU A CA    1 
ATOM   1949  C  C     . LEU A 1 281  ? 155.145 121.106 98.584  1.00 0.00   ? 281  LEU A C     1 
ATOM   1950  O  O     . LEU A 1 281  ? 155.646 120.095 99.075  1.00 0.00   ? 281  LEU A O     1 
ATOM   1951  C  CB    . LEU A 1 281  ? 154.946 121.502 96.123  1.00 0.00   ? 281  LEU A CB    1 
ATOM   1952  C  CG    . LEU A 1 281  ? 155.562 121.967 94.802  1.00 0.00   ? 281  LEU A CG    1 
ATOM   1953  C  CD1   . LEU A 1 281  ? 154.720 121.483 93.631  1.00 0.00   ? 281  LEU A CD1   1 
ATOM   1954  C  CD2   . LEU A 1 281  ? 155.681 123.478 94.802  1.00 0.00   ? 281  LEU A CD2   1 
ATOM   1955  N  N     . GLU A 1 282  ? 154.038 121.670 99.059  1.00 0.00   ? 282  GLU A N     1 
ATOM   1956  C  CA    . GLU A 1 282  ? 153.331 121.120 100.208 1.00 0.00   ? 282  GLU A CA    1 
ATOM   1957  C  C     . GLU A 1 282  ? 151.822 121.252 100.060 1.00 0.00   ? 282  GLU A C     1 
ATOM   1958  O  O     . GLU A 1 282  ? 151.311 122.324 99.728  1.00 0.00   ? 282  GLU A O     1 
ATOM   1959  C  CB    . GLU A 1 282  ? 153.774 121.820 101.496 1.00 0.00   ? 282  GLU A CB    1 
ATOM   1960  C  CG    . GLU A 1 282  ? 153.257 121.173 102.776 1.00 0.00   ? 282  GLU A CG    1 
ATOM   1961  C  CD    . GLU A 1 282  ? 153.689 121.912 104.029 1.00 0.00   ? 282  GLU A CD    1 
ATOM   1962  O  OE1   . GLU A 1 282  ? 154.702 122.643 103.965 1.00 0.00   ? 282  GLU A OE1   1 
ATOM   1963  O  OE2   . GLU A 1 282  ? 153.032 121.755 105.083 1.00 0.00   ? 282  GLU A OE2   1 
ATOM   1964  N  N     . ILE A 1 283  ? 151.121 120.147 100.310 1.00 0.00   ? 283  ILE A N     1 
ATOM   1965  C  CA    . ILE A 1 283  ? 149.668 120.112 100.226 1.00 0.00   ? 283  ILE A CA    1 
ATOM   1966  C  C     . ILE A 1 283  ? 149.083 120.256 101.625 1.00 0.00   ? 283  ILE A C     1 
ATOM   1967  O  O     . ILE A 1 283  ? 149.355 119.436 102.510 1.00 0.00   ? 283  ILE A O     1 
ATOM   1968  C  CB    . ILE A 1 283  ? 149.170 118.779 99.616  1.00 0.00   ? 283  ILE A CB    1 
ATOM   1969  C  CG1   . ILE A 1 283  ? 149.822 118.546 98.246  1.00 0.00   ? 283  ILE A CG1   1 
ATOM   1970  C  CG2   . ILE A 1 283  ? 147.657 118.806 99.478  1.00 0.00   ? 283  ILE A CG2   1 
ATOM   1971  C  CD1   . ILE A 1 283  ? 149.549 119.637 97.233  1.00 0.00   ? 283  ILE A CD1   1 
ATOM   1972  N  N     . ILE A 1 284  ? 148.290 121.298 101.821 1.00 0.00   ? 284  ILE A N     1 
ATOM   1973  C  CA    . ILE A 1 284  ? 147.664 121.544 103.114 1.00 0.00   ? 284  ILE A CA    1 
ATOM   1974  C  C     . ILE A 1 284  ? 146.223 121.051 103.085 1.00 0.00   ? 284  ILE A C     1 
ATOM   1975  O  O     . ILE A 1 284  ? 145.429 121.461 102.236 1.00 0.00   ? 284  ILE A O     1 
ATOM   1976  C  CB    . ILE A 1 284  ? 147.660 123.049 103.469 1.00 0.00   ? 284  ILE A CB    1 
ATOM   1977  C  CG1   . ILE A 1 284  ? 149.084 123.612 103.377 1.00 0.00   ? 284  ILE A CG1   1 
ATOM   1978  C  CG2   . ILE A 1 284  ? 147.123 123.243 104.876 1.00 0.00   ? 284  ILE A CG2   1 
ATOM   1979  C  CD1   . ILE A 1 284  ? 150.089 122.930 104.287 1.00 0.00   ? 284  ILE A CD1   1 
ATOM   1980  N  N     . VAL A 1 285  ? 145.900 120.157 104.012 1.00 0.00   ? 285  VAL A N     1 
ATOM   1981  C  CA    . VAL A 1 285  ? 144.561 119.593 104.113 1.00 0.00   ? 285  VAL A CA    1 
ATOM   1982  C  C     . VAL A 1 285  ? 143.878 120.046 105.397 1.00 0.00   ? 285  VAL A C     1 
ATOM   1983  O  O     . VAL A 1 285  ? 144.325 119.727 106.497 1.00 0.00   ? 285  VAL A O     1 
ATOM   1984  C  CB    . VAL A 1 285  ? 144.595 118.054 104.105 1.00 0.00   ? 285  VAL A CB    1 
ATOM   1985  C  CG1   . VAL A 1 285  ? 143.181 117.509 104.120 1.00 0.00   ? 285  VAL A CG1   1 
ATOM   1986  C  CG2   . VAL A 1 285  ? 145.345 117.553 102.880 1.00 0.00   ? 285  VAL A CG2   1 
ATOM   1987  N  N     . ILE A 1 286  ? 142.787 120.787 105.248 1.00 0.00   ? 286  ILE A N     1 
ATOM   1988  C  CA    . ILE A 1 286  ? 142.056 121.287 106.404 1.00 0.00   ? 286  ILE A CA    1 
ATOM   1989  C  C     . ILE A 1 286  ? 140.680 120.645 106.539 1.00 0.00   ? 286  ILE A C     1 
ATOM   1990  O  O     . ILE A 1 286  ? 139.891 120.629 105.591 1.00 0.00   ? 286  ILE A O     1 
ATOM   1991  C  CB    . ILE A 1 286  ? 141.870 122.820 106.330 1.00 0.00   ? 286  ILE A CB    1 
ATOM   1992  C  CG1   . ILE A 1 286  ? 143.228 123.502 106.137 1.00 0.00   ? 286  ILE A CG1   1 
ATOM   1993  C  CG2   . ILE A 1 286  ? 141.207 123.319 107.607 1.00 0.00   ? 286  ILE A CG2   1 
ATOM   1994  C  CD1   . ILE A 1 286  ? 144.230 123.217 107.236 1.00 0.00   ? 286  ILE A CD1   1 
ATOM   1995  N  N     . LEU A 1 287  ? 140.400 120.115 107.725 1.00 0.00   ? 287  LEU A N     1 
ATOM   1996  C  CA    . LEU A 1 287  ? 139.110 119.493 107.997 1.00 0.00   ? 287  LEU A CA    1 
ATOM   1997  C  C     . LEU A 1 287  ? 138.417 120.247 109.125 1.00 0.00   ? 287  LEU A C     1 
ATOM   1998  O  O     . LEU A 1 287  ? 138.807 120.138 110.290 1.00 0.00   ? 287  LEU A O     1 
ATOM   1999  C  CB    . LEU A 1 287  ? 139.289 118.022 108.385 1.00 0.00   ? 287  LEU A CB    1 
ATOM   2000  C  CG    . LEU A 1 287  ? 138.018 117.281 108.817 1.00 0.00   ? 287  LEU A CG    1 
ATOM   2001  C  CD1   . LEU A 1 287  ? 136.988 117.321 107.699 1.00 0.00   ? 287  LEU A CD1   1 
ATOM   2002  C  CD2   . LEU A 1 287  ? 138.350 115.843 109.184 1.00 0.00   ? 287  LEU A CD2   1 
ATOM   2003  N  N     . GLU A 1 288  ? 137.397 121.021 108.775 1.00 0.00   ? 288  GLU A N     1 
ATOM   2004  C  CA    . GLU A 1 288  ? 136.654 121.796 109.759 1.00 0.00   ? 288  GLU A CA    1 
ATOM   2005  C  C     . GLU A 1 288  ? 135.328 121.110 110.095 1.00 0.00   ? 288  GLU A C     1 
ATOM   2006  O  O     . GLU A 1 288  ? 134.950 120.128 109.456 1.00 0.00   ? 288  GLU A O     1 
ATOM   2007  C  CB    . GLU A 1 288  ? 136.402 123.213 109.229 1.00 0.00   ? 288  GLU A CB    1 
ATOM   2008  C  CG    . GLU A 1 288  ? 137.656 123.896 108.690 1.00 0.00   ? 288  GLU A CG    1 
ATOM   2009  C  CD    . GLU A 1 288  ? 137.434 125.359 108.355 1.00 0.00   ? 288  GLU A CD    1 
ATOM   2010  O  OE1   . GLU A 1 288  ? 136.455 125.670 107.641 1.00 0.00   ? 288  GLU A OE1   1 
ATOM   2011  O  OE2   . GLU A 1 288  ? 138.241 126.200 108.807 1.00 0.00   ? 288  GLU A OE2   1 
ATOM   2012  N  N     . GLY A 1 289  ? 134.639 121.627 111.108 1.00 0.00   ? 289  GLY A N     1 
ATOM   2013  C  CA    . GLY A 1 289  ? 133.366 121.057 111.519 1.00 0.00   ? 289  GLY A CA    1 
ATOM   2014  C  C     . GLY A 1 289  ? 133.115 121.244 113.002 1.00 0.00   ? 289  GLY A C     1 
ATOM   2015  O  O     . GLY A 1 289  ? 134.018 121.634 113.743 1.00 0.00   ? 289  GLY A O     1 
ATOM   2016  N  N     . VAL A 1 290  ? 131.897 120.957 113.439 1.00 0.00   ? 290  VAL A N     1 
ATOM   2017  C  CA    . VAL A 1 290  ? 131.546 121.113 114.845 1.00 0.00   ? 290  VAL A CA    1 
ATOM   2018  C  C     . VAL A 1 290  ? 131.280 119.783 115.543 1.00 0.00   ? 290  VAL A C     1 
ATOM   2019  O  O     . VAL A 1 290  ? 130.681 118.874 114.966 1.00 0.00   ? 290  VAL A O     1 
ATOM   2020  C  CB    . VAL A 1 290  ? 130.298 121.999 115.014 1.00 0.00   ? 290  VAL A CB    1 
ATOM   2021  C  CG1   . VAL A 1 290  ? 129.132 121.419 114.237 1.00 0.00   ? 290  VAL A CG1   1 
ATOM   2022  C  CG2   . VAL A 1 290  ? 129.942 122.098 116.477 1.00 0.00   ? 290  VAL A CG2   1 
ATOM   2023  N  N     . VAL A 1 291  ? 131.732 119.675 116.790 1.00 0.00   ? 291  VAL A N     1 
ATOM   2024  C  CA    . VAL A 1 291  ? 131.515 118.459 117.561 1.00 0.00   ? 291  VAL A CA    1 
ATOM   2025  C  C     . VAL A 1 291  ? 130.046 118.419 117.966 1.00 0.00   ? 291  VAL A C     1 
ATOM   2026  O  O     . VAL A 1 291  ? 129.527 119.372 118.541 1.00 0.00   ? 291  VAL A O     1 
ATOM   2027  C  CB    . VAL A 1 291  ? 132.375 118.424 118.845 1.00 0.00   ? 291  VAL A CB    1 
ATOM   2028  C  CG1   . VAL A 1 291  ? 132.093 117.144 119.607 1.00 0.00   ? 291  VAL A CG1   1 
ATOM   2029  C  CG2   . VAL A 1 291  ? 133.857 118.512 118.499 1.00 0.00   ? 291  VAL A CG2   1 
ATOM   2030  N  N     . GLU A 1 292  ? 129.381 117.306 117.670 1.00 0.00   ? 292  GLU A N     1 
ATOM   2031  C  CA    . GLU A 1 292  ? 127.969 117.135 117.979 1.00 0.00   ? 292  GLU A CA    1 
ATOM   2032  C  C     . GLU A 1 292  ? 127.641 117.266 119.465 1.00 0.00   ? 292  GLU A C     1 
ATOM   2033  O  O     . GLU A 1 292  ? 126.498 117.541 119.827 1.00 0.00   ? 292  GLU A O     1 
ATOM   2034  C  CB    . GLU A 1 292  ? 127.494 115.763 117.494 1.00 0.00   ? 292  GLU A CB    1 
ATOM   2035  C  CG    . GLU A 1 292  ? 128.284 114.609 118.095 1.00 0.00   ? 292  GLU A CG    1 
ATOM   2036  C  CD    . GLU A 1 292  ? 127.606 113.265 117.895 1.00 0.00   ? 292  GLU A CD    1 
ATOM   2037  O  OE1   . GLU A 1 292  ? 127.353 112.889 116.729 1.00 0.00   ? 292  GLU A OE1   1 
ATOM   2038  O  OE2   . GLU A 1 292  ? 127.331 112.581 118.905 1.00 0.00   ? 292  GLU A OE2   1 
ATOM   2039  N  N     . THR A 1 293  ? 128.636 117.074 120.321 1.00 0.00   ? 293  THR A N     1 
ATOM   2040  C  CA    . THR A 1 293  ? 128.408 117.135 121.759 1.00 0.00   ? 293  THR A CA    1 
ATOM   2041  C  C     . THR A 1 293  ? 128.581 118.507 122.404 1.00 0.00   ? 293  THR A C     1 
ATOM   2042  O  O     . THR A 1 293  ? 127.885 118.835 123.361 1.00 0.00   ? 293  THR A O     1 
ATOM   2043  C  CB    . THR A 1 293  ? 129.325 116.142 122.488 1.00 0.00   ? 293  THR A CB    1 
ATOM   2044  O  OG1   . THR A 1 293  ? 130.686 116.568 122.376 1.00 0.00   ? 293  THR A OG1   1 
ATOM   2045  C  CG2   . THR A 1 293  ? 129.201 114.771 121.865 1.00 0.00   ? 293  THR A CG2   1 
ATOM   2046  N  N     . THR A 1 294  ? 129.508 119.309 121.886 1.00 0.00   ? 294  THR A N     1 
ATOM   2047  C  CA    . THR A 1 294  ? 129.753 120.623 122.468 1.00 0.00   ? 294  THR A CA    1 
ATOM   2048  C  C     . THR A 1 294  ? 129.248 121.805 121.649 1.00 0.00   ? 294  THR A C     1 
ATOM   2049  O  O     . THR A 1 294  ? 128.778 122.795 122.207 1.00 0.00   ? 294  THR A O     1 
ATOM   2050  C  CB    . THR A 1 294  ? 131.256 120.840 122.733 1.00 0.00   ? 294  THR A CB    1 
ATOM   2051  O  OG1   . THR A 1 294  ? 131.974 120.810 121.493 1.00 0.00   ? 294  THR A OG1   1 
ATOM   2052  C  CG2   . THR A 1 294  ? 131.799 119.756 123.647 1.00 0.00   ? 294  THR A CG2   1 
ATOM   2053  N  N     . GLY A 1 295  ? 129.344 121.705 120.329 1.00 0.00   ? 295  GLY A N     1 
ATOM   2054  C  CA    . GLY A 1 295  ? 128.899 122.802 119.488 1.00 0.00   ? 295  GLY A CA    1 
ATOM   2055  C  C     . GLY A 1 295  ? 130.084 123.688 119.175 1.00 0.00   ? 295  GLY A C     1 
ATOM   2056  O  O     . GLY A 1 295  ? 129.949 124.776 118.613 1.00 0.00   ? 295  GLY A O     1 
ATOM   2057  N  N     . ILE A 1 296  ? 131.260 123.196 119.551 1.00 0.00   ? 296  ILE A N     1 
ATOM   2058  C  CA    . ILE A 1 296  ? 132.520 123.894 119.341 1.00 0.00   ? 296  ILE A CA    1 
ATOM   2059  C  C     . ILE A 1 296  ? 133.110 123.508 117.985 1.00 0.00   ? 296  ILE A C     1 
ATOM   2060  O  O     . ILE A 1 296  ? 133.237 122.325 117.667 1.00 0.00   ? 296  ILE A O     1 
ATOM   2061  C  CB    . ILE A 1 296  ? 133.530 123.521 120.447 1.00 0.00   ? 296  ILE A CB    1 
ATOM   2062  C  CG1   . ILE A 1 296  ? 132.989 123.970 121.814 1.00 0.00   ? 296  ILE A CG1   1 
ATOM   2063  C  CG2   . ILE A 1 296  ? 134.865 124.165 120.177 1.00 0.00   ? 296  ILE A CG2   1 
ATOM   2064  C  CD1   . ILE A 1 296  ? 132.719 125.460 121.911 1.00 0.00   ? 296  ILE A CD1   1 
ATOM   2065  N  N     . THR A 1 297  ? 133.472 124.508 117.189 1.00 0.00   ? 297  THR A N     1 
ATOM   2066  C  CA    . THR A 1 297  ? 134.060 124.265 115.877 1.00 0.00   ? 297  THR A CA    1 
ATOM   2067  C  C     . THR A 1 297  ? 135.543 123.935 116.030 1.00 0.00   ? 297  THR A C     1 
ATOM   2068  O  O     . THR A 1 297  ? 136.264 124.621 116.753 1.00 0.00   ? 297  THR A O     1 
ATOM   2069  C  CB    . THR A 1 297  ? 133.931 125.500 114.974 1.00 0.00   ? 297  THR A CB    1 
ATOM   2070  O  OG1   . THR A 1 297  ? 132.549 125.845 114.816 1.00 0.00   ? 297  THR A OG1   1 
ATOM   2071  C  CG2   . THR A 1 297  ? 134.530 125.212 113.616 1.00 0.00   ? 297  THR A CG2   1 
ATOM   2072  N  N     . THR A 1 298  ? 136.004 122.889 115.347 1.00 0.00   ? 298  THR A N     1 
ATOM   2073  C  CA    . THR A 1 298  ? 137.407 122.489 115.430 1.00 0.00   ? 298  THR A CA    1 
ATOM   2074  C  C     . THR A 1 298  ? 138.061 122.303 114.067 1.00 0.00   ? 298  THR A C     1 
ATOM   2075  O  O     . THR A 1 298  ? 137.399 122.352 113.030 1.00 0.00   ? 298  THR A O     1 
ATOM   2076  C  CB    . THR A 1 298  ? 137.566 121.174 116.216 1.00 0.00   ? 298  THR A CB    1 
ATOM   2077  O  OG1   . THR A 1 298  ? 136.923 120.105 115.508 1.00 0.00   ? 298  THR A OG1   1 
ATOM   2078  C  CG2   . THR A 1 298  ? 136.939 121.306 117.586 1.00 0.00   ? 298  THR A CG2   1 
ATOM   2079  N  N     . GLN A 1 299  ? 139.375 122.090 114.081 1.00 0.00   ? 299  GLN A N     1 
ATOM   2080  C  CA    . GLN A 1 299  ? 140.136 121.879 112.860 1.00 0.00   ? 299  GLN A CA    1 
ATOM   2081  C  C     . GLN A 1 299  ? 141.095 120.707 112.982 1.00 0.00   ? 299  GLN A C     1 
ATOM   2082  O  O     . GLN A 1 299  ? 141.692 120.464 114.037 1.00 0.00   ? 299  GLN A O     1 
ATOM   2083  C  CB    . GLN A 1 299  ? 140.953 123.116 112.484 1.00 0.00   ? 299  GLN A CB    1 
ATOM   2084  C  CG    . GLN A 1 299  ? 140.200 124.191 111.712 1.00 0.00   ? 299  GLN A CG    1 
ATOM   2085  C  CD    . GLN A 1 299  ? 141.142 125.149 111.010 1.00 0.00   ? 299  GLN A CD    1 
ATOM   2086  O  OE1   . GLN A 1 299  ? 142.223 125.449 111.520 1.00 0.00   ? 299  GLN A OE1   1 
ATOM   2087  N  NE2   . GLN A 1 299  ? 140.742 125.640 109.840 1.00 0.00   ? 299  GLN A NE2   1 
ATOM   2088  N  N     . ALA A 1 300  ? 141.219 119.965 111.892 1.00 0.00   ? 300  ALA A N     1 
ATOM   2089  C  CA    . ALA A 1 300  ? 142.130 118.836 111.823 1.00 0.00   ? 300  ALA A CA    1 
ATOM   2090  C  C     . ALA A 1 300  ? 143.077 119.280 110.721 1.00 0.00   ? 300  ALA A C     1 
ATOM   2091  O  O     . ALA A 1 300  ? 142.665 119.456 109.569 1.00 0.00   ? 300  ALA A O     1 
ATOM   2092  C  CB    . ALA A 1 300  ? 141.382 117.581 111.413 1.00 0.00   ? 300  ALA A CB    1 
ATOM   2093  N  N     . ARG A 1 301  ? 144.336 119.495 111.085 1.00 0.00   ? 301  ARG A N     1 
ATOM   2094  C  CA    . ARG A 1 301  ? 145.337 119.961 110.129 1.00 0.00   ? 301  ARG A CA    1 
ATOM   2095  C  C     . ARG A 1 301  ? 146.453 118.962 109.862 1.00 0.00   ? 301  ARG A C     1 
ATOM   2096  O  O     . ARG A 1 301  ? 147.012 118.367 110.785 1.00 0.00   ? 301  ARG A O     1 
ATOM   2097  C  CB    . ARG A 1 301  ? 145.934 121.282 110.619 1.00 0.00   ? 301  ARG A CB    1 
ATOM   2098  C  CG    . ARG A 1 301  ? 144.906 122.406 110.744 1.00 0.00   ? 301  ARG A CG    1 
ATOM   2099  C  CD    . ARG A 1 301  ? 145.525 123.639 111.375 1.00 0.00   ? 301  ARG A CD    1 
ATOM   2100  N  NE    . ARG A 1 301  ? 145.943 123.375 112.753 1.00 0.00   ? 301  ARG A NE    1 
ATOM   2101  C  CZ    . ARG A 1 301  ? 145.166 123.541 113.819 1.00 0.00   ? 301  ARG A CZ    1 
ATOM   2102  N  NH1   . ARG A 1 301  ? 143.922 123.977 113.674 1.00 0.00   ? 301  ARG A NH1   1 
ATOM   2103  N  NH2   . ARG A 1 301  ? 145.635 123.270 115.030 1.00 0.00   ? 301  ARG A NH2   1 
ATOM   2104  N  N     . THR A 1 302  ? 146.766 118.787 108.584 1.00 0.00   ? 302  THR A N     1 
ATOM   2105  C  CA    . THR A 1 302  ? 147.820 117.871 108.155 1.00 0.00   ? 302  THR A CA    1 
ATOM   2106  C  C     . THR A 1 302  ? 148.450 118.414 106.878 1.00 0.00   ? 302  THR A C     1 
ATOM   2107  O  O     . THR A 1 302  ? 147.933 119.350 106.265 1.00 0.00   ? 302  THR A O     1 
ATOM   2108  C  CB    . THR A 1 302  ? 147.260 116.460 107.871 1.00 0.00   ? 302  THR A CB    1 
ATOM   2109  O  OG1   . THR A 1 302  ? 148.349 115.538 107.715 1.00 0.00   ? 302  THR A OG1   1 
ATOM   2110  C  CG2   . THR A 1 302  ? 146.428 116.459 106.600 1.00 0.00   ? 302  THR A CG2   1 
ATOM   2111  N  N     . SER A 1 303  ? 149.566 117.819 106.479 1.00 0.00   ? 303  SER A N     1 
ATOM   2112  C  CA    . SER A 1 303  ? 150.256 118.252 105.276 1.00 0.00   ? 303  SER A CA    1 
ATOM   2113  C  C     . SER A 1 303  ? 150.936 117.082 104.578 1.00 0.00   ? 303  SER A C     1 
ATOM   2114  O  O     . SER A 1 303  ? 151.193 116.042 105.182 1.00 0.00   ? 303  SER A O     1 
ATOM   2115  C  CB    . SER A 1 303  ? 151.297 119.315 105.623 1.00 0.00   ? 303  SER A CB    1 
ATOM   2116  O  OG    . SER A 1 303  ? 152.270 118.816 106.524 1.00 0.00   ? 303  SER A OG    1 
ATOM   2117  N  N     . TYR A 1 304  ? 151.209 117.270 103.294 1.00 0.00   ? 304  TYR A N     1 
ATOM   2118  C  CA    . TYR A 1 304  ? 151.869 116.251 102.494 1.00 0.00   ? 304  TYR A CA    1 
ATOM   2119  C  C     . TYR A 1 304  ? 152.964 116.892 101.655 1.00 0.00   ? 304  TYR A C     1 
ATOM   2120  O  O     . TYR A 1 304  ? 152.691 117.667 100.734 1.00 0.00   ? 304  TYR A O     1 
ATOM   2121  C  CB    . TYR A 1 304  ? 150.859 115.545 101.581 1.00 0.00   ? 304  TYR A CB    1 
ATOM   2122  C  CG    . TYR A 1 304  ? 149.795 114.773 102.328 1.00 0.00   ? 304  TYR A CG    1 
ATOM   2123  C  CD1   . TYR A 1 304  ? 148.689 115.422 102.881 1.00 0.00   ? 304  TYR A CD1   1 
ATOM   2124  C  CD2   . TYR A 1 304  ? 149.902 113.393 102.502 1.00 0.00   ? 304  TYR A CD2   1 
ATOM   2125  C  CE1   . TYR A 1 304  ? 147.723 114.716 103.588 1.00 0.00   ? 304  TYR A CE1   1 
ATOM   2126  C  CE2   . TYR A 1 304  ? 148.941 112.678 103.211 1.00 0.00   ? 304  TYR A CE2   1 
ATOM   2127  C  CZ    . TYR A 1 304  ? 147.857 113.347 103.747 1.00 0.00   ? 304  TYR A CZ    1 
ATOM   2128  O  OH    . TYR A 1 304  ? 146.906 112.643 104.451 1.00 0.00   ? 304  TYR A OH    1 
ATOM   2129  N  N     . LEU A 1 305  ? 154.211 116.587 101.992 1.00 0.00   ? 305  LEU A N     1 
ATOM   2130  C  CA    . LEU A 1 305  ? 155.342 117.124 101.253 1.00 0.00   ? 305  LEU A CA    1 
ATOM   2131  C  C     . LEU A 1 305  ? 155.451 116.329 99.960  1.00 0.00   ? 305  LEU A C     1 
ATOM   2132  O  O     . LEU A 1 305  ? 154.742 115.339 99.774  1.00 0.00   ? 305  LEU A O     1 
ATOM   2133  C  CB    . LEU A 1 305  ? 156.625 117.006 102.082 1.00 0.00   ? 305  LEU A CB    1 
ATOM   2134  C  CG    . LEU A 1 305  ? 156.783 117.993 103.247 1.00 0.00   ? 305  LEU A CG    1 
ATOM   2135  C  CD1   . LEU A 1 305  ? 156.917 119.410 102.706 1.00 0.00   ? 305  LEU A CD1   1 
ATOM   2136  C  CD2   . LEU A 1 305  ? 155.589 117.895 104.188 1.00 0.00   ? 305  LEU A CD2   1 
ATOM   2137  N  N     . ALA A 1 306  ? 156.333 116.759 99.067  1.00 0.00   ? 306  ALA A N     1 
ATOM   2138  C  CA    . ALA A 1 306  ? 156.498 116.090 97.782  1.00 0.00   ? 306  ALA A CA    1 
ATOM   2139  C  C     . ALA A 1 306  ? 156.868 114.608 97.921  1.00 0.00   ? 306  ALA A C     1 
ATOM   2140  O  O     . ALA A 1 306  ? 156.375 113.769 97.170  1.00 0.00   ? 306  ALA A O     1 
ATOM   2141  C  CB    . ALA A 1 306  ? 157.556 116.827 96.962  1.00 0.00   ? 306  ALA A CB    1 
ATOM   2142  N  N     . ASP A 1 307  ? 157.721 114.296 98.891  1.00 0.00   ? 307  ASP A N     1 
ATOM   2143  C  CA    . ASP A 1 307  ? 158.157 112.921 99.118  1.00 0.00   ? 307  ASP A CA    1 
ATOM   2144  C  C     . ASP A 1 307  ? 157.178 112.068 99.923  1.00 0.00   ? 307  ASP A C     1 
ATOM   2145  O  O     . ASP A 1 307  ? 157.501 110.942 100.301 1.00 0.00   ? 307  ASP A O     1 
ATOM   2146  C  CB    . ASP A 1 307  ? 159.516 112.906 99.817  1.00 0.00   ? 307  ASP A CB    1 
ATOM   2147  C  CG    . ASP A 1 307  ? 159.525 113.734 101.081 1.00 0.00   ? 307  ASP A CG    1 
ATOM   2148  O  OD1   . ASP A 1 307  ? 158.436 113.962 101.660 1.00 0.00   ? 307  ASP A OD1   1 
ATOM   2149  O  OD2   . ASP A 1 307  ? 160.622 114.155 101.511 1.00 0.00   ? 307  ASP A OD2   1 
ATOM   2150  N  N     . GLU A 1 308  ? 155.998 112.610 100.206 1.00 0.00   ? 308  GLU A N     1 
ATOM   2151  C  CA    . GLU A 1 308  ? 154.991 111.875 100.961 1.00 0.00   ? 308  GLU A CA    1 
ATOM   2152  C  C     . GLU A 1 308  ? 153.848 111.481 100.039 1.00 0.00   ? 308  GLU A C     1 
ATOM   2153  O  O     . GLU A 1 308  ? 152.863 110.874 100.464 1.00 0.00   ? 308  GLU A O     1 
ATOM   2154  C  CB    . GLU A 1 308  ? 154.472 112.723 102.121 1.00 0.00   ? 308  GLU A CB    1 
ATOM   2155  N  N     . ILE A 1 309  ? 154.001 111.834 98.766  1.00 0.00   ? 309  ILE A N     1 
ATOM   2156  C  CA    . ILE A 1 309  ? 153.012 111.530 97.741  1.00 0.00   ? 309  ILE A CA    1 
ATOM   2157  C  C     . ILE A 1 309  ? 153.548 110.378 96.898  1.00 0.00   ? 309  ILE A C     1 
ATOM   2158  O  O     . ILE A 1 309  ? 154.733 110.348 96.559  1.00 0.00   ? 309  ILE A O     1 
ATOM   2159  C  CB    . ILE A 1 309  ? 152.764 112.744 96.817  1.00 0.00   ? 309  ILE A CB    1 
ATOM   2160  C  CG1   . ILE A 1 309  ? 152.326 113.953 97.652  1.00 0.00   ? 309  ILE A CG1   1 
ATOM   2161  C  CG2   . ILE A 1 309  ? 151.699 112.408 95.782  1.00 0.00   ? 309  ILE A CG2   1 
ATOM   2162  C  CD1   . ILE A 1 309  ? 151.052 113.734 98.432  1.00 0.00   ? 309  ILE A CD1   1 
ATOM   2163  N  N     . LEU A 1 310  ? 152.682 109.431 96.564  1.00 0.00   ? 310  LEU A N     1 
ATOM   2164  C  CA    . LEU A 1 310  ? 153.088 108.282 95.762  1.00 0.00   ? 310  LEU A CA    1 
ATOM   2165  C  C     . LEU A 1 310  ? 152.455 108.364 94.380  1.00 0.00   ? 310  LEU A C     1 
ATOM   2166  O  O     . LEU A 1 310  ? 151.285 108.722 94.243  1.00 0.00   ? 310  LEU A O     1 
ATOM   2167  C  CB    . LEU A 1 310  ? 152.665 106.986 96.455  1.00 0.00   ? 310  LEU A CB    1 
ATOM   2168  C  CG    . LEU A 1 310  ? 153.344 106.690 97.800  1.00 0.00   ? 310  LEU A CG    1 
ATOM   2169  C  CD1   . LEU A 1 310  ? 152.715 105.456 98.428  1.00 0.00   ? 310  LEU A CD1   1 
ATOM   2170  C  CD2   . LEU A 1 310  ? 154.838 106.487 97.599  1.00 0.00   ? 310  LEU A CD2   1 
ATOM   2171  N  N     . TRP A 1 311  ? 153.236 108.042 93.353  1.00 0.00   ? 311  TRP A N     1 
ATOM   2172  C  CA    . TRP A 1 311  ? 152.738 108.088 91.986  1.00 0.00   ? 311  TRP A CA    1 
ATOM   2173  C  C     . TRP A 1 311  ? 152.569 106.697 91.395  1.00 0.00   ? 311  TRP A C     1 
ATOM   2174  O  O     . TRP A 1 311  ? 153.521 105.918 91.319  1.00 0.00   ? 311  TRP A O     1 
ATOM   2175  C  CB    . TRP A 1 311  ? 153.676 108.917 91.101  1.00 0.00   ? 311  TRP A CB    1 
ATOM   2176  C  CG    . TRP A 1 311  ? 153.134 109.187 89.732  1.00 0.00   ? 311  TRP A CG    1 
ATOM   2177  C  CD1   . TRP A 1 311  ? 152.934 108.278 88.730  1.00 0.00   ? 311  TRP A CD1   1 
ATOM   2178  C  CD2   . TRP A 1 311  ? 152.692 110.451 89.225  1.00 0.00   ? 311  TRP A CD2   1 
ATOM   2179  N  NE1   . TRP A 1 311  ? 152.392 108.904 87.630  1.00 0.00   ? 311  TRP A NE1   1 
ATOM   2180  C  CE2   . TRP A 1 311  ? 152.234 110.234 87.903  1.00 0.00   ? 311  TRP A CE2   1 
ATOM   2181  C  CE3   . TRP A 1 311  ? 152.636 111.743 89.758  1.00 0.00   ? 311  TRP A CE3   1 
ATOM   2182  C  CZ2   . TRP A 1 311  ? 151.726 111.269 87.109  1.00 0.00   ? 311  TRP A CZ2   1 
ATOM   2183  C  CZ3   . TRP A 1 311  ? 152.126 112.772 88.966  1.00 0.00   ? 311  TRP A CZ3   1 
ATOM   2184  C  CH2   . TRP A 1 311  ? 151.680 112.526 87.654  1.00 0.00   ? 311  TRP A CH2   1 
ATOM   2185  N  N     . GLY A 1 312  ? 151.346 106.392 90.976  1.00 0.00   ? 312  GLY A N     1 
ATOM   2186  C  CA    . GLY A 1 312  ? 151.061 105.101 90.391  1.00 0.00   ? 312  GLY A CA    1 
ATOM   2187  C  C     . GLY A 1 312  ? 150.518 104.107 91.394  1.00 0.00   ? 312  GLY A C     1 
ATOM   2188  O  O     . GLY A 1 312  ? 150.484 102.902 91.132  1.00 0.00   ? 312  GLY A O     1 
ATOM   2189  N  N     . GLN A 1 313  ? 150.097 104.619 92.546  1.00 0.00   ? 313  GLN A N     1 
ATOM   2190  C  CA    . GLN A 1 313  ? 149.544 103.799 93.617  1.00 0.00   ? 313  GLN A CA    1 
ATOM   2191  C  C     . GLN A 1 313  ? 148.189 104.334 94.070  1.00 0.00   ? 313  GLN A C     1 
ATOM   2192  O  O     . GLN A 1 313  ? 147.906 105.524 93.930  1.00 0.00   ? 313  GLN A O     1 
ATOM   2193  C  CB    . GLN A 1 313  ? 150.494 103.790 94.825  1.00 0.00   ? 313  GLN A CB    1 
ATOM   2194  C  CG    . GLN A 1 313  ? 151.816 103.058 94.634  1.00 0.00   ? 313  GLN A CG    1 
ATOM   2195  C  CD    . GLN A 1 313  ? 152.649 103.043 95.904  1.00 0.00   ? 313  GLN A CD    1 
ATOM   2196  O  OE1   . GLN A 1 313  ? 152.202 102.566 96.948  1.00 0.00   ? 313  GLN A OE1   1 
ATOM   2197  N  NE2   . GLN A 1 313  ? 153.867 103.566 95.822  1.00 0.00   ? 313  GLN A NE2   1 
ATOM   2198  N  N     . ARG A 1 314  ? 147.370 103.424 94.583  1.00 0.00   ? 314  ARG A N     1 
ATOM   2199  C  CA    . ARG A 1 314  ? 146.035 103.731 95.066  1.00 0.00   ? 314  ARG A CA    1 
ATOM   2200  C  C     . ARG A 1 314  ? 145.809 103.123 96.447  1.00 0.00   ? 314  ARG A C     1 
ATOM   2201  O  O     . ARG A 1 314  ? 146.673 102.428 96.984  1.00 0.00   ? 314  ARG A O     1 
ATOM   2202  C  CB    . ARG A 1 314  ? 145.009 103.182 94.087  1.00 0.00   ? 314  ARG A CB    1 
ATOM   2203  C  CG    . ARG A 1 314  ? 145.370 101.800 93.587  1.00 0.00   ? 314  ARG A CG    1 
ATOM   2204  C  CD    . ARG A 1 314  ? 144.628 101.451 92.311  1.00 0.00   ? 314  ARG A CD    1 
ATOM   2205  N  NE    . ARG A 1 314  ? 144.962 100.105 91.862  1.00 0.00   ? 314  ARG A NE    1 
ATOM   2206  C  CZ    . ARG A 1 314  ? 144.635 98.998  92.519  1.00 0.00   ? 314  ARG A CZ    1 
ATOM   2207  N  NH1   . ARG A 1 314  ? 143.965 99.077  93.659  1.00 0.00   ? 314  ARG A NH1   1 
ATOM   2208  N  NH2   . ARG A 1 314  ? 144.980 97.814  92.039  1.00 0.00   ? 314  ARG A NH2   1 
ATOM   2209  N  N     . PHE A 1 315  ? 144.641 103.373 97.020  1.00 0.00   ? 315  PHE A N     1 
ATOM   2210  C  CA    . PHE A 1 315  ? 144.349 102.856 98.349  1.00 0.00   ? 315  PHE A CA    1 
ATOM   2211  C  C     . PHE A 1 315  ? 143.671 101.501 98.354  1.00 0.00   ? 315  PHE A C     1 
ATOM   2212  O  O     . PHE A 1 315  ? 142.875 101.185 97.476  1.00 0.00   ? 315  PHE A O     1 
ATOM   2213  C  CB    . PHE A 1 315  ? 143.522 103.863 99.139  1.00 0.00   ? 315  PHE A CB    1 
ATOM   2214  C  CG    . PHE A 1 315  ? 144.340 104.960 99.737  1.00 0.00   ? 315  PHE A CG    1 
ATOM   2215  C  CD1   . PHE A 1 315  ? 144.959 105.891 98.929  1.00 0.00   ? 315  PHE A CD1   1 
ATOM   2216  C  CD2   . PHE A 1 315  ? 144.502 105.050 101.104 1.00 0.00   ? 315  PHE A CD2   1 
ATOM   2217  C  CE1   . PHE A 1 315  ? 145.720 106.901 99.475  1.00 0.00   ? 315  PHE A CE1   1 
ATOM   2218  C  CE2   . PHE A 1 315  ? 145.262 106.056 101.657 1.00 0.00   ? 315  PHE A CE2   1 
ATOM   2219  C  CZ    . PHE A 1 315  ? 145.873 106.983 100.841 1.00 0.00   ? 315  PHE A CZ    1 
ATOM   2220  N  N     . VAL A 1 316  ? 144.000 100.706 99.363  1.00 0.00   ? 316  VAL A N     1 
ATOM   2221  C  CA    . VAL A 1 316  ? 143.433 99.371  99.522  1.00 0.00   ? 316  VAL A CA    1 
ATOM   2222  C  C     . VAL A 1 316  ? 142.081 99.531  100.220 1.00 0.00   ? 316  VAL A C     1 
ATOM   2223  O  O     . VAL A 1 316  ? 141.944 100.343 101.134 1.00 0.00   ? 316  VAL A O     1 
ATOM   2224  C  CB    . VAL A 1 316  ? 144.335 98.479  100.413 1.00 0.00   ? 316  VAL A CB    1 
ATOM   2225  C  CG1   . VAL A 1 316  ? 143.658 97.148  100.658 1.00 0.00   ? 316  VAL A CG1   1 
ATOM   2226  C  CG2   . VAL A 1 316  ? 145.692 98.264  99.754  1.00 0.00   ? 316  VAL A CG2   1 
ATOM   2227  N  N     . PRO A 1 317  ? 141.066 98.758  99.803  1.00 0.00   ? 317  PRO A N     1 
ATOM   2228  C  CA    . PRO A 1 317  ? 139.765 98.900  100.463 1.00 0.00   ? 317  PRO A CA    1 
ATOM   2229  C  C     . PRO A 1 317  ? 139.855 98.641  101.962 1.00 0.00   ? 317  PRO A C     1 
ATOM   2230  O  O     . PRO A 1 317  ? 140.517 97.700  102.402 1.00 0.00   ? 317  PRO A O     1 
ATOM   2231  C  CB    . PRO A 1 317  ? 138.906 97.864  99.752  1.00 0.00   ? 317  PRO A CB    1 
ATOM   2232  C  CG    . PRO A 1 317  ? 139.476 97.866  98.366  1.00 0.00   ? 317  PRO A CG    1 
ATOM   2233  C  CD    . PRO A 1 317  ? 140.963 97.867  98.635  1.00 0.00   ? 317  PRO A CD    1 
ATOM   2234  N  N     . ILE A 1 318  ? 139.186 99.480  102.750 1.00 0.00   ? 318  ILE A N     1 
ATOM   2235  C  CA    . ILE A 1 318  ? 139.208 99.355  104.206 1.00 0.00   ? 318  ILE A CA    1 
ATOM   2236  C  C     . ILE A 1 318  ? 137.966 98.668  104.769 1.00 0.00   ? 318  ILE A C     1 
ATOM   2237  O  O     . ILE A 1 318  ? 138.067 97.801  105.634 1.00 0.00   ? 318  ILE A O     1 
ATOM   2238  C  CB    . ILE A 1 318  ? 139.340 100.742 104.863 1.00 0.00   ? 318  ILE A CB    1 
ATOM   2239  C  CG1   . ILE A 1 318  ? 140.589 101.444 104.339 1.00 0.00   ? 318  ILE A CG1   1 
ATOM   2240  C  CG2   . ILE A 1 318  ? 139.431 100.593 106.372 1.00 0.00   ? 318  ILE A CG2   1 
ATOM   2241  C  CD1   . ILE A 1 318  ? 141.864 100.711 104.646 1.00 0.00   ? 318  ILE A CD1   1 
ATOM   2242  N  N     . VAL A 1 319  ? 136.795 99.070  104.279 1.00 0.00   ? 319  VAL A N     1 
ATOM   2243  C  CA    . VAL A 1 319  ? 135.531 98.522  104.759 1.00 0.00   ? 319  VAL A CA    1 
ATOM   2244  C  C     . VAL A 1 319  ? 135.173 97.127  104.247 1.00 0.00   ? 319  VAL A C     1 
ATOM   2245  O  O     . VAL A 1 319  ? 135.168 96.872  103.044 1.00 0.00   ? 319  VAL A O     1 
ATOM   2246  C  CB    . VAL A 1 319  ? 134.348 99.456  104.413 1.00 0.00   ? 319  VAL A CB    1 
ATOM   2247  C  CG1   . VAL A 1 319  ? 133.048 98.863  104.940 1.00 0.00   ? 319  VAL A CG1   1 
ATOM   2248  C  CG2   . VAL A 1 319  ? 134.576 100.833 105.011 1.00 0.00   ? 319  VAL A CG2   1 
ATOM   2249  N  N     . ALA A 1 320  ? 134.860 96.236  105.183 1.00 0.00   ? 320  ALA A N     1 
ATOM   2250  C  CA    . ALA A 1 320  ? 134.453 94.876  104.869 1.00 0.00   ? 320  ALA A CA    1 
ATOM   2251  C  C     . ALA A 1 320  ? 132.986 94.792  105.280 1.00 0.00   ? 320  ALA A C     1 
ATOM   2252  O  O     . ALA A 1 320  ? 132.384 95.817  105.594 1.00 0.00   ? 320  ALA A O     1 
ATOM   2253  C  CB    . ALA A 1 320  ? 135.284 93.872  105.657 1.00 0.00   ? 320  ALA A CB    1 
ATOM   2254  N  N     . GLU A 1 321  ? 132.406 93.597  105.288 1.00 0.00   ? 321  GLU A N     1 
ATOM   2255  C  CA    . GLU A 1 321  ? 131.006 93.471  105.680 1.00 0.00   ? 321  GLU A CA    1 
ATOM   2256  C  C     . GLU A 1 321  ? 130.685 92.202  106.458 1.00 0.00   ? 321  GLU A C     1 
ATOM   2257  O  O     . GLU A 1 321  ? 130.962 91.090  105.999 1.00 0.00   ? 321  GLU A O     1 
ATOM   2258  C  CB    . GLU A 1 321  ? 130.100 93.543  104.442 1.00 0.00   ? 321  GLU A CB    1 
ATOM   2259  C  CG    . GLU A 1 321  ? 128.620 93.741  104.765 1.00 0.00   ? 321  GLU A CG    1 
ATOM   2260  C  CD    . GLU A 1 321  ? 127.728 93.703  103.534 1.00 0.00   ? 321  GLU A CD    1 
ATOM   2261  O  OE1   . GLU A 1 321  ? 128.031 94.413  102.550 1.00 0.00   ? 321  GLU A OE1   1 
ATOM   2262  O  OE2   . GLU A 1 321  ? 126.714 92.969  103.555 1.00 0.00   ? 321  GLU A OE2   1 
ATOM   2263  N  N     . GLU A 1 322  ? 130.112 92.373  107.645 1.00 0.00   ? 322  GLU A N     1 
ATOM   2264  C  CA    . GLU A 1 322  ? 129.714 91.240  108.474 1.00 0.00   ? 322  GLU A CA    1 
ATOM   2265  C  C     . GLU A 1 322  ? 128.259 90.975  108.099 1.00 0.00   ? 322  GLU A C     1 
ATOM   2266  O  O     . GLU A 1 322  ? 127.652 91.773  107.386 1.00 0.00   ? 322  GLU A O     1 
ATOM   2267  C  CB    . GLU A 1 322  ? 129.838 91.592  109.966 1.00 0.00   ? 322  GLU A CB    1 
ATOM   2268  C  CG    . GLU A 1 322  ? 131.248 92.006  110.384 1.00 0.00   ? 322  GLU A CG    1 
ATOM   2269  C  CD    . GLU A 1 322  ? 131.412 92.163  111.887 1.00 0.00   ? 322  GLU A CD    1 
ATOM   2270  O  OE1   . GLU A 1 322  ? 130.390 92.248  112.601 1.00 0.00   ? 322  GLU A OE1   1 
ATOM   2271  O  OE2   . GLU A 1 322  ? 132.571 92.211  112.359 1.00 0.00   ? 322  GLU A OE2   1 
ATOM   2272  N  N     . ASP A 1 323  ? 127.693 89.866  108.560 1.00 0.00   ? 323  ASP A N     1 
ATOM   2273  C  CA    . ASP A 1 323  ? 126.313 89.547  108.223 1.00 0.00   ? 323  ASP A CA    1 
ATOM   2274  C  C     . ASP A 1 323  ? 125.316 90.602  108.697 1.00 0.00   ? 323  ASP A C     1 
ATOM   2275  O  O     . ASP A 1 323  ? 124.265 90.790  108.085 1.00 0.00   ? 323  ASP A O     1 
ATOM   2276  C  CB    . ASP A 1 323  ? 125.920 88.187  108.800 1.00 0.00   ? 323  ASP A CB    1 
ATOM   2277  C  CG    . ASP A 1 323  ? 126.772 87.061  108.262 1.00 0.00   ? 323  ASP A CG    1 
ATOM   2278  O  OD1   . ASP A 1 323  ? 127.181 87.136  107.081 1.00 0.00   ? 323  ASP A OD1   1 
ATOM   2279  O  OD2   . ASP A 1 323  ? 127.024 86.092  109.011 1.00 0.00   ? 323  ASP A OD2   1 
ATOM   2280  N  N     . GLY A 1 324  ? 125.650 91.291  109.781 1.00 0.00   ? 324  GLY A N     1 
ATOM   2281  C  CA    . GLY A 1 324  ? 124.751 92.303  110.304 1.00 0.00   ? 324  GLY A CA    1 
ATOM   2282  C  C     . GLY A 1 324  ? 125.192 93.747  110.183 1.00 0.00   ? 324  GLY A C     1 
ATOM   2283  O  O     . GLY A 1 324  ? 124.366 94.654  110.291 1.00 0.00   ? 324  GLY A O     1 
ATOM   2284  N  N     . ARG A 1 325  ? 126.480 93.982  109.951 1.00 0.00   ? 325  ARG A N     1 
ATOM   2285  C  CA    . ARG A 1 325  ? 126.970 95.353  109.853 1.00 0.00   ? 325  ARG A CA    1 
ATOM   2286  C  C     . ARG A 1 325  ? 128.151 95.527  108.905 1.00 0.00   ? 325  ARG A C     1 
ATOM   2287  O  O     . ARG A 1 325  ? 128.585 94.586  108.242 1.00 0.00   ? 325  ARG A O     1 
ATOM   2288  C  CB    . ARG A 1 325  ? 127.368 95.847  111.246 1.00 0.00   ? 325  ARG A CB    1 
ATOM   2289  C  CG    . ARG A 1 325  ? 128.513 95.060  111.898 1.00 0.00   ? 325  ARG A CG    1 
ATOM   2290  C  CD    . ARG A 1 325  ? 128.760 95.519  113.335 1.00 0.00   ? 325  ARG A CD    1 
ATOM   2291  N  NE    . ARG A 1 325  ? 127.606 95.264  114.194 1.00 0.00   ? 325  ARG A NE    1 
ATOM   2292  C  CZ    . ARG A 1 325  ? 127.173 94.055  114.536 1.00 0.00   ? 325  ARG A CZ    1 
ATOM   2293  N  NH1   . ARG A 1 325  ? 127.797 92.968  114.097 1.00 0.00   ? 325  ARG A NH1   1 
ATOM   2294  N  NH2   . ARG A 1 325  ? 126.103 93.931  115.311 1.00 0.00   ? 325  ARG A NH2   1 
ATOM   2295  N  N     . TYR A 1 326  ? 128.643 96.763  108.844 1.00 0.00   ? 326  TYR A N     1 
ATOM   2296  C  CA    . TYR A 1 326  ? 129.791 97.108  108.021 1.00 0.00   ? 326  TYR A CA    1 
ATOM   2297  C  C     . TYR A 1 326  ? 130.961 97.273  108.982 1.00 0.00   ? 326  TYR A C     1 
ATOM   2298  O  O     . TYR A 1 326  ? 130.799 97.825  110.074 1.00 0.00   ? 326  TYR A O     1 
ATOM   2299  C  CB    . TYR A 1 326  ? 129.541 98.410  107.257 1.00 0.00   ? 326  TYR A CB    1 
ATOM   2300  C  CG    . TYR A 1 326  ? 128.568 98.273  106.103 1.00 0.00   ? 326  TYR A CG    1 
ATOM   2301  C  CD1   . TYR A 1 326  ? 127.206 98.512  106.275 1.00 0.00   ? 326  TYR A CD1   1 
ATOM   2302  C  CD2   . TYR A 1 326  ? 129.014 97.881  104.844 1.00 0.00   ? 326  TYR A CD2   1 
ATOM   2303  C  CE1   . TYR A 1 326  ? 126.309 98.361  105.213 1.00 0.00   ? 326  TYR A CE1   1 
ATOM   2304  C  CE2   . TYR A 1 326  ? 128.130 97.724  103.780 1.00 0.00   ? 326  TYR A CE2   1 
ATOM   2305  C  CZ    . TYR A 1 326  ? 126.779 97.964  103.968 1.00 0.00   ? 326  TYR A CZ    1 
ATOM   2306  O  OH    . TYR A 1 326  ? 125.904 97.807  102.918 1.00 0.00   ? 326  TYR A OH    1 
ATOM   2307  N  N     . SER A 1 327  ? 132.132 96.786  108.592 1.00 0.00   ? 327  SER A N     1 
ATOM   2308  C  CA    . SER A 1 327  ? 133.297 96.872  109.461 1.00 0.00   ? 327  SER A CA    1 
ATOM   2309  C  C     . SER A 1 327  ? 134.477 97.596  108.823 1.00 0.00   ? 327  SER A C     1 
ATOM   2310  O  O     . SER A 1 327  ? 134.766 97.421  107.640 1.00 0.00   ? 327  SER A O     1 
ATOM   2311  C  CB    . SER A 1 327  ? 133.730 95.466  109.886 1.00 0.00   ? 327  SER A CB    1 
ATOM   2312  O  OG    . SER A 1 327  ? 134.786 95.524  110.825 1.00 0.00   ? 327  SER A OG    1 
ATOM   2313  N  N     . VAL A 1 328  ? 135.157 98.408  109.623 1.00 0.00   ? 328  VAL A N     1 
ATOM   2314  C  CA    . VAL A 1 328  ? 136.305 99.161  109.146 1.00 0.00   ? 328  VAL A CA    1 
ATOM   2315  C  C     . VAL A 1 328  ? 137.597 98.648  109.774 1.00 0.00   ? 328  VAL A C     1 
ATOM   2316  O  O     . VAL A 1 328  ? 137.718 98.575  110.996 1.00 0.00   ? 328  VAL A O     1 
ATOM   2317  C  CB    . VAL A 1 328  ? 136.176 100.666 109.471 1.00 0.00   ? 328  VAL A CB    1 
ATOM   2318  C  CG1   . VAL A 1 328  ? 137.349 101.419 108.881 1.00 0.00   ? 328  VAL A CG1   1 
ATOM   2319  C  CG2   . VAL A 1 328  ? 134.871 101.211 108.923 1.00 0.00   ? 328  VAL A CG2   1 
ATOM   2320  N  N     . ASP A 1 329  ? 138.557 98.300  108.928 1.00 0.00   ? 329  ASP A N     1 
ATOM   2321  C  CA    . ASP A 1 329  ? 139.854 97.824  109.383 1.00 0.00   ? 329  ASP A CA    1 
ATOM   2322  C  C     . ASP A 1 329  ? 140.814 99.006  109.327 1.00 0.00   ? 329  ASP A C     1 
ATOM   2323  O  O     . ASP A 1 329  ? 141.330 99.345  108.260 1.00 0.00   ? 329  ASP A O     1 
ATOM   2324  C  CB    . ASP A 1 329  ? 140.362 96.711  108.467 1.00 0.00   ? 329  ASP A CB    1 
ATOM   2325  C  CG    . ASP A 1 329  ? 141.707 96.181  108.898 1.00 0.00   ? 329  ASP A CG    1 
ATOM   2326  O  OD1   . ASP A 1 329  ? 142.409 96.892  109.647 1.00 0.00   ? 329  ASP A OD1   1 
ATOM   2327  O  OD2   . ASP A 1 329  ? 142.073 95.062  108.485 1.00 0.00   ? 329  ASP A OD2   1 
ATOM   2328  N  N     . TYR A 1 330  ? 141.068 99.629  110.473 1.00 0.00   ? 330  TYR A N     1 
ATOM   2329  C  CA    . TYR A 1 330  ? 141.954 100.783 110.516 1.00 0.00   ? 330  TYR A CA    1 
ATOM   2330  C  C     . TYR A 1 330  ? 143.438 100.486 110.326 1.00 0.00   ? 330  TYR A C     1 
ATOM   2331  O  O     . TYR A 1 330  ? 144.220 101.389 110.023 1.00 0.00   ? 330  TYR A O     1 
ATOM   2332  C  CB    . TYR A 1 330  ? 141.732 101.563 111.816 1.00 0.00   ? 330  TYR A CB    1 
ATOM   2333  C  CG    . TYR A 1 330  ? 140.428 102.324 111.822 1.00 0.00   ? 330  TYR A CG    1 
ATOM   2334  C  CD1   . TYR A 1 330  ? 139.219 101.678 112.077 1.00 0.00   ? 330  TYR A CD1   1 
ATOM   2335  C  CD2   . TYR A 1 330  ? 140.399 103.686 111.526 1.00 0.00   ? 330  TYR A CD2   1 
ATOM   2336  C  CE1   . TYR A 1 330  ? 138.014 102.373 112.036 1.00 0.00   ? 330  TYR A CE1   1 
ATOM   2337  C  CE2   . TYR A 1 330  ? 139.204 104.385 111.481 1.00 0.00   ? 330  TYR A CE2   1 
ATOM   2338  C  CZ    . TYR A 1 330  ? 138.018 103.726 111.737 1.00 0.00   ? 330  TYR A CZ    1 
ATOM   2339  O  OH    . TYR A 1 330  ? 136.835 104.422 111.696 1.00 0.00   ? 330  TYR A OH    1 
ATOM   2340  N  N     . SER A 1 331  ? 143.829 99.226  110.483 1.00 0.00   ? 331  SER A N     1 
ATOM   2341  C  CA    . SER A 1 331  ? 145.226 98.843  110.311 1.00 0.00   ? 331  SER A CA    1 
ATOM   2342  C  C     . SER A 1 331  ? 145.625 98.893  108.842 1.00 0.00   ? 331  SER A C     1 
ATOM   2343  O  O     . SER A 1 331  ? 146.809 98.848  108.504 1.00 0.00   ? 331  SER A O     1 
ATOM   2344  C  CB    . SER A 1 331  ? 145.468 97.433  110.847 1.00 0.00   ? 331  SER A CB    1 
ATOM   2345  O  OG    . SER A 1 331  ? 144.787 96.468  110.067 1.00 0.00   ? 331  SER A OG    1 
ATOM   2346  N  N     . LYS A 1 332  ? 144.625 98.983  107.967 1.00 0.00   ? 332  LYS A N     1 
ATOM   2347  C  CA    . LYS A 1 332  ? 144.864 99.036  106.530 1.00 0.00   ? 332  LYS A CA    1 
ATOM   2348  C  C     . LYS A 1 332  ? 144.790 100.461 105.980 1.00 0.00   ? 332  LYS A C     1 
ATOM   2349  O  O     . LYS A 1 332  ? 144.672 100.646 104.773 1.00 0.00   ? 332  LYS A O     1 
ATOM   2350  C  CB    . LYS A 1 332  ? 143.837 98.173  105.788 1.00 0.00   ? 332  LYS A CB    1 
ATOM   2351  C  CG    . LYS A 1 332  ? 143.929 96.672  106.026 1.00 0.00   ? 332  LYS A CG    1 
ATOM   2352  C  CD    . LYS A 1 332  ? 142.994 95.940  105.063 1.00 0.00   ? 332  LYS A CD    1 
ATOM   2353  C  CE    . LYS A 1 332  ? 143.146 94.426  105.131 1.00 0.00   ? 332  LYS A CE    1 
ATOM   2354  N  NZ    . LYS A 1 332  ? 142.615 93.841  106.392 1.00 0.00   ? 332  LYS A NZ    1 
ATOM   2355  N  N     . PHE A 1 333  ? 144.862 101.460 106.855 1.00 0.00   ? 333  PHE A N     1 
ATOM   2356  C  CA    . PHE A 1 333  ? 144.776 102.853 106.418 1.00 0.00   ? 333  PHE A CA    1 
ATOM   2357  C  C     . PHE A 1 333  ? 145.882 103.272 105.455 1.00 0.00   ? 333  PHE A C     1 
ATOM   2358  O  O     . PHE A 1 333  ? 145.606 103.840 104.397 1.00 0.00   ? 333  PHE A O     1 
ATOM   2359  C  CB    . PHE A 1 333  ? 144.787 103.797 107.624 1.00 0.00   ? 333  PHE A CB    1 
ATOM   2360  C  CG    . PHE A 1 333  ? 143.499 104.553 107.822 1.00 0.00   ? 333  PHE A CG    1 
ATOM   2361  C  CD1   . PHE A 1 333  ? 142.318 103.877 108.108 1.00 0.00   ? 333  PHE A CD1   1 
ATOM   2362  C  CD2   . PHE A 1 333  ? 143.471 105.942 107.756 1.00 0.00   ? 333  PHE A CD2   1 
ATOM   2363  C  CE1   . PHE A 1 333  ? 141.131 104.567 108.328 1.00 0.00   ? 333  PHE A CE1   1 
ATOM   2364  C  CE2   . PHE A 1 333  ? 142.284 106.647 107.977 1.00 0.00   ? 333  PHE A CE2   1 
ATOM   2365  C  CZ    . PHE A 1 333  ? 141.113 105.958 108.264 1.00 0.00   ? 333  PHE A CZ    1 
ATOM   2366  N  N     . GLY A 1 334  ? 147.129 103.003 105.826 1.00 0.00   ? 334  GLY A N     1 
ATOM   2367  C  CA    . GLY A 1 334  ? 148.249 103.380 104.980 1.00 0.00   ? 334  GLY A CA    1 
ATOM   2368  C  C     . GLY A 1 334  ? 148.582 102.384 103.884 1.00 0.00   ? 334  GLY A C     1 
ATOM   2369  O  O     . GLY A 1 334  ? 149.571 102.550 103.174 1.00 0.00   ? 334  GLY A O     1 
ATOM   2370  N  N     . ASN A 1 335  ? 147.750 101.358 103.742 1.00 0.00   ? 335  ASN A N     1 
ATOM   2371  C  CA    . ASN A 1 335  ? 147.959 100.331 102.729 1.00 0.00   ? 335  ASN A CA    1 
ATOM   2372  C  C     . ASN A 1 335  ? 147.602 100.788 101.320 1.00 0.00   ? 335  ASN A C     1 
ATOM   2373  O  O     . ASN A 1 335  ? 146.433 101.016 101.007 1.00 0.00   ? 335  ASN A O     1 
ATOM   2374  C  CB    . ASN A 1 335  ? 147.159 99.071  103.074 1.00 0.00   ? 335  ASN A CB    1 
ATOM   2375  C  CG    . ASN A 1 335  ? 147.744 98.311  104.250 1.00 0.00   ? 335  ASN A CG    1 
ATOM   2376  O  OD1   . ASN A 1 335  ? 148.759 98.709  104.822 1.00 0.00   ? 335  ASN A OD1   1 
ATOM   2377  N  ND2   . ASN A 1 335  ? 147.104 97.206  104.616 1.00 0.00   ? 335  ASN A ND2   1 
ATOM   2378  N  N     . THR A 1 336  ? 148.621 100.925 100.482 1.00 0.00   ? 336  THR A N     1 
ATOM   2379  C  CA    . THR A 1 336  ? 148.441 101.340 99.095  1.00 0.00   ? 336  THR A CA    1 
ATOM   2380  C  C     . THR A 1 336  ? 149.143 100.320 98.211  1.00 0.00   ? 336  THR A C     1 
ATOM   2381  O  O     . THR A 1 336  ? 150.126 99.703  98.631  1.00 0.00   ? 336  THR A O     1 
ATOM   2382  C  CB    . THR A 1 336  ? 149.077 102.717 98.830  1.00 0.00   ? 336  THR A CB    1 
ATOM   2383  O  OG1   . THR A 1 336  ? 150.472 102.666 99.144  1.00 0.00   ? 336  THR A OG1   1 
ATOM   2384  C  CG2   . THR A 1 336  ? 148.408 103.784 99.678  1.00 0.00   ? 336  THR A CG2   1 
ATOM   2385  N  N     . VAL A 1 337  ? 148.642 100.140 96.994  1.00 0.00   ? 337  VAL A N     1 
ATOM   2386  C  CA    . VAL A 1 337  ? 149.246 99.192  96.063  1.00 0.00   ? 337  VAL A CA    1 
ATOM   2387  C  C     . VAL A 1 337  ? 149.573 99.856  94.732  1.00 0.00   ? 337  VAL A C     1 
ATOM   2388  O  O     . VAL A 1 337  ? 148.924 100.822 94.332  1.00 0.00   ? 337  VAL A O     1 
ATOM   2389  C  CB    . VAL A 1 337  ? 148.310 97.986  95.797  1.00 0.00   ? 337  VAL A CB    1 
ATOM   2390  C  CG1   . VAL A 1 337  ? 148.065 97.222  97.086  1.00 0.00   ? 337  VAL A CG1   1 
ATOM   2391  C  CG2   . VAL A 1 337  ? 146.994 98.457  95.197  1.00 0.00   ? 337  VAL A CG2   1 
ATOM   2392  N  N     . LYS A 1 338  ? 150.588 99.337  94.052  1.00 0.00   ? 338  LYS A N     1 
ATOM   2393  C  CA    . LYS A 1 338  ? 150.992 99.880  92.760  1.00 0.00   ? 338  LYS A CA    1 
ATOM   2394  C  C     . LYS A 1 338  ? 150.053 99.413  91.656  1.00 0.00   ? 338  LYS A C     1 
ATOM   2395  O  O     . LYS A 1 338  ? 149.743 98.226  91.546  1.00 0.00   ? 338  LYS A O     1 
ATOM   2396  C  CB    . LYS A 1 338  ? 152.428 99.462  92.421  1.00 0.00   ? 338  LYS A CB    1 
ATOM   2397  C  CG    . LYS A 1 338  ? 153.501 100.125 93.281  1.00 0.00   ? 338  LYS A CG    1 
ATOM   2398  C  CD    . LYS A 1 338  ? 154.904 99.789  92.789  1.00 0.00   ? 338  LYS A CD    1 
ATOM   2399  C  CE    . LYS A 1 338  ? 155.966 100.530 93.594  1.00 0.00   ? 338  LYS A CE    1 
ATOM   2400  N  NZ    . LYS A 1 338  ? 157.354 100.231 93.137  1.00 0.00   ? 338  LYS A NZ    1 
ATOM   2401  N  N     . VAL A 1 339  ? 149.595 100.361 90.846  1.00 0.00   ? 339  VAL A N     1 
ATOM   2402  C  CA    . VAL A 1 339  ? 148.692 100.080 89.734  1.00 0.00   ? 339  VAL A CA    1 
ATOM   2403  C  C     . VAL A 1 339  ? 149.295 100.735 88.495  1.00 0.00   ? 339  VAL A C     1 
ATOM   2404  O  O     . VAL A 1 339  ? 149.914 101.795 88.592  1.00 0.00   ? 339  VAL A O     1 
ATOM   2405  C  CB    . VAL A 1 339  ? 147.288 100.673 89.987  1.00 0.00   ? 339  VAL A CB    1 
ATOM   2406  C  CG1   . VAL A 1 339  ? 147.366 102.187 90.081  1.00 0.00   ? 339  VAL A CG1   1 
ATOM   2407  C  CG2   . VAL A 1 339  ? 146.335 100.258 88.874  1.00 0.00   ? 339  VAL A CG2   1 
ATOM   2408  N  N     . PRO A 1 340  ? 149.125 100.114 87.314  1.00 0.00   ? 340  PRO A N     1 
ATOM   2409  C  CA    . PRO A 1 340  ? 149.689 100.716 86.101  1.00 0.00   ? 340  PRO A CA    1 
ATOM   2410  C  C     . PRO A 1 340  ? 149.124 102.116 85.911  1.00 0.00   ? 340  PRO A C     1 
ATOM   2411  O  O     . PRO A 1 340  ? 147.919 102.330 86.032  1.00 0.00   ? 340  PRO A O     1 
ATOM   2412  C  CB    . PRO A 1 340  ? 149.234 99.759  85.008  1.00 0.00   ? 340  PRO A CB    1 
ATOM   2413  C  CG    . PRO A 1 340  ? 149.266 98.441  85.708  1.00 0.00   ? 340  PRO A CG    1 
ATOM   2414  C  CD    . PRO A 1 340  ? 148.605 98.769  87.031  1.00 0.00   ? 340  PRO A CD    1 
ATOM   2415  N  N     . THR A 1 341  ? 149.998 103.073 85.618  1.00 0.00   ? 341  THR A N     1 
ATOM   2416  C  CA    . THR A 1 341  ? 149.579 104.462 85.439  1.00 0.00   ? 341  THR A CA    1 
ATOM   2417  C  C     . THR A 1 341  ? 150.449 105.180 84.420  1.00 0.00   ? 341  THR A C     1 
ATOM   2418  O  O     . THR A 1 341  ? 151.607 104.820 84.210  1.00 0.00   ? 341  THR A O     1 
ATOM   2419  C  CB    . THR A 1 341  ? 149.691 105.231 86.765  1.00 0.00   ? 341  THR A CB    1 
ATOM   2420  O  OG1   . THR A 1 341  ? 149.313 106.596 86.569  1.00 0.00   ? 341  THR A OG1   1 
ATOM   2421  C  CG2   . THR A 1 341  ? 151.128 105.183 87.272  1.00 0.00   ? 341  THR A CG2   1 
ATOM   2422  N  N     . PRO A 1 342  ? 149.897 106.210 83.760  1.00 0.00   ? 342  PRO A N     1 
ATOM   2423  C  CA    . PRO A 1 342  ? 150.693 106.947 82.775  1.00 0.00   ? 342  PRO A CA    1 
ATOM   2424  C  C     . PRO A 1 342  ? 151.798 107.670 83.533  1.00 0.00   ? 342  PRO A C     1 
ATOM   2425  O  O     . PRO A 1 342  ? 151.564 108.165 84.640  1.00 0.00   ? 342  PRO A O     1 
ATOM   2426  C  CB    . PRO A 1 342  ? 149.693 107.936 82.179  1.00 0.00   ? 342  PRO A CB    1 
ATOM   2427  C  CG    . PRO A 1 342  ? 148.379 107.245 82.357  1.00 0.00   ? 342  PRO A CG    1 
ATOM   2428  C  CD    . PRO A 1 342  ? 148.502 106.672 83.738  1.00 0.00   ? 342  PRO A CD    1 
ATOM   2429  N  N     . LEU A 1 343  ? 152.996 107.723 82.967  1.00 0.00   ? 343  LEU A N     1 
ATOM   2430  C  CA    . LEU A 1 343  ? 154.094 108.406 83.638  1.00 0.00   ? 343  LEU A CA    1 
ATOM   2431  C  C     . LEU A 1 343  ? 154.428 109.697 82.908  1.00 0.00   ? 343  LEU A C     1 
ATOM   2432  O  O     . LEU A 1 343  ? 155.494 109.838 82.307  1.00 0.00   ? 343  LEU A O     1 
ATOM   2433  C  CB    . LEU A 1 343  ? 155.314 107.488 83.706  1.00 0.00   ? 343  LEU A CB    1 
ATOM   2434  C  CG    . LEU A 1 343  ? 155.064 106.223 84.532  1.00 0.00   ? 343  LEU A CG    1 
ATOM   2435  C  CD1   . LEU A 1 343  ? 156.251 105.281 84.444  1.00 0.00   ? 343  LEU A CD1   1 
ATOM   2436  C  CD2   . LEU A 1 343  ? 154.789 106.619 85.974  1.00 0.00   ? 343  LEU A CD2   1 
ATOM   2437  N  N     . CYS A 1 344  ? 153.502 110.645 82.986  1.00 0.00   ? 344  CYS A N     1 
ATOM   2438  C  CA    . CYS A 1 344  ? 153.646 111.950 82.353  1.00 0.00   ? 344  CYS A CA    1 
ATOM   2439  C  C     . CYS A 1 344  ? 152.857 112.957 83.175  1.00 0.00   ? 344  CYS A C     1 
ATOM   2440  O  O     . CYS A 1 344  ? 152.180 112.589 84.136  1.00 0.00   ? 344  CYS A O     1 
ATOM   2441  C  CB    . CYS A 1 344  ? 153.092 111.906 80.929  1.00 0.00   ? 344  CYS A CB    1 
ATOM   2442  S  SG    . CYS A 1 344  ? 151.334 111.488 80.829  1.00 0.00   ? 344  CYS A SG    1 
ATOM   2443  N  N     . THR A 1 345  ? 152.944 114.228 82.804  1.00 0.00   ? 345  THR A N     1 
ATOM   2444  C  CA    . THR A 1 345  ? 152.213 115.276 83.509  1.00 0.00   ? 345  THR A CA    1 
ATOM   2445  C  C     . THR A 1 345  ? 150.758 115.186 83.062  1.00 0.00   ? 345  THR A C     1 
ATOM   2446  O  O     . THR A 1 345  ? 150.469 114.618 82.011  1.00 0.00   ? 345  THR A O     1 
ATOM   2447  C  CB    . THR A 1 345  ? 152.752 116.676 83.151  1.00 0.00   ? 345  THR A CB    1 
ATOM   2448  O  OG1   . THR A 1 345  ? 152.486 116.952 81.769  1.00 0.00   ? 345  THR A OG1   1 
ATOM   2449  C  CG2   . THR A 1 345  ? 154.251 116.744 83.386  1.00 0.00   ? 345  THR A CG2   1 
ATOM   2450  N  N     . ALA A 1 346  ? 149.843 115.734 83.856  1.00 0.00   ? 346  ALA A N     1 
ATOM   2451  C  CA    . ALA A 1 346  ? 148.426 115.697 83.503  1.00 0.00   ? 346  ALA A CA    1 
ATOM   2452  C  C     . ALA A 1 346  ? 148.220 116.390 82.162  1.00 0.00   ? 346  ALA A C     1 
ATOM   2453  O  O     . ALA A 1 346  ? 147.373 115.983 81.365  1.00 0.00   ? 346  ALA A O     1 
ATOM   2454  C  CB    . ALA A 1 346  ? 147.599 116.387 84.578  1.00 0.00   ? 346  ALA A CB    1 
ATOM   2455  N  N     . ARG A 1 347  ? 149.002 117.437 81.918  1.00 0.00   ? 347  ARG A N     1 
ATOM   2456  C  CA    . ARG A 1 347  ? 148.926 118.194 80.674  1.00 0.00   ? 347  ARG A CA    1 
ATOM   2457  C  C     . ARG A 1 347  ? 149.278 117.307 79.483  1.00 0.00   ? 347  ARG A C     1 
ATOM   2458  O  O     . ARG A 1 347  ? 148.540 117.258 78.498  1.00 0.00   ? 347  ARG A O     1 
ATOM   2459  C  CB    . ARG A 1 347  ? 149.889 119.386 80.738  1.00 0.00   ? 347  ARG A CB    1 
ATOM   2460  C  CG    . ARG A 1 347  ? 149.933 120.238 79.483  1.00 0.00   ? 347  ARG A CG    1 
ATOM   2461  C  CD    . ARG A 1 347  ? 151.098 121.220 79.524  1.00 0.00   ? 347  ARG A CD    1 
ATOM   2462  N  NE    . ARG A 1 347  ? 150.941 122.242 80.557  1.00 0.00   ? 347  ARG A NE    1 
ATOM   2463  C  CZ    . ARG A 1 347  ? 150.065 123.241 80.498  1.00 0.00   ? 347  ARG A CZ    1 
ATOM   2464  N  NH1   . ARG A 1 347  ? 149.255 123.362 79.452  1.00 0.00   ? 347  ARG A NH1   1 
ATOM   2465  N  NH2   . ARG A 1 347  ? 149.996 124.123 81.484  1.00 0.00   ? 347  ARG A NH2   1 
ATOM   2466  N  N     . GLN A 1 348  ? 150.406 116.607 79.584  1.00 0.00   ? 348  GLN A N     1 
ATOM   2467  C  CA    . GLN A 1 348  ? 150.858 115.716 78.519  1.00 0.00   ? 348  GLN A CA    1 
ATOM   2468  C  C     . GLN A 1 348  ? 149.830 114.620 78.271  1.00 0.00   ? 348  GLN A C     1 
ATOM   2469  O  O     . GLN A 1 348  ? 149.602 114.210 77.131  1.00 0.00   ? 348  GLN A O     1 
ATOM   2470  C  CB    . GLN A 1 348  ? 152.199 115.083 78.893  1.00 0.00   ? 348  GLN A CB    1 
ATOM   2471  C  CG    . GLN A 1 348  ? 153.336 116.082 79.034  1.00 0.00   ? 348  GLN A CG    1 
ATOM   2472  C  CD    . GLN A 1 348  ? 154.661 115.416 79.364  1.00 0.00   ? 348  GLN A CD    1 
ATOM   2473  O  OE1   . GLN A 1 348  ? 154.795 114.742 80.387  1.00 0.00   ? 348  GLN A OE1   1 
ATOM   2474  N  NE2   . GLN A 1 348  ? 155.644 115.600 78.493  1.00 0.00   ? 348  GLN A NE2   1 
ATOM   2475  N  N     . LEU A 1 349  ? 149.213 114.148 79.348  1.00 0.00   ? 349  LEU A N     1 
ATOM   2476  C  CA    . LEU A 1 349  ? 148.205 113.106 79.249  1.00 0.00   ? 349  LEU A CA    1 
ATOM   2477  C  C     . LEU A 1 349  ? 147.032 113.623 78.428  1.00 0.00   ? 349  LEU A C     1 
ATOM   2478  O  O     . LEU A 1 349  ? 146.468 112.895 77.610  1.00 0.00   ? 349  LEU A O     1 
ATOM   2479  C  CB    . LEU A 1 349  ? 147.718 112.693 80.639  1.00 0.00   ? 349  LEU A CB    1 
ATOM   2480  C  CG    . LEU A 1 349  ? 146.715 111.537 80.705  1.00 0.00   ? 349  LEU A CG    1 
ATOM   2481  C  CD1   . LEU A 1 349  ? 147.324 110.273 80.116  1.00 0.00   ? 349  LEU A CD1   1 
ATOM   2482  C  CD2   . LEU A 1 349  ? 146.312 111.309 82.151  1.00 0.00   ? 349  LEU A CD2   1 
ATOM   2483  N  N     . ASP A 1 350  ? 146.664 114.882 78.651  1.00 0.00   ? 350  ASP A N     1 
ATOM   2484  C  CA    . ASP A 1 350  ? 145.556 115.487 77.919  1.00 0.00   ? 350  ASP A CA    1 
ATOM   2485  C  C     . ASP A 1 350  ? 145.940 115.859 76.490  1.00 0.00   ? 350  ASP A C     1 
ATOM   2486  O  O     . ASP A 1 350  ? 145.115 115.764 75.581  1.00 0.00   ? 350  ASP A O     1 
ATOM   2487  C  CB    . ASP A 1 350  ? 145.039 116.737 78.648  1.00 0.00   ? 350  ASP A CB    1 
ATOM   2488  C  CG    . ASP A 1 350  ? 144.302 116.406 79.934  1.00 0.00   ? 350  ASP A CG    1 
ATOM   2489  O  OD1   . ASP A 1 350  ? 143.816 115.257 80.069  1.00 0.00   ? 350  ASP A OD1   1 
ATOM   2490  O  OD2   . ASP A 1 350  ? 144.189 117.293 80.808  1.00 0.00   ? 350  ASP A OD2   1 
ATOM   2491  N  N     . GLU A 1 351  ? 147.184 116.281 76.293  1.00 0.00   ? 351  GLU A N     1 
ATOM   2492  C  CA    . GLU A 1 351  ? 147.646 116.657 74.959  1.00 0.00   ? 351  GLU A CA    1 
ATOM   2493  C  C     . GLU A 1 351  ? 147.552 115.493 73.976  1.00 0.00   ? 351  GLU A C     1 
ATOM   2494  O  O     . GLU A 1 351  ? 147.275 115.696 72.795  1.00 0.00   ? 351  GLU A O     1 
ATOM   2495  C  CB    . GLU A 1 351  ? 149.096 117.156 74.999  1.00 0.00   ? 351  GLU A CB    1 
ATOM   2496  C  CG    . GLU A 1 351  ? 149.658 117.640 73.676  1.00 0.00   ? 351  GLU A CG    1 
ATOM   2497  C  CD    . GLU A 1 351  ? 150.105 116.487 72.793  1.00 0.00   ? 351  GLU A CD    1 
ATOM   2498  O  OE1   . GLU A 1 351  ? 150.425 115.408 73.345  1.00 0.00   ? 351  GLU A OE1   1 
ATOM   2499  O  OE2   . GLU A 1 351  ? 150.147 116.652 71.552  1.00 0.00   ? 351  GLU A OE2   1 
ATOM   2500  N  N     . ASP A 1 352  ? 147.788 114.276 74.460  1.00 0.00   ? 352  ASP A N     1 
ATOM   2501  C  CA    . ASP A 1 352  ? 147.734 113.094 73.600  1.00 0.00   ? 352  ASP A CA    1 
ATOM   2502  C  C     . ASP A 1 352  ? 146.375 112.400 73.599  1.00 0.00   ? 352  ASP A C     1 
ATOM   2503  O  O     . ASP A 1 352  ? 146.214 111.339 72.996  1.00 0.00   ? 352  ASP A O     1 
ATOM   2504  C  CB    . ASP A 1 352  ? 148.812 112.080 74.003  1.00 0.00   ? 352  ASP A CB    1 
ATOM   2505  C  CG    . ASP A 1 352  ? 148.812 110.845 73.121  1.00 0.00   ? 352  ASP A CG    1 
ATOM   2506  O  OD1   . ASP A 1 352  ? 149.104 110.979 71.911  1.00 0.00   ? 352  ASP A OD1   1 
ATOM   2507  O  OD2   . ASP A 1 352  ? 148.506 109.745 73.628  1.00 0.00   ? 352  ASP A OD2   1 
ATOM   2508  N  N     . ARG B 1 32   ? 133.550 163.996 103.141 1.00 0.00   ? 32   ARG B N     1 
ATOM   2509  C  CA    . ARG B 1 32   ? 134.714 163.061 103.186 1.00 0.00   ? 32   ARG B CA    1 
ATOM   2510  C  C     . ARG B 1 32   ? 134.640 162.173 104.425 1.00 0.00   ? 32   ARG B C     1 
ATOM   2511  O  O     . ARG B 1 32   ? 135.660 161.723 104.942 1.00 0.00   ? 32   ARG B O     1 
ATOM   2512  C  CB    . ARG B 1 32   ? 136.019 163.860 103.198 1.00 0.00   ? 32   ARG B CB    1 
ATOM   2513  C  CG    . ARG B 1 32   ? 136.161 164.821 102.027 1.00 0.00   ? 32   ARG B CG    1 
ATOM   2514  C  CD    . ARG B 1 32   ? 136.602 164.116 100.755 1.00 0.00   ? 32   ARG B CD    1 
ATOM   2515  N  NE    . ARG B 1 32   ? 137.994 163.688 100.835 1.00 0.00   ? 32   ARG B NE    1 
ATOM   2516  C  CZ    . ARG B 1 32   ? 138.718 163.289 99.792  1.00 0.00   ? 32   ARG B CZ    1 
ATOM   2517  N  NH1   . ARG B 1 32   ? 138.183 163.258 98.581  1.00 0.00   ? 32   ARG B NH1   1 
ATOM   2518  N  NH2   . ARG B 1 32   ? 139.986 162.933 99.968  1.00 0.00   ? 32   ARG B NH2   1 
ATOM   2519  N  N     . ALA B 1 33   ? 133.416 161.933 104.896 1.00 0.00   ? 33   ALA B N     1 
ATOM   2520  C  CA    . ALA B 1 33   ? 133.176 161.101 106.073 1.00 0.00   ? 33   ALA B CA    1 
ATOM   2521  C  C     . ALA B 1 33   ? 133.369 159.621 105.744 1.00 0.00   ? 33   ALA B C     1 
ATOM   2522  O  O     . ALA B 1 33   ? 132.889 159.137 104.719 1.00 0.00   ? 33   ALA B O     1 
ATOM   2523  C  CB    . ALA B 1 33   ? 131.759 161.341 106.600 1.00 0.00   ? 33   ALA B CB    1 
ATOM   2524  N  N     . ARG B 1 34   ? 134.072 158.904 106.615 1.00 0.00   ? 34   ARG B N     1 
ATOM   2525  C  CA    . ARG B 1 34   ? 134.312 157.479 106.412 1.00 0.00   ? 34   ARG B CA    1 
ATOM   2526  C  C     . ARG B 1 34   ? 133.156 156.637 106.945 1.00 0.00   ? 34   ARG B C     1 
ATOM   2527  O  O     . ARG B 1 34   ? 132.572 156.953 107.984 1.00 0.00   ? 34   ARG B O     1 
ATOM   2528  C  CB    . ARG B 1 34   ? 135.615 157.047 107.098 1.00 0.00   ? 34   ARG B CB    1 
ATOM   2529  C  CG    . ARG B 1 34   ? 136.892 157.578 106.452 1.00 0.00   ? 34   ARG B CG    1 
ATOM   2530  C  CD    . ARG B 1 34   ? 138.138 156.994 107.113 1.00 0.00   ? 34   ARG B CD    1 
ATOM   2531  N  NE    . ARG B 1 34   ? 138.210 157.298 108.539 1.00 0.00   ? 34   ARG B NE    1 
ATOM   2532  C  CZ    . ARG B 1 34   ? 139.224 156.953 109.330 1.00 0.00   ? 34   ARG B CZ    1 
ATOM   2533  N  NH1   . ARG B 1 34   ? 140.257 156.285 108.840 1.00 0.00   ? 34   ARG B NH1   1 
ATOM   2534  N  NH2   . ARG B 1 34   ? 139.200 157.280 110.616 1.00 0.00   ? 34   ARG B NH2   1 
ATOM   2535  N  N     . PHE B 1 35   ? 132.823 155.568 106.227 1.00 0.00   ? 35   PHE B N     1 
ATOM   2536  C  CA    . PHE B 1 35   ? 131.746 154.678 106.641 1.00 0.00   ? 35   PHE B CA    1 
ATOM   2537  C  C     . PHE B 1 35   ? 132.162 153.979 107.924 1.00 0.00   ? 35   PHE B C     1 
ATOM   2538  O  O     . PHE B 1 35   ? 131.417 153.946 108.903 1.00 0.00   ? 35   PHE B O     1 
ATOM   2539  C  CB    . PHE B 1 35   ? 131.468 153.634 105.554 1.00 0.00   ? 35   PHE B CB    1 
ATOM   2540  C  CG    . PHE B 1 35   ? 130.278 152.761 105.842 1.00 0.00   ? 35   PHE B CG    1 
ATOM   2541  C  CD1   . PHE B 1 35   ? 129.024 153.321 106.062 1.00 0.00   ? 35   PHE B CD1   1 
ATOM   2542  C  CD2   . PHE B 1 35   ? 130.402 151.376 105.869 1.00 0.00   ? 35   PHE B CD2   1 
ATOM   2543  C  CE1   . PHE B 1 35   ? 127.914 152.520 106.311 1.00 0.00   ? 35   PHE B CE1   1 
ATOM   2544  C  CE2   . PHE B 1 35   ? 129.296 150.562 106.117 1.00 0.00   ? 35   PHE B CE2   1 
ATOM   2545  C  CZ    . PHE B 1 35   ? 128.047 151.134 106.337 1.00 0.00   ? 35   PHE B CZ    1 
ATOM   2546  N  N     . VAL B 1 36   ? 133.366 153.415 107.899 1.00 0.00   ? 36   VAL B N     1 
ATOM   2547  C  CA    . VAL B 1 36   ? 133.939 152.715 109.039 1.00 0.00   ? 36   VAL B CA    1 
ATOM   2548  C  C     . VAL B 1 36   ? 135.392 153.171 109.163 1.00 0.00   ? 36   VAL B C     1 
ATOM   2549  O  O     . VAL B 1 36   ? 136.038 153.484 108.163 1.00 0.00   ? 36   VAL B O     1 
ATOM   2550  C  CB    . VAL B 1 36   ? 133.885 151.186 108.831 1.00 0.00   ? 36   VAL B CB    1 
ATOM   2551  C  CG1   . VAL B 1 36   ? 132.437 150.727 108.763 1.00 0.00   ? 36   VAL B CG1   1 
ATOM   2552  C  CG2   . VAL B 1 36   ? 134.600 150.810 107.558 1.00 0.00   ? 36   VAL B CG2   1 
ATOM   2553  N  N     . SER B 1 37   ? 135.900 153.213 110.388 1.00 0.00   ? 37   SER B N     1 
ATOM   2554  C  CA    . SER B 1 37   ? 137.270 153.653 110.636 1.00 0.00   ? 37   SER B CA    1 
ATOM   2555  C  C     . SER B 1 37   ? 138.300 152.636 110.158 1.00 0.00   ? 37   SER B C     1 
ATOM   2556  O  O     . SER B 1 37   ? 137.944 151.552 109.684 1.00 0.00   ? 37   SER B O     1 
ATOM   2557  C  CB    . SER B 1 37   ? 137.461 153.924 112.129 1.00 0.00   ? 37   SER B CB    1 
ATOM   2558  O  OG    . SER B 1 37   ? 138.801 154.275 112.427 1.00 0.00   ? 37   SER B OG    1 
ATOM   2559  N  N     . LYS B 1 38   ? 139.577 152.993 110.276 1.00 0.00   ? 38   LYS B N     1 
ATOM   2560  C  CA    . LYS B 1 38   ? 140.656 152.105 109.868 1.00 0.00   ? 38   LYS B CA    1 
ATOM   2561  C  C     . LYS B 1 38   ? 140.569 150.856 110.741 1.00 0.00   ? 38   LYS B C     1 
ATOM   2562  O  O     . LYS B 1 38   ? 140.943 149.759 110.325 1.00 0.00   ? 38   LYS B O     1 
ATOM   2563  C  CB    . LYS B 1 38   ? 142.010 152.777 110.075 1.00 0.00   ? 38   LYS B CB    1 
ATOM   2564  C  CG    . LYS B 1 38   ? 142.189 154.081 109.307 1.00 0.00   ? 38   LYS B CG    1 
ATOM   2565  C  CD    . LYS B 1 38   ? 142.029 153.842 107.815 1.00 0.00   ? 38   LYS B CD    1 
ATOM   2566  C  CE    . LYS B 1 38   ? 143.192 153.044 107.247 1.00 0.00   ? 38   LYS B CE    1 
ATOM   2567  N  NZ    . LYS B 1 38   ? 143.115 152.955 105.762 1.00 0.00   ? 38   LYS B NZ    1 
ATOM   2568  N  N     . LYS B 1 39   ? 140.060 151.041 111.953 1.00 0.00   ? 39   LYS B N     1 
ATOM   2569  C  CA    . LYS B 1 39   ? 139.906 149.964 112.928 1.00 0.00   ? 39   LYS B CA    1 
ATOM   2570  C  C     . LYS B 1 39   ? 138.444 149.529 113.016 1.00 0.00   ? 39   LYS B C     1 
ATOM   2571  O  O     . LYS B 1 39   ? 137.970 149.140 114.086 1.00 0.00   ? 39   LYS B O     1 
ATOM   2572  C  CB    . LYS B 1 39   ? 140.371 150.439 114.309 1.00 0.00   ? 39   LYS B CB    1 
ATOM   2573  C  CG    . LYS B 1 39   ? 141.721 151.140 114.314 1.00 0.00   ? 39   LYS B CG    1 
ATOM   2574  C  CD    . LYS B 1 39   ? 142.009 151.779 115.665 1.00 0.00   ? 39   LYS B CD    1 
ATOM   2575  C  CE    . LYS B 1 39   ? 143.364 152.469 115.658 1.00 0.00   ? 39   LYS B CE    1 
ATOM   2576  N  NZ    . LYS B 1 39   ? 143.686 153.105 116.967 1.00 0.00   ? 39   LYS B NZ    1 
ATOM   2577  N  N     . GLY B 1 40   ? 137.728 149.613 111.900 1.00 0.00   ? 40   GLY B N     1 
ATOM   2578  C  CA    . GLY B 1 40   ? 136.325 149.240 111.912 1.00 0.00   ? 40   GLY B CA    1 
ATOM   2579  C  C     . GLY B 1 40   ? 135.603 150.268 112.754 1.00 0.00   ? 40   GLY B C     1 
ATOM   2580  O  O     . GLY B 1 40   ? 135.630 151.456 112.430 1.00 0.00   ? 40   GLY B O     1 
ATOM   2581  N  N     . ASN B 1 41   ? 134.963 149.828 113.834 1.00 0.00   ? 41   ASN B N     1 
ATOM   2582  C  CA    . ASN B 1 41   ? 134.280 150.768 114.705 1.00 0.00   ? 41   ASN B CA    1 
ATOM   2583  C  C     . ASN B 1 41   ? 133.413 151.669 113.845 1.00 0.00   ? 41   ASN B C     1 
ATOM   2584  O  O     . ASN B 1 41   ? 133.601 152.885 113.811 1.00 0.00   ? 41   ASN B O     1 
ATOM   2585  C  CB    . ASN B 1 41   ? 135.300 151.593 115.488 1.00 0.00   ? 41   ASN B CB    1 
ATOM   2586  C  CG    . ASN B 1 41   ? 134.656 152.431 116.567 1.00 0.00   ? 41   ASN B CG    1 
ATOM   2587  O  OD1   . ASN B 1 41   ? 133.813 151.948 117.322 1.00 0.00   ? 41   ASN B OD1   1 
ATOM   2588  N  ND2   . ASN B 1 41   ? 135.057 153.697 116.651 1.00 0.00   ? 41   ASN B ND2   1 
ATOM   2589  N  N     . CYS B 1 42   ? 132.463 151.059 113.144 1.00 0.00   ? 42   CYS B N     1 
ATOM   2590  C  CA    . CYS B 1 42   ? 131.603 151.791 112.224 1.00 0.00   ? 42   CYS B CA    1 
ATOM   2591  C  C     . CYS B 1 42   ? 131.031 153.052 112.847 1.00 0.00   ? 42   CYS B C     1 
ATOM   2592  O  O     . CYS B 1 42   ? 130.479 153.045 113.944 1.00 0.00   ? 42   CYS B O     1 
ATOM   2593  C  CB    . CYS B 1 42   ? 130.454 150.885 111.772 1.00 0.00   ? 42   CYS B CB    1 
ATOM   2594  S  SG    . CYS B 1 42   ? 129.490 150.174 113.120 1.00 0.00   ? 42   CYS B SG    1 
ATOM   2595  N  N     . ASN B 1 43   ? 131.197 154.144 112.105 1.00 0.00   ? 43   ASN B N     1 
ATOM   2596  C  CA    . ASN B 1 43   ? 130.759 155.470 112.518 1.00 0.00   ? 43   ASN B CA    1 
ATOM   2597  C  C     . ASN B 1 43   ? 129.509 155.944 111.779 1.00 0.00   ? 43   ASN B C     1 
ATOM   2598  O  O     . ASN B 1 43   ? 129.592 156.685 110.798 1.00 0.00   ? 43   ASN B O     1 
ATOM   2599  C  CB    . ASN B 1 43   ? 131.922 156.449 112.306 1.00 0.00   ? 43   ASN B CB    1 
ATOM   2600  C  CG    . ASN B 1 43   ? 131.534 157.891 112.522 1.00 0.00   ? 43   ASN B CG    1 
ATOM   2601  O  OD1   . ASN B 1 43   ? 130.784 158.215 113.441 1.00 0.00   ? 43   ASN B OD1   1 
ATOM   2602  N  ND2   . ASN B 1 43   ? 132.065 158.778 111.685 1.00 0.00   ? 43   ASN B ND2   1 
ATOM   2603  N  N     . VAL B 1 44   ? 128.350 155.505 112.268 1.00 0.00   ? 44   VAL B N     1 
ATOM   2604  C  CA    . VAL B 1 44   ? 127.062 155.868 111.678 1.00 0.00   ? 44   VAL B CA    1 
ATOM   2605  C  C     . VAL B 1 44   ? 126.038 156.264 112.741 1.00 0.00   ? 44   VAL B C     1 
ATOM   2606  O  O     . VAL B 1 44   ? 125.819 155.528 113.706 1.00 0.00   ? 44   VAL B O     1 
ATOM   2607  C  CB    . VAL B 1 44   ? 126.462 154.705 110.862 1.00 0.00   ? 44   VAL B CB    1 
ATOM   2608  C  CG1   . VAL B 1 44   ? 125.072 155.083 110.360 1.00 0.00   ? 44   VAL B CG1   1 
ATOM   2609  C  CG2   . VAL B 1 44   ? 127.367 154.371 109.694 1.00 0.00   ? 44   VAL B CG2   1 
ATOM   2610  N  N     . ALA B 1 45   ? 125.414 157.418 112.560 1.00 0.00   ? 45   ALA B N     1 
ATOM   2611  C  CA    . ALA B 1 45   ? 124.396 157.886 113.494 1.00 0.00   ? 45   ALA B CA    1 
ATOM   2612  C  C     . ALA B 1 45   ? 123.056 157.290 113.056 1.00 0.00   ? 45   ALA B C     1 
ATOM   2613  O  O     . ALA B 1 45   ? 122.856 157.003 111.876 1.00 0.00   ? 45   ALA B O     1 
ATOM   2614  C  CB    . ALA B 1 45   ? 124.333 159.412 113.485 1.00 0.00   ? 45   ALA B CB    1 
ATOM   2615  N  N     . HIS B 1 46   ? 122.136 157.109 114.002 1.00 0.00   ? 46   HIS B N     1 
ATOM   2616  C  CA    . HIS B 1 46   ? 120.823 156.521 113.708 1.00 0.00   ? 46   HIS B CA    1 
ATOM   2617  C  C     . HIS B 1 46   ? 119.683 157.412 114.211 1.00 0.00   ? 46   HIS B C     1 
ATOM   2618  O  O     . HIS B 1 46   ? 119.309 157.354 115.383 1.00 0.00   ? 46   HIS B O     1 
ATOM   2619  C  CB    . HIS B 1 46   ? 120.734 155.149 114.371 1.00 0.00   ? 46   HIS B CB    1 
ATOM   2620  C  CG    . HIS B 1 46   ? 121.825 154.202 113.952 1.00 0.00   ? 46   HIS B CG    1 
ATOM   2621  N  ND1   . HIS B 1 46   ? 121.715 153.363 112.865 1.00 0.00   ? 46   HIS B ND1   1 
ATOM   2622  C  CD2   . HIS B 1 46   ? 123.052 153.973 114.476 1.00 0.00   ? 46   HIS B CD2   1 
ATOM   2623  C  CE1   . HIS B 1 46   ? 122.823 152.655 112.740 1.00 0.00   ? 46   HIS B CE1   1 
ATOM   2624  N  NE2   . HIS B 1 46   ? 123.651 153.004 113.706 1.00 0.00   ? 46   HIS B NE2   1 
ATOM   2625  N  N     . LYS B 1 47   ? 119.118 158.221 113.320 1.00 0.00   ? 47   LYS B N     1 
ATOM   2626  C  CA    . LYS B 1 47   ? 118.054 159.152 113.697 1.00 0.00   ? 47   LYS B CA    1 
ATOM   2627  C  C     . LYS B 1 47   ? 116.608 158.652 113.686 1.00 0.00   ? 47   LYS B C     1 
ATOM   2628  O  O     . LYS B 1 47   ? 116.214 157.836 112.848 1.00 0.00   ? 47   LYS B O     1 
ATOM   2629  C  CB    . LYS B 1 47   ? 118.180 160.437 112.861 1.00 0.00   ? 47   LYS B CB    1 
ATOM   2630  C  CG    . LYS B 1 47   ? 119.533 161.124 113.069 1.00 0.00   ? 47   LYS B CG    1 
ATOM   2631  C  CD    . LYS B 1 47   ? 119.608 162.551 112.528 1.00 0.00   ? 47   LYS B CD    1 
ATOM   2632  C  CE    . LYS B 1 47   ? 120.915 163.213 112.958 1.00 0.00   ? 47   LYS B CE    1 
ATOM   2633  N  NZ    . LYS B 1 47   ? 121.087 164.605 112.451 1.00 0.00   ? 47   LYS B NZ    1 
ATOM   2634  N  N     . ASN B 1 48   ? 115.830 159.181 114.632 1.00 0.00   ? 48   ASN B N     1 
ATOM   2635  C  CA    . ASN B 1 48   ? 114.420 158.851 114.828 1.00 0.00   ? 48   ASN B CA    1 
ATOM   2636  C  C     . ASN B 1 48   ? 114.156 157.408 115.182 1.00 0.00   ? 48   ASN B C     1 
ATOM   2637  O  O     . ASN B 1 48   ? 113.244 156.797 114.627 1.00 0.00   ? 48   ASN B O     1 
ATOM   2638  C  CB    . ASN B 1 48   ? 113.602 159.158 113.579 1.00 0.00   ? 48   ASN B CB    1 
ATOM   2639  C  CG    . ASN B 1 48   ? 113.812 160.543 113.080 1.00 0.00   ? 48   ASN B CG    1 
ATOM   2640  O  OD1   . ASN B 1 48   ? 113.244 161.509 113.596 1.00 0.00   ? 48   ASN B OD1   1 
ATOM   2641  N  ND2   . ASN B 1 48   ? 114.648 160.663 112.065 1.00 0.00   ? 48   ASN B ND2   1 
ATOM   2642  N  N     . ILE B 1 49   ? 114.945 156.813 116.055 1.00 0.00   ? 49   ILE B N     1 
ATOM   2643  C  CA    . ILE B 1 49   ? 114.627 155.442 116.359 1.00 0.00   ? 49   ILE B CA    1 
ATOM   2644  C  C     . ILE B 1 49   ? 113.308 155.496 117.098 1.00 0.00   ? 49   ILE B C     1 
ATOM   2645  O  O     . ILE B 1 49   ? 113.169 156.236 118.066 1.00 0.00   ? 49   ILE B O     1 
ATOM   2646  C  CB    . ILE B 1 49   ? 115.688 154.801 117.250 1.00 0.00   ? 49   ILE B CB    1 
ATOM   2647  C  CG1   . ILE B 1 49   ? 117.053 154.883 116.579 1.00 0.00   ? 49   ILE B CG1   1 
ATOM   2648  C  CG2   . ILE B 1 49   ? 115.336 153.353 117.523 1.00 0.00   ? 49   ILE B CG2   1 
ATOM   2649  C  CD1   . ILE B 1 49   ? 118.163 154.275 117.407 1.00 0.00   ? 49   ILE B CD1   1 
ATOM   2650  N  N     . ARG B 1 50   ? 112.336 154.719 116.645 1.00 0.00   ? 50   ARG B N     1 
ATOM   2651  C  CA    . ARG B 1 50   ? 111.048 154.680 117.313 1.00 0.00   ? 50   ARG B CA    1 
ATOM   2652  C  C     . ARG B 1 50   ? 111.202 153.647 118.401 1.00 0.00   ? 50   ARG B C     1 
ATOM   2653  O  O     . ARG B 1 50   ? 110.659 152.551 118.311 1.00 0.00   ? 50   ARG B O     1 
ATOM   2654  C  CB    . ARG B 1 50   ? 109.951 154.255 116.342 1.00 0.00   ? 50   ARG B CB    1 
ATOM   2655  C  CG    . ARG B 1 50   ? 109.212 155.399 115.676 1.00 0.00   ? 50   ARG B CG    1 
ATOM   2656  C  CD    . ARG B 1 50   ? 108.061 154.855 114.850 1.00 0.00   ? 50   ARG B CD    1 
ATOM   2657  N  NE    . ARG B 1 50   ? 107.446 153.706 115.505 1.00 0.00   ? 50   ARG B NE    1 
ATOM   2658  C  CZ    . ARG B 1 50   ? 106.507 152.944 114.958 1.00 0.00   ? 50   ARG B CZ    1 
ATOM   2659  N  NH1   . ARG B 1 50   ? 106.060 153.208 113.736 1.00 0.00   ? 50   ARG B NH1   1 
ATOM   2660  N  NH2   . ARG B 1 50   ? 106.013 151.917 115.633 1.00 0.00   ? 50   ARG B NH2   1 
ATOM   2661  N  N     . GLU B 1 51   ? 111.935 153.981 119.456 1.00 0.00   ? 51   GLU B N     1 
ATOM   2662  C  CA    . GLU B 1 51   ? 112.170 152.986 120.493 1.00 0.00   ? 51   GLU B CA    1 
ATOM   2663  C  C     . GLU B 1 51   ? 110.872 152.502 121.112 1.00 0.00   ? 51   GLU B C     1 
ATOM   2664  O  O     . GLU B 1 51   ? 110.026 153.292 121.519 1.00 0.00   ? 51   GLU B O     1 
ATOM   2665  C  CB    . GLU B 1 51   ? 113.077 153.557 121.586 1.00 0.00   ? 51   GLU B CB    1 
ATOM   2666  C  CG    . GLU B 1 51   ? 114.500 153.841 121.125 1.00 0.00   ? 51   GLU B CG    1 
ATOM   2667  C  CD    . GLU B 1 51   ? 115.356 154.472 122.206 1.00 0.00   ? 51   GLU B CD    1 
ATOM   2668  O  OE1   . GLU B 1 51   ? 114.798 154.865 123.251 1.00 0.00   ? 51   GLU B OE1   1 
ATOM   2669  O  OE2   . GLU B 1 51   ? 116.587 154.581 122.006 1.00 0.00   ? 51   GLU B OE2   1 
ATOM   2670  N  N     . GLN B 1 52   ? 110.735 151.181 121.176 1.00 0.00   ? 52   GLN B N     1 
ATOM   2671  C  CA    . GLN B 1 52   ? 109.572 150.547 121.766 1.00 0.00   ? 52   GLN B CA    1 
ATOM   2672  C  C     . GLN B 1 52   ? 109.946 150.000 123.129 1.00 0.00   ? 52   GLN B C     1 
ATOM   2673  O  O     . GLN B 1 52   ? 109.133 149.366 123.798 1.00 0.00   ? 52   GLN B O     1 
ATOM   2674  C  CB    . GLN B 1 52   ? 109.059 149.419 120.872 1.00 0.00   ? 52   GLN B CB    1 
ATOM   2675  C  CG    . GLN B 1 52   ? 108.793 149.834 119.436 1.00 0.00   ? 52   GLN B CG    1 
ATOM   2676  C  CD    . GLN B 1 52   ? 107.815 150.984 119.332 1.00 0.00   ? 52   GLN B CD    1 
ATOM   2677  O  OE1   . GLN B 1 52   ? 107.525 151.657 120.321 1.00 0.00   ? 52   GLN B OE1   1 
ATOM   2678  N  NE2   . GLN B 1 52   ? 107.301 151.221 118.130 1.00 0.00   ? 52   GLN B NE2   1 
ATOM   2679  N  N     . GLY B 1 53   ? 111.188 150.240 123.537 1.00 0.00   ? 53   GLY B N     1 
ATOM   2680  C  CA    . GLY B 1 53   ? 111.655 149.748 124.821 1.00 0.00   ? 53   GLY B CA    1 
ATOM   2681  C  C     . GLY B 1 53   ? 112.420 148.444 124.686 1.00 0.00   ? 53   GLY B C     1 
ATOM   2682  O  O     . GLY B 1 53   ? 112.934 147.908 125.668 1.00 0.00   ? 53   GLY B O     1 
ATOM   2683  N  N     . ARG B 1 54   ? 112.485 147.932 123.461 1.00 0.00   ? 54   ARG B N     1 
ATOM   2684  C  CA    . ARG B 1 54   ? 113.185 146.688 123.174 1.00 0.00   ? 54   ARG B CA    1 
ATOM   2685  C  C     . ARG B 1 54   ? 114.666 146.844 123.500 1.00 0.00   ? 54   ARG B C     1 
ATOM   2686  O  O     . ARG B 1 54   ? 115.385 145.862 123.675 1.00 0.00   ? 54   ARG B O     1 
ATOM   2687  C  CB    . ARG B 1 54   ? 113.007 146.320 121.698 1.00 0.00   ? 54   ARG B CB    1 
ATOM   2688  C  CG    . ARG B 1 54   ? 111.587 145.912 121.344 1.00 0.00   ? 54   ARG B CG    1 
ATOM   2689  C  CD    . ARG B 1 54   ? 111.507 145.258 119.976 1.00 0.00   ? 54   ARG B CD    1 
ATOM   2690  N  NE    . ARG B 1 54   ? 111.903 146.168 118.900 1.00 0.00   ? 54   ARG B NE    1 
ATOM   2691  C  CZ    . ARG B 1 54   ? 111.073 147.022 118.307 1.00 0.00   ? 54   ARG B CZ    1 
ATOM   2692  N  NH1   . ARG B 1 54   ? 109.803 147.081 118.682 1.00 0.00   ? 54   ARG B NH1   1 
ATOM   2693  N  NH2   . ARG B 1 54   ? 111.512 147.814 117.336 1.00 0.00   ? 54   ARG B NH2   1 
ATOM   2694  N  N     . PHE B 1 55   ? 115.113 148.095 123.572 1.00 0.00   ? 55   PHE B N     1 
ATOM   2695  C  CA    . PHE B 1 55   ? 116.500 148.400 123.875 1.00 0.00   ? 55   PHE B CA    1 
ATOM   2696  C  C     . PHE B 1 55   ? 116.876 147.864 125.252 1.00 0.00   ? 55   PHE B C     1 
ATOM   2697  O  O     . PHE B 1 55   ? 117.974 147.337 125.448 1.00 0.00   ? 55   PHE B O     1 
ATOM   2698  C  CB    . PHE B 1 55   ? 116.728 149.912 123.851 1.00 0.00   ? 55   PHE B CB    1 
ATOM   2699  C  CG    . PHE B 1 55   ? 118.154 150.309 124.094 1.00 0.00   ? 55   PHE B CG    1 
ATOM   2700  C  CD1   . PHE B 1 55   ? 119.111 150.147 123.104 1.00 0.00   ? 55   PHE B CD1   1 
ATOM   2701  C  CD2   . PHE B 1 55   ? 118.546 150.827 125.325 1.00 0.00   ? 55   PHE B CD2   1 
ATOM   2702  C  CE1   . PHE B 1 55   ? 120.436 150.487 123.326 1.00 0.00   ? 55   PHE B CE1   1 
ATOM   2703  C  CE2   . PHE B 1 55   ? 119.875 151.172 125.564 1.00 0.00   ? 55   PHE B CE2   1 
ATOM   2704  C  CZ    . PHE B 1 55   ? 120.823 151.001 124.562 1.00 0.00   ? 55   PHE B CZ    1 
ATOM   2705  N  N     . LEU B 1 56   ? 115.961 148.004 126.203 1.00 0.00   ? 56   LEU B N     1 
ATOM   2706  C  CA    . LEU B 1 56   ? 116.202 147.544 127.561 1.00 0.00   ? 56   LEU B CA    1 
ATOM   2707  C  C     . LEU B 1 56   ? 115.659 146.147 127.846 1.00 0.00   ? 56   LEU B C     1 
ATOM   2708  O  O     . LEU B 1 56   ? 116.112 145.490 128.784 1.00 0.00   ? 56   LEU B O     1 
ATOM   2709  C  CB    . LEU B 1 56   ? 115.621 148.544 128.565 1.00 0.00   ? 56   LEU B CB    1 
ATOM   2710  C  CG    . LEU B 1 56   ? 116.288 149.920 128.568 1.00 0.00   ? 56   LEU B CG    1 
ATOM   2711  C  CD1   . LEU B 1 56   ? 115.643 150.794 129.631 1.00 0.00   ? 56   LEU B CD1   1 
ATOM   2712  C  CD2   . LEU B 1 56   ? 117.780 149.773 128.831 1.00 0.00   ? 56   LEU B CD2   1 
ATOM   2713  N  N     . GLN B 1 57   ? 114.699 145.693 127.048 1.00 0.00   ? 57   GLN B N     1 
ATOM   2714  C  CA    . GLN B 1 57   ? 114.135 144.358 127.244 1.00 0.00   ? 57   GLN B CA    1 
ATOM   2715  C  C     . GLN B 1 57   ? 115.273 143.359 127.121 1.00 0.00   ? 57   GLN B C     1 
ATOM   2716  O  O     . GLN B 1 57   ? 115.339 142.373 127.852 1.00 0.00   ? 57   GLN B O     1 
ATOM   2717  C  CB    . GLN B 1 57   ? 113.077 144.041 126.184 1.00 0.00   ? 57   GLN B CB    1 
ATOM   2718  C  CG    . GLN B 1 57   ? 111.905 144.987 126.187 1.00 0.00   ? 57   GLN B CG    1 
ATOM   2719  C  CD    . GLN B 1 57   ? 110.731 144.456 125.390 1.00 0.00   ? 57   GLN B CD    1 
ATOM   2720  O  OE1   . GLN B 1 57   ? 110.795 144.345 124.165 1.00 0.00   ? 57   GLN B OE1   1 
ATOM   2721  N  NE2   . GLN B 1 57   ? 109.649 144.120 126.084 1.00 0.00   ? 57   GLN B NE2   1 
ATOM   2722  N  N     . ASP B 1 58   ? 116.160 143.639 126.171 1.00 0.00   ? 58   ASP B N     1 
ATOM   2723  C  CA    . ASP B 1 58   ? 117.333 142.810 125.923 1.00 0.00   ? 58   ASP B CA    1 
ATOM   2724  C  C     . ASP B 1 58   ? 118.350 143.216 126.981 1.00 0.00   ? 58   ASP B C     1 
ATOM   2725  O  O     . ASP B 1 58   ? 119.380 143.824 126.689 1.00 0.00   ? 58   ASP B O     1 
ATOM   2726  C  CB    . ASP B 1 58   ? 117.872 143.089 124.517 1.00 0.00   ? 58   ASP B CB    1 
ATOM   2727  C  CG    . ASP B 1 58   ? 119.036 142.193 124.146 1.00 0.00   ? 58   ASP B CG    1 
ATOM   2728  O  OD1   . ASP B 1 58   ? 119.426 141.337 124.969 1.00 0.00   ? 58   ASP B OD1   1 
ATOM   2729  O  OD2   . ASP B 1 58   ? 119.553 142.341 123.015 1.00 0.00   ? 58   ASP B OD2   1 
ATOM   2730  N  N     . VAL B 1 59   ? 118.032 142.871 128.221 1.00 0.00   ? 59   VAL B N     1 
ATOM   2731  C  CA    . VAL B 1 59   ? 118.866 143.192 129.367 1.00 0.00   ? 59   VAL B CA    1 
ATOM   2732  C  C     . VAL B 1 59   ? 120.234 142.520 129.339 1.00 0.00   ? 59   VAL B C     1 
ATOM   2733  O  O     . VAL B 1 59   ? 121.251 143.161 129.603 1.00 0.00   ? 59   VAL B O     1 
ATOM   2734  C  CB    . VAL B 1 59   ? 118.165 142.777 130.679 1.00 0.00   ? 59   VAL B CB    1 
ATOM   2735  C  CG1   . VAL B 1 59   ? 119.109 142.932 131.858 1.00 0.00   ? 59   VAL B CG1   1 
ATOM   2736  C  CG2   . VAL B 1 59   ? 116.916 143.618 130.881 1.00 0.00   ? 59   VAL B CG2   1 
ATOM   2737  N  N     . PHE B 1 60   ? 120.254 141.233 129.014 1.00 0.00   ? 60   PHE B N     1 
ATOM   2738  C  CA    . PHE B 1 60   ? 121.492 140.471 129.009 1.00 0.00   ? 60   PHE B CA    1 
ATOM   2739  C  C     . PHE B 1 60   ? 122.499 140.731 127.884 1.00 0.00   ? 60   PHE B C     1 
ATOM   2740  O  O     . PHE B 1 60   ? 123.700 140.589 128.095 1.00 0.00   ? 60   PHE B O     1 
ATOM   2741  C  CB    . PHE B 1 60   ? 121.161 138.981 129.119 1.00 0.00   ? 60   PHE B CB    1 
ATOM   2742  C  CG    . PHE B 1 60   ? 120.302 138.649 130.313 1.00 0.00   ? 60   PHE B CG    1 
ATOM   2743  C  CD1   . PHE B 1 60   ? 118.928 138.465 130.175 1.00 0.00   ? 60   PHE B CD1   1 
ATOM   2744  C  CD2   . PHE B 1 60   ? 120.860 138.564 131.588 1.00 0.00   ? 60   PHE B CD2   1 
ATOM   2745  C  CE1   . PHE B 1 60   ? 118.123 138.206 131.284 1.00 0.00   ? 60   PHE B CE1   1 
ATOM   2746  C  CE2   . PHE B 1 60   ? 120.061 138.304 132.703 1.00 0.00   ? 60   PHE B CE2   1 
ATOM   2747  C  CZ    . PHE B 1 60   ? 118.693 138.124 132.552 1.00 0.00   ? 60   PHE B CZ    1 
ATOM   2748  N  N     . THR B 1 61   ? 122.030 141.108 126.699 1.00 0.00   ? 61   THR B N     1 
ATOM   2749  C  CA    . THR B 1 61   ? 122.972 141.406 125.627 1.00 0.00   ? 61   THR B CA    1 
ATOM   2750  C  C     . THR B 1 61   ? 123.615 142.726 126.027 1.00 0.00   ? 61   THR B C     1 
ATOM   2751  O  O     . THR B 1 61   ? 124.799 142.972 125.779 1.00 0.00   ? 61   THR B O     1 
ATOM   2752  C  CB    . THR B 1 61   ? 122.265 141.606 124.282 1.00 0.00   ? 61   THR B CB    1 
ATOM   2753  O  OG1   . THR B 1 61   ? 121.591 140.402 123.916 1.00 0.00   ? 61   THR B OG1   1 
ATOM   2754  C  CG2   . THR B 1 61   ? 123.266 141.975 123.204 1.00 0.00   ? 61   THR B CG2   1 
ATOM   2755  N  N     . THR B 1 62   ? 122.801 143.562 126.658 1.00 0.00   ? 62   THR B N     1 
ATOM   2756  C  CA    . THR B 1 62   ? 123.206 144.875 127.131 1.00 0.00   ? 62   THR B CA    1 
ATOM   2757  C  C     . THR B 1 62   ? 124.235 144.758 128.248 1.00 0.00   ? 62   THR B C     1 
ATOM   2758  O  O     . THR B 1 62   ? 125.270 145.423 128.224 1.00 0.00   ? 62   THR B O     1 
ATOM   2759  C  CB    . THR B 1 62   ? 121.992 145.657 127.660 1.00 0.00   ? 62   THR B CB    1 
ATOM   2760  O  OG1   . THR B 1 62   ? 121.083 145.911 126.581 1.00 0.00   ? 62   THR B OG1   1 
ATOM   2761  C  CG2   . THR B 1 62   ? 122.426 146.976 128.275 1.00 0.00   ? 62   THR B CG2   1 
ATOM   2762  N  N     . LEU B 1 63   ? 123.945 143.904 129.227 1.00 0.00   ? 63   LEU B N     1 
ATOM   2763  C  CA    . LEU B 1 63   ? 124.856 143.710 130.347 1.00 0.00   ? 63   LEU B CA    1 
ATOM   2764  C  C     . LEU B 1 63   ? 126.209 143.230 129.847 1.00 0.00   ? 63   LEU B C     1 
ATOM   2765  O  O     . LEU B 1 63   ? 127.250 143.721 130.286 1.00 0.00   ? 63   LEU B O     1 
ATOM   2766  C  CB    . LEU B 1 63   ? 124.283 142.694 131.335 1.00 0.00   ? 63   LEU B CB    1 
ATOM   2767  C  CG    . LEU B 1 63   ? 123.174 143.181 132.263 1.00 0.00   ? 63   LEU B CG    1 
ATOM   2768  C  CD1   . LEU B 1 63   ? 122.725 142.029 133.143 1.00 0.00   ? 63   LEU B CD1   1 
ATOM   2769  C  CD2   . LEU B 1 63   ? 123.676 144.339 133.118 1.00 0.00   ? 63   LEU B CD2   1 
ATOM   2770  N  N     . VAL B 1 64   ? 126.194 142.276 128.923 1.00 0.00   ? 64   VAL B N     1 
ATOM   2771  C  CA    . VAL B 1 64   ? 127.430 141.751 128.364 1.00 0.00   ? 64   VAL B CA    1 
ATOM   2772  C  C     . VAL B 1 64   ? 128.146 142.834 127.565 1.00 0.00   ? 64   VAL B C     1 
ATOM   2773  O  O     . VAL B 1 64   ? 129.374 142.869 127.517 1.00 0.00   ? 64   VAL B O     1 
ATOM   2774  C  CB    . VAL B 1 64   ? 127.160 140.569 127.421 1.00 0.00   ? 64   VAL B CB    1 
ATOM   2775  C  CG1   . VAL B 1 64   ? 128.468 140.062 126.845 1.00 0.00   ? 64   VAL B CG1   1 
ATOM   2776  C  CG2   . VAL B 1 64   ? 126.441 139.457 128.161 1.00 0.00   ? 64   VAL B CG2   1 
ATOM   2777  N  N     . ASP B 1 65   ? 127.368 143.711 126.935 1.00 0.00   ? 65   ASP B N     1 
ATOM   2778  C  CA    . ASP B 1 65   ? 127.924 144.794 126.132 1.00 0.00   ? 65   ASP B CA    1 
ATOM   2779  C  C     . ASP B 1 65   ? 128.640 145.846 126.976 1.00 0.00   ? 65   ASP B C     1 
ATOM   2780  O  O     . ASP B 1 65   ? 129.540 146.536 126.496 1.00 0.00   ? 65   ASP B O     1 
ATOM   2781  C  CB    . ASP B 1 65   ? 126.827 145.473 125.304 1.00 0.00   ? 65   ASP B CB    1 
ATOM   2782  C  CG    . ASP B 1 65   ? 126.353 144.613 124.148 1.00 0.00   ? 65   ASP B CG    1 
ATOM   2783  O  OD1   . ASP B 1 65   ? 127.158 143.787 123.672 1.00 0.00   ? 65   ASP B OD1   1 
ATOM   2784  O  OD2   . ASP B 1 65   ? 125.193 144.771 123.701 1.00 0.00   ? 65   ASP B OD2   1 
ATOM   2785  N  N     . LEU B 1 66   ? 128.239 145.962 128.237 1.00 0.00   ? 66   LEU B N     1 
ATOM   2786  C  CA    . LEU B 1 66   ? 128.835 146.942 129.136 1.00 0.00   ? 66   LEU B CA    1 
ATOM   2787  C  C     . LEU B 1 66   ? 130.313 146.729 129.407 1.00 0.00   ? 66   LEU B C     1 
ATOM   2788  O  O     . LEU B 1 66   ? 130.805 145.598 129.387 1.00 0.00   ? 66   LEU B O     1 
ATOM   2789  C  CB    . LEU B 1 66   ? 128.089 146.953 130.469 1.00 0.00   ? 66   LEU B CB    1 
ATOM   2790  C  CG    . LEU B 1 66   ? 126.617 147.344 130.382 1.00 0.00   ? 66   LEU B CG    1 
ATOM   2791  C  CD1   . LEU B 1 66   ? 126.014 147.332 131.770 1.00 0.00   ? 66   LEU B CD1   1 
ATOM   2792  C  CD2   . LEU B 1 66   ? 126.487 148.719 129.753 1.00 0.00   ? 66   LEU B CD2   1 
ATOM   2793  N  N     . LYS B 1 67   ? 131.019 147.828 129.660 1.00 0.00   ? 67   LYS B N     1 
ATOM   2794  C  CA    . LYS B 1 67   ? 132.441 147.779 129.968 1.00 0.00   ? 67   LYS B CA    1 
ATOM   2795  C  C     . LYS B 1 67   ? 132.548 147.055 131.308 1.00 0.00   ? 67   LYS B C     1 
ATOM   2796  O  O     . LYS B 1 67   ? 131.568 146.980 132.049 1.00 0.00   ? 67   LYS B O     1 
ATOM   2797  C  CB    . LYS B 1 67   ? 133.004 149.203 130.066 1.00 0.00   ? 67   LYS B CB    1 
ATOM   2798  C  CG    . LYS B 1 67   ? 132.791 150.029 128.796 1.00 0.00   ? 67   LYS B CG    1 
ATOM   2799  C  CD    . LYS B 1 67   ? 133.297 151.464 128.932 1.00 0.00   ? 67   LYS B CD    1 
ATOM   2800  C  CE    . LYS B 1 67   ? 133.065 152.245 127.640 1.00 0.00   ? 67   LYS B CE    1 
ATOM   2801  N  NZ    . LYS B 1 67   ? 133.535 153.659 127.733 1.00 0.00   ? 67   LYS B NZ    1 
ATOM   2802  N  N     . TRP B 1 68   ? 133.726 146.527 131.626 1.00 0.00   ? 68   TRP B N     1 
ATOM   2803  C  CA    . TRP B 1 68   ? 133.911 145.793 132.879 1.00 0.00   ? 68   TRP B CA    1 
ATOM   2804  C  C     . TRP B 1 68   ? 133.626 146.589 134.150 1.00 0.00   ? 68   TRP B C     1 
ATOM   2805  O  O     . TRP B 1 68   ? 133.034 146.066 135.091 1.00 0.00   ? 68   TRP B O     1 
ATOM   2806  C  CB    . TRP B 1 68   ? 135.322 145.204 132.956 1.00 0.00   ? 68   TRP B CB    1 
ATOM   2807  C  CG    . TRP B 1 68   ? 135.437 143.839 132.346 1.00 0.00   ? 68   TRP B CG    1 
ATOM   2808  C  CD1   . TRP B 1 68   ? 136.092 143.505 131.197 1.00 0.00   ? 68   TRP B CD1   1 
ATOM   2809  C  CD2   . TRP B 1 68   ? 134.899 142.615 132.870 1.00 0.00   ? 68   TRP B CD2   1 
ATOM   2810  N  NE1   . TRP B 1 68   ? 136.003 142.150 130.973 1.00 0.00   ? 68   TRP B NE1   1 
ATOM   2811  C  CE2   . TRP B 1 68   ? 135.275 141.581 131.983 1.00 0.00   ? 68   TRP B CE2   1 
ATOM   2812  C  CE3   . TRP B 1 68   ? 134.137 142.296 134.000 1.00 0.00   ? 68   TRP B CE3   1 
ATOM   2813  C  CZ2   . TRP B 1 68   ? 134.916 140.241 132.192 1.00 0.00   ? 68   TRP B CZ2   1 
ATOM   2814  C  CZ3   . TRP B 1 68   ? 133.778 140.961 134.210 1.00 0.00   ? 68   TRP B CZ3   1 
ATOM   2815  C  CH2   . TRP B 1 68   ? 134.170 139.954 133.309 1.00 0.00   ? 68   TRP B CH2   1 
ATOM   2816  N  N     . PRO B 1 69   ? 134.058 147.860 134.199 1.00 0.00   ? 69   PRO B N     1 
ATOM   2817  C  CA    . PRO B 1 69   ? 133.820 148.682 135.389 1.00 0.00   ? 69   PRO B CA    1 
ATOM   2818  C  C     . PRO B 1 69   ? 132.340 148.851 135.719 1.00 0.00   ? 69   PRO B C     1 
ATOM   2819  O  O     . PRO B 1 69   ? 131.972 148.975 136.888 1.00 0.00   ? 69   PRO B O     1 
ATOM   2820  C  CB    . PRO B 1 69   ? 134.482 150.006 135.026 1.00 0.00   ? 69   PRO B CB    1 
ATOM   2821  C  CG    . PRO B 1 69   ? 135.617 149.576 134.164 1.00 0.00   ? 69   PRO B CG    1 
ATOM   2822  C  CD    . PRO B 1 69   ? 134.955 148.562 133.265 1.00 0.00   ? 69   PRO B CD    1 
ATOM   2823  N  N     . HIS B 1 70   ? 131.494 148.853 134.695 1.00 0.00   ? 70   HIS B N     1 
ATOM   2824  C  CA    . HIS B 1 70   ? 130.054 149.006 134.891 1.00 0.00   ? 70   HIS B CA    1 
ATOM   2825  C  C     . HIS B 1 70   ? 129.377 147.689 135.227 1.00 0.00   ? 70   HIS B C     1 
ATOM   2826  O  O     . HIS B 1 70   ? 128.372 147.660 135.931 1.00 0.00   ? 70   HIS B O     1 
ATOM   2827  C  CB    . HIS B 1 70   ? 129.407 149.619 133.648 1.00 0.00   ? 70   HIS B CB    1 
ATOM   2828  C  CG    . HIS B 1 70   ? 129.827 151.032 133.385 1.00 0.00   ? 70   HIS B CG    1 
ATOM   2829  N  ND1   . HIS B 1 70   ? 129.488 151.701 132.230 1.00 0.00   ? 70   HIS B ND1   1 
ATOM   2830  C  CD2   . HIS B 1 70   ? 130.558 151.900 134.121 1.00 0.00   ? 70   HIS B CD2   1 
ATOM   2831  C  CE1   . HIS B 1 70   ? 129.990 152.923 132.267 1.00 0.00   ? 70   HIS B CE1   1 
ATOM   2832  N  NE2   . HIS B 1 70   ? 130.643 153.069 133.406 1.00 0.00   ? 70   HIS B NE2   1 
ATOM   2833  N  N     . THR B 1 71   ? 129.918 146.596 134.708 1.00 0.00   ? 71   THR B N     1 
ATOM   2834  C  CA    . THR B 1 71   ? 129.364 145.281 134.999 1.00 0.00   ? 71   THR B CA    1 
ATOM   2835  C  C     . THR B 1 71   ? 129.582 145.038 136.482 1.00 0.00   ? 71   THR B C     1 
ATOM   2836  O  O     . THR B 1 71   ? 128.717 144.512 137.183 1.00 0.00   ? 71   THR B O     1 
ATOM   2837  C  CB    . THR B 1 71   ? 130.101 144.172 134.235 1.00 0.00   ? 71   THR B CB    1 
ATOM   2838  O  OG1   . THR B 1 71   ? 129.890 144.336 132.829 1.00 0.00   ? 71   THR B OG1   1 
ATOM   2839  C  CG2   . THR B 1 71   ? 129.604 142.813 134.683 1.00 0.00   ? 71   THR B CG2   1 
ATOM   2840  N  N     . LEU B 1 72   ? 130.757 145.447 136.946 1.00 0.00   ? 72   LEU B N     1 
ATOM   2841  C  CA    . LEU B 1 72   ? 131.139 145.292 138.341 1.00 0.00   ? 72   LEU B CA    1 
ATOM   2842  C  C     . LEU B 1 72   ? 130.302 146.179 139.257 1.00 0.00   ? 72   LEU B C     1 
ATOM   2843  O  O     . LEU B 1 72   ? 129.902 145.751 140.344 1.00 0.00   ? 72   LEU B O     1 
ATOM   2844  C  CB    . LEU B 1 72   ? 132.623 145.624 138.510 1.00 0.00   ? 72   LEU B CB    1 
ATOM   2845  C  CG    . LEU B 1 72   ? 133.606 144.739 137.738 1.00 0.00   ? 72   LEU B CG    1 
ATOM   2846  C  CD1   . LEU B 1 72   ? 135.017 145.298 137.860 1.00 0.00   ? 72   LEU B CD1   1 
ATOM   2847  C  CD2   . LEU B 1 72   ? 133.541 143.320 138.279 1.00 0.00   ? 72   LEU B CD2   1 
ATOM   2848  N  N     . LEU B 1 73   ? 130.048 147.411 138.829 1.00 0.00   ? 73   LEU B N     1 
ATOM   2849  C  CA    . LEU B 1 73   ? 129.248 148.328 139.633 1.00 0.00   ? 73   LEU B CA    1 
ATOM   2850  C  C     . LEU B 1 73   ? 127.823 147.818 139.751 1.00 0.00   ? 73   LEU B C     1 
ATOM   2851  O  O     . LEU B 1 73   ? 127.228 147.857 140.826 1.00 0.00   ? 73   LEU B O     1 
ATOM   2852  C  CB    . LEU B 1 73   ? 129.225 149.724 139.010 1.00 0.00   ? 73   LEU B CB    1 
ATOM   2853  C  CG    . LEU B 1 73   ? 130.439 150.635 139.186 1.00 0.00   ? 73   LEU B CG    1 
ATOM   2854  C  CD1   . LEU B 1 73   ? 130.158 151.958 138.492 1.00 0.00   ? 73   LEU B CD1   1 
ATOM   2855  C  CD2   . LEU B 1 73   ? 130.717 150.861 140.665 1.00 0.00   ? 73   LEU B CD2   1 
ATOM   2856  N  N     . ILE B 1 74   ? 127.257 147.337 138.651 1.00 0.00   ? 74   ILE B N     1 
ATOM   2857  C  CA    . ILE B 1 74   ? 125.887 146.838 138.695 1.00 0.00   ? 74   ILE B CA    1 
ATOM   2858  C  C     . ILE B 1 74   ? 125.734 145.672 139.653 1.00 0.00   ? 74   ILE B C     1 
ATOM   2859  O  O     . ILE B 1 74   ? 124.809 145.635 140.457 1.00 0.00   ? 74   ILE B O     1 
ATOM   2860  C  CB    . ILE B 1 74   ? 125.370 146.376 137.326 1.00 0.00   ? 74   ILE B CB    1 
ATOM   2861  C  CG1   . ILE B 1 74   ? 125.251 147.553 136.362 1.00 0.00   ? 74   ILE B CG1   1 
ATOM   2862  C  CG2   . ILE B 1 74   ? 124.031 145.683 137.486 1.00 0.00   ? 74   ILE B CG2   1 
ATOM   2863  C  CD1   . ILE B 1 74   ? 125.001 147.151 134.926 1.00 0.00   ? 74   ILE B CD1   1 
ATOM   2864  N  N     . PHE B 1 75   ? 126.637 144.711 139.566 1.00 0.00   ? 75   PHE B N     1 
ATOM   2865  C  CA    . PHE B 1 75   ? 126.534 143.552 140.442 1.00 0.00   ? 75   PHE B CA    1 
ATOM   2866  C  C     . PHE B 1 75   ? 126.930 143.908 141.868 1.00 0.00   ? 75   PHE B C     1 
ATOM   2867  O  O     . PHE B 1 75   ? 126.421 143.321 142.823 1.00 0.00   ? 75   PHE B O     1 
ATOM   2868  C  CB    . PHE B 1 75   ? 127.409 142.402 139.937 1.00 0.00   ? 75   PHE B CB    1 
ATOM   2869  C  CG    . PHE B 1 75   ? 126.929 141.774 138.647 1.00 0.00   ? 75   PHE B CG    1 
ATOM   2870  C  CD1   . PHE B 1 75   ? 125.591 141.430 138.465 1.00 0.00   ? 75   PHE B CD1   1 
ATOM   2871  C  CD2   . PHE B 1 75   ? 127.843 141.460 137.643 1.00 0.00   ? 75   PHE B CD2   1 
ATOM   2872  C  CE1   . PHE B 1 75   ? 125.172 140.783 137.298 1.00 0.00   ? 75   PHE B CE1   1 
ATOM   2873  C  CE2   . PHE B 1 75   ? 127.435 140.814 136.480 1.00 0.00   ? 75   PHE B CE2   1 
ATOM   2874  C  CZ    . PHE B 1 75   ? 126.100 140.472 136.306 1.00 0.00   ? 75   PHE B CZ    1 
ATOM   2875  N  N     . THR B 1 76   ? 127.801 144.896 142.033 1.00 0.00   ? 76   THR B N     1 
ATOM   2876  C  CA    . THR B 1 76   ? 128.139 145.313 143.385 1.00 0.00   ? 76   THR B CA    1 
ATOM   2877  C  C     . THR B 1 76   ? 126.869 145.930 143.941 1.00 0.00   ? 76   THR B C     1 
ATOM   2878  O  O     . THR B 1 76   ? 126.448 145.621 145.049 1.00 0.00   ? 76   THR B O     1 
ATOM   2879  C  CB    . THR B 1 76   ? 129.277 146.335 143.442 1.00 0.00   ? 76   THR B CB    1 
ATOM   2880  O  OG1   . THR B 1 76   ? 130.458 145.754 142.882 1.00 0.00   ? 76   THR B OG1   1 
ATOM   2881  C  CG2   . THR B 1 76   ? 129.555 146.723 144.883 1.00 0.00   ? 76   THR B CG2   1 
ATOM   2882  N  N     . MET B 1 77   ? 126.251 146.800 143.152 1.00 0.00   ? 77   MET B N     1 
ATOM   2883  C  CA    . MET B 1 77   ? 125.021 147.450 143.573 1.00 0.00   ? 77   MET B CA    1 
ATOM   2884  C  C     . MET B 1 77   ? 123.888 146.460 143.779 1.00 0.00   ? 77   MET B C     1 
ATOM   2885  O  O     . MET B 1 77   ? 123.143 146.556 144.750 1.00 0.00   ? 77   MET B O     1 
ATOM   2886  C  CB    . MET B 1 77   ? 124.585 148.496 142.549 1.00 0.00   ? 77   MET B CB    1 
ATOM   2887  C  CG    . MET B 1 77   ? 125.367 149.793 142.599 1.00 0.00   ? 77   MET B CG    1 
ATOM   2888  S  SD    . MET B 1 77   ? 125.280 150.580 144.216 1.00 0.00   ? 77   MET B SD    1 
ATOM   2889  C  CE    . MET B 1 77   ? 123.533 150.426 144.568 1.00 0.00   ? 77   MET B CE    1 
ATOM   2890  N  N     . SER B 1 78   ? 123.759 145.492 142.883 1.00 0.00   ? 78   SER B N     1 
ATOM   2891  C  CA    . SER B 1 78   ? 122.669 144.544 143.014 1.00 0.00   ? 78   SER B CA    1 
ATOM   2892  C  C     . SER B 1 78   ? 122.794 143.768 144.306 1.00 0.00   ? 78   SER B C     1 
ATOM   2893  O  O     . SER B 1 78   ? 121.822 143.616 145.041 1.00 0.00   ? 78   SER B O     1 
ATOM   2894  C  CB    . SER B 1 78   ? 122.676 143.558 141.850 1.00 0.00   ? 78   SER B CB    1 
ATOM   2895  O  OG    . SER B 1 78   ? 122.596 144.233 140.611 1.00 0.00   ? 78   SER B OG    1 
ATOM   2896  N  N     . PHE B 1 79   ? 123.996 143.298 144.604 1.00 0.00   ? 79   PHE B N     1 
ATOM   2897  C  CA    . PHE B 1 79   ? 124.180 142.554 145.830 1.00 0.00   ? 79   PHE B CA    1 
ATOM   2898  C  C     . PHE B 1 79   ? 123.932 143.445 147.027 1.00 0.00   ? 79   PHE B C     1 
ATOM   2899  O  O     . PHE B 1 79   ? 123.223 143.071 147.949 1.00 0.00   ? 79   PHE B O     1 
ATOM   2900  C  CB    . PHE B 1 79   ? 125.582 141.963 145.906 1.00 0.00   ? 79   PHE B CB    1 
ATOM   2901  C  CG    . PHE B 1 79   ? 125.864 140.953 144.843 1.00 0.00   ? 79   PHE B CG    1 
ATOM   2902  C  CD1   . PHE B 1 79   ? 124.833 140.338 144.165 1.00 0.00   ? 79   PHE B CD1   1 
ATOM   2903  C  CD2   . PHE B 1 79   ? 127.162 140.611 144.533 1.00 0.00   ? 79   PHE B CD2   1 
ATOM   2904  C  CE1   . PHE B 1 79   ? 125.089 139.402 143.188 1.00 0.00   ? 79   PHE B CE1   1 
ATOM   2905  C  CE2   . PHE B 1 79   ? 127.429 139.678 143.551 1.00 0.00   ? 79   PHE B CE2   1 
ATOM   2906  C  CZ    . PHE B 1 79   ? 126.392 139.071 142.879 1.00 0.00   ? 79   PHE B CZ    1 
ATOM   2907  N  N     . LEU B 1 80   ? 124.558 144.616 147.016 1.00 0.00   ? 80   LEU B N     1 
ATOM   2908  C  CA    . LEU B 1 80   ? 124.422 145.551 148.114 1.00 0.00   ? 80   LEU B CA    1 
ATOM   2909  C  C     . LEU B 1 80   ? 122.961 145.861 148.360 1.00 0.00   ? 80   LEU B C     1 
ATOM   2910  O  O     . LEU B 1 80   ? 122.488 145.780 149.487 1.00 0.00   ? 80   LEU B O     1 
ATOM   2911  C  CB    . LEU B 1 80   ? 125.183 146.837 147.828 1.00 0.00   ? 80   LEU B CB    1 
ATOM   2912  C  CG    . LEU B 1 80   ? 125.323 147.741 149.048 1.00 0.00   ? 80   LEU B CG    1 
ATOM   2913  C  CD1   . LEU B 1 80   ? 126.172 147.041 150.092 1.00 0.00   ? 80   LEU B CD1   1 
ATOM   2914  C  CD2   . LEU B 1 80   ? 125.938 149.073 148.667 1.00 0.00   ? 80   LEU B CD2   1 
ATOM   2915  N  N     . CYS B 1 81   ? 122.240 146.190 147.301 1.00 0.00   ? 81   CYS B N     1 
ATOM   2916  C  CA    . CYS B 1 81   ? 120.829 146.501 147.445 1.00 0.00   ? 81   CYS B CA    1 
ATOM   2917  C  C     . CYS B 1 81   ? 120.058 145.304 147.964 1.00 0.00   ? 81   CYS B C     1 
ATOM   2918  O  O     . CYS B 1 81   ? 119.290 145.419 148.916 1.00 0.00   ? 81   CYS B O     1 
ATOM   2919  C  CB    . CYS B 1 81   ? 120.236 146.961 146.117 1.00 0.00   ? 81   CYS B CB    1 
ATOM   2920  S  SG    . CYS B 1 81   ? 120.630 148.673 145.709 1.00 0.00   ? 81   CYS B SG    1 
ATOM   2921  N  N     . SER B 1 82   ? 120.271 144.149 147.350 1.00 0.00   ? 82   SER B N     1 
ATOM   2922  C  CA    . SER B 1 82   ? 119.551 142.961 147.760 1.00 0.00   ? 82   SER B CA    1 
ATOM   2923  C  C     . SER B 1 82   ? 119.842 142.653 149.215 1.00 0.00   ? 82   SER B C     1 
ATOM   2924  O  O     . SER B 1 82   ? 118.936 142.351 149.978 1.00 0.00   ? 82   SER B O     1 
ATOM   2925  C  CB    . SER B 1 82   ? 119.938 141.775 146.893 1.00 0.00   ? 82   SER B CB    1 
ATOM   2926  O  OG    . SER B 1 82   ? 121.331 141.554 146.963 1.00 0.00   ? 82   SER B OG    1 
ATOM   2927  N  N     . TRP B 1 83   ? 121.107 142.755 149.612 1.00 0.00   ? 83   TRP B N     1 
ATOM   2928  C  CA    . TRP B 1 83   ? 121.444 142.489 150.999 1.00 0.00   ? 83   TRP B CA    1 
ATOM   2929  C  C     . TRP B 1 83   ? 120.761 143.522 151.884 1.00 0.00   ? 83   TRP B C     1 
ATOM   2930  O  O     . TRP B 1 83   ? 120.192 143.191 152.917 1.00 0.00   ? 83   TRP B O     1 
ATOM   2931  C  CB    . TRP B 1 83   ? 122.957 142.518 151.219 1.00 0.00   ? 83   TRP B CB    1 
ATOM   2932  C  CG    . TRP B 1 83   ? 123.697 141.353 150.615 1.00 0.00   ? 83   TRP B CG    1 
ATOM   2933  C  CD1   . TRP B 1 83   ? 123.281 140.069 150.549 1.00 0.00   ? 83   TRP B CD1   1 
ATOM   2934  C  CD2   . TRP B 1 83   ? 124.999 141.382 150.020 1.00 0.00   ? 83   TRP B CD2   1 
ATOM   2935  N  NE1   . TRP B 1 83   ? 124.230 139.289 149.938 1.00 0.00   ? 83   TRP B NE1   1 
ATOM   2936  C  CE2   . TRP B 1 83   ? 125.300 140.079 149.609 1.00 0.00   ? 83   TRP B CE2   1 
ATOM   2937  C  CE3   . TRP B 1 83   ? 125.941 142.390 149.805 1.00 0.00   ? 83   TRP B CE3   1 
ATOM   2938  C  CZ2   . TRP B 1 83   ? 126.496 139.753 148.986 1.00 0.00   ? 83   TRP B CZ2   1 
ATOM   2939  C  CZ3   . TRP B 1 83   ? 127.125 142.068 149.187 1.00 0.00   ? 83   TRP B CZ3   1 
ATOM   2940  C  CH2   . TRP B 1 83   ? 127.394 140.761 148.784 1.00 0.00   ? 83   TRP B CH2   1 
ATOM   2941  N  N     . LEU B 1 84   ? 120.824 144.782 151.474 1.00 0.00   ? 84   LEU B N     1 
ATOM   2942  C  CA    . LEU B 1 84   ? 120.233 145.867 152.249 1.00 0.00   ? 84   LEU B CA    1 
ATOM   2943  C  C     . LEU B 1 84   ? 118.717 145.877 152.298 1.00 0.00   ? 84   LEU B C     1 
ATOM   2944  O  O     . LEU B 1 84   ? 118.139 146.081 153.358 1.00 0.00   ? 84   LEU B O     1 
ATOM   2945  C  CB    . LEU B 1 84   ? 120.720 147.224 151.750 1.00 0.00   ? 84   LEU B CB    1 
ATOM   2946  C  CG    . LEU B 1 84   ? 121.541 148.036 152.746 1.00 0.00   ? 84   LEU B CG    1 
ATOM   2947  C  CD1   . LEU B 1 84   ? 122.445 149.029 152.035 1.00 0.00   ? 84   LEU B CD1   1 
ATOM   2948  C  CD2   . LEU B 1 84   ? 120.599 148.752 153.698 1.00 0.00   ? 84   LEU B CD2   1 
ATOM   2949  N  N     . LEU B 1 85   ? 118.067 145.638 151.166 1.00 0.00   ? 85   LEU B N     1 
ATOM   2950  C  CA    . LEU B 1 85   ? 116.614 145.687 151.145 1.00 0.00   ? 85   LEU B CA    1 
ATOM   2951  C  C     . LEU B 1 85   ? 116.034 144.660 152.086 1.00 0.00   ? 85   LEU B C     1 
ATOM   2952  O  O     . LEU B 1 85   ? 115.119 144.950 152.848 1.00 0.00   ? 85   LEU B O     1 
ATOM   2953  C  CB    . LEU B 1 85   ? 116.106 145.419 149.735 1.00 0.00   ? 85   LEU B CB    1 
ATOM   2954  C  CG    . LEU B 1 85   ? 114.585 145.375 149.611 1.00 0.00   ? 85   LEU B CG    1 
ATOM   2955  C  CD1   . LEU B 1 85   ? 113.987 146.725 149.965 1.00 0.00   ? 85   LEU B CD1   1 
ATOM   2956  C  CD2   . LEU B 1 85   ? 114.169 144.939 148.214 1.00 0.00   ? 85   LEU B CD2   1 
ATOM   2957  N  N     . PHE B 1 86   ? 116.569 143.454 152.027 1.00 0.00   ? 86   PHE B N     1 
ATOM   2958  C  CA    . PHE B 1 86   ? 116.132 142.383 152.903 1.00 0.00   ? 86   PHE B CA    1 
ATOM   2959  C  C     . PHE B 1 86   ? 116.482 142.641 154.358 1.00 0.00   ? 86   PHE B C     1 
ATOM   2960  O  O     . PHE B 1 86   ? 115.716 142.317 155.260 1.00 0.00   ? 86   PHE B O     1 
ATOM   2961  C  CB    . PHE B 1 86   ? 116.676 141.055 152.446 1.00 0.00   ? 86   PHE B CB    1 
ATOM   2962  C  CG    . PHE B 1 86   ? 115.780 140.334 151.500 1.00 0.00   ? 86   PHE B CG    1 
ATOM   2963  C  CD1   . PHE B 1 86   ? 116.291 139.736 150.368 1.00 0.00   ? 86   PHE B CD1   1 
ATOM   2964  C  CD2   . PHE B 1 86   ? 114.426 140.262 151.740 1.00 0.00   ? 86   PHE B CD2   1 
ATOM   2965  C  CE1   . PHE B 1 86   ? 115.466 139.071 149.490 1.00 0.00   ? 86   PHE B CE1   1 
ATOM   2966  C  CE2   . PHE B 1 86   ? 113.593 139.600 150.868 1.00 0.00   ? 86   PHE B CE2   1 
ATOM   2967  C  CZ    . PHE B 1 86   ? 114.113 139.004 149.742 1.00 0.00   ? 86   PHE B CZ    1 
ATOM   2968  N  N     . ALA B 1 87   ? 117.640 143.260 154.585 1.00 0.00   ? 87   ALA B N     1 
ATOM   2969  C  CA    . ALA B 1 87   ? 118.123 143.541 155.936 1.00 0.00   ? 87   ALA B CA    1 
ATOM   2970  C  C     . ALA B 1 87   ? 117.151 144.414 156.704 1.00 0.00   ? 87   ALA B C     1 
ATOM   2971  O  O     . ALA B 1 87   ? 116.916 144.189 157.886 1.00 0.00   ? 87   ALA B O     1 
ATOM   2972  C  CB    . ALA B 1 87   ? 119.487 144.199 155.890 1.00 0.00   ? 87   ALA B CB    1 
ATOM   2973  N  N     . MET B 1 88   ? 116.560 145.399 156.035 1.00 0.00   ? 88   MET B N     1 
ATOM   2974  C  CA    . MET B 1 88   ? 115.569 146.258 156.652 1.00 0.00   ? 88   MET B CA    1 
ATOM   2975  C  C     . MET B 1 88   ? 114.378 145.414 157.095 1.00 0.00   ? 88   MET B C     1 
ATOM   2976  O  O     . MET B 1 88   ? 113.874 145.587 158.200 1.00 0.00   ? 88   MET B O     1 
ATOM   2977  C  CB    . MET B 1 88   ? 115.093 147.291 155.637 1.00 0.00   ? 88   MET B CB    1 
ATOM   2978  C  CG    . MET B 1 88   ? 113.936 148.142 156.113 1.00 0.00   ? 88   MET B CG    1 
ATOM   2979  S  SD    . MET B 1 88   ? 114.494 149.402 157.267 1.00 0.00   ? 88   MET B SD    1 
ATOM   2980  C  CE    . MET B 1 88   ? 115.794 150.172 156.307 1.00 0.00   ? 88   MET B CE    1 
ATOM   2981  N  N     . VAL B 1 89   ? 113.951 144.473 156.257 1.00 0.00   ? 89   VAL B N     1 
ATOM   2982  C  CA    . VAL B 1 89   ? 112.838 143.609 156.598 1.00 0.00   ? 89   VAL B CA    1 
ATOM   2983  C  C     . VAL B 1 89   ? 113.160 142.783 157.832 1.00 0.00   ? 89   VAL B C     1 
ATOM   2984  O  O     . VAL B 1 89   ? 112.315 142.617 158.706 1.00 0.00   ? 89   VAL B O     1 
ATOM   2985  C  CB    . VAL B 1 89   ? 112.519 142.631 155.463 1.00 0.00   ? 89   VAL B CB    1 
ATOM   2986  C  CG1   . VAL B 1 89   ? 111.568 141.558 155.954 1.00 0.00   ? 89   VAL B CG1   1 
ATOM   2987  C  CG2   . VAL B 1 89   ? 111.935 143.371 154.276 1.00 0.00   ? 89   VAL B CG2   1 
ATOM   2988  N  N     . TRP B 1 90   ? 114.384 142.271 157.910 1.00 0.00   ? 90   TRP B N     1 
ATOM   2989  C  CA    . TRP B 1 90   ? 114.786 141.472 159.063 1.00 0.00   ? 90   TRP B CA    1 
ATOM   2990  C  C     . TRP B 1 90   ? 114.749 142.305 160.325 1.00 0.00   ? 90   TRP B C     1 
ATOM   2991  O  O     . TRP B 1 90   ? 114.306 141.844 161.368 1.00 0.00   ? 90   TRP B O     1 
ATOM   2992  C  CB    . TRP B 1 90   ? 116.187 140.910 158.873 1.00 0.00   ? 90   TRP B CB    1 
ATOM   2993  C  CG    . TRP B 1 90   ? 116.207 139.649 158.108 1.00 0.00   ? 90   TRP B CG    1 
ATOM   2994  C  CD1   . TRP B 1 90   ? 116.863 139.410 156.944 1.00 0.00   ? 90   TRP B CD1   1 
ATOM   2995  C  CD2   . TRP B 1 90   ? 115.528 138.444 158.444 1.00 0.00   ? 90   TRP B CD2   1 
ATOM   2996  N  NE1   . TRP B 1 90   ? 116.641 138.123 156.533 1.00 0.00   ? 90   TRP B NE1   1 
ATOM   2997  C  CE2   . TRP B 1 90   ? 115.821 137.509 157.440 1.00 0.00   ? 90   TRP B CE2   1 
ATOM   2998  C  CE3   . TRP B 1 90   ? 114.702 138.061 159.498 1.00 0.00   ? 90   TRP B CE3   1 
ATOM   2999  C  CZ2   . TRP B 1 90   ? 115.318 136.218 157.457 1.00 0.00   ? 90   TRP B CZ2   1 
ATOM   3000  C  CZ3   . TRP B 1 90   ? 114.204 136.780 159.515 1.00 0.00   ? 90   TRP B CZ3   1 
ATOM   3001  C  CH2   . TRP B 1 90   ? 114.513 135.871 158.501 1.00 0.00   ? 90   TRP B CH2   1 
ATOM   3002  N  N     . TRP B 1 91   ? 115.210 143.542 160.227 1.00 0.00   ? 91   TRP B N     1 
ATOM   3003  C  CA    . TRP B 1 91   ? 115.219 144.421 161.378 1.00 0.00   ? 91   TRP B CA    1 
ATOM   3004  C  C     . TRP B 1 91   ? 113.803 144.687 161.851 1.00 0.00   ? 91   TRP B C     1 
ATOM   3005  O  O     . TRP B 1 91   ? 113.520 144.656 163.043 1.00 0.00   ? 91   TRP B O     1 
ATOM   3006  C  CB    . TRP B 1 91   ? 115.893 145.735 161.013 1.00 0.00   ? 91   TRP B CB    1 
ATOM   3007  C  CG    . TRP B 1 91   ? 115.789 146.780 162.060 1.00 0.00   ? 91   TRP B CG    1 
ATOM   3008  C  CD1   . TRP B 1 91   ? 116.254 146.710 163.335 1.00 0.00   ? 91   TRP B CD1   1 
ATOM   3009  C  CD2   . TRP B 1 91   ? 115.197 148.068 161.917 1.00 0.00   ? 91   TRP B CD2   1 
ATOM   3010  N  NE1   . TRP B 1 91   ? 115.979 147.874 164.001 1.00 0.00   ? 91   TRP B NE1   1 
ATOM   3011  C  CE2   . TRP B 1 91   ? 115.330 148.725 163.150 1.00 0.00   ? 91   TRP B CE2   1 
ATOM   3012  C  CE3   . TRP B 1 91   ? 114.565 148.731 160.866 1.00 0.00   ? 91   TRP B CE3   1 
ATOM   3013  C  CZ2   . TRP B 1 91   ? 114.852 150.008 163.363 1.00 0.00   ? 91   TRP B CZ2   1 
ATOM   3014  C  CZ3   . TRP B 1 91   ? 114.093 150.003 161.077 1.00 0.00   ? 91   TRP B CZ3   1 
ATOM   3015  C  CH2   . TRP B 1 91   ? 114.239 150.632 162.315 1.00 0.00   ? 91   TRP B CH2   1 
ATOM   3016  N  N     . LEU B 1 92   ? 112.906 144.911 160.903 1.00 0.00   ? 92   LEU B N     1 
ATOM   3017  C  CA    . LEU B 1 92   ? 111.518 145.190 161.221 1.00 0.00   ? 92   LEU B CA    1 
ATOM   3018  C  C     . LEU B 1 92   ? 110.827 144.001 161.888 1.00 0.00   ? 92   LEU B C     1 
ATOM   3019  O  O     . LEU B 1 92   ? 110.070 144.169 162.833 1.00 0.00   ? 92   LEU B O     1 
ATOM   3020  C  CB    . LEU B 1 92   ? 110.775 145.586 159.953 1.00 0.00   ? 92   LEU B CB    1 
ATOM   3021  C  CG    . LEU B 1 92   ? 109.354 146.094 160.151 1.00 0.00   ? 92   LEU B CG    1 
ATOM   3022  C  CD1   . LEU B 1 92   ? 109.043 147.143 159.101 1.00 0.00   ? 92   LEU B CD1   1 
ATOM   3023  C  CD2   . LEU B 1 92   ? 108.376 144.936 160.057 1.00 0.00   ? 92   LEU B CD2   1 
ATOM   3024  N  N     . ILE B 1 93   ? 111.083 142.798 161.397 1.00 0.00   ? 93   ILE B N     1 
ATOM   3025  C  CA    . ILE B 1 93   ? 110.455 141.620 161.968 1.00 0.00   ? 93   ILE B CA    1 
ATOM   3026  C  C     . ILE B 1 93   ? 110.924 141.461 163.403 1.00 0.00   ? 93   ILE B C     1 
ATOM   3027  O  O     . ILE B 1 93   ? 110.185 140.979 164.249 1.00 0.00   ? 93   ILE B O     1 
ATOM   3028  C  CB    . ILE B 1 93   ? 110.634 140.353 161.099 1.00 0.00   ? 93   ILE B CB    1 
ATOM   3029  C  CG1   . ILE B 1 93   ? 109.475 139.391 161.333 1.00 0.00   ? 93   ILE B CG1   1 
ATOM   3030  C  CG2   . ILE B 1 93   ? 111.956 139.650 161.353 1.00 0.00   ? 93   ILE B CG2   1 
ATOM   3031  C  CD1   . ILE B 1 93   ? 109.571 138.143 160.494 1.00 0.00   ? 93   ILE B CD1   1 
ATOM   3032  N  N     . ALA B 1 94   ? 112.156 141.878 163.689 1.00 0.00   ? 94   ALA B N     1 
ATOM   3033  C  CA    . ALA B 1 94   ? 112.657 141.825 165.043 1.00 0.00   ? 94   ALA B CA    1 
ATOM   3034  C  C     . ALA B 1 94   ? 111.848 142.797 165.873 1.00 0.00   ? 94   ALA B C     1 
ATOM   3035  O  O     . ALA B 1 94   ? 111.424 142.486 166.979 1.00 0.00   ? 94   ALA B O     1 
ATOM   3036  C  CB    . ALA B 1 94   ? 114.119 142.208 165.074 1.00 0.00   ? 94   ALA B CB    1 
ATOM   3037  N  N     . PHE B 1 95   ? 111.623 143.974 165.309 1.00 0.00   ? 95   PHE B N     1 
ATOM   3038  C  CA    . PHE B 1 95   ? 110.866 145.024 165.957 1.00 0.00   ? 95   PHE B CA    1 
ATOM   3039  C  C     . PHE B 1 95   ? 109.410 144.656 166.211 1.00 0.00   ? 95   PHE B C     1 
ATOM   3040  O  O     . PHE B 1 95   ? 108.877 144.936 167.281 1.00 0.00   ? 95   PHE B O     1 
ATOM   3041  C  CB    . PHE B 1 95   ? 110.914 146.281 165.099 1.00 0.00   ? 95   PHE B CB    1 
ATOM   3042  C  CG    . PHE B 1 95   ? 110.755 147.539 165.879 1.00 0.00   ? 95   PHE B CG    1 
ATOM   3043  C  CD1   . PHE B 1 95   ? 111.492 148.656 165.555 1.00 0.00   ? 95   PHE B CD1   1 
ATOM   3044  C  CD2   . PHE B 1 95   ? 109.886 147.593 166.944 1.00 0.00   ? 95   PHE B CD2   1 
ATOM   3045  C  CE1   . PHE B 1 95   ? 111.355 149.819 166.278 1.00 0.00   ? 95   PHE B CE1   1 
ATOM   3046  C  CE2   . PHE B 1 95   ? 109.739 148.752 167.672 1.00 0.00   ? 95   PHE B CE2   1 
ATOM   3047  C  CZ    . PHE B 1 95   ? 110.478 149.868 167.340 1.00 0.00   ? 95   PHE B CZ    1 
ATOM   3048  N  N     . ALA B 1 96   ? 108.764 144.026 165.235 1.00 0.00   ? 96   ALA B N     1 
ATOM   3049  C  CA    . ALA B 1 96   ? 107.361 143.676 165.401 1.00 0.00   ? 96   ALA B CA    1 
ATOM   3050  C  C     . ALA B 1 96   ? 107.220 142.717 166.561 1.00 0.00   ? 96   ALA B C     1 
ATOM   3051  O  O     . ALA B 1 96   ? 106.362 142.888 167.421 1.00 0.00   ? 96   ALA B O     1 
ATOM   3052  C  CB    . ALA B 1 96   ? 106.815 143.056 164.130 1.00 0.00   ? 96   ALA B CB    1 
ATOM   3053  N  N     . HIS B 1 97   ? 108.099 141.727 166.584 1.00 0.00   ? 97   HIS B N     1 
ATOM   3054  C  CA    . HIS B 1 97   ? 108.115 140.756 167.658 1.00 0.00   ? 97   HIS B CA    1 
ATOM   3055  C  C     . HIS B 1 97   ? 108.406 141.496 168.960 1.00 0.00   ? 97   HIS B C     1 
ATOM   3056  O  O     . HIS B 1 97   ? 107.923 141.110 170.021 1.00 0.00   ? 97   HIS B O     1 
ATOM   3057  C  CB    . HIS B 1 97   ? 109.167 139.685 167.406 1.00 0.00   ? 97   HIS B CB    1 
ATOM   3058  C  CG    . HIS B 1 97   ? 109.121 138.564 168.392 1.00 0.00   ? 97   HIS B CG    1 
ATOM   3059  N  ND1   . HIS B 1 97   ? 109.700 138.652 169.640 1.00 0.00   ? 97   HIS B ND1   1 
ATOM   3060  C  CD2   . HIS B 1 97   ? 108.568 137.333 168.321 1.00 0.00   ? 97   HIS B CD2   1 
ATOM   3061  C  CE1   . HIS B 1 97   ? 109.502 137.520 170.294 1.00 0.00   ? 97   HIS B CE1   1 
ATOM   3062  N  NE2   . HIS B 1 97   ? 108.820 136.702 169.514 1.00 0.00   ? 97   HIS B NE2   1 
ATOM   3063  N  N     . GLY B 1 98   ? 109.162 142.584 168.849 1.00 0.00   ? 98   GLY B N     1 
ATOM   3064  C  CA    . GLY B 1 98   ? 109.516 143.405 169.991 1.00 0.00   ? 98   GLY B CA    1 
ATOM   3065  C  C     . GLY B 1 98   ? 110.659 142.847 170.812 1.00 0.00   ? 98   GLY B C     1 
ATOM   3066  O  O     . GLY B 1 98   ? 110.910 143.294 171.921 1.00 0.00   ? 98   GLY B O     1 
ATOM   3067  N  N     . ASP B 1 99   ? 111.354 141.870 170.250 1.00 0.00   ? 99   ASP B N     1 
ATOM   3068  C  CA    . ASP B 1 99   ? 112.468 141.207 170.913 1.00 0.00   ? 99   ASP B CA    1 
ATOM   3069  C  C     . ASP B 1 99   ? 113.757 142.003 171.125 1.00 0.00   ? 99   ASP B C     1 
ATOM   3070  O  O     . ASP B 1 99   ? 114.585 141.618 171.947 1.00 0.00   ? 99   ASP B O     1 
ATOM   3071  C  CB    . ASP B 1 99   ? 112.801 139.899 170.196 1.00 0.00   ? 99   ASP B CB    1 
ATOM   3072  C  CG    . ASP B 1 99   ? 113.485 140.121 168.870 1.00 0.00   ? 99   ASP B CG    1 
ATOM   3073  O  OD1   . ASP B 1 99   ? 113.744 141.285 168.520 1.00 0.00   ? 99   ASP B OD1   1 
ATOM   3074  O  OD2   . ASP B 1 99   ? 113.765 139.122 168.176 1.00 0.00   ? 99   ASP B OD2   1 
ATOM   3075  N  N     . LEU B 1 100  ? 113.964 143.064 170.357 1.00 0.00   ? 100  LEU B N     1 
ATOM   3076  C  CA    . LEU B 1 100  ? 115.227 143.798 170.458 1.00 0.00   ? 100  LEU B CA    1 
ATOM   3077  C  C     . LEU B 1 100  ? 115.650 144.515 171.754 1.00 0.00   ? 100  LEU B C     1 
ATOM   3078  O  O     . LEU B 1 100  ? 116.807 144.384 172.150 1.00 0.00   ? 100  LEU B O     1 
ATOM   3079  C  CB    . LEU B 1 100  ? 115.407 144.732 169.257 1.00 0.00   ? 100  LEU B CB    1 
ATOM   3080  C  CG    . LEU B 1 100  ? 114.221 145.581 168.827 1.00 0.00   ? 100  LEU B CG    1 
ATOM   3081  C  CD1   . LEU B 1 100  ? 114.160 146.840 169.670 1.00 0.00   ? 100  LEU B CD1   1 
ATOM   3082  C  CD2   . LEU B 1 100  ? 114.391 145.943 167.364 1.00 0.00   ? 100  LEU B CD2   1 
ATOM   3083  N  N     . ALA B 1 101  ? 114.759 145.238 172.431 1.00 0.00   ? 101  ALA B N     1 
ATOM   3084  C  CA    . ALA B 1 101  ? 115.199 145.951 173.639 1.00 0.00   ? 101  ALA B CA    1 
ATOM   3085  C  C     . ALA B 1 101  ? 114.988 145.311 175.014 1.00 0.00   ? 101  ALA B C     1 
ATOM   3086  O  O     . ALA B 1 101  ? 115.605 145.741 175.984 1.00 0.00   ? 101  ALA B O     1 
ATOM   3087  C  CB    . ALA B 1 101  ? 114.735 147.402 173.633 1.00 0.00   ? 101  ALA B CB    1 
ATOM   3088  N  N     . PRO B 1 102  ? 114.127 144.305 175.117 1.00 0.00   ? 102  PRO B N     1 
ATOM   3089  C  CA    . PRO B 1 102  ? 113.926 143.644 176.410 1.00 0.00   ? 102  PRO B CA    1 
ATOM   3090  C  C     . PRO B 1 102  ? 115.199 142.942 176.840 1.00 0.00   ? 102  PRO B C     1 
ATOM   3091  O  O     . PRO B 1 102  ? 115.562 142.976 178.015 1.00 0.00   ? 102  PRO B O     1 
ATOM   3092  C  CB    . PRO B 1 102  ? 112.840 142.609 176.116 1.00 0.00   ? 102  PRO B CB    1 
ATOM   3093  C  CG    . PRO B 1 102  ? 112.197 143.067 174.859 1.00 0.00   ? 102  PRO B CG    1 
ATOM   3094  C  CD    . PRO B 1 102  ? 113.317 143.673 174.072 1.00 0.00   ? 102  PRO B CD    1 
ATOM   3095  N  N     . GLY B 1 103  ? 115.858 142.309 175.872 1.00 0.00   ? 103  GLY B N     1 
ATOM   3096  C  CA    . GLY B 1 103  ? 117.086 141.579 176.102 1.00 0.00   ? 103  GLY B CA    1 
ATOM   3097  C  C     . GLY B 1 103  ? 116.873 140.596 177.224 1.00 0.00   ? 103  GLY B C     1 
ATOM   3098  O  O     . GLY B 1 103  ? 117.823 140.140 177.854 1.00 0.00   ? 103  GLY B O     1 
ATOM   3099  N  N     . GLU B 1 104  ? 115.611 140.262 177.472 1.00 0.00   ? 104  GLU B N     1 
ATOM   3100  C  CA    . GLU B 1 104  ? 115.311 139.350 178.569 1.00 0.00   ? 104  GLU B CA    1 
ATOM   3101  C  C     . GLU B 1 104  ? 115.263 137.883 178.147 1.00 0.00   ? 104  GLU B C     1 
ATOM   3102  O  O     . GLU B 1 104  ? 114.839 137.549 177.043 1.00 0.00   ? 104  GLU B O     1 
ATOM   3103  C  CB    . GLU B 1 104  ? 113.989 139.760 179.229 1.00 0.00   ? 104  GLU B CB    1 
ATOM   3104  C  CG    . GLU B 1 104  ? 113.705 139.078 180.556 1.00 0.00   ? 104  GLU B CG    1 
ATOM   3105  C  CD    . GLU B 1 104  ? 112.780 139.895 181.429 1.00 0.00   ? 104  GLU B CD    1 
ATOM   3106  O  OE1   . GLU B 1 104  ? 112.651 141.113 181.182 1.00 0.00   ? 104  GLU B OE1   1 
ATOM   3107  O  OE2   . GLU B 1 104  ? 112.187 139.324 182.366 1.00 0.00   ? 104  GLU B OE2   1 
ATOM   3108  N  N     . GLY B 1 105  ? 115.709 137.015 179.046 1.00 0.00   ? 105  GLY B N     1 
ATOM   3109  C  CA    . GLY B 1 105  ? 115.748 135.586 178.800 1.00 0.00   ? 105  GLY B CA    1 
ATOM   3110  C  C     . GLY B 1 105  ? 114.421 134.890 178.567 1.00 0.00   ? 105  GLY B C     1 
ATOM   3111  O  O     . GLY B 1 105  ? 114.333 134.009 177.715 1.00 0.00   ? 105  GLY B O     1 
ATOM   3112  N  N     . THR B 1 106  ? 113.383 135.289 179.300 1.00 0.00   ? 106  THR B N     1 
ATOM   3113  C  CA    . THR B 1 106  ? 112.083 134.634 179.187 1.00 0.00   ? 106  THR B CA    1 
ATOM   3114  C  C     . THR B 1 106  ? 111.523 134.734 177.780 1.00 0.00   ? 106  THR B C     1 
ATOM   3115  O  O     . THR B 1 106  ? 111.000 133.764 177.237 1.00 0.00   ? 106  THR B O     1 
ATOM   3116  C  CB    . THR B 1 106  ? 111.053 135.278 180.129 1.00 0.00   ? 106  THR B CB    1 
ATOM   3117  O  OG1   . THR B 1 106  ? 110.661 136.552 179.606 1.00 0.00   ? 106  THR B OG1   1 
ATOM   3118  C  CG2   . THR B 1 106  ? 111.638 135.465 181.520 1.00 0.00   ? 106  THR B CG2   1 
ATOM   3119  N  N     . ASN B 1 107  ? 111.628 135.915 177.189 1.00 0.00   ? 107  ASN B N     1 
ATOM   3120  C  CA    . ASN B 1 107  ? 111.153 136.106 175.832 1.00 0.00   ? 107  ASN B CA    1 
ATOM   3121  C  C     . ASN B 1 107  ? 112.105 135.384 174.893 1.00 0.00   ? 107  ASN B C     1 
ATOM   3122  O  O     . ASN B 1 107  ? 113.302 135.317 175.159 1.00 0.00   ? 107  ASN B O     1 
ATOM   3123  C  CB    . ASN B 1 107  ? 111.090 137.594 175.496 1.00 0.00   ? 107  ASN B CB    1 
ATOM   3124  C  CG    . ASN B 1 107  ? 110.473 137.856 174.142 1.00 0.00   ? 107  ASN B CG    1 
ATOM   3125  O  OD1   . ASN B 1 107  ? 110.167 136.928 173.397 1.00 0.00   ? 107  ASN B OD1   1 
ATOM   3126  N  ND2   . ASN B 1 107  ? 110.286 139.127 173.810 1.00 0.00   ? 107  ASN B ND2   1 
ATOM   3127  N  N     . VAL B 1 108  ? 111.583 134.825 173.810 1.00 0.00   ? 108  VAL B N     1 
ATOM   3128  C  CA    . VAL B 1 108  ? 112.444 134.149 172.854 1.00 0.00   ? 108  VAL B CA    1 
ATOM   3129  C  C     . VAL B 1 108  ? 112.401 134.907 171.538 1.00 0.00   ? 108  VAL B C     1 
ATOM   3130  O  O     . VAL B 1 108  ? 111.338 135.109 170.965 1.00 0.00   ? 108  VAL B O     1 
ATOM   3131  C  CB    . VAL B 1 108  ? 111.999 132.703 172.620 1.00 0.00   ? 108  VAL B CB    1 
ATOM   3132  C  CG1   . VAL B 1 108  ? 113.053 131.954 171.828 1.00 0.00   ? 108  VAL B CG1   1 
ATOM   3133  C  CG2   . VAL B 1 108  ? 111.748 132.018 173.952 1.00 0.00   ? 108  VAL B CG2   1 
ATOM   3134  N  N     . PRO B 1 109  ? 113.563 135.313 171.047 1.00 0.00   ? 109  PRO B N     1 
ATOM   3135  C  CA    . PRO B 1 109  ? 113.617 136.060 169.791 1.00 0.00   ? 109  PRO B CA    1 
ATOM   3136  C  C     . PRO B 1 109  ? 113.384 135.180 168.576 1.00 0.00   ? 109  PRO B C     1 
ATOM   3137  O  O     . PRO B 1 109  ? 113.476 133.955 168.650 1.00 0.00   ? 109  PRO B O     1 
ATOM   3138  C  CB    . PRO B 1 109  ? 115.020 136.648 169.807 1.00 0.00   ? 109  PRO B CB    1 
ATOM   3139  C  CG    . PRO B 1 109  ? 115.805 135.569 170.473 1.00 0.00   ? 109  PRO B CG    1 
ATOM   3140  C  CD    . PRO B 1 109  ? 114.910 135.179 171.635 1.00 0.00   ? 109  PRO B CD    1 
ATOM   3141  N  N     . CYS B 1 110  ? 113.066 135.821 167.456 1.00 0.00   ? 110  CYS B N     1 
ATOM   3142  C  CA    . CYS B 1 110  ? 112.850 135.104 166.210 1.00 0.00   ? 110  CYS B CA    1 
ATOM   3143  C  C     . CYS B 1 110  ? 114.194 134.920 165.539 1.00 0.00   ? 110  CYS B C     1 
ATOM   3144  O  O     . CYS B 1 110  ? 114.472 133.891 164.925 1.00 0.00   ? 110  CYS B O     1 
ATOM   3145  C  CB    . CYS B 1 110  ? 111.868 135.844 165.309 1.00 0.00   ? 110  CYS B CB    1 
ATOM   3146  S  SG    . CYS B 1 110  ? 110.188 135.750 165.954 1.00 0.00   ? 110  CYS B SG    1 
ATOM   3147  N  N     . VAL B 1 111  ? 115.033 135.934 165.689 1.00 0.00   ? 111  VAL B N     1 
ATOM   3148  C  CA    . VAL B 1 111  ? 116.378 135.932 165.136 1.00 0.00   ? 111  VAL B CA    1 
ATOM   3149  C  C     . VAL B 1 111  ? 117.271 136.298 166.312 1.00 0.00   ? 111  VAL B C     1 
ATOM   3150  O  O     . VAL B 1 111  ? 117.209 137.412 166.826 1.00 0.00   ? 111  VAL B O     1 
ATOM   3151  C  CB    . VAL B 1 111  ? 116.541 136.986 164.031 1.00 0.00   ? 111  VAL B CB    1 
ATOM   3152  C  CG1   . VAL B 1 111  ? 117.964 136.955 163.502 1.00 0.00   ? 111  VAL B CG1   1 
ATOM   3153  C  CG2   . VAL B 1 111  ? 115.554 136.725 162.907 1.00 0.00   ? 111  VAL B CG2   1 
ATOM   3154  N  N     . THR B 1 112  ? 118.095 135.352 166.740 1.00 0.00   ? 112  THR B N     1 
ATOM   3155  C  CA    . THR B 1 112  ? 118.974 135.576 167.881 1.00 0.00   ? 112  THR B CA    1 
ATOM   3156  C  C     . THR B 1 112  ? 120.031 136.656 167.654 1.00 0.00   ? 112  THR B C     1 
ATOM   3157  O  O     . THR B 1 112  ? 120.415 136.939 166.522 1.00 0.00   ? 112  THR B O     1 
ATOM   3158  C  CB    . THR B 1 112  ? 119.699 134.281 168.293 1.00 0.00   ? 112  THR B CB    1 
ATOM   3159  O  OG1   . THR B 1 112  ? 120.608 133.894 167.255 1.00 0.00   ? 112  THR B OG1   1 
ATOM   3160  C  CG2   . THR B 1 112  ? 118.698 133.162 168.515 1.00 0.00   ? 112  THR B CG2   1 
ATOM   3161  N  N     . SER B 1 113  ? 120.481 137.257 168.755 1.00 0.00   ? 113  SER B N     1 
ATOM   3162  C  CA    . SER B 1 113  ? 121.511 138.287 168.731 1.00 0.00   ? 113  SER B CA    1 
ATOM   3163  C  C     . SER B 1 113  ? 121.222 139.516 167.875 1.00 0.00   ? 113  SER B C     1 
ATOM   3164  O  O     . SER B 1 113  ? 122.115 140.040 167.204 1.00 0.00   ? 113  SER B O     1 
ATOM   3165  C  CB    . SER B 1 113  ? 122.842 137.668 168.291 1.00 0.00   ? 113  SER B CB    1 
ATOM   3166  O  OG    . SER B 1 113  ? 123.248 136.653 169.195 1.00 0.00   ? 113  SER B OG    1 
ATOM   3167  N  N     . ILE B 1 114  ? 119.981 139.988 167.904 1.00 0.00   ? 114  ILE B N     1 
ATOM   3168  C  CA    . ILE B 1 114  ? 119.606 141.172 167.134 1.00 0.00   ? 114  ILE B CA    1 
ATOM   3169  C  C     . ILE B 1 114  ? 119.408 142.366 168.058 1.00 0.00   ? 114  ILE B C     1 
ATOM   3170  O  O     . ILE B 1 114  ? 118.368 142.503 168.705 1.00 0.00   ? 114  ILE B O     1 
ATOM   3171  C  CB    . ILE B 1 114  ? 118.306 140.928 166.351 1.00 0.00   ? 114  ILE B CB    1 
ATOM   3172  C  CG1   . ILE B 1 114  ? 118.516 139.799 165.339 1.00 0.00   ? 114  ILE B CG1   1 
ATOM   3173  C  CG2   . ILE B 1 114  ? 117.874 142.200 165.639 1.00 0.00   ? 114  ILE B CG2   1 
ATOM   3174  C  CD1   . ILE B 1 114  ? 119.578 140.101 164.302 1.00 0.00   ? 114  ILE B CD1   1 
ATOM   3175  N  N     . HIS B 1 115  ? 120.408 143.239 168.110 1.00 0.00   ? 115  HIS B N     1 
ATOM   3176  C  CA    . HIS B 1 115  ? 120.353 144.407 168.978 1.00 0.00   ? 115  HIS B CA    1 
ATOM   3177  C  C     . HIS B 1 115  ? 120.163 145.725 168.226 1.00 0.00   ? 115  HIS B C     1 
ATOM   3178  O  O     . HIS B 1 115  ? 119.528 146.646 168.738 1.00 0.00   ? 115  HIS B O     1 
ATOM   3179  C  CB    . HIS B 1 115  ? 121.622 144.451 169.829 1.00 0.00   ? 115  HIS B CB    1 
ATOM   3180  C  CG    . HIS B 1 115  ? 121.977 143.127 170.450 1.00 0.00   ? 115  HIS B CG    1 
ATOM   3181  N  ND1   . HIS B 1 115  ? 121.239 142.549 171.462 1.00 0.00   ? 115  HIS B ND1   1 
ATOM   3182  C  CD2   . HIS B 1 115  ? 122.987 142.259 170.188 1.00 0.00   ? 115  HIS B CD2   1 
ATOM   3183  C  CE1   . HIS B 1 115  ? 121.775 141.389 171.795 1.00 0.00   ? 115  HIS B CE1   1 
ATOM   3184  N  NE2   . HIS B 1 115  ? 122.837 141.189 171.037 1.00 0.00   ? 115  HIS B NE2   1 
ATOM   3185  N  N     . SER B 1 116  ? 120.698 145.818 167.014 1.00 0.00   ? 116  SER B N     1 
ATOM   3186  C  CA    . SER B 1 116  ? 120.557 147.040 166.222 1.00 0.00   ? 116  SER B CA    1 
ATOM   3187  C  C     . SER B 1 116  ? 120.328 146.708 164.744 1.00 0.00   ? 116  SER B C     1 
ATOM   3188  O  O     . SER B 1 116  ? 120.277 145.533 164.382 1.00 0.00   ? 116  SER B O     1 
ATOM   3189  C  CB    . SER B 1 116  ? 121.810 147.918 166.361 1.00 0.00   ? 116  SER B CB    1 
ATOM   3190  O  OG    . SER B 1 116  ? 122.968 147.242 165.915 1.00 0.00   ? 116  SER B OG    1 
ATOM   3191  N  N     . PHE B 1 117  ? 120.163 147.723 163.916 1.00 0.00   ? 117  PHE B N     1 
ATOM   3192  C  CA    . PHE B 1 117  ? 119.964 147.466 162.509 1.00 0.00   ? 117  PHE B CA    1 
ATOM   3193  C  C     . PHE B 1 117  ? 121.213 146.778 161.984 1.00 0.00   ? 117  PHE B C     1 
ATOM   3194  O  O     . PHE B 1 117  ? 121.142 145.821 161.220 1.00 0.00   ? 117  PHE B O     1 
ATOM   3195  C  CB    . PHE B 1 117  ? 119.731 148.778 161.775 1.00 0.00   ? 117  PHE B CB    1 
ATOM   3196  C  CG    . PHE B 1 117  ? 119.775 148.653 160.289 1.00 0.00   ? 117  PHE B CG    1 
ATOM   3197  C  CD1   . PHE B 1 117  ? 118.671 148.217 159.591 1.00 0.00   ? 117  PHE B CD1   1 
ATOM   3198  C  CD2   . PHE B 1 117  ? 120.922 148.967 159.594 1.00 0.00   ? 117  PHE B CD2   1 
ATOM   3199  C  CE1   . PHE B 1 117  ? 118.708 148.098 158.220 1.00 0.00   ? 117  PHE B CE1   1 
ATOM   3200  C  CE2   . PHE B 1 117  ? 120.968 148.853 158.224 1.00 0.00   ? 117  PHE B CE2   1 
ATOM   3201  C  CZ    . PHE B 1 117  ? 119.858 148.417 157.534 1.00 0.00   ? 117  PHE B CZ    1 
ATOM   3202  N  N     . SER B 1 118  ? 122.362 147.258 162.442 1.00 0.00   ? 118  SER B N     1 
ATOM   3203  C  CA    . SER B 1 118  ? 123.657 146.742 162.013 1.00 0.00   ? 118  SER B CA    1 
ATOM   3204  C  C     . SER B 1 118  ? 123.734 145.233 162.214 1.00 0.00   ? 118  SER B C     1 
ATOM   3205  O  O     . SER B 1 118  ? 124.231 144.506 161.352 1.00 0.00   ? 118  SER B O     1 
ATOM   3206  C  CB    . SER B 1 118  ? 124.777 147.421 162.801 1.00 0.00   ? 118  SER B CB    1 
ATOM   3207  O  OG    . SER B 1 118  ? 124.798 148.815 162.546 1.00 0.00   ? 118  SER B OG    1 
ATOM   3208  N  N     . SER B 1 119  ? 123.249 144.769 163.360 1.00 0.00   ? 119  SER B N     1 
ATOM   3209  C  CA    . SER B 1 119  ? 123.256 143.344 163.656 1.00 0.00   ? 119  SER B CA    1 
ATOM   3210  C  C     . SER B 1 119  ? 122.345 142.655 162.645 1.00 0.00   ? 119  SER B C     1 
ATOM   3211  O  O     . SER B 1 119  ? 122.637 141.557 162.175 1.00 0.00   ? 119  SER B O     1 
ATOM   3212  C  CB    . SER B 1 119  ? 122.736 143.089 165.074 1.00 0.00   ? 119  SER B CB    1 
ATOM   3213  O  OG    . SER B 1 119  ? 121.373 143.458 165.190 1.00 0.00   ? 119  SER B OG    1 
ATOM   3214  N  N     . ALA B 1 120  ? 121.242 143.318 162.313 1.00 0.00   ? 120  ALA B N     1 
ATOM   3215  C  CA    . ALA B 1 120  ? 120.279 142.782 161.357 1.00 0.00   ? 120  ALA B CA    1 
ATOM   3216  C  C     . ALA B 1 120  ? 120.886 142.735 159.960 1.00 0.00   ? 120  ALA B C     1 
ATOM   3217  O  O     . ALA B 1 120  ? 120.672 141.772 159.221 1.00 0.00   ? 120  ALA B O     1 
ATOM   3218  C  CB    . ALA B 1 120  ? 119.016 143.635 161.349 1.00 0.00   ? 120  ALA B CB    1 
ATOM   3219  N  N     . PHE B 1 121  ? 121.645 143.763 159.619 1.00 0.00   ? 121  PHE B N     1 
ATOM   3220  C  CA    . PHE B 1 121  ? 122.278 143.837 158.316 1.00 0.00   ? 121  PHE B CA    1 
ATOM   3221  C  C     . PHE B 1 121  ? 123.257 142.693 158.137 1.00 0.00   ? 121  PHE B C     1 
ATOM   3222  O  O     . PHE B 1 121  ? 123.248 142.003 157.131 1.00 0.00   ? 121  PHE B O     1 
ATOM   3223  C  CB    . PHE B 1 121  ? 123.009 145.162 158.168 1.00 0.00   ? 121  PHE B CB    1 
ATOM   3224  C  CG    . PHE B 1 121  ? 123.700 145.322 156.856 1.00 0.00   ? 121  PHE B CG    1 
ATOM   3225  C  CD1   . PHE B 1 121  ? 123.183 146.154 155.889 1.00 0.00   ? 121  PHE B CD1   1 
ATOM   3226  C  CD2   . PHE B 1 121  ? 124.862 144.634 156.591 1.00 0.00   ? 121  PHE B CD2   1 
ATOM   3227  C  CE1   . PHE B 1 121  ? 123.815 146.304 154.676 1.00 0.00   ? 121  PHE B CE1   1 
ATOM   3228  C  CE2   . PHE B 1 121  ? 125.503 144.779 155.382 1.00 0.00   ? 121  PHE B CE2   1 
ATOM   3229  C  CZ    . PHE B 1 121  ? 124.978 145.614 154.421 1.00 0.00   ? 121  PHE B CZ    1 
ATOM   3230  N  N     . LEU B 1 122  ? 124.116 142.494 159.119 1.00 0.00   ? 122  LEU B N     1 
ATOM   3231  C  CA    . LEU B 1 122  ? 125.105 141.419 159.054 1.00 0.00   ? 122  LEU B CA    1 
ATOM   3232  C  C     . LEU B 1 122  ? 124.409 140.075 158.896 1.00 0.00   ? 122  LEU B C     1 
ATOM   3233  O  O     . LEU B 1 122  ? 124.942 139.171 158.249 1.00 0.00   ? 122  LEU B O     1 
ATOM   3234  C  CB    . LEU B 1 122  ? 125.981 141.408 160.315 1.00 0.00   ? 122  LEU B CB    1 
ATOM   3235  C  CG    . LEU B 1 122  ? 127.028 142.512 160.479 1.00 0.00   ? 122  LEU B CG    1 
ATOM   3236  C  CD1   . LEU B 1 122  ? 127.684 142.374 161.844 1.00 0.00   ? 122  LEU B CD1   1 
ATOM   3237  C  CD2   . LEU B 1 122  ? 128.077 142.424 159.378 1.00 0.00   ? 122  LEU B CD2   1 
ATOM   3238  N  N     . PHE B 1 123  ? 123.224 139.946 159.484 1.00 0.00   ? 123  PHE B N     1 
ATOM   3239  C  CA    . PHE B 1 123  ? 122.461 138.705 159.379 1.00 0.00   ? 123  PHE B CA    1 
ATOM   3240  C  C     . PHE B 1 123  ? 122.047 138.497 157.930 1.00 0.00   ? 123  PHE B C     1 
ATOM   3241  O  O     . PHE B 1 123  ? 122.095 137.381 157.419 1.00 0.00   ? 123  PHE B O     1 
ATOM   3242  C  CB    . PHE B 1 123  ? 121.201 138.757 160.245 1.00 0.00   ? 123  PHE B CB    1 
ATOM   3243  C  CG    . PHE B 1 123  ? 120.352 137.523 160.137 1.00 0.00   ? 123  PHE B CG    1 
ATOM   3244  C  CD1   . PHE B 1 123  ? 120.729 136.347 160.771 1.00 0.00   ? 123  PHE B CD1   1 
ATOM   3245  C  CD2   . PHE B 1 123  ? 119.185 137.534 159.384 1.00 0.00   ? 123  PHE B CD2   1 
ATOM   3246  C  CE1   . PHE B 1 123  ? 119.953 135.198 160.662 1.00 0.00   ? 123  PHE B CE1   1 
ATOM   3247  C  CE2   . PHE B 1 123  ? 118.401 136.389 159.268 1.00 0.00   ? 123  PHE B CE2   1 
ATOM   3248  C  CZ    . PHE B 1 123  ? 118.786 135.216 159.907 1.00 0.00   ? 123  PHE B CZ    1 
ATOM   3249  N  N     . SER B 1 124  ? 121.631 139.578 157.275 1.00 0.00   ? 124  SER B N     1 
ATOM   3250  C  CA    . SER B 1 124  ? 121.205 139.526 155.878 1.00 0.00   ? 124  SER B CA    1 
ATOM   3251  C  C     . SER B 1 124  ? 122.344 139.033 154.999 1.00 0.00   ? 124  SER B C     1 
ATOM   3252  O  O     . SER B 1 124  ? 122.147 138.212 154.102 1.00 0.00   ? 124  SER B O     1 
ATOM   3253  C  CB    . SER B 1 124  ? 120.766 140.918 155.403 1.00 0.00   ? 124  SER B CB    1 
ATOM   3254  O  OG    . SER B 1 124  ? 120.303 140.885 154.065 1.00 0.00   ? 124  SER B OG    1 
ATOM   3255  N  N     . ILE B 1 125  ? 123.536 139.551 155.263 1.00 0.00   ? 125  ILE B N     1 
ATOM   3256  C  CA    . ILE B 1 125  ? 124.724 139.171 154.507 1.00 0.00   ? 125  ILE B CA    1 
ATOM   3257  C  C     . ILE B 1 125  ? 124.992 137.680 154.656 1.00 0.00   ? 125  ILE B C     1 
ATOM   3258  O  O     . ILE B 1 125  ? 125.175 136.970 153.674 1.00 0.00   ? 125  ILE B O     1 
ATOM   3259  C  CB    . ILE B 1 125  ? 125.963 139.952 155.003 1.00 0.00   ? 125  ILE B CB    1 
ATOM   3260  C  CG1   . ILE B 1 125  ? 125.769 141.453 154.748 1.00 0.00   ? 125  ILE B CG1   1 
ATOM   3261  C  CG2   . ILE B 1 125  ? 127.206 139.449 154.293 1.00 0.00   ? 125  ILE B CG2   1 
ATOM   3262  C  CD1   . ILE B 1 125  ? 125.722 141.826 153.295 1.00 0.00   ? 125  ILE B CD1   1 
ATOM   3263  N  N     . GLU B 1 126  ? 124.992 137.216 155.900 1.00 0.00   ? 126  GLU B N     1 
ATOM   3264  C  CA    . GLU B 1 126  ? 125.248 135.812 156.216 1.00 0.00   ? 126  GLU B CA    1 
ATOM   3265  C  C     . GLU B 1 126  ? 124.265 134.846 155.562 1.00 0.00   ? 126  GLU B C     1 
ATOM   3266  O  O     . GLU B 1 126  ? 124.575 133.665 155.391 1.00 0.00   ? 126  GLU B O     1 
ATOM   3267  C  CB    . GLU B 1 126  ? 125.216 135.608 157.734 1.00 0.00   ? 126  GLU B CB    1 
ATOM   3268  C  CG    . GLU B 1 126  ? 126.300 136.354 158.484 1.00 0.00   ? 126  GLU B CG    1 
ATOM   3269  C  CD    . GLU B 1 126  ? 126.174 136.212 159.990 1.00 0.00   ? 126  GLU B CD    1 
ATOM   3270  O  OE1   . GLU B 1 126  ? 126.121 135.065 160.485 1.00 0.00   ? 126  GLU B OE1   1 
ATOM   3271  O  OE2   . GLU B 1 126  ? 126.134 137.255 160.681 1.00 0.00   ? 126  GLU B OE2   1 
ATOM   3272  N  N     . VAL B 1 127  ? 123.085 135.341 155.193 1.00 0.00   ? 127  VAL B N     1 
ATOM   3273  C  CA    . VAL B 1 127  ? 122.057 134.504 154.576 1.00 0.00   ? 127  VAL B CA    1 
ATOM   3274  C  C     . VAL B 1 127  ? 122.175 134.354 153.060 1.00 0.00   ? 127  VAL B C     1 
ATOM   3275  O  O     . VAL B 1 127  ? 122.138 133.235 152.540 1.00 0.00   ? 127  VAL B O     1 
ATOM   3276  C  CB    . VAL B 1 127  ? 120.636 135.039 154.903 1.00 0.00   ? 127  VAL B CB    1 
ATOM   3277  C  CG1   . VAL B 1 127  ? 119.590 134.248 154.136 1.00 0.00   ? 127  VAL B CG1   1 
ATOM   3278  C  CG2   . VAL B 1 127  ? 120.372 134.931 156.393 1.00 0.00   ? 127  VAL B CG2   1 
ATOM   3279  N  N     . GLN B 1 128  ? 122.315 135.469 152.349 1.00 0.00   ? 128  GLN B N     1 
ATOM   3280  C  CA    . GLN B 1 128  ? 122.412 135.418 150.895 1.00 0.00   ? 128  GLN B CA    1 
ATOM   3281  C  C     . GLN B 1 128  ? 123.722 134.828 150.367 1.00 0.00   ? 128  GLN B C     1 
ATOM   3282  O  O     . GLN B 1 128  ? 123.711 134.109 149.368 1.00 0.00   ? 128  GLN B O     1 
ATOM   3283  C  CB    . GLN B 1 128  ? 122.166 136.806 150.286 1.00 0.00   ? 128  GLN B CB    1 
ATOM   3284  C  CG    . GLN B 1 128  ? 120.720 137.283 150.387 1.00 0.00   ? 128  GLN B CG    1 
ATOM   3285  C  CD    . GLN B 1 128  ? 120.445 138.509 149.537 1.00 0.00   ? 128  GLN B CD    1 
ATOM   3286  O  OE1   . GLN B 1 128  ? 119.720 139.416 149.947 1.00 0.00   ? 128  GLN B OE1   1 
ATOM   3287  N  NE2   . GLN B 1 128  ? 121.022 138.541 148.342 1.00 0.00   ? 128  GLN B NE2   1 
ATOM   3288  N  N     . VAL B 1 129  ? 124.844 135.123 151.023 1.00 0.00   ? 129  VAL B N     1 
ATOM   3289  C  CA    . VAL B 1 129  ? 126.128 134.575 150.591 1.00 0.00   ? 129  VAL B CA    1 
ATOM   3290  C  C     . VAL B 1 129  ? 126.448 133.293 151.359 1.00 0.00   ? 129  VAL B C     1 
ATOM   3291  O  O     . VAL B 1 129  ? 127.588 132.834 151.379 1.00 0.00   ? 129  VAL B O     1 
ATOM   3292  C  CB    . VAL B 1 129  ? 127.290 135.581 150.789 1.00 0.00   ? 129  VAL B CB    1 
ATOM   3293  C  CG1   . VAL B 1 129  ? 128.609 134.925 150.444 1.00 0.00   ? 129  VAL B CG1   1 
ATOM   3294  C  CG2   . VAL B 1 129  ? 127.069 136.804 149.934 1.00 0.00   ? 129  VAL B CG2   1 
ATOM   3295  N  N     . THR B 1 130  ? 125.417 132.740 151.986 1.00 0.00   ? 130  THR B N     1 
ATOM   3296  C  CA    . THR B 1 130  ? 125.480 131.502 152.761 1.00 0.00   ? 130  THR B CA    1 
ATOM   3297  C  C     . THR B 1 130  ? 126.636 131.323 153.737 1.00 0.00   ? 130  THR B C     1 
ATOM   3298  O  O     . THR B 1 130  ? 127.305 130.285 153.727 1.00 0.00   ? 130  THR B O     1 
ATOM   3299  C  CB    . THR B 1 130  ? 125.445 130.262 151.835 1.00 0.00   ? 130  THR B CB    1 
ATOM   3300  O  OG1   . THR B 1 130  ? 126.639 130.208 151.047 1.00 0.00   ? 130  THR B OG1   1 
ATOM   3301  C  CG2   . THR B 1 130  ? 124.243 130.331 150.912 1.00 0.00   ? 130  THR B CG2   1 
ATOM   3302  N  N     . ILE B 1 131  ? 126.877 132.316 154.589 1.00 0.00   ? 131  ILE B N     1 
ATOM   3303  C  CA    . ILE B 1 131  ? 127.966 132.206 155.558 1.00 0.00   ? 131  ILE B CA    1 
ATOM   3304  C  C     . ILE B 1 131  ? 127.472 131.512 156.828 1.00 0.00   ? 131  ILE B C     1 
ATOM   3305  O  O     . ILE B 1 131  ? 128.077 130.541 157.288 1.00 0.00   ? 131  ILE B O     1 
ATOM   3306  C  CB    . ILE B 1 131  ? 128.537 133.585 155.921 1.00 0.00   ? 131  ILE B CB    1 
ATOM   3307  C  CG1   . ILE B 1 131  ? 129.150 134.229 154.666 1.00 0.00   ? 131  ILE B CG1   1 
ATOM   3308  C  CG2   . ILE B 1 131  ? 129.588 133.441 157.004 1.00 0.00   ? 131  ILE B CG2   1 
ATOM   3309  C  CD1   . ILE B 1 131  ? 129.805 135.579 154.909 1.00 0.00   ? 131  ILE B CD1   1 
ATOM   3310  N  N     . GLY B 1 132  ? 126.379 132.010 157.399 1.00 0.00   ? 132  GLY B N     1 
ATOM   3311  C  CA    . GLY B 1 132  ? 125.831 131.385 158.589 1.00 0.00   ? 132  GLY B CA    1 
ATOM   3312  C  C     . GLY B 1 132  ? 126.769 131.302 159.779 1.00 0.00   ? 132  GLY B C     1 
ATOM   3313  O  O     . GLY B 1 132  ? 126.979 130.212 160.307 1.00 0.00   ? 132  GLY B O     1 
ATOM   3314  N  N     . PHE B 1 133  ? 127.316 132.430 160.223 1.00 0.00   ? 133  PHE B N     1 
ATOM   3315  C  CA    . PHE B 1 133  ? 128.246 132.403 161.346 1.00 0.00   ? 133  PHE B CA    1 
ATOM   3316  C  C     . PHE B 1 133  ? 127.655 131.690 162.562 1.00 0.00   ? 133  PHE B C     1 
ATOM   3317  O  O     . PHE B 1 133  ? 128.374 131.022 163.294 1.00 0.00   ? 133  PHE B O     1 
ATOM   3318  C  CB    . PHE B 1 133  ? 128.655 133.825 161.753 1.00 0.00   ? 133  PHE B CB    1 
ATOM   3319  C  CG    . PHE B 1 133  ? 129.679 134.453 160.847 1.00 0.00   ? 133  PHE B CG    1 
ATOM   3320  C  CD1   . PHE B 1 133  ? 130.868 133.794 160.547 1.00 0.00   ? 133  PHE B CD1   1 
ATOM   3321  C  CD2   . PHE B 1 133  ? 129.463 135.720 160.319 1.00 0.00   ? 133  PHE B CD2   1 
ATOM   3322  C  CE1   . PHE B 1 133  ? 131.830 134.393 159.736 1.00 0.00   ? 133  PHE B CE1   1 
ATOM   3323  C  CE2   . PHE B 1 133  ? 130.420 136.327 159.507 1.00 0.00   ? 133  PHE B CE2   1 
ATOM   3324  C  CZ    . PHE B 1 133  ? 131.606 135.662 159.215 1.00 0.00   ? 133  PHE B CZ    1 
ATOM   3325  N  N     . GLY B 1 134  ? 126.352 131.827 162.781 1.00 0.00   ? 134  GLY B N     1 
ATOM   3326  C  CA    . GLY B 1 134  ? 125.735 131.147 163.908 1.00 0.00   ? 134  GLY B CA    1 
ATOM   3327  C  C     . GLY B 1 134  ? 125.442 131.961 165.153 1.00 0.00   ? 134  GLY B C     1 
ATOM   3328  O  O     . GLY B 1 134  ? 124.660 131.529 166.003 1.00 0.00   ? 134  GLY B O     1 
ATOM   3329  N  N     . GLY B 1 135  ? 126.082 133.117 165.280 1.00 0.00   ? 135  GLY B N     1 
ATOM   3330  C  CA    . GLY B 1 135  ? 125.845 133.960 166.438 1.00 0.00   ? 135  GLY B CA    1 
ATOM   3331  C  C     . GLY B 1 135  ? 124.441 134.510 166.313 1.00 0.00   ? 135  GLY B C     1 
ATOM   3332  O  O     . GLY B 1 135  ? 123.811 134.916 167.290 1.00 0.00   ? 135  GLY B O     1 
ATOM   3333  N  N     . ARG B 1 136  ? 123.958 134.514 165.074 1.00 0.00   ? 136  ARG B N     1 
ATOM   3334  C  CA    . ARG B 1 136  ? 122.625 134.996 164.747 1.00 0.00   ? 136  ARG B CA    1 
ATOM   3335  C  C     . ARG B 1 136  ? 121.881 133.859 164.038 1.00 0.00   ? 136  ARG B C     1 
ATOM   3336  O  O     . ARG B 1 136  ? 122.140 133.561 162.867 1.00 0.00   ? 136  ARG B O     1 
ATOM   3337  C  CB    . ARG B 1 136  ? 122.729 136.224 163.837 1.00 0.00   ? 136  ARG B CB    1 
ATOM   3338  C  CG    . ARG B 1 136  ? 123.761 137.251 164.306 1.00 0.00   ? 136  ARG B CG    1 
ATOM   3339  C  CD    . ARG B 1 136  ? 123.706 138.522 163.467 1.00 0.00   ? 136  ARG B CD    1 
ATOM   3340  N  NE    . ARG B 1 136  ? 124.609 139.566 163.958 1.00 0.00   ? 136  ARG B NE    1 
ATOM   3341  C  CZ    . ARG B 1 136  ? 125.937 139.529 163.868 1.00 0.00   ? 136  ARG B CZ    1 
ATOM   3342  N  NH1   . ARG B 1 136  ? 126.540 138.490 163.300 1.00 0.00   ? 136  ARG B NH1   1 
ATOM   3343  N  NH2   . ARG B 1 136  ? 126.663 140.534 164.340 1.00 0.00   ? 136  ARG B NH2   1 
ATOM   3344  N  N     . MET B 1 137  ? 120.959 133.226 164.756 1.00 0.00   ? 137  MET B N     1 
ATOM   3345  C  CA    . MET B 1 137  ? 120.189 132.105 164.222 1.00 0.00   ? 137  MET B CA    1 
ATOM   3346  C  C     . MET B 1 137  ? 118.691 132.393 164.140 1.00 0.00   ? 137  MET B C     1 
ATOM   3347  O  O     . MET B 1 137  ? 118.172 133.266 164.836 1.00 0.00   ? 137  MET B O     1 
ATOM   3348  C  CB    . MET B 1 137  ? 120.419 130.871 165.094 1.00 0.00   ? 137  MET B CB    1 
ATOM   3349  C  CG    . MET B 1 137  ? 121.887 130.532 165.313 1.00 0.00   ? 137  MET B CG    1 
ATOM   3350  S  SD    . MET B 1 137  ? 122.134 129.378 166.669 1.00 0.00   ? 137  MET B SD    1 
ATOM   3351  C  CE    . MET B 1 137  ? 122.089 130.505 168.066 1.00 0.00   ? 137  MET B CE    1 
ATOM   3352  N  N     . VAL B 1 138  ? 118.002 131.644 163.283 1.00 0.00   ? 138  VAL B N     1 
ATOM   3353  C  CA    . VAL B 1 138  ? 116.562 131.797 163.107 1.00 0.00   ? 138  VAL B CA    1 
ATOM   3354  C  C     . VAL B 1 138  ? 115.836 130.767 163.967 1.00 0.00   ? 138  VAL B C     1 
ATOM   3355  O  O     . VAL B 1 138  ? 116.124 129.575 163.887 1.00 0.00   ? 138  VAL B O     1 
ATOM   3356  C  CB    . VAL B 1 138  ? 116.153 131.570 161.636 1.00 0.00   ? 138  VAL B CB    1 
ATOM   3357  C  CG1   . VAL B 1 138  ? 114.642 131.656 161.497 1.00 0.00   ? 138  VAL B CG1   1 
ATOM   3358  C  CG2   . VAL B 1 138  ? 116.821 132.594 160.742 1.00 0.00   ? 138  VAL B CG2   1 
ATOM   3359  N  N     . THR B 1 139  ? 114.892 131.221 164.789 1.00 0.00   ? 139  THR B N     1 
ATOM   3360  C  CA    . THR B 1 139  ? 114.153 130.299 165.640 1.00 0.00   ? 139  THR B CA    1 
ATOM   3361  C  C     . THR B 1 139  ? 112.820 129.934 165.008 1.00 0.00   ? 139  THR B C     1 
ATOM   3362  O  O     . THR B 1 139  ? 112.527 130.331 163.877 1.00 0.00   ? 139  THR B O     1 
ATOM   3363  C  CB    . THR B 1 139  ? 113.892 130.892 167.039 1.00 0.00   ? 139  THR B CB    1 
ATOM   3364  O  OG1   . THR B 1 139  ? 112.966 131.980 166.936 1.00 0.00   ? 139  THR B OG1   1 
ATOM   3365  C  CG2   . THR B 1 139  ? 115.192 131.392 167.654 1.00 0.00   ? 139  THR B CG2   1 
ATOM   3366  N  N     . GLU B 1 140  ? 112.008 129.183 165.743 1.00 0.00   ? 140  GLU B N     1 
ATOM   3367  C  CA    . GLU B 1 140  ? 110.707 128.764 165.235 1.00 0.00   ? 140  GLU B CA    1 
ATOM   3368  C  C     . GLU B 1 140  ? 109.600 129.693 165.713 1.00 0.00   ? 140  GLU B C     1 
ATOM   3369  O  O     . GLU B 1 140  ? 108.421 129.440 165.461 1.00 0.00   ? 140  GLU B O     1 
ATOM   3370  C  CB    . GLU B 1 140  ? 110.385 127.334 165.686 1.00 0.00   ? 140  GLU B CB    1 
ATOM   3371  C  CG    . GLU B 1 140  ? 111.457 126.300 165.382 1.00 0.00   ? 140  GLU B CG    1 
ATOM   3372  C  CD    . GLU B 1 140  ? 112.698 126.479 166.232 1.00 0.00   ? 140  GLU B CD    1 
ATOM   3373  O  OE1   . GLU B 1 140  ? 112.632 127.204 167.247 1.00 0.00   ? 140  GLU B OE1   1 
ATOM   3374  O  OE2   . GLU B 1 140  ? 113.740 125.886 165.892 1.00 0.00   ? 140  GLU B OE2   1 
ATOM   3375  N  N     . GLU B 1 141  ? 109.955 130.780 166.375 1.00 0.00   ? 141  GLU B N     1 
ATOM   3376  C  CA    . GLU B 1 141  ? 108.931 131.690 166.862 1.00 0.00   ? 141  GLU B CA    1 
ATOM   3377  C  C     . GLU B 1 141  ? 108.136 132.367 165.750 1.00 0.00   ? 141  GLU B C     1 
ATOM   3378  O  O     . GLU B 1 141  ? 106.910 132.395 165.780 1.00 0.00   ? 141  GLU B O     1 
ATOM   3379  C  CB    . GLU B 1 141  ? 109.548 132.740 167.783 1.00 0.00   ? 141  GLU B CB    1 
ATOM   3380  C  CG    . GLU B 1 141  ? 110.126 132.162 169.058 1.00 0.00   ? 141  GLU B CG    1 
ATOM   3381  C  CD    . GLU B 1 141  ? 109.095 131.407 169.865 1.00 0.00   ? 141  GLU B CD    1 
ATOM   3382  O  OE1   . GLU B 1 141  ? 107.942 131.875 169.946 1.00 0.00   ? 141  GLU B OE1   1 
ATOM   3383  O  OE2   . GLU B 1 141  ? 109.435 130.340 170.419 1.00 0.00   ? 141  GLU B OE2   1 
ATOM   3384  N  N     . CYS B 1 142  ? 108.840 132.906 164.763 1.00 0.00   ? 142  CYS B N     1 
ATOM   3385  C  CA    . CYS B 1 142  ? 108.209 133.617 163.661 1.00 0.00   ? 142  CYS B CA    1 
ATOM   3386  C  C     . CYS B 1 142  ? 108.005 132.764 162.417 1.00 0.00   ? 142  CYS B C     1 
ATOM   3387  O  O     . CYS B 1 142  ? 108.956 132.544 161.672 1.00 0.00   ? 142  CYS B O     1 
ATOM   3388  C  CB    . CYS B 1 142  ? 109.081 134.817 163.281 1.00 0.00   ? 142  CYS B CB    1 
ATOM   3389  S  SG    . CYS B 1 142  ? 108.999 136.239 164.393 1.00 0.00   ? 142  CYS B SG    1 
ATOM   3390  N  N     . PRO B 1 143  ? 106.784 132.293 162.165 1.00 0.00   ? 143  PRO B N     1 
ATOM   3391  C  CA    . PRO B 1 143  ? 106.575 131.488 160.963 1.00 0.00   ? 143  PRO B CA    1 
ATOM   3392  C  C     . PRO B 1 143  ? 106.863 132.384 159.760 1.00 0.00   ? 143  PRO B C     1 
ATOM   3393  O  O     . PRO B 1 143  ? 107.141 131.907 158.660 1.00 0.00   ? 143  PRO B O     1 
ATOM   3394  C  CB    . PRO B 1 143  ? 105.103 131.079 161.068 1.00 0.00   ? 143  PRO B CB    1 
ATOM   3395  C  CG    . PRO B 1 143  ? 104.493 132.228 161.815 1.00 0.00   ? 143  PRO B CG    1 
ATOM   3396  C  CD    . PRO B 1 143  ? 105.519 132.517 162.881 1.00 0.00   ? 143  PRO B CD    1 
ATOM   3397  N  N     . LEU B 1 144  ? 106.816 133.693 160.001 1.00 0.00   ? 144  LEU B N     1 
ATOM   3398  C  CA    . LEU B 1 144  ? 107.083 134.694 158.975 1.00 0.00   ? 144  LEU B CA    1 
ATOM   3399  C  C     . LEU B 1 144  ? 108.577 134.781 158.687 1.00 0.00   ? 144  LEU B C     1 
ATOM   3400  O  O     . LEU B 1 144  ? 108.989 134.895 157.532 1.00 0.00   ? 144  LEU B O     1 
ATOM   3401  C  CB    . LEU B 1 144  ? 106.574 136.068 159.424 1.00 0.00   ? 144  LEU B CB    1 
ATOM   3402  C  CG    . LEU B 1 144  ? 106.944 137.252 158.530 1.00 0.00   ? 144  LEU B CG    1 
ATOM   3403  C  CD1   . LEU B 1 144  ? 106.340 137.082 157.141 1.00 0.00   ? 144  LEU B CD1   1 
ATOM   3404  C  CD2   . LEU B 1 144  ? 106.448 138.533 159.173 1.00 0.00   ? 144  LEU B CD2   1 
ATOM   3405  N  N     . ALA B 1 145  ? 109.388 134.733 159.743 1.00 0.00   ? 145  ALA B N     1 
ATOM   3406  C  CA    . ALA B 1 145  ? 110.836 134.792 159.591 1.00 0.00   ? 145  ALA B CA    1 
ATOM   3407  C  C     . ALA B 1 145  ? 111.258 133.624 158.716 1.00 0.00   ? 145  ALA B C     1 
ATOM   3408  O  O     . ALA B 1 145  ? 112.127 133.761 157.856 1.00 0.00   ? 145  ALA B O     1 
ATOM   3409  C  CB    . ALA B 1 145  ? 111.523 134.707 160.956 1.00 0.00   ? 145  ALA B CB    1 
ATOM   3410  N  N     . ILE B 1 146  ? 110.629 132.472 158.931 1.00 0.00   ? 146  ILE B N     1 
ATOM   3411  C  CA    . ILE B 1 146  ? 110.939 131.285 158.145 1.00 0.00   ? 146  ILE B CA    1 
ATOM   3412  C  C     . ILE B 1 146  ? 110.647 131.539 156.674 1.00 0.00   ? 146  ILE B C     1 
ATOM   3413  O  O     . ILE B 1 146  ? 111.420 131.147 155.801 1.00 0.00   ? 146  ILE B O     1 
ATOM   3414  C  CB    . ILE B 1 146  ? 110.116 130.077 158.616 1.00 0.00   ? 146  ILE B CB    1 
ATOM   3415  C  CG1   . ILE B 1 146  ? 110.475 129.753 160.068 1.00 0.00   ? 146  ILE B CG1   1 
ATOM   3416  C  CG2   . ILE B 1 146  ? 110.378 128.882 157.706 1.00 0.00   ? 146  ILE B CG2   1 
ATOM   3417  C  CD1   . ILE B 1 146  ? 109.737 128.566 160.638 1.00 0.00   ? 146  ILE B CD1   1 
ATOM   3418  N  N     . LEU B 1 147  ? 109.522 132.192 156.409 1.00 0.00   ? 147  LEU B N     1 
ATOM   3419  C  CA    . LEU B 1 147  ? 109.128 132.514 155.046 1.00 0.00   ? 147  LEU B CA    1 
ATOM   3420  C  C     . LEU B 1 147  ? 110.113 133.499 154.436 1.00 0.00   ? 147  LEU B C     1 
ATOM   3421  O  O     . LEU B 1 147  ? 110.545 133.337 153.296 1.00 0.00   ? 147  LEU B O     1 
ATOM   3422  C  CB    . LEU B 1 147  ? 107.723 133.114 155.015 1.00 0.00   ? 147  LEU B CB    1 
ATOM   3423  C  CG    . LEU B 1 147  ? 107.266 133.631 153.648 1.00 0.00   ? 147  LEU B CG    1 
ATOM   3424  C  CD1   . LEU B 1 147  ? 107.237 132.489 152.640 1.00 0.00   ? 147  LEU B CD1   1 
ATOM   3425  C  CD2   . LEU B 1 147  ? 105.892 134.260 153.778 1.00 0.00   ? 147  LEU B CD2   1 
ATOM   3426  N  N     . ILE B 1 148  ? 110.467 134.524 155.204 1.00 0.00   ? 148  ILE B N     1 
ATOM   3427  C  CA    . ILE B 1 148  ? 111.404 135.534 154.727 1.00 0.00   ? 148  ILE B CA    1 
ATOM   3428  C  C     . ILE B 1 148  ? 112.733 134.878 154.368 1.00 0.00   ? 148  ILE B C     1 
ATOM   3429  O  O     . ILE B 1 148  ? 113.353 135.216 153.362 1.00 0.00   ? 148  ILE B O     1 
ATOM   3430  C  CB    . ILE B 1 148  ? 111.650 136.614 155.795 1.00 0.00   ? 148  ILE B CB    1 
ATOM   3431  C  CG1   . ILE B 1 148  ? 110.326 137.319 156.127 1.00 0.00   ? 148  ILE B CG1   1 
ATOM   3432  C  CG2   . ILE B 1 148  ? 112.691 137.607 155.298 1.00 0.00   ? 148  ILE B CG2   1 
ATOM   3433  C  CD1   . ILE B 1 148  ? 110.458 138.426 157.153 1.00 0.00   ? 148  ILE B CD1   1 
ATOM   3434  N  N     . LEU B 1 149  ? 113.165 133.935 155.202 1.00 0.00   ? 149  LEU B N     1 
ATOM   3435  C  CA    . LEU B 1 149  ? 114.412 133.219 154.971 1.00 0.00   ? 149  LEU B CA    1 
ATOM   3436  C  C     . LEU B 1 149  ? 114.351 132.487 153.640 1.00 0.00   ? 149  LEU B C     1 
ATOM   3437  O  O     . LEU B 1 149  ? 115.302 132.511 152.861 1.00 0.00   ? 149  LEU B O     1 
ATOM   3438  C  CB    . LEU B 1 149  ? 114.665 132.214 156.097 1.00 0.00   ? 149  LEU B CB    1 
ATOM   3439  C  CG    . LEU B 1 149  ? 115.921 131.352 155.961 1.00 0.00   ? 149  LEU B CG    1 
ATOM   3440  C  CD1   . LEU B 1 149  ? 117.164 132.235 155.920 1.00 0.00   ? 149  LEU B CD1   1 
ATOM   3441  C  CD2   . LEU B 1 149  ? 115.992 130.383 157.124 1.00 0.00   ? 149  LEU B CD2   1 
ATOM   3442  N  N     . ILE B 1 150  ? 113.226 131.824 153.387 1.00 0.00   ? 150  ILE B N     1 
ATOM   3443  C  CA    . ILE B 1 150  ? 113.049 131.091 152.142 1.00 0.00   ? 150  ILE B CA    1 
ATOM   3444  C  C     . ILE B 1 150  ? 113.145 132.043 150.955 1.00 0.00   ? 150  ILE B C     1 
ATOM   3445  O  O     . ILE B 1 150  ? 113.866 131.782 149.992 1.00 0.00   ? 150  ILE B O     1 
ATOM   3446  C  CB    . ILE B 1 150  ? 111.683 130.380 152.099 1.00 0.00   ? 150  ILE B CB    1 
ATOM   3447  C  CG1   . ILE B 1 150  ? 111.622 129.334 153.224 1.00 0.00   ? 150  ILE B CG1   1 
ATOM   3448  C  CG2   . ILE B 1 150  ? 111.466 129.742 150.734 1.00 0.00   ? 150  ILE B CG2   1 
ATOM   3449  C  CD1   . ILE B 1 150  ? 110.329 128.544 153.268 1.00 0.00   ? 150  ILE B CD1   1 
ATOM   3450  N  N     . VAL B 1 151  ? 112.412 133.149 151.031 1.00 0.00   ? 151  VAL B N     1 
ATOM   3451  C  CA    . VAL B 1 151  ? 112.403 134.142 149.966 1.00 0.00   ? 151  VAL B CA    1 
ATOM   3452  C  C     . VAL B 1 151  ? 113.781 134.747 149.707 1.00 0.00   ? 151  VAL B C     1 
ATOM   3453  O  O     . VAL B 1 151  ? 114.227 134.816 148.564 1.00 0.00   ? 151  VAL B O     1 
ATOM   3454  C  CB    . VAL B 1 151  ? 111.408 135.272 150.289 1.00 0.00   ? 151  VAL B CB    1 
ATOM   3455  C  CG1   . VAL B 1 151  ? 111.486 136.361 149.228 1.00 0.00   ? 151  VAL B CG1   1 
ATOM   3456  C  CG2   . VAL B 1 151  ? 110.002 134.705 150.357 1.00 0.00   ? 151  VAL B CG2   1 
ATOM   3457  N  N     . GLN B 1 152  ? 114.450 135.185 150.768 1.00 0.00   ? 152  GLN B N     1 
ATOM   3458  C  CA    . GLN B 1 152  ? 115.773 135.778 150.638 1.00 0.00   ? 152  GLN B CA    1 
ATOM   3459  C  C     . GLN B 1 152  ? 116.786 134.807 150.033 1.00 0.00   ? 152  GLN B C     1 
ATOM   3460  O  O     . GLN B 1 152  ? 117.593 135.198 149.191 1.00 0.00   ? 152  GLN B O     1 
ATOM   3461  C  CB    . GLN B 1 152  ? 116.274 136.274 151.999 1.00 0.00   ? 152  GLN B CB    1 
ATOM   3462  C  CG    . GLN B 1 152  ? 117.735 136.698 152.014 1.00 0.00   ? 152  GLN B CG    1 
ATOM   3463  C  CD    . GLN B 1 152  ? 118.087 137.539 153.225 1.00 0.00   ? 152  GLN B CD    1 
ATOM   3464  O  OE1   . GLN B 1 152  ? 117.750 137.189 154.356 1.00 0.00   ? 152  GLN B OE1   1 
ATOM   3465  N  NE2   . GLN B 1 152  ? 118.766 138.656 152.994 1.00 0.00   ? 152  GLN B NE2   1 
ATOM   3466  N  N     . ASN B 1 153  ? 116.750 133.549 150.459 1.00 0.00   ? 153  ASN B N     1 
ATOM   3467  C  CA    . ASN B 1 153  ? 117.676 132.563 149.919 1.00 0.00   ? 153  ASN B CA    1 
ATOM   3468  C  C     . ASN B 1 153  ? 117.469 132.403 148.421 1.00 0.00   ? 153  ASN B C     1 
ATOM   3469  O  O     . ASN B 1 153  ? 118.420 132.432 147.644 1.00 0.00   ? 153  ASN B O     1 
ATOM   3470  C  CB    . ASN B 1 153  ? 117.501 131.197 150.592 1.00 0.00   ? 153  ASN B CB    1 
ATOM   3471  C  CG    . ASN B 1 153  ? 118.117 131.149 151.976 1.00 0.00   ? 153  ASN B CG    1 
ATOM   3472  O  OD1   . ASN B 1 153  ? 119.082 131.857 152.271 1.00 0.00   ? 153  ASN B OD1   1 
ATOM   3473  N  ND2   . ASN B 1 153  ? 117.576 130.285 152.829 1.00 0.00   ? 153  ASN B ND2   1 
ATOM   3474  N  N     . ILE B 1 154  ? 116.215 132.240 148.024 1.00 0.00   ? 154  ILE B N     1 
ATOM   3475  C  CA    . ILE B 1 154  ? 115.874 132.064 146.620 1.00 0.00   ? 154  ILE B CA    1 
ATOM   3476  C  C     . ILE B 1 154  ? 116.220 133.279 145.763 1.00 0.00   ? 154  ILE B C     1 
ATOM   3477  O  O     . ILE B 1 154  ? 116.794 133.136 144.686 1.00 0.00   ? 154  ILE B O     1 
ATOM   3478  C  CB    . ILE B 1 154  ? 114.382 131.753 146.450 1.00 0.00   ? 154  ILE B CB    1 
ATOM   3479  C  CG1   . ILE B 1 154  ? 114.065 130.417 147.131 1.00 0.00   ? 154  ILE B CG1   1 
ATOM   3480  C  CG2   . ILE B 1 154  ? 114.024 131.713 144.973 1.00 0.00   ? 154  ILE B CG2   1 
ATOM   3481  C  CD1   . ILE B 1 154  ? 112.628 129.972 146.983 1.00 0.00   ? 154  ILE B CD1   1 
ATOM   3482  N  N     . VAL B 1 155  ? 115.860 134.469 146.234 1.00 0.00   ? 155  VAL B N     1 
ATOM   3483  C  CA    . VAL B 1 155  ? 116.147 135.695 145.496 1.00 0.00   ? 155  VAL B CA    1 
ATOM   3484  C  C     . VAL B 1 155  ? 117.650 135.846 145.303 1.00 0.00   ? 155  VAL B C     1 
ATOM   3485  O  O     . VAL B 1 155  ? 118.130 136.091 144.192 1.00 0.00   ? 155  VAL B O     1 
ATOM   3486  C  CB    . VAL B 1 155  ? 115.623 136.933 146.246 1.00 0.00   ? 155  VAL B CB    1 
ATOM   3487  C  CG1   . VAL B 1 155  ? 116.092 138.196 145.546 1.00 0.00   ? 155  VAL B CG1   1 
ATOM   3488  C  CG2   . VAL B 1 155  ? 114.109 136.899 146.314 1.00 0.00   ? 155  VAL B CG2   1 
ATOM   3489  N  N     . GLY B 1 156  ? 118.389 135.720 146.400 1.00 0.00   ? 156  GLY B N     1 
ATOM   3490  C  CA    . GLY B 1 156  ? 119.834 135.829 146.342 1.00 0.00   ? 156  GLY B CA    1 
ATOM   3491  C  C     . GLY B 1 156  ? 120.400 134.742 145.452 1.00 0.00   ? 156  GLY B C     1 
ATOM   3492  O  O     . GLY B 1 156  ? 121.374 134.950 144.731 1.00 0.00   ? 156  GLY B O     1 
ATOM   3493  N  N     . LEU B 1 157  ? 119.776 133.571 145.515 1.00 0.00   ? 157  LEU B N     1 
ATOM   3494  C  CA    . LEU B 1 157  ? 120.193 132.432 144.720 1.00 0.00   ? 157  LEU B CA    1 
ATOM   3495  C  C     . LEU B 1 157  ? 120.035 132.736 143.234 1.00 0.00   ? 157  LEU B C     1 
ATOM   3496  O  O     . LEU B 1 157  ? 120.949 132.510 142.444 1.00 0.00   ? 157  LEU B O     1 
ATOM   3497  C  CB    . LEU B 1 157  ? 119.371 131.200 145.088 1.00 0.00   ? 157  LEU B CB    1 
ATOM   3498  C  CG    . LEU B 1 157  ? 119.790 129.855 144.490 1.00 0.00   ? 157  LEU B CG    1 
ATOM   3499  C  CD1   . LEU B 1 157  ? 119.501 128.719 145.461 1.00 0.00   ? 157  LEU B CD1   1 
ATOM   3500  C  CD2   . LEU B 1 157  ? 119.039 129.657 143.193 1.00 0.00   ? 157  LEU B CD2   1 
ATOM   3501  N  N     . MET B 1 158  ? 118.870 133.251 142.855 1.00 0.00   ? 158  MET B N     1 
ATOM   3502  C  CA    . MET B 1 158  ? 118.609 133.593 141.461 1.00 0.00   ? 158  MET B CA    1 
ATOM   3503  C  C     . MET B 1 158  ? 119.557 134.676 140.972 1.00 0.00   ? 158  MET B C     1 
ATOM   3504  O  O     . MET B 1 158  ? 119.995 134.657 139.822 1.00 0.00   ? 158  MET B O     1 
ATOM   3505  C  CB    . MET B 1 158  ? 117.161 134.057 141.275 1.00 0.00   ? 158  MET B CB    1 
ATOM   3506  C  CG    . MET B 1 158  ? 116.142 132.935 141.247 1.00 0.00   ? 158  MET B CG    1 
ATOM   3507  S  SD    . MET B 1 158  ? 116.467 131.760 139.921 1.00 0.00   ? 158  MET B SD    1 
ATOM   3508  C  CE    . MET B 1 158  ? 115.781 130.268 140.615 1.00 0.00   ? 158  MET B CE    1 
ATOM   3509  N  N     . ILE B 1 159  ? 119.869 135.627 141.846 1.00 0.00   ? 159  ILE B N     1 
ATOM   3510  C  CA    . ILE B 1 159  ? 120.775 136.706 141.489 1.00 0.00   ? 159  ILE B CA    1 
ATOM   3511  C  C     . ILE B 1 159  ? 122.140 136.137 141.117 1.00 0.00   ? 159  ILE B C     1 
ATOM   3512  O  O     . ILE B 1 159  ? 122.717 136.521 140.098 1.00 0.00   ? 159  ILE B O     1 
ATOM   3513  C  CB    . ILE B 1 159  ? 120.948 137.698 142.653 1.00 0.00   ? 159  ILE B CB    1 
ATOM   3514  C  CG1   . ILE B 1 159  ? 119.605 138.384 142.937 1.00 0.00   ? 159  ILE B CG1   1 
ATOM   3515  C  CG2   . ILE B 1 159  ? 122.018 138.720 142.312 1.00 0.00   ? 159  ILE B CG2   1 
ATOM   3516  C  CD1   . ILE B 1 159  ? 119.666 139.440 144.014 1.00 0.00   ? 159  ILE B CD1   1 
ATOM   3517  N  N     . ASN B 1 160  ? 122.651 135.225 141.937 1.00 0.00   ? 160  ASN B N     1 
ATOM   3518  C  CA    . ASN B 1 160  ? 123.948 134.612 141.664 1.00 0.00   ? 160  ASN B CA    1 
ATOM   3519  C  C     . ASN B 1 160  ? 123.928 133.860 140.345 1.00 0.00   ? 160  ASN B C     1 
ATOM   3520  O  O     . ASN B 1 160  ? 124.913 133.861 139.601 1.00 0.00   ? 160  ASN B O     1 
ATOM   3521  C  CB    . ASN B 1 160  ? 124.339 133.641 142.779 1.00 0.00   ? 160  ASN B CB    1 
ATOM   3522  C  CG    . ASN B 1 160  ? 124.685 134.344 144.069 1.00 0.00   ? 160  ASN B CG    1 
ATOM   3523  O  OD1   . ASN B 1 160  ? 125.150 135.482 144.058 1.00 0.00   ? 160  ASN B OD1   1 
ATOM   3524  N  ND2   . ASN B 1 160  ? 124.474 133.663 145.192 1.00 0.00   ? 160  ASN B ND2   1 
ATOM   3525  N  N     . ALA B 1 161  ? 122.801 133.214 140.063 1.00 0.00   ? 161  ALA B N     1 
ATOM   3526  C  CA    . ALA B 1 161  ? 122.637 132.454 138.834 1.00 0.00   ? 161  ALA B CA    1 
ATOM   3527  C  C     . ALA B 1 161  ? 122.736 133.385 137.631 1.00 0.00   ? 161  ALA B C     1 
ATOM   3528  O  O     . ALA B 1 161  ? 123.481 133.125 136.686 1.00 0.00   ? 161  ALA B O     1 
ATOM   3529  C  CB    . ALA B 1 161  ? 121.295 131.737 138.844 1.00 0.00   ? 161  ALA B CB    1 
ATOM   3530  N  N     . ILE B 1 162  ? 121.980 134.480 137.674 1.00 0.00   ? 162  ILE B N     1 
ATOM   3531  C  CA    . ILE B 1 162  ? 121.980 135.459 136.594 1.00 0.00   ? 162  ILE B CA    1 
ATOM   3532  C  C     . ILE B 1 162  ? 123.343 136.127 136.465 1.00 0.00   ? 162  ILE B C     1 
ATOM   3533  O  O     . ILE B 1 162  ? 123.848 136.325 135.358 1.00 0.00   ? 162  ILE B O     1 
ATOM   3534  C  CB    . ILE B 1 162  ? 120.927 136.546 136.842 1.00 0.00   ? 162  ILE B CB    1 
ATOM   3535  C  CG1   . ILE B 1 162  ? 119.533 135.910 136.836 1.00 0.00   ? 162  ILE B CG1   1 
ATOM   3536  C  CG2   . ILE B 1 162  ? 121.051 137.644 135.798 1.00 0.00   ? 162  ILE B CG2   1 
ATOM   3537  C  CD1   . ILE B 1 162  ? 118.411 136.897 137.041 1.00 0.00   ? 162  ILE B CD1   1 
ATOM   3538  N  N     . MET B 1 163  ? 123.928 136.484 137.607 1.00 0.00   ? 163  MET B N     1 
ATOM   3539  C  CA    . MET B 1 163  ? 125.228 137.139 137.642 1.00 0.00   ? 163  MET B CA    1 
ATOM   3540  C  C     . MET B 1 163  ? 126.294 136.263 136.995 1.00 0.00   ? 163  MET B C     1 
ATOM   3541  O  O     . MET B 1 163  ? 127.137 136.754 136.246 1.00 0.00   ? 163  MET B O     1 
ATOM   3542  C  CB    . MET B 1 163  ? 125.608 137.453 139.094 1.00 0.00   ? 163  MET B CB    1 
ATOM   3543  C  CG    . MET B 1 163  ? 126.996 138.056 139.294 1.00 0.00   ? 163  MET B CG    1 
ATOM   3544  S  SD    . MET B 1 163  ? 128.335 136.852 139.162 1.00 0.00   ? 163  MET B SD    1 
ATOM   3545  C  CE    . MET B 1 163  ? 128.234 136.053 140.763 1.00 0.00   ? 163  MET B CE    1 
ATOM   3546  N  N     . LEU B 1 164  ? 126.257 134.967 137.290 1.00 0.00   ? 164  LEU B N     1 
ATOM   3547  C  CA    . LEU B 1 164  ? 127.224 134.047 136.709 1.00 0.00   ? 164  LEU B CA    1 
ATOM   3548  C  C     . LEU B 1 164  ? 127.035 133.997 135.201 1.00 0.00   ? 164  LEU B C     1 
ATOM   3549  O  O     . LEU B 1 164  ? 127.996 134.117 134.441 1.00 0.00   ? 164  LEU B O     1 
ATOM   3550  C  CB    . LEU B 1 164  ? 127.059 132.650 137.307 1.00 0.00   ? 164  LEU B CB    1 
ATOM   3551  C  CG    . LEU B 1 164  ? 127.573 132.461 138.731 1.00 0.00   ? 164  LEU B CG    1 
ATOM   3552  C  CD1   . LEU B 1 164  ? 127.291 131.038 139.172 1.00 0.00   ? 164  LEU B CD1   1 
ATOM   3553  C  CD2   . LEU B 1 164  ? 129.070 132.749 138.793 1.00 0.00   ? 164  LEU B CD2   1 
ATOM   3554  N  N     . GLY B 1 165  ? 125.787 133.820 134.779 1.00 0.00   ? 165  GLY B N     1 
ATOM   3555  C  CA    . GLY B 1 165  ? 125.486 133.760 133.362 1.00 0.00   ? 165  GLY B CA    1 
ATOM   3556  C  C     . GLY B 1 165  ? 126.054 134.955 132.621 1.00 0.00   ? 165  GLY B C     1 
ATOM   3557  O  O     . GLY B 1 165  ? 126.648 134.809 131.554 1.00 0.00   ? 165  GLY B O     1 
ATOM   3558  N  N     . CYS B 1 166  ? 125.875 136.143 133.189 1.00 0.00   ? 166  CYS B N     1 
ATOM   3559  C  CA    . CYS B 1 166  ? 126.372 137.374 132.587 1.00 0.00   ? 166  CYS B CA    1 
ATOM   3560  C  C     . CYS B 1 166  ? 127.891 137.403 132.497 1.00 0.00   ? 166  CYS B C     1 
ATOM   3561  O  O     . CYS B 1 166  ? 128.459 137.785 131.475 1.00 0.00   ? 166  CYS B O     1 
ATOM   3562  C  CB    . CYS B 1 166  ? 125.891 138.582 133.392 1.00 0.00   ? 166  CYS B CB    1 
ATOM   3563  S  SG    . CYS B 1 166  ? 124.106 138.801 133.382 1.00 0.00   ? 166  CYS B SG    1 
ATOM   3564  N  N     . ILE B 1 167  ? 128.547 137.001 133.582 1.00 0.00   ? 167  ILE B N     1 
ATOM   3565  C  CA    . ILE B 1 167  ? 130.003 136.976 133.635 1.00 0.00   ? 167  ILE B CA    1 
ATOM   3566  C  C     . ILE B 1 167  ? 130.595 136.017 132.611 1.00 0.00   ? 167  ILE B C     1 
ATOM   3567  O  O     . ILE B 1 167  ? 131.617 136.311 131.989 1.00 0.00   ? 167  ILE B O     1 
ATOM   3568  C  CB    . ILE B 1 167  ? 130.484 136.567 135.035 1.00 0.00   ? 167  ILE B CB    1 
ATOM   3569  C  CG1   . ILE B 1 167  ? 130.122 137.665 136.038 1.00 0.00   ? 167  ILE B CG1   1 
ATOM   3570  C  CG2   . ILE B 1 167  ? 131.982 136.312 135.018 1.00 0.00   ? 167  ILE B CG2   1 
ATOM   3571  C  CD1   . ILE B 1 167  ? 130.777 138.996 135.746 1.00 0.00   ? 167  ILE B CD1   1 
ATOM   3572  N  N     . PHE B 1 168  ? 129.953 134.862 132.450 1.00 0.00   ? 168  PHE B N     1 
ATOM   3573  C  CA    . PHE B 1 168  ? 130.420 133.862 131.494 1.00 0.00   ? 168  PHE B CA    1 
ATOM   3574  C  C     . PHE B 1 168  ? 130.428 134.415 130.073 1.00 0.00   ? 168  PHE B C     1 
ATOM   3575  O  O     . PHE B 1 168  ? 131.407 134.263 129.348 1.00 0.00   ? 168  PHE B O     1 
ATOM   3576  C  CB    . PHE B 1 168  ? 129.534 132.621 131.554 1.00 0.00   ? 168  PHE B CB    1 
ATOM   3577  C  CG    . PHE B 1 168  ? 129.844 131.700 132.704 1.00 0.00   ? 168  PHE B CG    1 
ATOM   3578  C  CD1   . PHE B 1 168  ? 129.947 132.183 134.008 1.00 0.00   ? 168  PHE B CD1   1 
ATOM   3579  C  CD2   . PHE B 1 168  ? 129.983 130.333 132.489 1.00 0.00   ? 168  PHE B CD2   1 
ATOM   3580  C  CE1   . PHE B 1 168  ? 130.180 131.316 135.076 1.00 0.00   ? 168  PHE B CE1   1 
ATOM   3581  C  CE2   . PHE B 1 168  ? 130.214 129.463 133.550 1.00 0.00   ? 168  PHE B CE2   1 
ATOM   3582  C  CZ    . PHE B 1 168  ? 130.312 129.951 134.845 1.00 0.00   ? 168  PHE B CZ    1 
ATOM   3583  N  N     . MET B 1 169  ? 129.333 135.052 129.674 1.00 0.00   ? 169  MET B N     1 
ATOM   3584  C  CA    . MET B 1 169  ? 129.236 135.619 128.332 1.00 0.00   ? 169  MET B CA    1 
ATOM   3585  C  C     . MET B 1 169  ? 130.255 136.734 128.128 1.00 0.00   ? 169  MET B C     1 
ATOM   3586  O  O     . MET B 1 169  ? 130.712 136.969 127.009 1.00 0.00   ? 169  MET B O     1 
ATOM   3587  C  CB    . MET B 1 169  ? 127.826 136.160 128.074 1.00 0.00   ? 169  MET B CB    1 
ATOM   3588  C  CG    . MET B 1 169  ? 126.725 135.111 128.154 1.00 0.00   ? 169  MET B CG    1 
ATOM   3589  S  SD    . MET B 1 169  ? 125.109 135.756 127.653 1.00 0.00   ? 169  MET B SD    1 
ATOM   3590  C  CE    . MET B 1 169  ? 124.399 136.211 129.242 1.00 0.00   ? 169  MET B CE    1 
ATOM   3591  N  N     . LYS B 1 170  ? 130.604 137.429 129.207 1.00 0.00   ? 170  LYS B N     1 
ATOM   3592  C  CA    . LYS B 1 170  ? 131.580 138.510 129.108 1.00 0.00   ? 170  LYS B CA    1 
ATOM   3593  C  C     . LYS B 1 170  ? 132.967 137.928 128.876 1.00 0.00   ? 170  LYS B C     1 
ATOM   3594  O  O     . LYS B 1 170  ? 133.770 138.491 128.131 1.00 0.00   ? 170  LYS B O     1 
ATOM   3595  C  CB    . LYS B 1 170  ? 131.594 139.370 130.377 1.00 0.00   ? 170  LYS B CB    1 
ATOM   3596  C  CG    . LYS B 1 170  ? 130.380 140.274 130.540 1.00 0.00   ? 170  LYS B CG    1 
ATOM   3597  C  CD    . LYS B 1 170  ? 130.651 141.376 131.561 1.00 0.00   ? 170  LYS B CD    1 
ATOM   3598  C  CE    . LYS B 1 170  ? 131.667 142.377 131.029 1.00 0.00   ? 170  LYS B CE    1 
ATOM   3599  N  NZ    . LYS B 1 170  ? 131.196 143.026 129.776 1.00 0.00   ? 170  LYS B NZ    1 
ATOM   3600  N  N     . THR B 1 171  ? 133.243 136.797 129.518 1.00 0.00   ? 171  THR B N     1 
ATOM   3601  C  CA    . THR B 1 171  ? 134.534 136.134 129.372 1.00 0.00   ? 171  THR B CA    1 
ATOM   3602  C  C     . THR B 1 171  ? 134.625 135.497 127.991 1.00 0.00   ? 171  THR B C     1 
ATOM   3603  O  O     . THR B 1 171  ? 135.671 134.970 127.608 1.00 0.00   ? 171  THR B O     1 
ATOM   3604  C  CB    . THR B 1 171  ? 134.713 135.032 130.430 1.00 0.00   ? 171  THR B CB    1 
ATOM   3605  O  OG1   . THR B 1 171  ? 133.654 134.075 130.307 1.00 0.00   ? 171  THR B OG1   1 
ATOM   3606  C  CG2   . THR B 1 171  ? 134.688 135.626 131.827 1.00 0.00   ? 171  THR B CG2   1 
ATOM   3607  N  N     . ALA B 1 172  ? 133.526 135.548 127.251 1.00 0.00   ? 172  ALA B N     1 
ATOM   3608  C  CA    . ALA B 1 172  ? 133.477 134.971 125.918 1.00 0.00   ? 172  ALA B CA    1 
ATOM   3609  C  C     . ALA B 1 172  ? 133.508 136.060 124.854 1.00 0.00   ? 172  ALA B C     1 
ATOM   3610  O  O     . ALA B 1 172  ? 133.352 135.780 123.664 1.00 0.00   ? 172  ALA B O     1 
ATOM   3611  C  CB    . ALA B 1 172  ? 132.220 134.125 125.769 1.00 0.00   ? 172  ALA B CB    1 
ATOM   3612  N  N     . GLN B 1 173  ? 133.712 137.304 125.287 1.00 0.00   ? 173  GLN B N     1 
ATOM   3613  C  CA    . GLN B 1 173  ? 133.774 138.431 124.368 1.00 0.00   ? 173  GLN B CA    1 
ATOM   3614  C  C     . GLN B 1 173  ? 135.026 138.306 123.509 1.00 0.00   ? 173  GLN B C     1 
ATOM   3615  O  O     . GLN B 1 173  ? 136.073 138.885 123.812 1.00 0.00   ? 173  GLN B O     1 
ATOM   3616  C  CB    . GLN B 1 173  ? 133.775 139.754 125.147 1.00 0.00   ? 173  GLN B CB    1 
ATOM   3617  C  CG    . GLN B 1 173  ? 132.427 140.081 125.774 1.00 0.00   ? 173  GLN B CG    1 
ATOM   3618  C  CD    . GLN B 1 173  ? 131.318 140.097 124.744 1.00 0.00   ? 173  GLN B CD    1 
ATOM   3619  O  OE1   . GLN B 1 173  ? 131.274 140.964 123.873 1.00 0.00   ? 173  GLN B OE1   1 
ATOM   3620  N  NE2   . GLN B 1 173  ? 130.421 139.120 124.828 1.00 0.00   ? 173  GLN B NE2   1 
ATOM   3621  N  N     . ALA B 1 174  ? 134.904 137.541 122.433 1.00 0.00   ? 174  ALA B N     1 
ATOM   3622  C  CA    . ALA B 1 174  ? 136.018 137.298 121.533 1.00 0.00   ? 174  ALA B CA    1 
ATOM   3623  C  C     . ALA B 1 174  ? 136.405 138.481 120.653 1.00 0.00   ? 174  ALA B C     1 
ATOM   3624  O  O     . ALA B 1 174  ? 137.309 138.354 119.820 1.00 0.00   ? 174  ALA B O     1 
ATOM   3625  C  CB    . ALA B 1 174  ? 135.712 136.083 120.667 1.00 0.00   ? 174  ALA B CB    1 
ATOM   3626  N  N     . HIS B 1 175  ? 135.751 139.631 120.823 1.00 0.00   ? 175  HIS B N     1 
ATOM   3627  C  CA    . HIS B 1 175  ? 136.103 140.774 119.990 1.00 0.00   ? 175  HIS B CA    1 
ATOM   3628  C  C     . HIS B 1 175  ? 137.548 141.167 120.277 1.00 0.00   ? 175  HIS B C     1 
ATOM   3629  O  O     . HIS B 1 175  ? 138.195 141.825 119.464 1.00 0.00   ? 175  HIS B O     1 
ATOM   3630  C  CB    . HIS B 1 175  ? 135.185 141.974 120.251 1.00 0.00   ? 175  HIS B CB    1 
ATOM   3631  C  CG    . HIS B 1 175  ? 135.396 142.631 121.581 1.00 0.00   ? 175  HIS B CG    1 
ATOM   3632  N  ND1   . HIS B 1 175  ? 134.886 142.122 122.756 1.00 0.00   ? 175  HIS B ND1   1 
ATOM   3633  C  CD2   . HIS B 1 175  ? 136.072 143.754 121.928 1.00 0.00   ? 175  HIS B CD2   1 
ATOM   3634  C  CE1   . HIS B 1 175  ? 135.238 142.897 123.765 1.00 0.00   ? 175  HIS B CE1   1 
ATOM   3635  N  NE2   . HIS B 1 175  ? 135.961 143.895 123.291 1.00 0.00   ? 175  HIS B NE2   1 
ATOM   3636  N  N     . ARG B 1 176  ? 138.050 140.746 121.430 1.00 0.00   ? 176  ARG B N     1 
ATOM   3637  C  CA    . ARG B 1 176  ? 139.425 141.034 121.809 1.00 0.00   ? 176  ARG B CA    1 
ATOM   3638  C  C     . ARG B 1 176  ? 140.380 140.362 120.826 1.00 0.00   ? 176  ARG B C     1 
ATOM   3639  O  O     . ARG B 1 176  ? 141.513 140.817 120.638 1.00 0.00   ? 176  ARG B O     1 
ATOM   3640  C  CB    . ARG B 1 176  ? 139.696 140.542 123.227 1.00 0.00   ? 176  ARG B CB    1 
ATOM   3641  C  CG    . ARG B 1 176  ? 139.040 141.412 124.290 1.00 0.00   ? 176  ARG B CG    1 
ATOM   3642  C  CD    . ARG B 1 176  ? 139.616 142.820 124.246 1.00 0.00   ? 176  ARG B CD    1 
ATOM   3643  N  NE    . ARG B 1 176  ? 139.003 143.713 125.223 1.00 0.00   ? 176  ARG B NE    1 
ATOM   3644  C  CZ    . ARG B 1 176  ? 139.268 145.012 125.312 1.00 0.00   ? 176  ARG B CZ    1 
ATOM   3645  N  NH1   . ARG B 1 176  ? 140.140 145.571 124.478 1.00 0.00   ? 176  ARG B NH1   1 
ATOM   3646  N  NH2   . ARG B 1 176  ? 138.663 145.756 126.227 1.00 0.00   ? 176  ARG B NH2   1 
ATOM   3647  N  N     . ARG B 1 177  ? 139.918 139.279 120.206 1.00 0.00   ? 177  ARG B N     1 
ATOM   3648  C  CA    . ARG B 1 177  ? 140.718 138.558 119.224 1.00 0.00   ? 177  ARG B CA    1 
ATOM   3649  C  C     . ARG B 1 177  ? 140.639 139.302 117.900 1.00 0.00   ? 177  ARG B C     1 
ATOM   3650  O  O     . ARG B 1 177  ? 141.544 139.218 117.076 1.00 0.00   ? 177  ARG B O     1 
ATOM   3651  C  CB    . ARG B 1 177  ? 140.208 137.124 119.043 1.00 0.00   ? 177  ARG B CB    1 
ATOM   3652  C  CG    . ARG B 1 177  ? 140.801 136.116 120.024 1.00 0.00   ? 177  ARG B CG    1 
ATOM   3653  C  CD    . ARG B 1 177  ? 142.336 136.164 120.024 1.00 0.00   ? 177  ARG B CD    1 
ATOM   3654  N  NE    . ARG B 1 177  ? 142.911 135.946 118.697 1.00 0.00   ? 177  ARG B NE    1 
ATOM   3655  C  CZ    . ARG B 1 177  ? 142.996 134.759 118.098 1.00 0.00   ? 177  ARG B CZ    1 
ATOM   3656  N  NH1   . ARG B 1 177  ? 142.544 133.669 118.704 1.00 0.00   ? 177  ARG B NH1   1 
ATOM   3657  N  NH2   . ARG B 1 177  ? 143.519 134.667 116.882 1.00 0.00   ? 177  ARG B NH2   1 
ATOM   3658  N  N     . ALA B 1 178  ? 139.545 140.031 117.705 1.00 0.00   ? 178  ALA B N     1 
ATOM   3659  C  CA    . ALA B 1 178  ? 139.356 140.801 116.492 1.00 0.00   ? 178  ALA B CA    1 
ATOM   3660  C  C     . ALA B 1 178  ? 140.450 141.871 116.419 1.00 0.00   ? 178  ALA B C     1 
ATOM   3661  O  O     . ALA B 1 178  ? 140.882 142.259 115.334 1.00 0.00   ? 178  ALA B O     1 
ATOM   3662  C  CB    . ALA B 1 178  ? 137.981 141.448 116.489 1.00 0.00   ? 178  ALA B CB    1 
ATOM   3663  N  N     . GLU B 1 179  ? 140.893 142.337 117.585 1.00 0.00   ? 179  GLU B N     1 
ATOM   3664  C  CA    . GLU B 1 179  ? 141.932 143.354 117.659 1.00 0.00   ? 179  GLU B CA    1 
ATOM   3665  C  C     . GLU B 1 179  ? 143.300 142.777 117.303 1.00 0.00   ? 179  GLU B C     1 
ATOM   3666  O  O     . GLU B 1 179  ? 144.243 143.520 117.030 1.00 0.00   ? 179  GLU B O     1 
ATOM   3667  C  CB    . GLU B 1 179  ? 141.989 143.951 119.068 1.00 0.00   ? 179  GLU B CB    1 
ATOM   3668  C  CG    . GLU B 1 179  ? 140.668 144.497 119.577 1.00 0.00   ? 179  GLU B CG    1 
ATOM   3669  C  CD    . GLU B 1 179  ? 140.811 145.191 120.920 1.00 0.00   ? 179  GLU B CD    1 
ATOM   3670  O  OE1   . GLU B 1 179  ? 141.277 144.544 121.884 1.00 0.00   ? 179  GLU B OE1   1 
ATOM   3671  O  OE2   . GLU B 1 179  ? 140.454 146.387 121.018 1.00 0.00   ? 179  GLU B OE2   1 
ATOM   3672  N  N     . THR B 1 180  ? 143.410 141.453 117.309 1.00 0.00   ? 180  THR B N     1 
ATOM   3673  C  CA    . THR B 1 180  ? 144.678 140.803 116.991 1.00 0.00   ? 180  THR B CA    1 
ATOM   3674  C  C     . THR B 1 180  ? 144.836 140.594 115.489 1.00 0.00   ? 180  THR B C     1 
ATOM   3675  O  O     . THR B 1 180  ? 145.890 140.156 115.024 1.00 0.00   ? 180  THR B O     1 
ATOM   3676  C  CB    . THR B 1 180  ? 144.809 139.441 117.694 1.00 0.00   ? 180  THR B CB    1 
ATOM   3677  O  OG1   . THR B 1 180  ? 143.848 138.522 117.155 1.00 0.00   ? 180  THR B OG1   1 
ATOM   3678  C  CG2   . THR B 1 180  ? 144.572 139.586 119.188 1.00 0.00   ? 180  THR B CG2   1 
ATOM   3679  N  N     . LEU B 1 181  ? 143.789 140.904 114.731 1.00 0.00   ? 181  LEU B N     1 
ATOM   3680  C  CA    . LEU B 1 181  ? 143.824 140.743 113.281 1.00 0.00   ? 181  LEU B CA    1 
ATOM   3681  C  C     . LEU B 1 181  ? 144.374 141.996 112.614 1.00 0.00   ? 181  LEU B C     1 
ATOM   3682  O  O     . LEU B 1 181  ? 144.002 143.116 112.963 1.00 0.00   ? 181  LEU B O     1 
ATOM   3683  C  CB    . LEU B 1 181  ? 142.424 140.434 112.754 1.00 0.00   ? 181  LEU B CB    1 
ATOM   3684  C  CG    . LEU B 1 181  ? 141.861 139.121 113.313 1.00 0.00   ? 181  LEU B CG    1 
ATOM   3685  C  CD1   . LEU B 1 181  ? 140.454 138.902 112.799 1.00 0.00   ? 181  LEU B CD1   1 
ATOM   3686  C  CD2   . LEU B 1 181  ? 142.764 137.967 112.915 1.00 0.00   ? 181  LEU B CD2   1 
ATOM   3687  N  N     . ILE B 1 182  ? 145.261 141.797 111.648 1.00 0.00   ? 182  ILE B N     1 
ATOM   3688  C  CA    . ILE B 1 182  ? 145.901 142.911 110.965 1.00 0.00   ? 182  ILE B CA    1 
ATOM   3689  C  C     . ILE B 1 182  ? 145.513 143.108 109.506 1.00 0.00   ? 182  ILE B C     1 
ATOM   3690  O  O     . ILE B 1 182  ? 145.366 142.149 108.747 1.00 0.00   ? 182  ILE B O     1 
ATOM   3691  C  CB    . ILE B 1 182  ? 147.430 142.770 111.021 1.00 0.00   ? 182  ILE B CB    1 
ATOM   3692  C  CG1   . ILE B 1 182  ? 147.876 142.678 112.485 1.00 0.00   ? 182  ILE B CG1   1 
ATOM   3693  C  CG2   . ILE B 1 182  ? 148.090 143.951 110.321 1.00 0.00   ? 182  ILE B CG2   1 
ATOM   3694  C  CD1   . ILE B 1 182  ? 147.487 143.874 113.326 1.00 0.00   ? 182  ILE B CD1   1 
ATOM   3695  N  N     . PHE B 1 183  ? 145.356 144.377 109.139 1.00 0.00   ? 183  PHE B N     1 
ATOM   3696  C  CA    . PHE B 1 183  ? 145.030 144.778 107.778 1.00 0.00   ? 183  PHE B CA    1 
ATOM   3697  C  C     . PHE B 1 183  ? 146.019 145.880 107.431 1.00 0.00   ? 183  PHE B C     1 
ATOM   3698  O  O     . PHE B 1 183  ? 146.119 146.879 108.144 1.00 0.00   ? 183  PHE B O     1 
ATOM   3699  C  CB    . PHE B 1 183  ? 143.606 145.330 107.690 1.00 0.00   ? 183  PHE B CB    1 
ATOM   3700  C  CG    . PHE B 1 183  ? 142.542 144.282 107.815 1.00 0.00   ? 183  PHE B CG    1 
ATOM   3701  C  CD1   . PHE B 1 183  ? 142.037 143.924 109.063 1.00 0.00   ? 183  PHE B CD1   1 
ATOM   3702  C  CD2   . PHE B 1 183  ? 142.031 143.655 106.684 1.00 0.00   ? 183  PHE B CD2   1 
ATOM   3703  C  CE1   . PHE B 1 183  ? 141.038 142.958 109.177 1.00 0.00   ? 183  PHE B CE1   1 
ATOM   3704  C  CE2   . PHE B 1 183  ? 141.037 142.689 106.790 1.00 0.00   ? 183  PHE B CE2   1 
ATOM   3705  C  CZ    . PHE B 1 183  ? 140.536 142.338 108.036 1.00 0.00   ? 183  PHE B CZ    1 
ATOM   3706  N  N     . SER B 1 184  ? 146.663 145.754 106.282 1.00 0.00   ? 184  SER B N     1 
ATOM   3707  C  CA    . SER B 1 184  ? 147.618 146.759 105.868 1.00 0.00   ? 184  SER B CA    1 
ATOM   3708  C  C     . SER B 1 184  ? 146.873 148.069 105.758 1.00 0.00   ? 184  SER B C     1 
ATOM   3709  O  O     . SER B 1 184  ? 145.707 148.109 105.376 1.00 0.00   ? 184  SER B O     1 
ATOM   3710  C  CB    . SER B 1 184  ? 148.206 146.406 104.510 1.00 0.00   ? 184  SER B CB    1 
ATOM   3711  O  OG    . SER B 1 184  ? 147.275 146.676 103.482 1.00 0.00   ? 184  SER B OG    1 
ATOM   3712  N  N     . LYS B 1 185  ? 147.554 149.159 106.082 1.00 0.00   ? 185  LYS B N     1 
ATOM   3713  C  CA    . LYS B 1 185  ? 146.919 150.461 106.055 1.00 0.00   ? 185  LYS B CA    1 
ATOM   3714  C  C     . LYS B 1 185  ? 146.406 150.817 104.666 1.00 0.00   ? 185  LYS B C     1 
ATOM   3715  O  O     . LYS B 1 185  ? 145.317 151.361 104.537 1.00 0.00   ? 185  LYS B O     1 
ATOM   3716  C  CB    . LYS B 1 185  ? 147.889 151.532 106.547 1.00 0.00   ? 185  LYS B CB    1 
ATOM   3717  C  CG    . LYS B 1 185  ? 147.258 152.905 106.687 1.00 0.00   ? 185  LYS B CG    1 
ATOM   3718  C  CD    . LYS B 1 185  ? 148.299 154.008 106.698 1.00 0.00   ? 185  LYS B CD    1 
ATOM   3719  C  CE    . LYS B 1 185  ? 149.347 153.747 107.763 1.00 0.00   ? 185  LYS B CE    1 
ATOM   3720  N  NZ    . LYS B 1 185  ? 150.302 154.878 107.899 1.00 0.00   ? 185  LYS B NZ    1 
ATOM   3721  N  N     . HIS B 1 186  ? 147.170 150.499 103.627 1.00 0.00   ? 186  HIS B N     1 
ATOM   3722  C  CA    . HIS B 1 186  ? 146.728 150.802 102.270 1.00 0.00   ? 186  HIS B CA    1 
ATOM   3723  C  C     . HIS B 1 186  ? 146.776 149.597 101.334 1.00 0.00   ? 186  HIS B C     1 
ATOM   3724  O  O     . HIS B 1 186  ? 147.643 148.736 101.455 1.00 0.00   ? 186  HIS B O     1 
ATOM   3725  C  CB    . HIS B 1 186  ? 147.517 151.967 101.689 1.00 0.00   ? 186  HIS B CB    1 
ATOM   3726  C  CG    . HIS B 1 186  ? 148.985 151.707 101.587 1.00 0.00   ? 186  HIS B CG    1 
ATOM   3727  N  ND1   . HIS B 1 186  ? 149.533 150.936 100.588 1.00 0.00   ? 186  HIS B ND1   1 
ATOM   3728  C  CD2   . HIS B 1 186  ? 150.017 152.107 102.368 1.00 0.00   ? 186  HIS B CD2   1 
ATOM   3729  C  CE1   . HIS B 1 186  ? 150.842 150.875 100.754 1.00 0.00   ? 186  HIS B CE1   1 
ATOM   3730  N  NE2   . HIS B 1 186  ? 151.162 151.575 101.824 1.00 0.00   ? 186  HIS B NE2   1 
ATOM   3731  N  N     . ALA B 1 187  ? 145.833 149.558 100.402 1.00 0.00   ? 187  ALA B N     1 
ATOM   3732  C  CA    . ALA B 1 187  ? 145.721 148.479 99.428  1.00 0.00   ? 187  ALA B CA    1 
ATOM   3733  C  C     . ALA B 1 187  ? 146.166 149.001 98.079  1.00 0.00   ? 187  ALA B C     1 
ATOM   3734  O  O     . ALA B 1 187  ? 145.893 150.148 97.727  1.00 0.00   ? 187  ALA B O     1 
ATOM   3735  C  CB    . ALA B 1 187  ? 144.296 147.964 99.360  1.00 0.00   ? 187  ALA B CB    1 
ATOM   3736  N  N     . VAL B 1 188  ? 146.849 148.158 97.319  1.00 0.00   ? 188  VAL B N     1 
ATOM   3737  C  CA    . VAL B 1 188  ? 147.399 148.572 96.038  1.00 0.00   ? 188  VAL B CA    1 
ATOM   3738  C  C     . VAL B 1 188  ? 146.665 148.013 94.832  1.00 0.00   ? 188  VAL B C     1 
ATOM   3739  O  O     . VAL B 1 188  ? 145.894 147.056 94.933  1.00 0.00   ? 188  VAL B O     1 
ATOM   3740  C  CB    . VAL B 1 188  ? 148.898 148.195 95.914  1.00 0.00   ? 188  VAL B CB    1 
ATOM   3741  C  CG1   . VAL B 1 188  ? 149.669 148.796 97.073  1.00 0.00   ? 188  VAL B CG1   1 
ATOM   3742  C  CG2   . VAL B 1 188  ? 149.063 146.682 95.872  1.00 0.00   ? 188  VAL B CG2   1 
ATOM   3743  N  N     . ILE B 1 189  ? 146.915 148.643 93.691  1.00 0.00   ? 189  ILE B N     1 
ATOM   3744  C  CA    . ILE B 1 189  ? 146.328 148.244 92.422  1.00 0.00   ? 189  ILE B CA    1 
ATOM   3745  C  C     . ILE B 1 189  ? 147.480 147.936 91.485  1.00 0.00   ? 189  ILE B C     1 
ATOM   3746  O  O     . ILE B 1 189  ? 148.227 148.833 91.084  1.00 0.00   ? 189  ILE B O     1 
ATOM   3747  C  CB    . ILE B 1 189  ? 145.477 149.375 91.801  1.00 0.00   ? 189  ILE B CB    1 
ATOM   3748  C  CG1   . ILE B 1 189  ? 144.229 149.627 92.655  1.00 0.00   ? 189  ILE B CG1   1 
ATOM   3749  C  CG2   . ILE B 1 189  ? 145.086 149.004 90.376  1.00 0.00   ? 189  ILE B CG2   1 
ATOM   3750  C  CD1   . ILE B 1 189  ? 143.274 150.651 92.063  1.00 0.00   ? 189  ILE B CD1   1 
ATOM   3751  N  N     . THR B 1 190  ? 147.634 146.661 91.140  1.00 0.00   ? 190  THR B N     1 
ATOM   3752  C  CA    . THR B 1 190  ? 148.711 146.234 90.253  1.00 0.00   ? 190  THR B CA    1 
ATOM   3753  C  C     . THR B 1 190  ? 148.246 145.089 89.365  1.00 0.00   ? 190  THR B C     1 
ATOM   3754  O  O     . THR B 1 190  ? 147.287 144.382 89.698  1.00 0.00   ? 190  THR B O     1 
ATOM   3755  C  CB    . THR B 1 190  ? 149.931 145.775 91.075  1.00 0.00   ? 190  THR B CB    1 
ATOM   3756  O  OG1   . THR B 1 190  ? 150.961 145.318 90.193  1.00 0.00   ? 190  THR B OG1   1 
ATOM   3757  C  CG2   . THR B 1 190  ? 149.547 144.645 92.025  1.00 0.00   ? 190  THR B CG2   1 
ATOM   3758  N  N     . PRO B 1 191  ? 148.901 144.897 88.211  1.00 0.00   ? 191  PRO B N     1 
ATOM   3759  C  CA    . PRO B 1 191  ? 148.482 143.800 87.343  1.00 0.00   ? 191  PRO B CA    1 
ATOM   3760  C  C     . PRO B 1 191  ? 149.170 142.507 87.756  1.00 0.00   ? 191  PRO B C     1 
ATOM   3761  O  O     . PRO B 1 191  ? 150.337 142.515 88.150  1.00 0.00   ? 191  PRO B O     1 
ATOM   3762  C  CB    . PRO B 1 191  ? 148.932 144.271 85.971  1.00 0.00   ? 191  PRO B CB    1 
ATOM   3763  C  CG    . PRO B 1 191  ? 150.250 144.890 86.297  1.00 0.00   ? 191  PRO B CG    1 
ATOM   3764  C  CD    . PRO B 1 191  ? 149.934 145.708 87.547  1.00 0.00   ? 191  PRO B CD    1 
ATOM   3765  N  N     . ARG B 1 192  ? 148.435 141.404 87.687  1.00 0.00   ? 192  ARG B N     1 
ATOM   3766  C  CA    . ARG B 1 192  ? 148.973 140.103 88.036  1.00 0.00   ? 192  ARG B CA    1 
ATOM   3767  C  C     . ARG B 1 192  ? 148.486 139.160 86.951  1.00 0.00   ? 192  ARG B C     1 
ATOM   3768  O  O     . ARG B 1 192  ? 147.289 139.085 86.682  1.00 0.00   ? 192  ARG B O     1 
ATOM   3769  C  CB    . ARG B 1 192  ? 148.459 139.645 89.399  1.00 0.00   ? 192  ARG B CB    1 
ATOM   3770  C  CG    . ARG B 1 192  ? 148.992 138.286 89.816  1.00 0.00   ? 192  ARG B CG    1 
ATOM   3771  C  CD    . ARG B 1 192  ? 148.337 137.762 91.083  1.00 0.00   ? 192  ARG B CD    1 
ATOM   3772  N  NE    . ARG B 1 192  ? 148.989 138.217 92.308  1.00 0.00   ? 192  ARG B NE    1 
ATOM   3773  C  CZ    . ARG B 1 192  ? 148.800 137.655 93.499  1.00 0.00   ? 192  ARG B CZ    1 
ATOM   3774  N  NH1   . ARG B 1 192  ? 147.977 136.620 93.618  1.00 0.00   ? 192  ARG B NH1   1 
ATOM   3775  N  NH2   . ARG B 1 192  ? 149.433 138.118 94.568  1.00 0.00   ? 192  ARG B NH2   1 
ATOM   3776  N  N     . HIS B 1 193  ? 149.413 138.443 86.328  1.00 0.00   ? 193  HIS B N     1 
ATOM   3777  C  CA    . HIS B 1 193  ? 149.068 137.530 85.242  1.00 0.00   ? 193  HIS B CA    1 
ATOM   3778  C  C     . HIS B 1 193  ? 148.430 138.334 84.118  1.00 0.00   ? 193  HIS B C     1 
ATOM   3779  O  O     . HIS B 1 193  ? 147.549 137.847 83.411  1.00 0.00   ? 193  HIS B O     1 
ATOM   3780  C  CB    . HIS B 1 193  ? 148.108 136.451 85.737  1.00 0.00   ? 193  HIS B CB    1 
ATOM   3781  C  CG    . HIS B 1 193  ? 148.692 135.570 86.800  1.00 0.00   ? 193  HIS B CG    1 
ATOM   3782  N  ND1   . HIS B 1 193  ? 149.862 134.861 86.619  1.00 0.00   ? 193  HIS B ND1   1 
ATOM   3783  C  CD2   . HIS B 1 193  ? 148.280 135.290 88.060  1.00 0.00   ? 193  HIS B CD2   1 
ATOM   3784  C  CE1   . HIS B 1 193  ? 150.146 134.190 87.717  1.00 0.00   ? 193  HIS B CE1   1 
ATOM   3785  N  NE2   . HIS B 1 193  ? 149.202 134.434 88.612  1.00 0.00   ? 193  HIS B NE2   1 
ATOM   3786  N  N     . GLY B 1 194  ? 148.881 139.576 83.967  1.00 0.00   ? 194  GLY B N     1 
ATOM   3787  C  CA    . GLY B 1 194  ? 148.362 140.434 82.920  1.00 0.00   ? 194  GLY B CA    1 
ATOM   3788  C  C     . GLY B 1 194  ? 147.054 141.137 83.230  1.00 0.00   ? 194  GLY B C     1 
ATOM   3789  O  O     . GLY B 1 194  ? 146.636 142.016 82.481  1.00 0.00   ? 194  GLY B O     1 
ATOM   3790  N  N     . ARG B 1 195  ? 146.404 140.754 84.325  1.00 0.00   ? 195  ARG B N     1 
ATOM   3791  C  CA    . ARG B 1 195  ? 145.133 141.362 84.712  1.00 0.00   ? 195  ARG B CA    1 
ATOM   3792  C  C     . ARG B 1 195  ? 145.270 142.349 85.866  1.00 0.00   ? 195  ARG B C     1 
ATOM   3793  O  O     . ARG B 1 195  ? 145.872 142.041 86.896  1.00 0.00   ? 195  ARG B O     1 
ATOM   3794  C  CB    . ARG B 1 195  ? 144.115 140.280 85.097  1.00 0.00   ? 195  ARG B CB    1 
ATOM   3795  C  CG    . ARG B 1 195  ? 143.713 139.364 83.950  1.00 0.00   ? 195  ARG B CG    1 
ATOM   3796  C  CD    . ARG B 1 195  ? 143.127 140.163 82.793  1.00 0.00   ? 195  ARG B CD    1 
ATOM   3797  N  NE    . ARG B 1 195  ? 141.880 140.830 83.155  1.00 0.00   ? 195  ARG B NE    1 
ATOM   3798  C  CZ    . ARG B 1 195  ? 140.717 140.204 83.308  1.00 0.00   ? 195  ARG B CZ    1 
ATOM   3799  N  NH1   . ARG B 1 195  ? 140.630 138.891 83.130  1.00 0.00   ? 195  ARG B NH1   1 
ATOM   3800  N  NH2   . ARG B 1 195  ? 139.633 140.895 83.641  1.00 0.00   ? 195  ARG B NH2   1 
ATOM   3801  N  N     . LEU B 1 196  ? 144.702 143.537 85.689  1.00 0.00   ? 196  LEU B N     1 
ATOM   3802  C  CA    . LEU B 1 196  ? 144.750 144.565 86.716  1.00 0.00   ? 196  LEU B CA    1 
ATOM   3803  C  C     . LEU B 1 196  ? 143.957 144.078 87.926  1.00 0.00   ? 196  LEU B C     1 
ATOM   3804  O  O     . LEU B 1 196  ? 142.802 143.675 87.792  1.00 0.00   ? 196  LEU B O     1 
ATOM   3805  C  CB    . LEU B 1 196  ? 144.142 145.863 86.187  1.00 0.00   ? 196  LEU B CB    1 
ATOM   3806  C  CG    . LEU B 1 196  ? 144.359 147.100 87.060  1.00 0.00   ? 196  LEU B CG    1 
ATOM   3807  C  CD1   . LEU B 1 196  ? 145.846 147.422 87.123  1.00 0.00   ? 196  LEU B CD1   1 
ATOM   3808  C  CD2   . LEU B 1 196  ? 143.583 148.273 86.485  1.00 0.00   ? 196  LEU B CD2   1 
ATOM   3809  N  N     . CYS B 1 197  ? 144.573 144.112 89.102  1.00 0.00   ? 197  CYS B N     1 
ATOM   3810  C  CA    . CYS B 1 197  ? 143.905 143.649 90.315  1.00 0.00   ? 197  CYS B CA    1 
ATOM   3811  C  C     . CYS B 1 197  ? 144.086 144.550 91.531  1.00 0.00   ? 197  CYS B C     1 
ATOM   3812  O  O     . CYS B 1 197  ? 144.966 145.411 91.569  1.00 0.00   ? 197  CYS B O     1 
ATOM   3813  C  CB    . CYS B 1 197  ? 144.374 142.234 90.663  1.00 0.00   ? 197  CYS B CB    1 
ATOM   3814  S  SG    . CYS B 1 197  ? 146.153 142.076 90.968  1.00 0.00   ? 197  CYS B SG    1 
ATOM   3815  N  N     . PHE B 1 198  ? 143.225 144.334 92.526  1.00 0.00   ? 198  PHE B N     1 
ATOM   3816  C  CA    . PHE B 1 198  ? 143.231 145.077 93.784  1.00 0.00   ? 198  PHE B CA    1 
ATOM   3817  C  C     . PHE B 1 198  ? 143.864 144.170 94.845  1.00 0.00   ? 198  PHE B C     1 
ATOM   3818  O  O     . PHE B 1 198  ? 143.374 143.067 95.077  1.00 0.00   ? 198  PHE B O     1 
ATOM   3819  C  CB    . PHE B 1 198  ? 141.787 145.417 94.176  1.00 0.00   ? 198  PHE B CB    1 
ATOM   3820  C  CG    . PHE B 1 198  ? 141.662 146.194 95.464  1.00 0.00   ? 198  PHE B CG    1 
ATOM   3821  C  CD1   . PHE B 1 198  ? 141.788 147.580 95.476  1.00 0.00   ? 198  PHE B CD1   1 
ATOM   3822  C  CD2   . PHE B 1 198  ? 141.398 145.539 96.661  1.00 0.00   ? 198  PHE B CD2   1 
ATOM   3823  C  CE1   . PHE B 1 198  ? 141.649 148.301 96.663  1.00 0.00   ? 198  PHE B CE1   1 
ATOM   3824  C  CE2   . PHE B 1 198  ? 141.261 146.249 97.855  1.00 0.00   ? 198  PHE B CE2   1 
ATOM   3825  C  CZ    . PHE B 1 198  ? 141.386 147.635 97.857  1.00 0.00   ? 198  PHE B CZ    1 
ATOM   3826  N  N     . MET B 1 199  ? 144.943 144.625 95.482  1.00 0.00   ? 199  MET B N     1 
ATOM   3827  C  CA    . MET B 1 199  ? 145.600 143.813 96.507  1.00 0.00   ? 199  MET B CA    1 
ATOM   3828  C  C     . MET B 1 199  ? 145.567 144.415 97.915  1.00 0.00   ? 199  MET B C     1 
ATOM   3829  O  O     . MET B 1 199  ? 145.580 145.634 98.090  1.00 0.00   ? 199  MET B O     1 
ATOM   3830  C  CB    . MET B 1 199  ? 147.051 143.523 96.106  1.00 0.00   ? 199  MET B CB    1 
ATOM   3831  C  CG    . MET B 1 199  ? 147.190 142.583 94.910  1.00 0.00   ? 199  MET B CG    1 
ATOM   3832  S  SD    . MET B 1 199  ? 148.898 142.091 94.577  1.00 0.00   ? 199  MET B SD    1 
ATOM   3833  C  CE    . MET B 1 199  ? 148.680 141.050 93.124  1.00 0.00   ? 199  MET B CE    1 
ATOM   3834  N  N     . LEU B 1 200  ? 145.509 143.531 98.908  1.00 0.00   ? 200  LEU B N     1 
ATOM   3835  C  CA    . LEU B 1 200  ? 145.458 143.899 100.322 1.00 0.00   ? 200  LEU B CA    1 
ATOM   3836  C  C     . LEU B 1 200  ? 146.096 142.797 101.174 1.00 0.00   ? 200  LEU B C     1 
ATOM   3837  O  O     . LEU B 1 200  ? 145.861 141.616 100.939 1.00 0.00   ? 200  LEU B O     1 
ATOM   3838  C  CB    . LEU B 1 200  ? 144.000 144.102 100.747 1.00 0.00   ? 200  LEU B CB    1 
ATOM   3839  C  CG    . LEU B 1 200  ? 143.621 144.181 102.230 1.00 0.00   ? 200  LEU B CG    1 
ATOM   3840  C  CD1   . LEU B 1 200  ? 142.211 144.723 102.346 1.00 0.00   ? 200  LEU B CD1   1 
ATOM   3841  C  CD2   . LEU B 1 200  ? 143.705 142.809 102.880 1.00 0.00   ? 200  LEU B CD2   1 
ATOM   3842  N  N     . ARG B 1 201  ? 146.895 143.189 102.160 1.00 0.00   ? 201  ARG B N     1 
ATOM   3843  C  CA    . ARG B 1 201  ? 147.547 142.224 103.038 1.00 0.00   ? 201  ARG B CA    1 
ATOM   3844  C  C     . ARG B 1 201  ? 146.783 142.097 104.353 1.00 0.00   ? 201  ARG B C     1 
ATOM   3845  O  O     . ARG B 1 201  ? 146.311 143.088 104.911 1.00 0.00   ? 201  ARG B O     1 
ATOM   3846  C  CB    . ARG B 1 201  ? 148.998 142.651 103.311 1.00 0.00   ? 201  ARG B CB    1 
ATOM   3847  C  CG    . ARG B 1 201  ? 149.770 141.681 104.210 1.00 0.00   ? 201  ARG B CG    1 
ATOM   3848  C  CD    . ARG B 1 201  ? 151.140 142.220 104.623 1.00 0.00   ? 201  ARG B CD    1 
ATOM   3849  N  NE    . ARG B 1 201  ? 152.045 142.420 103.494 1.00 0.00   ? 201  ARG B NE    1 
ATOM   3850  C  CZ    . ARG B 1 201  ? 152.439 141.451 102.672 1.00 0.00   ? 201  ARG B CZ    1 
ATOM   3851  N  NH1   . ARG B 1 201  ? 152.003 140.211 102.849 1.00 0.00   ? 201  ARG B NH1   1 
ATOM   3852  N  NH2   . ARG B 1 201  ? 153.275 141.722 101.680 1.00 0.00   ? 201  ARG B NH2   1 
ATOM   3853  N  N     . VAL B 1 202  ? 146.651 140.866 104.838 1.00 0.00   ? 202  VAL B N     1 
ATOM   3854  C  CA    . VAL B 1 202  ? 145.950 140.597 106.092 1.00 0.00   ? 202  VAL B CA    1 
ATOM   3855  C  C     . VAL B 1 202  ? 146.713 139.556 106.907 1.00 0.00   ? 202  VAL B C     1 
ATOM   3856  O  O     . VAL B 1 202  ? 147.323 138.650 106.345 1.00 0.00   ? 202  VAL B O     1 
ATOM   3857  C  CB    . VAL B 1 202  ? 144.517 140.081 105.835 1.00 0.00   ? 202  VAL B CB    1 
ATOM   3858  C  CG1   . VAL B 1 202  ? 144.564 138.832 104.982 1.00 0.00   ? 202  VAL B CG1   1 
ATOM   3859  C  CG2   . VAL B 1 202  ? 143.824 139.793 107.158 1.00 0.00   ? 202  VAL B CG2   1 
ATOM   3860  N  N     . GLY B 1 203  ? 146.678 139.693 108.228 1.00 0.00   ? 203  GLY B N     1 
ATOM   3861  C  CA    . GLY B 1 203  ? 147.385 138.753 109.075 1.00 0.00   ? 203  GLY B CA    1 
ATOM   3862  C  C     . GLY B 1 203  ? 146.733 138.488 110.417 1.00 0.00   ? 203  GLY B C     1 
ATOM   3863  O  O     . GLY B 1 203  ? 145.671 139.034 110.721 1.00 0.00   ? 203  GLY B O     1 
ATOM   3864  N  N     . ASP B 1 204  ? 147.372 137.638 111.212 1.00 0.00   ? 204  ASP B N     1 
ATOM   3865  C  CA    . ASP B 1 204  ? 146.885 137.285 112.544 1.00 0.00   ? 204  ASP B CA    1 
ATOM   3866  C  C     . ASP B 1 204  ? 148.098 137.199 113.467 1.00 0.00   ? 204  ASP B C     1 
ATOM   3867  O  O     . ASP B 1 204  ? 149.035 136.446 113.198 1.00 0.00   ? 204  ASP B O     1 
ATOM   3868  C  CB    . ASP B 1 204  ? 146.174 135.930 112.508 1.00 0.00   ? 204  ASP B CB    1 
ATOM   3869  C  CG    . ASP B 1 204  ? 145.390 135.658 113.771 1.00 0.00   ? 204  ASP B CG    1 
ATOM   3870  O  OD1   . ASP B 1 204  ? 145.891 135.987 114.866 1.00 0.00   ? 204  ASP B OD1   1 
ATOM   3871  O  OD2   . ASP B 1 204  ? 144.269 135.108 113.676 1.00 0.00   ? 204  ASP B OD2   1 
ATOM   3872  N  N     . LEU B 1 205  ? 148.082 137.955 114.560 1.00 0.00   ? 205  LEU B N     1 
ATOM   3873  C  CA    . LEU B 1 205  ? 149.203 137.970 115.499 1.00 0.00   ? 205  LEU B CA    1 
ATOM   3874  C  C     . LEU B 1 205  ? 149.260 136.840 116.527 1.00 0.00   ? 205  LEU B C     1 
ATOM   3875  O  O     . LEU B 1 205  ? 150.307 136.602 117.133 1.00 0.00   ? 205  LEU B O     1 
ATOM   3876  C  CB    . LEU B 1 205  ? 149.243 139.312 116.233 1.00 0.00   ? 205  LEU B CB    1 
ATOM   3877  C  CG    . LEU B 1 205  ? 149.583 140.545 115.400 1.00 0.00   ? 205  LEU B CG    1 
ATOM   3878  C  CD1   . LEU B 1 205  ? 149.479 141.789 116.266 1.00 0.00   ? 205  LEU B CD1   1 
ATOM   3879  C  CD2   . LEU B 1 205  ? 150.981 140.406 114.820 1.00 0.00   ? 205  LEU B CD2   1 
ATOM   3880  N  N     . ARG B 1 206  ? 148.146 136.142 116.733 1.00 0.00   ? 206  ARG B N     1 
ATOM   3881  C  CA    . ARG B 1 206  ? 148.113 135.058 117.714 1.00 0.00   ? 206  ARG B CA    1 
ATOM   3882  C  C     . ARG B 1 206  ? 148.433 133.674 117.141 1.00 0.00   ? 206  ARG B C     1 
ATOM   3883  O  O     . ARG B 1 206  ? 148.160 133.389 115.972 1.00 0.00   ? 206  ARG B O     1 
ATOM   3884  C  CB    . ARG B 1 206  ? 146.739 135.017 118.399 1.00 0.00   ? 206  ARG B CB    1 
ATOM   3885  C  CG    . ARG B 1 206  ? 146.441 136.194 119.327 1.00 0.00   ? 206  ARG B CG    1 
ATOM   3886  C  CD    . ARG B 1 206  ? 147.339 136.190 120.560 1.00 0.00   ? 206  ARG B CD    1 
ATOM   3887  N  NE    . ARG B 1 206  ? 148.637 136.802 120.299 1.00 0.00   ? 206  ARG B NE    1 
ATOM   3888  C  CZ    . ARG B 1 206  ? 148.853 138.114 120.259 1.00 0.00   ? 206  ARG B CZ    1 
ATOM   3889  N  NH1   . ARG B 1 206  ? 147.853 138.962 120.473 1.00 0.00   ? 206  ARG B NH1   1 
ATOM   3890  N  NH2   . ARG B 1 206  ? 150.065 138.583 120.000 1.00 0.00   ? 206  ARG B NH2   1 
ATOM   3891  N  N     . LYS B 1 207  ? 149.014 132.818 117.982 1.00 0.00   ? 207  LYS B N     1 
ATOM   3892  C  CA    . LYS B 1 207  ? 149.369 131.454 117.601 1.00 0.00   ? 207  LYS B CA    1 
ATOM   3893  C  C     . LYS B 1 207  ? 148.094 130.672 117.298 1.00 0.00   ? 207  LYS B C     1 
ATOM   3894  O  O     . LYS B 1 207  ? 148.057 129.862 116.371 1.00 0.00   ? 207  LYS B O     1 
ATOM   3895  C  CB    . LYS B 1 207  ? 150.140 130.770 118.737 1.00 0.00   ? 207  LYS B CB    1 
ATOM   3896  C  CG    . LYS B 1 207  ? 150.529 129.312 118.477 1.00 0.00   ? 207  LYS B CG    1 
ATOM   3897  C  CD    . LYS B 1 207  ? 151.273 128.719 119.676 1.00 0.00   ? 207  LYS B CD    1 
ATOM   3898  C  CE    . LYS B 1 207  ? 151.698 127.271 119.444 1.00 0.00   ? 207  LYS B CE    1 
ATOM   3899  N  NZ    . LYS B 1 207  ? 152.449 126.728 120.617 1.00 0.00   ? 207  LYS B NZ    1 
ATOM   3900  N  N     . SER B 1 208  ? 147.053 130.921 118.088 1.00 0.00   ? 208  SER B N     1 
ATOM   3901  C  CA    . SER B 1 208  ? 145.767 130.251 117.907 1.00 0.00   ? 208  SER B CA    1 
ATOM   3902  C  C     . SER B 1 208  ? 145.144 130.645 116.568 1.00 0.00   ? 208  SER B C     1 
ATOM   3903  O  O     . SER B 1 208  ? 145.327 131.765 116.092 1.00 0.00   ? 208  SER B O     1 
ATOM   3904  C  CB    . SER B 1 208  ? 144.812 130.614 119.049 1.00 0.00   ? 208  SER B CB    1 
ATOM   3905  O  OG    . SER B 1 208  ? 144.502 132.003 119.046 1.00 0.00   ? 208  SER B OG    1 
ATOM   3906  N  N     . MET B 1 209  ? 144.406 129.717 115.967 1.00 0.00   ? 209  MET B N     1 
ATOM   3907  C  CA    . MET B 1 209  ? 143.774 129.948 114.674 1.00 0.00   ? 209  MET B CA    1 
ATOM   3908  C  C     . MET B 1 209  ? 142.323 130.412 114.748 1.00 0.00   ? 209  MET B C     1 
ATOM   3909  O  O     . MET B 1 209  ? 141.684 130.349 115.801 1.00 0.00   ? 209  MET B O     1 
ATOM   3910  C  CB    . MET B 1 209  ? 143.823 128.669 113.832 1.00 0.00   ? 209  MET B CB    1 
ATOM   3911  C  CG    . MET B 1 209  ? 145.218 128.169 113.514 1.00 0.00   ? 209  MET B CG    1 
ATOM   3912  S  SD    . MET B 1 209  ? 146.126 129.300 112.454 1.00 0.00   ? 209  MET B SD    1 
ATOM   3913  C  CE    . MET B 1 209  ? 145.237 129.081 110.898 1.00 0.00   ? 209  MET B CE    1 
ATOM   3914  N  N     . ILE B 1 210  ? 141.833 130.879 113.604 1.00 0.00   ? 210  ILE B N     1 
ATOM   3915  C  CA    . ILE B 1 210  ? 140.456 131.331 113.442 1.00 0.00   ? 210  ILE B CA    1 
ATOM   3916  C  C     . ILE B 1 210  ? 139.888 130.369 112.402 1.00 0.00   ? 210  ILE B C     1 
ATOM   3917  O  O     . ILE B 1 210  ? 140.268 130.415 111.232 1.00 0.00   ? 210  ILE B O     1 
ATOM   3918  C  CB    . ILE B 1 210  ? 140.383 132.760 112.883 1.00 0.00   ? 210  ILE B CB    1 
ATOM   3919  C  CG1   . ILE B 1 210  ? 140.948 133.767 113.901 1.00 0.00   ? 210  ILE B CG1   1 
ATOM   3920  C  CG2   . ILE B 1 210  ? 138.944 133.101 112.538 1.00 0.00   ? 210  ILE B CG2   1 
ATOM   3921  C  CD1   . ILE B 1 210  ? 140.842 135.219 113.463 1.00 0.00   ? 210  ILE B CD1   1 
ATOM   3922  N  N     . ILE B 1 211  ? 138.990 129.489 112.833 1.00 0.00   ? 211  ILE B N     1 
ATOM   3923  C  CA    . ILE B 1 211  ? 138.408 128.492 111.936 1.00 0.00   ? 211  ILE B CA    1 
ATOM   3924  C  C     . ILE B 1 211  ? 137.331 129.028 111.003 1.00 0.00   ? 211  ILE B C     1 
ATOM   3925  O  O     . ILE B 1 211  ? 136.548 129.904 111.373 1.00 0.00   ? 211  ILE B O     1 
ATOM   3926  C  CB    . ILE B 1 211  ? 137.821 127.307 112.733 1.00 0.00   ? 211  ILE B CB    1 
ATOM   3927  C  CG1   . ILE B 1 211  ? 138.890 126.749 113.680 1.00 0.00   ? 211  ILE B CG1   1 
ATOM   3928  C  CG2   . ILE B 1 211  ? 137.339 126.231 111.771 1.00 0.00   ? 211  ILE B CG2   1 
ATOM   3929  C  CD1   . ILE B 1 211  ? 138.384 125.684 114.648 1.00 0.00   ? 211  ILE B CD1   1 
ATOM   3930  N  N     . SER B 1 212  ? 137.299 128.475 109.796 1.00 0.00   ? 212  SER B N     1 
ATOM   3931  C  CA    . SER B 1 212  ? 136.336 128.875 108.779 1.00 0.00   ? 212  SER B CA    1 
ATOM   3932  C  C     . SER B 1 212  ? 136.474 130.370 108.522 1.00 0.00   ? 212  SER B C     1 
ATOM   3933  O  O     . SER B 1 212  ? 135.482 131.070 108.317 1.00 0.00   ? 212  SER B O     1 
ATOM   3934  C  CB    . SER B 1 212  ? 134.910 128.553 109.230 1.00 0.00   ? 212  SER B CB    1 
ATOM   3935  O  OG    . SER B 1 212  ? 134.738 127.159 109.430 1.00 0.00   ? 212  SER B OG    1 
ATOM   3936  N  N     . ALA B 1 213  ? 137.711 130.850 108.531 1.00 0.00   ? 213  ALA B N     1 
ATOM   3937  C  CA    . ALA B 1 213  ? 137.979 132.261 108.286 1.00 0.00   ? 213  ALA B CA    1 
ATOM   3938  C  C     . ALA B 1 213  ? 137.441 132.611 106.905 1.00 0.00   ? 213  ALA B C     1 
ATOM   3939  O  O     . ALA B 1 213  ? 137.880 132.057 105.899 1.00 0.00   ? 213  ALA B O     1 
ATOM   3940  C  CB    . ALA B 1 213  ? 139.476 132.535 108.347 1.00 0.00   ? 213  ALA B CB    1 
ATOM   3941  N  N     . THR B 1 214  ? 136.473 133.520 106.867 1.00 0.00   ? 214  THR B N     1 
ATOM   3942  C  CA    . THR B 1 214  ? 135.870 133.929 105.614 1.00 0.00   ? 214  THR B CA    1 
ATOM   3943  C  C     . THR B 1 214  ? 136.047 135.414 105.377 1.00 0.00   ? 214  THR B C     1 
ATOM   3944  O  O     . THR B 1 214  ? 135.885 136.226 106.289 1.00 0.00   ? 214  THR B O     1 
ATOM   3945  C  CB    . THR B 1 214  ? 134.364 133.603 105.593 1.00 0.00   ? 214  THR B CB    1 
ATOM   3946  O  OG1   . THR B 1 214  ? 134.174 132.210 105.861 1.00 0.00   ? 214  THR B OG1   1 
ATOM   3947  C  CG2   . THR B 1 214  ? 133.768 133.929 104.230 1.00 0.00   ? 214  THR B CG2   1 
ATOM   3948  N  N     . ILE B 1 215  ? 136.383 135.769 104.140 1.00 0.00   ? 215  ILE B N     1 
ATOM   3949  C  CA    . ILE B 1 215  ? 136.586 137.161 103.782 1.00 0.00   ? 215  ILE B CA    1 
ATOM   3950  C  C     . ILE B 1 215  ? 135.544 137.659 102.797 1.00 0.00   ? 215  ILE B C     1 
ATOM   3951  O  O     . ILE B 1 215  ? 135.281 137.030 101.771 1.00 0.00   ? 215  ILE B O     1 
ATOM   3952  C  CB    . ILE B 1 215  ? 137.980 137.382 103.163 1.00 0.00   ? 215  ILE B CB    1 
ATOM   3953  C  CG1   . ILE B 1 215  ? 139.071 137.102 104.210 1.00 0.00   ? 215  ILE B CG1   1 
ATOM   3954  C  CG2   . ILE B 1 215  ? 138.092 138.807 102.633 1.00 0.00   ? 215  ILE B CG2   1 
ATOM   3955  C  CD1   . ILE B 1 215  ? 140.481 137.391 103.731 1.00 0.00   ? 215  ILE B CD1   1 
ATOM   3956  N  N     . HIS B 1 216  ? 134.956 138.801 103.127 1.00 0.00   ? 216  HIS B N     1 
ATOM   3957  C  CA    . HIS B 1 216  ? 133.953 139.441 102.285 1.00 0.00   ? 216  HIS B CA    1 
ATOM   3958  C  C     . HIS B 1 216  ? 134.470 140.840 101.977 1.00 0.00   ? 216  HIS B C     1 
ATOM   3959  O  O     . HIS B 1 216  ? 135.091 141.482 102.830 1.00 0.00   ? 216  HIS B O     1 
ATOM   3960  C  CB    . HIS B 1 216  ? 132.619 139.534 103.018 1.00 0.00   ? 216  HIS B CB    1 
ATOM   3961  C  CG    . HIS B 1 216  ? 131.974 138.208 103.282 1.00 0.00   ? 216  HIS B CG    1 
ATOM   3962  N  ND1   . HIS B 1 216  ? 131.545 137.372 102.271 1.00 0.00   ? 216  HIS B ND1   1 
ATOM   3963  C  CD2   . HIS B 1 216  ? 131.668 137.575 104.442 1.00 0.00   ? 216  HIS B CD2   1 
ATOM   3964  C  CE1   . HIS B 1 216  ? 131.003 136.288 102.794 1.00 0.00   ? 216  HIS B CE1   1 
ATOM   3965  N  NE2   . HIS B 1 216  ? 131.063 136.385 104.109 1.00 0.00   ? 216  HIS B NE2   1 
ATOM   3966  N  N     . MET B 1 217  ? 134.230 141.312 100.762 1.00 0.00   ? 217  MET B N     1 
ATOM   3967  C  CA    . MET B 1 217  ? 134.693 142.634 100.369 1.00 0.00   ? 217  MET B CA    1 
ATOM   3968  C  C     . MET B 1 217  ? 133.575 143.394 99.676  1.00 0.00   ? 217  MET B C     1 
ATOM   3969  O  O     . MET B 1 217  ? 133.015 142.929 98.683  1.00 0.00   ? 217  MET B O     1 
ATOM   3970  C  CB    . MET B 1 217  ? 135.905 142.513 99.439  1.00 0.00   ? 217  MET B CB    1 
ATOM   3971  C  CG    . MET B 1 217  ? 136.629 143.819 99.183  1.00 0.00   ? 217  MET B CG    1 
ATOM   3972  S  SD    . MET B 1 217  ? 138.138 143.603 98.208  1.00 0.00   ? 217  MET B SD    1 
ATOM   3973  C  CE    . MET B 1 217  ? 139.271 142.973 99.455  1.00 0.00   ? 217  MET B CE    1 
ATOM   3974  N  N     . GLN B 1 218  ? 133.244 144.568 100.209 1.00 0.00   ? 218  GLN B N     1 
ATOM   3975  C  CA    . GLN B 1 218  ? 132.185 145.383 99.630  1.00 0.00   ? 218  GLN B CA    1 
ATOM   3976  C  C     . GLN B 1 218  ? 132.670 146.778 99.270  1.00 0.00   ? 218  GLN B C     1 
ATOM   3977  O  O     . GLN B 1 218  ? 133.550 147.337 99.932  1.00 0.00   ? 218  GLN B O     1 
ATOM   3978  C  CB    . GLN B 1 218  ? 131.007 145.497 100.600 1.00 0.00   ? 218  GLN B CB    1 
ATOM   3979  C  CG    . GLN B 1 218  ? 130.392 144.164 101.000 1.00 0.00   ? 218  GLN B CG    1 
ATOM   3980  C  CD    . GLN B 1 218  ? 129.174 144.321 101.896 1.00 0.00   ? 218  GLN B CD    1 
ATOM   3981  O  OE1   . GLN B 1 218  ? 128.594 143.333 102.351 1.00 0.00   ? 218  GLN B OE1   1 
ATOM   3982  N  NE2   . GLN B 1 218  ? 128.782 145.564 102.153 1.00 0.00   ? 218  GLN B NE2   1 
ATOM   3983  N  N     . VAL B 1 219  ? 132.098 147.330 98.209  1.00 0.00   ? 219  VAL B N     1 
ATOM   3984  C  CA    . VAL B 1 219  ? 132.450 148.667 97.753  1.00 0.00   ? 219  VAL B CA    1 
ATOM   3985  C  C     . VAL B 1 219  ? 131.308 149.631 98.057  1.00 0.00   ? 219  VAL B C     1 
ATOM   3986  O  O     . VAL B 1 219  ? 130.190 149.463 97.560  1.00 0.00   ? 219  VAL B O     1 
ATOM   3987  C  CB    . VAL B 1 219  ? 132.735 148.688 96.231  1.00 0.00   ? 219  VAL B CB    1 
ATOM   3988  C  CG1   . VAL B 1 219  ? 133.075 150.103 95.784  1.00 0.00   ? 219  VAL B CG1   1 
ATOM   3989  C  CG2   . VAL B 1 219  ? 133.885 147.754 95.898  1.00 0.00   ? 219  VAL B CG2   1 
ATOM   3990  N  N     . VAL B 1 220  ? 131.587 150.624 98.892  1.00 0.00   ? 220  VAL B N     1 
ATOM   3991  C  CA    . VAL B 1 220  ? 130.586 151.623 99.238  1.00 0.00   ? 220  VAL B CA    1 
ATOM   3992  C  C     . VAL B 1 220  ? 130.736 152.761 98.243  1.00 0.00   ? 220  VAL B C     1 
ATOM   3993  O  O     . VAL B 1 220  ? 131.801 153.371 98.136  1.00 0.00   ? 220  VAL B O     1 
ATOM   3994  C  CB    . VAL B 1 220  ? 130.791 152.172 100.657 1.00 0.00   ? 220  VAL B CB    1 
ATOM   3995  C  CG1   . VAL B 1 220  ? 129.737 153.225 100.958 1.00 0.00   ? 220  VAL B CG1   1 
ATOM   3996  C  CG2   . VAL B 1 220  ? 130.709 151.045 101.668 1.00 0.00   ? 220  VAL B CG2   1 
ATOM   3997  N  N     . ARG B 1 221  ? 129.663 153.041 97.512  1.00 0.00   ? 221  ARG B N     1 
ATOM   3998  C  CA    . ARG B 1 221  ? 129.680 154.088 96.503  1.00 0.00   ? 221  ARG B CA    1 
ATOM   3999  C  C     . ARG B 1 221  ? 128.315 154.730 96.302  1.00 0.00   ? 221  ARG B C     1 
ATOM   4000  O  O     . ARG B 1 221  ? 127.328 154.028 96.079  1.00 0.00   ? 221  ARG B O     1 
ATOM   4001  C  CB    . ARG B 1 221  ? 130.140 153.495 95.170  1.00 0.00   ? 221  ARG B CB    1 
ATOM   4002  C  CG    . ARG B 1 221  ? 129.845 154.361 93.953  1.00 0.00   ? 221  ARG B CG    1 
ATOM   4003  C  CD    . ARG B 1 221  ? 129.767 153.521 92.690  1.00 0.00   ? 221  ARG B CD    1 
ATOM   4004  N  NE    . ARG B 1 221  ? 131.013 152.801 92.435  1.00 0.00   ? 221  ARG B NE    1 
ATOM   4005  C  CZ    . ARG B 1 221  ? 132.126 153.367 91.984  1.00 0.00   ? 221  ARG B CZ    1 
ATOM   4006  N  NH1   . ARG B 1 221  ? 132.160 154.670 91.731  1.00 0.00   ? 221  ARG B NH1   1 
ATOM   4007  N  NH2   . ARG B 1 221  ? 133.212 152.631 91.787  1.00 0.00   ? 221  ARG B NH2   1 
ATOM   4008  N  N     . LYS B 1 222  ? 128.244 156.057 96.392  1.00 0.00   ? 222  LYS B N     1 
ATOM   4009  C  CA    . LYS B 1 222  ? 126.972 156.719 96.146  1.00 0.00   ? 222  LYS B CA    1 
ATOM   4010  C  C     . LYS B 1 222  ? 126.767 156.501 94.656  1.00 0.00   ? 222  LYS B C     1 
ATOM   4011  O  O     . LYS B 1 222  ? 127.577 156.946 93.844  1.00 0.00   ? 222  LYS B O     1 
ATOM   4012  C  CB    . LYS B 1 222  ? 127.026 158.223 96.440  1.00 0.00   ? 222  LYS B CB    1 
ATOM   4013  C  CG    . LYS B 1 222  ? 125.712 158.930 96.081  1.00 0.00   ? 222  LYS B CG    1 
ATOM   4014  C  CD    . LYS B 1 222  ? 125.701 160.417 96.404  1.00 0.00   ? 222  LYS B CD    1 
ATOM   4015  C  CE    . LYS B 1 222  ? 124.338 161.017 96.063  1.00 0.00   ? 222  LYS B CE    1 
ATOM   4016  N  NZ    . LYS B 1 222  ? 124.214 162.456 96.439  1.00 0.00   ? 222  LYS B NZ    1 
ATOM   4017  N  N     . THR B 1 223  ? 125.738 155.742 94.312  1.00 0.00   ? 223  THR B N     1 
ATOM   4018  C  CA    . THR B 1 223  ? 125.498 155.399 92.922  1.00 0.00   ? 223  THR B CA    1 
ATOM   4019  C  C     . THR B 1 223  ? 124.128 155.771 92.402  1.00 0.00   ? 223  THR B C     1 
ATOM   4020  O  O     . THR B 1 223  ? 123.153 155.843 93.149  1.00 0.00   ? 223  THR B O     1 
ATOM   4021  C  CB    . THR B 1 223  ? 125.690 153.886 92.701  1.00 0.00   ? 223  THR B CB    1 
ATOM   4022  O  OG1   . THR B 1 223  ? 127.038 153.517 93.022  1.00 0.00   ? 223  THR B OG1   1 
ATOM   4023  C  CG2   . THR B 1 223  ? 125.416 153.526 91.253  1.00 0.00   ? 223  THR B CG2   1 
ATOM   4024  N  N     . THR B 1 224  ? 124.075 156.006 91.097  1.00 0.00   ? 224  THR B N     1 
ATOM   4025  C  CA    . THR B 1 224  ? 122.837 156.353 90.429  1.00 0.00   ? 224  THR B CA    1 
ATOM   4026  C  C     . THR B 1 224  ? 122.564 155.393 89.282  1.00 0.00   ? 224  THR B C     1 
ATOM   4027  O  O     . THR B 1 224  ? 123.446 155.118 88.471  1.00 0.00   ? 224  THR B O     1 
ATOM   4028  C  CB    . THR B 1 224  ? 122.890 157.776 89.851  1.00 0.00   ? 224  THR B CB    1 
ATOM   4029  O  OG1   . THR B 1 224  ? 123.662 157.774 88.646  1.00 0.00   ? 224  THR B OG1   1 
ATOM   4030  C  CG2   . THR B 1 224  ? 123.515 158.732 90.847  1.00 0.00   ? 224  THR B CG2   1 
ATOM   4031  N  N     . SER B 1 225  ? 121.338 154.887 89.217  1.00 0.00   ? 225  SER B N     1 
ATOM   4032  C  CA    . SER B 1 225  ? 120.930 153.992 88.133  1.00 0.00   ? 225  SER B CA    1 
ATOM   4033  C  C     . SER B 1 225  ? 120.462 154.805 86.924  1.00 0.00   ? 225  SER B C     1 
ATOM   4034  O  O     . SER B 1 225  ? 120.439 156.045 86.967  1.00 0.00   ? 225  SER B O     1 
ATOM   4035  C  CB    . SER B 1 225  ? 119.784 153.103 88.600  1.00 0.00   ? 225  SER B CB    1 
ATOM   4036  O  OG    . SER B 1 225  ? 118.644 153.889 88.900  1.00 0.00   ? 225  SER B OG    1 
ATOM   4037  N  N     . PRO B 1 226  ? 120.058 154.131 85.843  1.00 0.00   ? 226  PRO B N     1 
ATOM   4038  C  CA    . PRO B 1 226  ? 119.593 154.904 84.690  1.00 0.00   ? 226  PRO B CA    1 
ATOM   4039  C  C     . PRO B 1 226  ? 118.171 155.407 84.897  1.00 0.00   ? 226  PRO B C     1 
ATOM   4040  O  O     . PRO B 1 226  ? 117.723 156.338 84.222  1.00 0.00   ? 226  PRO B O     1 
ATOM   4041  C  CB    . PRO B 1 226  ? 119.691 153.902 83.541  1.00 0.00   ? 226  PRO B CB    1 
ATOM   4042  C  CG    . PRO B 1 226  ? 120.839 153.030 83.954  1.00 0.00   ? 226  PRO B CG    1 
ATOM   4043  C  CD    . PRO B 1 226  ? 120.550 152.808 85.422  1.00 0.00   ? 226  PRO B CD    1 
ATOM   4044  N  N     . GLU B 1 227  ? 117.428 154.743 85.778  1.00 0.00   ? 227  GLU B N     1 
ATOM   4045  C  CA    . GLU B 1 227  ? 116.066 155.161 86.079  1.00 0.00   ? 227  GLU B CA    1 
ATOM   4046  C  C     . GLU B 1 227  ? 116.019 156.428 86.932  1.00 0.00   ? 227  GLU B C     1 
ATOM   4047  O  O     . GLU B 1 227  ? 114.948 156.865 87.347  1.00 0.00   ? 227  GLU B O     1 
ATOM   4048  C  CB    . GLU B 1 227  ? 115.311 154.033 86.783  1.00 0.00   ? 227  GLU B CB    1 
ATOM   4049  C  CG    . GLU B 1 227  ? 115.096 152.792 85.936  1.00 0.00   ? 227  GLU B CG    1 
ATOM   4050  C  CD    . GLU B 1 227  ? 114.342 153.073 84.656  1.00 0.00   ? 227  GLU B CD    1 
ATOM   4051  O  OE1   . GLU B 1 227  ? 113.386 153.877 84.691  1.00 0.00   ? 227  GLU B OE1   1 
ATOM   4052  O  OE2   . GLU B 1 227  ? 114.707 152.491 83.613  1.00 0.00   ? 227  GLU B OE2   1 
ATOM   4053  N  N     . GLY B 1 228  ? 117.186 157.012 87.196  1.00 0.00   ? 228  GLY B N     1 
ATOM   4054  C  CA    . GLY B 1 228  ? 117.294 158.214 88.000  1.00 0.00   ? 228  GLY B CA    1 
ATOM   4055  C  C     . GLY B 1 228  ? 117.322 157.955 89.497  1.00 0.00   ? 228  GLY B C     1 
ATOM   4056  O  O     . GLY B 1 228  ? 117.335 158.893 90.291  1.00 0.00   ? 228  GLY B O     1 
ATOM   4057  N  N     . GLU B 1 229  ? 117.327 156.687 89.889  1.00 0.00   ? 229  GLU B N     1 
ATOM   4058  C  CA    . GLU B 1 229  ? 117.357 156.338 91.297  1.00 0.00   ? 229  GLU B CA    1 
ATOM   4059  C  C     . GLU B 1 229  ? 118.712 156.657 91.899  1.00 0.00   ? 229  GLU B C     1 
ATOM   4060  O  O     . GLU B 1 229  ? 119.742 156.394 91.290  1.00 0.00   ? 229  GLU B O     1 
ATOM   4061  C  CB    . GLU B 1 229  ? 117.015 154.867 91.498  1.00 0.00   ? 229  GLU B CB    1 
ATOM   4062  C  CG    . GLU B 1 229  ? 116.247 154.615 92.780  1.00 0.00   ? 229  GLU B CG    1 
ATOM   4063  C  CD    . GLU B 1 229  ? 115.088 155.580 92.945  1.00 0.00   ? 229  GLU B CD    1 
ATOM   4064  O  OE1   . GLU B 1 229  ? 114.741 156.265 91.961  1.00 0.00   ? 229  GLU B OE1   1 
ATOM   4065  O  OE2   . GLU B 1 229  ? 114.519 155.647 94.053  1.00 0.00   ? 229  GLU B OE2   1 
ATOM   4066  N  N     . VAL B 1 230  ? 118.703 157.204 93.108  1.00 0.00   ? 230  VAL B N     1 
ATOM   4067  C  CA    . VAL B 1 230  ? 119.937 157.572 93.786  1.00 0.00   ? 230  VAL B CA    1 
ATOM   4068  C  C     . VAL B 1 230  ? 120.096 156.834 95.104  1.00 0.00   ? 230  VAL B C     1 
ATOM   4069  O  O     . VAL B 1 230  ? 119.174 156.790 95.913  1.00 0.00   ? 230  VAL B O     1 
ATOM   4070  C  CB    . VAL B 1 230  ? 119.983 159.083 94.069  1.00 0.00   ? 230  VAL B CB    1 
ATOM   4071  C  CG1   . VAL B 1 230  ? 121.265 159.453 94.795  1.00 0.00   ? 230  VAL B CG1   1 
ATOM   4072  C  CG2   . VAL B 1 230  ? 119.856 159.869 92.778  1.00 0.00   ? 230  VAL B CG2   1 
ATOM   4073  N  N     . VAL B 1 231  ? 121.266 156.246 95.311  1.00 0.00   ? 231  VAL B N     1 
ATOM   4074  C  CA    . VAL B 1 231  ? 121.569 155.533 96.544  1.00 0.00   ? 231  VAL B CA    1 
ATOM   4075  C  C     . VAL B 1 231  ? 122.784 156.198 97.163  1.00 0.00   ? 231  VAL B C     1 
ATOM   4076  O  O     . VAL B 1 231  ? 123.795 156.379 96.497  1.00 0.00   ? 231  VAL B O     1 
ATOM   4077  C  CB    . VAL B 1 231  ? 121.874 154.054 96.284  1.00 0.00   ? 231  VAL B CB    1 
ATOM   4078  C  CG1   . VAL B 1 231  ? 122.632 153.463 97.461  1.00 0.00   ? 231  VAL B CG1   1 
ATOM   4079  C  CG2   . VAL B 1 231  ? 120.588 153.290 96.021  1.00 0.00   ? 231  VAL B CG2   1 
ATOM   4080  N  N     . PRO B 1 232  ? 122.679 156.563 98.433  1.00 0.00   ? 232  PRO B N     1 
ATOM   4081  C  CA    . PRO B 1 232  ? 123.765 157.250 99.139  1.00 0.00   ? 232  PRO B CA    1 
ATOM   4082  C  C     . PRO B 1 232  ? 124.927 156.344 99.541  1.00 0.00   ? 232  PRO B C     1 
ATOM   4083  O  O     . PRO B 1 232  ? 126.077 156.773 99.555  1.00 0.00   ? 232  PRO B O     1 
ATOM   4084  C  CB    . PRO B 1 232  ? 123.057 157.857 100.344 1.00 0.00   ? 232  PRO B CB    1 
ATOM   4085  C  CG    . PRO B 1 232  ? 121.972 156.859 100.617 1.00 0.00   ? 232  PRO B CG    1 
ATOM   4086  C  CD    . PRO B 1 232  ? 121.442 156.586 99.234  1.00 0.00   ? 232  PRO B CD    1 
ATOM   4087  N  N     . LEU B 1 233  ? 124.618 155.093 99.873  1.00 0.00   ? 233  LEU B N     1 
ATOM   4088  C  CA    . LEU B 1 233  ? 125.638 154.128 100.273 1.00 0.00   ? 233  LEU B CA    1 
ATOM   4089  C  C     . LEU B 1 233  ? 125.354 152.768 99.657  1.00 0.00   ? 233  LEU B C     1 
ATOM   4090  O  O     . LEU B 1 233  ? 124.985 151.827 100.367 1.00 0.00   ? 233  LEU B O     1 
ATOM   4091  C  CB    . LEU B 1 233  ? 125.666 153.974 101.797 1.00 0.00   ? 233  LEU B CB    1 
ATOM   4092  C  CG    . LEU B 1 233  ? 126.027 155.178 102.666 1.00 0.00   ? 233  LEU B CG    1 
ATOM   4093  C  CD1   . LEU B 1 233  ? 125.780 154.831 104.125 1.00 0.00   ? 233  LEU B CD1   1 
ATOM   4094  C  CD2   . LEU B 1 233  ? 127.480 155.563 102.443 1.00 0.00   ? 233  LEU B CD2   1 
ATOM   4095  N  N     . HIS B 1 234  ? 125.512 152.648 98.342  1.00 0.00   ? 234  HIS B N     1 
ATOM   4096  C  CA    . HIS B 1 234  ? 125.262 151.371 97.686  1.00 0.00   ? 234  HIS B CA    1 
ATOM   4097  C  C     . HIS B 1 234  ? 126.442 150.445 97.950  1.00 0.00   ? 234  HIS B C     1 
ATOM   4098  O  O     . HIS B 1 234  ? 127.601 150.835 97.796  1.00 0.00   ? 234  HIS B O     1 
ATOM   4099  C  CB    . HIS B 1 234  ? 125.062 151.559 96.178  1.00 0.00   ? 234  HIS B CB    1 
ATOM   4100  C  CG    . HIS B 1 234  ? 124.573 150.328 95.478  1.00 0.00   ? 234  HIS B CG    1 
ATOM   4101  N  ND1   . HIS B 1 234  ? 125.339 149.192 95.347  1.00 0.00   ? 234  HIS B ND1   1 
ATOM   4102  C  CD2   . HIS B 1 234  ? 123.385 150.052 94.889  1.00 0.00   ? 234  HIS B CD2   1 
ATOM   4103  C  CE1   . HIS B 1 234  ? 124.644 148.268 94.709  1.00 0.00   ? 234  HIS B CE1   1 
ATOM   4104  N  NE2   . HIS B 1 234  ? 123.454 148.764 94.421  1.00 0.00   ? 234  HIS B NE2   1 
ATOM   4105  N  N     . GLN B 1 235  ? 126.143 149.220 98.361  1.00 0.00   ? 235  GLN B N     1 
ATOM   4106  C  CA    . GLN B 1 235  ? 127.186 148.249 98.651  1.00 0.00   ? 235  GLN B CA    1 
ATOM   4107  C  C     . GLN B 1 235  ? 127.259 147.203 97.553  1.00 0.00   ? 235  GLN B C     1 
ATOM   4108  O  O     . GLN B 1 235  ? 126.264 146.542 97.238  1.00 0.00   ? 235  GLN B O     1 
ATOM   4109  C  CB    . GLN B 1 235  ? 126.926 147.581 100.005 1.00 0.00   ? 235  GLN B CB    1 
ATOM   4110  C  CG    . GLN B 1 235  ? 126.629 148.573 101.121 1.00 0.00   ? 235  GLN B CG    1 
ATOM   4111  C  CD    . GLN B 1 235  ? 126.555 147.919 102.487 1.00 0.00   ? 235  GLN B CD    1 
ATOM   4112  O  OE1   . GLN B 1 235  ? 126.309 146.719 102.598 1.00 0.00   ? 235  GLN B OE1   1 
ATOM   4113  N  NE2   . GLN B 1 235  ? 126.757 148.710 103.535 1.00 0.00   ? 235  GLN B NE2   1 
ATOM   4114  N  N     . VAL B 1 236  ? 128.444 147.064 96.963  1.00 0.00   ? 236  VAL B N     1 
ATOM   4115  C  CA    . VAL B 1 236  ? 128.670 146.108 95.892  1.00 0.00   ? 236  VAL B CA    1 
ATOM   4116  C  C     . VAL B 1 236  ? 129.529 144.944 96.371  1.00 0.00   ? 236  VAL B C     1 
ATOM   4117  O  O     . VAL B 1 236  ? 130.539 145.139 97.050  1.00 0.00   ? 236  VAL B O     1 
ATOM   4118  C  CB    . VAL B 1 236  ? 129.368 146.772 94.688  1.00 0.00   ? 236  VAL B CB    1 
ATOM   4119  C  CG1   . VAL B 1 236  ? 129.508 145.769 93.553  1.00 0.00   ? 236  VAL B CG1   1 
ATOM   4120  C  CG2   . VAL B 1 236  ? 128.576 147.987 94.226  1.00 0.00   ? 236  VAL B CG2   1 
ATOM   4121  N  N     . ASP B 1 237  ? 129.122 143.735 96.001  1.00 0.00   ? 237  ASP B N     1 
ATOM   4122  C  CA    . ASP B 1 237  ? 129.850 142.531 96.384  1.00 0.00   ? 237  ASP B CA    1 
ATOM   4123  C  C     . ASP B 1 237  ? 131.085 142.357 95.507  1.00 0.00   ? 237  ASP B C     1 
ATOM   4124  O  O     . ASP B 1 237  ? 131.012 142.484 94.284  1.00 0.00   ? 237  ASP B O     1 
ATOM   4125  C  CB    . ASP B 1 237  ? 128.942 141.305 96.254  1.00 0.00   ? 237  ASP B CB    1 
ATOM   4126  C  CG    . ASP B 1 237  ? 127.651 141.455 97.038  1.00 0.00   ? 237  ASP B CG    1 
ATOM   4127  O  OD1   . ASP B 1 237  ? 127.709 141.612 98.279  1.00 0.00   ? 237  ASP B OD1   1 
ATOM   4128  O  OD2   . ASP B 1 237  ? 126.568 141.411 96.415  1.00 0.00   ? 237  ASP B OD2   1 
ATOM   4129  N  N     . ILE B 1 238  ? 132.209 142.054 96.141  1.00 0.00   ? 238  ILE B N     1 
ATOM   4130  C  CA    . ILE B 1 238  ? 133.477 141.864 95.438  1.00 0.00   ? 238  ILE B CA    1 
ATOM   4131  C  C     . ILE B 1 238  ? 134.032 140.451 95.609  1.00 0.00   ? 238  ILE B C     1 
ATOM   4132  O  O     . ILE B 1 238  ? 134.283 139.991 96.723  1.00 0.00   ? 238  ILE B O     1 
ATOM   4133  C  CB    . ILE B 1 238  ? 134.537 142.868 95.948  1.00 0.00   ? 238  ILE B CB    1 
ATOM   4134  C  CG1   . ILE B 1 238  ? 134.043 144.308 95.762  1.00 0.00   ? 238  ILE B CG1   1 
ATOM   4135  C  CG2   . ILE B 1 238  ? 135.836 142.674 95.205  1.00 0.00   ? 238  ILE B CG2   1 
ATOM   4136  C  CD1   . ILE B 1 238  ? 133.747 144.689 94.321  1.00 0.00   ? 238  ILE B CD1   1 
ATOM   4137  N  N     . PRO B 1 239  ? 134.232 139.740 94.491  1.00 0.00   ? 239  PRO B N     1 
ATOM   4138  C  CA    . PRO B 1 239  ? 134.761 138.372 94.504  1.00 0.00   ? 239  PRO B CA    1 
ATOM   4139  C  C     . PRO B 1 239  ? 136.218 138.322 94.984  1.00 0.00   ? 239  PRO B C     1 
ATOM   4140  O  O     . PRO B 1 239  ? 136.991 139.243 94.724  1.00 0.00   ? 239  PRO B O     1 
ATOM   4141  C  CB    . PRO B 1 239  ? 134.609 137.937 93.049  1.00 0.00   ? 239  PRO B CB    1 
ATOM   4142  C  CG    . PRO B 1 239  ? 134.800 139.232 92.304  1.00 0.00   ? 239  PRO B CG    1 
ATOM   4143  C  CD    . PRO B 1 239  ? 133.972 140.189 93.113  1.00 0.00   ? 239  PRO B CD    1 
ATOM   4144  N  N     . MET B 1 240  ? 136.580 137.249 95.681  1.00 0.00   ? 240  MET B N     1 
ATOM   4145  C  CA    . MET B 1 240  ? 137.926 137.087 96.230  1.00 0.00   ? 240  MET B CA    1 
ATOM   4146  C  C     . MET B 1 240  ? 138.932 136.360 95.331  1.00 0.00   ? 240  MET B C     1 
ATOM   4147  O  O     . MET B 1 240  ? 140.047 136.045 95.759  1.00 0.00   ? 240  MET B O     1 
ATOM   4148  C  CB    . MET B 1 240  ? 137.849 136.361 97.578  1.00 0.00   ? 240  MET B CB    1 
ATOM   4149  C  CG    . MET B 1 240  ? 137.288 137.207 98.707  1.00 0.00   ? 240  MET B CG    1 
ATOM   4150  S  SD    . MET B 1 240  ? 138.348 138.609 99.091  1.00 0.00   ? 240  MET B SD    1 
ATOM   4151  C  CE    . MET B 1 240  ? 137.690 139.841 97.989  1.00 0.00   ? 240  MET B CE    1 
ATOM   4152  N  N     . GLU B 1 241  ? 138.546 136.109 94.086  1.00 0.00   ? 241  GLU B N     1 
ATOM   4153  C  CA    . GLU B 1 241  ? 139.415 135.411 93.140  1.00 0.00   ? 241  GLU B CA    1 
ATOM   4154  C  C     . GLU B 1 241  ? 139.828 134.053 93.695  1.00 0.00   ? 241  GLU B C     1 
ATOM   4155  O  O     . GLU B 1 241  ? 140.899 133.534 93.363  1.00 0.00   ? 241  GLU B O     1 
ATOM   4156  C  CB    . GLU B 1 241  ? 140.676 136.230 92.839  1.00 0.00   ? 241  GLU B CB    1 
ATOM   4157  N  N     . ASN B 1 242  ? 138.984 133.489 94.551  1.00 0.00   ? 242  ASN B N     1 
ATOM   4158  C  CA    . ASN B 1 242  ? 139.269 132.188 95.138  1.00 0.00   ? 242  ASN B CA    1 
ATOM   4159  C  C     . ASN B 1 242  ? 139.282 131.160 94.014  1.00 0.00   ? 242  ASN B C     1 
ATOM   4160  O  O     . ASN B 1 242  ? 138.425 131.187 93.130  1.00 0.00   ? 242  ASN B O     1 
ATOM   4161  C  CB    . ASN B 1 242  ? 138.200 131.853 96.170  1.00 0.00   ? 242  ASN B CB    1 
ATOM   4162  C  CG    . ASN B 1 242  ? 138.507 130.588 96.937  1.00 0.00   ? 242  ASN B CG    1 
ATOM   4163  O  OD1   . ASN B 1 242  ? 138.430 129.488 96.395  1.00 0.00   ? 242  ASN B OD1   1 
ATOM   4164  N  ND2   . ASN B 1 242  ? 138.871 130.741 98.207  1.00 0.00   ? 242  ASN B ND2   1 
ATOM   4165  N  N     . GLY B 1 243  ? 140.247 130.252 94.055  1.00 0.00   ? 243  GLY B N     1 
ATOM   4166  C  CA    . GLY B 1 243  ? 140.352 129.258 93.003  1.00 0.00   ? 243  GLY B CA    1 
ATOM   4167  C  C     . GLY B 1 243  ? 139.116 128.398 92.819  1.00 0.00   ? 243  GLY B C     1 
ATOM   4168  O  O     . GLY B 1 243  ? 138.828 127.963 91.703  1.00 0.00   ? 243  GLY B O     1 
ATOM   4169  N  N     . VAL B 1 244  ? 138.375 128.157 93.896  1.00 0.00   ? 244  VAL B N     1 
ATOM   4170  C  CA    . VAL B 1 244  ? 137.175 127.335 93.815  1.00 0.00   ? 244  VAL B CA    1 
ATOM   4171  C  C     . VAL B 1 244  ? 135.897 128.149 93.976  1.00 0.00   ? 244  VAL B C     1 
ATOM   4172  O  O     . VAL B 1 244  ? 134.813 127.594 94.136  1.00 0.00   ? 244  VAL B O     1 
ATOM   4173  C  CB    . VAL B 1 244  ? 137.185 126.218 94.882  1.00 0.00   ? 244  VAL B CB    1 
ATOM   4174  C  CG1   . VAL B 1 244  ? 138.380 125.305 94.669  1.00 0.00   ? 244  VAL B CG1   1 
ATOM   4175  C  CG2   . VAL B 1 244  ? 137.228 126.825 96.272  1.00 0.00   ? 244  VAL B CG2   1 
ATOM   4176  N  N     . GLY B 1 245  ? 136.040 129.471 93.926  1.00 0.00   ? 245  GLY B N     1 
ATOM   4177  C  CA    . GLY B 1 245  ? 134.892 130.347 94.072  1.00 0.00   ? 245  GLY B CA    1 
ATOM   4178  C  C     . GLY B 1 245  ? 134.444 130.489 95.513  1.00 0.00   ? 245  GLY B C     1 
ATOM   4179  O  O     . GLY B 1 245  ? 133.366 131.027 95.785  1.00 0.00   ? 245  GLY B O     1 
ATOM   4180  N  N     . GLY B 1 246  ? 135.271 130.012 96.442  1.00 0.00   ? 246  GLY B N     1 
ATOM   4181  C  CA    . GLY B 1 246  ? 134.939 130.096 97.855  1.00 0.00   ? 246  GLY B CA    1 
ATOM   4182  C  C     . GLY B 1 246  ? 135.421 131.376 98.515  1.00 0.00   ? 246  GLY B C     1 
ATOM   4183  O  O     . GLY B 1 246  ? 136.204 132.120 97.938  1.00 0.00   ? 246  GLY B O     1 
ATOM   4184  N  N     . ASN B 1 247  ? 134.944 131.636 99.727  1.00 0.00   ? 247  ASN B N     1 
ATOM   4185  C  CA    . ASN B 1 247  ? 135.329 132.844 100.450 1.00 0.00   ? 247  ASN B CA    1 
ATOM   4186  C  C     . ASN B 1 247  ? 136.208 132.548 101.663 1.00 0.00   ? 247  ASN B C     1 
ATOM   4187  O  O     . ASN B 1 247  ? 136.587 133.456 102.406 1.00 0.00   ? 247  ASN B O     1 
ATOM   4188  C  CB    . ASN B 1 247  ? 134.070 133.597 100.888 1.00 0.00   ? 247  ASN B CB    1 
ATOM   4189  C  CG    . ASN B 1 247  ? 133.224 134.038 99.709  1.00 0.00   ? 247  ASN B CG    1 
ATOM   4190  O  OD1   . ASN B 1 247  ? 133.603 134.942 98.961  1.00 0.00   ? 247  ASN B OD1   1 
ATOM   4191  N  ND2   . ASN B 1 247  ? 132.074 133.396 99.531  1.00 0.00   ? 247  ASN B ND2   1 
ATOM   4192  N  N     . SER B 1 248  ? 136.532 131.276 101.856 1.00 0.00   ? 248  SER B N     1 
ATOM   4193  C  CA    . SER B 1 248  ? 137.351 130.851 102.988 1.00 0.00   ? 248  SER B CA    1 
ATOM   4194  C  C     . SER B 1 248  ? 138.845 130.994 102.729 1.00 0.00   ? 248  SER B C     1 
ATOM   4195  O  O     . SER B 1 248  ? 139.290 130.986 101.580 1.00 0.00   ? 248  SER B O     1 
ATOM   4196  C  CB    . SER B 1 248  ? 137.045 129.394 103.341 1.00 0.00   ? 248  SER B CB    1 
ATOM   4197  O  OG    . SER B 1 248  ? 137.460 128.517 102.312 1.00 0.00   ? 248  SER B OG    1 
ATOM   4198  N  N     . ILE B 1 249  ? 139.618 131.135 103.806 1.00 0.00   ? 249  ILE B N     1 
ATOM   4199  C  CA    . ILE B 1 249  ? 141.068 131.267 103.695 1.00 0.00   ? 249  ILE B CA    1 
ATOM   4200  C  C     . ILE B 1 249  ? 141.802 130.742 104.937 1.00 0.00   ? 249  ILE B C     1 
ATOM   4201  O  O     . ILE B 1 249  ? 141.489 131.134 106.062 1.00 0.00   ? 249  ILE B O     1 
ATOM   4202  C  CB    . ILE B 1 249  ? 141.465 132.736 103.486 1.00 0.00   ? 249  ILE B CB    1 
ATOM   4203  C  CG1   . ILE B 1 249  ? 142.968 132.845 103.201 1.00 0.00   ? 249  ILE B CG1   1 
ATOM   4204  C  CG2   . ILE B 1 249  ? 141.110 133.557 104.717 1.00 0.00   ? 249  ILE B CG2   1 
ATOM   4205  C  CD1   . ILE B 1 249  ? 143.428 132.100 101.955 1.00 0.00   ? 249  ILE B CD1   1 
ATOM   4206  N  N     . PHE B 1 250  ? 142.777 129.859 104.739 1.00 0.00   ? 250  PHE B N     1 
ATOM   4207  C  CA    . PHE B 1 250  ? 143.568 129.311 105.843 1.00 0.00   ? 250  PHE B CA    1 
ATOM   4208  C  C     . PHE B 1 250  ? 144.710 130.289 106.108 1.00 0.00   ? 250  PHE B C     1 
ATOM   4209  O  O     . PHE B 1 250  ? 145.806 130.142 105.569 1.00 0.00   ? 250  PHE B O     1 
ATOM   4210  C  CB    . PHE B 1 250  ? 144.130 127.937 105.472 1.00 0.00   ? 250  PHE B CB    1 
ATOM   4211  C  CG    . PHE B 1 250  ? 144.966 127.301 106.554 1.00 0.00   ? 250  PHE B CG    1 
ATOM   4212  C  CD1   . PHE B 1 250  ? 144.406 126.961 107.787 1.00 0.00   ? 250  PHE B CD1   1 
ATOM   4213  C  CD2   . PHE B 1 250  ? 146.307 127.009 106.333 1.00 0.00   ? 250  PHE B CD2   1 
ATOM   4214  C  CE1   . PHE B 1 250  ? 145.172 126.342 108.773 1.00 0.00   ? 250  PHE B CE1   1 
ATOM   4215  C  CE2   . PHE B 1 250  ? 147.084 126.388 107.315 1.00 0.00   ? 250  PHE B CE2   1 
ATOM   4216  C  CZ    . PHE B 1 250  ? 146.511 126.051 108.534 1.00 0.00   ? 250  PHE B CZ    1 
ATOM   4217  N  N     . LEU B 1 251  ? 144.443 131.285 106.947 1.00 0.00   ? 251  LEU B N     1 
ATOM   4218  C  CA    . LEU B 1 251  ? 145.425 132.309 107.254 1.00 0.00   ? 251  LEU B CA    1 
ATOM   4219  C  C     . LEU B 1 251  ? 146.327 132.035 108.453 1.00 0.00   ? 251  LEU B C     1 
ATOM   4220  O  O     . LEU B 1 251  ? 145.913 132.187 109.606 1.00 0.00   ? 251  LEU B O     1 
ATOM   4221  C  CB    . LEU B 1 251  ? 144.714 133.650 107.440 1.00 0.00   ? 251  LEU B CB    1 
ATOM   4222  C  CG    . LEU B 1 251  ? 145.533 134.925 107.693 1.00 0.00   ? 251  LEU B CG    1 
ATOM   4223  C  CD1   . LEU B 1 251  ? 144.648 136.134 107.456 1.00 0.00   ? 251  LEU B CD1   1 
ATOM   4224  C  CD2   . LEU B 1 251  ? 146.077 134.939 109.110 1.00 0.00   ? 251  LEU B CD2   1 
ATOM   4225  N  N     . VAL B 1 252  ? 147.559 131.619 108.172 1.00 0.00   ? 252  VAL B N     1 
ATOM   4226  C  CA    . VAL B 1 252  ? 148.553 131.365 109.214 1.00 0.00   ? 252  VAL B CA    1 
ATOM   4227  C  C     . VAL B 1 252  ? 149.609 132.450 109.072 1.00 0.00   ? 252  VAL B C     1 
ATOM   4228  O  O     . VAL B 1 252  ? 149.991 133.101 110.039 1.00 0.00   ? 252  VAL B O     1 
ATOM   4229  C  CB    . VAL B 1 252  ? 149.238 130.005 109.039 1.00 0.00   ? 252  VAL B CB    1 
ATOM   4230  C  CG1   . VAL B 1 252  ? 150.374 129.884 110.038 1.00 0.00   ? 252  VAL B CG1   1 
ATOM   4231  C  CG2   . VAL B 1 252  ? 148.240 128.886 109.249 1.00 0.00   ? 252  VAL B CG2   1 
ATOM   4232  N  N     . ALA B 1 253  ? 150.079 132.628 107.842 1.00 0.00   ? 253  ALA B N     1 
ATOM   4233  C  CA    . ALA B 1 253  ? 151.084 133.636 107.533 1.00 0.00   ? 253  ALA B CA    1 
ATOM   4234  C  C     . ALA B 1 253  ? 150.347 134.802 106.877 1.00 0.00   ? 253  ALA B C     1 
ATOM   4235  O  O     . ALA B 1 253  ? 149.233 134.634 106.376 1.00 0.00   ? 253  ALA B O     1 
ATOM   4236  C  CB    . ALA B 1 253  ? 152.123 133.069 106.580 1.00 0.00   ? 253  ALA B CB    1 
ATOM   4237  N  N     . PRO B 1 254  ? 150.957 135.995 106.865 1.00 0.00   ? 254  PRO B N     1 
ATOM   4238  C  CA    . PRO B 1 254  ? 150.253 137.114 106.236 1.00 0.00   ? 254  PRO B CA    1 
ATOM   4239  C  C     . PRO B 1 254  ? 149.943 136.745 104.795 1.00 0.00   ? 254  PRO B C     1 
ATOM   4240  O  O     . PRO B 1 254  ? 150.787 136.194 104.092 1.00 0.00   ? 254  PRO B O     1 
ATOM   4241  C  CB    . PRO B 1 254  ? 151.259 138.251 106.333 1.00 0.00   ? 254  PRO B CB    1 
ATOM   4242  C  CG    . PRO B 1 254  ? 151.962 137.948 107.612 1.00 0.00   ? 254  PRO B CG    1 
ATOM   4243  C  CD    . PRO B 1 254  ? 152.195 136.459 107.511 1.00 0.00   ? 254  PRO B CD    1 
ATOM   4244  N  N     . LEU B 1 255  ? 148.720 137.037 104.370 1.00 0.00   ? 255  LEU B N     1 
ATOM   4245  C  CA    . LEU B 1 255  ? 148.290 136.723 103.017 1.00 0.00   ? 255  LEU B CA    1 
ATOM   4246  C  C     . LEU B 1 255  ? 147.939 137.964 102.229 1.00 0.00   ? 255  LEU B C     1 
ATOM   4247  O  O     . LEU B 1 255  ? 147.617 139.013 102.793 1.00 0.00   ? 255  LEU B O     1 
ATOM   4248  C  CB    . LEU B 1 255  ? 147.068 135.809 103.055 1.00 0.00   ? 255  LEU B CB    1 
ATOM   4249  C  CG    . LEU B 1 255  ? 147.192 134.539 103.889 1.00 0.00   ? 255  LEU B CG    1 
ATOM   4250  C  CD1   . LEU B 1 255  ? 145.827 133.924 104.082 1.00 0.00   ? 255  LEU B CD1   1 
ATOM   4251  C  CD2   . LEU B 1 255  ? 148.139 133.567 103.212 1.00 0.00   ? 255  LEU B CD2   1 
ATOM   4252  N  N     . ILE B 1 256  ? 147.999 137.820 100.914 1.00 0.00   ? 256  ILE B N     1 
ATOM   4253  C  CA    . ILE B 1 256  ? 147.665 138.897 99.998  1.00 0.00   ? 256  ILE B CA    1 
ATOM   4254  C  C     . ILE B 1 256  ? 146.293 138.607 99.405  1.00 0.00   ? 256  ILE B C     1 
ATOM   4255  O  O     . ILE B 1 256  ? 146.152 137.758 98.517  1.00 0.00   ? 256  ILE B O     1 
ATOM   4256  C  CB    . ILE B 1 256  ? 148.686 138.995 98.847  1.00 0.00   ? 256  ILE B CB    1 
ATOM   4257  C  CG1   . ILE B 1 256  ? 150.050 139.464 99.386  1.00 0.00   ? 256  ILE B CG1   1 
ATOM   4258  C  CG2   . ILE B 1 256  ? 148.174 139.936 97.768  1.00 0.00   ? 256  ILE B CG2   1 
ATOM   4259  C  CD1   . ILE B 1 256  ? 150.002 140.812 100.081 1.00 0.00   ? 256  ILE B CD1   1 
ATOM   4260  N  N     . ILE B 1 257  ? 145.278 139.298 99.907  1.00 0.00   ? 257  ILE B N     1 
ATOM   4261  C  CA    . ILE B 1 257  ? 143.919 139.118 99.404  1.00 0.00   ? 257  ILE B CA    1 
ATOM   4262  C  C     . ILE B 1 257  ? 143.777 140.068 98.219  1.00 0.00   ? 257  ILE B C     1 
ATOM   4263  O  O     . ILE B 1 257  ? 144.170 141.232 98.307  1.00 0.00   ? 257  ILE B O     1 
ATOM   4264  C  CB    . ILE B 1 257  ? 142.864 139.466 100.473 1.00 0.00   ? 257  ILE B CB    1 
ATOM   4265  C  CG1   . ILE B 1 257  ? 143.153 138.689 101.766 1.00 0.00   ? 257  ILE B CG1   1 
ATOM   4266  C  CG2   . ILE B 1 257  ? 141.483 139.117 99.969  1.00 0.00   ? 257  ILE B CG2   1 
ATOM   4267  C  CD1   . ILE B 1 257  ? 143.222 137.186 101.587 1.00 0.00   ? 257  ILE B CD1   1 
ATOM   4268  N  N     . TYR B 1 258  ? 143.223 139.577 97.114  1.00 0.00   ? 258  TYR B N     1 
ATOM   4269  C  CA    . TYR B 1 258  ? 143.082 140.408 95.927  1.00 0.00   ? 258  TYR B CA    1 
ATOM   4270  C  C     . TYR B 1 258  ? 141.792 140.187 95.139  1.00 0.00   ? 258  TYR B C     1 
ATOM   4271  O  O     . TYR B 1 258  ? 141.132 139.154 95.276  1.00 0.00   ? 258  TYR B O     1 
ATOM   4272  C  CB    . TYR B 1 258  ? 144.287 140.192 95.007  1.00 0.00   ? 258  TYR B CB    1 
ATOM   4273  C  CG    . TYR B 1 258  ? 144.343 138.834 94.339  1.00 0.00   ? 258  TYR B CG    1 
ATOM   4274  C  CD1   . TYR B 1 258  ? 143.791 138.639 93.073  1.00 0.00   ? 258  TYR B CD1   1 
ATOM   4275  C  CD2   . TYR B 1 258  ? 144.940 137.743 94.973  1.00 0.00   ? 258  TYR B CD2   1 
ATOM   4276  C  CE1   . TYR B 1 258  ? 143.838 137.393 92.454  1.00 0.00   ? 258  TYR B CE1   1 
ATOM   4277  C  CE2   . TYR B 1 258  ? 144.986 136.493 94.358  1.00 0.00   ? 258  TYR B CE2   1 
ATOM   4278  C  CZ    . TYR B 1 258  ? 144.435 136.325 93.100  1.00 0.00   ? 258  TYR B CZ    1 
ATOM   4279  O  OH    . TYR B 1 258  ? 144.485 135.096 92.487  1.00 0.00   ? 258  TYR B OH    1 
ATOM   4280  N  N     . HIS B 1 259  ? 141.442 141.178 94.323  1.00 0.00   ? 259  HIS B N     1 
ATOM   4281  C  CA    . HIS B 1 259  ? 140.254 141.135 93.475  1.00 0.00   ? 259  HIS B CA    1 
ATOM   4282  C  C     . HIS B 1 259  ? 140.659 141.509 92.050  1.00 0.00   ? 259  HIS B C     1 
ATOM   4283  O  O     . HIS B 1 259  ? 141.176 142.602 91.807  1.00 0.00   ? 259  HIS B O     1 
ATOM   4284  C  CB    . HIS B 1 259  ? 139.199 142.126 93.972  1.00 0.00   ? 259  HIS B CB    1 
ATOM   4285  C  CG    . HIS B 1 259  ? 138.186 142.516 92.938  1.00 0.00   ? 259  HIS B CG    1 
ATOM   4286  N  ND1   . HIS B 1 259  ? 137.258 141.633 92.434  1.00 0.00   ? 259  HIS B ND1   1 
ATOM   4287  C  CD2   . HIS B 1 259  ? 137.948 143.701 92.328  1.00 0.00   ? 259  HIS B CD2   1 
ATOM   4288  C  CE1   . HIS B 1 259  ? 136.491 142.258 91.558  1.00 0.00   ? 259  HIS B CE1   1 
ATOM   4289  N  NE2   . HIS B 1 259  ? 136.886 143.514 91.477  1.00 0.00   ? 259  HIS B NE2   1 
ATOM   4290  N  N     . VAL B 1 260  ? 140.437 140.597 91.110  1.00 0.00   ? 260  VAL B N     1 
ATOM   4291  C  CA    . VAL B 1 260  ? 140.773 140.862 89.719  1.00 0.00   ? 260  VAL B CA    1 
ATOM   4292  C  C     . VAL B 1 260  ? 139.645 141.684 89.110  1.00 0.00   ? 260  VAL B C     1 
ATOM   4293  O  O     . VAL B 1 260  ? 138.491 141.272 89.146  1.00 0.00   ? 260  VAL B O     1 
ATOM   4294  C  CB    . VAL B 1 260  ? 140.938 139.554 88.922  1.00 0.00   ? 260  VAL B CB    1 
ATOM   4295  C  CG1   . VAL B 1 260  ? 141.173 139.865 87.459  1.00 0.00   ? 260  VAL B CG1   1 
ATOM   4296  C  CG2   . VAL B 1 260  ? 142.105 138.743 89.480  1.00 0.00   ? 260  VAL B CG2   1 
ATOM   4297  N  N     . ILE B 1 261  ? 139.984 142.846 88.555  1.00 0.00   ? 261  ILE B N     1 
ATOM   4298  C  CA    . ILE B 1 261  ? 138.986 143.733 87.956  1.00 0.00   ? 261  ILE B CA    1 
ATOM   4299  C  C     . ILE B 1 261  ? 138.574 143.294 86.555  1.00 0.00   ? 261  ILE B C     1 
ATOM   4300  O  O     . ILE B 1 261  ? 139.405 143.214 85.649  1.00 0.00   ? 261  ILE B O     1 
ATOM   4301  C  CB    . ILE B 1 261  ? 139.515 145.182 87.872  1.00 0.00   ? 261  ILE B CB    1 
ATOM   4302  C  CG1   . ILE B 1 261  ? 139.933 145.663 89.266  1.00 0.00   ? 261  ILE B CG1   1 
ATOM   4303  C  CG2   . ILE B 1 261  ? 138.443 146.092 87.286  1.00 0.00   ? 261  ILE B CG2   1 
ATOM   4304  C  CD1   . ILE B 1 261  ? 140.584 147.040 89.285  1.00 0.00   ? 261  ILE B CD1   1 
ATOM   4305  N  N     . ASP B 1 262  ? 137.285 143.013 86.384  1.00 0.00   ? 262  ASP B N     1 
ATOM   4306  C  CA    . ASP B 1 262  ? 136.756 142.588 85.091  1.00 0.00   ? 262  ASP B CA    1 
ATOM   4307  C  C     . ASP B 1 262  ? 135.503 143.376 84.712  1.00 0.00   ? 262  ASP B C     1 
ATOM   4308  O  O     . ASP B 1 262  ? 135.171 144.374 85.346  1.00 0.00   ? 262  ASP B O     1 
ATOM   4309  C  CB    . ASP B 1 262  ? 136.446 141.087 85.096  1.00 0.00   ? 262  ASP B CB    1 
ATOM   4310  C  CG    . ASP B 1 262  ? 135.373 140.709 86.099  1.00 0.00   ? 262  ASP B CG    1 
ATOM   4311  O  OD1   . ASP B 1 262  ? 134.607 141.593 86.534  1.00 0.00   ? 262  ASP B OD1   1 
ATOM   4312  O  OD2   . ASP B 1 262  ? 135.277 139.509 86.439  1.00 0.00   ? 262  ASP B OD2   1 
ATOM   4313  N  N     . SER B 1 263  ? 134.815 142.912 83.669  1.00 0.00   ? 263  SER B N     1 
ATOM   4314  C  CA    . SER B 1 263  ? 133.603 143.568 83.185  1.00 0.00   ? 263  SER B CA    1 
ATOM   4315  C  C     . SER B 1 263  ? 132.486 143.648 84.223  1.00 0.00   ? 263  SER B C     1 
ATOM   4316  O  O     . SER B 1 263  ? 131.564 144.452 84.085  1.00 0.00   ? 263  SER B O     1 
ATOM   4317  C  CB    . SER B 1 263  ? 133.087 142.860 81.928  1.00 0.00   ? 263  SER B CB    1 
ATOM   4318  O  OG    . SER B 1 263  ? 132.788 141.496 82.177  1.00 0.00   ? 263  SER B OG    1 
ATOM   4319  N  N     . ASN B 1 264  ? 132.564 142.824 85.264  1.00 0.00   ? 264  ASN B N     1 
ATOM   4320  C  CA    . ASN B 1 264  ? 131.535 142.825 86.300  1.00 0.00   ? 264  ASN B CA    1 
ATOM   4321  C  C     . ASN B 1 264  ? 131.964 143.526 87.587  1.00 0.00   ? 264  ASN B C     1 
ATOM   4322  O  O     . ASN B 1 264  ? 131.193 143.616 88.542  1.00 0.00   ? 264  ASN B O     1 
ATOM   4323  C  CB    . ASN B 1 264  ? 131.099 141.392 86.621  1.00 0.00   ? 264  ASN B CB    1 
ATOM   4324  C  CG    . ASN B 1 264  ? 130.476 140.690 85.427  1.00 0.00   ? 264  ASN B CG    1 
ATOM   4325  O  OD1   . ASN B 1 264  ? 129.575 141.223 84.782  1.00 0.00   ? 264  ASN B OD1   1 
ATOM   4326  N  ND2   . ASN B 1 264  ? 130.946 139.481 85.141  1.00 0.00   ? 264  ASN B ND2   1 
ATOM   4327  N  N     . SER B 1 265  ? 133.196 144.024 87.610  1.00 0.00   ? 265  SER B N     1 
ATOM   4328  C  CA    . SER B 1 265  ? 133.719 144.709 88.783  1.00 0.00   ? 265  SER B CA    1 
ATOM   4329  C  C     . SER B 1 265  ? 133.425 146.202 88.708  1.00 0.00   ? 265  SER B C     1 
ATOM   4330  O  O     . SER B 1 265  ? 133.562 146.816 87.653  1.00 0.00   ? 265  SER B O     1 
ATOM   4331  C  CB    . SER B 1 265  ? 135.227 144.486 88.885  1.00 0.00   ? 265  SER B CB    1 
ATOM   4332  O  OG    . SER B 1 265  ? 135.785 145.215 89.963  1.00 0.00   ? 265  SER B OG    1 
ATOM   4333  N  N     . PRO B 1 266  ? 133.019 146.805 89.837  1.00 0.00   ? 266  PRO B N     1 
ATOM   4334  C  CA    . PRO B 1 266  ? 132.711 148.236 89.867  1.00 0.00   ? 266  PRO B CA    1 
ATOM   4335  C  C     . PRO B 1 266  ? 133.958 149.103 89.719  1.00 0.00   ? 266  PRO B C     1 
ATOM   4336  O  O     . PRO B 1 266  ? 133.863 150.320 89.584  1.00 0.00   ? 266  PRO B O     1 
ATOM   4337  C  CB    . PRO B 1 266  ? 132.042 148.406 91.225  1.00 0.00   ? 266  PRO B CB    1 
ATOM   4338  C  CG    . PRO B 1 266  ? 132.794 147.425 92.066  1.00 0.00   ? 266  PRO B CG    1 
ATOM   4339  C  CD    . PRO B 1 266  ? 132.846 146.206 91.170  1.00 0.00   ? 266  PRO B CD    1 
ATOM   4340  N  N     . LEU B 1 267  ? 135.128 148.473 89.745  1.00 0.00   ? 267  LEU B N     1 
ATOM   4341  C  CA    . LEU B 1 267  ? 136.392 149.191 89.616  1.00 0.00   ? 267  LEU B CA    1 
ATOM   4342  C  C     . LEU B 1 267  ? 136.915 149.111 88.182  1.00 0.00   ? 267  LEU B C     1 
ATOM   4343  O  O     . LEU B 1 267  ? 138.056 149.484 87.903  1.00 0.00   ? 267  LEU B O     1 
ATOM   4344  C  CB    . LEU B 1 267  ? 137.430 148.599 90.580  1.00 0.00   ? 267  LEU B CB    1 
ATOM   4345  C  CG    . LEU B 1 267  ? 136.982 148.388 92.030  1.00 0.00   ? 267  LEU B CG    1 
ATOM   4346  C  CD1   . LEU B 1 267  ? 138.113 147.738 92.810  1.00 0.00   ? 267  LEU B CD1   1 
ATOM   4347  C  CD2   . LEU B 1 267  ? 136.582 149.712 92.666  1.00 0.00   ? 267  LEU B CD2   1 
ATOM   4348  N  N     . TYR B 1 268  ? 136.066 148.636 87.275  1.00 0.00   ? 268  TYR B N     1 
ATOM   4349  C  CA    . TYR B 1 268  ? 136.433 148.494 85.868  1.00 0.00   ? 268  TYR B CA    1 
ATOM   4350  C  C     . TYR B 1 268  ? 136.750 149.840 85.221  1.00 0.00   ? 268  TYR B C     1 
ATOM   4351  O  O     . TYR B 1 268  ? 137.440 149.894 84.206  1.00 0.00   ? 268  TYR B O     1 
ATOM   4352  C  CB    . TYR B 1 268  ? 135.301 147.808 85.099  1.00 0.00   ? 268  TYR B CB    1 
ATOM   4353  C  CG    . TYR B 1 268  ? 135.719 147.172 83.785  1.00 0.00   ? 268  TYR B CG    1 
ATOM   4354  C  CD1   . TYR B 1 268  ? 136.741 146.219 83.736  1.00 0.00   ? 268  TYR B CD1   1 
ATOM   4355  C  CD2   . TYR B 1 268  ? 135.072 147.496 82.593  1.00 0.00   ? 268  TYR B CD2   1 
ATOM   4356  C  CE1   . TYR B 1 268  ? 137.100 145.608 82.537  1.00 0.00   ? 268  TYR B CE1   1 
ATOM   4357  C  CE2   . TYR B 1 268  ? 135.423 146.890 81.391  1.00 0.00   ? 268  TYR B CE2   1 
ATOM   4358  C  CZ    . TYR B 1 268  ? 136.436 145.951 81.368  1.00 0.00   ? 268  TYR B CZ    1 
ATOM   4359  O  OH    . TYR B 1 268  ? 136.773 145.363 80.175  1.00 0.00   ? 268  TYR B OH    1 
ATOM   4360  N  N     . ASP B 1 269  ? 136.231 150.923 85.797  1.00 0.00   ? 269  ASP B N     1 
ATOM   4361  C  CA    . ASP B 1 269  ? 136.466 152.268 85.262  1.00 0.00   ? 269  ASP B CA    1 
ATOM   4362  C  C     . ASP B 1 269  ? 137.299 153.186 86.158  1.00 0.00   ? 269  ASP B C     1 
ATOM   4363  O  O     . ASP B 1 269  ? 137.166 154.409 86.085  1.00 0.00   ? 269  ASP B O     1 
ATOM   4364  C  CB    . ASP B 1 269  ? 135.134 152.959 84.966  1.00 0.00   ? 269  ASP B CB    1 
ATOM   4365  C  CG    . ASP B 1 269  ? 134.328 152.242 83.905  1.00 0.00   ? 269  ASP B CG    1 
ATOM   4366  O  OD1   . ASP B 1 269  ? 134.835 152.084 82.771  1.00 0.00   ? 269  ASP B OD1   1 
ATOM   4367  O  OD2   . ASP B 1 269  ? 133.183 151.838 84.196  1.00 0.00   ? 269  ASP B OD2   1 
ATOM   4368  N  N     . LEU B 1 270  ? 138.147 152.607 86.999  1.00 0.00   ? 270  LEU B N     1 
ATOM   4369  C  CA    . LEU B 1 270  ? 138.974 153.407 87.894  1.00 0.00   ? 270  LEU B CA    1 
ATOM   4370  C  C     . LEU B 1 270  ? 140.019 154.239 87.164  1.00 0.00   ? 270  LEU B C     1 
ATOM   4371  O  O     . LEU B 1 270  ? 140.720 153.744 86.284  1.00 0.00   ? 270  LEU B O     1 
ATOM   4372  C  CB    . LEU B 1 270  ? 139.673 152.509 88.917  1.00 0.00   ? 270  LEU B CB    1 
ATOM   4373  C  CG    . LEU B 1 270  ? 138.833 151.974 90.074  1.00 0.00   ? 270  LEU B CG    1 
ATOM   4374  C  CD1   . LEU B 1 270  ? 139.713 151.084 90.930  1.00 0.00   ? 270  LEU B CD1   1 
ATOM   4375  C  CD2   . LEU B 1 270  ? 138.272 153.120 90.904  1.00 0.00   ? 270  LEU B CD2   1 
ATOM   4376  N  N     . ALA B 1 271  ? 140.105 155.511 87.538  1.00 0.00   ? 271  ALA B N     1 
ATOM   4377  C  CA    . ALA B 1 271  ? 141.072 156.416 86.946  1.00 0.00   ? 271  ALA B CA    1 
ATOM   4378  C  C     . ALA B 1 271  ? 142.322 156.320 87.817  1.00 0.00   ? 271  ALA B C     1 
ATOM   4379  O  O     . ALA B 1 271  ? 142.244 156.479 89.028  1.00 0.00   ? 271  ALA B O     1 
ATOM   4380  C  CB    . ALA B 1 271  ? 140.520 157.833 86.953  1.00 0.00   ? 271  ALA B CB    1 
ATOM   4381  N  N     . PRO B 1 272  ? 143.494 156.067 87.213  1.00 0.00   ? 272  PRO B N     1 
ATOM   4382  C  CA    . PRO B 1 272  ? 144.717 155.953 88.011  1.00 0.00   ? 272  PRO B CA    1 
ATOM   4383  C  C     . PRO B 1 272  ? 145.107 157.168 88.856  1.00 0.00   ? 272  PRO B C     1 
ATOM   4384  O  O     . PRO B 1 272  ? 145.895 157.045 89.794  1.00 0.00   ? 272  PRO B O     1 
ATOM   4385  C  CB    . PRO B 1 272  ? 145.780 155.616 86.967  1.00 0.00   ? 272  PRO B CB    1 
ATOM   4386  C  CG    . PRO B 1 272  ? 145.004 154.854 85.936  1.00 0.00   ? 272  PRO B CG    1 
ATOM   4387  C  CD    . PRO B 1 272  ? 143.744 155.676 85.813  1.00 0.00   ? 272  PRO B CD    1 
ATOM   4388  N  N     . SER B 1 273  ? 144.581 158.345 88.514  1.00 0.00   ? 273  SER B N     1 
ATOM   4389  C  CA    . SER B 1 273  ? 144.903 159.556 89.264  1.00 0.00   ? 273  SER B CA    1 
ATOM   4390  C  C     . SER B 1 273  ? 143.759 160.193 90.053  1.00 0.00   ? 273  SER B C     1 
ATOM   4391  O  O     . SER B 1 273  ? 143.934 160.563 91.213  1.00 0.00   ? 273  SER B O     1 
ATOM   4392  C  CB    . SER B 1 273  ? 145.516 160.607 88.337  1.00 0.00   ? 273  SER B CB    1 
ATOM   4393  O  OG    . SER B 1 273  ? 144.584 161.048 87.373  1.00 0.00   ? 273  SER B OG    1 
ATOM   4394  N  N     . ASP B 1 274  ? 142.595 160.338 89.424  1.00 0.00   ? 274  ASP B N     1 
ATOM   4395  C  CA    . ASP B 1 274  ? 141.443 160.968 90.076  1.00 0.00   ? 274  ASP B CA    1 
ATOM   4396  C  C     . ASP B 1 274  ? 140.647 160.063 91.015  1.00 0.00   ? 274  ASP B C     1 
ATOM   4397  O  O     . ASP B 1 274  ? 139.917 160.544 91.884  1.00 0.00   ? 274  ASP B O     1 
ATOM   4398  C  CB    . ASP B 1 274  ? 140.490 161.548 89.027  1.00 0.00   ? 274  ASP B CB    1 
ATOM   4399  C  CG    . ASP B 1 274  ? 141.192 162.461 88.041  1.00 0.00   ? 274  ASP B CG    1 
ATOM   4400  O  OD1   . ASP B 1 274  ? 142.235 163.052 88.408  1.00 0.00   ? 274  ASP B OD1   1 
ATOM   4401  O  OD2   . ASP B 1 274  ? 140.699 162.602 86.901  1.00 0.00   ? 274  ASP B OD2   1 
ATOM   4402  N  N     . LEU B 1 275  ? 140.790 158.753 90.842  1.00 0.00   ? 275  LEU B N     1 
ATOM   4403  C  CA    . LEU B 1 275  ? 140.073 157.792 91.670  1.00 0.00   ? 275  LEU B CA    1 
ATOM   4404  C  C     . LEU B 1 275  ? 140.461 157.974 93.125  1.00 0.00   ? 275  LEU B C     1 
ATOM   4405  O  O     . LEU B 1 275  ? 139.656 157.741 94.029  1.00 0.00   ? 275  LEU B O     1 
ATOM   4406  C  CB    . LEU B 1 275  ? 140.396 156.354 91.239  1.00 0.00   ? 275  LEU B CB    1 
ATOM   4407  N  N     . HIS B 1 276  ? 141.701 158.392 93.342  1.00 0.00   ? 276  HIS B N     1 
ATOM   4408  C  CA    . HIS B 1 276  ? 142.233 158.568 94.684  1.00 0.00   ? 276  HIS B CA    1 
ATOM   4409  C  C     . HIS B 1 276  ? 141.738 159.777 95.466  1.00 0.00   ? 276  HIS B C     1 
ATOM   4410  O  O     . HIS B 1 276  ? 141.431 159.666 96.647  1.00 0.00   ? 276  HIS B O     1 
ATOM   4411  C  CB    . HIS B 1 276  ? 143.761 158.608 94.620  1.00 0.00   ? 276  HIS B CB    1 
ATOM   4412  C  CG    . HIS B 1 276  ? 144.366 157.362 94.050  1.00 0.00   ? 276  HIS B CG    1 
ATOM   4413  N  ND1   . HIS B 1 276  ? 144.247 156.130 94.654  1.00 0.00   ? 276  HIS B ND1   1 
ATOM   4414  C  CD2   . HIS B 1 276  ? 145.084 157.160 92.922  1.00 0.00   ? 276  HIS B CD2   1 
ATOM   4415  C  CE1   . HIS B 1 276  ? 144.868 155.220 93.921  1.00 0.00   ? 276  HIS B CE1   1 
ATOM   4416  N  NE2   . HIS B 1 276  ? 145.385 155.821 92.864  1.00 0.00   ? 276  HIS B NE2   1 
ATOM   4417  N  N     . HIS B 1 277  ? 141.666 160.935 94.824  1.00 0.00   ? 277  HIS B N     1 
ATOM   4418  C  CA    . HIS B 1 277  ? 141.247 162.138 95.540  1.00 0.00   ? 277  HIS B CA    1 
ATOM   4419  C  C     . HIS B 1 277  ? 139.916 162.809 95.210  1.00 0.00   ? 277  HIS B C     1 
ATOM   4420  O  O     . HIS B 1 277  ? 139.186 163.198 96.114  1.00 0.00   ? 277  HIS B O     1 
ATOM   4421  C  CB    . HIS B 1 277  ? 142.384 163.156 95.460  1.00 0.00   ? 277  HIS B CB    1 
ATOM   4422  C  CG    . HIS B 1 277  ? 143.727 162.577 95.798  1.00 0.00   ? 277  HIS B CG    1 
ATOM   4423  N  ND1   . HIS B 1 277  ? 144.062 162.165 97.072  1.00 0.00   ? 277  HIS B ND1   1 
ATOM   4424  C  CD2   . HIS B 1 277  ? 144.796 162.295 95.021  1.00 0.00   ? 277  HIS B CD2   1 
ATOM   4425  C  CE1   . HIS B 1 277  ? 145.279 161.653 97.062  1.00 0.00   ? 277  HIS B CE1   1 
ATOM   4426  N  NE2   . HIS B 1 277  ? 145.750 161.720 95.829  1.00 0.00   ? 277  HIS B NE2   1 
ATOM   4427  N  N     . HIS B 1 278  ? 139.590 162.942 93.931  1.00 0.00   ? 278  HIS B N     1 
ATOM   4428  C  CA    . HIS B 1 278  ? 138.337 163.600 93.543  1.00 0.00   ? 278  HIS B CA    1 
ATOM   4429  C  C     . HIS B 1 278  ? 137.107 162.714 93.689  1.00 0.00   ? 278  HIS B C     1 
ATOM   4430  O  O     . HIS B 1 278  ? 135.997 163.206 93.898  1.00 0.00   ? 278  HIS B O     1 
ATOM   4431  C  CB    . HIS B 1 278  ? 138.447 164.133 92.118  1.00 0.00   ? 278  HIS B CB    1 
ATOM   4432  C  CG    . HIS B 1 278  ? 139.627 165.029 91.909  1.00 0.00   ? 278  HIS B CG    1 
ATOM   4433  N  ND1   . HIS B 1 278  ? 139.765 166.240 92.547  1.00 0.00   ? 278  HIS B ND1   1 
ATOM   4434  C  CD2   . HIS B 1 278  ? 140.745 164.869 91.160  1.00 0.00   ? 278  HIS B CD2   1 
ATOM   4435  C  CE1   . HIS B 1 278  ? 140.915 166.788 92.208  1.00 0.00   ? 278  HIS B CE1   1 
ATOM   4436  N  NE2   . HIS B 1 278  ? 141.531 165.976 91.367  1.00 0.00   ? 278  HIS B NE2   1 
ATOM   4437  N  N     . GLN B 1 279  ? 137.301 161.407 93.574  1.00 0.00   ? 279  GLN B N     1 
ATOM   4438  C  CA    . GLN B 1 279  ? 136.210 160.464 93.757  1.00 0.00   ? 279  GLN B CA    1 
ATOM   4439  C  C     . GLN B 1 279  ? 136.279 160.144 95.246  1.00 0.00   ? 279  GLN B C     1 
ATOM   4440  O  O     . GLN B 1 279  ? 137.362 160.166 95.832  1.00 0.00   ? 279  GLN B O     1 
ATOM   4441  C  CB    . GLN B 1 279  ? 136.424 159.188 92.936  1.00 0.00   ? 279  GLN B CB    1 
ATOM   4442  C  CG    . GLN B 1 279  ? 136.462 159.379 91.419  1.00 0.00   ? 279  GLN B CG    1 
ATOM   4443  C  CD    . GLN B 1 279  ? 136.482 158.055 90.672  1.00 0.00   ? 279  GLN B CD    1 
ATOM   4444  O  OE1   . GLN B 1 279  ? 136.641 156.993 91.275  1.00 0.00   ? 279  GLN B OE1   1 
ATOM   4445  N  NE2   . GLN B 1 279  ? 136.325 158.112 89.353  1.00 0.00   ? 279  GLN B NE2   1 
ATOM   4446  N  N     . ASP B 1 280  ? 135.139 159.868 95.869  1.00 0.00   ? 280  ASP B N     1 
ATOM   4447  C  CA    . ASP B 1 280  ? 135.140 159.573 97.297  1.00 0.00   ? 280  ASP B CA    1 
ATOM   4448  C  C     . ASP B 1 280  ? 134.505 158.219 97.591  1.00 0.00   ? 280  ASP B C     1 
ATOM   4449  O  O     . ASP B 1 280  ? 133.424 158.138 98.182  1.00 0.00   ? 280  ASP B O     1 
ATOM   4450  C  CB    . ASP B 1 280  ? 134.416 160.691 98.059  1.00 0.00   ? 280  ASP B CB    1 
ATOM   4451  C  CG    . ASP B 1 280  ? 134.707 160.672 99.544  1.00 0.00   ? 280  ASP B CG    1 
ATOM   4452  O  OD1   . ASP B 1 280  ? 135.738 160.086 99.935  1.00 0.00   ? 280  ASP B OD1   1 
ATOM   4453  O  OD2   . ASP B 1 280  ? 133.919 161.252 100.327 1.00 0.00   ? 280  ASP B OD2   1 
ATOM   4454  N  N     . LEU B 1 281  ? 135.192 157.152 97.183  1.00 0.00   ? 281  LEU B N     1 
ATOM   4455  C  CA    . LEU B 1 281  ? 134.706 155.791 97.384  1.00 0.00   ? 281  LEU B CA    1 
ATOM   4456  C  C     . LEU B 1 281  ? 135.381 155.151 98.595  1.00 0.00   ? 281  LEU B C     1 
ATOM   4457  O  O     . LEU B 1 281  ? 136.392 155.652 99.086  1.00 0.00   ? 281  LEU B O     1 
ATOM   4458  C  CB    . LEU B 1 281  ? 134.985 154.952 96.134  1.00 0.00   ? 281  LEU B CB    1 
ATOM   4459  C  CG    . LEU B 1 281  ? 134.519 155.569 94.813  1.00 0.00   ? 281  LEU B CG    1 
ATOM   4460  C  CD1   . LEU B 1 281  ? 135.003 154.727 93.642  1.00 0.00   ? 281  LEU B CD1   1 
ATOM   4461  C  CD2   . LEU B 1 281  ? 133.008 155.687 94.814  1.00 0.00   ? 281  LEU B CD2   1 
ATOM   4462  N  N     . GLU B 1 282  ? 134.817 154.044 99.070  1.00 0.00   ? 282  GLU B N     1 
ATOM   4463  C  CA    . GLU B 1 282  ? 135.367 153.337 100.219 1.00 0.00   ? 282  GLU B CA    1 
ATOM   4464  C  C     . GLU B 1 282  ? 135.235 151.828 100.070 1.00 0.00   ? 282  GLU B C     1 
ATOM   4465  O  O     . GLU B 1 282  ? 134.163 151.317 99.738  1.00 0.00   ? 282  GLU B O     1 
ATOM   4466  C  CB    . GLU B 1 282  ? 134.667 153.779 101.507 1.00 0.00   ? 282  GLU B CB    1 
ATOM   4467  C  CG    . GLU B 1 282  ? 135.314 153.262 102.787 1.00 0.00   ? 282  GLU B CG    1 
ATOM   4468  C  CD    . GLU B 1 282  ? 134.575 153.694 104.040 1.00 0.00   ? 282  GLU B CD    1 
ATOM   4469  O  OE1   . GLU B 1 282  ? 133.844 154.707 103.976 1.00 0.00   ? 282  GLU B OE1   1 
ATOM   4470  O  OE2   . GLU B 1 282  ? 134.733 153.036 105.094 1.00 0.00   ? 282  GLU B OE2   1 
ATOM   4471  N  N     . ILE B 1 283  ? 136.340 151.127 100.320 1.00 0.00   ? 283  ILE B N     1 
ATOM   4472  C  CA    . ILE B 1 283  ? 136.376 149.674 100.236 1.00 0.00   ? 283  ILE B CA    1 
ATOM   4473  C  C     . ILE B 1 283  ? 136.232 149.088 101.635 1.00 0.00   ? 283  ILE B C     1 
ATOM   4474  O  O     . ILE B 1 283  ? 137.052 149.360 102.520 1.00 0.00   ? 283  ILE B O     1 
ATOM   4475  C  CB    . ILE B 1 283  ? 137.709 149.176 99.626  1.00 0.00   ? 283  ILE B CB    1 
ATOM   4476  C  CG1   . ILE B 1 283  ? 137.941 149.828 98.256  1.00 0.00   ? 283  ILE B CG1   1 
ATOM   4477  C  CG2   . ILE B 1 283  ? 137.682 147.663 99.487  1.00 0.00   ? 283  ILE B CG2   1 
ATOM   4478  C  CD1   . ILE B 1 283  ? 136.850 149.555 97.243  1.00 0.00   ? 283  ILE B CD1   1 
ATOM   4479  N  N     . ILE B 1 284  ? 135.190 148.295 101.831 1.00 0.00   ? 284  ILE B N     1 
ATOM   4480  C  CA    . ILE B 1 284  ? 134.944 147.669 103.124 1.00 0.00   ? 284  ILE B CA    1 
ATOM   4481  C  C     . ILE B 1 284  ? 135.437 146.228 103.094 1.00 0.00   ? 284  ILE B C     1 
ATOM   4482  O  O     . ILE B 1 284  ? 135.027 145.434 102.245 1.00 0.00   ? 284  ILE B O     1 
ATOM   4483  C  CB    . ILE B 1 284  ? 133.439 147.665 103.479 1.00 0.00   ? 284  ILE B CB    1 
ATOM   4484  C  CG1   . ILE B 1 284  ? 132.876 149.089 103.387 1.00 0.00   ? 284  ILE B CG1   1 
ATOM   4485  C  CG2   . ILE B 1 284  ? 133.245 147.127 104.886 1.00 0.00   ? 284  ILE B CG2   1 
ATOM   4486  C  CD1   . ILE B 1 284  ? 133.558 150.093 104.297 1.00 0.00   ? 284  ILE B CD1   1 
ATOM   4487  N  N     . VAL B 1 285  ? 136.331 145.905 104.021 1.00 0.00   ? 285  VAL B N     1 
ATOM   4488  C  CA    . VAL B 1 285  ? 136.895 144.566 104.122 1.00 0.00   ? 285  VAL B CA    1 
ATOM   4489  C  C     . VAL B 1 285  ? 136.443 143.883 105.406 1.00 0.00   ? 285  VAL B C     1 
ATOM   4490  O  O     . VAL B 1 285  ? 136.762 144.329 106.506 1.00 0.00   ? 285  VAL B O     1 
ATOM   4491  C  CB    . VAL B 1 285  ? 138.434 144.600 104.114 1.00 0.00   ? 285  VAL B CB    1 
ATOM   4492  C  CG1   . VAL B 1 285  ? 138.980 143.186 104.128 1.00 0.00   ? 285  VAL B CG1   1 
ATOM   4493  C  CG2   . VAL B 1 285  ? 138.935 145.350 102.889 1.00 0.00   ? 285  VAL B CG2   1 
ATOM   4494  N  N     . ILE B 1 286  ? 135.702 142.791 105.256 1.00 0.00   ? 286  ILE B N     1 
ATOM   4495  C  CA    . ILE B 1 286  ? 135.202 142.060 106.412 1.00 0.00   ? 286  ILE B CA    1 
ATOM   4496  C  C     . ILE B 1 286  ? 135.844 140.684 106.547 1.00 0.00   ? 286  ILE B C     1 
ATOM   4497  O  O     . ILE B 1 286  ? 135.860 139.895 105.599 1.00 0.00   ? 286  ILE B O     1 
ATOM   4498  C  CB    . ILE B 1 286  ? 133.669 141.874 106.338 1.00 0.00   ? 286  ILE B CB    1 
ATOM   4499  C  CG1   . ILE B 1 286  ? 132.987 143.232 106.146 1.00 0.00   ? 286  ILE B CG1   1 
ATOM   4500  C  CG2   . ILE B 1 286  ? 133.170 141.211 107.615 1.00 0.00   ? 286  ILE B CG2   1 
ATOM   4501  C  CD1   . ILE B 1 286  ? 133.272 144.234 107.245 1.00 0.00   ? 286  ILE B CD1   1 
ATOM   4502  N  N     . LEU B 1 287  ? 136.374 140.404 107.733 1.00 0.00   ? 287  LEU B N     1 
ATOM   4503  C  CA    . LEU B 1 287  ? 136.996 139.114 108.005 1.00 0.00   ? 287  LEU B CA    1 
ATOM   4504  C  C     . LEU B 1 287  ? 136.242 138.421 109.132 1.00 0.00   ? 287  LEU B C     1 
ATOM   4505  O  O     . LEU B 1 287  ? 136.352 138.810 110.298 1.00 0.00   ? 287  LEU B O     1 
ATOM   4506  C  CB    . LEU B 1 287  ? 138.467 139.293 108.392 1.00 0.00   ? 287  LEU B CB    1 
ATOM   4507  C  CG    . LEU B 1 287  ? 139.209 138.022 108.824 1.00 0.00   ? 287  LEU B CG    1 
ATOM   4508  C  CD1   . LEU B 1 287  ? 139.169 136.992 107.706 1.00 0.00   ? 287  LEU B CD1   1 
ATOM   4509  C  CD2   . LEU B 1 287  ? 140.647 138.354 109.191 1.00 0.00   ? 287  LEU B CD2   1 
ATOM   4510  N  N     . GLU B 1 288  ? 135.469 137.401 108.782 1.00 0.00   ? 288  GLU B N     1 
ATOM   4511  C  CA    . GLU B 1 288  ? 134.694 136.657 109.766 1.00 0.00   ? 288  GLU B CA    1 
ATOM   4512  C  C     . GLU B 1 288  ? 135.380 135.331 110.102 1.00 0.00   ? 288  GLU B C     1 
ATOM   4513  O  O     . GLU B 1 288  ? 136.362 134.954 109.463 1.00 0.00   ? 288  GLU B O     1 
ATOM   4514  C  CB    . GLU B 1 288  ? 133.277 136.405 109.236 1.00 0.00   ? 288  GLU B CB    1 
ATOM   4515  C  CG    . GLU B 1 288  ? 132.594 137.659 108.698 1.00 0.00   ? 288  GLU B CG    1 
ATOM   4516  C  CD    . GLU B 1 288  ? 131.131 137.437 108.363 1.00 0.00   ? 288  GLU B CD    1 
ATOM   4517  O  OE1   . GLU B 1 288  ? 130.820 136.458 107.648 1.00 0.00   ? 288  GLU B OE1   1 
ATOM   4518  O  OE2   . GLU B 1 288  ? 130.289 138.244 108.815 1.00 0.00   ? 288  GLU B OE2   1 
ATOM   4519  N  N     . GLY B 1 289  ? 134.863 134.642 111.115 1.00 0.00   ? 289  GLY B N     1 
ATOM   4520  C  CA    . GLY B 1 289  ? 135.433 133.369 111.525 1.00 0.00   ? 289  GLY B CA    1 
ATOM   4521  C  C     . GLY B 1 289  ? 135.246 133.118 113.008 1.00 0.00   ? 289  GLY B C     1 
ATOM   4522  O  O     . GLY B 1 289  ? 134.856 134.021 113.750 1.00 0.00   ? 289  GLY B O     1 
ATOM   4523  N  N     . VAL B 1 290  ? 135.534 131.900 113.445 1.00 0.00   ? 290  VAL B N     1 
ATOM   4524  C  CA    . VAL B 1 290  ? 135.378 131.548 114.851 1.00 0.00   ? 290  VAL B CA    1 
ATOM   4525  C  C     . VAL B 1 290  ? 136.708 131.282 115.549 1.00 0.00   ? 290  VAL B C     1 
ATOM   4526  O  O     . VAL B 1 290  ? 137.617 130.684 114.972 1.00 0.00   ? 290  VAL B O     1 
ATOM   4527  C  CB    . VAL B 1 290  ? 134.492 130.300 115.020 1.00 0.00   ? 290  VAL B CB    1 
ATOM   4528  C  CG1   . VAL B 1 290  ? 135.072 129.134 114.242 1.00 0.00   ? 290  VAL B CG1   1 
ATOM   4529  C  CG2   . VAL B 1 290  ? 134.393 129.944 116.483 1.00 0.00   ? 290  VAL B CG2   1 
ATOM   4530  N  N     . VAL B 1 291  ? 136.816 131.734 116.796 1.00 0.00   ? 291  VAL B N     1 
ATOM   4531  C  CA    . VAL B 1 291  ? 138.032 131.517 117.567 1.00 0.00   ? 291  VAL B CA    1 
ATOM   4532  C  C     . VAL B 1 291  ? 138.072 130.048 117.971 1.00 0.00   ? 291  VAL B C     1 
ATOM   4533  O  O     . VAL B 1 291  ? 137.119 129.529 118.546 1.00 0.00   ? 291  VAL B O     1 
ATOM   4534  C  CB    . VAL B 1 291  ? 138.067 132.377 118.851 1.00 0.00   ? 291  VAL B CB    1 
ATOM   4535  C  CG1   . VAL B 1 291  ? 139.347 132.095 119.613 1.00 0.00   ? 291  VAL B CG1   1 
ATOM   4536  C  CG2   . VAL B 1 291  ? 137.979 133.859 118.505 1.00 0.00   ? 291  VAL B CG2   1 
ATOM   4537  N  N     . GLU B 1 292  ? 139.185 129.383 117.675 1.00 0.00   ? 292  GLU B N     1 
ATOM   4538  C  CA    . GLU B 1 292  ? 139.356 127.971 117.984 1.00 0.00   ? 292  GLU B CA    1 
ATOM   4539  C  C     . GLU B 1 292  ? 139.226 127.643 119.470 1.00 0.00   ? 292  GLU B C     1 
ATOM   4540  O  O     . GLU B 1 292  ? 138.951 126.500 119.832 1.00 0.00   ? 292  GLU B O     1 
ATOM   4541  C  CB    . GLU B 1 292  ? 140.728 127.496 117.499 1.00 0.00   ? 292  GLU B CB    1 
ATOM   4542  C  CG    . GLU B 1 292  ? 141.882 128.286 118.100 1.00 0.00   ? 292  GLU B CG    1 
ATOM   4543  C  CD    . GLU B 1 292  ? 143.226 127.608 117.899 1.00 0.00   ? 292  GLU B CD    1 
ATOM   4544  O  OE1   . GLU B 1 292  ? 143.602 127.356 116.733 1.00 0.00   ? 292  GLU B OE1   1 
ATOM   4545  O  OE2   . GLU B 1 292  ? 143.911 127.333 118.909 1.00 0.00   ? 292  GLU B OE2   1 
ATOM   4546  N  N     . THR B 1 293  ? 139.418 128.638 120.326 1.00 0.00   ? 293  THR B N     1 
ATOM   4547  C  CA    . THR B 1 293  ? 139.357 128.409 121.764 1.00 0.00   ? 293  THR B CA    1 
ATOM   4548  C  C     . THR B 1 293  ? 137.985 128.582 122.409 1.00 0.00   ? 293  THR B C     1 
ATOM   4549  O  O     . THR B 1 293  ? 137.657 127.886 123.366 1.00 0.00   ? 293  THR B O     1 
ATOM   4550  C  CB    . THR B 1 293  ? 140.350 129.326 122.493 1.00 0.00   ? 293  THR B CB    1 
ATOM   4551  O  OG1   . THR B 1 293  ? 139.923 130.687 122.381 1.00 0.00   ? 293  THR B OG1   1 
ATOM   4552  C  CG2   . THR B 1 293  ? 141.721 129.202 121.870 1.00 0.00   ? 293  THR B CG2   1 
ATOM   4553  N  N     . THR B 1 294  ? 137.183 129.509 121.891 1.00 0.00   ? 294  THR B N     1 
ATOM   4554  C  CA    . THR B 1 294  ? 135.869 129.754 122.474 1.00 0.00   ? 294  THR B CA    1 
ATOM   4555  C  C     . THR B 1 294  ? 134.687 129.249 121.655 1.00 0.00   ? 294  THR B C     1 
ATOM   4556  O  O     . THR B 1 294  ? 133.697 128.779 122.213 1.00 0.00   ? 294  THR B O     1 
ATOM   4557  C  CB    . THR B 1 294  ? 135.651 131.257 122.739 1.00 0.00   ? 294  THR B CB    1 
ATOM   4558  O  OG1   . THR B 1 294  ? 135.681 131.975 121.499 1.00 0.00   ? 294  THR B OG1   1 
ATOM   4559  C  CG2   . THR B 1 294  ? 136.735 131.800 123.653 1.00 0.00   ? 294  THR B CG2   1 
ATOM   4560  N  N     . GLY B 1 295  ? 134.786 129.345 120.335 1.00 0.00   ? 295  GLY B N     1 
ATOM   4561  C  CA    . GLY B 1 295  ? 133.689 128.900 119.494 1.00 0.00   ? 295  GLY B CA    1 
ATOM   4562  C  C     . GLY B 1 295  ? 132.803 130.085 119.181 1.00 0.00   ? 295  GLY B C     1 
ATOM   4563  O  O     . GLY B 1 295  ? 131.715 129.950 118.619 1.00 0.00   ? 295  GLY B O     1 
ATOM   4564  N  N     . ILE B 1 296  ? 133.295 131.261 119.557 1.00 0.00   ? 296  ILE B N     1 
ATOM   4565  C  CA    . ILE B 1 296  ? 132.597 132.521 119.347 1.00 0.00   ? 296  ILE B CA    1 
ATOM   4566  C  C     . ILE B 1 296  ? 132.983 133.111 117.992 1.00 0.00   ? 296  ILE B C     1 
ATOM   4567  O  O     . ILE B 1 296  ? 134.166 133.239 117.673 1.00 0.00   ? 296  ILE B O     1 
ATOM   4568  C  CB    . ILE B 1 296  ? 132.970 133.531 120.454 1.00 0.00   ? 296  ILE B CB    1 
ATOM   4569  C  CG1   . ILE B 1 296  ? 132.521 132.989 121.821 1.00 0.00   ? 296  ILE B CG1   1 
ATOM   4570  C  CG2   . ILE B 1 296  ? 132.326 134.866 120.184 1.00 0.00   ? 296  ILE B CG2   1 
ATOM   4571  C  CD1   . ILE B 1 296  ? 131.031 132.719 121.918 1.00 0.00   ? 296  ILE B CD1   1 
ATOM   4572  N  N     . THR B 1 297  ? 131.983 133.473 117.196 1.00 0.00   ? 297  THR B N     1 
ATOM   4573  C  CA    . THR B 1 297  ? 132.226 134.062 115.884 1.00 0.00   ? 297  THR B CA    1 
ATOM   4574  C  C     . THR B 1 297  ? 132.555 135.545 116.037 1.00 0.00   ? 297  THR B C     1 
ATOM   4575  O  O     . THR B 1 297  ? 131.869 136.266 116.760 1.00 0.00   ? 297  THR B O     1 
ATOM   4576  C  CB    . THR B 1 297  ? 130.990 133.933 114.981 1.00 0.00   ? 297  THR B CB    1 
ATOM   4577  O  OG1   . THR B 1 297  ? 130.646 132.551 114.823 1.00 0.00   ? 297  THR B OG1   1 
ATOM   4578  C  CG2   . THR B 1 297  ? 131.278 134.532 113.623 1.00 0.00   ? 297  THR B CG2   1 
ATOM   4579  N  N     . THR B 1 298  ? 133.601 136.006 115.354 1.00 0.00   ? 298  THR B N     1 
ATOM   4580  C  CA    . THR B 1 298  ? 134.001 137.409 115.437 1.00 0.00   ? 298  THR B CA    1 
ATOM   4581  C  C     . THR B 1 298  ? 134.187 138.063 114.075 1.00 0.00   ? 298  THR B C     1 
ATOM   4582  O  O     . THR B 1 298  ? 134.138 137.402 113.037 1.00 0.00   ? 298  THR B O     1 
ATOM   4583  C  CB    . THR B 1 298  ? 135.316 137.568 116.223 1.00 0.00   ? 298  THR B CB    1 
ATOM   4584  O  OG1   . THR B 1 298  ? 136.385 136.925 115.515 1.00 0.00   ? 298  THR B OG1   1 
ATOM   4585  C  CG2   . THR B 1 298  ? 135.184 136.941 117.593 1.00 0.00   ? 298  THR B CG2   1 
ATOM   4586  N  N     . GLN B 1 299  ? 134.400 139.377 114.089 1.00 0.00   ? 299  GLN B N     1 
ATOM   4587  C  CA    . GLN B 1 299  ? 134.611 140.139 112.868 1.00 0.00   ? 299  GLN B CA    1 
ATOM   4588  C  C     . GLN B 1 299  ? 135.783 141.098 112.990 1.00 0.00   ? 299  GLN B C     1 
ATOM   4589  O  O     . GLN B 1 299  ? 136.026 141.695 114.045 1.00 0.00   ? 299  GLN B O     1 
ATOM   4590  C  CB    . GLN B 1 299  ? 133.374 140.956 112.492 1.00 0.00   ? 299  GLN B CB    1 
ATOM   4591  C  CG    . GLN B 1 299  ? 132.299 140.203 111.720 1.00 0.00   ? 299  GLN B CG    1 
ATOM   4592  C  CD    . GLN B 1 299  ? 131.340 141.145 111.018 1.00 0.00   ? 299  GLN B CD    1 
ATOM   4593  O  OE1   . GLN B 1 299  ? 131.040 142.226 111.529 1.00 0.00   ? 299  GLN B OE1   1 
ATOM   4594  N  NE2   . GLN B 1 299  ? 130.849 140.745 109.848 1.00 0.00   ? 299  GLN B NE2   1 
ATOM   4595  N  N     . ALA B 1 300  ? 136.524 141.222 111.900 1.00 0.00   ? 300  ALA B N     1 
ATOM   4596  C  CA    . ALA B 1 300  ? 137.653 142.133 111.831 1.00 0.00   ? 300  ALA B CA    1 
ATOM   4597  C  C     . ALA B 1 300  ? 137.209 143.080 110.729 1.00 0.00   ? 300  ALA B C     1 
ATOM   4598  O  O     . ALA B 1 300  ? 137.033 142.669 109.577 1.00 0.00   ? 300  ALA B O     1 
ATOM   4599  C  CB    . ALA B 1 300  ? 138.908 141.385 111.421 1.00 0.00   ? 300  ALA B CB    1 
ATOM   4600  N  N     . ARG B 1 301  ? 136.994 144.339 111.094 1.00 0.00   ? 301  ARG B N     1 
ATOM   4601  C  CA    . ARG B 1 301  ? 136.528 145.340 110.138 1.00 0.00   ? 301  ARG B CA    1 
ATOM   4602  C  C     . ARG B 1 301  ? 137.527 146.457 109.871 1.00 0.00   ? 301  ARG B C     1 
ATOM   4603  O  O     . ARG B 1 301  ? 138.122 147.016 110.794 1.00 0.00   ? 301  ARG B O     1 
ATOM   4604  C  CB    . ARG B 1 301  ? 135.207 145.937 110.628 1.00 0.00   ? 301  ARG B CB    1 
ATOM   4605  C  CG    . ARG B 1 301  ? 134.083 144.909 110.753 1.00 0.00   ? 301  ARG B CG    1 
ATOM   4606  C  CD    . ARG B 1 301  ? 132.850 145.528 111.384 1.00 0.00   ? 301  ARG B CD    1 
ATOM   4607  N  NE    . ARG B 1 301  ? 133.114 145.946 112.762 1.00 0.00   ? 301  ARG B NE    1 
ATOM   4608  C  CZ    . ARG B 1 301  ? 132.948 145.168 113.828 1.00 0.00   ? 301  ARG B CZ    1 
ATOM   4609  N  NH1   . ARG B 1 301  ? 132.512 143.924 113.683 1.00 0.00   ? 301  ARG B NH1   1 
ATOM   4610  N  NH2   . ARG B 1 301  ? 133.219 145.637 115.039 1.00 0.00   ? 301  ARG B NH2   1 
ATOM   4611  N  N     . THR B 1 302  ? 137.702 146.770 108.593 1.00 0.00   ? 302  THR B N     1 
ATOM   4612  C  CA    . THR B 1 302  ? 138.617 147.824 108.164 1.00 0.00   ? 302  THR B CA    1 
ATOM   4613  C  C     . THR B 1 302  ? 138.074 148.454 106.887 1.00 0.00   ? 302  THR B C     1 
ATOM   4614  O  O     . THR B 1 302  ? 137.138 147.937 106.274 1.00 0.00   ? 302  THR B O     1 
ATOM   4615  C  CB    . THR B 1 302  ? 140.028 147.264 107.880 1.00 0.00   ? 302  THR B CB    1 
ATOM   4616  O  OG1   . THR B 1 302  ? 140.950 148.353 107.724 1.00 0.00   ? 302  THR B OG1   1 
ATOM   4617  C  CG2   . THR B 1 302  ? 140.029 146.433 106.609 1.00 0.00   ? 302  THR B CG2   1 
ATOM   4618  N  N     . SER B 1 303  ? 138.669 149.571 106.489 1.00 0.00   ? 303  SER B N     1 
ATOM   4619  C  CA    . SER B 1 303  ? 138.236 150.261 105.286 1.00 0.00   ? 303  SER B CA    1 
ATOM   4620  C  C     . SER B 1 303  ? 139.406 150.941 104.588 1.00 0.00   ? 303  SER B C     1 
ATOM   4621  O  O     . SER B 1 303  ? 140.446 151.198 105.192 1.00 0.00   ? 303  SER B O     1 
ATOM   4622  C  CB    . SER B 1 303  ? 137.173 151.302 105.633 1.00 0.00   ? 303  SER B CB    1 
ATOM   4623  O  OG    . SER B 1 303  ? 137.672 152.274 106.534 1.00 0.00   ? 303  SER B OG    1 
ATOM   4624  N  N     . TYR B 1 304  ? 139.218 151.214 103.304 1.00 0.00   ? 304  TYR B N     1 
ATOM   4625  C  CA    . TYR B 1 304  ? 140.236 151.875 102.504 1.00 0.00   ? 304  TYR B CA    1 
ATOM   4626  C  C     . TYR B 1 304  ? 139.595 152.970 101.665 1.00 0.00   ? 304  TYR B C     1 
ATOM   4627  O  O     . TYR B 1 304  ? 138.820 152.697 100.744 1.00 0.00   ? 304  TYR B O     1 
ATOM   4628  C  CB    . TYR B 1 304  ? 140.943 150.865 101.591 1.00 0.00   ? 304  TYR B CB    1 
ATOM   4629  C  CG    . TYR B 1 304  ? 141.715 149.801 102.337 1.00 0.00   ? 304  TYR B CG    1 
ATOM   4630  C  CD1   . TYR B 1 304  ? 141.066 148.695 102.890 1.00 0.00   ? 304  TYR B CD1   1 
ATOM   4631  C  CD2   . TYR B 1 304  ? 143.095 149.908 102.511 1.00 0.00   ? 304  TYR B CD2   1 
ATOM   4632  C  CE1   . TYR B 1 304  ? 141.772 147.728 103.597 1.00 0.00   ? 304  TYR B CE1   1 
ATOM   4633  C  CE2   . TYR B 1 304  ? 143.810 148.947 103.220 1.00 0.00   ? 304  TYR B CE2   1 
ATOM   4634  C  CZ    . TYR B 1 304  ? 143.141 147.863 103.756 1.00 0.00   ? 304  TYR B CZ    1 
ATOM   4635  O  OH    . TYR B 1 304  ? 143.845 146.912 104.460 1.00 0.00   ? 304  TYR B OH    1 
ATOM   4636  N  N     . LEU B 1 305  ? 139.900 154.217 102.003 1.00 0.00   ? 305  LEU B N     1 
ATOM   4637  C  CA    . LEU B 1 305  ? 139.363 155.348 101.264 1.00 0.00   ? 305  LEU B CA    1 
ATOM   4638  C  C     . LEU B 1 305  ? 140.158 155.457 99.971  1.00 0.00   ? 305  LEU B C     1 
ATOM   4639  O  O     . LEU B 1 305  ? 141.148 154.748 99.785  1.00 0.00   ? 305  LEU B O     1 
ATOM   4640  C  CB    . LEU B 1 305  ? 139.481 156.631 102.093 1.00 0.00   ? 305  LEU B CB    1 
ATOM   4641  C  CG    . LEU B 1 305  ? 138.494 156.788 103.258 1.00 0.00   ? 305  LEU B CG    1 
ATOM   4642  C  CD1   . LEU B 1 305  ? 137.077 156.922 102.717 1.00 0.00   ? 305  LEU B CD1   1 
ATOM   4643  C  CD2   . LEU B 1 305  ? 138.592 155.594 104.199 1.00 0.00   ? 305  LEU B CD2   1 
ATOM   4644  N  N     . ALA B 1 306  ? 139.728 156.339 99.078  1.00 0.00   ? 306  ALA B N     1 
ATOM   4645  C  CA    . ALA B 1 306  ? 140.397 156.505 97.793  1.00 0.00   ? 306  ALA B CA    1 
ATOM   4646  C  C     . ALA B 1 306  ? 141.879 156.875 97.932  1.00 0.00   ? 306  ALA B C     1 
ATOM   4647  O  O     . ALA B 1 306  ? 142.718 156.382 97.181  1.00 0.00   ? 306  ALA B O     1 
ATOM   4648  C  CB    . ALA B 1 306  ? 139.659 157.563 96.973  1.00 0.00   ? 306  ALA B CB    1 
ATOM   4649  N  N     . ASP B 1 307  ? 142.191 157.728 98.902  1.00 0.00   ? 307  ASP B N     1 
ATOM   4650  C  CA    . ASP B 1 307  ? 143.566 158.164 99.129  1.00 0.00   ? 307  ASP B CA    1 
ATOM   4651  C  C     . ASP B 1 307  ? 144.419 157.185 99.934  1.00 0.00   ? 307  ASP B C     1 
ATOM   4652  O  O     . ASP B 1 307  ? 145.545 157.508 100.312 1.00 0.00   ? 307  ASP B O     1 
ATOM   4653  C  CB    . ASP B 1 307  ? 143.580 159.523 99.828  1.00 0.00   ? 307  ASP B CB    1 
ATOM   4654  C  CG    . ASP B 1 307  ? 142.753 159.531 101.093 1.00 0.00   ? 307  ASP B CG    1 
ATOM   4655  O  OD1   . ASP B 1 307  ? 142.525 158.442 101.671 1.00 0.00   ? 307  ASP B OD1   1 
ATOM   4656  O  OD2   . ASP B 1 307  ? 142.331 160.628 101.523 1.00 0.00   ? 307  ASP B OD2   1 
ATOM   4657  N  N     . GLU B 1 308  ? 143.877 156.004 100.217 1.00 0.00   ? 308  GLU B N     1 
ATOM   4658  C  CA    . GLU B 1 308  ? 144.612 154.997 100.971 1.00 0.00   ? 308  GLU B CA    1 
ATOM   4659  C  C     . GLU B 1 308  ? 145.006 153.855 100.049 1.00 0.00   ? 308  GLU B C     1 
ATOM   4660  O  O     . GLU B 1 308  ? 145.613 152.870 100.474 1.00 0.00   ? 308  GLU B O     1 
ATOM   4661  C  CB    . GLU B 1 308  ? 143.764 154.478 102.131 1.00 0.00   ? 308  GLU B CB    1 
ATOM   4662  N  N     . ILE B 1 309  ? 144.653 154.008 98.776  1.00 0.00   ? 309  ILE B N     1 
ATOM   4663  C  CA    . ILE B 1 309  ? 144.957 153.019 97.751  1.00 0.00   ? 309  ILE B CA    1 
ATOM   4664  C  C     . ILE B 1 309  ? 146.109 153.555 96.908  1.00 0.00   ? 309  ILE B C     1 
ATOM   4665  O  O     . ILE B 1 309  ? 146.139 154.741 96.569  1.00 0.00   ? 309  ILE B O     1 
ATOM   4666  C  CB    . ILE B 1 309  ? 143.743 152.771 96.827  1.00 0.00   ? 309  ILE B CB    1 
ATOM   4667  C  CG1   . ILE B 1 309  ? 142.534 152.333 97.662  1.00 0.00   ? 309  ILE B CG1   1 
ATOM   4668  C  CG2   . ILE B 1 309  ? 144.079 151.706 95.792  1.00 0.00   ? 309  ILE B CG2   1 
ATOM   4669  C  CD1   . ILE B 1 309  ? 142.753 151.059 98.442  1.00 0.00   ? 309  ILE B CD1   1 
ATOM   4670  N  N     . LEU B 1 310  ? 147.056 152.690 96.574  1.00 0.00   ? 310  LEU B N     1 
ATOM   4671  C  CA    . LEU B 1 310  ? 148.205 153.096 95.772  1.00 0.00   ? 310  LEU B CA    1 
ATOM   4672  C  C     . LEU B 1 310  ? 148.123 152.463 94.389  1.00 0.00   ? 310  LEU B C     1 
ATOM   4673  O  O     . LEU B 1 310  ? 147.765 151.293 94.252  1.00 0.00   ? 310  LEU B O     1 
ATOM   4674  C  CB    . LEU B 1 310  ? 149.501 152.673 96.464  1.00 0.00   ? 310  LEU B CB    1 
ATOM   4675  C  CG    . LEU B 1 310  ? 149.797 153.352 97.810  1.00 0.00   ? 310  LEU B CG    1 
ATOM   4676  C  CD1   . LEU B 1 310  ? 151.031 152.723 98.437  1.00 0.00   ? 310  LEU B CD1   1 
ATOM   4677  C  CD2   . LEU B 1 310  ? 150.000 154.846 97.609  1.00 0.00   ? 310  LEU B CD2   1 
ATOM   4678  N  N     . TRP B 1 311  ? 148.445 153.244 93.363  1.00 0.00   ? 311  TRP B N     1 
ATOM   4679  C  CA    . TRP B 1 311  ? 148.398 152.747 91.996  1.00 0.00   ? 311  TRP B CA    1 
ATOM   4680  C  C     . TRP B 1 311  ? 149.789 152.578 91.404  1.00 0.00   ? 311  TRP B C     1 
ATOM   4681  O  O     . TRP B 1 311  ? 150.568 153.530 91.328  1.00 0.00   ? 311  TRP B O     1 
ATOM   4682  C  CB    . TRP B 1 311  ? 147.569 153.685 91.111  1.00 0.00   ? 311  TRP B CB    1 
ATOM   4683  C  CG    . TRP B 1 311  ? 147.299 153.143 89.742  1.00 0.00   ? 311  TRP B CG    1 
ATOM   4684  C  CD1   . TRP B 1 311  ? 148.208 152.943 88.740  1.00 0.00   ? 311  TRP B CD1   1 
ATOM   4685  C  CD2   . TRP B 1 311  ? 146.035 152.701 89.235  1.00 0.00   ? 311  TRP B CD2   1 
ATOM   4686  N  NE1   . TRP B 1 311  ? 147.582 152.402 87.640  1.00 0.00   ? 311  TRP B NE1   1 
ATOM   4687  C  CE2   . TRP B 1 311  ? 146.252 152.243 87.913  1.00 0.00   ? 311  TRP B CE2   1 
ATOM   4688  C  CE3   . TRP B 1 311  ? 144.743 152.645 89.768  1.00 0.00   ? 311  TRP B CE3   1 
ATOM   4689  C  CZ2   . TRP B 1 311  ? 145.217 151.735 87.119  1.00 0.00   ? 311  TRP B CZ2   1 
ATOM   4690  C  CZ3   . TRP B 1 311  ? 143.714 152.135 88.976  1.00 0.00   ? 311  TRP B CZ3   1 
ATOM   4691  C  CH2   . TRP B 1 311  ? 143.960 151.689 87.664  1.00 0.00   ? 311  TRP B CH2   1 
ATOM   4692  N  N     . GLY B 1 312  ? 150.095 151.355 90.985  1.00 0.00   ? 312  GLY B N     1 
ATOM   4693  C  CA    . GLY B 1 312  ? 151.385 151.070 90.400  1.00 0.00   ? 312  GLY B CA    1 
ATOM   4694  C  C     . GLY B 1 312  ? 152.380 150.527 91.403  1.00 0.00   ? 312  GLY B C     1 
ATOM   4695  O  O     . GLY B 1 312  ? 153.585 150.493 91.141  1.00 0.00   ? 312  GLY B O     1 
ATOM   4696  N  N     . GLN B 1 313  ? 151.868 150.106 92.555  1.00 0.00   ? 313  GLN B N     1 
ATOM   4697  C  CA    . GLN B 1 313  ? 152.688 149.553 93.625  1.00 0.00   ? 313  GLN B CA    1 
ATOM   4698  C  C     . GLN B 1 313  ? 152.153 148.198 94.078  1.00 0.00   ? 313  GLN B C     1 
ATOM   4699  O  O     . GLN B 1 313  ? 150.963 147.915 93.938  1.00 0.00   ? 313  GLN B O     1 
ATOM   4700  C  CB    . GLN B 1 313  ? 152.697 150.503 94.834  1.00 0.00   ? 313  GLN B CB    1 
ATOM   4701  C  CG    . GLN B 1 313  ? 153.429 151.825 94.643  1.00 0.00   ? 313  GLN B CG    1 
ATOM   4702  C  CD    . GLN B 1 313  ? 153.444 152.657 95.913  1.00 0.00   ? 313  GLN B CD    1 
ATOM   4703  O  OE1   . GLN B 1 313  ? 153.921 152.210 96.957  1.00 0.00   ? 313  GLN B OE1   1 
ATOM   4704  N  NE2   . GLN B 1 313  ? 152.921 153.875 95.831  1.00 0.00   ? 313  GLN B NE2   1 
ATOM   4705  N  N     . ARG B 1 314  ? 153.063 147.379 94.591  1.00 0.00   ? 314  ARG B N     1 
ATOM   4706  C  CA    . ARG B 1 314  ? 152.756 146.044 95.074  1.00 0.00   ? 314  ARG B CA    1 
ATOM   4707  C  C     . ARG B 1 314  ? 153.365 145.817 96.455  1.00 0.00   ? 314  ARG B C     1 
ATOM   4708  O  O     . ARG B 1 314  ? 154.060 146.681 96.992  1.00 0.00   ? 314  ARG B O     1 
ATOM   4709  C  CB    . ARG B 1 314  ? 153.305 145.018 94.094  1.00 0.00   ? 314  ARG B CB    1 
ATOM   4710  C  CG    . ARG B 1 314  ? 154.687 145.379 93.594  1.00 0.00   ? 314  ARG B CG    1 
ATOM   4711  C  CD    . ARG B 1 314  ? 155.036 144.637 92.318  1.00 0.00   ? 314  ARG B CD    1 
ATOM   4712  N  NE    . ARG B 1 314  ? 156.382 144.972 91.869  1.00 0.00   ? 314  ARG B NE    1 
ATOM   4713  C  CZ    . ARG B 1 314  ? 157.489 144.645 92.526  1.00 0.00   ? 314  ARG B CZ    1 
ATOM   4714  N  NH1   . ARG B 1 314  ? 157.411 143.974 93.666  1.00 0.00   ? 314  ARG B NH1   1 
ATOM   4715  N  NH2   . ARG B 1 314  ? 158.673 144.990 92.046  1.00 0.00   ? 314  ARG B NH2   1 
ATOM   4716  N  N     . PHE B 1 315  ? 153.115 144.649 97.027  1.00 0.00   ? 315  PHE B N     1 
ATOM   4717  C  CA    . PHE B 1 315  ? 153.632 144.357 98.356  1.00 0.00   ? 315  PHE B CA    1 
ATOM   4718  C  C     . PHE B 1 315  ? 154.987 143.679 98.361  1.00 0.00   ? 315  PHE B C     1 
ATOM   4719  O  O     . PHE B 1 315  ? 155.303 142.883 97.483  1.00 0.00   ? 315  PHE B O     1 
ATOM   4720  C  CB    . PHE B 1 315  ? 152.625 143.530 99.146  1.00 0.00   ? 315  PHE B CB    1 
ATOM   4721  C  CG    . PHE B 1 315  ? 151.528 144.347 99.744  1.00 0.00   ? 315  PHE B CG    1 
ATOM   4722  C  CD1   . PHE B 1 315  ? 150.597 144.966 98.937  1.00 0.00   ? 315  PHE B CD1   1 
ATOM   4723  C  CD2   . PHE B 1 315  ? 151.438 144.509 101.111 1.00 0.00   ? 315  PHE B CD2   1 
ATOM   4724  C  CE1   . PHE B 1 315  ? 149.587 145.727 99.483  1.00 0.00   ? 315  PHE B CE1   1 
ATOM   4725  C  CE2   . PHE B 1 315  ? 150.432 145.269 101.665 1.00 0.00   ? 315  PHE B CE2   1 
ATOM   4726  C  CZ    . PHE B 1 315  ? 149.505 145.880 100.849 1.00 0.00   ? 315  PHE B CZ    1 
ATOM   4727  N  N     . VAL B 1 316  ? 155.782 144.008 99.370  1.00 0.00   ? 316  VAL B N     1 
ATOM   4728  C  CA    . VAL B 1 316  ? 157.117 143.441 99.529  1.00 0.00   ? 316  VAL B CA    1 
ATOM   4729  C  C     . VAL B 1 316  ? 156.957 142.089 100.226 1.00 0.00   ? 316  VAL B C     1 
ATOM   4730  O  O     . VAL B 1 316  ? 156.145 141.952 101.140 1.00 0.00   ? 316  VAL B O     1 
ATOM   4731  C  CB    . VAL B 1 316  ? 158.009 144.343 100.420 1.00 0.00   ? 316  VAL B CB    1 
ATOM   4732  C  CG1   . VAL B 1 316  ? 159.340 143.666 100.665 1.00 0.00   ? 316  VAL B CG1   1 
ATOM   4733  C  CG2   . VAL B 1 316  ? 158.224 145.700 99.761  1.00 0.00   ? 316  VAL B CG2   1 
ATOM   4734  N  N     . PRO B 1 317  ? 157.730 141.074 99.809  1.00 0.00   ? 317  PRO B N     1 
ATOM   4735  C  CA    . PRO B 1 317  ? 157.589 139.773 100.469 1.00 0.00   ? 317  PRO B CA    1 
ATOM   4736  C  C     . PRO B 1 317  ? 157.848 139.863 101.968 1.00 0.00   ? 317  PRO B C     1 
ATOM   4737  O  O     . PRO B 1 317  ? 158.789 140.525 102.408 1.00 0.00   ? 317  PRO B O     1 
ATOM   4738  C  CB    . PRO B 1 317  ? 158.625 138.914 99.758  1.00 0.00   ? 317  PRO B CB    1 
ATOM   4739  C  CG    . PRO B 1 317  ? 158.622 139.484 98.372  1.00 0.00   ? 317  PRO B CG    1 
ATOM   4740  C  CD    . PRO B 1 317  ? 158.621 140.971 98.641  1.00 0.00   ? 317  PRO B CD    1 
ATOM   4741  N  N     . ILE B 1 318  ? 157.009 139.193 102.756 1.00 0.00   ? 318  ILE B N     1 
ATOM   4742  C  CA    . ILE B 1 318  ? 157.134 139.215 104.212 1.00 0.00   ? 318  ILE B CA    1 
ATOM   4743  C  C     . ILE B 1 318  ? 157.821 137.973 104.774 1.00 0.00   ? 318  ILE B C     1 
ATOM   4744  O  O     . ILE B 1 318  ? 158.688 138.074 105.639 1.00 0.00   ? 318  ILE B O     1 
ATOM   4745  C  CB    . ILE B 1 318  ? 155.747 139.347 104.869 1.00 0.00   ? 318  ILE B CB    1 
ATOM   4746  C  CG1   . ILE B 1 318  ? 155.045 140.596 104.345 1.00 0.00   ? 318  ILE B CG1   1 
ATOM   4747  C  CG2   . ILE B 1 318  ? 155.896 139.437 106.378 1.00 0.00   ? 318  ILE B CG2   1 
ATOM   4748  C  CD1   . ILE B 1 318  ? 155.778 141.871 104.652 1.00 0.00   ? 318  ILE B CD1   1 
ATOM   4749  N  N     . VAL B 1 319  ? 157.419 136.802 104.284 1.00 0.00   ? 319  VAL B N     1 
ATOM   4750  C  CA    . VAL B 1 319  ? 157.967 135.538 104.764 1.00 0.00   ? 319  VAL B CA    1 
ATOM   4751  C  C     . VAL B 1 319  ? 159.362 135.180 104.252 1.00 0.00   ? 319  VAL B C     1 
ATOM   4752  O  O     . VAL B 1 319  ? 159.617 135.175 103.049 1.00 0.00   ? 319  VAL B O     1 
ATOM   4753  C  CB    . VAL B 1 319  ? 157.034 134.355 104.418 1.00 0.00   ? 319  VAL B CB    1 
ATOM   4754  C  CG1   . VAL B 1 319  ? 157.627 133.055 104.944 1.00 0.00   ? 319  VAL B CG1   1 
ATOM   4755  C  CG2   . VAL B 1 319  ? 155.657 134.583 105.016 1.00 0.00   ? 319  VAL B CG2   1 
ATOM   4756  N  N     . ALA B 1 320  ? 160.254 134.867 105.188 1.00 0.00   ? 320  ALA B N     1 
ATOM   4757  C  CA    . ALA B 1 320  ? 161.614 134.460 104.873 1.00 0.00   ? 320  ALA B CA    1 
ATOM   4758  C  C     . ALA B 1 320  ? 161.698 132.993 105.284 1.00 0.00   ? 320  ALA B C     1 
ATOM   4759  O  O     . ALA B 1 320  ? 160.673 132.391 105.598 1.00 0.00   ? 320  ALA B O     1 
ATOM   4760  C  CB    . ALA B 1 320  ? 162.618 135.291 105.661 1.00 0.00   ? 320  ALA B CB    1 
ATOM   4761  N  N     . GLU B 1 321  ? 162.893 132.413 105.292 1.00 0.00   ? 321  GLU B N     1 
ATOM   4762  C  CA    . GLU B 1 321  ? 163.019 131.013 105.683 1.00 0.00   ? 321  GLU B CA    1 
ATOM   4763  C  C     . GLU B 1 321  ? 164.288 130.692 106.461 1.00 0.00   ? 321  GLU B C     1 
ATOM   4764  O  O     . GLU B 1 321  ? 165.400 130.969 106.002 1.00 0.00   ? 321  GLU B O     1 
ATOM   4765  C  CB    . GLU B 1 321  ? 162.947 130.108 104.445 1.00 0.00   ? 321  GLU B CB    1 
ATOM   4766  C  CG    . GLU B 1 321  ? 162.749 128.627 104.768 1.00 0.00   ? 321  GLU B CG    1 
ATOM   4767  C  CD    . GLU B 1 321  ? 162.787 127.736 103.537 1.00 0.00   ? 321  GLU B CD    1 
ATOM   4768  O  OE1   . GLU B 1 321  ? 162.077 128.039 102.553 1.00 0.00   ? 321  GLU B OE1   1 
ATOM   4769  O  OE2   . GLU B 1 321  ? 163.521 126.722 103.557 1.00 0.00   ? 321  GLU B OE2   1 
ATOM   4770  N  N     . GLU B 1 322  ? 164.117 130.119 107.648 1.00 0.00   ? 322  GLU B N     1 
ATOM   4771  C  CA    . GLU B 1 322  ? 165.250 129.721 108.477 1.00 0.00   ? 322  GLU B CA    1 
ATOM   4772  C  C     . GLU B 1 322  ? 165.515 128.266 108.102 1.00 0.00   ? 322  GLU B C     1 
ATOM   4773  O  O     . GLU B 1 322  ? 164.717 127.659 107.389 1.00 0.00   ? 322  GLU B O     1 
ATOM   4774  C  CB    . GLU B 1 322  ? 164.898 129.845 109.969 1.00 0.00   ? 322  GLU B CB    1 
ATOM   4775  C  CG    . GLU B 1 322  ? 164.484 131.254 110.387 1.00 0.00   ? 322  GLU B CG    1 
ATOM   4776  C  CD    . GLU B 1 322  ? 164.327 131.418 111.890 1.00 0.00   ? 322  GLU B CD    1 
ATOM   4777  O  OE1   . GLU B 1 322  ? 164.243 130.396 112.604 1.00 0.00   ? 322  GLU B OE1   1 
ATOM   4778  O  OE2   . GLU B 1 322  ? 164.279 132.577 112.363 1.00 0.00   ? 322  GLU B OE2   1 
ATOM   4779  N  N     . ASP B 1 323  ? 166.625 127.700 108.562 1.00 0.00   ? 323  ASP B N     1 
ATOM   4780  C  CA    . ASP B 1 323  ? 166.944 126.320 108.225 1.00 0.00   ? 323  ASP B CA    1 
ATOM   4781  C  C     . ASP B 1 323  ? 165.889 125.323 108.699 1.00 0.00   ? 323  ASP B C     1 
ATOM   4782  O  O     . ASP B 1 323  ? 165.701 124.272 108.087 1.00 0.00   ? 323  ASP B O     1 
ATOM   4783  C  CB    . ASP B 1 323  ? 168.304 125.927 108.802 1.00 0.00   ? 323  ASP B CB    1 
ATOM   4784  C  CG    . ASP B 1 323  ? 169.430 126.779 108.264 1.00 0.00   ? 323  ASP B CG    1 
ATOM   4785  O  OD1   . ASP B 1 323  ? 169.355 127.189 107.083 1.00 0.00   ? 323  ASP B OD1   1 
ATOM   4786  O  OD2   . ASP B 1 323  ? 170.399 127.031 109.013 1.00 0.00   ? 323  ASP B OD2   1 
ATOM   4787  N  N     . GLY B 1 324  ? 165.200 125.657 109.783 1.00 0.00   ? 324  GLY B N     1 
ATOM   4788  C  CA    . GLY B 1 324  ? 164.188 124.757 110.306 1.00 0.00   ? 324  GLY B CA    1 
ATOM   4789  C  C     . GLY B 1 324  ? 162.744 125.198 110.185 1.00 0.00   ? 324  GLY B C     1 
ATOM   4790  O  O     . GLY B 1 324  ? 161.837 124.372 110.293 1.00 0.00   ? 324  GLY B O     1 
ATOM   4791  N  N     . ARG B 1 325  ? 162.509 126.486 109.953 1.00 0.00   ? 325  ARG B N     1 
ATOM   4792  C  CA    . ARG B 1 325  ? 161.138 126.976 109.856 1.00 0.00   ? 325  ARG B CA    1 
ATOM   4793  C  C     . ARG B 1 325  ? 160.964 128.157 108.908 1.00 0.00   ? 325  ARG B C     1 
ATOM   4794  O  O     . ARG B 1 325  ? 161.904 128.592 108.245 1.00 0.00   ? 325  ARG B O     1 
ATOM   4795  C  CB    . ARG B 1 325  ? 160.644 127.374 111.249 1.00 0.00   ? 325  ARG B CB    1 
ATOM   4796  C  CG    . ARG B 1 325  ? 161.431 128.519 111.901 1.00 0.00   ? 325  ARG B CG    1 
ATOM   4797  C  CD    . ARG B 1 325  ? 160.972 128.765 113.338 1.00 0.00   ? 325  ARG B CD    1 
ATOM   4798  N  NE    . ARG B 1 325  ? 161.227 127.611 114.197 1.00 0.00   ? 325  ARG B NE    1 
ATOM   4799  C  CZ    . ARG B 1 325  ? 162.436 127.178 114.539 1.00 0.00   ? 325  ARG B CZ    1 
ATOM   4800  N  NH1   . ARG B 1 325  ? 163.523 127.802 114.100 1.00 0.00   ? 325  ARG B NH1   1 
ATOM   4801  N  NH2   . ARG B 1 325  ? 162.560 126.108 115.313 1.00 0.00   ? 325  ARG B NH2   1 
ATOM   4802  N  N     . TYR B 1 326  ? 159.728 128.649 108.847 1.00 0.00   ? 326  TYR B N     1 
ATOM   4803  C  CA    . TYR B 1 326  ? 159.382 129.797 108.024 1.00 0.00   ? 326  TYR B CA    1 
ATOM   4804  C  C     . TYR B 1 326  ? 159.217 130.967 108.986 1.00 0.00   ? 326  TYR B C     1 
ATOM   4805  O  O     . TYR B 1 326  ? 158.665 130.805 110.078 1.00 0.00   ? 326  TYR B O     1 
ATOM   4806  C  CB    . TYR B 1 326  ? 158.080 129.547 107.261 1.00 0.00   ? 326  TYR B CB    1 
ATOM   4807  C  CG    . TYR B 1 326  ? 158.217 128.575 106.106 1.00 0.00   ? 326  TYR B CG    1 
ATOM   4808  C  CD1   . TYR B 1 326  ? 157.978 127.213 106.278 1.00 0.00   ? 326  TYR B CD1   1 
ATOM   4809  C  CD2   . TYR B 1 326  ? 158.609 129.021 104.847 1.00 0.00   ? 326  TYR B CD2   1 
ATOM   4810  C  CE1   . TYR B 1 326  ? 158.129 126.316 105.216 1.00 0.00   ? 326  TYR B CE1   1 
ATOM   4811  C  CE2   . TYR B 1 326  ? 158.766 128.137 103.783 1.00 0.00   ? 326  TYR B CE2   1 
ATOM   4812  C  CZ    . TYR B 1 326  ? 158.526 126.786 103.971 1.00 0.00   ? 326  TYR B CZ    1 
ATOM   4813  O  OH    . TYR B 1 326  ? 158.683 125.911 102.921 1.00 0.00   ? 326  TYR B OH    1 
ATOM   4814  N  N     . SER B 1 327  ? 159.704 132.138 108.596 1.00 0.00   ? 327  SER B N     1 
ATOM   4815  C  CA    . SER B 1 327  ? 159.618 133.303 109.465 1.00 0.00   ? 327  SER B CA    1 
ATOM   4816  C  C     . SER B 1 327  ? 158.894 134.483 108.828 1.00 0.00   ? 327  SER B C     1 
ATOM   4817  O  O     . SER B 1 327  ? 159.069 134.772 107.645 1.00 0.00   ? 327  SER B O     1 
ATOM   4818  C  CB    . SER B 1 327  ? 161.024 133.736 109.890 1.00 0.00   ? 327  SER B CB    1 
ATOM   4819  O  OG    . SER B 1 327  ? 160.966 134.792 110.829 1.00 0.00   ? 327  SER B OG    1 
ATOM   4820  N  N     . VAL B 1 328  ? 158.082 135.163 109.628 1.00 0.00   ? 328  VAL B N     1 
ATOM   4821  C  CA    . VAL B 1 328  ? 157.329 136.311 109.151 1.00 0.00   ? 328  VAL B CA    1 
ATOM   4822  C  C     . VAL B 1 328  ? 157.842 137.603 109.779 1.00 0.00   ? 328  VAL B C     1 
ATOM   4823  O  O     . VAL B 1 328  ? 157.915 137.724 111.001 1.00 0.00   ? 328  VAL B O     1 
ATOM   4824  C  CB    . VAL B 1 328  ? 155.824 136.182 109.476 1.00 0.00   ? 328  VAL B CB    1 
ATOM   4825  C  CG1   . VAL B 1 328  ? 155.071 137.355 108.887 1.00 0.00   ? 328  VAL B CG1   1 
ATOM   4826  C  CG2   . VAL B 1 328  ? 155.279 134.877 108.928 1.00 0.00   ? 328  VAL B CG2   1 
ATOM   4827  N  N     . ASP B 1 329  ? 158.189 138.563 108.934 1.00 0.00   ? 329  ASP B N     1 
ATOM   4828  C  CA    . ASP B 1 329  ? 158.665 139.860 109.389 1.00 0.00   ? 329  ASP B CA    1 
ATOM   4829  C  C     . ASP B 1 329  ? 157.483 140.820 109.333 1.00 0.00   ? 329  ASP B C     1 
ATOM   4830  O  O     . ASP B 1 329  ? 157.144 141.336 108.266 1.00 0.00   ? 329  ASP B O     1 
ATOM   4831  C  CB    . ASP B 1 329  ? 159.778 140.368 108.473 1.00 0.00   ? 329  ASP B CB    1 
ATOM   4832  C  CG    . ASP B 1 329  ? 160.308 141.713 108.904 1.00 0.00   ? 329  ASP B CG    1 
ATOM   4833  O  OD1   . ASP B 1 329  ? 159.597 142.415 109.653 1.00 0.00   ? 329  ASP B OD1   1 
ATOM   4834  O  OD2   . ASP B 1 329  ? 161.427 142.079 108.491 1.00 0.00   ? 329  ASP B OD2   1 
ATOM   4835  N  N     . TYR B 1 330  ? 156.860 141.074 110.479 1.00 0.00   ? 330  TYR B N     1 
ATOM   4836  C  CA    . TYR B 1 330  ? 155.706 141.959 110.522 1.00 0.00   ? 330  TYR B CA    1 
ATOM   4837  C  C     . TYR B 1 330  ? 156.003 143.444 110.333 1.00 0.00   ? 330  TYR B C     1 
ATOM   4838  O  O     . TYR B 1 330  ? 155.100 144.225 110.030 1.00 0.00   ? 330  TYR B O     1 
ATOM   4839  C  CB    . TYR B 1 330  ? 154.926 141.737 111.822 1.00 0.00   ? 330  TYR B CB    1 
ATOM   4840  C  CG    . TYR B 1 330  ? 154.166 140.433 111.828 1.00 0.00   ? 330  TYR B CG    1 
ATOM   4841  C  CD1   . TYR B 1 330  ? 154.812 139.224 112.083 1.00 0.00   ? 330  TYR B CD1   1 
ATOM   4842  C  CD2   . TYR B 1 330  ? 152.804 140.404 111.532 1.00 0.00   ? 330  TYR B CD2   1 
ATOM   4843  C  CE1   . TYR B 1 330  ? 154.117 138.019 112.042 1.00 0.00   ? 330  TYR B CE1   1 
ATOM   4844  C  CE2   . TYR B 1 330  ? 152.105 139.209 111.487 1.00 0.00   ? 330  TYR B CE2   1 
ATOM   4845  C  CZ    . TYR B 1 330  ? 152.764 138.023 111.743 1.00 0.00   ? 330  TYR B CZ    1 
ATOM   4846  O  OH    . TYR B 1 330  ? 152.068 136.840 111.702 1.00 0.00   ? 330  TYR B OH    1 
ATOM   4847  N  N     . SER B 1 331  ? 157.263 143.835 110.490 1.00 0.00   ? 331  SER B N     1 
ATOM   4848  C  CA    . SER B 1 331  ? 157.646 145.232 110.318 1.00 0.00   ? 331  SER B CA    1 
ATOM   4849  C  C     . SER B 1 331  ? 157.596 145.631 108.849 1.00 0.00   ? 331  SER B C     1 
ATOM   4850  O  O     . SER B 1 331  ? 157.641 146.815 108.511 1.00 0.00   ? 331  SER B O     1 
ATOM   4851  C  CB    . SER B 1 331  ? 159.056 145.474 110.854 1.00 0.00   ? 331  SER B CB    1 
ATOM   4852  O  OG    . SER B 1 331  ? 160.021 144.793 110.074 1.00 0.00   ? 331  SER B OG    1 
ATOM   4853  N  N     . LYS B 1 332  ? 157.506 144.631 107.974 1.00 0.00   ? 332  LYS B N     1 
ATOM   4854  C  CA    . LYS B 1 332  ? 157.453 144.870 106.537 1.00 0.00   ? 332  LYS B CA    1 
ATOM   4855  C  C     . LYS B 1 332  ? 156.028 144.796 105.987 1.00 0.00   ? 332  LYS B C     1 
ATOM   4856  O  O     . LYS B 1 332  ? 155.842 144.679 104.780 1.00 0.00   ? 332  LYS B O     1 
ATOM   4857  C  CB    . LYS B 1 332  ? 158.316 143.844 105.795 1.00 0.00   ? 332  LYS B CB    1 
ATOM   4858  C  CG    . LYS B 1 332  ? 159.817 143.936 106.033 1.00 0.00   ? 332  LYS B CG    1 
ATOM   4859  C  CD    . LYS B 1 332  ? 160.549 143.001 105.069 1.00 0.00   ? 332  LYS B CD    1 
ATOM   4860  C  CE    . LYS B 1 332  ? 162.063 143.153 105.137 1.00 0.00   ? 332  LYS B CE    1 
ATOM   4861  N  NZ    . LYS B 1 332  ? 162.648 142.622 106.398 1.00 0.00   ? 332  LYS B NZ    1 
ATOM   4862  N  N     . PHE B 1 333  ? 155.029 144.868 106.862 1.00 0.00   ? 333  PHE B N     1 
ATOM   4863  C  CA    . PHE B 1 333  ? 153.636 144.782 106.425 1.00 0.00   ? 333  PHE B CA    1 
ATOM   4864  C  C     . PHE B 1 333  ? 153.216 145.888 105.463 1.00 0.00   ? 333  PHE B C     1 
ATOM   4865  O  O     . PHE B 1 333  ? 152.648 145.612 104.405 1.00 0.00   ? 333  PHE B O     1 
ATOM   4866  C  CB    . PHE B 1 333  ? 152.692 144.793 107.631 1.00 0.00   ? 333  PHE B CB    1 
ATOM   4867  C  CG    . PHE B 1 333  ? 151.936 143.505 107.829 1.00 0.00   ? 333  PHE B CG    1 
ATOM   4868  C  CD1   . PHE B 1 333  ? 152.612 142.324 108.115 1.00 0.00   ? 333  PHE B CD1   1 
ATOM   4869  C  CD2   . PHE B 1 333  ? 150.547 143.476 107.763 1.00 0.00   ? 333  PHE B CD2   1 
ATOM   4870  C  CE1   . PHE B 1 333  ? 151.922 141.137 108.335 1.00 0.00   ? 333  PHE B CE1   1 
ATOM   4871  C  CE2   . PHE B 1 333  ? 149.842 142.289 107.984 1.00 0.00   ? 333  PHE B CE2   1 
ATOM   4872  C  CZ    . PHE B 1 333  ? 150.531 141.118 108.271 1.00 0.00   ? 333  PHE B CZ    1 
ATOM   4873  N  N     . GLY B 1 334  ? 153.485 147.135 105.834 1.00 0.00   ? 334  GLY B N     1 
ATOM   4874  C  CA    . GLY B 1 334  ? 153.108 148.255 104.988 1.00 0.00   ? 334  GLY B CA    1 
ATOM   4875  C  C     . GLY B 1 334  ? 154.104 148.589 103.892 1.00 0.00   ? 334  GLY B C     1 
ATOM   4876  O  O     . GLY B 1 334  ? 153.938 149.578 103.182 1.00 0.00   ? 334  GLY B O     1 
ATOM   4877  N  N     . ASN B 1 335  ? 155.130 147.757 103.750 1.00 0.00   ? 335  ASN B N     1 
ATOM   4878  C  CA    . ASN B 1 335  ? 156.157 147.966 102.737 1.00 0.00   ? 335  ASN B CA    1 
ATOM   4879  C  C     . ASN B 1 335  ? 155.700 147.609 101.328 1.00 0.00   ? 335  ASN B C     1 
ATOM   4880  O  O     . ASN B 1 335  ? 155.472 146.441 101.014 1.00 0.00   ? 335  ASN B O     1 
ATOM   4881  C  CB    . ASN B 1 335  ? 157.417 147.166 103.081 1.00 0.00   ? 335  ASN B CB    1 
ATOM   4882  C  CG    . ASN B 1 335  ? 158.177 147.751 104.258 1.00 0.00   ? 335  ASN B CG    1 
ATOM   4883  O  OD1   . ASN B 1 335  ? 157.779 148.766 104.830 1.00 0.00   ? 335  ASN B OD1   1 
ATOM   4884  N  ND2   . ASN B 1 335  ? 159.282 147.111 104.623 1.00 0.00   ? 335  ASN B ND2   1 
ATOM   4885  N  N     . THR B 1 336  ? 155.563 148.629 100.490 1.00 0.00   ? 336  THR B N     1 
ATOM   4886  C  CA    . THR B 1 336  ? 155.148 148.449 99.103  1.00 0.00   ? 336  THR B CA    1 
ATOM   4887  C  C     . THR B 1 336  ? 156.167 149.151 98.219  1.00 0.00   ? 336  THR B C     1 
ATOM   4888  O  O     . THR B 1 336  ? 156.784 150.134 98.639  1.00 0.00   ? 336  THR B O     1 
ATOM   4889  C  CB    . THR B 1 336  ? 153.770 149.085 98.838  1.00 0.00   ? 336  THR B CB    1 
ATOM   4890  O  OG1   . THR B 1 336  ? 153.821 150.480 99.153  1.00 0.00   ? 336  THR B OG1   1 
ATOM   4891  C  CG2   . THR B 1 336  ? 152.704 148.416 99.686  1.00 0.00   ? 336  THR B CG2   1 
ATOM   4892  N  N     . VAL B 1 337  ? 156.347 148.650 97.002  1.00 0.00   ? 337  VAL B N     1 
ATOM   4893  C  CA    . VAL B 1 337  ? 157.295 149.255 96.071  1.00 0.00   ? 337  VAL B CA    1 
ATOM   4894  C  C     . VAL B 1 337  ? 156.631 149.582 94.740  1.00 0.00   ? 337  VAL B C     1 
ATOM   4895  O  O     . VAL B 1 337  ? 155.665 148.933 94.340  1.00 0.00   ? 337  VAL B O     1 
ATOM   4896  C  CB    . VAL B 1 337  ? 158.501 148.319 95.805  1.00 0.00   ? 337  VAL B CB    1 
ATOM   4897  C  CG1   . VAL B 1 337  ? 159.265 148.074 97.094  1.00 0.00   ? 337  VAL B CG1   1 
ATOM   4898  C  CG2   . VAL B 1 337  ? 158.030 147.003 95.204  1.00 0.00   ? 337  VAL B CG2   1 
ATOM   4899  N  N     . LYS B 1 338  ? 157.150 150.597 94.060  1.00 0.00   ? 338  LYS B N     1 
ATOM   4900  C  CA    . LYS B 1 338  ? 156.607 151.001 92.768  1.00 0.00   ? 338  LYS B CA    1 
ATOM   4901  C  C     . LYS B 1 338  ? 157.074 150.063 91.664  1.00 0.00   ? 338  LYS B C     1 
ATOM   4902  O  O     . LYS B 1 338  ? 158.261 149.753 91.554  1.00 0.00   ? 338  LYS B O     1 
ATOM   4903  C  CB    . LYS B 1 338  ? 157.025 152.438 92.430  1.00 0.00   ? 338  LYS B CB    1 
ATOM   4904  C  CG    . LYS B 1 338  ? 156.361 153.510 93.290  1.00 0.00   ? 338  LYS B CG    1 
ATOM   4905  C  CD    . LYS B 1 338  ? 156.697 154.913 92.798  1.00 0.00   ? 338  LYS B CD    1 
ATOM   4906  C  CE    . LYS B 1 338  ? 155.956 155.975 93.604  1.00 0.00   ? 338  LYS B CE    1 
ATOM   4907  N  NZ    . LYS B 1 338  ? 156.255 157.363 93.147  1.00 0.00   ? 338  LYS B NZ    1 
ATOM   4908  N  N     . VAL B 1 339  ? 156.126 149.605 90.854  1.00 0.00   ? 339  VAL B N     1 
ATOM   4909  C  CA    . VAL B 1 339  ? 156.407 148.702 89.742  1.00 0.00   ? 339  VAL B CA    1 
ATOM   4910  C  C     . VAL B 1 339  ? 155.752 149.305 88.503  1.00 0.00   ? 339  VAL B C     1 
ATOM   4911  O  O     . VAL B 1 339  ? 154.691 149.924 88.600  1.00 0.00   ? 339  VAL B O     1 
ATOM   4912  C  CB    . VAL B 1 339  ? 155.814 147.298 89.995  1.00 0.00   ? 339  VAL B CB    1 
ATOM   4913  C  CG1   . VAL B 1 339  ? 154.300 147.376 90.089  1.00 0.00   ? 339  VAL B CG1   1 
ATOM   4914  C  CG2   . VAL B 1 339  ? 156.229 146.345 88.881  1.00 0.00   ? 339  VAL B CG2   1 
ATOM   4915  N  N     . PRO B 1 340  ? 156.372 149.136 87.322  1.00 0.00   ? 340  PRO B N     1 
ATOM   4916  C  CA    . PRO B 1 340  ? 155.770 149.700 86.109  1.00 0.00   ? 340  PRO B CA    1 
ATOM   4917  C  C     . PRO B 1 340  ? 154.370 149.135 85.919  1.00 0.00   ? 340  PRO B C     1 
ATOM   4918  O  O     . PRO B 1 340  ? 154.156 147.930 86.040  1.00 0.00   ? 340  PRO B O     1 
ATOM   4919  C  CB    . PRO B 1 340  ? 156.727 149.245 85.016  1.00 0.00   ? 340  PRO B CB    1 
ATOM   4920  C  CG    . PRO B 1 340  ? 158.045 149.277 85.716  1.00 0.00   ? 340  PRO B CG    1 
ATOM   4921  C  CD    . PRO B 1 340  ? 157.717 148.616 87.039  1.00 0.00   ? 340  PRO B CD    1 
ATOM   4922  N  N     . THR B 1 341  ? 153.413 150.009 85.626  1.00 0.00   ? 341  THR B N     1 
ATOM   4923  C  CA    . THR B 1 341  ? 152.024 149.590 85.447  1.00 0.00   ? 341  THR B CA    1 
ATOM   4924  C  C     . THR B 1 341  ? 151.306 150.460 84.429  1.00 0.00   ? 341  THR B C     1 
ATOM   4925  O  O     . THR B 1 341  ? 151.666 151.618 84.219  1.00 0.00   ? 341  THR B O     1 
ATOM   4926  C  CB    . THR B 1 341  ? 151.255 149.701 86.774  1.00 0.00   ? 341  THR B CB    1 
ATOM   4927  O  OG1   . THR B 1 341  ? 149.890 149.323 86.578  1.00 0.00   ? 341  THR B OG1   1 
ATOM   4928  C  CG2   . THR B 1 341  ? 151.303 151.138 87.281  1.00 0.00   ? 341  THR B CG2   1 
ATOM   4929  N  N     . PRO B 1 342  ? 150.276 149.908 83.769  1.00 0.00   ? 342  PRO B N     1 
ATOM   4930  C  CA    . PRO B 1 342  ? 149.539 150.704 82.784  1.00 0.00   ? 342  PRO B CA    1 
ATOM   4931  C  C     . PRO B 1 342  ? 148.816 151.809 83.542  1.00 0.00   ? 342  PRO B C     1 
ATOM   4932  O  O     . PRO B 1 342  ? 148.321 151.574 84.649  1.00 0.00   ? 342  PRO B O     1 
ATOM   4933  C  CB    . PRO B 1 342  ? 148.550 149.704 82.188  1.00 0.00   ? 342  PRO B CB    1 
ATOM   4934  C  CG    . PRO B 1 342  ? 149.241 148.390 82.365  1.00 0.00   ? 342  PRO B CG    1 
ATOM   4935  C  CD    . PRO B 1 342  ? 149.814 148.513 83.746  1.00 0.00   ? 342  PRO B CD    1 
ATOM   4936  N  N     . LEU B 1 343  ? 148.763 153.007 82.977  1.00 0.00   ? 343  LEU B N     1 
ATOM   4937  C  CA    . LEU B 1 343  ? 148.080 154.105 83.648  1.00 0.00   ? 343  LEU B CA    1 
ATOM   4938  C  C     . LEU B 1 343  ? 146.788 154.439 82.918  1.00 0.00   ? 343  LEU B C     1 
ATOM   4939  O  O     . LEU B 1 343  ? 146.647 155.505 82.317  1.00 0.00   ? 343  LEU B O     1 
ATOM   4940  C  CB    . LEU B 1 343  ? 148.997 155.325 83.716  1.00 0.00   ? 343  LEU B CB    1 
ATOM   4941  C  CG    . LEU B 1 343  ? 150.263 155.075 84.542  1.00 0.00   ? 343  LEU B CG    1 
ATOM   4942  C  CD1   . LEU B 1 343  ? 151.204 156.262 84.454  1.00 0.00   ? 343  LEU B CD1   1 
ATOM   4943  C  CD2   . LEU B 1 343  ? 149.867 154.799 85.984  1.00 0.00   ? 343  LEU B CD2   1 
ATOM   4944  N  N     . CYS B 1 344  ? 145.841 153.512 82.996  1.00 0.00   ? 344  CYS B N     1 
ATOM   4945  C  CA    . CYS B 1 344  ? 144.536 153.656 82.363  1.00 0.00   ? 344  CYS B CA    1 
ATOM   4946  C  C     . CYS B 1 344  ? 143.529 152.867 83.185  1.00 0.00   ? 344  CYS B C     1 
ATOM   4947  O  O     . CYS B 1 344  ? 143.897 152.190 84.146  1.00 0.00   ? 344  CYS B O     1 
ATOM   4948  C  CB    . CYS B 1 344  ? 144.579 153.103 80.939  1.00 0.00   ? 344  CYS B CB    1 
ATOM   4949  S  SG    . CYS B 1 344  ? 144.998 151.345 80.838  1.00 0.00   ? 344  CYS B SG    1 
ATOM   4950  N  N     . THR B 1 345  ? 142.258 152.954 82.814  1.00 0.00   ? 345  THR B N     1 
ATOM   4951  C  CA    . THR B 1 345  ? 141.210 152.223 83.519  1.00 0.00   ? 345  THR B CA    1 
ATOM   4952  C  C     . THR B 1 345  ? 141.300 150.768 83.072  1.00 0.00   ? 345  THR B C     1 
ATOM   4953  O  O     . THR B 1 345  ? 141.868 150.479 82.021  1.00 0.00   ? 345  THR B O     1 
ATOM   4954  C  CB    . THR B 1 345  ? 139.810 152.762 83.161  1.00 0.00   ? 345  THR B CB    1 
ATOM   4955  O  OG1   . THR B 1 345  ? 139.534 152.496 81.779  1.00 0.00   ? 345  THR B OG1   1 
ATOM   4956  C  CG2   . THR B 1 345  ? 139.742 154.261 83.397  1.00 0.00   ? 345  THR B CG2   1 
ATOM   4957  N  N     . ALA B 1 346  ? 140.752 149.853 83.866  1.00 0.00   ? 346  ALA B N     1 
ATOM   4958  C  CA    . ALA B 1 346  ? 140.789 148.436 83.512  1.00 0.00   ? 346  ALA B CA    1 
ATOM   4959  C  C     . ALA B 1 346  ? 140.096 148.230 82.171  1.00 0.00   ? 346  ALA B C     1 
ATOM   4960  O  O     . ALA B 1 346  ? 140.503 147.383 81.374  1.00 0.00   ? 346  ALA B O     1 
ATOM   4961  C  CB    . ALA B 1 346  ? 140.099 147.609 84.587  1.00 0.00   ? 346  ALA B CB    1 
ATOM   4962  N  N     . ARG B 1 347  ? 139.049 149.012 81.928  1.00 0.00   ? 347  ARG B N     1 
ATOM   4963  C  CA    . ARG B 1 347  ? 138.292 148.936 80.684  1.00 0.00   ? 347  ARG B CA    1 
ATOM   4964  C  C     . ARG B 1 347  ? 139.179 149.289 79.493  1.00 0.00   ? 347  ARG B C     1 
ATOM   4965  O  O     . ARG B 1 347  ? 139.228 148.551 78.507  1.00 0.00   ? 347  ARG B O     1 
ATOM   4966  C  CB    . ARG B 1 347  ? 137.100 149.899 80.748  1.00 0.00   ? 347  ARG B CB    1 
ATOM   4967  C  CG    . ARG B 1 347  ? 136.248 149.943 79.493  1.00 0.00   ? 347  ARG B CG    1 
ATOM   4968  C  CD    . ARG B 1 347  ? 135.266 151.108 79.534  1.00 0.00   ? 347  ARG B CD    1 
ATOM   4969  N  NE    . ARG B 1 347  ? 134.244 150.951 80.567  1.00 0.00   ? 347  ARG B NE    1 
ATOM   4970  C  CZ    . ARG B 1 347  ? 133.245 150.075 80.508  1.00 0.00   ? 347  ARG B CZ    1 
ATOM   4971  N  NH1   . ARG B 1 347  ? 133.124 149.265 79.462  1.00 0.00   ? 347  ARG B NH1   1 
ATOM   4972  N  NH2   . ARG B 1 347  ? 132.363 150.005 81.494  1.00 0.00   ? 347  ARG B NH2   1 
ATOM   4973  N  N     . GLN B 1 348  ? 139.879 150.417 79.594  1.00 0.00   ? 348  GLN B N     1 
ATOM   4974  C  CA    . GLN B 1 348  ? 140.769 150.869 78.529  1.00 0.00   ? 348  GLN B CA    1 
ATOM   4975  C  C     . GLN B 1 348  ? 141.866 149.841 78.280  1.00 0.00   ? 348  GLN B C     1 
ATOM   4976  O  O     . GLN B 1 348  ? 142.275 149.613 77.140  1.00 0.00   ? 348  GLN B O     1 
ATOM   4977  C  CB    . GLN B 1 348  ? 141.402 152.210 78.903  1.00 0.00   ? 348  GLN B CB    1 
ATOM   4978  C  CG    . GLN B 1 348  ? 140.403 153.347 79.044  1.00 0.00   ? 348  GLN B CG    1 
ATOM   4979  C  CD    . GLN B 1 348  ? 141.069 154.672 79.375  1.00 0.00   ? 348  GLN B CD    1 
ATOM   4980  O  OE1   . GLN B 1 348  ? 141.743 154.806 80.398  1.00 0.00   ? 348  GLN B OE1   1 
ATOM   4981  N  NE2   . GLN B 1 348  ? 140.885 155.655 78.504  1.00 0.00   ? 348  GLN B NE2   1 
ATOM   4982  N  N     . LEU B 1 349  ? 142.338 149.224 79.357  1.00 0.00   ? 349  LEU B N     1 
ATOM   4983  C  CA    . LEU B 1 349  ? 143.380 148.216 79.258  1.00 0.00   ? 349  LEU B CA    1 
ATOM   4984  C  C     . LEU B 1 349  ? 142.863 147.043 78.437  1.00 0.00   ? 349  LEU B C     1 
ATOM   4985  O  O     . LEU B 1 349  ? 143.591 146.479 77.619  1.00 0.00   ? 349  LEU B O     1 
ATOM   4986  C  CB    . LEU B 1 349  ? 143.793 147.729 80.648  1.00 0.00   ? 349  LEU B CB    1 
ATOM   4987  C  CG    . LEU B 1 349  ? 144.949 146.726 80.713  1.00 0.00   ? 349  LEU B CG    1 
ATOM   4988  C  CD1   . LEU B 1 349  ? 146.213 147.335 80.125  1.00 0.00   ? 349  LEU B CD1   1 
ATOM   4989  C  CD2   . LEU B 1 349  ? 145.177 146.323 82.159  1.00 0.00   ? 349  LEU B CD2   1 
ATOM   4990  N  N     . ASP B 1 350  ? 141.604 146.675 78.660  1.00 0.00   ? 350  ASP B N     1 
ATOM   4991  C  CA    . ASP B 1 350  ? 140.999 145.567 77.928  1.00 0.00   ? 350  ASP B CA    1 
ATOM   4992  C  C     . ASP B 1 350  ? 140.627 145.951 76.499  1.00 0.00   ? 350  ASP B C     1 
ATOM   4993  O  O     . ASP B 1 350  ? 140.722 145.127 75.590  1.00 0.00   ? 350  ASP B O     1 
ATOM   4994  C  CB    . ASP B 1 350  ? 139.749 145.050 78.657  1.00 0.00   ? 350  ASP B CB    1 
ATOM   4995  C  CG    . ASP B 1 350  ? 140.080 144.313 79.942  1.00 0.00   ? 350  ASP B CG    1 
ATOM   4996  O  OD1   . ASP B 1 350  ? 141.229 143.827 80.077  1.00 0.00   ? 350  ASP B OD1   1 
ATOM   4997  O  OD2   . ASP B 1 350  ? 139.193 144.199 80.816  1.00 0.00   ? 350  ASP B OD2   1 
ATOM   4998  N  N     . GLU B 1 351  ? 140.205 147.195 76.302  1.00 0.00   ? 351  GLU B N     1 
ATOM   4999  C  CA    . GLU B 1 351  ? 139.828 147.658 74.968  1.00 0.00   ? 351  GLU B CA    1 
ATOM   5000  C  C     . GLU B 1 351  ? 140.992 147.564 73.985  1.00 0.00   ? 351  GLU B C     1 
ATOM   5001  O  O     . GLU B 1 351  ? 140.789 147.287 72.804  1.00 0.00   ? 351  GLU B O     1 
ATOM   5002  C  CB    . GLU B 1 351  ? 139.329 149.108 75.009  1.00 0.00   ? 351  GLU B CB    1 
ATOM   5003  C  CG    . GLU B 1 351  ? 138.845 149.670 73.686  1.00 0.00   ? 351  GLU B CG    1 
ATOM   5004  C  CD    . GLU B 1 351  ? 139.998 150.117 72.803  1.00 0.00   ? 351  GLU B CD    1 
ATOM   5005  O  OE1   . GLU B 1 351  ? 141.077 150.437 73.355  1.00 0.00   ? 351  GLU B OE1   1 
ATOM   5006  O  OE2   . GLU B 1 351  ? 139.833 150.159 71.562  1.00 0.00   ? 351  GLU B OE2   1 
ATOM   5007  N  N     . ASP B 1 352  ? 142.209 147.800 74.469  1.00 0.00   ? 352  ASP B N     1 
ATOM   5008  C  CA    . ASP B 1 352  ? 143.391 147.746 73.609  1.00 0.00   ? 352  ASP B CA    1 
ATOM   5009  C  C     . ASP B 1 352  ? 144.085 146.387 73.607  1.00 0.00   ? 352  ASP B C     1 
ATOM   5010  O  O     . ASP B 1 352  ? 145.146 146.227 73.004  1.00 0.00   ? 352  ASP B O     1 
ATOM   5011  C  CB    . ASP B 1 352  ? 144.405 148.824 74.012  1.00 0.00   ? 352  ASP B CB    1 
ATOM   5012  C  CG    . ASP B 1 352  ? 145.640 148.825 73.130  1.00 0.00   ? 352  ASP B CG    1 
ATOM   5013  O  OD1   . ASP B 1 352  ? 145.506 149.117 71.920  1.00 0.00   ? 352  ASP B OD1   1 
ATOM   5014  O  OD2   . ASP B 1 352  ? 146.740 148.519 73.637  1.00 0.00   ? 352  ASP B OD2   1 
ATOM   5015  N  N     . ARG C 1 32   ? 92.506  133.551 103.139 1.00 0.00   ? 32   ARG C N     1 
ATOM   5016  C  CA    . ARG C 1 32   ? 93.441  134.715 103.184 1.00 0.00   ? 32   ARG C CA    1 
ATOM   5017  C  C     . ARG C 1 32   ? 94.329  134.640 104.423 1.00 0.00   ? 32   ARG C C     1 
ATOM   5018  O  O     . ARG C 1 32   ? 94.779  135.660 104.940 1.00 0.00   ? 32   ARG C O     1 
ATOM   5019  C  CB    . ARG C 1 32   ? 92.642  136.020 103.196 1.00 0.00   ? 32   ARG C CB    1 
ATOM   5020  C  CG    . ARG C 1 32   ? 91.681  136.161 102.025 1.00 0.00   ? 32   ARG C CG    1 
ATOM   5021  C  CD    . ARG C 1 32   ? 92.387  136.602 100.753 1.00 0.00   ? 32   ARG C CD    1 
ATOM   5022  N  NE    . ARG C 1 32   ? 92.815  137.994 100.832 1.00 0.00   ? 32   ARG C NE    1 
ATOM   5023  C  CZ    . ARG C 1 32   ? 93.213  138.718 99.789  1.00 0.00   ? 32   ARG C CZ    1 
ATOM   5024  N  NH1   . ARG C 1 32   ? 93.244  138.183 98.578  1.00 0.00   ? 32   ARG C NH1   1 
ATOM   5025  N  NH2   . ARG C 1 32   ? 93.569  139.986 99.965  1.00 0.00   ? 32   ARG C NH2   1 
ATOM   5026  N  N     . ALA C 1 33   ? 94.569  133.416 104.894 1.00 0.00   ? 33   ALA C N     1 
ATOM   5027  C  CA    . ALA C 1 33   ? 95.401  133.176 106.071 1.00 0.00   ? 33   ALA C CA    1 
ATOM   5028  C  C     . ALA C 1 33   ? 96.881  133.369 105.743 1.00 0.00   ? 33   ALA C C     1 
ATOM   5029  O  O     . ALA C 1 33   ? 97.365  132.889 104.718 1.00 0.00   ? 33   ALA C O     1 
ATOM   5030  C  CB    . ALA C 1 33   ? 95.161  131.760 106.598 1.00 0.00   ? 33   ALA C CB    1 
ATOM   5031  N  N     . ARG C 1 34   ? 97.598  134.073 106.614 1.00 0.00   ? 34   ARG C N     1 
ATOM   5032  C  CA    . ARG C 1 34   ? 99.023  134.313 106.410 1.00 0.00   ? 34   ARG C CA    1 
ATOM   5033  C  C     . ARG C 1 34   ? 99.865  133.157 106.944 1.00 0.00   ? 34   ARG C C     1 
ATOM   5034  O  O     . ARG C 1 34   ? 99.549  132.573 107.983 1.00 0.00   ? 34   ARG C O     1 
ATOM   5035  C  CB    . ARG C 1 34   ? 99.455  135.616 107.096 1.00 0.00   ? 34   ARG C CB    1 
ATOM   5036  C  CG    . ARG C 1 34   ? 98.923  136.893 106.450 1.00 0.00   ? 34   ARG C CG    1 
ATOM   5037  C  CD    . ARG C 1 34   ? 99.507  138.139 107.112 1.00 0.00   ? 34   ARG C CD    1 
ATOM   5038  N  NE    . ARG C 1 34   ? 99.204  138.211 108.538 1.00 0.00   ? 34   ARG C NE    1 
ATOM   5039  C  CZ    . ARG C 1 34   ? 99.549  139.224 109.328 1.00 0.00   ? 34   ARG C CZ    1 
ATOM   5040  N  NH1   . ARG C 1 34   ? 100.216 140.257 108.838 1.00 0.00   ? 34   ARG C NH1   1 
ATOM   5041  N  NH2   . ARG C 1 34   ? 99.222  139.201 110.614 1.00 0.00   ? 34   ARG C NH2   1 
ATOM   5042  N  N     . PHE C 1 35   ? 100.934 132.824 106.226 1.00 0.00   ? 35   PHE C N     1 
ATOM   5043  C  CA    . PHE C 1 35   ? 101.824 131.746 106.641 1.00 0.00   ? 35   PHE C CA    1 
ATOM   5044  C  C     . PHE C 1 35   ? 102.523 132.162 107.923 1.00 0.00   ? 35   PHE C C     1 
ATOM   5045  O  O     . PHE C 1 35   ? 102.555 131.418 108.903 1.00 0.00   ? 35   PHE C O     1 
ATOM   5046  C  CB    . PHE C 1 35   ? 102.868 131.468 105.554 1.00 0.00   ? 35   PHE C CB    1 
ATOM   5047  C  CG    . PHE C 1 35   ? 103.741 130.278 105.842 1.00 0.00   ? 35   PHE C CG    1 
ATOM   5048  C  CD1   . PHE C 1 35   ? 103.181 129.024 106.062 1.00 0.00   ? 35   PHE C CD1   1 
ATOM   5049  C  CD2   . PHE C 1 35   ? 105.126 130.402 105.868 1.00 0.00   ? 35   PHE C CD2   1 
ATOM   5050  C  CE1   . PHE C 1 35   ? 103.981 127.914 106.311 1.00 0.00   ? 35   PHE C CE1   1 
ATOM   5051  C  CE2   . PHE C 1 35   ? 105.940 129.296 106.117 1.00 0.00   ? 35   PHE C CE2   1 
ATOM   5052  C  CZ    . PHE C 1 35   ? 105.367 128.047 106.337 1.00 0.00   ? 35   PHE C CZ    1 
ATOM   5053  N  N     . VAL C 1 36   ? 103.087 133.366 107.898 1.00 0.00   ? 36   VAL C N     1 
ATOM   5054  C  CA    . VAL C 1 36   ? 103.786 133.940 109.038 1.00 0.00   ? 36   VAL C CA    1 
ATOM   5055  C  C     . VAL C 1 36   ? 103.331 135.393 109.162 1.00 0.00   ? 36   VAL C C     1 
ATOM   5056  O  O     . VAL C 1 36   ? 103.018 136.039 108.162 1.00 0.00   ? 36   VAL C O     1 
ATOM   5057  C  CB    . VAL C 1 36   ? 105.315 133.886 108.831 1.00 0.00   ? 36   VAL C CB    1 
ATOM   5058  C  CG1   . VAL C 1 36   ? 105.774 132.438 108.763 1.00 0.00   ? 36   VAL C CG1   1 
ATOM   5059  C  CG2   . VAL C 1 36   ? 105.692 134.601 107.558 1.00 0.00   ? 36   VAL C CG2   1 
ATOM   5060  N  N     . SER C 1 37   ? 103.288 135.901 110.387 1.00 0.00   ? 37   SER C N     1 
ATOM   5061  C  CA    . SER C 1 37   ? 102.848 137.271 110.634 1.00 0.00   ? 37   SER C CA    1 
ATOM   5062  C  C     . SER C 1 37   ? 103.866 138.301 110.157 1.00 0.00   ? 37   SER C C     1 
ATOM   5063  O  O     . SER C 1 37   ? 104.950 137.945 109.683 1.00 0.00   ? 37   SER C O     1 
ATOM   5064  C  CB    . SER C 1 37   ? 102.577 137.462 112.127 1.00 0.00   ? 37   SER C CB    1 
ATOM   5065  O  OG    . SER C 1 37   ? 102.226 138.802 112.425 1.00 0.00   ? 37   SER C OG    1 
ATOM   5066  N  N     . LYS C 1 38   ? 103.509 139.578 110.275 1.00 0.00   ? 38   LYS C N     1 
ATOM   5067  C  CA    . LYS C 1 38   ? 104.397 140.657 109.866 1.00 0.00   ? 38   LYS C CA    1 
ATOM   5068  C  C     . LYS C 1 38   ? 105.646 140.570 110.739 1.00 0.00   ? 38   LYS C C     1 
ATOM   5069  O  O     . LYS C 1 38   ? 106.743 140.944 110.323 1.00 0.00   ? 38   LYS C O     1 
ATOM   5070  C  CB    . LYS C 1 38   ? 103.724 142.011 110.073 1.00 0.00   ? 38   LYS C CB    1 
ATOM   5071  C  CG    . LYS C 1 38   ? 102.420 142.190 109.305 1.00 0.00   ? 38   LYS C CG    1 
ATOM   5072  C  CD    . LYS C 1 38   ? 102.660 142.029 107.813 1.00 0.00   ? 38   LYS C CD    1 
ATOM   5073  C  CE    . LYS C 1 38   ? 103.458 143.192 107.245 1.00 0.00   ? 38   LYS C CE    1 
ATOM   5074  N  NZ    . LYS C 1 38   ? 103.547 143.115 105.760 1.00 0.00   ? 38   LYS C NZ    1 
ATOM   5075  N  N     . LYS C 1 39   ? 105.460 140.062 111.951 1.00 0.00   ? 39   LYS C N     1 
ATOM   5076  C  CA    . LYS C 1 39   ? 106.537 139.907 112.926 1.00 0.00   ? 39   LYS C CA    1 
ATOM   5077  C  C     . LYS C 1 39   ? 106.972 138.445 113.015 1.00 0.00   ? 39   LYS C C     1 
ATOM   5078  O  O     . LYS C 1 39   ? 107.361 137.971 114.085 1.00 0.00   ? 39   LYS C O     1 
ATOM   5079  C  CB    . LYS C 1 39   ? 106.062 140.372 114.307 1.00 0.00   ? 39   LYS C CB    1 
ATOM   5080  C  CG    . LYS C 1 39   ? 105.361 141.722 114.312 1.00 0.00   ? 39   LYS C CG    1 
ATOM   5081  C  CD    . LYS C 1 39   ? 104.722 142.010 115.663 1.00 0.00   ? 39   LYS C CD    1 
ATOM   5082  C  CE    . LYS C 1 39   ? 104.032 143.365 115.656 1.00 0.00   ? 39   LYS C CE    1 
ATOM   5083  N  NZ    . LYS C 1 39   ? 103.396 143.687 116.965 1.00 0.00   ? 39   LYS C NZ    1 
ATOM   5084  N  N     . GLY C 1 40   ? 106.888 137.729 111.899 1.00 0.00   ? 40   GLY C N     1 
ATOM   5085  C  CA    . GLY C 1 40   ? 107.261 136.326 111.911 1.00 0.00   ? 40   GLY C CA    1 
ATOM   5086  C  C     . GLY C 1 40   ? 106.233 135.604 112.753 1.00 0.00   ? 40   GLY C C     1 
ATOM   5087  O  O     . GLY C 1 40   ? 105.045 135.632 112.429 1.00 0.00   ? 40   GLY C O     1 
ATOM   5088  N  N     . ASN C 1 41   ? 106.674 134.964 113.833 1.00 0.00   ? 41   ASN C N     1 
ATOM   5089  C  CA    . ASN C 1 41   ? 105.733 134.281 114.705 1.00 0.00   ? 41   ASN C CA    1 
ATOM   5090  C  C     . ASN C 1 41   ? 104.832 133.414 113.844 1.00 0.00   ? 41   ASN C C     1 
ATOM   5091  O  O     . ASN C 1 41   ? 103.616 133.603 113.810 1.00 0.00   ? 41   ASN C O     1 
ATOM   5092  C  CB    . ASN C 1 41   ? 104.908 135.301 115.488 1.00 0.00   ? 41   ASN C CB    1 
ATOM   5093  C  CG    . ASN C 1 41   ? 104.070 134.657 116.566 1.00 0.00   ? 41   ASN C CG    1 
ATOM   5094  O  OD1   . ASN C 1 41   ? 104.553 133.815 117.321 1.00 0.00   ? 41   ASN C OD1   1 
ATOM   5095  N  ND2   . ASN C 1 41   ? 102.804 135.058 116.650 1.00 0.00   ? 41   ASN C ND2   1 
ATOM   5096  N  N     . CYS C 1 42   ? 105.442 132.464 113.143 1.00 0.00   ? 42   CYS C N     1 
ATOM   5097  C  CA    . CYS C 1 42   ? 104.711 131.605 112.223 1.00 0.00   ? 42   CYS C CA    1 
ATOM   5098  C  C     . CYS C 1 42   ? 103.449 131.033 112.847 1.00 0.00   ? 42   CYS C C     1 
ATOM   5099  O  O     . CYS C 1 42   ? 103.456 130.481 113.944 1.00 0.00   ? 42   CYS C O     1 
ATOM   5100  C  CB    . CYS C 1 42   ? 105.616 130.456 111.771 1.00 0.00   ? 42   CYS C CB    1 
ATOM   5101  S  SG    . CYS C 1 42   ? 106.327 129.491 113.120 1.00 0.00   ? 42   CYS C SG    1 
ATOM   5102  N  N     . ASN C 1 43   ? 102.357 131.198 112.105 1.00 0.00   ? 43   ASN C N     1 
ATOM   5103  C  CA    . ASN C 1 43   ? 101.031 130.760 112.517 1.00 0.00   ? 43   ASN C CA    1 
ATOM   5104  C  C     . ASN C 1 43   ? 100.557 129.510 111.778 1.00 0.00   ? 43   ASN C C     1 
ATOM   5105  O  O     . ASN C 1 43   ? 99.817  129.593 110.797 1.00 0.00   ? 43   ASN C O     1 
ATOM   5106  C  CB    . ASN C 1 43   ? 100.053 131.923 112.305 1.00 0.00   ? 43   ASN C CB    1 
ATOM   5107  C  CG    . ASN C 1 43   ? 98.610  131.535 112.521 1.00 0.00   ? 43   ASN C CG    1 
ATOM   5108  O  OD1   . ASN C 1 43   ? 98.286  130.785 113.440 1.00 0.00   ? 43   ASN C OD1   1 
ATOM   5109  N  ND2   . ASN C 1 43   ? 97.724  132.066 111.684 1.00 0.00   ? 43   ASN C ND2   1 
ATOM   5110  N  N     . VAL C 1 44   ? 100.996 128.351 112.267 1.00 0.00   ? 44   VAL C N     1 
ATOM   5111  C  CA    . VAL C 1 44   ? 100.633 127.063 111.678 1.00 0.00   ? 44   VAL C CA    1 
ATOM   5112  C  C     . VAL C 1 44   ? 100.237 126.039 112.741 1.00 0.00   ? 44   VAL C C     1 
ATOM   5113  O  O     . VAL C 1 44   ? 100.973 125.820 113.706 1.00 0.00   ? 44   VAL C O     1 
ATOM   5114  C  CB    . VAL C 1 44   ? 101.796 126.463 110.862 1.00 0.00   ? 44   VAL C CB    1 
ATOM   5115  C  CG1   . VAL C 1 44   ? 101.418 125.073 110.360 1.00 0.00   ? 44   VAL C CG1   1 
ATOM   5116  C  CG2   . VAL C 1 44   ? 102.131 127.368 109.693 1.00 0.00   ? 44   VAL C CG2   1 
ATOM   5117  N  N     . ALA C 1 45   ? 99.083  125.415 112.559 1.00 0.00   ? 45   ALA C N     1 
ATOM   5118  C  CA    . ALA C 1 45   ? 98.614  124.397 113.494 1.00 0.00   ? 45   ALA C CA    1 
ATOM   5119  C  C     . ALA C 1 45   ? 99.211  123.057 113.056 1.00 0.00   ? 45   ALA C C     1 
ATOM   5120  O  O     . ALA C 1 45   ? 99.498  122.857 111.876 1.00 0.00   ? 45   ALA C O     1 
ATOM   5121  C  CB    . ALA C 1 45   ? 97.088  124.334 113.485 1.00 0.00   ? 45   ALA C CB    1 
ATOM   5122  N  N     . HIS C 1 46   ? 99.392  122.137 114.002 1.00 0.00   ? 46   HIS C N     1 
ATOM   5123  C  CA    . HIS C 1 46   ? 99.980  120.824 113.708 1.00 0.00   ? 46   HIS C CA    1 
ATOM   5124  C  C     . HIS C 1 46   ? 99.089  119.684 114.211 1.00 0.00   ? 46   HIS C C     1 
ATOM   5125  O  O     . HIS C 1 46   ? 99.147  119.311 115.383 1.00 0.00   ? 46   HIS C O     1 
ATOM   5126  C  CB    . HIS C 1 46   ? 101.352 120.736 114.372 1.00 0.00   ? 46   HIS C CB    1 
ATOM   5127  C  CG    . HIS C 1 46   ? 102.299 121.827 113.953 1.00 0.00   ? 46   HIS C CG    1 
ATOM   5128  N  ND1   . HIS C 1 46   ? 103.138 121.717 112.866 1.00 0.00   ? 46   HIS C ND1   1 
ATOM   5129  C  CD2   . HIS C 1 46   ? 102.528 123.054 114.476 1.00 0.00   ? 46   HIS C CD2   1 
ATOM   5130  C  CE1   . HIS C 1 46   ? 103.845 122.825 112.740 1.00 0.00   ? 46   HIS C CE1   1 
ATOM   5131  N  NE2   . HIS C 1 46   ? 103.497 123.653 113.706 1.00 0.00   ? 46   HIS C NE2   1 
ATOM   5132  N  N     . LYS C 1 47   ? 98.280  119.119 113.321 1.00 0.00   ? 47   LYS C N     1 
ATOM   5133  C  CA    . LYS C 1 47   ? 97.349  118.055 113.697 1.00 0.00   ? 47   LYS C CA    1 
ATOM   5134  C  C     . LYS C 1 47   ? 97.849  116.609 113.686 1.00 0.00   ? 47   LYS C C     1 
ATOM   5135  O  O     . LYS C 1 47   ? 98.665  116.215 112.849 1.00 0.00   ? 47   LYS C O     1 
ATOM   5136  C  CB    . LYS C 1 47   ? 96.064  118.181 112.861 1.00 0.00   ? 47   LYS C CB    1 
ATOM   5137  C  CG    . LYS C 1 47   ? 95.377  119.535 113.069 1.00 0.00   ? 47   LYS C CG    1 
ATOM   5138  C  CD    . LYS C 1 47   ? 93.950  119.610 112.528 1.00 0.00   ? 47   LYS C CD    1 
ATOM   5139  C  CE    . LYS C 1 47   ? 93.288  120.917 112.958 1.00 0.00   ? 47   LYS C CE    1 
ATOM   5140  N  NZ    . LYS C 1 47   ? 91.896  121.088 112.450 1.00 0.00   ? 47   LYS C NZ    1 
ATOM   5141  N  N     . ASN C 1 48   ? 97.319  115.831 114.632 1.00 0.00   ? 48   ASN C N     1 
ATOM   5142  C  CA    . ASN C 1 48   ? 97.650  114.421 114.829 1.00 0.00   ? 48   ASN C CA    1 
ATOM   5143  C  C     . ASN C 1 48   ? 99.093  114.158 115.183 1.00 0.00   ? 48   ASN C C     1 
ATOM   5144  O  O     . ASN C 1 48   ? 99.704  113.246 114.628 1.00 0.00   ? 48   ASN C O     1 
ATOM   5145  C  CB    . ASN C 1 48   ? 97.342  113.603 113.580 1.00 0.00   ? 48   ASN C CB    1 
ATOM   5146  C  CG    . ASN C 1 48   ? 95.957  113.813 113.081 1.00 0.00   ? 48   ASN C CG    1 
ATOM   5147  O  OD1   . ASN C 1 48   ? 94.991  113.246 113.596 1.00 0.00   ? 48   ASN C OD1   1 
ATOM   5148  N  ND2   . ASN C 1 48   ? 95.838  114.650 112.066 1.00 0.00   ? 48   ASN C ND2   1 
ATOM   5149  N  N     . ILE C 1 49   ? 99.688  114.947 116.056 1.00 0.00   ? 49   ILE C N     1 
ATOM   5150  C  CA    . ILE C 1 49   ? 101.059 114.629 116.360 1.00 0.00   ? 49   ILE C CA    1 
ATOM   5151  C  C     . ILE C 1 49   ? 101.004 113.310 117.099 1.00 0.00   ? 49   ILE C C     1 
ATOM   5152  O  O     . ILE C 1 49   ? 100.264 113.171 118.068 1.00 0.00   ? 49   ILE C O     1 
ATOM   5153  C  CB    . ILE C 1 49   ? 101.700 115.690 117.251 1.00 0.00   ? 49   ILE C CB    1 
ATOM   5154  C  CG1   . ILE C 1 49   ? 101.617 117.055 116.580 1.00 0.00   ? 49   ILE C CG1   1 
ATOM   5155  C  CG2   . ILE C 1 49   ? 103.148 115.337 117.524 1.00 0.00   ? 49   ILE C CG2   1 
ATOM   5156  C  CD1   . ILE C 1 49   ? 102.225 118.164 117.407 1.00 0.00   ? 49   ILE C CD1   1 
ATOM   5157  N  N     . ARG C 1 50   ? 101.781 112.338 116.647 1.00 0.00   ? 50   ARG C N     1 
ATOM   5158  C  CA    . ARG C 1 50   ? 101.820 111.049 117.315 1.00 0.00   ? 50   ARG C CA    1 
ATOM   5159  C  C     . ARG C 1 50   ? 102.853 111.204 118.403 1.00 0.00   ? 50   ARG C C     1 
ATOM   5160  O  O     . ARG C 1 50   ? 103.949 110.661 118.313 1.00 0.00   ? 50   ARG C O     1 
ATOM   5161  C  CB    . ARG C 1 50   ? 102.245 109.953 116.344 1.00 0.00   ? 50   ARG C CB    1 
ATOM   5162  C  CG    . ARG C 1 50   ? 101.101 109.214 115.677 1.00 0.00   ? 50   ARG C CG    1 
ATOM   5163  C  CD    . ARG C 1 50   ? 101.645 108.063 114.851 1.00 0.00   ? 50   ARG C CD    1 
ATOM   5164  N  NE    . ARG C 1 50   ? 102.794 107.448 115.507 1.00 0.00   ? 50   ARG C NE    1 
ATOM   5165  C  CZ    . ARG C 1 50   ? 103.556 106.509 114.961 1.00 0.00   ? 50   ARG C CZ    1 
ATOM   5166  N  NH1   . ARG C 1 50   ? 103.292 106.062 113.739 1.00 0.00   ? 50   ARG C NH1   1 
ATOM   5167  N  NH2   . ARG C 1 50   ? 104.583 106.014 115.636 1.00 0.00   ? 50   ARG C NH2   1 
ATOM   5168  N  N     . GLU C 1 51   ? 102.519 111.937 119.458 1.00 0.00   ? 51   GLU C N     1 
ATOM   5169  C  CA    . GLU C 1 51   ? 103.514 112.172 120.494 1.00 0.00   ? 51   GLU C CA    1 
ATOM   5170  C  C     . GLU C 1 51   ? 103.998 110.874 121.114 1.00 0.00   ? 51   GLU C C     1 
ATOM   5171  O  O     . GLU C 1 51   ? 103.208 110.028 121.521 1.00 0.00   ? 51   GLU C O     1 
ATOM   5172  C  CB    . GLU C 1 51   ? 102.942 113.079 121.587 1.00 0.00   ? 51   GLU C CB    1 
ATOM   5173  C  CG    . GLU C 1 51   ? 102.659 114.502 121.126 1.00 0.00   ? 51   GLU C CG    1 
ATOM   5174  C  CD    . GLU C 1 51   ? 102.028 115.358 122.207 1.00 0.00   ? 51   GLU C CD    1 
ATOM   5175  O  OE1   . GLU C 1 51   ? 101.635 114.801 123.252 1.00 0.00   ? 51   GLU C OE1   1 
ATOM   5176  O  OE2   . GLU C 1 51   ? 101.919 116.589 122.007 1.00 0.00   ? 51   GLU C OE2   1 
ATOM   5177  N  N     . GLN C 1 52   ? 105.319 110.737 121.177 1.00 0.00   ? 52   GLN C N     1 
ATOM   5178  C  CA    . GLN C 1 52   ? 105.953 109.575 121.769 1.00 0.00   ? 52   GLN C CA    1 
ATOM   5179  C  C     . GLN C 1 52   ? 106.500 109.948 123.132 1.00 0.00   ? 52   GLN C C     1 
ATOM   5180  O  O     . GLN C 1 52   ? 107.134 109.135 123.801 1.00 0.00   ? 52   GLN C O     1 
ATOM   5181  C  CB    . GLN C 1 52   ? 107.081 109.062 120.875 1.00 0.00   ? 52   GLN C CB    1 
ATOM   5182  C  CG    . GLN C 1 52   ? 106.667 108.795 119.439 1.00 0.00   ? 52   GLN C CG    1 
ATOM   5183  C  CD    . GLN C 1 52   ? 105.516 107.817 119.334 1.00 0.00   ? 52   GLN C CD    1 
ATOM   5184  O  OE1   . GLN C 1 52   ? 104.843 107.527 120.323 1.00 0.00   ? 52   GLN C OE1   1 
ATOM   5185  N  NE2   . GLN C 1 52   ? 105.280 107.303 118.132 1.00 0.00   ? 52   GLN C NE2   1 
ATOM   5186  N  N     . GLY C 1 53   ? 106.260 111.190 123.539 1.00 0.00   ? 53   GLY C N     1 
ATOM   5187  C  CA    . GLY C 1 53   ? 106.752 111.657 124.823 1.00 0.00   ? 53   GLY C CA    1 
ATOM   5188  C  C     . GLY C 1 53   ? 108.056 112.422 124.688 1.00 0.00   ? 53   GLY C C     1 
ATOM   5189  O  O     . GLY C 1 53   ? 108.592 112.937 125.670 1.00 0.00   ? 53   GLY C O     1 
ATOM   5190  N  N     . ARG C 1 54   ? 108.568 112.487 123.463 1.00 0.00   ? 54   ARG C N     1 
ATOM   5191  C  CA    . ARG C 1 54   ? 109.812 113.187 123.176 1.00 0.00   ? 54   ARG C CA    1 
ATOM   5192  C  C     . ARG C 1 54   ? 109.656 114.668 123.502 1.00 0.00   ? 54   ARG C C     1 
ATOM   5193  O  O     . ARG C 1 54   ? 110.638 115.387 123.677 1.00 0.00   ? 54   ARG C O     1 
ATOM   5194  C  CB    . ARG C 1 54   ? 110.179 113.009 121.700 1.00 0.00   ? 54   ARG C CB    1 
ATOM   5195  C  CG    . ARG C 1 54   ? 110.588 111.589 121.347 1.00 0.00   ? 54   ARG C CG    1 
ATOM   5196  C  CD    . ARG C 1 54   ? 111.242 111.509 119.979 1.00 0.00   ? 54   ARG C CD    1 
ATOM   5197  N  NE    . ARG C 1 54   ? 110.332 111.904 118.903 1.00 0.00   ? 54   ARG C NE    1 
ATOM   5198  C  CZ    . ARG C 1 54   ? 109.478 111.075 118.309 1.00 0.00   ? 54   ARG C CZ    1 
ATOM   5199  N  NH1   . ARG C 1 54   ? 109.419 109.805 118.684 1.00 0.00   ? 54   ARG C NH1   1 
ATOM   5200  N  NH2   . ARG C 1 54   ? 108.686 111.514 117.338 1.00 0.00   ? 54   ARG C NH2   1 
ATOM   5201  N  N     . PHE C 1 55   ? 108.405 115.115 123.574 1.00 0.00   ? 55   PHE C N     1 
ATOM   5202  C  CA    . PHE C 1 55   ? 108.099 116.502 123.877 1.00 0.00   ? 55   PHE C CA    1 
ATOM   5203  C  C     . PHE C 1 55   ? 108.636 116.879 125.254 1.00 0.00   ? 55   PHE C C     1 
ATOM   5204  O  O     . PHE C 1 55   ? 109.163 117.977 125.450 1.00 0.00   ? 55   PHE C O     1 
ATOM   5205  C  CB    . PHE C 1 55   ? 106.587 116.730 123.852 1.00 0.00   ? 55   PHE C CB    1 
ATOM   5206  C  CG    . PHE C 1 55   ? 106.190 118.156 124.095 1.00 0.00   ? 55   PHE C CG    1 
ATOM   5207  C  CD1   . PHE C 1 55   ? 106.353 119.113 123.105 1.00 0.00   ? 55   PHE C CD1   1 
ATOM   5208  C  CD2   . PHE C 1 55   ? 105.672 118.548 125.326 1.00 0.00   ? 55   PHE C CD2   1 
ATOM   5209  C  CE1   . PHE C 1 55   ? 106.013 120.439 123.327 1.00 0.00   ? 55   PHE C CE1   1 
ATOM   5210  C  CE2   . PHE C 1 55   ? 105.327 119.877 125.565 1.00 0.00   ? 55   PHE C CE2   1 
ATOM   5211  C  CZ    . PHE C 1 55   ? 105.499 120.825 124.562 1.00 0.00   ? 55   PHE C CZ    1 
ATOM   5212  N  N     . LEU C 1 56   ? 108.496 115.964 126.205 1.00 0.00   ? 56   LEU C N     1 
ATOM   5213  C  CA    . LEU C 1 56   ? 108.955 116.205 127.563 1.00 0.00   ? 56   LEU C CA    1 
ATOM   5214  C  C     . LEU C 1 56   ? 110.352 115.662 127.848 1.00 0.00   ? 56   LEU C C     1 
ATOM   5215  O  O     . LEU C 1 56   ? 111.009 116.115 128.786 1.00 0.00   ? 56   LEU C O     1 
ATOM   5216  C  CB    . LEU C 1 56   ? 107.955 115.624 128.567 1.00 0.00   ? 56   LEU C CB    1 
ATOM   5217  C  CG    . LEU C 1 56   ? 106.579 116.291 128.569 1.00 0.00   ? 56   LEU C CG    1 
ATOM   5218  C  CD1   . LEU C 1 56   ? 105.705 115.646 129.632 1.00 0.00   ? 56   LEU C CD1   1 
ATOM   5219  C  CD2   . LEU C 1 56   ? 106.726 117.783 128.832 1.00 0.00   ? 56   LEU C CD2   1 
ATOM   5220  N  N     . GLN C 1 57   ? 110.806 114.702 127.050 1.00 0.00   ? 57   GLN C N     1 
ATOM   5221  C  CA    . GLN C 1 57   ? 112.141 114.138 127.246 1.00 0.00   ? 57   GLN C CA    1 
ATOM   5222  C  C     . GLN C 1 57   ? 113.140 115.275 127.124 1.00 0.00   ? 57   GLN C C     1 
ATOM   5223  O  O     . GLN C 1 57   ? 114.126 115.342 127.854 1.00 0.00   ? 57   GLN C O     1 
ATOM   5224  C  CB    . GLN C 1 57   ? 112.458 113.080 126.186 1.00 0.00   ? 57   GLN C CB    1 
ATOM   5225  C  CG    . GLN C 1 57   ? 111.512 111.908 126.189 1.00 0.00   ? 57   GLN C CG    1 
ATOM   5226  C  CD    . GLN C 1 57   ? 112.043 110.734 125.393 1.00 0.00   ? 57   GLN C CD    1 
ATOM   5227  O  OE1   . GLN C 1 57   ? 112.155 110.798 124.168 1.00 0.00   ? 57   GLN C OE1   1 
ATOM   5228  N  NE2   . GLN C 1 57   ? 112.379 109.652 126.087 1.00 0.00   ? 57   GLN C NE2   1 
ATOM   5229  N  N     . ASP C 1 58   ? 112.861 116.163 126.173 1.00 0.00   ? 58   ASP C N     1 
ATOM   5230  C  CA    . ASP C 1 58   ? 113.690 117.335 125.925 1.00 0.00   ? 58   ASP C CA    1 
ATOM   5231  C  C     . ASP C 1 58   ? 113.284 118.352 126.983 1.00 0.00   ? 58   ASP C C     1 
ATOM   5232  O  O     . ASP C 1 58   ? 112.676 119.383 126.691 1.00 0.00   ? 58   ASP C O     1 
ATOM   5233  C  CB    . ASP C 1 58   ? 113.410 117.875 124.519 1.00 0.00   ? 58   ASP C CB    1 
ATOM   5234  C  CG    . ASP C 1 58   ? 114.307 119.039 124.148 1.00 0.00   ? 58   ASP C CG    1 
ATOM   5235  O  OD1   . ASP C 1 58   ? 115.162 119.428 124.970 1.00 0.00   ? 58   ASP C OD1   1 
ATOM   5236  O  OD2   . ASP C 1 58   ? 114.159 119.556 123.017 1.00 0.00   ? 58   ASP C OD2   1 
ATOM   5237  N  N     . VAL C 1 59   ? 113.629 118.035 128.223 1.00 0.00   ? 59   VAL C N     1 
ATOM   5238  C  CA    . VAL C 1 59   ? 113.307 118.869 129.369 1.00 0.00   ? 59   VAL C CA    1 
ATOM   5239  C  C     . VAL C 1 59   ? 113.980 120.237 129.340 1.00 0.00   ? 59   VAL C C     1 
ATOM   5240  O  O     . VAL C 1 59   ? 113.339 121.254 129.604 1.00 0.00   ? 59   VAL C O     1 
ATOM   5241  C  CB    . VAL C 1 59   ? 113.722 118.168 130.681 1.00 0.00   ? 59   VAL C CB    1 
ATOM   5242  C  CG1   . VAL C 1 59   ? 113.567 119.112 131.860 1.00 0.00   ? 59   VAL C CG1   1 
ATOM   5243  C  CG2   . VAL C 1 59   ? 112.881 116.919 130.883 1.00 0.00   ? 59   VAL C CG2   1 
ATOM   5244  N  N     . PHE C 1 60   ? 115.267 120.257 129.016 1.00 0.00   ? 60   PHE C N     1 
ATOM   5245  C  CA    . PHE C 1 60   ? 116.029 121.495 129.011 1.00 0.00   ? 60   PHE C CA    1 
ATOM   5246  C  C     . PHE C 1 60   ? 115.768 122.502 127.886 1.00 0.00   ? 60   PHE C C     1 
ATOM   5247  O  O     . PHE C 1 60   ? 115.910 123.703 128.097 1.00 0.00   ? 60   PHE C O     1 
ATOM   5248  C  CB    . PHE C 1 60   ? 117.519 121.164 129.121 1.00 0.00   ? 60   PHE C CB    1 
ATOM   5249  C  CG    . PHE C 1 60   ? 117.850 120.305 130.315 1.00 0.00   ? 60   PHE C CG    1 
ATOM   5250  C  CD1   . PHE C 1 60   ? 118.034 118.931 130.177 1.00 0.00   ? 60   PHE C CD1   1 
ATOM   5251  C  CD2   . PHE C 1 60   ? 117.935 120.864 131.590 1.00 0.00   ? 60   PHE C CD2   1 
ATOM   5252  C  CE1   . PHE C 1 60   ? 118.293 118.127 131.286 1.00 0.00   ? 60   PHE C CE1   1 
ATOM   5253  C  CE2   . PHE C 1 60   ? 118.195 120.064 132.705 1.00 0.00   ? 60   PHE C CE2   1 
ATOM   5254  C  CZ    . PHE C 1 60   ? 118.375 118.696 132.554 1.00 0.00   ? 60   PHE C CZ    1 
ATOM   5255  N  N     . THR C 1 61   ? 115.391 122.032 126.701 1.00 0.00   ? 61   THR C N     1 
ATOM   5256  C  CA    . THR C 1 61   ? 115.094 122.974 125.629 1.00 0.00   ? 61   THR C CA    1 
ATOM   5257  C  C     . THR C 1 61   ? 113.774 123.617 126.029 1.00 0.00   ? 61   THR C C     1 
ATOM   5258  O  O     . THR C 1 61   ? 113.528 124.802 125.781 1.00 0.00   ? 61   THR C O     1 
ATOM   5259  C  CB    . THR C 1 61   ? 114.894 122.267 124.284 1.00 0.00   ? 61   THR C CB    1 
ATOM   5260  O  OG1   . THR C 1 61   ? 116.098 121.593 123.918 1.00 0.00   ? 61   THR C OG1   1 
ATOM   5261  C  CG2   . THR C 1 61   ? 114.525 123.269 123.206 1.00 0.00   ? 61   THR C CG2   1 
ATOM   5262  N  N     . THR C 1 62   ? 112.937 122.803 126.659 1.00 0.00   ? 62   THR C N     1 
ATOM   5263  C  CA    . THR C 1 62   ? 111.624 123.209 127.132 1.00 0.00   ? 62   THR C CA    1 
ATOM   5264  C  C     . THR C 1 62   ? 111.741 124.237 128.249 1.00 0.00   ? 62   THR C C     1 
ATOM   5265  O  O     . THR C 1 62   ? 111.076 125.273 128.225 1.00 0.00   ? 62   THR C O     1 
ATOM   5266  C  CB    . THR C 1 62   ? 110.842 121.995 127.662 1.00 0.00   ? 62   THR C CB    1 
ATOM   5267  O  OG1   . THR C 1 62   ? 110.588 121.086 126.583 1.00 0.00   ? 62   THR C OG1   1 
ATOM   5268  C  CG2   . THR C 1 62   ? 109.523 122.429 128.276 1.00 0.00   ? 62   THR C CG2   1 
ATOM   5269  N  N     . LEU C 1 63   ? 112.595 123.948 129.228 1.00 0.00   ? 63   LEU C N     1 
ATOM   5270  C  CA    . LEU C 1 63   ? 112.789 124.859 130.348 1.00 0.00   ? 63   LEU C CA    1 
ATOM   5271  C  C     . LEU C 1 63   ? 113.269 126.212 129.848 1.00 0.00   ? 63   LEU C C     1 
ATOM   5272  O  O     . LEU C 1 63   ? 112.778 127.253 130.287 1.00 0.00   ? 63   LEU C O     1 
ATOM   5273  C  CB    . LEU C 1 63   ? 113.806 124.286 131.337 1.00 0.00   ? 63   LEU C CB    1 
ATOM   5274  C  CG    . LEU C 1 63   ? 113.318 123.177 132.264 1.00 0.00   ? 63   LEU C CG    1 
ATOM   5275  C  CD1   . LEU C 1 63   ? 114.470 122.729 133.145 1.00 0.00   ? 63   LEU C CD1   1 
ATOM   5276  C  CD2   . LEU C 1 63   ? 112.160 123.679 133.119 1.00 0.00   ? 63   LEU C CD2   1 
ATOM   5277  N  N     . VAL C 1 64   ? 114.223 126.197 128.924 1.00 0.00   ? 64   VAL C N     1 
ATOM   5278  C  CA    . VAL C 1 64   ? 114.749 127.433 128.365 1.00 0.00   ? 64   VAL C CA    1 
ATOM   5279  C  C     . VAL C 1 64   ? 113.666 128.148 127.566 1.00 0.00   ? 64   VAL C C     1 
ATOM   5280  O  O     . VAL C 1 64   ? 113.631 129.376 127.518 1.00 0.00   ? 64   VAL C O     1 
ATOM   5281  C  CB    . VAL C 1 64   ? 115.931 127.163 127.422 1.00 0.00   ? 64   VAL C CB    1 
ATOM   5282  C  CG1   . VAL C 1 64   ? 116.438 128.471 126.846 1.00 0.00   ? 64   VAL C CG1   1 
ATOM   5283  C  CG2   . VAL C 1 64   ? 117.042 126.444 128.162 1.00 0.00   ? 64   VAL C CG2   1 
ATOM   5284  N  N     . ASP C 1 65   ? 112.789 127.370 126.936 1.00 0.00   ? 65   ASP C N     1 
ATOM   5285  C  CA    . ASP C 1 65   ? 111.706 127.927 126.132 1.00 0.00   ? 65   ASP C CA    1 
ATOM   5286  C  C     . ASP C 1 65   ? 110.654 128.643 126.976 1.00 0.00   ? 65   ASP C C     1 
ATOM   5287  O  O     . ASP C 1 65   ? 109.964 129.543 126.496 1.00 0.00   ? 65   ASP C O     1 
ATOM   5288  C  CB    . ASP C 1 65   ? 111.027 126.830 125.304 1.00 0.00   ? 65   ASP C CB    1 
ATOM   5289  C  CG    . ASP C 1 65   ? 111.887 126.356 124.148 1.00 0.00   ? 65   ASP C CG    1 
ATOM   5290  O  OD1   . ASP C 1 65   ? 112.713 127.161 123.673 1.00 0.00   ? 65   ASP C OD1   1 
ATOM   5291  O  OD2   . ASP C 1 65   ? 111.729 125.196 123.702 1.00 0.00   ? 65   ASP C OD2   1 
ATOM   5292  N  N     . LEU C 1 66   ? 110.538 128.242 128.237 1.00 0.00   ? 66   LEU C N     1 
ATOM   5293  C  CA    . LEU C 1 66   ? 109.557 128.838 129.136 1.00 0.00   ? 66   LEU C CA    1 
ATOM   5294  C  C     . LEU C 1 66   ? 109.771 130.316 129.407 1.00 0.00   ? 66   LEU C C     1 
ATOM   5295  O  O     . LEU C 1 66   ? 110.902 130.808 129.388 1.00 0.00   ? 66   LEU C O     1 
ATOM   5296  C  CB    . LEU C 1 66   ? 109.546 128.093 130.469 1.00 0.00   ? 66   LEU C CB    1 
ATOM   5297  C  CG    . LEU C 1 66   ? 109.155 126.621 130.383 1.00 0.00   ? 66   LEU C CG    1 
ATOM   5298  C  CD1   . LEU C 1 66   ? 109.168 126.017 131.771 1.00 0.00   ? 66   LEU C CD1   1 
ATOM   5299  C  CD2   . LEU C 1 66   ? 107.780 126.490 129.753 1.00 0.00   ? 66   LEU C CD2   1 
ATOM   5300  N  N     . LYS C 1 67   ? 108.672 131.022 129.660 1.00 0.00   ? 67   LYS C N     1 
ATOM   5301  C  CA    . LYS C 1 67   ? 108.721 132.445 129.968 1.00 0.00   ? 67   LYS C CA    1 
ATOM   5302  C  C     . LYS C 1 67   ? 109.444 132.551 131.308 1.00 0.00   ? 67   LYS C C     1 
ATOM   5303  O  O     . LYS C 1 67   ? 109.519 131.571 132.049 1.00 0.00   ? 67   LYS C O     1 
ATOM   5304  C  CB    . LYS C 1 67   ? 107.297 133.007 130.066 1.00 0.00   ? 67   LYS C CB    1 
ATOM   5305  C  CG    . LYS C 1 67   ? 106.471 132.794 128.796 1.00 0.00   ? 67   LYS C CG    1 
ATOM   5306  C  CD    . LYS C 1 67   ? 105.036 133.300 128.931 1.00 0.00   ? 67   LYS C CD    1 
ATOM   5307  C  CE    . LYS C 1 67   ? 104.254 133.068 127.639 1.00 0.00   ? 67   LYS C CE    1 
ATOM   5308  N  NZ    . LYS C 1 67   ? 102.840 133.538 127.732 1.00 0.00   ? 67   LYS C NZ    1 
ATOM   5309  N  N     . TRP C 1 68   ? 109.972 133.729 131.626 1.00 0.00   ? 68   TRP C N     1 
ATOM   5310  C  CA    . TRP C 1 68   ? 110.706 133.914 132.879 1.00 0.00   ? 68   TRP C CA    1 
ATOM   5311  C  C     . TRP C 1 68   ? 109.910 133.629 134.150 1.00 0.00   ? 68   TRP C C     1 
ATOM   5312  O  O     . TRP C 1 68   ? 110.433 133.038 135.091 1.00 0.00   ? 68   TRP C O     1 
ATOM   5313  C  CB    . TRP C 1 68   ? 111.295 135.325 132.956 1.00 0.00   ? 68   TRP C CB    1 
ATOM   5314  C  CG    . TRP C 1 68   ? 112.660 135.440 132.346 1.00 0.00   ? 68   TRP C CG    1 
ATOM   5315  C  CD1   . TRP C 1 68   ? 112.995 136.095 131.196 1.00 0.00   ? 68   TRP C CD1   1 
ATOM   5316  C  CD2   . TRP C 1 68   ? 113.884 134.903 132.870 1.00 0.00   ? 68   TRP C CD2   1 
ATOM   5317  N  NE1   . TRP C 1 68   ? 114.350 136.006 130.973 1.00 0.00   ? 68   TRP C NE1   1 
ATOM   5318  C  CE2   . TRP C 1 68   ? 114.919 135.278 131.983 1.00 0.00   ? 68   TRP C CE2   1 
ATOM   5319  C  CE3   . TRP C 1 68   ? 114.203 134.141 134.001 1.00 0.00   ? 68   TRP C CE3   1 
ATOM   5320  C  CZ2   . TRP C 1 68   ? 116.258 134.920 132.192 1.00 0.00   ? 68   TRP C CZ2   1 
ATOM   5321  C  CZ3   . TRP C 1 68   ? 115.538 133.782 134.211 1.00 0.00   ? 68   TRP C CZ3   1 
ATOM   5322  C  CH2   . TRP C 1 68   ? 116.545 134.174 133.309 1.00 0.00   ? 68   TRP C CH2   1 
ATOM   5323  N  N     . PRO C 1 69   ? 108.639 134.061 134.198 1.00 0.00   ? 69   PRO C N     1 
ATOM   5324  C  CA    . PRO C 1 69   ? 107.817 133.824 135.388 1.00 0.00   ? 69   PRO C CA    1 
ATOM   5325  C  C     . PRO C 1 69   ? 107.647 132.344 135.719 1.00 0.00   ? 69   PRO C C     1 
ATOM   5326  O  O     . PRO C 1 69   ? 107.524 131.976 136.888 1.00 0.00   ? 69   PRO C O     1 
ATOM   5327  C  CB    . PRO C 1 69   ? 106.493 134.485 135.025 1.00 0.00   ? 69   PRO C CB    1 
ATOM   5328  C  CG    . PRO C 1 69   ? 106.923 135.620 134.163 1.00 0.00   ? 69   PRO C CG    1 
ATOM   5329  C  CD    . PRO C 1 69   ? 107.937 134.958 133.264 1.00 0.00   ? 69   PRO C CD    1 
ATOM   5330  N  N     . HIS C 1 70   ? 107.646 131.497 134.695 1.00 0.00   ? 70   HIS C N     1 
ATOM   5331  C  CA    . HIS C 1 70   ? 107.493 130.057 134.891 1.00 0.00   ? 70   HIS C CA    1 
ATOM   5332  C  C     . HIS C 1 70   ? 108.810 129.381 135.227 1.00 0.00   ? 70   HIS C C     1 
ATOM   5333  O  O     . HIS C 1 70   ? 108.839 128.376 135.931 1.00 0.00   ? 70   HIS C O     1 
ATOM   5334  C  CB    . HIS C 1 70   ? 106.880 129.411 133.647 1.00 0.00   ? 70   HIS C CB    1 
ATOM   5335  C  CG    . HIS C 1 70   ? 105.467 129.831 133.385 1.00 0.00   ? 70   HIS C CG    1 
ATOM   5336  N  ND1   . HIS C 1 70   ? 104.798 129.492 132.230 1.00 0.00   ? 70   HIS C ND1   1 
ATOM   5337  C  CD2   . HIS C 1 70   ? 104.599 130.562 134.121 1.00 0.00   ? 70   HIS C CD2   1 
ATOM   5338  C  CE1   . HIS C 1 70   ? 103.576 129.994 132.267 1.00 0.00   ? 70   HIS C CE1   1 
ATOM   5339  N  NE2   . HIS C 1 70   ? 103.430 130.647 133.406 1.00 0.00   ? 70   HIS C NE2   1 
ATOM   5340  N  N     . THR C 1 71   ? 109.903 129.922 134.708 1.00 0.00   ? 71   THR C N     1 
ATOM   5341  C  CA    . THR C 1 71   ? 111.218 129.368 134.999 1.00 0.00   ? 71   THR C CA    1 
ATOM   5342  C  C     . THR C 1 71   ? 111.461 129.586 136.483 1.00 0.00   ? 71   THR C C     1 
ATOM   5343  O  O     . THR C 1 71   ? 111.987 128.721 137.184 1.00 0.00   ? 71   THR C O     1 
ATOM   5344  C  CB    . THR C 1 71   ? 112.326 130.105 134.236 1.00 0.00   ? 71   THR C CB    1 
ATOM   5345  O  OG1   . THR C 1 71   ? 112.163 129.893 132.830 1.00 0.00   ? 71   THR C OG1   1 
ATOM   5346  C  CG2   . THR C 1 71   ? 113.686 129.608 134.684 1.00 0.00   ? 71   THR C CG2   1 
ATOM   5347  N  N     . LEU C 1 72   ? 111.052 130.761 136.947 1.00 0.00   ? 72   LEU C N     1 
ATOM   5348  C  CA    . LEU C 1 72   ? 111.207 131.143 138.342 1.00 0.00   ? 72   LEU C CA    1 
ATOM   5349  C  C     . LEU C 1 72   ? 110.319 130.307 139.257 1.00 0.00   ? 72   LEU C C     1 
ATOM   5350  O  O     . LEU C 1 72   ? 110.747 129.907 140.344 1.00 0.00   ? 72   LEU C O     1 
ATOM   5351  C  CB    . LEU C 1 72   ? 110.875 132.627 138.510 1.00 0.00   ? 72   LEU C CB    1 
ATOM   5352  C  CG    . LEU C 1 72   ? 111.760 133.610 137.738 1.00 0.00   ? 72   LEU C CG    1 
ATOM   5353  C  CD1   . LEU C 1 72   ? 111.201 135.021 137.860 1.00 0.00   ? 72   LEU C CD1   1 
ATOM   5354  C  CD2   . LEU C 1 72   ? 113.179 133.545 138.279 1.00 0.00   ? 72   LEU C CD2   1 
ATOM   5355  N  N     . LEU C 1 73   ? 109.087 130.052 138.829 1.00 0.00   ? 73   LEU C N     1 
ATOM   5356  C  CA    . LEU C 1 73   ? 108.170 129.252 139.633 1.00 0.00   ? 73   LEU C CA    1 
ATOM   5357  C  C     . LEU C 1 73   ? 108.680 127.828 139.752 1.00 0.00   ? 73   LEU C C     1 
ATOM   5358  O  O     . LEU C 1 73   ? 108.642 127.233 140.827 1.00 0.00   ? 73   LEU C O     1 
ATOM   5359  C  CB    . LEU C 1 73   ? 106.774 129.229 139.010 1.00 0.00   ? 73   LEU C CB    1 
ATOM   5360  C  CG    . LEU C 1 73   ? 105.863 130.443 139.185 1.00 0.00   ? 73   LEU C CG    1 
ATOM   5361  C  CD1   . LEU C 1 73   ? 104.541 130.162 138.492 1.00 0.00   ? 73   LEU C CD1   1 
ATOM   5362  C  CD2   . LEU C 1 73   ? 105.637 130.721 140.664 1.00 0.00   ? 73   LEU C CD2   1 
ATOM   5363  N  N     . ILE C 1 74   ? 109.161 127.261 138.652 1.00 0.00   ? 74   ILE C N     1 
ATOM   5364  C  CA    . ILE C 1 74   ? 109.660 125.891 138.696 1.00 0.00   ? 74   ILE C CA    1 
ATOM   5365  C  C     . ILE C 1 74   ? 110.827 125.739 139.654 1.00 0.00   ? 74   ILE C C     1 
ATOM   5366  O  O     . ILE C 1 74   ? 110.864 124.813 140.458 1.00 0.00   ? 74   ILE C O     1 
ATOM   5367  C  CB    . ILE C 1 74   ? 110.122 125.374 137.327 1.00 0.00   ? 74   ILE C CB    1 
ATOM   5368  C  CG1   . ILE C 1 74   ? 108.946 125.255 136.363 1.00 0.00   ? 74   ILE C CG1   1 
ATOM   5369  C  CG2   . ILE C 1 74   ? 110.815 124.035 137.487 1.00 0.00   ? 74   ILE C CG2   1 
ATOM   5370  C  CD1   . ILE C 1 74   ? 109.348 125.005 134.927 1.00 0.00   ? 74   ILE C CD1   1 
ATOM   5371  N  N     . PHE C 1 75   ? 111.787 126.641 139.566 1.00 0.00   ? 75   PHE C N     1 
ATOM   5372  C  CA    . PHE C 1 75   ? 112.947 126.538 140.443 1.00 0.00   ? 75   PHE C CA    1 
ATOM   5373  C  C     . PHE C 1 75   ? 112.590 126.934 141.869 1.00 0.00   ? 75   PHE C C     1 
ATOM   5374  O  O     . PHE C 1 75   ? 113.177 126.426 142.824 1.00 0.00   ? 75   PHE C O     1 
ATOM   5375  C  CB    . PHE C 1 75   ? 114.096 127.413 139.938 1.00 0.00   ? 75   PHE C CB    1 
ATOM   5376  C  CG    . PHE C 1 75   ? 114.724 126.933 138.648 1.00 0.00   ? 75   PHE C CG    1 
ATOM   5377  C  CD1   . PHE C 1 75   ? 115.068 125.595 138.466 1.00 0.00   ? 75   PHE C CD1   1 
ATOM   5378  C  CD2   . PHE C 1 75   ? 115.038 127.847 137.644 1.00 0.00   ? 75   PHE C CD2   1 
ATOM   5379  C  CE1   . PHE C 1 75   ? 115.715 125.176 137.299 1.00 0.00   ? 75   PHE C CE1   1 
ATOM   5380  C  CE2   . PHE C 1 75   ? 115.685 127.438 136.481 1.00 0.00   ? 75   PHE C CE2   1 
ATOM   5381  C  CZ    . PHE C 1 75   ? 116.027 126.103 136.307 1.00 0.00   ? 75   PHE C CZ    1 
ATOM   5382  N  N     . THR C 1 76   ? 111.603 127.805 142.033 1.00 0.00   ? 76   THR C N     1 
ATOM   5383  C  CA    . THR C 1 76   ? 111.185 128.143 143.385 1.00 0.00   ? 76   THR C CA    1 
ATOM   5384  C  C     . THR C 1 76   ? 110.568 126.874 143.942 1.00 0.00   ? 76   THR C C     1 
ATOM   5385  O  O     . THR C 1 76   ? 110.877 126.453 145.050 1.00 0.00   ? 76   THR C O     1 
ATOM   5386  C  CB    . THR C 1 76   ? 110.163 129.281 143.442 1.00 0.00   ? 76   THR C CB    1 
ATOM   5387  O  OG1   . THR C 1 76   ? 110.745 130.462 142.882 1.00 0.00   ? 76   THR C OG1   1 
ATOM   5388  C  CG2   . THR C 1 76   ? 109.775 129.560 144.883 1.00 0.00   ? 76   THR C CG2   1 
ATOM   5389  N  N     . MET C 1 77   ? 109.698 126.255 143.153 1.00 0.00   ? 77   MET C N     1 
ATOM   5390  C  CA    . MET C 1 77   ? 109.048 125.025 143.574 1.00 0.00   ? 77   MET C CA    1 
ATOM   5391  C  C     . MET C 1 77   ? 110.038 123.892 143.780 1.00 0.00   ? 77   MET C C     1 
ATOM   5392  O  O     . MET C 1 77   ? 109.941 123.148 144.751 1.00 0.00   ? 77   MET C O     1 
ATOM   5393  C  CB    . MET C 1 77   ? 108.002 124.590 142.549 1.00 0.00   ? 77   MET C CB    1 
ATOM   5394  C  CG    . MET C 1 77   ? 106.705 125.372 142.599 1.00 0.00   ? 77   MET C CG    1 
ATOM   5395  S  SD    . MET C 1 77   ? 105.918 125.285 144.216 1.00 0.00   ? 77   MET C SD    1 
ATOM   5396  C  CE    . MET C 1 77   ? 106.072 123.538 144.569 1.00 0.00   ? 77   MET C CE    1 
ATOM   5397  N  N     . SER C 1 78   ? 111.006 123.763 142.884 1.00 0.00   ? 78   SER C N     1 
ATOM   5398  C  CA    . SER C 1 78   ? 111.954 122.673 143.015 1.00 0.00   ? 78   SER C CA    1 
ATOM   5399  C  C     . SER C 1 78   ? 112.729 122.799 144.307 1.00 0.00   ? 78   SER C C     1 
ATOM   5400  O  O     . SER C 1 78   ? 112.882 121.827 145.042 1.00 0.00   ? 78   SER C O     1 
ATOM   5401  C  CB    . SER C 1 78   ? 112.940 122.680 141.851 1.00 0.00   ? 78   SER C CB    1 
ATOM   5402  O  OG    . SER C 1 78   ? 112.265 122.600 140.612 1.00 0.00   ? 78   SER C OG    1 
ATOM   5403  N  N     . PHE C 1 79   ? 113.200 124.001 144.605 1.00 0.00   ? 79   PHE C N     1 
ATOM   5404  C  CA    . PHE C 1 79   ? 113.943 124.185 145.832 1.00 0.00   ? 79   PHE C CA    1 
ATOM   5405  C  C     . PHE C 1 79   ? 113.053 123.937 147.028 1.00 0.00   ? 79   PHE C C     1 
ATOM   5406  O  O     . PHE C 1 79   ? 113.427 123.229 147.950 1.00 0.00   ? 79   PHE C O     1 
ATOM   5407  C  CB    . PHE C 1 79   ? 114.534 125.587 145.907 1.00 0.00   ? 79   PHE C CB    1 
ATOM   5408  C  CG    . PHE C 1 79   ? 115.545 125.869 144.844 1.00 0.00   ? 79   PHE C CG    1 
ATOM   5409  C  CD1   . PHE C 1 79   ? 116.160 124.838 144.166 1.00 0.00   ? 79   PHE C CD1   1 
ATOM   5410  C  CD2   . PHE C 1 79   ? 115.887 127.167 144.534 1.00 0.00   ? 79   PHE C CD2   1 
ATOM   5411  C  CE1   . PHE C 1 79   ? 117.096 125.094 143.189 1.00 0.00   ? 79   PHE C CE1   1 
ATOM   5412  C  CE2   . PHE C 1 79   ? 116.820 127.434 143.553 1.00 0.00   ? 79   PHE C CE2   1 
ATOM   5413  C  CZ    . PHE C 1 79   ? 117.427 126.397 142.881 1.00 0.00   ? 79   PHE C CZ    1 
ATOM   5414  N  N     . LEU C 1 80   ? 111.882 124.563 147.017 1.00 0.00   ? 80   LEU C N     1 
ATOM   5415  C  CA    . LEU C 1 80   ? 110.947 124.427 148.115 1.00 0.00   ? 80   LEU C CA    1 
ATOM   5416  C  C     . LEU C 1 80   ? 110.637 122.966 148.361 1.00 0.00   ? 80   LEU C C     1 
ATOM   5417  O  O     . LEU C 1 80   ? 110.717 122.494 149.488 1.00 0.00   ? 80   LEU C O     1 
ATOM   5418  C  CB    . LEU C 1 80   ? 109.661 125.188 147.829 1.00 0.00   ? 80   LEU C CB    1 
ATOM   5419  C  CG    . LEU C 1 80   ? 108.757 125.328 149.049 1.00 0.00   ? 80   LEU C CG    1 
ATOM   5420  C  CD1   . LEU C 1 80   ? 109.457 126.178 150.093 1.00 0.00   ? 80   LEU C CD1   1 
ATOM   5421  C  CD2   . LEU C 1 80   ? 107.425 125.943 148.667 1.00 0.00   ? 80   LEU C CD2   1 
ATOM   5422  N  N     . CYS C 1 81   ? 110.308 122.245 147.303 1.00 0.00   ? 81   CYS C N     1 
ATOM   5423  C  CA    . CYS C 1 81   ? 109.997 120.834 147.446 1.00 0.00   ? 81   CYS C CA    1 
ATOM   5424  C  C     . CYS C 1 81   ? 111.193 120.063 147.966 1.00 0.00   ? 81   CYS C C     1 
ATOM   5425  O  O     . CYS C 1 81   ? 111.078 119.296 148.918 1.00 0.00   ? 81   CYS C O     1 
ATOM   5426  C  CB    . CYS C 1 81   ? 109.537 120.241 146.118 1.00 0.00   ? 81   CYS C CB    1 
ATOM   5427  S  SG    . CYS C 1 81   ? 107.825 120.635 145.710 1.00 0.00   ? 81   CYS C SG    1 
ATOM   5428  N  N     . SER C 1 82   ? 112.349 120.276 147.352 1.00 0.00   ? 82   SER C N     1 
ATOM   5429  C  CA    . SER C 1 82   ? 113.536 119.557 147.762 1.00 0.00   ? 82   SER C CA    1 
ATOM   5430  C  C     . SER C 1 82   ? 113.844 119.847 149.217 1.00 0.00   ? 82   SER C C     1 
ATOM   5431  O  O     . SER C 1 82   ? 114.146 118.941 149.980 1.00 0.00   ? 82   SER C O     1 
ATOM   5432  C  CB    . SER C 1 82   ? 114.723 119.943 146.894 1.00 0.00   ? 82   SER C CB    1 
ATOM   5433  O  OG    . SER C 1 82   ? 114.944 121.336 146.965 1.00 0.00   ? 82   SER C OG    1 
ATOM   5434  N  N     . TRP C 1 83   ? 113.742 121.112 149.613 1.00 0.00   ? 83   TRP C N     1 
ATOM   5435  C  CA    . TRP C 1 83   ? 114.008 121.449 151.000 1.00 0.00   ? 83   TRP C CA    1 
ATOM   5436  C  C     . TRP C 1 83   ? 112.976 120.766 151.885 1.00 0.00   ? 83   TRP C C     1 
ATOM   5437  O  O     . TRP C 1 83   ? 113.306 120.198 152.919 1.00 0.00   ? 83   TRP C O     1 
ATOM   5438  C  CB    . TRP C 1 83   ? 113.979 122.962 151.220 1.00 0.00   ? 83   TRP C CB    1 
ATOM   5439  C  CG    . TRP C 1 83   ? 115.144 123.702 150.617 1.00 0.00   ? 83   TRP C CG    1 
ATOM   5440  C  CD1   . TRP C 1 83   ? 116.428 123.286 150.551 1.00 0.00   ? 83   TRP C CD1   1 
ATOM   5441  C  CD2   . TRP C 1 83   ? 115.115 125.004 150.021 1.00 0.00   ? 83   TRP C CD2   1 
ATOM   5442  N  NE1   . TRP C 1 83   ? 117.208 124.235 149.939 1.00 0.00   ? 83   TRP C NE1   1 
ATOM   5443  C  CE2   . TRP C 1 83   ? 116.419 125.305 149.610 1.00 0.00   ? 83   TRP C CE2   1 
ATOM   5444  C  CE3   . TRP C 1 83   ? 114.108 125.946 149.806 1.00 0.00   ? 83   TRP C CE3   1 
ATOM   5445  C  CZ2   . TRP C 1 83   ? 116.745 126.501 148.987 1.00 0.00   ? 83   TRP C CZ2   1 
ATOM   5446  C  CZ3   . TRP C 1 83   ? 114.430 127.130 149.188 1.00 0.00   ? 83   TRP C CZ3   1 
ATOM   5447  C  CH2   . TRP C 1 83   ? 115.737 127.399 148.785 1.00 0.00   ? 83   TRP C CH2   1 
ATOM   5448  N  N     . LEU C 1 84   ? 111.715 120.829 151.476 1.00 0.00   ? 84   LEU C N     1 
ATOM   5449  C  CA    . LEU C 1 84   ? 110.630 120.238 152.251 1.00 0.00   ? 84   LEU C CA    1 
ATOM   5450  C  C     . LEU C 1 84   ? 110.620 118.722 152.299 1.00 0.00   ? 84   LEU C C     1 
ATOM   5451  O  O     . LEU C 1 84   ? 110.416 118.144 153.359 1.00 0.00   ? 84   LEU C O     1 
ATOM   5452  C  CB    . LEU C 1 84   ? 109.274 120.726 151.751 1.00 0.00   ? 84   LEU C CB    1 
ATOM   5453  C  CG    . LEU C 1 84   ? 108.461 121.547 152.747 1.00 0.00   ? 84   LEU C CG    1 
ATOM   5454  C  CD1   . LEU C 1 84   ? 107.468 122.451 152.036 1.00 0.00   ? 84   LEU C CD1   1 
ATOM   5455  C  CD2   . LEU C 1 84   ? 107.745 120.605 153.699 1.00 0.00   ? 84   LEU C CD2   1 
ATOM   5456  N  N     . LEU C 1 85   ? 110.859 118.073 151.167 1.00 0.00   ? 85   LEU C N     1 
ATOM   5457  C  CA    . LEU C 1 85   ? 110.810 116.620 151.147 1.00 0.00   ? 85   LEU C CA    1 
ATOM   5458  C  C     . LEU C 1 85   ? 111.837 116.039 152.088 1.00 0.00   ? 85   LEU C C     1 
ATOM   5459  O  O     . LEU C 1 85   ? 111.547 115.124 152.850 1.00 0.00   ? 85   LEU C O     1 
ATOM   5460  C  CB    . LEU C 1 85   ? 111.079 116.112 149.737 1.00 0.00   ? 85   LEU C CB    1 
ATOM   5461  C  CG    . LEU C 1 85   ? 111.122 114.591 149.613 1.00 0.00   ? 85   LEU C CG    1 
ATOM   5462  C  CD1   . LEU C 1 85   ? 109.772 113.993 149.967 1.00 0.00   ? 85   LEU C CD1   1 
ATOM   5463  C  CD2   . LEU C 1 85   ? 111.559 114.175 148.216 1.00 0.00   ? 85   LEU C CD2   1 
ATOM   5464  N  N     . PHE C 1 86   ? 113.043 116.574 152.029 1.00 0.00   ? 86   PHE C N     1 
ATOM   5465  C  CA    . PHE C 1 86   ? 114.114 116.138 152.905 1.00 0.00   ? 86   PHE C CA    1 
ATOM   5466  C  C     . PHE C 1 86   ? 113.856 116.488 154.360 1.00 0.00   ? 86   PHE C C     1 
ATOM   5467  O  O     . PHE C 1 86   ? 114.179 115.722 155.262 1.00 0.00   ? 86   PHE C O     1 
ATOM   5468  C  CB    . PHE C 1 86   ? 115.442 116.682 152.448 1.00 0.00   ? 86   PHE C CB    1 
ATOM   5469  C  CG    . PHE C 1 86   ? 116.163 115.786 151.502 1.00 0.00   ? 86   PHE C CG    1 
ATOM   5470  C  CD1   . PHE C 1 86   ? 116.761 116.296 150.371 1.00 0.00   ? 86   PHE C CD1   1 
ATOM   5471  C  CD2   . PHE C 1 86   ? 116.235 114.432 151.742 1.00 0.00   ? 86   PHE C CD2   1 
ATOM   5472  C  CE1   . PHE C 1 86   ? 117.427 115.471 149.493 1.00 0.00   ? 86   PHE C CE1   1 
ATOM   5473  C  CE2   . PHE C 1 86   ? 116.897 113.599 150.870 1.00 0.00   ? 86   PHE C CE2   1 
ATOM   5474  C  CZ    . PHE C 1 86   ? 117.493 114.118 149.744 1.00 0.00   ? 86   PHE C CZ    1 
ATOM   5475  N  N     . ALA C 1 87   ? 113.237 117.646 154.587 1.00 0.00   ? 87   ALA C N     1 
ATOM   5476  C  CA    . ALA C 1 87   ? 112.955 118.129 155.938 1.00 0.00   ? 87   ALA C CA    1 
ATOM   5477  C  C     . ALA C 1 87   ? 112.082 117.157 156.706 1.00 0.00   ? 87   ALA C C     1 
ATOM   5478  O  O     . ALA C 1 87   ? 112.308 116.923 157.888 1.00 0.00   ? 87   ALA C O     1 
ATOM   5479  C  CB    . ALA C 1 87   ? 112.298 119.493 155.892 1.00 0.00   ? 87   ALA C CB    1 
ATOM   5480  N  N     . MET C 1 88   ? 111.097 116.566 156.037 1.00 0.00   ? 88   MET C N     1 
ATOM   5481  C  CA    . MET C 1 88   ? 110.239 115.575 156.654 1.00 0.00   ? 88   MET C CA    1 
ATOM   5482  C  C     . MET C 1 88   ? 111.083 114.384 157.097 1.00 0.00   ? 88   MET C C     1 
ATOM   5483  O  O     . MET C 1 88   ? 110.909 113.880 158.202 1.00 0.00   ? 88   MET C O     1 
ATOM   5484  C  CB    . MET C 1 88   ? 109.205 115.099 155.639 1.00 0.00   ? 88   MET C CB    1 
ATOM   5485  C  CG    . MET C 1 88   ? 108.355 113.942 156.114 1.00 0.00   ? 88   MET C CG    1 
ATOM   5486  S  SD    . MET C 1 88   ? 107.095 114.500 157.268 1.00 0.00   ? 88   MET C SD    1 
ATOM   5487  C  CE    . MET C 1 88   ? 106.325 115.801 156.308 1.00 0.00   ? 88   MET C CE    1 
ATOM   5488  N  N     . VAL C 1 89   ? 112.024 113.957 156.259 1.00 0.00   ? 89   VAL C N     1 
ATOM   5489  C  CA    . VAL C 1 89   ? 112.888 112.844 156.600 1.00 0.00   ? 89   VAL C CA    1 
ATOM   5490  C  C     . VAL C 1 89   ? 113.713 113.167 157.835 1.00 0.00   ? 89   VAL C C     1 
ATOM   5491  O  O     . VAL C 1 89   ? 113.879 112.322 158.709 1.00 0.00   ? 89   VAL C O     1 
ATOM   5492  C  CB    . VAL C 1 89   ? 113.866 112.525 155.466 1.00 0.00   ? 89   VAL C CB    1 
ATOM   5493  C  CG1   . VAL C 1 89   ? 114.939 111.574 155.957 1.00 0.00   ? 89   VAL C CG1   1 
ATOM   5494  C  CG2   . VAL C 1 89   ? 113.126 111.941 154.278 1.00 0.00   ? 89   VAL C CG2   1 
ATOM   5495  N  N     . TRP C 1 90   ? 114.226 114.391 157.913 1.00 0.00   ? 90   TRP C N     1 
ATOM   5496  C  CA    . TRP C 1 90   ? 115.024 114.792 159.065 1.00 0.00   ? 90   TRP C CA    1 
ATOM   5497  C  C     . TRP C 1 90   ? 114.191 114.755 160.328 1.00 0.00   ? 90   TRP C C     1 
ATOM   5498  O  O     . TRP C 1 90   ? 114.652 114.312 161.371 1.00 0.00   ? 90   TRP C O     1 
ATOM   5499  C  CB    . TRP C 1 90   ? 115.587 116.193 158.875 1.00 0.00   ? 90   TRP C CB    1 
ATOM   5500  C  CG    . TRP C 1 90   ? 116.848 116.213 158.111 1.00 0.00   ? 90   TRP C CG    1 
ATOM   5501  C  CD1   . TRP C 1 90   ? 117.087 116.869 156.947 1.00 0.00   ? 90   TRP C CD1   1 
ATOM   5502  C  CD2   . TRP C 1 90   ? 118.053 115.534 158.447 1.00 0.00   ? 90   TRP C CD2   1 
ATOM   5503  N  NE1   . TRP C 1 90   ? 118.373 116.647 156.536 1.00 0.00   ? 90   TRP C NE1   1 
ATOM   5504  C  CE2   . TRP C 1 90   ? 118.988 115.827 157.443 1.00 0.00   ? 90   TRP C CE2   1 
ATOM   5505  C  CE3   . TRP C 1 90   ? 118.435 114.708 159.501 1.00 0.00   ? 90   TRP C CE3   1 
ATOM   5506  C  CZ2   . TRP C 1 90   ? 120.279 115.324 157.460 1.00 0.00   ? 90   TRP C CZ2   1 
ATOM   5507  C  CZ3   . TRP C 1 90   ? 119.716 114.211 159.518 1.00 0.00   ? 90   TRP C CZ3   1 
ATOM   5508  C  CH2   . TRP C 1 90   ? 120.625 114.519 158.504 1.00 0.00   ? 90   TRP C CH2   1 
ATOM   5509  N  N     . TRP C 1 91   ? 112.954 115.216 160.230 1.00 0.00   ? 91   TRP C N     1 
ATOM   5510  C  CA    . TRP C 1 91   ? 112.075 115.225 161.380 1.00 0.00   ? 91   TRP C CA    1 
ATOM   5511  C  C     . TRP C 1 91   ? 111.809 113.809 161.853 1.00 0.00   ? 91   TRP C C     1 
ATOM   5512  O  O     . TRP C 1 91   ? 111.840 113.527 163.045 1.00 0.00   ? 91   TRP C O     1 
ATOM   5513  C  CB    . TRP C 1 91   ? 110.761 115.900 161.015 1.00 0.00   ? 91   TRP C CB    1 
ATOM   5514  C  CG    . TRP C 1 91   ? 109.716 115.796 162.062 1.00 0.00   ? 91   TRP C CG    1 
ATOM   5515  C  CD1   . TRP C 1 91   ? 109.786 116.261 163.337 1.00 0.00   ? 91   TRP C CD1   1 
ATOM   5516  C  CD2   . TRP C 1 91   ? 108.428 115.204 161.919 1.00 0.00   ? 91   TRP C CD2   1 
ATOM   5517  N  NE1   . TRP C 1 91   ? 108.621 115.986 164.003 1.00 0.00   ? 91   TRP C NE1   1 
ATOM   5518  C  CE2   . TRP C 1 91   ? 107.771 115.337 163.151 1.00 0.00   ? 91   TRP C CE2   1 
ATOM   5519  C  CE3   . TRP C 1 91   ? 107.765 114.572 160.867 1.00 0.00   ? 91   TRP C CE3   1 
ATOM   5520  C  CZ2   . TRP C 1 91   ? 106.487 114.859 163.365 1.00 0.00   ? 91   TRP C CZ2   1 
ATOM   5521  C  CZ3   . TRP C 1 91   ? 106.493 114.100 161.079 1.00 0.00   ? 91   TRP C CZ3   1 
ATOM   5522  C  CH2   . TRP C 1 91   ? 105.864 114.246 162.317 1.00 0.00   ? 91   TRP C CH2   1 
ATOM   5523  N  N     . LEU C 1 92   ? 111.585 112.913 160.905 1.00 0.00   ? 92   LEU C N     1 
ATOM   5524  C  CA    . LEU C 1 92   ? 111.307 111.525 161.224 1.00 0.00   ? 92   LEU C CA    1 
ATOM   5525  C  C     . LEU C 1 92   ? 112.495 110.833 161.891 1.00 0.00   ? 92   LEU C C     1 
ATOM   5526  O  O     . LEU C 1 92   ? 112.327 110.077 162.836 1.00 0.00   ? 92   LEU C O     1 
ATOM   5527  C  CB    . LEU C 1 92   ? 110.910 110.782 159.956 1.00 0.00   ? 92   LEU C CB    1 
ATOM   5528  C  CG    . LEU C 1 92   ? 110.403 109.361 160.153 1.00 0.00   ? 92   LEU C CG    1 
ATOM   5529  C  CD1   . LEU C 1 92   ? 109.353 109.050 159.103 1.00 0.00   ? 92   LEU C CD1   1 
ATOM   5530  C  CD2   . LEU C 1 92   ? 111.560 108.383 160.060 1.00 0.00   ? 92   LEU C CD2   1 
ATOM   5531  N  N     . ILE C 1 93   ? 113.698 111.089 161.399 1.00 0.00   ? 93   ILE C N     1 
ATOM   5532  C  CA    . ILE C 1 93   ? 114.876 110.462 161.971 1.00 0.00   ? 93   ILE C CA    1 
ATOM   5533  C  C     . ILE C 1 93   ? 115.035 110.931 163.406 1.00 0.00   ? 93   ILE C C     1 
ATOM   5534  O  O     . ILE C 1 93   ? 115.517 110.192 164.252 1.00 0.00   ? 93   ILE C O     1 
ATOM   5535  C  CB    . ILE C 1 93   ? 116.143 110.641 161.102 1.00 0.00   ? 93   ILE C CB    1 
ATOM   5536  C  CG1   . ILE C 1 93   ? 117.105 109.482 161.336 1.00 0.00   ? 93   ILE C CG1   1 
ATOM   5537  C  CG2   . ILE C 1 93   ? 116.846 111.963 161.356 1.00 0.00   ? 93   ILE C CG2   1 
ATOM   5538  C  CD1   . ILE C 1 93   ? 118.354 109.578 160.497 1.00 0.00   ? 93   ILE C CD1   1 
ATOM   5539  N  N     . ALA C 1 94   ? 114.618 112.163 163.692 1.00 0.00   ? 94   ALA C N     1 
ATOM   5540  C  CA    . ALA C 1 94   ? 114.671 112.664 165.046 1.00 0.00   ? 94   ALA C CA    1 
ATOM   5541  C  C     . ALA C 1 94   ? 113.699 111.855 165.875 1.00 0.00   ? 94   ALA C C     1 
ATOM   5542  O  O     . ALA C 1 94   ? 114.009 111.432 166.981 1.00 0.00   ? 94   ALA C O     1 
ATOM   5543  C  CB    . ALA C 1 94   ? 114.288 114.126 165.077 1.00 0.00   ? 94   ALA C CB    1 
ATOM   5544  N  N     . PHE C 1 95   ? 112.522 111.630 165.311 1.00 0.00   ? 95   PHE C N     1 
ATOM   5545  C  CA    . PHE C 1 95   ? 111.471 110.873 165.960 1.00 0.00   ? 95   PHE C CA    1 
ATOM   5546  C  C     . PHE C 1 95   ? 111.839 109.417 166.214 1.00 0.00   ? 95   PHE C C     1 
ATOM   5547  O  O     . PHE C 1 95   ? 111.559 108.884 167.284 1.00 0.00   ? 95   PHE C O     1 
ATOM   5548  C  CB    . PHE C 1 95   ? 110.215 110.921 165.102 1.00 0.00   ? 95   PHE C CB    1 
ATOM   5549  C  CG    . PHE C 1 95   ? 108.956 110.762 165.881 1.00 0.00   ? 95   PHE C CG    1 
ATOM   5550  C  CD1   . PHE C 1 95   ? 107.840 111.500 165.557 1.00 0.00   ? 95   PHE C CD1   1 
ATOM   5551  C  CD2   . PHE C 1 95   ? 108.902 109.893 166.946 1.00 0.00   ? 95   PHE C CD2   1 
ATOM   5552  C  CE1   . PHE C 1 95   ? 106.676 111.363 166.280 1.00 0.00   ? 95   PHE C CE1   1 
ATOM   5553  C  CE2   . PHE C 1 95   ? 107.743 109.746 167.674 1.00 0.00   ? 95   PHE C CE2   1 
ATOM   5554  C  CZ    . PHE C 1 95   ? 106.627 110.486 167.342 1.00 0.00   ? 95   PHE C CZ    1 
ATOM   5555  N  N     . ALA C 1 96   ? 112.469 108.771 165.238 1.00 0.00   ? 96   ALA C N     1 
ATOM   5556  C  CA    . ALA C 1 96   ? 112.819 107.368 165.404 1.00 0.00   ? 96   ALA C CA    1 
ATOM   5557  C  C     . ALA C 1 96   ? 113.779 107.227 166.564 1.00 0.00   ? 96   ALA C C     1 
ATOM   5558  O  O     . ALA C 1 96   ? 113.608 106.370 167.424 1.00 0.00   ? 96   ALA C O     1 
ATOM   5559  C  CB    . ALA C 1 96   ? 113.439 106.822 164.133 1.00 0.00   ? 96   ALA C CB    1 
ATOM   5560  N  N     . HIS C 1 97   ? 114.768 108.107 166.587 1.00 0.00   ? 97   HIS C N     1 
ATOM   5561  C  CA    . HIS C 1 97   ? 115.740 108.123 167.662 1.00 0.00   ? 97   HIS C CA    1 
ATOM   5562  C  C     . HIS C 1 97   ? 115.000 108.414 168.963 1.00 0.00   ? 97   HIS C C     1 
ATOM   5563  O  O     . HIS C 1 97   ? 115.385 107.930 170.024 1.00 0.00   ? 97   HIS C O     1 
ATOM   5564  C  CB    . HIS C 1 97   ? 116.810 109.174 167.409 1.00 0.00   ? 97   HIS C CB    1 
ATOM   5565  C  CG    . HIS C 1 97   ? 117.932 109.128 168.395 1.00 0.00   ? 97   HIS C CG    1 
ATOM   5566  N  ND1   . HIS C 1 97   ? 117.844 109.707 169.643 1.00 0.00   ? 97   HIS C ND1   1 
ATOM   5567  C  CD2   . HIS C 1 97   ? 119.163 108.575 168.324 1.00 0.00   ? 97   HIS C CD2   1 
ATOM   5568  C  CE1   . HIS C 1 97   ? 118.975 109.510 170.297 1.00 0.00   ? 97   HIS C CE1   1 
ATOM   5569  N  NE2   . HIS C 1 97   ? 119.793 108.828 169.518 1.00 0.00   ? 97   HIS C NE2   1 
ATOM   5570  N  N     . GLY C 1 98   ? 113.912 109.170 168.852 1.00 0.00   ? 98   GLY C N     1 
ATOM   5571  C  CA    . GLY C 1 98   ? 113.090 109.524 169.994 1.00 0.00   ? 98   GLY C CA    1 
ATOM   5572  C  C     . GLY C 1 98   ? 113.648 110.666 170.814 1.00 0.00   ? 98   GLY C C     1 
ATOM   5573  O  O     . GLY C 1 98   ? 113.201 110.918 171.923 1.00 0.00   ? 98   GLY C O     1 
ATOM   5574  N  N     . ASP C 1 99   ? 114.626 111.361 170.253 1.00 0.00   ? 99   ASP C N     1 
ATOM   5575  C  CA    . ASP C 1 99   ? 115.289 112.475 170.916 1.00 0.00   ? 99   ASP C CA    1 
ATOM   5576  C  C     . ASP C 1 99   ? 114.493 113.764 171.128 1.00 0.00   ? 99   ASP C C     1 
ATOM   5577  O  O     . ASP C 1 99   ? 114.878 114.593 171.950 1.00 0.00   ? 99   ASP C O     1 
ATOM   5578  C  CB    . ASP C 1 99   ? 116.597 112.808 170.199 1.00 0.00   ? 99   ASP C CB    1 
ATOM   5579  C  CG    . ASP C 1 99   ? 116.374 113.492 168.873 1.00 0.00   ? 99   ASP C CG    1 
ATOM   5580  O  OD1   . ASP C 1 99   ? 115.210 113.752 168.523 1.00 0.00   ? 99   ASP C OD1   1 
ATOM   5581  O  OD2   . ASP C 1 99   ? 117.373 113.772 168.178 1.00 0.00   ? 99   ASP C OD2   1 
ATOM   5582  N  N     . LEU C 1 100  ? 113.431 113.972 170.360 1.00 0.00   ? 100  LEU C N     1 
ATOM   5583  C  CA    . LEU C 1 100  ? 112.697 115.235 170.461 1.00 0.00   ? 100  LEU C CA    1 
ATOM   5584  C  C     . LEU C 1 100  ? 111.980 115.658 171.756 1.00 0.00   ? 100  LEU C C     1 
ATOM   5585  O  O     . LEU C 1 100  ? 112.111 116.815 172.152 1.00 0.00   ? 100  LEU C O     1 
ATOM   5586  C  CB    . LEU C 1 100  ? 111.763 115.415 169.259 1.00 0.00   ? 100  LEU C CB    1 
ATOM   5587  C  CG    . LEU C 1 100  ? 110.914 114.229 168.829 1.00 0.00   ? 100  LEU C CG    1 
ATOM   5588  C  CD1   . LEU C 1 100  ? 109.655 114.168 169.672 1.00 0.00   ? 100  LEU C CD1   1 
ATOM   5589  C  CD2   . LEU C 1 100  ? 110.553 114.398 167.366 1.00 0.00   ? 100  LEU C CD2   1 
ATOM   5590  N  N     . ALA C 1 101  ? 111.257 114.767 172.433 1.00 0.00   ? 101  ALA C N     1 
ATOM   5591  C  CA    . ALA C 1 101  ? 110.544 115.208 173.641 1.00 0.00   ? 101  ALA C CA    1 
ATOM   5592  C  C     . ALA C 1 101  ? 111.184 114.996 175.016 1.00 0.00   ? 101  ALA C C     1 
ATOM   5593  O  O     . ALA C 1 101  ? 110.754 115.613 175.986 1.00 0.00   ? 101  ALA C O     1 
ATOM   5594  C  CB    . ALA C 1 101  ? 109.093 114.743 173.635 1.00 0.00   ? 101  ALA C CB    1 
ATOM   5595  N  N     . PRO C 1 102  ? 112.190 114.135 175.119 1.00 0.00   ? 102  PRO C N     1 
ATOM   5596  C  CA    . PRO C 1 102  ? 112.850 113.934 176.412 1.00 0.00   ? 102  PRO C CA    1 
ATOM   5597  C  C     . PRO C 1 102  ? 113.553 115.208 176.843 1.00 0.00   ? 102  PRO C C     1 
ATOM   5598  O  O     . PRO C 1 102  ? 113.518 115.571 178.017 1.00 0.00   ? 102  PRO C O     1 
ATOM   5599  C  CB    . PRO C 1 102  ? 113.885 112.848 176.119 1.00 0.00   ? 102  PRO C CB    1 
ATOM   5600  C  CG    . PRO C 1 102  ? 113.428 112.205 174.861 1.00 0.00   ? 102  PRO C CG    1 
ATOM   5601  C  CD    . PRO C 1 102  ? 112.822 113.325 174.074 1.00 0.00   ? 102  PRO C CD    1 
ATOM   5602  N  N     . GLY C 1 103  ? 114.186 115.866 175.874 1.00 0.00   ? 103  GLY C N     1 
ATOM   5603  C  CA    . GLY C 1 103  ? 114.916 117.095 176.104 1.00 0.00   ? 103  GLY C CA    1 
ATOM   5604  C  C     . GLY C 1 103  ? 115.899 116.882 177.226 1.00 0.00   ? 103  GLY C C     1 
ATOM   5605  O  O     . GLY C 1 103  ? 116.355 117.832 177.857 1.00 0.00   ? 103  GLY C O     1 
ATOM   5606  N  N     . GLU C 1 104  ? 116.232 115.620 177.474 1.00 0.00   ? 104  GLU C N     1 
ATOM   5607  C  CA    . GLU C 1 104  ? 117.144 115.319 178.572 1.00 0.00   ? 104  GLU C CA    1 
ATOM   5608  C  C     . GLU C 1 104  ? 118.611 115.271 178.150 1.00 0.00   ? 104  GLU C C     1 
ATOM   5609  O  O     . GLU C 1 104  ? 118.945 114.847 177.046 1.00 0.00   ? 104  GLU C O     1 
ATOM   5610  C  CB    . GLU C 1 104  ? 116.735 113.997 179.231 1.00 0.00   ? 104  GLU C CB    1 
ATOM   5611  C  CG    . GLU C 1 104  ? 117.417 113.714 180.558 1.00 0.00   ? 104  GLU C CG    1 
ATOM   5612  C  CD    . GLU C 1 104  ? 116.599 112.789 181.432 1.00 0.00   ? 104  GLU C CD    1 
ATOM   5613  O  OE1   . GLU C 1 104  ? 115.381 112.660 181.185 1.00 0.00   ? 104  GLU C OE1   1 
ATOM   5614  O  OE2   . GLU C 1 104  ? 117.170 112.196 182.369 1.00 0.00   ? 104  GLU C OE2   1 
ATOM   5615  N  N     . GLY C 1 105  ? 119.479 115.718 179.049 1.00 0.00   ? 105  GLY C N     1 
ATOM   5616  C  CA    . GLY C 1 105  ? 120.908 115.757 178.803 1.00 0.00   ? 105  GLY C CA    1 
ATOM   5617  C  C     . GLY C 1 105  ? 121.604 114.430 178.570 1.00 0.00   ? 105  GLY C C     1 
ATOM   5618  O  O     . GLY C 1 105  ? 122.485 114.342 177.719 1.00 0.00   ? 105  GLY C O     1 
ATOM   5619  N  N     . THR C 1 106  ? 121.206 113.392 179.303 1.00 0.00   ? 106  THR C N     1 
ATOM   5620  C  CA    . THR C 1 106  ? 121.861 112.092 179.190 1.00 0.00   ? 106  THR C CA    1 
ATOM   5621  C  C     . THR C 1 106  ? 121.761 111.531 177.783 1.00 0.00   ? 106  THR C C     1 
ATOM   5622  O  O     . THR C 1 106  ? 122.731 111.008 177.240 1.00 0.00   ? 106  THR C O     1 
ATOM   5623  C  CB    . THR C 1 106  ? 121.216 111.062 180.132 1.00 0.00   ? 106  THR C CB    1 
ATOM   5624  O  OG1   . THR C 1 106  ? 119.942 110.670 179.610 1.00 0.00   ? 106  THR C OG1   1 
ATOM   5625  C  CG2   . THR C 1 106  ? 121.029 111.647 181.523 1.00 0.00   ? 106  THR C CG2   1 
ATOM   5626  N  N     . ASN C 1 107  ? 120.579 111.636 177.192 1.00 0.00   ? 107  ASN C N     1 
ATOM   5627  C  CA    . ASN C 1 107  ? 120.388 111.161 175.836 1.00 0.00   ? 107  ASN C CA    1 
ATOM   5628  C  C     . ASN C 1 107  ? 121.111 112.113 174.896 1.00 0.00   ? 107  ASN C C     1 
ATOM   5629  O  O     . ASN C 1 107  ? 121.178 113.310 175.162 1.00 0.00   ? 107  ASN C O     1 
ATOM   5630  C  CB    . ASN C 1 107  ? 118.900 111.099 175.500 1.00 0.00   ? 107  ASN C CB    1 
ATOM   5631  C  CG    . ASN C 1 107  ? 118.639 110.481 174.145 1.00 0.00   ? 107  ASN C CG    1 
ATOM   5632  O  OD1   . ASN C 1 107  ? 119.567 110.175 173.401 1.00 0.00   ? 107  ASN C OD1   1 
ATOM   5633  N  ND2   . ASN C 1 107  ? 117.368 110.294 173.813 1.00 0.00   ? 107  ASN C ND2   1 
ATOM   5634  N  N     . VAL C 1 108  ? 121.670 111.591 173.813 1.00 0.00   ? 108  VAL C N     1 
ATOM   5635  C  CA    . VAL C 1 108  ? 122.346 112.452 172.857 1.00 0.00   ? 108  VAL C CA    1 
ATOM   5636  C  C     . VAL C 1 108  ? 121.588 112.409 171.541 1.00 0.00   ? 108  VAL C C     1 
ATOM   5637  O  O     . VAL C 1 108  ? 121.386 111.346 170.968 1.00 0.00   ? 108  VAL C O     1 
ATOM   5638  C  CB    . VAL C 1 108  ? 123.792 112.007 172.624 1.00 0.00   ? 108  VAL C CB    1 
ATOM   5639  C  CG1   . VAL C 1 108  ? 124.541 113.061 171.832 1.00 0.00   ? 108  VAL C CG1   1 
ATOM   5640  C  CG2   . VAL C 1 108  ? 124.477 111.756 173.956 1.00 0.00   ? 108  VAL C CG2   1 
ATOM   5641  N  N     . PRO C 1 109  ? 121.183 113.571 171.050 1.00 0.00   ? 109  PRO C N     1 
ATOM   5642  C  CA    . PRO C 1 109  ? 120.435 113.625 169.794 1.00 0.00   ? 109  PRO C CA    1 
ATOM   5643  C  C     . PRO C 1 109  ? 121.315 113.392 168.579 1.00 0.00   ? 109  PRO C C     1 
ATOM   5644  O  O     . PRO C 1 109  ? 122.540 113.484 168.654 1.00 0.00   ? 109  PRO C O     1 
ATOM   5645  C  CB    . PRO C 1 109  ? 119.847 115.028 169.810 1.00 0.00   ? 109  PRO C CB    1 
ATOM   5646  C  CG    . PRO C 1 109  ? 120.926 115.813 170.476 1.00 0.00   ? 109  PRO C CG    1 
ATOM   5647  C  CD    . PRO C 1 109  ? 121.316 114.918 171.638 1.00 0.00   ? 109  PRO C CD    1 
ATOM   5648  N  N     . CYS C 1 110  ? 120.674 113.073 167.459 1.00 0.00   ? 110  CYS C N     1 
ATOM   5649  C  CA    . CYS C 1 110  ? 121.392 112.857 166.213 1.00 0.00   ? 110  CYS C CA    1 
ATOM   5650  C  C     . CYS C 1 110  ? 121.576 114.201 165.542 1.00 0.00   ? 110  CYS C C     1 
ATOM   5651  O  O     . CYS C 1 110  ? 122.605 114.479 164.929 1.00 0.00   ? 110  CYS C O     1 
ATOM   5652  C  CB    . CYS C 1 110  ? 120.652 111.875 165.312 1.00 0.00   ? 110  CYS C CB    1 
ATOM   5653  S  SG    . CYS C 1 110  ? 120.745 110.195 165.958 1.00 0.00   ? 110  CYS C SG    1 
ATOM   5654  N  N     . VAL C 1 111  ? 120.562 115.040 165.692 1.00 0.00   ? 111  VAL C N     1 
ATOM   5655  C  CA    . VAL C 1 111  ? 120.564 116.385 165.138 1.00 0.00   ? 111  VAL C CA    1 
ATOM   5656  C  C     . VAL C 1 111  ? 120.198 117.278 166.314 1.00 0.00   ? 111  VAL C C     1 
ATOM   5657  O  O     . VAL C 1 111  ? 119.084 117.216 166.828 1.00 0.00   ? 111  VAL C O     1 
ATOM   5658  C  CB    . VAL C 1 111  ? 119.509 116.547 164.034 1.00 0.00   ? 111  VAL C CB    1 
ATOM   5659  C  CG1   . VAL C 1 111  ? 119.541 117.971 163.504 1.00 0.00   ? 111  VAL C CG1   1 
ATOM   5660  C  CG2   . VAL C 1 111  ? 119.771 115.561 162.910 1.00 0.00   ? 111  VAL C CG2   1 
ATOM   5661  N  N     . THR C 1 112  ? 121.144 118.102 166.743 1.00 0.00   ? 112  THR C N     1 
ATOM   5662  C  CA    . THR C 1 112  ? 120.920 118.981 167.884 1.00 0.00   ? 112  THR C CA    1 
ATOM   5663  C  C     . THR C 1 112  ? 119.840 120.038 167.657 1.00 0.00   ? 112  THR C C     1 
ATOM   5664  O  O     . THR C 1 112  ? 119.556 120.422 166.524 1.00 0.00   ? 112  THR C O     1 
ATOM   5665  C  CB    . THR C 1 112  ? 122.215 119.707 168.296 1.00 0.00   ? 112  THR C CB    1 
ATOM   5666  O  OG1   . THR C 1 112  ? 122.601 120.615 167.257 1.00 0.00   ? 112  THR C OG1   1 
ATOM   5667  C  CG2   . THR C 1 112  ? 123.334 118.706 168.518 1.00 0.00   ? 112  THR C CG2   1 
ATOM   5668  N  N     . SER C 1 113  ? 119.239 120.488 168.757 1.00 0.00   ? 113  SER C N     1 
ATOM   5669  C  CA    . SER C 1 113  ? 118.209 121.518 168.733 1.00 0.00   ? 113  SER C CA    1 
ATOM   5670  C  C     . SER C 1 113  ? 116.979 121.229 167.877 1.00 0.00   ? 113  SER C C     1 
ATOM   5671  O  O     . SER C 1 113  ? 116.455 122.123 167.206 1.00 0.00   ? 113  SER C O     1 
ATOM   5672  C  CB    . SER C 1 113  ? 118.827 122.849 168.293 1.00 0.00   ? 113  SER C CB    1 
ATOM   5673  O  OG    . SER C 1 113  ? 119.842 123.256 169.197 1.00 0.00   ? 113  SER C OG    1 
ATOM   5674  N  N     . ILE C 1 114  ? 116.508 119.988 167.906 1.00 0.00   ? 114  ILE C N     1 
ATOM   5675  C  CA    . ILE C 1 114  ? 115.324 119.614 167.135 1.00 0.00   ? 114  ILE C CA    1 
ATOM   5676  C  C     . ILE C 1 114  ? 114.130 119.416 168.060 1.00 0.00   ? 114  ILE C C     1 
ATOM   5677  O  O     . ILE C 1 114  ? 113.993 118.376 168.707 1.00 0.00   ? 114  ILE C O     1 
ATOM   5678  C  CB    . ILE C 1 114  ? 115.568 118.314 166.353 1.00 0.00   ? 114  ILE C CB    1 
ATOM   5679  C  CG1   . ILE C 1 114  ? 116.696 118.523 165.341 1.00 0.00   ? 114  ILE C CG1   1 
ATOM   5680  C  CG2   . ILE C 1 114  ? 114.295 117.881 165.641 1.00 0.00   ? 114  ILE C CG2   1 
ATOM   5681  C  CD1   . ILE C 1 114  ? 116.395 119.585 164.304 1.00 0.00   ? 114  ILE C CD1   1 
ATOM   5682  N  N     . HIS C 1 115  ? 113.257 120.416 168.112 1.00 0.00   ? 115  HIS C N     1 
ATOM   5683  C  CA    . HIS C 1 115  ? 112.089 120.361 168.980 1.00 0.00   ? 115  HIS C CA    1 
ATOM   5684  C  C     . HIS C 1 115  ? 110.771 120.171 168.228 1.00 0.00   ? 115  HIS C C     1 
ATOM   5685  O  O     . HIS C 1 115  ? 109.850 119.536 168.739 1.00 0.00   ? 115  HIS C O     1 
ATOM   5686  C  CB    . HIS C 1 115  ? 112.045 121.630 169.830 1.00 0.00   ? 115  HIS C CB    1 
ATOM   5687  C  CG    . HIS C 1 115  ? 113.369 121.985 170.451 1.00 0.00   ? 115  HIS C CG    1 
ATOM   5688  N  ND1   . HIS C 1 115  ? 113.946 121.246 171.463 1.00 0.00   ? 115  HIS C ND1   1 
ATOM   5689  C  CD2   . HIS C 1 115  ? 114.237 122.994 170.190 1.00 0.00   ? 115  HIS C CD2   1 
ATOM   5690  C  CE1   . HIS C 1 115  ? 115.106 121.783 171.797 1.00 0.00   ? 115  HIS C CE1   1 
ATOM   5691  N  NE2   . HIS C 1 115  ? 115.307 122.845 171.039 1.00 0.00   ? 115  HIS C NE2   1 
ATOM   5692  N  N     . SER C 1 116  ? 110.677 120.705 167.016 1.00 0.00   ? 116  SER C N     1 
ATOM   5693  C  CA    . SER C 1 116  ? 109.455 120.564 166.223 1.00 0.00   ? 116  SER C CA    1 
ATOM   5694  C  C     . SER C 1 116  ? 109.788 120.335 164.745 1.00 0.00   ? 116  SER C C     1 
ATOM   5695  O  O     . SER C 1 116  ? 110.963 120.284 164.384 1.00 0.00   ? 116  SER C O     1 
ATOM   5696  C  CB    . SER C 1 116  ? 108.578 121.817 166.362 1.00 0.00   ? 116  SER C CB    1 
ATOM   5697  O  OG    . SER C 1 116  ? 109.254 122.975 165.915 1.00 0.00   ? 116  SER C OG    1 
ATOM   5698  N  N     . PHE C 1 117  ? 108.773 120.170 163.917 1.00 0.00   ? 117  PHE C N     1 
ATOM   5699  C  CA    . PHE C 1 117  ? 109.030 119.971 162.510 1.00 0.00   ? 117  PHE C CA    1 
ATOM   5700  C  C     . PHE C 1 117  ? 109.718 121.220 161.985 1.00 0.00   ? 117  PHE C C     1 
ATOM   5701  O  O     . PHE C 1 117  ? 110.676 121.149 161.222 1.00 0.00   ? 117  PHE C O     1 
ATOM   5702  C  CB    . PHE C 1 117  ? 107.718 119.738 161.776 1.00 0.00   ? 117  PHE C CB    1 
ATOM   5703  C  CG    . PHE C 1 117  ? 107.844 119.782 160.290 1.00 0.00   ? 117  PHE C CG    1 
ATOM   5704  C  CD1   . PHE C 1 117  ? 108.280 118.678 159.592 1.00 0.00   ? 117  PHE C CD1   1 
ATOM   5705  C  CD2   . PHE C 1 117  ? 107.529 120.928 159.595 1.00 0.00   ? 117  PHE C CD2   1 
ATOM   5706  C  CE1   . PHE C 1 117  ? 108.398 118.714 158.221 1.00 0.00   ? 117  PHE C CE1   1 
ATOM   5707  C  CE2   . PHE C 1 117  ? 107.643 120.974 158.225 1.00 0.00   ? 117  PHE C CE2   1 
ATOM   5708  C  CZ    . PHE C 1 117  ? 108.079 119.864 157.535 1.00 0.00   ? 117  PHE C CZ    1 
ATOM   5709  N  N     . SER C 1 118  ? 109.238 122.369 162.443 1.00 0.00   ? 118  SER C N     1 
ATOM   5710  C  CA    . SER C 1 118  ? 109.755 123.664 162.014 1.00 0.00   ? 118  SER C CA    1 
ATOM   5711  C  C     . SER C 1 118  ? 111.264 123.741 162.215 1.00 0.00   ? 118  SER C C     1 
ATOM   5712  O  O     . SER C 1 118  ? 111.990 124.238 161.353 1.00 0.00   ? 118  SER C O     1 
ATOM   5713  C  CB    . SER C 1 118  ? 109.076 124.784 162.802 1.00 0.00   ? 118  SER C CB    1 
ATOM   5714  O  OG    . SER C 1 118  ? 107.681 124.805 162.546 1.00 0.00   ? 118  SER C OG    1 
ATOM   5715  N  N     . SER C 1 119  ? 111.727 123.256 163.361 1.00 0.00   ? 119  SER C N     1 
ATOM   5716  C  CA    . SER C 1 119  ? 113.152 123.263 163.657 1.00 0.00   ? 119  SER C CA    1 
ATOM   5717  C  C     . SER C 1 119  ? 113.841 122.352 162.646 1.00 0.00   ? 119  SER C C     1 
ATOM   5718  O  O     . SER C 1 119  ? 114.940 122.644 162.177 1.00 0.00   ? 119  SER C O     1 
ATOM   5719  C  CB    . SER C 1 119  ? 113.407 122.743 165.075 1.00 0.00   ? 119  SER C CB    1 
ATOM   5720  O  OG    . SER C 1 119  ? 113.038 121.380 165.191 1.00 0.00   ? 119  SER C OG    1 
ATOM   5721  N  N     . ALA C 1 120  ? 113.178 121.249 162.314 1.00 0.00   ? 120  ALA C N     1 
ATOM   5722  C  CA    . ALA C 1 120  ? 113.714 120.285 161.358 1.00 0.00   ? 120  ALA C CA    1 
ATOM   5723  C  C     . ALA C 1 120  ? 113.762 120.892 159.961 1.00 0.00   ? 120  ALA C C     1 
ATOM   5724  O  O     . ALA C 1 120  ? 114.724 120.678 159.222 1.00 0.00   ? 120  ALA C O     1 
ATOM   5725  C  CB    . ALA C 1 120  ? 112.861 119.022 161.351 1.00 0.00   ? 120  ALA C CB    1 
ATOM   5726  N  N     . PHE C 1 121  ? 112.733 121.652 159.620 1.00 0.00   ? 121  PHE C N     1 
ATOM   5727  C  CA    . PHE C 1 121  ? 112.659 122.285 158.317 1.00 0.00   ? 121  PHE C CA    1 
ATOM   5728  C  C     . PHE C 1 121  ? 113.803 123.264 158.138 1.00 0.00   ? 121  PHE C C     1 
ATOM   5729  O  O     . PHE C 1 121  ? 114.494 123.255 157.133 1.00 0.00   ? 121  PHE C O     1 
ATOM   5730  C  CB    . PHE C 1 121  ? 111.334 123.016 158.169 1.00 0.00   ? 121  PHE C CB    1 
ATOM   5731  C  CG    . PHE C 1 121  ? 111.175 123.706 156.857 1.00 0.00   ? 121  PHE C CG    1 
ATOM   5732  C  CD1   . PHE C 1 121  ? 110.343 123.189 155.890 1.00 0.00   ? 121  PHE C CD1   1 
ATOM   5733  C  CD2   . PHE C 1 121  ? 111.863 124.868 156.592 1.00 0.00   ? 121  PHE C CD2   1 
ATOM   5734  C  CE1   . PHE C 1 121  ? 110.193 123.821 154.677 1.00 0.00   ? 121  PHE C CE1   1 
ATOM   5735  C  CE2   . PHE C 1 121  ? 111.718 125.509 155.383 1.00 0.00   ? 121  PHE C CE2   1 
ATOM   5736  C  CZ    . PHE C 1 121  ? 110.882 124.984 154.422 1.00 0.00   ? 121  PHE C CZ    1 
ATOM   5737  N  N     . LEU C 1 122  ? 114.002 124.122 159.121 1.00 0.00   ? 122  LEU C N     1 
ATOM   5738  C  CA    . LEU C 1 122  ? 115.077 125.111 159.055 1.00 0.00   ? 122  LEU C CA    1 
ATOM   5739  C  C     . LEU C 1 122  ? 116.421 124.415 158.897 1.00 0.00   ? 122  LEU C C     1 
ATOM   5740  O  O     . LEU C 1 122  ? 117.326 124.948 158.250 1.00 0.00   ? 122  LEU C O     1 
ATOM   5741  C  CB    . LEU C 1 122  ? 115.088 125.987 160.316 1.00 0.00   ? 122  LEU C CB    1 
ATOM   5742  C  CG    . LEU C 1 122  ? 113.984 127.034 160.480 1.00 0.00   ? 122  LEU C CG    1 
ATOM   5743  C  CD1   . LEU C 1 122  ? 114.122 127.691 161.845 1.00 0.00   ? 122  LEU C CD1   1 
ATOM   5744  C  CD2   . LEU C 1 122  ? 114.073 128.083 159.379 1.00 0.00   ? 122  LEU C CD2   1 
ATOM   5745  N  N     . PHE C 1 123  ? 116.550 123.230 159.486 1.00 0.00   ? 123  PHE C N     1 
ATOM   5746  C  CA    . PHE C 1 123  ? 117.791 122.467 159.381 1.00 0.00   ? 123  PHE C CA    1 
ATOM   5747  C  C     . PHE C 1 123  ? 117.999 122.053 157.932 1.00 0.00   ? 123  PHE C C     1 
ATOM   5748  O  O     . PHE C 1 123  ? 119.116 122.101 157.421 1.00 0.00   ? 123  PHE C O     1 
ATOM   5749  C  CB    . PHE C 1 123  ? 117.740 121.208 160.247 1.00 0.00   ? 123  PHE C CB    1 
ATOM   5750  C  CG    . PHE C 1 123  ? 118.974 120.359 160.139 1.00 0.00   ? 123  PHE C CG    1 
ATOM   5751  C  CD1   . PHE C 1 123  ? 120.150 120.736 160.774 1.00 0.00   ? 123  PHE C CD1   1 
ATOM   5752  C  CD2   . PHE C 1 123  ? 118.963 119.191 159.386 1.00 0.00   ? 123  PHE C CD2   1 
ATOM   5753  C  CE1   . PHE C 1 123  ? 121.299 119.960 160.665 1.00 0.00   ? 123  PHE C CE1   1 
ATOM   5754  C  CE2   . PHE C 1 123  ? 120.108 118.408 159.270 1.00 0.00   ? 123  PHE C CE2   1 
ATOM   5755  C  CZ    . PHE C 1 123  ? 121.281 118.793 159.910 1.00 0.00   ? 123  PHE C CZ    1 
ATOM   5756  N  N     . SER C 1 124  ? 116.919 121.637 157.277 1.00 0.00   ? 124  SER C N     1 
ATOM   5757  C  CA    . SER C 1 124  ? 116.971 121.211 155.880 1.00 0.00   ? 124  SER C CA    1 
ATOM   5758  C  C     . SER C 1 124  ? 117.464 122.349 155.001 1.00 0.00   ? 124  SER C C     1 
ATOM   5759  O  O     . SER C 1 124  ? 118.285 122.152 154.104 1.00 0.00   ? 124  SER C O     1 
ATOM   5760  C  CB    . SER C 1 124  ? 115.579 120.772 155.405 1.00 0.00   ? 124  SER C CB    1 
ATOM   5761  O  OG    . SER C 1 124  ? 115.612 120.309 154.067 1.00 0.00   ? 124  SER C OG    1 
ATOM   5762  N  N     . ILE C 1 125  ? 116.946 123.542 155.264 1.00 0.00   ? 125  ILE C N     1 
ATOM   5763  C  CA    . ILE C 1 125  ? 117.325 124.730 154.508 1.00 0.00   ? 125  ILE C CA    1 
ATOM   5764  C  C     . ILE C 1 125  ? 118.816 124.997 154.658 1.00 0.00   ? 125  ILE C C     1 
ATOM   5765  O  O     . ILE C 1 125  ? 119.527 125.180 153.676 1.00 0.00   ? 125  ILE C O     1 
ATOM   5766  C  CB    . ILE C 1 125  ? 116.544 125.969 155.004 1.00 0.00   ? 125  ILE C CB    1 
ATOM   5767  C  CG1   . ILE C 1 125  ? 115.044 125.775 154.749 1.00 0.00   ? 125  ILE C CG1   1 
ATOM   5768  C  CG2   . ILE C 1 125  ? 117.048 127.212 154.295 1.00 0.00   ? 125  ILE C CG2   1 
ATOM   5769  C  CD1   . ILE C 1 125  ? 114.671 125.728 153.296 1.00 0.00   ? 125  ILE C CD1   1 
ATOM   5770  N  N     . GLU C 1 126  ? 119.281 124.998 155.902 1.00 0.00   ? 126  GLU C N     1 
ATOM   5771  C  CA    . GLU C 1 126  ? 120.685 125.254 156.218 1.00 0.00   ? 126  GLU C CA    1 
ATOM   5772  C  C     . GLU C 1 126  ? 121.651 124.271 155.564 1.00 0.00   ? 126  GLU C C     1 
ATOM   5773  O  O     . GLU C 1 126  ? 122.832 124.581 155.393 1.00 0.00   ? 126  GLU C O     1 
ATOM   5774  C  CB    . GLU C 1 126  ? 120.889 125.222 157.736 1.00 0.00   ? 126  GLU C CB    1 
ATOM   5775  C  CG    . GLU C 1 126  ? 120.143 126.306 158.485 1.00 0.00   ? 126  GLU C CG    1 
ATOM   5776  C  CD    . GLU C 1 126  ? 120.284 126.181 159.991 1.00 0.00   ? 126  GLU C CD    1 
ATOM   5777  O  OE1   . GLU C 1 126  ? 121.431 126.128 160.486 1.00 0.00   ? 126  GLU C OE1   1 
ATOM   5778  O  OE2   . GLU C 1 126  ? 119.241 126.141 160.683 1.00 0.00   ? 126  GLU C OE2   1 
ATOM   5779  N  N     . VAL C 1 127  ? 121.156 123.091 155.195 1.00 0.00   ? 127  VAL C N     1 
ATOM   5780  C  CA    . VAL C 1 127  ? 121.993 122.063 154.578 1.00 0.00   ? 127  VAL C CA    1 
ATOM   5781  C  C     . VAL C 1 127  ? 122.143 122.180 153.062 1.00 0.00   ? 127  VAL C C     1 
ATOM   5782  O  O     . VAL C 1 127  ? 123.262 122.143 152.542 1.00 0.00   ? 127  VAL C O     1 
ATOM   5783  C  CB    . VAL C 1 127  ? 121.458 120.642 154.905 1.00 0.00   ? 127  VAL C CB    1 
ATOM   5784  C  CG1   . VAL C 1 127  ? 122.249 119.596 154.139 1.00 0.00   ? 127  VAL C CG1   1 
ATOM   5785  C  CG2   . VAL C 1 127  ? 121.566 120.378 156.396 1.00 0.00   ? 127  VAL C CG2   1 
ATOM   5786  N  N     . GLN C 1 128  ? 121.028 122.320 152.351 1.00 0.00   ? 128  GLN C N     1 
ATOM   5787  C  CA    . GLN C 1 128  ? 121.079 122.417 150.897 1.00 0.00   ? 128  GLN C CA    1 
ATOM   5788  C  C     . GLN C 1 128  ? 121.669 123.727 150.369 1.00 0.00   ? 128  GLN C C     1 
ATOM   5789  O  O     . GLN C 1 128  ? 122.388 123.716 149.370 1.00 0.00   ? 128  GLN C O     1 
ATOM   5790  C  CB    . GLN C 1 128  ? 119.691 122.172 150.288 1.00 0.00   ? 128  GLN C CB    1 
ATOM   5791  C  CG    . GLN C 1 128  ? 119.214 120.726 150.389 1.00 0.00   ? 128  GLN C CG    1 
ATOM   5792  C  CD    . GLN C 1 128  ? 117.988 120.450 149.539 1.00 0.00   ? 128  GLN C CD    1 
ATOM   5793  O  OE1   . GLN C 1 128  ? 117.081 119.725 149.949 1.00 0.00   ? 128  GLN C OE1   1 
ATOM   5794  N  NE2   . GLN C 1 128  ? 117.956 121.027 148.344 1.00 0.00   ? 128  GLN C NE2   1 
ATOM   5795  N  N     . VAL C 1 129  ? 121.374 124.849 151.025 1.00 0.00   ? 129  VAL C N     1 
ATOM   5796  C  CA    . VAL C 1 129  ? 121.922 126.133 150.593 1.00 0.00   ? 129  VAL C CA    1 
ATOM   5797  C  C     . VAL C 1 129  ? 123.204 126.453 151.361 1.00 0.00   ? 129  VAL C C     1 
ATOM   5798  O  O     . VAL C 1 129  ? 123.663 127.593 151.381 1.00 0.00   ? 129  VAL C O     1 
ATOM   5799  C  CB    . VAL C 1 129  ? 120.917 127.295 150.790 1.00 0.00   ? 129  VAL C CB    1 
ATOM   5800  C  CG1   . VAL C 1 129  ? 121.573 128.614 150.446 1.00 0.00   ? 129  VAL C CG1   1 
ATOM   5801  C  CG2   . VAL C 1 129  ? 119.694 127.075 149.935 1.00 0.00   ? 129  VAL C CG2   1 
ATOM   5802  N  N     . THR C 1 130  ? 123.757 125.422 151.988 1.00 0.00   ? 130  THR C N     1 
ATOM   5803  C  CA    . THR C 1 130  ? 124.995 125.486 152.763 1.00 0.00   ? 130  THR C CA    1 
ATOM   5804  C  C     . THR C 1 130  ? 125.174 126.642 153.739 1.00 0.00   ? 130  THR C C     1 
ATOM   5805  O  O     . THR C 1 130  ? 126.212 127.311 153.730 1.00 0.00   ? 130  THR C O     1 
ATOM   5806  C  CB    . THR C 1 130  ? 126.235 125.451 151.837 1.00 0.00   ? 130  THR C CB    1 
ATOM   5807  O  OG1   . THR C 1 130  ? 126.289 126.644 151.050 1.00 0.00   ? 130  THR C OG1   1 
ATOM   5808  C  CG2   . THR C 1 130  ? 126.166 124.248 150.914 1.00 0.00   ? 130  THR C CG2   1 
ATOM   5809  N  N     . ILE C 1 131  ? 124.181 126.883 154.591 1.00 0.00   ? 131  ILE C N     1 
ATOM   5810  C  CA    . ILE C 1 131  ? 124.291 127.972 155.560 1.00 0.00   ? 131  ILE C CA    1 
ATOM   5811  C  C     . ILE C 1 131  ? 124.985 127.478 156.830 1.00 0.00   ? 131  ILE C C     1 
ATOM   5812  O  O     . ILE C 1 131  ? 125.956 128.083 157.290 1.00 0.00   ? 131  ILE C O     1 
ATOM   5813  C  CB    . ILE C 1 131  ? 122.912 128.543 155.923 1.00 0.00   ? 131  ILE C CB    1 
ATOM   5814  C  CG1   . ILE C 1 131  ? 122.268 129.156 154.668 1.00 0.00   ? 131  ILE C CG1   1 
ATOM   5815  C  CG2   . ILE C 1 131  ? 123.055 129.594 157.005 1.00 0.00   ? 131  ILE C CG2   1 
ATOM   5816  C  CD1   . ILE C 1 131  ? 120.918 129.811 154.911 1.00 0.00   ? 131  ILE C CD1   1 
ATOM   5817  N  N     . GLY C 1 132  ? 124.487 126.386 157.401 1.00 0.00   ? 132  GLY C N     1 
ATOM   5818  C  CA    . GLY C 1 132  ? 125.112 125.837 158.591 1.00 0.00   ? 132  GLY C CA    1 
ATOM   5819  C  C     . GLY C 1 132  ? 125.194 126.775 159.781 1.00 0.00   ? 132  GLY C C     1 
ATOM   5820  O  O     . GLY C 1 132  ? 126.284 126.985 160.310 1.00 0.00   ? 132  GLY C O     1 
ATOM   5821  N  N     . PHE C 1 133  ? 124.066 127.322 160.225 1.00 0.00   ? 133  PHE C N     1 
ATOM   5822  C  CA    . PHE C 1 133  ? 124.093 128.252 161.348 1.00 0.00   ? 133  PHE C CA    1 
ATOM   5823  C  C     . PHE C 1 133  ? 124.806 127.662 162.564 1.00 0.00   ? 133  PHE C C     1 
ATOM   5824  O  O     . PHE C 1 133  ? 125.474 128.381 163.296 1.00 0.00   ? 133  PHE C O     1 
ATOM   5825  C  CB    . PHE C 1 133  ? 122.671 128.661 161.755 1.00 0.00   ? 133  PHE C CB    1 
ATOM   5826  C  CG    . PHE C 1 133  ? 122.044 129.685 160.849 1.00 0.00   ? 133  PHE C CG    1 
ATOM   5827  C  CD1   . PHE C 1 133  ? 122.703 130.874 160.548 1.00 0.00   ? 133  PHE C CD1   1 
ATOM   5828  C  CD2   . PHE C 1 133  ? 120.777 129.470 160.321 1.00 0.00   ? 133  PHE C CD2   1 
ATOM   5829  C  CE1   . PHE C 1 133  ? 122.103 131.837 159.737 1.00 0.00   ? 133  PHE C CE1   1 
ATOM   5830  C  CE2   . PHE C 1 133  ? 120.170 130.427 159.509 1.00 0.00   ? 133  PHE C CE2   1 
ATOM   5831  C  CZ    . PHE C 1 133  ? 120.834 131.613 159.216 1.00 0.00   ? 133  PHE C CZ    1 
ATOM   5832  N  N     . GLY C 1 134  ? 124.669 126.359 162.783 1.00 0.00   ? 134  GLY C N     1 
ATOM   5833  C  CA    . GLY C 1 134  ? 125.349 125.742 163.910 1.00 0.00   ? 134  GLY C CA    1 
ATOM   5834  C  C     . GLY C 1 134  ? 124.535 125.449 165.155 1.00 0.00   ? 134  GLY C C     1 
ATOM   5835  O  O     . GLY C 1 134  ? 124.967 124.667 166.005 1.00 0.00   ? 134  GLY C O     1 
ATOM   5836  N  N     . GLY C 1 135  ? 123.379 126.089 165.282 1.00 0.00   ? 135  GLY C N     1 
ATOM   5837  C  CA    . GLY C 1 135  ? 122.536 125.852 166.440 1.00 0.00   ? 135  GLY C CA    1 
ATOM   5838  C  C     . GLY C 1 135  ? 121.986 124.448 166.315 1.00 0.00   ? 135  GLY C C     1 
ATOM   5839  O  O     . GLY C 1 135  ? 121.580 123.818 167.292 1.00 0.00   ? 135  GLY C O     1 
ATOM   5840  N  N     . ARG C 1 136  ? 121.982 123.965 165.076 1.00 0.00   ? 136  ARG C N     1 
ATOM   5841  C  CA    . ARG C 1 136  ? 121.500 122.632 164.749 1.00 0.00   ? 136  ARG C CA    1 
ATOM   5842  C  C     . ARG C 1 136  ? 122.637 121.888 164.040 1.00 0.00   ? 136  ARG C C     1 
ATOM   5843  O  O     . ARG C 1 136  ? 122.935 122.147 162.869 1.00 0.00   ? 136  ARG C O     1 
ATOM   5844  C  CB    . ARG C 1 136  ? 120.272 122.735 163.839 1.00 0.00   ? 136  ARG C CB    1 
ATOM   5845  C  CG    . ARG C 1 136  ? 119.245 123.767 164.308 1.00 0.00   ? 136  ARG C CG    1 
ATOM   5846  C  CD    . ARG C 1 136  ? 117.974 123.713 163.468 1.00 0.00   ? 136  ARG C CD    1 
ATOM   5847  N  NE    . ARG C 1 136  ? 116.930 124.616 163.959 1.00 0.00   ? 136  ARG C NE    1 
ATOM   5848  C  CZ    . ARG C 1 136  ? 116.968 125.944 163.869 1.00 0.00   ? 136  ARG C CZ    1 
ATOM   5849  N  NH1   . ARG C 1 136  ? 118.006 126.547 163.302 1.00 0.00   ? 136  ARG C NH1   1 
ATOM   5850  N  NH2   . ARG C 1 136  ? 115.962 126.670 164.341 1.00 0.00   ? 136  ARG C NH2   1 
ATOM   5851  N  N     . MET C 1 137  ? 123.270 120.966 164.758 1.00 0.00   ? 137  MET C N     1 
ATOM   5852  C  CA    . MET C 1 137  ? 124.391 120.196 164.225 1.00 0.00   ? 137  MET C CA    1 
ATOM   5853  C  C     . MET C 1 137  ? 124.103 118.698 164.143 1.00 0.00   ? 137  MET C C     1 
ATOM   5854  O  O     . MET C 1 137  ? 123.229 118.179 164.839 1.00 0.00   ? 137  MET C O     1 
ATOM   5855  C  CB    . MET C 1 137  ? 125.625 120.426 165.097 1.00 0.00   ? 137  MET C CB    1 
ATOM   5856  C  CG    . MET C 1 137  ? 125.964 121.894 165.316 1.00 0.00   ? 137  MET C CG    1 
ATOM   5857  S  SD    . MET C 1 137  ? 127.117 122.141 166.671 1.00 0.00   ? 137  MET C SD    1 
ATOM   5858  C  CE    . MET C 1 137  ? 125.990 122.096 168.069 1.00 0.00   ? 137  MET C CE    1 
ATOM   5859  N  N     . VAL C 1 138  ? 124.852 118.009 163.286 1.00 0.00   ? 138  VAL C N     1 
ATOM   5860  C  CA    . VAL C 1 138  ? 124.699 116.569 163.110 1.00 0.00   ? 138  VAL C CA    1 
ATOM   5861  C  C     . VAL C 1 138  ? 125.728 115.843 163.970 1.00 0.00   ? 138  VAL C C     1 
ATOM   5862  O  O     . VAL C 1 138  ? 126.920 116.131 163.891 1.00 0.00   ? 138  VAL C O     1 
ATOM   5863  C  CB    . VAL C 1 138  ? 124.926 116.159 161.639 1.00 0.00   ? 138  VAL C CB    1 
ATOM   5864  C  CG1   . VAL C 1 138  ? 124.840 114.648 161.500 1.00 0.00   ? 138  VAL C CG1   1 
ATOM   5865  C  CG2   . VAL C 1 138  ? 123.902 116.827 160.745 1.00 0.00   ? 138  VAL C CG2   1 
ATOM   5866  N  N     . THR C 1 139  ? 125.275 114.899 164.792 1.00 0.00   ? 139  THR C N     1 
ATOM   5867  C  CA    . THR C 1 139  ? 126.197 114.160 165.643 1.00 0.00   ? 139  THR C CA    1 
ATOM   5868  C  C     . THR C 1 139  ? 126.562 112.827 165.011 1.00 0.00   ? 139  THR C C     1 
ATOM   5869  O  O     . THR C 1 139  ? 126.165 112.534 163.881 1.00 0.00   ? 139  THR C O     1 
ATOM   5870  C  CB    . THR C 1 139  ? 125.604 113.900 167.042 1.00 0.00   ? 139  THR C CB    1 
ATOM   5871  O  OG1   . THR C 1 139  ? 124.515 112.974 166.940 1.00 0.00   ? 139  THR C OG1   1 
ATOM   5872  C  CG2   . THR C 1 139  ? 125.104 115.200 167.657 1.00 0.00   ? 139  THR C CG2   1 
ATOM   5873  N  N     . GLU C 1 140  ? 127.313 112.015 165.747 1.00 0.00   ? 140  GLU C N     1 
ATOM   5874  C  CA    . GLU C 1 140  ? 127.732 110.713 165.239 1.00 0.00   ? 140  GLU C CA    1 
ATOM   5875  C  C     . GLU C 1 140  ? 126.802 109.607 165.717 1.00 0.00   ? 140  GLU C C     1 
ATOM   5876  O  O     . GLU C 1 140  ? 127.055 108.428 165.465 1.00 0.00   ? 140  GLU C O     1 
ATOM   5877  C  CB    . GLU C 1 140  ? 129.161 110.392 165.691 1.00 0.00   ? 140  GLU C CB    1 
ATOM   5878  C  CG    . GLU C 1 140  ? 130.196 111.464 165.386 1.00 0.00   ? 140  GLU C CG    1 
ATOM   5879  C  CD    . GLU C 1 140  ? 130.017 112.705 166.236 1.00 0.00   ? 140  GLU C CD    1 
ATOM   5880  O  OE1   . GLU C 1 140  ? 129.291 112.639 167.251 1.00 0.00   ? 140  GLU C OE1   1 
ATOM   5881  O  OE2   . GLU C 1 140  ? 130.610 113.747 165.896 1.00 0.00   ? 140  GLU C OE2   1 
ATOM   5882  N  N     . GLU C 1 141  ? 125.715 109.962 166.379 1.00 0.00   ? 141  GLU C N     1 
ATOM   5883  C  CA    . GLU C 1 141  ? 124.805 108.939 166.866 1.00 0.00   ? 141  GLU C CA    1 
ATOM   5884  C  C     . GLU C 1 141  ? 124.128 108.143 165.754 1.00 0.00   ? 141  GLU C C     1 
ATOM   5885  O  O     . GLU C 1 141  ? 124.100 106.917 165.784 1.00 0.00   ? 141  GLU C O     1 
ATOM   5886  C  CB    . GLU C 1 141  ? 123.756 109.556 167.786 1.00 0.00   ? 141  GLU C CB    1 
ATOM   5887  C  CG    . GLU C 1 141  ? 124.334 110.134 169.062 1.00 0.00   ? 141  GLU C CG    1 
ATOM   5888  C  CD    . GLU C 1 141  ? 125.088 109.102 169.869 1.00 0.00   ? 141  GLU C CD    1 
ATOM   5889  O  OE1   . GLU C 1 141  ? 124.620 107.949 169.951 1.00 0.00   ? 141  GLU C OE1   1 
ATOM   5890  O  OE2   . GLU C 1 141  ? 126.155 109.442 170.423 1.00 0.00   ? 141  GLU C OE2   1 
ATOM   5891  N  N     . CYS C 1 142  ? 123.589 108.847 164.767 1.00 0.00   ? 142  CYS C N     1 
ATOM   5892  C  CA    . CYS C 1 142  ? 122.879 108.216 163.665 1.00 0.00   ? 142  CYS C CA    1 
ATOM   5893  C  C     . CYS C 1 142  ? 123.732 108.012 162.421 1.00 0.00   ? 142  CYS C C     1 
ATOM   5894  O  O     . CYS C 1 142  ? 123.952 108.962 161.676 1.00 0.00   ? 142  CYS C O     1 
ATOM   5895  C  CB    . CYS C 1 142  ? 121.679 109.087 163.285 1.00 0.00   ? 142  CYS C CB    1 
ATOM   5896  S  SG    . CYS C 1 142  ? 120.257 109.006 164.397 1.00 0.00   ? 142  CYS C SG    1 
ATOM   5897  N  N     . PRO C 1 143  ? 124.203 106.790 162.169 1.00 0.00   ? 143  PRO C N     1 
ATOM   5898  C  CA    . PRO C 1 143  ? 125.008 106.581 160.967 1.00 0.00   ? 143  PRO C CA    1 
ATOM   5899  C  C     . PRO C 1 143  ? 124.112 106.869 159.764 1.00 0.00   ? 143  PRO C C     1 
ATOM   5900  O  O     . PRO C 1 143  ? 124.590 107.147 158.664 1.00 0.00   ? 143  PRO C O     1 
ATOM   5901  C  CB    . PRO C 1 143  ? 125.417 105.109 161.072 1.00 0.00   ? 143  PRO C CB    1 
ATOM   5902  C  CG    . PRO C 1 143  ? 124.268 104.499 161.819 1.00 0.00   ? 143  PRO C CG    1 
ATOM   5903  C  CD    . PRO C 1 143  ? 123.979 105.526 162.885 1.00 0.00   ? 143  PRO C CD    1 
ATOM   5904  N  N     . LEU C 1 144  ? 122.803 106.822 160.005 1.00 0.00   ? 144  LEU C N     1 
ATOM   5905  C  CA    . LEU C 1 144  ? 121.803 107.090 158.979 1.00 0.00   ? 144  LEU C CA    1 
ATOM   5906  C  C     . LEU C 1 144  ? 121.715 108.584 158.691 1.00 0.00   ? 144  LEU C C     1 
ATOM   5907  O  O     . LEU C 1 144  ? 121.601 108.995 157.536 1.00 0.00   ? 144  LEU C O     1 
ATOM   5908  C  CB    . LEU C 1 144  ? 120.428 106.581 159.427 1.00 0.00   ? 144  LEU C CB    1 
ATOM   5909  C  CG    . LEU C 1 144  ? 119.245 106.950 158.534 1.00 0.00   ? 144  LEU C CG    1 
ATOM   5910  C  CD1   . LEU C 1 144  ? 119.414 106.346 157.145 1.00 0.00   ? 144  LEU C CD1   1 
ATOM   5911  C  CD2   . LEU C 1 144  ? 117.963 106.454 159.177 1.00 0.00   ? 144  LEU C CD2   1 
ATOM   5912  N  N     . ALA C 1 145  ? 121.764 109.395 159.747 1.00 0.00   ? 145  ALA C N     1 
ATOM   5913  C  CA    . ALA C 1 145  ? 121.704 110.843 159.594 1.00 0.00   ? 145  ALA C CA    1 
ATOM   5914  C  C     . ALA C 1 145  ? 122.872 111.265 158.719 1.00 0.00   ? 145  ALA C C     1 
ATOM   5915  O  O     . ALA C 1 145  ? 122.735 112.133 157.859 1.00 0.00   ? 145  ALA C O     1 
ATOM   5916  C  CB    . ALA C 1 145  ? 121.789 111.529 160.959 1.00 0.00   ? 145  ALA C CB    1 
ATOM   5917  N  N     . ILE C 1 146  ? 124.024 110.635 158.935 1.00 0.00   ? 146  ILE C N     1 
ATOM   5918  C  CA    . ILE C 1 146  ? 125.211 110.945 158.149 1.00 0.00   ? 146  ILE C CA    1 
ATOM   5919  C  C     . ILE C 1 146  ? 124.957 110.653 156.678 1.00 0.00   ? 146  ILE C C     1 
ATOM   5920  O  O     . ILE C 1 146  ? 125.350 111.426 155.805 1.00 0.00   ? 146  ILE C O     1 
ATOM   5921  C  CB    . ILE C 1 146  ? 126.419 110.122 158.620 1.00 0.00   ? 146  ILE C CB    1 
ATOM   5922  C  CG1   . ILE C 1 146  ? 126.743 110.481 160.072 1.00 0.00   ? 146  ILE C CG1   1 
ATOM   5923  C  CG2   . ILE C 1 146  ? 127.614 110.384 157.710 1.00 0.00   ? 146  ILE C CG2   1 
ATOM   5924  C  CD1   . ILE C 1 146  ? 127.931 109.744 160.642 1.00 0.00   ? 146  ILE C CD1   1 
ATOM   5925  N  N     . LEU C 1 147  ? 124.304 109.528 156.413 1.00 0.00   ? 147  LEU C N     1 
ATOM   5926  C  CA    . LEU C 1 147  ? 123.983 109.134 155.050 1.00 0.00   ? 147  LEU C CA    1 
ATOM   5927  C  C     . LEU C 1 147  ? 122.998 110.119 154.439 1.00 0.00   ? 147  LEU C C     1 
ATOM   5928  O  O     . LEU C 1 147  ? 123.160 110.551 153.299 1.00 0.00   ? 147  LEU C O     1 
ATOM   5929  C  CB    . LEU C 1 147  ? 123.383 107.729 155.019 1.00 0.00   ? 147  LEU C CB    1 
ATOM   5930  C  CG    . LEU C 1 147  ? 122.866 107.272 153.652 1.00 0.00   ? 147  LEU C CG    1 
ATOM   5931  C  CD1   . LEU C 1 147  ? 124.008 107.243 152.644 1.00 0.00   ? 147  LEU C CD1   1 
ATOM   5932  C  CD2   . LEU C 1 147  ? 122.237 105.898 153.782 1.00 0.00   ? 147  LEU C CD2   1 
ATOM   5933  N  N     . ILE C 1 148  ? 121.973 110.473 155.207 1.00 0.00   ? 148  ILE C N     1 
ATOM   5934  C  CA    . ILE C 1 148  ? 120.963 111.410 154.730 1.00 0.00   ? 148  ILE C CA    1 
ATOM   5935  C  C     . ILE C 1 148  ? 121.619 112.739 154.371 1.00 0.00   ? 148  ILE C C     1 
ATOM   5936  O  O     . ILE C 1 148  ? 121.280 113.358 153.365 1.00 0.00   ? 148  ILE C O     1 
ATOM   5937  C  CB    . ILE C 1 148  ? 119.883 111.656 155.798 1.00 0.00   ? 148  ILE C CB    1 
ATOM   5938  C  CG1   . ILE C 1 148  ? 119.178 110.332 156.131 1.00 0.00   ? 148  ILE C CG1   1 
ATOM   5939  C  CG2   . ILE C 1 148  ? 118.890 112.697 155.301 1.00 0.00   ? 148  ILE C CG2   1 
ATOM   5940  C  CD1   . ILE C 1 148  ? 118.070 110.464 157.156 1.00 0.00   ? 148  ILE C CD1   1 
ATOM   5941  N  N     . LEU C 1 149  ? 122.562 113.171 155.206 1.00 0.00   ? 149  LEU C N     1 
ATOM   5942  C  CA    . LEU C 1 149  ? 123.277 114.418 154.975 1.00 0.00   ? 149  LEU C CA    1 
ATOM   5943  C  C     . LEU C 1 149  ? 124.010 114.357 153.643 1.00 0.00   ? 149  LEU C C     1 
ATOM   5944  O  O     . LEU C 1 149  ? 123.986 115.308 152.864 1.00 0.00   ? 149  LEU C O     1 
ATOM   5945  C  CB    . LEU C 1 149  ? 124.283 114.671 156.100 1.00 0.00   ? 149  LEU C CB    1 
ATOM   5946  C  CG    . LEU C 1 149  ? 125.144 115.927 155.964 1.00 0.00   ? 149  LEU C CG    1 
ATOM   5947  C  CD1   . LEU C 1 149  ? 124.261 117.170 155.923 1.00 0.00   ? 149  LEU C CD1   1 
ATOM   5948  C  CD2   . LEU C 1 149  ? 126.114 115.998 157.128 1.00 0.00   ? 149  LEU C CD2   1 
ATOM   5949  N  N     . ILE C 1 150  ? 124.672 113.232 153.391 1.00 0.00   ? 150  ILE C N     1 
ATOM   5950  C  CA    . ILE C 1 150  ? 125.406 113.055 152.146 1.00 0.00   ? 150  ILE C CA    1 
ATOM   5951  C  C     . ILE C 1 150  ? 124.454 113.150 150.959 1.00 0.00   ? 150  ILE C C     1 
ATOM   5952  O  O     . ILE C 1 150  ? 124.715 113.871 149.995 1.00 0.00   ? 150  ILE C O     1 
ATOM   5953  C  CB    . ILE C 1 150  ? 126.117 111.689 152.103 1.00 0.00   ? 150  ILE C CB    1 
ATOM   5954  C  CG1   . ILE C 1 150  ? 127.163 111.628 153.228 1.00 0.00   ? 150  ILE C CG1   1 
ATOM   5955  C  CG2   . ILE C 1 150  ? 126.755 111.471 150.738 1.00 0.00   ? 150  ILE C CG2   1 
ATOM   5956  C  CD1   . ILE C 1 150  ? 127.953 110.335 153.272 1.00 0.00   ? 150  ILE C CD1   1 
ATOM   5957  N  N     . VAL C 1 151  ? 123.348 112.417 151.035 1.00 0.00   ? 151  VAL C N     1 
ATOM   5958  C  CA    . VAL C 1 151  ? 122.355 112.408 149.969 1.00 0.00   ? 151  VAL C CA    1 
ATOM   5959  C  C     . VAL C 1 151  ? 121.750 113.787 149.710 1.00 0.00   ? 151  VAL C C     1 
ATOM   5960  O  O     . VAL C 1 151  ? 121.682 114.232 148.567 1.00 0.00   ? 151  VAL C O     1 
ATOM   5961  C  CB    . VAL C 1 151  ? 121.225 111.414 150.292 1.00 0.00   ? 151  VAL C CB    1 
ATOM   5962  C  CG1   . VAL C 1 151  ? 120.136 111.491 149.232 1.00 0.00   ? 151  VAL C CG1   1 
ATOM   5963  C  CG2   . VAL C 1 151  ? 121.792 110.007 150.361 1.00 0.00   ? 151  VAL C CG2   1 
ATOM   5964  N  N     . GLN C 1 152  ? 121.312 114.455 150.771 1.00 0.00   ? 152  GLN C N     1 
ATOM   5965  C  CA    . GLN C 1 152  ? 120.719 115.779 150.641 1.00 0.00   ? 152  GLN C CA    1 
ATOM   5966  C  C     . GLN C 1 152  ? 121.691 116.791 150.036 1.00 0.00   ? 152  GLN C C     1 
ATOM   5967  O  O     . GLN C 1 152  ? 121.299 117.599 149.194 1.00 0.00   ? 152  GLN C O     1 
ATOM   5968  C  CB    . GLN C 1 152  ? 120.223 116.279 152.002 1.00 0.00   ? 152  GLN C CB    1 
ATOM   5969  C  CG    . GLN C 1 152  ? 119.799 117.741 152.016 1.00 0.00   ? 152  GLN C CG    1 
ATOM   5970  C  CD    . GLN C 1 152  ? 118.958 118.092 153.227 1.00 0.00   ? 152  GLN C CD    1 
ATOM   5971  O  OE1   . GLN C 1 152  ? 119.308 117.755 154.358 1.00 0.00   ? 152  GLN C OE1   1 
ATOM   5972  N  NE2   . GLN C 1 152  ? 117.841 118.772 152.996 1.00 0.00   ? 152  GLN C NE2   1 
ATOM   5973  N  N     . ASN C 1 153  ? 122.948 116.755 150.462 1.00 0.00   ? 153  ASN C N     1 
ATOM   5974  C  CA    . ASN C 1 153  ? 123.935 117.681 149.922 1.00 0.00   ? 153  ASN C CA    1 
ATOM   5975  C  C     . ASN C 1 153  ? 124.094 117.474 148.424 1.00 0.00   ? 153  ASN C C     1 
ATOM   5976  O  O     . ASN C 1 153  ? 124.065 118.425 147.647 1.00 0.00   ? 153  ASN C O     1 
ATOM   5977  C  CB    . ASN C 1 153  ? 125.301 117.506 150.596 1.00 0.00   ? 153  ASN C CB    1 
ATOM   5978  C  CG    . ASN C 1 153  ? 125.348 118.123 151.979 1.00 0.00   ? 153  ASN C CG    1 
ATOM   5979  O  OD1   . ASN C 1 153  ? 124.640 119.088 152.273 1.00 0.00   ? 153  ASN C OD1   1 
ATOM   5980  N  ND2   . ASN C 1 153  ? 126.212 117.582 152.833 1.00 0.00   ? 153  ASN C ND2   1 
ATOM   5981  N  N     . ILE C 1 154  ? 124.257 116.220 148.027 1.00 0.00   ? 154  ILE C N     1 
ATOM   5982  C  CA    . ILE C 1 154  ? 124.433 115.878 146.623 1.00 0.00   ? 154  ILE C CA    1 
ATOM   5983  C  C     . ILE C 1 154  ? 123.218 116.225 145.766 1.00 0.00   ? 154  ILE C C     1 
ATOM   5984  O  O     . ILE C 1 154  ? 123.362 116.799 144.689 1.00 0.00   ? 154  ILE C O     1 
ATOM   5985  C  CB    . ILE C 1 154  ? 124.744 114.386 146.453 1.00 0.00   ? 154  ILE C CB    1 
ATOM   5986  C  CG1   . ILE C 1 154  ? 126.081 114.070 147.134 1.00 0.00   ? 154  ILE C CG1   1 
ATOM   5987  C  CG2   . ILE C 1 154  ? 124.784 114.029 144.976 1.00 0.00   ? 154  ILE C CG2   1 
ATOM   5988  C  CD1   . ILE C 1 154  ? 126.526 112.633 146.986 1.00 0.00   ? 154  ILE C CD1   1 
ATOM   5989  N  N     . VAL C 1 155  ? 122.028 115.865 146.237 1.00 0.00   ? 155  VAL C N     1 
ATOM   5990  C  CA    . VAL C 1 155  ? 120.803 116.152 145.498 1.00 0.00   ? 155  VAL C CA    1 
ATOM   5991  C  C     . VAL C 1 155  ? 120.652 117.655 145.305 1.00 0.00   ? 155  VAL C C     1 
ATOM   5992  O  O     . VAL C 1 155  ? 120.407 118.134 144.194 1.00 0.00   ? 155  VAL C O     1 
ATOM   5993  C  CB    . VAL C 1 155  ? 119.564 115.628 146.249 1.00 0.00   ? 155  VAL C CB    1 
ATOM   5994  C  CG1   . VAL C 1 155  ? 118.302 116.097 145.549 1.00 0.00   ? 155  VAL C CG1   1 
ATOM   5995  C  CG2   . VAL C 1 155  ? 119.598 114.114 146.317 1.00 0.00   ? 155  VAL C CG2   1 
ATOM   5996  N  N     . GLY C 1 156  ? 120.778 118.394 146.403 1.00 0.00   ? 156  GLY C N     1 
ATOM   5997  C  CA    . GLY C 1 156  ? 120.669 119.839 146.345 1.00 0.00   ? 156  GLY C CA    1 
ATOM   5998  C  C     . GLY C 1 156  ? 121.756 120.405 145.454 1.00 0.00   ? 156  GLY C C     1 
ATOM   5999  O  O     . GLY C 1 156  ? 121.548 121.379 144.733 1.00 0.00   ? 156  GLY C O     1 
ATOM   6000  N  N     . LEU C 1 157  ? 122.927 119.781 145.517 1.00 0.00   ? 157  LEU C N     1 
ATOM   6001  C  CA    . LEU C 1 157  ? 124.066 120.198 144.722 1.00 0.00   ? 157  LEU C CA    1 
ATOM   6002  C  C     . LEU C 1 157  ? 123.762 120.040 143.236 1.00 0.00   ? 157  LEU C C     1 
ATOM   6003  O  O     . LEU C 1 157  ? 123.988 120.953 142.447 1.00 0.00   ? 157  LEU C O     1 
ATOM   6004  C  CB    . LEU C 1 157  ? 125.298 119.376 145.091 1.00 0.00   ? 157  LEU C CB    1 
ATOM   6005  C  CG    . LEU C 1 157  ? 126.643 119.794 144.493 1.00 0.00   ? 157  LEU C CG    1 
ATOM   6006  C  CD1   . LEU C 1 157  ? 127.779 119.505 145.464 1.00 0.00   ? 157  LEU C CD1   1 
ATOM   6007  C  CD2   . LEU C 1 157  ? 126.841 119.044 143.196 1.00 0.00   ? 157  LEU C CD2   1 
ATOM   6008  N  N     . MET C 1 158  ? 123.247 118.874 142.858 1.00 0.00   ? 158  MET C N     1 
ATOM   6009  C  CA    . MET C 1 158  ? 122.905 118.613 141.464 1.00 0.00   ? 158  MET C CA    1 
ATOM   6010  C  C     . MET C 1 158  ? 121.822 119.561 140.975 1.00 0.00   ? 158  MET C C     1 
ATOM   6011  O  O     . MET C 1 158  ? 121.841 119.999 139.825 1.00 0.00   ? 158  MET C O     1 
ATOM   6012  C  CB    . MET C 1 158  ? 122.442 117.165 141.278 1.00 0.00   ? 158  MET C CB    1 
ATOM   6013  C  CG    . MET C 1 158  ? 123.563 116.146 141.250 1.00 0.00   ? 158  MET C CG    1 
ATOM   6014  S  SD    . MET C 1 158  ? 124.738 116.471 139.924 1.00 0.00   ? 158  MET C SD    1 
ATOM   6015  C  CE    . MET C 1 158  ? 126.231 115.785 140.619 1.00 0.00   ? 158  MET C CE    1 
ATOM   6016  N  N     . ILE C 1 159  ? 120.871 119.873 141.849 1.00 0.00   ? 159  ILE C N     1 
ATOM   6017  C  CA    . ILE C 1 159  ? 119.792 120.779 141.492 1.00 0.00   ? 159  ILE C CA    1 
ATOM   6018  C  C     . ILE C 1 159  ? 120.361 122.144 141.119 1.00 0.00   ? 159  ILE C C     1 
ATOM   6019  O  O     . ILE C 1 159  ? 119.977 122.722 140.100 1.00 0.00   ? 159  ILE C O     1 
ATOM   6020  C  CB    . ILE C 1 159  ? 118.800 120.952 142.655 1.00 0.00   ? 159  ILE C CB    1 
ATOM   6021  C  CG1   . ILE C 1 159  ? 118.114 119.609 142.939 1.00 0.00   ? 159  ILE C CG1   1 
ATOM   6022  C  CG2   . ILE C 1 159  ? 117.778 122.023 142.314 1.00 0.00   ? 159  ILE C CG2   1 
ATOM   6023  C  CD1   . ILE C 1 159  ? 117.058 119.671 144.016 1.00 0.00   ? 159  ILE C CD1   1 
ATOM   6024  N  N     . ASN C 1 160  ? 121.273 122.655 141.939 1.00 0.00   ? 160  ASN C N     1 
ATOM   6025  C  CA    . ASN C 1 160  ? 121.886 123.952 141.666 1.00 0.00   ? 160  ASN C CA    1 
ATOM   6026  C  C     . ASN C 1 160  ? 122.638 123.932 140.347 1.00 0.00   ? 160  ASN C C     1 
ATOM   6027  O  O     . ASN C 1 160  ? 122.638 124.917 139.603 1.00 0.00   ? 160  ASN C O     1 
ATOM   6028  C  CB    . ASN C 1 160  ? 122.857 124.343 142.782 1.00 0.00   ? 160  ASN C CB    1 
ATOM   6029  C  CG    . ASN C 1 160  ? 122.154 124.690 144.071 1.00 0.00   ? 160  ASN C CG    1 
ATOM   6030  O  OD1   . ASN C 1 160  ? 121.016 125.155 144.060 1.00 0.00   ? 160  ASN C OD1   1 
ATOM   6031  N  ND2   . ASN C 1 160  ? 122.834 124.479 145.195 1.00 0.00   ? 160  ASN C ND2   1 
ATOM   6032  N  N     . ALA C 1 161  ? 123.284 122.805 140.066 1.00 0.00   ? 161  ALA C N     1 
ATOM   6033  C  CA    . ALA C 1 161  ? 124.045 122.641 138.837 1.00 0.00   ? 161  ALA C CA    1 
ATOM   6034  C  C     . ALA C 1 161  ? 123.114 122.739 137.633 1.00 0.00   ? 161  ALA C C     1 
ATOM   6035  O  O     . ALA C 1 161  ? 123.373 123.484 136.689 1.00 0.00   ? 161  ALA C O     1 
ATOM   6036  C  CB    . ALA C 1 161  ? 124.762 121.299 138.847 1.00 0.00   ? 161  ALA C CB    1 
ATOM   6037  N  N     . ILE C 1 162  ? 122.019 121.984 137.676 1.00 0.00   ? 162  ILE C N     1 
ATOM   6038  C  CA    . ILE C 1 162  ? 121.040 121.984 136.596 1.00 0.00   ? 162  ILE C CA    1 
ATOM   6039  C  C     . ILE C 1 162  ? 120.371 123.347 136.467 1.00 0.00   ? 162  ILE C C     1 
ATOM   6040  O  O     . ILE C 1 162  ? 120.174 123.852 135.360 1.00 0.00   ? 162  ILE C O     1 
ATOM   6041  C  CB    . ILE C 1 162  ? 119.953 120.931 136.845 1.00 0.00   ? 162  ILE C CB    1 
ATOM   6042  C  CG1   . ILE C 1 162  ? 120.589 119.537 136.839 1.00 0.00   ? 162  ILE C CG1   1 
ATOM   6043  C  CG2   . ILE C 1 162  ? 118.855 121.055 135.800 1.00 0.00   ? 162  ILE C CG2   1 
ATOM   6044  C  CD1   . ILE C 1 162  ? 119.602 118.415 137.043 1.00 0.00   ? 162  ILE C CD1   1 
ATOM   6045  N  N     . MET C 1 163  ? 120.014 123.932 137.609 1.00 0.00   ? 163  MET C N     1 
ATOM   6046  C  CA    . MET C 1 163  ? 119.359 125.232 137.644 1.00 0.00   ? 163  MET C CA    1 
ATOM   6047  C  C     . MET C 1 163  ? 120.235 126.298 136.996 1.00 0.00   ? 163  MET C C     1 
ATOM   6048  O  O     . MET C 1 163  ? 119.745 127.141 136.247 1.00 0.00   ? 163  MET C O     1 
ATOM   6049  C  CB    . MET C 1 163  ? 119.046 125.612 139.096 1.00 0.00   ? 163  MET C CB    1 
ATOM   6050  C  CG    . MET C 1 163  ? 118.442 127.000 139.296 1.00 0.00   ? 163  MET C CG    1 
ATOM   6051  S  SD    . MET C 1 163  ? 119.646 128.339 139.163 1.00 0.00   ? 163  MET C SD    1 
ATOM   6052  C  CE    . MET C 1 163  ? 120.445 128.238 140.764 1.00 0.00   ? 163  MET C CE    1 
ATOM   6053  N  N     . LEU C 1 164  ? 121.531 126.261 137.291 1.00 0.00   ? 164  LEU C N     1 
ATOM   6054  C  CA    . LEU C 1 164  ? 122.452 127.228 136.711 1.00 0.00   ? 164  LEU C CA    1 
ATOM   6055  C  C     . LEU C 1 164  ? 122.502 127.039 135.203 1.00 0.00   ? 164  LEU C C     1 
ATOM   6056  O  O     . LEU C 1 164  ? 122.382 128.000 134.443 1.00 0.00   ? 164  LEU C O     1 
ATOM   6057  C  CB    . LEU C 1 164  ? 123.848 127.062 137.309 1.00 0.00   ? 164  LEU C CB    1 
ATOM   6058  C  CG    . LEU C 1 164  ? 124.037 127.577 138.733 1.00 0.00   ? 164  LEU C CG    1 
ATOM   6059  C  CD1   . LEU C 1 164  ? 125.460 127.295 139.174 1.00 0.00   ? 164  LEU C CD1   1 
ATOM   6060  C  CD2   . LEU C 1 164  ? 123.749 129.074 138.794 1.00 0.00   ? 164  LEU C CD2   1 
ATOM   6061  N  N     . GLY C 1 165  ? 122.679 125.791 134.781 1.00 0.00   ? 165  GLY C N     1 
ATOM   6062  C  CA    . GLY C 1 165  ? 122.739 125.489 133.364 1.00 0.00   ? 165  GLY C CA    1 
ATOM   6063  C  C     . GLY C 1 165  ? 121.544 126.057 132.622 1.00 0.00   ? 165  GLY C C     1 
ATOM   6064  O  O     . GLY C 1 165  ? 121.690 126.651 131.556 1.00 0.00   ? 165  GLY C O     1 
ATOM   6065  N  N     . CYS C 1 166  ? 120.356 125.878 133.191 1.00 0.00   ? 166  CYS C N     1 
ATOM   6066  C  CA    . CYS C 1 166  ? 119.125 126.375 132.589 1.00 0.00   ? 166  CYS C CA    1 
ATOM   6067  C  C     . CYS C 1 166  ? 119.096 127.894 132.498 1.00 0.00   ? 166  CYS C C     1 
ATOM   6068  O  O     . CYS C 1 166  ? 118.714 128.462 131.476 1.00 0.00   ? 166  CYS C O     1 
ATOM   6069  C  CB    . CYS C 1 166  ? 117.917 125.894 133.394 1.00 0.00   ? 166  CYS C CB    1 
ATOM   6070  S  SG    . CYS C 1 166  ? 117.698 124.109 133.383 1.00 0.00   ? 166  CYS C SG    1 
ATOM   6071  N  N     . ILE C 1 167  ? 119.498 128.550 133.583 1.00 0.00   ? 167  ILE C N     1 
ATOM   6072  C  CA    . ILE C 1 167  ? 119.523 130.006 133.636 1.00 0.00   ? 167  ILE C CA    1 
ATOM   6073  C  C     . ILE C 1 167  ? 120.482 130.598 132.613 1.00 0.00   ? 167  ILE C C     1 
ATOM   6074  O  O     . ILE C 1 167  ? 120.188 131.620 131.990 1.00 0.00   ? 167  ILE C O     1 
ATOM   6075  C  CB    . ILE C 1 167  ? 119.932 130.488 135.036 1.00 0.00   ? 167  ILE C CB    1 
ATOM   6076  C  CG1   . ILE C 1 167  ? 118.834 130.126 136.039 1.00 0.00   ? 167  ILE C CG1   1 
ATOM   6077  C  CG2   . ILE C 1 167  ? 120.187 131.986 135.019 1.00 0.00   ? 167  ILE C CG2   1 
ATOM   6078  C  CD1   . ILE C 1 167  ? 117.503 130.780 135.747 1.00 0.00   ? 167  ILE C CD1   1 
ATOM   6079  N  N     . PHE C 1 168  ? 121.637 129.956 132.452 1.00 0.00   ? 168  PHE C N     1 
ATOM   6080  C  CA    . PHE C 1 168  ? 122.637 130.423 131.495 1.00 0.00   ? 168  PHE C CA    1 
ATOM   6081  C  C     . PHE C 1 168  ? 122.084 130.431 130.074 1.00 0.00   ? 168  PHE C C     1 
ATOM   6082  O  O     . PHE C 1 168  ? 122.237 131.410 129.349 1.00 0.00   ? 168  PHE C O     1 
ATOM   6083  C  CB    . PHE C 1 168  ? 123.878 129.537 131.555 1.00 0.00   ? 168  PHE C CB    1 
ATOM   6084  C  CG    . PHE C 1 168  ? 124.799 129.848 132.705 1.00 0.00   ? 168  PHE C CG    1 
ATOM   6085  C  CD1   . PHE C 1 168  ? 124.316 129.951 134.009 1.00 0.00   ? 168  PHE C CD1   1 
ATOM   6086  C  CD2   . PHE C 1 168  ? 126.166 129.987 132.491 1.00 0.00   ? 168  PHE C CD2   1 
ATOM   6087  C  CE1   . PHE C 1 168  ? 125.183 130.183 135.078 1.00 0.00   ? 168  PHE C CE1   1 
ATOM   6088  C  CE2   . PHE C 1 168  ? 127.036 130.217 133.552 1.00 0.00   ? 168  PHE C CE2   1 
ATOM   6089  C  CZ    . PHE C 1 168  ? 126.548 130.315 134.847 1.00 0.00   ? 168  PHE C CZ    1 
ATOM   6090  N  N     . MET C 1 169  ? 121.447 129.336 129.676 1.00 0.00   ? 169  MET C N     1 
ATOM   6091  C  CA    . MET C 1 169  ? 120.881 129.238 128.334 1.00 0.00   ? 169  MET C CA    1 
ATOM   6092  C  C     . MET C 1 169  ? 119.766 130.258 128.129 1.00 0.00   ? 169  MET C C     1 
ATOM   6093  O  O     . MET C 1 169  ? 119.531 130.715 127.010 1.00 0.00   ? 169  MET C O     1 
ATOM   6094  C  CB    . MET C 1 169  ? 120.340 127.829 128.075 1.00 0.00   ? 169  MET C CB    1 
ATOM   6095  C  CG    . MET C 1 169  ? 121.388 126.727 128.155 1.00 0.00   ? 169  MET C CG    1 
ATOM   6096  S  SD    . MET C 1 169  ? 120.743 125.112 127.655 1.00 0.00   ? 169  MET C SD    1 
ATOM   6097  C  CE    . MET C 1 169  ? 120.288 124.401 129.244 1.00 0.00   ? 169  MET C CE    1 
ATOM   6098  N  N     . LYS C 1 170  ? 119.071 130.607 129.208 1.00 0.00   ? 170  LYS C N     1 
ATOM   6099  C  CA    . LYS C 1 170  ? 117.990 131.583 129.109 1.00 0.00   ? 170  LYS C CA    1 
ATOM   6100  C  C     . LYS C 1 170  ? 118.572 132.970 128.876 1.00 0.00   ? 170  LYS C C     1 
ATOM   6101  O  O     . LYS C 1 170  ? 118.008 133.773 128.131 1.00 0.00   ? 170  LYS C O     1 
ATOM   6102  C  CB    . LYS C 1 170  ? 117.129 131.597 130.378 1.00 0.00   ? 170  LYS C CB    1 
ATOM   6103  C  CG    . LYS C 1 170  ? 116.225 130.383 130.541 1.00 0.00   ? 170  LYS C CG    1 
ATOM   6104  C  CD    . LYS C 1 170  ? 115.123 130.654 131.561 1.00 0.00   ? 170  LYS C CD    1 
ATOM   6105  C  CE    . LYS C 1 170  ? 114.122 131.670 131.029 1.00 0.00   ? 170  LYS C CE    1 
ATOM   6106  N  NZ    . LYS C 1 170  ? 113.474 131.199 129.776 1.00 0.00   ? 170  LYS C NZ    1 
ATOM   6107  N  N     . THR C 1 171  ? 119.703 133.246 129.519 1.00 0.00   ? 171  THR C N     1 
ATOM   6108  C  CA    . THR C 1 171  ? 120.365 134.536 129.373 1.00 0.00   ? 171  THR C CA    1 
ATOM   6109  C  C     . THR C 1 171  ? 121.002 134.628 127.992 1.00 0.00   ? 171  THR C C     1 
ATOM   6110  O  O     . THR C 1 171  ? 121.530 135.673 127.608 1.00 0.00   ? 171  THR C O     1 
ATOM   6111  C  CB    . THR C 1 171  ? 121.468 134.716 130.431 1.00 0.00   ? 171  THR C CB    1 
ATOM   6112  O  OG1   . THR C 1 171  ? 122.425 133.657 130.308 1.00 0.00   ? 171  THR C OG1   1 
ATOM   6113  C  CG2   . THR C 1 171  ? 120.874 134.691 131.828 1.00 0.00   ? 171  THR C CG2   1 
ATOM   6114  N  N     . ALA C 1 172  ? 120.951 133.529 127.252 1.00 0.00   ? 172  ALA C N     1 
ATOM   6115  C  CA    . ALA C 1 172  ? 121.529 133.480 125.919 1.00 0.00   ? 172  ALA C CA    1 
ATOM   6116  C  C     . ALA C 1 172  ? 120.440 133.511 124.855 1.00 0.00   ? 172  ALA C C     1 
ATOM   6117  O  O     . ALA C 1 172  ? 120.720 133.354 123.665 1.00 0.00   ? 172  ALA C O     1 
ATOM   6118  C  CB    . ALA C 1 172  ? 122.375 132.223 125.770 1.00 0.00   ? 172  ALA C CB    1 
ATOM   6119  N  N     . GLN C 1 173  ? 119.196 133.715 125.288 1.00 0.00   ? 173  GLN C N     1 
ATOM   6120  C  CA    . GLN C 1 173  ? 118.069 133.776 124.368 1.00 0.00   ? 173  GLN C CA    1 
ATOM   6121  C  C     . GLN C 1 173  ? 118.194 135.028 123.509 1.00 0.00   ? 173  GLN C C     1 
ATOM   6122  O  O     . GLN C 1 173  ? 117.615 136.075 123.812 1.00 0.00   ? 173  GLN C O     1 
ATOM   6123  C  CB    . GLN C 1 173  ? 116.746 133.777 125.147 1.00 0.00   ? 173  GLN C CB    1 
ATOM   6124  C  CG    . GLN C 1 173  ? 116.419 132.429 125.775 1.00 0.00   ? 173  GLN C CG    1 
ATOM   6125  C  CD    . GLN C 1 173  ? 116.403 131.320 124.745 1.00 0.00   ? 173  GLN C CD    1 
ATOM   6126  O  OE1   . GLN C 1 173  ? 115.536 131.276 123.874 1.00 0.00   ? 173  GLN C OE1   1 
ATOM   6127  N  NE2   . GLN C 1 173  ? 117.380 130.423 124.829 1.00 0.00   ? 173  GLN C NE2   1 
ATOM   6128  N  N     . ALA C 1 174  ? 118.960 134.906 122.434 1.00 0.00   ? 174  ALA C N     1 
ATOM   6129  C  CA    . ALA C 1 174  ? 119.202 136.020 121.534 1.00 0.00   ? 174  ALA C CA    1 
ATOM   6130  C  C     . ALA C 1 174  ? 118.019 136.406 120.654 1.00 0.00   ? 174  ALA C C     1 
ATOM   6131  O  O     . ALA C 1 174  ? 118.146 137.311 119.820 1.00 0.00   ? 174  ALA C O     1 
ATOM   6132  C  CB    . ALA C 1 174  ? 120.417 135.714 120.668 1.00 0.00   ? 174  ALA C CB    1 
ATOM   6133  N  N     . HIS C 1 175  ? 116.869 135.753 120.823 1.00 0.00   ? 175  HIS C N     1 
ATOM   6134  C  CA    . HIS C 1 175  ? 115.726 136.105 119.990 1.00 0.00   ? 175  HIS C CA    1 
ATOM   6135  C  C     . HIS C 1 175  ? 115.333 137.550 120.277 1.00 0.00   ? 175  HIS C C     1 
ATOM   6136  O  O     . HIS C 1 175  ? 114.676 138.197 119.464 1.00 0.00   ? 175  HIS C O     1 
ATOM   6137  C  CB    . HIS C 1 175  ? 114.526 135.187 120.251 1.00 0.00   ? 175  HIS C CB    1 
ATOM   6138  C  CG    . HIS C 1 175  ? 113.869 135.398 121.581 1.00 0.00   ? 175  HIS C CG    1 
ATOM   6139  N  ND1   . HIS C 1 175  ? 114.379 134.889 122.756 1.00 0.00   ? 175  HIS C ND1   1 
ATOM   6140  C  CD2   . HIS C 1 175  ? 112.746 136.074 121.927 1.00 0.00   ? 175  HIS C CD2   1 
ATOM   6141  C  CE1   . HIS C 1 175  ? 113.603 135.241 123.764 1.00 0.00   ? 175  HIS C CE1   1 
ATOM   6142  N  NE2   . HIS C 1 175  ? 112.606 135.964 123.290 1.00 0.00   ? 175  HIS C NE2   1 
ATOM   6143  N  N     . ARG C 1 176  ? 115.754 138.052 121.430 1.00 0.00   ? 176  ARG C N     1 
ATOM   6144  C  CA    . ARG C 1 176  ? 115.466 139.427 121.808 1.00 0.00   ? 176  ARG C CA    1 
ATOM   6145  C  C     . ARG C 1 176  ? 116.139 140.382 120.826 1.00 0.00   ? 176  ARG C C     1 
ATOM   6146  O  O     . ARG C 1 176  ? 115.684 141.515 120.638 1.00 0.00   ? 176  ARG C O     1 
ATOM   6147  C  CB    . ARG C 1 176  ? 115.958 139.698 123.226 1.00 0.00   ? 176  ARG C CB    1 
ATOM   6148  C  CG    . ARG C 1 176  ? 115.088 139.042 124.289 1.00 0.00   ? 176  ARG C CG    1 
ATOM   6149  C  CD    . ARG C 1 176  ? 113.680 139.619 124.246 1.00 0.00   ? 176  ARG C CD    1 
ATOM   6150  N  NE    . ARG C 1 176  ? 112.787 139.006 125.223 1.00 0.00   ? 176  ARG C NE    1 
ATOM   6151  C  CZ    . ARG C 1 176  ? 111.488 139.271 125.311 1.00 0.00   ? 176  ARG C CZ    1 
ATOM   6152  N  NH1   . ARG C 1 176  ? 110.929 140.143 124.477 1.00 0.00   ? 176  ARG C NH1   1 
ATOM   6153  N  NH2   . ARG C 1 176  ? 110.744 138.666 126.226 1.00 0.00   ? 176  ARG C NH2   1 
ATOM   6154  N  N     . ARG C 1 177  ? 117.222 139.920 120.206 1.00 0.00   ? 177  ARG C N     1 
ATOM   6155  C  CA    . ARG C 1 177  ? 117.943 140.720 119.224 1.00 0.00   ? 177  ARG C CA    1 
ATOM   6156  C  C     . ARG C 1 177  ? 117.199 140.641 117.900 1.00 0.00   ? 177  ARG C C     1 
ATOM   6157  O  O     . ARG C 1 177  ? 117.282 141.546 117.076 1.00 0.00   ? 177  ARG C O     1 
ATOM   6158  C  CB    . ARG C 1 177  ? 119.377 140.209 119.043 1.00 0.00   ? 177  ARG C CB    1 
ATOM   6159  C  CG    . ARG C 1 177  ? 120.385 140.803 120.023 1.00 0.00   ? 177  ARG C CG    1 
ATOM   6160  C  CD    . ARG C 1 177  ? 120.337 142.338 120.024 1.00 0.00   ? 177  ARG C CD    1 
ATOM   6161  N  NE    . ARG C 1 177  ? 120.554 142.912 118.697 1.00 0.00   ? 177  ARG C NE    1 
ATOM   6162  C  CZ    . ARG C 1 177  ? 121.741 142.997 118.098 1.00 0.00   ? 177  ARG C CZ    1 
ATOM   6163  N  NH1   . ARG C 1 177  ? 122.831 142.545 118.704 1.00 0.00   ? 177  ARG C NH1   1 
ATOM   6164  N  NH2   . ARG C 1 177  ? 121.834 143.520 116.882 1.00 0.00   ? 177  ARG C NH2   1 
ATOM   6165  N  N     . ALA C 1 178  ? 116.470 139.547 117.705 1.00 0.00   ? 178  ALA C N     1 
ATOM   6166  C  CA    . ALA C 1 178  ? 115.699 139.357 116.491 1.00 0.00   ? 178  ALA C CA    1 
ATOM   6167  C  C     . ALA C 1 178  ? 114.630 140.451 116.418 1.00 0.00   ? 178  ALA C C     1 
ATOM   6168  O  O     . ALA C 1 178  ? 114.242 140.883 115.333 1.00 0.00   ? 178  ALA C O     1 
ATOM   6169  C  CB    . ALA C 1 178  ? 115.053 137.982 116.489 1.00 0.00   ? 178  ALA C CB    1 
ATOM   6170  N  N     . GLU C 1 179  ? 114.163 140.894 117.584 1.00 0.00   ? 179  GLU C N     1 
ATOM   6171  C  CA    . GLU C 1 179  ? 113.146 141.933 117.658 1.00 0.00   ? 179  GLU C CA    1 
ATOM   6172  C  C     . GLU C 1 179  ? 113.724 143.301 117.302 1.00 0.00   ? 179  GLU C C     1 
ATOM   6173  O  O     . GLU C 1 179  ? 112.981 144.244 117.029 1.00 0.00   ? 179  GLU C O     1 
ATOM   6174  C  CB    . GLU C 1 179  ? 112.550 141.991 119.067 1.00 0.00   ? 179  GLU C CB    1 
ATOM   6175  C  CG    . GLU C 1 179  ? 112.004 140.670 119.577 1.00 0.00   ? 179  GLU C CG    1 
ATOM   6176  C  CD    . GLU C 1 179  ? 111.310 140.813 120.919 1.00 0.00   ? 179  GLU C CD    1 
ATOM   6177  O  OE1   . GLU C 1 179  ? 111.956 141.279 121.883 1.00 0.00   ? 179  GLU C OE1   1 
ATOM   6178  O  OE2   . GLU C 1 179  ? 110.114 140.456 121.017 1.00 0.00   ? 179  GLU C OE2   1 
ATOM   6179  N  N     . THR C 1 180  ? 115.048 143.412 117.309 1.00 0.00   ? 180  THR C N     1 
ATOM   6180  C  CA    . THR C 1 180  ? 115.698 144.679 116.990 1.00 0.00   ? 180  THR C CA    1 
ATOM   6181  C  C     . THR C 1 180  ? 115.907 144.837 115.488 1.00 0.00   ? 180  THR C C     1 
ATOM   6182  O  O     . THR C 1 180  ? 116.345 145.891 115.023 1.00 0.00   ? 180  THR C O     1 
ATOM   6183  C  CB    . THR C 1 180  ? 117.060 144.811 117.693 1.00 0.00   ? 180  THR C CB    1 
ATOM   6184  O  OG1   . THR C 1 180  ? 117.979 143.850 117.154 1.00 0.00   ? 180  THR C OG1   1 
ATOM   6185  C  CG2   . THR C 1 180  ? 116.914 144.574 119.187 1.00 0.00   ? 180  THR C CG2   1 
ATOM   6186  N  N     . LEU C 1 181  ? 115.597 143.790 114.730 1.00 0.00   ? 181  LEU C N     1 
ATOM   6187  C  CA    . LEU C 1 181  ? 115.759 143.825 113.280 1.00 0.00   ? 181  LEU C CA    1 
ATOM   6188  C  C     . LEU C 1 181  ? 114.506 144.375 112.613 1.00 0.00   ? 181  LEU C C     1 
ATOM   6189  O  O     . LEU C 1 181  ? 113.386 144.003 112.962 1.00 0.00   ? 181  LEU C O     1 
ATOM   6190  C  CB    . LEU C 1 181  ? 116.068 142.425 112.754 1.00 0.00   ? 181  LEU C CB    1 
ATOM   6191  C  CG    . LEU C 1 181  ? 117.380 141.862 113.313 1.00 0.00   ? 181  LEU C CG    1 
ATOM   6192  C  CD1   . LEU C 1 181  ? 117.599 140.455 112.799 1.00 0.00   ? 181  LEU C CD1   1 
ATOM   6193  C  CD2   . LEU C 1 181  ? 118.535 142.765 112.914 1.00 0.00   ? 181  LEU C CD2   1 
ATOM   6194  N  N     . ILE C 1 182  ? 114.704 145.262 111.647 1.00 0.00   ? 182  ILE C N     1 
ATOM   6195  C  CA    . ILE C 1 182  ? 113.590 145.902 110.963 1.00 0.00   ? 182  ILE C CA    1 
ATOM   6196  C  C     . ILE C 1 182  ? 113.394 145.514 109.504 1.00 0.00   ? 182  ILE C C     1 
ATOM   6197  O  O     . ILE C 1 182  ? 114.353 145.367 108.746 1.00 0.00   ? 182  ILE C O     1 
ATOM   6198  C  CB    . ILE C 1 182  ? 113.731 147.431 111.020 1.00 0.00   ? 182  ILE C CB    1 
ATOM   6199  C  CG1   . ILE C 1 182  ? 113.823 147.877 112.484 1.00 0.00   ? 182  ILE C CG1   1 
ATOM   6200  C  CG2   . ILE C 1 182  ? 112.551 148.091 110.319 1.00 0.00   ? 182  ILE C CG2   1 
ATOM   6201  C  CD1   . ILE C 1 182  ? 112.627 147.488 113.324 1.00 0.00   ? 182  ILE C CD1   1 
ATOM   6202  N  N     . PHE C 1 183  ? 112.125 145.357 109.138 1.00 0.00   ? 183  PHE C N     1 
ATOM   6203  C  CA    . PHE C 1 183  ? 111.724 145.030 107.777 1.00 0.00   ? 183  PHE C CA    1 
ATOM   6204  C  C     . PHE C 1 183  ? 110.622 146.019 107.430 1.00 0.00   ? 183  PHE C C     1 
ATOM   6205  O  O     . PHE C 1 183  ? 109.623 146.119 108.143 1.00 0.00   ? 183  PHE C O     1 
ATOM   6206  C  CB    . PHE C 1 183  ? 111.172 143.606 107.689 1.00 0.00   ? 183  PHE C CB    1 
ATOM   6207  C  CG    . PHE C 1 183  ? 112.220 142.542 107.814 1.00 0.00   ? 183  PHE C CG    1 
ATOM   6208  C  CD1   . PHE C 1 183  ? 112.577 142.038 109.062 1.00 0.00   ? 183  PHE C CD1   1 
ATOM   6209  C  CD2   . PHE C 1 183  ? 112.847 142.031 106.683 1.00 0.00   ? 183  PHE C CD2   1 
ATOM   6210  C  CE1   . PHE C 1 183  ? 113.543 141.039 109.176 1.00 0.00   ? 183  PHE C CE1   1 
ATOM   6211  C  CE2   . PHE C 1 183  ? 113.813 141.037 106.789 1.00 0.00   ? 183  PHE C CE2   1 
ATOM   6212  C  CZ    . PHE C 1 183  ? 114.163 140.537 108.035 1.00 0.00   ? 183  PHE C CZ    1 
ATOM   6213  N  N     . SER C 1 184  ? 110.748 146.664 106.280 1.00 0.00   ? 184  SER C N     1 
ATOM   6214  C  CA    . SER C 1 184  ? 109.743 147.619 105.866 1.00 0.00   ? 184  SER C CA    1 
ATOM   6215  C  C     . SER C 1 184  ? 108.433 146.874 105.756 1.00 0.00   ? 184  SER C C     1 
ATOM   6216  O  O     . SER C 1 184  ? 108.394 145.707 105.374 1.00 0.00   ? 184  SER C O     1 
ATOM   6217  C  CB    . SER C 1 184  ? 110.096 148.206 104.508 1.00 0.00   ? 184  SER C CB    1 
ATOM   6218  O  OG    . SER C 1 184  ? 109.826 147.275 103.480 1.00 0.00   ? 184  SER C OG    1 
ATOM   6219  N  N     . LYS C 1 185  ? 107.343 147.555 106.080 1.00 0.00   ? 185  LYS C N     1 
ATOM   6220  C  CA    . LYS C 1 185  ? 106.040 146.919 106.053 1.00 0.00   ? 185  LYS C CA    1 
ATOM   6221  C  C     . LYS C 1 185  ? 105.685 146.406 104.664 1.00 0.00   ? 185  LYS C C     1 
ATOM   6222  O  O     . LYS C 1 185  ? 105.141 145.317 104.535 1.00 0.00   ? 185  LYS C O     1 
ATOM   6223  C  CB    . LYS C 1 185  ? 104.969 147.889 106.545 1.00 0.00   ? 185  LYS C CB    1 
ATOM   6224  C  CG    . LYS C 1 185  ? 103.597 147.258 106.684 1.00 0.00   ? 185  LYS C CG    1 
ATOM   6225  C  CD    . LYS C 1 185  ? 102.493 148.299 106.695 1.00 0.00   ? 185  LYS C CD    1 
ATOM   6226  C  CE    . LYS C 1 185  ? 102.754 149.347 107.760 1.00 0.00   ? 185  LYS C CE    1 
ATOM   6227  N  NZ    . LYS C 1 185  ? 101.623 150.302 107.896 1.00 0.00   ? 185  LYS C NZ    1 
ATOM   6228  N  N     . HIS C 1 186  ? 106.003 147.170 103.625 1.00 0.00   ? 186  HIS C N     1 
ATOM   6229  C  CA    . HIS C 1 186  ? 105.700 146.728 102.268 1.00 0.00   ? 186  HIS C CA    1 
ATOM   6230  C  C     . HIS C 1 186  ? 106.906 146.775 101.332 1.00 0.00   ? 186  HIS C C     1 
ATOM   6231  O  O     . HIS C 1 186  ? 107.767 147.643 101.453 1.00 0.00   ? 186  HIS C O     1 
ATOM   6232  C  CB    . HIS C 1 186  ? 104.536 147.517 101.687 1.00 0.00   ? 186  HIS C CB    1 
ATOM   6233  C  CG    . HIS C 1 186  ? 104.796 148.985 101.585 1.00 0.00   ? 186  HIS C CG    1 
ATOM   6234  N  ND1   . HIS C 1 186  ? 105.567 149.533 100.586 1.00 0.00   ? 186  HIS C ND1   1 
ATOM   6235  C  CD2   . HIS C 1 186  ? 104.396 150.017 102.366 1.00 0.00   ? 186  HIS C CD2   1 
ATOM   6236  C  CE1   . HIS C 1 186  ? 105.627 150.842 100.751 1.00 0.00   ? 186  HIS C CE1   1 
ATOM   6237  N  NE2   . HIS C 1 186  ? 104.928 151.162 101.821 1.00 0.00   ? 186  HIS C NE2   1 
ATOM   6238  N  N     . ALA C 1 187  ? 106.945 145.832 100.400 1.00 0.00   ? 187  ALA C N     1 
ATOM   6239  C  CA    . ALA C 1 187  ? 108.024 145.720 99.426  1.00 0.00   ? 187  ALA C CA    1 
ATOM   6240  C  C     . ALA C 1 187  ? 107.502 146.166 98.077  1.00 0.00   ? 187  ALA C C     1 
ATOM   6241  O  O     . ALA C 1 187  ? 106.355 145.893 97.725  1.00 0.00   ? 187  ALA C O     1 
ATOM   6242  C  CB    . ALA C 1 187  ? 108.539 144.295 99.358  1.00 0.00   ? 187  ALA C CB    1 
ATOM   6243  N  N     . VAL C 1 188  ? 108.344 146.849 97.317  1.00 0.00   ? 188  VAL C N     1 
ATOM   6244  C  CA    . VAL C 1 188  ? 107.931 147.399 96.036  1.00 0.00   ? 188  VAL C CA    1 
ATOM   6245  C  C     . VAL C 1 188  ? 108.490 146.664 94.830  1.00 0.00   ? 188  VAL C C     1 
ATOM   6246  O  O     . VAL C 1 188  ? 109.447 145.893 94.932  1.00 0.00   ? 188  VAL C O     1 
ATOM   6247  C  CB    . VAL C 1 188  ? 108.308 148.898 95.912  1.00 0.00   ? 188  VAL C CB    1 
ATOM   6248  C  CG1   . VAL C 1 188  ? 107.707 149.669 97.070  1.00 0.00   ? 188  VAL C CG1   1 
ATOM   6249  C  CG2   . VAL C 1 188  ? 109.821 149.063 95.870  1.00 0.00   ? 188  VAL C CG2   1 
ATOM   6250  N  N     . ILE C 1 189  ? 107.860 146.914 93.689  1.00 0.00   ? 189  ILE C N     1 
ATOM   6251  C  CA    . ILE C 1 189  ? 108.259 146.327 92.420  1.00 0.00   ? 189  ILE C CA    1 
ATOM   6252  C  C     . ILE C 1 189  ? 108.568 147.479 91.483  1.00 0.00   ? 189  ILE C C     1 
ATOM   6253  O  O     . ILE C 1 189  ? 107.671 148.225 91.082  1.00 0.00   ? 189  ILE C O     1 
ATOM   6254  C  CB    . ILE C 1 189  ? 107.128 145.476 91.799  1.00 0.00   ? 189  ILE C CB    1 
ATOM   6255  C  CG1   . ILE C 1 189  ? 106.876 144.228 92.653  1.00 0.00   ? 189  ILE C CG1   1 
ATOM   6256  C  CG2   . ILE C 1 189  ? 107.500 145.084 90.374  1.00 0.00   ? 189  ILE C CG2   1 
ATOM   6257  C  CD1   . ILE C 1 189  ? 105.852 143.273 92.062  1.00 0.00   ? 189  ILE C CD1   1 
ATOM   6258  N  N     . THR C 1 190  ? 109.843 147.633 91.138  1.00 0.00   ? 190  THR C N     1 
ATOM   6259  C  CA    . THR C 1 190  ? 110.269 148.710 90.251  1.00 0.00   ? 190  THR C CA    1 
ATOM   6260  C  C     . THR C 1 190  ? 111.414 148.244 89.363  1.00 0.00   ? 190  THR C C     1 
ATOM   6261  O  O     . THR C 1 190  ? 112.121 147.286 89.696  1.00 0.00   ? 190  THR C O     1 
ATOM   6262  C  CB    . THR C 1 190  ? 110.728 149.930 91.073  1.00 0.00   ? 190  THR C CB    1 
ATOM   6263  O  OG1   . THR C 1 190  ? 111.185 150.960 90.191  1.00 0.00   ? 190  THR C OG1   1 
ATOM   6264  C  CG2   . THR C 1 190  ? 111.859 149.546 92.023  1.00 0.00   ? 190  THR C CG2   1 
ATOM   6265  N  N     . PRO C 1 191  ? 111.607 148.899 88.209  1.00 0.00   ? 191  PRO C N     1 
ATOM   6266  C  CA    . PRO C 1 191  ? 112.704 148.480 87.341  1.00 0.00   ? 191  PRO C CA    1 
ATOM   6267  C  C     . PRO C 1 191  ? 113.997 149.168 87.755  1.00 0.00   ? 191  PRO C C     1 
ATOM   6268  O  O     . PRO C 1 191  ? 113.989 150.335 88.148  1.00 0.00   ? 191  PRO C O     1 
ATOM   6269  C  CB    . PRO C 1 191  ? 112.233 148.930 85.969  1.00 0.00   ? 191  PRO C CB    1 
ATOM   6270  C  CG    . PRO C 1 191  ? 111.614 150.248 86.295  1.00 0.00   ? 191  PRO C CG    1 
ATOM   6271  C  CD    . PRO C 1 191  ? 110.796 149.932 87.545  1.00 0.00   ? 191  PRO C CD    1 
ATOM   6272  N  N     . ARG C 1 192  ? 115.100 148.433 87.686  1.00 0.00   ? 192  ARG C N     1 
ATOM   6273  C  CA    . ARG C 1 192  ? 116.401 148.972 88.034  1.00 0.00   ? 192  ARG C CA    1 
ATOM   6274  C  C     . ARG C 1 192  ? 117.344 148.484 86.950  1.00 0.00   ? 192  ARG C C     1 
ATOM   6275  O  O     . ARG C 1 192  ? 117.419 147.287 86.681  1.00 0.00   ? 192  ARG C O     1 
ATOM   6276  C  CB    . ARG C 1 192  ? 116.858 148.457 89.397  1.00 0.00   ? 192  ARG C CB    1 
ATOM   6277  C  CG    . ARG C 1 192  ? 118.217 148.990 89.815  1.00 0.00   ? 192  ARG C CG    1 
ATOM   6278  C  CD    . ARG C 1 192  ? 118.742 148.335 91.082  1.00 0.00   ? 192  ARG C CD    1 
ATOM   6279  N  NE    . ARG C 1 192  ? 118.287 148.988 92.307  1.00 0.00   ? 192  ARG C NE    1 
ATOM   6280  C  CZ    . ARG C 1 192  ? 118.848 148.799 93.498  1.00 0.00   ? 192  ARG C CZ    1 
ATOM   6281  N  NH1   . ARG C 1 192  ? 119.883 147.976 93.617  1.00 0.00   ? 192  ARG C NH1   1 
ATOM   6282  N  NH2   . ARG C 1 192  ? 118.385 149.432 94.567  1.00 0.00   ? 192  ARG C NH2   1 
ATOM   6283  N  N     . HIS C 1 193  ? 118.061 149.411 86.327  1.00 0.00   ? 193  HIS C N     1 
ATOM   6284  C  CA    . HIS C 1 193  ? 118.974 149.066 85.241  1.00 0.00   ? 193  HIS C CA    1 
ATOM   6285  C  C     . HIS C 1 193  ? 118.170 148.428 84.117  1.00 0.00   ? 193  HIS C C     1 
ATOM   6286  O  O     . HIS C 1 193  ? 118.658 147.547 83.410  1.00 0.00   ? 193  HIS C O     1 
ATOM   6287  C  CB    . HIS C 1 193  ? 120.053 148.105 85.736  1.00 0.00   ? 193  HIS C CB    1 
ATOM   6288  C  CG    . HIS C 1 193  ? 120.934 148.690 86.799  1.00 0.00   ? 193  HIS C CG    1 
ATOM   6289  N  ND1   . HIS C 1 193  ? 121.643 149.860 86.618  1.00 0.00   ? 193  HIS C ND1   1 
ATOM   6290  C  CD2   . HIS C 1 193  ? 121.214 148.278 88.059  1.00 0.00   ? 193  HIS C CD2   1 
ATOM   6291  C  CE1   . HIS C 1 193  ? 122.314 150.144 87.716  1.00 0.00   ? 193  HIS C CE1   1 
ATOM   6292  N  NE2   . HIS C 1 193  ? 122.070 149.200 88.612  1.00 0.00   ? 193  HIS C NE2   1 
ATOM   6293  N  N     . GLY C 1 194  ? 116.929 148.879 83.965  1.00 0.00   ? 194  GLY C N     1 
ATOM   6294  C  CA    . GLY C 1 194  ? 116.070 148.360 82.918  1.00 0.00   ? 194  GLY C CA    1 
ATOM   6295  C  C     . GLY C 1 194  ? 115.368 147.052 83.229  1.00 0.00   ? 194  GLY C C     1 
ATOM   6296  O  O     . GLY C 1 194  ? 114.489 146.633 82.480  1.00 0.00   ? 194  GLY C O     1 
ATOM   6297  N  N     . ARG C 1 195  ? 115.750 146.402 84.324  1.00 0.00   ? 195  ARG C N     1 
ATOM   6298  C  CA    . ARG C 1 195  ? 115.142 145.131 84.711  1.00 0.00   ? 195  ARG C CA    1 
ATOM   6299  C  C     . ARG C 1 195  ? 114.155 145.268 85.865  1.00 0.00   ? 195  ARG C C     1 
ATOM   6300  O  O     . ARG C 1 195  ? 114.463 145.870 86.895  1.00 0.00   ? 195  ARG C O     1 
ATOM   6301  C  CB    . ARG C 1 195  ? 116.224 144.113 85.096  1.00 0.00   ? 195  ARG C CB    1 
ATOM   6302  C  CG    . ARG C 1 195  ? 117.140 143.711 83.949  1.00 0.00   ? 195  ARG C CG    1 
ATOM   6303  C  CD    . ARG C 1 195  ? 116.341 143.125 82.792  1.00 0.00   ? 195  ARG C CD    1 
ATOM   6304  N  NE    . ARG C 1 195  ? 115.674 141.878 83.155  1.00 0.00   ? 195  ARG C NE    1 
ATOM   6305  C  CZ    . ARG C 1 195  ? 116.300 140.715 83.308  1.00 0.00   ? 195  ARG C CZ    1 
ATOM   6306  N  NH1   . ARG C 1 195  ? 117.613 140.628 83.130  1.00 0.00   ? 195  ARG C NH1   1 
ATOM   6307  N  NH2   . ARG C 1 195  ? 115.609 139.631 83.640  1.00 0.00   ? 195  ARG C NH2   1 
ATOM   6308  N  N     . LEU C 1 196  ? 112.967 144.700 85.688  1.00 0.00   ? 196  LEU C N     1 
ATOM   6309  C  CA    . LEU C 1 196  ? 111.939 144.748 86.715  1.00 0.00   ? 196  LEU C CA    1 
ATOM   6310  C  C     . LEU C 1 196  ? 112.426 143.955 87.925  1.00 0.00   ? 196  LEU C C     1 
ATOM   6311  O  O     . LEU C 1 196  ? 112.829 142.800 87.791  1.00 0.00   ? 196  LEU C O     1 
ATOM   6312  C  CB    . LEU C 1 196  ? 110.641 144.140 86.186  1.00 0.00   ? 196  LEU C CB    1 
ATOM   6313  C  CG    . LEU C 1 196  ? 109.403 144.357 87.058  1.00 0.00   ? 196  LEU C CG    1 
ATOM   6314  C  CD1   . LEU C 1 196  ? 109.082 145.844 87.121  1.00 0.00   ? 196  LEU C CD1   1 
ATOM   6315  C  CD2   . LEU C 1 196  ? 108.230 143.582 86.483  1.00 0.00   ? 196  LEU C CD2   1 
ATOM   6316  N  N     . CYS C 1 197  ? 112.392 144.571 89.101  1.00 0.00   ? 197  CYS C N     1 
ATOM   6317  C  CA    . CYS C 1 197  ? 112.855 143.904 90.314  1.00 0.00   ? 197  CYS C CA    1 
ATOM   6318  C  C     . CYS C 1 197  ? 111.953 144.085 91.530  1.00 0.00   ? 197  CYS C C     1 
ATOM   6319  O  O     . CYS C 1 197  ? 111.092 144.965 91.568  1.00 0.00   ? 197  CYS C O     1 
ATOM   6320  C  CB    . CYS C 1 197  ? 114.270 144.373 90.662  1.00 0.00   ? 197  CYS C CB    1 
ATOM   6321  S  SG    . CYS C 1 197  ? 114.428 146.152 90.967  1.00 0.00   ? 197  CYS C SG    1 
ATOM   6322  N  N     . PHE C 1 198  ? 112.169 143.224 92.525  1.00 0.00   ? 198  PHE C N     1 
ATOM   6323  C  CA    . PHE C 1 198  ? 111.426 143.230 93.783  1.00 0.00   ? 198  PHE C CA    1 
ATOM   6324  C  C     . PHE C 1 198  ? 112.333 143.863 94.844  1.00 0.00   ? 198  PHE C C     1 
ATOM   6325  O  O     . PHE C 1 198  ? 113.436 143.373 95.076  1.00 0.00   ? 198  PHE C O     1 
ATOM   6326  C  CB    . PHE C 1 198  ? 111.086 141.786 94.175  1.00 0.00   ? 198  PHE C CB    1 
ATOM   6327  C  CG    . PHE C 1 198  ? 110.309 141.662 95.463  1.00 0.00   ? 198  PHE C CG    1 
ATOM   6328  C  CD1   . PHE C 1 198  ? 108.923 141.787 95.475  1.00 0.00   ? 198  PHE C CD1   1 
ATOM   6329  C  CD2   . PHE C 1 198  ? 110.964 141.397 96.660  1.00 0.00   ? 198  PHE C CD2   1 
ATOM   6330  C  CE1   . PHE C 1 198  ? 108.202 141.649 96.662  1.00 0.00   ? 198  PHE C CE1   1 
ATOM   6331  C  CE2   . PHE C 1 198  ? 110.254 141.260 97.854  1.00 0.00   ? 198  PHE C CE2   1 
ATOM   6332  C  CZ    . PHE C 1 198  ? 108.868 141.385 97.856  1.00 0.00   ? 198  PHE C CZ    1 
ATOM   6333  N  N     . MET C 1 199  ? 111.878 144.942 95.481  1.00 0.00   ? 199  MET C N     1 
ATOM   6334  C  CA    . MET C 1 199  ? 112.689 145.599 96.505  1.00 0.00   ? 199  MET C CA    1 
ATOM   6335  C  C     . MET C 1 199  ? 112.088 145.566 97.914  1.00 0.00   ? 199  MET C C     1 
ATOM   6336  O  O     . MET C 1 199  ? 110.869 145.579 98.089  1.00 0.00   ? 199  MET C O     1 
ATOM   6337  C  CB    . MET C 1 199  ? 112.980 147.050 96.104  1.00 0.00   ? 199  MET C CB    1 
ATOM   6338  C  CG    . MET C 1 199  ? 113.920 147.189 94.909  1.00 0.00   ? 199  MET C CG    1 
ATOM   6339  S  SD    . MET C 1 199  ? 114.412 148.897 94.576  1.00 0.00   ? 199  MET C SD    1 
ATOM   6340  C  CE    . MET C 1 199  ? 115.454 148.679 93.122  1.00 0.00   ? 199  MET C CE    1 
ATOM   6341  N  N     . LEU C 1 200  ? 112.972 145.509 98.906  1.00 0.00   ? 200  LEU C N     1 
ATOM   6342  C  CA    . LEU C 1 200  ? 112.604 145.458 100.320 1.00 0.00   ? 200  LEU C CA    1 
ATOM   6343  C  C     . LEU C 1 200  ? 113.705 146.096 101.172 1.00 0.00   ? 200  LEU C C     1 
ATOM   6344  O  O     . LEU C 1 200  ? 114.887 145.861 100.938 1.00 0.00   ? 200  LEU C O     1 
ATOM   6345  C  CB    . LEU C 1 200  ? 112.400 144.000 100.746 1.00 0.00   ? 200  LEU C CB    1 
ATOM   6346  C  CG    . LEU C 1 200  ? 112.321 143.621 102.229 1.00 0.00   ? 200  LEU C CG    1 
ATOM   6347  C  CD1   . LEU C 1 200  ? 111.779 142.211 102.345 1.00 0.00   ? 200  LEU C CD1   1 
ATOM   6348  C  CD2   . LEU C 1 200  ? 113.693 143.705 102.879 1.00 0.00   ? 200  LEU C CD2   1 
ATOM   6349  N  N     . ARG C 1 201  ? 113.313 146.895 102.158 1.00 0.00   ? 201  ARG C N     1 
ATOM   6350  C  CA    . ARG C 1 201  ? 114.278 147.547 103.037 1.00 0.00   ? 201  ARG C CA    1 
ATOM   6351  C  C     . ARG C 1 201  ? 114.405 146.783 104.352 1.00 0.00   ? 201  ARG C C     1 
ATOM   6352  O  O     . ARG C 1 201  ? 113.414 146.311 104.909 1.00 0.00   ? 201  ARG C O     1 
ATOM   6353  C  CB    . ARG C 1 201  ? 113.851 148.998 103.310 1.00 0.00   ? 201  ARG C CB    1 
ATOM   6354  C  CG    . ARG C 1 201  ? 114.821 149.770 104.208 1.00 0.00   ? 201  ARG C CG    1 
ATOM   6355  C  CD    . ARG C 1 201  ? 114.282 151.140 104.621 1.00 0.00   ? 201  ARG C CD    1 
ATOM   6356  N  NE    . ARG C 1 201  ? 114.083 152.045 103.492 1.00 0.00   ? 201  ARG C NE    1 
ATOM   6357  C  CZ    . ARG C 1 201  ? 115.052 152.439 102.670 1.00 0.00   ? 201  ARG C CZ    1 
ATOM   6358  N  NH1   . ARG C 1 201  ? 116.292 152.003 102.848 1.00 0.00   ? 201  ARG C NH1   1 
ATOM   6359  N  NH2   . ARG C 1 201  ? 114.780 153.275 101.678 1.00 0.00   ? 201  ARG C NH2   1 
ATOM   6360  N  N     . VAL C 1 202  ? 115.636 146.651 104.837 1.00 0.00   ? 202  VAL C N     1 
ATOM   6361  C  CA    . VAL C 1 202  ? 115.905 145.950 106.091 1.00 0.00   ? 202  VAL C CA    1 
ATOM   6362  C  C     . VAL C 1 202  ? 116.946 146.714 106.906 1.00 0.00   ? 202  VAL C C     1 
ATOM   6363  O  O     . VAL C 1 202  ? 117.851 147.324 106.344 1.00 0.00   ? 202  VAL C O     1 
ATOM   6364  C  CB    . VAL C 1 202  ? 116.421 144.517 105.834 1.00 0.00   ? 202  VAL C CB    1 
ATOM   6365  C  CG1   . VAL C 1 202  ? 117.670 144.564 104.981 1.00 0.00   ? 202  VAL C CG1   1 
ATOM   6366  C  CG2   . VAL C 1 202  ? 116.709 143.825 107.157 1.00 0.00   ? 202  VAL C CG2   1 
ATOM   6367  N  N     . GLY C 1 203  ? 116.809 146.679 108.227 1.00 0.00   ? 203  GLY C N     1 
ATOM   6368  C  CA    . GLY C 1 203  ? 117.749 147.386 109.073 1.00 0.00   ? 203  GLY C CA    1 
ATOM   6369  C  C     . GLY C 1 203  ? 118.014 146.733 110.416 1.00 0.00   ? 203  GLY C C     1 
ATOM   6370  O  O     . GLY C 1 203  ? 117.467 145.671 110.720 1.00 0.00   ? 203  GLY C O     1 
ATOM   6371  N  N     . ASP C 1 204  ? 118.863 147.373 111.211 1.00 0.00   ? 204  ASP C N     1 
ATOM   6372  C  CA    . ASP C 1 204  ? 119.216 146.886 112.543 1.00 0.00   ? 204  ASP C CA    1 
ATOM   6373  C  C     . ASP C 1 204  ? 119.302 148.099 113.466 1.00 0.00   ? 204  ASP C C     1 
ATOM   6374  O  O     . ASP C 1 204  ? 120.055 149.036 113.197 1.00 0.00   ? 204  ASP C O     1 
ATOM   6375  C  CB    . ASP C 1 204  ? 120.571 146.175 112.507 1.00 0.00   ? 204  ASP C CB    1 
ATOM   6376  C  CG    . ASP C 1 204  ? 120.844 145.391 113.770 1.00 0.00   ? 204  ASP C CG    1 
ATOM   6377  O  OD1   . ASP C 1 204  ? 120.514 145.892 114.865 1.00 0.00   ? 204  ASP C OD1   1 
ATOM   6378  O  OD2   . ASP C 1 204  ? 121.394 144.270 113.676 1.00 0.00   ? 204  ASP C OD2   1 
ATOM   6379  N  N     . LEU C 1 205  ? 118.546 148.083 114.559 1.00 0.00   ? 205  LEU C N     1 
ATOM   6380  C  CA    . LEU C 1 205  ? 118.531 149.204 115.498 1.00 0.00   ? 205  LEU C CA    1 
ATOM   6381  C  C     . LEU C 1 205  ? 119.661 149.262 116.526 1.00 0.00   ? 205  LEU C C     1 
ATOM   6382  O  O     . LEU C 1 205  ? 119.899 150.309 117.132 1.00 0.00   ? 205  LEU C O     1 
ATOM   6383  C  CB    . LEU C 1 205  ? 117.189 149.244 116.232 1.00 0.00   ? 205  LEU C CB    1 
ATOM   6384  C  CG    . LEU C 1 205  ? 115.956 149.584 115.398 1.00 0.00   ? 205  LEU C CG    1 
ATOM   6385  C  CD1   . LEU C 1 205  ? 114.713 149.480 116.264 1.00 0.00   ? 205  LEU C CD1   1 
ATOM   6386  C  CD2   . LEU C 1 205  ? 116.095 150.982 114.818 1.00 0.00   ? 205  LEU C CD2   1 
ATOM   6387  N  N     . ARG C 1 206  ? 120.359 148.148 116.732 1.00 0.00   ? 206  ARG C N     1 
ATOM   6388  C  CA    . ARG C 1 206  ? 121.443 148.114 117.713 1.00 0.00   ? 206  ARG C CA    1 
ATOM   6389  C  C     . ARG C 1 206  ? 122.827 148.434 117.141 1.00 0.00   ? 206  ARG C C     1 
ATOM   6390  O  O     . ARG C 1 206  ? 123.112 148.161 115.972 1.00 0.00   ? 206  ARG C O     1 
ATOM   6391  C  CB    . ARG C 1 206  ? 121.484 146.740 118.398 1.00 0.00   ? 206  ARG C CB    1 
ATOM   6392  C  CG    . ARG C 1 206  ? 120.307 146.442 119.326 1.00 0.00   ? 206  ARG C CG    1 
ATOM   6393  C  CD    . ARG C 1 206  ? 120.310 147.341 120.559 1.00 0.00   ? 206  ARG C CD    1 
ATOM   6394  N  NE    . ARG C 1 206  ? 119.699 148.639 120.298 1.00 0.00   ? 206  ARG C NE    1 
ATOM   6395  C  CZ    . ARG C 1 206  ? 118.387 148.854 120.258 1.00 0.00   ? 206  ARG C CZ    1 
ATOM   6396  N  NH1   . ARG C 1 206  ? 117.538 147.855 120.471 1.00 0.00   ? 206  ARG C NH1   1 
ATOM   6397  N  NH2   . ARG C 1 206  ? 117.918 150.067 119.999 1.00 0.00   ? 206  ARG C NH2   1 
ATOM   6398  N  N     . LYS C 1 207  ? 123.683 149.015 117.981 1.00 0.00   ? 207  LYS C N     1 
ATOM   6399  C  CA    . LYS C 1 207  ? 125.047 149.370 117.600 1.00 0.00   ? 207  LYS C CA    1 
ATOM   6400  C  C     . LYS C 1 207  ? 125.829 148.095 117.297 1.00 0.00   ? 207  LYS C C     1 
ATOM   6401  O  O     . LYS C 1 207  ? 126.639 148.058 116.371 1.00 0.00   ? 207  LYS C O     1 
ATOM   6402  C  CB    . LYS C 1 207  ? 125.731 150.142 118.737 1.00 0.00   ? 207  LYS C CB    1 
ATOM   6403  C  CG    . LYS C 1 207  ? 127.189 150.531 118.477 1.00 0.00   ? 207  LYS C CG    1 
ATOM   6404  C  CD    . LYS C 1 207  ? 127.782 151.275 119.675 1.00 0.00   ? 207  LYS C CD    1 
ATOM   6405  C  CE    . LYS C 1 207  ? 129.230 151.699 119.443 1.00 0.00   ? 207  LYS C CE    1 
ATOM   6406  N  NZ    . LYS C 1 207  ? 129.773 152.451 120.617 1.00 0.00   ? 207  LYS C NZ    1 
ATOM   6407  N  N     . SER C 1 208  ? 125.580 147.055 118.088 1.00 0.00   ? 208  SER C N     1 
ATOM   6408  C  CA    . SER C 1 208  ? 126.250 145.769 117.907 1.00 0.00   ? 208  SER C CA    1 
ATOM   6409  C  C     . SER C 1 208  ? 125.856 145.145 116.568 1.00 0.00   ? 208  SER C C     1 
ATOM   6410  O  O     . SER C 1 208  ? 124.736 145.328 116.092 1.00 0.00   ? 208  SER C O     1 
ATOM   6411  C  CB    . SER C 1 208  ? 125.886 144.814 119.049 1.00 0.00   ? 208  SER C CB    1 
ATOM   6412  O  OG    . SER C 1 208  ? 124.497 144.505 119.045 1.00 0.00   ? 208  SER C OG    1 
ATOM   6413  N  N     . MET C 1 209  ? 126.784 144.407 115.967 1.00 0.00   ? 209  MET C N     1 
ATOM   6414  C  CA    . MET C 1 209  ? 126.553 143.775 114.674 1.00 0.00   ? 209  MET C CA    1 
ATOM   6415  C  C     . MET C 1 209  ? 126.089 142.324 114.748 1.00 0.00   ? 209  MET C C     1 
ATOM   6416  O  O     . MET C 1 209  ? 126.152 141.685 115.802 1.00 0.00   ? 209  MET C O     1 
ATOM   6417  C  CB    . MET C 1 209  ? 127.832 143.824 113.832 1.00 0.00   ? 209  MET C CB    1 
ATOM   6418  C  CG    . MET C 1 209  ? 128.333 145.219 113.515 1.00 0.00   ? 209  MET C CG    1 
ATOM   6419  S  SD    . MET C 1 209  ? 127.201 146.127 112.454 1.00 0.00   ? 209  MET C SD    1 
ATOM   6420  C  CE    . MET C 1 209  ? 127.420 145.237 110.898 1.00 0.00   ? 209  MET C CE    1 
ATOM   6421  N  N     . ILE C 1 210  ? 125.622 141.834 113.605 1.00 0.00   ? 210  ILE C N     1 
ATOM   6422  C  CA    . ILE C 1 210  ? 125.170 140.457 113.443 1.00 0.00   ? 210  ILE C CA    1 
ATOM   6423  C  C     . ILE C 1 210  ? 126.132 139.888 112.403 1.00 0.00   ? 210  ILE C C     1 
ATOM   6424  O  O     . ILE C 1 210  ? 126.087 140.268 111.233 1.00 0.00   ? 210  ILE C O     1 
ATOM   6425  C  CB    . ILE C 1 210  ? 123.741 140.384 112.883 1.00 0.00   ? 210  ILE C CB    1 
ATOM   6426  C  CG1   . ILE C 1 210  ? 122.734 140.949 113.901 1.00 0.00   ? 210  ILE C CG1   1 
ATOM   6427  C  CG2   . ILE C 1 210  ? 123.400 138.945 112.538 1.00 0.00   ? 210  ILE C CG2   1 
ATOM   6428  C  CD1   . ILE C 1 210  ? 121.282 140.843 113.463 1.00 0.00   ? 210  ILE C CD1   1 
ATOM   6429  N  N     . ILE C 1 211  ? 127.012 138.991 112.834 1.00 0.00   ? 211  ILE C N     1 
ATOM   6430  C  CA    . ILE C 1 211  ? 128.009 138.409 111.937 1.00 0.00   ? 211  ILE C CA    1 
ATOM   6431  C  C     . ILE C 1 211  ? 127.473 137.331 111.004 1.00 0.00   ? 211  ILE C C     1 
ATOM   6432  O  O     . ILE C 1 211  ? 126.597 136.548 111.374 1.00 0.00   ? 211  ILE C O     1 
ATOM   6433  C  CB    . ILE C 1 211  ? 129.194 137.822 112.734 1.00 0.00   ? 211  ILE C CB    1 
ATOM   6434  C  CG1   . ILE C 1 211  ? 129.752 138.891 113.681 1.00 0.00   ? 211  ILE C CG1   1 
ATOM   6435  C  CG2   . ILE C 1 211  ? 130.270 137.340 111.772 1.00 0.00   ? 211  ILE C CG2   1 
ATOM   6436  C  CD1   . ILE C 1 211  ? 130.817 138.385 114.650 1.00 0.00   ? 211  ILE C CD1   1 
ATOM   6437  N  N     . SER C 1 212  ? 128.027 137.299 109.797 1.00 0.00   ? 212  SER C N     1 
ATOM   6438  C  CA    . SER C 1 212  ? 127.627 136.337 108.780 1.00 0.00   ? 212  SER C CA    1 
ATOM   6439  C  C     . SER C 1 212  ? 126.132 136.475 108.523 1.00 0.00   ? 212  SER C C     1 
ATOM   6440  O  O     . SER C 1 212  ? 125.432 135.483 108.318 1.00 0.00   ? 212  SER C O     1 
ATOM   6441  C  CB    . SER C 1 212  ? 127.949 134.910 109.232 1.00 0.00   ? 212  SER C CB    1 
ATOM   6442  O  OG    . SER C 1 212  ? 129.342 134.738 109.432 1.00 0.00   ? 212  SER C OG    1 
ATOM   6443  N  N     . ALA C 1 213  ? 125.652 137.712 108.531 1.00 0.00   ? 213  ALA C N     1 
ATOM   6444  C  CA    . ALA C 1 213  ? 124.241 137.979 108.287 1.00 0.00   ? 213  ALA C CA    1 
ATOM   6445  C  C     . ALA C 1 213  ? 123.890 137.441 106.906 1.00 0.00   ? 213  ALA C C     1 
ATOM   6446  O  O     . ALA C 1 213  ? 124.445 137.880 105.900 1.00 0.00   ? 213  ALA C O     1 
ATOM   6447  C  CB    . ALA C 1 213  ? 123.966 139.476 108.347 1.00 0.00   ? 213  ALA C CB    1 
ATOM   6448  N  N     . THR C 1 214  ? 122.982 136.473 106.868 1.00 0.00   ? 214  THR C N     1 
ATOM   6449  C  CA    . THR C 1 214  ? 122.572 135.870 105.615 1.00 0.00   ? 214  THR C CA    1 
ATOM   6450  C  C     . THR C 1 214  ? 121.087 136.048 105.377 1.00 0.00   ? 214  THR C C     1 
ATOM   6451  O  O     . THR C 1 214  ? 120.276 135.886 106.289 1.00 0.00   ? 214  THR C O     1 
ATOM   6452  C  CB    . THR C 1 214  ? 122.899 134.364 105.593 1.00 0.00   ? 214  THR C CB    1 
ATOM   6453  O  OG1   . THR C 1 214  ? 124.292 134.174 105.862 1.00 0.00   ? 214  THR C OG1   1 
ATOM   6454  C  CG2   . THR C 1 214  ? 122.573 133.768 104.231 1.00 0.00   ? 214  THR C CG2   1 
ATOM   6455  N  N     . ILE C 1 215  ? 120.733 136.383 104.140 1.00 0.00   ? 215  ILE C N     1 
ATOM   6456  C  CA    . ILE C 1 215  ? 119.341 136.586 103.782 1.00 0.00   ? 215  ILE C CA    1 
ATOM   6457  C  C     . ILE C 1 215  ? 118.843 135.544 102.798 1.00 0.00   ? 215  ILE C C     1 
ATOM   6458  O  O     . ILE C 1 215  ? 119.472 135.281 101.772 1.00 0.00   ? 215  ILE C O     1 
ATOM   6459  C  CB    . ILE C 1 215  ? 119.120 137.980 103.163 1.00 0.00   ? 215  ILE C CB    1 
ATOM   6460  C  CG1   . ILE C 1 215  ? 119.400 139.071 104.210 1.00 0.00   ? 215  ILE C CG1   1 
ATOM   6461  C  CG2   . ILE C 1 215  ? 117.695 138.092 102.633 1.00 0.00   ? 215  ILE C CG2   1 
ATOM   6462  C  CD1   . ILE C 1 215  ? 119.111 140.481 103.731 1.00 0.00   ? 215  ILE C CD1   1 
ATOM   6463  N  N     . HIS C 1 216  ? 117.701 134.956 103.127 1.00 0.00   ? 216  HIS C N     1 
ATOM   6464  C  CA    . HIS C 1 216  ? 117.061 133.953 102.285 1.00 0.00   ? 216  HIS C CA    1 
ATOM   6465  C  C     . HIS C 1 216  ? 115.662 134.469 101.977 1.00 0.00   ? 216  HIS C C     1 
ATOM   6466  O  O     . HIS C 1 216  ? 115.020 135.091 102.830 1.00 0.00   ? 216  HIS C O     1 
ATOM   6467  C  CB    . HIS C 1 216  ? 116.968 132.619 103.019 1.00 0.00   ? 216  HIS C CB    1 
ATOM   6468  C  CG    . HIS C 1 216  ? 118.294 131.974 103.283 1.00 0.00   ? 216  HIS C CG    1 
ATOM   6469  N  ND1   . HIS C 1 216  ? 119.130 131.545 102.272 1.00 0.00   ? 216  HIS C ND1   1 
ATOM   6470  C  CD2   . HIS C 1 216  ? 118.927 131.668 104.443 1.00 0.00   ? 216  HIS C CD2   1 
ATOM   6471  C  CE1   . HIS C 1 216  ? 120.215 131.003 102.795 1.00 0.00   ? 216  HIS C CE1   1 
ATOM   6472  N  NE2   . HIS C 1 216  ? 120.117 131.063 104.110 1.00 0.00   ? 216  HIS C NE2   1 
ATOM   6473  N  N     . MET C 1 217  ? 115.190 134.230 100.762 1.00 0.00   ? 217  MET C N     1 
ATOM   6474  C  CA    . MET C 1 217  ? 113.868 134.693 100.370 1.00 0.00   ? 217  MET C CA    1 
ATOM   6475  C  C     . MET C 1 217  ? 113.108 133.575 99.676  1.00 0.00   ? 217  MET C C     1 
ATOM   6476  O  O     . MET C 1 217  ? 113.574 133.015 98.683  1.00 0.00   ? 217  MET C O     1 
ATOM   6477  C  CB    . MET C 1 217  ? 113.990 135.905 99.439  1.00 0.00   ? 217  MET C CB    1 
ATOM   6478  C  CG    . MET C 1 217  ? 112.684 136.629 99.182  1.00 0.00   ? 217  MET C CG    1 
ATOM   6479  S  SD    . MET C 1 217  ? 112.899 138.137 98.208  1.00 0.00   ? 217  MET C SD    1 
ATOM   6480  C  CE    . MET C 1 217  ? 113.529 139.271 99.455  1.00 0.00   ? 217  MET C CE    1 
ATOM   6481  N  N     . GLN C 1 218  ? 111.934 133.244 100.209 1.00 0.00   ? 218  GLN C N     1 
ATOM   6482  C  CA    . GLN C 1 218  ? 111.119 132.185 99.630  1.00 0.00   ? 218  GLN C CA    1 
ATOM   6483  C  C     . GLN C 1 218  ? 109.724 132.669 99.269  1.00 0.00   ? 218  GLN C C     1 
ATOM   6484  O  O     . GLN C 1 218  ? 109.165 133.549 99.931  1.00 0.00   ? 218  GLN C O     1 
ATOM   6485  C  CB    . GLN C 1 218  ? 111.005 131.007 100.601 1.00 0.00   ? 218  GLN C CB    1 
ATOM   6486  C  CG    . GLN C 1 218  ? 112.338 130.392 101.001 1.00 0.00   ? 218  GLN C CG    1 
ATOM   6487  C  CD    . GLN C 1 218  ? 112.182 129.174 101.897 1.00 0.00   ? 218  GLN C CD    1 
ATOM   6488  O  OE1   . GLN C 1 218  ? 113.169 128.594 102.352 1.00 0.00   ? 218  GLN C OE1   1 
ATOM   6489  N  NE2   . GLN C 1 218  ? 110.938 128.782 102.153 1.00 0.00   ? 218  GLN C NE2   1 
ATOM   6490  N  N     . VAL C 1 219  ? 109.173 132.097 98.209  1.00 0.00   ? 219  VAL C N     1 
ATOM   6491  C  CA    . VAL C 1 219  ? 107.836 132.450 97.753  1.00 0.00   ? 219  VAL C CA    1 
ATOM   6492  C  C     . VAL C 1 219  ? 106.872 131.308 98.057  1.00 0.00   ? 219  VAL C C     1 
ATOM   6493  O  O     . VAL C 1 219  ? 107.040 130.190 97.560  1.00 0.00   ? 219  VAL C O     1 
ATOM   6494  C  CB    . VAL C 1 219  ? 107.815 132.735 96.231  1.00 0.00   ? 219  VAL C CB    1 
ATOM   6495  C  CG1   . VAL C 1 219  ? 106.399 133.074 95.784  1.00 0.00   ? 219  VAL C CG1   1 
ATOM   6496  C  CG2   . VAL C 1 219  ? 108.748 133.885 95.897  1.00 0.00   ? 219  VAL C CG2   1 
ATOM   6497  N  N     . VAL C 1 220  ? 105.878 131.587 98.891  1.00 0.00   ? 220  VAL C N     1 
ATOM   6498  C  CA    . VAL C 1 220  ? 104.879 130.586 99.237  1.00 0.00   ? 220  VAL C CA    1 
ATOM   6499  C  C     . VAL C 1 220  ? 103.742 130.736 98.243  1.00 0.00   ? 220  VAL C C     1 
ATOM   6500  O  O     . VAL C 1 220  ? 103.132 131.801 98.135  1.00 0.00   ? 220  VAL C O     1 
ATOM   6501  C  CB    . VAL C 1 220  ? 104.330 130.791 100.657 1.00 0.00   ? 220  VAL C CB    1 
ATOM   6502  C  CG1   . VAL C 1 220  ? 103.277 129.737 100.958 1.00 0.00   ? 220  VAL C CG1   1 
ATOM   6503  C  CG2   . VAL C 1 220  ? 105.457 130.709 101.667 1.00 0.00   ? 220  VAL C CG2   1 
ATOM   6504  N  N     . ARG C 1 221  ? 103.462 129.662 97.512  1.00 0.00   ? 221  ARG C N     1 
ATOM   6505  C  CA    . ARG C 1 221  ? 102.415 129.679 96.503  1.00 0.00   ? 221  ARG C CA    1 
ATOM   6506  C  C     . ARG C 1 221  ? 101.773 128.314 96.301  1.00 0.00   ? 221  ARG C C     1 
ATOM   6507  O  O     . ARG C 1 221  ? 102.475 127.327 96.078  1.00 0.00   ? 221  ARG C O     1 
ATOM   6508  C  CB    . ARG C 1 221  ? 103.008 130.139 95.170  1.00 0.00   ? 221  ARG C CB    1 
ATOM   6509  C  CG    . ARG C 1 221  ? 102.142 129.845 93.952  1.00 0.00   ? 221  ARG C CG    1 
ATOM   6510  C  CD    . ARG C 1 221  ? 102.982 129.766 92.690  1.00 0.00   ? 221  ARG C CD    1 
ATOM   6511  N  NE    . ARG C 1 221  ? 103.702 131.012 92.435  1.00 0.00   ? 221  ARG C NE    1 
ATOM   6512  C  CZ    . ARG C 1 221  ? 103.136 132.125 91.983  1.00 0.00   ? 221  ARG C CZ    1 
ATOM   6513  N  NH1   . ARG C 1 221  ? 101.833 132.159 91.731  1.00 0.00   ? 221  ARG C NH1   1 
ATOM   6514  N  NH2   . ARG C 1 221  ? 103.872 133.211 91.786  1.00 0.00   ? 221  ARG C NH2   1 
ATOM   6515  N  N     . LYS C 1 222  ? 100.446 128.244 96.392  1.00 0.00   ? 222  LYS C N     1 
ATOM   6516  C  CA    . LYS C 1 222  ? 99.784  126.972 96.146  1.00 0.00   ? 222  LYS C CA    1 
ATOM   6517  C  C     . LYS C 1 222  ? 100.002 126.767 94.656  1.00 0.00   ? 222  LYS C C     1 
ATOM   6518  O  O     . LYS C 1 222  ? 99.557  127.576 93.844  1.00 0.00   ? 222  LYS C O     1 
ATOM   6519  C  CB    . LYS C 1 222  ? 98.280  127.026 96.439  1.00 0.00   ? 222  LYS C CB    1 
ATOM   6520  C  CG    . LYS C 1 222  ? 97.572  125.712 96.080  1.00 0.00   ? 222  LYS C CG    1 
ATOM   6521  C  CD    . LYS C 1 222  ? 96.085  125.701 96.404  1.00 0.00   ? 222  LYS C CD    1 
ATOM   6522  C  CE    . LYS C 1 222  ? 95.485  124.337 96.063  1.00 0.00   ? 222  LYS C CE    1 
ATOM   6523  N  NZ    . LYS C 1 222  ? 94.046  124.213 96.438  1.00 0.00   ? 222  LYS C NZ    1 
ATOM   6524  N  N     . THR C 1 223  ? 100.761 125.738 94.312  1.00 0.00   ? 223  THR C N     1 
ATOM   6525  C  CA    . THR C 1 223  ? 101.104 125.497 92.922  1.00 0.00   ? 223  THR C CA    1 
ATOM   6526  C  C     . THR C 1 223  ? 100.732 124.127 92.402  1.00 0.00   ? 223  THR C C     1 
ATOM   6527  O  O     . THR C 1 223  ? 100.660 123.152 93.150  1.00 0.00   ? 223  THR C O     1 
ATOM   6528  C  CB    . THR C 1 223  ? 102.617 125.689 92.701  1.00 0.00   ? 223  THR C CB    1 
ATOM   6529  O  OG1   . THR C 1 223  ? 102.986 127.037 93.021  1.00 0.00   ? 223  THR C OG1   1 
ATOM   6530  C  CG2   . THR C 1 223  ? 102.977 125.415 91.253  1.00 0.00   ? 223  THR C CG2   1 
ATOM   6531  N  N     . THR C 1 224  ? 100.497 124.074 91.097  1.00 0.00   ? 224  THR C N     1 
ATOM   6532  C  CA    . THR C 1 224  ? 100.150 122.836 90.429  1.00 0.00   ? 224  THR C CA    1 
ATOM   6533  C  C     . THR C 1 224  ? 101.111 122.563 89.283  1.00 0.00   ? 224  THR C C     1 
ATOM   6534  O  O     . THR C 1 224  ? 101.385 123.444 88.471  1.00 0.00   ? 224  THR C O     1 
ATOM   6535  C  CB    . THR C 1 224  ? 98.728  122.888 89.851  1.00 0.00   ? 224  THR C CB    1 
ATOM   6536  O  OG1   . THR C 1 224  ? 98.729  123.660 88.646  1.00 0.00   ? 224  THR C OG1   1 
ATOM   6537  C  CG2   . THR C 1 224  ? 97.771  123.514 90.847  1.00 0.00   ? 224  THR C CG2   1 
ATOM   6538  N  N     . SER C 1 225  ? 101.617 121.337 89.218  1.00 0.00   ? 225  SER C N     1 
ATOM   6539  C  CA    . SER C 1 225  ? 102.512 120.928 88.134  1.00 0.00   ? 225  SER C CA    1 
ATOM   6540  C  C     . SER C 1 225  ? 101.699 120.460 86.925  1.00 0.00   ? 225  SER C C     1 
ATOM   6541  O  O     . SER C 1 225  ? 100.459 120.437 86.967  1.00 0.00   ? 225  SER C O     1 
ATOM   6542  C  CB    . SER C 1 225  ? 103.400 119.783 88.601  1.00 0.00   ? 225  SER C CB    1 
ATOM   6543  O  OG    . SER C 1 225  ? 102.614 118.643 88.901  1.00 0.00   ? 225  SER C OG    1 
ATOM   6544  N  N     . PRO C 1 226  ? 102.372 120.056 85.844  1.00 0.00   ? 226  PRO C N     1 
ATOM   6545  C  CA    . PRO C 1 226  ? 101.599 119.591 84.690  1.00 0.00   ? 226  PRO C CA    1 
ATOM   6546  C  C     . PRO C 1 226  ? 101.096 118.169 84.897  1.00 0.00   ? 226  PRO C C     1 
ATOM   6547  O  O     . PRO C 1 226  ? 100.165 117.721 84.223  1.00 0.00   ? 226  PRO C O     1 
ATOM   6548  C  CB    . PRO C 1 226  ? 102.602 119.688 83.542  1.00 0.00   ? 226  PRO C CB    1 
ATOM   6549  C  CG    . PRO C 1 226  ? 103.474 120.837 83.955  1.00 0.00   ? 226  PRO C CG    1 
ATOM   6550  C  CD    . PRO C 1 226  ? 103.695 120.548 85.423  1.00 0.00   ? 226  PRO C CD    1 
ATOM   6551  N  N     . GLU C 1 227  ? 101.761 117.426 85.779  1.00 0.00   ? 227  GLU C N     1 
ATOM   6552  C  CA    . GLU C 1 227  ? 101.343 116.064 86.080  1.00 0.00   ? 227  GLU C CA    1 
ATOM   6553  C  C     . GLU C 1 227  ? 100.075 116.017 86.933  1.00 0.00   ? 227  GLU C C     1 
ATOM   6554  O  O     . GLU C 1 227  ? 99.638  114.946 87.348  1.00 0.00   ? 227  GLU C O     1 
ATOM   6555  C  CB    . GLU C 1 227  ? 102.470 115.309 86.784  1.00 0.00   ? 227  GLU C CB    1 
ATOM   6556  C  CG    . GLU C 1 227  ? 103.712 115.094 85.938  1.00 0.00   ? 227  GLU C CG    1 
ATOM   6557  C  CD    . GLU C 1 227  ? 103.431 114.340 84.657  1.00 0.00   ? 227  GLU C CD    1 
ATOM   6558  O  OE1   . GLU C 1 227  ? 102.627 113.384 84.692  1.00 0.00   ? 227  GLU C OE1   1 
ATOM   6559  O  OE2   . GLU C 1 227  ? 104.013 114.705 83.615  1.00 0.00   ? 227  GLU C OE2   1 
ATOM   6560  N  N     . GLY C 1 228  ? 99.492  117.184 87.197  1.00 0.00   ? 228  GLY C N     1 
ATOM   6561  C  CA    . GLY C 1 228  ? 98.289  117.292 88.001  1.00 0.00   ? 228  GLY C CA    1 
ATOM   6562  C  C     . GLY C 1 228  ? 98.548  117.320 89.498  1.00 0.00   ? 228  GLY C C     1 
ATOM   6563  O  O     . GLY C 1 228  ? 97.610  117.333 90.291  1.00 0.00   ? 228  GLY C O     1 
ATOM   6564  N  N     . GLU C 1 229  ? 99.816  117.326 89.890  1.00 0.00   ? 229  GLU C N     1 
ATOM   6565  C  CA    . GLU C 1 229  ? 100.165 117.356 91.298  1.00 0.00   ? 229  GLU C CA    1 
ATOM   6566  C  C     . GLU C 1 229  ? 99.846  118.711 91.900  1.00 0.00   ? 229  GLU C C     1 
ATOM   6567  O  O     . GLU C 1 229  ? 100.109 119.741 91.290  1.00 0.00   ? 229  GLU C O     1 
ATOM   6568  C  CB    . GLU C 1 229  ? 101.636 117.014 91.499  1.00 0.00   ? 229  GLU C CB    1 
ATOM   6569  C  CG    . GLU C 1 229  ? 101.888 116.246 92.781  1.00 0.00   ? 229  GLU C CG    1 
ATOM   6570  C  CD    . GLU C 1 229  ? 100.923 115.087 92.946  1.00 0.00   ? 229  GLU C CD    1 
ATOM   6571  O  OE1   . GLU C 1 229  ? 100.238 114.740 91.962  1.00 0.00   ? 229  GLU C OE1   1 
ATOM   6572  O  OE2   . GLU C 1 229  ? 100.856 114.518 94.054  1.00 0.00   ? 229  GLU C OE2   1 
ATOM   6573  N  N     . VAL C 1 230  ? 99.298  118.702 93.109  1.00 0.00   ? 230  VAL C N     1 
ATOM   6574  C  CA    . VAL C 1 230  ? 98.930  119.936 93.786  1.00 0.00   ? 230  VAL C CA    1 
ATOM   6575  C  C     . VAL C 1 230  ? 99.669  120.096 95.104  1.00 0.00   ? 230  VAL C C     1 
ATOM   6576  O  O     . VAL C 1 230  ? 99.713  119.174 95.913  1.00 0.00   ? 230  VAL C O     1 
ATOM   6577  C  CB    . VAL C 1 230  ? 97.419  119.982 94.070  1.00 0.00   ? 230  VAL C CB    1 
ATOM   6578  C  CG1   . VAL C 1 230  ? 97.049  121.264 94.795  1.00 0.00   ? 230  VAL C CG1   1 
ATOM   6579  C  CG2   . VAL C 1 230  ? 96.634  119.855 92.778  1.00 0.00   ? 230  VAL C CG2   1 
ATOM   6580  N  N     . VAL C 1 231  ? 100.256 121.266 95.311  1.00 0.00   ? 231  VAL C N     1 
ATOM   6581  C  CA    . VAL C 1 231  ? 100.970 121.568 96.544  1.00 0.00   ? 231  VAL C CA    1 
ATOM   6582  C  C     . VAL C 1 231  ? 100.305 122.783 97.163  1.00 0.00   ? 231  VAL C C     1 
ATOM   6583  O  O     . VAL C 1 231  ? 100.123 123.795 96.497  1.00 0.00   ? 231  VAL C O     1 
ATOM   6584  C  CB    . VAL C 1 231  ? 102.449 121.873 96.285  1.00 0.00   ? 231  VAL C CB    1 
ATOM   6585  C  CG1   . VAL C 1 231  ? 103.040 122.631 97.461  1.00 0.00   ? 231  VAL C CG1   1 
ATOM   6586  C  CG2   . VAL C 1 231  ? 103.213 120.587 96.022  1.00 0.00   ? 231  VAL C CG2   1 
ATOM   6587  N  N     . PRO C 1 232  ? 99.940  122.678 98.433  1.00 0.00   ? 232  PRO C N     1 
ATOM   6588  C  CA    . PRO C 1 232  ? 99.253  123.764 99.139  1.00 0.00   ? 232  PRO C CA    1 
ATOM   6589  C  C     . PRO C 1 232  ? 100.159 124.927 99.541  1.00 0.00   ? 232  PRO C C     1 
ATOM   6590  O  O     . PRO C 1 232  ? 99.730  126.076 99.555  1.00 0.00   ? 232  PRO C O     1 
ATOM   6591  C  CB    . PRO C 1 232  ? 98.645  123.057 100.344 1.00 0.00   ? 232  PRO C CB    1 
ATOM   6592  C  CG    . PRO C 1 232  ? 99.643  121.972 100.617 1.00 0.00   ? 232  PRO C CG    1 
ATOM   6593  C  CD    . PRO C 1 232  ? 99.916  121.441 99.234  1.00 0.00   ? 232  PRO C CD    1 
ATOM   6594  N  N     . LEU C 1 233  ? 101.409 124.618 99.873  1.00 0.00   ? 233  LEU C N     1 
ATOM   6595  C  CA    . LEU C 1 233  ? 102.375 125.638 100.273 1.00 0.00   ? 233  LEU C CA    1 
ATOM   6596  C  C     . LEU C 1 233  ? 103.735 125.354 99.657  1.00 0.00   ? 233  LEU C C     1 
ATOM   6597  O  O     . LEU C 1 233  ? 104.675 124.985 100.368 1.00 0.00   ? 233  LEU C O     1 
ATOM   6598  C  CB    . LEU C 1 233  ? 102.528 125.666 101.797 1.00 0.00   ? 233  LEU C CB    1 
ATOM   6599  C  CG    . LEU C 1 233  ? 101.324 126.027 102.666 1.00 0.00   ? 233  LEU C CG    1 
ATOM   6600  C  CD1   . LEU C 1 233  ? 101.671 125.781 104.125 1.00 0.00   ? 233  LEU C CD1   1 
ATOM   6601  C  CD2   . LEU C 1 233  ? 100.939 127.480 102.443 1.00 0.00   ? 233  LEU C CD2   1 
ATOM   6602  N  N     . HIS C 1 234  ? 103.854 125.512 98.342  1.00 0.00   ? 234  HIS C N     1 
ATOM   6603  C  CA    . HIS C 1 234  ? 105.131 125.262 97.687  1.00 0.00   ? 234  HIS C CA    1 
ATOM   6604  C  C     . HIS C 1 234  ? 106.057 126.442 97.950  1.00 0.00   ? 234  HIS C C     1 
ATOM   6605  O  O     . HIS C 1 234  ? 105.667 127.601 97.796  1.00 0.00   ? 234  HIS C O     1 
ATOM   6606  C  CB    . HIS C 1 234  ? 104.943 125.061 96.179  1.00 0.00   ? 234  HIS C CB    1 
ATOM   6607  C  CG    . HIS C 1 234  ? 106.174 124.572 95.479  1.00 0.00   ? 234  HIS C CG    1 
ATOM   6608  N  ND1   . HIS C 1 234  ? 107.311 125.338 95.347  1.00 0.00   ? 234  HIS C ND1   1 
ATOM   6609  C  CD2   . HIS C 1 234  ? 106.450 123.384 94.890  1.00 0.00   ? 234  HIS C CD2   1 
ATOM   6610  C  CE1   . HIS C 1 234  ? 108.235 124.643 94.709  1.00 0.00   ? 234  HIS C CE1   1 
ATOM   6611  N  NE2   . HIS C 1 234  ? 107.739 123.453 94.422  1.00 0.00   ? 234  HIS C NE2   1 
ATOM   6612  N  N     . GLN C 1 235  ? 107.282 126.143 98.361  1.00 0.00   ? 235  GLN C N     1 
ATOM   6613  C  CA    . GLN C 1 235  ? 108.253 127.185 98.652  1.00 0.00   ? 235  GLN C CA    1 
ATOM   6614  C  C     . GLN C 1 235  ? 109.299 127.258 97.554  1.00 0.00   ? 235  GLN C C     1 
ATOM   6615  O  O     . GLN C 1 235  ? 109.960 126.263 97.239  1.00 0.00   ? 235  GLN C O     1 
ATOM   6616  C  CB    . GLN C 1 235  ? 108.922 126.925 100.006 1.00 0.00   ? 235  GLN C CB    1 
ATOM   6617  C  CG    . GLN C 1 235  ? 107.929 126.629 101.121 1.00 0.00   ? 235  GLN C CG    1 
ATOM   6618  C  CD    . GLN C 1 235  ? 108.583 126.555 102.488 1.00 0.00   ? 235  GLN C CD    1 
ATOM   6619  O  OE1   . GLN C 1 235  ? 109.783 126.309 102.599 1.00 0.00   ? 235  GLN C OE1   1 
ATOM   6620  N  NE2   . GLN C 1 235  ? 107.792 126.757 103.535 1.00 0.00   ? 235  GLN C NE2   1 
ATOM   6621  N  N     . VAL C 1 236  ? 109.439 128.443 96.963  1.00 0.00   ? 236  VAL C N     1 
ATOM   6622  C  CA    . VAL C 1 236  ? 110.395 128.669 95.892  1.00 0.00   ? 236  VAL C CA    1 
ATOM   6623  C  C     . VAL C 1 236  ? 111.559 129.528 96.372  1.00 0.00   ? 236  VAL C C     1 
ATOM   6624  O  O     . VAL C 1 236  ? 111.364 130.538 97.051  1.00 0.00   ? 236  VAL C O     1 
ATOM   6625  C  CB    . VAL C 1 236  ? 109.731 129.367 94.688  1.00 0.00   ? 236  VAL C CB    1 
ATOM   6626  C  CG1   . VAL C 1 236  ? 110.734 129.507 93.553  1.00 0.00   ? 236  VAL C CG1   1 
ATOM   6627  C  CG2   . VAL C 1 236  ? 108.516 128.575 94.226  1.00 0.00   ? 236  VAL C CG2   1 
ATOM   6628  N  N     . ASP C 1 237  ? 112.768 129.121 96.002  1.00 0.00   ? 237  ASP C N     1 
ATOM   6629  C  CA    . ASP C 1 237  ? 113.972 129.849 96.385  1.00 0.00   ? 237  ASP C CA    1 
ATOM   6630  C  C     . ASP C 1 237  ? 114.146 131.084 95.507  1.00 0.00   ? 237  ASP C C     1 
ATOM   6631  O  O     . ASP C 1 237  ? 114.018 131.011 94.284  1.00 0.00   ? 237  ASP C O     1 
ATOM   6632  C  CB    . ASP C 1 237  ? 115.198 128.941 96.255  1.00 0.00   ? 237  ASP C CB    1 
ATOM   6633  C  CG    . ASP C 1 237  ? 115.047 127.650 97.039  1.00 0.00   ? 237  ASP C CG    1 
ATOM   6634  O  OD1   . ASP C 1 237  ? 114.890 127.709 98.280  1.00 0.00   ? 237  ASP C OD1   1 
ATOM   6635  O  OD2   . ASP C 1 237  ? 115.091 126.567 96.416  1.00 0.00   ? 237  ASP C OD2   1 
ATOM   6636  N  N     . ILE C 1 238  ? 114.449 132.208 96.141  1.00 0.00   ? 238  ILE C N     1 
ATOM   6637  C  CA    . ILE C 1 238  ? 114.638 133.476 95.439  1.00 0.00   ? 238  ILE C CA    1 
ATOM   6638  C  C     . ILE C 1 238  ? 116.051 134.031 95.609  1.00 0.00   ? 238  ILE C C     1 
ATOM   6639  O  O     . ILE C 1 238  ? 116.511 134.282 96.723  1.00 0.00   ? 238  ILE C O     1 
ATOM   6640  C  CB    . ILE C 1 238  ? 113.634 134.536 95.948  1.00 0.00   ? 238  ILE C CB    1 
ATOM   6641  C  CG1   . ILE C 1 238  ? 112.194 134.042 95.762  1.00 0.00   ? 238  ILE C CG1   1 
ATOM   6642  C  CG2   . ILE C 1 238  ? 113.829 135.835 95.205  1.00 0.00   ? 238  ILE C CG2   1 
ATOM   6643  C  CD1   . ILE C 1 238  ? 111.814 133.746 94.321  1.00 0.00   ? 238  ILE C CD1   1 
ATOM   6644  N  N     . PRO C 1 239  ? 116.763 134.231 94.491  1.00 0.00   ? 239  PRO C N     1 
ATOM   6645  C  CA    . PRO C 1 239  ? 118.131 134.760 94.504  1.00 0.00   ? 239  PRO C CA    1 
ATOM   6646  C  C     . PRO C 1 239  ? 118.181 136.217 94.985  1.00 0.00   ? 239  PRO C C     1 
ATOM   6647  O  O     . PRO C 1 239  ? 117.260 136.990 94.724  1.00 0.00   ? 239  PRO C O     1 
ATOM   6648  C  CB    . PRO C 1 239  ? 118.566 134.608 93.050  1.00 0.00   ? 239  PRO C CB    1 
ATOM   6649  C  CG    . PRO C 1 239  ? 117.271 134.799 92.304  1.00 0.00   ? 239  PRO C CG    1 
ATOM   6650  C  CD    . PRO C 1 239  ? 116.314 133.971 93.113  1.00 0.00   ? 239  PRO C CD    1 
ATOM   6651  N  N     . MET C 1 240  ? 119.254 136.579 95.681  1.00 0.00   ? 240  MET C N     1 
ATOM   6652  C  CA    . MET C 1 240  ? 119.416 137.926 96.230  1.00 0.00   ? 240  MET C CA    1 
ATOM   6653  C  C     . MET C 1 240  ? 120.143 138.931 95.331  1.00 0.00   ? 240  MET C C     1 
ATOM   6654  O  O     . MET C 1 240  ? 120.458 140.046 95.759  1.00 0.00   ? 240  MET C O     1 
ATOM   6655  C  CB    . MET C 1 240  ? 120.141 137.848 97.578  1.00 0.00   ? 240  MET C CB    1 
ATOM   6656  C  CG    . MET C 1 240  ? 119.295 137.287 98.707  1.00 0.00   ? 240  MET C CG    1 
ATOM   6657  S  SD    . MET C 1 240  ? 117.893 138.347 99.091  1.00 0.00   ? 240  MET C SD    1 
ATOM   6658  C  CE    . MET C 1 240  ? 116.661 137.690 97.989  1.00 0.00   ? 240  MET C CE    1 
ATOM   6659  N  N     . GLU C 1 241  ? 120.394 138.545 94.086  1.00 0.00   ? 241  GLU C N     1 
ATOM   6660  C  CA    . GLU C 1 241  ? 121.093 139.414 93.141  1.00 0.00   ? 241  GLU C CA    1 
ATOM   6661  C  C     . GLU C 1 241  ? 122.450 139.826 93.695  1.00 0.00   ? 241  GLU C C     1 
ATOM   6662  O  O     . GLU C 1 241  ? 122.969 140.897 93.363  1.00 0.00   ? 241  GLU C O     1 
ATOM   6663  C  CB    . GLU C 1 241  ? 120.273 140.675 92.839  1.00 0.00   ? 241  GLU C CB    1 
ATOM   6664  N  N     . ASN C 1 242  ? 123.014 138.983 94.552  1.00 0.00   ? 242  ASN C N     1 
ATOM   6665  C  CA    . ASN C 1 242  ? 124.315 139.268 95.138  1.00 0.00   ? 242  ASN C CA    1 
ATOM   6666  C  C     . ASN C 1 242  ? 125.343 139.281 94.014  1.00 0.00   ? 242  ASN C C     1 
ATOM   6667  O  O     . ASN C 1 242  ? 125.316 138.423 93.130  1.00 0.00   ? 242  ASN C O     1 
ATOM   6668  C  CB    . ASN C 1 242  ? 124.650 138.199 96.170  1.00 0.00   ? 242  ASN C CB    1 
ATOM   6669  C  CG    . ASN C 1 242  ? 125.915 138.506 96.938  1.00 0.00   ? 242  ASN C CG    1 
ATOM   6670  O  OD1   . ASN C 1 242  ? 127.015 138.429 96.396  1.00 0.00   ? 242  ASN C OD1   1 
ATOM   6671  N  ND2   . ASN C 1 242  ? 125.761 138.871 98.208  1.00 0.00   ? 242  ASN C ND2   1 
ATOM   6672  N  N     . GLY C 1 243  ? 126.251 140.246 94.056  1.00 0.00   ? 243  GLY C N     1 
ATOM   6673  C  CA    . GLY C 1 243  ? 127.245 140.351 93.004  1.00 0.00   ? 243  GLY C CA    1 
ATOM   6674  C  C     . GLY C 1 243  ? 128.106 139.115 92.820  1.00 0.00   ? 243  GLY C C     1 
ATOM   6675  O  O     . GLY C 1 243  ? 128.540 138.826 91.704  1.00 0.00   ? 243  GLY C O     1 
ATOM   6676  N  N     . VAL C 1 244  ? 128.346 138.374 93.897  1.00 0.00   ? 244  VAL C N     1 
ATOM   6677  C  CA    . VAL C 1 244  ? 129.168 137.174 93.816  1.00 0.00   ? 244  VAL C CA    1 
ATOM   6678  C  C     . VAL C 1 244  ? 128.354 135.896 93.977  1.00 0.00   ? 244  VAL C C     1 
ATOM   6679  O  O     . VAL C 1 244  ? 128.909 134.812 94.138  1.00 0.00   ? 244  VAL C O     1 
ATOM   6680  C  CB    . VAL C 1 244  ? 130.285 137.183 94.883  1.00 0.00   ? 244  VAL C CB    1 
ATOM   6681  C  CG1   . VAL C 1 244  ? 131.198 138.378 94.671  1.00 0.00   ? 244  VAL C CG1   1 
ATOM   6682  C  CG2   . VAL C 1 244  ? 129.678 137.227 96.273  1.00 0.00   ? 244  VAL C CG2   1 
ATOM   6683  N  N     . GLY C 1 245  ? 127.032 136.039 93.928  1.00 0.00   ? 245  GLY C N     1 
ATOM   6684  C  CA    . GLY C 1 245  ? 126.156 134.891 94.073  1.00 0.00   ? 245  GLY C CA    1 
ATOM   6685  C  C     . GLY C 1 245  ? 126.013 134.443 95.514  1.00 0.00   ? 245  GLY C C     1 
ATOM   6686  O  O     . GLY C 1 245  ? 125.475 133.365 95.786  1.00 0.00   ? 245  GLY C O     1 
ATOM   6687  N  N     . GLY C 1 246  ? 126.490 135.270 96.443  1.00 0.00   ? 246  GLY C N     1 
ATOM   6688  C  CA    . GLY C 1 246  ? 126.407 134.939 97.856  1.00 0.00   ? 246  GLY C CA    1 
ATOM   6689  C  C     . GLY C 1 246  ? 125.127 135.421 98.516  1.00 0.00   ? 246  GLY C C     1 
ATOM   6690  O  O     . GLY C 1 246  ? 124.382 136.203 97.939  1.00 0.00   ? 246  GLY C O     1 
ATOM   6691  N  N     . ASN C 1 247  ? 124.867 134.944 99.728  1.00 0.00   ? 247  ASN C N     1 
ATOM   6692  C  CA    . ASN C 1 247  ? 123.659 135.329 100.451 1.00 0.00   ? 247  ASN C CA    1 
ATOM   6693  C  C     . ASN C 1 247  ? 123.954 136.208 101.664 1.00 0.00   ? 247  ASN C C     1 
ATOM   6694  O  O     . ASN C 1 247  ? 123.046 136.587 102.407 1.00 0.00   ? 247  ASN C O     1 
ATOM   6695  C  CB    . ASN C 1 247  ? 122.905 134.070 100.889 1.00 0.00   ? 247  ASN C CB    1 
ATOM   6696  C  CG    . ASN C 1 247  ? 122.464 133.224 99.710  1.00 0.00   ? 247  ASN C CG    1 
ATOM   6697  O  OD1   . ASN C 1 247  ? 121.561 133.602 98.962  1.00 0.00   ? 247  ASN C OD1   1 
ATOM   6698  N  ND2   . ASN C 1 247  ? 123.106 132.074 99.532  1.00 0.00   ? 247  ASN C ND2   1 
ATOM   6699  N  N     . SER C 1 248  ? 125.226 136.531 101.857 1.00 0.00   ? 248  SER C N     1 
ATOM   6700  C  CA    . SER C 1 248  ? 125.651 137.351 102.989 1.00 0.00   ? 248  SER C CA    1 
ATOM   6701  C  C     . SER C 1 248  ? 125.508 138.844 102.729 1.00 0.00   ? 248  SER C C     1 
ATOM   6702  O  O     . SER C 1 248  ? 125.517 139.289 101.580 1.00 0.00   ? 248  SER C O     1 
ATOM   6703  C  CB    . SER C 1 248  ? 127.108 137.045 103.342 1.00 0.00   ? 248  SER C CB    1 
ATOM   6704  O  OG    . SER C 1 248  ? 127.985 137.460 102.313 1.00 0.00   ? 248  SER C OG    1 
ATOM   6705  N  N     . ILE C 1 249  ? 125.367 139.618 103.806 1.00 0.00   ? 249  ILE C N     1 
ATOM   6706  C  CA    . ILE C 1 249  ? 125.235 141.068 103.696 1.00 0.00   ? 249  ILE C CA    1 
ATOM   6707  C  C     . ILE C 1 249  ? 125.760 141.802 104.938 1.00 0.00   ? 249  ILE C C     1 
ATOM   6708  O  O     . ILE C 1 249  ? 125.368 141.489 106.063 1.00 0.00   ? 249  ILE C O     1 
ATOM   6709  C  CB    . ILE C 1 249  ? 123.766 141.464 103.486 1.00 0.00   ? 249  ILE C CB    1 
ATOM   6710  C  CG1   . ILE C 1 249  ? 123.657 142.967 103.201 1.00 0.00   ? 249  ILE C CG1   1 
ATOM   6711  C  CG2   . ILE C 1 249  ? 122.945 141.110 104.717 1.00 0.00   ? 249  ILE C CG2   1 
ATOM   6712  C  CD1   . ILE C 1 249  ? 124.402 143.427 101.955 1.00 0.00   ? 249  ILE C CD1   1 
ATOM   6713  N  N     . PHE C 1 250  ? 126.643 142.777 104.739 1.00 0.00   ? 250  PHE C N     1 
ATOM   6714  C  CA    . PHE C 1 250  ? 127.191 143.568 105.843 1.00 0.00   ? 250  PHE C CA    1 
ATOM   6715  C  C     . PHE C 1 250  ? 126.213 144.710 106.108 1.00 0.00   ? 250  PHE C C     1 
ATOM   6716  O  O     . PHE C 1 250  ? 126.360 145.806 105.569 1.00 0.00   ? 250  PHE C O     1 
ATOM   6717  C  CB    . PHE C 1 250  ? 128.565 144.130 105.473 1.00 0.00   ? 250  PHE C CB    1 
ATOM   6718  C  CG    . PHE C 1 250  ? 129.201 144.967 106.555 1.00 0.00   ? 250  PHE C CG    1 
ATOM   6719  C  CD1   . PHE C 1 250  ? 129.541 144.406 107.788 1.00 0.00   ? 250  PHE C CD1   1 
ATOM   6720  C  CD2   . PHE C 1 250  ? 129.493 146.308 106.333 1.00 0.00   ? 250  PHE C CD2   1 
ATOM   6721  C  CE1   . PHE C 1 250  ? 130.160 145.172 108.773 1.00 0.00   ? 250  PHE C CE1   1 
ATOM   6722  C  CE2   . PHE C 1 250  ? 130.114 147.084 107.315 1.00 0.00   ? 250  PHE C CE2   1 
ATOM   6723  C  CZ    . PHE C 1 250  ? 130.451 146.511 108.534 1.00 0.00   ? 250  PHE C CZ    1 
ATOM   6724  N  N     . LEU C 1 251  ? 125.217 144.443 106.947 1.00 0.00   ? 251  LEU C N     1 
ATOM   6725  C  CA    . LEU C 1 251  ? 124.193 145.425 107.254 1.00 0.00   ? 251  LEU C CA    1 
ATOM   6726  C  C     . LEU C 1 251  ? 124.467 146.328 108.453 1.00 0.00   ? 251  LEU C C     1 
ATOM   6727  O  O     . LEU C 1 251  ? 124.315 145.914 109.606 1.00 0.00   ? 251  LEU C O     1 
ATOM   6728  C  CB    . LEU C 1 251  ? 122.852 144.714 107.439 1.00 0.00   ? 251  LEU C CB    1 
ATOM   6729  C  CG    . LEU C 1 251  ? 121.577 145.533 107.692 1.00 0.00   ? 251  LEU C CG    1 
ATOM   6730  C  CD1   . LEU C 1 251  ? 120.368 144.648 107.456 1.00 0.00   ? 251  LEU C CD1   1 
ATOM   6731  C  CD2   . LEU C 1 251  ? 121.563 146.077 109.109 1.00 0.00   ? 251  LEU C CD2   1 
ATOM   6732  N  N     . VAL C 1 252  ? 124.883 147.560 108.172 1.00 0.00   ? 252  VAL C N     1 
ATOM   6733  C  CA    . VAL C 1 252  ? 125.137 148.554 109.213 1.00 0.00   ? 252  VAL C CA    1 
ATOM   6734  C  C     . VAL C 1 252  ? 124.052 149.610 109.071 1.00 0.00   ? 252  VAL C C     1 
ATOM   6735  O  O     . VAL C 1 252  ? 123.401 149.992 110.038 1.00 0.00   ? 252  VAL C O     1 
ATOM   6736  C  CB    . VAL C 1 252  ? 126.497 149.239 109.039 1.00 0.00   ? 252  VAL C CB    1 
ATOM   6737  C  CG1   . VAL C 1 252  ? 126.618 150.375 110.038 1.00 0.00   ? 252  VAL C CG1   1 
ATOM   6738  C  CG2   . VAL C 1 252  ? 127.616 148.240 109.249 1.00 0.00   ? 252  VAL C CG2   1 
ATOM   6739  N  N     . ALA C 1 253  ? 123.873 150.079 107.841 1.00 0.00   ? 253  ALA C N     1 
ATOM   6740  C  CA    . ALA C 1 253  ? 122.866 151.084 107.532 1.00 0.00   ? 253  ALA C CA    1 
ATOM   6741  C  C     . ALA C 1 253  ? 121.700 150.347 106.876 1.00 0.00   ? 253  ALA C C     1 
ATOM   6742  O  O     . ALA C 1 253  ? 121.868 149.233 106.376 1.00 0.00   ? 253  ALA C O     1 
ATOM   6743  C  CB    . ALA C 1 253  ? 123.433 152.123 106.579 1.00 0.00   ? 253  ALA C CB    1 
ATOM   6744  N  N     . PRO C 1 254  ? 120.507 150.957 106.863 1.00 0.00   ? 254  PRO C N     1 
ATOM   6745  C  CA    . PRO C 1 254  ? 119.388 150.254 106.235 1.00 0.00   ? 254  PRO C CA    1 
ATOM   6746  C  C     . PRO C 1 254  ? 119.757 149.943 104.794 1.00 0.00   ? 254  PRO C C     1 
ATOM   6747  O  O     . PRO C 1 254  ? 120.308 150.787 104.090 1.00 0.00   ? 254  PRO C O     1 
ATOM   6748  C  CB    . PRO C 1 254  ? 118.251 151.260 106.332 1.00 0.00   ? 254  PRO C CB    1 
ATOM   6749  C  CG    . PRO C 1 254  ? 118.554 151.963 107.610 1.00 0.00   ? 254  PRO C CG    1 
ATOM   6750  C  CD    . PRO C 1 254  ? 120.043 152.195 107.509 1.00 0.00   ? 254  PRO C CD    1 
ATOM   6751  N  N     . LEU C 1 255  ? 119.465 148.720 104.369 1.00 0.00   ? 255  LEU C N     1 
ATOM   6752  C  CA    . LEU C 1 255  ? 119.779 148.290 103.016 1.00 0.00   ? 255  LEU C CA    1 
ATOM   6753  C  C     . LEU C 1 255  ? 118.538 147.939 102.228 1.00 0.00   ? 255  LEU C C     1 
ATOM   6754  O  O     . LEU C 1 255  ? 117.489 147.617 102.791 1.00 0.00   ? 255  LEU C O     1 
ATOM   6755  C  CB    . LEU C 1 255  ? 120.693 147.068 103.054 1.00 0.00   ? 255  LEU C CB    1 
ATOM   6756  C  CG    . LEU C 1 255  ? 121.963 147.192 103.888 1.00 0.00   ? 255  LEU C CG    1 
ATOM   6757  C  CD1   . LEU C 1 255  ? 122.578 145.826 104.081 1.00 0.00   ? 255  LEU C CD1   1 
ATOM   6758  C  CD2   . LEU C 1 255  ? 122.935 148.139 103.212 1.00 0.00   ? 255  LEU C CD2   1 
ATOM   6759  N  N     . ILE C 1 256  ? 118.683 147.998 100.913 1.00 0.00   ? 256  ILE C N     1 
ATOM   6760  C  CA    . ILE C 1 256  ? 117.606 147.664 99.996  1.00 0.00   ? 256  ILE C CA    1 
ATOM   6761  C  C     . ILE C 1 256  ? 117.896 146.292 99.404  1.00 0.00   ? 256  ILE C C     1 
ATOM   6762  O  O     . ILE C 1 256  ? 118.745 146.151 98.517  1.00 0.00   ? 256  ILE C O     1 
ATOM   6763  C  CB    . ILE C 1 256  ? 117.507 148.685 98.846  1.00 0.00   ? 256  ILE C CB    1 
ATOM   6764  C  CG1   . ILE C 1 256  ? 117.038 150.049 99.385  1.00 0.00   ? 256  ILE C CG1   1 
ATOM   6765  C  CG2   . ILE C 1 256  ? 116.566 148.174 97.766  1.00 0.00   ? 256  ILE C CG2   1 
ATOM   6766  C  CD1   . ILE C 1 256  ? 115.690 150.002 100.079 1.00 0.00   ? 256  ILE C CD1   1 
ATOM   6767  N  N     . ILE C 1 257  ? 117.205 145.277 99.906  1.00 0.00   ? 257  ILE C N     1 
ATOM   6768  C  CA    . ILE C 1 257  ? 117.385 143.918 99.403  1.00 0.00   ? 257  ILE C CA    1 
ATOM   6769  C  C     . ILE C 1 257  ? 116.435 143.777 98.218  1.00 0.00   ? 257  ILE C C     1 
ATOM   6770  O  O     . ILE C 1 257  ? 115.271 144.170 98.306  1.00 0.00   ? 257  ILE C O     1 
ATOM   6771  C  CB    . ILE C 1 257  ? 117.036 142.863 100.472 1.00 0.00   ? 257  ILE C CB    1 
ATOM   6772  C  CG1   . ILE C 1 257  ? 117.813 143.153 101.765 1.00 0.00   ? 257  ILE C CG1   1 
ATOM   6773  C  CG2   . ILE C 1 257  ? 117.385 141.482 99.969  1.00 0.00   ? 257  ILE C CG2   1 
ATOM   6774  C  CD1   . ILE C 1 257  ? 119.316 143.222 101.586 1.00 0.00   ? 257  ILE C CD1   1 
ATOM   6775  N  N     . TYR C 1 258  ? 116.926 143.223 97.113  1.00 0.00   ? 258  TYR C N     1 
ATOM   6776  C  CA    . TYR C 1 258  ? 116.095 143.081 95.927  1.00 0.00   ? 258  TYR C CA    1 
ATOM   6777  C  C     . TYR C 1 258  ? 116.316 141.791 95.139  1.00 0.00   ? 258  TYR C C     1 
ATOM   6778  O  O     . TYR C 1 258  ? 117.349 141.131 95.276  1.00 0.00   ? 258  TYR C O     1 
ATOM   6779  C  CB    . TYR C 1 258  ? 116.311 144.286 95.006  1.00 0.00   ? 258  TYR C CB    1 
ATOM   6780  C  CG    . TYR C 1 258  ? 117.669 144.342 94.338  1.00 0.00   ? 258  TYR C CG    1 
ATOM   6781  C  CD1   . TYR C 1 258  ? 117.864 143.790 93.072  1.00 0.00   ? 258  TYR C CD1   1 
ATOM   6782  C  CD2   . TYR C 1 258  ? 118.760 144.939 94.972  1.00 0.00   ? 258  TYR C CD2   1 
ATOM   6783  C  CE1   . TYR C 1 258  ? 119.110 143.837 92.453  1.00 0.00   ? 258  TYR C CE1   1 
ATOM   6784  C  CE2   . TYR C 1 258  ? 120.010 144.985 94.358  1.00 0.00   ? 258  TYR C CE2   1 
ATOM   6785  C  CZ    . TYR C 1 258  ? 120.178 144.434 93.100  1.00 0.00   ? 258  TYR C CZ    1 
ATOM   6786  O  OH    . TYR C 1 258  ? 121.407 144.484 92.487  1.00 0.00   ? 258  TYR C OH    1 
ATOM   6787  N  N     . HIS C 1 259  ? 115.325 141.441 94.322  1.00 0.00   ? 259  HIS C N     1 
ATOM   6788  C  CA    . HIS C 1 259  ? 115.369 140.253 93.474  1.00 0.00   ? 259  HIS C CA    1 
ATOM   6789  C  C     . HIS C 1 259  ? 114.994 140.657 92.049  1.00 0.00   ? 259  HIS C C     1 
ATOM   6790  O  O     . HIS C 1 259  ? 113.901 141.174 91.806  1.00 0.00   ? 259  HIS C O     1 
ATOM   6791  C  CB    . HIS C 1 259  ? 114.377 139.198 93.972  1.00 0.00   ? 259  HIS C CB    1 
ATOM   6792  C  CG    . HIS C 1 259  ? 113.987 138.184 92.938  1.00 0.00   ? 259  HIS C CG    1 
ATOM   6793  N  ND1   . HIS C 1 259  ? 114.870 137.256 92.434  1.00 0.00   ? 259  HIS C ND1   1 
ATOM   6794  C  CD2   . HIS C 1 259  ? 112.803 137.947 92.328  1.00 0.00   ? 259  HIS C CD2   1 
ATOM   6795  C  CE1   . HIS C 1 259  ? 114.246 136.489 91.558  1.00 0.00   ? 259  HIS C CE1   1 
ATOM   6796  N  NE2   . HIS C 1 259  ? 112.990 136.885 91.477  1.00 0.00   ? 259  HIS C NE2   1 
ATOM   6797  N  N     . VAL C 1 260  ? 115.906 140.435 91.109  1.00 0.00   ? 260  VAL C N     1 
ATOM   6798  C  CA    . VAL C 1 260  ? 115.641 140.771 89.718  1.00 0.00   ? 260  VAL C CA    1 
ATOM   6799  C  C     . VAL C 1 260  ? 114.819 139.644 89.109  1.00 0.00   ? 260  VAL C C     1 
ATOM   6800  O  O     . VAL C 1 260  ? 115.231 138.490 89.146  1.00 0.00   ? 260  VAL C O     1 
ATOM   6801  C  CB    . VAL C 1 260  ? 116.950 140.936 88.922  1.00 0.00   ? 260  VAL C CB    1 
ATOM   6802  C  CG1   . VAL C 1 260  ? 116.639 141.172 87.459  1.00 0.00   ? 260  VAL C CG1   1 
ATOM   6803  C  CG2   . VAL C 1 260  ? 117.761 142.103 89.480  1.00 0.00   ? 260  VAL C CG2   1 
ATOM   6804  N  N     . ILE C 1 261  ? 113.658 139.982 88.554  1.00 0.00   ? 261  ILE C N     1 
ATOM   6805  C  CA    . ILE C 1 261  ? 112.771 138.984 87.956  1.00 0.00   ? 261  ILE C CA    1 
ATOM   6806  C  C     . ILE C 1 261  ? 113.210 138.572 86.555  1.00 0.00   ? 261  ILE C C     1 
ATOM   6807  O  O     . ILE C 1 261  ? 113.290 139.403 85.649  1.00 0.00   ? 261  ILE C O     1 
ATOM   6808  C  CB    . ILE C 1 261  ? 111.322 139.513 87.871  1.00 0.00   ? 261  ILE C CB    1 
ATOM   6809  C  CG1   . ILE C 1 261  ? 110.840 139.931 89.265  1.00 0.00   ? 261  ILE C CG1   1 
ATOM   6810  C  CG2   . ILE C 1 261  ? 110.412 138.441 87.285  1.00 0.00   ? 261  ILE C CG2   1 
ATOM   6811  C  CD1   . ILE C 1 261  ? 109.464 140.582 89.284  1.00 0.00   ? 261  ILE C CD1   1 
ATOM   6812  N  N     . ASP C 1 262  ? 113.491 137.283 86.384  1.00 0.00   ? 262  ASP C N     1 
ATOM   6813  C  CA    . ASP C 1 262  ? 113.916 136.754 85.091  1.00 0.00   ? 262  ASP C CA    1 
ATOM   6814  C  C     . ASP C 1 262  ? 113.128 135.501 84.711  1.00 0.00   ? 262  ASP C C     1 
ATOM   6815  O  O     . ASP C 1 262  ? 112.130 135.169 85.346  1.00 0.00   ? 262  ASP C O     1 
ATOM   6816  C  CB    . ASP C 1 262  ? 115.417 136.444 85.096  1.00 0.00   ? 262  ASP C CB    1 
ATOM   6817  C  CG    . ASP C 1 262  ? 115.795 135.371 86.099  1.00 0.00   ? 262  ASP C CG    1 
ATOM   6818  O  OD1   . ASP C 1 262  ? 114.910 134.605 86.534  1.00 0.00   ? 262  ASP C OD1   1 
ATOM   6819  O  OD2   . ASP C 1 262  ? 116.995 135.275 86.439  1.00 0.00   ? 262  ASP C OD2   1 
ATOM   6820  N  N     . SER C 1 263  ? 113.592 134.812 83.669  1.00 0.00   ? 263  SER C N     1 
ATOM   6821  C  CA    . SER C 1 263  ? 112.936 133.600 83.185  1.00 0.00   ? 263  SER C CA    1 
ATOM   6822  C  C     . SER C 1 263  ? 112.856 132.484 84.223  1.00 0.00   ? 263  SER C C     1 
ATOM   6823  O  O     . SER C 1 263  ? 112.052 131.561 84.085  1.00 0.00   ? 263  SER C O     1 
ATOM   6824  C  CB    . SER C 1 263  ? 113.644 133.084 81.928  1.00 0.00   ? 263  SER C CB    1 
ATOM   6825  O  OG    . SER C 1 263  ? 115.008 132.785 82.178  1.00 0.00   ? 263  SER C OG    1 
ATOM   6826  N  N     . ASN C 1 264  ? 113.680 132.562 85.264  1.00 0.00   ? 264  ASN C N     1 
ATOM   6827  C  CA    . ASN C 1 264  ? 113.678 131.533 86.300  1.00 0.00   ? 264  ASN C CA    1 
ATOM   6828  C  C     . ASN C 1 264  ? 112.978 131.962 87.587  1.00 0.00   ? 264  ASN C C     1 
ATOM   6829  O  O     . ASN C 1 264  ? 112.888 131.191 88.542  1.00 0.00   ? 264  ASN C O     1 
ATOM   6830  C  CB    . ASN C 1 264  ? 115.112 131.097 86.621  1.00 0.00   ? 264  ASN C CB    1 
ATOM   6831  C  CG    . ASN C 1 264  ? 115.813 130.474 85.428  1.00 0.00   ? 264  ASN C CG    1 
ATOM   6832  O  OD1   . ASN C 1 264  ? 115.280 129.573 84.782  1.00 0.00   ? 264  ASN C OD1   1 
ATOM   6833  N  ND2   . ASN C 1 264  ? 117.022 130.944 85.142  1.00 0.00   ? 264  ASN C ND2   1 
ATOM   6834  N  N     . SER C 1 265  ? 112.479 133.194 87.610  1.00 0.00   ? 265  SER C N     1 
ATOM   6835  C  CA    . SER C 1 265  ? 111.795 133.717 88.783  1.00 0.00   ? 265  SER C CA    1 
ATOM   6836  C  C     . SER C 1 265  ? 110.302 133.423 88.708  1.00 0.00   ? 265  SER C C     1 
ATOM   6837  O  O     . SER C 1 265  ? 109.687 133.560 87.652  1.00 0.00   ? 265  SER C O     1 
ATOM   6838  C  CB    . SER C 1 265  ? 112.017 135.225 88.885  1.00 0.00   ? 265  SER C CB    1 
ATOM   6839  O  OG    . SER C 1 265  ? 111.289 135.784 89.963  1.00 0.00   ? 265  SER C OG    1 
ATOM   6840  N  N     . PRO C 1 266  ? 109.699 133.017 89.836  1.00 0.00   ? 266  PRO C N     1 
ATOM   6841  C  CA    . PRO C 1 266  ? 108.268 132.709 89.867  1.00 0.00   ? 266  PRO C CA    1 
ATOM   6842  C  C     . PRO C 1 266  ? 107.401 133.956 89.718  1.00 0.00   ? 266  PRO C C     1 
ATOM   6843  O  O     . PRO C 1 266  ? 106.184 133.861 89.584  1.00 0.00   ? 266  PRO C O     1 
ATOM   6844  C  CB    . PRO C 1 266  ? 108.097 132.041 91.225  1.00 0.00   ? 266  PRO C CB    1 
ATOM   6845  C  CG    . PRO C 1 266  ? 109.078 132.793 92.066  1.00 0.00   ? 266  PRO C CG    1 
ATOM   6846  C  CD    . PRO C 1 266  ? 110.297 132.845 91.170  1.00 0.00   ? 266  PRO C CD    1 
ATOM   6847  N  N     . LEU C 1 267  ? 108.031 135.126 89.744  1.00 0.00   ? 267  LEU C N     1 
ATOM   6848  C  CA    . LEU C 1 267  ? 107.312 136.390 89.615  1.00 0.00   ? 267  LEU C CA    1 
ATOM   6849  C  C     . LEU C 1 267  ? 107.392 136.913 88.181  1.00 0.00   ? 267  LEU C C     1 
ATOM   6850  O  O     . LEU C 1 267  ? 107.020 138.055 87.902  1.00 0.00   ? 267  LEU C O     1 
ATOM   6851  C  CB    . LEU C 1 267  ? 107.904 137.428 90.579  1.00 0.00   ? 267  LEU C CB    1 
ATOM   6852  C  CG    . LEU C 1 267  ? 108.116 136.981 92.029  1.00 0.00   ? 267  LEU C CG    1 
ATOM   6853  C  CD1   . LEU C 1 267  ? 108.765 138.112 92.809  1.00 0.00   ? 267  LEU C CD1   1 
ATOM   6854  C  CD2   . LEU C 1 267  ? 106.791 136.581 92.665  1.00 0.00   ? 267  LEU C CD2   1 
ATOM   6855  N  N     . TYR C 1 268  ? 107.867 136.065 87.274  1.00 0.00   ? 268  TYR C N     1 
ATOM   6856  C  CA    . TYR C 1 268  ? 108.010 136.431 85.867  1.00 0.00   ? 268  TYR C CA    1 
ATOM   6857  C  C     . TYR C 1 268  ? 106.664 136.748 85.220  1.00 0.00   ? 268  TYR C C     1 
ATOM   6858  O  O     . TYR C 1 268  ? 106.610 137.438 84.205  1.00 0.00   ? 268  TYR C O     1 
ATOM   6859  C  CB    . TYR C 1 268  ? 108.696 135.299 85.098  1.00 0.00   ? 268  TYR C CB    1 
ATOM   6860  C  CG    . TYR C 1 268  ? 109.332 135.717 83.785  1.00 0.00   ? 268  TYR C CG    1 
ATOM   6861  C  CD1   . TYR C 1 268  ? 110.285 136.739 83.736  1.00 0.00   ? 268  TYR C CD1   1 
ATOM   6862  C  CD2   . TYR C 1 268  ? 109.008 135.070 82.592  1.00 0.00   ? 268  TYR C CD2   1 
ATOM   6863  C  CE1   . TYR C 1 268  ? 110.896 137.098 82.536  1.00 0.00   ? 268  TYR C CE1   1 
ATOM   6864  C  CE2   . TYR C 1 268  ? 109.614 135.421 81.391  1.00 0.00   ? 268  TYR C CE2   1 
ATOM   6865  C  CZ    . TYR C 1 268  ? 110.553 136.434 81.368  1.00 0.00   ? 268  TYR C CZ    1 
ATOM   6866  O  OH    . TYR C 1 268  ? 111.141 136.771 80.174  1.00 0.00   ? 268  TYR C OH    1 
ATOM   6867  N  N     . ASP C 1 269  ? 105.581 136.229 85.796  1.00 0.00   ? 269  ASP C N     1 
ATOM   6868  C  CA    . ASP C 1 269  ? 104.236 136.464 85.261  1.00 0.00   ? 269  ASP C CA    1 
ATOM   6869  C  C     . ASP C 1 269  ? 103.318 137.297 86.156  1.00 0.00   ? 269  ASP C C     1 
ATOM   6870  O  O     . ASP C 1 269  ? 102.095 137.164 86.083  1.00 0.00   ? 269  ASP C O     1 
ATOM   6871  C  CB    . ASP C 1 269  ? 103.545 135.132 84.965  1.00 0.00   ? 269  ASP C CB    1 
ATOM   6872  C  CG    . ASP C 1 269  ? 104.262 134.326 83.904  1.00 0.00   ? 269  ASP C CG    1 
ATOM   6873  O  OD1   . ASP C 1 269  ? 104.420 134.832 82.770  1.00 0.00   ? 269  ASP C OD1   1 
ATOM   6874  O  OD2   . ASP C 1 269  ? 104.666 133.181 84.195  1.00 0.00   ? 269  ASP C OD2   1 
ATOM   6875  N  N     . LEU C 1 270  ? 103.897 138.145 86.998  1.00 0.00   ? 270  LEU C N     1 
ATOM   6876  C  CA    . LEU C 1 270  ? 103.097 138.972 87.893  1.00 0.00   ? 270  LEU C CA    1 
ATOM   6877  C  C     . LEU C 1 270  ? 102.265 140.017 87.162  1.00 0.00   ? 270  LEU C C     1 
ATOM   6878  O  O     . LEU C 1 270  ? 102.760 140.718 86.283  1.00 0.00   ? 270  LEU C O     1 
ATOM   6879  C  CB    . LEU C 1 270  ? 103.995 139.672 88.916  1.00 0.00   ? 270  LEU C CB    1 
ATOM   6880  C  CG    . LEU C 1 270  ? 104.529 138.832 90.073  1.00 0.00   ? 270  LEU C CG    1 
ATOM   6881  C  CD1   . LEU C 1 270  ? 105.419 139.711 90.929  1.00 0.00   ? 270  LEU C CD1   1 
ATOM   6882  C  CD2   . LEU C 1 270  ? 103.383 138.271 90.903  1.00 0.00   ? 270  LEU C CD2   1 
ATOM   6883  N  N     . ALA C 1 271  ? 100.993 140.103 87.536  1.00 0.00   ? 271  ALA C N     1 
ATOM   6884  C  CA    . ALA C 1 271  ? 100.088 141.070 86.944  1.00 0.00   ? 271  ALA C CA    1 
ATOM   6885  C  C     . ALA C 1 271  ? 100.184 142.320 87.815  1.00 0.00   ? 271  ALA C C     1 
ATOM   6886  O  O     . ALA C 1 271  ? 100.025 142.242 89.026  1.00 0.00   ? 271  ALA C O     1 
ATOM   6887  C  CB    . ALA C 1 271  ? 98.671  140.519 86.951  1.00 0.00   ? 271  ALA C CB    1 
ATOM   6888  N  N     . PRO C 1 272  ? 100.436 143.492 87.210  1.00 0.00   ? 272  PRO C N     1 
ATOM   6889  C  CA    . PRO C 1 272  ? 100.550 144.715 88.008  1.00 0.00   ? 272  PRO C CA    1 
ATOM   6890  C  C     . PRO C 1 272  ? 99.336  145.105 88.853  1.00 0.00   ? 272  PRO C C     1 
ATOM   6891  O  O     . PRO C 1 272  ? 99.459  145.893 89.791  1.00 0.00   ? 272  PRO C O     1 
ATOM   6892  C  CB    . PRO C 1 272  ? 100.888 145.778 86.965  1.00 0.00   ? 272  PRO C CB    1 
ATOM   6893  C  CG    . PRO C 1 272  ? 101.650 145.002 85.934  1.00 0.00   ? 272  PRO C CG    1 
ATOM   6894  C  CD    . PRO C 1 272  ? 100.828 143.742 85.810  1.00 0.00   ? 272  PRO C CD    1 
ATOM   6895  N  N     . SER C 1 273  ? 98.159  144.579 88.511  1.00 0.00   ? 273  SER C N     1 
ATOM   6896  C  CA    . SER C 1 273  ? 96.948  144.902 89.262  1.00 0.00   ? 273  SER C CA    1 
ATOM   6897  C  C     . SER C 1 273  ? 96.311  143.758 90.050  1.00 0.00   ? 273  SER C C     1 
ATOM   6898  O  O     . SER C 1 273  ? 95.940  143.932 91.210  1.00 0.00   ? 273  SER C O     1 
ATOM   6899  C  CB    . SER C 1 273  ? 95.896  145.515 88.335  1.00 0.00   ? 273  SER C CB    1 
ATOM   6900  O  OG    . SER C 1 273  ? 95.455  144.583 87.370  1.00 0.00   ? 273  SER C OG    1 
ATOM   6901  N  N     . ASP C 1 274  ? 96.166  142.594 89.421  1.00 0.00   ? 274  ASP C N     1 
ATOM   6902  C  CA    . ASP C 1 274  ? 95.535  141.442 90.073  1.00 0.00   ? 274  ASP C CA    1 
ATOM   6903  C  C     . ASP C 1 274  ? 96.440  140.645 91.012  1.00 0.00   ? 274  ASP C C     1 
ATOM   6904  O  O     . ASP C 1 274  ? 95.959  139.916 91.882  1.00 0.00   ? 274  ASP C O     1 
ATOM   6905  C  CB    . ASP C 1 274  ? 94.956  140.489 89.025  1.00 0.00   ? 274  ASP C CB    1 
ATOM   6906  C  CG    . ASP C 1 274  ? 94.043  141.191 88.039  1.00 0.00   ? 274  ASP C CG    1 
ATOM   6907  O  OD1   . ASP C 1 274  ? 93.452  142.234 88.406  1.00 0.00   ? 274  ASP C OD1   1 
ATOM   6908  O  OD2   . ASP C 1 274  ? 93.902  140.697 86.899  1.00 0.00   ? 274  ASP C OD2   1 
ATOM   6909  N  N     . LEU C 1 275  ? 97.750  140.789 90.839  1.00 0.00   ? 275  LEU C N     1 
ATOM   6910  C  CA    . LEU C 1 275  ? 98.711  140.072 91.668  1.00 0.00   ? 275  LEU C CA    1 
ATOM   6911  C  C     . LEU C 1 275  ? 98.529  140.460 93.123  1.00 0.00   ? 275  LEU C C     1 
ATOM   6912  O  O     . LEU C 1 275  ? 98.762  139.655 94.027  1.00 0.00   ? 275  LEU C O     1 
ATOM   6913  C  CB    . LEU C 1 275  ? 100.149 140.395 91.237  1.00 0.00   ? 275  LEU C CB    1 
ATOM   6914  N  N     . HIS C 1 276  ? 98.111  141.700 93.340  1.00 0.00   ? 276  HIS C N     1 
ATOM   6915  C  CA    . HIS C 1 276  ? 97.936  142.232 94.682  1.00 0.00   ? 276  HIS C CA    1 
ATOM   6916  C  C     . HIS C 1 276  ? 96.726  141.737 95.463  1.00 0.00   ? 276  HIS C C     1 
ATOM   6917  O  O     . HIS C 1 276  ? 96.837  141.431 96.644  1.00 0.00   ? 276  HIS C O     1 
ATOM   6918  C  CB    . HIS C 1 276  ? 97.895  143.760 94.618  1.00 0.00   ? 276  HIS C CB    1 
ATOM   6919  C  CG    . HIS C 1 276  ? 99.141  144.365 94.047  1.00 0.00   ? 276  HIS C CG    1 
ATOM   6920  N  ND1   . HIS C 1 276  ? 100.373 144.247 94.651  1.00 0.00   ? 276  HIS C ND1   1 
ATOM   6921  C  CD2   . HIS C 1 276  ? 99.343  145.083 92.919  1.00 0.00   ? 276  HIS C CD2   1 
ATOM   6922  C  CE1   . HIS C 1 276  ? 101.283 144.867 93.919  1.00 0.00   ? 276  HIS C CE1   1 
ATOM   6923  N  NE2   . HIS C 1 276  ? 100.682 145.384 92.862  1.00 0.00   ? 276  HIS C NE2   1 
ATOM   6924  N  N     . HIS C 1 277  ? 95.568  141.665 94.821  1.00 0.00   ? 277  HIS C N     1 
ATOM   6925  C  CA    . HIS C 1 277  ? 94.365  141.246 95.538  1.00 0.00   ? 277  HIS C CA    1 
ATOM   6926  C  C     . HIS C 1 277  ? 93.694  139.915 95.208  1.00 0.00   ? 277  HIS C C     1 
ATOM   6927  O  O     . HIS C 1 277  ? 93.305  139.185 96.111  1.00 0.00   ? 277  HIS C O     1 
ATOM   6928  C  CB    . HIS C 1 277  ? 93.347  142.383 95.457  1.00 0.00   ? 277  HIS C CB    1 
ATOM   6929  C  CG    . HIS C 1 277  ? 93.926  143.726 95.795  1.00 0.00   ? 277  HIS C CG    1 
ATOM   6930  N  ND1   . HIS C 1 277  ? 94.338  144.061 97.069  1.00 0.00   ? 277  HIS C ND1   1 
ATOM   6931  C  CD2   . HIS C 1 277  ? 94.208  144.795 95.018  1.00 0.00   ? 277  HIS C CD2   1 
ATOM   6932  C  CE1   . HIS C 1 277  ? 94.850  145.279 97.059  1.00 0.00   ? 277  HIS C CE1   1 
ATOM   6933  N  NE2   . HIS C 1 277  ? 94.783  145.749 95.826  1.00 0.00   ? 277  HIS C NE2   1 
ATOM   6934  N  N     . HIS C 1 278  ? 93.561  139.589 93.928  1.00 0.00   ? 278  HIS C N     1 
ATOM   6935  C  CA    . HIS C 1 278  ? 92.903  138.337 93.540  1.00 0.00   ? 278  HIS C CA    1 
ATOM   6936  C  C     . HIS C 1 278  ? 93.789  137.106 93.687  1.00 0.00   ? 278  HIS C C     1 
ATOM   6937  O  O     . HIS C 1 278  ? 93.297  135.996 93.896  1.00 0.00   ? 278  HIS C O     1 
ATOM   6938  C  CB    . HIS C 1 278  ? 92.371  138.446 92.115  1.00 0.00   ? 278  HIS C CB    1 
ATOM   6939  C  CG    . HIS C 1 278  ? 91.474  139.626 91.906  1.00 0.00   ? 278  HIS C CG    1 
ATOM   6940  N  ND1   . HIS C 1 278  ? 90.263  139.764 92.544  1.00 0.00   ? 278  HIS C ND1   1 
ATOM   6941  C  CD2   . HIS C 1 278  ? 91.634  140.744 91.157  1.00 0.00   ? 278  HIS C CD2   1 
ATOM   6942  C  CE1   . HIS C 1 278  ? 89.715  140.914 92.205  1.00 0.00   ? 278  HIS C CE1   1 
ATOM   6943  N  NE2   . HIS C 1 278  ? 90.527  141.530 91.364  1.00 0.00   ? 278  HIS C NE2   1 
ATOM   6944  N  N     . GLN C 1 279  ? 95.096  137.300 93.572  1.00 0.00   ? 279  GLN C N     1 
ATOM   6945  C  CA    . GLN C 1 279  ? 96.039  136.209 93.755  1.00 0.00   ? 279  GLN C CA    1 
ATOM   6946  C  C     . GLN C 1 279  ? 96.359  136.278 95.244  1.00 0.00   ? 279  GLN C C     1 
ATOM   6947  O  O     . GLN C 1 279  ? 96.337  137.361 95.830  1.00 0.00   ? 279  GLN C O     1 
ATOM   6948  C  CB    . GLN C 1 279  ? 97.315  136.423 92.934  1.00 0.00   ? 279  GLN C CB    1 
ATOM   6949  C  CG    . GLN C 1 279  ? 97.125  136.461 91.417  1.00 0.00   ? 279  GLN C CG    1 
ATOM   6950  C  CD    . GLN C 1 279  ? 98.449  136.481 90.670  1.00 0.00   ? 279  GLN C CD    1 
ATOM   6951  O  OE1   . GLN C 1 279  ? 99.511  136.640 91.274  1.00 0.00   ? 279  GLN C OE1   1 
ATOM   6952  N  NE2   . GLN C 1 279  ? 98.391  136.323 89.351  1.00 0.00   ? 279  GLN C NE2   1 
ATOM   6953  N  N     . ASP C 1 280  ? 96.634  135.138 95.868  1.00 0.00   ? 280  ASP C N     1 
ATOM   6954  C  CA    . ASP C 1 280  ? 96.929  135.140 97.296  1.00 0.00   ? 280  ASP C CA    1 
ATOM   6955  C  C     . ASP C 1 280  ? 98.284  134.505 97.589  1.00 0.00   ? 280  ASP C C     1 
ATOM   6956  O  O     . ASP C 1 280  ? 98.365  133.424 98.181  1.00 0.00   ? 280  ASP C O     1 
ATOM   6957  C  CB    . ASP C 1 280  ? 95.812  134.416 98.057  1.00 0.00   ? 280  ASP C CB    1 
ATOM   6958  C  CG    . ASP C 1 280  ? 95.831  134.707 99.543  1.00 0.00   ? 280  ASP C CG    1 
ATOM   6959  O  OD1   . ASP C 1 280  ? 96.417  135.738 99.933  1.00 0.00   ? 280  ASP C OD1   1 
ATOM   6960  O  OD2   . ASP C 1 280  ? 95.250  133.919 100.325 1.00 0.00   ? 280  ASP C OD2   1 
ATOM   6961  N  N     . LEU C 1 281  ? 99.350  135.192 97.181  1.00 0.00   ? 281  LEU C N     1 
ATOM   6962  C  CA    . LEU C 1 281  ? 100.712 134.705 97.383  1.00 0.00   ? 281  LEU C CA    1 
ATOM   6963  C  C     . LEU C 1 281  ? 101.352 135.380 98.594  1.00 0.00   ? 281  LEU C C     1 
ATOM   6964  O  O     . LEU C 1 281  ? 100.851 136.391 99.085  1.00 0.00   ? 281  LEU C O     1 
ATOM   6965  C  CB    . LEU C 1 281  ? 101.550 134.984 96.133  1.00 0.00   ? 281  LEU C CB    1 
ATOM   6966  C  CG    . LEU C 1 281  ? 100.934 134.519 94.812  1.00 0.00   ? 281  LEU C CG    1 
ATOM   6967  C  CD1   . LEU C 1 281  ? 101.776 135.002 93.641  1.00 0.00   ? 281  LEU C CD1   1 
ATOM   6968  C  CD2   . LEU C 1 281  ? 100.815 133.008 94.812  1.00 0.00   ? 281  LEU C CD2   1 
ATOM   6969  N  N     . GLU C 1 282  ? 102.459 134.817 99.069  1.00 0.00   ? 282  GLU C N     1 
ATOM   6970  C  CA    . GLU C 1 282  ? 103.166 135.367 100.218 1.00 0.00   ? 282  GLU C CA    1 
ATOM   6971  C  C     . GLU C 1 282  ? 104.675 135.235 100.070 1.00 0.00   ? 282  GLU C C     1 
ATOM   6972  O  O     . GLU C 1 282  ? 105.186 134.163 99.738  1.00 0.00   ? 282  GLU C O     1 
ATOM   6973  C  CB    . GLU C 1 282  ? 102.723 134.667 101.506 1.00 0.00   ? 282  GLU C CB    1 
ATOM   6974  C  CG    . GLU C 1 282  ? 103.240 135.314 102.786 1.00 0.00   ? 282  GLU C CG    1 
ATOM   6975  C  CD    . GLU C 1 282  ? 102.808 134.576 104.039 1.00 0.00   ? 282  GLU C CD    1 
ATOM   6976  O  OE1   . GLU C 1 282  ? 101.795 133.845 103.975 1.00 0.00   ? 282  GLU C OE1   1 
ATOM   6977  O  OE2   . GLU C 1 282  ? 103.465 134.733 105.093 1.00 0.00   ? 282  GLU C OE2   1 
ATOM   6978  N  N     . ILE C 1 283  ? 105.376 136.340 100.319 1.00 0.00   ? 283  ILE C N     1 
ATOM   6979  C  CA    . ILE C 1 283  ? 106.829 136.375 100.235 1.00 0.00   ? 283  ILE C CA    1 
ATOM   6980  C  C     . ILE C 1 283  ? 107.414 136.232 101.634 1.00 0.00   ? 283  ILE C C     1 
ATOM   6981  O  O     . ILE C 1 283  ? 107.142 137.052 102.519 1.00 0.00   ? 283  ILE C O     1 
ATOM   6982  C  CB    . ILE C 1 283  ? 107.327 137.708 99.625  1.00 0.00   ? 283  ILE C CB    1 
ATOM   6983  C  CG1   . ILE C 1 283  ? 106.674 137.941 98.255  1.00 0.00   ? 283  ILE C CG1   1 
ATOM   6984  C  CG2   . ILE C 1 283  ? 108.840 137.681 99.487  1.00 0.00   ? 283  ILE C CG2   1 
ATOM   6985  C  CD1   . ILE C 1 283  ? 106.947 136.850 97.242  1.00 0.00   ? 283  ILE C CD1   1 
ATOM   6986  N  N     . ILE C 1 284  ? 108.207 135.190 101.830 1.00 0.00   ? 284  ILE C N     1 
ATOM   6987  C  CA    . ILE C 1 284  ? 108.833 134.944 103.123 1.00 0.00   ? 284  ILE C CA    1 
ATOM   6988  C  C     . ILE C 1 284  ? 110.274 135.437 103.094 1.00 0.00   ? 284  ILE C C     1 
ATOM   6989  O  O     . ILE C 1 284  ? 111.068 135.027 102.245 1.00 0.00   ? 284  ILE C O     1 
ATOM   6990  C  CB    . ILE C 1 284  ? 108.837 133.439 103.478 1.00 0.00   ? 284  ILE C CB    1 
ATOM   6991  C  CG1   . ILE C 1 284  ? 107.413 132.876 103.387 1.00 0.00   ? 284  ILE C CG1   1 
ATOM   6992  C  CG2   . ILE C 1 284  ? 109.375 133.245 104.885 1.00 0.00   ? 284  ILE C CG2   1 
ATOM   6993  C  CD1   . ILE C 1 284  ? 106.408 133.558 104.297 1.00 0.00   ? 284  ILE C CD1   1 
ATOM   6994  N  N     . VAL C 1 285  ? 110.597 136.331 104.021 1.00 0.00   ? 285  VAL C N     1 
ATOM   6995  C  CA    . VAL C 1 285  ? 111.936 136.896 104.121 1.00 0.00   ? 285  VAL C CA    1 
ATOM   6996  C  C     . VAL C 1 285  ? 112.619 136.443 105.405 1.00 0.00   ? 285  VAL C C     1 
ATOM   6997  O  O     . VAL C 1 285  ? 112.172 136.762 106.505 1.00 0.00   ? 285  VAL C O     1 
ATOM   6998  C  CB    . VAL C 1 285  ? 111.902 138.435 104.113 1.00 0.00   ? 285  VAL C CB    1 
ATOM   6999  C  CG1   . VAL C 1 285  ? 113.316 138.980 104.128 1.00 0.00   ? 285  VAL C CG1   1 
ATOM   7000  C  CG2   . VAL C 1 285  ? 111.152 138.935 102.888 1.00 0.00   ? 285  VAL C CG2   1 
ATOM   7001  N  N     . ILE C 1 286  ? 113.710 135.702 105.256 1.00 0.00   ? 286  ILE C N     1 
ATOM   7002  C  CA    . ILE C 1 286  ? 114.442 135.202 106.412 1.00 0.00   ? 286  ILE C CA    1 
ATOM   7003  C  C     . ILE C 1 286  ? 115.818 135.844 106.547 1.00 0.00   ? 286  ILE C C     1 
ATOM   7004  O  O     . ILE C 1 286  ? 116.606 135.860 105.599 1.00 0.00   ? 286  ILE C O     1 
ATOM   7005  C  CB    . ILE C 1 286  ? 114.628 133.669 106.339 1.00 0.00   ? 286  ILE C CB    1 
ATOM   7006  C  CG1   . ILE C 1 286  ? 113.270 132.987 106.146 1.00 0.00   ? 286  ILE C CG1   1 
ATOM   7007  C  CG2   . ILE C 1 286  ? 115.291 133.171 107.616 1.00 0.00   ? 286  ILE C CG2   1 
ATOM   7008  C  CD1   . ILE C 1 286  ? 112.268 133.272 107.245 1.00 0.00   ? 286  ILE C CD1   1 
ATOM   7009  N  N     . LEU C 1 287  ? 116.098 136.375 107.733 1.00 0.00   ? 287  LEU C N     1 
ATOM   7010  C  CA    . LEU C 1 287  ? 117.388 136.997 108.005 1.00 0.00   ? 287  LEU C CA    1 
ATOM   7011  C  C     . LEU C 1 287  ? 118.081 136.243 109.133 1.00 0.00   ? 287  LEU C C     1 
ATOM   7012  O  O     . LEU C 1 287  ? 117.691 136.352 110.298 1.00 0.00   ? 287  LEU C O     1 
ATOM   7013  C  CB    . LEU C 1 287  ? 117.209 138.468 108.392 1.00 0.00   ? 287  LEU C CB    1 
ATOM   7014  C  CG    . LEU C 1 287  ? 118.480 139.209 108.824 1.00 0.00   ? 287  LEU C CG    1 
ATOM   7015  C  CD1   . LEU C 1 287  ? 119.509 139.169 107.706 1.00 0.00   ? 287  LEU C CD1   1 
ATOM   7016  C  CD2   . LEU C 1 287  ? 118.147 140.647 109.191 1.00 0.00   ? 287  LEU C CD2   1 
ATOM   7017  N  N     . GLU C 1 288  ? 119.101 135.469 108.783 1.00 0.00   ? 288  GLU C N     1 
ATOM   7018  C  CA    . GLU C 1 288  ? 119.844 134.694 109.767 1.00 0.00   ? 288  GLU C CA    1 
ATOM   7019  C  C     . GLU C 1 288  ? 121.170 135.381 110.102 1.00 0.00   ? 288  GLU C C     1 
ATOM   7020  O  O     . GLU C 1 288  ? 121.548 136.362 109.463 1.00 0.00   ? 288  GLU C O     1 
ATOM   7021  C  CB    . GLU C 1 288  ? 120.096 133.277 109.237 1.00 0.00   ? 288  GLU C CB    1 
ATOM   7022  C  CG    . GLU C 1 288  ? 118.842 132.594 108.698 1.00 0.00   ? 288  GLU C CG    1 
ATOM   7023  C  CD    . GLU C 1 288  ? 119.064 131.131 108.364 1.00 0.00   ? 288  GLU C CD    1 
ATOM   7024  O  OE1   . GLU C 1 288  ? 120.043 130.820 107.650 1.00 0.00   ? 288  GLU C OE1   1 
ATOM   7025  O  OE2   . GLU C 1 288  ? 118.257 130.290 108.816 1.00 0.00   ? 288  GLU C OE2   1 
ATOM   7026  N  N     . GLY C 1 289  ? 121.859 134.864 111.116 1.00 0.00   ? 289  GLY C N     1 
ATOM   7027  C  CA    . GLY C 1 289  ? 123.132 135.434 111.526 1.00 0.00   ? 289  GLY C CA    1 
ATOM   7028  C  C     . GLY C 1 289  ? 123.383 135.247 113.009 1.00 0.00   ? 289  GLY C C     1 
ATOM   7029  O  O     . GLY C 1 289  ? 122.481 134.857 113.750 1.00 0.00   ? 289  GLY C O     1 
ATOM   7030  N  N     . VAL C 1 290  ? 124.601 135.535 113.446 1.00 0.00   ? 290  VAL C N     1 
ATOM   7031  C  CA    . VAL C 1 290  ? 124.953 135.379 114.852 1.00 0.00   ? 290  VAL C CA    1 
ATOM   7032  C  C     . VAL C 1 290  ? 125.219 136.709 115.550 1.00 0.00   ? 290  VAL C C     1 
ATOM   7033  O  O     . VAL C 1 290  ? 125.817 137.618 114.972 1.00 0.00   ? 290  VAL C O     1 
ATOM   7034  C  CB    . VAL C 1 290  ? 126.201 134.493 115.021 1.00 0.00   ? 290  VAL C CB    1 
ATOM   7035  C  CG1   . VAL C 1 290  ? 127.367 135.073 114.244 1.00 0.00   ? 290  VAL C CG1   1 
ATOM   7036  C  CG2   . VAL C 1 290  ? 126.557 134.394 116.484 1.00 0.00   ? 290  VAL C CG2   1 
ATOM   7037  N  N     . VAL C 1 291  ? 124.767 136.817 116.797 1.00 0.00   ? 291  VAL C N     1 
ATOM   7038  C  CA    . VAL C 1 291  ? 124.984 138.033 117.567 1.00 0.00   ? 291  VAL C CA    1 
ATOM   7039  C  C     . VAL C 1 291  ? 126.453 138.074 117.972 1.00 0.00   ? 291  VAL C C     1 
ATOM   7040  O  O     . VAL C 1 291  ? 126.972 137.121 118.547 1.00 0.00   ? 291  VAL C O     1 
ATOM   7041  C  CB    . VAL C 1 291  ? 124.124 138.069 118.852 1.00 0.00   ? 291  VAL C CB    1 
ATOM   7042  C  CG1   . VAL C 1 291  ? 124.406 139.349 119.613 1.00 0.00   ? 291  VAL C CG1   1 
ATOM   7043  C  CG2   . VAL C 1 291  ? 122.642 137.980 118.506 1.00 0.00   ? 291  VAL C CG2   1 
ATOM   7044  N  N     . GLU C 1 292  ? 127.118 139.187 117.676 1.00 0.00   ? 292  GLU C N     1 
ATOM   7045  C  CA    . GLU C 1 292  ? 128.530 139.358 117.985 1.00 0.00   ? 292  GLU C CA    1 
ATOM   7046  C  C     . GLU C 1 292  ? 128.858 139.227 119.471 1.00 0.00   ? 292  GLU C C     1 
ATOM   7047  O  O     . GLU C 1 292  ? 130.001 138.952 119.833 1.00 0.00   ? 292  GLU C O     1 
ATOM   7048  C  CB    . GLU C 1 292  ? 129.004 140.730 117.499 1.00 0.00   ? 292  GLU C CB    1 
ATOM   7049  C  CG    . GLU C 1 292  ? 128.214 141.884 118.100 1.00 0.00   ? 292  GLU C CG    1 
ATOM   7050  C  CD    . GLU C 1 292  ? 128.892 143.228 117.900 1.00 0.00   ? 292  GLU C CD    1 
ATOM   7051  O  OE1   . GLU C 1 292  ? 129.145 143.604 116.734 1.00 0.00   ? 292  GLU C OE1   1 
ATOM   7052  O  OE2   . GLU C 1 292  ? 129.167 143.912 118.910 1.00 0.00   ? 292  GLU C OE2   1 
ATOM   7053  N  N     . THR C 1 293  ? 127.863 139.419 120.327 1.00 0.00   ? 293  THR C N     1 
ATOM   7054  C  CA    . THR C 1 293  ? 128.091 139.359 121.765 1.00 0.00   ? 293  THR C CA    1 
ATOM   7055  C  C     . THR C 1 293  ? 127.918 137.987 122.410 1.00 0.00   ? 293  THR C C     1 
ATOM   7056  O  O     . THR C 1 293  ? 128.614 137.659 123.367 1.00 0.00   ? 293  THR C O     1 
ATOM   7057  C  CB    . THR C 1 293  ? 127.174 140.352 122.494 1.00 0.00   ? 293  THR C CB    1 
ATOM   7058  O  OG1   . THR C 1 293  ? 125.813 139.926 122.382 1.00 0.00   ? 293  THR C OG1   1 
ATOM   7059  C  CG2   . THR C 1 293  ? 127.298 141.723 121.870 1.00 0.00   ? 293  THR C CG2   1 
ATOM   7060  N  N     . THR C 1 294  ? 126.991 137.185 121.892 1.00 0.00   ? 294  THR C N     1 
ATOM   7061  C  CA    . THR C 1 294  ? 126.747 135.871 122.475 1.00 0.00   ? 294  THR C CA    1 
ATOM   7062  C  C     . THR C 1 294  ? 127.252 134.688 121.656 1.00 0.00   ? 294  THR C C     1 
ATOM   7063  O  O     . THR C 1 294  ? 127.722 133.699 122.214 1.00 0.00   ? 294  THR C O     1 
ATOM   7064  C  CB    . THR C 1 294  ? 125.244 135.654 122.740 1.00 0.00   ? 294  THR C CB    1 
ATOM   7065  O  OG1   . THR C 1 294  ? 124.525 135.683 121.500 1.00 0.00   ? 294  THR C OG1   1 
ATOM   7066  C  CG2   . THR C 1 294  ? 124.701 136.738 123.654 1.00 0.00   ? 294  THR C CG2   1 
ATOM   7067  N  N     . GLY C 1 295  ? 127.155 134.788 120.336 1.00 0.00   ? 295  GLY C N     1 
ATOM   7068  C  CA    . GLY C 1 295  ? 127.600 133.691 119.495 1.00 0.00   ? 295  GLY C CA    1 
ATOM   7069  C  C     . GLY C 1 295  ? 126.415 132.805 119.182 1.00 0.00   ? 295  GLY C C     1 
ATOM   7070  O  O     . GLY C 1 295  ? 126.550 131.717 118.621 1.00 0.00   ? 295  GLY C O     1 
ATOM   7071  N  N     . ILE C 1 296  ? 125.239 133.297 119.558 1.00 0.00   ? 296  ILE C N     1 
ATOM   7072  C  CA    . ILE C 1 296  ? 123.979 132.599 119.349 1.00 0.00   ? 296  ILE C CA    1 
ATOM   7073  C  C     . ILE C 1 296  ? 123.389 132.984 117.993 1.00 0.00   ? 296  ILE C C     1 
ATOM   7074  O  O     . ILE C 1 296  ? 123.262 134.167 117.674 1.00 0.00   ? 296  ILE C O     1 
ATOM   7075  C  CB    . ILE C 1 296  ? 122.970 132.972 120.455 1.00 0.00   ? 296  ILE C CB    1 
ATOM   7076  C  CG1   . ILE C 1 296  ? 123.511 132.523 121.822 1.00 0.00   ? 296  ILE C CG1   1 
ATOM   7077  C  CG2   . ILE C 1 296  ? 121.635 132.328 120.185 1.00 0.00   ? 296  ILE C CG2   1 
ATOM   7078  C  CD1   . ILE C 1 296  ? 123.781 131.033 121.919 1.00 0.00   ? 296  ILE C CD1   1 
ATOM   7079  N  N     . THR C 1 297  ? 123.027 131.984 117.197 1.00 0.00   ? 297  THR C N     1 
ATOM   7080  C  CA    . THR C 1 297  ? 122.439 132.227 115.885 1.00 0.00   ? 297  THR C CA    1 
ATOM   7081  C  C     . THR C 1 297  ? 120.956 132.557 116.038 1.00 0.00   ? 297  THR C C     1 
ATOM   7082  O  O     . THR C 1 297  ? 120.235 131.871 116.761 1.00 0.00   ? 297  THR C O     1 
ATOM   7083  C  CB    . THR C 1 297  ? 122.568 130.992 114.982 1.00 0.00   ? 297  THR C CB    1 
ATOM   7084  O  OG1   . THR C 1 297  ? 123.950 130.647 114.824 1.00 0.00   ? 297  THR C OG1   1 
ATOM   7085  C  CG2   . THR C 1 297  ? 121.969 131.279 113.624 1.00 0.00   ? 297  THR C CG2   1 
ATOM   7086  N  N     . THR C 1 298  ? 120.495 133.603 115.355 1.00 0.00   ? 298  THR C N     1 
ATOM   7087  C  CA    . THR C 1 298  ? 119.092 134.002 115.438 1.00 0.00   ? 298  THR C CA    1 
ATOM   7088  C  C     . THR C 1 298  ? 118.438 134.188 114.075 1.00 0.00   ? 298  THR C C     1 
ATOM   7089  O  O     . THR C 1 298  ? 119.100 134.139 113.038 1.00 0.00   ? 298  THR C O     1 
ATOM   7090  C  CB    . THR C 1 298  ? 118.933 135.318 116.224 1.00 0.00   ? 298  THR C CB    1 
ATOM   7091  O  OG1   . THR C 1 298  ? 119.576 136.387 115.515 1.00 0.00   ? 298  THR C OG1   1 
ATOM   7092  C  CG2   . THR C 1 298  ? 119.560 135.186 117.594 1.00 0.00   ? 298  THR C CG2   1 
ATOM   7093  N  N     . GLN C 1 299  ? 117.124 134.401 114.089 1.00 0.00   ? 299  GLN C N     1 
ATOM   7094  C  CA    . GLN C 1 299  ? 116.362 134.612 112.868 1.00 0.00   ? 299  GLN C CA    1 
ATOM   7095  C  C     . GLN C 1 299  ? 115.403 135.784 112.990 1.00 0.00   ? 299  GLN C C     1 
ATOM   7096  O  O     . GLN C 1 299  ? 114.806 136.027 114.045 1.00 0.00   ? 299  GLN C O     1 
ATOM   7097  C  CB    . GLN C 1 299  ? 115.546 133.375 112.493 1.00 0.00   ? 299  GLN C CB    1 
ATOM   7098  C  CG    . GLN C 1 299  ? 116.299 132.299 111.721 1.00 0.00   ? 299  GLN C CG    1 
ATOM   7099  C  CD    . GLN C 1 299  ? 115.357 131.341 111.019 1.00 0.00   ? 299  GLN C CD    1 
ATOM   7100  O  OE1   . GLN C 1 299  ? 114.276 131.041 111.529 1.00 0.00   ? 299  GLN C OE1   1 
ATOM   7101  N  NE2   . GLN C 1 299  ? 115.756 130.850 109.849 1.00 0.00   ? 299  GLN C NE2   1 
ATOM   7102  N  N     . ALA C 1 300  ? 115.279 136.525 111.900 1.00 0.00   ? 300  ALA C N     1 
ATOM   7103  C  CA    . ALA C 1 300  ? 114.368 137.654 111.831 1.00 0.00   ? 300  ALA C CA    1 
ATOM   7104  C  C     . ALA C 1 300  ? 113.421 137.210 110.729 1.00 0.00   ? 300  ALA C C     1 
ATOM   7105  O  O     . ALA C 1 300  ? 113.833 137.034 109.577 1.00 0.00   ? 300  ALA C O     1 
ATOM   7106  C  CB    . ALA C 1 300  ? 115.116 138.909 111.421 1.00 0.00   ? 300  ALA C CB    1 
ATOM   7107  N  N     . ARG C 1 301  ? 112.162 136.995 111.093 1.00 0.00   ? 301  ARG C N     1 
ATOM   7108  C  CA    . ARG C 1 301  ? 111.161 136.529 110.137 1.00 0.00   ? 301  ARG C CA    1 
ATOM   7109  C  C     . ARG C 1 301  ? 110.045 137.528 109.870 1.00 0.00   ? 301  ARG C C     1 
ATOM   7110  O  O     . ARG C 1 301  ? 109.486 138.123 110.793 1.00 0.00   ? 301  ARG C O     1 
ATOM   7111  C  CB    . ARG C 1 301  ? 110.564 135.208 110.628 1.00 0.00   ? 301  ARG C CB    1 
ATOM   7112  C  CG    . ARG C 1 301  ? 111.592 134.084 110.753 1.00 0.00   ? 301  ARG C CG    1 
ATOM   7113  C  CD    . ARG C 1 301  ? 110.973 132.851 111.384 1.00 0.00   ? 301  ARG C CD    1 
ATOM   7114  N  NE    . ARG C 1 301  ? 110.556 133.115 112.762 1.00 0.00   ? 301  ARG C NE    1 
ATOM   7115  C  CZ    . ARG C 1 301  ? 111.333 132.949 113.828 1.00 0.00   ? 301  ARG C CZ    1 
ATOM   7116  N  NH1   . ARG C 1 301  ? 112.577 132.514 113.683 1.00 0.00   ? 301  ARG C NH1   1 
ATOM   7117  N  NH2   . ARG C 1 301  ? 110.864 133.221 115.039 1.00 0.00   ? 301  ARG C NH2   1 
ATOM   7118  N  N     . THR C 1 302  ? 109.732 137.702 108.592 1.00 0.00   ? 302  THR C N     1 
ATOM   7119  C  CA    . THR C 1 302  ? 108.678 138.618 108.163 1.00 0.00   ? 302  THR C CA    1 
ATOM   7120  C  C     . THR C 1 302  ? 108.047 138.075 106.887 1.00 0.00   ? 302  THR C C     1 
ATOM   7121  O  O     . THR C 1 302  ? 108.564 137.139 106.274 1.00 0.00   ? 302  THR C O     1 
ATOM   7122  C  CB    . THR C 1 302  ? 109.237 140.029 107.879 1.00 0.00   ? 302  THR C CB    1 
ATOM   7123  O  OG1   . THR C 1 302  ? 108.148 140.951 107.723 1.00 0.00   ? 302  THR C OG1   1 
ATOM   7124  C  CG2   . THR C 1 302  ? 110.069 140.030 106.608 1.00 0.00   ? 302  THR C CG2   1 
ATOM   7125  N  N     . SER C 1 303  ? 106.931 138.670 106.488 1.00 0.00   ? 303  SER C N     1 
ATOM   7126  C  CA    . SER C 1 303  ? 106.241 138.236 105.285 1.00 0.00   ? 303  SER C CA    1 
ATOM   7127  C  C     . SER C 1 303  ? 105.561 139.406 104.587 1.00 0.00   ? 303  SER C C     1 
ATOM   7128  O  O     . SER C 1 303  ? 105.304 140.446 105.190 1.00 0.00   ? 303  SER C O     1 
ATOM   7129  C  CB    . SER C 1 303  ? 105.200 137.173 105.632 1.00 0.00   ? 303  SER C CB    1 
ATOM   7130  O  OG    . SER C 1 303  ? 104.227 137.672 106.533 1.00 0.00   ? 303  SER C OG    1 
ATOM   7131  N  N     . TYR C 1 304  ? 105.288 139.218 103.303 1.00 0.00   ? 304  TYR C N     1 
ATOM   7132  C  CA    . TYR C 1 304  ? 104.628 140.237 102.503 1.00 0.00   ? 304  TYR C CA    1 
ATOM   7133  C  C     . TYR C 1 304  ? 103.533 139.595 101.664 1.00 0.00   ? 304  TYR C C     1 
ATOM   7134  O  O     . TYR C 1 304  ? 103.806 138.820 100.743 1.00 0.00   ? 304  TYR C O     1 
ATOM   7135  C  CB    . TYR C 1 304  ? 105.637 140.942 101.589 1.00 0.00   ? 304  TYR C CB    1 
ATOM   7136  C  CG    . TYR C 1 304  ? 106.702 141.715 102.336 1.00 0.00   ? 304  TYR C CG    1 
ATOM   7137  C  CD1   . TYR C 1 304  ? 107.808 141.066 102.889 1.00 0.00   ? 304  TYR C CD1   1 
ATOM   7138  C  CD2   . TYR C 1 304  ? 106.594 143.095 102.510 1.00 0.00   ? 304  TYR C CD2   1 
ATOM   7139  C  CE1   . TYR C 1 304  ? 108.774 141.772 103.596 1.00 0.00   ? 304  TYR C CE1   1 
ATOM   7140  C  CE2   . TYR C 1 304  ? 107.555 143.810 103.218 1.00 0.00   ? 304  TYR C CE2   1 
ATOM   7141  C  CZ    . TYR C 1 304  ? 108.640 143.141 103.754 1.00 0.00   ? 304  TYR C CZ    1 
ATOM   7142  O  OH    . TYR C 1 304  ? 109.591 143.845 104.458 1.00 0.00   ? 304  TYR C OH    1 
ATOM   7143  N  N     . LEU C 1 305  ? 102.286 139.900 102.001 1.00 0.00   ? 305  LEU C N     1 
ATOM   7144  C  CA    . LEU C 1 305  ? 101.155 139.363 101.262 1.00 0.00   ? 305  LEU C CA    1 
ATOM   7145  C  C     . LEU C 1 305  ? 101.045 140.158 99.969  1.00 0.00   ? 305  LEU C C     1 
ATOM   7146  O  O     . LEU C 1 305  ? 101.754 141.148 99.783  1.00 0.00   ? 305  LEU C O     1 
ATOM   7147  C  CB    . LEU C 1 305  ? 99.872  139.481 102.091 1.00 0.00   ? 305  LEU C CB    1 
ATOM   7148  C  CG    . LEU C 1 305  ? 99.714  138.494 103.257 1.00 0.00   ? 305  LEU C CG    1 
ATOM   7149  C  CD1   . LEU C 1 305  ? 99.580  137.077 102.716 1.00 0.00   ? 305  LEU C CD1   1 
ATOM   7150  C  CD2   . LEU C 1 305  ? 100.908 138.593 104.197 1.00 0.00   ? 305  LEU C CD2   1 
ATOM   7151  N  N     . ALA C 1 306  ? 100.163 139.727 99.076  1.00 0.00   ? 306  ALA C N     1 
ATOM   7152  C  CA    . ALA C 1 306  ? 99.998  140.396 97.791  1.00 0.00   ? 306  ALA C CA    1 
ATOM   7153  C  C     . ALA C 1 306  ? 99.628  141.878 97.930  1.00 0.00   ? 306  ALA C C     1 
ATOM   7154  O  O     . ALA C 1 306  ? 100.121 142.717 97.179  1.00 0.00   ? 306  ALA C O     1 
ATOM   7155  C  CB    . ALA C 1 306  ? 98.940  139.659 96.971  1.00 0.00   ? 306  ALA C CB    1 
ATOM   7156  N  N     . ASP C 1 307  ? 98.775  142.190 98.900  1.00 0.00   ? 307  ASP C N     1 
ATOM   7157  C  CA    . ASP C 1 307  ? 98.339  143.565 99.127  1.00 0.00   ? 307  ASP C CA    1 
ATOM   7158  C  C     . ASP C 1 307  ? 99.318  144.419 99.931  1.00 0.00   ? 307  ASP C C     1 
ATOM   7159  O  O     . ASP C 1 307  ? 98.995  145.545 100.309 1.00 0.00   ? 307  ASP C O     1 
ATOM   7160  C  CB    . ASP C 1 307  ? 96.980  143.580 99.826  1.00 0.00   ? 307  ASP C CB    1 
ATOM   7161  C  CG    . ASP C 1 307  ? 96.971  142.753 101.090 1.00 0.00   ? 307  ASP C CG    1 
ATOM   7162  O  OD1   . ASP C 1 307  ? 98.060  142.525 101.669 1.00 0.00   ? 307  ASP C OD1   1 
ATOM   7163  O  OD2   . ASP C 1 307  ? 95.874  142.332 101.520 1.00 0.00   ? 307  ASP C OD2   1 
ATOM   7164  N  N     . GLU C 1 308  ? 100.498 143.877 100.214 1.00 0.00   ? 308  GLU C N     1 
ATOM   7165  C  CA    . GLU C 1 308  ? 101.505 144.612 100.969 1.00 0.00   ? 308  GLU C CA    1 
ATOM   7166  C  C     . GLU C 1 308  ? 102.648 145.006 100.047 1.00 0.00   ? 308  GLU C C     1 
ATOM   7167  O  O     . GLU C 1 308  ? 103.633 145.613 100.472 1.00 0.00   ? 308  GLU C O     1 
ATOM   7168  C  CB    . GLU C 1 308  ? 102.024 143.764 102.129 1.00 0.00   ? 308  GLU C CB    1 
ATOM   7169  N  N     . ILE C 1 309  ? 102.495 144.653 98.774  1.00 0.00   ? 309  ILE C N     1 
ATOM   7170  C  CA    . ILE C 1 309  ? 103.484 144.956 97.749  1.00 0.00   ? 309  ILE C CA    1 
ATOM   7171  C  C     . ILE C 1 309  ? 102.947 146.108 96.906  1.00 0.00   ? 309  ILE C C     1 
ATOM   7172  O  O     . ILE C 1 309  ? 101.762 146.138 96.567  1.00 0.00   ? 309  ILE C O     1 
ATOM   7173  C  CB    . ILE C 1 309  ? 103.732 143.742 96.825  1.00 0.00   ? 309  ILE C CB    1 
ATOM   7174  C  CG1   . ILE C 1 309  ? 104.170 142.534 97.660  1.00 0.00   ? 309  ILE C CG1   1 
ATOM   7175  C  CG2   . ILE C 1 309  ? 104.796 144.078 95.790  1.00 0.00   ? 309  ILE C CG2   1 
ATOM   7176  C  CD1   . ILE C 1 309  ? 105.444 142.753 98.440  1.00 0.00   ? 309  ILE C CD1   1 
ATOM   7177  N  N     . LEU C 1 310  ? 103.813 147.055 96.571  1.00 0.00   ? 310  LEU C N     1 
ATOM   7178  C  CA    . LEU C 1 310  ? 103.407 148.204 95.769  1.00 0.00   ? 310  LEU C CA    1 
ATOM   7179  C  C     . LEU C 1 310  ? 104.040 148.122 94.387  1.00 0.00   ? 310  LEU C C     1 
ATOM   7180  O  O     . LEU C 1 310  ? 105.210 147.764 94.250  1.00 0.00   ? 310  LEU C O     1 
ATOM   7181  C  CB    . LEU C 1 310  ? 103.830 149.500 96.462  1.00 0.00   ? 310  LEU C CB    1 
ATOM   7182  C  CG    . LEU C 1 310  ? 103.151 149.796 97.807  1.00 0.00   ? 310  LEU C CG    1 
ATOM   7183  C  CD1   . LEU C 1 310  ? 103.780 151.031 98.434  1.00 0.00   ? 310  LEU C CD1   1 
ATOM   7184  C  CD2   . LEU C 1 310  ? 101.657 149.999 97.606  1.00 0.00   ? 310  LEU C CD2   1 
ATOM   7185  N  N     . TRP C 1 311  ? 103.259 148.444 93.360  1.00 0.00   ? 311  TRP C N     1 
ATOM   7186  C  CA    . TRP C 1 311  ? 103.757 148.397 91.993  1.00 0.00   ? 311  TRP C CA    1 
ATOM   7187  C  C     . TRP C 1 311  ? 103.925 149.788 91.402  1.00 0.00   ? 311  TRP C C     1 
ATOM   7188  O  O     . TRP C 1 311  ? 102.973 150.567 91.326  1.00 0.00   ? 311  TRP C O     1 
ATOM   7189  C  CB    . TRP C 1 311  ? 102.819 147.568 91.108  1.00 0.00   ? 311  TRP C CB    1 
ATOM   7190  C  CG    . TRP C 1 311  ? 103.360 147.298 89.739  1.00 0.00   ? 311  TRP C CG    1 
ATOM   7191  C  CD1   . TRP C 1 311  ? 103.560 148.207 88.737  1.00 0.00   ? 311  TRP C CD1   1 
ATOM   7192  C  CD2   . TRP C 1 311  ? 103.802 146.034 89.232  1.00 0.00   ? 311  TRP C CD2   1 
ATOM   7193  N  NE1   . TRP C 1 311  ? 104.102 147.580 87.637  1.00 0.00   ? 311  TRP C NE1   1 
ATOM   7194  C  CE2   . TRP C 1 311  ? 104.260 146.251 87.910  1.00 0.00   ? 311  TRP C CE2   1 
ATOM   7195  C  CE3   . TRP C 1 311  ? 103.859 144.742 89.766  1.00 0.00   ? 311  TRP C CE3   1 
ATOM   7196  C  CZ2   . TRP C 1 311  ? 104.768 145.215 87.117  1.00 0.00   ? 311  TRP C CZ2   1 
ATOM   7197  C  CZ3   . TRP C 1 311  ? 104.369 143.713 88.974  1.00 0.00   ? 311  TRP C CZ3   1 
ATOM   7198  C  CH2   . TRP C 1 311  ? 104.814 143.959 87.662  1.00 0.00   ? 311  TRP C CH2   1 
ATOM   7199  N  N     . GLY C 1 312  ? 105.148 150.093 90.982  1.00 0.00   ? 312  GLY C N     1 
ATOM   7200  C  CA    . GLY C 1 312  ? 105.433 151.384 90.397  1.00 0.00   ? 312  GLY C CA    1 
ATOM   7201  C  C     . GLY C 1 312  ? 105.976 152.378 91.400  1.00 0.00   ? 312  GLY C C     1 
ATOM   7202  O  O     . GLY C 1 312  ? 106.010 153.583 91.138  1.00 0.00   ? 312  GLY C O     1 
ATOM   7203  N  N     . GLN C 1 313  ? 106.397 151.867 92.552  1.00 0.00   ? 313  GLN C N     1 
ATOM   7204  C  CA    . GLN C 1 313  ? 106.950 152.687 93.623  1.00 0.00   ? 313  GLN C CA    1 
ATOM   7205  C  C     . GLN C 1 313  ? 108.306 152.152 94.076  1.00 0.00   ? 313  GLN C C     1 
ATOM   7206  O  O     . GLN C 1 313  ? 108.589 150.962 93.936  1.00 0.00   ? 313  GLN C O     1 
ATOM   7207  C  CB    . GLN C 1 313  ? 106.001 152.696 94.831  1.00 0.00   ? 313  GLN C CB    1 
ATOM   7208  C  CG    . GLN C 1 313  ? 104.678 153.428 94.640  1.00 0.00   ? 313  GLN C CG    1 
ATOM   7209  C  CD    . GLN C 1 313  ? 103.846 153.443 95.910  1.00 0.00   ? 313  GLN C CD    1 
ATOM   7210  O  OE1   . GLN C 1 313  ? 104.293 153.920 96.954  1.00 0.00   ? 313  GLN C OE1   1 
ATOM   7211  N  NE2   . GLN C 1 313  ? 102.628 152.920 95.828  1.00 0.00   ? 313  GLN C NE2   1 
ATOM   7212  N  N     . ARG C 1 314  ? 109.125 153.062 94.588  1.00 0.00   ? 314  ARG C N     1 
ATOM   7213  C  CA    . ARG C 1 314  ? 110.460 152.756 95.071  1.00 0.00   ? 314  ARG C CA    1 
ATOM   7214  C  C     . ARG C 1 314  ? 110.686 153.364 96.452  1.00 0.00   ? 314  ARG C C     1 
ATOM   7215  O  O     . ARG C 1 314  ? 109.822 154.059 96.989  1.00 0.00   ? 314  ARG C O     1 
ATOM   7216  C  CB    . ARG C 1 314  ? 111.485 153.304 94.092  1.00 0.00   ? 314  ARG C CB    1 
ATOM   7217  C  CG    . ARG C 1 314  ? 111.124 154.686 93.592  1.00 0.00   ? 314  ARG C CG    1 
ATOM   7218  C  CD    . ARG C 1 314  ? 111.866 155.035 92.316  1.00 0.00   ? 314  ARG C CD    1 
ATOM   7219  N  NE    . ARG C 1 314  ? 111.532 156.381 91.866  1.00 0.00   ? 314  ARG C NE    1 
ATOM   7220  C  CZ    . ARG C 1 314  ? 111.859 157.488 92.523  1.00 0.00   ? 314  ARG C CZ    1 
ATOM   7221  N  NH1   . ARG C 1 314  ? 112.529 157.409 93.663  1.00 0.00   ? 314  ARG C NH1   1 
ATOM   7222  N  NH2   . ARG C 1 314  ? 111.514 158.672 92.043  1.00 0.00   ? 314  ARG C NH2   1 
ATOM   7223  N  N     . PHE C 1 315  ? 111.854 153.114 97.025  1.00 0.00   ? 315  PHE C N     1 
ATOM   7224  C  CA    . PHE C 1 315  ? 112.146 153.631 98.354  1.00 0.00   ? 315  PHE C CA    1 
ATOM   7225  C  C     . PHE C 1 315  ? 112.824 154.986 98.359  1.00 0.00   ? 315  PHE C C     1 
ATOM   7226  O  O     . PHE C 1 315  ? 113.620 155.302 97.480  1.00 0.00   ? 315  PHE C O     1 
ATOM   7227  C  CB    . PHE C 1 315  ? 112.973 152.625 99.144  1.00 0.00   ? 315  PHE C CB    1 
ATOM   7228  C  CG    . PHE C 1 315  ? 112.155 151.528 99.742  1.00 0.00   ? 315  PHE C CG    1 
ATOM   7229  C  CD1   . PHE C 1 315  ? 111.536 150.596 98.935  1.00 0.00   ? 315  PHE C CD1   1 
ATOM   7230  C  CD2   . PHE C 1 315  ? 111.993 151.438 101.109 1.00 0.00   ? 315  PHE C CD2   1 
ATOM   7231  C  CE1   . PHE C 1 315  ? 110.775 149.586 99.481  1.00 0.00   ? 315  PHE C CE1   1 
ATOM   7232  C  CE2   . PHE C 1 315  ? 111.234 150.432 101.663 1.00 0.00   ? 315  PHE C CE2   1 
ATOM   7233  C  CZ    . PHE C 1 315  ? 110.623 149.505 100.847 1.00 0.00   ? 315  PHE C CZ    1 
ATOM   7234  N  N     . VAL C 1 316  ? 112.495 155.782 99.367  1.00 0.00   ? 316  VAL C N     1 
ATOM   7235  C  CA    . VAL C 1 316  ? 113.062 157.117 99.526  1.00 0.00   ? 316  VAL C CA    1 
ATOM   7236  C  C     . VAL C 1 316  ? 114.414 156.957 100.224 1.00 0.00   ? 316  VAL C C     1 
ATOM   7237  O  O     . VAL C 1 316  ? 114.551 156.145 101.138 1.00 0.00   ? 316  VAL C O     1 
ATOM   7238  C  CB    . VAL C 1 316  ? 112.160 158.009 100.417 1.00 0.00   ? 316  VAL C CB    1 
ATOM   7239  C  CG1   . VAL C 1 316  ? 112.837 159.340 100.662 1.00 0.00   ? 316  VAL C CG1   1 
ATOM   7240  C  CG2   . VAL C 1 316  ? 110.803 158.224 99.758  1.00 0.00   ? 316  VAL C CG2   1 
ATOM   7241  N  N     . PRO C 1 317  ? 115.429 157.730 99.807  1.00 0.00   ? 317  PRO C N     1 
ATOM   7242  C  CA    . PRO C 1 317  ? 116.730 157.588 100.466 1.00 0.00   ? 317  PRO C CA    1 
ATOM   7243  C  C     . PRO C 1 317  ? 116.640 157.848 101.965 1.00 0.00   ? 317  PRO C C     1 
ATOM   7244  O  O     . PRO C 1 317  ? 115.978 158.789 102.405 1.00 0.00   ? 317  PRO C O     1 
ATOM   7245  C  CB    . PRO C 1 317  ? 117.589 158.624 99.755  1.00 0.00   ? 317  PRO C CB    1 
ATOM   7246  C  CG    . PRO C 1 317  ? 117.018 158.622 98.369  1.00 0.00   ? 317  PRO C CG    1 
ATOM   7247  C  CD    . PRO C 1 317  ? 115.532 158.621 98.638  1.00 0.00   ? 317  PRO C CD    1 
ATOM   7248  N  N     . ILE C 1 318  ? 117.309 157.009 102.754 1.00 0.00   ? 318  ILE C N     1 
ATOM   7249  C  CA    . ILE C 1 318  ? 117.287 157.134 104.210 1.00 0.00   ? 318  ILE C CA    1 
ATOM   7250  C  C     . ILE C 1 318  ? 118.529 157.821 104.772 1.00 0.00   ? 318  ILE C C     1 
ATOM   7251  O  O     . ILE C 1 318  ? 118.428 158.688 105.637 1.00 0.00   ? 318  ILE C O     1 
ATOM   7252  C  CB    . ILE C 1 318  ? 117.156 155.747 104.867 1.00 0.00   ? 318  ILE C CB    1 
ATOM   7253  C  CG1   . ILE C 1 318  ? 115.907 155.045 104.343 1.00 0.00   ? 318  ILE C CG1   1 
ATOM   7254  C  CG2   . ILE C 1 318  ? 117.065 155.896 106.376 1.00 0.00   ? 318  ILE C CG2   1 
ATOM   7255  C  CD1   . ILE C 1 318  ? 114.632 155.778 104.650 1.00 0.00   ? 318  ILE C CD1   1 
ATOM   7256  N  N     . VAL C 1 319  ? 119.700 157.419 104.282 1.00 0.00   ? 319  VAL C N     1 
ATOM   7257  C  CA    . VAL C 1 319  ? 120.964 157.967 104.762 1.00 0.00   ? 319  VAL C CA    1 
ATOM   7258  C  C     . VAL C 1 319  ? 121.322 159.362 104.250 1.00 0.00   ? 319  VAL C C     1 
ATOM   7259  O  O     . VAL C 1 319  ? 121.327 159.617 103.047 1.00 0.00   ? 319  VAL C O     1 
ATOM   7260  C  CB    . VAL C 1 319  ? 122.147 157.034 104.416 1.00 0.00   ? 319  VAL C CB    1 
ATOM   7261  C  CG1   . VAL C 1 319  ? 123.447 157.627 104.943 1.00 0.00   ? 319  VAL C CG1   1 
ATOM   7262  C  CG2   . VAL C 1 319  ? 121.920 155.657 105.014 1.00 0.00   ? 319  VAL C CG2   1 
ATOM   7263  N  N     . ALA C 1 320  ? 121.635 160.254 105.185 1.00 0.00   ? 320  ALA C N     1 
ATOM   7264  C  CA    . ALA C 1 320  ? 122.042 161.614 104.871 1.00 0.00   ? 320  ALA C CA    1 
ATOM   7265  C  C     . ALA C 1 320  ? 123.509 161.698 105.282 1.00 0.00   ? 320  ALA C C     1 
ATOM   7266  O  O     . ALA C 1 320  ? 124.111 160.673 105.596 1.00 0.00   ? 320  ALA C O     1 
ATOM   7267  C  CB    . ALA C 1 320  ? 121.211 162.618 105.659 1.00 0.00   ? 320  ALA C CB    1 
ATOM   7268  N  N     . GLU C 1 321  ? 124.089 162.893 105.289 1.00 0.00   ? 321  GLU C N     1 
ATOM   7269  C  CA    . GLU C 1 321  ? 125.489 163.019 105.681 1.00 0.00   ? 321  GLU C CA    1 
ATOM   7270  C  C     . GLU C 1 321  ? 125.810 164.288 106.459 1.00 0.00   ? 321  GLU C C     1 
ATOM   7271  O  O     . GLU C 1 321  ? 125.533 165.400 106.000 1.00 0.00   ? 321  GLU C O     1 
ATOM   7272  C  CB    . GLU C 1 321  ? 126.395 162.947 104.443 1.00 0.00   ? 321  GLU C CB    1 
ATOM   7273  C  CG    . GLU C 1 321  ? 127.875 162.749 104.766 1.00 0.00   ? 321  GLU C CG    1 
ATOM   7274  C  CD    . GLU C 1 321  ? 128.767 162.787 103.535 1.00 0.00   ? 321  GLU C CD    1 
ATOM   7275  O  OE1   . GLU C 1 321  ? 128.464 162.077 102.551 1.00 0.00   ? 321  GLU C OE1   1 
ATOM   7276  O  OE2   . GLU C 1 321  ? 129.781 163.521 103.556 1.00 0.00   ? 321  GLU C OE2   1 
ATOM   7277  N  N     . GLU C 1 322  ? 126.383 164.118 107.646 1.00 0.00   ? 322  GLU C N     1 
ATOM   7278  C  CA    . GLU C 1 322  ? 126.781 165.251 108.475 1.00 0.00   ? 322  GLU C CA    1 
ATOM   7279  C  C     . GLU C 1 322  ? 128.236 165.516 108.099 1.00 0.00   ? 322  GLU C C     1 
ATOM   7280  O  O     . GLU C 1 322  ? 128.843 164.718 107.387 1.00 0.00   ? 322  GLU C O     1 
ATOM   7281  C  CB    . GLU C 1 322  ? 126.657 164.899 109.967 1.00 0.00   ? 322  GLU C CB    1 
ATOM   7282  C  CG    . GLU C 1 322  ? 125.247 164.485 110.385 1.00 0.00   ? 322  GLU C CG    1 
ATOM   7283  C  CD    . GLU C 1 322  ? 125.084 164.328 111.888 1.00 0.00   ? 322  GLU C CD    1 
ATOM   7284  O  OE1   . GLU C 1 322  ? 126.106 164.244 112.602 1.00 0.00   ? 322  GLU C OE1   1 
ATOM   7285  O  OE2   . GLU C 1 322  ? 123.925 164.280 112.360 1.00 0.00   ? 322  GLU C OE2   1 
ATOM   7286  N  N     . ASP C 1 323  ? 128.802 166.625 108.560 1.00 0.00   ? 323  ASP C N     1 
ATOM   7287  C  CA    . ASP C 1 323  ? 130.182 166.944 108.223 1.00 0.00   ? 323  ASP C CA    1 
ATOM   7288  C  C     . ASP C 1 323  ? 131.179 165.889 108.697 1.00 0.00   ? 323  ASP C C     1 
ATOM   7289  O  O     . ASP C 1 323  ? 132.230 165.701 108.085 1.00 0.00   ? 323  ASP C O     1 
ATOM   7290  C  CB    . ASP C 1 323  ? 130.575 168.304 108.800 1.00 0.00   ? 323  ASP C CB    1 
ATOM   7291  C  CG    . ASP C 1 323  ? 129.723 169.430 108.261 1.00 0.00   ? 323  ASP C CG    1 
ATOM   7292  O  OD1   . ASP C 1 323  ? 129.314 169.355 107.081 1.00 0.00   ? 323  ASP C OD1   1 
ATOM   7293  O  OD2   . ASP C 1 323  ? 129.471 170.399 109.010 1.00 0.00   ? 323  ASP C OD2   1 
ATOM   7294  N  N     . GLY C 1 324  ? 130.845 165.200 109.781 1.00 0.00   ? 324  GLY C N     1 
ATOM   7295  C  CA    . GLY C 1 324  ? 131.744 164.189 110.304 1.00 0.00   ? 324  GLY C CA    1 
ATOM   7296  C  C     . GLY C 1 324  ? 131.304 162.745 110.184 1.00 0.00   ? 324  GLY C C     1 
ATOM   7297  O  O     . GLY C 1 324  ? 132.130 161.838 110.292 1.00 0.00   ? 324  GLY C O     1 
ATOM   7298  N  N     . ARG C 1 325  ? 130.016 162.509 109.952 1.00 0.00   ? 325  ARG C N     1 
ATOM   7299  C  CA    . ARG C 1 325  ? 129.526 161.138 109.854 1.00 0.00   ? 325  ARG C CA    1 
ATOM   7300  C  C     . ARG C 1 325  ? 128.345 160.964 108.906 1.00 0.00   ? 325  ARG C C     1 
ATOM   7301  O  O     . ARG C 1 325  ? 127.910 161.905 108.243 1.00 0.00   ? 325  ARG C O     1 
ATOM   7302  C  CB    . ARG C 1 325  ? 129.128 160.645 111.247 1.00 0.00   ? 325  ARG C CB    1 
ATOM   7303  C  CG    . ARG C 1 325  ? 127.983 161.432 111.899 1.00 0.00   ? 325  ARG C CG    1 
ATOM   7304  C  CD    . ARG C 1 325  ? 127.736 160.973 113.336 1.00 0.00   ? 325  ARG C CD    1 
ATOM   7305  N  NE    . ARG C 1 325  ? 128.890 161.228 114.195 1.00 0.00   ? 325  ARG C NE    1 
ATOM   7306  C  CZ    . ARG C 1 325  ? 129.323 162.437 114.537 1.00 0.00   ? 325  ARG C CZ    1 
ATOM   7307  N  NH1   . ARG C 1 325  ? 128.699 163.524 114.098 1.00 0.00   ? 325  ARG C NH1   1 
ATOM   7308  N  NH2   . ARG C 1 325  ? 130.393 162.561 115.312 1.00 0.00   ? 325  ARG C NH2   1 
ATOM   7309  N  N     . TYR C 1 326  ? 127.853 159.728 108.846 1.00 0.00   ? 326  TYR C N     1 
ATOM   7310  C  CA    . TYR C 1 326  ? 126.705 159.383 108.023 1.00 0.00   ? 326  TYR C CA    1 
ATOM   7311  C  C     . TYR C 1 326  ? 125.535 159.218 108.984 1.00 0.00   ? 326  TYR C C     1 
ATOM   7312  O  O     . TYR C 1 326  ? 125.697 158.666 110.076 1.00 0.00   ? 326  TYR C O     1 
ATOM   7313  C  CB    . TYR C 1 326  ? 126.955 158.081 107.259 1.00 0.00   ? 326  TYR C CB    1 
ATOM   7314  C  CG    . TYR C 1 326  ? 127.927 158.217 106.105 1.00 0.00   ? 326  TYR C CG    1 
ATOM   7315  C  CD1   . TYR C 1 326  ? 129.290 157.979 106.277 1.00 0.00   ? 326  TYR C CD1   1 
ATOM   7316  C  CD2   . TYR C 1 326  ? 127.481 158.609 104.846 1.00 0.00   ? 326  TYR C CD2   1 
ATOM   7317  C  CE1   . TYR C 1 326  ? 130.186 158.129 105.215 1.00 0.00   ? 326  TYR C CE1   1 
ATOM   7318  C  CE2   . TYR C 1 326  ? 128.365 158.766 103.782 1.00 0.00   ? 326  TYR C CE2   1 
ATOM   7319  C  CZ    . TYR C 1 326  ? 129.716 158.526 103.970 1.00 0.00   ? 326  TYR C CZ    1 
ATOM   7320  O  OH    . TYR C 1 326  ? 130.591 158.683 102.920 1.00 0.00   ? 326  TYR C OH    1 
ATOM   7321  N  N     . SER C 1 327  ? 124.364 159.705 108.594 1.00 0.00   ? 327  SER C N     1 
ATOM   7322  C  CA    . SER C 1 327  ? 123.199 159.619 109.463 1.00 0.00   ? 327  SER C CA    1 
ATOM   7323  C  C     . SER C 1 327  ? 122.019 158.894 108.826 1.00 0.00   ? 327  SER C C     1 
ATOM   7324  O  O     . SER C 1 327  ? 121.730 159.069 107.643 1.00 0.00   ? 327  SER C O     1 
ATOM   7325  C  CB    . SER C 1 327  ? 122.766 161.025 109.888 1.00 0.00   ? 327  SER C CB    1 
ATOM   7326  O  OG    . SER C 1 327  ? 121.710 160.967 110.827 1.00 0.00   ? 327  SER C OG    1 
ATOM   7327  N  N     . VAL C 1 328  ? 121.339 158.082 109.626 1.00 0.00   ? 328  VAL C N     1 
ATOM   7328  C  CA    . VAL C 1 328  ? 120.191 157.329 109.149 1.00 0.00   ? 328  VAL C CA    1 
ATOM   7329  C  C     . VAL C 1 328  ? 118.899 157.842 109.777 1.00 0.00   ? 328  VAL C C     1 
ATOM   7330  O  O     . VAL C 1 328  ? 118.778 157.916 110.999 1.00 0.00   ? 328  VAL C O     1 
ATOM   7331  C  CB    . VAL C 1 328  ? 120.320 155.824 109.474 1.00 0.00   ? 328  VAL C CB    1 
ATOM   7332  C  CG1   . VAL C 1 328  ? 119.147 155.071 108.885 1.00 0.00   ? 328  VAL C CG1   1 
ATOM   7333  C  CG2   . VAL C 1 328  ? 121.625 155.279 108.926 1.00 0.00   ? 328  VAL C CG2   1 
ATOM   7334  N  N     . ASP C 1 329  ? 117.939 158.190 108.931 1.00 0.00   ? 329  ASP C N     1 
ATOM   7335  C  CA    . ASP C 1 329  ? 116.642 158.666 109.386 1.00 0.00   ? 329  ASP C CA    1 
ATOM   7336  C  C     . ASP C 1 329  ? 115.682 157.484 109.331 1.00 0.00   ? 329  ASP C C     1 
ATOM   7337  O  O     . ASP C 1 329  ? 115.166 157.145 108.264 1.00 0.00   ? 329  ASP C O     1 
ATOM   7338  C  CB    . ASP C 1 329  ? 116.134 159.779 108.470 1.00 0.00   ? 329  ASP C CB    1 
ATOM   7339  C  CG    . ASP C 1 329  ? 114.789 160.309 108.901 1.00 0.00   ? 329  ASP C CG    1 
ATOM   7340  O  OD1   . ASP C 1 329  ? 114.087 159.598 109.650 1.00 0.00   ? 329  ASP C OD1   1 
ATOM   7341  O  OD2   . ASP C 1 329  ? 114.422 161.428 108.488 1.00 0.00   ? 329  ASP C OD2   1 
ATOM   7342  N  N     . TYR C 1 330  ? 115.428 156.861 110.477 1.00 0.00   ? 330  TYR C N     1 
ATOM   7343  C  CA    . TYR C 1 330  ? 114.542 155.707 110.520 1.00 0.00   ? 330  TYR C CA    1 
ATOM   7344  C  C     . TYR C 1 330  ? 113.058 156.004 110.330 1.00 0.00   ? 330  TYR C C     1 
ATOM   7345  O  O     . TYR C 1 330  ? 112.276 155.101 110.028 1.00 0.00   ? 330  TYR C O     1 
ATOM   7346  C  CB    . TYR C 1 330  ? 114.764 154.927 111.820 1.00 0.00   ? 330  TYR C CB    1 
ATOM   7347  C  CG    . TYR C 1 330  ? 116.069 154.166 111.826 1.00 0.00   ? 330  TYR C CG    1 
ATOM   7348  C  CD1   . TYR C 1 330  ? 117.278 154.813 112.081 1.00 0.00   ? 330  TYR C CD1   1 
ATOM   7349  C  CD2   . TYR C 1 330  ? 116.098 152.804 111.531 1.00 0.00   ? 330  TYR C CD2   1 
ATOM   7350  C  CE1   . TYR C 1 330  ? 118.483 154.118 112.040 1.00 0.00   ? 330  TYR C CE1   1 
ATOM   7351  C  CE2   . TYR C 1 330  ? 117.293 152.106 111.486 1.00 0.00   ? 330  TYR C CE2   1 
ATOM   7352  C  CZ    . TYR C 1 330  ? 118.479 152.765 111.741 1.00 0.00   ? 330  TYR C CZ    1 
ATOM   7353  O  OH    . TYR C 1 330  ? 119.662 152.069 111.700 1.00 0.00   ? 330  TYR C OH    1 
ATOM   7354  N  N     . SER C 1 331  ? 112.667 157.264 110.487 1.00 0.00   ? 331  SER C N     1 
ATOM   7355  C  CA    . SER C 1 331  ? 111.270 157.647 110.315 1.00 0.00   ? 331  SER C CA    1 
ATOM   7356  C  C     . SER C 1 331  ? 110.871 157.596 108.846 1.00 0.00   ? 331  SER C C     1 
ATOM   7357  O  O     . SER C 1 331  ? 109.687 157.641 108.508 1.00 0.00   ? 331  SER C O     1 
ATOM   7358  C  CB    . SER C 1 331  ? 111.028 159.057 110.851 1.00 0.00   ? 331  SER C CB    1 
ATOM   7359  O  OG    . SER C 1 331  ? 111.709 160.022 110.071 1.00 0.00   ? 331  SER C OG    1 
ATOM   7360  N  N     . LYS C 1 332  ? 111.871 157.506 107.971 1.00 0.00   ? 332  LYS C N     1 
ATOM   7361  C  CA    . LYS C 1 332  ? 111.632 157.453 106.534 1.00 0.00   ? 332  LYS C CA    1 
ATOM   7362  C  C     . LYS C 1 332  ? 111.706 156.028 105.984 1.00 0.00   ? 332  LYS C C     1 
ATOM   7363  O  O     . LYS C 1 332  ? 111.824 155.843 104.777 1.00 0.00   ? 332  LYS C O     1 
ATOM   7364  C  CB    . LYS C 1 332  ? 112.658 158.316 105.792 1.00 0.00   ? 332  LYS C CB    1 
ATOM   7365  C  CG    . LYS C 1 332  ? 112.566 159.817 106.030 1.00 0.00   ? 332  LYS C CG    1 
ATOM   7366  C  CD    . LYS C 1 332  ? 113.501 160.549 105.066 1.00 0.00   ? 332  LYS C CD    1 
ATOM   7367  C  CE    . LYS C 1 332  ? 113.349 162.063 105.134 1.00 0.00   ? 332  LYS C CE    1 
ATOM   7368  N  NZ    . LYS C 1 332  ? 113.880 162.648 106.395 1.00 0.00   ? 332  LYS C NZ    1 
ATOM   7369  N  N     . PHE C 1 333  ? 111.634 155.029 106.860 1.00 0.00   ? 333  PHE C N     1 
ATOM   7370  C  CA    . PHE C 1 333  ? 111.720 153.636 106.423 1.00 0.00   ? 333  PHE C CA    1 
ATOM   7371  C  C     . PHE C 1 333  ? 110.614 153.217 105.460 1.00 0.00   ? 333  PHE C C     1 
ATOM   7372  O  O     . PHE C 1 333  ? 110.890 152.648 104.402 1.00 0.00   ? 333  PHE C O     1 
ATOM   7373  C  CB    . PHE C 1 333  ? 111.709 152.692 107.629 1.00 0.00   ? 333  PHE C CB    1 
ATOM   7374  C  CG    . PHE C 1 333  ? 112.997 151.936 107.827 1.00 0.00   ? 333  PHE C CG    1 
ATOM   7375  C  CD1   . PHE C 1 333  ? 114.178 152.613 108.113 1.00 0.00   ? 333  PHE C CD1   1 
ATOM   7376  C  CD2   . PHE C 1 333  ? 113.025 150.547 107.761 1.00 0.00   ? 333  PHE C CD2   1 
ATOM   7377  C  CE1   . PHE C 1 333  ? 115.365 151.923 108.333 1.00 0.00   ? 333  PHE C CE1   1 
ATOM   7378  C  CE2   . PHE C 1 333  ? 114.212 149.843 107.982 1.00 0.00   ? 333  PHE C CE2   1 
ATOM   7379  C  CZ    . PHE C 1 333  ? 115.383 150.532 108.269 1.00 0.00   ? 333  PHE C CZ    1 
ATOM   7380  N  N     . GLY C 1 334  ? 109.367 153.486 105.831 1.00 0.00   ? 334  GLY C N     1 
ATOM   7381  C  CA    . GLY C 1 334  ? 108.247 153.108 104.985 1.00 0.00   ? 334  GLY C CA    1 
ATOM   7382  C  C     . GLY C 1 334  ? 107.914 154.104 103.889 1.00 0.00   ? 334  GLY C C     1 
ATOM   7383  O  O     . GLY C 1 334  ? 106.925 153.938 103.179 1.00 0.00   ? 334  GLY C O     1 
ATOM   7384  N  N     . ASN C 1 335  ? 108.745 155.130 103.747 1.00 0.00   ? 335  ASN C N     1 
ATOM   7385  C  CA    . ASN C 1 335  ? 108.536 156.157 102.734 1.00 0.00   ? 335  ASN C CA    1 
ATOM   7386  C  C     . ASN C 1 335  ? 108.893 155.700 101.325 1.00 0.00   ? 335  ASN C C     1 
ATOM   7387  O  O     . ASN C 1 335  ? 110.062 155.472 101.012 1.00 0.00   ? 335  ASN C O     1 
ATOM   7388  C  CB    . ASN C 1 335  ? 109.336 157.417 103.078 1.00 0.00   ? 335  ASN C CB    1 
ATOM   7389  C  CG    . ASN C 1 335  ? 108.751 158.177 104.254 1.00 0.00   ? 335  ASN C CG    1 
ATOM   7390  O  OD1   . ASN C 1 335  ? 107.736 157.779 104.827 1.00 0.00   ? 335  ASN C OD1   1 
ATOM   7391  N  ND2   . ASN C 1 335  ? 109.391 159.282 104.620 1.00 0.00   ? 335  ASN C ND2   1 
ATOM   7392  N  N     . THR C 1 336  ? 107.874 155.562 100.487 1.00 0.00   ? 336  THR C N     1 
ATOM   7393  C  CA    . THR C 1 336  ? 108.054 155.147 99.100  1.00 0.00   ? 336  THR C CA    1 
ATOM   7394  C  C     . THR C 1 336  ? 107.352 156.167 98.216  1.00 0.00   ? 336  THR C C     1 
ATOM   7395  O  O     . THR C 1 336  ? 106.369 156.784 98.636  1.00 0.00   ? 336  THR C O     1 
ATOM   7396  C  CB    . THR C 1 336  ? 107.418 153.770 98.835  1.00 0.00   ? 336  THR C CB    1 
ATOM   7397  O  OG1   . THR C 1 336  ? 106.023 153.821 99.150  1.00 0.00   ? 336  THR C OG1   1 
ATOM   7398  C  CG2   . THR C 1 336  ? 108.087 152.703 99.684  1.00 0.00   ? 336  THR C CG2   1 
ATOM   7399  N  N     . VAL C 1 337  ? 107.853 156.347 96.999  1.00 0.00   ? 337  VAL C N     1 
ATOM   7400  C  CA    . VAL C 1 337  ? 107.248 157.294 96.068  1.00 0.00   ? 337  VAL C CA    1 
ATOM   7401  C  C     . VAL C 1 337  ? 106.921 156.630 94.737  1.00 0.00   ? 337  VAL C C     1 
ATOM   7402  O  O     . VAL C 1 337  ? 107.570 155.664 94.337  1.00 0.00   ? 337  VAL C O     1 
ATOM   7403  C  CB    . VAL C 1 337  ? 108.184 158.500 95.801  1.00 0.00   ? 337  VAL C CB    1 
ATOM   7404  C  CG1   . VAL C 1 337  ? 108.429 159.265 97.090  1.00 0.00   ? 337  VAL C CG1   1 
ATOM   7405  C  CG2   . VAL C 1 337  ? 109.500 158.029 95.201  1.00 0.00   ? 337  VAL C CG2   1 
ATOM   7406  N  N     . LYS C 1 338  ? 105.906 157.149 94.057  1.00 0.00   ? 338  LYS C N     1 
ATOM   7407  C  CA    . LYS C 1 338  ? 105.502 156.606 92.765  1.00 0.00   ? 338  LYS C CA    1 
ATOM   7408  C  C     . LYS C 1 338  ? 106.441 157.072 91.661  1.00 0.00   ? 338  LYS C C     1 
ATOM   7409  O  O     . LYS C 1 338  ? 106.751 158.259 91.551  1.00 0.00   ? 338  LYS C O     1 
ATOM   7410  C  CB    . LYS C 1 338  ? 104.066 157.023 92.426  1.00 0.00   ? 338  LYS C CB    1 
ATOM   7411  C  CG    . LYS C 1 338  ? 102.993 156.361 93.286  1.00 0.00   ? 338  LYS C CG    1 
ATOM   7412  C  CD    . LYS C 1 338  ? 101.590 156.696 92.795  1.00 0.00   ? 338  LYS C CD    1 
ATOM   7413  C  CE    . LYS C 1 338  ? 100.528 155.955 93.600  1.00 0.00   ? 338  LYS C CE    1 
ATOM   7414  N  NZ    . LYS C 1 338  ? 99.140  156.254 93.143  1.00 0.00   ? 338  LYS C NZ    1 
ATOM   7415  N  N     . VAL C 1 339  ? 106.899 156.124 90.851  1.00 0.00   ? 339  VAL C N     1 
ATOM   7416  C  CA    . VAL C 1 339  ? 107.802 156.405 89.739  1.00 0.00   ? 339  VAL C CA    1 
ATOM   7417  C  C     . VAL C 1 339  ? 107.199 155.750 88.500  1.00 0.00   ? 339  VAL C C     1 
ATOM   7418  O  O     . VAL C 1 339  ? 106.580 154.690 88.597  1.00 0.00   ? 339  VAL C O     1 
ATOM   7419  C  CB    . VAL C 1 339  ? 109.206 155.812 89.992  1.00 0.00   ? 339  VAL C CB    1 
ATOM   7420  C  CG1   . VAL C 1 339  ? 109.128 154.298 90.086  1.00 0.00   ? 339  VAL C CG1   1 
ATOM   7421  C  CG2   . VAL C 1 339  ? 110.159 156.227 88.879  1.00 0.00   ? 339  VAL C CG2   1 
ATOM   7422  N  N     . PRO C 1 340  ? 107.368 156.371 87.319  1.00 0.00   ? 340  PRO C N     1 
ATOM   7423  C  CA    . PRO C 1 340  ? 106.804 155.768 86.106  1.00 0.00   ? 340  PRO C CA    1 
ATOM   7424  C  C     . PRO C 1 340  ? 107.369 154.368 85.916  1.00 0.00   ? 340  PRO C C     1 
ATOM   7425  O  O     . PRO C 1 340  ? 108.574 154.155 86.037  1.00 0.00   ? 340  PRO C O     1 
ATOM   7426  C  CB    . PRO C 1 340  ? 107.259 156.725 85.013  1.00 0.00   ? 340  PRO C CB    1 
ATOM   7427  C  CG    . PRO C 1 340  ? 107.227 158.043 85.713  1.00 0.00   ? 340  PRO C CG    1 
ATOM   7428  C  CD    . PRO C 1 340  ? 107.888 157.716 87.036  1.00 0.00   ? 340  PRO C CD    1 
ATOM   7429  N  N     . THR C 1 341  ? 106.495 153.411 85.624  1.00 0.00   ? 341  THR C N     1 
ATOM   7430  C  CA    . THR C 1 341  ? 106.914 152.022 85.445  1.00 0.00   ? 341  THR C CA    1 
ATOM   7431  C  C     . THR C 1 341  ? 106.044 151.304 84.426  1.00 0.00   ? 341  THR C C     1 
ATOM   7432  O  O     . THR C 1 341  ? 104.886 151.664 84.216  1.00 0.00   ? 341  THR C O     1 
ATOM   7433  C  CB    . THR C 1 341  ? 106.803 151.254 86.771  1.00 0.00   ? 341  THR C CB    1 
ATOM   7434  O  OG1   . THR C 1 341  ? 107.181 149.889 86.575  1.00 0.00   ? 341  THR C OG1   1 
ATOM   7435  C  CG2   . THR C 1 341  ? 105.366 151.301 87.278  1.00 0.00   ? 341  THR C CG2   1 
ATOM   7436  N  N     . PRO C 1 342  ? 106.596 150.274 83.766  1.00 0.00   ? 342  PRO C N     1 
ATOM   7437  C  CA    . PRO C 1 342  ? 105.800 149.537 82.781  1.00 0.00   ? 342  PRO C CA    1 
ATOM   7438  C  C     . PRO C 1 342  ? 104.696 148.814 83.540  1.00 0.00   ? 342  PRO C C     1 
ATOM   7439  O  O     . PRO C 1 342  ? 104.930 148.319 84.647  1.00 0.00   ? 342  PRO C O     1 
ATOM   7440  C  CB    . PRO C 1 342  ? 106.800 148.548 82.186  1.00 0.00   ? 342  PRO C CB    1 
ATOM   7441  C  CG    . PRO C 1 342  ? 108.114 149.239 82.363  1.00 0.00   ? 342  PRO C CG    1 
ATOM   7442  C  CD    . PRO C 1 342  ? 107.991 149.812 83.744  1.00 0.00   ? 342  PRO C CD    1 
ATOM   7443  N  N     . LEU C 1 343  ? 103.497 148.760 82.974  1.00 0.00   ? 343  LEU C N     1 
ATOM   7444  C  CA    . LEU C 1 343  ? 102.400 148.077 83.645  1.00 0.00   ? 343  LEU C CA    1 
ATOM   7445  C  C     . LEU C 1 343  ? 102.066 146.786 82.916  1.00 0.00   ? 343  LEU C C     1 
ATOM   7446  O  O     . LEU C 1 343  ? 101.000 146.645 82.315  1.00 0.00   ? 343  LEU C O     1 
ATOM   7447  C  CB    . LEU C 1 343  ? 101.180 148.995 83.713  1.00 0.00   ? 343  LEU C CB    1 
ATOM   7448  C  CG    . LEU C 1 343  ? 101.430 150.261 84.539  1.00 0.00   ? 343  LEU C CG    1 
ATOM   7449  C  CD1   . LEU C 1 343  ? 100.242 151.202 84.451  1.00 0.00   ? 343  LEU C CD1   1 
ATOM   7450  C  CD2   . LEU C 1 343  ? 101.705 149.865 85.981  1.00 0.00   ? 343  LEU C CD2   1 
ATOM   7451  N  N     . CYS C 1 344  ? 102.992 145.838 82.994  1.00 0.00   ? 344  CYS C N     1 
ATOM   7452  C  CA    . CYS C 1 344  ? 102.848 144.533 82.361  1.00 0.00   ? 344  CYS C CA    1 
ATOM   7453  C  C     . CYS C 1 344  ? 103.637 143.526 83.183  1.00 0.00   ? 344  CYS C C     1 
ATOM   7454  O  O     . CYS C 1 344  ? 104.314 143.895 84.144  1.00 0.00   ? 344  CYS C O     1 
ATOM   7455  C  CB    . CYS C 1 344  ? 103.402 144.577 80.937  1.00 0.00   ? 344  CYS C CB    1 
ATOM   7456  S  SG    . CYS C 1 344  ? 105.160 144.995 80.837  1.00 0.00   ? 344  CYS C SG    1 
ATOM   7457  N  N     . THR C 1 345  ? 103.550 142.255 82.812  1.00 0.00   ? 345  THR C N     1 
ATOM   7458  C  CA    . THR C 1 345  ? 104.281 141.208 83.517  1.00 0.00   ? 345  THR C CA    1 
ATOM   7459  C  C     . THR C 1 345  ? 105.736 141.298 83.070  1.00 0.00   ? 345  THR C C     1 
ATOM   7460  O  O     . THR C 1 345  ? 106.025 141.865 82.019  1.00 0.00   ? 345  THR C O     1 
ATOM   7461  C  CB    . THR C 1 345  ? 103.742 139.807 83.160  1.00 0.00   ? 345  THR C CB    1 
ATOM   7462  O  OG1   . THR C 1 345  ? 104.008 139.531 81.778  1.00 0.00   ? 345  THR C OG1   1 
ATOM   7463  C  CG2   . THR C 1 345  ? 102.243 139.739 83.395  1.00 0.00   ? 345  THR C CG2   1 
ATOM   7464  N  N     . ALA C 1 346  ? 106.651 140.750 83.864  1.00 0.00   ? 346  ALA C N     1 
ATOM   7465  C  CA    . ALA C 1 346  ? 108.068 140.787 83.511  1.00 0.00   ? 346  ALA C CA    1 
ATOM   7466  C  C     . ALA C 1 346  ? 108.274 140.094 82.170  1.00 0.00   ? 346  ALA C C     1 
ATOM   7467  O  O     . ALA C 1 346  ? 109.121 140.501 81.373  1.00 0.00   ? 346  ALA C O     1 
ATOM   7468  C  CB    . ALA C 1 346  ? 108.895 140.097 84.586  1.00 0.00   ? 346  ALA C CB    1 
ATOM   7469  N  N     . ARG C 1 347  ? 107.492 139.047 81.926  1.00 0.00   ? 347  ARG C N     1 
ATOM   7470  C  CA    . ARG C 1 347  ? 107.568 138.289 80.683  1.00 0.00   ? 347  ARG C CA    1 
ATOM   7471  C  C     . ARG C 1 347  ? 107.216 139.176 79.491  1.00 0.00   ? 347  ARG C C     1 
ATOM   7472  O  O     . ARG C 1 347  ? 107.954 139.225 78.506  1.00 0.00   ? 347  ARG C O     1 
ATOM   7473  C  CB    . ARG C 1 347  ? 106.605 137.097 80.747  1.00 0.00   ? 347  ARG C CB    1 
ATOM   7474  C  CG    . ARG C 1 347  ? 106.561 136.245 79.492  1.00 0.00   ? 347  ARG C CG    1 
ATOM   7475  C  CD    . ARG C 1 347  ? 105.396 135.263 79.533  1.00 0.00   ? 347  ARG C CD    1 
ATOM   7476  N  NE    . ARG C 1 347  ? 105.553 134.241 80.567  1.00 0.00   ? 347  ARG C NE    1 
ATOM   7477  C  CZ    . ARG C 1 347  ? 106.430 133.242 80.508  1.00 0.00   ? 347  ARG C CZ    1 
ATOM   7478  N  NH1   . ARG C 1 347  ? 107.239 133.121 79.462  1.00 0.00   ? 347  ARG C NH1   1 
ATOM   7479  N  NH2   . ARG C 1 347  ? 106.499 132.360 81.494  1.00 0.00   ? 347  ARG C NH2   1 
ATOM   7480  N  N     . GLN C 1 348  ? 106.088 139.876 79.592  1.00 0.00   ? 348  GLN C N     1 
ATOM   7481  C  CA    . GLN C 1 348  ? 105.636 140.767 78.527  1.00 0.00   ? 348  GLN C CA    1 
ATOM   7482  C  C     . GLN C 1 348  ? 106.664 141.863 78.279  1.00 0.00   ? 348  GLN C C     1 
ATOM   7483  O  O     . GLN C 1 348  ? 106.891 142.273 77.139  1.00 0.00   ? 348  GLN C O     1 
ATOM   7484  C  CB    . GLN C 1 348  ? 104.295 141.400 78.901  1.00 0.00   ? 348  GLN C CB    1 
ATOM   7485  C  CG    . GLN C 1 348  ? 103.158 140.401 79.043  1.00 0.00   ? 348  GLN C CG    1 
ATOM   7486  C  CD    . GLN C 1 348  ? 101.833 141.067 79.373  1.00 0.00   ? 348  GLN C CD    1 
ATOM   7487  O  OE1   . GLN C 1 348  ? 101.699 141.741 80.396  1.00 0.00   ? 348  GLN C OE1   1 
ATOM   7488  N  NE2   . GLN C 1 348  ? 100.850 140.882 78.502  1.00 0.00   ? 348  GLN C NE2   1 
ATOM   7489  N  N     . LEU C 1 349  ? 107.281 142.335 79.356  1.00 0.00   ? 349  LEU C N     1 
ATOM   7490  C  CA    . LEU C 1 349  ? 108.288 143.377 79.256  1.00 0.00   ? 349  LEU C CA    1 
ATOM   7491  C  C     . LEU C 1 349  ? 109.461 142.860 78.435  1.00 0.00   ? 349  LEU C C     1 
ATOM   7492  O  O     . LEU C 1 349  ? 110.025 143.588 77.617  1.00 0.00   ? 349  LEU C O     1 
ATOM   7493  C  CB    . LEU C 1 349  ? 108.776 143.790 80.646  1.00 0.00   ? 349  LEU C CB    1 
ATOM   7494  C  CG    . LEU C 1 349  ? 109.779 144.947 80.712  1.00 0.00   ? 349  LEU C CG    1 
ATOM   7495  C  CD1   . LEU C 1 349  ? 109.169 146.210 80.123  1.00 0.00   ? 349  LEU C CD1   1 
ATOM   7496  C  CD2   . LEU C 1 349  ? 110.182 145.175 82.158  1.00 0.00   ? 349  LEU C CD2   1 
ATOM   7497  N  N     . ASP C 1 350  ? 109.830 141.601 78.659  1.00 0.00   ? 350  ASP C N     1 
ATOM   7498  C  CA    . ASP C 1 350  ? 110.938 140.996 77.927  1.00 0.00   ? 350  ASP C CA    1 
ATOM   7499  C  C     . ASP C 1 350  ? 110.553 140.624 76.498  1.00 0.00   ? 350  ASP C C     1 
ATOM   7500  O  O     . ASP C 1 350  ? 111.378 140.719 75.589  1.00 0.00   ? 350  ASP C O     1 
ATOM   7501  C  CB    . ASP C 1 350  ? 111.455 139.746 78.656  1.00 0.00   ? 350  ASP C CB    1 
ATOM   7502  C  CG    . ASP C 1 350  ? 112.192 140.078 79.942  1.00 0.00   ? 350  ASP C CG    1 
ATOM   7503  O  OD1   . ASP C 1 350  ? 112.678 141.227 80.076  1.00 0.00   ? 350  ASP C OD1   1 
ATOM   7504  O  OD2   . ASP C 1 350  ? 112.305 139.191 80.816  1.00 0.00   ? 350  ASP C OD2   1 
ATOM   7505  N  N     . GLU C 1 351  ? 109.309 140.202 76.301  1.00 0.00   ? 351  GLU C N     1 
ATOM   7506  C  CA    . GLU C 1 351  ? 108.847 139.825 74.967  1.00 0.00   ? 351  GLU C CA    1 
ATOM   7507  C  C     . GLU C 1 351  ? 108.941 140.989 73.984  1.00 0.00   ? 351  GLU C C     1 
ATOM   7508  O  O     . GLU C 1 351  ? 109.218 140.786 72.803  1.00 0.00   ? 351  GLU C O     1 
ATOM   7509  C  CB    . GLU C 1 351  ? 107.397 139.326 75.007  1.00 0.00   ? 351  GLU C CB    1 
ATOM   7510  C  CG    . GLU C 1 351  ? 106.835 138.842 73.685  1.00 0.00   ? 351  GLU C CG    1 
ATOM   7511  C  CD    . GLU C 1 351  ? 106.388 139.995 72.801  1.00 0.00   ? 351  GLU C CD    1 
ATOM   7512  O  OE1   . GLU C 1 351  ? 106.068 141.074 73.353  1.00 0.00   ? 351  GLU C OE1   1 
ATOM   7513  O  OE2   . GLU C 1 351  ? 106.346 139.829 71.560  1.00 0.00   ? 351  GLU C OE2   1 
ATOM   7514  N  N     . ASP C 1 352  ? 108.705 142.206 74.468  1.00 0.00   ? 352  ASP C N     1 
ATOM   7515  C  CA    . ASP C 1 352  ? 108.759 143.388 73.607  1.00 0.00   ? 352  ASP C CA    1 
ATOM   7516  C  C     . ASP C 1 352  ? 110.118 144.082 73.606  1.00 0.00   ? 352  ASP C C     1 
ATOM   7517  O  O     . ASP C 1 352  ? 110.279 145.143 73.003  1.00 0.00   ? 352  ASP C O     1 
ATOM   7518  C  CB    . ASP C 1 352  ? 107.681 144.402 74.010  1.00 0.00   ? 352  ASP C CB    1 
ATOM   7519  C  CG    . ASP C 1 352  ? 107.681 145.637 73.128  1.00 0.00   ? 352  ASP C CG    1 
ATOM   7520  O  OD1   . ASP C 1 352  ? 107.388 145.503 71.918  1.00 0.00   ? 352  ASP C OD1   1 
ATOM   7521  O  OD2   . ASP C 1 352  ? 107.986 146.737 73.635  1.00 0.00   ? 352  ASP C OD2   1 
ATOM   7522  N  N     . ARG D 1 32   ? 122.948 92.507  103.143 1.00 0.00   ? 32   ARG D N     1 
ATOM   7523  C  CA    . ARG D 1 32   ? 121.784 93.442  103.188 1.00 0.00   ? 32   ARG D CA    1 
ATOM   7524  C  C     . ARG D 1 32   ? 121.859 94.330  104.427 1.00 0.00   ? 32   ARG D C     1 
ATOM   7525  O  O     . ARG D 1 32   ? 120.839 94.780  104.943 1.00 0.00   ? 32   ARG D O     1 
ATOM   7526  C  CB    . ARG D 1 32   ? 120.479 92.643  103.200 1.00 0.00   ? 32   ARG D CB    1 
ATOM   7527  C  CG    . ARG D 1 32   ? 120.338 91.682  102.029 1.00 0.00   ? 32   ARG D CG    1 
ATOM   7528  C  CD    . ARG D 1 32   ? 119.897 92.388  100.757 1.00 0.00   ? 32   ARG D CD    1 
ATOM   7529  N  NE    . ARG D 1 32   ? 118.505 92.816  100.836 1.00 0.00   ? 32   ARG D NE    1 
ATOM   7530  C  CZ    . ARG D 1 32   ? 117.781 93.214  99.793  1.00 0.00   ? 32   ARG D CZ    1 
ATOM   7531  N  NH1   . ARG D 1 32   ? 118.316 93.245  98.582  1.00 0.00   ? 32   ARG D NH1   1 
ATOM   7532  N  NH2   . ARG D 1 32   ? 116.513 93.570  99.969  1.00 0.00   ? 32   ARG D NH2   1 
ATOM   7533  N  N     . ALA D 1 33   ? 123.083 94.570  104.898 1.00 0.00   ? 33   ALA D N     1 
ATOM   7534  C  CA    . ALA D 1 33   ? 123.323 95.402  106.075 1.00 0.00   ? 33   ALA D CA    1 
ATOM   7535  C  C     . ALA D 1 33   ? 123.130 96.882  105.747 1.00 0.00   ? 33   ALA D C     1 
ATOM   7536  O  O     . ALA D 1 33   ? 123.610 97.366  104.722 1.00 0.00   ? 33   ALA D O     1 
ATOM   7537  C  CB    . ALA D 1 33   ? 124.740 95.162  106.602 1.00 0.00   ? 33   ALA D CB    1 
ATOM   7538  N  N     . ARG D 1 34   ? 122.426 97.599  106.617 1.00 0.00   ? 34   ARG D N     1 
ATOM   7539  C  CA    . ARG D 1 34   ? 122.186 99.024  106.414 1.00 0.00   ? 34   ARG D CA    1 
ATOM   7540  C  C     . ARG D 1 34   ? 123.342 99.866  106.947 1.00 0.00   ? 34   ARG D C     1 
ATOM   7541  O  O     . ARG D 1 34   ? 123.926 99.550  107.986 1.00 0.00   ? 34   ARG D O     1 
ATOM   7542  C  CB    . ARG D 1 34   ? 120.883 99.456  107.100 1.00 0.00   ? 34   ARG D CB    1 
ATOM   7543  C  CG    . ARG D 1 34   ? 119.606 98.924  106.454 1.00 0.00   ? 34   ARG D CG    1 
ATOM   7544  C  CD    . ARG D 1 34   ? 118.360 99.508  107.115 1.00 0.00   ? 34   ARG D CD    1 
ATOM   7545  N  NE    . ARG D 1 34   ? 118.288 99.205  108.541 1.00 0.00   ? 34   ARG D NE    1 
ATOM   7546  C  CZ    . ARG D 1 34   ? 117.275 99.550  109.332 1.00 0.00   ? 34   ARG D CZ    1 
ATOM   7547  N  NH1   . ARG D 1 34   ? 116.242 100.217 108.842 1.00 0.00   ? 34   ARG D NH1   1 
ATOM   7548  N  NH2   . ARG D 1 34   ? 117.298 99.223  110.618 1.00 0.00   ? 34   ARG D NH2   1 
ATOM   7549  N  N     . PHE D 1 35   ? 123.675 100.935 106.229 1.00 0.00   ? 35   PHE D N     1 
ATOM   7550  C  CA    . PHE D 1 35   ? 124.753 101.825 106.644 1.00 0.00   ? 35   PHE D CA    1 
ATOM   7551  C  C     . PHE D 1 35   ? 124.337 102.524 107.927 1.00 0.00   ? 35   PHE D C     1 
ATOM   7552  O  O     . PHE D 1 35   ? 125.081 102.556 108.906 1.00 0.00   ? 35   PHE D O     1 
ATOM   7553  C  CB    . PHE D 1 35   ? 125.031 102.869 105.557 1.00 0.00   ? 35   PHE D CB    1 
ATOM   7554  C  CG    . PHE D 1 35   ? 126.221 103.742 105.845 1.00 0.00   ? 35   PHE D CG    1 
ATOM   7555  C  CD1   . PHE D 1 35   ? 127.475 103.182 106.066 1.00 0.00   ? 35   PHE D CD1   1 
ATOM   7556  C  CD2   . PHE D 1 35   ? 126.097 105.127 105.872 1.00 0.00   ? 35   PHE D CD2   1 
ATOM   7557  C  CE1   . PHE D 1 35   ? 128.585 103.982 106.315 1.00 0.00   ? 35   PHE D CE1   1 
ATOM   7558  C  CE2   . PHE D 1 35   ? 127.203 105.941 106.120 1.00 0.00   ? 35   PHE D CE2   1 
ATOM   7559  C  CZ    . PHE D 1 35   ? 128.452 105.368 106.341 1.00 0.00   ? 35   PHE D CZ    1 
ATOM   7560  N  N     . VAL D 1 36   ? 123.133 103.088 107.902 1.00 0.00   ? 36   VAL D N     1 
ATOM   7561  C  CA    . VAL D 1 36   ? 122.559 103.787 109.042 1.00 0.00   ? 36   VAL D CA    1 
ATOM   7562  C  C     . VAL D 1 36   ? 121.106 103.332 109.165 1.00 0.00   ? 36   VAL D C     1 
ATOM   7563  O  O     . VAL D 1 36   ? 120.461 103.019 108.165 1.00 0.00   ? 36   VAL D O     1 
ATOM   7564  C  CB    . VAL D 1 36   ? 122.613 105.316 108.834 1.00 0.00   ? 36   VAL D CB    1 
ATOM   7565  C  CG1   . VAL D 1 36   ? 124.061 105.775 108.767 1.00 0.00   ? 36   VAL D CG1   1 
ATOM   7566  C  CG2   . VAL D 1 36   ? 121.898 105.693 107.561 1.00 0.00   ? 36   VAL D CG2   1 
ATOM   7567  N  N     . SER D 1 37   ? 120.598 103.289 110.390 1.00 0.00   ? 37   SER D N     1 
ATOM   7568  C  CA    . SER D 1 37   ? 119.228 102.849 110.638 1.00 0.00   ? 37   SER D CA    1 
ATOM   7569  C  C     . SER D 1 37   ? 118.198 103.867 110.161 1.00 0.00   ? 37   SER D C     1 
ATOM   7570  O  O     . SER D 1 37   ? 118.554 104.951 109.687 1.00 0.00   ? 37   SER D O     1 
ATOM   7571  C  CB    . SER D 1 37   ? 119.037 102.578 112.131 1.00 0.00   ? 37   SER D CB    1 
ATOM   7572  O  OG    . SER D 1 37   ? 117.697 102.227 112.429 1.00 0.00   ? 37   SER D OG    1 
ATOM   7573  N  N     . LYS D 1 38   ? 116.921 103.510 110.279 1.00 0.00   ? 38   LYS D N     1 
ATOM   7574  C  CA    . LYS D 1 38   ? 115.842 104.398 109.870 1.00 0.00   ? 38   LYS D CA    1 
ATOM   7575  C  C     . LYS D 1 38   ? 115.929 105.647 110.743 1.00 0.00   ? 38   LYS D C     1 
ATOM   7576  O  O     . LYS D 1 38   ? 115.555 106.744 110.327 1.00 0.00   ? 38   LYS D O     1 
ATOM   7577  C  CB    . LYS D 1 38   ? 114.488 103.725 110.077 1.00 0.00   ? 38   LYS D CB    1 
ATOM   7578  C  CG    . LYS D 1 38   ? 114.309 102.421 109.309 1.00 0.00   ? 38   LYS D CG    1 
ATOM   7579  C  CD    . LYS D 1 38   ? 114.470 102.661 107.817 1.00 0.00   ? 38   LYS D CD    1 
ATOM   7580  C  CE    . LYS D 1 38   ? 113.307 103.459 107.249 1.00 0.00   ? 38   LYS D CE    1 
ATOM   7581  N  NZ    . LYS D 1 38   ? 113.384 103.548 105.764 1.00 0.00   ? 38   LYS D NZ    1 
ATOM   7582  N  N     . LYS D 1 39   ? 116.438 105.461 111.955 1.00 0.00   ? 39   LYS D N     1 
ATOM   7583  C  CA    . LYS D 1 39   ? 116.592 106.538 112.930 1.00 0.00   ? 39   LYS D CA    1 
ATOM   7584  C  C     . LYS D 1 39   ? 118.054 106.973 113.018 1.00 0.00   ? 39   LYS D C     1 
ATOM   7585  O  O     . LYS D 1 39   ? 118.528 107.362 114.088 1.00 0.00   ? 39   LYS D O     1 
ATOM   7586  C  CB    . LYS D 1 39   ? 116.127 106.063 114.311 1.00 0.00   ? 39   LYS D CB    1 
ATOM   7587  C  CG    . LYS D 1 39   ? 114.777 105.362 114.316 1.00 0.00   ? 39   LYS D CG    1 
ATOM   7588  C  CD    . LYS D 1 39   ? 114.489 104.723 115.667 1.00 0.00   ? 39   LYS D CD    1 
ATOM   7589  C  CE    . LYS D 1 39   ? 113.134 104.033 115.660 1.00 0.00   ? 39   LYS D CE    1 
ATOM   7590  N  NZ    . LYS D 1 39   ? 112.812 103.397 116.969 1.00 0.00   ? 39   LYS D NZ    1 
ATOM   7591  N  N     . GLY D 1 40   ? 118.771 106.889 111.903 1.00 0.00   ? 40   GLY D N     1 
ATOM   7592  C  CA    . GLY D 1 40   ? 120.173 107.262 111.915 1.00 0.00   ? 40   GLY D CA    1 
ATOM   7593  C  C     . GLY D 1 40   ? 120.895 106.234 112.757 1.00 0.00   ? 40   GLY D C     1 
ATOM   7594  O  O     . GLY D 1 40   ? 120.868 105.046 112.433 1.00 0.00   ? 40   GLY D O     1 
ATOM   7595  N  N     . ASN D 1 41   ? 121.535 106.675 113.837 1.00 0.00   ? 41   ASN D N     1 
ATOM   7596  C  CA    . ASN D 1 41   ? 122.218 105.734 114.708 1.00 0.00   ? 41   ASN D CA    1 
ATOM   7597  C  C     . ASN D 1 41   ? 123.085 104.833 113.848 1.00 0.00   ? 41   ASN D C     1 
ATOM   7598  O  O     . ASN D 1 41   ? 122.896 103.617 113.814 1.00 0.00   ? 41   ASN D O     1 
ATOM   7599  C  CB    . ASN D 1 41   ? 121.198 104.909 115.491 1.00 0.00   ? 41   ASN D CB    1 
ATOM   7600  C  CG    . ASN D 1 41   ? 121.842 104.071 116.569 1.00 0.00   ? 41   ASN D CG    1 
ATOM   7601  O  OD1   . ASN D 1 41   ? 122.685 104.554 117.325 1.00 0.00   ? 41   ASN D OD1   1 
ATOM   7602  N  ND2   . ASN D 1 41   ? 121.441 102.805 116.654 1.00 0.00   ? 41   ASN D ND2   1 
ATOM   7603  N  N     . CYS D 1 42   ? 124.035 105.443 113.147 1.00 0.00   ? 42   CYS D N     1 
ATOM   7604  C  CA    . CYS D 1 42   ? 124.895 104.712 112.227 1.00 0.00   ? 42   CYS D CA    1 
ATOM   7605  C  C     . CYS D 1 42   ? 125.467 103.450 112.850 1.00 0.00   ? 42   CYS D C     1 
ATOM   7606  O  O     . CYS D 1 42   ? 126.018 103.457 113.947 1.00 0.00   ? 42   CYS D O     1 
ATOM   7607  C  CB    . CYS D 1 42   ? 126.044 105.617 111.775 1.00 0.00   ? 42   CYS D CB    1 
ATOM   7608  S  SG    . CYS D 1 42   ? 127.008 106.328 113.123 1.00 0.00   ? 42   CYS D SG    1 
ATOM   7609  N  N     . ASN D 1 43   ? 125.301 102.358 112.108 1.00 0.00   ? 43   ASN D N     1 
ATOM   7610  C  CA    . ASN D 1 43   ? 125.739 101.032 112.521 1.00 0.00   ? 43   ASN D CA    1 
ATOM   7611  C  C     . ASN D 1 43   ? 126.989 100.558 111.782 1.00 0.00   ? 43   ASN D C     1 
ATOM   7612  O  O     . ASN D 1 43   ? 126.906 99.818  110.801 1.00 0.00   ? 43   ASN D O     1 
ATOM   7613  C  CB    . ASN D 1 43   ? 124.576 100.054 112.308 1.00 0.00   ? 43   ASN D CB    1 
ATOM   7614  C  CG    . ASN D 1 43   ? 124.964 98.611  112.525 1.00 0.00   ? 43   ASN D CG    1 
ATOM   7615  O  OD1   . ASN D 1 43   ? 125.714 98.287  113.444 1.00 0.00   ? 43   ASN D OD1   1 
ATOM   7616  N  ND2   . ASN D 1 43   ? 124.433 97.725  111.688 1.00 0.00   ? 43   ASN D ND2   1 
ATOM   7617  N  N     . VAL D 1 44   ? 128.148 100.997 112.271 1.00 0.00   ? 44   VAL D N     1 
ATOM   7618  C  CA    . VAL D 1 44   ? 129.436 100.634 111.681 1.00 0.00   ? 44   VAL D CA    1 
ATOM   7619  C  C     . VAL D 1 44   ? 130.460 100.238 112.745 1.00 0.00   ? 44   VAL D C     1 
ATOM   7620  O  O     . VAL D 1 44   ? 130.679 100.974 113.709 1.00 0.00   ? 44   VAL D O     1 
ATOM   7621  C  CB    . VAL D 1 44   ? 130.036 101.797 110.865 1.00 0.00   ? 44   VAL D CB    1 
ATOM   7622  C  CG1   . VAL D 1 44   ? 131.426 101.419 110.364 1.00 0.00   ? 44   VAL D CG1   1 
ATOM   7623  C  CG2   . VAL D 1 44   ? 129.131 102.132 109.697 1.00 0.00   ? 44   VAL D CG2   1 
ATOM   7624  N  N     . ALA D 1 45   ? 131.084 99.084  112.563 1.00 0.00   ? 45   ALA D N     1 
ATOM   7625  C  CA    . ALA D 1 45   ? 132.102 98.615  113.497 1.00 0.00   ? 45   ALA D CA    1 
ATOM   7626  C  C     . ALA D 1 45   ? 133.442 99.211  113.059 1.00 0.00   ? 45   ALA D C     1 
ATOM   7627  O  O     . ALA D 1 45   ? 133.642 99.499  111.879 1.00 0.00   ? 45   ALA D O     1 
ATOM   7628  C  CB    . ALA D 1 45   ? 132.165 97.089  113.488 1.00 0.00   ? 45   ALA D CB    1 
ATOM   7629  N  N     . HIS D 1 46   ? 134.362 99.393  114.005 1.00 0.00   ? 46   HIS D N     1 
ATOM   7630  C  CA    . HIS D 1 46   ? 135.675 99.981  113.712 1.00 0.00   ? 46   HIS D CA    1 
ATOM   7631  C  C     . HIS D 1 46   ? 136.815 99.090  114.215 1.00 0.00   ? 46   HIS D C     1 
ATOM   7632  O  O     . HIS D 1 46   ? 137.189 99.148  115.387 1.00 0.00   ? 46   HIS D O     1 
ATOM   7633  C  CB    . HIS D 1 46   ? 135.764 101.353 114.375 1.00 0.00   ? 46   HIS D CB    1 
ATOM   7634  C  CG    . HIS D 1 46   ? 134.673 102.300 113.956 1.00 0.00   ? 46   HIS D CG    1 
ATOM   7635  N  ND1   . HIS D 1 46   ? 134.783 103.139 112.869 1.00 0.00   ? 46   HIS D ND1   1 
ATOM   7636  C  CD2   . HIS D 1 46   ? 133.445 102.529 114.480 1.00 0.00   ? 46   HIS D CD2   1 
ATOM   7637  C  CE1   . HIS D 1 46   ? 133.675 103.846 112.744 1.00 0.00   ? 46   HIS D CE1   1 
ATOM   7638  N  NE2   . HIS D 1 46   ? 132.846 103.498 113.710 1.00 0.00   ? 46   HIS D NE2   1 
ATOM   7639  N  N     . LYS D 1 47   ? 137.380 98.281  113.324 1.00 0.00   ? 47   LYS D N     1 
ATOM   7640  C  CA    . LYS D 1 47   ? 138.444 97.350  113.700 1.00 0.00   ? 47   LYS D CA    1 
ATOM   7641  C  C     . LYS D 1 47   ? 139.890 97.850  113.690 1.00 0.00   ? 47   LYS D C     1 
ATOM   7642  O  O     . LYS D 1 47   ? 140.284 98.666  112.853 1.00 0.00   ? 47   LYS D O     1 
ATOM   7643  C  CB    . LYS D 1 47   ? 138.318 96.065  112.865 1.00 0.00   ? 47   LYS D CB    1 
ATOM   7644  C  CG    . LYS D 1 47   ? 136.964 95.378  113.072 1.00 0.00   ? 47   LYS D CG    1 
ATOM   7645  C  CD    . LYS D 1 47   ? 136.890 93.951  112.532 1.00 0.00   ? 47   LYS D CD    1 
ATOM   7646  C  CE    . LYS D 1 47   ? 135.583 93.289  112.961 1.00 0.00   ? 47   LYS D CE    1 
ATOM   7647  N  NZ    . LYS D 1 47   ? 135.411 91.897  112.454 1.00 0.00   ? 47   LYS D NZ    1 
ATOM   7648  N  N     . ASN D 1 48   ? 140.668 97.320  114.636 1.00 0.00   ? 48   ASN D N     1 
ATOM   7649  C  CA    . ASN D 1 48   ? 142.078 97.650  114.832 1.00 0.00   ? 48   ASN D CA    1 
ATOM   7650  C  C     . ASN D 1 48   ? 142.342 99.094  115.186 1.00 0.00   ? 48   ASN D C     1 
ATOM   7651  O  O     . ASN D 1 48   ? 143.254 99.705  114.631 1.00 0.00   ? 48   ASN D O     1 
ATOM   7652  C  CB    . ASN D 1 48   ? 142.896 97.343  113.583 1.00 0.00   ? 48   ASN D CB    1 
ATOM   7653  C  CG    . ASN D 1 48   ? 142.686 95.958  113.084 1.00 0.00   ? 48   ASN D CG    1 
ATOM   7654  O  OD1   . ASN D 1 48   ? 143.253 94.992  113.600 1.00 0.00   ? 48   ASN D OD1   1 
ATOM   7655  N  ND2   . ASN D 1 48   ? 141.849 95.839  112.069 1.00 0.00   ? 48   ASN D ND2   1 
ATOM   7656  N  N     . ILE D 1 49   ? 141.552 99.689  116.060 1.00 0.00   ? 49   ILE D N     1 
ATOM   7657  C  CA    . ILE D 1 49   ? 141.870 101.060 116.364 1.00 0.00   ? 49   ILE D CA    1 
ATOM   7658  C  C     . ILE D 1 49   ? 143.189 101.005 117.103 1.00 0.00   ? 49   ILE D C     1 
ATOM   7659  O  O     . ILE D 1 49   ? 143.328 100.265 118.071 1.00 0.00   ? 49   ILE D O     1 
ATOM   7660  C  CB    . ILE D 1 49   ? 140.809 101.701 117.254 1.00 0.00   ? 49   ILE D CB    1 
ATOM   7661  C  CG1   . ILE D 1 49   ? 139.444 101.618 116.583 1.00 0.00   ? 49   ILE D CG1   1 
ATOM   7662  C  CG2   . ILE D 1 49   ? 141.162 103.149 117.527 1.00 0.00   ? 49   ILE D CG2   1 
ATOM   7663  C  CD1   . ILE D 1 49   ? 138.335 102.226 117.411 1.00 0.00   ? 49   ILE D CD1   1 
ATOM   7664  N  N     . ARG D 1 50   ? 144.161 101.782 116.650 1.00 0.00   ? 50   ARG D N     1 
ATOM   7665  C  CA    . ARG D 1 50   ? 145.450 101.821 117.318 1.00 0.00   ? 50   ARG D CA    1 
ATOM   7666  C  C     . ARG D 1 50   ? 145.296 102.854 118.406 1.00 0.00   ? 50   ARG D C     1 
ATOM   7667  O  O     . ARG D 1 50   ? 145.839 103.950 118.316 1.00 0.00   ? 50   ARG D O     1 
ATOM   7668  C  CB    . ARG D 1 50   ? 146.546 102.246 116.347 1.00 0.00   ? 50   ARG D CB    1 
ATOM   7669  C  CG    . ARG D 1 50   ? 147.285 101.102 115.681 1.00 0.00   ? 50   ARG D CG    1 
ATOM   7670  C  CD    . ARG D 1 50   ? 148.436 101.646 114.855 1.00 0.00   ? 50   ARG D CD    1 
ATOM   7671  N  NE    . ARG D 1 50   ? 149.051 102.795 115.511 1.00 0.00   ? 50   ARG D NE    1 
ATOM   7672  C  CZ    . ARG D 1 50   ? 149.990 103.557 114.964 1.00 0.00   ? 50   ARG D CZ    1 
ATOM   7673  N  NH1   . ARG D 1 50   ? 150.437 103.293 113.742 1.00 0.00   ? 50   ARG D NH1   1 
ATOM   7674  N  NH2   . ARG D 1 50   ? 150.485 104.584 115.639 1.00 0.00   ? 50   ARG D NH2   1 
ATOM   7675  N  N     . GLU D 1 51   ? 144.563 102.520 119.461 1.00 0.00   ? 51   GLU D N     1 
ATOM   7676  C  CA    . GLU D 1 51   ? 144.327 103.515 120.498 1.00 0.00   ? 51   GLU D CA    1 
ATOM   7677  C  C     . GLU D 1 51   ? 145.625 103.999 121.117 1.00 0.00   ? 51   GLU D C     1 
ATOM   7678  O  O     . GLU D 1 51   ? 146.471 103.209 121.524 1.00 0.00   ? 51   GLU D O     1 
ATOM   7679  C  CB    . GLU D 1 51   ? 143.420 102.943 121.591 1.00 0.00   ? 51   GLU D CB    1 
ATOM   7680  C  CG    . GLU D 1 51   ? 141.997 102.660 121.129 1.00 0.00   ? 51   GLU D CG    1 
ATOM   7681  C  CD    . GLU D 1 51   ? 141.141 102.029 122.210 1.00 0.00   ? 51   GLU D CD    1 
ATOM   7682  O  OE1   . GLU D 1 51   ? 141.699 101.635 123.255 1.00 0.00   ? 51   GLU D OE1   1 
ATOM   7683  O  OE2   . GLU D 1 51   ? 139.910 101.920 122.010 1.00 0.00   ? 51   GLU D OE2   1 
ATOM   7684  N  N     . GLN D 1 52   ? 145.762 105.320 121.181 1.00 0.00   ? 52   GLN D N     1 
ATOM   7685  C  CA    . GLN D 1 52   ? 146.925 105.954 121.772 1.00 0.00   ? 52   GLN D CA    1 
ATOM   7686  C  C     . GLN D 1 52   ? 146.551 106.501 123.135 1.00 0.00   ? 52   GLN D C     1 
ATOM   7687  O  O     . GLN D 1 52   ? 147.364 107.135 123.804 1.00 0.00   ? 52   GLN D O     1 
ATOM   7688  C  CB    . GLN D 1 52   ? 147.438 107.082 120.878 1.00 0.00   ? 52   GLN D CB    1 
ATOM   7689  C  CG    . GLN D 1 52   ? 147.704 106.668 119.442 1.00 0.00   ? 52   GLN D CG    1 
ATOM   7690  C  CD    . GLN D 1 52   ? 148.682 105.517 119.337 1.00 0.00   ? 52   GLN D CD    1 
ATOM   7691  O  OE1   . GLN D 1 52   ? 148.972 104.844 120.326 1.00 0.00   ? 52   GLN D OE1   1 
ATOM   7692  N  NE2   . GLN D 1 52   ? 149.197 105.281 118.135 1.00 0.00   ? 52   GLN D NE2   1 
ATOM   7693  N  N     . GLY D 1 53   ? 145.309 106.261 123.543 1.00 0.00   ? 53   GLY D N     1 
ATOM   7694  C  CA    . GLY D 1 53   ? 144.842 106.753 124.826 1.00 0.00   ? 53   GLY D CA    1 
ATOM   7695  C  C     . GLY D 1 53   ? 144.077 108.057 124.691 1.00 0.00   ? 53   GLY D C     1 
ATOM   7696  O  O     . GLY D 1 53   ? 143.563 108.593 125.673 1.00 0.00   ? 53   GLY D O     1 
ATOM   7697  N  N     . ARG D 1 54   ? 144.012 108.569 123.466 1.00 0.00   ? 54   ARG D N     1 
ATOM   7698  C  CA    . ARG D 1 54   ? 143.312 109.813 123.180 1.00 0.00   ? 54   ARG D CA    1 
ATOM   7699  C  C     . ARG D 1 54   ? 141.831 109.657 123.505 1.00 0.00   ? 54   ARG D C     1 
ATOM   7700  O  O     . ARG D 1 54   ? 141.112 110.638 123.680 1.00 0.00   ? 54   ARG D O     1 
ATOM   7701  C  CB    . ARG D 1 54   ? 143.490 110.180 121.704 1.00 0.00   ? 54   ARG D CB    1 
ATOM   7702  C  CG    . ARG D 1 54   ? 144.910 110.589 121.350 1.00 0.00   ? 54   ARG D CG    1 
ATOM   7703  C  CD    . ARG D 1 54   ? 144.991 111.243 119.982 1.00 0.00   ? 54   ARG D CD    1 
ATOM   7704  N  NE    . ARG D 1 54   ? 144.595 110.333 118.906 1.00 0.00   ? 54   ARG D NE    1 
ATOM   7705  C  CZ    . ARG D 1 54   ? 145.424 109.479 118.312 1.00 0.00   ? 54   ARG D CZ    1 
ATOM   7706  N  NH1   . ARG D 1 54   ? 146.694 109.420 118.687 1.00 0.00   ? 54   ARG D NH1   1 
ATOM   7707  N  NH2   . ARG D 1 54   ? 144.985 108.687 117.341 1.00 0.00   ? 54   ARG D NH2   1 
ATOM   7708  N  N     . PHE D 1 55   ? 141.384 108.406 123.578 1.00 0.00   ? 55   PHE D N     1 
ATOM   7709  C  CA    . PHE D 1 55   ? 139.997 108.100 123.880 1.00 0.00   ? 55   PHE D CA    1 
ATOM   7710  C  C     . PHE D 1 55   ? 139.621 108.637 125.257 1.00 0.00   ? 55   PHE D C     1 
ATOM   7711  O  O     . PHE D 1 55   ? 138.523 109.163 125.453 1.00 0.00   ? 55   PHE D O     1 
ATOM   7712  C  CB    . PHE D 1 55   ? 139.769 106.588 123.855 1.00 0.00   ? 55   PHE D CB    1 
ATOM   7713  C  CG    . PHE D 1 55   ? 138.343 106.191 124.098 1.00 0.00   ? 55   PHE D CG    1 
ATOM   7714  C  CD1   . PHE D 1 55   ? 137.386 106.354 123.108 1.00 0.00   ? 55   PHE D CD1   1 
ATOM   7715  C  CD2   . PHE D 1 55   ? 137.951 105.673 125.329 1.00 0.00   ? 55   PHE D CD2   1 
ATOM   7716  C  CE1   . PHE D 1 55   ? 136.060 106.014 123.331 1.00 0.00   ? 55   PHE D CE1   1 
ATOM   7717  C  CE2   . PHE D 1 55   ? 136.622 105.328 125.568 1.00 0.00   ? 55   PHE D CE2   1 
ATOM   7718  C  CZ    . PHE D 1 55   ? 135.674 105.500 124.566 1.00 0.00   ? 55   PHE D CZ    1 
ATOM   7719  N  N     . LEU D 1 56   ? 140.536 108.497 126.208 1.00 0.00   ? 56   LEU D N     1 
ATOM   7720  C  CA    . LEU D 1 56   ? 140.294 108.956 127.566 1.00 0.00   ? 56   LEU D CA    1 
ATOM   7721  C  C     . LEU D 1 56   ? 140.837 110.353 127.851 1.00 0.00   ? 56   LEU D C     1 
ATOM   7722  O  O     . LEU D 1 56   ? 140.384 111.010 128.789 1.00 0.00   ? 56   LEU D O     1 
ATOM   7723  C  CB    . LEU D 1 56   ? 140.875 107.956 128.570 1.00 0.00   ? 56   LEU D CB    1 
ATOM   7724  C  CG    . LEU D 1 56   ? 140.208 106.580 128.573 1.00 0.00   ? 56   LEU D CG    1 
ATOM   7725  C  CD1   . LEU D 1 56   ? 140.853 105.706 129.636 1.00 0.00   ? 56   LEU D CD1   1 
ATOM   7726  C  CD2   . LEU D 1 56   ? 138.716 106.727 128.835 1.00 0.00   ? 56   LEU D CD2   1 
ATOM   7727  N  N     . GLN D 1 57   ? 141.797 110.807 127.053 1.00 0.00   ? 57   GLN D N     1 
ATOM   7728  C  CA    . GLN D 1 57   ? 142.361 112.142 127.249 1.00 0.00   ? 57   GLN D CA    1 
ATOM   7729  C  C     . GLN D 1 57   ? 141.224 113.141 127.127 1.00 0.00   ? 57   GLN D C     1 
ATOM   7730  O  O     . GLN D 1 57   ? 141.158 114.127 127.858 1.00 0.00   ? 57   GLN D O     1 
ATOM   7731  C  CB    . GLN D 1 57   ? 143.419 112.459 126.189 1.00 0.00   ? 57   GLN D CB    1 
ATOM   7732  C  CG    . GLN D 1 57   ? 144.591 111.513 126.193 1.00 0.00   ? 57   GLN D CG    1 
ATOM   7733  C  CD    . GLN D 1 57   ? 145.766 112.044 125.396 1.00 0.00   ? 57   GLN D CD    1 
ATOM   7734  O  OE1   . GLN D 1 57   ? 145.702 112.156 124.171 1.00 0.00   ? 57   GLN D OE1   1 
ATOM   7735  N  NE2   . GLN D 1 57   ? 146.847 112.380 126.090 1.00 0.00   ? 57   GLN D NE2   1 
ATOM   7736  N  N     . ASP D 1 58   ? 140.336 112.862 126.177 1.00 0.00   ? 58   ASP D N     1 
ATOM   7737  C  CA    . ASP D 1 58   ? 139.164 113.691 125.928 1.00 0.00   ? 58   ASP D CA    1 
ATOM   7738  C  C     . ASP D 1 58   ? 138.147 113.285 126.986 1.00 0.00   ? 58   ASP D C     1 
ATOM   7739  O  O     . ASP D 1 58   ? 137.116 112.677 126.694 1.00 0.00   ? 58   ASP D O     1 
ATOM   7740  C  CB    . ASP D 1 58   ? 138.625 113.411 124.522 1.00 0.00   ? 58   ASP D CB    1 
ATOM   7741  C  CG    . ASP D 1 58   ? 137.461 114.308 124.151 1.00 0.00   ? 58   ASP D CG    1 
ATOM   7742  O  OD1   . ASP D 1 58   ? 137.071 115.163 124.974 1.00 0.00   ? 58   ASP D OD1   1 
ATOM   7743  O  OD2   . ASP D 1 58   ? 136.944 114.160 123.020 1.00 0.00   ? 58   ASP D OD2   1 
ATOM   7744  N  N     . VAL D 1 59   ? 138.465 113.630 128.226 1.00 0.00   ? 59   VAL D N     1 
ATOM   7745  C  CA    . VAL D 1 59   ? 137.631 113.308 129.372 1.00 0.00   ? 59   VAL D CA    1 
ATOM   7746  C  C     . VAL D 1 59   ? 136.263 113.981 129.344 1.00 0.00   ? 59   VAL D C     1 
ATOM   7747  O  O     . VAL D 1 59   ? 135.246 113.340 129.608 1.00 0.00   ? 59   VAL D O     1 
ATOM   7748  C  CB    . VAL D 1 59   ? 138.331 113.723 130.684 1.00 0.00   ? 59   VAL D CB    1 
ATOM   7749  C  CG1   . VAL D 1 59   ? 137.387 113.568 131.863 1.00 0.00   ? 59   VAL D CG1   1 
ATOM   7750  C  CG2   . VAL D 1 59   ? 139.580 112.882 130.887 1.00 0.00   ? 59   VAL D CG2   1 
ATOM   7751  N  N     . PHE D 1 60   ? 136.243 115.268 129.020 1.00 0.00   ? 60   PHE D N     1 
ATOM   7752  C  CA    . PHE D 1 60   ? 135.005 116.030 129.014 1.00 0.00   ? 60   PHE D CA    1 
ATOM   7753  C  C     . PHE D 1 60   ? 133.998 115.769 127.889 1.00 0.00   ? 60   PHE D C     1 
ATOM   7754  O  O     . PHE D 1 60   ? 132.797 115.911 128.100 1.00 0.00   ? 60   PHE D O     1 
ATOM   7755  C  CB    . PHE D 1 60   ? 135.335 117.520 129.124 1.00 0.00   ? 60   PHE D CB    1 
ATOM   7756  C  CG    . PHE D 1 60   ? 136.194 117.851 130.318 1.00 0.00   ? 60   PHE D CG    1 
ATOM   7757  C  CD1   . PHE D 1 60   ? 137.568 118.035 130.181 1.00 0.00   ? 60   PHE D CD1   1 
ATOM   7758  C  CD2   . PHE D 1 60   ? 135.636 117.936 131.593 1.00 0.00   ? 60   PHE D CD2   1 
ATOM   7759  C  CE1   . PHE D 1 60   ? 138.373 118.294 131.290 1.00 0.00   ? 60   PHE D CE1   1 
ATOM   7760  C  CE2   . PHE D 1 60   ? 136.436 118.196 132.708 1.00 0.00   ? 60   PHE D CE2   1 
ATOM   7761  C  CZ    . PHE D 1 60   ? 137.804 118.376 132.558 1.00 0.00   ? 60   PHE D CZ    1 
ATOM   7762  N  N     . THR D 1 61   ? 134.467 115.392 126.704 1.00 0.00   ? 61   THR D N     1 
ATOM   7763  C  CA    . THR D 1 61   ? 133.525 115.095 125.632 1.00 0.00   ? 61   THR D CA    1 
ATOM   7764  C  C     . THR D 1 61   ? 132.882 113.775 126.032 1.00 0.00   ? 61   THR D C     1 
ATOM   7765  O  O     . THR D 1 61   ? 131.697 113.529 125.784 1.00 0.00   ? 61   THR D O     1 
ATOM   7766  C  CB    . THR D 1 61   ? 134.233 114.895 124.287 1.00 0.00   ? 61   THR D CB    1 
ATOM   7767  O  OG1   . THR D 1 61   ? 134.906 116.099 123.921 1.00 0.00   ? 61   THR D OG1   1 
ATOM   7768  C  CG2   . THR D 1 61   ? 133.231 114.526 123.209 1.00 0.00   ? 61   THR D CG2   1 
ATOM   7769  N  N     . THR D 1 62   ? 133.696 112.938 126.663 1.00 0.00   ? 62   THR D N     1 
ATOM   7770  C  CA    . THR D 1 62   ? 133.290 111.625 127.136 1.00 0.00   ? 62   THR D CA    1 
ATOM   7771  C  C     . THR D 1 62   ? 132.262 111.742 128.252 1.00 0.00   ? 62   THR D C     1 
ATOM   7772  O  O     . THR D 1 62   ? 131.226 111.077 128.228 1.00 0.00   ? 62   THR D O     1 
ATOM   7773  C  CB    . THR D 1 62   ? 134.504 110.843 127.665 1.00 0.00   ? 62   THR D CB    1 
ATOM   7774  O  OG1   . THR D 1 62   ? 135.413 110.589 126.586 1.00 0.00   ? 62   THR D OG1   1 
ATOM   7775  C  CG2   . THR D 1 62   ? 134.070 109.524 128.279 1.00 0.00   ? 62   THR D CG2   1 
ATOM   7776  N  N     . LEU D 1 63   ? 132.552 112.596 129.231 1.00 0.00   ? 63   LEU D N     1 
ATOM   7777  C  CA    . LEU D 1 63   ? 131.641 112.791 130.351 1.00 0.00   ? 63   LEU D CA    1 
ATOM   7778  C  C     . LEU D 1 63   ? 130.288 113.270 129.852 1.00 0.00   ? 63   LEU D C     1 
ATOM   7779  O  O     . LEU D 1 63   ? 129.247 112.779 130.291 1.00 0.00   ? 63   LEU D O     1 
ATOM   7780  C  CB    . LEU D 1 63   ? 132.213 113.807 131.340 1.00 0.00   ? 63   LEU D CB    1 
ATOM   7781  C  CG    . LEU D 1 63   ? 133.322 113.319 132.267 1.00 0.00   ? 63   LEU D CG    1 
ATOM   7782  C  CD1   . LEU D 1 63   ? 133.771 114.471 133.148 1.00 0.00   ? 63   LEU D CD1   1 
ATOM   7783  C  CD2   . LEU D 1 63   ? 132.820 112.161 133.122 1.00 0.00   ? 63   LEU D CD2   1 
ATOM   7784  N  N     . VAL D 1 64   ? 130.303 114.224 128.928 1.00 0.00   ? 64   VAL D N     1 
ATOM   7785  C  CA    . VAL D 1 64   ? 129.067 114.750 128.368 1.00 0.00   ? 64   VAL D CA    1 
ATOM   7786  C  C     . VAL D 1 64   ? 128.351 113.667 127.569 1.00 0.00   ? 64   VAL D C     1 
ATOM   7787  O  O     . VAL D 1 64   ? 127.123 113.632 127.521 1.00 0.00   ? 64   VAL D O     1 
ATOM   7788  C  CB    . VAL D 1 64   ? 129.337 115.932 127.425 1.00 0.00   ? 64   VAL D CB    1 
ATOM   7789  C  CG1   . VAL D 1 64   ? 128.029 116.439 126.850 1.00 0.00   ? 64   VAL D CG1   1 
ATOM   7790  C  CG2   . VAL D 1 64   ? 130.056 117.043 128.165 1.00 0.00   ? 64   VAL D CG2   1 
ATOM   7791  N  N     . ASP D 1 65   ? 129.129 112.790 126.940 1.00 0.00   ? 65   ASP D N     1 
ATOM   7792  C  CA    . ASP D 1 65   ? 128.572 111.707 126.136 1.00 0.00   ? 65   ASP D CA    1 
ATOM   7793  C  C     . ASP D 1 65   ? 127.856 110.655 126.980 1.00 0.00   ? 65   ASP D C     1 
ATOM   7794  O  O     . ASP D 1 65   ? 126.957 109.965 126.500 1.00 0.00   ? 65   ASP D O     1 
ATOM   7795  C  CB    . ASP D 1 65   ? 129.670 111.028 125.308 1.00 0.00   ? 65   ASP D CB    1 
ATOM   7796  C  CG    . ASP D 1 65   ? 130.144 111.888 124.152 1.00 0.00   ? 65   ASP D CG    1 
ATOM   7797  O  OD1   . ASP D 1 65   ? 129.339 112.714 123.677 1.00 0.00   ? 65   ASP D OD1   1 
ATOM   7798  O  OD2   . ASP D 1 65   ? 131.304 111.730 123.705 1.00 0.00   ? 65   ASP D OD2   1 
ATOM   7799  N  N     . LEU D 1 66   ? 128.257 110.539 128.241 1.00 0.00   ? 66   LEU D N     1 
ATOM   7800  C  CA    . LEU D 1 66   ? 127.661 109.558 129.140 1.00 0.00   ? 66   LEU D CA    1 
ATOM   7801  C  C     . LEU D 1 66   ? 126.183 109.772 129.411 1.00 0.00   ? 66   LEU D C     1 
ATOM   7802  O  O     . LEU D 1 66   ? 125.692 110.903 129.391 1.00 0.00   ? 66   LEU D O     1 
ATOM   7803  C  CB    . LEU D 1 66   ? 128.407 109.547 130.473 1.00 0.00   ? 66   LEU D CB    1 
ATOM   7804  C  CG    . LEU D 1 66   ? 129.879 109.156 130.386 1.00 0.00   ? 66   LEU D CG    1 
ATOM   7805  C  CD1   . LEU D 1 66   ? 130.483 109.169 131.774 1.00 0.00   ? 66   LEU D CD1   1 
ATOM   7806  C  CD2   . LEU D 1 66   ? 130.009 107.781 129.756 1.00 0.00   ? 66   LEU D CD2   1 
ATOM   7807  N  N     . LYS D 1 67   ? 125.477 108.673 129.664 1.00 0.00   ? 67   LYS D N     1 
ATOM   7808  C  CA    . LYS D 1 67   ? 124.055 108.722 129.971 1.00 0.00   ? 67   LYS D CA    1 
ATOM   7809  C  C     . LYS D 1 67   ? 123.949 109.445 131.311 1.00 0.00   ? 67   LYS D C     1 
ATOM   7810  O  O     . LYS D 1 67   ? 124.929 109.520 132.052 1.00 0.00   ? 67   LYS D O     1 
ATOM   7811  C  CB    . LYS D 1 67   ? 123.492 107.298 130.069 1.00 0.00   ? 67   LYS D CB    1 
ATOM   7812  C  CG    . LYS D 1 67   ? 123.705 106.472 128.799 1.00 0.00   ? 67   LYS D CG    1 
ATOM   7813  C  CD    . LYS D 1 67   ? 123.200 105.037 128.935 1.00 0.00   ? 67   LYS D CD    1 
ATOM   7814  C  CE    . LYS D 1 67   ? 123.432 104.255 127.643 1.00 0.00   ? 67   LYS D CE    1 
ATOM   7815  N  NZ    . LYS D 1 67   ? 122.962 102.841 127.736 1.00 0.00   ? 67   LYS D NZ    1 
ATOM   7816  N  N     . TRP D 1 68   ? 122.771 109.973 131.630 1.00 0.00   ? 68   TRP D N     1 
ATOM   7817  C  CA    . TRP D 1 68   ? 122.585 110.707 132.883 1.00 0.00   ? 68   TRP D CA    1 
ATOM   7818  C  C     . TRP D 1 68   ? 122.870 109.911 134.154 1.00 0.00   ? 68   TRP D C     1 
ATOM   7819  O  O     . TRP D 1 68   ? 123.462 110.434 135.095 1.00 0.00   ? 68   TRP D O     1 
ATOM   7820  C  CB    . TRP D 1 68   ? 121.174 111.296 132.959 1.00 0.00   ? 68   TRP D CB    1 
ATOM   7821  C  CG    . TRP D 1 68   ? 121.059 112.661 132.349 1.00 0.00   ? 68   TRP D CG    1 
ATOM   7822  C  CD1   . TRP D 1 68   ? 120.404 112.996 131.200 1.00 0.00   ? 68   TRP D CD1   1 
ATOM   7823  C  CD2   . TRP D 1 68   ? 121.597 113.885 132.874 1.00 0.00   ? 68   TRP D CD2   1 
ATOM   7824  N  NE1   . TRP D 1 68   ? 120.493 114.351 130.977 1.00 0.00   ? 68   TRP D NE1   1 
ATOM   7825  C  CE2   . TRP D 1 68   ? 121.221 114.920 131.987 1.00 0.00   ? 68   TRP D CE2   1 
ATOM   7826  C  CE3   . TRP D 1 68   ? 122.359 114.204 134.004 1.00 0.00   ? 68   TRP D CE3   1 
ATOM   7827  C  CZ2   . TRP D 1 68   ? 121.580 116.259 132.196 1.00 0.00   ? 68   TRP D CZ2   1 
ATOM   7828  C  CZ3   . TRP D 1 68   ? 122.718 115.539 134.214 1.00 0.00   ? 68   TRP D CZ3   1 
ATOM   7829  C  CH2   . TRP D 1 68   ? 122.326 116.546 133.313 1.00 0.00   ? 68   TRP D CH2   1 
ATOM   7830  N  N     . PRO D 1 69   ? 122.438 108.640 134.202 1.00 0.00   ? 69   PRO D N     1 
ATOM   7831  C  CA    . PRO D 1 69   ? 122.676 107.818 135.392 1.00 0.00   ? 69   PRO D CA    1 
ATOM   7832  C  C     . PRO D 1 69   ? 124.156 107.649 135.722 1.00 0.00   ? 69   PRO D C     1 
ATOM   7833  O  O     . PRO D 1 69   ? 124.524 107.525 136.892 1.00 0.00   ? 69   PRO D O     1 
ATOM   7834  C  CB    . PRO D 1 69   ? 122.014 106.494 135.029 1.00 0.00   ? 69   PRO D CB    1 
ATOM   7835  C  CG    . PRO D 1 69   ? 120.879 106.924 134.167 1.00 0.00   ? 69   PRO D CG    1 
ATOM   7836  C  CD    . PRO D 1 69   ? 121.541 107.938 133.268 1.00 0.00   ? 69   PRO D CD    1 
ATOM   7837  N  N     . HIS D 1 70   ? 125.002 107.647 134.699 1.00 0.00   ? 70   HIS D N     1 
ATOM   7838  C  CA    . HIS D 1 70   ? 126.442 107.494 134.895 1.00 0.00   ? 70   HIS D CA    1 
ATOM   7839  C  C     . HIS D 1 70   ? 127.119 108.811 135.231 1.00 0.00   ? 70   HIS D C     1 
ATOM   7840  O  O     . HIS D 1 70   ? 128.124 108.840 135.935 1.00 0.00   ? 70   HIS D O     1 
ATOM   7841  C  CB    . HIS D 1 70   ? 127.088 106.882 133.651 1.00 0.00   ? 70   HIS D CB    1 
ATOM   7842  C  CG    . HIS D 1 70   ? 126.669 105.468 133.388 1.00 0.00   ? 70   HIS D CG    1 
ATOM   7843  N  ND1   . HIS D 1 70   ? 127.008 104.799 132.233 1.00 0.00   ? 70   HIS D ND1   1 
ATOM   7844  C  CD2   . HIS D 1 70   ? 125.938 104.600 134.124 1.00 0.00   ? 70   HIS D CD2   1 
ATOM   7845  C  CE1   . HIS D 1 70   ? 126.506 103.577 132.270 1.00 0.00   ? 70   HIS D CE1   1 
ATOM   7846  N  NE2   . HIS D 1 70   ? 125.853 103.431 133.409 1.00 0.00   ? 70   HIS D NE2   1 
ATOM   7847  N  N     . THR D 1 71   ? 126.578 109.904 134.712 1.00 0.00   ? 71   THR D N     1 
ATOM   7848  C  CA    . THR D 1 71   ? 127.132 111.219 135.003 1.00 0.00   ? 71   THR D CA    1 
ATOM   7849  C  C     . THR D 1 71   ? 126.914 111.462 136.486 1.00 0.00   ? 71   THR D C     1 
ATOM   7850  O  O     . THR D 1 71   ? 127.778 111.988 137.188 1.00 0.00   ? 71   THR D O     1 
ATOM   7851  C  CB    . THR D 1 71   ? 126.395 112.328 134.239 1.00 0.00   ? 71   THR D CB    1 
ATOM   7852  O  OG1   . THR D 1 71   ? 126.606 112.164 132.833 1.00 0.00   ? 71   THR D OG1   1 
ATOM   7853  C  CG2   . THR D 1 71   ? 126.892 113.687 134.687 1.00 0.00   ? 71   THR D CG2   1 
ATOM   7854  N  N     . LEU D 1 72   ? 125.739 111.053 136.950 1.00 0.00   ? 72   LEU D N     1 
ATOM   7855  C  CA    . LEU D 1 72   ? 125.356 111.208 138.345 1.00 0.00   ? 72   LEU D CA    1 
ATOM   7856  C  C     . LEU D 1 72   ? 126.193 110.320 139.260 1.00 0.00   ? 72   LEU D C     1 
ATOM   7857  O  O     . LEU D 1 72   ? 126.593 110.748 140.347 1.00 0.00   ? 72   LEU D O     1 
ATOM   7858  C  CB    . LEU D 1 72   ? 123.872 110.876 138.514 1.00 0.00   ? 72   LEU D CB    1 
ATOM   7859  C  CG    . LEU D 1 72   ? 122.889 111.761 137.742 1.00 0.00   ? 72   LEU D CG    1 
ATOM   7860  C  CD1   . LEU D 1 72   ? 121.478 111.202 137.863 1.00 0.00   ? 72   LEU D CD1   1 
ATOM   7861  C  CD2   . LEU D 1 72   ? 122.955 113.180 138.283 1.00 0.00   ? 72   LEU D CD2   1 
ATOM   7862  N  N     . LEU D 1 73   ? 126.447 109.088 138.833 1.00 0.00   ? 73   LEU D N     1 
ATOM   7863  C  CA    . LEU D 1 73   ? 127.247 108.171 139.637 1.00 0.00   ? 73   LEU D CA    1 
ATOM   7864  C  C     . LEU D 1 73   ? 128.672 108.681 139.755 1.00 0.00   ? 73   LEU D C     1 
ATOM   7865  O  O     . LEU D 1 73   ? 129.267 108.643 140.830 1.00 0.00   ? 73   LEU D O     1 
ATOM   7866  C  CB    . LEU D 1 73   ? 127.271 106.775 139.013 1.00 0.00   ? 73   LEU D CB    1 
ATOM   7867  C  CG    . LEU D 1 73   ? 126.057 105.864 139.189 1.00 0.00   ? 73   LEU D CG    1 
ATOM   7868  C  CD1   . LEU D 1 73   ? 126.338 104.542 138.495 1.00 0.00   ? 73   LEU D CD1   1 
ATOM   7869  C  CD2   . LEU D 1 73   ? 125.778 105.638 140.668 1.00 0.00   ? 73   LEU D CD2   1 
ATOM   7870  N  N     . ILE D 1 74   ? 129.238 109.162 138.655 1.00 0.00   ? 74   ILE D N     1 
ATOM   7871  C  CA    . ILE D 1 74   ? 130.608 109.661 138.699 1.00 0.00   ? 74   ILE D CA    1 
ATOM   7872  C  C     . ILE D 1 74   ? 130.761 110.828 139.657 1.00 0.00   ? 74   ILE D C     1 
ATOM   7873  O  O     . ILE D 1 74   ? 131.687 110.865 140.461 1.00 0.00   ? 74   ILE D O     1 
ATOM   7874  C  CB    . ILE D 1 74   ? 131.126 110.123 137.330 1.00 0.00   ? 74   ILE D CB    1 
ATOM   7875  C  CG1   . ILE D 1 74   ? 131.245 108.947 136.367 1.00 0.00   ? 74   ILE D CG1   1 
ATOM   7876  C  CG2   . ILE D 1 74   ? 132.464 110.816 137.491 1.00 0.00   ? 74   ILE D CG2   1 
ATOM   7877  C  CD1   . ILE D 1 74   ? 131.495 109.349 134.931 1.00 0.00   ? 74   ILE D CD1   1 
ATOM   7878  N  N     . PHE D 1 75   ? 129.859 111.789 139.570 1.00 0.00   ? 75   PHE D N     1 
ATOM   7879  C  CA    . PHE D 1 75   ? 129.962 112.948 140.447 1.00 0.00   ? 75   PHE D CA    1 
ATOM   7880  C  C     . PHE D 1 75   ? 129.565 112.591 141.873 1.00 0.00   ? 75   PHE D C     1 
ATOM   7881  O  O     . PHE D 1 75   ? 130.074 113.178 142.828 1.00 0.00   ? 75   PHE D O     1 
ATOM   7882  C  CB    . PHE D 1 75   ? 129.087 114.097 139.942 1.00 0.00   ? 75   PHE D CB    1 
ATOM   7883  C  CG    . PHE D 1 75   ? 129.567 114.725 138.652 1.00 0.00   ? 75   PHE D CG    1 
ATOM   7884  C  CD1   . PHE D 1 75   ? 130.905 115.069 138.470 1.00 0.00   ? 75   PHE D CD1   1 
ATOM   7885  C  CD2   . PHE D 1 75   ? 128.653 115.039 137.647 1.00 0.00   ? 75   PHE D CD2   1 
ATOM   7886  C  CE1   . PHE D 1 75   ? 131.324 115.716 137.303 1.00 0.00   ? 75   PHE D CE1   1 
ATOM   7887  C  CE2   . PHE D 1 75   ? 129.061 115.686 136.484 1.00 0.00   ? 75   PHE D CE2   1 
ATOM   7888  C  CZ    . PHE D 1 75   ? 130.396 116.028 136.311 1.00 0.00   ? 75   PHE D CZ    1 
ATOM   7889  N  N     . THR D 1 76   ? 128.695 111.604 142.037 1.00 0.00   ? 76   THR D N     1 
ATOM   7890  C  CA    . THR D 1 76   ? 128.356 111.186 143.389 1.00 0.00   ? 76   THR D CA    1 
ATOM   7891  C  C     . THR D 1 76   ? 129.626 110.569 143.945 1.00 0.00   ? 76   THR D C     1 
ATOM   7892  O  O     . THR D 1 76   ? 130.047 110.878 145.053 1.00 0.00   ? 76   THR D O     1 
ATOM   7893  C  CB    . THR D 1 76   ? 127.218 110.164 143.446 1.00 0.00   ? 76   THR D CB    1 
ATOM   7894  O  OG1   . THR D 1 76   ? 126.037 110.746 142.885 1.00 0.00   ? 76   THR D OG1   1 
ATOM   7895  C  CG2   . THR D 1 76   ? 126.940 109.776 144.887 1.00 0.00   ? 76   THR D CG2   1 
ATOM   7896  N  N     . MET D 1 77   ? 130.244 109.699 143.156 1.00 0.00   ? 77   MET D N     1 
ATOM   7897  C  CA    . MET D 1 77   ? 131.474 109.049 143.578 1.00 0.00   ? 77   MET D CA    1 
ATOM   7898  C  C     . MET D 1 77   ? 132.607 110.039 143.784 1.00 0.00   ? 77   MET D C     1 
ATOM   7899  O  O     . MET D 1 77   ? 133.352 109.942 144.755 1.00 0.00   ? 77   MET D O     1 
ATOM   7900  C  CB    . MET D 1 77   ? 131.910 108.003 142.553 1.00 0.00   ? 77   MET D CB    1 
ATOM   7901  C  CG    . MET D 1 77   ? 131.128 106.706 142.603 1.00 0.00   ? 77   MET D CG    1 
ATOM   7902  S  SD    . MET D 1 77   ? 131.215 105.919 144.220 1.00 0.00   ? 77   MET D SD    1 
ATOM   7903  C  CE    . MET D 1 77   ? 132.962 106.073 144.572 1.00 0.00   ? 77   MET D CE    1 
ATOM   7904  N  N     . SER D 1 78   ? 132.736 111.007 142.888 1.00 0.00   ? 78   SER D N     1 
ATOM   7905  C  CA    . SER D 1 78   ? 133.826 111.955 143.019 1.00 0.00   ? 78   SER D CA    1 
ATOM   7906  C  C     . SER D 1 78   ? 133.701 112.730 144.311 1.00 0.00   ? 78   SER D C     1 
ATOM   7907  O  O     . SER D 1 78   ? 134.673 112.883 145.046 1.00 0.00   ? 78   SER D O     1 
ATOM   7908  C  CB    . SER D 1 78   ? 133.819 112.941 141.855 1.00 0.00   ? 78   SER D CB    1 
ATOM   7909  O  OG    . SER D 1 78   ? 133.900 112.266 140.616 1.00 0.00   ? 78   SER D OG    1 
ATOM   7910  N  N     . PHE D 1 79   ? 132.499 113.201 144.608 1.00 0.00   ? 79   PHE D N     1 
ATOM   7911  C  CA    . PHE D 1 79   ? 132.315 113.945 145.835 1.00 0.00   ? 79   PHE D CA    1 
ATOM   7912  C  C     . PHE D 1 79   ? 132.562 113.054 147.031 1.00 0.00   ? 79   PHE D C     1 
ATOM   7913  O  O     . PHE D 1 79   ? 133.271 113.428 147.953 1.00 0.00   ? 79   PHE D O     1 
ATOM   7914  C  CB    . PHE D 1 79   ? 130.913 114.535 145.911 1.00 0.00   ? 79   PHE D CB    1 
ATOM   7915  C  CG    . PHE D 1 79   ? 130.631 115.546 144.848 1.00 0.00   ? 79   PHE D CG    1 
ATOM   7916  C  CD1   . PHE D 1 79   ? 131.662 116.161 144.170 1.00 0.00   ? 79   PHE D CD1   1 
ATOM   7917  C  CD2   . PHE D 1 79   ? 129.333 115.888 144.537 1.00 0.00   ? 79   PHE D CD2   1 
ATOM   7918  C  CE1   . PHE D 1 79   ? 131.406 117.097 143.193 1.00 0.00   ? 79   PHE D CE1   1 
ATOM   7919  C  CE2   . PHE D 1 79   ? 129.066 116.821 143.556 1.00 0.00   ? 79   PHE D CE2   1 
ATOM   7920  C  CZ    . PHE D 1 79   ? 130.103 117.428 142.884 1.00 0.00   ? 79   PHE D CZ    1 
ATOM   7921  N  N     . LEU D 1 80   ? 131.937 111.883 147.020 1.00 0.00   ? 80   LEU D N     1 
ATOM   7922  C  CA    . LEU D 1 80   ? 132.072 110.948 148.118 1.00 0.00   ? 80   LEU D CA    1 
ATOM   7923  C  C     . LEU D 1 80   ? 133.533 110.638 148.365 1.00 0.00   ? 80   LEU D C     1 
ATOM   7924  O  O     . LEU D 1 80   ? 134.006 110.718 149.492 1.00 0.00   ? 80   LEU D O     1 
ATOM   7925  C  CB    . LEU D 1 80   ? 131.312 109.662 147.833 1.00 0.00   ? 80   LEU D CB    1 
ATOM   7926  C  CG    . LEU D 1 80   ? 131.171 108.758 149.053 1.00 0.00   ? 80   LEU D CG    1 
ATOM   7927  C  CD1   . LEU D 1 80   ? 130.322 109.458 150.096 1.00 0.00   ? 80   LEU D CD1   1 
ATOM   7928  C  CD2   . LEU D 1 80   ? 130.557 107.426 148.671 1.00 0.00   ? 80   LEU D CD2   1 
ATOM   7929  N  N     . CYS D 1 81   ? 134.255 110.309 147.306 1.00 0.00   ? 81   CYS D N     1 
ATOM   7930  C  CA    . CYS D 1 81   ? 135.666 109.998 147.449 1.00 0.00   ? 81   CYS D CA    1 
ATOM   7931  C  C     . CYS D 1 81   ? 136.436 111.194 147.969 1.00 0.00   ? 81   CYS D C     1 
ATOM   7932  O  O     . CYS D 1 81   ? 137.204 111.079 148.921 1.00 0.00   ? 81   CYS D O     1 
ATOM   7933  C  CB    . CYS D 1 81   ? 136.259 109.538 146.121 1.00 0.00   ? 81   CYS D CB    1 
ATOM   7934  S  SG    . CYS D 1 81   ? 135.865 107.826 145.714 1.00 0.00   ? 81   CYS D SG    1 
ATOM   7935  N  N     . SER D 1 82   ? 136.223 112.350 147.355 1.00 0.00   ? 82   SER D N     1 
ATOM   7936  C  CA    . SER D 1 82   ? 136.943 113.537 147.765 1.00 0.00   ? 82   SER D CA    1 
ATOM   7937  C  C     . SER D 1 82   ? 136.653 113.845 149.220 1.00 0.00   ? 82   SER D C     1 
ATOM   7938  O  O     . SER D 1 82   ? 137.559 114.148 149.983 1.00 0.00   ? 82   SER D O     1 
ATOM   7939  C  CB    . SER D 1 82   ? 136.557 114.724 146.898 1.00 0.00   ? 82   SER D CB    1 
ATOM   7940  O  OG    . SER D 1 82   ? 135.164 114.945 146.969 1.00 0.00   ? 82   SER D OG    1 
ATOM   7941  N  N     . TRP D 1 83   ? 135.388 113.743 149.617 1.00 0.00   ? 83   TRP D N     1 
ATOM   7942  C  CA    . TRP D 1 83   ? 135.051 114.009 151.004 1.00 0.00   ? 83   TRP D CA    1 
ATOM   7943  C  C     . TRP D 1 83   ? 135.734 112.977 151.889 1.00 0.00   ? 83   TRP D C     1 
ATOM   7944  O  O     . TRP D 1 83   ? 136.302 113.307 152.922 1.00 0.00   ? 83   TRP D O     1 
ATOM   7945  C  CB    . TRP D 1 83   ? 133.538 113.980 151.223 1.00 0.00   ? 83   TRP D CB    1 
ATOM   7946  C  CG    . TRP D 1 83   ? 132.798 115.145 150.620 1.00 0.00   ? 83   TRP D CG    1 
ATOM   7947  C  CD1   . TRP D 1 83   ? 133.214 116.429 150.554 1.00 0.00   ? 83   TRP D CD1   1 
ATOM   7948  C  CD2   . TRP D 1 83   ? 131.496 115.116 150.025 1.00 0.00   ? 83   TRP D CD2   1 
ATOM   7949  N  NE1   . TRP D 1 83   ? 132.265 117.209 149.943 1.00 0.00   ? 83   TRP D NE1   1 
ATOM   7950  C  CE2   . TRP D 1 83   ? 131.195 116.420 149.614 1.00 0.00   ? 83   TRP D CE2   1 
ATOM   7951  C  CE3   . TRP D 1 83   ? 130.554 114.109 149.810 1.00 0.00   ? 83   TRP D CE3   1 
ATOM   7952  C  CZ2   . TRP D 1 83   ? 129.999 116.746 148.990 1.00 0.00   ? 83   TRP D CZ2   1 
ATOM   7953  C  CZ3   . TRP D 1 83   ? 129.370 114.431 149.192 1.00 0.00   ? 83   TRP D CZ3   1 
ATOM   7954  C  CH2   . TRP D 1 83   ? 129.101 115.738 148.788 1.00 0.00   ? 83   TRP D CH2   1 
ATOM   7955  N  N     . LEU D 1 84   ? 135.671 111.717 151.479 1.00 0.00   ? 84   LEU D N     1 
ATOM   7956  C  CA    . LEU D 1 84   ? 136.262 110.631 152.254 1.00 0.00   ? 84   LEU D CA    1 
ATOM   7957  C  C     . LEU D 1 84   ? 137.778 110.621 152.303 1.00 0.00   ? 84   LEU D C     1 
ATOM   7958  O  O     . LEU D 1 84   ? 138.356 110.417 153.363 1.00 0.00   ? 84   LEU D O     1 
ATOM   7959  C  CB    . LEU D 1 84   ? 135.774 109.275 151.754 1.00 0.00   ? 84   LEU D CB    1 
ATOM   7960  C  CG    . LEU D 1 84   ? 134.953 108.462 152.750 1.00 0.00   ? 84   LEU D CG    1 
ATOM   7961  C  CD1   . LEU D 1 84   ? 134.049 107.469 152.039 1.00 0.00   ? 84   LEU D CD1   1 
ATOM   7962  C  CD2   . LEU D 1 84   ? 135.895 107.746 153.703 1.00 0.00   ? 84   LEU D CD2   1 
ATOM   7963  N  N     . LEU D 1 85   ? 138.427 110.860 151.171 1.00 0.00   ? 85   LEU D N     1 
ATOM   7964  C  CA    . LEU D 1 85   ? 139.880 110.811 151.150 1.00 0.00   ? 85   LEU D CA    1 
ATOM   7965  C  C     . LEU D 1 85   ? 140.461 111.838 152.091 1.00 0.00   ? 85   LEU D C     1 
ATOM   7966  O  O     . LEU D 1 85   ? 141.376 111.548 152.853 1.00 0.00   ? 85   LEU D O     1 
ATOM   7967  C  CB    . LEU D 1 85   ? 140.388 111.080 149.740 1.00 0.00   ? 85   LEU D CB    1 
ATOM   7968  C  CG    . LEU D 1 85   ? 141.909 111.123 149.616 1.00 0.00   ? 85   LEU D CG    1 
ATOM   7969  C  CD1   . LEU D 1 85   ? 142.507 109.773 149.971 1.00 0.00   ? 85   LEU D CD1   1 
ATOM   7970  C  CD2   . LEU D 1 85   ? 142.325 111.560 148.219 1.00 0.00   ? 85   LEU D CD2   1 
ATOM   7971  N  N     . PHE D 1 86   ? 139.926 113.044 152.033 1.00 0.00   ? 86   PHE D N     1 
ATOM   7972  C  CA    . PHE D 1 86   ? 140.362 114.115 152.909 1.00 0.00   ? 86   PHE D CA    1 
ATOM   7973  C  C     . PHE D 1 86   ? 140.012 113.857 154.364 1.00 0.00   ? 86   PHE D C     1 
ATOM   7974  O  O     . PHE D 1 86   ? 140.778 114.180 155.266 1.00 0.00   ? 86   PHE D O     1 
ATOM   7975  C  CB    . PHE D 1 86   ? 139.818 115.443 152.451 1.00 0.00   ? 86   PHE D CB    1 
ATOM   7976  C  CG    . PHE D 1 86   ? 140.714 116.164 151.505 1.00 0.00   ? 86   PHE D CG    1 
ATOM   7977  C  CD1   . PHE D 1 86   ? 140.204 116.762 150.374 1.00 0.00   ? 86   PHE D CD1   1 
ATOM   7978  C  CD2   . PHE D 1 86   ? 142.068 116.236 151.746 1.00 0.00   ? 86   PHE D CD2   1 
ATOM   7979  C  CE1   . PHE D 1 86   ? 141.029 117.428 149.496 1.00 0.00   ? 86   PHE D CE1   1 
ATOM   7980  C  CE2   . PHE D 1 86   ? 142.901 116.898 150.874 1.00 0.00   ? 86   PHE D CE2   1 
ATOM   7981  C  CZ    . PHE D 1 86   ? 142.382 117.494 149.748 1.00 0.00   ? 86   PHE D CZ    1 
ATOM   7982  N  N     . ALA D 1 87   ? 138.854 113.238 154.590 1.00 0.00   ? 87   ALA D N     1 
ATOM   7983  C  CA    . ALA D 1 87   ? 138.371 112.956 155.941 1.00 0.00   ? 87   ALA D CA    1 
ATOM   7984  C  C     . ALA D 1 87   ? 139.343 112.084 156.710 1.00 0.00   ? 87   ALA D C     1 
ATOM   7985  O  O     . ALA D 1 87   ? 139.578 112.309 157.892 1.00 0.00   ? 87   ALA D O     1 
ATOM   7986  C  CB    . ALA D 1 87   ? 137.007 112.299 155.895 1.00 0.00   ? 87   ALA D CB    1 
ATOM   7987  N  N     . MET D 1 88   ? 139.934 111.098 156.040 1.00 0.00   ? 88   MET D N     1 
ATOM   7988  C  CA    . MET D 1 88   ? 140.925 110.240 156.657 1.00 0.00   ? 88   MET D CA    1 
ATOM   7989  C  C     . MET D 1 88   ? 142.116 111.084 157.100 1.00 0.00   ? 88   MET D C     1 
ATOM   7990  O  O     . MET D 1 88   ? 142.620 110.910 158.205 1.00 0.00   ? 88   MET D O     1 
ATOM   7991  C  CB    . MET D 1 88   ? 141.401 109.207 155.642 1.00 0.00   ? 88   MET D CB    1 
ATOM   7992  C  CG    . MET D 1 88   ? 142.558 108.356 156.118 1.00 0.00   ? 88   MET D CG    1 
ATOM   7993  S  SD    . MET D 1 88   ? 142.000 107.096 157.272 1.00 0.00   ? 88   MET D SD    1 
ATOM   7994  C  CE    . MET D 1 88   ? 140.699 106.326 156.312 1.00 0.00   ? 88   MET D CE    1 
ATOM   7995  N  N     . VAL D 1 89   ? 142.543 112.025 156.262 1.00 0.00   ? 89   VAL D N     1 
ATOM   7996  C  CA    . VAL D 1 89   ? 143.656 112.889 156.603 1.00 0.00   ? 89   VAL D CA    1 
ATOM   7997  C  C     . VAL D 1 89   ? 143.333 113.714 157.838 1.00 0.00   ? 89   VAL D C     1 
ATOM   7998  O  O     . VAL D 1 89   ? 144.178 113.880 158.712 1.00 0.00   ? 89   VAL D O     1 
ATOM   7999  C  CB    . VAL D 1 89   ? 143.975 113.867 155.469 1.00 0.00   ? 89   VAL D CB    1 
ATOM   8000  C  CG1   . VAL D 1 89   ? 144.926 114.940 155.960 1.00 0.00   ? 89   VAL D CG1   1 
ATOM   8001  C  CG2   . VAL D 1 89   ? 144.559 113.127 154.282 1.00 0.00   ? 89   VAL D CG2   1 
ATOM   8002  N  N     . TRP D 1 90   ? 142.109 114.227 157.916 1.00 0.00   ? 90   TRP D N     1 
ATOM   8003  C  CA    . TRP D 1 90   ? 141.708 115.025 159.069 1.00 0.00   ? 90   TRP D CA    1 
ATOM   8004  C  C     . TRP D 1 90   ? 141.745 114.192 160.331 1.00 0.00   ? 90   TRP D C     1 
ATOM   8005  O  O     . TRP D 1 90   ? 142.188 114.653 161.374 1.00 0.00   ? 90   TRP D O     1 
ATOM   8006  C  CB    . TRP D 1 90   ? 140.307 115.588 158.878 1.00 0.00   ? 90   TRP D CB    1 
ATOM   8007  C  CG    . TRP D 1 90   ? 140.287 116.849 158.114 1.00 0.00   ? 90   TRP D CG    1 
ATOM   8008  C  CD1   . TRP D 1 90   ? 139.631 117.088 156.950 1.00 0.00   ? 90   TRP D CD1   1 
ATOM   8009  C  CD2   . TRP D 1 90   ? 140.966 118.054 158.450 1.00 0.00   ? 90   TRP D CD2   1 
ATOM   8010  N  NE1   . TRP D 1 90   ? 139.853 118.375 156.539 1.00 0.00   ? 90   TRP D NE1   1 
ATOM   8011  C  CE2   . TRP D 1 90   ? 140.673 118.989 157.446 1.00 0.00   ? 90   TRP D CE2   1 
ATOM   8012  C  CE3   . TRP D 1 90   ? 141.792 118.436 159.504 1.00 0.00   ? 90   TRP D CE3   1 
ATOM   8013  C  CZ2   . TRP D 1 90   ? 141.176 120.280 157.463 1.00 0.00   ? 90   TRP D CZ2   1 
ATOM   8014  C  CZ3   . TRP D 1 90   ? 142.290 119.717 159.521 1.00 0.00   ? 90   TRP D CZ3   1 
ATOM   8015  C  CH2   . TRP D 1 90   ? 141.981 120.626 158.507 1.00 0.00   ? 90   TRP D CH2   1 
ATOM   8016  N  N     . TRP D 1 91   ? 141.284 112.955 160.233 1.00 0.00   ? 91   TRP D N     1 
ATOM   8017  C  CA    . TRP D 1 91   ? 141.275 112.076 161.383 1.00 0.00   ? 91   TRP D CA    1 
ATOM   8018  C  C     . TRP D 1 91   ? 142.691 111.810 161.856 1.00 0.00   ? 91   TRP D C     1 
ATOM   8019  O  O     . TRP D 1 91   ? 142.974 111.841 163.048 1.00 0.00   ? 91   TRP D O     1 
ATOM   8020  C  CB    . TRP D 1 91   ? 140.600 110.762 161.018 1.00 0.00   ? 91   TRP D CB    1 
ATOM   8021  C  CG    . TRP D 1 91   ? 140.704 109.717 162.065 1.00 0.00   ? 91   TRP D CG    1 
ATOM   8022  C  CD1   . TRP D 1 91   ? 140.239 109.787 163.340 1.00 0.00   ? 91   TRP D CD1   1 
ATOM   8023  C  CD2   . TRP D 1 91   ? 141.296 108.429 161.923 1.00 0.00   ? 91   TRP D CD2   1 
ATOM   8024  N  NE1   . TRP D 1 91   ? 140.514 108.623 164.006 1.00 0.00   ? 91   TRP D NE1   1 
ATOM   8025  C  CE2   . TRP D 1 91   ? 141.163 107.772 163.155 1.00 0.00   ? 91   TRP D CE2   1 
ATOM   8026  C  CE3   . TRP D 1 91   ? 141.928 107.766 160.871 1.00 0.00   ? 91   TRP D CE3   1 
ATOM   8027  C  CZ2   . TRP D 1 91   ? 141.641 106.489 163.368 1.00 0.00   ? 91   TRP D CZ2   1 
ATOM   8028  C  CZ3   . TRP D 1 91   ? 142.400 106.494 161.082 1.00 0.00   ? 91   TRP D CZ3   1 
ATOM   8029  C  CH2   . TRP D 1 91   ? 142.254 105.865 162.320 1.00 0.00   ? 91   TRP D CH2   1 
ATOM   8030  N  N     . LEU D 1 92   ? 143.587 111.586 160.909 1.00 0.00   ? 92   LEU D N     1 
ATOM   8031  C  CA    . LEU D 1 92   ? 144.975 111.308 161.227 1.00 0.00   ? 92   LEU D CA    1 
ATOM   8032  C  C     . LEU D 1 92   ? 145.667 112.496 161.894 1.00 0.00   ? 92   LEU D C     1 
ATOM   8033  O  O     . LEU D 1 92   ? 146.424 112.328 162.839 1.00 0.00   ? 92   LEU D O     1 
ATOM   8034  C  CB    . LEU D 1 92   ? 145.718 110.911 159.959 1.00 0.00   ? 92   LEU D CB    1 
ATOM   8035  C  CG    . LEU D 1 92   ? 147.139 110.404 160.156 1.00 0.00   ? 92   LEU D CG    1 
ATOM   8036  C  CD1   . LEU D 1 92   ? 147.451 109.355 159.107 1.00 0.00   ? 92   LEU D CD1   1 
ATOM   8037  C  CD2   . LEU D 1 92   ? 148.117 111.561 160.063 1.00 0.00   ? 92   LEU D CD2   1 
ATOM   8038  N  N     . ILE D 1 93   ? 145.411 113.699 161.403 1.00 0.00   ? 93   ILE D N     1 
ATOM   8039  C  CA    . ILE D 1 93   ? 146.039 114.877 161.975 1.00 0.00   ? 93   ILE D CA    1 
ATOM   8040  C  C     . ILE D 1 93   ? 145.569 115.036 163.409 1.00 0.00   ? 93   ILE D C     1 
ATOM   8041  O  O     . ILE D 1 93   ? 146.308 115.518 164.256 1.00 0.00   ? 93   ILE D O     1 
ATOM   8042  C  CB    . ILE D 1 93   ? 145.860 116.144 161.105 1.00 0.00   ? 93   ILE D CB    1 
ATOM   8043  C  CG1   . ILE D 1 93   ? 147.018 117.106 161.339 1.00 0.00   ? 93   ILE D CG1   1 
ATOM   8044  C  CG2   . ILE D 1 93   ? 144.537 116.848 161.359 1.00 0.00   ? 93   ILE D CG2   1 
ATOM   8045  C  CD1   . ILE D 1 93   ? 146.923 118.355 160.500 1.00 0.00   ? 93   ILE D CD1   1 
ATOM   8046  N  N     . ALA D 1 94   ? 144.337 114.619 163.695 1.00 0.00   ? 94   ALA D N     1 
ATOM   8047  C  CA    . ALA D 1 94   ? 143.836 114.672 165.049 1.00 0.00   ? 94   ALA D CA    1 
ATOM   8048  C  C     . ALA D 1 94   ? 144.645 113.700 165.878 1.00 0.00   ? 94   ALA D C     1 
ATOM   8049  O  O     . ALA D 1 94   ? 145.069 114.010 166.985 1.00 0.00   ? 94   ALA D O     1 
ATOM   8050  C  CB    . ALA D 1 94   ? 142.374 114.289 165.080 1.00 0.00   ? 94   ALA D CB    1 
ATOM   8051  N  N     . PHE D 1 95   ? 144.870 112.523 165.315 1.00 0.00   ? 95   PHE D N     1 
ATOM   8052  C  CA    . PHE D 1 95   ? 145.627 111.472 165.963 1.00 0.00   ? 95   PHE D CA    1 
ATOM   8053  C  C     . PHE D 1 95   ? 147.083 111.840 166.217 1.00 0.00   ? 95   PHE D C     1 
ATOM   8054  O  O     . PHE D 1 95   ? 147.616 111.561 167.287 1.00 0.00   ? 95   PHE D O     1 
ATOM   8055  C  CB    . PHE D 1 95   ? 145.579 110.216 165.105 1.00 0.00   ? 95   PHE D CB    1 
ATOM   8056  C  CG    . PHE D 1 95   ? 145.738 108.957 165.884 1.00 0.00   ? 95   PHE D CG    1 
ATOM   8057  C  CD1   . PHE D 1 95   ? 145.000 107.841 165.560 1.00 0.00   ? 95   PHE D CD1   1 
ATOM   8058  C  CD2   . PHE D 1 95   ? 146.607 108.903 166.949 1.00 0.00   ? 95   PHE D CD2   1 
ATOM   8059  C  CE1   . PHE D 1 95   ? 145.137 106.677 166.283 1.00 0.00   ? 95   PHE D CE1   1 
ATOM   8060  C  CE2   . PHE D 1 95   ? 146.754 107.745 167.678 1.00 0.00   ? 95   PHE D CE2   1 
ATOM   8061  C  CZ    . PHE D 1 95   ? 146.014 106.628 167.346 1.00 0.00   ? 95   PHE D CZ    1 
ATOM   8062  N  N     . ALA D 1 96   ? 147.729 112.470 165.241 1.00 0.00   ? 96   ALA D N     1 
ATOM   8063  C  CA    . ALA D 1 96   ? 149.132 112.820 165.407 1.00 0.00   ? 96   ALA D CA    1 
ATOM   8064  C  C     . ALA D 1 96   ? 149.273 113.780 166.567 1.00 0.00   ? 96   ALA D C     1 
ATOM   8065  O  O     . ALA D 1 96   ? 150.131 113.609 167.427 1.00 0.00   ? 96   ALA D O     1 
ATOM   8066  C  CB    . ALA D 1 96   ? 149.678 113.440 164.136 1.00 0.00   ? 96   ALA D CB    1 
ATOM   8067  N  N     . HIS D 1 97   ? 148.394 114.770 166.590 1.00 0.00   ? 97   HIS D N     1 
ATOM   8068  C  CA    . HIS D 1 97   ? 148.377 115.741 167.665 1.00 0.00   ? 97   HIS D CA    1 
ATOM   8069  C  C     . HIS D 1 97   ? 148.086 115.001 168.966 1.00 0.00   ? 97   HIS D C     1 
ATOM   8070  O  O     . HIS D 1 97   ? 148.570 115.386 170.027 1.00 0.00   ? 97   HIS D O     1 
ATOM   8071  C  CB    . HIS D 1 97   ? 147.326 116.812 167.413 1.00 0.00   ? 97   HIS D CB    1 
ATOM   8072  C  CG    . HIS D 1 97   ? 147.372 117.933 168.398 1.00 0.00   ? 97   HIS D CG    1 
ATOM   8073  N  ND1   . HIS D 1 97   ? 146.793 117.845 169.646 1.00 0.00   ? 97   HIS D ND1   1 
ATOM   8074  C  CD2   . HIS D 1 97   ? 147.925 119.164 168.327 1.00 0.00   ? 97   HIS D CD2   1 
ATOM   8075  C  CE1   . HIS D 1 97   ? 146.991 118.976 170.300 1.00 0.00   ? 97   HIS D CE1   1 
ATOM   8076  N  NE2   . HIS D 1 97   ? 147.673 119.794 169.521 1.00 0.00   ? 97   HIS D NE2   1 
ATOM   8077  N  N     . GLY D 1 98   ? 147.330 113.913 168.855 1.00 0.00   ? 98   GLY D N     1 
ATOM   8078  C  CA    . GLY D 1 98   ? 146.976 113.091 169.997 1.00 0.00   ? 98   GLY D CA    1 
ATOM   8079  C  C     . GLY D 1 98   ? 145.834 113.649 170.818 1.00 0.00   ? 98   GLY D C     1 
ATOM   8080  O  O     . GLY D 1 98   ? 145.583 113.202 171.927 1.00 0.00   ? 98   GLY D O     1 
ATOM   8081  N  N     . ASP D 1 99   ? 145.139 114.627 170.256 1.00 0.00   ? 99   ASP D N     1 
ATOM   8082  C  CA    . ASP D 1 99   ? 144.025 115.290 170.919 1.00 0.00   ? 99   ASP D CA    1 
ATOM   8083  C  C     . ASP D 1 99   ? 142.736 114.494 171.131 1.00 0.00   ? 99   ASP D C     1 
ATOM   8084  O  O     . ASP D 1 99   ? 141.908 114.879 171.953 1.00 0.00   ? 99   ASP D O     1 
ATOM   8085  C  CB    . ASP D 1 99   ? 143.692 116.598 170.202 1.00 0.00   ? 99   ASP D CB    1 
ATOM   8086  C  CG    . ASP D 1 99   ? 143.008 116.375 168.876 1.00 0.00   ? 99   ASP D CG    1 
ATOM   8087  O  OD1   . ASP D 1 99   ? 142.748 115.211 168.526 1.00 0.00   ? 99   ASP D OD1   1 
ATOM   8088  O  OD2   . ASP D 1 99   ? 142.728 117.374 168.182 1.00 0.00   ? 99   ASP D OD2   1 
ATOM   8089  N  N     . LEU D 1 100  ? 142.528 113.433 170.363 1.00 0.00   ? 100  LEU D N     1 
ATOM   8090  C  CA    . LEU D 1 100  ? 141.265 112.698 170.464 1.00 0.00   ? 100  LEU D CA    1 
ATOM   8091  C  C     . LEU D 1 100  ? 140.842 111.982 171.759 1.00 0.00   ? 100  LEU D C     1 
ATOM   8092  O  O     . LEU D 1 100  ? 139.685 112.112 172.156 1.00 0.00   ? 100  LEU D O     1 
ATOM   8093  C  CB    . LEU D 1 100  ? 141.085 111.764 169.262 1.00 0.00   ? 100  LEU D CB    1 
ATOM   8094  C  CG    . LEU D 1 100  ? 142.272 110.915 168.832 1.00 0.00   ? 100  LEU D CG    1 
ATOM   8095  C  CD1   . LEU D 1 100  ? 142.333 109.656 169.676 1.00 0.00   ? 100  LEU D CD1   1 
ATOM   8096  C  CD2   . LEU D 1 100  ? 142.102 110.554 167.369 1.00 0.00   ? 100  LEU D CD2   1 
ATOM   8097  N  N     . ALA D 1 101  ? 141.733 111.258 172.436 1.00 0.00   ? 101  ALA D N     1 
ATOM   8098  C  CA    . ALA D 1 101  ? 141.293 110.545 173.644 1.00 0.00   ? 101  ALA D CA    1 
ATOM   8099  C  C     . ALA D 1 101  ? 141.504 111.185 175.019 1.00 0.00   ? 101  ALA D C     1 
ATOM   8100  O  O     . ALA D 1 101  ? 140.887 110.755 175.989 1.00 0.00   ? 101  ALA D O     1 
ATOM   8101  C  CB    . ALA D 1 101  ? 141.757 109.094 173.639 1.00 0.00   ? 101  ALA D CB    1 
ATOM   8102  N  N     . PRO D 1 102  ? 142.365 112.191 175.122 1.00 0.00   ? 102  PRO D N     1 
ATOM   8103  C  CA    . PRO D 1 102  ? 142.566 112.851 176.415 1.00 0.00   ? 102  PRO D CA    1 
ATOM   8104  C  C     . PRO D 1 102  ? 141.293 113.554 176.846 1.00 0.00   ? 102  PRO D C     1 
ATOM   8105  O  O     . PRO D 1 102  ? 140.930 113.519 178.021 1.00 0.00   ? 102  PRO D O     1 
ATOM   8106  C  CB    . PRO D 1 102  ? 143.652 113.886 176.122 1.00 0.00   ? 102  PRO D CB    1 
ATOM   8107  C  CG    . PRO D 1 102  ? 144.295 113.429 174.864 1.00 0.00   ? 102  PRO D CG    1 
ATOM   8108  C  CD    . PRO D 1 102  ? 143.175 112.823 174.077 1.00 0.00   ? 102  PRO D CD    1 
ATOM   8109  N  N     . GLY D 1 103  ? 140.634 114.187 175.878 1.00 0.00   ? 103  GLY D N     1 
ATOM   8110  C  CA    . GLY D 1 103  ? 139.406 114.917 176.107 1.00 0.00   ? 103  GLY D CA    1 
ATOM   8111  C  C     . GLY D 1 103  ? 139.619 115.900 177.229 1.00 0.00   ? 103  GLY D C     1 
ATOM   8112  O  O     . GLY D 1 103  ? 138.668 116.356 177.860 1.00 0.00   ? 103  GLY D O     1 
ATOM   8113  N  N     . GLU D 1 104  ? 140.881 116.233 177.477 1.00 0.00   ? 104  GLU D N     1 
ATOM   8114  C  CA    . GLU D 1 104  ? 141.181 117.145 178.575 1.00 0.00   ? 104  GLU D CA    1 
ATOM   8115  C  C     . GLU D 1 104  ? 141.229 118.612 178.153 1.00 0.00   ? 104  GLU D C     1 
ATOM   8116  O  O     . GLU D 1 104  ? 141.653 118.946 177.049 1.00 0.00   ? 104  GLU D O     1 
ATOM   8117  C  CB    . GLU D 1 104  ? 142.503 116.736 179.235 1.00 0.00   ? 104  GLU D CB    1 
ATOM   8118  C  CG    . GLU D 1 104  ? 142.787 117.418 180.562 1.00 0.00   ? 104  GLU D CG    1 
ATOM   8119  C  CD    . GLU D 1 104  ? 143.712 116.600 181.435 1.00 0.00   ? 104  GLU D CD    1 
ATOM   8120  O  OE1   . GLU D 1 104  ? 143.841 115.382 181.188 1.00 0.00   ? 104  GLU D OE1   1 
ATOM   8121  O  OE2   . GLU D 1 104  ? 144.305 117.171 182.372 1.00 0.00   ? 104  GLU D OE2   1 
ATOM   8122  N  N     . GLY D 1 105  ? 140.783 119.480 179.052 1.00 0.00   ? 105  GLY D N     1 
ATOM   8123  C  CA    . GLY D 1 105  ? 140.744 120.909 178.806 1.00 0.00   ? 105  GLY D CA    1 
ATOM   8124  C  C     . GLY D 1 105  ? 142.071 121.606 178.573 1.00 0.00   ? 105  GLY D C     1 
ATOM   8125  O  O     . GLY D 1 105  ? 142.159 122.486 177.722 1.00 0.00   ? 105  GLY D O     1 
ATOM   8126  N  N     . THR D 1 106  ? 143.109 121.207 179.306 1.00 0.00   ? 106  THR D N     1 
ATOM   8127  C  CA    . THR D 1 106  ? 144.409 121.862 179.193 1.00 0.00   ? 106  THR D CA    1 
ATOM   8128  C  C     . THR D 1 106  ? 144.969 121.762 177.787 1.00 0.00   ? 106  THR D C     1 
ATOM   8129  O  O     . THR D 1 106  ? 145.492 122.732 177.243 1.00 0.00   ? 106  THR D O     1 
ATOM   8130  C  CB    . THR D 1 106  ? 145.439 121.217 180.136 1.00 0.00   ? 106  THR D CB    1 
ATOM   8131  O  OG1   . THR D 1 106  ? 145.831 119.943 179.613 1.00 0.00   ? 106  THR D OG1   1 
ATOM   8132  C  CG2   . THR D 1 106  ? 144.853 121.030 181.527 1.00 0.00   ? 106  THR D CG2   1 
ATOM   8133  N  N     . ASN D 1 107  ? 144.864 120.581 177.196 1.00 0.00   ? 107  ASN D N     1 
ATOM   8134  C  CA    . ASN D 1 107  ? 145.339 120.389 175.839 1.00 0.00   ? 107  ASN D CA    1 
ATOM   8135  C  C     . ASN D 1 107  ? 144.388 121.112 174.899 1.00 0.00   ? 107  ASN D C     1 
ATOM   8136  O  O     . ASN D 1 107  ? 143.191 121.179 175.165 1.00 0.00   ? 107  ASN D O     1 
ATOM   8137  C  CB    . ASN D 1 107  ? 145.402 118.901 175.503 1.00 0.00   ? 107  ASN D CB    1 
ATOM   8138  C  CG    . ASN D 1 107  ? 146.019 118.640 174.148 1.00 0.00   ? 107  ASN D CG    1 
ATOM   8139  O  OD1   . ASN D 1 107  ? 146.325 119.568 173.404 1.00 0.00   ? 107  ASN D OD1   1 
ATOM   8140  N  ND2   . ASN D 1 107  ? 146.206 117.369 173.816 1.00 0.00   ? 107  ASN D ND2   1 
ATOM   8141  N  N     . VAL D 1 108  ? 144.910 121.671 173.817 1.00 0.00   ? 108  VAL D N     1 
ATOM   8142  C  CA    . VAL D 1 108  ? 144.049 122.347 172.860 1.00 0.00   ? 108  VAL D CA    1 
ATOM   8143  C  C     . VAL D 1 108  ? 144.091 121.589 171.544 1.00 0.00   ? 108  VAL D C     1 
ATOM   8144  O  O     . VAL D 1 108  ? 145.154 121.387 170.972 1.00 0.00   ? 108  VAL D O     1 
ATOM   8145  C  CB    . VAL D 1 108  ? 144.494 123.793 172.627 1.00 0.00   ? 108  VAL D CB    1 
ATOM   8146  C  CG1   . VAL D 1 108  ? 143.440 124.542 171.835 1.00 0.00   ? 108  VAL D CG1   1 
ATOM   8147  C  CG2   . VAL D 1 108  ? 144.744 124.478 173.959 1.00 0.00   ? 108  VAL D CG2   1 
ATOM   8148  N  N     . PRO D 1 109  ? 142.929 121.184 171.053 1.00 0.00   ? 109  PRO D N     1 
ATOM   8149  C  CA    . PRO D 1 109  ? 142.876 120.436 169.797 1.00 0.00   ? 109  PRO D CA    1 
ATOM   8150  C  C     . PRO D 1 109  ? 143.109 121.316 168.582 1.00 0.00   ? 109  PRO D C     1 
ATOM   8151  O  O     . PRO D 1 109  ? 143.017 122.541 168.657 1.00 0.00   ? 109  PRO D O     1 
ATOM   8152  C  CB    . PRO D 1 109  ? 141.473 119.848 169.813 1.00 0.00   ? 109  PRO D CB    1 
ATOM   8153  C  CG    . PRO D 1 109  ? 140.687 120.927 170.479 1.00 0.00   ? 109  PRO D CG    1 
ATOM   8154  C  CD    . PRO D 1 109  ? 141.582 121.318 171.641 1.00 0.00   ? 109  PRO D CD    1 
ATOM   8155  N  N     . CYS D 1 110  ? 143.427 120.675 167.462 1.00 0.00   ? 110  CYS D N     1 
ATOM   8156  C  CA    . CYS D 1 110  ? 143.643 121.393 166.216 1.00 0.00   ? 110  CYS D CA    1 
ATOM   8157  C  C     . CYS D 1 110  ? 142.299 121.577 165.545 1.00 0.00   ? 110  CYS D C     1 
ATOM   8158  O  O     . CYS D 1 110  ? 142.021 122.606 164.932 1.00 0.00   ? 110  CYS D O     1 
ATOM   8159  C  CB    . CYS D 1 110  ? 144.625 120.653 165.316 1.00 0.00   ? 110  CYS D CB    1 
ATOM   8160  S  SG    . CYS D 1 110  ? 146.305 120.746 165.961 1.00 0.00   ? 110  CYS D SG    1 
ATOM   8161  N  N     . VAL D 1 111  ? 141.460 120.563 165.695 1.00 0.00   ? 111  VAL D N     1 
ATOM   8162  C  CA    . VAL D 1 111  ? 140.115 120.565 165.142 1.00 0.00   ? 111  VAL D CA    1 
ATOM   8163  C  C     . VAL D 1 111  ? 139.222 120.199 166.318 1.00 0.00   ? 111  VAL D C     1 
ATOM   8164  O  O     . VAL D 1 111  ? 139.284 119.085 166.832 1.00 0.00   ? 111  VAL D O     1 
ATOM   8165  C  CB    . VAL D 1 111  ? 139.953 119.510 164.037 1.00 0.00   ? 111  VAL D CB    1 
ATOM   8166  C  CG1   . VAL D 1 111  ? 138.529 119.542 163.508 1.00 0.00   ? 111  VAL D CG1   1 
ATOM   8167  C  CG2   . VAL D 1 111  ? 140.939 119.772 162.913 1.00 0.00   ? 111  VAL D CG2   1 
ATOM   8168  N  N     . THR D 1 112  ? 138.398 121.145 166.746 1.00 0.00   ? 112  THR D N     1 
ATOM   8169  C  CA    . THR D 1 112  ? 137.519 120.921 167.887 1.00 0.00   ? 112  THR D CA    1 
ATOM   8170  C  C     . THR D 1 112  ? 136.462 119.841 167.660 1.00 0.00   ? 112  THR D C     1 
ATOM   8171  O  O     . THR D 1 112  ? 136.078 119.557 166.527 1.00 0.00   ? 112  THR D O     1 
ATOM   8172  C  CB    . THR D 1 112  ? 136.794 122.216 168.299 1.00 0.00   ? 112  THR D CB    1 
ATOM   8173  O  OG1   . THR D 1 112  ? 135.885 122.603 167.261 1.00 0.00   ? 112  THR D OG1   1 
ATOM   8174  C  CG2   . THR D 1 112  ? 137.795 123.335 168.521 1.00 0.00   ? 112  THR D CG2   1 
ATOM   8175  N  N     . SER D 1 113  ? 136.012 119.240 168.760 1.00 0.00   ? 113  SER D N     1 
ATOM   8176  C  CA    . SER D 1 113  ? 134.982 118.210 168.736 1.00 0.00   ? 113  SER D CA    1 
ATOM   8177  C  C     . SER D 1 113  ? 135.271 116.981 167.880 1.00 0.00   ? 113  SER D C     1 
ATOM   8178  O  O     . SER D 1 113  ? 134.377 116.456 167.209 1.00 0.00   ? 113  SER D O     1 
ATOM   8179  C  CB    . SER D 1 113  ? 133.651 118.828 168.297 1.00 0.00   ? 113  SER D CB    1 
ATOM   8180  O  OG    . SER D 1 113  ? 133.245 119.844 169.201 1.00 0.00   ? 113  SER D OG    1 
ATOM   8181  N  N     . ILE D 1 114  ? 136.512 116.509 167.910 1.00 0.00   ? 114  ILE D N     1 
ATOM   8182  C  CA    . ILE D 1 114  ? 136.887 115.325 167.139 1.00 0.00   ? 114  ILE D CA    1 
ATOM   8183  C  C     . ILE D 1 114  ? 137.084 114.131 168.063 1.00 0.00   ? 114  ILE D C     1 
ATOM   8184  O  O     . ILE D 1 114  ? 138.124 113.994 168.710 1.00 0.00   ? 114  ILE D O     1 
ATOM   8185  C  CB    . ILE D 1 114  ? 138.187 115.569 166.356 1.00 0.00   ? 114  ILE D CB    1 
ATOM   8186  C  CG1   . ILE D 1 114  ? 137.977 116.697 165.345 1.00 0.00   ? 114  ILE D CG1   1 
ATOM   8187  C  CG2   . ILE D 1 114  ? 138.619 114.297 165.644 1.00 0.00   ? 114  ILE D CG2   1 
ATOM   8188  C  CD1   . ILE D 1 114  ? 136.915 116.396 164.308 1.00 0.00   ? 114  ILE D CD1   1 
ATOM   8189  N  N     . HIS D 1 115  ? 136.085 113.258 168.115 1.00 0.00   ? 115  HIS D N     1 
ATOM   8190  C  CA    . HIS D 1 115  ? 136.139 112.090 168.983 1.00 0.00   ? 115  HIS D CA    1 
ATOM   8191  C  C     . HIS D 1 115  ? 136.330 110.772 168.231 1.00 0.00   ? 115  HIS D C     1 
ATOM   8192  O  O     . HIS D 1 115  ? 136.965 109.851 168.743 1.00 0.00   ? 115  HIS D O     1 
ATOM   8193  C  CB    . HIS D 1 115  ? 134.870 112.046 169.834 1.00 0.00   ? 115  HIS D CB    1 
ATOM   8194  C  CG    . HIS D 1 115  ? 134.515 113.370 170.455 1.00 0.00   ? 115  HIS D CG    1 
ATOM   8195  N  ND1   . HIS D 1 115  ? 135.254 113.947 171.467 1.00 0.00   ? 115  HIS D ND1   1 
ATOM   8196  C  CD2   . HIS D 1 115  ? 133.506 114.238 170.193 1.00 0.00   ? 115  HIS D CD2   1 
ATOM   8197  C  CE1   . HIS D 1 115  ? 134.718 115.107 171.800 1.00 0.00   ? 115  HIS D CE1   1 
ATOM   8198  N  NE2   . HIS D 1 115  ? 133.656 115.308 171.042 1.00 0.00   ? 115  HIS D NE2   1 
ATOM   8199  N  N     . SER D 1 116  ? 135.795 110.678 167.019 1.00 0.00   ? 116  SER D N     1 
ATOM   8200  C  CA    . SER D 1 116  ? 135.936 109.456 166.226 1.00 0.00   ? 116  SER D CA    1 
ATOM   8201  C  C     . SER D 1 116  ? 136.165 109.789 164.748 1.00 0.00   ? 116  SER D C     1 
ATOM   8202  O  O     . SER D 1 116  ? 136.216 110.964 164.387 1.00 0.00   ? 116  SER D O     1 
ATOM   8203  C  CB    . SER D 1 116  ? 134.683 108.579 166.365 1.00 0.00   ? 116  SER D CB    1 
ATOM   8204  O  OG    . SER D 1 116  ? 133.525 109.255 165.919 1.00 0.00   ? 116  SER D OG    1 
ATOM   8205  N  N     . PHE D 1 117  ? 136.330 108.774 163.921 1.00 0.00   ? 117  PHE D N     1 
ATOM   8206  C  CA    . PHE D 1 117  ? 136.529 109.031 162.514 1.00 0.00   ? 117  PHE D CA    1 
ATOM   8207  C  C     . PHE D 1 117  ? 135.280 109.719 161.988 1.00 0.00   ? 117  PHE D C     1 
ATOM   8208  O  O     . PHE D 1 117  ? 135.351 110.677 161.225 1.00 0.00   ? 117  PHE D O     1 
ATOM   8209  C  CB    . PHE D 1 117  ? 136.762 107.719 161.780 1.00 0.00   ? 117  PHE D CB    1 
ATOM   8210  C  CG    . PHE D 1 117  ? 136.718 107.845 160.294 1.00 0.00   ? 117  PHE D CG    1 
ATOM   8211  C  CD1   . PHE D 1 117  ? 137.823 108.281 159.596 1.00 0.00   ? 117  PHE D CD1   1 
ATOM   8212  C  CD2   . PHE D 1 117  ? 135.572 107.531 159.599 1.00 0.00   ? 117  PHE D CD2   1 
ATOM   8213  C  CE1   . PHE D 1 117  ? 137.786 108.400 158.225 1.00 0.00   ? 117  PHE D CE1   1 
ATOM   8214  C  CE2   . PHE D 1 117  ? 135.526 107.644 158.229 1.00 0.00   ? 117  PHE D CE2   1 
ATOM   8215  C  CZ    . PHE D 1 117  ? 136.636 108.080 157.539 1.00 0.00   ? 117  PHE D CZ    1 
ATOM   8216  N  N     . SER D 1 118  ? 134.131 109.239 162.446 1.00 0.00   ? 118  SER D N     1 
ATOM   8217  C  CA    . SER D 1 118  ? 132.836 109.756 162.018 1.00 0.00   ? 118  SER D CA    1 
ATOM   8218  C  C     . SER D 1 118  ? 132.759 111.265 162.219 1.00 0.00   ? 118  SER D C     1 
ATOM   8219  O  O     . SER D 1 118  ? 132.262 111.991 161.356 1.00 0.00   ? 118  SER D O     1 
ATOM   8220  C  CB    . SER D 1 118  ? 131.716 109.077 162.806 1.00 0.00   ? 118  SER D CB    1 
ATOM   8221  O  OG    . SER D 1 118  ? 131.695 107.683 162.550 1.00 0.00   ? 118  SER D OG    1 
ATOM   8222  N  N     . SER D 1 119  ? 133.245 111.728 163.365 1.00 0.00   ? 119  SER D N     1 
ATOM   8223  C  CA    . SER D 1 119  ? 133.237 113.153 163.660 1.00 0.00   ? 119  SER D CA    1 
ATOM   8224  C  C     . SER D 1 119  ? 134.149 113.842 162.650 1.00 0.00   ? 119  SER D C     1 
ATOM   8225  O  O     . SER D 1 119  ? 133.856 114.941 162.180 1.00 0.00   ? 119  SER D O     1 
ATOM   8226  C  CB    . SER D 1 119  ? 133.757 113.408 165.078 1.00 0.00   ? 119  SER D CB    1 
ATOM   8227  O  OG    . SER D 1 119  ? 135.120 113.039 165.195 1.00 0.00   ? 119  SER D OG    1 
ATOM   8228  N  N     . ALA D 1 120  ? 135.252 113.179 162.318 1.00 0.00   ? 120  ALA D N     1 
ATOM   8229  C  CA    . ALA D 1 120  ? 136.215 113.715 161.362 1.00 0.00   ? 120  ALA D CA    1 
ATOM   8230  C  C     . ALA D 1 120  ? 135.608 113.763 159.965 1.00 0.00   ? 120  ALA D C     1 
ATOM   8231  O  O     . ALA D 1 120  ? 135.822 114.726 159.226 1.00 0.00   ? 120  ALA D O     1 
ATOM   8232  C  CB    . ALA D 1 120  ? 137.478 112.862 161.354 1.00 0.00   ? 120  ALA D CB    1 
ATOM   8233  N  N     . PHE D 1 121  ? 134.848 112.734 159.624 1.00 0.00   ? 121  PHE D N     1 
ATOM   8234  C  CA    . PHE D 1 121  ? 134.215 112.660 158.321 1.00 0.00   ? 121  PHE D CA    1 
ATOM   8235  C  C     . PHE D 1 121  ? 133.236 113.804 158.141 1.00 0.00   ? 121  PHE D C     1 
ATOM   8236  O  O     . PHE D 1 121  ? 133.245 114.495 157.136 1.00 0.00   ? 121  PHE D O     1 
ATOM   8237  C  CB    . PHE D 1 121  ? 133.485 111.335 158.173 1.00 0.00   ? 121  PHE D CB    1 
ATOM   8238  C  CG    . PHE D 1 121  ? 132.794 111.176 156.861 1.00 0.00   ? 121  PHE D CG    1 
ATOM   8239  C  CD1   . PHE D 1 121  ? 133.311 110.344 155.894 1.00 0.00   ? 121  PHE D CD1   1 
ATOM   8240  C  CD2   . PHE D 1 121  ? 131.632 111.864 156.595 1.00 0.00   ? 121  PHE D CD2   1 
ATOM   8241  C  CE1   . PHE D 1 121  ? 132.679 110.194 154.681 1.00 0.00   ? 121  PHE D CE1   1 
ATOM   8242  C  CE2   . PHE D 1 121  ? 130.991 111.719 155.386 1.00 0.00   ? 121  PHE D CE2   1 
ATOM   8243  C  CZ    . PHE D 1 121  ? 131.516 110.884 154.425 1.00 0.00   ? 121  PHE D CZ    1 
ATOM   8244  N  N     . LEU D 1 122  ? 132.378 114.003 159.124 1.00 0.00   ? 122  LEU D N     1 
ATOM   8245  C  CA    . LEU D 1 122  ? 131.389 115.078 159.059 1.00 0.00   ? 122  LEU D CA    1 
ATOM   8246  C  C     . LEU D 1 122  ? 132.085 116.422 158.901 1.00 0.00   ? 122  LEU D C     1 
ATOM   8247  O  O     . LEU D 1 122  ? 131.552 117.327 158.254 1.00 0.00   ? 122  LEU D O     1 
ATOM   8248  C  CB    . LEU D 1 122  ? 130.513 115.089 160.320 1.00 0.00   ? 122  LEU D CB    1 
ATOM   8249  C  CG    . LEU D 1 122  ? 129.466 113.985 160.484 1.00 0.00   ? 122  LEU D CG    1 
ATOM   8250  C  CD1   . LEU D 1 122  ? 128.810 114.123 161.848 1.00 0.00   ? 122  LEU D CD1   1 
ATOM   8251  C  CD2   . LEU D 1 122  ? 128.417 114.074 159.382 1.00 0.00   ? 122  LEU D CD2   1 
ATOM   8252  N  N     . PHE D 1 123  ? 133.270 116.551 159.489 1.00 0.00   ? 123  PHE D N     1 
ATOM   8253  C  CA    . PHE D 1 123  ? 134.033 117.792 159.384 1.00 0.00   ? 123  PHE D CA    1 
ATOM   8254  C  C     . PHE D 1 123  ? 134.447 118.000 157.935 1.00 0.00   ? 123  PHE D C     1 
ATOM   8255  O  O     . PHE D 1 123  ? 134.399 119.117 157.425 1.00 0.00   ? 123  PHE D O     1 
ATOM   8256  C  CB    . PHE D 1 123  ? 135.293 117.741 160.250 1.00 0.00   ? 123  PHE D CB    1 
ATOM   8257  C  CG    . PHE D 1 123  ? 136.142 118.975 160.142 1.00 0.00   ? 123  PHE D CG    1 
ATOM   8258  C  CD1   . PHE D 1 123  ? 135.764 120.151 160.777 1.00 0.00   ? 123  PHE D CD1   1 
ATOM   8259  C  CD2   . PHE D 1 123  ? 137.309 118.964 159.389 1.00 0.00   ? 123  PHE D CD2   1 
ATOM   8260  C  CE1   . PHE D 1 123  ? 136.540 121.300 160.668 1.00 0.00   ? 123  PHE D CE1   1 
ATOM   8261  C  CE2   . PHE D 1 123  ? 138.093 120.109 159.273 1.00 0.00   ? 123  PHE D CE2   1 
ATOM   8262  C  CZ    . PHE D 1 123  ? 137.707 121.282 159.913 1.00 0.00   ? 123  PHE D CZ    1 
ATOM   8263  N  N     . SER D 1 124  ? 134.863 116.920 157.280 1.00 0.00   ? 124  SER D N     1 
ATOM   8264  C  CA    . SER D 1 124  ? 135.289 116.972 155.883 1.00 0.00   ? 124  SER D CA    1 
ATOM   8265  C  C     . SER D 1 124  ? 134.151 117.465 155.004 1.00 0.00   ? 124  SER D C     1 
ATOM   8266  O  O     . SER D 1 124  ? 134.348 118.286 154.107 1.00 0.00   ? 124  SER D O     1 
ATOM   8267  C  CB    . SER D 1 124  ? 135.728 115.580 155.409 1.00 0.00   ? 124  SER D CB    1 
ATOM   8268  O  OG    . SER D 1 124  ? 136.191 115.613 154.071 1.00 0.00   ? 124  SER D OG    1 
ATOM   8269  N  N     . ILE D 1 125  ? 132.958 116.947 155.268 1.00 0.00   ? 125  ILE D N     1 
ATOM   8270  C  CA    . ILE D 1 125  ? 131.770 117.327 154.512 1.00 0.00   ? 125  ILE D CA    1 
ATOM   8271  C  C     . ILE D 1 125  ? 131.503 118.818 154.661 1.00 0.00   ? 125  ILE D C     1 
ATOM   8272  O  O     . ILE D 1 125  ? 131.320 119.528 153.679 1.00 0.00   ? 125  ILE D O     1 
ATOM   8273  C  CB    . ILE D 1 125  ? 130.531 116.546 155.007 1.00 0.00   ? 125  ILE D CB    1 
ATOM   8274  C  CG1   . ILE D 1 125  ? 130.725 115.046 154.753 1.00 0.00   ? 125  ILE D CG1   1 
ATOM   8275  C  CG2   . ILE D 1 125  ? 129.288 117.049 154.298 1.00 0.00   ? 125  ILE D CG2   1 
ATOM   8276  C  CD1   . ILE D 1 125  ? 130.772 114.672 153.300 1.00 0.00   ? 125  ILE D CD1   1 
ATOM   8277  N  N     . GLU D 1 126  ? 131.502 119.282 155.905 1.00 0.00   ? 126  GLU D N     1 
ATOM   8278  C  CA    . GLU D 1 126  ? 131.246 120.686 156.221 1.00 0.00   ? 126  GLU D CA    1 
ATOM   8279  C  C     . GLU D 1 126  ? 132.229 121.652 155.567 1.00 0.00   ? 126  GLU D C     1 
ATOM   8280  O  O     . GLU D 1 126  ? 131.919 122.833 155.397 1.00 0.00   ? 126  GLU D O     1 
ATOM   8281  C  CB    . GLU D 1 126  ? 131.278 120.890 157.739 1.00 0.00   ? 126  GLU D CB    1 
ATOM   8282  C  CG    . GLU D 1 126  ? 130.194 120.144 158.489 1.00 0.00   ? 126  GLU D CG    1 
ATOM   8283  C  CD    . GLU D 1 126  ? 130.319 120.285 159.995 1.00 0.00   ? 126  GLU D CD    1 
ATOM   8284  O  OE1   . GLU D 1 126  ? 130.372 121.432 160.490 1.00 0.00   ? 126  GLU D OE1   1 
ATOM   8285  O  OE2   . GLU D 1 126  ? 130.359 119.242 160.686 1.00 0.00   ? 126  GLU D OE2   1 
ATOM   8286  N  N     . VAL D 1 127  ? 133.409 121.157 155.198 1.00 0.00   ? 127  VAL D N     1 
ATOM   8287  C  CA    . VAL D 1 127  ? 134.437 121.994 154.582 1.00 0.00   ? 127  VAL D CA    1 
ATOM   8288  C  C     . VAL D 1 127  ? 134.320 122.144 153.065 1.00 0.00   ? 127  VAL D C     1 
ATOM   8289  O  O     . VAL D 1 127  ? 134.357 123.264 152.545 1.00 0.00   ? 127  VAL D O     1 
ATOM   8290  C  CB    . VAL D 1 127  ? 135.858 121.459 154.909 1.00 0.00   ? 127  VAL D CB    1 
ATOM   8291  C  CG1   . VAL D 1 127  ? 136.904 122.250 154.142 1.00 0.00   ? 127  VAL D CG1   1 
ATOM   8292  C  CG2   . VAL D 1 127  ? 136.122 121.567 156.399 1.00 0.00   ? 127  VAL D CG2   1 
ATOM   8293  N  N     . GLN D 1 128  ? 134.180 121.030 152.355 1.00 0.00   ? 128  GLN D N     1 
ATOM   8294  C  CA    . GLN D 1 128  ? 134.083 121.080 150.901 1.00 0.00   ? 128  GLN D CA    1 
ATOM   8295  C  C     . GLN D 1 128  ? 132.773 121.670 150.372 1.00 0.00   ? 128  GLN D C     1 
ATOM   8296  O  O     . GLN D 1 128  ? 132.784 122.389 149.373 1.00 0.00   ? 128  GLN D O     1 
ATOM   8297  C  CB    . GLN D 1 128  ? 134.328 119.692 150.292 1.00 0.00   ? 128  GLN D CB    1 
ATOM   8298  C  CG    . GLN D 1 128  ? 135.774 119.215 150.392 1.00 0.00   ? 128  GLN D CG    1 
ATOM   8299  C  CD    . GLN D 1 128  ? 136.050 117.989 149.542 1.00 0.00   ? 128  GLN D CD    1 
ATOM   8300  O  OE1   . GLN D 1 128  ? 136.775 117.082 149.953 1.00 0.00   ? 128  GLN D OE1   1 
ATOM   8301  N  NE2   . GLN D 1 128  ? 135.473 117.957 148.347 1.00 0.00   ? 128  GLN D NE2   1 
ATOM   8302  N  N     . VAL D 1 129  ? 131.651 121.375 151.028 1.00 0.00   ? 129  VAL D N     1 
ATOM   8303  C  CA    . VAL D 1 129  ? 130.367 121.923 150.597 1.00 0.00   ? 129  VAL D CA    1 
ATOM   8304  C  C     . VAL D 1 129  ? 130.047 123.205 151.365 1.00 0.00   ? 129  VAL D C     1 
ATOM   8305  O  O     . VAL D 1 129  ? 128.907 123.664 151.384 1.00 0.00   ? 129  VAL D O     1 
ATOM   8306  C  CB    . VAL D 1 129  ? 129.205 120.918 150.794 1.00 0.00   ? 129  VAL D CB    1 
ATOM   8307  C  CG1   . VAL D 1 129  ? 127.886 121.574 150.449 1.00 0.00   ? 129  VAL D CG1   1 
ATOM   8308  C  CG2   . VAL D 1 129  ? 129.425 119.695 149.939 1.00 0.00   ? 129  VAL D CG2   1 
ATOM   8309  N  N     . THR D 1 130  ? 131.078 123.758 151.992 1.00 0.00   ? 130  THR D N     1 
ATOM   8310  C  CA    . THR D 1 130  ? 131.014 124.996 152.767 1.00 0.00   ? 130  THR D CA    1 
ATOM   8311  C  C     . THR D 1 130  ? 129.858 125.175 153.742 1.00 0.00   ? 130  THR D C     1 
ATOM   8312  O  O     . THR D 1 130  ? 129.189 126.213 153.733 1.00 0.00   ? 130  THR D O     1 
ATOM   8313  C  CB    . THR D 1 130  ? 131.049 126.236 151.840 1.00 0.00   ? 130  THR D CB    1 
ATOM   8314  O  OG1   . THR D 1 130  ? 129.856 126.290 151.053 1.00 0.00   ? 130  THR D OG1   1 
ATOM   8315  C  CG2   . THR D 1 130  ? 132.252 126.167 150.918 1.00 0.00   ? 130  THR D CG2   1 
ATOM   8316  N  N     . ILE D 1 131  ? 129.617 124.182 154.594 1.00 0.00   ? 131  ILE D N     1 
ATOM   8317  C  CA    . ILE D 1 131  ? 128.528 124.292 155.563 1.00 0.00   ? 131  ILE D CA    1 
ATOM   8318  C  C     . ILE D 1 131  ? 129.022 124.986 156.833 1.00 0.00   ? 131  ILE D C     1 
ATOM   8319  O  O     . ILE D 1 131  ? 128.417 125.957 157.294 1.00 0.00   ? 131  ILE D O     1 
ATOM   8320  C  CB    . ILE D 1 131  ? 127.957 122.913 155.926 1.00 0.00   ? 131  ILE D CB    1 
ATOM   8321  C  CG1   . ILE D 1 131  ? 127.344 122.269 154.671 1.00 0.00   ? 131  ILE D CG1   1 
ATOM   8322  C  CG2   . ILE D 1 131  ? 126.906 123.056 157.009 1.00 0.00   ? 131  ILE D CG2   1 
ATOM   8323  C  CD1   . ILE D 1 131  ? 126.689 120.919 154.914 1.00 0.00   ? 131  ILE D CD1   1 
ATOM   8324  N  N     . GLY D 1 132  ? 130.115 124.488 157.404 1.00 0.00   ? 132  GLY D N     1 
ATOM   8325  C  CA    . GLY D 1 132  ? 130.663 125.113 158.594 1.00 0.00   ? 132  GLY D CA    1 
ATOM   8326  C  C     . GLY D 1 132  ? 129.725 125.195 159.784 1.00 0.00   ? 132  GLY D C     1 
ATOM   8327  O  O     . GLY D 1 132  ? 129.515 126.285 160.313 1.00 0.00   ? 132  GLY D O     1 
ATOM   8328  N  N     . PHE D 1 133  ? 129.178 124.067 160.228 1.00 0.00   ? 133  PHE D N     1 
ATOM   8329  C  CA    . PHE D 1 133  ? 128.248 124.094 161.351 1.00 0.00   ? 133  PHE D CA    1 
ATOM   8330  C  C     . PHE D 1 133  ? 128.839 124.807 162.567 1.00 0.00   ? 133  PHE D C     1 
ATOM   8331  O  O     . PHE D 1 133  ? 128.119 125.475 163.300 1.00 0.00   ? 133  PHE D O     1 
ATOM   8332  C  CB    . PHE D 1 133  ? 127.839 122.672 161.758 1.00 0.00   ? 133  PHE D CB    1 
ATOM   8333  C  CG    . PHE D 1 133  ? 126.815 122.045 160.852 1.00 0.00   ? 133  PHE D CG    1 
ATOM   8334  C  CD1   . PHE D 1 133  ? 125.626 122.704 160.552 1.00 0.00   ? 133  PHE D CD1   1 
ATOM   8335  C  CD2   . PHE D 1 133  ? 127.030 120.778 160.324 1.00 0.00   ? 133  PHE D CD2   1 
ATOM   8336  C  CE1   . PHE D 1 133  ? 124.663 122.105 159.741 1.00 0.00   ? 133  PHE D CE1   1 
ATOM   8337  C  CE2   . PHE D 1 133  ? 126.074 120.171 159.512 1.00 0.00   ? 133  PHE D CE2   1 
ATOM   8338  C  CZ    . PHE D 1 133  ? 124.888 120.836 159.220 1.00 0.00   ? 133  PHE D CZ    1 
ATOM   8339  N  N     . GLY D 1 134  ? 130.142 124.670 162.786 1.00 0.00   ? 134  GLY D N     1 
ATOM   8340  C  CA    . GLY D 1 134  ? 130.758 125.350 163.913 1.00 0.00   ? 134  GLY D CA    1 
ATOM   8341  C  C     . GLY D 1 134  ? 131.051 124.536 165.159 1.00 0.00   ? 134  GLY D C     1 
ATOM   8342  O  O     . GLY D 1 134  ? 131.833 124.968 166.009 1.00 0.00   ? 134  GLY D O     1 
ATOM   8343  N  N     . GLY D 1 135  ? 130.411 123.380 165.286 1.00 0.00   ? 135  GLY D N     1 
ATOM   8344  C  CA    . GLY D 1 135  ? 130.648 122.537 166.444 1.00 0.00   ? 135  GLY D CA    1 
ATOM   8345  C  C     . GLY D 1 135  ? 132.052 121.987 166.318 1.00 0.00   ? 135  GLY D C     1 
ATOM   8346  O  O     . GLY D 1 135  ? 132.682 121.581 167.295 1.00 0.00   ? 135  GLY D O     1 
ATOM   8347  N  N     . ARG D 1 136  ? 132.535 121.983 165.079 1.00 0.00   ? 136  ARG D N     1 
ATOM   8348  C  CA    . ARG D 1 136  ? 133.868 121.501 164.752 1.00 0.00   ? 136  ARG D CA    1 
ATOM   8349  C  C     . ARG D 1 136  ? 134.612 122.638 164.043 1.00 0.00   ? 136  ARG D C     1 
ATOM   8350  O  O     . ARG D 1 136  ? 134.354 122.936 162.872 1.00 0.00   ? 136  ARG D O     1 
ATOM   8351  C  CB    . ARG D 1 136  ? 133.765 120.273 163.843 1.00 0.00   ? 136  ARG D CB    1 
ATOM   8352  C  CG    . ARG D 1 136  ? 132.733 119.246 164.312 1.00 0.00   ? 136  ARG D CG    1 
ATOM   8353  C  CD    . ARG D 1 136  ? 132.787 117.975 163.472 1.00 0.00   ? 136  ARG D CD    1 
ATOM   8354  N  NE    . ARG D 1 136  ? 131.884 116.931 163.963 1.00 0.00   ? 136  ARG D NE    1 
ATOM   8355  C  CZ    . ARG D 1 136  ? 130.556 116.969 163.872 1.00 0.00   ? 136  ARG D CZ    1 
ATOM   8356  N  NH1   . ARG D 1 136  ? 129.953 118.008 163.305 1.00 0.00   ? 136  ARG D NH1   1 
ATOM   8357  N  NH2   . ARG D 1 136  ? 129.830 115.963 164.344 1.00 0.00   ? 136  ARG D NH2   1 
ATOM   8358  N  N     . MET D 1 137  ? 135.534 123.271 164.762 1.00 0.00   ? 137  MET D N     1 
ATOM   8359  C  CA    . MET D 1 137  ? 136.304 124.392 164.229 1.00 0.00   ? 137  MET D CA    1 
ATOM   8360  C  C     . MET D 1 137  ? 137.802 124.104 164.146 1.00 0.00   ? 137  MET D C     1 
ATOM   8361  O  O     . MET D 1 137  ? 138.321 123.230 164.842 1.00 0.00   ? 137  MET D O     1 
ATOM   8362  C  CB    . MET D 1 137  ? 136.074 125.626 165.100 1.00 0.00   ? 137  MET D CB    1 
ATOM   8363  C  CG    . MET D 1 137  ? 134.606 125.965 165.319 1.00 0.00   ? 137  MET D CG    1 
ATOM   8364  S  SD    . MET D 1 137  ? 134.360 127.118 166.675 1.00 0.00   ? 137  MET D SD    1 
ATOM   8365  C  CE    . MET D 1 137  ? 134.404 125.992 168.072 1.00 0.00   ? 137  MET D CE    1 
ATOM   8366  N  N     . VAL D 1 138  ? 138.491 124.853 163.289 1.00 0.00   ? 138  VAL D N     1 
ATOM   8367  C  CA    . VAL D 1 138  ? 139.931 124.700 163.113 1.00 0.00   ? 138  VAL D CA    1 
ATOM   8368  C  C     . VAL D 1 138  ? 140.657 125.730 163.973 1.00 0.00   ? 138  VAL D C     1 
ATOM   8369  O  O     . VAL D 1 138  ? 140.369 126.922 163.894 1.00 0.00   ? 138  VAL D O     1 
ATOM   8370  C  CB    . VAL D 1 138  ? 140.341 124.927 161.642 1.00 0.00   ? 138  VAL D CB    1 
ATOM   8371  C  CG1   . VAL D 1 138  ? 141.852 124.841 161.504 1.00 0.00   ? 138  VAL D CG1   1 
ATOM   8372  C  CG2   . VAL D 1 138  ? 139.673 123.903 160.748 1.00 0.00   ? 138  VAL D CG2   1 
ATOM   8373  N  N     . THR D 1 139  ? 141.601 125.276 164.795 1.00 0.00   ? 139  THR D N     1 
ATOM   8374  C  CA    . THR D 1 139  ? 142.340 126.198 165.646 1.00 0.00   ? 139  THR D CA    1 
ATOM   8375  C  C     . THR D 1 139  ? 143.673 126.563 165.015 1.00 0.00   ? 139  THR D C     1 
ATOM   8376  O  O     . THR D 1 139  ? 143.966 126.166 163.884 1.00 0.00   ? 139  THR D O     1 
ATOM   8377  C  CB    . THR D 1 139  ? 142.601 125.605 167.046 1.00 0.00   ? 139  THR D CB    1 
ATOM   8378  O  OG1   . THR D 1 139  ? 143.527 124.516 166.943 1.00 0.00   ? 139  THR D OG1   1 
ATOM   8379  C  CG2   . THR D 1 139  ? 141.301 125.105 167.660 1.00 0.00   ? 139  THR D CG2   1 
ATOM   8380  N  N     . GLU D 1 140  ? 144.486 127.314 165.750 1.00 0.00   ? 140  GLU D N     1 
ATOM   8381  C  CA    . GLU D 1 140  ? 145.787 127.733 165.242 1.00 0.00   ? 140  GLU D CA    1 
ATOM   8382  C  C     . GLU D 1 140  ? 146.893 126.803 165.720 1.00 0.00   ? 140  GLU D C     1 
ATOM   8383  O  O     . GLU D 1 140  ? 148.072 127.056 165.468 1.00 0.00   ? 140  GLU D O     1 
ATOM   8384  C  CB    . GLU D 1 140  ? 146.109 129.162 165.694 1.00 0.00   ? 140  GLU D CB    1 
ATOM   8385  C  CG    . GLU D 1 140  ? 145.037 130.197 165.389 1.00 0.00   ? 140  GLU D CG    1 
ATOM   8386  C  CD    . GLU D 1 140  ? 143.795 130.018 166.239 1.00 0.00   ? 140  GLU D CD    1 
ATOM   8387  O  OE1   . GLU D 1 140  ? 143.861 129.292 167.254 1.00 0.00   ? 140  GLU D OE1   1 
ATOM   8388  O  OE2   . GLU D 1 140  ? 142.753 130.611 165.899 1.00 0.00   ? 140  GLU D OE2   1 
ATOM   8389  N  N     . GLU D 1 141  ? 146.538 125.716 166.382 1.00 0.00   ? 141  GLU D N     1 
ATOM   8390  C  CA    . GLU D 1 141  ? 147.562 124.807 166.870 1.00 0.00   ? 141  GLU D CA    1 
ATOM   8391  C  C     . GLU D 1 141  ? 148.357 124.129 165.757 1.00 0.00   ? 141  GLU D C     1 
ATOM   8392  O  O     . GLU D 1 141  ? 149.583 124.102 165.787 1.00 0.00   ? 141  GLU D O     1 
ATOM   8393  C  CB    . GLU D 1 141  ? 146.945 123.757 167.790 1.00 0.00   ? 141  GLU D CB    1 
ATOM   8394  C  CG    . GLU D 1 141  ? 146.366 124.335 169.065 1.00 0.00   ? 141  GLU D CG    1 
ATOM   8395  C  CD    . GLU D 1 141  ? 147.398 125.089 169.873 1.00 0.00   ? 141  GLU D CD    1 
ATOM   8396  O  OE1   . GLU D 1 141  ? 148.551 124.621 169.954 1.00 0.00   ? 141  GLU D OE1   1 
ATOM   8397  O  OE2   . GLU D 1 141  ? 147.058 126.156 170.426 1.00 0.00   ? 141  GLU D OE2   1 
ATOM   8398  N  N     . CYS D 1 142  ? 147.653 123.590 164.770 1.00 0.00   ? 142  CYS D N     1 
ATOM   8399  C  CA    . CYS D 1 142  ? 148.285 122.880 163.668 1.00 0.00   ? 142  CYS D CA    1 
ATOM   8400  C  C     . CYS D 1 142  ? 148.489 123.733 162.424 1.00 0.00   ? 142  CYS D C     1 
ATOM   8401  O  O     . CYS D 1 142  ? 147.538 123.953 161.679 1.00 0.00   ? 142  CYS D O     1 
ATOM   8402  C  CB    . CYS D 1 142  ? 147.413 121.680 163.288 1.00 0.00   ? 142  CYS D CB    1 
ATOM   8403  S  SG    . CYS D 1 142  ? 147.495 120.258 164.400 1.00 0.00   ? 142  CYS D SG    1 
ATOM   8404  N  N     . PRO D 1 143  ? 149.710 124.204 162.172 1.00 0.00   ? 143  PRO D N     1 
ATOM   8405  C  CA    . PRO D 1 143  ? 149.919 125.009 160.970 1.00 0.00   ? 143  PRO D CA    1 
ATOM   8406  C  C     . PRO D 1 143  ? 149.631 124.113 159.767 1.00 0.00   ? 143  PRO D C     1 
ATOM   8407  O  O     . PRO D 1 143  ? 149.353 124.591 158.667 1.00 0.00   ? 143  PRO D O     1 
ATOM   8408  C  CB    . PRO D 1 143  ? 151.391 125.418 161.075 1.00 0.00   ? 143  PRO D CB    1 
ATOM   8409  C  CG    . PRO D 1 143  ? 152.001 124.269 161.822 1.00 0.00   ? 143  PRO D CG    1 
ATOM   8410  C  CD    . PRO D 1 143  ? 150.975 123.980 162.888 1.00 0.00   ? 143  PRO D CD    1 
ATOM   8411  N  N     . LEU D 1 144  ? 149.678 122.804 160.008 1.00 0.00   ? 144  LEU D N     1 
ATOM   8412  C  CA    . LEU D 1 144  ? 149.410 121.804 158.982 1.00 0.00   ? 144  LEU D CA    1 
ATOM   8413  C  C     . LEU D 1 144  ? 147.917 121.717 158.694 1.00 0.00   ? 144  LEU D C     1 
ATOM   8414  O  O     . LEU D 1 144  ? 147.505 121.602 157.539 1.00 0.00   ? 144  LEU D O     1 
ATOM   8415  C  CB    . LEU D 1 144  ? 149.920 120.429 159.431 1.00 0.00   ? 144  LEU D CB    1 
ATOM   8416  C  CG    . LEU D 1 144  ? 149.550 119.246 158.537 1.00 0.00   ? 144  LEU D CG    1 
ATOM   8417  C  CD1   . LEU D 1 144  ? 150.154 119.416 157.148 1.00 0.00   ? 144  LEU D CD1   1 
ATOM   8418  C  CD2   . LEU D 1 144  ? 150.046 117.964 159.180 1.00 0.00   ? 144  LEU D CD2   1 
ATOM   8419  N  N     . ALA D 1 145  ? 147.105 121.765 159.750 1.00 0.00   ? 145  ALA D N     1 
ATOM   8420  C  CA    . ALA D 1 145  ? 145.657 121.705 159.598 1.00 0.00   ? 145  ALA D CA    1 
ATOM   8421  C  C     . ALA D 1 145  ? 145.235 122.873 158.722 1.00 0.00   ? 145  ALA D C     1 
ATOM   8422  O  O     . ALA D 1 145  ? 144.367 122.736 157.862 1.00 0.00   ? 145  ALA D O     1 
ATOM   8423  C  CB    . ALA D 1 145  ? 144.971 121.791 160.963 1.00 0.00   ? 145  ALA D CB    1 
ATOM   8424  N  N     . ILE D 1 146  ? 145.865 124.025 158.938 1.00 0.00   ? 146  ILE D N     1 
ATOM   8425  C  CA    . ILE D 1 146  ? 145.555 125.212 158.152 1.00 0.00   ? 146  ILE D CA    1 
ATOM   8426  C  C     . ILE D 1 146  ? 145.847 124.958 156.681 1.00 0.00   ? 146  ILE D C     1 
ATOM   8427  O  O     . ILE D 1 146  ? 145.074 125.351 155.808 1.00 0.00   ? 146  ILE D O     1 
ATOM   8428  C  CB    . ILE D 1 146  ? 146.378 126.420 158.623 1.00 0.00   ? 146  ILE D CB    1 
ATOM   8429  C  CG1   . ILE D 1 146  ? 146.019 126.745 160.075 1.00 0.00   ? 146  ILE D CG1   1 
ATOM   8430  C  CG2   . ILE D 1 146  ? 146.116 127.615 157.713 1.00 0.00   ? 146  ILE D CG2   1 
ATOM   8431  C  CD1   . ILE D 1 146  ? 146.757 127.932 160.645 1.00 0.00   ? 146  ILE D CD1   1 
ATOM   8432  N  N     . LEU D 1 147  ? 146.972 124.305 156.417 1.00 0.00   ? 147  LEU D N     1 
ATOM   8433  C  CA    . LEU D 1 147  ? 147.366 123.984 155.053 1.00 0.00   ? 147  LEU D CA    1 
ATOM   8434  C  C     . LEU D 1 147  ? 146.381 122.999 154.443 1.00 0.00   ? 147  LEU D C     1 
ATOM   8435  O  O     . LEU D 1 147  ? 145.949 123.161 153.303 1.00 0.00   ? 147  LEU D O     1 
ATOM   8436  C  CB    . LEU D 1 147  ? 148.771 123.384 155.022 1.00 0.00   ? 147  LEU D CB    1 
ATOM   8437  C  CG    . LEU D 1 147  ? 149.228 122.867 153.655 1.00 0.00   ? 147  LEU D CG    1 
ATOM   8438  C  CD1   . LEU D 1 147  ? 149.257 124.009 152.647 1.00 0.00   ? 147  LEU D CD1   1 
ATOM   8439  C  CD2   . LEU D 1 147  ? 150.602 122.238 153.785 1.00 0.00   ? 147  LEU D CD2   1 
ATOM   8440  N  N     . ILE D 1 148  ? 146.027 121.974 155.211 1.00 0.00   ? 148  ILE D N     1 
ATOM   8441  C  CA    . ILE D 1 148  ? 145.090 120.964 154.734 1.00 0.00   ? 148  ILE D CA    1 
ATOM   8442  C  C     . ILE D 1 148  ? 143.761 121.620 154.374 1.00 0.00   ? 148  ILE D C     1 
ATOM   8443  O  O     . ILE D 1 148  ? 143.142 121.281 153.368 1.00 0.00   ? 148  ILE D O     1 
ATOM   8444  C  CB    . ILE D 1 148  ? 144.844 119.884 155.802 1.00 0.00   ? 148  ILE D CB    1 
ATOM   8445  C  CG1   . ILE D 1 148  ? 146.168 119.179 156.134 1.00 0.00   ? 148  ILE D CG1   1 
ATOM   8446  C  CG2   . ILE D 1 148  ? 143.803 118.891 155.305 1.00 0.00   ? 148  ILE D CG2   1 
ATOM   8447  C  CD1   . ILE D 1 148  ? 146.036 118.071 157.159 1.00 0.00   ? 148  ILE D CD1   1 
ATOM   8448  N  N     . LEU D 1 149  ? 143.329 122.563 155.209 1.00 0.00   ? 149  LEU D N     1 
ATOM   8449  C  CA    . LEU D 1 149  ? 142.082 123.279 154.978 1.00 0.00   ? 149  LEU D CA    1 
ATOM   8450  C  C     . LEU D 1 149  ? 142.143 124.011 153.647 1.00 0.00   ? 149  LEU D C     1 
ATOM   8451  O  O     . LEU D 1 149  ? 141.192 123.987 152.868 1.00 0.00   ? 149  LEU D O     1 
ATOM   8452  C  CB    . LEU D 1 149  ? 141.829 124.284 156.104 1.00 0.00   ? 149  LEU D CB    1 
ATOM   8453  C  CG    . LEU D 1 149  ? 140.573 125.146 155.967 1.00 0.00   ? 149  LEU D CG    1 
ATOM   8454  C  CD1   . LEU D 1 149  ? 139.330 124.262 155.926 1.00 0.00   ? 149  LEU D CD1   1 
ATOM   8455  C  CD2   . LEU D 1 149  ? 140.502 126.115 157.131 1.00 0.00   ? 149  LEU D CD2   1 
ATOM   8456  N  N     . ILE D 1 150  ? 143.268 124.673 153.394 1.00 0.00   ? 150  ILE D N     1 
ATOM   8457  C  CA    . ILE D 1 150  ? 143.445 125.407 152.149 1.00 0.00   ? 150  ILE D CA    1 
ATOM   8458  C  C     . ILE D 1 150  ? 143.350 124.455 150.962 1.00 0.00   ? 150  ILE D C     1 
ATOM   8459  O  O     . ILE D 1 150  ? 142.629 124.716 149.999 1.00 0.00   ? 150  ILE D O     1 
ATOM   8460  C  CB    . ILE D 1 150  ? 144.811 126.118 152.106 1.00 0.00   ? 150  ILE D CB    1 
ATOM   8461  C  CG1   . ILE D 1 150  ? 144.872 127.164 153.231 1.00 0.00   ? 150  ILE D CG1   1 
ATOM   8462  C  CG2   . ILE D 1 150  ? 145.029 126.756 150.741 1.00 0.00   ? 150  ILE D CG2   1 
ATOM   8463  C  CD1   . ILE D 1 150  ? 146.165 127.954 153.275 1.00 0.00   ? 150  ILE D CD1   1 
ATOM   8464  N  N     . VAL D 1 151  ? 144.083 123.349 151.038 1.00 0.00   ? 151  VAL D N     1 
ATOM   8465  C  CA    . VAL D 1 151  ? 144.092 122.356 149.972 1.00 0.00   ? 151  VAL D CA    1 
ATOM   8466  C  C     . VAL D 1 151  ? 142.713 121.751 149.713 1.00 0.00   ? 151  VAL D C     1 
ATOM   8467  O  O     . VAL D 1 151  ? 142.267 121.683 148.570 1.00 0.00   ? 151  VAL D O     1 
ATOM   8468  C  CB    . VAL D 1 151  ? 145.086 121.226 150.296 1.00 0.00   ? 151  VAL D CB    1 
ATOM   8469  C  CG1   . VAL D 1 151  ? 145.008 120.137 149.235 1.00 0.00   ? 151  VAL D CG1   1 
ATOM   8470  C  CG2   . VAL D 1 151  ? 146.493 121.793 150.364 1.00 0.00   ? 151  VAL D CG2   1 
ATOM   8471  N  N     . GLN D 1 152  ? 142.045 121.313 150.774 1.00 0.00   ? 152  GLN D N     1 
ATOM   8472  C  CA    . GLN D 1 152  ? 140.721 120.720 150.644 1.00 0.00   ? 152  GLN D CA    1 
ATOM   8473  C  C     . GLN D 1 152  ? 139.709 121.692 150.040 1.00 0.00   ? 152  GLN D C     1 
ATOM   8474  O  O     . GLN D 1 152  ? 138.901 121.301 149.197 1.00 0.00   ? 152  GLN D O     1 
ATOM   8475  C  CB    . GLN D 1 152  ? 140.221 120.224 152.005 1.00 0.00   ? 152  GLN D CB    1 
ATOM   8476  C  CG    . GLN D 1 152  ? 138.759 119.800 152.020 1.00 0.00   ? 152  GLN D CG    1 
ATOM   8477  C  CD    . GLN D 1 152  ? 138.408 118.959 153.231 1.00 0.00   ? 152  GLN D CD    1 
ATOM   8478  O  OE1   . GLN D 1 152  ? 138.745 119.309 154.362 1.00 0.00   ? 152  GLN D OE1   1 
ATOM   8479  N  NE2   . GLN D 1 152  ? 137.728 117.842 153.000 1.00 0.00   ? 152  GLN D NE2   1 
ATOM   8480  N  N     . ASN D 1 153  ? 139.745 122.949 150.465 1.00 0.00   ? 153  ASN D N     1 
ATOM   8481  C  CA    . ASN D 1 153  ? 138.819 123.936 149.925 1.00 0.00   ? 153  ASN D CA    1 
ATOM   8482  C  C     . ASN D 1 153  ? 139.026 124.095 148.427 1.00 0.00   ? 153  ASN D C     1 
ATOM   8483  O  O     . ASN D 1 153  ? 138.075 124.066 147.650 1.00 0.00   ? 153  ASN D O     1 
ATOM   8484  C  CB    . ASN D 1 153  ? 138.994 125.302 150.599 1.00 0.00   ? 153  ASN D CB    1 
ATOM   8485  C  CG    . ASN D 1 153  ? 138.377 125.349 151.983 1.00 0.00   ? 153  ASN D CG    1 
ATOM   8486  O  OD1   . ASN D 1 153  ? 137.412 124.641 152.277 1.00 0.00   ? 153  ASN D OD1   1 
ATOM   8487  N  ND2   . ASN D 1 153  ? 138.918 126.213 152.836 1.00 0.00   ? 153  ASN D ND2   1 
ATOM   8488  N  N     . ILE D 1 154  ? 140.280 124.258 148.030 1.00 0.00   ? 154  ILE D N     1 
ATOM   8489  C  CA    . ILE D 1 154  ? 140.622 124.434 146.626 1.00 0.00   ? 154  ILE D CA    1 
ATOM   8490  C  C     . ILE D 1 154  ? 140.275 123.219 145.769 1.00 0.00   ? 154  ILE D C     1 
ATOM   8491  O  O     . ILE D 1 154  ? 139.701 123.363 144.692 1.00 0.00   ? 154  ILE D O     1 
ATOM   8492  C  CB    . ILE D 1 154  ? 142.114 124.745 146.457 1.00 0.00   ? 154  ILE D CB    1 
ATOM   8493  C  CG1   . ILE D 1 154  ? 142.430 126.082 147.137 1.00 0.00   ? 154  ILE D CG1   1 
ATOM   8494  C  CG2   . ILE D 1 154  ? 142.471 124.785 144.980 1.00 0.00   ? 154  ILE D CG2   1 
ATOM   8495  C  CD1   . ILE D 1 154  ? 143.867 126.527 146.990 1.00 0.00   ? 154  ILE D CD1   1 
ATOM   8496  N  N     . VAL D 1 155  ? 140.635 122.029 146.241 1.00 0.00   ? 155  VAL D N     1 
ATOM   8497  C  CA    . VAL D 1 155  ? 140.348 120.804 145.502 1.00 0.00   ? 155  VAL D CA    1 
ATOM   8498  C  C     . VAL D 1 155  ? 138.845 120.653 145.309 1.00 0.00   ? 155  VAL D C     1 
ATOM   8499  O  O     . VAL D 1 155  ? 138.365 120.408 144.197 1.00 0.00   ? 155  VAL D O     1 
ATOM   8500  C  CB    . VAL D 1 155  ? 140.872 119.565 146.252 1.00 0.00   ? 155  VAL D CB    1 
ATOM   8501  C  CG1   . VAL D 1 155  ? 140.403 118.303 145.552 1.00 0.00   ? 155  VAL D CG1   1 
ATOM   8502  C  CG2   . VAL D 1 155  ? 142.386 119.599 146.320 1.00 0.00   ? 155  VAL D CG2   1 
ATOM   8503  N  N     . GLY D 1 156  ? 138.106 120.779 146.406 1.00 0.00   ? 156  GLY D N     1 
ATOM   8504  C  CA    . GLY D 1 156  ? 136.661 120.670 146.348 1.00 0.00   ? 156  GLY D CA    1 
ATOM   8505  C  C     . GLY D 1 156  ? 136.095 121.757 145.458 1.00 0.00   ? 156  GLY D C     1 
ATOM   8506  O  O     . GLY D 1 156  ? 135.121 121.549 144.737 1.00 0.00   ? 156  GLY D O     1 
ATOM   8507  N  N     . LEU D 1 157  ? 136.719 122.928 145.521 1.00 0.00   ? 157  LEU D N     1 
ATOM   8508  C  CA    . LEU D 1 157  ? 136.302 124.067 144.726 1.00 0.00   ? 157  LEU D CA    1 
ATOM   8509  C  C     . LEU D 1 157  ? 136.460 123.763 143.240 1.00 0.00   ? 157  LEU D C     1 
ATOM   8510  O  O     . LEU D 1 157  ? 135.546 123.989 142.450 1.00 0.00   ? 157  LEU D O     1 
ATOM   8511  C  CB    . LEU D 1 157  ? 137.124 125.299 145.095 1.00 0.00   ? 157  LEU D CB    1 
ATOM   8512  C  CG    . LEU D 1 157  ? 136.706 126.644 144.496 1.00 0.00   ? 157  LEU D CG    1 
ATOM   8513  C  CD1   . LEU D 1 157  ? 136.994 127.780 145.467 1.00 0.00   ? 157  LEU D CD1   1 
ATOM   8514  C  CD2   . LEU D 1 157  ? 137.456 126.842 143.199 1.00 0.00   ? 157  LEU D CD2   1 
ATOM   8515  N  N     . MET D 1 158  ? 137.625 123.248 142.861 1.00 0.00   ? 158  MET D N     1 
ATOM   8516  C  CA    . MET D 1 158  ? 137.887 122.906 141.467 1.00 0.00   ? 158  MET D CA    1 
ATOM   8517  C  C     . MET D 1 158  ? 136.939 121.823 140.978 1.00 0.00   ? 158  MET D C     1 
ATOM   8518  O  O     . MET D 1 158  ? 136.501 121.842 139.828 1.00 0.00   ? 158  MET D O     1 
ATOM   8519  C  CB    . MET D 1 158  ? 139.335 122.443 141.281 1.00 0.00   ? 158  MET D CB    1 
ATOM   8520  C  CG    . MET D 1 158  ? 140.354 123.564 141.253 1.00 0.00   ? 158  MET D CG    1 
ATOM   8521  S  SD    . MET D 1 158  ? 140.029 124.739 139.927 1.00 0.00   ? 158  MET D SD    1 
ATOM   8522  C  CE    . MET D 1 158  ? 140.715 126.232 140.622 1.00 0.00   ? 158  MET D CE    1 
ATOM   8523  N  N     . ILE D 1 159  ? 136.627 120.872 141.852 1.00 0.00   ? 159  ILE D N     1 
ATOM   8524  C  CA    . ILE D 1 159  ? 135.721 119.793 141.495 1.00 0.00   ? 159  ILE D CA    1 
ATOM   8525  C  C     . ILE D 1 159  ? 134.356 120.362 141.123 1.00 0.00   ? 159  ILE D C     1 
ATOM   8526  O  O     . ILE D 1 159  ? 133.778 119.978 140.104 1.00 0.00   ? 159  ILE D O     1 
ATOM   8527  C  CB    . ILE D 1 159  ? 135.548 118.801 142.658 1.00 0.00   ? 159  ILE D CB    1 
ATOM   8528  C  CG1   . ILE D 1 159  ? 136.891 118.115 142.942 1.00 0.00   ? 159  ILE D CG1   1 
ATOM   8529  C  CG2   . ILE D 1 159  ? 134.477 117.779 142.317 1.00 0.00   ? 159  ILE D CG2   1 
ATOM   8530  C  CD1   . ILE D 1 159  ? 136.829 117.059 144.020 1.00 0.00   ? 159  ILE D CD1   1 
ATOM   8531  N  N     . ASN D 1 160  ? 133.845 121.274 141.943 1.00 0.00   ? 160  ASN D N     1 
ATOM   8532  C  CA    . ASN D 1 160  ? 132.548 121.887 141.669 1.00 0.00   ? 160  ASN D CA    1 
ATOM   8533  C  C     . ASN D 1 160  ? 132.568 122.639 140.350 1.00 0.00   ? 160  ASN D C     1 
ATOM   8534  O  O     . ASN D 1 160  ? 131.583 122.639 139.607 1.00 0.00   ? 160  ASN D O     1 
ATOM   8535  C  CB    . ASN D 1 160  ? 132.156 122.858 142.785 1.00 0.00   ? 160  ASN D CB    1 
ATOM   8536  C  CG    . ASN D 1 160  ? 131.810 122.155 144.074 1.00 0.00   ? 160  ASN D CG    1 
ATOM   8537  O  OD1   . ASN D 1 160  ? 131.345 121.017 144.063 1.00 0.00   ? 160  ASN D OD1   1 
ATOM   8538  N  ND2   . ASN D 1 160  ? 132.021 122.835 145.198 1.00 0.00   ? 160  ASN D ND2   1 
ATOM   8539  N  N     . ALA D 1 161  ? 133.695 123.285 140.069 1.00 0.00   ? 161  ALA D N     1 
ATOM   8540  C  CA    . ALA D 1 161  ? 133.859 124.046 138.840 1.00 0.00   ? 161  ALA D CA    1 
ATOM   8541  C  C     . ALA D 1 161  ? 133.760 123.115 137.636 1.00 0.00   ? 161  ALA D C     1 
ATOM   8542  O  O     . ALA D 1 161  ? 133.015 123.374 136.692 1.00 0.00   ? 161  ALA D O     1 
ATOM   8543  C  CB    . ALA D 1 161  ? 135.201 124.763 138.850 1.00 0.00   ? 161  ALA D CB    1 
ATOM   8544  N  N     . ILE D 1 162  ? 134.515 122.020 137.680 1.00 0.00   ? 162  ILE D N     1 
ATOM   8545  C  CA    . ILE D 1 162  ? 134.516 121.041 136.600 1.00 0.00   ? 162  ILE D CA    1 
ATOM   8546  C  C     . ILE D 1 162  ? 133.153 120.372 136.470 1.00 0.00   ? 162  ILE D C     1 
ATOM   8547  O  O     . ILE D 1 162  ? 132.648 120.175 135.363 1.00 0.00   ? 162  ILE D O     1 
ATOM   8548  C  CB    . ILE D 1 162  ? 135.569 119.954 136.848 1.00 0.00   ? 162  ILE D CB    1 
ATOM   8549  C  CG1   . ILE D 1 162  ? 136.963 120.590 136.842 1.00 0.00   ? 162  ILE D CG1   1 
ATOM   8550  C  CG2   . ILE D 1 162  ? 135.445 118.856 135.803 1.00 0.00   ? 162  ILE D CG2   1 
ATOM   8551  C  CD1   . ILE D 1 162  ? 138.085 119.603 137.047 1.00 0.00   ? 162  ILE D CD1   1 
ATOM   8552  N  N     . MET D 1 163  ? 132.568 120.016 137.612 1.00 0.00   ? 163  MET D N     1 
ATOM   8553  C  CA    . MET D 1 163  ? 131.268 119.360 137.647 1.00 0.00   ? 163  MET D CA    1 
ATOM   8554  C  C     . MET D 1 163  ? 130.202 120.236 137.000 1.00 0.00   ? 163  MET D C     1 
ATOM   8555  O  O     . MET D 1 163  ? 129.359 119.746 136.251 1.00 0.00   ? 163  MET D O     1 
ATOM   8556  C  CB    . MET D 1 163  ? 130.887 119.047 139.099 1.00 0.00   ? 163  MET D CB    1 
ATOM   8557  C  CG    . MET D 1 163  ? 129.499 118.443 139.299 1.00 0.00   ? 163  MET D CG    1 
ATOM   8558  S  SD    . MET D 1 163  ? 128.160 119.647 139.167 1.00 0.00   ? 163  MET D SD    1 
ATOM   8559  C  CE    . MET D 1 163  ? 128.262 120.447 140.768 1.00 0.00   ? 163  MET D CE    1 
ATOM   8560  N  N     . LEU D 1 164  ? 130.239 121.532 137.295 1.00 0.00   ? 164  LEU D N     1 
ATOM   8561  C  CA    . LEU D 1 164  ? 129.272 122.453 136.715 1.00 0.00   ? 164  LEU D CA    1 
ATOM   8562  C  C     . LEU D 1 164  ? 129.461 122.503 135.207 1.00 0.00   ? 164  LEU D C     1 
ATOM   8563  O  O     . LEU D 1 164  ? 128.500 122.383 134.446 1.00 0.00   ? 164  LEU D O     1 
ATOM   8564  C  CB    . LEU D 1 164  ? 129.437 123.849 137.312 1.00 0.00   ? 164  LEU D CB    1 
ATOM   8565  C  CG    . LEU D 1 164  ? 128.923 124.038 138.736 1.00 0.00   ? 164  LEU D CG    1 
ATOM   8566  C  CD1   . LEU D 1 164  ? 129.205 125.461 139.177 1.00 0.00   ? 164  LEU D CD1   1 
ATOM   8567  C  CD2   . LEU D 1 164  ? 127.426 123.750 138.798 1.00 0.00   ? 164  LEU D CD2   1 
ATOM   8568  N  N     . GLY D 1 165  ? 130.709 122.680 134.785 1.00 0.00   ? 165  GLY D N     1 
ATOM   8569  C  CA    . GLY D 1 165  ? 131.010 122.740 133.368 1.00 0.00   ? 165  GLY D CA    1 
ATOM   8570  C  C     . GLY D 1 165  ? 130.442 121.545 132.626 1.00 0.00   ? 165  GLY D C     1 
ATOM   8571  O  O     . GLY D 1 165  ? 129.849 121.692 131.560 1.00 0.00   ? 165  GLY D O     1 
ATOM   8572  N  N     . CYS D 1 166  ? 130.621 120.357 133.194 1.00 0.00   ? 166  CYS D N     1 
ATOM   8573  C  CA    . CYS D 1 166  ? 130.125 119.126 132.592 1.00 0.00   ? 166  CYS D CA    1 
ATOM   8574  C  C     . CYS D 1 166  ? 128.606 119.098 132.502 1.00 0.00   ? 166  CYS D C     1 
ATOM   8575  O  O     . CYS D 1 166  ? 128.038 118.715 131.480 1.00 0.00   ? 166  CYS D O     1 
ATOM   8576  C  CB    . CYS D 1 166  ? 130.606 117.918 133.397 1.00 0.00   ? 166  CYS D CB    1 
ATOM   8577  S  SG    . CYS D 1 166  ? 132.391 117.699 133.387 1.00 0.00   ? 166  CYS D SG    1 
ATOM   8578  N  N     . ILE D 1 167  ? 127.949 119.499 133.587 1.00 0.00   ? 167  ILE D N     1 
ATOM   8579  C  CA    . ILE D 1 167  ? 126.493 119.524 133.639 1.00 0.00   ? 167  ILE D CA    1 
ATOM   8580  C  C     . ILE D 1 167  ? 125.901 120.483 132.616 1.00 0.00   ? 167  ILE D C     1 
ATOM   8581  O  O     . ILE D 1 167  ? 124.880 120.189 131.994 1.00 0.00   ? 167  ILE D O     1 
ATOM   8582  C  CB    . ILE D 1 167  ? 126.012 119.933 135.039 1.00 0.00   ? 167  ILE D CB    1 
ATOM   8583  C  CG1   . ILE D 1 167  ? 126.374 118.835 136.042 1.00 0.00   ? 167  ILE D CG1   1 
ATOM   8584  C  CG2   . ILE D 1 167  ? 124.514 120.188 135.023 1.00 0.00   ? 167  ILE D CG2   1 
ATOM   8585  C  CD1   . ILE D 1 167  ? 125.719 117.504 135.750 1.00 0.00   ? 167  ILE D CD1   1 
ATOM   8586  N  N     . PHE D 1 168  ? 126.543 121.638 132.455 1.00 0.00   ? 168  PHE D N     1 
ATOM   8587  C  CA    . PHE D 1 168  ? 126.077 122.638 131.499 1.00 0.00   ? 168  PHE D CA    1 
ATOM   8588  C  C     . PHE D 1 168  ? 126.069 122.085 130.078 1.00 0.00   ? 168  PHE D C     1 
ATOM   8589  O  O     . PHE D 1 168  ? 125.090 122.238 129.353 1.00 0.00   ? 168  PHE D O     1 
ATOM   8590  C  CB    . PHE D 1 168  ? 126.962 123.879 131.559 1.00 0.00   ? 168  PHE D CB    1 
ATOM   8591  C  CG    . PHE D 1 168  ? 126.652 124.800 132.709 1.00 0.00   ? 168  PHE D CG    1 
ATOM   8592  C  CD1   . PHE D 1 168  ? 126.549 124.318 134.013 1.00 0.00   ? 168  PHE D CD1   1 
ATOM   8593  C  CD2   . PHE D 1 168  ? 126.513 126.167 132.495 1.00 0.00   ? 168  PHE D CD2   1 
ATOM   8594  C  CE1   . PHE D 1 168  ? 126.317 125.184 135.082 1.00 0.00   ? 168  PHE D CE1   1 
ATOM   8595  C  CE2   . PHE D 1 168  ? 126.283 127.037 133.555 1.00 0.00   ? 168  PHE D CE2   1 
ATOM   8596  C  CZ    . PHE D 1 168  ? 126.185 126.549 134.850 1.00 0.00   ? 168  PHE D CZ    1 
ATOM   8597  N  N     . MET D 1 169  ? 127.164 121.448 129.679 1.00 0.00   ? 169  MET D N     1 
ATOM   8598  C  CA    . MET D 1 169  ? 127.261 120.882 128.337 1.00 0.00   ? 169  MET D CA    1 
ATOM   8599  C  C     . MET D 1 169  ? 126.241 119.767 128.132 1.00 0.00   ? 169  MET D C     1 
ATOM   8600  O  O     . MET D 1 169  ? 125.785 119.532 127.013 1.00 0.00   ? 169  MET D O     1 
ATOM   8601  C  CB    . MET D 1 169  ? 128.670 120.341 128.079 1.00 0.00   ? 169  MET D CB    1 
ATOM   8602  C  CG    . MET D 1 169  ? 129.772 121.389 128.159 1.00 0.00   ? 169  MET D CG    1 
ATOM   8603  S  SD    . MET D 1 169  ? 131.387 120.744 127.658 1.00 0.00   ? 169  MET D SD    1 
ATOM   8604  C  CE    . MET D 1 169  ? 132.098 120.289 129.247 1.00 0.00   ? 169  MET D CE    1 
ATOM   8605  N  N     . LYS D 1 170  ? 125.892 119.072 129.211 1.00 0.00   ? 170  LYS D N     1 
ATOM   8606  C  CA    . LYS D 1 170  ? 124.916 117.991 129.112 1.00 0.00   ? 170  LYS D CA    1 
ATOM   8607  C  C     . LYS D 1 170  ? 123.529 118.573 128.880 1.00 0.00   ? 170  LYS D C     1 
ATOM   8608  O  O     . LYS D 1 170  ? 122.727 118.009 128.135 1.00 0.00   ? 170  LYS D O     1 
ATOM   8609  C  CB    . LYS D 1 170  ? 124.902 117.130 130.381 1.00 0.00   ? 170  LYS D CB    1 
ATOM   8610  C  CG    . LYS D 1 170  ? 126.116 116.226 130.545 1.00 0.00   ? 170  LYS D CG    1 
ATOM   8611  C  CD    . LYS D 1 170  ? 125.845 115.124 131.565 1.00 0.00   ? 170  LYS D CD    1 
ATOM   8612  C  CE    . LYS D 1 170  ? 124.829 114.123 131.033 1.00 0.00   ? 170  LYS D CE    1 
ATOM   8613  N  NZ    . LYS D 1 170  ? 125.301 113.475 129.780 1.00 0.00   ? 170  LYS D NZ    1 
ATOM   8614  N  N     . THR D 1 171  ? 123.253 119.704 129.523 1.00 0.00   ? 171  THR D N     1 
ATOM   8615  C  CA    . THR D 1 171  ? 121.963 120.367 129.376 1.00 0.00   ? 171  THR D CA    1 
ATOM   8616  C  C     . THR D 1 171  ? 121.871 121.003 127.995 1.00 0.00   ? 171  THR D C     1 
ATOM   8617  O  O     . THR D 1 171  ? 120.826 121.531 127.612 1.00 0.00   ? 171  THR D O     1 
ATOM   8618  C  CB    . THR D 1 171  ? 121.784 121.469 130.434 1.00 0.00   ? 171  THR D CB    1 
ATOM   8619  O  OG1   . THR D 1 171  ? 122.843 122.426 130.311 1.00 0.00   ? 171  THR D OG1   1 
ATOM   8620  C  CG2   . THR D 1 171  ? 121.809 120.875 131.831 1.00 0.00   ? 171  THR D CG2   1 
ATOM   8621  N  N     . ALA D 1 172  ? 122.970 120.952 127.256 1.00 0.00   ? 172  ALA D N     1 
ATOM   8622  C  CA    . ALA D 1 172  ? 123.020 121.530 125.922 1.00 0.00   ? 172  ALA D CA    1 
ATOM   8623  C  C     . ALA D 1 172  ? 122.989 120.441 124.859 1.00 0.00   ? 172  ALA D C     1 
ATOM   8624  O  O     . ALA D 1 172  ? 123.145 120.721 123.669 1.00 0.00   ? 172  ALA D O     1 
ATOM   8625  C  CB    . ALA D 1 172  ? 124.277 122.376 125.774 1.00 0.00   ? 172  ALA D CB    1 
ATOM   8626  N  N     . GLN D 1 173  ? 122.785 119.197 125.292 1.00 0.00   ? 173  GLN D N     1 
ATOM   8627  C  CA    . GLN D 1 173  ? 122.723 118.070 124.372 1.00 0.00   ? 173  GLN D CA    1 
ATOM   8628  C  C     . GLN D 1 173  ? 121.471 118.195 123.513 1.00 0.00   ? 173  GLN D C     1 
ATOM   8629  O  O     . GLN D 1 173  ? 120.424 117.616 123.815 1.00 0.00   ? 173  GLN D O     1 
ATOM   8630  C  CB    . GLN D 1 173  ? 122.722 116.747 125.151 1.00 0.00   ? 173  GLN D CB    1 
ATOM   8631  C  CG    . GLN D 1 173  ? 124.070 116.420 125.778 1.00 0.00   ? 173  GLN D CG    1 
ATOM   8632  C  CD    . GLN D 1 173  ? 125.179 116.404 124.749 1.00 0.00   ? 173  GLN D CD    1 
ATOM   8633  O  OE1   . GLN D 1 173  ? 125.224 115.537 123.878 1.00 0.00   ? 173  GLN D OE1   1 
ATOM   8634  N  NE2   . GLN D 1 173  ? 126.076 117.381 124.833 1.00 0.00   ? 173  GLN D NE2   1 
ATOM   8635  N  N     . ALA D 1 174  ? 121.594 118.961 122.438 1.00 0.00   ? 174  ALA D N     1 
ATOM   8636  C  CA    . ALA D 1 174  ? 120.480 119.203 121.537 1.00 0.00   ? 174  ALA D CA    1 
ATOM   8637  C  C     . ALA D 1 174  ? 120.093 118.020 120.657 1.00 0.00   ? 174  ALA D C     1 
ATOM   8638  O  O     . ALA D 1 174  ? 119.188 118.147 119.824 1.00 0.00   ? 174  ALA D O     1 
ATOM   8639  C  CB    . ALA D 1 174  ? 120.786 120.418 120.671 1.00 0.00   ? 174  ALA D CB    1 
ATOM   8640  N  N     . HIS D 1 175  ? 120.746 116.870 120.827 1.00 0.00   ? 175  HIS D N     1 
ATOM   8641  C  CA    . HIS D 1 175  ? 120.394 115.727 119.994 1.00 0.00   ? 175  HIS D CA    1 
ATOM   8642  C  C     . HIS D 1 175  ? 118.949 115.334 120.280 1.00 0.00   ? 175  HIS D C     1 
ATOM   8643  O  O     . HIS D 1 175  ? 118.302 114.677 119.467 1.00 0.00   ? 175  HIS D O     1 
ATOM   8644  C  CB    . HIS D 1 175  ? 121.312 114.527 120.255 1.00 0.00   ? 175  HIS D CB    1 
ATOM   8645  C  CG    . HIS D 1 175  ? 121.101 113.870 121.585 1.00 0.00   ? 175  HIS D CG    1 
ATOM   8646  N  ND1   . HIS D 1 175  ? 121.611 114.380 122.760 1.00 0.00   ? 175  HIS D ND1   1 
ATOM   8647  C  CD2   . HIS D 1 175  ? 120.425 112.747 121.931 1.00 0.00   ? 175  HIS D CD2   1 
ATOM   8648  C  CE1   . HIS D 1 175  ? 121.259 113.604 123.768 1.00 0.00   ? 175  HIS D CE1   1 
ATOM   8649  N  NE2   . HIS D 1 175  ? 120.536 112.607 123.294 1.00 0.00   ? 175  HIS D NE2   1 
ATOM   8650  N  N     . ARG D 1 176  ? 118.447 115.755 121.433 1.00 0.00   ? 176  ARG D N     1 
ATOM   8651  C  CA    . ARG D 1 176  ? 117.072 115.467 121.812 1.00 0.00   ? 176  ARG D CA    1 
ATOM   8652  C  C     . ARG D 1 176  ? 116.117 116.140 120.830 1.00 0.00   ? 176  ARG D C     1 
ATOM   8653  O  O     . ARG D 1 176  ? 114.984 115.685 120.642 1.00 0.00   ? 176  ARG D O     1 
ATOM   8654  C  CB    . ARG D 1 176  ? 116.802 115.959 123.230 1.00 0.00   ? 176  ARG D CB    1 
ATOM   8655  C  CG    . ARG D 1 176  ? 117.458 115.090 124.293 1.00 0.00   ? 176  ARG D CG    1 
ATOM   8656  C  CD    . ARG D 1 176  ? 116.881 113.681 124.249 1.00 0.00   ? 176  ARG D CD    1 
ATOM   8657  N  NE    . ARG D 1 176  ? 117.494 112.788 125.227 1.00 0.00   ? 176  ARG D NE    1 
ATOM   8658  C  CZ    . ARG D 1 176  ? 117.229 111.489 125.315 1.00 0.00   ? 176  ARG D CZ    1 
ATOM   8659  N  NH1   . ARG D 1 176  ? 116.357 110.930 124.481 1.00 0.00   ? 176  ARG D NH1   1 
ATOM   8660  N  NH2   . ARG D 1 176  ? 117.834 110.745 126.230 1.00 0.00   ? 176  ARG D NH2   1 
ATOM   8661  N  N     . ARG D 1 177  ? 116.579 117.223 120.210 1.00 0.00   ? 177  ARG D N     1 
ATOM   8662  C  CA    . ARG D 1 177  ? 115.779 117.944 119.228 1.00 0.00   ? 177  ARG D CA    1 
ATOM   8663  C  C     . ARG D 1 177  ? 115.859 117.200 117.904 1.00 0.00   ? 177  ARG D C     1 
ATOM   8664  O  O     . ARG D 1 177  ? 114.954 117.283 117.080 1.00 0.00   ? 177  ARG D O     1 
ATOM   8665  C  CB    . ARG D 1 177  ? 116.290 119.378 119.046 1.00 0.00   ? 177  ARG D CB    1 
ATOM   8666  C  CG    . ARG D 1 177  ? 115.697 120.386 120.027 1.00 0.00   ? 177  ARG D CG    1 
ATOM   8667  C  CD    . ARG D 1 177  ? 114.162 120.338 120.028 1.00 0.00   ? 177  ARG D CD    1 
ATOM   8668  N  NE    . ARG D 1 177  ? 113.587 120.555 118.701 1.00 0.00   ? 177  ARG D NE    1 
ATOM   8669  C  CZ    . ARG D 1 177  ? 113.502 121.742 118.102 1.00 0.00   ? 177  ARG D CZ    1 
ATOM   8670  N  NH1   . ARG D 1 177  ? 113.954 122.832 118.708 1.00 0.00   ? 177  ARG D NH1   1 
ATOM   8671  N  NH2   . ARG D 1 177  ? 112.979 121.835 116.886 1.00 0.00   ? 177  ARG D NH2   1 
ATOM   8672  N  N     . ALA D 1 178  ? 116.953 116.471 117.709 1.00 0.00   ? 178  ALA D N     1 
ATOM   8673  C  CA    . ALA D 1 178  ? 117.142 115.700 116.495 1.00 0.00   ? 178  ALA D CA    1 
ATOM   8674  C  C     . ALA D 1 178  ? 116.048 114.631 116.422 1.00 0.00   ? 178  ALA D C     1 
ATOM   8675  O  O     . ALA D 1 178  ? 115.616 114.243 115.337 1.00 0.00   ? 178  ALA D O     1 
ATOM   8676  C  CB    . ALA D 1 178  ? 118.517 115.054 116.492 1.00 0.00   ? 178  ALA D CB    1 
ATOM   8677  N  N     . GLU D 1 179  ? 115.605 114.164 117.588 1.00 0.00   ? 179  GLU D N     1 
ATOM   8678  C  CA    . GLU D 1 179  ? 114.566 113.147 117.662 1.00 0.00   ? 179  GLU D CA    1 
ATOM   8679  C  C     . GLU D 1 179  ? 113.198 113.725 117.306 1.00 0.00   ? 179  GLU D C     1 
ATOM   8680  O  O     . GLU D 1 179  ? 112.255 112.982 117.033 1.00 0.00   ? 179  GLU D O     1 
ATOM   8681  C  CB    . GLU D 1 179  ? 114.509 112.551 119.071 1.00 0.00   ? 179  GLU D CB    1 
ATOM   8682  C  CG    . GLU D 1 179  ? 115.830 112.005 119.580 1.00 0.00   ? 179  GLU D CG    1 
ATOM   8683  C  CD    . GLU D 1 179  ? 115.686 111.311 120.922 1.00 0.00   ? 179  GLU D CD    1 
ATOM   8684  O  OE1   . GLU D 1 179  ? 115.220 111.957 121.887 1.00 0.00   ? 179  GLU D OE1   1 
ATOM   8685  O  OE2   . GLU D 1 179  ? 116.044 110.115 121.021 1.00 0.00   ? 179  GLU D OE2   1 
ATOM   8686  N  N     . THR D 1 180  ? 113.088 115.049 117.312 1.00 0.00   ? 180  THR D N     1 
ATOM   8687  C  CA    . THR D 1 180  ? 111.820 115.699 116.994 1.00 0.00   ? 180  THR D CA    1 
ATOM   8688  C  C     . THR D 1 180  ? 111.662 115.908 115.492 1.00 0.00   ? 180  THR D C     1 
ATOM   8689  O  O     . THR D 1 180  ? 110.608 116.346 115.027 1.00 0.00   ? 180  THR D O     1 
ATOM   8690  C  CB    . THR D 1 180  ? 111.689 117.061 117.697 1.00 0.00   ? 180  THR D CB    1 
ATOM   8691  O  OG1   . THR D 1 180  ? 112.650 117.980 117.158 1.00 0.00   ? 180  THR D OG1   1 
ATOM   8692  C  CG2   . THR D 1 180  ? 111.925 116.915 119.191 1.00 0.00   ? 180  THR D CG2   1 
ATOM   8693  N  N     . LEU D 1 181  ? 112.709 115.598 114.734 1.00 0.00   ? 181  LEU D N     1 
ATOM   8694  C  CA    . LEU D 1 181  ? 112.674 115.760 113.284 1.00 0.00   ? 181  LEU D CA    1 
ATOM   8695  C  C     . LEU D 1 181  ? 112.124 114.507 112.617 1.00 0.00   ? 181  LEU D C     1 
ATOM   8696  O  O     . LEU D 1 181  ? 112.496 113.387 112.966 1.00 0.00   ? 181  LEU D O     1 
ATOM   8697  C  CB    . LEU D 1 181  ? 114.075 116.069 112.757 1.00 0.00   ? 181  LEU D CB    1 
ATOM   8698  C  CG    . LEU D 1 181  ? 114.637 117.381 113.316 1.00 0.00   ? 181  LEU D CG    1 
ATOM   8699  C  CD1   . LEU D 1 181  ? 116.044 117.600 112.803 1.00 0.00   ? 181  LEU D CD1   1 
ATOM   8700  C  CD2   . LEU D 1 181  ? 113.734 118.536 112.918 1.00 0.00   ? 181  LEU D CD2   1 
ATOM   8701  N  N     . ILE D 1 182  ? 111.237 114.705 111.651 1.00 0.00   ? 182  ILE D N     1 
ATOM   8702  C  CA    . ILE D 1 182  ? 110.597 113.591 110.967 1.00 0.00   ? 182  ILE D CA    1 
ATOM   8703  C  C     . ILE D 1 182  ? 110.985 113.395 109.508 1.00 0.00   ? 182  ILE D C     1 
ATOM   8704  O  O     . ILE D 1 182  ? 111.132 114.354 108.750 1.00 0.00   ? 182  ILE D O     1 
ATOM   8705  C  CB    . ILE D 1 182  ? 109.068 113.732 111.024 1.00 0.00   ? 182  ILE D CB    1 
ATOM   8706  C  CG1   . ILE D 1 182  ? 108.622 113.824 112.488 1.00 0.00   ? 182  ILE D CG1   1 
ATOM   8707  C  CG2   . ILE D 1 182  ? 108.408 112.552 110.323 1.00 0.00   ? 182  ILE D CG2   1 
ATOM   8708  C  CD1   . ILE D 1 182  ? 109.011 112.628 113.328 1.00 0.00   ? 182  ILE D CD1   1 
ATOM   8709  N  N     . PHE D 1 183  ? 111.143 112.126 109.141 1.00 0.00   ? 183  PHE D N     1 
ATOM   8710  C  CA    . PHE D 1 183  ? 111.469 111.725 107.781 1.00 0.00   ? 183  PHE D CA    1 
ATOM   8711  C  C     . PHE D 1 183  ? 110.480 110.623 107.434 1.00 0.00   ? 183  PHE D C     1 
ATOM   8712  O  O     . PHE D 1 183  ? 110.380 109.624 108.147 1.00 0.00   ? 183  PHE D O     1 
ATOM   8713  C  CB    . PHE D 1 183  ? 112.893 111.173 107.693 1.00 0.00   ? 183  PHE D CB    1 
ATOM   8714  C  CG    . PHE D 1 183  ? 113.957 112.221 107.818 1.00 0.00   ? 183  PHE D CG    1 
ATOM   8715  C  CD1   . PHE D 1 183  ? 114.462 112.578 109.066 1.00 0.00   ? 183  PHE D CD1   1 
ATOM   8716  C  CD2   . PHE D 1 183  ? 114.468 112.848 106.687 1.00 0.00   ? 183  PHE D CD2   1 
ATOM   8717  C  CE1   . PHE D 1 183  ? 115.460 113.544 109.180 1.00 0.00   ? 183  PHE D CE1   1 
ATOM   8718  C  CE2   . PHE D 1 183  ? 115.462 113.814 106.793 1.00 0.00   ? 183  PHE D CE2   1 
ATOM   8719  C  CZ    . PHE D 1 183  ? 115.963 114.164 108.039 1.00 0.00   ? 183  PHE D CZ    1 
ATOM   8720  N  N     . SER D 1 184  ? 109.835 110.749 106.284 1.00 0.00   ? 184  SER D N     1 
ATOM   8721  C  CA    . SER D 1 184  ? 108.880 109.744 105.870 1.00 0.00   ? 184  SER D CA    1 
ATOM   8722  C  C     . SER D 1 184  ? 109.626 108.434 105.760 1.00 0.00   ? 184  SER D C     1 
ATOM   8723  O  O     . SER D 1 184  ? 110.792 108.395 105.378 1.00 0.00   ? 184  SER D O     1 
ATOM   8724  C  CB    . SER D 1 184  ? 108.293 110.097 104.512 1.00 0.00   ? 184  SER D CB    1 
ATOM   8725  O  OG    . SER D 1 184  ? 109.224 109.827 103.484 1.00 0.00   ? 184  SER D OG    1 
ATOM   8726  N  N     . LYS D 1 185  ? 108.945 107.344 106.084 1.00 0.00   ? 185  LYS D N     1 
ATOM   8727  C  CA    . LYS D 1 185  ? 109.580 106.042 106.057 1.00 0.00   ? 185  LYS D CA    1 
ATOM   8728  C  C     . LYS D 1 185  ? 110.093 105.686 104.668 1.00 0.00   ? 185  LYS D C     1 
ATOM   8729  O  O     . LYS D 1 185  ? 111.182 105.142 104.539 1.00 0.00   ? 185  LYS D O     1 
ATOM   8730  C  CB    . LYS D 1 185  ? 108.610 104.970 106.549 1.00 0.00   ? 185  LYS D CB    1 
ATOM   8731  C  CG    . LYS D 1 185  ? 109.241 103.598 106.688 1.00 0.00   ? 185  LYS D CG    1 
ATOM   8732  C  CD    . LYS D 1 185  ? 108.200 102.494 106.699 1.00 0.00   ? 185  LYS D CD    1 
ATOM   8733  C  CE    . LYS D 1 185  ? 107.152 102.756 107.764 1.00 0.00   ? 185  LYS D CE    1 
ATOM   8734  N  NZ    . LYS D 1 185  ? 106.197 101.624 107.900 1.00 0.00   ? 185  LYS D NZ    1 
ATOM   8735  N  N     . HIS D 1 186  ? 109.329 106.004 103.629 1.00 0.00   ? 186  HIS D N     1 
ATOM   8736  C  CA    . HIS D 1 186  ? 109.771 105.701 102.272 1.00 0.00   ? 186  HIS D CA    1 
ATOM   8737  C  C     . HIS D 1 186  ? 109.723 106.907 101.336 1.00 0.00   ? 186  HIS D C     1 
ATOM   8738  O  O     . HIS D 1 186  ? 108.856 107.768 101.457 1.00 0.00   ? 186  HIS D O     1 
ATOM   8739  C  CB    . HIS D 1 186  ? 108.982 104.537 101.691 1.00 0.00   ? 186  HIS D CB    1 
ATOM   8740  C  CG    . HIS D 1 186  ? 107.514 104.797 101.589 1.00 0.00   ? 186  HIS D CG    1 
ATOM   8741  N  ND1   . HIS D 1 186  ? 106.966 105.568 100.590 1.00 0.00   ? 186  HIS D ND1   1 
ATOM   8742  C  CD2   . HIS D 1 186  ? 106.482 104.397 102.370 1.00 0.00   ? 186  HIS D CD2   1 
ATOM   8743  C  CE1   . HIS D 1 186  ? 105.657 105.628 100.755 1.00 0.00   ? 186  HIS D CE1   1 
ATOM   8744  N  NE2   . HIS D 1 186  ? 105.337 104.929 101.825 1.00 0.00   ? 186  HIS D NE2   1 
ATOM   8745  N  N     . ALA D 1 187  ? 110.667 106.946 100.404 1.00 0.00   ? 187  ALA D N     1 
ATOM   8746  C  CA    . ALA D 1 187  ? 110.779 108.025 99.430  1.00 0.00   ? 187  ALA D CA    1 
ATOM   8747  C  C     . ALA D 1 187  ? 110.333 107.503 98.081  1.00 0.00   ? 187  ALA D C     1 
ATOM   8748  O  O     . ALA D 1 187  ? 110.606 106.356 97.729  1.00 0.00   ? 187  ALA D O     1 
ATOM   8749  C  CB    . ALA D 1 187  ? 112.204 108.540 99.362  1.00 0.00   ? 187  ALA D CB    1 
ATOM   8750  N  N     . VAL D 1 188  ? 109.650 108.345 97.321  1.00 0.00   ? 188  VAL D N     1 
ATOM   8751  C  CA    . VAL D 1 188  ? 109.100 107.932 96.040  1.00 0.00   ? 188  VAL D CA    1 
ATOM   8752  C  C     . VAL D 1 188  ? 109.835 108.491 94.834  1.00 0.00   ? 188  VAL D C     1 
ATOM   8753  O  O     . VAL D 1 188  ? 110.605 109.448 94.936  1.00 0.00   ? 188  VAL D O     1 
ATOM   8754  C  CB    . VAL D 1 188  ? 107.601 108.309 95.916  1.00 0.00   ? 188  VAL D CB    1 
ATOM   8755  C  CG1   . VAL D 1 188  ? 106.830 107.708 97.074  1.00 0.00   ? 188  VAL D CG1   1 
ATOM   8756  C  CG2   . VAL D 1 188  ? 107.436 109.822 95.874  1.00 0.00   ? 188  VAL D CG2   1 
ATOM   8757  N  N     . ILE D 1 189  ? 109.585 107.861 93.693  1.00 0.00   ? 189  ILE D N     1 
ATOM   8758  C  CA    . ILE D 1 189  ? 110.172 108.260 92.424  1.00 0.00   ? 189  ILE D CA    1 
ATOM   8759  C  C     . ILE D 1 189  ? 109.020 108.569 91.487  1.00 0.00   ? 189  ILE D C     1 
ATOM   8760  O  O     . ILE D 1 189  ? 108.273 107.672 91.085  1.00 0.00   ? 189  ILE D O     1 
ATOM   8761  C  CB    . ILE D 1 189  ? 111.023 107.129 91.803  1.00 0.00   ? 189  ILE D CB    1 
ATOM   8762  C  CG1   . ILE D 1 189  ? 112.271 106.877 92.657  1.00 0.00   ? 189  ILE D CG1   1 
ATOM   8763  C  CG2   . ILE D 1 189  ? 111.414 107.501 90.378  1.00 0.00   ? 189  ILE D CG2   1 
ATOM   8764  C  CD1   . ILE D 1 189  ? 113.226 105.853 92.066  1.00 0.00   ? 189  ILE D CD1   1 
ATOM   8765  N  N     . THR D 1 190  ? 108.866 109.844 91.142  1.00 0.00   ? 190  THR D N     1 
ATOM   8766  C  CA    . THR D 1 190  ? 107.789 110.270 90.255  1.00 0.00   ? 190  THR D CA    1 
ATOM   8767  C  C     . THR D 1 190  ? 108.254 111.415 89.367  1.00 0.00   ? 190  THR D C     1 
ATOM   8768  O  O     . THR D 1 190  ? 109.213 112.122 89.700  1.00 0.00   ? 190  THR D O     1 
ATOM   8769  C  CB    . THR D 1 190  ? 106.569 110.729 91.077  1.00 0.00   ? 190  THR D CB    1 
ATOM   8770  O  OG1   . THR D 1 190  ? 105.539 111.186 90.195  1.00 0.00   ? 190  THR D OG1   1 
ATOM   8771  C  CG2   . THR D 1 190  ? 106.953 111.860 92.027  1.00 0.00   ? 190  THR D CG2   1 
ATOM   8772  N  N     . PRO D 1 191  ? 107.599 111.608 88.213  1.00 0.00   ? 191  PRO D N     1 
ATOM   8773  C  CA    . PRO D 1 191  ? 108.019 112.705 87.345  1.00 0.00   ? 191  PRO D CA    1 
ATOM   8774  C  C     . PRO D 1 191  ? 107.330 113.998 87.759  1.00 0.00   ? 191  PRO D C     1 
ATOM   8775  O  O     . PRO D 1 191  ? 106.163 113.990 88.152  1.00 0.00   ? 191  PRO D O     1 
ATOM   8776  C  CB    . PRO D 1 191  ? 107.569 112.234 85.973  1.00 0.00   ? 191  PRO D CB    1 
ATOM   8777  C  CG    . PRO D 1 191  ? 106.251 111.615 86.299  1.00 0.00   ? 191  PRO D CG    1 
ATOM   8778  C  CD    . PRO D 1 191  ? 106.567 110.797 87.549  1.00 0.00   ? 191  PRO D CD    1 
ATOM   8779  N  N     . ARG D 1 192  ? 108.065 115.101 87.690  1.00 0.00   ? 192  ARG D N     1 
ATOM   8780  C  CA    . ARG D 1 192  ? 107.527 116.402 88.038  1.00 0.00   ? 192  ARG D CA    1 
ATOM   8781  C  C     . ARG D 1 192  ? 108.014 117.345 86.954  1.00 0.00   ? 192  ARG D C     1 
ATOM   8782  O  O     . ARG D 1 192  ? 109.211 117.420 86.684  1.00 0.00   ? 192  ARG D O     1 
ATOM   8783  C  CB    . ARG D 1 192  ? 108.042 116.859 89.401  1.00 0.00   ? 192  ARG D CB    1 
ATOM   8784  C  CG    . ARG D 1 192  ? 107.509 118.218 89.819  1.00 0.00   ? 192  ARG D CG    1 
ATOM   8785  C  CD    . ARG D 1 192  ? 108.163 118.742 91.086  1.00 0.00   ? 192  ARG D CD    1 
ATOM   8786  N  NE    . ARG D 1 192  ? 107.511 118.288 92.311  1.00 0.00   ? 192  ARG D NE    1 
ATOM   8787  C  CZ    . ARG D 1 192  ? 107.700 118.849 93.502  1.00 0.00   ? 192  ARG D CZ    1 
ATOM   8788  N  NH1   . ARG D 1 192  ? 108.523 119.884 93.621  1.00 0.00   ? 192  ARG D NH1   1 
ATOM   8789  N  NH2   . ARG D 1 192  ? 107.067 118.386 94.571  1.00 0.00   ? 192  ARG D NH2   1 
ATOM   8790  N  N     . HIS D 1 193  ? 107.087 118.062 86.331  1.00 0.00   ? 193  HIS D N     1 
ATOM   8791  C  CA    . HIS D 1 193  ? 107.432 118.975 85.245  1.00 0.00   ? 193  HIS D CA    1 
ATOM   8792  C  C     . HIS D 1 193  ? 108.071 118.171 84.121  1.00 0.00   ? 193  HIS D C     1 
ATOM   8793  O  O     . HIS D 1 193  ? 108.952 118.659 83.414  1.00 0.00   ? 193  HIS D O     1 
ATOM   8794  C  CB    . HIS D 1 193  ? 108.393 120.054 85.740  1.00 0.00   ? 193  HIS D CB    1 
ATOM   8795  C  CG    . HIS D 1 193  ? 107.809 120.935 86.803  1.00 0.00   ? 193  HIS D CG    1 
ATOM   8796  N  ND1   . HIS D 1 193  ? 106.639 121.644 86.622  1.00 0.00   ? 193  HIS D ND1   1 
ATOM   8797  C  CD2   . HIS D 1 193  ? 108.221 121.215 88.063  1.00 0.00   ? 193  HIS D CD2   1 
ATOM   8798  C  CE1   . HIS D 1 193  ? 106.355 122.315 87.720  1.00 0.00   ? 193  HIS D CE1   1 
ATOM   8799  N  NE2   . HIS D 1 193  ? 107.299 122.071 88.615  1.00 0.00   ? 193  HIS D NE2   1 
ATOM   8800  N  N     . GLY D 1 194  ? 107.620 116.930 83.969  1.00 0.00   ? 194  GLY D N     1 
ATOM   8801  C  CA    . GLY D 1 194  ? 108.139 116.071 82.922  1.00 0.00   ? 194  GLY D CA    1 
ATOM   8802  C  C     . GLY D 1 194  ? 109.447 115.369 83.233  1.00 0.00   ? 194  GLY D C     1 
ATOM   8803  O  O     . GLY D 1 194  ? 109.865 114.490 82.484  1.00 0.00   ? 194  GLY D O     1 
ATOM   8804  N  N     . ARG D 1 195  ? 110.097 115.751 84.328  1.00 0.00   ? 195  ARG D N     1 
ATOM   8805  C  CA    . ARG D 1 195  ? 111.368 115.143 84.715  1.00 0.00   ? 195  ARG D CA    1 
ATOM   8806  C  C     . ARG D 1 195  ? 111.231 114.156 85.869  1.00 0.00   ? 195  ARG D C     1 
ATOM   8807  O  O     . ARG D 1 195  ? 110.628 114.464 86.899  1.00 0.00   ? 195  ARG D O     1 
ATOM   8808  C  CB    . ARG D 1 195  ? 112.386 116.225 85.100  1.00 0.00   ? 195  ARG D CB    1 
ATOM   8809  C  CG    . ARG D 1 195  ? 112.788 117.141 83.953  1.00 0.00   ? 195  ARG D CG    1 
ATOM   8810  C  CD    . ARG D 1 195  ? 113.374 116.342 82.796  1.00 0.00   ? 195  ARG D CD    1 
ATOM   8811  N  NE    . ARG D 1 195  ? 114.621 115.675 83.159  1.00 0.00   ? 195  ARG D NE    1 
ATOM   8812  C  CZ    . ARG D 1 195  ? 115.784 116.301 83.312  1.00 0.00   ? 195  ARG D CZ    1 
ATOM   8813  N  NH1   . ARG D 1 195  ? 115.871 117.614 83.134  1.00 0.00   ? 195  ARG D NH1   1 
ATOM   8814  N  NH2   . ARG D 1 195  ? 116.868 115.610 83.644  1.00 0.00   ? 195  ARG D NH2   1 
ATOM   8815  N  N     . LEU D 1 196  ? 111.799 112.968 85.691  1.00 0.00   ? 196  LEU D N     1 
ATOM   8816  C  CA    . LEU D 1 196  ? 111.751 111.940 86.719  1.00 0.00   ? 196  LEU D CA    1 
ATOM   8817  C  C     . LEU D 1 196  ? 112.543 112.426 87.929  1.00 0.00   ? 196  LEU D C     1 
ATOM   8818  O  O     . LEU D 1 196  ? 113.698 112.830 87.795  1.00 0.00   ? 196  LEU D O     1 
ATOM   8819  C  CB    . LEU D 1 196  ? 112.359 110.642 86.190  1.00 0.00   ? 196  LEU D CB    1 
ATOM   8820  C  CG    . LEU D 1 196  ? 112.142 109.404 87.062  1.00 0.00   ? 196  LEU D CG    1 
ATOM   8821  C  CD1   . LEU D 1 196  ? 110.655 109.083 87.125  1.00 0.00   ? 196  LEU D CD1   1 
ATOM   8822  C  CD2   . LEU D 1 196  ? 112.917 108.231 86.487  1.00 0.00   ? 196  LEU D CD2   1 
ATOM   8823  N  N     . CYS D 1 197  ? 111.927 112.393 89.105  1.00 0.00   ? 197  CYS D N     1 
ATOM   8824  C  CA    . CYS D 1 197  ? 112.595 112.856 90.318  1.00 0.00   ? 197  CYS D CA    1 
ATOM   8825  C  C     . CYS D 1 197  ? 112.414 111.954 91.534  1.00 0.00   ? 197  CYS D C     1 
ATOM   8826  O  O     . CYS D 1 197  ? 111.534 111.093 91.572  1.00 0.00   ? 197  CYS D O     1 
ATOM   8827  C  CB    . CYS D 1 197  ? 112.126 114.271 90.665  1.00 0.00   ? 197  CYS D CB    1 
ATOM   8828  S  SG    . CYS D 1 197  ? 110.347 114.429 90.971  1.00 0.00   ? 197  CYS D SG    1 
ATOM   8829  N  N     . PHE D 1 198  ? 113.275 112.170 92.529  1.00 0.00   ? 198  PHE D N     1 
ATOM   8830  C  CA    . PHE D 1 198  ? 113.268 111.427 93.787  1.00 0.00   ? 198  PHE D CA    1 
ATOM   8831  C  C     . PHE D 1 198  ? 112.636 112.334 94.848  1.00 0.00   ? 198  PHE D C     1 
ATOM   8832  O  O     . PHE D 1 198  ? 113.126 113.437 95.080  1.00 0.00   ? 198  PHE D O     1 
ATOM   8833  C  CB    . PHE D 1 198  ? 114.712 111.087 94.179  1.00 0.00   ? 198  PHE D CB    1 
ATOM   8834  C  CG    . PHE D 1 198  ? 114.837 110.310 95.466  1.00 0.00   ? 198  PHE D CG    1 
ATOM   8835  C  CD1   . PHE D 1 198  ? 114.711 108.924 95.479  1.00 0.00   ? 198  PHE D CD1   1 
ATOM   8836  C  CD2   . PHE D 1 198  ? 115.102 110.965 96.663  1.00 0.00   ? 198  PHE D CD2   1 
ATOM   8837  C  CE1   . PHE D 1 198  ? 114.850 108.203 96.666  1.00 0.00   ? 198  PHE D CE1   1 
ATOM   8838  C  CE2   . PHE D 1 198  ? 115.239 110.255 97.857  1.00 0.00   ? 198  PHE D CE2   1 
ATOM   8839  C  CZ    . PHE D 1 198  ? 115.114 108.869 97.860  1.00 0.00   ? 198  PHE D CZ    1 
ATOM   8840  N  N     . MET D 1 199  ? 111.557 111.879 95.485  1.00 0.00   ? 199  MET D N     1 
ATOM   8841  C  CA    . MET D 1 199  ? 110.900 112.690 96.509  1.00 0.00   ? 199  MET D CA    1 
ATOM   8842  C  C     . MET D 1 199  ? 110.933 112.089 97.917  1.00 0.00   ? 199  MET D C     1 
ATOM   8843  O  O     . MET D 1 199  ? 110.920 110.870 98.093  1.00 0.00   ? 199  MET D O     1 
ATOM   8844  C  CB    . MET D 1 199  ? 109.449 112.981 96.108  1.00 0.00   ? 199  MET D CB    1 
ATOM   8845  C  CG    . MET D 1 199  ? 109.310 113.921 94.913  1.00 0.00   ? 199  MET D CG    1 
ATOM   8846  S  SD    . MET D 1 199  ? 107.602 114.413 94.580  1.00 0.00   ? 199  MET D SD    1 
ATOM   8847  C  CE    . MET D 1 199  ? 107.820 115.455 93.126  1.00 0.00   ? 199  MET D CE    1 
ATOM   8848  N  N     . LEU D 1 200  ? 110.990 112.973 98.910  1.00 0.00   ? 200  LEU D N     1 
ATOM   8849  C  CA    . LEU D 1 200  ? 111.041 112.605 100.324 1.00 0.00   ? 200  LEU D CA    1 
ATOM   8850  C  C     . LEU D 1 200  ? 110.403 113.706 101.176 1.00 0.00   ? 200  LEU D C     1 
ATOM   8851  O  O     . LEU D 1 200  ? 110.638 114.888 100.942 1.00 0.00   ? 200  LEU D O     1 
ATOM   8852  C  CB    . LEU D 1 200  ? 112.499 112.401 100.750 1.00 0.00   ? 200  LEU D CB    1 
ATOM   8853  C  CG    . LEU D 1 200  ? 112.878 112.322 102.233 1.00 0.00   ? 200  LEU D CG    1 
ATOM   8854  C  CD1   . LEU D 1 200  ? 114.288 111.780 102.349 1.00 0.00   ? 200  LEU D CD1   1 
ATOM   8855  C  CD2   . LEU D 1 200  ? 112.794 113.694 102.883 1.00 0.00   ? 200  LEU D CD2   1 
ATOM   8856  N  N     . ARG D 1 201  ? 109.604 113.314 102.162 1.00 0.00   ? 201  ARG D N     1 
ATOM   8857  C  CA    . ARG D 1 201  ? 108.953 114.279 103.041 1.00 0.00   ? 201  ARG D CA    1 
ATOM   8858  C  C     . ARG D 1 201  ? 109.716 114.406 104.356 1.00 0.00   ? 201  ARG D C     1 
ATOM   8859  O  O     . ARG D 1 201  ? 110.188 113.415 104.913 1.00 0.00   ? 201  ARG D O     1 
ATOM   8860  C  CB    . ARG D 1 201  ? 107.502 113.852 103.314 1.00 0.00   ? 201  ARG D CB    1 
ATOM   8861  C  CG    . ARG D 1 201  ? 106.729 114.822 104.212 1.00 0.00   ? 201  ARG D CG    1 
ATOM   8862  C  CD    . ARG D 1 201  ? 105.359 114.283 104.625 1.00 0.00   ? 201  ARG D CD    1 
ATOM   8863  N  NE    . ARG D 1 201  ? 104.454 114.084 103.496 1.00 0.00   ? 201  ARG D NE    1 
ATOM   8864  C  CZ    . ARG D 1 201  ? 104.061 115.053 102.674 1.00 0.00   ? 201  ARG D CZ    1 
ATOM   8865  N  NH1   . ARG D 1 201  ? 104.496 116.293 102.852 1.00 0.00   ? 201  ARG D NH1   1 
ATOM   8866  N  NH2   . ARG D 1 201  ? 103.224 114.781 101.682 1.00 0.00   ? 201  ARG D NH2   1 
ATOM   8867  N  N     . VAL D 1 202  ? 109.848 115.637 104.841 1.00 0.00   ? 202  VAL D N     1 
ATOM   8868  C  CA    . VAL D 1 202  ? 110.549 115.906 106.095 1.00 0.00   ? 202  VAL D CA    1 
ATOM   8869  C  C     . VAL D 1 202  ? 109.786 116.947 106.910 1.00 0.00   ? 202  VAL D C     1 
ATOM   8870  O  O     . VAL D 1 202  ? 109.176 117.853 106.348 1.00 0.00   ? 202  VAL D O     1 
ATOM   8871  C  CB    . VAL D 1 202  ? 111.982 116.422 105.838 1.00 0.00   ? 202  VAL D CB    1 
ATOM   8872  C  CG1   . VAL D 1 202  ? 111.935 117.671 104.985 1.00 0.00   ? 202  VAL D CG1   1 
ATOM   8873  C  CG2   . VAL D 1 202  ? 112.675 116.710 107.161 1.00 0.00   ? 202  VAL D CG2   1 
ATOM   8874  N  N     . GLY D 1 203  ? 109.820 116.810 108.231 1.00 0.00   ? 203  GLY D N     1 
ATOM   8875  C  CA    . GLY D 1 203  ? 109.113 117.750 109.077 1.00 0.00   ? 203  GLY D CA    1 
ATOM   8876  C  C     . GLY D 1 203  ? 109.766 118.015 110.419 1.00 0.00   ? 203  GLY D C     1 
ATOM   8877  O  O     . GLY D 1 203  ? 110.828 117.468 110.724 1.00 0.00   ? 203  GLY D O     1 
ATOM   8878  N  N     . ASP D 1 204  ? 109.127 118.864 111.215 1.00 0.00   ? 204  ASP D N     1 
ATOM   8879  C  CA    . ASP D 1 204  ? 109.613 119.217 112.547 1.00 0.00   ? 204  ASP D CA    1 
ATOM   8880  C  C     . ASP D 1 204  ? 108.400 119.303 113.470 1.00 0.00   ? 204  ASP D C     1 
ATOM   8881  O  O     . ASP D 1 204  ? 107.463 120.056 113.201 1.00 0.00   ? 204  ASP D O     1 
ATOM   8882  C  CB    . ASP D 1 204  ? 110.324 120.572 112.511 1.00 0.00   ? 204  ASP D CB    1 
ATOM   8883  C  CG    . ASP D 1 204  ? 111.108 120.845 113.774 1.00 0.00   ? 204  ASP D CG    1 
ATOM   8884  O  OD1   . ASP D 1 204  ? 110.607 120.515 114.869 1.00 0.00   ? 204  ASP D OD1   1 
ATOM   8885  O  OD2   . ASP D 1 204  ? 112.229 121.395 113.679 1.00 0.00   ? 204  ASP D OD2   1 
ATOM   8886  N  N     . LEU D 1 205  ? 108.416 118.547 114.563 1.00 0.00   ? 205  LEU D N     1 
ATOM   8887  C  CA    . LEU D 1 205  ? 107.295 118.533 115.502 1.00 0.00   ? 205  LEU D CA    1 
ATOM   8888  C  C     . LEU D 1 205  ? 107.238 119.662 116.530 1.00 0.00   ? 205  LEU D C     1 
ATOM   8889  O  O     . LEU D 1 205  ? 106.190 119.900 117.136 1.00 0.00   ? 205  LEU D O     1 
ATOM   8890  C  CB    . LEU D 1 205  ? 107.255 117.190 116.236 1.00 0.00   ? 205  LEU D CB    1 
ATOM   8891  C  CG    . LEU D 1 205  ? 106.915 115.957 115.402 1.00 0.00   ? 205  LEU D CG    1 
ATOM   8892  C  CD1   . LEU D 1 205  ? 107.019 114.714 116.268 1.00 0.00   ? 205  LEU D CD1   1 
ATOM   8893  C  CD2   . LEU D 1 205  ? 105.517 116.096 114.822 1.00 0.00   ? 205  LEU D CD2   1 
ATOM   8894  N  N     . ARG D 1 206  ? 108.351 120.360 116.736 1.00 0.00   ? 206  ARG D N     1 
ATOM   8895  C  CA    . ARG D 1 206  ? 108.385 121.444 117.717 1.00 0.00   ? 206  ARG D CA    1 
ATOM   8896  C  C     . ARG D 1 206  ? 108.065 122.828 117.145 1.00 0.00   ? 206  ARG D C     1 
ATOM   8897  O  O     . ARG D 1 206  ? 108.338 123.113 115.976 1.00 0.00   ? 206  ARG D O     1 
ATOM   8898  C  CB    . ARG D 1 206  ? 109.759 121.485 118.402 1.00 0.00   ? 206  ARG D CB    1 
ATOM   8899  C  CG    . ARG D 1 206  ? 110.057 120.308 119.330 1.00 0.00   ? 206  ARG D CG    1 
ATOM   8900  C  CD    . ARG D 1 206  ? 109.159 120.311 120.563 1.00 0.00   ? 206  ARG D CD    1 
ATOM   8901  N  NE    . ARG D 1 206  ? 107.861 119.700 120.302 1.00 0.00   ? 206  ARG D NE    1 
ATOM   8902  C  CZ    . ARG D 1 206  ? 107.645 118.388 120.262 1.00 0.00   ? 206  ARG D CZ    1 
ATOM   8903  N  NH1   . ARG D 1 206  ? 108.644 117.539 120.475 1.00 0.00   ? 206  ARG D NH1   1 
ATOM   8904  N  NH2   . ARG D 1 206  ? 106.432 117.919 120.003 1.00 0.00   ? 206  ARG D NH2   1 
ATOM   8905  N  N     . LYS D 1 207  ? 107.484 123.684 117.985 1.00 0.00   ? 207  LYS D N     1 
ATOM   8906  C  CA    . LYS D 1 207  ? 107.129 125.048 117.604 1.00 0.00   ? 207  LYS D CA    1 
ATOM   8907  C  C     . LYS D 1 207  ? 108.404 125.830 117.301 1.00 0.00   ? 207  LYS D C     1 
ATOM   8908  O  O     . LYS D 1 207  ? 108.441 126.640 116.375 1.00 0.00   ? 207  LYS D O     1 
ATOM   8909  C  CB    . LYS D 1 207  ? 106.358 125.732 118.741 1.00 0.00   ? 207  LYS D CB    1 
ATOM   8910  C  CG    . LYS D 1 207  ? 105.969 127.190 118.481 1.00 0.00   ? 207  LYS D CG    1 
ATOM   8911  C  CD    . LYS D 1 207  ? 105.224 127.783 119.679 1.00 0.00   ? 207  LYS D CD    1 
ATOM   8912  C  CE    . LYS D 1 207  ? 104.800 129.231 119.447 1.00 0.00   ? 207  LYS D CE    1 
ATOM   8913  N  NZ    . LYS D 1 207  ? 104.049 129.774 120.621 1.00 0.00   ? 207  LYS D NZ    1 
ATOM   8914  N  N     . SER D 1 208  ? 109.445 125.581 118.091 1.00 0.00   ? 208  SER D N     1 
ATOM   8915  C  CA    . SER D 1 208  ? 110.731 126.251 117.911 1.00 0.00   ? 208  SER D CA    1 
ATOM   8916  C  C     . SER D 1 208  ? 111.354 125.857 116.572 1.00 0.00   ? 208  SER D C     1 
ATOM   8917  O  O     . SER D 1 208  ? 111.171 124.737 116.096 1.00 0.00   ? 208  SER D O     1 
ATOM   8918  C  CB    . SER D 1 208  ? 111.686 125.887 119.053 1.00 0.00   ? 208  SER D CB    1 
ATOM   8919  O  OG    . SER D 1 208  ? 111.995 124.498 119.048 1.00 0.00   ? 208  SER D OG    1 
ATOM   8920  N  N     . MET D 1 209  ? 112.092 126.785 115.971 1.00 0.00   ? 209  MET D N     1 
ATOM   8921  C  CA    . MET D 1 209  ? 112.724 126.554 114.678 1.00 0.00   ? 209  MET D CA    1 
ATOM   8922  C  C     . MET D 1 209  ? 114.175 126.090 114.752 1.00 0.00   ? 209  MET D C     1 
ATOM   8923  O  O     . MET D 1 209  ? 114.814 126.153 115.805 1.00 0.00   ? 209  MET D O     1 
ATOM   8924  C  CB    . MET D 1 209  ? 112.675 127.833 113.836 1.00 0.00   ? 209  MET D CB    1 
ATOM   8925  C  CG    . MET D 1 209  ? 111.280 128.334 113.518 1.00 0.00   ? 209  MET D CG    1 
ATOM   8926  S  SD    . MET D 1 209  ? 110.373 127.202 112.457 1.00 0.00   ? 209  MET D SD    1 
ATOM   8927  C  CE    . MET D 1 209  ? 111.262 127.421 110.902 1.00 0.00   ? 209  MET D CE    1 
ATOM   8928  N  N     . ILE D 1 210  ? 114.666 125.623 113.608 1.00 0.00   ? 210  ILE D N     1 
ATOM   8929  C  CA    . ILE D 1 210  ? 116.043 125.171 113.447 1.00 0.00   ? 210  ILE D CA    1 
ATOM   8930  C  C     . ILE D 1 210  ? 116.611 126.133 112.407 1.00 0.00   ? 210  ILE D C     1 
ATOM   8931  O  O     . ILE D 1 210  ? 116.231 126.088 111.237 1.00 0.00   ? 210  ILE D O     1 
ATOM   8932  C  CB    . ILE D 1 210  ? 116.115 123.742 112.887 1.00 0.00   ? 210  ILE D CB    1 
ATOM   8933  C  CG1   . ILE D 1 210  ? 115.550 122.735 113.905 1.00 0.00   ? 210  ILE D CG1   1 
ATOM   8934  C  CG2   . ILE D 1 210  ? 117.554 123.401 112.542 1.00 0.00   ? 210  ILE D CG2   1 
ATOM   8935  C  CD1   . ILE D 1 210  ? 115.656 121.283 113.467 1.00 0.00   ? 210  ILE D CD1   1 
ATOM   8936  N  N     . ILE D 1 211  ? 117.509 127.013 112.838 1.00 0.00   ? 211  ILE D N     1 
ATOM   8937  C  CA    . ILE D 1 211  ? 118.091 128.010 111.941 1.00 0.00   ? 211  ILE D CA    1 
ATOM   8938  C  C     . ILE D 1 211  ? 119.168 127.474 111.008 1.00 0.00   ? 211  ILE D C     1 
ATOM   8939  O  O     . ILE D 1 211  ? 119.951 126.598 111.377 1.00 0.00   ? 211  ILE D O     1 
ATOM   8940  C  CB    . ILE D 1 211  ? 118.677 129.195 112.738 1.00 0.00   ? 211  ILE D CB    1 
ATOM   8941  C  CG1   . ILE D 1 211  ? 117.608 129.753 113.684 1.00 0.00   ? 211  ILE D CG1   1 
ATOM   8942  C  CG2   . ILE D 1 211  ? 119.159 130.271 111.776 1.00 0.00   ? 211  ILE D CG2   1 
ATOM   8943  C  CD1   . ILE D 1 211  ? 118.114 130.818 114.653 1.00 0.00   ? 211  ILE D CD1   1 
ATOM   8944  N  N     . SER D 1 212  ? 119.200 128.028 109.801 1.00 0.00   ? 212  SER D N     1 
ATOM   8945  C  CA    . SER D 1 212  ? 120.162 127.628 108.784 1.00 0.00   ? 212  SER D CA    1 
ATOM   8946  C  C     . SER D 1 212  ? 120.024 126.133 108.526 1.00 0.00   ? 212  SER D C     1 
ATOM   8947  O  O     . SER D 1 212  ? 121.017 125.433 108.322 1.00 0.00   ? 212  SER D O     1 
ATOM   8948  C  CB    . SER D 1 212  ? 121.589 127.950 109.235 1.00 0.00   ? 212  SER D CB    1 
ATOM   8949  O  OG    . SER D 1 212  ? 121.761 129.343 109.435 1.00 0.00   ? 212  SER D OG    1 
ATOM   8950  N  N     . ALA D 1 213  ? 118.788 125.653 108.535 1.00 0.00   ? 213  ALA D N     1 
ATOM   8951  C  CA    . ALA D 1 213  ? 118.520 124.242 108.290 1.00 0.00   ? 213  ALA D CA    1 
ATOM   8952  C  C     . ALA D 1 213  ? 119.058 123.891 106.909 1.00 0.00   ? 213  ALA D C     1 
ATOM   8953  O  O     . ALA D 1 213  ? 118.619 124.446 105.903 1.00 0.00   ? 213  ALA D O     1 
ATOM   8954  C  CB    . ALA D 1 213  ? 117.023 123.967 108.351 1.00 0.00   ? 213  ALA D CB    1 
ATOM   8955  N  N     . THR D 1 214  ? 120.026 122.983 106.872 1.00 0.00   ? 214  THR D N     1 
ATOM   8956  C  CA    . THR D 1 214  ? 120.629 122.573 105.619 1.00 0.00   ? 214  THR D CA    1 
ATOM   8957  C  C     . THR D 1 214  ? 120.451 121.088 105.381 1.00 0.00   ? 214  THR D C     1 
ATOM   8958  O  O     . THR D 1 214  ? 120.613 120.277 106.293 1.00 0.00   ? 214  THR D O     1 
ATOM   8959  C  CB    . THR D 1 214  ? 122.135 122.900 105.597 1.00 0.00   ? 214  THR D CB    1 
ATOM   8960  O  OG1   . THR D 1 214  ? 122.325 124.293 105.866 1.00 0.00   ? 214  THR D OG1   1 
ATOM   8961  C  CG2   . THR D 1 214  ? 122.732 122.574 104.234 1.00 0.00   ? 214  THR D CG2   1 
ATOM   8962  N  N     . ILE D 1 215  ? 120.116 120.734 104.144 1.00 0.00   ? 215  ILE D N     1 
ATOM   8963  C  CA    . ILE D 1 215  ? 119.913 119.342 103.786 1.00 0.00   ? 215  ILE D CA    1 
ATOM   8964  C  C     . ILE D 1 215  ? 120.955 118.844 102.801 1.00 0.00   ? 215  ILE D C     1 
ATOM   8965  O  O     . ILE D 1 215  ? 121.218 119.473 101.775 1.00 0.00   ? 215  ILE D O     1 
ATOM   8966  C  CB    . ILE D 1 215  ? 118.519 119.121 103.167 1.00 0.00   ? 215  ILE D CB    1 
ATOM   8967  C  CG1   . ILE D 1 215  ? 117.428 119.401 104.214 1.00 0.00   ? 215  ILE D CG1   1 
ATOM   8968  C  CG2   . ILE D 1 215  ? 118.407 117.696 102.637 1.00 0.00   ? 215  ILE D CG2   1 
ATOM   8969  C  CD1   . ILE D 1 215  ? 116.018 119.112 103.734 1.00 0.00   ? 215  ILE D CD1   1 
ATOM   8970  N  N     . HIS D 1 216  ? 121.543 117.702 103.131 1.00 0.00   ? 216  HIS D N     1 
ATOM   8971  C  CA    . HIS D 1 216  ? 122.546 117.062 102.289 1.00 0.00   ? 216  HIS D CA    1 
ATOM   8972  C  C     . HIS D 1 216  ? 122.030 115.663 101.981 1.00 0.00   ? 216  HIS D C     1 
ATOM   8973  O  O     . HIS D 1 216  ? 121.408 115.021 102.834 1.00 0.00   ? 216  HIS D O     1 
ATOM   8974  C  CB    . HIS D 1 216  ? 123.880 116.969 103.022 1.00 0.00   ? 216  HIS D CB    1 
ATOM   8975  C  CG    . HIS D 1 216  ? 124.525 118.295 103.286 1.00 0.00   ? 216  HIS D CG    1 
ATOM   8976  N  ND1   . HIS D 1 216  ? 124.954 119.131 102.275 1.00 0.00   ? 216  HIS D ND1   1 
ATOM   8977  C  CD2   . HIS D 1 216  ? 124.831 118.928 104.446 1.00 0.00   ? 216  HIS D CD2   1 
ATOM   8978  C  CE1   . HIS D 1 216  ? 125.496 120.215 102.799 1.00 0.00   ? 216  HIS D CE1   1 
ATOM   8979  N  NE2   . HIS D 1 216  ? 125.436 120.118 104.114 1.00 0.00   ? 216  HIS D NE2   1 
ATOM   8980  N  N     . MET D 1 217  ? 122.269 115.191 100.766 1.00 0.00   ? 217  MET D N     1 
ATOM   8981  C  CA    . MET D 1 217  ? 121.806 113.869 100.373 1.00 0.00   ? 217  MET D CA    1 
ATOM   8982  C  C     . MET D 1 217  ? 122.924 113.109 99.680  1.00 0.00   ? 217  MET D C     1 
ATOM   8983  O  O     . MET D 1 217  ? 123.484 113.575 98.687  1.00 0.00   ? 217  MET D O     1 
ATOM   8984  C  CB    . MET D 1 217  ? 120.594 113.991 99.443  1.00 0.00   ? 217  MET D CB    1 
ATOM   8985  C  CG    . MET D 1 217  ? 119.870 112.685 99.186  1.00 0.00   ? 217  MET D CG    1 
ATOM   8986  S  SD    . MET D 1 217  ? 118.362 112.900 98.212  1.00 0.00   ? 217  MET D SD    1 
ATOM   8987  C  CE    . MET D 1 217  ? 117.228 113.530 99.458  1.00 0.00   ? 217  MET D CE    1 
ATOM   8988  N  N     . GLN D 1 218  ? 123.255 111.935 100.213 1.00 0.00   ? 218  GLN D N     1 
ATOM   8989  C  CA    . GLN D 1 218  ? 124.314 111.120 99.634  1.00 0.00   ? 218  GLN D CA    1 
ATOM   8990  C  C     . GLN D 1 218  ? 123.830 109.725 99.273  1.00 0.00   ? 218  GLN D C     1 
ATOM   8991  O  O     . GLN D 1 218  ? 122.950 109.166 99.935  1.00 0.00   ? 218  GLN D O     1 
ATOM   8992  C  CB    . GLN D 1 218  ? 125.492 111.006 100.604 1.00 0.00   ? 218  GLN D CB    1 
ATOM   8993  C  CG    . GLN D 1 218  ? 126.107 112.339 101.004 1.00 0.00   ? 218  GLN D CG    1 
ATOM   8994  C  CD    . GLN D 1 218  ? 127.325 112.183 101.900 1.00 0.00   ? 218  GLN D CD    1 
ATOM   8995  O  OE1   . GLN D 1 218  ? 127.905 113.170 102.355 1.00 0.00   ? 218  GLN D OE1   1 
ATOM   8996  N  NE2   . GLN D 1 218  ? 127.717 110.939 102.157 1.00 0.00   ? 218  GLN D NE2   1 
ATOM   8997  N  N     . VAL D 1 219  ? 124.402 109.174 98.212  1.00 0.00   ? 219  VAL D N     1 
ATOM   8998  C  CA    . VAL D 1 219  ? 124.049 107.837 97.756  1.00 0.00   ? 219  VAL D CA    1 
ATOM   8999  C  C     . VAL D 1 219  ? 125.191 106.873 98.061  1.00 0.00   ? 219  VAL D C     1 
ATOM   9000  O  O     . VAL D 1 219  ? 126.309 107.041 97.564  1.00 0.00   ? 219  VAL D O     1 
ATOM   9001  C  CB    . VAL D 1 219  ? 123.764 107.816 96.234  1.00 0.00   ? 219  VAL D CB    1 
ATOM   9002  C  CG1   . VAL D 1 219  ? 123.425 106.400 95.787  1.00 0.00   ? 219  VAL D CG1   1 
ATOM   9003  C  CG2   . VAL D 1 219  ? 122.614 108.749 95.901  1.00 0.00   ? 219  VAL D CG2   1 
ATOM   9004  N  N     . VAL D 1 220  ? 124.912 105.879 98.895  1.00 0.00   ? 220  VAL D N     1 
ATOM   9005  C  CA    . VAL D 1 220  ? 125.913 104.880 99.241  1.00 0.00   ? 220  VAL D CA    1 
ATOM   9006  C  C     . VAL D 1 220  ? 125.763 103.743 98.246  1.00 0.00   ? 220  VAL D C     1 
ATOM   9007  O  O     . VAL D 1 220  ? 124.698 103.133 98.139  1.00 0.00   ? 220  VAL D O     1 
ATOM   9008  C  CB    . VAL D 1 220  ? 125.708 104.331 100.660 1.00 0.00   ? 220  VAL D CB    1 
ATOM   9009  C  CG1   . VAL D 1 220  ? 126.762 103.278 100.961 1.00 0.00   ? 220  VAL D CG1   1 
ATOM   9010  C  CG2   . VAL D 1 220  ? 125.790 105.458 101.671 1.00 0.00   ? 220  VAL D CG2   1 
ATOM   9011  N  N     . ARG D 1 221  ? 126.836 103.463 97.515  1.00 0.00   ? 221  ARG D N     1 
ATOM   9012  C  CA    . ARG D 1 221  ? 126.820 102.416 96.507  1.00 0.00   ? 221  ARG D CA    1 
ATOM   9013  C  C     . ARG D 1 221  ? 128.185 101.774 96.305  1.00 0.00   ? 221  ARG D C     1 
ATOM   9014  O  O     . ARG D 1 221  ? 129.172 102.476 96.082  1.00 0.00   ? 221  ARG D O     1 
ATOM   9015  C  CB    . ARG D 1 221  ? 126.360 103.009 95.173  1.00 0.00   ? 221  ARG D CB    1 
ATOM   9016  C  CG    . ARG D 1 221  ? 126.654 102.142 93.956  1.00 0.00   ? 221  ARG D CG    1 
ATOM   9017  C  CD    . ARG D 1 221  ? 126.732 102.983 92.693  1.00 0.00   ? 221  ARG D CD    1 
ATOM   9018  N  NE    . ARG D 1 221  ? 125.486 103.703 92.438  1.00 0.00   ? 221  ARG D NE    1 
ATOM   9019  C  CZ    . ARG D 1 221  ? 124.374 103.137 91.987  1.00 0.00   ? 221  ARG D CZ    1 
ATOM   9020  N  NH1   . ARG D 1 221  ? 124.340 101.834 91.734  1.00 0.00   ? 221  ARG D NH1   1 
ATOM   9021  N  NH2   . ARG D 1 221  ? 123.288 103.873 91.790  1.00 0.00   ? 221  ARG D NH2   1 
ATOM   9022  N  N     . LYS D 1 222  ? 128.255 100.447 96.395  1.00 0.00   ? 222  LYS D N     1 
ATOM   9023  C  CA    . LYS D 1 222  ? 129.527 99.785  96.149  1.00 0.00   ? 222  LYS D CA    1 
ATOM   9024  C  C     . LYS D 1 222  ? 129.732 100.003 94.659  1.00 0.00   ? 222  LYS D C     1 
ATOM   9025  O  O     . LYS D 1 222  ? 128.923 99.558  93.847  1.00 0.00   ? 222  LYS D O     1 
ATOM   9026  C  CB    . LYS D 1 222  ? 129.473 98.281  96.443  1.00 0.00   ? 222  LYS D CB    1 
ATOM   9027  C  CG    . LYS D 1 222  ? 130.787 97.573  96.084  1.00 0.00   ? 222  LYS D CG    1 
ATOM   9028  C  CD    . LYS D 1 222  ? 130.798 96.086  96.407  1.00 0.00   ? 222  LYS D CD    1 
ATOM   9029  C  CE    . LYS D 1 222  ? 132.161 95.486  96.066  1.00 0.00   ? 222  LYS D CE    1 
ATOM   9030  N  NZ    . LYS D 1 222  ? 132.286 94.047  96.442  1.00 0.00   ? 222  LYS D NZ    1 
ATOM   9031  N  N     . THR D 1 223  ? 130.761 100.762 94.316  1.00 0.00   ? 223  THR D N     1 
ATOM   9032  C  CA    . THR D 1 223  ? 131.002 101.105 92.926  1.00 0.00   ? 223  THR D CA    1 
ATOM   9033  C  C     . THR D 1 223  ? 132.372 100.733 92.406  1.00 0.00   ? 223  THR D C     1 
ATOM   9034  O  O     . THR D 1 223  ? 133.347 100.661 93.153  1.00 0.00   ? 223  THR D O     1 
ATOM   9035  C  CB    . THR D 1 223  ? 130.809 102.618 92.704  1.00 0.00   ? 223  THR D CB    1 
ATOM   9036  O  OG1   . THR D 1 223  ? 129.461 102.987 93.025  1.00 0.00   ? 223  THR D OG1   1 
ATOM   9037  C  CG2   . THR D 1 223  ? 131.084 102.978 91.256  1.00 0.00   ? 223  THR D CG2   1 
ATOM   9038  N  N     . THR D 1 224  ? 132.425 100.498 91.101  1.00 0.00   ? 224  THR D N     1 
ATOM   9039  C  CA    . THR D 1 224  ? 133.663 100.151 90.432  1.00 0.00   ? 224  THR D CA    1 
ATOM   9040  C  C     . THR D 1 224  ? 133.936 101.112 89.286  1.00 0.00   ? 224  THR D C     1 
ATOM   9041  O  O     . THR D 1 224  ? 133.054 101.386 88.475  1.00 0.00   ? 224  THR D O     1 
ATOM   9042  C  CB    . THR D 1 224  ? 133.610 98.729  89.854  1.00 0.00   ? 224  THR D CB    1 
ATOM   9043  O  OG1   . THR D 1 224  ? 132.839 98.730  88.649  1.00 0.00   ? 224  THR D OG1   1 
ATOM   9044  C  CG2   . THR D 1 224  ? 132.985 97.772  90.850  1.00 0.00   ? 224  THR D CG2   1 
ATOM   9045  N  N     . SER D 1 225  ? 135.162 101.618 89.221  1.00 0.00   ? 225  SER D N     1 
ATOM   9046  C  CA    . SER D 1 225  ? 135.570 102.513 88.137  1.00 0.00   ? 225  SER D CA    1 
ATOM   9047  C  C     . SER D 1 225  ? 136.039 101.699 86.928  1.00 0.00   ? 225  SER D C     1 
ATOM   9048  O  O     . SER D 1 225  ? 136.062 100.459 86.971  1.00 0.00   ? 225  SER D O     1 
ATOM   9049  C  CB    . SER D 1 225  ? 136.716 103.401 88.604  1.00 0.00   ? 225  SER D CB    1 
ATOM   9050  O  OG    . SER D 1 225  ? 137.856 102.615 88.905  1.00 0.00   ? 225  SER D OG    1 
ATOM   9051  N  N     . PRO D 1 226  ? 136.443 102.373 85.847  1.00 0.00   ? 226  PRO D N     1 
ATOM   9052  C  CA    . PRO D 1 226  ? 136.908 101.600 84.694  1.00 0.00   ? 226  PRO D CA    1 
ATOM   9053  C  C     . PRO D 1 226  ? 138.330 101.097 84.901  1.00 0.00   ? 226  PRO D C     1 
ATOM   9054  O  O     . PRO D 1 226  ? 138.777 100.166 84.226  1.00 0.00   ? 226  PRO D O     1 
ATOM   9055  C  CB    . PRO D 1 226  ? 136.810 102.603 83.545  1.00 0.00   ? 226  PRO D CB    1 
ATOM   9056  C  CG    . PRO D 1 226  ? 135.662 103.475 83.958  1.00 0.00   ? 226  PRO D CG    1 
ATOM   9057  C  CD    . PRO D 1 226  ? 135.951 103.696 85.426  1.00 0.00   ? 226  PRO D CD    1 
ATOM   9058  N  N     . GLU D 1 227  ? 139.073 101.762 85.782  1.00 0.00   ? 227  GLU D N     1 
ATOM   9059  C  CA    . GLU D 1 227  ? 140.435 101.344 86.083  1.00 0.00   ? 227  GLU D CA    1 
ATOM   9060  C  C     . GLU D 1 227  ? 140.482 100.076 86.936  1.00 0.00   ? 227  GLU D C     1 
ATOM   9061  O  O     . GLU D 1 227  ? 141.553 99.639  87.352  1.00 0.00   ? 227  GLU D O     1 
ATOM   9062  C  CB    . GLU D 1 227  ? 141.190 102.471 86.787  1.00 0.00   ? 227  GLU D CB    1 
ATOM   9063  C  CG    . GLU D 1 227  ? 141.405 103.713 85.941  1.00 0.00   ? 227  GLU D CG    1 
ATOM   9064  C  CD    . GLU D 1 227  ? 142.159 103.432 84.660  1.00 0.00   ? 227  GLU D CD    1 
ATOM   9065  O  OE1   . GLU D 1 227  ? 143.115 102.628 84.696  1.00 0.00   ? 227  GLU D OE1   1 
ATOM   9066  O  OE2   . GLU D 1 227  ? 141.794 104.013 83.618  1.00 0.00   ? 227  GLU D OE2   1 
ATOM   9067  N  N     . GLY D 1 228  ? 139.315 99.493  87.200  1.00 0.00   ? 228  GLY D N     1 
ATOM   9068  C  CA    . GLY D 1 228  ? 139.207 98.290  88.004  1.00 0.00   ? 228  GLY D CA    1 
ATOM   9069  C  C     . GLY D 1 228  ? 139.178 98.549  89.501  1.00 0.00   ? 228  GLY D C     1 
ATOM   9070  O  O     . GLY D 1 228  ? 139.165 97.611  90.294  1.00 0.00   ? 228  GLY D O     1 
ATOM   9071  N  N     . GLU D 1 229  ? 139.173 99.817  89.893  1.00 0.00   ? 229  GLU D N     1 
ATOM   9072  C  CA    . GLU D 1 229  ? 139.143 100.166 91.301  1.00 0.00   ? 229  GLU D CA    1 
ATOM   9073  C  C     . GLU D 1 229  ? 137.788 99.847  91.903  1.00 0.00   ? 229  GLU D C     1 
ATOM   9074  O  O     . GLU D 1 229  ? 136.758 100.110 91.294  1.00 0.00   ? 229  GLU D O     1 
ATOM   9075  C  CB    . GLU D 1 229  ? 139.485 101.637 91.502  1.00 0.00   ? 229  GLU D CB    1 
ATOM   9076  C  CG    . GLU D 1 229  ? 140.253 101.889 92.784  1.00 0.00   ? 229  GLU D CG    1 
ATOM   9077  C  CD    . GLU D 1 229  ? 141.412 100.924 92.949  1.00 0.00   ? 229  GLU D CD    1 
ATOM   9078  O  OE1   . GLU D 1 229  ? 141.759 100.239 91.966  1.00 0.00   ? 229  GLU D OE1   1 
ATOM   9079  O  OE2   . GLU D 1 229  ? 141.980 100.857 94.058  1.00 0.00   ? 229  GLU D OE2   1 
ATOM   9080  N  N     . VAL D 1 230  ? 137.797 99.299  93.112  1.00 0.00   ? 230  VAL D N     1 
ATOM   9081  C  CA    . VAL D 1 230  ? 136.563 98.931  93.790  1.00 0.00   ? 230  VAL D CA    1 
ATOM   9082  C  C     . VAL D 1 230  ? 136.403 99.669  95.108  1.00 0.00   ? 230  VAL D C     1 
ATOM   9083  O  O     . VAL D 1 230  ? 137.325 99.714  95.917  1.00 0.00   ? 230  VAL D O     1 
ATOM   9084  C  CB    . VAL D 1 230  ? 136.517 97.420  94.073  1.00 0.00   ? 230  VAL D CB    1 
ATOM   9085  C  CG1   . VAL D 1 230  ? 135.235 97.050  94.799  1.00 0.00   ? 230  VAL D CG1   1 
ATOM   9086  C  CG2   . VAL D 1 230  ? 136.644 96.635  92.781  1.00 0.00   ? 230  VAL D CG2   1 
ATOM   9087  N  N     . VAL D 1 231  ? 135.233 100.257 95.314  1.00 0.00   ? 231  VAL D N     1 
ATOM   9088  C  CA    . VAL D 1 231  ? 134.931 100.971 96.547  1.00 0.00   ? 231  VAL D CA    1 
ATOM   9089  C  C     . VAL D 1 231  ? 133.716 100.306 97.166  1.00 0.00   ? 231  VAL D C     1 
ATOM   9090  O  O     . VAL D 1 231  ? 132.704 100.124 96.501  1.00 0.00   ? 231  VAL D O     1 
ATOM   9091  C  CB    . VAL D 1 231  ? 134.626 102.449 96.288  1.00 0.00   ? 231  VAL D CB    1 
ATOM   9092  C  CG1   . VAL D 1 231  ? 133.868 103.041 97.465  1.00 0.00   ? 231  VAL D CG1   1 
ATOM   9093  C  CG2   . VAL D 1 231  ? 135.912 103.214 96.025  1.00 0.00   ? 231  VAL D CG2   1 
ATOM   9094  N  N     . PRO D 1 232  ? 133.821 99.941  98.436  1.00 0.00   ? 232  PRO D N     1 
ATOM   9095  C  CA    . PRO D 1 232  ? 132.735 99.254  99.142  1.00 0.00   ? 232  PRO D CA    1 
ATOM   9096  C  C     . PRO D 1 232  ? 131.572 100.160 99.545  1.00 0.00   ? 232  PRO D C     1 
ATOM   9097  O  O     . PRO D 1 232  ? 130.422 99.731  99.559  1.00 0.00   ? 232  PRO D O     1 
ATOM   9098  C  CB    . PRO D 1 232  ? 133.442 98.646  100.347 1.00 0.00   ? 232  PRO D CB    1 
ATOM   9099  C  CG    . PRO D 1 232  ? 134.527 99.644  100.620 1.00 0.00   ? 232  PRO D CG    1 
ATOM   9100  C  CD    . PRO D 1 232  ? 135.057 99.917  99.237  1.00 0.00   ? 232  PRO D CD    1 
ATOM   9101  N  N     . LEU D 1 233  ? 131.881 101.410 99.877  1.00 0.00   ? 233  LEU D N     1 
ATOM   9102  C  CA    . LEU D 1 233  ? 130.861 102.376 100.276 1.00 0.00   ? 233  LEU D CA    1 
ATOM   9103  C  C     . LEU D 1 233  ? 131.145 103.736 99.660  1.00 0.00   ? 233  LEU D C     1 
ATOM   9104  O  O     . LEU D 1 233  ? 131.514 104.676 100.371 1.00 0.00   ? 233  LEU D O     1 
ATOM   9105  C  CB    . LEU D 1 233  ? 130.833 102.529 101.800 1.00 0.00   ? 233  LEU D CB    1 
ATOM   9106  C  CG    . LEU D 1 233  ? 130.472 101.325 102.669 1.00 0.00   ? 233  LEU D CG    1 
ATOM   9107  C  CD1   . LEU D 1 233  ? 130.718 101.672 104.128 1.00 0.00   ? 233  LEU D CD1   1 
ATOM   9108  C  CD2   . LEU D 1 233  ? 129.019 100.940 102.446 1.00 0.00   ? 233  LEU D CD2   1 
ATOM   9109  N  N     . HIS D 1 234  ? 130.987 103.855 98.345  1.00 0.00   ? 234  HIS D N     1 
ATOM   9110  C  CA    . HIS D 1 234  ? 131.237 105.132 97.690  1.00 0.00   ? 234  HIS D CA    1 
ATOM   9111  C  C     . HIS D 1 234  ? 130.057 106.058 97.954  1.00 0.00   ? 234  HIS D C     1 
ATOM   9112  O  O     . HIS D 1 234  ? 128.898 105.668 97.800  1.00 0.00   ? 234  HIS D O     1 
ATOM   9113  C  CB    . HIS D 1 234  ? 131.438 104.944 96.182  1.00 0.00   ? 234  HIS D CB    1 
ATOM   9114  C  CG    . HIS D 1 234  ? 131.927 106.175 95.482  1.00 0.00   ? 234  HIS D CG    1 
ATOM   9115  N  ND1   . HIS D 1 234  ? 131.161 107.312 95.351  1.00 0.00   ? 234  HIS D ND1   1 
ATOM   9116  C  CD2   . HIS D 1 234  ? 133.115 106.451 94.893  1.00 0.00   ? 234  HIS D CD2   1 
ATOM   9117  C  CE1   . HIS D 1 234  ? 131.856 108.236 94.713  1.00 0.00   ? 234  HIS D CE1   1 
ATOM   9118  N  NE2   . HIS D 1 234  ? 133.046 107.740 94.425  1.00 0.00   ? 234  HIS D NE2   1 
ATOM   9119  N  N     . GLN D 1 235  ? 130.356 107.283 98.365  1.00 0.00   ? 235  GLN D N     1 
ATOM   9120  C  CA    . GLN D 1 235  ? 129.314 108.254 98.655  1.00 0.00   ? 235  GLN D CA    1 
ATOM   9121  C  C     . GLN D 1 235  ? 129.241 109.300 97.557  1.00 0.00   ? 235  GLN D C     1 
ATOM   9122  O  O     . GLN D 1 235  ? 130.236 109.961 97.242  1.00 0.00   ? 235  GLN D O     1 
ATOM   9123  C  CB    . GLN D 1 235  ? 129.574 108.922 100.009 1.00 0.00   ? 235  GLN D CB    1 
ATOM   9124  C  CG    . GLN D 1 235  ? 129.870 107.930 101.124 1.00 0.00   ? 235  GLN D CG    1 
ATOM   9125  C  CD    . GLN D 1 235  ? 129.944 108.584 102.491 1.00 0.00   ? 235  GLN D CD    1 
ATOM   9126  O  OE1   . GLN D 1 235  ? 130.190 109.784 102.602 1.00 0.00   ? 235  GLN D OE1   1 
ATOM   9127  N  NE2   . GLN D 1 235  ? 129.742 107.793 103.538 1.00 0.00   ? 235  GLN D NE2   1 
ATOM   9128  N  N     . VAL D 1 236  ? 128.056 109.440 96.967  1.00 0.00   ? 236  VAL D N     1 
ATOM   9129  C  CA    . VAL D 1 236  ? 127.830 110.396 95.896  1.00 0.00   ? 236  VAL D CA    1 
ATOM   9130  C  C     . VAL D 1 236  ? 126.971 111.560 96.375  1.00 0.00   ? 236  VAL D C     1 
ATOM   9131  O  O     . VAL D 1 236  ? 125.961 111.365 97.054  1.00 0.00   ? 236  VAL D O     1 
ATOM   9132  C  CB    . VAL D 1 236  ? 127.131 109.732 94.692  1.00 0.00   ? 236  VAL D CB    1 
ATOM   9133  C  CG1   . VAL D 1 236  ? 126.992 110.734 93.557  1.00 0.00   ? 236  VAL D CG1   1 
ATOM   9134  C  CG2   . VAL D 1 236  ? 127.924 108.517 94.230  1.00 0.00   ? 236  VAL D CG2   1 
ATOM   9135  N  N     . ASP D 1 237  ? 127.378 112.769 96.005  1.00 0.00   ? 237  ASP D N     1 
ATOM   9136  C  CA    . ASP D 1 237  ? 126.650 113.973 96.388  1.00 0.00   ? 237  ASP D CA    1 
ATOM   9137  C  C     . ASP D 1 237  ? 125.415 114.147 95.511  1.00 0.00   ? 237  ASP D C     1 
ATOM   9138  O  O     . ASP D 1 237  ? 125.488 114.019 94.288  1.00 0.00   ? 237  ASP D O     1 
ATOM   9139  C  CB    . ASP D 1 237  ? 127.558 115.199 96.258  1.00 0.00   ? 237  ASP D CB    1 
ATOM   9140  C  CG    . ASP D 1 237  ? 128.849 115.048 97.042  1.00 0.00   ? 237  ASP D CG    1 
ATOM   9141  O  OD1   . ASP D 1 237  ? 128.790 114.891 98.283  1.00 0.00   ? 237  ASP D OD1   1 
ATOM   9142  O  OD2   . ASP D 1 237  ? 129.932 115.092 96.420  1.00 0.00   ? 237  ASP D OD2   1 
ATOM   9143  N  N     . ILE D 1 238  ? 124.291 114.450 96.145  1.00 0.00   ? 238  ILE D N     1 
ATOM   9144  C  CA    . ILE D 1 238  ? 123.023 114.639 95.442  1.00 0.00   ? 238  ILE D CA    1 
ATOM   9145  C  C     . ILE D 1 238  ? 122.468 116.052 95.613  1.00 0.00   ? 238  ILE D C     1 
ATOM   9146  O  O     . ILE D 1 238  ? 122.216 116.512 96.727  1.00 0.00   ? 238  ILE D O     1 
ATOM   9147  C  CB    . ILE D 1 238  ? 121.963 113.635 95.951  1.00 0.00   ? 238  ILE D CB    1 
ATOM   9148  C  CG1   . ILE D 1 238  ? 122.457 112.195 95.766  1.00 0.00   ? 238  ILE D CG1   1 
ATOM   9149  C  CG2   . ILE D 1 238  ? 120.664 113.830 95.209  1.00 0.00   ? 238  ILE D CG2   1 
ATOM   9150  C  CD1   . ILE D 1 238  ? 122.753 111.815 94.325  1.00 0.00   ? 238  ILE D CD1   1 
ATOM   9151  N  N     . PRO D 1 239  ? 122.268 116.764 94.495  1.00 0.00   ? 239  PRO D N     1 
ATOM   9152  C  CA    . PRO D 1 239  ? 121.739 118.132 94.508  1.00 0.00   ? 239  PRO D CA    1 
ATOM   9153  C  C     . PRO D 1 239  ? 120.282 118.182 94.988  1.00 0.00   ? 239  PRO D C     1 
ATOM   9154  O  O     . PRO D 1 239  ? 119.509 117.261 94.727  1.00 0.00   ? 239  PRO D O     1 
ATOM   9155  C  CB    . PRO D 1 239  ? 121.891 118.567 93.054  1.00 0.00   ? 239  PRO D CB    1 
ATOM   9156  C  CG    . PRO D 1 239  ? 121.700 117.272 92.308  1.00 0.00   ? 239  PRO D CG    1 
ATOM   9157  C  CD    . PRO D 1 239  ? 122.528 116.315 93.117  1.00 0.00   ? 239  PRO D CD    1 
ATOM   9158  N  N     . MET D 1 240  ? 119.919 119.255 95.685  1.00 0.00   ? 240  MET D N     1 
ATOM   9159  C  CA    . MET D 1 240  ? 118.573 119.417 96.234  1.00 0.00   ? 240  MET D CA    1 
ATOM   9160  C  C     . MET D 1 240  ? 117.567 120.144 95.335  1.00 0.00   ? 240  MET D C     1 
ATOM   9161  O  O     . MET D 1 240  ? 116.453 120.459 95.762  1.00 0.00   ? 240  MET D O     1 
ATOM   9162  C  CB    . MET D 1 240  ? 118.651 120.142 97.582  1.00 0.00   ? 240  MET D CB    1 
ATOM   9163  C  CG    . MET D 1 240  ? 119.212 119.296 98.711  1.00 0.00   ? 240  MET D CG    1 
ATOM   9164  S  SD    . MET D 1 240  ? 118.152 117.894 99.095  1.00 0.00   ? 240  MET D SD    1 
ATOM   9165  C  CE    . MET D 1 240  ? 118.809 116.662 97.992  1.00 0.00   ? 240  MET D CE    1 
ATOM   9166  N  N     . GLU D 1 241  ? 117.954 120.395 94.090  1.00 0.00   ? 241  GLU D N     1 
ATOM   9167  C  CA    . GLU D 1 241  ? 117.085 121.094 93.144  1.00 0.00   ? 241  GLU D CA    1 
ATOM   9168  C  C     . GLU D 1 241  ? 116.673 122.451 93.699  1.00 0.00   ? 241  GLU D C     1 
ATOM   9169  O  O     . GLU D 1 241  ? 115.602 122.970 93.367  1.00 0.00   ? 241  GLU D O     1 
ATOM   9170  C  CB    . GLU D 1 241  ? 115.824 120.274 92.842  1.00 0.00   ? 241  GLU D CB    1 
ATOM   9171  N  N     . ASN D 1 242  ? 117.516 123.015 94.555  1.00 0.00   ? 242  ASN D N     1 
ATOM   9172  C  CA    . ASN D 1 242  ? 117.231 124.316 95.142  1.00 0.00   ? 242  ASN D CA    1 
ATOM   9173  C  C     . ASN D 1 242  ? 117.218 125.344 94.018  1.00 0.00   ? 242  ASN D C     1 
ATOM   9174  O  O     . ASN D 1 242  ? 118.075 125.317 93.134  1.00 0.00   ? 242  ASN D O     1 
ATOM   9175  C  CB    . ASN D 1 242  ? 118.300 124.651 96.174  1.00 0.00   ? 242  ASN D CB    1 
ATOM   9176  C  CG    . ASN D 1 242  ? 117.993 125.916 96.942  1.00 0.00   ? 242  ASN D CG    1 
ATOM   9177  O  OD1   . ASN D 1 242  ? 118.070 127.016 96.400  1.00 0.00   ? 242  ASN D OD1   1 
ATOM   9178  N  ND2   . ASN D 1 242  ? 117.628 125.762 98.212  1.00 0.00   ? 242  ASN D ND2   1 
ATOM   9179  N  N     . GLY D 1 243  ? 116.253 126.252 94.060  1.00 0.00   ? 243  GLY D N     1 
ATOM   9180  C  CA    . GLY D 1 243  ? 116.148 127.246 93.007  1.00 0.00   ? 243  GLY D CA    1 
ATOM   9181  C  C     . GLY D 1 243  ? 117.384 128.107 92.824  1.00 0.00   ? 243  GLY D C     1 
ATOM   9182  O  O     . GLY D 1 243  ? 117.672 128.541 91.708  1.00 0.00   ? 243  GLY D O     1 
ATOM   9183  N  N     . VAL D 1 244  ? 118.125 128.347 93.901  1.00 0.00   ? 244  VAL D N     1 
ATOM   9184  C  CA    . VAL D 1 244  ? 119.325 129.169 93.820  1.00 0.00   ? 244  VAL D CA    1 
ATOM   9185  C  C     . VAL D 1 244  ? 120.603 128.355 93.981  1.00 0.00   ? 244  VAL D C     1 
ATOM   9186  O  O     . VAL D 1 244  ? 121.687 128.910 94.141  1.00 0.00   ? 244  VAL D O     1 
ATOM   9187  C  CB    . VAL D 1 244  ? 119.316 130.286 94.887  1.00 0.00   ? 244  VAL D CB    1 
ATOM   9188  C  CG1   . VAL D 1 244  ? 118.121 131.199 94.674  1.00 0.00   ? 244  VAL D CG1   1 
ATOM   9189  C  CG2   . VAL D 1 244  ? 119.272 129.679 96.277  1.00 0.00   ? 244  VAL D CG2   1 
ATOM   9190  N  N     . GLY D 1 245  ? 120.460 127.033 93.931  1.00 0.00   ? 245  GLY D N     1 
ATOM   9191  C  CA    . GLY D 1 245  ? 121.608 126.157 94.077  1.00 0.00   ? 245  GLY D CA    1 
ATOM   9192  C  C     . GLY D 1 245  ? 122.056 126.014 95.518  1.00 0.00   ? 245  GLY D C     1 
ATOM   9193  O  O     . GLY D 1 245  ? 123.134 125.476 95.790  1.00 0.00   ? 245  GLY D O     1 
ATOM   9194  N  N     . GLY D 1 246  ? 121.229 126.491 96.447  1.00 0.00   ? 246  GLY D N     1 
ATOM   9195  C  CA    . GLY D 1 246  ? 121.560 126.408 97.860  1.00 0.00   ? 246  GLY D CA    1 
ATOM   9196  C  C     . GLY D 1 246  ? 121.078 125.128 98.520  1.00 0.00   ? 246  GLY D C     1 
ATOM   9197  O  O     . GLY D 1 246  ? 120.296 124.383 97.943  1.00 0.00   ? 246  GLY D O     1 
ATOM   9198  N  N     . ASN D 1 247  ? 121.555 124.868 99.732  1.00 0.00   ? 247  ASN D N     1 
ATOM   9199  C  CA    . ASN D 1 247  ? 121.170 123.660 100.455 1.00 0.00   ? 247  ASN D CA    1 
ATOM   9200  C  C     . ASN D 1 247  ? 120.291 123.955 101.668 1.00 0.00   ? 247  ASN D C     1 
ATOM   9201  O  O     . ASN D 1 247  ? 119.912 123.047 102.411 1.00 0.00   ? 247  ASN D O     1 
ATOM   9202  C  CB    . ASN D 1 247  ? 122.429 122.906 100.892 1.00 0.00   ? 247  ASN D CB    1 
ATOM   9203  C  CG    . ASN D 1 247  ? 123.275 122.465 99.713  1.00 0.00   ? 247  ASN D CG    1 
ATOM   9204  O  OD1   . ASN D 1 247  ? 122.897 121.562 98.965  1.00 0.00   ? 247  ASN D OD1   1 
ATOM   9205  N  ND2   . ASN D 1 247  ? 124.425 123.107 99.536  1.00 0.00   ? 247  ASN D ND2   1 
ATOM   9206  N  N     . SER D 1 248  ? 119.968 125.227 101.860 1.00 0.00   ? 248  SER D N     1 
ATOM   9207  C  CA    . SER D 1 248  ? 119.149 125.652 102.992 1.00 0.00   ? 248  SER D CA    1 
ATOM   9208  C  C     . SER D 1 248  ? 117.655 125.509 102.733 1.00 0.00   ? 248  SER D C     1 
ATOM   9209  O  O     . SER D 1 248  ? 117.210 125.518 101.584 1.00 0.00   ? 248  SER D O     1 
ATOM   9210  C  CB    . SER D 1 248  ? 119.454 127.109 103.346 1.00 0.00   ? 248  SER D CB    1 
ATOM   9211  O  OG    . SER D 1 248  ? 119.039 127.986 102.317 1.00 0.00   ? 248  SER D OG    1 
ATOM   9212  N  N     . ILE D 1 249  ? 116.881 125.368 103.810 1.00 0.00   ? 249  ILE D N     1 
ATOM   9213  C  CA    . ILE D 1 249  ? 115.431 125.236 103.700 1.00 0.00   ? 249  ILE D CA    1 
ATOM   9214  C  C     . ILE D 1 249  ? 114.697 125.761 104.941 1.00 0.00   ? 249  ILE D C     1 
ATOM   9215  O  O     . ILE D 1 249  ? 115.010 125.369 106.066 1.00 0.00   ? 249  ILE D O     1 
ATOM   9216  C  CB    . ILE D 1 249  ? 115.035 123.767 103.490 1.00 0.00   ? 249  ILE D CB    1 
ATOM   9217  C  CG1   . ILE D 1 249  ? 113.532 123.658 103.204 1.00 0.00   ? 249  ILE D CG1   1 
ATOM   9218  C  CG2   . ILE D 1 249  ? 115.389 122.946 104.721 1.00 0.00   ? 249  ILE D CG2   1 
ATOM   9219  C  CD1   . ILE D 1 249  ? 113.072 124.403 101.959 1.00 0.00   ? 249  ILE D CD1   1 
ATOM   9220  N  N     . PHE D 1 250  ? 113.722 126.644 104.743 1.00 0.00   ? 250  PHE D N     1 
ATOM   9221  C  CA    . PHE D 1 250  ? 112.931 127.192 105.847 1.00 0.00   ? 250  PHE D CA    1 
ATOM   9222  C  C     . PHE D 1 250  ? 111.789 126.214 106.112 1.00 0.00   ? 250  PHE D C     1 
ATOM   9223  O  O     . PHE D 1 250  ? 110.693 126.361 105.573 1.00 0.00   ? 250  PHE D O     1 
ATOM   9224  C  CB    . PHE D 1 250  ? 112.369 128.566 105.477 1.00 0.00   ? 250  PHE D CB    1 
ATOM   9225  C  CG    . PHE D 1 250  ? 111.533 129.202 106.558 1.00 0.00   ? 250  PHE D CG    1 
ATOM   9226  C  CD1   . PHE D 1 250  ? 112.093 129.542 107.791 1.00 0.00   ? 250  PHE D CD1   1 
ATOM   9227  C  CD2   . PHE D 1 250  ? 110.192 129.494 106.337 1.00 0.00   ? 250  PHE D CD2   1 
ATOM   9228  C  CE1   . PHE D 1 250  ? 111.327 130.161 108.777 1.00 0.00   ? 250  PHE D CE1   1 
ATOM   9229  C  CE2   . PHE D 1 250  ? 109.415 130.115 107.319 1.00 0.00   ? 250  PHE D CE2   1 
ATOM   9230  C  CZ    . PHE D 1 250  ? 109.988 130.452 108.538 1.00 0.00   ? 250  PHE D CZ    1 
ATOM   9231  N  N     . LEU D 1 251  ? 112.056 125.218 106.951 1.00 0.00   ? 251  LEU D N     1 
ATOM   9232  C  CA    . LEU D 1 251  ? 111.074 124.194 107.258 1.00 0.00   ? 251  LEU D CA    1 
ATOM   9233  C  C     . LEU D 1 251  ? 110.172 124.468 108.457 1.00 0.00   ? 251  LEU D C     1 
ATOM   9234  O  O     . LEU D 1 251  ? 110.585 124.316 109.610 1.00 0.00   ? 251  LEU D O     1 
ATOM   9235  C  CB    . LEU D 1 251  ? 111.785 122.853 107.443 1.00 0.00   ? 251  LEU D CB    1 
ATOM   9236  C  CG    . LEU D 1 251  ? 110.966 121.578 107.696 1.00 0.00   ? 251  LEU D CG    1 
ATOM   9237  C  CD1   . LEU D 1 251  ? 111.851 120.369 107.460 1.00 0.00   ? 251  LEU D CD1   1 
ATOM   9238  C  CD2   . LEU D 1 251  ? 110.422 121.564 109.113 1.00 0.00   ? 251  LEU D CD2   1 
ATOM   9239  N  N     . VAL D 1 252  ? 108.940 124.884 108.175 1.00 0.00   ? 252  VAL D N     1 
ATOM   9240  C  CA    . VAL D 1 252  ? 107.945 125.138 109.217 1.00 0.00   ? 252  VAL D CA    1 
ATOM   9241  C  C     . VAL D 1 252  ? 106.890 124.053 109.075 1.00 0.00   ? 252  VAL D C     1 
ATOM   9242  O  O     . VAL D 1 252  ? 106.507 123.402 110.042 1.00 0.00   ? 252  VAL D O     1 
ATOM   9243  C  CB    . VAL D 1 252  ? 107.260 126.498 109.043 1.00 0.00   ? 252  VAL D CB    1 
ATOM   9244  C  CG1   . VAL D 1 252  ? 106.124 126.619 110.042 1.00 0.00   ? 252  VAL D CG1   1 
ATOM   9245  C  CG2   . VAL D 1 252  ? 108.259 127.617 109.253 1.00 0.00   ? 252  VAL D CG2   1 
ATOM   9246  N  N     . ALA D 1 253  ? 106.420 123.874 107.845 1.00 0.00   ? 253  ALA D N     1 
ATOM   9247  C  CA    . ALA D 1 253  ? 105.415 122.867 107.536 1.00 0.00   ? 253  ALA D CA    1 
ATOM   9248  C  C     . ALA D 1 253  ? 106.152 121.701 106.880 1.00 0.00   ? 253  ALA D C     1 
ATOM   9249  O  O     . ALA D 1 253  ? 107.266 121.869 106.380 1.00 0.00   ? 253  ALA D O     1 
ATOM   9250  C  CB    . ALA D 1 253  ? 104.376 123.434 106.583 1.00 0.00   ? 253  ALA D CB    1 
ATOM   9251  N  N     . PRO D 1 254  ? 105.542 120.508 106.867 1.00 0.00   ? 254  PRO D N     1 
ATOM   9252  C  CA    . PRO D 1 254  ? 106.245 119.389 106.239 1.00 0.00   ? 254  PRO D CA    1 
ATOM   9253  C  C     . PRO D 1 254  ? 106.556 119.758 104.798 1.00 0.00   ? 254  PRO D C     1 
ATOM   9254  O  O     . PRO D 1 254  ? 105.712 120.309 104.094 1.00 0.00   ? 254  PRO D O     1 
ATOM   9255  C  CB    . PRO D 1 254  ? 105.240 118.252 106.336 1.00 0.00   ? 254  PRO D CB    1 
ATOM   9256  C  CG    . PRO D 1 254  ? 104.536 118.555 107.614 1.00 0.00   ? 254  PRO D CG    1 
ATOM   9257  C  CD    . PRO D 1 254  ? 104.304 120.044 107.513 1.00 0.00   ? 254  PRO D CD    1 
ATOM   9258  N  N     . LEU D 1 255  ? 107.779 119.466 104.373 1.00 0.00   ? 255  LEU D N     1 
ATOM   9259  C  CA    . LEU D 1 255  ? 108.209 119.780 103.020 1.00 0.00   ? 255  LEU D CA    1 
ATOM   9260  C  C     . LEU D 1 255  ? 108.560 118.539 102.232 1.00 0.00   ? 255  LEU D C     1 
ATOM   9261  O  O     . LEU D 1 255  ? 108.882 117.490 102.795 1.00 0.00   ? 255  LEU D O     1 
ATOM   9262  C  CB    . LEU D 1 255  ? 109.431 120.694 103.058 1.00 0.00   ? 255  LEU D CB    1 
ATOM   9263  C  CG    . LEU D 1 255  ? 109.307 121.964 103.892 1.00 0.00   ? 255  LEU D CG    1 
ATOM   9264  C  CD1   . LEU D 1 255  ? 110.673 122.579 104.085 1.00 0.00   ? 255  LEU D CD1   1 
ATOM   9265  C  CD2   . LEU D 1 255  ? 108.360 122.936 103.216 1.00 0.00   ? 255  LEU D CD2   1 
ATOM   9266  N  N     . ILE D 1 256  ? 108.501 118.684 100.917 1.00 0.00   ? 256  ILE D N     1 
ATOM   9267  C  CA    . ILE D 1 256  ? 108.835 117.607 100.000 1.00 0.00   ? 256  ILE D CA    1 
ATOM   9268  C  C     . ILE D 1 256  ? 110.207 117.897 99.408  1.00 0.00   ? 256  ILE D C     1 
ATOM   9269  O  O     . ILE D 1 256  ? 110.348 118.746 98.520  1.00 0.00   ? 256  ILE D O     1 
ATOM   9270  C  CB    . ILE D 1 256  ? 107.814 117.508 98.850  1.00 0.00   ? 256  ILE D CB    1 
ATOM   9271  C  CG1   . ILE D 1 256  ? 106.450 117.039 99.389  1.00 0.00   ? 256  ILE D CG1   1 
ATOM   9272  C  CG2   . ILE D 1 256  ? 108.325 116.567 97.770  1.00 0.00   ? 256  ILE D CG2   1 
ATOM   9273  C  CD1   . ILE D 1 256  ? 106.497 115.691 100.083 1.00 0.00   ? 256  ILE D CD1   1 
ATOM   9274  N  N     . ILE D 1 257  ? 111.222 117.206 99.910  1.00 0.00   ? 257  ILE D N     1 
ATOM   9275  C  CA    . ILE D 1 257  ? 112.581 117.386 99.407  1.00 0.00   ? 257  ILE D CA    1 
ATOM   9276  C  C     . ILE D 1 257  ? 112.722 116.436 98.222  1.00 0.00   ? 257  ILE D C     1 
ATOM   9277  O  O     . ILE D 1 257  ? 112.329 115.272 98.310  1.00 0.00   ? 257  ILE D O     1 
ATOM   9278  C  CB    . ILE D 1 257  ? 113.636 117.037 100.476 1.00 0.00   ? 257  ILE D CB    1 
ATOM   9279  C  CG1   . ILE D 1 257  ? 113.346 117.814 101.769 1.00 0.00   ? 257  ILE D CG1   1 
ATOM   9280  C  CG2   . ILE D 1 257  ? 115.017 117.386 99.973  1.00 0.00   ? 257  ILE D CG2   1 
ATOM   9281  C  CD1   . ILE D 1 257  ? 113.277 119.317 101.590 1.00 0.00   ? 257  ILE D CD1   1 
ATOM   9282  N  N     . TYR D 1 258  ? 113.276 116.927 97.117  1.00 0.00   ? 258  TYR D N     1 
ATOM   9283  C  CA    . TYR D 1 258  ? 113.418 116.096 95.930  1.00 0.00   ? 258  TYR D CA    1 
ATOM   9284  C  C     . TYR D 1 258  ? 114.708 116.317 95.143  1.00 0.00   ? 258  TYR D C     1 
ATOM   9285  O  O     . TYR D 1 258  ? 115.368 117.350 95.280  1.00 0.00   ? 258  TYR D O     1 
ATOM   9286  C  CB    . TYR D 1 258  ? 112.213 116.312 95.010  1.00 0.00   ? 258  TYR D CB    1 
ATOM   9287  C  CG    . TYR D 1 258  ? 112.157 117.670 94.342  1.00 0.00   ? 258  TYR D CG    1 
ATOM   9288  C  CD1   . TYR D 1 258  ? 112.709 117.865 93.076  1.00 0.00   ? 258  TYR D CD1   1 
ATOM   9289  C  CD2   . TYR D 1 258  ? 111.560 118.761 94.976  1.00 0.00   ? 258  TYR D CD2   1 
ATOM   9290  C  CE1   . TYR D 1 258  ? 112.662 119.111 92.457  1.00 0.00   ? 258  TYR D CE1   1 
ATOM   9291  C  CE2   . TYR D 1 258  ? 111.514 120.011 94.362  1.00 0.00   ? 258  TYR D CE2   1 
ATOM   9292  C  CZ    . TYR D 1 258  ? 112.065 120.179 93.104  1.00 0.00   ? 258  TYR D CZ    1 
ATOM   9293  O  OH    . TYR D 1 258  ? 112.015 121.408 92.490  1.00 0.00   ? 258  TYR D OH    1 
ATOM   9294  N  N     . HIS D 1 259  ? 115.058 115.326 94.326  1.00 0.00   ? 259  HIS D N     1 
ATOM   9295  C  CA    . HIS D 1 259  ? 116.246 115.370 93.478  1.00 0.00   ? 259  HIS D CA    1 
ATOM   9296  C  C     . HIS D 1 259  ? 115.841 114.995 92.053  1.00 0.00   ? 259  HIS D C     1 
ATOM   9297  O  O     . HIS D 1 259  ? 115.325 113.902 91.810  1.00 0.00   ? 259  HIS D O     1 
ATOM   9298  C  CB    . HIS D 1 259  ? 117.301 114.378 93.975  1.00 0.00   ? 259  HIS D CB    1 
ATOM   9299  C  CG    . HIS D 1 259  ? 118.314 113.988 92.942  1.00 0.00   ? 259  HIS D CG    1 
ATOM   9300  N  ND1   . HIS D 1 259  ? 119.242 114.871 92.438  1.00 0.00   ? 259  HIS D ND1   1 
ATOM   9301  C  CD2   . HIS D 1 259  ? 118.552 112.804 92.332  1.00 0.00   ? 259  HIS D CD2   1 
ATOM   9302  C  CE1   . HIS D 1 259  ? 120.010 114.247 91.562  1.00 0.00   ? 259  HIS D CE1   1 
ATOM   9303  N  NE2   . HIS D 1 259  ? 119.614 112.991 91.481  1.00 0.00   ? 259  HIS D NE2   1 
ATOM   9304  N  N     . VAL D 1 260  ? 116.064 115.907 91.113  1.00 0.00   ? 260  VAL D N     1 
ATOM   9305  C  CA    . VAL D 1 260  ? 115.728 115.642 89.722  1.00 0.00   ? 260  VAL D CA    1 
ATOM   9306  C  C     . VAL D 1 260  ? 116.855 114.820 89.113  1.00 0.00   ? 260  VAL D C     1 
ATOM   9307  O  O     . VAL D 1 260  ? 118.009 115.232 89.149  1.00 0.00   ? 260  VAL D O     1 
ATOM   9308  C  CB    . VAL D 1 260  ? 115.563 116.951 88.926  1.00 0.00   ? 260  VAL D CB    1 
ATOM   9309  C  CG1   . VAL D 1 260  ? 115.327 116.640 87.463  1.00 0.00   ? 260  VAL D CG1   1 
ATOM   9310  C  CG2   . VAL D 1 260  ? 114.396 117.762 89.483  1.00 0.00   ? 260  VAL D CG2   1 
ATOM   9311  N  N     . ILE D 1 261  ? 116.516 113.659 88.558  1.00 0.00   ? 261  ILE D N     1 
ATOM   9312  C  CA    . ILE D 1 261  ? 117.514 112.772 87.960  1.00 0.00   ? 261  ILE D CA    1 
ATOM   9313  C  C     . ILE D 1 261  ? 117.927 113.211 86.559  1.00 0.00   ? 261  ILE D C     1 
ATOM   9314  O  O     . ILE D 1 261  ? 117.096 113.291 85.652  1.00 0.00   ? 261  ILE D O     1 
ATOM   9315  C  CB    . ILE D 1 261  ? 116.986 111.323 87.875  1.00 0.00   ? 261  ILE D CB    1 
ATOM   9316  C  CG1   . ILE D 1 261  ? 116.567 110.841 89.269  1.00 0.00   ? 261  ILE D CG1   1 
ATOM   9317  C  CG2   . ILE D 1 261  ? 118.058 110.413 87.289  1.00 0.00   ? 261  ILE D CG2   1 
ATOM   9318  C  CD1   . ILE D 1 261  ? 115.916 109.465 89.288  1.00 0.00   ? 261  ILE D CD1   1 
ATOM   9319  N  N     . ASP D 1 262  ? 119.216 113.492 86.388  1.00 0.00   ? 262  ASP D N     1 
ATOM   9320  C  CA    . ASP D 1 262  ? 119.745 113.917 85.095  1.00 0.00   ? 262  ASP D CA    1 
ATOM   9321  C  C     . ASP D 1 262  ? 120.998 113.129 84.715  1.00 0.00   ? 262  ASP D C     1 
ATOM   9322  O  O     . ASP D 1 262  ? 121.330 112.131 85.349  1.00 0.00   ? 262  ASP D O     1 
ATOM   9323  C  CB    . ASP D 1 262  ? 120.055 115.418 85.100  1.00 0.00   ? 262  ASP D CB    1 
ATOM   9324  C  CG    . ASP D 1 262  ? 121.128 115.796 86.103  1.00 0.00   ? 262  ASP D CG    1 
ATOM   9325  O  OD1   . ASP D 1 262  ? 121.894 114.911 86.538  1.00 0.00   ? 262  ASP D OD1   1 
ATOM   9326  O  OD2   . ASP D 1 262  ? 121.223 116.996 86.443  1.00 0.00   ? 262  ASP D OD2   1 
ATOM   9327  N  N     . SER D 1 263  ? 121.686 113.593 83.672  1.00 0.00   ? 263  SER D N     1 
ATOM   9328  C  CA    . SER D 1 263  ? 122.898 112.937 83.189  1.00 0.00   ? 263  SER D CA    1 
ATOM   9329  C  C     . SER D 1 263  ? 124.015 112.857 84.227  1.00 0.00   ? 263  SER D C     1 
ATOM   9330  O  O     . SER D 1 263  ? 124.937 112.053 84.089  1.00 0.00   ? 263  SER D O     1 
ATOM   9331  C  CB    . SER D 1 263  ? 123.414 113.645 81.932  1.00 0.00   ? 263  SER D CB    1 
ATOM   9332  O  OG    . SER D 1 263  ? 123.713 115.009 82.181  1.00 0.00   ? 263  SER D OG    1 
ATOM   9333  N  N     . ASN D 1 264  ? 123.937 113.681 85.268  1.00 0.00   ? 264  ASN D N     1 
ATOM   9334  C  CA    . ASN D 1 264  ? 124.966 113.679 86.304  1.00 0.00   ? 264  ASN D CA    1 
ATOM   9335  C  C     . ASN D 1 264  ? 124.536 112.978 87.591  1.00 0.00   ? 264  ASN D C     1 
ATOM   9336  O  O     . ASN D 1 264  ? 125.307 112.889 88.546  1.00 0.00   ? 264  ASN D O     1 
ATOM   9337  C  CB    . ASN D 1 264  ? 125.401 115.112 86.625  1.00 0.00   ? 264  ASN D CB    1 
ATOM   9338  C  CG    . ASN D 1 264  ? 126.025 115.814 85.432  1.00 0.00   ? 264  ASN D CG    1 
ATOM   9339  O  OD1   . ASN D 1 264  ? 126.926 115.281 84.786  1.00 0.00   ? 264  ASN D OD1   1 
ATOM   9340  N  ND2   . ASN D 1 264  ? 125.555 117.023 85.146  1.00 0.00   ? 264  ASN D ND2   1 
ATOM   9341  N  N     . SER D 1 265  ? 123.305 112.480 87.614  1.00 0.00   ? 265  SER D N     1 
ATOM   9342  C  CA    . SER D 1 265  ? 122.781 111.795 88.787  1.00 0.00   ? 265  SER D CA    1 
ATOM   9343  C  C     . SER D 1 265  ? 123.076 110.303 88.712  1.00 0.00   ? 265  SER D C     1 
ATOM   9344  O  O     . SER D 1 265  ? 122.939 109.688 87.656  1.00 0.00   ? 265  SER D O     1 
ATOM   9345  C  CB    . SER D 1 265  ? 121.273 112.018 88.888  1.00 0.00   ? 265  SER D CB    1 
ATOM   9346  O  OG    . SER D 1 265  ? 120.715 111.289 89.966  1.00 0.00   ? 265  SER D OG    1 
ATOM   9347  N  N     . PRO D 1 266  ? 123.481 109.700 89.840  1.00 0.00   ? 266  PRO D N     1 
ATOM   9348  C  CA    . PRO D 1 266  ? 123.789 108.269 89.870  1.00 0.00   ? 266  PRO D CA    1 
ATOM   9349  C  C     . PRO D 1 266  ? 122.543 107.402 89.722  1.00 0.00   ? 266  PRO D C     1 
ATOM   9350  O  O     . PRO D 1 266  ? 122.638 106.185 89.587  1.00 0.00   ? 266  PRO D O     1 
ATOM   9351  C  CB    . PRO D 1 266  ? 124.458 108.098 91.228  1.00 0.00   ? 266  PRO D CB    1 
ATOM   9352  C  CG    . PRO D 1 266  ? 123.706 109.079 92.069  1.00 0.00   ? 266  PRO D CG    1 
ATOM   9353  C  CD    . PRO D 1 266  ? 123.654 110.298 91.174  1.00 0.00   ? 266  PRO D CD    1 
ATOM   9354  N  N     . LEU D 1 267  ? 121.373 108.031 89.748  1.00 0.00   ? 267  LEU D N     1 
ATOM   9355  C  CA    . LEU D 1 267  ? 120.109 107.313 89.619  1.00 0.00   ? 267  LEU D CA    1 
ATOM   9356  C  C     . LEU D 1 267  ? 119.586 107.393 88.185  1.00 0.00   ? 267  LEU D C     1 
ATOM   9357  O  O     . LEU D 1 267  ? 118.444 107.021 87.905  1.00 0.00   ? 267  LEU D O     1 
ATOM   9358  C  CB    . LEU D 1 267  ? 119.070 107.905 90.582  1.00 0.00   ? 267  LEU D CB    1 
ATOM   9359  C  CG    . LEU D 1 267  ? 119.518 108.117 92.033  1.00 0.00   ? 267  LEU D CG    1 
ATOM   9360  C  CD1   . LEU D 1 267  ? 118.387 108.766 92.813  1.00 0.00   ? 267  LEU D CD1   1 
ATOM   9361  C  CD2   . LEU D 1 267  ? 119.918 106.792 92.669  1.00 0.00   ? 267  LEU D CD2   1 
ATOM   9362  N  N     . TYR D 1 268  ? 120.434 107.868 87.278  1.00 0.00   ? 268  TYR D N     1 
ATOM   9363  C  CA    . TYR D 1 268  ? 120.067 108.011 85.871  1.00 0.00   ? 268  TYR D CA    1 
ATOM   9364  C  C     . TYR D 1 268  ? 119.750 106.665 85.224  1.00 0.00   ? 268  TYR D C     1 
ATOM   9365  O  O     . TYR D 1 268  ? 119.061 106.611 84.209  1.00 0.00   ? 268  TYR D O     1 
ATOM   9366  C  CB    . TYR D 1 268  ? 121.199 108.697 85.102  1.00 0.00   ? 268  TYR D CB    1 
ATOM   9367  C  CG    . TYR D 1 268  ? 120.782 109.333 83.789  1.00 0.00   ? 268  TYR D CG    1 
ATOM   9368  C  CD1   . TYR D 1 268  ? 119.759 110.286 83.739  1.00 0.00   ? 268  TYR D CD1   1 
ATOM   9369  C  CD2   . TYR D 1 268  ? 121.429 109.009 82.596  1.00 0.00   ? 268  TYR D CD2   1 
ATOM   9370  C  CE1   . TYR D 1 268  ? 119.401 110.897 82.540  1.00 0.00   ? 268  TYR D CE1   1 
ATOM   9371  C  CE2   . TYR D 1 268  ? 121.078 109.615 81.395  1.00 0.00   ? 268  TYR D CE2   1 
ATOM   9372  C  CZ    . TYR D 1 268  ? 120.065 110.554 81.371  1.00 0.00   ? 268  TYR D CZ    1 
ATOM   9373  O  OH    . TYR D 1 268  ? 119.728 111.142 80.178  1.00 0.00   ? 268  TYR D OH    1 
ATOM   9374  N  N     . ASP D 1 269  ? 120.269 105.582 85.800  1.00 0.00   ? 269  ASP D N     1 
ATOM   9375  C  CA    . ASP D 1 269  ? 120.035 104.237 85.265  1.00 0.00   ? 269  ASP D CA    1 
ATOM   9376  C  C     . ASP D 1 269  ? 119.202 103.319 86.160  1.00 0.00   ? 269  ASP D C     1 
ATOM   9377  O  O     . ASP D 1 269  ? 119.335 102.096 86.087  1.00 0.00   ? 269  ASP D O     1 
ATOM   9378  C  CB    . ASP D 1 269  ? 121.367 103.546 84.968  1.00 0.00   ? 269  ASP D CB    1 
ATOM   9379  C  CG    . ASP D 1 269  ? 122.173 104.263 83.907  1.00 0.00   ? 269  ASP D CG    1 
ATOM   9380  O  OD1   . ASP D 1 269  ? 121.666 104.421 82.773  1.00 0.00   ? 269  ASP D OD1   1 
ATOM   9381  O  OD2   . ASP D 1 269  ? 123.318 104.667 84.199  1.00 0.00   ? 269  ASP D OD2   1 
ATOM   9382  N  N     . LEU D 1 270  ? 118.353 103.898 87.002  1.00 0.00   ? 270  LEU D N     1 
ATOM   9383  C  CA    . LEU D 1 270  ? 117.526 103.098 87.897  1.00 0.00   ? 270  LEU D CA    1 
ATOM   9384  C  C     . LEU D 1 270  ? 116.482 102.266 87.166  1.00 0.00   ? 270  LEU D C     1 
ATOM   9385  O  O     . LEU D 1 270  ? 115.781 102.761 86.286  1.00 0.00   ? 270  LEU D O     1 
ATOM   9386  C  CB    . LEU D 1 270  ? 116.827 103.996 88.920  1.00 0.00   ? 270  LEU D CB    1 
ATOM   9387  C  CG    . LEU D 1 270  ? 117.667 104.530 90.077  1.00 0.00   ? 270  LEU D CG    1 
ATOM   9388  C  CD1   . LEU D 1 270  ? 116.788 105.420 90.932  1.00 0.00   ? 270  LEU D CD1   1 
ATOM   9389  C  CD2   . LEU D 1 270  ? 118.228 103.384 90.907  1.00 0.00   ? 270  LEU D CD2   1 
ATOM   9390  N  N     . ALA D 1 271  ? 116.396 100.994 87.540  1.00 0.00   ? 271  ALA D N     1 
ATOM   9391  C  CA    . ALA D 1 271  ? 115.429 100.089 86.948  1.00 0.00   ? 271  ALA D CA    1 
ATOM   9392  C  C     . ALA D 1 271  ? 114.179 100.185 87.819  1.00 0.00   ? 271  ALA D C     1 
ATOM   9393  O  O     . ALA D 1 271  ? 114.256 100.026 89.030  1.00 0.00   ? 271  ALA D O     1 
ATOM   9394  C  CB    . ALA D 1 271  ? 115.980 98.672  86.955  1.00 0.00   ? 271  ALA D CB    1 
ATOM   9395  N  N     . PRO D 1 272  ? 113.007 100.437 87.214  1.00 0.00   ? 272  PRO D N     1 
ATOM   9396  C  CA    . PRO D 1 272  ? 111.784 100.551 88.012  1.00 0.00   ? 272  PRO D CA    1 
ATOM   9397  C  C     . PRO D 1 272  ? 111.393 99.336  88.857  1.00 0.00   ? 272  PRO D C     1 
ATOM   9398  O  O     . PRO D 1 272  ? 110.605 99.460  89.795  1.00 0.00   ? 272  PRO D O     1 
ATOM   9399  C  CB    . PRO D 1 272  ? 110.721 100.889 86.969  1.00 0.00   ? 272  PRO D CB    1 
ATOM   9400  C  CG    . PRO D 1 272  ? 111.497 101.651 85.938  1.00 0.00   ? 272  PRO D CG    1 
ATOM   9401  C  CD    . PRO D 1 272  ? 112.757 100.829 85.814  1.00 0.00   ? 272  PRO D CD    1 
ATOM   9402  N  N     . SER D 1 273  ? 111.920 98.160  88.515  1.00 0.00   ? 273  SER D N     1 
ATOM   9403  C  CA    . SER D 1 273  ? 111.597 96.949  89.265  1.00 0.00   ? 273  SER D CA    1 
ATOM   9404  C  C     . SER D 1 273  ? 112.740 96.312  90.054  1.00 0.00   ? 273  SER D C     1 
ATOM   9405  O  O     . SER D 1 273  ? 112.566 95.941  91.214  1.00 0.00   ? 273  SER D O     1 
ATOM   9406  C  CB    . SER D 1 273  ? 110.984 95.897  88.338  1.00 0.00   ? 273  SER D CB    1 
ATOM   9407  O  OG    . SER D 1 273  ? 111.916 95.456  87.374  1.00 0.00   ? 273  SER D OG    1 
ATOM   9408  N  N     . ASP D 1 274  ? 113.905 96.167  89.425  1.00 0.00   ? 274  ASP D N     1 
ATOM   9409  C  CA    . ASP D 1 274  ? 115.057 95.536  90.077  1.00 0.00   ? 274  ASP D CA    1 
ATOM   9410  C  C     . ASP D 1 274  ? 115.853 96.441  91.016  1.00 0.00   ? 274  ASP D C     1 
ATOM   9411  O  O     . ASP D 1 274  ? 116.583 95.960  91.886  1.00 0.00   ? 274  ASP D O     1 
ATOM   9412  C  CB    . ASP D 1 274  ? 116.010 94.957  89.029  1.00 0.00   ? 274  ASP D CB    1 
ATOM   9413  C  CG    . ASP D 1 274  ? 115.308 94.044  88.043  1.00 0.00   ? 274  ASP D CG    1 
ATOM   9414  O  OD1   . ASP D 1 274  ? 114.265 93.453  88.409  1.00 0.00   ? 274  ASP D OD1   1 
ATOM   9415  O  OD2   . ASP D 1 274  ? 115.801 93.903  86.903  1.00 0.00   ? 274  ASP D OD2   1 
ATOM   9416  N  N     . LEU D 1 275  ? 115.710 97.751  90.843  1.00 0.00   ? 275  LEU D N     1 
ATOM   9417  C  CA    . LEU D 1 275  ? 116.427 98.712  91.672  1.00 0.00   ? 275  LEU D CA    1 
ATOM   9418  C  C     . LEU D 1 275  ? 116.039 98.530  93.127  1.00 0.00   ? 275  LEU D C     1 
ATOM   9419  O  O     . LEU D 1 275  ? 116.844 98.763  94.031  1.00 0.00   ? 275  LEU D O     1 
ATOM   9420  C  CB    . LEU D 1 275  ? 116.104 100.150 91.241  1.00 0.00   ? 275  LEU D CB    1 
ATOM   9421  N  N     . HIS D 1 276  ? 114.799 98.112  93.344  1.00 0.00   ? 276  HIS D N     1 
ATOM   9422  C  CA    . HIS D 1 276  ? 114.266 97.936  94.686  1.00 0.00   ? 276  HIS D CA    1 
ATOM   9423  C  C     . HIS D 1 276  ? 114.761 96.727  95.467  1.00 0.00   ? 276  HIS D C     1 
ATOM   9424  O  O     . HIS D 1 276  ? 115.068 96.838  96.648  1.00 0.00   ? 276  HIS D O     1 
ATOM   9425  C  CB    . HIS D 1 276  ? 112.739 97.896  94.622  1.00 0.00   ? 276  HIS D CB    1 
ATOM   9426  C  CG    . HIS D 1 276  ? 112.134 99.142  94.051  1.00 0.00   ? 276  HIS D CG    1 
ATOM   9427  N  ND1   . HIS D 1 276  ? 112.252 100.374 94.655  1.00 0.00   ? 276  HIS D ND1   1 
ATOM   9428  C  CD2   . HIS D 1 276  ? 111.416 99.344  92.923  1.00 0.00   ? 276  HIS D CD2   1 
ATOM   9429  C  CE1   . HIS D 1 276  ? 111.631 101.284 93.923  1.00 0.00   ? 276  HIS D CE1   1 
ATOM   9430  N  NE2   . HIS D 1 276  ? 111.115 100.683 92.866  1.00 0.00   ? 276  HIS D NE2   1 
ATOM   9431  N  N     . HIS D 1 277  ? 114.834 95.569  94.825  1.00 0.00   ? 277  HIS D N     1 
ATOM   9432  C  CA    . HIS D 1 277  ? 115.253 94.366  95.541  1.00 0.00   ? 277  HIS D CA    1 
ATOM   9433  C  C     . HIS D 1 277  ? 116.584 93.695  95.212  1.00 0.00   ? 277  HIS D C     1 
ATOM   9434  O  O     . HIS D 1 277  ? 117.314 93.306  96.115  1.00 0.00   ? 277  HIS D O     1 
ATOM   9435  C  CB    . HIS D 1 277  ? 114.116 93.348  95.461  1.00 0.00   ? 277  HIS D CB    1 
ATOM   9436  C  CG    . HIS D 1 277  ? 112.773 93.926  95.799  1.00 0.00   ? 277  HIS D CG    1 
ATOM   9437  N  ND1   . HIS D 1 277  ? 112.437 94.339  97.073  1.00 0.00   ? 277  HIS D ND1   1 
ATOM   9438  C  CD2   . HIS D 1 277  ? 111.704 94.209  95.022  1.00 0.00   ? 277  HIS D CD2   1 
ATOM   9439  C  CE1   . HIS D 1 277  ? 111.220 94.851  97.063  1.00 0.00   ? 277  HIS D CE1   1 
ATOM   9440  N  NE2   . HIS D 1 277  ? 110.750 94.784  95.830  1.00 0.00   ? 277  HIS D NE2   1 
ATOM   9441  N  N     . HIS D 1 278  ? 116.910 93.562  93.932  1.00 0.00   ? 278  HIS D N     1 
ATOM   9442  C  CA    . HIS D 1 278  ? 118.162 92.904  93.544  1.00 0.00   ? 278  HIS D CA    1 
ATOM   9443  C  C     . HIS D 1 278  ? 119.393 93.790  93.690  1.00 0.00   ? 278  HIS D C     1 
ATOM   9444  O  O     . HIS D 1 278  ? 120.503 93.298  93.900  1.00 0.00   ? 278  HIS D O     1 
ATOM   9445  C  CB    . HIS D 1 278  ? 118.052 92.371  92.119  1.00 0.00   ? 278  HIS D CB    1 
ATOM   9446  C  CG    . HIS D 1 278  ? 116.873 91.475  91.910  1.00 0.00   ? 278  HIS D CG    1 
ATOM   9447  N  ND1   . HIS D 1 278  ? 116.735 90.264  92.548  1.00 0.00   ? 278  HIS D ND1   1 
ATOM   9448  C  CD2   . HIS D 1 278  ? 115.755 91.635  91.161  1.00 0.00   ? 278  HIS D CD2   1 
ATOM   9449  C  CE1   . HIS D 1 278  ? 115.585 89.716  92.209  1.00 0.00   ? 278  HIS D CE1   1 
ATOM   9450  N  NE2   . HIS D 1 278  ? 114.969 90.528  91.368  1.00 0.00   ? 278  HIS D NE2   1 
ATOM   9451  N  N     . GLN D 1 279  ? 119.199 95.097  93.576  1.00 0.00   ? 279  GLN D N     1 
ATOM   9452  C  CA    . GLN D 1 279  ? 120.290 96.040  93.759  1.00 0.00   ? 279  GLN D CA    1 
ATOM   9453  C  C     . GLN D 1 279  ? 120.221 96.360  95.248  1.00 0.00   ? 279  GLN D C     1 
ATOM   9454  O  O     . GLN D 1 279  ? 119.137 96.338  95.834  1.00 0.00   ? 279  GLN D O     1 
ATOM   9455  C  CB    . GLN D 1 279  ? 120.076 97.316  92.938  1.00 0.00   ? 279  GLN D CB    1 
ATOM   9456  C  CG    . GLN D 1 279  ? 120.038 97.126  91.421  1.00 0.00   ? 279  GLN D CG    1 
ATOM   9457  C  CD    . GLN D 1 279  ? 120.018 98.449  90.674  1.00 0.00   ? 279  GLN D CD    1 
ATOM   9458  O  OE1   . GLN D 1 279  ? 119.859 99.512  91.278  1.00 0.00   ? 279  GLN D OE1   1 
ATOM   9459  N  NE2   . GLN D 1 279  ? 120.175 98.392  89.355  1.00 0.00   ? 279  GLN D NE2   1 
ATOM   9460  N  N     . ASP D 1 280  ? 121.360 96.635  95.871  1.00 0.00   ? 280  ASP D N     1 
ATOM   9461  C  CA    . ASP D 1 280  ? 121.359 96.930  97.299  1.00 0.00   ? 280  ASP D CA    1 
ATOM   9462  C  C     . ASP D 1 280  ? 121.994 98.285  97.593  1.00 0.00   ? 280  ASP D C     1 
ATOM   9463  O  O     . ASP D 1 280  ? 123.075 98.366  98.184  1.00 0.00   ? 280  ASP D O     1 
ATOM   9464  C  CB    . ASP D 1 280  ? 122.083 95.813  98.061  1.00 0.00   ? 280  ASP D CB    1 
ATOM   9465  C  CG    . ASP D 1 280  ? 121.792 95.832  99.546  1.00 0.00   ? 280  ASP D CG    1 
ATOM   9466  O  OD1   . ASP D 1 280  ? 120.761 96.418  99.937  1.00 0.00   ? 280  ASP D OD1   1 
ATOM   9467  O  OD2   . ASP D 1 280  ? 122.580 95.251  100.329 1.00 0.00   ? 280  ASP D OD2   1 
ATOM   9468  N  N     . LEU D 1 281  ? 121.307 99.351  97.185  1.00 0.00   ? 281  LEU D N     1 
ATOM   9469  C  CA    . LEU D 1 281  ? 121.794 100.712 97.387  1.00 0.00   ? 281  LEU D CA    1 
ATOM   9470  C  C     . LEU D 1 281  ? 121.118 101.353 98.598  1.00 0.00   ? 281  LEU D C     1 
ATOM   9471  O  O     . LEU D 1 281  ? 120.107 100.852 99.089  1.00 0.00   ? 281  LEU D O     1 
ATOM   9472  C  CB    . LEU D 1 281  ? 121.515 101.551 96.137  1.00 0.00   ? 281  LEU D CB    1 
ATOM   9473  C  CG    . LEU D 1 281  ? 121.980 100.935 94.816  1.00 0.00   ? 281  LEU D CG    1 
ATOM   9474  C  CD1   . LEU D 1 281  ? 121.496 101.777 93.645  1.00 0.00   ? 281  LEU D CD1   1 
ATOM   9475  C  CD2   . LEU D 1 281  ? 123.491 100.816 94.816  1.00 0.00   ? 281  LEU D CD2   1 
ATOM   9476  N  N     . GLU D 1 282  ? 121.682 102.460 99.073  1.00 0.00   ? 282  GLU D N     1 
ATOM   9477  C  CA    . GLU D 1 282  ? 121.132 103.167 100.221 1.00 0.00   ? 282  GLU D CA    1 
ATOM   9478  C  C     . GLU D 1 282  ? 121.264 104.676 100.073 1.00 0.00   ? 282  GLU D C     1 
ATOM   9479  O  O     . GLU D 1 282  ? 122.336 105.187 99.741  1.00 0.00   ? 282  GLU D O     1 
ATOM   9480  C  CB    . GLU D 1 282  ? 121.832 102.724 101.510 1.00 0.00   ? 282  GLU D CB    1 
ATOM   9481  C  CG    . GLU D 1 282  ? 121.185 103.241 102.789 1.00 0.00   ? 282  GLU D CG    1 
ATOM   9482  C  CD    . GLU D 1 282  ? 121.923 102.809 104.043 1.00 0.00   ? 282  GLU D CD    1 
ATOM   9483  O  OE1   . GLU D 1 282  ? 122.654 101.796 103.979 1.00 0.00   ? 282  GLU D OE1   1 
ATOM   9484  O  OE2   . GLU D 1 282  ? 121.766 103.466 105.097 1.00 0.00   ? 282  GLU D OE2   1 
ATOM   9485  N  N     . ILE D 1 283  ? 120.159 105.377 100.323 1.00 0.00   ? 283  ILE D N     1 
ATOM   9486  C  CA    . ILE D 1 283  ? 120.124 106.830 100.239 1.00 0.00   ? 283  ILE D CA    1 
ATOM   9487  C  C     . ILE D 1 283  ? 120.267 107.415 101.638 1.00 0.00   ? 283  ILE D C     1 
ATOM   9488  O  O     . ILE D 1 283  ? 119.447 107.143 102.523 1.00 0.00   ? 283  ILE D O     1 
ATOM   9489  C  CB    . ILE D 1 283  ? 118.791 107.328 99.628  1.00 0.00   ? 283  ILE D CB    1 
ATOM   9490  C  CG1   . ILE D 1 283  ? 118.558 106.675 98.259  1.00 0.00   ? 283  ILE D CG1   1 
ATOM   9491  C  CG2   . ILE D 1 283  ? 118.818 108.840 99.490  1.00 0.00   ? 283  ILE D CG2   1 
ATOM   9492  C  CD1   . ILE D 1 283  ? 119.649 106.948 97.246  1.00 0.00   ? 283  ILE D CD1   1 
ATOM   9493  N  N     . ILE D 1 284  ? 121.309 108.208 101.834 1.00 0.00   ? 284  ILE D N     1 
ATOM   9494  C  CA    . ILE D 1 284  ? 121.555 108.834 103.127 1.00 0.00   ? 284  ILE D CA    1 
ATOM   9495  C  C     . ILE D 1 284  ? 121.062 110.275 103.098 1.00 0.00   ? 284  ILE D C     1 
ATOM   9496  O  O     . ILE D 1 284  ? 121.472 111.069 102.249 1.00 0.00   ? 284  ILE D O     1 
ATOM   9497  C  CB    . ILE D 1 284  ? 123.060 108.838 103.482 1.00 0.00   ? 284  ILE D CB    1 
ATOM   9498  C  CG1   . ILE D 1 284  ? 123.623 107.414 103.390 1.00 0.00   ? 284  ILE D CG1   1 
ATOM   9499  C  CG2   . ILE D 1 284  ? 123.254 109.376 104.889 1.00 0.00   ? 284  ILE D CG2   1 
ATOM   9500  C  CD1   . ILE D 1 284  ? 122.941 106.409 104.300 1.00 0.00   ? 284  ILE D CD1   1 
ATOM   9501  N  N     . VAL D 1 285  ? 120.168 110.598 104.024 1.00 0.00   ? 285  VAL D N     1 
ATOM   9502  C  CA    . VAL D 1 285  ? 119.604 111.937 104.125 1.00 0.00   ? 285  VAL D CA    1 
ATOM   9503  C  C     . VAL D 1 285  ? 120.056 112.620 105.409 1.00 0.00   ? 285  VAL D C     1 
ATOM   9504  O  O     . VAL D 1 285  ? 119.737 112.173 106.509 1.00 0.00   ? 285  VAL D O     1 
ATOM   9505  C  CB    . VAL D 1 285  ? 118.065 111.903 104.117 1.00 0.00   ? 285  VAL D CB    1 
ATOM   9506  C  CG1   . VAL D 1 285  ? 117.519 113.317 104.131 1.00 0.00   ? 285  VAL D CG1   1 
ATOM   9507  C  CG2   . VAL D 1 285  ? 117.564 111.153 102.892 1.00 0.00   ? 285  VAL D CG2   1 
ATOM   9508  N  N     . ILE D 1 286  ? 120.797 113.711 105.260 1.00 0.00   ? 286  ILE D N     1 
ATOM   9509  C  CA    . ILE D 1 286  ? 121.297 114.443 106.416 1.00 0.00   ? 286  ILE D CA    1 
ATOM   9510  C  C     . ILE D 1 286  ? 120.655 115.819 106.551 1.00 0.00   ? 286  ILE D C     1 
ATOM   9511  O  O     . ILE D 1 286  ? 120.639 116.607 105.603 1.00 0.00   ? 286  ILE D O     1 
ATOM   9512  C  CB    . ILE D 1 286  ? 122.830 114.629 106.342 1.00 0.00   ? 286  ILE D CB    1 
ATOM   9513  C  CG1   . ILE D 1 286  ? 123.512 113.271 106.150 1.00 0.00   ? 286  ILE D CG1   1 
ATOM   9514  C  CG2   . ILE D 1 286  ? 123.329 115.292 107.619 1.00 0.00   ? 286  ILE D CG2   1 
ATOM   9515  C  CD1   . ILE D 1 286  ? 123.227 112.269 107.249 1.00 0.00   ? 286  ILE D CD1   1 
ATOM   9516  N  N     . LEU D 1 287  ? 120.124 116.099 107.737 1.00 0.00   ? 287  LEU D N     1 
ATOM   9517  C  CA    . LEU D 1 287  ? 119.502 117.389 108.008 1.00 0.00   ? 287  LEU D CA    1 
ATOM   9518  C  C     . LEU D 1 287  ? 120.256 118.082 109.136 1.00 0.00   ? 287  LEU D C     1 
ATOM   9519  O  O     . LEU D 1 287  ? 120.147 117.692 110.301 1.00 0.00   ? 287  LEU D O     1 
ATOM   9520  C  CB    . LEU D 1 287  ? 118.031 117.210 108.396 1.00 0.00   ? 287  LEU D CB    1 
ATOM   9521  C  CG    . LEU D 1 287  ? 117.290 118.481 108.828 1.00 0.00   ? 287  LEU D CG    1 
ATOM   9522  C  CD1   . LEU D 1 287  ? 117.330 119.510 107.710 1.00 0.00   ? 287  LEU D CD1   1 
ATOM   9523  C  CD2   . LEU D 1 287  ? 115.852 118.148 109.195 1.00 0.00   ? 287  LEU D CD2   1 
ATOM   9524  N  N     . GLU D 1 288  ? 121.030 119.102 108.786 1.00 0.00   ? 288  GLU D N     1 
ATOM   9525  C  CA    . GLU D 1 288  ? 121.805 119.845 109.770 1.00 0.00   ? 288  GLU D CA    1 
ATOM   9526  C  C     . GLU D 1 288  ? 121.119 121.171 110.106 1.00 0.00   ? 288  GLU D C     1 
ATOM   9527  O  O     . GLU D 1 288  ? 120.137 121.549 109.467 1.00 0.00   ? 288  GLU D O     1 
ATOM   9528  C  CB    . GLU D 1 288  ? 123.222 120.097 109.241 1.00 0.00   ? 288  GLU D CB    1 
ATOM   9529  C  CG    . GLU D 1 288  ? 123.905 118.843 108.702 1.00 0.00   ? 288  GLU D CG    1 
ATOM   9530  C  CD    . GLU D 1 288  ? 125.368 119.065 108.367 1.00 0.00   ? 288  GLU D CD    1 
ATOM   9531  O  OE1   . GLU D 1 288  ? 125.679 120.044 107.653 1.00 0.00   ? 288  GLU D OE1   1 
ATOM   9532  O  OE2   . GLU D 1 288  ? 126.209 118.258 108.819 1.00 0.00   ? 288  GLU D OE2   1 
ATOM   9533  N  N     . GLY D 1 289  ? 121.635 121.860 111.119 1.00 0.00   ? 289  GLY D N     1 
ATOM   9534  C  CA    . GLY D 1 289  ? 121.065 123.133 111.530 1.00 0.00   ? 289  GLY D CA    1 
ATOM   9535  C  C     . GLY D 1 289  ? 121.252 123.384 113.013 1.00 0.00   ? 289  GLY D C     1 
ATOM   9536  O  O     . GLY D 1 289  ? 121.642 122.482 113.754 1.00 0.00   ? 289  GLY D O     1 
ATOM   9537  N  N     . VAL D 1 290  ? 120.965 124.602 113.450 1.00 0.00   ? 290  VAL D N     1 
ATOM   9538  C  CA    . VAL D 1 290  ? 121.120 124.954 114.856 1.00 0.00   ? 290  VAL D CA    1 
ATOM   9539  C  C     . VAL D 1 290  ? 119.790 125.220 115.553 1.00 0.00   ? 290  VAL D C     1 
ATOM   9540  O  O     . VAL D 1 290  ? 118.881 125.818 114.976 1.00 0.00   ? 290  VAL D O     1 
ATOM   9541  C  CB    . VAL D 1 290  ? 122.006 126.202 115.025 1.00 0.00   ? 290  VAL D CB    1 
ATOM   9542  C  CG1   . VAL D 1 290  ? 121.426 127.368 114.247 1.00 0.00   ? 290  VAL D CG1   1 
ATOM   9543  C  CG2   . VAL D 1 290  ? 122.105 126.558 116.488 1.00 0.00   ? 290  VAL D CG2   1 
ATOM   9544  N  N     . VAL D 1 291  ? 119.682 124.768 116.800 1.00 0.00   ? 291  VAL D N     1 
ATOM   9545  C  CA    . VAL D 1 291  ? 118.466 124.985 117.571 1.00 0.00   ? 291  VAL D CA    1 
ATOM   9546  C  C     . VAL D 1 291  ? 118.426 126.454 117.976 1.00 0.00   ? 291  VAL D C     1 
ATOM   9547  O  O     . VAL D 1 291  ? 119.379 126.973 118.551 1.00 0.00   ? 291  VAL D O     1 
ATOM   9548  C  CB    . VAL D 1 291  ? 118.431 124.125 118.855 1.00 0.00   ? 291  VAL D CB    1 
ATOM   9549  C  CG1   . VAL D 1 291  ? 117.151 124.407 119.617 1.00 0.00   ? 291  VAL D CG1   1 
ATOM   9550  C  CG2   . VAL D 1 291  ? 118.519 122.643 118.509 1.00 0.00   ? 291  VAL D CG2   1 
ATOM   9551  N  N     . GLU D 1 292  ? 117.313 127.119 117.680 1.00 0.00   ? 292  GLU D N     1 
ATOM   9552  C  CA    . GLU D 1 292  ? 117.141 128.531 117.988 1.00 0.00   ? 292  GLU D CA    1 
ATOM   9553  C  C     . GLU D 1 292  ? 117.272 128.859 119.474 1.00 0.00   ? 292  GLU D C     1 
ATOM   9554  O  O     . GLU D 1 292  ? 117.547 130.002 119.836 1.00 0.00   ? 292  GLU D O     1 
ATOM   9555  C  CB    . GLU D 1 292  ? 115.770 129.005 117.503 1.00 0.00   ? 292  GLU D CB    1 
ATOM   9556  C  CG    . GLU D 1 292  ? 114.616 128.215 118.104 1.00 0.00   ? 292  GLU D CG    1 
ATOM   9557  C  CD    . GLU D 1 292  ? 113.271 128.893 117.904 1.00 0.00   ? 292  GLU D CD    1 
ATOM   9558  O  OE1   . GLU D 1 292  ? 112.896 129.146 116.738 1.00 0.00   ? 292  GLU D OE1   1 
ATOM   9559  O  OE2   . GLU D 1 292  ? 112.587 129.168 118.914 1.00 0.00   ? 292  GLU D OE2   1 
ATOM   9560  N  N     . THR D 1 293  ? 117.080 127.864 120.331 1.00 0.00   ? 293  THR D N     1 
ATOM   9561  C  CA    . THR D 1 293  ? 117.141 128.092 121.769 1.00 0.00   ? 293  THR D CA    1 
ATOM   9562  C  C     . THR D 1 293  ? 118.513 127.919 122.414 1.00 0.00   ? 293  THR D C     1 
ATOM   9563  O  O     . THR D 1 293  ? 118.840 128.616 123.371 1.00 0.00   ? 293  THR D O     1 
ATOM   9564  C  CB    . THR D 1 293  ? 116.148 127.175 122.497 1.00 0.00   ? 293  THR D CB    1 
ATOM   9565  O  OG1   . THR D 1 293  ? 116.574 125.814 122.386 1.00 0.00   ? 293  THR D OG1   1 
ATOM   9566  C  CG2   . THR D 1 293  ? 114.777 127.299 121.874 1.00 0.00   ? 293  THR D CG2   1 
ATOM   9567  N  N     . THR D 1 294  ? 119.315 126.992 121.896 1.00 0.00   ? 294  THR D N     1 
ATOM   9568  C  CA    . THR D 1 294  ? 120.629 126.748 122.478 1.00 0.00   ? 294  THR D CA    1 
ATOM   9569  C  C     . THR D 1 294  ? 121.811 127.253 121.660 1.00 0.00   ? 294  THR D C     1 
ATOM   9570  O  O     . THR D 1 294  ? 122.801 127.723 122.218 1.00 0.00   ? 294  THR D O     1 
ATOM   9571  C  CB    . THR D 1 294  ? 120.846 125.245 122.744 1.00 0.00   ? 294  THR D CB    1 
ATOM   9572  O  OG1   . THR D 1 294  ? 120.816 124.526 121.504 1.00 0.00   ? 294  THR D OG1   1 
ATOM   9573  C  CG2   . THR D 1 294  ? 119.762 124.702 123.657 1.00 0.00   ? 294  THR D CG2   1 
ATOM   9574  N  N     . GLY D 1 295  ? 121.711 127.156 120.340 1.00 0.00   ? 295  GLY D N     1 
ATOM   9575  C  CA    . GLY D 1 295  ? 122.808 127.601 119.499 1.00 0.00   ? 295  GLY D CA    1 
ATOM   9576  C  C     . GLY D 1 295  ? 123.694 126.416 119.186 1.00 0.00   ? 295  GLY D C     1 
ATOM   9577  O  O     . GLY D 1 295  ? 124.783 126.551 118.624 1.00 0.00   ? 295  GLY D O     1 
ATOM   9578  N  N     . ILE D 1 296  ? 123.202 125.240 119.562 1.00 0.00   ? 296  ILE D N     1 
ATOM   9579  C  CA    . ILE D 1 296  ? 123.901 123.980 119.352 1.00 0.00   ? 296  ILE D CA    1 
ATOM   9580  C  C     . ILE D 1 296  ? 123.515 123.390 117.996 1.00 0.00   ? 296  ILE D C     1 
ATOM   9581  O  O     . ILE D 1 296  ? 122.332 123.263 117.678 1.00 0.00   ? 296  ILE D O     1 
ATOM   9582  C  CB    . ILE D 1 296  ? 123.528 122.971 120.458 1.00 0.00   ? 296  ILE D CB    1 
ATOM   9583  C  CG1   . ILE D 1 296  ? 123.976 123.512 121.825 1.00 0.00   ? 296  ILE D CG1   1 
ATOM   9584  C  CG2   . ILE D 1 296  ? 124.172 121.636 120.189 1.00 0.00   ? 296  ILE D CG2   1 
ATOM   9585  C  CD1   . ILE D 1 296  ? 125.466 123.782 121.923 1.00 0.00   ? 296  ILE D CD1   1 
ATOM   9586  N  N     . THR D 1 297  ? 124.515 123.028 117.201 1.00 0.00   ? 297  THR D N     1 
ATOM   9587  C  CA    . THR D 1 297  ? 124.272 122.440 115.889 1.00 0.00   ? 297  THR D CA    1 
ATOM   9588  C  C     . THR D 1 297  ? 123.943 120.957 116.042 1.00 0.00   ? 297  THR D C     1 
ATOM   9589  O  O     . THR D 1 297  ? 124.628 120.236 116.765 1.00 0.00   ? 297  THR D O     1 
ATOM   9590  C  CB    . THR D 1 297  ? 125.508 122.569 114.986 1.00 0.00   ? 297  THR D CB    1 
ATOM   9591  O  OG1   . THR D 1 297  ? 125.852 123.951 114.828 1.00 0.00   ? 297  THR D OG1   1 
ATOM   9592  C  CG2   . THR D 1 297  ? 125.220 121.970 113.628 1.00 0.00   ? 297  THR D CG2   1 
ATOM   9593  N  N     . THR D 1 298  ? 122.897 120.496 115.359 1.00 0.00   ? 298  THR D N     1 
ATOM   9594  C  CA    . THR D 1 298  ? 122.497 119.093 115.442 1.00 0.00   ? 298  THR D CA    1 
ATOM   9595  C  C     . THR D 1 298  ? 122.311 118.439 114.079 1.00 0.00   ? 298  THR D C     1 
ATOM   9596  O  O     . THR D 1 298  ? 122.360 119.101 113.042 1.00 0.00   ? 298  THR D O     1 
ATOM   9597  C  CB    . THR D 1 298  ? 121.182 118.934 116.227 1.00 0.00   ? 298  THR D CB    1 
ATOM   9598  O  OG1   . THR D 1 298  ? 120.113 119.577 115.519 1.00 0.00   ? 298  THR D OG1   1 
ATOM   9599  C  CG2   . THR D 1 298  ? 121.313 119.561 117.597 1.00 0.00   ? 298  THR D CG2   1 
ATOM   9600  N  N     . GLN D 1 299  ? 122.098 117.125 114.093 1.00 0.00   ? 299  GLN D N     1 
ATOM   9601  C  CA    . GLN D 1 299  ? 121.888 116.363 112.872 1.00 0.00   ? 299  GLN D CA    1 
ATOM   9602  C  C     . GLN D 1 299  ? 120.716 115.404 112.994 1.00 0.00   ? 299  GLN D C     1 
ATOM   9603  O  O     . GLN D 1 299  ? 120.472 114.807 114.049 1.00 0.00   ? 299  GLN D O     1 
ATOM   9604  C  CB    . GLN D 1 299  ? 123.125 115.547 112.496 1.00 0.00   ? 299  GLN D CB    1 
ATOM   9605  C  CG    . GLN D 1 299  ? 124.200 116.300 111.724 1.00 0.00   ? 299  GLN D CG    1 
ATOM   9606  C  CD    . GLN D 1 299  ? 125.158 115.358 111.023 1.00 0.00   ? 299  GLN D CD    1 
ATOM   9607  O  OE1   . GLN D 1 299  ? 125.458 114.277 111.533 1.00 0.00   ? 299  GLN D OE1   1 
ATOM   9608  N  NE2   . GLN D 1 299  ? 125.649 115.757 109.853 1.00 0.00   ? 299  GLN D NE2   1 
ATOM   9609  N  N     . ALA D 1 300  ? 119.974 115.280 111.904 1.00 0.00   ? 300  ALA D N     1 
ATOM   9610  C  CA    . ALA D 1 300  ? 118.845 114.369 111.835 1.00 0.00   ? 300  ALA D CA    1 
ATOM   9611  C  C     . ALA D 1 300  ? 119.289 113.422 110.733 1.00 0.00   ? 300  ALA D C     1 
ATOM   9612  O  O     . ALA D 1 300  ? 119.465 113.834 109.581 1.00 0.00   ? 300  ALA D O     1 
ATOM   9613  C  CB    . ALA D 1 300  ? 117.590 115.117 111.424 1.00 0.00   ? 300  ALA D CB    1 
ATOM   9614  N  N     . ARG D 1 301  ? 119.504 112.163 111.097 1.00 0.00   ? 301  ARG D N     1 
ATOM   9615  C  CA    . ARG D 1 301  ? 119.970 111.162 110.141 1.00 0.00   ? 301  ARG D CA    1 
ATOM   9616  C  C     . ARG D 1 301  ? 118.972 110.046 109.874 1.00 0.00   ? 301  ARG D C     1 
ATOM   9617  O  O     . ARG D 1 301  ? 118.376 109.487 110.797 1.00 0.00   ? 301  ARG D O     1 
ATOM   9618  C  CB    . ARG D 1 301  ? 121.291 110.565 110.632 1.00 0.00   ? 301  ARG D CB    1 
ATOM   9619  C  CG    . ARG D 1 301  ? 122.415 111.593 110.757 1.00 0.00   ? 301  ARG D CG    1 
ATOM   9620  C  CD    . ARG D 1 301  ? 123.648 110.974 111.388 1.00 0.00   ? 301  ARG D CD    1 
ATOM   9621  N  NE    . ARG D 1 301  ? 123.384 110.557 112.766 1.00 0.00   ? 301  ARG D NE    1 
ATOM   9622  C  CZ    . ARG D 1 301  ? 123.550 111.334 113.832 1.00 0.00   ? 301  ARG D CZ    1 
ATOM   9623  N  NH1   . ARG D 1 301  ? 123.986 112.578 113.687 1.00 0.00   ? 301  ARG D NH1   1 
ATOM   9624  N  NH2   . ARG D 1 301  ? 123.279 110.865 115.043 1.00 0.00   ? 301  ARG D NH2   1 
ATOM   9625  N  N     . THR D 1 302  ? 118.797 109.733 108.596 1.00 0.00   ? 302  THR D N     1 
ATOM   9626  C  CA    . THR D 1 302  ? 117.881 108.679 108.167 1.00 0.00   ? 302  THR D CA    1 
ATOM   9627  C  C     . THR D 1 302  ? 118.424 108.048 106.890 1.00 0.00   ? 302  THR D C     1 
ATOM   9628  O  O     . THR D 1 302  ? 119.360 108.565 106.277 1.00 0.00   ? 302  THR D O     1 
ATOM   9629  C  CB    . THR D 1 302  ? 116.470 109.238 107.883 1.00 0.00   ? 302  THR D CB    1 
ATOM   9630  O  OG1   . THR D 1 302  ? 115.548 108.149 107.727 1.00 0.00   ? 302  THR D OG1   1 
ATOM   9631  C  CG2   . THR D 1 302  ? 116.469 110.070 106.612 1.00 0.00   ? 302  THR D CG2   1 
ATOM   9632  N  N     . SER D 1 303  ? 117.830 106.932 106.491 1.00 0.00   ? 303  SER D N     1 
ATOM   9633  C  CA    . SER D 1 303  ? 118.263 106.242 105.289 1.00 0.00   ? 303  SER D CA    1 
ATOM   9634  C  C     . SER D 1 303  ? 117.093 105.562 104.590 1.00 0.00   ? 303  SER D C     1 
ATOM   9635  O  O     . SER D 1 303  ? 116.053 105.305 105.194 1.00 0.00   ? 303  SER D O     1 
ATOM   9636  C  CB    . SER D 1 303  ? 119.326 105.201 105.636 1.00 0.00   ? 303  SER D CB    1 
ATOM   9637  O  OG    . SER D 1 303  ? 118.827 104.228 106.537 1.00 0.00   ? 303  SER D OG    1 
ATOM   9638  N  N     . TYR D 1 304  ? 117.281 105.289 103.306 1.00 0.00   ? 304  TYR D N     1 
ATOM   9639  C  CA    . TYR D 1 304  ? 116.262 104.629 102.506 1.00 0.00   ? 304  TYR D CA    1 
ATOM   9640  C  C     . TYR D 1 304  ? 116.904 103.534 101.668 1.00 0.00   ? 304  TYR D C     1 
ATOM   9641  O  O     . TYR D 1 304  ? 117.679 103.807 100.747 1.00 0.00   ? 304  TYR D O     1 
ATOM   9642  C  CB    . TYR D 1 304  ? 115.557 105.638 101.593 1.00 0.00   ? 304  TYR D CB    1 
ATOM   9643  C  CG    . TYR D 1 304  ? 114.784 106.702 102.340 1.00 0.00   ? 304  TYR D CG    1 
ATOM   9644  C  CD1   . TYR D 1 304  ? 115.433 107.809 102.893 1.00 0.00   ? 304  TYR D CD1   1 
ATOM   9645  C  CD2   . TYR D 1 304  ? 113.404 106.595 102.514 1.00 0.00   ? 304  TYR D CD2   1 
ATOM   9646  C  CE1   . TYR D 1 304  ? 114.727 108.775 103.600 1.00 0.00   ? 304  TYR D CE1   1 
ATOM   9647  C  CE2   . TYR D 1 304  ? 112.689 107.556 103.222 1.00 0.00   ? 304  TYR D CE2   1 
ATOM   9648  C  CZ    . TYR D 1 304  ? 113.358 108.641 103.758 1.00 0.00   ? 304  TYR D CZ    1 
ATOM   9649  O  OH    . TYR D 1 304  ? 112.654 109.592 104.462 1.00 0.00   ? 304  TYR D OH    1 
ATOM   9650  N  N     . LEU D 1 305  ? 116.599 102.287 102.005 1.00 0.00   ? 305  LEU D N     1 
ATOM   9651  C  CA    . LEU D 1 305  ? 117.136 101.156 101.266 1.00 0.00   ? 305  LEU D CA    1 
ATOM   9652  C  C     . LEU D 1 305  ? 116.341 101.046 99.973  1.00 0.00   ? 305  LEU D C     1 
ATOM   9653  O  O     . LEU D 1 305  ? 115.351 101.755 99.787  1.00 0.00   ? 305  LEU D O     1 
ATOM   9654  C  CB    . LEU D 1 305  ? 117.018 99.873  102.095 1.00 0.00   ? 305  LEU D CB    1 
ATOM   9655  C  CG    . LEU D 1 305  ? 118.005 99.715  103.260 1.00 0.00   ? 305  LEU D CG    1 
ATOM   9656  C  CD1   . LEU D 1 305  ? 119.422 99.581  102.720 1.00 0.00   ? 305  LEU D CD1   1 
ATOM   9657  C  CD2   . LEU D 1 305  ? 117.906 100.909 104.201 1.00 0.00   ? 305  LEU D CD2   1 
ATOM   9658  N  N     . ALA D 1 306  ? 116.771 100.164 99.080  1.00 0.00   ? 306  ALA D N     1 
ATOM   9659  C  CA    . ALA D 1 306  ? 116.103 99.999  97.795  1.00 0.00   ? 306  ALA D CA    1 
ATOM   9660  C  C     . ALA D 1 306  ? 114.621 99.629  97.934  1.00 0.00   ? 306  ALA D C     1 
ATOM   9661  O  O     . ALA D 1 306  ? 113.782 100.122 97.182  1.00 0.00   ? 306  ALA D O     1 
ATOM   9662  C  CB    . ALA D 1 306  ? 116.840 98.941  96.975  1.00 0.00   ? 306  ALA D CB    1 
ATOM   9663  N  N     . ASP D 1 307  ? 114.309 98.776  98.904  1.00 0.00   ? 307  ASP D N     1 
ATOM   9664  C  CA    . ASP D 1 307  ? 112.934 98.340  99.131  1.00 0.00   ? 307  ASP D CA    1 
ATOM   9665  C  C     . ASP D 1 307  ? 112.080 99.319  99.935  1.00 0.00   ? 307  ASP D C     1 
ATOM   9666  O  O     . ASP D 1 307  ? 110.954 98.996  100.313 1.00 0.00   ? 307  ASP D O     1 
ATOM   9667  C  CB    . ASP D 1 307  ? 112.919 96.981  99.830  1.00 0.00   ? 307  ASP D CB    1 
ATOM   9668  C  CG    . ASP D 1 307  ? 113.746 96.972  101.094 1.00 0.00   ? 307  ASP D CG    1 
ATOM   9669  O  OD1   . ASP D 1 307  ? 113.974 98.061  101.673 1.00 0.00   ? 307  ASP D OD1   1 
ATOM   9670  O  OD2   . ASP D 1 307  ? 114.167 95.875  101.524 1.00 0.00   ? 307  ASP D OD2   1 
ATOM   9671  N  N     . GLU D 1 308  ? 112.622 100.499 100.218 1.00 0.00   ? 308  GLU D N     1 
ATOM   9672  C  CA    . GLU D 1 308  ? 111.887 101.506 100.973 1.00 0.00   ? 308  GLU D CA    1 
ATOM   9673  C  C     . GLU D 1 308  ? 111.493 102.649 100.051 1.00 0.00   ? 308  GLU D C     1 
ATOM   9674  O  O     . GLU D 1 308  ? 110.886 103.634 100.475 1.00 0.00   ? 308  GLU D O     1 
ATOM   9675  C  CB    . GLU D 1 308  ? 112.735 102.025 102.133 1.00 0.00   ? 308  GLU D CB    1 
ATOM   9676  N  N     . ILE D 1 309  ? 111.846 102.496 98.778  1.00 0.00   ? 309  ILE D N     1 
ATOM   9677  C  CA    . ILE D 1 309  ? 111.542 103.485 97.753  1.00 0.00   ? 309  ILE D CA    1 
ATOM   9678  C  C     . ILE D 1 309  ? 110.391 102.948 96.909  1.00 0.00   ? 309  ILE D C     1 
ATOM   9679  O  O     . ILE D 1 309  ? 110.361 101.763 96.571  1.00 0.00   ? 309  ILE D O     1 
ATOM   9680  C  CB    . ILE D 1 309  ? 112.757 103.733 96.829  1.00 0.00   ? 309  ILE D CB    1 
ATOM   9681  C  CG1   . ILE D 1 309  ? 113.965 104.171 97.664  1.00 0.00   ? 309  ILE D CG1   1 
ATOM   9682  C  CG2   . ILE D 1 309  ? 112.421 104.797 95.794  1.00 0.00   ? 309  ILE D CG2   1 
ATOM   9683  C  CD1   . ILE D 1 309  ? 113.746 105.445 98.444  1.00 0.00   ? 309  ILE D CD1   1 
ATOM   9684  N  N     . LEU D 1 310  ? 109.444 103.814 96.575  1.00 0.00   ? 310  LEU D N     1 
ATOM   9685  C  CA    . LEU D 1 310  ? 108.295 103.408 95.773  1.00 0.00   ? 310  LEU D CA    1 
ATOM   9686  C  C     . LEU D 1 310  ? 108.377 104.041 94.391  1.00 0.00   ? 310  LEU D C     1 
ATOM   9687  O  O     . LEU D 1 310  ? 108.735 105.211 94.254  1.00 0.00   ? 310  LEU D O     1 
ATOM   9688  C  CB    . LEU D 1 310  ? 106.999 103.831 96.466  1.00 0.00   ? 310  LEU D CB    1 
ATOM   9689  C  CG    . LEU D 1 310  ? 106.702 103.152 97.811  1.00 0.00   ? 310  LEU D CG    1 
ATOM   9690  C  CD1   . LEU D 1 310  ? 105.468 103.781 98.438  1.00 0.00   ? 310  LEU D CD1   1 
ATOM   9691  C  CD2   . LEU D 1 310  ? 106.500 101.658 97.610  1.00 0.00   ? 310  LEU D CD2   1 
ATOM   9692  N  N     . TRP D 1 311  ? 108.055 103.260 93.364  1.00 0.00   ? 311  TRP D N     1 
ATOM   9693  C  CA    . TRP D 1 311  ? 108.101 103.758 91.997  1.00 0.00   ? 311  TRP D CA    1 
ATOM   9694  C  C     . TRP D 1 311  ? 106.711 103.926 91.406  1.00 0.00   ? 311  TRP D C     1 
ATOM   9695  O  O     . TRP D 1 311  ? 105.932 102.974 91.330  1.00 0.00   ? 311  TRP D O     1 
ATOM   9696  C  CB    . TRP D 1 311  ? 108.931 102.820 91.112  1.00 0.00   ? 311  TRP D CB    1 
ATOM   9697  C  CG    . TRP D 1 311  ? 109.201 103.361 89.743  1.00 0.00   ? 311  TRP D CG    1 
ATOM   9698  C  CD1   . TRP D 1 311  ? 108.292 103.561 88.741  1.00 0.00   ? 311  TRP D CD1   1 
ATOM   9699  C  CD2   . TRP D 1 311  ? 110.465 103.803 89.236  1.00 0.00   ? 311  TRP D CD2   1 
ATOM   9700  N  NE1   . TRP D 1 311  ? 108.918 104.103 87.641  1.00 0.00   ? 311  TRP D NE1   1 
ATOM   9701  C  CE2   . TRP D 1 311  ? 110.248 104.261 87.914  1.00 0.00   ? 311  TRP D CE2   1 
ATOM   9702  C  CE3   . TRP D 1 311  ? 111.757 103.860 89.770  1.00 0.00   ? 311  TRP D CE3   1 
ATOM   9703  C  CZ2   . TRP D 1 311  ? 111.283 104.769 87.120  1.00 0.00   ? 311  TRP D CZ2   1 
ATOM   9704  C  CZ3   . TRP D 1 311  ? 112.786 104.370 88.978  1.00 0.00   ? 311  TRP D CZ3   1 
ATOM   9705  C  CH2   . TRP D 1 311  ? 112.540 104.815 87.666  1.00 0.00   ? 311  TRP D CH2   1 
ATOM   9706  N  N     . GLY D 1 312  ? 106.406 105.149 90.986  1.00 0.00   ? 312  GLY D N     1 
ATOM   9707  C  CA    . GLY D 1 312  ? 105.115 105.434 90.401  1.00 0.00   ? 312  GLY D CA    1 
ATOM   9708  C  C     . GLY D 1 312  ? 104.120 105.977 91.404  1.00 0.00   ? 312  GLY D C     1 
ATOM   9709  O  O     . GLY D 1 312  ? 102.915 106.011 91.142  1.00 0.00   ? 312  GLY D O     1 
ATOM   9710  N  N     . GLN D 1 313  ? 104.632 106.398 92.556  1.00 0.00   ? 313  GLN D N     1 
ATOM   9711  C  CA    . GLN D 1 313  ? 103.812 106.951 93.627  1.00 0.00   ? 313  GLN D CA    1 
ATOM   9712  C  C     . GLN D 1 313  ? 104.347 108.307 94.080  1.00 0.00   ? 313  GLN D C     1 
ATOM   9713  O  O     . GLN D 1 313  ? 105.537 108.590 93.940  1.00 0.00   ? 313  GLN D O     1 
ATOM   9714  C  CB    . GLN D 1 313  ? 103.803 106.002 94.835  1.00 0.00   ? 313  GLN D CB    1 
ATOM   9715  C  CG    . GLN D 1 313  ? 103.071 104.680 94.644  1.00 0.00   ? 313  GLN D CG    1 
ATOM   9716  C  CD    . GLN D 1 313  ? 103.056 103.847 95.914  1.00 0.00   ? 313  GLN D CD    1 
ATOM   9717  O  OE1   . GLN D 1 313  ? 102.579 104.294 96.958  1.00 0.00   ? 313  GLN D OE1   1 
ATOM   9718  N  NE2   . GLN D 1 313  ? 103.579 102.629 95.832  1.00 0.00   ? 313  GLN D NE2   1 
ATOM   9719  N  N     . ARG D 1 314  ? 103.437 109.126 94.592  1.00 0.00   ? 314  ARG D N     1 
ATOM   9720  C  CA    . ARG D 1 314  ? 103.743 110.461 95.075  1.00 0.00   ? 314  ARG D CA    1 
ATOM   9721  C  C     . ARG D 1 314  ? 103.135 110.687 96.456  1.00 0.00   ? 314  ARG D C     1 
ATOM   9722  O  O     . ARG D 1 314  ? 102.440 109.823 96.993  1.00 0.00   ? 314  ARG D O     1 
ATOM   9723  C  CB    . ARG D 1 314  ? 103.194 111.486 94.096  1.00 0.00   ? 314  ARG D CB    1 
ATOM   9724  C  CG    . ARG D 1 314  ? 101.813 111.125 93.596  1.00 0.00   ? 314  ARG D CG    1 
ATOM   9725  C  CD    . ARG D 1 314  ? 101.464 111.867 92.320  1.00 0.00   ? 314  ARG D CD    1 
ATOM   9726  N  NE    . ARG D 1 314  ? 100.118 111.533 91.870  1.00 0.00   ? 314  ARG D NE    1 
ATOM   9727  C  CZ    . ARG D 1 314  ? 99.011  111.860 92.527  1.00 0.00   ? 314  ARG D CZ    1 
ATOM   9728  N  NH1   . ARG D 1 314  ? 99.089  112.530 93.667  1.00 0.00   ? 314  ARG D NH1   1 
ATOM   9729  N  NH2   . ARG D 1 314  ? 97.827  111.515 92.047  1.00 0.00   ? 314  ARG D NH2   1 
ATOM   9730  N  N     . PHE D 1 315  ? 103.385 111.855 97.029  1.00 0.00   ? 315  PHE D N     1 
ATOM   9731  C  CA    . PHE D 1 315  ? 102.868 112.147 98.358  1.00 0.00   ? 315  PHE D CA    1 
ATOM   9732  C  C     . PHE D 1 315  ? 101.513 112.825 98.363  1.00 0.00   ? 315  PHE D C     1 
ATOM   9733  O  O     . PHE D 1 315  ? 101.197 113.621 97.484  1.00 0.00   ? 315  PHE D O     1 
ATOM   9734  C  CB    . PHE D 1 315  ? 103.874 112.974 99.148  1.00 0.00   ? 315  PHE D CB    1 
ATOM   9735  C  CG    . PHE D 1 315  ? 104.971 112.156 99.746  1.00 0.00   ? 315  PHE D CG    1 
ATOM   9736  C  CD1   . PHE D 1 315  ? 105.903 111.537 98.939  1.00 0.00   ? 315  PHE D CD1   1 
ATOM   9737  C  CD2   . PHE D 1 315  ? 105.061 111.994 101.113 1.00 0.00   ? 315  PHE D CD2   1 
ATOM   9738  C  CE1   . PHE D 1 315  ? 106.912 110.776 99.485  1.00 0.00   ? 315  PHE D CE1   1 
ATOM   9739  C  CE2   . PHE D 1 315  ? 106.067 111.235 101.667 1.00 0.00   ? 315  PHE D CE2   1 
ATOM   9740  C  CZ    . PHE D 1 315  ? 106.994 110.624 100.851 1.00 0.00   ? 315  PHE D CZ    1 
ATOM   9741  N  N     . VAL D 1 316  ? 100.717 112.496 99.371  1.00 0.00   ? 316  VAL D N     1 
ATOM   9742  C  CA    . VAL D 1 316  ? 99.382  113.063 99.530  1.00 0.00   ? 316  VAL D CA    1 
ATOM   9743  C  C     . VAL D 1 316  ? 99.542  114.415 100.228 1.00 0.00   ? 316  VAL D C     1 
ATOM   9744  O  O     . VAL D 1 316  ? 100.354 114.552 101.142 1.00 0.00   ? 316  VAL D O     1 
ATOM   9745  C  CB    . VAL D 1 316  ? 98.490  112.161 100.421 1.00 0.00   ? 316  VAL D CB    1 
ATOM   9746  C  CG1   . VAL D 1 316  ? 97.159  112.838 100.666 1.00 0.00   ? 316  VAL D CG1   1 
ATOM   9747  C  CG2   . VAL D 1 316  ? 98.275  110.804 99.762  1.00 0.00   ? 316  VAL D CG2   1 
ATOM   9748  N  N     . PRO D 1 317  ? 98.769  115.430 99.811  1.00 0.00   ? 317  PRO D N     1 
ATOM   9749  C  CA    . PRO D 1 317  ? 98.911  116.731 100.471 1.00 0.00   ? 317  PRO D CA    1 
ATOM   9750  C  C     . PRO D 1 317  ? 98.652  116.641 101.970 1.00 0.00   ? 317  PRO D C     1 
ATOM   9751  O  O     . PRO D 1 317  ? 97.710  115.979 102.409 1.00 0.00   ? 317  PRO D O     1 
ATOM   9752  C  CB    . PRO D 1 317  ? 97.875  117.590 99.759  1.00 0.00   ? 317  PRO D CB    1 
ATOM   9753  C  CG    . PRO D 1 317  ? 97.877  117.020 98.373  1.00 0.00   ? 317  PRO D CG    1 
ATOM   9754  C  CD    . PRO D 1 317  ? 97.878  115.533 98.643  1.00 0.00   ? 317  PRO D CD    1 
ATOM   9755  N  N     . ILE D 1 318  ? 99.490  117.310 102.758 1.00 0.00   ? 318  ILE D N     1 
ATOM   9756  C  CA    . ILE D 1 318  ? 99.365  117.288 104.214 1.00 0.00   ? 318  ILE D CA    1 
ATOM   9757  C  C     . ILE D 1 318  ? 98.678  118.530 104.776 1.00 0.00   ? 318  ILE D C     1 
ATOM   9758  O  O     . ILE D 1 318  ? 97.811  118.429 105.641 1.00 0.00   ? 318  ILE D O     1 
ATOM   9759  C  CB    . ILE D 1 318  ? 100.752 117.157 104.871 1.00 0.00   ? 318  ILE D CB    1 
ATOM   9760  C  CG1   . ILE D 1 318  ? 101.454 115.908 104.347 1.00 0.00   ? 318  ILE D CG1   1 
ATOM   9761  C  CG2   . ILE D 1 318  ? 100.603 117.066 106.380 1.00 0.00   ? 318  ILE D CG2   1 
ATOM   9762  C  CD1   . ILE D 1 318  ? 100.721 114.633 104.654 1.00 0.00   ? 318  ILE D CD1   1 
ATOM   9763  N  N     . VAL D 1 319  ? 99.080  119.701 104.286 1.00 0.00   ? 319  VAL D N     1 
ATOM   9764  C  CA    . VAL D 1 319  ? 98.532  120.965 104.766 1.00 0.00   ? 319  VAL D CA    1 
ATOM   9765  C  C     . VAL D 1 319  ? 97.137  121.323 104.254 1.00 0.00   ? 319  VAL D C     1 
ATOM   9766  O  O     . VAL D 1 319  ? 96.882  121.328 103.051 1.00 0.00   ? 319  VAL D O     1 
ATOM   9767  C  CB    . VAL D 1 319  ? 99.466  122.148 104.420 1.00 0.00   ? 319  VAL D CB    1 
ATOM   9768  C  CG1   . VAL D 1 319  ? 98.872  123.448 104.947 1.00 0.00   ? 319  VAL D CG1   1 
ATOM   9769  C  CG2   . VAL D 1 319  ? 100.842 121.921 105.018 1.00 0.00   ? 319  VAL D CG2   1 
ATOM   9770  N  N     . ALA D 1 320  ? 96.245  121.636 105.189 1.00 0.00   ? 320  ALA D N     1 
ATOM   9771  C  CA    . ALA D 1 320  ? 94.885  122.043 104.875 1.00 0.00   ? 320  ALA D CA    1 
ATOM   9772  C  C     . ALA D 1 320  ? 94.801  123.510 105.286 1.00 0.00   ? 320  ALA D C     1 
ATOM   9773  O  O     . ALA D 1 320  ? 95.826  124.112 105.600 1.00 0.00   ? 320  ALA D O     1 
ATOM   9774  C  CB    . ALA D 1 320  ? 93.881  121.212 105.663 1.00 0.00   ? 320  ALA D CB    1 
ATOM   9775  N  N     . GLU D 1 321  ? 93.606  124.090 105.294 1.00 0.00   ? 321  GLU D N     1 
ATOM   9776  C  CA    . GLU D 1 321  ? 93.480  125.490 105.685 1.00 0.00   ? 321  GLU D CA    1 
ATOM   9777  C  C     . GLU D 1 321  ? 92.211  125.811 106.463 1.00 0.00   ? 321  GLU D C     1 
ATOM   9778  O  O     . GLU D 1 321  ? 91.099  125.534 106.004 1.00 0.00   ? 321  GLU D O     1 
ATOM   9779  C  CB    . GLU D 1 321  ? 93.552  126.396 104.447 1.00 0.00   ? 321  GLU D CB    1 
ATOM   9780  C  CG    . GLU D 1 321  ? 93.750  127.876 104.770 1.00 0.00   ? 321  GLU D CG    1 
ATOM   9781  C  CD    . GLU D 1 321  ? 93.712  128.768 103.539 1.00 0.00   ? 321  GLU D CD    1 
ATOM   9782  O  OE1   . GLU D 1 321  ? 94.422  128.465 102.555 1.00 0.00   ? 321  GLU D OE1   1 
ATOM   9783  O  OE2   . GLU D 1 321  ? 92.978  129.782 103.560 1.00 0.00   ? 321  GLU D OE2   1 
ATOM   9784  N  N     . GLU D 1 322  ? 92.382  126.384 107.650 1.00 0.00   ? 322  GLU D N     1 
ATOM   9785  C  CA    . GLU D 1 322  ? 91.248  126.782 108.479 1.00 0.00   ? 322  GLU D CA    1 
ATOM   9786  C  C     . GLU D 1 322  ? 90.983  128.237 108.104 1.00 0.00   ? 322  GLU D C     1 
ATOM   9787  O  O     . GLU D 1 322  ? 91.781  128.844 107.391 1.00 0.00   ? 322  GLU D O     1 
ATOM   9788  C  CB    . GLU D 1 322  ? 91.600  126.658 109.971 1.00 0.00   ? 322  GLU D CB    1 
ATOM   9789  C  CG    . GLU D 1 322  ? 92.014  125.249 110.389 1.00 0.00   ? 322  GLU D CG    1 
ATOM   9790  C  CD    . GLU D 1 322  ? 92.171  125.085 111.892 1.00 0.00   ? 322  GLU D CD    1 
ATOM   9791  O  OE1   . GLU D 1 322  ? 92.256  126.107 112.606 1.00 0.00   ? 322  GLU D OE1   1 
ATOM   9792  O  OE2   . GLU D 1 322  ? 92.219  123.926 112.364 1.00 0.00   ? 322  GLU D OE2   1 
ATOM   9793  N  N     . ASP D 1 323  ? 89.874  128.803 108.564 1.00 0.00   ? 323  ASP D N     1 
ATOM   9794  C  CA    . ASP D 1 323  ? 89.555  130.183 108.227 1.00 0.00   ? 323  ASP D CA    1 
ATOM   9795  C  C     . ASP D 1 323  ? 90.610  131.180 108.701 1.00 0.00   ? 323  ASP D C     1 
ATOM   9796  O  O     . ASP D 1 323  ? 90.798  132.231 108.089 1.00 0.00   ? 323  ASP D O     1 
ATOM   9797  C  CB    . ASP D 1 323  ? 88.195  130.576 108.804 1.00 0.00   ? 323  ASP D CB    1 
ATOM   9798  C  CG    . ASP D 1 323  ? 87.069  129.724 108.266 1.00 0.00   ? 323  ASP D CG    1 
ATOM   9799  O  OD1   . ASP D 1 323  ? 87.144  129.315 107.085 1.00 0.00   ? 323  ASP D OD1   1 
ATOM   9800  O  OD2   . ASP D 1 323  ? 86.100  129.472 109.015 1.00 0.00   ? 323  ASP D OD2   1 
ATOM   9801  N  N     . GLY D 1 324  ? 91.299  130.846 109.785 1.00 0.00   ? 324  GLY D N     1 
ATOM   9802  C  CA    . GLY D 1 324  ? 92.311  131.746 110.308 1.00 0.00   ? 324  GLY D CA    1 
ATOM   9803  C  C     . GLY D 1 324  ? 93.755  131.305 110.188 1.00 0.00   ? 324  GLY D C     1 
ATOM   9804  O  O     . GLY D 1 324  ? 94.662  132.131 110.296 1.00 0.00   ? 324  GLY D O     1 
ATOM   9805  N  N     . ARG D 1 325  ? 93.990  130.017 109.956 1.00 0.00   ? 325  ARG D N     1 
ATOM   9806  C  CA    . ARG D 1 325  ? 95.361  129.527 109.858 1.00 0.00   ? 325  ARG D CA    1 
ATOM   9807  C  C     . ARG D 1 325  ? 95.535  128.346 108.911 1.00 0.00   ? 325  ARG D C     1 
ATOM   9808  O  O     . ARG D 1 325  ? 94.594  127.911 108.247 1.00 0.00   ? 325  ARG D O     1 
ATOM   9809  C  CB    . ARG D 1 325  ? 95.855  129.129 111.251 1.00 0.00   ? 325  ARG D CB    1 
ATOM   9810  C  CG    . ARG D 1 325  ? 95.068  127.984 111.903 1.00 0.00   ? 325  ARG D CG    1 
ATOM   9811  C  CD    . ARG D 1 325  ? 95.526  127.737 113.341 1.00 0.00   ? 325  ARG D CD    1 
ATOM   9812  N  NE    . ARG D 1 325  ? 95.271  128.891 114.199 1.00 0.00   ? 325  ARG D NE    1 
ATOM   9813  C  CZ    . ARG D 1 325  ? 94.062  129.324 114.541 1.00 0.00   ? 325  ARG D CZ    1 
ATOM   9814  N  NH1   . ARG D 1 325  ? 92.975  128.700 114.102 1.00 0.00   ? 325  ARG D NH1   1 
ATOM   9815  N  NH2   . ARG D 1 325  ? 93.938  130.394 115.316 1.00 0.00   ? 325  ARG D NH2   1 
ATOM   9816  N  N     . TYR D 1 326  ? 96.771  127.854 108.850 1.00 0.00   ? 326  TYR D N     1 
ATOM   9817  C  CA    . TYR D 1 326  ? 97.117  126.706 108.027 1.00 0.00   ? 326  TYR D CA    1 
ATOM   9818  C  C     . TYR D 1 326  ? 97.281  125.536 108.988 1.00 0.00   ? 326  TYR D C     1 
ATOM   9819  O  O     . TYR D 1 326  ? 97.833  125.698 110.080 1.00 0.00   ? 326  TYR D O     1 
ATOM   9820  C  CB    . TYR D 1 326