data_6BCH
# 
_entry.id   6BCH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.299 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6BCH         
WWPDB D_1000230646 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6BCH 
_pdbx_database_status.recvd_initial_deposition_date   2017-10-20 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Brown, C.'        1 ? 
'Zhang, K.'        2 ? 
'McMurrough, T.A.' 3 ? 
'Gloor, G.B.'      4 ? 
'Edgell, D.R.'     5 ? 
'Junop, M.'        6 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'To Be Published' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            0353 
_citation.journal_id_ISSN           ? 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'I-LtrI E29D bound to cognate substrate (nicked complex)' 
_citation.year                      ? 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'McMurrough, T.A.' 1 ? 
primary 'Brown, C.'        2 ? 
primary 'Zhang, K.'        3 ? 
primary 'Junop, M.'        4 ? 
primary 'Gloor, G.B.'      5 ? 
primary 'Edgell, D.R.'     6 ? 
# 
_cell.angle_alpha                  90.03 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.03 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.22 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6BCH 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     43.760 
_cell.length_a_esd                 ? 
_cell.length_b                     66.315 
_cell.length_b_esd                 ? 
_cell.length_c                     169.924 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6BCH 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Ribosomal protein 3/homing endonuclease-like fusion protein'    36001.211 4  ? ? ? ? 
2 polymer syn 
;DNA (5'-D(*GP*GP*TP*CP*TP*AP*AP*AP*CP*GP*TP*CP*GP*TP*AP*T)-3')
;
4913.203  4  ? ? ? ? 
3 polymer syn 'DNA (26-MER)'                                                   7931.144  4  ? ? ? ? 
4 polymer syn 
;DNA (5'-D(*TP*AP*GP*GP*AP*GP*CP*AP*TP*TP*T)-3')
;
3388.233  4  ? ? ? ? 
5 water   nat water                                                            18.015    10 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;SYSTLANFPVQARNDNISPWTITGFADADSSFMLTVSKDSKRNTGWSVRPRFRIGLHNKDVTILKSIREYLGAGIITSDI
DARIRFESLKELEVVINHFDKYPLITQKRADYLLFKKAFYLIKNKEHLTEEGLNQILTLKASLNLGLSEELKEAFPNTIP
AERLLVTGQEIPDSNWVAGFTAGEGSFYIRIAKNSTLKTGYQVQSVFQITQDTRDIELMKNLISYLNCGNIRIRKYKGSE
GIHDTCVDLVVTNLNDIKEKIIPFFNKNHIIGVKLQDYRDWCKVVTLIDNKEHLTSEGLEKIQKIKEGMNRGRSL
;
;SYSTLANFPVQARNDNISPWTITGFADADSSFMLTVSKDSKRNTGWSVRPRFRIGLHNKDVTILKSIREYLGAGIITSDI
DARIRFESLKELEVVINHFDKYPLITQKRADYLLFKKAFYLIKNKEHLTEEGLNQILTLKASLNLGLSEELKEAFPNTIP
AERLLVTGQEIPDSNWVAGFTAGEGSFYIRIAKNSTLKTGYQVQSVFQITQDTRDIELMKNLISYLNCGNIRIRKYKGSE
GIHDTCVDLVVTNLNDIKEKIIPFFNKNHIIGVKLQDYRDWCKVVTLIDNKEHLTSEGLEKIQKIKEGMNRGRSL
;
A,D,H,L ? 
2 polydeoxyribonucleotide no no '(DG)(DG)(DT)(DC)(DT)(DA)(DA)(DA)(DC)(DG)(DT)(DC)(DG)(DT)(DA)(DT)' GGTCTAAACGTCGTAT B,E,I,N ? 
3 polydeoxyribonucleotide no no 
;(DC)(DA)(DA)(DA)(DT)(DG)(DC)(DT)(DC)(DC)(DT)(DA)(DT)(DA)(DC)(DG)(DA)(DC)(DG)(DT)
(DT)(DT)(DA)(DG)(DA)(DC)
;
CAAATGCTCCTATACGACGTTTAGAC C,F,J,O ? 
4 polydeoxyribonucleotide no no '(DT)(DA)(DG)(DG)(DA)(DG)(DC)(DA)(DT)(DT)(DT)' TAGGAGCATTT X,G,K,P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   TYR n 
1 3   SER n 
1 4   THR n 
1 5   LEU n 
1 6   ALA n 
1 7   ASN n 
1 8   PHE n 
1 9   PRO n 
1 10  VAL n 
1 11  GLN n 
1 12  ALA n 
1 13  ARG n 
1 14  ASN n 
1 15  ASP n 
1 16  ASN n 
1 17  ILE n 
1 18  SER n 
1 19  PRO n 
1 20  TRP n 
1 21  THR n 
1 22  ILE n 
1 23  THR n 
1 24  GLY n 
1 25  PHE n 
1 26  ALA n 
1 27  ASP n 
1 28  ALA n 
1 29  ASP n 
1 30  SER n 
1 31  SER n 
1 32  PHE n 
1 33  MET n 
1 34  LEU n 
1 35  THR n 
1 36  VAL n 
1 37  SER n 
1 38  LYS n 
1 39  ASP n 
1 40  SER n 
1 41  LYS n 
1 42  ARG n 
1 43  ASN n 
1 44  THR n 
1 45  GLY n 
1 46  TRP n 
1 47  SER n 
1 48  VAL n 
1 49  ARG n 
1 50  PRO n 
1 51  ARG n 
1 52  PHE n 
1 53  ARG n 
1 54  ILE n 
1 55  GLY n 
1 56  LEU n 
1 57  HIS n 
1 58  ASN n 
1 59  LYS n 
1 60  ASP n 
1 61  VAL n 
1 62  THR n 
1 63  ILE n 
1 64  LEU n 
1 65  LYS n 
1 66  SER n 
1 67  ILE n 
1 68  ARG n 
1 69  GLU n 
1 70  TYR n 
1 71  LEU n 
1 72  GLY n 
1 73  ALA n 
1 74  GLY n 
1 75  ILE n 
1 76  ILE n 
1 77  THR n 
1 78  SER n 
1 79  ASP n 
1 80  ILE n 
1 81  ASP n 
1 82  ALA n 
1 83  ARG n 
1 84  ILE n 
1 85  ARG n 
1 86  PHE n 
1 87  GLU n 
1 88  SER n 
1 89  LEU n 
1 90  LYS n 
1 91  GLU n 
1 92  LEU n 
1 93  GLU n 
1 94  VAL n 
1 95  VAL n 
1 96  ILE n 
1 97  ASN n 
1 98  HIS n 
1 99  PHE n 
1 100 ASP n 
1 101 LYS n 
1 102 TYR n 
1 103 PRO n 
1 104 LEU n 
1 105 ILE n 
1 106 THR n 
1 107 GLN n 
1 108 LYS n 
1 109 ARG n 
1 110 ALA n 
1 111 ASP n 
1 112 TYR n 
1 113 LEU n 
1 114 LEU n 
1 115 PHE n 
1 116 LYS n 
1 117 LYS n 
1 118 ALA n 
1 119 PHE n 
1 120 TYR n 
1 121 LEU n 
1 122 ILE n 
1 123 LYS n 
1 124 ASN n 
1 125 LYS n 
1 126 GLU n 
1 127 HIS n 
1 128 LEU n 
1 129 THR n 
1 130 GLU n 
1 131 GLU n 
1 132 GLY n 
1 133 LEU n 
1 134 ASN n 
1 135 GLN n 
1 136 ILE n 
1 137 LEU n 
1 138 THR n 
1 139 LEU n 
1 140 LYS n 
1 141 ALA n 
1 142 SER n 
1 143 LEU n 
1 144 ASN n 
1 145 LEU n 
1 146 GLY n 
1 147 LEU n 
1 148 SER n 
1 149 GLU n 
1 150 GLU n 
1 151 LEU n 
1 152 LYS n 
1 153 GLU n 
1 154 ALA n 
1 155 PHE n 
1 156 PRO n 
1 157 ASN n 
1 158 THR n 
1 159 ILE n 
1 160 PRO n 
1 161 ALA n 
1 162 GLU n 
1 163 ARG n 
1 164 LEU n 
1 165 LEU n 
1 166 VAL n 
1 167 THR n 
1 168 GLY n 
1 169 GLN n 
1 170 GLU n 
1 171 ILE n 
1 172 PRO n 
1 173 ASP n 
1 174 SER n 
1 175 ASN n 
1 176 TRP n 
1 177 VAL n 
1 178 ALA n 
1 179 GLY n 
1 180 PHE n 
1 181 THR n 
1 182 ALA n 
1 183 GLY n 
1 184 GLU n 
1 185 GLY n 
1 186 SER n 
1 187 PHE n 
1 188 TYR n 
1 189 ILE n 
1 190 ARG n 
1 191 ILE n 
1 192 ALA n 
1 193 LYS n 
1 194 ASN n 
1 195 SER n 
1 196 THR n 
1 197 LEU n 
1 198 LYS n 
1 199 THR n 
1 200 GLY n 
1 201 TYR n 
1 202 GLN n 
1 203 VAL n 
1 204 GLN n 
1 205 SER n 
1 206 VAL n 
1 207 PHE n 
1 208 GLN n 
1 209 ILE n 
1 210 THR n 
1 211 GLN n 
1 212 ASP n 
1 213 THR n 
1 214 ARG n 
1 215 ASP n 
1 216 ILE n 
1 217 GLU n 
1 218 LEU n 
1 219 MET n 
1 220 LYS n 
1 221 ASN n 
1 222 LEU n 
1 223 ILE n 
1 224 SER n 
1 225 TYR n 
1 226 LEU n 
1 227 ASN n 
1 228 CYS n 
1 229 GLY n 
1 230 ASN n 
1 231 ILE n 
1 232 ARG n 
1 233 ILE n 
1 234 ARG n 
1 235 LYS n 
1 236 TYR n 
1 237 LYS n 
1 238 GLY n 
1 239 SER n 
1 240 GLU n 
1 241 GLY n 
1 242 ILE n 
1 243 HIS n 
1 244 ASP n 
1 245 THR n 
1 246 CYS n 
1 247 VAL n 
1 248 ASP n 
1 249 LEU n 
1 250 VAL n 
1 251 VAL n 
1 252 THR n 
1 253 ASN n 
1 254 LEU n 
1 255 ASN n 
1 256 ASP n 
1 257 ILE n 
1 258 LYS n 
1 259 GLU n 
1 260 LYS n 
1 261 ILE n 
1 262 ILE n 
1 263 PRO n 
1 264 PHE n 
1 265 PHE n 
1 266 ASN n 
1 267 LYS n 
1 268 ASN n 
1 269 HIS n 
1 270 ILE n 
1 271 ILE n 
1 272 GLY n 
1 273 VAL n 
1 274 LYS n 
1 275 LEU n 
1 276 GLN n 
1 277 ASP n 
1 278 TYR n 
1 279 ARG n 
1 280 ASP n 
1 281 TRP n 
1 282 CYS n 
1 283 LYS n 
1 284 VAL n 
1 285 VAL n 
1 286 THR n 
1 287 LEU n 
1 288 ILE n 
1 289 ASP n 
1 290 ASN n 
1 291 LYS n 
1 292 GLU n 
1 293 HIS n 
1 294 LEU n 
1 295 THR n 
1 296 SER n 
1 297 GLU n 
1 298 GLY n 
1 299 LEU n 
1 300 GLU n 
1 301 LYS n 
1 302 ILE n 
1 303 GLN n 
1 304 LYS n 
1 305 ILE n 
1 306 LYS n 
1 307 GLU n 
1 308 GLY n 
1 309 MET n 
1 310 ASN n 
1 311 ARG n 
1 312 GLY n 
1 313 ARG n 
1 314 SER n 
1 315 LEU n 
2 1   DG  n 
2 2   DG  n 
2 3   DT  n 
2 4   DC  n 
2 5   DT  n 
2 6   DA  n 
2 7   DA  n 
2 8   DA  n 
2 9   DC  n 
2 10  DG  n 
2 11  DT  n 
2 12  DC  n 
2 13  DG  n 
2 14  DT  n 
2 15  DA  n 
2 16  DT  n 
3 1   DC  n 
3 2   DA  n 
3 3   DA  n 
3 4   DA  n 
3 5   DT  n 
3 6   DG  n 
3 7   DC  n 
3 8   DT  n 
3 9   DC  n 
3 10  DC  n 
3 11  DT  n 
3 12  DA  n 
3 13  DT  n 
3 14  DA  n 
3 15  DC  n 
3 16  DG  n 
3 17  DA  n 
3 18  DC  n 
3 19  DG  n 
3 20  DT  n 
3 21  DT  n 
3 22  DT  n 
3 23  DA  n 
3 24  DG  n 
3 25  DA  n 
3 26  DC  n 
4 1   DT  n 
4 2   DA  n 
4 3   DG  n 
4 4   DG  n 
4 5   DA  n 
4 6   DG  n 
4 7   DC  n 
4 8   DA  n 
4 9   DT  n 
4 10  DT  n 
4 11  DT  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   315 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'HEG fusion, rps3' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Leptographium truncatum' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     330483 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 16 'Leptographium truncatum' ? 330483 ? 
3 1 sample 1 26 'Leptographium truncatum' ? 330483 ? 
4 1 sample 1 11 'Leptographium truncatum' ? 330483 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP C7SWF3_9PEZI C7SWF3 ? 1 
;SYSTLANFPVQARNDNISPWTITGFADAESSFMLTVSKDSKRNTGWSVRPRFRIGLHNKDVTILKSIREYLGAGIITSDI
DARIRFESLKELEVVINHFDKYPLITQKRADYLLFKKAFYLIKNKEHLTEEGLNQILTLKASLNLGLSEELKEAFPNTIP
AERLLVTGQEIPDSNWVAGFTAGEGSFYIRIAKNSTLKTGYQVQSVFQITQDTRDIELMKNLISYLNCGNIRIRKYKGSE
GIHDTCVDLVVTNLNDIKEKIIPFFNKNHIIGVKLQDYRDWCKVVTLIDNKEHLTSEGLEKIQKIKEGMNRGRSL
;
398 
2 PDB 6BCH         6BCH   ? 2 ? 1   
3 PDB 6BCH         6BCH   ? 3 ? 1   
4 PDB 6BCH         6BCH   ? 4 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6BCH A 1 ? 315 ? C7SWF3 398 ? 712 ? 1  315 
2  2 6BCH B 1 ? 16  ? 6BCH   1   ? 16  ? 1  16  
3  3 6BCH C 1 ? 26  ? 6BCH   1   ? 26  ? 1  26  
4  4 6BCH X 1 ? 11  ? 6BCH   16  ? 26  ? 16 26  
5  1 6BCH D 1 ? 315 ? C7SWF3 398 ? 712 ? 1  315 
6  2 6BCH E 1 ? 16  ? 6BCH   1   ? 16  ? 1  16  
7  3 6BCH F 1 ? 26  ? 6BCH   1   ? 26  ? 1  26  
8  4 6BCH G 1 ? 11  ? 6BCH   16  ? 26  ? 16 26  
9  1 6BCH H 1 ? 315 ? C7SWF3 398 ? 712 ? 1  315 
10 2 6BCH I 1 ? 16  ? 6BCH   1   ? 16  ? 1  16  
11 3 6BCH J 1 ? 26  ? 6BCH   1   ? 26  ? 1  26  
12 4 6BCH K 1 ? 11  ? 6BCH   16  ? 26  ? 16 26  
13 1 6BCH L 1 ? 315 ? C7SWF3 398 ? 712 ? 1  315 
14 2 6BCH N 1 ? 16  ? 6BCH   1   ? 16  ? 1  16  
15 3 6BCH O 1 ? 26  ? 6BCH   1   ? 26  ? 1  26  
16 4 6BCH P 1 ? 11  ? 6BCH   16  ? 26  ? 16 26  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  6BCH ASP A 29 ? UNP C7SWF3 GLU 426 'engineered mutation' 29 1 
5  6BCH ASP D 29 ? UNP C7SWF3 GLU 426 'engineered mutation' 29 2 
9  6BCH ASP H 29 ? UNP C7SWF3 GLU 426 'engineered mutation' 29 3 
13 6BCH ASP L 29 ? UNP C7SWF3 GLU 426 'engineered mutation' 29 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6BCH 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.36 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         47.88 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;0.1M TRIS pH 7.0
20% W/V PEG 2000 MME
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 S 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-12-10 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9798 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 17-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9798 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   17-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6BCH 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.00 
_reflns.d_resolution_low                 66.21 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       14038 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.9 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5.6 
_reflns.pdbx_Rmerge_I_obs                0.111 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            6.1 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.0000 
_reflns_shell.d_res_low                   3.0492 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.0 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        96.9 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             3.2 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6BCH 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.000 
_refine.ls_d_res_low                             38.913 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     14038 
_refine.ls_number_reflns_R_free                  1850 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    77.93 
_refine.ls_percent_reflns_R_free                 5.00 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2570 
_refine.ls_R_factor_R_free                       0.3065 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2543 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.96 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 38.47 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.48 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8593 
_refine_hist.pdbx_number_atoms_nucleic_acid   4252 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             10 
_refine_hist.number_atoms_total               12855 
_refine_hist.d_res_high                       3.000 
_refine_hist.d_res_low                        38.913 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.006  ? 13501 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.005  ? 19251 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 22.954 ? 5003  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.043  ? 2280  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.007  ? 1718  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 3.0000 3.0492  . . 140 2756 77.00 . . . 0.3965 . 0.3630 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0492 3.1017  . . 176 2568 76.00 . . . 0.5063 . 0.3565 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1017 3.1581  . . 107 2683 75.00 . . . 0.4684 . 0.3687 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1581 3.2188  . . 122 2302 70.00 . . . 0.5253 . 0.3038 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2188 3.2845  . . 166 2348 69.00 . . . 0.3466 . 0.2974 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2845 3.3559  . . 102 2505 70.00 . . . 0.5052 . 0.2859 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3559 3.4339  . . 194 2551 76.00 . . . 0.3717 . 0.2875 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4339 3.5197  . . 110 2637 77.00 . . . 0.5304 . 0.2862 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5197 3.6148  . . 101 2569 71.00 . . . 0.3548 . 0.2906 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6148 3.7211  . . 155 2445 73.00 . . . 0.2854 . 0.2727 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7211 3.8411  . . 129 2828 81.00 . . . 0.3837 . 0.2954 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8411 3.9783  . . 165 3029 85.00 . . . 0.3876 . 0.2985 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.9783 4.1374  . . 142 2855 84.00 . . . 0.3622 . 0.2780 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.1374 4.3254  . . 125 2951 85.00 . . . 0.2784 . 0.2473 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.3254 4.5532  . . 142 2877 84.00 . . . 0.2734 . 0.2452 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.5532 4.8379  . . 212 2840 82.00 . . . 0.3150 . 0.2341 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.8379 5.2107  . . 159 2769 80.00 . . . 0.2774 . 0.2280 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.2107 5.7336  . . 134 2617 77.00 . . . 0.2976 . 0.2380 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.7336 6.5598  . . 101 2551 72.00 . . . 0.2629 . 0.2502 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.5598 8.2517  . . 117 2776 80.00 . . . 0.2147 . 0.2242 . . . . . . . . . . 
'X-RAY DIFFRACTION' 8.2517 38.9158 . . 185 3219 93.00 . . . 0.1676 . 0.1838 . . . . . . . . . . 
# 
_struct.entry_id                     6BCH 
_struct.title                        'I-LtrI E29D bound to cognate substrate (nicked complex)' 
_struct.pdbx_descriptor              'Ribosomal protein 3/homing endonuclease-like fusion protein/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6BCH 
_struct_keywords.text            'Nucleid Acid, HYDROLASE, HYDROLASE-DNA complex' 
_struct_keywords.pdbx_keywords   HYDROLASE/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 1 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 1 ? 
J N N 2 ? 
K N N 3 ? 
L N N 4 ? 
M N N 1 ? 
N N N 2 ? 
O N N 3 ? 
P N N 4 ? 
Q N N 5 ? 
R N N 5 ? 
S N N 5 ? 
T N N 5 ? 
U N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 SER A 18  ? ASP A 29  ? SER A 18  ASP A 29  1 ? 12 
HELX_P HELX_P2  AA2 HIS A 57  ? LYS A 59  ? HIS A 57  LYS A 59  5 ? 3  
HELX_P HELX_P3  AA3 ASP A 60  ? GLY A 72  ? ASP A 60  GLY A 72  1 ? 13 
HELX_P HELX_P4  AA4 SER A 88  ? TYR A 102 ? SER A 88  TYR A 102 1 ? 15 
HELX_P HELX_P5  AA5 GLN A 107 ? ASN A 124 ? GLN A 107 ASN A 124 1 ? 18 
HELX_P HELX_P6  AA6 LYS A 125 ? LEU A 128 ? LYS A 125 LEU A 128 5 ? 4  
HELX_P HELX_P7  AA7 THR A 129 ? SER A 142 ? THR A 129 SER A 142 1 ? 14 
HELX_P HELX_P8  AA8 SER A 148 ? PHE A 155 ? SER A 148 PHE A 155 1 ? 8  
HELX_P HELX_P9  AA9 ASP A 173 ? GLU A 184 ? ASP A 173 GLU A 184 1 ? 12 
HELX_P HELX_P10 AB1 ASP A 215 ? ASN A 227 ? ASP A 215 ASN A 227 1 ? 13 
HELX_P HELX_P11 AB2 ASN A 253 ? LYS A 260 ? ASN A 253 LYS A 260 1 ? 8  
HELX_P HELX_P12 AB3 LYS A 260 ? ASN A 268 ? LYS A 260 ASN A 268 1 ? 9  
HELX_P HELX_P13 AB4 VAL A 273 ? ASN A 290 ? VAL A 273 ASN A 290 1 ? 18 
HELX_P HELX_P14 AB5 LYS A 291 ? LEU A 294 ? LYS A 291 LEU A 294 5 ? 4  
HELX_P HELX_P15 AB6 THR A 295 ? GLU A 307 ? THR A 295 GLU A 307 1 ? 13 
HELX_P HELX_P16 AB7 GLY A 308 ? ARG A 313 ? GLY A 308 ARG A 313 5 ? 6  
HELX_P HELX_P17 AB8 SER E 18  ? ASP E 29  ? SER D 18  ASP D 29  1 ? 12 
HELX_P HELX_P18 AB9 HIS E 57  ? LYS E 59  ? HIS D 57  LYS D 59  5 ? 3  
HELX_P HELX_P19 AC1 ASP E 60  ? GLY E 72  ? ASP D 60  GLY D 72  1 ? 13 
HELX_P HELX_P20 AC2 SER E 88  ? TYR E 102 ? SER D 88  TYR D 102 1 ? 15 
HELX_P HELX_P21 AC3 GLN E 107 ? ASN E 124 ? GLN D 107 ASN D 124 1 ? 18 
HELX_P HELX_P22 AC4 LYS E 125 ? LEU E 128 ? LYS D 125 LEU D 128 5 ? 4  
HELX_P HELX_P23 AC5 THR E 129 ? SER E 142 ? THR D 129 SER D 142 1 ? 14 
HELX_P HELX_P24 AC6 SER E 148 ? PHE E 155 ? SER D 148 PHE D 155 1 ? 8  
HELX_P HELX_P25 AC7 ASP E 173 ? GLU E 184 ? ASP D 173 GLU D 184 1 ? 12 
HELX_P HELX_P26 AC8 ASP E 215 ? ASN E 227 ? ASP D 215 ASN D 227 1 ? 13 
HELX_P HELX_P27 AC9 ASN E 253 ? LYS E 260 ? ASN D 253 LYS D 260 1 ? 8  
HELX_P HELX_P28 AD1 LYS E 260 ? ASN E 268 ? LYS D 260 ASN D 268 1 ? 9  
HELX_P HELX_P29 AD2 VAL E 273 ? ASN E 290 ? VAL D 273 ASN D 290 1 ? 18 
HELX_P HELX_P30 AD3 LYS E 291 ? LEU E 294 ? LYS D 291 LEU D 294 5 ? 4  
HELX_P HELX_P31 AD4 THR E 295 ? GLU E 307 ? THR D 295 GLU D 307 1 ? 13 
HELX_P HELX_P32 AD5 GLY E 308 ? ARG E 313 ? GLY D 308 ARG D 313 5 ? 6  
HELX_P HELX_P33 AD6 SER I 18  ? ASP I 29  ? SER H 18  ASP H 29  1 ? 12 
HELX_P HELX_P34 AD7 HIS I 57  ? LYS I 59  ? HIS H 57  LYS H 59  5 ? 3  
HELX_P HELX_P35 AD8 ASP I 60  ? GLY I 72  ? ASP H 60  GLY H 72  1 ? 13 
HELX_P HELX_P36 AD9 SER I 88  ? TYR I 102 ? SER H 88  TYR H 102 1 ? 15 
HELX_P HELX_P37 AE1 GLN I 107 ? ASN I 124 ? GLN H 107 ASN H 124 1 ? 18 
HELX_P HELX_P38 AE2 LYS I 125 ? LEU I 128 ? LYS H 125 LEU H 128 5 ? 4  
HELX_P HELX_P39 AE3 THR I 129 ? SER I 142 ? THR H 129 SER H 142 1 ? 14 
HELX_P HELX_P40 AE4 SER I 148 ? PHE I 155 ? SER H 148 PHE H 155 1 ? 8  
HELX_P HELX_P41 AE5 ASP I 173 ? GLU I 184 ? ASP H 173 GLU H 184 1 ? 12 
HELX_P HELX_P42 AE6 ASP I 215 ? ASN I 227 ? ASP H 215 ASN H 227 1 ? 13 
HELX_P HELX_P43 AE7 ASN I 253 ? LYS I 260 ? ASN H 253 LYS H 260 1 ? 8  
HELX_P HELX_P44 AE8 LYS I 260 ? ASN I 268 ? LYS H 260 ASN H 268 1 ? 9  
HELX_P HELX_P45 AE9 GLY I 272 ? ASN I 290 ? GLY H 272 ASN H 290 1 ? 19 
HELX_P HELX_P46 AF1 LYS I 291 ? LEU I 294 ? LYS H 291 LEU H 294 5 ? 4  
HELX_P HELX_P47 AF2 THR I 295 ? GLU I 307 ? THR H 295 GLU H 307 1 ? 13 
HELX_P HELX_P48 AF3 GLY I 308 ? ARG I 313 ? GLY H 308 ARG H 313 5 ? 6  
HELX_P HELX_P49 AF4 SER M 18  ? ASP M 29  ? SER L 18  ASP L 29  1 ? 12 
HELX_P HELX_P50 AF5 HIS M 57  ? LYS M 59  ? HIS L 57  LYS L 59  5 ? 3  
HELX_P HELX_P51 AF6 ASP M 60  ? GLY M 72  ? ASP L 60  GLY L 72  1 ? 13 
HELX_P HELX_P52 AF7 SER M 88  ? TYR M 102 ? SER L 88  TYR L 102 1 ? 15 
HELX_P HELX_P53 AF8 GLN M 107 ? ASN M 124 ? GLN L 107 ASN L 124 1 ? 18 
HELX_P HELX_P54 AF9 LYS M 125 ? LEU M 128 ? LYS L 125 LEU L 128 5 ? 4  
HELX_P HELX_P55 AG1 THR M 129 ? SER M 142 ? THR L 129 SER L 142 1 ? 14 
HELX_P HELX_P56 AG2 SER M 148 ? PHE M 155 ? SER L 148 PHE L 155 1 ? 8  
HELX_P HELX_P57 AG3 ASP M 173 ? GLU M 184 ? ASP L 173 GLU L 184 1 ? 12 
HELX_P HELX_P58 AG4 ASP M 215 ? ASN M 227 ? ASP L 215 ASN L 227 1 ? 13 
HELX_P HELX_P59 AG5 ASN M 253 ? LYS M 260 ? ASN L 253 LYS L 260 1 ? 8  
HELX_P HELX_P60 AG6 LYS M 260 ? ASN M 268 ? LYS L 260 ASN L 268 1 ? 9  
HELX_P HELX_P61 AG7 GLY M 272 ? ASN M 290 ? GLY L 272 ASN L 290 1 ? 19 
HELX_P HELX_P62 AG8 LYS M 291 ? LEU M 294 ? LYS L 291 LEU L 294 5 ? 4  
HELX_P HELX_P63 AG9 THR M 295 ? GLU M 307 ? THR L 295 GLU L 307 1 ? 13 
HELX_P HELX_P64 AH1 GLY M 308 ? ARG M 313 ? GLY L 308 ARG L 313 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1   hydrog ? ? B DG 2  N1 ? ? ? 1_555 C DC 26 N3 ? ? B DG 2  C DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2   hydrog ? ? B DG 2  N2 ? ? ? 1_555 C DC 26 O2 ? ? B DG 2  C DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3   hydrog ? ? B DG 2  O6 ? ? ? 1_555 C DC 26 N4 ? ? B DG 2  C DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4   hydrog ? ? B DT 3  N3 ? ? ? 1_555 C DA 25 N1 ? ? B DT 3  C DA 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5   hydrog ? ? B DT 3  O4 ? ? ? 1_555 C DA 25 N6 ? ? B DT 3  C DA 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6   hydrog ? ? B DC 4  N3 ? ? ? 1_555 C DG 24 N1 ? ? B DC 4  C DG 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7   hydrog ? ? B DC 4  N4 ? ? ? 1_555 C DG 24 O6 ? ? B DC 4  C DG 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8   hydrog ? ? B DC 4  O2 ? ? ? 1_555 C DG 24 N2 ? ? B DC 4  C DG 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9   hydrog ? ? B DT 5  N3 ? ? ? 1_555 C DA 23 N1 ? ? B DT 5  C DA 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10  hydrog ? ? B DT 5  O4 ? ? ? 1_555 C DA 23 N6 ? ? B DT 5  C DA 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11  hydrog ? ? B DA 6  N1 ? ? ? 1_555 C DT 22 N3 ? ? B DA 6  C DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12  hydrog ? ? B DA 6  N6 ? ? ? 1_555 C DT 22 O4 ? ? B DA 6  C DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13  hydrog ? ? B DA 7  N1 ? ? ? 1_555 C DT 21 N3 ? ? B DA 7  C DT 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14  hydrog ? ? B DA 7  N6 ? ? ? 1_555 C DT 21 O4 ? ? B DA 7  C DT 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15  hydrog ? ? B DA 8  N1 ? ? ? 1_555 C DT 20 N3 ? ? B DA 8  C DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16  hydrog ? ? B DA 8  N6 ? ? ? 1_555 C DT 20 O4 ? ? B DA 8  C DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17  hydrog ? ? B DC 9  N3 ? ? ? 1_555 C DG 19 N1 ? ? B DC 9  C DG 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18  hydrog ? ? B DC 9  N4 ? ? ? 1_555 C DG 19 O6 ? ? B DC 9  C DG 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19  hydrog ? ? B DC 9  O2 ? ? ? 1_555 C DG 19 N2 ? ? B DC 9  C DG 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20  hydrog ? ? B DG 10 N1 ? ? ? 1_555 C DC 18 N3 ? ? B DG 10 C DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21  hydrog ? ? B DG 10 N2 ? ? ? 1_555 C DC 18 O2 ? ? B DG 10 C DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22  hydrog ? ? B DG 10 O6 ? ? ? 1_555 C DC 18 N4 ? ? B DG 10 C DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23  hydrog ? ? B DT 11 N3 ? ? ? 1_555 C DA 17 N1 ? ? B DT 11 C DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24  hydrog ? ? B DT 11 O4 ? ? ? 1_555 C DA 17 N6 ? ? B DT 11 C DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25  hydrog ? ? B DC 12 N3 ? ? ? 1_555 C DG 16 N1 ? ? B DC 12 C DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26  hydrog ? ? B DC 12 N4 ? ? ? 1_555 C DG 16 O6 ? ? B DC 12 C DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27  hydrog ? ? B DC 12 O2 ? ? ? 1_555 C DG 16 N2 ? ? B DC 12 C DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28  hydrog ? ? B DG 13 N1 ? ? ? 1_555 C DC 15 N3 ? ? B DG 13 C DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29  hydrog ? ? B DG 13 N2 ? ? ? 1_555 C DC 15 O2 ? ? B DG 13 C DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30  hydrog ? ? B DG 13 O6 ? ? ? 1_555 C DC 15 N4 ? ? B DG 13 C DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31  hydrog ? ? B DA 15 N1 ? ? ? 1_555 C DT 13 N3 ? ? B DA 15 C DT 13 1_555 ? ? ? ? ? ? 'DA-DT PAIR' ? ? 
hydrog32  hydrog ? ? C DC 1  N3 ? ? ? 1_555 F DG 1  N1 ? ? C DC 1  E DG 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33  hydrog ? ? C DC 1  N4 ? ? ? 1_555 F DG 1  O6 ? ? C DC 1  E DG 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34  hydrog ? ? C DC 1  O2 ? ? ? 1_555 F DG 1  N2 ? ? C DC 1  E DG 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35  hydrog ? ? C DA 2  N1 ? ? ? 1_555 D DT 11 N3 ? ? C DA 2  X DT 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36  hydrog ? ? C DA 2  N6 ? ? ? 1_555 D DT 11 O4 ? ? C DA 2  X DT 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37  hydrog ? ? C DA 3  N1 ? ? ? 1_555 D DT 10 N3 ? ? C DA 3  X DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38  hydrog ? ? C DA 3  N6 ? ? ? 1_555 D DT 10 O4 ? ? C DA 3  X DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39  hydrog ? ? C DA 4  N1 ? ? ? 1_555 D DT 9  N3 ? ? C DA 4  X DT 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40  hydrog ? ? C DA 4  N6 ? ? ? 1_555 D DT 9  O4 ? ? C DA 4  X DT 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41  hydrog ? ? C DT 5  N3 ? ? ? 1_555 D DA 8  N1 ? ? C DT 5  X DA 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42  hydrog ? ? C DT 5  O4 ? ? ? 1_555 D DA 8  N6 ? ? C DT 5  X DA 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog43  hydrog ? ? C DG 6  N1 ? ? ? 1_555 D DC 7  N3 ? ? C DG 6  X DC 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog44  hydrog ? ? C DG 6  N2 ? ? ? 1_555 D DC 7  O2 ? ? C DG 6  X DC 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45  hydrog ? ? C DG 6  O6 ? ? ? 1_555 D DC 7  N4 ? ? C DG 6  X DC 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46  hydrog ? ? C DC 7  N3 ? ? ? 1_555 D DG 6  N1 ? ? C DC 7  X DG 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog47  hydrog ? ? C DC 7  N4 ? ? ? 1_555 D DG 6  O6 ? ? C DC 7  X DG 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog48  hydrog ? ? C DC 7  O2 ? ? ? 1_555 D DG 6  N2 ? ? C DC 7  X DG 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog49  hydrog ? ? C DT 8  N3 ? ? ? 1_555 D DA 5  N1 ? ? C DT 8  X DA 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog50  hydrog ? ? C DT 8  O4 ? ? ? 1_555 D DA 5  N6 ? ? C DT 8  X DA 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog51  hydrog ? ? C DC 9  N3 ? ? ? 1_555 D DG 4  N1 ? ? C DC 9  X DG 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog52  hydrog ? ? C DC 9  N4 ? ? ? 1_555 D DG 4  O6 ? ? C DC 9  X DG 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog53  hydrog ? ? C DC 9  O2 ? ? ? 1_555 D DG 4  N2 ? ? C DC 9  X DG 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog54  hydrog ? ? C DC 10 N3 ? ? ? 1_555 D DG 3  N1 ? ? C DC 10 X DG 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog55  hydrog ? ? C DC 10 N4 ? ? ? 1_555 D DG 3  O6 ? ? C DC 10 X DG 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog56  hydrog ? ? C DC 10 O2 ? ? ? 1_555 D DG 3  N2 ? ? C DC 10 X DG 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog57  hydrog ? ? C DT 11 N3 ? ? ? 1_555 D DA 2  N1 ? ? C DT 11 X DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog58  hydrog ? ? C DT 11 O4 ? ? ? 1_555 D DA 2  N6 ? ? C DT 11 X DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog59  hydrog ? ? C DA 12 N1 ? ? ? 1_555 D DT 1  N3 ? ? C DA 12 X DT 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog60  hydrog ? ? C DA 12 N6 ? ? ? 1_555 D DT 1  O4 ? ? C DA 12 X DT 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog61  hydrog ? ? F DG 2  N1 ? ? ? 1_555 G DC 26 N3 ? ? E DG 2  F DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog62  hydrog ? ? F DG 2  N2 ? ? ? 1_555 G DC 26 O2 ? ? E DG 2  F DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog63  hydrog ? ? F DG 2  O6 ? ? ? 1_555 G DC 26 N4 ? ? E DG 2  F DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog64  hydrog ? ? F DT 3  N3 ? ? ? 1_555 G DA 25 N1 ? ? E DT 3  F DA 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog65  hydrog ? ? F DT 3  O4 ? ? ? 1_555 G DA 25 N6 ? ? E DT 3  F DA 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog66  hydrog ? ? F DC 4  N3 ? ? ? 1_555 G DG 24 N1 ? ? E DC 4  F DG 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog67  hydrog ? ? F DC 4  N4 ? ? ? 1_555 G DG 24 O6 ? ? E DC 4  F DG 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog68  hydrog ? ? F DC 4  O2 ? ? ? 1_555 G DG 24 N2 ? ? E DC 4  F DG 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog69  hydrog ? ? F DT 5  N3 ? ? ? 1_555 G DA 23 N1 ? ? E DT 5  F DA 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog70  hydrog ? ? F DT 5  O4 ? ? ? 1_555 G DA 23 N6 ? ? E DT 5  F DA 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog71  hydrog ? ? F DA 6  N1 ? ? ? 1_555 G DT 22 N3 ? ? E DA 6  F DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog72  hydrog ? ? F DA 6  N6 ? ? ? 1_555 G DT 22 O4 ? ? E DA 6  F DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog73  hydrog ? ? F DA 7  N1 ? ? ? 1_555 G DT 21 N3 ? ? E DA 7  F DT 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog74  hydrog ? ? F DA 7  N6 ? ? ? 1_555 G DT 21 O4 ? ? E DA 7  F DT 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog75  hydrog ? ? F DA 8  N1 ? ? ? 1_555 G DT 20 N3 ? ? E DA 8  F DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog76  hydrog ? ? F DA 8  N6 ? ? ? 1_555 G DT 20 O4 ? ? E DA 8  F DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog77  hydrog ? ? F DC 9  N3 ? ? ? 1_555 G DG 19 N1 ? ? E DC 9  F DG 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog78  hydrog ? ? F DC 9  N4 ? ? ? 1_555 G DG 19 O6 ? ? E DC 9  F DG 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog79  hydrog ? ? F DC 9  O2 ? ? ? 1_555 G DG 19 N2 ? ? E DC 9  F DG 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog80  hydrog ? ? F DG 10 N1 ? ? ? 1_555 G DC 18 N3 ? ? E DG 10 F DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog81  hydrog ? ? F DG 10 N2 ? ? ? 1_555 G DC 18 O2 ? ? E DG 10 F DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog82  hydrog ? ? F DG 10 O6 ? ? ? 1_555 G DC 18 N4 ? ? E DG 10 F DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog83  hydrog ? ? F DT 11 N3 ? ? ? 1_555 G DA 17 N1 ? ? E DT 11 F DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog84  hydrog ? ? F DT 11 O4 ? ? ? 1_555 G DA 17 N6 ? ? E DT 11 F DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog85  hydrog ? ? F DC 12 N3 ? ? ? 1_555 G DG 16 N1 ? ? E DC 12 F DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog86  hydrog ? ? F DC 12 N4 ? ? ? 1_555 G DG 16 O6 ? ? E DC 12 F DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog87  hydrog ? ? F DC 12 O2 ? ? ? 1_555 G DG 16 N2 ? ? E DC 12 F DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog88  hydrog ? ? F DG 13 N1 ? ? ? 1_555 G DC 15 N3 ? ? E DG 13 F DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog89  hydrog ? ? F DG 13 N2 ? ? ? 1_555 G DC 15 O2 ? ? E DG 13 F DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog90  hydrog ? ? F DG 13 O6 ? ? ? 1_555 G DC 15 N4 ? ? E DG 13 F DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog91  hydrog ? ? F DT 14 N3 ? ? ? 1_555 G DA 14 N1 ? ? E DT 14 F DA 14 1_555 ? ? ? ? ? ? 'DT-DA PAIR' ? ? 
hydrog92  hydrog ? ? F DA 15 N1 ? ? ? 1_555 G DT 13 N3 ? ? E DA 15 F DT 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog93  hydrog ? ? F DA 15 N6 ? ? ? 1_555 G DT 13 O4 ? ? E DA 15 F DT 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog94  hydrog ? ? G DA 2  N1 ? ? ? 1_555 H DT 11 N3 ? ? F DA 2  G DT 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog95  hydrog ? ? G DA 2  N6 ? ? ? 1_555 H DT 11 O4 ? ? F DA 2  G DT 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog96  hydrog ? ? G DA 3  N1 ? ? ? 1_555 H DT 10 N3 ? ? F DA 3  G DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog97  hydrog ? ? G DA 3  N6 ? ? ? 1_555 H DT 10 O4 ? ? F DA 3  G DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog98  hydrog ? ? G DA 4  N1 ? ? ? 1_555 H DT 9  N3 ? ? F DA 4  G DT 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog99  hydrog ? ? G DA 4  N6 ? ? ? 1_555 H DT 9  O4 ? ? F DA 4  G DT 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog100 hydrog ? ? G DT 5  N3 ? ? ? 1_555 H DA 8  N1 ? ? F DT 5  G DA 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog101 hydrog ? ? G DT 5  O4 ? ? ? 1_555 H DA 8  N6 ? ? F DT 5  G DA 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog102 hydrog ? ? G DG 6  N1 ? ? ? 1_555 H DC 7  N3 ? ? F DG 6  G DC 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog103 hydrog ? ? G DG 6  N2 ? ? ? 1_555 H DC 7  O2 ? ? F DG 6  G DC 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog104 hydrog ? ? G DG 6  O6 ? ? ? 1_555 H DC 7  N4 ? ? F DG 6  G DC 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog105 hydrog ? ? G DC 7  N3 ? ? ? 1_555 H DG 6  N1 ? ? F DC 7  G DG 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog106 hydrog ? ? G DC 7  N4 ? ? ? 1_555 H DG 6  O6 ? ? F DC 7  G DG 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog107 hydrog ? ? G DC 7  O2 ? ? ? 1_555 H DG 6  N2 ? ? F DC 7  G DG 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog108 hydrog ? ? G DT 8  N3 ? ? ? 1_555 H DA 5  N1 ? ? F DT 8  G DA 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog109 hydrog ? ? G DT 8  O4 ? ? ? 1_555 H DA 5  N6 ? ? F DT 8  G DA 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog110 hydrog ? ? G DC 9  N3 ? ? ? 1_555 H DG 4  N1 ? ? F DC 9  G DG 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog111 hydrog ? ? G DC 9  N4 ? ? ? 1_555 H DG 4  O6 ? ? F DC 9  G DG 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog112 hydrog ? ? G DC 9  O2 ? ? ? 1_555 H DG 4  N2 ? ? F DC 9  G DG 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog113 hydrog ? ? G DC 10 N3 ? ? ? 1_555 H DG 3  N1 ? ? F DC 10 G DG 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog114 hydrog ? ? G DC 10 N4 ? ? ? 1_555 H DG 3  O6 ? ? F DC 10 G DG 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog115 hydrog ? ? G DC 10 O2 ? ? ? 1_555 H DG 3  N2 ? ? F DC 10 G DG 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog116 hydrog ? ? G DT 11 N3 ? ? ? 1_555 H DA 2  N1 ? ? F DT 11 G DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog117 hydrog ? ? G DT 11 O4 ? ? ? 1_555 H DA 2  N6 ? ? F DT 11 G DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog118 hydrog ? ? G DA 12 N1 ? ? ? 1_555 H DT 1  N3 ? ? F DA 12 G DT 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog119 hydrog ? ? G DA 12 N6 ? ? ? 1_555 H DT 1  O4 ? ? F DA 12 G DT 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog120 hydrog ? ? J DG 2  N1 ? ? ? 1_555 K DC 26 N3 ? ? I DG 2  J DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog121 hydrog ? ? J DG 2  N2 ? ? ? 1_555 K DC 26 O2 ? ? I DG 2  J DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog122 hydrog ? ? J DG 2  O6 ? ? ? 1_555 K DC 26 N4 ? ? I DG 2  J DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog123 hydrog ? ? J DT 3  N3 ? ? ? 1_555 K DA 25 N1 ? ? I DT 3  J DA 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog124 hydrog ? ? J DT 3  O4 ? ? ? 1_555 K DA 25 N6 ? ? I DT 3  J DA 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog125 hydrog ? ? J DC 4  N3 ? ? ? 1_555 K DG 24 N1 ? ? I DC 4  J DG 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog126 hydrog ? ? J DC 4  N4 ? ? ? 1_555 K DG 24 O6 ? ? I DC 4  J DG 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog127 hydrog ? ? J DC 4  O2 ? ? ? 1_555 K DG 24 N2 ? ? I DC 4  J DG 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog128 hydrog ? ? J DT 5  N3 ? ? ? 1_555 K DA 23 N1 ? ? I DT 5  J DA 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog129 hydrog ? ? J DT 5  O4 ? ? ? 1_555 K DA 23 N6 ? ? I DT 5  J DA 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog130 hydrog ? ? J DA 6  N1 ? ? ? 1_555 K DT 22 N3 ? ? I DA 6  J DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog131 hydrog ? ? J DA 6  N6 ? ? ? 1_555 K DT 22 O4 ? ? I DA 6  J DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog132 hydrog ? ? J DA 7  N1 ? ? ? 1_555 K DT 21 N3 ? ? I DA 7  J DT 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog133 hydrog ? ? J DA 7  N6 ? ? ? 1_555 K DT 21 O4 ? ? I DA 7  J DT 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog134 hydrog ? ? J DA 8  N1 ? ? ? 1_555 K DT 20 N3 ? ? I DA 8  J DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog135 hydrog ? ? J DA 8  N6 ? ? ? 1_555 K DT 20 O4 ? ? I DA 8  J DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog136 hydrog ? ? J DC 9  N3 ? ? ? 1_555 K DG 19 N1 ? ? I DC 9  J DG 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog137 hydrog ? ? J DC 9  N4 ? ? ? 1_555 K DG 19 O6 ? ? I DC 9  J DG 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog138 hydrog ? ? J DC 9  O2 ? ? ? 1_555 K DG 19 N2 ? ? I DC 9  J DG 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog139 hydrog ? ? J DG 10 N1 ? ? ? 1_555 K DC 18 N3 ? ? I DG 10 J DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog140 hydrog ? ? J DG 10 N2 ? ? ? 1_555 K DC 18 O2 ? ? I DG 10 J DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog141 hydrog ? ? J DG 10 O6 ? ? ? 1_555 K DC 18 N4 ? ? I DG 10 J DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog142 hydrog ? ? J DT 11 N3 ? ? ? 1_555 K DA 17 N1 ? ? I DT 11 J DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog143 hydrog ? ? J DT 11 O4 ? ? ? 1_555 K DA 17 N6 ? ? I DT 11 J DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog144 hydrog ? ? J DC 12 N3 ? ? ? 1_555 K DG 16 N1 ? ? I DC 12 J DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog145 hydrog ? ? J DC 12 N4 ? ? ? 1_555 K DG 16 O6 ? ? I DC 12 J DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog146 hydrog ? ? J DC 12 O2 ? ? ? 1_555 K DG 16 N2 ? ? I DC 12 J DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog147 hydrog ? ? J DG 13 N1 ? ? ? 1_555 K DC 15 N3 ? ? I DG 13 J DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog148 hydrog ? ? J DG 13 N2 ? ? ? 1_555 K DC 15 O2 ? ? I DG 13 J DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog149 hydrog ? ? J DG 13 O6 ? ? ? 1_555 K DC 15 N4 ? ? I DG 13 J DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog150 hydrog ? ? J DT 14 N3 ? ? ? 1_555 K DA 14 N1 ? ? I DT 14 J DA 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog151 hydrog ? ? J DT 14 O4 ? ? ? 1_555 K DA 14 N6 ? ? I DT 14 J DA 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog152 hydrog ? ? J DA 15 N1 ? ? ? 1_555 K DT 13 N3 ? ? I DA 15 J DT 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog153 hydrog ? ? J DA 15 N6 ? ? ? 1_555 K DT 13 O4 ? ? I DA 15 J DT 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog154 hydrog ? ? K DC 1  N3 ? ? ? 1_555 N DG 1  N1 ? ? J DC 1  N DG 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog155 hydrog ? ? K DC 1  N4 ? ? ? 1_555 N DG 1  O6 ? ? J DC 1  N DG 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog156 hydrog ? ? K DC 1  O2 ? ? ? 1_555 N DG 1  N2 ? ? J DC 1  N DG 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog157 hydrog ? ? K DA 2  N1 ? ? ? 1_555 L DT 11 N3 ? ? J DA 2  K DT 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog158 hydrog ? ? K DA 2  N6 ? ? ? 1_555 L DT 11 O4 ? ? J DA 2  K DT 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog159 hydrog ? ? K DA 3  N1 ? ? ? 1_555 L DT 10 N3 ? ? J DA 3  K DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog160 hydrog ? ? K DA 3  N6 ? ? ? 1_555 L DT 10 O4 ? ? J DA 3  K DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog161 hydrog ? ? K DA 4  N1 ? ? ? 1_555 L DT 9  N3 ? ? J DA 4  K DT 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog162 hydrog ? ? K DA 4  N6 ? ? ? 1_555 L DT 9  O4 ? ? J DA 4  K DT 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog163 hydrog ? ? K DT 5  N3 ? ? ? 1_555 L DA 8  N1 ? ? J DT 5  K DA 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog164 hydrog ? ? K DT 5  O4 ? ? ? 1_555 L DA 8  N6 ? ? J DT 5  K DA 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog165 hydrog ? ? K DG 6  N1 ? ? ? 1_555 L DC 7  N3 ? ? J DG 6  K DC 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog166 hydrog ? ? K DG 6  N2 ? ? ? 1_555 L DC 7  O2 ? ? J DG 6  K DC 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog167 hydrog ? ? K DG 6  O6 ? ? ? 1_555 L DC 7  N4 ? ? J DG 6  K DC 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog168 hydrog ? ? K DC 7  N3 ? ? ? 1_555 L DG 6  N1 ? ? J DC 7  K DG 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog169 hydrog ? ? K DC 7  N4 ? ? ? 1_555 L DG 6  O6 ? ? J DC 7  K DG 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog170 hydrog ? ? K DC 7  O2 ? ? ? 1_555 L DG 6  N2 ? ? J DC 7  K DG 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog171 hydrog ? ? K DT 8  N3 ? ? ? 1_555 L DA 5  N1 ? ? J DT 8  K DA 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog172 hydrog ? ? K DT 8  O4 ? ? ? 1_555 L DA 5  N6 ? ? J DT 8  K DA 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog173 hydrog ? ? K DC 9  N3 ? ? ? 1_555 L DG 4  N1 ? ? J DC 9  K DG 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog174 hydrog ? ? K DC 9  N4 ? ? ? 1_555 L DG 4  O6 ? ? J DC 9  K DG 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog175 hydrog ? ? K DC 9  O2 ? ? ? 1_555 L DG 4  N2 ? ? J DC 9  K DG 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog176 hydrog ? ? K DC 10 N3 ? ? ? 1_555 L DG 3  N1 ? ? J DC 10 K DG 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog177 hydrog ? ? K DC 10 N4 ? ? ? 1_555 L DG 3  O6 ? ? J DC 10 K DG 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog178 hydrog ? ? K DC 10 O2 ? ? ? 1_555 L DG 3  N2 ? ? J DC 10 K DG 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog179 hydrog ? ? K DT 11 N3 ? ? ? 1_555 L DA 2  N1 ? ? J DT 11 K DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog180 hydrog ? ? K DT 11 O4 ? ? ? 1_555 L DA 2  N6 ? ? J DT 11 K DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog181 hydrog ? ? K DA 12 N1 ? ? ? 1_555 L DT 1  N3 ? ? J DA 12 K DT 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog182 hydrog ? ? K DA 12 N6 ? ? ? 1_555 L DT 1  O4 ? ? J DA 12 K DT 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog183 hydrog ? ? N DG 2  N1 ? ? ? 1_555 O DC 26 N3 ? ? N DG 2  O DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog184 hydrog ? ? N DG 2  N2 ? ? ? 1_555 O DC 26 O2 ? ? N DG 2  O DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog185 hydrog ? ? N DG 2  O6 ? ? ? 1_555 O DC 26 N4 ? ? N DG 2  O DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog186 hydrog ? ? N DT 3  N3 ? ? ? 1_555 O DA 25 N1 ? ? N DT 3  O DA 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog187 hydrog ? ? N DT 3  O4 ? ? ? 1_555 O DA 25 N6 ? ? N DT 3  O DA 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog188 hydrog ? ? N DC 4  N3 ? ? ? 1_555 O DG 24 N1 ? ? N DC 4  O DG 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog189 hydrog ? ? N DC 4  N4 ? ? ? 1_555 O DG 24 O6 ? ? N DC 4  O DG 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog190 hydrog ? ? N DC 4  O2 ? ? ? 1_555 O DG 24 N2 ? ? N DC 4  O DG 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog191 hydrog ? ? N DT 5  N3 ? ? ? 1_555 O DA 23 N1 ? ? N DT 5  O DA 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog192 hydrog ? ? N DT 5  O4 ? ? ? 1_555 O DA 23 N6 ? ? N DT 5  O DA 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog193 hydrog ? ? N DA 6  N1 ? ? ? 1_555 O DT 22 N3 ? ? N DA 6  O DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog194 hydrog ? ? N DA 6  N6 ? ? ? 1_555 O DT 22 O4 ? ? N DA 6  O DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog195 hydrog ? ? N DA 7  N1 ? ? ? 1_555 O DT 21 N3 ? ? N DA 7  O DT 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog196 hydrog ? ? N DA 7  N6 ? ? ? 1_555 O DT 21 O4 ? ? N DA 7  O DT 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog197 hydrog ? ? N DA 8  N1 ? ? ? 1_555 O DT 20 N3 ? ? N DA 8  O DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog198 hydrog ? ? N DA 8  N6 ? ? ? 1_555 O DT 20 O4 ? ? N DA 8  O DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog199 hydrog ? ? N DC 9  N3 ? ? ? 1_555 O DG 19 N1 ? ? N DC 9  O DG 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog200 hydrog ? ? N DC 9  N4 ? ? ? 1_555 O DG 19 O6 ? ? N DC 9  O DG 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog201 hydrog ? ? N DC 9  O2 ? ? ? 1_555 O DG 19 N2 ? ? N DC 9  O DG 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog202 hydrog ? ? N DG 10 N1 ? ? ? 1_555 O DC 18 N3 ? ? N DG 10 O DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog203 hydrog ? ? N DG 10 N2 ? ? ? 1_555 O DC 18 O2 ? ? N DG 10 O DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog204 hydrog ? ? N DG 10 O6 ? ? ? 1_555 O DC 18 N4 ? ? N DG 10 O DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog205 hydrog ? ? N DT 11 N3 ? ? ? 1_555 O DA 17 N1 ? ? N DT 11 O DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog206 hydrog ? ? N DT 11 O4 ? ? ? 1_555 O DA 17 N6 ? ? N DT 11 O DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog207 hydrog ? ? N DC 12 N3 ? ? ? 1_555 O DG 16 N1 ? ? N DC 12 O DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog208 hydrog ? ? N DC 12 N4 ? ? ? 1_555 O DG 16 O6 ? ? N DC 12 O DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog209 hydrog ? ? N DC 12 O2 ? ? ? 1_555 O DG 16 N2 ? ? N DC 12 O DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog210 hydrog ? ? N DG 13 N1 ? ? ? 1_555 O DC 15 N3 ? ? N DG 13 O DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog211 hydrog ? ? N DG 13 N2 ? ? ? 1_555 O DC 15 O2 ? ? N DG 13 O DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog212 hydrog ? ? N DG 13 O6 ? ? ? 1_555 O DC 15 N4 ? ? N DG 13 O DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog213 hydrog ? ? N DT 14 N3 ? ? ? 1_555 O DA 14 N1 ? ? N DT 14 O DA 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog214 hydrog ? ? N DT 14 O4 ? ? ? 1_555 O DA 14 N6 ? ? N DT 14 O DA 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog215 hydrog ? ? N DA 15 N1 ? ? ? 1_555 O DT 13 N3 ? ? N DA 15 O DT 13 1_555 ? ? ? ? ? ? 'DA-DT PAIR' ? ? 
hydrog216 hydrog ? ? O DA 2  N1 ? ? ? 1_555 P DT 11 N3 ? ? O DA 2  P DT 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog217 hydrog ? ? O DA 2  N6 ? ? ? 1_555 P DT 11 O4 ? ? O DA 2  P DT 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog218 hydrog ? ? O DA 3  N1 ? ? ? 1_555 P DT 10 N3 ? ? O DA 3  P DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog219 hydrog ? ? O DA 3  N6 ? ? ? 1_555 P DT 10 O4 ? ? O DA 3  P DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog220 hydrog ? ? O DA 4  N1 ? ? ? 1_555 P DT 9  N3 ? ? O DA 4  P DT 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog221 hydrog ? ? O DA 4  N6 ? ? ? 1_555 P DT 9  O4 ? ? O DA 4  P DT 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog222 hydrog ? ? O DT 5  N3 ? ? ? 1_555 P DA 8  N1 ? ? O DT 5  P DA 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog223 hydrog ? ? O DT 5  O4 ? ? ? 1_555 P DA 8  N6 ? ? O DT 5  P DA 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog224 hydrog ? ? O DG 6  N1 ? ? ? 1_555 P DC 7  N3 ? ? O DG 6  P DC 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog225 hydrog ? ? O DG 6  N2 ? ? ? 1_555 P DC 7  O2 ? ? O DG 6  P DC 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog226 hydrog ? ? O DG 6  O6 ? ? ? 1_555 P DC 7  N4 ? ? O DG 6  P DC 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog227 hydrog ? ? O DC 7  N3 ? ? ? 1_555 P DG 6  N1 ? ? O DC 7  P DG 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog228 hydrog ? ? O DC 7  N4 ? ? ? 1_555 P DG 6  O6 ? ? O DC 7  P DG 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog229 hydrog ? ? O DC 7  O2 ? ? ? 1_555 P DG 6  N2 ? ? O DC 7  P DG 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog230 hydrog ? ? O DT 8  N3 ? ? ? 1_555 P DA 5  N1 ? ? O DT 8  P DA 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog231 hydrog ? ? O DT 8  O4 ? ? ? 1_555 P DA 5  N6 ? ? O DT 8  P DA 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog232 hydrog ? ? O DC 9  N3 ? ? ? 1_555 P DG 4  N1 ? ? O DC 9  P DG 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog233 hydrog ? ? O DC 9  N4 ? ? ? 1_555 P DG 4  O6 ? ? O DC 9  P DG 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog234 hydrog ? ? O DC 9  O2 ? ? ? 1_555 P DG 4  N2 ? ? O DC 9  P DG 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog235 hydrog ? ? O DC 10 N3 ? ? ? 1_555 P DG 3  N1 ? ? O DC 10 P DG 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog236 hydrog ? ? O DC 10 N4 ? ? ? 1_555 P DG 3  O6 ? ? O DC 10 P DG 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog237 hydrog ? ? O DC 10 O2 ? ? ? 1_555 P DG 3  N2 ? ? O DC 10 P DG 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog238 hydrog ? ? O DT 11 N3 ? ? ? 1_555 P DA 2  N1 ? ? O DT 11 P DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog239 hydrog ? ? O DT 11 O4 ? ? ? 1_555 P DA 2  N6 ? ? O DT 11 P DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog240 hydrog ? ? O DA 12 N1 ? ? ? 1_555 P DT 1  N3 ? ? O DA 12 P DT 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog241 hydrog ? ? O DA 12 N6 ? ? ? 1_555 P DT 1  O4 ? ? O DA 12 P DT 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 4 ? 
AA3 ? 4 ? 
AA4 ? 4 ? 
AA5 ? 4 ? 
AA6 ? 4 ? 
AA7 ? 4 ? 
AA8 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 SER A 30  ? LYS A 38  ? SER A 30  LYS A 38  
AA1 2 TRP A 46  ? GLY A 55  ? TRP A 46  GLY A 55  
AA1 3 ALA A 82  ? PHE A 86  ? ALA A 82  PHE A 86  
AA1 4 ILE A 75  ? SER A 78  ? ILE A 75  SER A 78  
AA2 1 GLY A 185 ? LYS A 193 ? GLY A 185 LYS A 193 
AA2 2 TYR A 201 ? ASP A 212 ? TYR A 201 ASP A 212 
AA2 3 CYS A 246 ? VAL A 251 ? CYS A 246 VAL A 251 
AA2 4 ASN A 230 ? ILE A 233 ? ASN A 230 ILE A 233 
AA3 1 SER E 30  ? LYS E 38  ? SER D 30  LYS D 38  
AA3 2 TRP E 46  ? LEU E 56  ? TRP D 46  LEU D 56  
AA3 3 ALA E 82  ? PHE E 86  ? ALA D 82  PHE D 86  
AA3 4 ILE E 75  ? SER E 78  ? ILE D 75  SER D 78  
AA4 1 GLY E 185 ? LYS E 193 ? GLY D 185 LYS D 193 
AA4 2 TYR E 201 ? ASP E 212 ? TYR D 201 ASP D 212 
AA4 3 CYS E 246 ? VAL E 251 ? CYS D 246 VAL D 251 
AA4 4 ASN E 230 ? ILE E 233 ? ASN D 230 ILE D 233 
AA5 1 SER I 30  ? LYS I 38  ? SER H 30  LYS H 38  
AA5 2 TRP I 46  ? LEU I 56  ? TRP H 46  LEU H 56  
AA5 3 ALA I 82  ? PHE I 86  ? ALA H 82  PHE H 86  
AA5 4 ILE I 75  ? SER I 78  ? ILE H 75  SER H 78  
AA6 1 GLY I 185 ? LYS I 193 ? GLY H 185 LYS H 193 
AA6 2 TYR I 201 ? ASP I 212 ? TYR H 201 ASP H 212 
AA6 3 CYS I 246 ? VAL I 251 ? CYS H 246 VAL H 251 
AA6 4 ASN I 230 ? ILE I 233 ? ASN H 230 ILE H 233 
AA7 1 SER M 30  ? LYS M 38  ? SER L 30  LYS L 38  
AA7 2 TRP M 46  ? LEU M 56  ? TRP L 46  LEU L 56  
AA7 3 ALA M 82  ? PHE M 86  ? ALA L 82  PHE L 86  
AA7 4 ILE M 75  ? SER M 78  ? ILE L 75  SER L 78  
AA8 1 GLY M 185 ? LYS M 193 ? GLY L 185 LYS L 193 
AA8 2 TYR M 201 ? ASP M 212 ? TYR L 201 ASP L 212 
AA8 3 CYS M 246 ? VAL M 251 ? CYS L 246 VAL L 251 
AA8 4 ASN M 230 ? ILE M 233 ? ASN L 230 ILE L 233 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N SER A 37  ? N SER A 37  O SER A 47  ? O SER A 47  
AA1 2 3 N PHE A 52  ? N PHE A 52  O PHE A 86  ? O PHE A 86  
AA1 3 4 O ARG A 83  ? O ARG A 83  N THR A 77  ? N THR A 77  
AA2 1 2 N ARG A 190 ? N ARG A 190 O GLN A 204 ? O GLN A 204 
AA2 2 3 N GLN A 211 ? N GLN A 211 O VAL A 247 ? O VAL A 247 
AA2 3 4 O VAL A 250 ? O VAL A 250 N ASN A 230 ? N ASN A 230 
AA3 1 2 N SER E 37  ? N SER D 37  O SER E 47  ? O SER D 47  
AA3 2 3 N LEU E 56  ? N LEU D 56  O ALA E 82  ? O ALA D 82  
AA3 3 4 O ARG E 83  ? O ARG D 83  N THR E 77  ? N THR D 77  
AA4 1 2 N ARG E 190 ? N ARG D 190 O GLN E 204 ? O GLN D 204 
AA4 2 3 N GLN E 211 ? N GLN D 211 O VAL E 247 ? O VAL D 247 
AA4 3 4 O VAL E 250 ? O VAL D 250 N ASN E 230 ? N ASN D 230 
AA5 1 2 N SER I 37  ? N SER H 37  O SER I 47  ? O SER H 47  
AA5 2 3 N LEU I 56  ? N LEU H 56  O ALA I 82  ? O ALA H 82  
AA5 3 4 O ARG I 83  ? O ARG H 83  N THR I 77  ? N THR H 77  
AA6 1 2 N TYR I 188 ? N TYR H 188 O VAL I 206 ? O VAL H 206 
AA6 2 3 N GLN I 211 ? N GLN H 211 O VAL I 247 ? O VAL H 247 
AA6 3 4 O VAL I 250 ? O VAL H 250 N ASN I 230 ? N ASN H 230 
AA7 1 2 N MET M 33  ? N MET L 33  O ARG M 51  ? O ARG L 51  
AA7 2 3 N LEU M 56  ? N LEU L 56  O ALA M 82  ? O ALA L 82  
AA7 3 4 O ARG M 83  ? O ARG L 83  N THR M 77  ? N THR L 77  
AA8 1 2 N ARG M 190 ? N ARG L 190 O GLN M 204 ? O GLN L 204 
AA8 2 3 N GLN M 211 ? N GLN L 211 O VAL M 247 ? O VAL L 247 
AA8 3 4 O VAL M 250 ? O VAL L 250 N ASN M 230 ? N ASN L 230 
# 
_atom_sites.entry_id                    6BCH 
_atom_sites.fract_transf_matrix[1][1]   0.022852 
_atom_sites.fract_transf_matrix[1][2]   0.000090 
_atom_sites.fract_transf_matrix[1][3]   0.000014 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015080 
_atom_sites.fract_transf_matrix[2][3]   0.000008 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005885 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N     . ASN A 1 16  ? 4.127   -47.722 -9.530   1.00 92.00  ?  16  ASN A N     1 
ATOM   2     C CA    . ASN A 1 16  ? 3.002   -47.295 -10.352  1.00 90.53  ?  16  ASN A CA    1 
ATOM   3     C C     . ASN A 1 16  ? 1.733   -47.100 -9.530   1.00 86.46  ?  16  ASN A C     1 
ATOM   4     O O     . ASN A 1 16  ? 1.373   -47.950 -8.716   1.00 97.45  ?  16  ASN A O     1 
ATOM   5     C CB    . ASN A 1 16  ? 2.746   -48.309 -11.469  1.00 87.53  ?  16  ASN A CB    1 
ATOM   6     N N     . ILE A 1 17  ? 1.061   -45.974 -9.749   1.00 82.50  ?  17  ILE A N     1 
ATOM   7     C CA    . ILE A 1 17  ? -0.143  -45.638 -8.998   1.00 89.34  ?  17  ILE A CA    1 
ATOM   8     C C     . ILE A 1 17  ? -1.286  -46.599 -9.323   1.00 68.36  ?  17  ILE A C     1 
ATOM   9     O O     . ILE A 1 17  ? -1.401  -47.088 -10.447  1.00 69.16  ?  17  ILE A O     1 
ATOM   10    C CB    . ILE A 1 17  ? -0.589  -44.180 -9.280   1.00 90.56  ?  17  ILE A CB    1 
ATOM   11    C CG1   . ILE A 1 17  ? -1.717  -43.760 -8.334   1.00 86.68  ?  17  ILE A CG1   1 
ATOM   12    C CG2   . ILE A 1 17  ? -1.005  -44.007 -10.737  1.00 82.44  ?  17  ILE A CG2   1 
ATOM   13    C CD1   . ILE A 1 17  ? -2.164  -42.328 -8.515   1.00 88.54  ?  17  ILE A CD1   1 
ATOM   14    N N     . SER A 1 18  ? -2.111  -46.890 -8.323   1.00 77.75  ?  18  SER A N     1 
ATOM   15    C CA    . SER A 1 18  ? -3.253  -47.772 -8.513   1.00 81.10  ?  18  SER A CA    1 
ATOM   16    C C     . SER A 1 18  ? -4.417  -47.003 -9.129   1.00 71.43  ?  18  SER A C     1 
ATOM   17    O O     . SER A 1 18  ? -4.579  -45.811 -8.872   1.00 70.99  ?  18  SER A O     1 
ATOM   18    C CB    . SER A 1 18  ? -3.670  -48.396 -7.177   1.00 88.83  ?  18  SER A CB    1 
ATOM   19    O OG    . SER A 1 18  ? -5.028  -48.804 -7.196   1.00 88.49  ?  18  SER A OG    1 
ATOM   20    N N     . PRO A 1 19  ? -5.234  -47.686 -9.946   1.00 71.75  ?  19  PRO A N     1 
ATOM   21    C CA    . PRO A 1 19  ? -6.391  -47.066 -10.599  1.00 82.41  ?  19  PRO A CA    1 
ATOM   22    C C     . PRO A 1 19  ? -7.405  -46.545 -9.586   1.00 74.69  ?  19  PRO A C     1 
ATOM   23    O O     . PRO A 1 19  ? -8.038  -45.506 -9.794   1.00 79.46  ?  19  PRO A O     1 
ATOM   24    C CB    . PRO A 1 19  ? -6.982  -48.209 -11.433  1.00 83.87  ?  19  PRO A CB    1 
ATOM   25    C CG    . PRO A 1 19  ? -6.454  -49.456 -10.806  1.00 87.89  ?  19  PRO A CG    1 
ATOM   26    C CD    . PRO A 1 19  ? -5.086  -49.100 -10.329  1.00 80.91  ?  19  PRO A CD    1 
ATOM   27    N N     . TRP A 1 20  ? -7.545  -47.275 -8.486   1.00 75.81  ?  20  TRP A N     1 
ATOM   28    C CA    . TRP A 1 20  ? -8.471  -46.900 -7.430   1.00 71.50  ?  20  TRP A CA    1 
ATOM   29    C C     . TRP A 1 20  ? -7.997  -45.660 -6.676   1.00 71.13  ?  20  TRP A C     1 
ATOM   30    O O     . TRP A 1 20  ? -8.812  -44.889 -6.171   1.00 67.86  ?  20  TRP A O     1 
ATOM   31    C CB    . TRP A 1 20  ? -8.654  -48.069 -6.461   1.00 67.40  ?  20  TRP A CB    1 
ATOM   32    C CG    . TRP A 1 20  ? -9.643  -49.085 -6.944   1.00 69.24  ?  20  TRP A CG    1 
ATOM   33    C CD1   . TRP A 1 20  ? -9.402  -50.403 -7.202   1.00 79.13  ?  20  TRP A CD1   1 
ATOM   34    C CD2   . TRP A 1 20  ? -11.028 -48.866 -7.235   1.00 69.17  ?  20  TRP A CD2   1 
ATOM   35    N NE1   . TRP A 1 20  ? -10.552 -51.019 -7.634   1.00 88.99  ?  20  TRP A NE1   1 
ATOM   36    C CE2   . TRP A 1 20  ? -11.564 -50.096 -7.662   1.00 79.42  ?  20  TRP A CE2   1 
ATOM   37    C CE3   . TRP A 1 20  ? -11.867 -47.749 -7.173   1.00 74.87  ?  20  TRP A CE3   1 
ATOM   38    C CZ2   . TRP A 1 20  ? -12.901 -50.241 -8.026   1.00 80.76  ?  20  TRP A CZ2   1 
ATOM   39    C CZ3   . TRP A 1 20  ? -13.193 -47.895 -7.537   1.00 80.49  ?  20  TRP A CZ3   1 
ATOM   40    C CH2   . TRP A 1 20  ? -13.697 -49.132 -7.955   1.00 75.90  ?  20  TRP A CH2   1 
ATOM   41    N N     . THR A 1 21  ? -6.682  -45.468 -6.605   1.00 74.10  ?  21  THR A N     1 
ATOM   42    C CA    . THR A 1 21  ? -6.124  -44.247 -6.031   1.00 76.52  ?  21  THR A CA    1 
ATOM   43    C C     . THR A 1 21  ? -6.532  -43.058 -6.892   1.00 71.87  ?  21  THR A C     1 
ATOM   44    O O     . THR A 1 21  ? -6.915  -41.995 -6.390   1.00 61.92  ?  21  THR A O     1 
ATOM   45    C CB    . THR A 1 21  ? -4.587  -44.310 -5.936   1.00 82.47  ?  21  THR A CB    1 
ATOM   46    O OG1   . THR A 1 21  ? -4.195  -45.458 -5.172   1.00 87.56  ?  21  THR A OG1   1 
ATOM   47    C CG2   . THR A 1 21  ? -4.037  -43.053 -5.280   1.00 83.44  ?  21  THR A CG2   1 
ATOM   48    N N     . ILE A 1 22  ? -6.463  -43.269 -8.201   1.00 73.47  ?  22  ILE A N     1 
ATOM   49    C CA    . ILE A 1 22  ? -6.836  -42.263 -9.182   1.00 64.85  ?  22  ILE A CA    1 
ATOM   50    C C     . ILE A 1 22  ? -8.306  -41.906 -9.024   1.00 65.24  ?  22  ILE A C     1 
ATOM   51    O O     . ILE A 1 22  ? -8.676  -40.727 -8.972   1.00 61.31  ?  22  ILE A O     1 
ATOM   52    C CB    . ILE A 1 22  ? -6.575  -42.751 -10.623  1.00 64.48  ?  22  ILE A CB    1 
ATOM   53    C CG1   . ILE A 1 22  ? -5.078  -42.967 -10.854  1.00 73.92  ?  22  ILE A CG1   1 
ATOM   54    C CG2   . ILE A 1 22  ? -7.149  -41.770 -11.638  1.00 60.53  ?  22  ILE A CG2   1 
ATOM   55    C CD1   . ILE A 1 22  ? -4.733  -43.398 -12.267  1.00 90.21  ?  22  ILE A CD1   1 
ATOM   56    N N     . THR A 1 23  ? -9.141  -42.937 -8.926   1.00 56.63  ?  23  THR A N     1 
ATOM   57    C CA    . THR A 1 23  ? -10.571 -42.723 -8.789   1.00 53.21  ?  23  THR A CA    1 
ATOM   58    C C     . THR A 1 23  ? -10.901 -42.000 -7.489   1.00 60.83  ?  23  THR A C     1 
ATOM   59    O O     . THR A 1 23  ? -11.749 -41.121 -7.479   1.00 63.82  ?  23  THR A O     1 
ATOM   60    C CB    . THR A 1 23  ? -11.335 -44.065 -8.836   1.00 57.32  ?  23  THR A CB    1 
ATOM   61    O OG1   . THR A 1 23  ? -11.234 -44.631 -10.149  1.00 70.49  ?  23  THR A OG1   1 
ATOM   62    C CG2   . THR A 1 23  ? -12.803 -43.875 -8.484   1.00 60.14  ?  23  THR A CG2   1 
ATOM   63    N N     . GLY A 1 24  ? -10.254 -42.382 -6.394   1.00 68.28  ?  24  GLY A N     1 
ATOM   64    C CA    . GLY A 1 24  ? -10.457 -41.703 -5.124   1.00 71.41  ?  24  GLY A CA    1 
ATOM   65    C C     . GLY A 1 24  ? -10.064 -40.234 -5.108   1.00 61.09  ?  24  GLY A C     1 
ATOM   66    O O     . GLY A 1 24  ? -10.772 -39.359 -4.586   1.00 60.52  ?  24  GLY A O     1 
ATOM   67    N N     . PHE A 1 25  ? -8.913  -39.961 -5.711   1.00 49.38  ?  25  PHE A N     1 
ATOM   68    C CA    . PHE A 1 25  ? -8.408  -38.602 -5.796   1.00 53.64  ?  25  PHE A CA    1 
ATOM   69    C C     . PHE A 1 25  ? -9.286  -37.715 -6.681   1.00 60.57  ?  25  PHE A C     1 
ATOM   70    O O     . PHE A 1 25  ? -9.521  -36.536 -6.373   1.00 63.18  ?  25  PHE A O     1 
ATOM   71    C CB    . PHE A 1 25  ? -6.971  -38.638 -6.302   1.00 59.10  ?  25  PHE A CB    1 
ATOM   72    C CG    . PHE A 1 25  ? -6.235  -37.363 -6.102   1.00 61.69  ?  25  PHE A CG    1 
ATOM   73    C CD1   . PHE A 1 25  ? -5.780  -37.007 -4.842   1.00 53.68  ?  25  PHE A CD1   1 
ATOM   74    C CD2   . PHE A 1 25  ? -5.980  -36.528 -7.164   1.00 67.66  ?  25  PHE A CD2   1 
ATOM   75    C CE1   . PHE A 1 25  ? -5.096  -35.830 -4.648   1.00 60.11  ?  25  PHE A CE1   1 
ATOM   76    C CE2   . PHE A 1 25  ? -5.296  -35.363 -6.978   1.00 73.27  ?  25  PHE A CE2   1 
ATOM   77    C CZ    . PHE A 1 25  ? -4.852  -35.006 -5.719   1.00 71.54  ?  25  PHE A CZ    1 
ATOM   78    N N     . ALA A 1 26  ? -9.794  -38.299 -7.764   1.00 60.29  ?  26  ALA A N     1 
ATOM   79    C CA    . ALA A 1 26  ? -10.701 -37.586 -8.654   1.00 53.01  ?  26  ALA A CA    1 
ATOM   80    C C     . ALA A 1 26  ? -12.018 -37.360 -7.930   1.00 59.02  ?  26  ALA A C     1 
ATOM   81    O O     . ALA A 1 26  ? -12.649 -36.312 -8.056   1.00 59.73  ?  26  ALA A O     1 
ATOM   82    C CB    . ALA A 1 26  ? -10.919 -38.362 -9.936   1.00 51.58  ?  26  ALA A CB    1 
ATOM   83    N N     . ASP A 1 27  ? -12.417 -38.379 -7.176   1.00 64.86  ?  27  ASP A N     1 
ATOM   84    C CA    . ASP A 1 27  ? -13.557 -38.327 -6.272   1.00 64.51  ?  27  ASP A CA    1 
ATOM   85    C C     . ASP A 1 27  ? -13.457 -37.118 -5.363   1.00 49.96  ?  27  ASP A C     1 
ATOM   86    O O     . ASP A 1 27  ? -14.467 -36.496 -5.028   1.00 47.67  ?  27  ASP A O     1 
ATOM   87    C CB    . ASP A 1 27  ? -13.647 -39.605 -5.432   1.00 59.68  ?  27  ASP A CB    1 
ATOM   88    C CG    . ASP A 1 27  ? -14.789 -40.509 -5.856   1.00 65.74  ?  27  ASP A CG    1 
ATOM   89    O OD1   . ASP A 1 27  ? -15.865 -39.989 -6.218   1.00 70.16  ?  27  ASP A OD1   1 
ATOM   90    O OD2   . ASP A 1 27  ? -14.609 -41.745 -5.825   1.00 65.86  -1 27  ASP A OD2   1 
ATOM   91    N N     . ALA A 1 28  ? -12.243 -36.778 -4.947   1.00 40.55  ?  28  ALA A N     1 
ATOM   92    C CA    . ALA A 1 28  ? -12.099 -35.605 -4.097   1.00 46.21  ?  28  ALA A CA    1 
ATOM   93    C C     . ALA A 1 28  ? -12.081 -34.273 -4.855   1.00 54.23  ?  28  ALA A C     1 
ATOM   94    O O     . ALA A 1 28  ? -12.901 -33.386 -4.579   1.00 64.17  ?  28  ALA A O     1 
ATOM   95    C CB    . ALA A 1 28  ? -10.834 -35.753 -3.289   1.00 48.96  ?  28  ALA A CB    1 
ATOM   96    N N     . ASP A 1 29  ? -11.159 -34.127 -5.807   1.00 54.36  ?  29  ASP A N     1 
ATOM   97    C CA    . ASP A 1 29  ? -10.825 -32.818 -6.408   1.00 65.43  ?  29  ASP A CA    1 
ATOM   98    C C     . ASP A 1 29  ? -11.203 -32.575 -7.883   1.00 72.77  ?  29  ASP A C     1 
ATOM   99    O O     . ASP A 1 29  ? -11.009 -31.463 -8.380   1.00 81.31  ?  29  ASP A O     1 
ATOM   100   C CB    . ASP A 1 29  ? -9.333  -32.478 -6.221   1.00 64.75  ?  29  ASP A CB    1 
ATOM   101   C CG    . ASP A 1 29  ? -8.931  -32.337 -4.757   1.00 73.60  ?  29  ASP A CG    1 
ATOM   102   O OD1   . ASP A 1 29  ? -9.795  -32.452 -3.869   1.00 69.57  ?  29  ASP A OD1   1 
ATOM   103   O OD2   . ASP A 1 29  ? -7.740  -32.060 -4.500   1.00 76.08  -1 29  ASP A OD2   1 
ATOM   104   N N     . SER A 1 30  ? -11.757 -33.560 -8.583   1.00 59.59  ?  30  SER A N     1 
ATOM   105   C CA    . SER A 1 30  ? -11.917 -33.405 -10.034  1.00 46.35  ?  30  SER A CA    1 
ATOM   106   C C     . SER A 1 30  ? -13.259 -32.775 -10.397  1.00 49.61  ?  30  SER A C     1 
ATOM   107   O O     . SER A 1 30  ? -14.154 -32.670 -9.561   1.00 58.97  ?  30  SER A O     1 
ATOM   108   C CB    . SER A 1 30  ? -11.772 -34.757 -10.738  1.00 51.45  ?  30  SER A CB    1 
ATOM   109   O OG    . SER A 1 30  ? -12.928 -35.558 -10.576  1.00 48.08  ?  30  SER A OG    1 
ATOM   110   N N     . SER A 1 31  ? -13.381 -32.344 -11.651  1.00 55.96  ?  31  SER A N     1 
ATOM   111   C CA    . SER A 1 31  ? -14.642 -31.821 -12.177  1.00 48.00  ?  31  SER A CA    1 
ATOM   112   C C     . SER A 1 31  ? -15.038 -32.283 -13.582  1.00 38.01  ?  31  SER A C     1 
ATOM   113   O O     . SER A 1 31  ? -14.213 -32.339 -14.500  1.00 43.91  ?  31  SER A O     1 
ATOM   114   C CB    . SER A 1 31  ? -14.602 -30.292 -12.157  1.00 41.84  ?  31  SER A CB    1 
ATOM   115   O OG    . SER A 1 31  ? -15.867 -29.748 -12.488  1.00 68.70  ?  31  SER A OG    1 
ATOM   116   N N     . PHE A 1 32  ? -16.320 -32.618 -13.716  1.00 38.67  ?  32  PHE A N     1 
ATOM   117   C CA    . PHE A 1 32  ? -16.946 -32.912 -15.002  1.00 38.64  ?  32  PHE A CA    1 
ATOM   118   C C     . PHE A 1 32  ? -17.787 -31.715 -15.443  1.00 45.75  ?  32  PHE A C     1 
ATOM   119   O O     . PHE A 1 32  ? -18.624 -31.224 -14.687  1.00 42.67  ?  32  PHE A O     1 
ATOM   120   C CB    . PHE A 1 32  ? -17.852 -34.138 -14.894  1.00 42.11  ?  32  PHE A CB    1 
ATOM   121   C CG    . PHE A 1 32  ? -17.130 -35.416 -14.590  1.00 48.12  ?  32  PHE A CG    1 
ATOM   122   C CD1   . PHE A 1 32  ? -16.615 -36.196 -15.610  1.00 48.74  ?  32  PHE A CD1   1 
ATOM   123   C CD2   . PHE A 1 32  ? -16.984 -35.848 -13.281  1.00 45.54  ?  32  PHE A CD2   1 
ATOM   124   C CE1   . PHE A 1 32  ? -15.963 -37.379 -15.332  1.00 51.98  ?  32  PHE A CE1   1 
ATOM   125   C CE2   . PHE A 1 32  ? -16.328 -37.030 -12.997  1.00 44.53  ?  32  PHE A CE2   1 
ATOM   126   C CZ    . PHE A 1 32  ? -15.816 -37.795 -14.023  1.00 40.88  ?  32  PHE A CZ    1 
ATOM   127   N N     . MET A 1 33  ? -17.564 -31.246 -16.668  1.00 41.00  ?  33  MET A N     1 
ATOM   128   C CA    . MET A 1 33  ? -18.150 -29.986 -17.117  1.00 44.06  ?  33  MET A CA    1 
ATOM   129   C C     . MET A 1 33  ? -18.758 -30.054 -18.516  1.00 43.99  ?  33  MET A C     1 
ATOM   130   O O     . MET A 1 33  ? -18.313 -30.823 -19.365  1.00 48.76  ?  33  MET A O     1 
ATOM   131   C CB    . MET A 1 33  ? -17.103 -28.872 -17.087  1.00 43.53  ?  33  MET A CB    1 
ATOM   132   C CG    . MET A 1 33  ? -16.728 -28.393 -15.699  1.00 42.12  ?  33  MET A CG    1 
ATOM   133   S SD    . MET A 1 33  ? -15.251 -27.362 -15.717  1.00 47.47  ?  33  MET A SD    1 
ATOM   134   C CE    . MET A 1 33  ? -14.013 -28.552 -16.226  1.00 45.82  ?  33  MET A CE    1 
ATOM   135   N N     . LEU A 1 34  ? -19.787 -29.241 -18.738  1.00 41.53  ?  34  LEU A N     1 
ATOM   136   C CA    . LEU A 1 34  ? -20.368 -29.055 -20.063  1.00 48.11  ?  34  LEU A CA    1 
ATOM   137   C C     . LEU A 1 34  ? -20.447 -27.566 -20.380  1.00 48.41  ?  34  LEU A C     1 
ATOM   138   O O     . LEU A 1 34  ? -21.130 -26.812 -19.686  1.00 46.71  ?  34  LEU A O     1 
ATOM   139   C CB    . LEU A 1 34  ? -21.756 -29.687 -20.144  1.00 54.27  ?  34  LEU A CB    1 
ATOM   140   C CG    . LEU A 1 34  ? -21.821 -31.214 -20.153  1.00 60.39  ?  34  LEU A CG    1 
ATOM   141   C CD1   . LEU A 1 34  ? -23.259 -31.671 -20.005  1.00 71.12  ?  34  LEU A CD1   1 
ATOM   142   C CD2   . LEU A 1 34  ? -21.210 -31.772 -21.427  1.00 58.99  ?  34  LEU A CD2   1 
ATOM   143   N N     . THR A 1 35  ? -19.749 -27.146 -21.430  1.00 43.24  ?  35  THR A N     1 
ATOM   144   C CA    . THR A 1 35  ? -19.805 -25.761 -21.885  1.00 37.72  ?  35  THR A CA    1 
ATOM   145   C C     . THR A 1 35  ? -20.761 -25.561 -23.059  1.00 47.81  ?  35  THR A C     1 
ATOM   146   O O     . THR A 1 35  ? -20.654 -26.237 -24.092  1.00 61.15  ?  35  THR A O     1 
ATOM   147   C CB    . THR A 1 35  ? -18.410 -25.256 -22.289  1.00 37.13  ?  35  THR A CB    1 
ATOM   148   O OG1   . THR A 1 35  ? -17.509 -25.399 -21.184  1.00 36.38  ?  35  THR A OG1   1 
ATOM   149   C CG2   . THR A 1 35  ? -18.470 -23.796 -22.701  1.00 52.61  ?  35  THR A CG2   1 
ATOM   150   N N     . VAL A 1 36  ? -21.696 -24.629 -22.879  1.00 44.90  ?  36  VAL A N     1 
ATOM   151   C CA    . VAL A 1 36  ? -22.634 -24.233 -23.923  1.00 44.15  ?  36  VAL A CA    1 
ATOM   152   C C     . VAL A 1 36  ? -22.506 -22.738 -24.223  1.00 47.96  ?  36  VAL A C     1 
ATOM   153   O O     . VAL A 1 36  ? -22.983 -21.895 -23.464  1.00 62.92  ?  36  VAL A O     1 
ATOM   154   C CB    . VAL A 1 36  ? -24.087 -24.550 -23.526  1.00 47.17  ?  36  VAL A CB    1 
ATOM   155   C CG1   . VAL A 1 36  ? -25.038 -24.134 -24.634  1.00 51.55  ?  36  VAL A CG1   1 
ATOM   156   C CG2   . VAL A 1 36  ? -24.243 -26.030 -23.223  1.00 44.74  ?  36  VAL A CG2   1 
ATOM   157   N N     . SER A 1 37  ? -21.843 -22.425 -25.332  1.00 59.66  ?  37  SER A N     1 
ATOM   158   C CA    . SER A 1 37  ? -21.512 -21.050 -25.706  1.00 67.97  ?  37  SER A CA    1 
ATOM   159   C C     . SER A 1 37  ? -22.217 -20.640 -26.998  1.00 54.66  ?  37  SER A C     1 
ATOM   160   O O     . SER A 1 37  ? -22.251 -21.410 -27.948  1.00 52.92  ?  37  SER A O     1 
ATOM   161   C CB    . SER A 1 37  ? -19.998 -20.883 -25.855  1.00 74.24  ?  37  SER A CB    1 
ATOM   162   O OG    . SER A 1 37  ? -19.366 -20.817 -24.588  1.00 70.91  ?  37  SER A OG    1 
ATOM   163   N N     . LYS A 1 38  ? -22.760 -19.426 -27.040  1.00 61.09  ?  38  LYS A N     1 
ATOM   164   C CA    . LYS A 1 38  ? -23.390 -18.914 -28.260  1.00 48.20  ?  38  LYS A CA    1 
ATOM   165   C C     . LYS A 1 38  ? -22.414 -18.884 -29.432  1.00 51.54  ?  38  LYS A C     1 
ATOM   166   O O     . LYS A 1 38  ? -21.286 -18.407 -29.310  1.00 41.75  ?  38  LYS A O     1 
ATOM   167   C CB    . LYS A 1 38  ? -23.956 -17.512 -28.024  1.00 34.57  ?  38  LYS A CB    1 
ATOM   168   N N     . ASP A 1 39  ? -22.873 -19.405 -30.567  1.00 70.72  ?  39  ASP A N     1 
ATOM   169   C CA    . ASP A 1 39  ? -22.051 -19.538 -31.767  1.00 72.91  ?  39  ASP A CA    1 
ATOM   170   C C     . ASP A 1 39  ? -22.883 -19.446 -33.046  1.00 71.19  ?  39  ASP A C     1 
ATOM   171   O O     . ASP A 1 39  ? -23.687 -20.330 -33.342  1.00 70.61  ?  39  ASP A O     1 
ATOM   172   C CB    . ASP A 1 39  ? -21.281 -20.860 -31.738  1.00 80.28  ?  39  ASP A CB    1 
ATOM   173   C CG    . ASP A 1 39  ? -20.169 -20.908 -32.767  1.00 85.13  ?  39  ASP A CG    1 
ATOM   174   O OD1   . ASP A 1 39  ? -19.030 -20.519 -32.431  1.00 82.05  ?  39  ASP A OD1   1 
ATOM   175   O OD2   . ASP A 1 39  ? -20.431 -21.335 -33.912  1.00 82.84  -1 39  ASP A OD2   1 
ATOM   176   N N     . SER A 1 40  ? -22.671 -18.372 -33.800  1.00 78.50  ?  40  SER A N     1 
ATOM   177   C CA    . SER A 1 40  ? -23.394 -18.099 -35.043  1.00 82.84  ?  40  SER A CA    1 
ATOM   178   C C     . SER A 1 40  ? -23.188 -19.181 -36.104  1.00 82.08  ?  40  SER A C     1 
ATOM   179   O O     . SER A 1 40  ? -24.065 -19.424 -36.935  1.00 57.63  ?  40  SER A O     1 
ATOM   180   C CB    . SER A 1 40  ? -22.972 -16.742 -35.608  1.00 67.25  ?  40  SER A CB    1 
ATOM   181   O OG    . SER A 1 40  ? -22.743 -15.805 -34.571  1.00 65.49  ?  40  SER A OG    1 
ATOM   182   N N     . LYS A 1 41  ? -22.028 -19.823 -36.070  1.00 84.96  ?  41  LYS A N     1 
ATOM   183   C CA    . LYS A 1 41  ? -21.625 -20.766 -37.106  1.00 66.40  ?  41  LYS A CA    1 
ATOM   184   C C     . LYS A 1 41  ? -22.352 -22.108 -37.004  1.00 75.23  ?  41  LYS A C     1 
ATOM   185   O O     . LYS A 1 41  ? -22.316 -22.905 -37.941  1.00 78.94  ?  41  LYS A O     1 
ATOM   186   C CB    . LYS A 1 41  ? -20.112 -20.993 -37.051  1.00 46.27  ?  41  LYS A CB    1 
ATOM   187   N N     . ARG A 1 42  ? -23.021 -22.356 -35.883  1.00 91.10  ?  42  ARG A N     1 
ATOM   188   C CA    . ARG A 1 42  ? -23.701 -23.633 -35.689  1.00 98.57  ?  42  ARG A CA    1 
ATOM   189   C C     . ARG A 1 42  ? -25.169 -23.531 -36.093  1.00 85.30  ?  42  ARG A C     1 
ATOM   190   O O     . ARG A 1 42  ? -25.767 -22.458 -36.023  1.00 78.41  ?  42  ARG A O     1 
ATOM   191   C CB    . ARG A 1 42  ? -23.629 -24.071 -34.222  1.00 88.93  ?  42  ARG A CB    1 
ATOM   192   C CG    . ARG A 1 42  ? -22.311 -23.825 -33.508  1.00 76.33  ?  42  ARG A CG    1 
ATOM   193   C CD    . ARG A 1 42  ? -21.150 -24.596 -34.093  1.00 72.89  ?  42  ARG A CD    1 
ATOM   194   N NE    . ARG A 1 42  ? -19.945 -24.386 -33.296  1.00 83.56  ?  42  ARG A NE    1 
ATOM   195   C CZ    . ARG A 1 42  ? -18.832 -25.100 -33.418  1.00 79.59  ?  42  ARG A CZ    1 
ATOM   196   N NH1   . ARG A 1 42  ? -18.767 -26.081 -34.306  1.00 77.96  1  42  ARG A NH1   1 
ATOM   197   N NH2   . ARG A 1 42  ? -17.786 -24.838 -32.646  1.00 46.54  ?  42  ARG A NH2   1 
ATOM   198   N N     . ASN A 1 43  ? -25.742 -24.651 -36.524  1.00 80.78  ?  43  ASN A N     1 
ATOM   199   C CA    . ASN A 1 43  ? -27.125 -24.672 -36.987  1.00 86.71  ?  43  ASN A CA    1 
ATOM   200   C C     . ASN A 1 43  ? -28.110 -24.382 -35.859  1.00 85.03  ?  43  ASN A C     1 
ATOM   201   O O     . ASN A 1 43  ? -29.167 -23.788 -36.075  1.00 77.49  ?  43  ASN A O     1 
ATOM   202   C CB    . ASN A 1 43  ? -27.452 -26.022 -37.627  1.00 85.46  ?  43  ASN A CB    1 
ATOM   203   N N     . THR A 1 44  ? -27.750 -24.807 -34.653  1.00 90.53  ?  44  THR A N     1 
ATOM   204   C CA    . THR A 1 44  ? -28.554 -24.537 -33.468  1.00 92.25  ?  44  THR A CA    1 
ATOM   205   C C     . THR A 1 44  ? -28.264 -23.156 -32.893  1.00 86.16  ?  44  THR A C     1 
ATOM   206   O O     . THR A 1 44  ? -29.025 -22.643 -32.071  1.00 71.45  ?  44  THR A O     1 
ATOM   207   C CB    . THR A 1 44  ? -28.315 -25.596 -32.374  1.00 87.83  ?  44  THR A CB    1 
ATOM   208   O OG1   . THR A 1 44  ? -26.943 -25.561 -31.961  1.00 84.52  ?  44  THR A OG1   1 
ATOM   209   C CG2   . THR A 1 44  ? -28.651 -26.987 -32.893  1.00 77.79  ?  44  THR A CG2   1 
ATOM   210   N N     . GLY A 1 45  ? -27.157 -22.560 -33.325  1.00 85.39  ?  45  GLY A N     1 
ATOM   211   C CA    . GLY A 1 45  ? -26.738 -21.278 -32.792  1.00 82.76  ?  45  GLY A CA    1 
ATOM   212   C C     . GLY A 1 45  ? -25.884 -21.433 -31.550  1.00 76.38  ?  45  GLY A C     1 
ATOM   213   O O     . GLY A 1 45  ? -25.482 -20.444 -30.936  1.00 67.22  ?  45  GLY A O     1 
ATOM   214   N N     . TRP A 1 46  ? -25.611 -22.678 -31.172  1.00 83.02  ?  46  TRP A N     1 
ATOM   215   C CA    . TRP A 1 46  ? -24.847 -22.946 -29.962  1.00 70.70  ?  46  TRP A CA    1 
ATOM   216   C C     . TRP A 1 46  ? -23.760 -24.005 -30.147  1.00 67.98  ?  46  TRP A C     1 
ATOM   217   O O     . TRP A 1 46  ? -23.898 -24.943 -30.933  1.00 83.77  ?  46  TRP A O     1 
ATOM   218   C CB    . TRP A 1 46  ? -25.804 -23.353 -28.840  1.00 67.67  ?  46  TRP A CB    1 
ATOM   219   C CG    . TRP A 1 46  ? -26.729 -22.235 -28.462  1.00 73.63  ?  46  TRP A CG    1 
ATOM   220   C CD1   . TRP A 1 46  ? -27.927 -21.935 -29.042  1.00 77.50  ?  46  TRP A CD1   1 
ATOM   221   C CD2   . TRP A 1 46  ? -26.532 -21.265 -27.426  1.00 69.38  ?  46  TRP A CD2   1 
ATOM   222   N NE1   . TRP A 1 46  ? -28.485 -20.836 -28.436  1.00 70.75  ?  46  TRP A NE1   1 
ATOM   223   C CE2   . TRP A 1 46  ? -27.650 -20.408 -27.438  1.00 69.71  ?  46  TRP A CE2   1 
ATOM   224   C CE3   . TRP A 1 46  ? -25.521 -21.040 -26.488  1.00 61.12  ?  46  TRP A CE3   1 
ATOM   225   C CZ2   . TRP A 1 46  ? -27.785 -19.344 -26.549  1.00 65.80  ?  46  TRP A CZ2   1 
ATOM   226   C CZ3   . TRP A 1 46  ? -25.655 -19.981 -25.609  1.00 64.14  ?  46  TRP A CZ3   1 
ATOM   227   C CH2   . TRP A 1 46  ? -26.779 -19.148 -25.644  1.00 61.33  ?  46  TRP A CH2   1 
ATOM   228   N N     . SER A 1 47  ? -22.680 -23.826 -29.395  1.00 56.59  ?  47  SER A N     1 
ATOM   229   C CA    . SER A 1 47  ? -21.569 -24.762 -29.321  1.00 58.23  ?  47  SER A CA    1 
ATOM   230   C C     . SER A 1 47  ? -21.605 -25.483 -27.979  1.00 65.25  ?  47  SER A C     1 
ATOM   231   O O     . SER A 1 47  ? -21.715 -24.860 -26.922  1.00 59.75  ?  47  SER A O     1 
ATOM   232   C CB    . SER A 1 47  ? -20.234 -24.039 -29.509  1.00 66.71  ?  47  SER A CB    1 
ATOM   233   O OG    . SER A 1 47  ? -19.890 -23.302 -28.349  1.00 80.80  ?  47  SER A OG    1 
ATOM   234   N N     . VAL A 1 48  ? -21.515 -26.804 -28.039  1.00 60.88  ?  48  VAL A N     1 
ATOM   235   C CA    . VAL A 1 48  ? -21.543 -27.658 -26.859  1.00 36.07  ?  48  VAL A CA    1 
ATOM   236   C C     . VAL A 1 48  ? -20.313 -28.551 -26.777  1.00 36.34  ?  48  VAL A C     1 
ATOM   237   O O     . VAL A 1 48  ? -19.944 -29.197 -27.756  1.00 50.25  ?  48  VAL A O     1 
ATOM   238   C CB    . VAL A 1 48  ? -22.811 -28.534 -26.839  1.00 51.27  ?  48  VAL A CB    1 
ATOM   239   C CG1   . VAL A 1 48  ? -22.651 -29.705 -25.875  1.00 65.05  ?  48  VAL A CG1   1 
ATOM   240   C CG2   . VAL A 1 48  ? -24.013 -27.694 -26.462  1.00 54.29  ?  48  VAL A CG2   1 
ATOM   241   N N     . ARG A 1 49  ? -19.670 -28.575 -25.613  1.00 36.34  ?  49  ARG A N     1 
ATOM   242   C CA    . ARG A 1 49  ? -18.480 -29.401 -25.446  1.00 33.71  ?  49  ARG A CA    1 
ATOM   243   C C     . ARG A 1 49  ? -18.324 -29.940 -24.032  1.00 50.12  ?  49  ARG A C     1 
ATOM   244   O O     . ARG A 1 49  ? -18.658 -29.274 -23.051  1.00 53.69  ?  49  ARG A O     1 
ATOM   245   C CB    . ARG A 1 49  ? -17.203 -28.622 -25.775  1.00 36.04  ?  49  ARG A CB    1 
ATOM   246   C CG    . ARG A 1 49  ? -16.936 -27.495 -24.788  1.00 36.55  ?  49  ARG A CG    1 
ATOM   247   C CD    . ARG A 1 49  ? -15.851 -26.538 -25.226  1.00 40.10  ?  49  ARG A CD    1 
ATOM   248   N NE    . ARG A 1 49  ? -14.562 -27.226 -25.255  1.00 30.52  ?  49  ARG A NE    1 
ATOM   249   C CZ    . ARG A 1 49  ? -13.402 -26.640 -25.527  1.00 40.87  ?  49  ARG A CZ    1 
ATOM   250   N NH1   . ARG A 1 49  ? -13.358 -25.339 -25.776  1.00 42.33  1  49  ARG A NH1   1 
ATOM   251   N NH2   . ARG A 1 49  ? -12.283 -27.350 -25.521  1.00 42.09  ?  49  ARG A NH2   1 
ATOM   252   N N     . PRO A 1 50  ? -17.848 -31.187 -23.932  1.00 51.65  ?  50  PRO A N     1 
ATOM   253   C CA    . PRO A 1 50  ? -17.616 -31.834 -22.641  1.00 49.35  ?  50  PRO A CA    1 
ATOM   254   C C     . PRO A 1 50  ? -16.174 -31.657 -22.165  1.00 47.26  ?  50  PRO A C     1 
ATOM   255   O O     . PRO A 1 50  ? -15.264 -31.546 -22.987  1.00 59.74  ?  50  PRO A O     1 
ATOM   256   C CB    . PRO A 1 50  ? -17.934 -33.298 -22.939  1.00 51.77  ?  50  PRO A CB    1 
ATOM   257   C CG    . PRO A 1 50  ? -17.539 -33.471 -24.385  1.00 50.86  ?  50  PRO A CG    1 
ATOM   258   C CD    . PRO A 1 50  ? -17.648 -32.119 -25.058  1.00 32.49  ?  50  PRO A CD    1 
ATOM   259   N N     . ARG A 1 51  ? -15.977 -31.627 -20.850  1.00 41.53  ?  51  ARG A N     1 
ATOM   260   C CA    . ARG A 1 51  ? -14.648 -31.513 -20.254  1.00 38.48  ?  51  ARG A CA    1 
ATOM   261   C C     . ARG A 1 51  ? -14.525 -32.368 -18.998  1.00 50.23  ?  51  ARG A C     1 
ATOM   262   O O     . ARG A 1 51  ? -15.477 -32.496 -18.228  1.00 45.74  ?  51  ARG A O     1 
ATOM   263   C CB    . ARG A 1 51  ? -14.308 -30.065 -19.882  1.00 41.10  ?  51  ARG A CB    1 
ATOM   264   C CG    . ARG A 1 51  ? -14.675 -28.975 -20.871  1.00 33.64  ?  51  ARG A CG    1 
ATOM   265   C CD    . ARG A 1 51  ? -14.331 -27.621 -20.258  1.00 44.19  ?  51  ARG A CD    1 
ATOM   266   N NE    . ARG A 1 51  ? -14.910 -26.494 -20.980  1.00 40.14  ?  51  ARG A NE    1 
ATOM   267   C CZ    . ARG A 1 51  ? -14.227 -25.722 -21.817  1.00 44.94  ?  51  ARG A CZ    1 
ATOM   268   N NH1   . ARG A 1 51  ? -12.940 -25.958 -22.031  1.00 47.54  1  51  ARG A NH1   1 
ATOM   269   N NH2   . ARG A 1 51  ? -14.820 -24.699 -22.418  1.00 65.24  ?  51  ARG A NH2   1 
ATOM   270   N N     . PHE A 1 52  ? -13.355 -32.963 -18.803  1.00 49.99  ?  52  PHE A N     1 
ATOM   271   C CA    . PHE A 1 52  ? -13.000 -33.551 -17.514  1.00 41.14  ?  52  PHE A CA    1 
ATOM   272   C C     . PHE A 1 52  ? -11.675 -32.953 -17.044  1.00 45.26  ?  52  PHE A C     1 
ATOM   273   O O     . PHE A 1 52  ? -10.740 -32.864 -17.831  1.00 55.66  ?  52  PHE A O     1 
ATOM   274   C CB    . PHE A 1 52  ? -12.921 -35.075 -17.598  1.00 48.26  ?  52  PHE A CB    1 
ATOM   275   C CG    . PHE A 1 52  ? -12.365 -35.716 -16.361  1.00 46.49  ?  52  PHE A CG    1 
ATOM   276   C CD1   . PHE A 1 52  ? -13.117 -35.759 -15.200  1.00 49.42  ?  52  PHE A CD1   1 
ATOM   277   C CD2   . PHE A 1 52  ? -11.108 -36.293 -16.359  1.00 51.36  ?  52  PHE A CD2   1 
ATOM   278   C CE1   . PHE A 1 52  ? -12.622 -36.348 -14.053  1.00 49.80  ?  52  PHE A CE1   1 
ATOM   279   C CE2   . PHE A 1 52  ? -10.606 -36.888 -15.213  1.00 61.33  ?  52  PHE A CE2   1 
ATOM   280   C CZ    . PHE A 1 52  ? -11.367 -36.915 -14.059  1.00 47.41  ?  52  PHE A CZ    1 
ATOM   281   N N     . ARG A 1 53  ? -11.569 -32.543 -15.781  1.00 47.01  ?  53  ARG A N     1 
ATOM   282   C CA    . ARG A 1 53  ? -10.359 -31.824 -15.364  1.00 39.78  ?  53  ARG A CA    1 
ATOM   283   C C     . ARG A 1 53  ? -9.969  -32.063 -13.905  1.00 53.03  ?  53  ARG A C     1 
ATOM   284   O O     . ARG A 1 53  ? -10.828 -32.229 -13.037  1.00 59.98  ?  53  ARG A O     1 
ATOM   285   C CB    . ARG A 1 53  ? -10.543 -30.321 -15.588  1.00 44.58  ?  53  ARG A CB    1 
ATOM   286   C CG    . ARG A 1 53  ? -9.256  -29.511 -15.530  1.00 55.76  ?  53  ARG A CG    1 
ATOM   287   C CD    . ARG A 1 53  ? -9.460  -28.123 -16.105  1.00 49.41  ?  53  ARG A CD    1 
ATOM   288   N NE    . ARG A 1 53  ? -10.345 -27.329 -15.259  1.00 56.92  ?  53  ARG A NE    1 
ATOM   289   C CZ    . ARG A 1 53  ? -11.204 -26.423 -15.712  1.00 63.43  ?  53  ARG A CZ    1 
ATOM   290   N NH1   . ARG A 1 53  ? -11.304 -26.188 -17.013  1.00 34.21  1  53  ARG A NH1   1 
ATOM   291   N NH2   . ARG A 1 53  ? -11.964 -25.752 -14.860  1.00 66.72  ?  53  ARG A NH2   1 
ATOM   292   N N     . ILE A 1 54  ? -8.657  -32.075 -13.654  1.00 56.30  ?  54  ILE A N     1 
ATOM   293   C CA    . ILE A 1 54  ? -8.105  -32.030 -12.297  1.00 55.93  ?  54  ILE A CA    1 
ATOM   294   C C     . ILE A 1 54  ? -7.100  -30.888 -12.053  1.00 59.95  ?  54  ILE A C     1 
ATOM   295   O O     . ILE A 1 54  ? -6.153  -30.716 -12.816  1.00 64.42  ?  54  ILE A O     1 
ATOM   296   C CB    . ILE A 1 54  ? -7.416  -33.377 -11.966  1.00 41.15  ?  54  ILE A CB    1 
ATOM   297   C CG1   . ILE A 1 54  ? -8.438  -34.516 -11.960  1.00 39.83  ?  54  ILE A CG1   1 
ATOM   298   C CG2   . ILE A 1 54  ? -6.679  -33.303 -10.644  1.00 63.44  ?  54  ILE A CG2   1 
ATOM   299   C CD1   . ILE A 1 54  ? -7.823  -35.889 -12.114  1.00 38.71  ?  54  ILE A CD1   1 
ATOM   300   N N     . GLY A 1 55  ? -7.335  -30.133 -10.983  1.00 55.51  ?  55  GLY A N     1 
ATOM   301   C CA    . GLY A 1 55  ? -6.472  -29.040 -10.560  1.00 62.53  ?  55  GLY A CA    1 
ATOM   302   C C     . GLY A 1 55  ? -5.980  -29.408 -9.168   1.00 73.49  ?  55  GLY A C     1 
ATOM   303   O O     . GLY A 1 55  ? -6.668  -30.133 -8.443   1.00 83.53  ?  55  GLY A O     1 
ATOM   304   N N     . LEU A 1 56  ? -4.815  -28.915 -8.758   1.00 66.64  ?  56  LEU A N     1 
ATOM   305   C CA    . LEU A 1 56  ? -4.320  -29.328 -7.430   1.00 72.05  ?  56  LEU A CA    1 
ATOM   306   C C     . LEU A 1 56  ? -3.424  -28.332 -6.678   1.00 79.37  ?  56  LEU A C     1 
ATOM   307   O O     . LEU A 1 56  ? -3.737  -27.958 -5.537   1.00 88.31  ?  56  LEU A O     1 
ATOM   308   C CB    . LEU A 1 56  ? -3.554  -30.650 -7.520   1.00 52.31  ?  56  LEU A CB    1 
ATOM   309   C CG    . LEU A 1 56  ? -4.235  -31.810 -8.228   1.00 56.44  ?  56  LEU A CG    1 
ATOM   310   C CD1   . LEU A 1 56  ? -3.294  -32.999 -8.296   1.00 56.09  ?  56  LEU A CD1   1 
ATOM   311   C CD2   . LEU A 1 56  ? -5.509  -32.135 -7.479   1.00 79.00  ?  56  LEU A CD2   1 
ATOM   312   N N     . HIS A 1 57  ? -2.305  -27.966 -7.308   1.00 63.73  ?  57  HIS A N     1 
ATOM   313   C CA    . HIS A 1 57  ? -1.383  -26.887 -6.909   1.00 68.23  ?  57  HIS A CA    1 
ATOM   314   C C     . HIS A 1 57  ? -0.138  -27.142 -7.736   1.00 79.28  ?  57  HIS A C     1 
ATOM   315   O O     . HIS A 1 57  ? 0.167   -28.302 -8.020   1.00 75.74  ?  57  HIS A O     1 
ATOM   316   C CB    . HIS A 1 57  ? -1.038  -26.888 -5.417   1.00 83.03  ?  57  HIS A CB    1 
ATOM   317   C CG    . HIS A 1 57  ? -0.313  -25.660 -4.950   1.00 93.42  ?  57  HIS A CG    1 
ATOM   318   N ND1   . HIS A 1 57  ? 1.019   -25.427 -5.218   1.00 91.96  ?  57  HIS A ND1   1 
ATOM   319   C CD2   . HIS A 1 57  ? -0.739  -24.602 -4.218   1.00 98.32  ?  57  HIS A CD2   1 
ATOM   320   C CE1   . HIS A 1 57  ? 1.381   -24.278 -4.674   1.00 86.35  ?  57  HIS A CE1   1 
ATOM   321   N NE2   . HIS A 1 57  ? 0.333   -23.757 -4.062   1.00 93.33  ?  57  HIS A NE2   1 
ATOM   322   N N     . ASN A 1 58  ? 0.557   -26.092 -8.166   1.00 75.04  ?  58  ASN A N     1 
ATOM   323   C CA    . ASN A 1 58  ? 1.795   -26.295 -8.904   1.00 67.74  ?  58  ASN A CA    1 
ATOM   324   C C     . ASN A 1 58  ? 2.724   -27.325 -8.249   1.00 71.90  ?  58  ASN A C     1 
ATOM   325   O O     . ASN A 1 58  ? 3.304   -28.181 -8.930   1.00 76.66  ?  58  ASN A O     1 
ATOM   326   C CB    . ASN A 1 58  ? 2.542   -24.962 -9.026   1.00 63.73  ?  58  ASN A CB    1 
ATOM   327   C CG    . ASN A 1 58  ? 2.005   -24.087 -10.140  1.00 92.69  ?  58  ASN A CG    1 
ATOM   328   O OD1   . ASN A 1 58  ? 1.592   -24.579 -11.189  1.00 89.97  ?  58  ASN A OD1   1 
ATOM   329   N ND2   . ASN A 1 58  ? 2.004   -22.776 -9.914   1.00 96.82  ?  58  ASN A ND2   1 
ATOM   330   N N     . LYS A 1 59  ? 2.728   -27.355 -6.919   1.00 86.79  ?  59  LYS A N     1 
ATOM   331   C CA    . LYS A 1 59  ? 3.628   -28.249 -6.202   1.00 89.16  ?  59  LYS A CA    1 
ATOM   332   C C     . LYS A 1 59  ? 3.322   -29.713 -6.477   1.00 86.29  ?  59  LYS A C     1 
ATOM   333   O O     . LYS A 1 59  ? 4.147   -30.588 -6.215   1.00 87.30  ?  59  LYS A O     1 
ATOM   334   C CB    . LYS A 1 59  ? 3.552   -27.979 -4.698   1.00 58.96  ?  59  LYS A CB    1 
ATOM   335   N N     . ASP A 1 60  ? 2.132   -29.979 -7.002   1.00 80.06  ?  60  ASP A N     1 
ATOM   336   C CA    . ASP A 1 60  ? 1.715   -31.354 -7.200   1.00 85.30  ?  60  ASP A CA    1 
ATOM   337   C C     . ASP A 1 60  ? 1.579   -31.702 -8.675   1.00 75.43  ?  60  ASP A C     1 
ATOM   338   O O     . ASP A 1 60  ? 0.874   -32.666 -9.007   1.00 63.68  ?  60  ASP A O     1 
ATOM   339   C CB    . ASP A 1 60  ? 0.390   -31.614 -6.480   1.00 81.91  ?  60  ASP A CB    1 
ATOM   340   C CG    . ASP A 1 60  ? 0.588   -32.112 -5.064   1.00 79.80  ?  60  ASP A CG    1 
ATOM   341   O OD1   . ASP A 1 60  ? 1.626   -32.753 -4.806   1.00 78.15  ?  60  ASP A OD1   1 
ATOM   342   O OD2   . ASP A 1 60  ? -0.291  -31.866 -4.212   1.00 77.97  -1 60  ASP A OD2   1 
ATOM   343   N N     . VAL A 1 61  ? 2.289   -30.988 -9.554   1.00 79.30  ?  61  VAL A N     1 
ATOM   344   C CA    . VAL A 1 61  ? 2.302   -31.403 -10.964  1.00 76.55  ?  61  VAL A CA    1 
ATOM   345   C C     . VAL A 1 61  ? 2.661   -32.877 -11.146  1.00 87.46  ?  61  VAL A C     1 
ATOM   346   O O     . VAL A 1 61  ? 2.077   -33.572 -11.986  1.00 87.76  ?  61  VAL A O     1 
ATOM   347   C CB    . VAL A 1 61  ? 3.285   -30.555 -11.813  1.00 70.15  ?  61  VAL A CB    1 
ATOM   348   C CG1   . VAL A 1 61  ? 3.306   -31.036 -13.256  1.00 94.91  ?  61  VAL A CG1   1 
ATOM   349   C CG2   . VAL A 1 61  ? 2.925   -29.085 -11.758  1.00 67.10  ?  61  VAL A CG2   1 
ATOM   350   N N     . THR A 1 62  ? 3.562   -33.367 -10.302  1.00 87.65  ?  62  THR A N     1 
ATOM   351   C CA    . THR A 1 62  ? 4.000   -34.754 -10.373  1.00 99.53  ?  62  THR A CA    1 
ATOM   352   C C     . THR A 1 62  ? 2.868   -35.769 -10.248  1.00 92.49  ?  62  THR A C     1 
ATOM   353   O O     . THR A 1 62  ? 2.843   -36.761 -10.987  1.00 92.93  ?  62  THR A O     1 
ATOM   354   C CB    . THR A 1 62  ? 5.037   -35.061 -9.274   1.00 93.64  ?  62  THR A CB    1 
ATOM   355   O OG1   . THR A 1 62  ? 4.428   -34.913 -7.984   1.00 79.84  ?  62  THR A OG1   1 
ATOM   356   C CG2   . THR A 1 62  ? 6.223   -34.118 -9.380   1.00 95.29  ?  62  THR A CG2   1 
ATOM   357   N N     . ILE A 1 63  ? 1.858   -35.446 -9.441   1.00 83.51  ?  63  ILE A N     1 
ATOM   358   C CA    . ILE A 1 63  ? 0.712   -36.341 -9.304   1.00 89.46  ?  63  ILE A CA    1 
ATOM   359   C C     . ILE A 1 63  ? 0.022   -36.502 -10.643  1.00 86.78  ?  63  ILE A C     1 
ATOM   360   O O     . ILE A 1 63  ? -0.255  -37.624 -11.086  1.00 74.90  ?  63  ILE A O     1 
ATOM   361   C CB    . ILE A 1 63  ? -0.297  -35.820 -8.261   1.00 57.10  ?  63  ILE A CB    1 
ATOM   362   N N     . LEU A 1 64  ? -0.154  -35.382 -11.328  1.00 74.33  ?  64  LEU A N     1 
ATOM   363   C CA    . LEU A 1 64  ? -0.822  -35.384 -12.612  1.00 65.94  ?  64  LEU A CA    1 
ATOM   364   C C     . LEU A 1 64  ? -0.028  -36.221 -13.597  1.00 77.88  ?  64  LEU A C     1 
ATOM   365   O O     . LEU A 1 64  ? -0.603  -37.022 -14.344  1.00 76.94  ?  64  LEU A O     1 
ATOM   366   C CB    . LEU A 1 64  ? -0.997  -33.959 -13.137  1.00 59.50  ?  64  LEU A CB    1 
ATOM   367   C CG    . LEU A 1 64  ? -1.691  -32.979 -12.193  1.00 57.10  ?  64  LEU A CG    1 
ATOM   368   C CD1   . LEU A 1 64  ? -1.877  -31.633 -12.867  1.00 60.28  ?  64  LEU A CD1   1 
ATOM   369   C CD2   . LEU A 1 64  ? -3.032  -33.547 -11.773  1.00 59.24  ?  64  LEU A CD2   1 
ATOM   370   N N     . LYS A 1 65  ? 1.297   -36.134 -13.513  1.00 73.45  ?  65  LYS A N     1 
ATOM   371   C CA    . LYS A 1 65  ? 2.122   -36.909 -14.423  1.00 80.63  ?  65  LYS A CA    1 
ATOM   372   C C     . LYS A 1 65  ? 1.916   -38.394 -14.208  1.00 83.88  ?  65  LYS A C     1 
ATOM   373   O O     . LYS A 1 65  ? 1.772   -39.144 -15.181  1.00 82.15  ?  65  LYS A O     1 
ATOM   374   C CB    . LYS A 1 65  ? 3.598   -36.550 -14.243  1.00 69.22  ?  65  LYS A CB    1 
ATOM   375   N N     . SER A 1 66  ? 1.743   -38.797 -12.955  1.00 82.40  ?  66  SER A N     1 
ATOM   376   C CA    . SER A 1 66  ? 1.538   -40.206 -12.673  1.00 87.02  ?  66  SER A CA    1 
ATOM   377   C C     . SER A 1 66  ? 0.238   -40.638 -13.323  1.00 86.72  ?  66  SER A C     1 
ATOM   378   O O     . SER A 1 66  ? 0.196   -41.652 -14.029  1.00 86.96  ?  66  SER A O     1 
ATOM   379   C CB    . SER A 1 66  ? 1.505   -40.468 -11.167  1.00 84.51  ?  66  SER A CB    1 
ATOM   380   N N     . ILE A 1 67  ? -0.777  -39.789 -13.206  1.00 78.72  ?  67  ILE A N     1 
ATOM   381   C CA    . ILE A 1 67  ? -2.061  -40.085 -13.813  1.00 85.57  ?  67  ILE A CA    1 
ATOM   382   C C     . ILE A 1 67  ? -1.885  -40.150 -15.316  1.00 93.00  ?  67  ILE A C     1 
ATOM   383   O O     . ILE A 1 67  ? -2.334  -41.105 -15.960  1.00 87.87  ?  67  ILE A O     1 
ATOM   384   C CB    . ILE A 1 67  ? -3.128  -39.034 -13.459  1.00 81.13  ?  67  ILE A CB    1 
ATOM   385   C CG1   . ILE A 1 67  ? -3.522  -39.146 -11.986  1.00 73.85  ?  67  ILE A CG1   1 
ATOM   386   C CG2   . ILE A 1 67  ? -4.354  -39.202 -14.340  1.00 82.90  ?  67  ILE A CG2   1 
ATOM   387   C CD1   . ILE A 1 67  ? -4.427  -38.030 -11.515  1.00 64.35  ?  67  ILE A CD1   1 
ATOM   388   N N     . ARG A 1 68  ? -1.172  -39.170 -15.861  1.00 84.59  ?  68  ARG A N     1 
ATOM   389   C CA    . ARG A 1 68  ? -0.919  -39.147 -17.289  1.00 80.38  ?  68  ARG A CA    1 
ATOM   390   C C     . ARG A 1 68  ? -0.211  -40.430 -17.689  1.00 89.77  ?  68  ARG A C     1 
ATOM   391   O O     . ARG A 1 68  ? -0.656  -41.132 -18.611  1.00 86.15  ?  68  ARG A O     1 
ATOM   392   C CB    . ARG A 1 68  ? -0.080  -37.923 -17.665  1.00 83.69  ?  68  ARG A CB    1 
ATOM   393   C CG    . ARG A 1 68  ? 0.600   -38.006 -19.020  1.00 68.59  ?  68  ARG A CG    1 
ATOM   394   C CD    . ARG A 1 68  ? -0.397  -37.753 -20.137  1.00 70.10  ?  68  ARG A CD    1 
ATOM   395   N NE    . ARG A 1 68  ? -0.093  -38.519 -21.341  1.00 86.60  ?  68  ARG A NE    1 
ATOM   396   C CZ    . ARG A 1 68  ? -0.504  -38.184 -22.559  1.00 89.80  ?  68  ARG A CZ    1 
ATOM   397   N NH1   . ARG A 1 68  ? -1.241  -37.095 -22.736  1.00 83.07  1  68  ARG A NH1   1 
ATOM   398   N NH2   . ARG A 1 68  ? -0.182  -38.937 -23.602  1.00 102.01 ?  68  ARG A NH2   1 
ATOM   399   N N     . GLU A 1 69  ? 0.758   -40.835 -16.871  1.00 98.41  ?  69  GLU A N     1 
ATOM   400   C CA    . GLU A 1 69  ? 1.548   -42.013 -17.184  1.00 98.05  ?  69  GLU A CA    1 
ATOM   401   C C     . GLU A 1 69  ? 0.648   -43.224 -17.139  1.00 96.19  ?  69  GLU A C     1 
ATOM   402   O O     . GLU A 1 69  ? 0.807   -44.149 -17.936  1.00 100.94 ?  69  GLU A O     1 
ATOM   403   C CB    . GLU A 1 69  ? 2.715   -42.167 -16.206  1.00 90.56  ?  69  GLU A CB    1 
ATOM   404   N N     . TYR A 1 70  ? -0.289  -43.229 -16.202  1.00 84.23  ?  70  TYR A N     1 
ATOM   405   C CA    . TYR A 1 70  ? -1.221  -44.333 -16.141  1.00 76.67  ?  70  TYR A CA    1 
ATOM   406   C C     . TYR A 1 70  ? -2.068  -44.395 -17.412  1.00 80.62  ?  70  TYR A C     1 
ATOM   407   O O     . TYR A 1 70  ? -2.172  -45.452 -18.037  1.00 81.74  ?  70  TYR A O     1 
ATOM   408   C CB    . TYR A 1 70  ? -2.124  -44.224 -14.911  1.00 76.38  ?  70  TYR A CB    1 
ATOM   409   C CG    . TYR A 1 70  ? -3.001  -45.438 -14.697  1.00 65.62  ?  70  TYR A CG    1 
ATOM   410   C CD1   . TYR A 1 70  ? -2.571  -46.498 -13.910  1.00 62.89  ?  70  TYR A CD1   1 
ATOM   411   C CD2   . TYR A 1 70  ? -4.254  -45.530 -15.290  1.00 64.30  ?  70  TYR A CD2   1 
ATOM   412   C CE1   . TYR A 1 70  ? -3.364  -47.614 -13.718  1.00 76.35  ?  70  TYR A CE1   1 
ATOM   413   C CE2   . TYR A 1 70  ? -5.056  -46.639 -15.100  1.00 70.94  ?  70  TYR A CE2   1 
ATOM   414   C CZ    . TYR A 1 70  ? -4.605  -47.679 -14.314  1.00 82.23  ?  70  TYR A CZ    1 
ATOM   415   O OH    . TYR A 1 70  ? -5.401  -48.784 -14.118  1.00 84.20  ?  70  TYR A OH    1 
ATOM   416   N N     . LEU A 1 71  ? -2.674  -43.272 -17.798  1.00 84.42  ?  71  LEU A N     1 
ATOM   417   C CA    . LEU A 1 71  ? -3.689  -43.350 -18.851  1.00 77.62  ?  71  LEU A CA    1 
ATOM   418   C C     . LEU A 1 71  ? -3.184  -43.247 -20.284  1.00 73.14  ?  71  LEU A C     1 
ATOM   419   O O     . LEU A 1 71  ? -3.852  -43.702 -21.213  1.00 80.67  ?  71  LEU A O     1 
ATOM   420   C CB    . LEU A 1 71  ? -4.751  -42.272 -18.623  1.00 73.62  ?  71  LEU A CB    1 
ATOM   421   C CG    . LEU A 1 71  ? -5.554  -42.413 -17.328  1.00 76.73  ?  71  LEU A CG    1 
ATOM   422   C CD1   . LEU A 1 71  ? -6.299  -41.127 -17.010  1.00 67.14  ?  71  LEU A CD1   1 
ATOM   423   C CD2   . LEU A 1 71  ? -6.516  -43.589 -17.417  1.00 72.50  ?  71  LEU A CD2   1 
ATOM   424   N N     . GLY A 1 72  ? -2.010  -42.658 -20.468  1.00 78.19  ?  72  GLY A N     1 
ATOM   425   C CA    . GLY A 1 72  ? -1.497  -42.435 -21.805  1.00 77.80  ?  72  GLY A CA    1 
ATOM   426   C C     . GLY A 1 72  ? -2.317  -41.354 -22.484  1.00 63.97  ?  72  GLY A C     1 
ATOM   427   O O     . GLY A 1 72  ? -2.465  -41.349 -23.706  1.00 98.74  ?  72  GLY A O     1 
ATOM   428   N N     . ALA A 1 73  ? -2.850  -40.435 -21.685  1.00 64.23  ?  73  ALA A N     1 
ATOM   429   C CA    . ALA A 1 73  ? -3.746  -39.398 -22.186  1.00 65.62  ?  73  ALA A CA    1 
ATOM   430   C C     . ALA A 1 73  ? -3.876  -38.265 -21.176  1.00 67.17  ?  73  ALA A C     1 
ATOM   431   O O     . ALA A 1 73  ? -3.570  -38.439 -19.997  1.00 73.54  ?  73  ALA A O     1 
ATOM   432   C CB    . ALA A 1 73  ? -5.114  -39.983 -22.505  1.00 55.83  ?  73  ALA A CB    1 
ATOM   433   N N     . GLY A 1 74  ? -4.337  -37.107 -21.638  1.00 60.47  ?  74  GLY A N     1 
ATOM   434   C CA    . GLY A 1 74  ? -4.484  -35.961 -20.763  1.00 42.64  ?  74  GLY A CA    1 
ATOM   435   C C     . GLY A 1 74  ? -3.499  -34.864 -21.107  1.00 42.09  ?  74  GLY A C     1 
ATOM   436   O O     . GLY A 1 74  ? -2.361  -35.144 -21.484  1.00 61.08  ?  74  GLY A O     1 
ATOM   437   N N     . ILE A 1 75  ? -3.928  -33.612 -20.985  1.00 42.81  ?  75  ILE A N     1 
ATOM   438   C CA    . ILE A 1 75  ? -3.046  -32.492 -21.290  1.00 47.41  ?  75  ILE A CA    1 
ATOM   439   C C     . ILE A 1 75  ? -2.732  -31.733 -20.008  1.00 47.70  ?  75  ILE A C     1 
ATOM   440   O O     . ILE A 1 75  ? -3.633  -31.256 -19.320  1.00 55.15  ?  75  ILE A O     1 
ATOM   441   C CB    . ILE A 1 75  ? -3.674  -31.529 -22.315  1.00 48.21  ?  75  ILE A CB    1 
ATOM   442   C CG1   . ILE A 1 75  ? -3.939  -32.251 -23.637  1.00 41.03  ?  75  ILE A CG1   1 
ATOM   443   C CG2   . ILE A 1 75  ? -2.774  -30.325 -22.534  1.00 38.28  ?  75  ILE A CG2   1 
ATOM   444   C CD1   . ILE A 1 75  ? -4.633  -31.387 -24.670  1.00 53.78  ?  75  ILE A CD1   1 
ATOM   445   N N     . ILE A 1 76  ? -1.445  -31.615 -19.700  1.00 46.50  ?  76  ILE A N     1 
ATOM   446   C CA    . ILE A 1 76  ? -1.007  -30.955 -18.476  1.00 41.73  ?  76  ILE A CA    1 
ATOM   447   C C     . ILE A 1 76  ? -0.586  -29.508 -18.717  1.00 48.55  ?  76  ILE A C     1 
ATOM   448   O O     . ILE A 1 76  ? 0.141   -29.208 -19.664  1.00 68.66  ?  76  ILE A O     1 
ATOM   449   C CB    . ILE A 1 76  ? 0.156   -31.730 -17.822  1.00 34.56  ?  76  ILE A CB    1 
ATOM   450   C CG1   . ILE A 1 76  ? -0.284  -33.157 -17.490  1.00 38.87  ?  76  ILE A CG1   1 
ATOM   451   C CG2   . ILE A 1 76  ? 0.647   -31.018 -16.571  1.00 42.05  ?  76  ILE A CG2   1 
ATOM   452   C CD1   . ILE A 1 76  ? 0.701   -33.926 -16.638  1.00 42.35  ?  76  ILE A CD1   1 
ATOM   453   N N     . THR A 1 77  ? -1.052  -28.619 -17.845  1.00 53.04  ?  77  THR A N     1 
ATOM   454   C CA    . THR A 1 77  ? -0.678  -27.212 -17.875  1.00 54.11  ?  77  THR A CA    1 
ATOM   455   C C     . THR A 1 77  ? -0.282  -26.738 -16.481  1.00 59.54  ?  77  THR A C     1 
ATOM   456   O O     . THR A 1 77  ? -0.748  -27.272 -15.474  1.00 57.53  ?  77  THR A O     1 
ATOM   457   C CB    . THR A 1 77  ? -1.824  -26.330 -18.403  1.00 57.06  ?  77  THR A CB    1 
ATOM   458   O OG1   . THR A 1 77  ? -3.027  -26.620 -17.679  1.00 71.70  ?  77  THR A OG1   1 
ATOM   459   C CG2   . THR A 1 77  ? -2.056  -26.586 -19.881  1.00 68.92  ?  77  THR A CG2   1 
ATOM   460   N N     . SER A 1 78  ? 0.575   -25.724 -16.437  1.00 73.50  ?  78  SER A N     1 
ATOM   461   C CA    . SER A 1 78  ? 1.019   -25.131 -15.182  1.00 57.15  ?  78  SER A CA    1 
ATOM   462   C C     . SER A 1 78  ? 1.128   -23.617 -15.305  1.00 71.11  ?  78  SER A C     1 
ATOM   463   O O     . SER A 1 78  ? 1.938   -23.103 -16.077  1.00 70.46  ?  78  SER A O     1 
ATOM   464   C CB    . SER A 1 78  ? 2.361   -25.721 -14.746  1.00 69.95  ?  78  SER A CB    1 
ATOM   465   O OG    . SER A 1 78  ? 2.665   -25.364 -13.409  1.00 73.94  ?  78  SER A OG    1 
ATOM   466   N N     . ASP A 1 79  ? 0.306   -22.911 -14.538  1.00 63.94  ?  79  ASP A N     1 
ATOM   467   C CA    . ASP A 1 79  ? 0.356   -21.456 -14.495  1.00 65.00  ?  79  ASP A CA    1 
ATOM   468   C C     . ASP A 1 79  ? 0.069   -20.973 -13.081  1.00 74.52  ?  79  ASP A C     1 
ATOM   469   O O     . ASP A 1 79  ? 0.939   -21.050 -12.214  1.00 88.75  ?  79  ASP A O     1 
ATOM   470   C CB    . ASP A 1 79  ? -0.645  -20.851 -15.480  1.00 55.53  ?  79  ASP A CB    1 
ATOM   471   N N     . ILE A 1 80  ? -1.139  -20.477 -12.838  1.00 71.90  ?  80  ILE A N     1 
ATOM   472   C CA    . ILE A 1 80  ? -1.501  -20.073 -11.486  1.00 70.13  ?  80  ILE A CA    1 
ATOM   473   C C     . ILE A 1 80  ? -1.835  -21.319 -10.672  1.00 60.17  ?  80  ILE A C     1 
ATOM   474   O O     . ILE A 1 80  ? -1.779  -21.315 -9.443   1.00 59.02  ?  80  ILE A O     1 
ATOM   475   C CB    . ILE A 1 80  ? -2.701  -19.103 -11.487  1.00 74.92  ?  80  ILE A CB    1 
ATOM   476   C CG1   . ILE A 1 80  ? -2.527  -18.042 -12.576  1.00 67.97  ?  80  ILE A CG1   1 
ATOM   477   C CG2   . ILE A 1 80  ? -2.880  -18.457 -10.118  1.00 71.00  ?  80  ILE A CG2   1 
ATOM   478   C CD1   . ILE A 1 80  ? -3.706  -17.105 -12.707  1.00 79.78  ?  80  ILE A CD1   1 
ATOM   479   N N     . ASP A 1 81  ? -2.163  -22.392 -11.381  1.00 72.33  ?  81  ASP A N     1 
ATOM   480   C CA    . ASP A 1 81  ? -2.302  -23.714 -10.785  1.00 64.47  ?  81  ASP A CA    1 
ATOM   481   C C     . ASP A 1 81  ? -1.842  -24.797 -11.757  1.00 75.39  ?  81  ASP A C     1 
ATOM   482   O O     . ASP A 1 81  ? -1.444  -24.500 -12.884  1.00 85.00  ?  81  ASP A O     1 
ATOM   483   C CB    . ASP A 1 81  ? -3.750  -23.954 -10.330  1.00 66.93  ?  81  ASP A CB    1 
ATOM   484   C CG    . ASP A 1 81  ? -4.754  -23.935 -11.479  1.00 76.02  ?  81  ASP A CG    1 
ATOM   485   O OD1   . ASP A 1 81  ? -4.351  -23.895 -12.660  1.00 72.12  ?  81  ASP A OD1   1 
ATOM   486   O OD2   . ASP A 1 81  ? -5.969  -23.965 -11.189  1.00 71.85  -1 81  ASP A OD2   1 
ATOM   487   N N     . ALA A 1 82  ? -1.896  -26.049 -11.321  1.00 68.29  ?  82  ALA A N     1 
ATOM   488   C CA    . ALA A 1 82  ? -1.544  -27.163 -12.189  1.00 52.99  ?  82  ALA A CA    1 
ATOM   489   C C     . ALA A 1 82  ? -2.794  -27.945 -12.557  1.00 56.38  ?  82  ALA A C     1 
ATOM   490   O O     . ALA A 1 82  ? -3.602  -28.271 -11.691  1.00 68.24  ?  82  ALA A O     1 
ATOM   491   C CB    . ALA A 1 82  ? -0.532  -28.066 -11.514  1.00 54.65  ?  82  ALA A CB    1 
ATOM   492   N N     . ARG A 1 83  ? -2.950  -28.248 -13.842  1.00 63.20  ?  83  ARG A N     1 
ATOM   493   C CA    . ARG A 1 83  ? -4.160  -28.911 -14.316  1.00 54.04  ?  83  ARG A CA    1 
ATOM   494   C C     . ARG A 1 83  ? -3.846  -30.032 -15.298  1.00 45.41  ?  83  ARG A C     1 
ATOM   495   O O     . ARG A 1 83  ? -2.939  -29.912 -16.112  1.00 52.32  ?  83  ARG A O     1 
ATOM   496   C CB    . ARG A 1 83  ? -5.102  -27.904 -14.983  1.00 43.57  ?  83  ARG A CB    1 
ATOM   497   C CG    . ARG A 1 83  ? -5.663  -26.827 -14.066  1.00 47.92  ?  83  ARG A CG    1 
ATOM   498   C CD    . ARG A 1 83  ? -6.480  -25.820 -14.865  1.00 46.26  ?  83  ARG A CD    1 
ATOM   499   N NE    . ARG A 1 83  ? -7.184  -24.861 -14.018  1.00 47.73  ?  83  ARG A NE    1 
ATOM   500   C CZ    . ARG A 1 83  ? -8.350  -24.305 -14.330  1.00 53.01  ?  83  ARG A CZ    1 
ATOM   501   N NH1   . ARG A 1 83  ? -8.948  -24.612 -15.474  1.00 60.95  1  83  ARG A NH1   1 
ATOM   502   N NH2   . ARG A 1 83  ? -8.918  -23.439 -13.503  1.00 46.14  ?  83  ARG A NH2   1 
ATOM   503   N N     . ILE A 1 84  ? -4.598  -31.123 -15.217  1.00 39.40  ?  84  ILE A N     1 
ATOM   504   C CA    . ILE A 1 84  ? -4.665  -32.077 -16.314  1.00 33.83  ?  84  ILE A CA    1 
ATOM   505   C C     . ILE A 1 84  ? -6.088  -32.085 -16.875  1.00 51.96  ?  84  ILE A C     1 
ATOM   506   O O     . ILE A 1 84  ? -7.069  -32.127 -16.121  1.00 56.85  ?  84  ILE A O     1 
ATOM   507   C CB    . ILE A 1 84  ? -4.216  -33.495 -15.881  1.00 36.18  ?  84  ILE A CB    1 
ATOM   508   C CG1   . ILE A 1 84  ? -4.132  -34.418 -17.098  1.00 31.31  ?  84  ILE A CG1   1 
ATOM   509   C CG2   . ILE A 1 84  ? -5.135  -34.072 -14.809  1.00 55.48  ?  84  ILE A CG2   1 
ATOM   510   C CD1   . ILE A 1 84  ? -3.738  -35.837 -16.769  1.00 43.14  ?  84  ILE A CD1   1 
ATOM   511   N N     . ARG A 1 85  ? -6.200  -31.995 -18.198  1.00 49.20  ?  85  ARG A N     1 
ATOM   512   C CA    . ARG A 1 85  ? -7.508  -31.884 -18.831  1.00 42.20  ?  85  ARG A CA    1 
ATOM   513   C C     . ARG A 1 85  ? -7.744  -32.906 -19.938  1.00 45.12  ?  85  ARG A C     1 
ATOM   514   O O     . ARG A 1 85  ? -6.817  -33.336 -20.629  1.00 55.14  ?  85  ARG A O     1 
ATOM   515   C CB    . ARG A 1 85  ? -7.713  -30.479 -19.405  1.00 48.97  ?  85  ARG A CB    1 
ATOM   516   C CG    . ARG A 1 85  ? -6.806  -30.133 -20.574  1.00 45.95  ?  85  ARG A CG    1 
ATOM   517   C CD    . ARG A 1 85  ? -7.009  -28.695 -21.018  1.00 50.27  ?  85  ARG A CD    1 
ATOM   518   N NE    . ARG A 1 85  ? -6.487  -28.463 -22.362  1.00 46.94  ?  85  ARG A NE    1 
ATOM   519   C CZ    . ARG A 1 85  ? -5.305  -27.917 -22.623  1.00 55.26  ?  85  ARG A CZ    1 
ATOM   520   N NH1   . ARG A 1 85  ? -4.514  -27.540 -21.628  1.00 73.34  1  85  ARG A NH1   1 
ATOM   521   N NH2   . ARG A 1 85  ? -4.914  -27.748 -23.878  1.00 54.72  ?  85  ARG A NH2   1 
ATOM   522   N N     . PHE A 1 86  ? -9.010  -33.277 -20.083  1.00 47.33  ?  86  PHE A N     1 
ATOM   523   C CA    . PHE A 1 86  ? -9.480  -34.206 -21.100  1.00 58.35  ?  86  PHE A CA    1 
ATOM   524   C C     . PHE A 1 86  ? -10.641 -33.516 -21.805  1.00 55.77  ?  86  PHE A C     1 
ATOM   525   O O     . PHE A 1 86  ? -11.686 -33.259 -21.197  1.00 49.64  ?  86  PHE A O     1 
ATOM   526   C CB    . PHE A 1 86  ? -9.906  -35.548 -20.499  1.00 60.34  ?  86  PHE A CB    1 
ATOM   527   C CG    . PHE A 1 86  ? -8.817  -36.247 -19.730  1.00 56.88  ?  86  PHE A CG    1 
ATOM   528   C CD1   . PHE A 1 86  ? -8.454  -35.823 -18.462  1.00 46.44  ?  86  PHE A CD1   1 
ATOM   529   C CD2   . PHE A 1 86  ? -8.145  -37.324 -20.287  1.00 64.69  ?  86  PHE A CD2   1 
ATOM   530   C CE1   . PHE A 1 86  ? -7.452  -36.465 -17.761  1.00 49.88  ?  86  PHE A CE1   1 
ATOM   531   C CE2   . PHE A 1 86  ? -7.143  -37.971 -19.590  1.00 71.72  ?  86  PHE A CE2   1 
ATOM   532   C CZ    . PHE A 1 86  ? -6.796  -37.540 -18.325  1.00 59.13  ?  86  PHE A CZ    1 
ATOM   533   N N     . GLU A 1 87  ? -10.449 -33.208 -23.084  1.00 50.08  ?  87  GLU A N     1 
ATOM   534   C CA    . GLU A 1 87  ? -11.413 -32.407 -23.826  1.00 45.30  ?  87  GLU A CA    1 
ATOM   535   C C     . GLU A 1 87  ? -11.750 -33.017 -25.185  1.00 55.26  ?  87  GLU A C     1 
ATOM   536   O O     . GLU A 1 87  ? -12.838 -32.792 -25.717  1.00 57.65  ?  87  GLU A O     1 
ATOM   537   C CB    . GLU A 1 87  ? -10.866 -30.987 -23.999  1.00 42.67  ?  87  GLU A CB    1 
ATOM   538   C CG    . GLU A 1 87  ? -10.741 -30.218 -22.686  1.00 50.74  ?  87  GLU A CG    1 
ATOM   539   C CD    . GLU A 1 87  ? -10.397 -28.756 -22.883  1.00 54.10  ?  87  GLU A CD    1 
ATOM   540   O OE1   . GLU A 1 87  ? -9.877  -28.410 -23.963  1.00 51.51  ?  87  GLU A OE1   1 
ATOM   541   O OE2   . GLU A 1 87  ? -10.636 -27.956 -21.954  1.00 56.87  -1 87  GLU A OE2   1 
ATOM   542   N N     . SER A 1 88  ? -10.819 -33.783 -25.749  1.00 56.74  ?  88  SER A N     1 
ATOM   543   C CA    . SER A 1 88  ? -11.062 -34.450 -27.026  1.00 52.78  ?  88  SER A CA    1 
ATOM   544   C C     . SER A 1 88  ? -11.915 -35.697 -26.813  1.00 56.49  ?  88  SER A C     1 
ATOM   545   O O     . SER A 1 88  ? -11.912 -36.274 -25.725  1.00 55.09  ?  88  SER A O     1 
ATOM   546   C CB    . SER A 1 88  ? -9.742  -34.821 -27.699  1.00 50.12  ?  88  SER A CB    1 
ATOM   547   O OG    . SER A 1 88  ? -9.136  -35.921 -27.044  1.00 49.57  ?  88  SER A OG    1 
ATOM   548   N N     . LEU A 1 89  ? -12.650 -36.105 -27.843  1.00 59.45  ?  89  LEU A N     1 
ATOM   549   C CA    . LEU A 1 89  ? -13.527 -37.265 -27.718  1.00 57.11  ?  89  LEU A CA    1 
ATOM   550   C C     . LEU A 1 89  ? -12.787 -38.560 -27.376  1.00 59.83  ?  89  LEU A C     1 
ATOM   551   O O     . LEU A 1 89  ? -13.284 -39.372 -26.601  1.00 56.11  ?  89  LEU A O     1 
ATOM   552   C CB    . LEU A 1 89  ? -14.314 -37.463 -29.017  1.00 52.66  ?  89  LEU A CB    1 
ATOM   553   C CG    . LEU A 1 89  ? -15.393 -36.427 -29.346  1.00 59.24  ?  89  LEU A CG    1 
ATOM   554   C CD1   . LEU A 1 89  ? -16.011 -36.702 -30.708  1.00 79.33  ?  89  LEU A CD1   1 
ATOM   555   C CD2   . LEU A 1 89  ? -16.464 -36.395 -28.272  1.00 57.49  ?  89  LEU A CD2   1 
ATOM   556   N N     . LYS A 1 90  ? -11.613 -38.758 -27.971  1.00 58.20  ?  90  LYS A N     1 
ATOM   557   C CA    . LYS A 1 90  ? -10.787 -39.930 -27.676  1.00 65.98  ?  90  LYS A CA    1 
ATOM   558   C C     . LYS A 1 90  ? -10.322 -40.012 -26.220  1.00 66.04  ?  90  LYS A C     1 
ATOM   559   O O     . LYS A 1 90  ? -10.395 -41.068 -25.571  1.00 64.75  ?  90  LYS A O     1 
ATOM   560   C CB    . LYS A 1 90  ? -9.569  -39.950 -28.602  1.00 62.69  ?  90  LYS A CB    1 
ATOM   561   N N     . GLU A 1 91  ? -9.895  -38.866 -25.699  1.00 53.84  ?  91  GLU A N     1 
ATOM   562   C CA    . GLU A 1 91  ? -9.416  -38.774 -24.329  1.00 57.88  ?  91  GLU A CA    1 
ATOM   563   C C     . GLU A 1 91  ? -10.550 -38.969 -23.344  1.00 60.21  ?  91  GLU A C     1 
ATOM   564   O O     . GLU A 1 91  ? -10.407 -39.668 -22.332  1.00 67.09  ?  91  GLU A O     1 
ATOM   565   C CB    . GLU A 1 91  ? -8.736  -37.424 -24.097  1.00 58.85  ?  91  GLU A CB    1 
ATOM   566   N N     . LEU A 1 92  ? -11.686 -38.350 -23.638  1.00 51.10  ?  92  LEU A N     1 
ATOM   567   C CA    . LEU A 1 92  ? -12.814 -38.475 -22.744  1.00 53.85  ?  92  LEU A CA    1 
ATOM   568   C C     . LEU A 1 92  ? -13.292 -39.916 -22.808  1.00 64.00  ?  92  LEU A C     1 
ATOM   569   O O     . LEU A 1 92  ? -13.792 -40.447 -21.826  1.00 66.64  ?  92  LEU A O     1 
ATOM   570   C CB    . LEU A 1 92  ? -13.921 -37.496 -23.125  1.00 48.00  ?  92  LEU A CB    1 
ATOM   571   C CG    . LEU A 1 92  ? -13.595 -36.047 -22.758  1.00 52.22  ?  92  LEU A CG    1 
ATOM   572   C CD1   . LEU A 1 92  ? -14.585 -35.090 -23.386  1.00 50.71  ?  92  LEU A CD1   1 
ATOM   573   C CD2   . LEU A 1 92  ? -13.571 -35.881 -21.249  1.00 56.79  ?  92  LEU A CD2   1 
ATOM   574   N N     . GLU A 1 93  ? -13.128 -40.546 -23.971  1.00 73.75  ?  93  GLU A N     1 
ATOM   575   C CA    . GLU A 1 93  ? -13.463 -41.956 -24.126  1.00 72.92  ?  93  GLU A CA    1 
ATOM   576   C C     . GLU A 1 93  ? -12.610 -42.789 -23.174  1.00 74.16  ?  93  GLU A C     1 
ATOM   577   O O     . GLU A 1 93  ? -13.099 -43.722 -22.534  1.00 80.78  ?  93  GLU A O     1 
ATOM   578   C CB    . GLU A 1 93  ? -13.261 -42.415 -25.572  1.00 69.76  ?  93  GLU A CB    1 
ATOM   579   N N     . VAL A 1 94  ? -11.328 -42.433 -23.088  1.00 60.00  ?  94  VAL A N     1 
ATOM   580   C CA    . VAL A 1 94  ? -10.410 -43.088 -22.156  1.00 60.76  ?  94  VAL A CA    1 
ATOM   581   C C     . VAL A 1 94  ? -10.857 -42.908 -20.702  1.00 69.31  ?  94  VAL A C     1 
ATOM   582   O O     . VAL A 1 94  ? -10.840 -43.854 -19.903  1.00 67.13  ?  94  VAL A O     1 
ATOM   583   C CB    . VAL A 1 94  ? -8.972  -42.555 -22.317  1.00 65.16  ?  94  VAL A CB    1 
ATOM   584   C CG1   . VAL A 1 94  ? -8.057  -43.159 -21.263  1.00 68.40  ?  94  VAL A CG1   1 
ATOM   585   C CG2   . VAL A 1 94  ? -8.449  -42.856 -23.714  1.00 65.97  ?  94  VAL A CG2   1 
ATOM   586   N N     . VAL A 1 95  ? -11.292 -41.692 -20.382  1.00 67.13  ?  95  VAL A N     1 
ATOM   587   C CA    . VAL A 1 95  ? -11.789 -41.369 -19.046  1.00 49.09  ?  95  VAL A CA    1 
ATOM   588   C C     . VAL A 1 95  ? -13.025 -42.188 -18.685  1.00 61.27  ?  95  VAL A C     1 
ATOM   589   O O     . VAL A 1 95  ? -13.096 -42.781 -17.603  1.00 70.18  ?  95  VAL A O     1 
ATOM   590   C CB    . VAL A 1 95  ? -12.128 -39.871 -18.922  1.00 44.60  ?  95  VAL A CB    1 
ATOM   591   C CG1   . VAL A 1 95  ? -12.851 -39.591 -17.619  1.00 52.54  ?  95  VAL A CG1   1 
ATOM   592   C CG2   . VAL A 1 95  ? -10.867 -39.038 -19.018  1.00 49.19  ?  95  VAL A CG2   1 
ATOM   593   N N     . ILE A 1 96  ? -13.990 -42.227 -19.599  1.00 62.52  ?  96  ILE A N     1 
ATOM   594   C CA    . ILE A 1 96  ? -15.220 -42.970 -19.376  1.00 71.11  ?  96  ILE A CA    1 
ATOM   595   C C     . ILE A 1 96  ? -14.896 -44.449 -19.230  1.00 74.40  ?  96  ILE A C     1 
ATOM   596   O O     . ILE A 1 96  ? -15.472 -45.119 -18.383  1.00 64.47  ?  96  ILE A O     1 
ATOM   597   C CB    . ILE A 1 96  ? -16.250 -42.751 -20.513  1.00 64.61  ?  96  ILE A CB    1 
ATOM   598   C CG1   . ILE A 1 96  ? -16.963 -41.409 -20.333  1.00 61.03  ?  96  ILE A CG1   1 
ATOM   599   C CG2   . ILE A 1 96  ? -17.307 -43.840 -20.507  1.00 77.11  ?  96  ILE A CG2   1 
ATOM   600   C CD1   . ILE A 1 96  ? -16.846 -40.475 -21.509  1.00 56.25  ?  96  ILE A CD1   1 
ATOM   601   N N     . ASN A 1 97  ? -13.989 -44.964 -20.053  1.00 75.91  ?  97  ASN A N     1 
ATOM   602   C CA    . ASN A 1 97  ? -13.609 -46.370 -19.948  1.00 77.06  ?  97  ASN A CA    1 
ATOM   603   C C     . ASN A 1 97  ? -13.014 -46.661 -18.569  1.00 81.08  ?  97  ASN A C     1 
ATOM   604   O O     . ASN A 1 97  ? -13.328 -47.683 -17.934  1.00 86.84  ?  97  ASN A O     1 
ATOM   605   C CB    . ASN A 1 97  ? -12.613 -46.746 -21.046  1.00 79.81  ?  97  ASN A CB    1 
ATOM   606   N N     . HIS A 1 98  ? -12.202 -45.723 -18.082  1.00 79.14  ?  98  HIS A N     1 
ATOM   607   C CA    . HIS A 1 98  ? -11.594 -45.866 -16.763  1.00 81.96  ?  98  HIS A CA    1 
ATOM   608   C C     . HIS A 1 98  ? -12.638 -45.888 -15.654  1.00 70.96  ?  98  HIS A C     1 
ATOM   609   O O     . HIS A 1 98  ? -12.631 -46.791 -14.818  1.00 71.43  ?  98  HIS A O     1 
ATOM   610   C CB    . HIS A 1 98  ? -10.591 -44.741 -16.500  1.00 76.64  ?  98  HIS A CB    1 
ATOM   611   C CG    . HIS A 1 98  ? -10.024 -44.754 -15.113  1.00 69.83  ?  98  HIS A CG    1 
ATOM   612   N ND1   . HIS A 1 98  ? -9.049  -45.642 -14.715  1.00 71.50  ?  98  HIS A ND1   1 
ATOM   613   C CD2   . HIS A 1 98  ? -10.307 -43.996 -14.027  1.00 70.77  ?  98  HIS A CD2   1 
ATOM   614   C CE1   . HIS A 1 98  ? -8.749  -45.426 -13.447  1.00 79.55  ?  98  HIS A CE1   1 
ATOM   615   N NE2   . HIS A 1 98  ? -9.500  -44.432 -13.006  1.00 72.90  ?  98  HIS A NE2   1 
ATOM   616   N N     . PHE A 1 99  ? -13.535 -44.905 -15.633  1.00 64.93  ?  99  PHE A N     1 
ATOM   617   C CA    . PHE A 1 99  ? -14.478 -44.823 -14.522  1.00 57.94  ?  99  PHE A CA    1 
ATOM   618   C C     . PHE A 1 99  ? -15.552 -45.896 -14.651  1.00 72.58  ?  99  PHE A C     1 
ATOM   619   O O     . PHE A 1 99  ? -16.207 -46.247 -13.672  1.00 68.18  ?  99  PHE A O     1 
ATOM   620   C CB    . PHE A 1 99  ? -15.123 -43.439 -14.434  1.00 67.95  ?  99  PHE A CB    1 
ATOM   621   C CG    . PHE A 1 99  ? -14.217 -42.384 -13.873  1.00 70.44  ?  99  PHE A CG    1 
ATOM   622   C CD1   . PHE A 1 99  ? -13.703 -42.508 -12.592  1.00 74.74  ?  99  PHE A CD1   1 
ATOM   623   C CD2   . PHE A 1 99  ? -13.893 -41.261 -14.613  1.00 65.36  ?  99  PHE A CD2   1 
ATOM   624   C CE1   . PHE A 1 99  ? -12.871 -41.540 -12.065  1.00 61.81  ?  99  PHE A CE1   1 
ATOM   625   C CE2   . PHE A 1 99  ? -13.061 -40.286 -14.090  1.00 67.79  ?  99  PHE A CE2   1 
ATOM   626   C CZ    . PHE A 1 99  ? -12.551 -40.426 -12.814  1.00 66.39  ?  99  PHE A CZ    1 
ATOM   627   N N     . ASP A 1 100 ? -15.745 -46.407 -15.862  1.00 83.65  ?  100 ASP A N     1 
ATOM   628   C CA    . ASP A 1 100 ? -16.603 -47.565 -16.049  1.00 82.74  ?  100 ASP A CA    1 
ATOM   629   C C     . ASP A 1 100 ? -15.933 -48.771 -15.414  1.00 70.12  ?  100 ASP A C     1 
ATOM   630   O O     . ASP A 1 100 ? -16.605 -49.652 -14.880  1.00 63.91  ?  100 ASP A O     1 
ATOM   631   C CB    . ASP A 1 100 ? -16.886 -47.815 -17.530  1.00 93.25  ?  100 ASP A CB    1 
ATOM   632   C CG    . ASP A 1 100 ? -17.952 -46.887 -18.083  1.00 89.18  ?  100 ASP A CG    1 
ATOM   633   O OD1   . ASP A 1 100 ? -18.578 -46.158 -17.285  1.00 79.50  ?  100 ASP A OD1   1 
ATOM   634   O OD2   . ASP A 1 100 ? -18.162 -46.887 -19.314  1.00 82.98  -1 100 ASP A OD2   1 
ATOM   635   N N     . LYS A 1 101 ? -14.603 -48.814 -15.472  1.00 67.44  ?  101 LYS A N     1 
ATOM   636   C CA    . LYS A 1 101 ? -13.904 -49.964 -14.911  1.00 78.56  ?  101 LYS A CA    1 
ATOM   637   C C     . LYS A 1 101 ? -13.642 -49.755 -13.415  1.00 88.69  ?  101 LYS A C     1 
ATOM   638   O O     . LYS A 1 101 ? -13.730 -50.689 -12.619  1.00 98.16  ?  101 LYS A O     1 
ATOM   639   C CB    . LYS A 1 101 ? -12.589 -50.210 -15.653  1.00 73.08  ?  101 LYS A CB    1 
ATOM   640   N N     . TYR A 1 102 ? -13.320 -48.516 -13.051  1.00 86.33  ?  102 TYR A N     1 
ATOM   641   C CA    . TYR A 1 102 ? -12.994 -48.149 -11.673  1.00 67.18  ?  102 TYR A CA    1 
ATOM   642   C C     . TYR A 1 102 ? -13.860 -46.992 -11.160  1.00 61.82  ?  102 TYR A C     1 
ATOM   643   O O     . TYR A 1 102 ? -13.389 -45.860 -11.078  1.00 64.12  ?  102 TYR A O     1 
ATOM   644   C CB    . TYR A 1 102 ? -11.508 -47.810 -11.561  1.00 67.85  ?  102 TYR A CB    1 
ATOM   645   C CG    . TYR A 1 102 ? -10.620 -48.944 -12.026  1.00 83.54  ?  102 TYR A CG    1 
ATOM   646   C CD1   . TYR A 1 102 ? -10.245 -49.961 -11.157  1.00 88.15  ?  102 TYR A CD1   1 
ATOM   647   C CD2   . TYR A 1 102 ? -10.159 -48.998 -13.335  1.00 81.72  ?  102 TYR A CD2   1 
ATOM   648   C CE1   . TYR A 1 102 ? -9.436  -51.001 -11.581  1.00 92.44  ?  102 TYR A CE1   1 
ATOM   649   C CE2   . TYR A 1 102 ? -9.349  -50.034 -13.767  1.00 96.46  ?  102 TYR A CE2   1 
ATOM   650   C CZ    . TYR A 1 102 ? -8.989  -51.031 -12.886  1.00 101.46 ?  102 TYR A CZ    1 
ATOM   651   O OH    . TYR A 1 102 ? -8.186  -52.064 -13.315  1.00 103.34 ?  102 TYR A OH    1 
ATOM   652   N N     . PRO A 1 103 ? -15.125 -47.270 -10.811  1.00 55.49  ?  103 PRO A N     1 
ATOM   653   C CA    . PRO A 1 103 ? -16.141 -46.229 -10.590  1.00 60.49  ?  103 PRO A CA    1 
ATOM   654   C C     . PRO A 1 103 ? -15.944 -45.342 -9.356   1.00 59.09  ?  103 PRO A C     1 
ATOM   655   O O     . PRO A 1 103 ? -15.500 -45.796 -8.302   1.00 73.01  ?  103 PRO A O     1 
ATOM   656   C CB    . PRO A 1 103 ? -17.444 -47.034 -10.453  1.00 56.65  ?  103 PRO A CB    1 
ATOM   657   C CG    . PRO A 1 103 ? -17.138 -48.389 -10.999  1.00 53.47  ?  103 PRO A CG    1 
ATOM   658   C CD    . PRO A 1 103 ? -15.697 -48.623 -10.719  1.00 60.87  ?  103 PRO A CD    1 
ATOM   659   N N     . LEU A 1 104 ? -16.292 -44.067 -9.527   1.00 61.84  ?  104 LEU A N     1 
ATOM   660   C CA    . LEU A 1 104 ? -16.391 -43.085 -8.445   1.00 51.57  ?  104 LEU A CA    1 
ATOM   661   C C     . LEU A 1 104 ? -17.404 -43.519 -7.402   1.00 52.94  ?  104 LEU A C     1 
ATOM   662   O O     . LEU A 1 104 ? -18.342 -44.254 -7.709   1.00 49.80  ?  104 LEU A O     1 
ATOM   663   C CB    . LEU A 1 104 ? -16.777 -41.703 -8.981   1.00 49.34  ?  104 LEU A CB    1 
ATOM   664   C CG    . LEU A 1 104 ? -15.907 -41.034 -10.043  1.00 51.32  ?  104 LEU A CG    1 
ATOM   665   C CD1   . LEU A 1 104 ? -16.750 -40.097 -10.888  1.00 65.05  ?  104 LEU A CD1   1 
ATOM   666   C CD2   . LEU A 1 104 ? -14.772 -40.273 -9.382   1.00 52.12  ?  104 LEU A CD2   1 
ATOM   667   N N     . ILE A 1 105 ? -17.216 -43.068 -6.164   1.00 68.87  ?  105 ILE A N     1 
ATOM   668   C CA    . ILE A 1 105 ? -18.127 -43.445 -5.095   1.00 65.89  ?  105 ILE A CA    1 
ATOM   669   C C     . ILE A 1 105 ? -18.673 -42.240 -4.316   1.00 63.82  ?  105 ILE A C     1 
ATOM   670   O O     . ILE A 1 105 ? -19.545 -42.390 -3.458   1.00 65.55  ?  105 ILE A O     1 
ATOM   671   C CB    . ILE A 1 105 ? -17.393 -44.396 -4.095   1.00 63.06  ?  105 ILE A CB    1 
ATOM   672   C CG1   . ILE A 1 105 ? -16.496 -45.394 -4.835   1.00 78.77  ?  105 ILE A CG1   1 
ATOM   673   C CG2   . ILE A 1 105 ? -18.356 -45.141 -3.207   1.00 70.31  ?  105 ILE A CG2   1 
ATOM   674   C CD1   . ILE A 1 105 ? -17.253 -46.479 -5.577   1.00 75.72  ?  105 ILE A CD1   1 
ATOM   675   N N     . THR A 1 106 ? -18.193 -41.039 -4.628   1.00 51.41  ?  106 THR A N     1 
ATOM   676   C CA    . THR A 1 106 ? -18.840 -39.824 -4.130   1.00 54.47  ?  106 THR A CA    1 
ATOM   677   C C     . THR A 1 106 ? -20.025 -39.429 -5.014   1.00 65.21  ?  106 THR A C     1 
ATOM   678   O O     . THR A 1 106 ? -20.329 -40.110 -5.993   1.00 70.77  ?  106 THR A O     1 
ATOM   679   C CB    . THR A 1 106 ? -17.854 -38.649 -4.037   1.00 54.64  ?  106 THR A CB    1 
ATOM   680   O OG1   . THR A 1 106 ? -17.437 -38.266 -5.352   1.00 68.45  ?  106 THR A OG1   1 
ATOM   681   C CG2   . THR A 1 106 ? -16.636 -39.046 -3.223   1.00 61.77  ?  106 THR A CG2   1 
ATOM   682   N N     . GLN A 1 107 ? -20.684 -38.324 -4.665   1.00 64.07  ?  107 GLN A N     1 
ATOM   683   C CA    . GLN A 1 107 ? -21.802 -37.786 -5.447   1.00 59.67  ?  107 GLN A CA    1 
ATOM   684   C C     . GLN A 1 107 ? -21.421 -37.390 -6.869   1.00 62.99  ?  107 GLN A C     1 
ATOM   685   O O     . GLN A 1 107 ? -22.283 -37.247 -7.739   1.00 60.57  ?  107 GLN A O     1 
ATOM   686   C CB    . GLN A 1 107 ? -22.418 -36.571 -4.752   1.00 57.34  ?  107 GLN A CB    1 
ATOM   687   C CG    . GLN A 1 107 ? -23.061 -36.864 -3.417   1.00 83.69  ?  107 GLN A CG    1 
ATOM   688   C CD    . GLN A 1 107 ? -24.551 -36.589 -3.434   1.00 84.04  ?  107 GLN A CD    1 
ATOM   689   O OE1   . GLN A 1 107 ? -24.989 -35.500 -3.809   1.00 67.76  ?  107 GLN A OE1   1 
ATOM   690   N NE2   . GLN A 1 107 ? -25.340 -37.578 -3.033   1.00 88.49  ?  107 GLN A NE2   1 
ATOM   691   N N     . LYS A 1 108 ? -20.123 -37.253 -7.113   1.00 51.08  ?  108 LYS A N     1 
ATOM   692   C CA    . LYS A 1 108 ? -19.641 -36.937 -8.446   1.00 67.12  ?  108 LYS A CA    1 
ATOM   693   C C     . LYS A 1 108 ? -19.960 -38.003 -9.481   1.00 69.32  ?  108 LYS A C     1 
ATOM   694   O O     . LYS A 1 108 ? -20.057 -37.696 -10.677  1.00 73.91  ?  108 LYS A O     1 
ATOM   695   C CB    . LYS A 1 108 ? -18.121 -36.762 -8.384   1.00 63.89  ?  108 LYS A CB    1 
ATOM   696   C CG    . LYS A 1 108 ? -17.489 -36.100 -9.586   1.00 67.83  ?  108 LYS A CG    1 
ATOM   697   C CD    . LYS A 1 108 ? -15.994 -35.931 -9.370   1.00 65.06  ?  108 LYS A CD    1 
ATOM   698   C CE    . LYS A 1 108 ? -15.701 -35.079 -8.147   1.00 48.95  ?  108 LYS A CE    1 
ATOM   699   N NZ    . LYS A 1 108 ? -16.098 -33.656 -8.336   1.00 53.50  ?  108 LYS A NZ    1 
ATOM   700   N N     . ARG A 1 109 ? -20.239 -39.217 -9.019   1.00 52.92  ?  109 ARG A N     1 
ATOM   701   C CA    . ARG A 1 109 ? -20.734 -40.256 -9.905   1.00 67.95  ?  109 ARG A CA    1 
ATOM   702   C C     . ARG A 1 109 ? -21.995 -39.820 -10.630  1.00 64.15  ?  109 ARG A C     1 
ATOM   703   O O     . ARG A 1 109 ? -22.123 -40.026 -11.839  1.00 63.27  ?  109 ARG A O     1 
ATOM   704   C CB    . ARG A 1 109 ? -20.998 -41.541 -9.121   1.00 50.08  ?  109 ARG A CB    1 
ATOM   705   N N     . ALA A 1 110 ? -22.859 -39.086 -9.937   1.00 47.65  ?  110 ALA A N     1 
ATOM   706   C CA    . ALA A 1 110 ? -24.090 -38.664 -10.575  1.00 55.83  ?  110 ALA A CA    1 
ATOM   707   C C     . ALA A 1 110 ? -23.773 -37.615 -11.619  1.00 70.56  ?  110 ALA A C     1 
ATOM   708   O O     . ALA A 1 110 ? -24.288 -37.674 -12.744  1.00 72.45  ?  110 ALA A O     1 
ATOM   709   C CB    . ALA A 1 110 ? -25.072 -38.124 -9.546   1.00 56.34  ?  110 ALA A CB    1 
ATOM   710   N N     . ASP A 1 111 ? -22.827 -36.737 -11.297  1.00 61.26  ?  111 ASP A N     1 
ATOM   711   C CA    . ASP A 1 111 ? -22.408 -35.747 -12.269  1.00 45.52  ?  111 ASP A CA    1 
ATOM   712   C C     . ASP A 1 111 ? -21.793 -36.475 -13.446  1.00 50.01  ?  111 ASP A C     1 
ATOM   713   O O     . ASP A 1 111 ? -22.128 -36.200 -14.607  1.00 50.81  ?  111 ASP A O     1 
ATOM   714   C CB    . ASP A 1 111 ? -21.405 -34.767 -11.656  1.00 47.07  ?  111 ASP A CB    1 
ATOM   715   C CG    . ASP A 1 111 ? -22.035 -33.862 -10.612  1.00 60.51  ?  111 ASP A CG    1 
ATOM   716   O OD1   . ASP A 1 111 ? -23.074 -33.237 -10.912  1.00 68.89  ?  111 ASP A OD1   1 
ATOM   717   O OD2   . ASP A 1 111 ? -21.487 -33.772 -9.493   1.00 67.71  -1 111 ASP A OD2   1 
ATOM   718   N N     . TYR A 1 112 ? -21.038 -37.523 -13.127  1.00 53.46  ?  112 TYR A N     1 
ATOM   719   C CA    . TYR A 1 112 ? -20.378 -38.302 -14.153  1.00 49.34  ?  112 TYR A CA    1 
ATOM   720   C C     . TYR A 1 112 ? -21.424 -38.887 -15.069  1.00 48.85  ?  112 TYR A C     1 
ATOM   721   O O     . TYR A 1 112 ? -21.312 -38.783 -16.295  1.00 51.78  ?  112 TYR A O     1 
ATOM   722   C CB    . TYR A 1 112 ? -19.529 -39.404 -13.511  1.00 48.45  ?  112 TYR A CB    1 
ATOM   723   C CG    . TYR A 1 112 ? -18.978 -40.433 -14.469  1.00 41.82  ?  112 TYR A CG    1 
ATOM   724   C CD1   . TYR A 1 112 ? -17.908 -40.138 -15.299  1.00 48.17  ?  112 TYR A CD1   1 
ATOM   725   C CD2   . TYR A 1 112 ? -19.521 -41.709 -14.531  1.00 57.35  ?  112 TYR A CD2   1 
ATOM   726   C CE1   . TYR A 1 112 ? -17.400 -41.078 -16.173  1.00 56.49  ?  112 TYR A CE1   1 
ATOM   727   C CE2   . TYR A 1 112 ? -19.019 -42.657 -15.397  1.00 51.87  ?  112 TYR A CE2   1 
ATOM   728   C CZ    . TYR A 1 112 ? -17.960 -42.336 -16.217  1.00 59.25  ?  112 TYR A CZ    1 
ATOM   729   O OH    . TYR A 1 112 ? -17.451 -43.281 -17.078  1.00 62.79  ?  112 TYR A OH    1 
ATOM   730   N N     . LEU A 1 113 ? -22.518 -39.354 -14.484  1.00 50.43  ?  113 LEU A N     1 
ATOM   731   C CA    . LEU A 1 113 ? -23.505 -40.032 -15.291  1.00 55.93  ?  113 LEU A CA    1 
ATOM   732   C C     . LEU A 1 113 ? -24.188 -39.043 -16.211  1.00 62.64  ?  113 LEU A C     1 
ATOM   733   O O     . LEU A 1 113 ? -24.346 -39.322 -17.408  1.00 52.83  ?  113 LEU A O     1 
ATOM   734   C CB    . LEU A 1 113 ? -24.535 -40.735 -14.405  1.00 48.22  ?  113 LEU A CB    1 
ATOM   735   C CG    . LEU A 1 113 ? -24.039 -42.012 -13.727  1.00 48.12  ?  113 LEU A CG    1 
ATOM   736   C CD1   . LEU A 1 113 ? -25.118 -42.589 -12.829  1.00 63.19  ?  113 LEU A CD1   1 
ATOM   737   C CD2   . LEU A 1 113 ? -23.591 -43.026 -14.758  1.00 47.18  ?  113 LEU A CD2   1 
ATOM   738   N N     . LEU A 1 114 ? -24.435 -37.835 -15.707  1.00 48.75  ?  114 LEU A N     1 
ATOM   739   C CA    . LEU A 1 114 ? -25.001 -36.811 -16.565  1.00 39.72  ?  114 LEU A CA    1 
ATOM   740   C C     . LEU A 1 114 ? -24.025 -36.516 -17.674  1.00 53.71  ?  114 LEU A C     1 
ATOM   741   O O     . LEU A 1 114 ? -24.369 -36.590 -18.862  1.00 63.98  ?  114 LEU A O     1 
ATOM   742   C CB    . LEU A 1 114 ? -25.309 -35.544 -15.765  1.00 34.69  ?  114 LEU A CB    1 
ATOM   743   C CG    . LEU A 1 114 ? -26.407 -35.663 -14.705  1.00 43.12  ?  114 LEU A CG    1 
ATOM   744   C CD1   . LEU A 1 114 ? -26.343 -34.484 -13.757  1.00 55.96  ?  114 LEU A CD1   1 
ATOM   745   C CD2   . LEU A 1 114 ? -27.775 -35.753 -15.352  1.00 52.72  ?  114 LEU A CD2   1 
ATOM   746   N N     . PHE A 1 115 ? -22.775 -36.328 -17.279  1.00 51.76  ?  115 PHE A N     1 
ATOM   747   C CA    . PHE A 1 115 ? -21.712 -36.075 -18.222  1.00 39.36  ?  115 PHE A CA    1 
ATOM   748   C C     . PHE A 1 115 ? -21.639 -37.186 -19.236  1.00 49.46  ?  115 PHE A C     1 
ATOM   749   O O     . PHE A 1 115 ? -21.611 -36.932 -20.444  1.00 58.50  ?  115 PHE A O     1 
ATOM   750   C CB    . PHE A 1 115 ? -20.389 -35.954 -17.474  1.00 38.37  ?  115 PHE A CB    1 
ATOM   751   C CG    . PHE A 1 115 ? -19.188 -35.787 -18.362  1.00 41.16  ?  115 PHE A CG    1 
ATOM   752   C CD1   . PHE A 1 115 ? -18.828 -34.534 -18.835  1.00 51.08  ?  115 PHE A CD1   1 
ATOM   753   C CD2   . PHE A 1 115 ? -18.398 -36.881 -18.692  1.00 44.23  ?  115 PHE A CD2   1 
ATOM   754   C CE1   . PHE A 1 115 ? -17.714 -34.382 -19.636  1.00 51.30  ?  115 PHE A CE1   1 
ATOM   755   C CE2   . PHE A 1 115 ? -17.289 -36.733 -19.495  1.00 45.91  ?  115 PHE A CE2   1 
ATOM   756   C CZ    . PHE A 1 115 ? -16.947 -35.486 -19.967  1.00 48.53  ?  115 PHE A CZ    1 
ATOM   757   N N     . LYS A 1 116 ? -21.789 -38.415 -18.772  1.00 48.17  ?  116 LYS A N     1 
ATOM   758   C CA    . LYS A 1 116 ? -21.614 -39.512 -19.691  1.00 49.52  ?  116 LYS A CA    1 
ATOM   759   C C     . LYS A 1 116 ? -22.729 -39.520 -20.726  1.00 60.14  ?  116 LYS A C     1 
ATOM   760   O O     . LYS A 1 116 ? -22.455 -39.610 -21.934  1.00 57.53  ?  116 LYS A O     1 
ATOM   761   C CB    . LYS A 1 116 ? -21.589 -40.817 -18.894  1.00 52.63  ?  116 LYS A CB    1 
ATOM   762   C CG    . LYS A 1 116 ? -21.476 -42.108 -19.663  1.00 61.90  ?  116 LYS A CG    1 
ATOM   763   C CD    . LYS A 1 116 ? -21.469 -43.246 -18.646  1.00 57.93  ?  116 LYS A CD    1 
ATOM   764   C CE    . LYS A 1 116 ? -21.327 -44.618 -19.277  1.00 72.74  ?  116 LYS A CE    1 
ATOM   765   N NZ    . LYS A 1 116 ? -21.205 -44.579 -20.756  1.00 86.59  ?  116 LYS A NZ    1 
ATOM   766   N N     . LYS A 1 117 ? -23.951 -39.209 -20.301  1.00 63.94  ?  117 LYS A N     1 
ATOM   767   C CA    . LYS A 1 117 ? -25.045 -39.172 -21.259  1.00 58.48  ?  117 LYS A CA    1 
ATOM   768   C C     . LYS A 1 117 ? -24.808 -38.099 -22.301  1.00 52.92  ?  117 LYS A C     1 
ATOM   769   O O     . LYS A 1 117 ? -24.891 -38.364 -23.508  1.00 52.41  ?  117 LYS A O     1 
ATOM   770   C CB    . LYS A 1 117 ? -26.375 -38.934 -20.542  1.00 50.86  ?  117 LYS A CB    1 
ATOM   771   N N     . ALA A 1 118 ? -24.321 -36.948 -21.844  1.00 50.21  ?  118 ALA A N     1 
ATOM   772   C CA    . ALA A 1 118 ? -24.084 -35.857 -22.763  1.00 45.48  ?  118 ALA A CA    1 
ATOM   773   C C     . ALA A 1 118 ? -23.015 -36.234 -23.751  1.00 47.25  ?  118 ALA A C     1 
ATOM   774   O O     . ALA A 1 118 ? -23.184 -36.037 -24.960  1.00 47.41  ?  118 ALA A O     1 
ATOM   775   C CB    . ALA A 1 118 ? -23.696 -34.595 -22.014  1.00 47.04  ?  118 ALA A CB    1 
ATOM   776   N N     . PHE A 1 119 ? -21.971 -36.884 -23.252  1.00 46.34  ?  119 PHE A N     1 
ATOM   777   C CA    . PHE A 1 119 ? -20.886 -37.274 -24.122  1.00 47.57  ?  119 PHE A CA    1 
ATOM   778   C C     . PHE A 1 119 ? -21.389 -38.146 -25.250  1.00 49.53  ?  119 PHE A C     1 
ATOM   779   O O     . PHE A 1 119 ? -21.063 -37.913 -26.417  1.00 63.38  ?  119 PHE A O     1 
ATOM   780   C CB    . PHE A 1 119 ? -19.811 -38.009 -23.328  1.00 46.22  ?  119 PHE A CB    1 
ATOM   781   C CG    . PHE A 1 119 ? -18.780 -38.684 -24.181  1.00 35.53  ?  119 PHE A CG    1 
ATOM   782   C CD1   . PHE A 1 119 ? -17.740 -37.960 -24.733  1.00 31.26  ?  119 PHE A CD1   1 
ATOM   783   C CD2   . PHE A 1 119 ? -18.848 -40.046 -24.424  1.00 47.06  ?  119 PHE A CD2   1 
ATOM   784   C CE1   . PHE A 1 119 ? -16.784 -38.581 -25.513  1.00 49.06  ?  119 PHE A CE1   1 
ATOM   785   C CE2   . PHE A 1 119 ? -17.898 -40.672 -25.205  1.00 50.74  ?  119 PHE A CE2   1 
ATOM   786   C CZ    . PHE A 1 119 ? -16.864 -39.939 -25.750  1.00 44.80  ?  119 PHE A CZ    1 
ATOM   787   N N     . TYR A 1 120 ? -22.297 -39.054 -24.923  1.00 49.47  ?  120 TYR A N     1 
ATOM   788   C CA    . TYR A 1 120 ? -22.796 -39.964 -25.934  1.00 55.28  ?  120 TYR A CA    1 
ATOM   789   C C     . TYR A 1 120 ? -23.597 -39.182 -26.966  1.00 58.80  ?  120 TYR A C     1 
ATOM   790   O O     . TYR A 1 120 ? -23.365 -39.325 -28.172  1.00 61.75  ?  120 TYR A O     1 
ATOM   791   C CB    . TYR A 1 120 ? -23.588 -41.088 -25.274  1.00 63.04  ?  120 TYR A CB    1 
ATOM   792   C CG    . TYR A 1 120 ? -22.677 -42.266 -25.010  1.00 67.01  ?  120 TYR A CG    1 
ATOM   793   C CD1   . TYR A 1 120 ? -21.830 -42.264 -23.907  1.00 66.84  ?  120 TYR A CD1   1 
ATOM   794   C CD2   . TYR A 1 120 ? -22.619 -43.348 -25.875  1.00 84.40  ?  120 TYR A CD2   1 
ATOM   795   C CE1   . TYR A 1 120 ? -20.973 -43.315 -23.659  1.00 63.38  ?  120 TYR A CE1   1 
ATOM   796   C CE2   . TYR A 1 120 ? -21.761 -44.409 -25.634  1.00 87.64  ?  120 TYR A CE2   1 
ATOM   797   C CZ    . TYR A 1 120 ? -20.942 -44.386 -24.523  1.00 80.62  ?  120 TYR A CZ    1 
ATOM   798   O OH    . TYR A 1 120 ? -20.086 -45.435 -24.274  1.00 91.57  ?  120 TYR A OH    1 
ATOM   799   N N     . LEU A 1 121 ? -24.454 -38.287 -26.483  1.00 55.03  ?  121 LEU A N     1 
ATOM   800   C CA    . LEU A 1 121 ? -25.235 -37.415 -27.352  1.00 50.35  ?  121 LEU A CA    1 
ATOM   801   C C     . LEU A 1 121 ? -24.272 -36.672 -28.261  1.00 51.79  ?  121 LEU A C     1 
ATOM   802   O O     . LEU A 1 121 ? -24.512 -36.534 -29.458  1.00 57.69  ?  121 LEU A O     1 
ATOM   803   C CB    . LEU A 1 121 ? -26.095 -36.442 -26.548  1.00 52.34  ?  121 LEU A CB    1 
ATOM   804   C CG    . LEU A 1 121 ? -27.269 -37.077 -25.802  1.00 57.55  ?  121 LEU A CG    1 
ATOM   805   C CD1   . LEU A 1 121 ? -27.910 -36.076 -24.855  1.00 60.11  ?  121 LEU A CD1   1 
ATOM   806   C CD2   . LEU A 1 121 ? -28.292 -37.627 -26.785  1.00 63.01  ?  121 LEU A CD2   1 
ATOM   807   N N     . ILE A 1 122 ? -23.179 -36.193 -27.683  1.00 53.73  ?  122 ILE A N     1 
ATOM   808   C CA    . ILE A 1 122 ? -22.198 -35.443 -28.446  1.00 48.81  ?  122 ILE A CA    1 
ATOM   809   C C     . ILE A 1 122 ? -21.456 -36.385 -29.396  1.00 58.57  ?  122 ILE A C     1 
ATOM   810   O O     . ILE A 1 122 ? -21.240 -36.046 -30.563  1.00 56.32  ?  122 ILE A O     1 
ATOM   811   C CB    . ILE A 1 122 ? -21.208 -34.709 -27.527  1.00 41.66  ?  122 ILE A CB    1 
ATOM   812   C CG1   . ILE A 1 122 ? -21.951 -33.668 -26.688  1.00 45.24  ?  122 ILE A CG1   1 
ATOM   813   C CG2   . ILE A 1 122 ? -20.122 -34.032 -28.342  1.00 50.95  ?  122 ILE A CG2   1 
ATOM   814   C CD1   . ILE A 1 122 ? -21.207 -33.240 -25.445  1.00 51.83  ?  122 ILE A CD1   1 
ATOM   815   N N     . LYS A 1 123 ? -21.064 -37.557 -28.901  1.00 58.58  ?  123 LYS A N     1 
ATOM   816   C CA    . LYS A 1 123 ? -20.352 -38.533 -29.727  1.00 62.71  ?  123 LYS A CA    1 
ATOM   817   C C     . LYS A 1 123 ? -21.151 -38.896 -30.980  1.00 62.05  ?  123 LYS A C     1 
ATOM   818   O O     . LYS A 1 123 ? -20.586 -39.088 -32.057  1.00 46.12  ?  123 LYS A O     1 
ATOM   819   C CB    . LYS A 1 123 ? -20.031 -39.798 -28.925  1.00 67.74  ?  123 LYS A CB    1 
ATOM   820   C CG    . LYS A 1 123 ? -19.872 -41.051 -29.779  1.00 84.97  ?  123 LYS A CG    1 
ATOM   821   C CD    . LYS A 1 123 ? -19.695 -42.300 -28.938  1.00 85.81  ?  123 LYS A CD    1 
ATOM   822   C CE    . LYS A 1 123 ? -20.975 -43.113 -28.897  1.00 96.35  ?  123 LYS A CE    1 
ATOM   823   N NZ    . LYS A 1 123 ? -21.344 -43.644 -30.239  1.00 108.00 1  123 LYS A NZ    1 
ATOM   824   N N     . ASN A 1 124 ? -22.470 -38.962 -30.835  1.00 69.87  ?  124 ASN A N     1 
ATOM   825   C CA    . ASN A 1 124 ? -23.358 -39.336 -31.930  1.00 71.89  ?  124 ASN A CA    1 
ATOM   826   C C     . ASN A 1 124 ? -23.837 -38.133 -32.737  1.00 68.48  ?  124 ASN A C     1 
ATOM   827   O O     . ASN A 1 124 ? -24.680 -38.272 -33.624  1.00 69.30  ?  124 ASN A O     1 
ATOM   828   C CB    . ASN A 1 124 ? -24.563 -40.109 -31.392  1.00 77.41  ?  124 ASN A CB    1 
ATOM   829   C CG    . ASN A 1 124 ? -24.178 -41.455 -30.811  1.00 86.74  ?  124 ASN A CG    1 
ATOM   830   O OD1   . ASN A 1 124 ? -23.129 -42.009 -31.140  1.00 87.09  ?  124 ASN A OD1   1 
ATOM   831   N ND2   . ASN A 1 124 ? -25.026 -41.986 -29.938  1.00 81.21  ?  124 ASN A ND2   1 
ATOM   832   N N     . LYS A 1 125 ? -23.314 -36.954 -32.399  1.00 63.26  ?  125 LYS A N     1 
ATOM   833   C CA    . LYS A 1 125 ? -23.587 -35.719 -33.138  1.00 49.19  ?  125 LYS A CA    1 
ATOM   834   C C     . LYS A 1 125 ? -25.053 -35.300 -33.061  1.00 46.15  ?  125 LYS A C     1 
ATOM   835   O O     . LYS A 1 125 ? -25.523 -34.499 -33.866  1.00 59.89  ?  125 LYS A O     1 
ATOM   836   C CB    . LYS A 1 125 ? -23.156 -35.865 -34.600  1.00 44.19  ?  125 LYS A CB    1 
ATOM   837   C CG    . LYS A 1 125 ? -21.657 -35.740 -34.816  1.00 45.36  ?  125 LYS A CG    1 
ATOM   838   C CD    . LYS A 1 125 ? -21.295 -35.840 -36.287  1.00 54.27  ?  125 LYS A CD    1 
ATOM   839   C CE    . LYS A 1 125 ? -19.789 -35.782 -36.495  1.00 54.79  ?  125 LYS A CE    1 
ATOM   840   N NZ    . LYS A 1 125 ? -19.211 -34.470 -36.095  1.00 51.51  1  125 LYS A NZ    1 
ATOM   841   N N     . GLU A 1 126 ? -25.768 -35.853 -32.088  1.00 38.47  ?  126 GLU A N     1 
ATOM   842   C CA    . GLU A 1 126 ? -27.157 -35.489 -31.827  1.00 50.59  ?  126 GLU A CA    1 
ATOM   843   C C     . GLU A 1 126 ? -27.268 -34.083 -31.240  1.00 64.54  ?  126 GLU A C     1 
ATOM   844   O O     . GLU A 1 126 ? -28.346 -33.490 -31.223  1.00 74.79  ?  126 GLU A O     1 
ATOM   845   C CB    . GLU A 1 126 ? -27.812 -36.499 -30.885  1.00 60.10  ?  126 GLU A CB    1 
ATOM   846   C CG    . GLU A 1 126 ? -27.909 -37.908 -31.447  1.00 74.20  ?  126 GLU A CG    1 
ATOM   847   C CD    . GLU A 1 126 ? -28.894 -38.770 -30.679  1.00 86.32  ?  126 GLU A CD    1 
ATOM   848   O OE1   . GLU A 1 126 ? -29.840 -38.210 -30.082  1.00 46.76  ?  126 GLU A OE1   1 
ATOM   849   O OE2   . GLU A 1 126 ? -28.723 -40.008 -30.672  1.00 93.84  -1 126 GLU A OE2   1 
ATOM   850   N N     . HIS A 1 127 ? -26.144 -33.556 -30.765  1.00 71.26  ?  127 HIS A N     1 
ATOM   851   C CA    . HIS A 1 127 ? -26.092 -32.205 -30.216  1.00 65.35  ?  127 HIS A CA    1 
ATOM   852   C C     . HIS A 1 127 ? -26.236 -31.148 -31.303  1.00 66.17  ?  127 HIS A C     1 
ATOM   853   O O     . HIS A 1 127 ? -26.393 -29.963 -31.010  1.00 67.43  ?  127 HIS A O     1 
ATOM   854   C CB    . HIS A 1 127 ? -24.790 -31.994 -29.440  1.00 55.72  ?  127 HIS A CB    1 
ATOM   855   C CG    . HIS A 1 127 ? -23.571 -31.918 -30.304  1.00 46.25  ?  127 HIS A CG    1 
ATOM   856   N ND1   . HIS A 1 127 ? -23.126 -32.984 -31.056  1.00 47.73  ?  127 HIS A ND1   1 
ATOM   857   C CD2   . HIS A 1 127 ? -22.688 -30.914 -30.515  1.00 38.23  ?  127 HIS A CD2   1 
ATOM   858   C CE1   . HIS A 1 127 ? -22.029 -32.635 -31.704  1.00 45.70  ?  127 HIS A CE1   1 
ATOM   859   N NE2   . HIS A 1 127 ? -21.741 -31.385 -31.392  1.00 40.71  ?  127 HIS A NE2   1 
ATOM   860   N N     . LEU A 1 128 ? -26.175 -31.581 -32.558  1.00 58.90  ?  128 LEU A N     1 
ATOM   861   C CA    . LEU A 1 128 ? -26.238 -30.663 -33.685  1.00 48.76  ?  128 LEU A CA    1 
ATOM   862   C C     . LEU A 1 128 ? -27.695 -30.448 -34.083  1.00 60.01  ?  128 LEU A C     1 
ATOM   863   O O     . LEU A 1 128 ? -27.989 -29.866 -35.127  1.00 70.25  ?  128 LEU A O     1 
ATOM   864   C CB    . LEU A 1 128 ? -25.427 -31.190 -34.865  1.00 49.04  ?  128 LEU A CB    1 
ATOM   865   C CG    . LEU A 1 128 ? -23.931 -31.326 -34.584  1.00 36.37  ?  128 LEU A CG    1 
ATOM   866   C CD1   . LEU A 1 128 ? -23.192 -31.846 -35.805  1.00 46.91  ?  128 LEU A CD1   1 
ATOM   867   C CD2   . LEU A 1 128 ? -23.357 -29.997 -34.124  1.00 41.49  ?  128 LEU A CD2   1 
ATOM   868   N N     . THR A 1 129 ? -28.600 -30.940 -33.241  1.00 60.78  ?  129 THR A N     1 
ATOM   869   C CA    . THR A 1 129 ? -30.034 -30.778 -33.445  1.00 57.32  ?  129 THR A CA    1 
ATOM   870   C C     . THR A 1 129 ? -30.571 -29.902 -32.320  1.00 67.05  ?  129 THR A C     1 
ATOM   871   O O     . THR A 1 129 ? -29.961 -29.830 -31.254  1.00 82.61  ?  129 THR A O     1 
ATOM   872   C CB    . THR A 1 129 ? -30.764 -32.139 -33.439  1.00 61.80  ?  129 THR A CB    1 
ATOM   873   O OG1   . THR A 1 129 ? -30.033 -33.084 -34.229  1.00 72.83  ?  129 THR A OG1   1 
ATOM   874   C CG2   . THR A 1 129 ? -32.186 -32.009 -33.976  1.00 77.59  ?  129 THR A CG2   1 
ATOM   875   N N     . GLU A 1 130 ? -31.696 -29.230 -32.547  1.00 53.24  ?  130 GLU A N     1 
ATOM   876   C CA    . GLU A 1 130 ? -32.363 -28.500 -31.475  1.00 67.44  ?  130 GLU A CA    1 
ATOM   877   C C     . GLU A 1 130 ? -32.757 -29.435 -30.334  1.00 78.59  ?  130 GLU A C     1 
ATOM   878   O O     . GLU A 1 130 ? -32.633 -29.090 -29.155  1.00 88.28  ?  130 GLU A O     1 
ATOM   879   C CB    . GLU A 1 130 ? -33.599 -27.773 -32.009  1.00 55.14  ?  130 GLU A CB    1 
ATOM   880   N N     . GLU A 1 131 ? -33.215 -30.628 -30.701  1.00 77.57  ?  131 GLU A N     1 
ATOM   881   C CA    . GLU A 1 131 ? -33.680 -31.614 -29.732  1.00 91.26  ?  131 GLU A CA    1 
ATOM   882   C C     . GLU A 1 131 ? -32.557 -32.116 -28.833  1.00 84.22  ?  131 GLU A C     1 
ATOM   883   O O     . GLU A 1 131 ? -32.677 -32.128 -27.599  1.00 91.59  ?  131 GLU A O     1 
ATOM   884   C CB    . GLU A 1 131 ? -34.322 -32.792 -30.468  1.00 98.35  ?  131 GLU A CB    1 
ATOM   885   C CG    . GLU A 1 131 ? -34.900 -33.867 -29.570  1.00 120.70 ?  131 GLU A CG    1 
ATOM   886   C CD    . GLU A 1 131 ? -35.647 -34.928 -30.354  1.00 133.73 ?  131 GLU A CD    1 
ATOM   887   O OE1   . GLU A 1 131 ? -35.466 -36.128 -30.058  1.00 142.41 ?  131 GLU A OE1   1 
ATOM   888   O OE2   . GLU A 1 131 ? -36.420 -34.562 -31.265  1.00 137.51 -1 131 GLU A OE2   1 
ATOM   889   N N     . GLY A 1 132 ? -31.452 -32.507 -29.462  1.00 77.61  ?  132 GLY A N     1 
ATOM   890   C CA    . GLY A 1 132 ? -30.318 -33.031 -28.730  1.00 83.45  ?  132 GLY A CA    1 
ATOM   891   C C     . GLY A 1 132 ? -29.713 -31.954 -27.861  1.00 78.07  ?  132 GLY A C     1 
ATOM   892   O O     . GLY A 1 132 ? -29.294 -32.216 -26.734  1.00 71.28  ?  132 GLY A O     1 
ATOM   893   N N     . LEU A 1 133 ? -29.668 -30.735 -28.392  1.00 77.13  ?  133 LEU A N     1 
ATOM   894   C CA    . LEU A 1 133 ? -29.152 -29.605 -27.638  1.00 73.92  ?  133 LEU A CA    1 
ATOM   895   C C     . LEU A 1 133 ? -29.985 -29.370 -26.387  1.00 63.73  ?  133 LEU A C     1 
ATOM   896   O O     . LEU A 1 133 ? -29.447 -29.253 -25.284  1.00 62.71  ?  133 LEU A O     1 
ATOM   897   C CB    . LEU A 1 133 ? -29.148 -28.343 -28.504  1.00 78.04  ?  133 LEU A CB    1 
ATOM   898   C CG    . LEU A 1 133 ? -28.790 -27.028 -27.810  1.00 71.64  ?  133 LEU A CG    1 
ATOM   899   C CD1   . LEU A 1 133 ? -27.428 -27.138 -27.163  1.00 76.63  ?  133 LEU A CD1   1 
ATOM   900   C CD2   . LEU A 1 133 ? -28.830 -25.855 -28.776  1.00 74.94  ?  133 LEU A CD2   1 
ATOM   901   N N     . ASN A 1 134 ? -31.305 -29.343 -26.559  1.00 69.05  ?  134 ASN A N     1 
ATOM   902   C CA    . ASN A 1 134 ? -32.203 -29.166 -25.425  1.00 71.70  ?  134 ASN A CA    1 
ATOM   903   C C     . ASN A 1 134 ? -32.035 -30.260 -24.377  1.00 70.64  ?  134 ASN A C     1 
ATOM   904   O O     . ASN A 1 134 ? -32.062 -29.988 -23.168  1.00 77.39  ?  134 ASN A O     1 
ATOM   905   C CB    . ASN A 1 134 ? -33.656 -29.119 -25.903  1.00 77.23  ?  134 ASN A CB    1 
ATOM   906   C CG    . ASN A 1 134 ? -34.037 -27.768 -26.479  1.00 84.33  ?  134 ASN A CG    1 
ATOM   907   O OD1   . ASN A 1 134 ? -34.493 -27.671 -27.617  1.00 96.69  ?  134 ASN A OD1   1 
ATOM   908   N ND2   . ASN A 1 134 ? -33.846 -26.714 -25.693  1.00 80.05  ?  134 ASN A ND2   1 
ATOM   909   N N     . GLN A 1 135 ? -31.809 -31.488 -24.838  1.00 55.92  ?  135 GLN A N     1 
ATOM   910   C CA    . GLN A 1 135 ? -31.670 -32.597 -23.905  1.00 66.03  ?  135 GLN A CA    1 
ATOM   911   C C     . GLN A 1 135 ? -30.368 -32.418 -23.129  1.00 70.47  ?  135 GLN A C     1 
ATOM   912   O O     . GLN A 1 135 ? -30.305 -32.667 -21.914  1.00 62.55  ?  135 GLN A O     1 
ATOM   913   C CB    . GLN A 1 135 ? -31.699 -33.938 -24.637  1.00 63.67  ?  135 GLN A CB    1 
ATOM   914   C CG    . GLN A 1 135 ? -31.589 -35.147 -23.720  1.00 73.33  ?  135 GLN A CG    1 
ATOM   915   C CD    . GLN A 1 135 ? -32.026 -36.432 -24.395  1.00 87.11  ?  135 GLN A CD    1 
ATOM   916   O OE1   . GLN A 1 135 ? -32.073 -36.516 -25.623  1.00 94.15  ?  135 GLN A OE1   1 
ATOM   917   N NE2   . GLN A 1 135 ? -32.354 -37.440 -23.595  1.00 77.34  ?  135 GLN A NE2   1 
ATOM   918   N N     . ILE A 1 136 ? -29.334 -31.972 -23.842  1.00 67.31  ?  136 ILE A N     1 
ATOM   919   C CA    . ILE A 1 136 ? -28.043 -31.714 -23.220  1.00 59.91  ?  136 ILE A CA    1 
ATOM   920   C C     . ILE A 1 136 ? -28.222 -30.681 -22.122  1.00 54.99  ?  136 ILE A C     1 
ATOM   921   O O     . ILE A 1 136 ? -27.671 -30.832 -21.040  1.00 64.87  ?  136 ILE A O     1 
ATOM   922   C CB    . ILE A 1 136 ? -26.993 -31.239 -24.234  1.00 63.32  ?  136 ILE A CB    1 
ATOM   923   C CG1   . ILE A 1 136 ? -26.583 -32.405 -25.132  1.00 55.97  ?  136 ILE A CG1   1 
ATOM   924   C CG2   . ILE A 1 136 ? -25.763 -30.701 -23.522  1.00 53.75  ?  136 ILE A CG2   1 
ATOM   925   C CD1   . ILE A 1 136 ? -25.425 -32.095 -26.029  1.00 43.22  ?  136 ILE A CD1   1 
ATOM   926   N N     . LEU A 1 137 ? -28.987 -29.629 -22.400  1.00 47.47  ?  137 LEU A N     1 
ATOM   927   C CA    . LEU A 1 137 ? -29.275 -28.632 -21.368  1.00 57.96  ?  137 LEU A CA    1 
ATOM   928   C C     . LEU A 1 137 ? -30.015 -29.237 -20.184  1.00 66.52  ?  137 LEU A C     1 
ATOM   929   O O     . LEU A 1 137 ? -29.792 -28.823 -19.044  1.00 59.00  ?  137 LEU A O     1 
ATOM   930   C CB    . LEU A 1 137 ? -30.041 -27.431 -21.918  1.00 55.87  ?  137 LEU A CB    1 
ATOM   931   C CG    . LEU A 1 137 ? -29.152 -26.361 -22.562  1.00 62.08  ?  137 LEU A CG    1 
ATOM   932   C CD1   . LEU A 1 137 ? -28.419 -26.817 -23.804  1.00 65.54  ?  137 LEU A CD1   1 
ATOM   933   C CD2   . LEU A 1 137 ? -29.966 -25.126 -22.839  1.00 66.51  ?  137 LEU A CD2   1 
ATOM   934   N N     . THR A 1 138 ? -30.899 -30.201 -20.440  1.00 58.77  ?  138 THR A N     1 
ATOM   935   C CA    . THR A 1 138 ? -31.558 -30.864 -19.318  1.00 59.60  ?  138 THR A CA    1 
ATOM   936   C C     . THR A 1 138 ? -30.507 -31.584 -18.476  1.00 64.95  ?  138 THR A C     1 
ATOM   937   O O     . THR A 1 138 ? -30.634 -31.653 -17.254  1.00 70.61  ?  138 THR A O     1 
ATOM   938   C CB    . THR A 1 138 ? -32.634 -31.874 -19.768  1.00 57.37  ?  138 THR A CB    1 
ATOM   939   O OG1   . THR A 1 138 ? -32.005 -33.018 -20.359  1.00 57.48  ?  138 THR A OG1   1 
ATOM   940   C CG2   . THR A 1 138 ? -33.579 -31.244 -20.773  1.00 87.22  ?  138 THR A CG2   1 
ATOM   941   N N     . LEU A 1 139 ? -29.473 -32.119 -19.122  1.00 58.67  ?  139 LEU A N     1 
ATOM   942   C CA    . LEU A 1 139 ? -28.394 -32.781 -18.381  1.00 59.13  ?  139 LEU A CA    1 
ATOM   943   C C     . LEU A 1 139 ? -27.537 -31.782 -17.585  1.00 61.94  ?  139 LEU A C     1 
ATOM   944   O O     . LEU A 1 139 ? -27.246 -32.000 -16.408  1.00 66.44  ?  139 LEU A O     1 
ATOM   945   C CB    . LEU A 1 139 ? -27.507 -33.597 -19.320  1.00 45.00  ?  139 LEU A CB    1 
ATOM   946   C CG    . LEU A 1 139 ? -28.205 -34.725 -20.078  1.00 47.68  ?  139 LEU A CG    1 
ATOM   947   C CD1   . LEU A 1 139 ? -27.277 -35.321 -21.118  1.00 52.49  ?  139 LEU A CD1   1 
ATOM   948   C CD2   . LEU A 1 139 ? -28.681 -35.794 -19.110  1.00 46.70  ?  139 LEU A CD2   1 
ATOM   949   N N     . LYS A 1 140 ? -27.137 -30.697 -18.244  1.00 49.41  ?  140 LYS A N     1 
ATOM   950   C CA    . LYS A 1 140 ? -26.323 -29.637 -17.647  1.00 54.74  ?  140 LYS A CA    1 
ATOM   951   C C     . LYS A 1 140 ? -27.012 -28.964 -16.466  1.00 65.34  ?  140 LYS A C     1 
ATOM   952   O O     . LYS A 1 140 ? -26.352 -28.531 -15.519  1.00 70.06  ?  140 LYS A O     1 
ATOM   953   C CB    . LYS A 1 140 ? -25.960 -28.580 -18.695  1.00 47.72  ?  140 LYS A CB    1 
ATOM   954   C CG    . LYS A 1 140 ? -25.014 -27.502 -18.178  1.00 45.44  ?  140 LYS A CG    1 
ATOM   955   C CD    . LYS A 1 140 ? -24.573 -26.552 -19.278  1.00 45.66  ?  140 LYS A CD    1 
ATOM   956   C CE    . LYS A 1 140 ? -23.952 -25.290 -18.694  1.00 40.55  ?  140 LYS A CE    1 
ATOM   957   N NZ    . LYS A 1 140 ? -22.736 -25.582 -17.891  1.00 40.23  1  140 LYS A NZ    1 
ATOM   958   N N     . ALA A 1 141 ? -28.335 -28.865 -16.532  1.00 67.47  ?  141 ALA A N     1 
ATOM   959   C CA    . ALA A 1 141 ? -29.104 -28.198 -15.487  1.00 65.47  ?  141 ALA A CA    1 
ATOM   960   C C     . ALA A 1 141 ? -28.889 -28.887 -14.143  1.00 58.71  ?  141 ALA A C     1 
ATOM   961   O O     . ALA A 1 141 ? -28.956 -28.250 -13.093  1.00 60.48  ?  141 ALA A O     1 
ATOM   962   C CB    . ALA A 1 141 ? -30.580 -28.173 -15.845  1.00 69.80  ?  141 ALA A CB    1 
ATOM   963   N N     . SER A 1 142 ? -28.631 -30.190 -14.183  1.00 62.37  ?  142 SER A N     1 
ATOM   964   C CA    . SER A 1 142 ? -28.459 -30.974 -12.965  1.00 65.06  ?  142 SER A CA    1 
ATOM   965   C C     . SER A 1 142 ? -26.975 -31.239 -12.704  1.00 63.55  ?  142 SER A C     1 
ATOM   966   O O     . SER A 1 142 ? -26.610 -31.847 -11.699  1.00 62.28  ?  142 SER A O     1 
ATOM   967   C CB    . SER A 1 142 ? -29.227 -32.294 -13.060  1.00 70.03  ?  142 SER A CB    1 
ATOM   968   O OG    . SER A 1 142 ? -30.617 -32.066 -13.213  1.00 77.07  ?  142 SER A OG    1 
ATOM   969   N N     . LEU A 1 143 ? -26.127 -30.772 -13.617  1.00 66.57  ?  143 LEU A N     1 
ATOM   970   C CA    . LEU A 1 143 ? -24.685 -30.987 -13.528  1.00 54.29  ?  143 LEU A CA    1 
ATOM   971   C C     . LEU A 1 143 ? -23.999 -29.828 -12.817  1.00 59.74  ?  143 LEU A C     1 
ATOM   972   O O     . LEU A 1 143 ? -24.119 -28.680 -13.246  1.00 60.53  ?  143 LEU A O     1 
ATOM   973   C CB    . LEU A 1 143 ? -24.083 -31.166 -14.922  1.00 51.00  ?  143 LEU A CB    1 
ATOM   974   C CG    . LEU A 1 143 ? -22.562 -31.312 -15.001  1.00 46.78  ?  143 LEU A CG    1 
ATOM   975   C CD1   . LEU A 1 143 ? -22.115 -32.626 -14.398  1.00 43.02  ?  143 LEU A CD1   1 
ATOM   976   C CD2   . LEU A 1 143 ? -22.082 -31.192 -16.438  1.00 70.35  ?  143 LEU A CD2   1 
ATOM   977   N N     . ASN A 1 144 ? -23.252 -30.145 -11.760  1.00 57.15  ?  144 ASN A N     1 
ATOM   978   C CA    . ASN A 1 144 ? -22.548 -29.142 -10.961  1.00 49.31  ?  144 ASN A CA    1 
ATOM   979   C C     . ASN A 1 144 ? -23.455 -27.969 -10.604  1.00 46.20  ?  144 ASN A C     1 
ATOM   980   O O     . ASN A 1 144 ? -24.455 -28.135 -9.909   1.00 62.09  ?  144 ASN A O     1 
ATOM   981   C CB    . ASN A 1 144 ? -21.306 -28.634 -11.698  1.00 45.81  ?  144 ASN A CB    1 
ATOM   982   C CG    . ASN A 1 144 ? -20.367 -29.753 -12.103  1.00 52.70  ?  144 ASN A CG    1 
ATOM   983   O OD1   . ASN A 1 144 ? -20.339 -30.816 -11.484  1.00 43.09  ?  144 ASN A OD1   1 
ATOM   984   N ND2   . ASN A 1 144 ? -19.585 -29.514 -13.148  1.00 62.83  ?  144 ASN A ND2   1 
ATOM   985   N N     . LEU A 1 145 ? -23.094 -26.784 -11.078  1.00 39.21  ?  145 LEU A N     1 
ATOM   986   C CA    . LEU A 1 145 ? -23.772 -25.557 -10.679  1.00 49.02  ?  145 LEU A CA    1 
ATOM   987   C C     . LEU A 1 145 ? -25.020 -25.315 -11.529  1.00 58.22  ?  145 LEU A C     1 
ATOM   988   O O     . LEU A 1 145 ? -25.742 -24.340 -11.318  1.00 56.40  ?  145 LEU A O     1 
ATOM   989   C CB    . LEU A 1 145 ? -22.827 -24.360 -10.769  1.00 47.50  ?  145 LEU A CB    1 
ATOM   990   C CG    . LEU A 1 145 ? -21.617 -24.411 -9.837   1.00 46.29  ?  145 LEU A CG    1 
ATOM   991   C CD1   . LEU A 1 145 ? -20.883 -23.080 -9.838   1.00 48.43  ?  145 LEU A CD1   1 
ATOM   992   C CD2   . LEU A 1 145 ? -22.042 -24.796 -8.431   1.00 41.06  ?  145 LEU A CD2   1 
ATOM   993   N N     . GLY A 1 146 ? -25.267 -26.199 -12.493  1.00 50.63  ?  146 GLY A N     1 
ATOM   994   C CA    . GLY A 1 146 ? -26.470 -26.101 -13.300  1.00 68.95  ?  146 GLY A CA    1 
ATOM   995   C C     . GLY A 1 146 ? -26.384 -25.012 -14.351  1.00 71.25  ?  146 GLY A C     1 
ATOM   996   O O     . GLY A 1 146 ? -25.290 -24.591 -14.729  1.00 64.72  ?  146 GLY A O     1 
ATOM   997   N N     . LEU A 1 147 ? -27.539 -24.561 -14.834  1.00 66.55  ?  147 LEU A N     1 
ATOM   998   C CA    . LEU A 1 147 ? -27.580 -23.606 -15.933  1.00 65.58  ?  147 LEU A CA    1 
ATOM   999   C C     . LEU A 1 147 ? -27.391 -22.204 -15.378  1.00 60.03  ?  147 LEU A C     1 
ATOM   1000  O O     . LEU A 1 147 ? -27.972 -21.849 -14.353  1.00 67.90  ?  147 LEU A O     1 
ATOM   1001  C CB    . LEU A 1 147 ? -28.910 -23.693 -16.685  1.00 55.80  ?  147 LEU A CB    1 
ATOM   1002  C CG    . LEU A 1 147 ? -29.292 -25.021 -17.336  1.00 53.01  ?  147 LEU A CG    1 
ATOM   1003  C CD1   . LEU A 1 147 ? -30.413 -24.809 -18.337  1.00 52.76  ?  147 LEU A CD1   1 
ATOM   1004  C CD2   . LEU A 1 147 ? -28.091 -25.656 -18.008  1.00 63.46  ?  147 LEU A CD2   1 
ATOM   1005  N N     . SER A 1 148 ? -26.573 -21.411 -16.060  1.00 57.33  ?  148 SER A N     1 
ATOM   1006  C CA    . SER A 1 148 ? -26.456 -19.992 -15.755  1.00 60.05  ?  148 SER A CA    1 
ATOM   1007  C C     . SER A 1 148 ? -27.730 -19.216 -16.066  1.00 70.26  ?  148 SER A C     1 
ATOM   1008  O O     . SER A 1 148 ? -28.609 -19.699 -16.781  1.00 71.00  ?  148 SER A O     1 
ATOM   1009  C CB    . SER A 1 148 ? -25.280 -19.385 -16.520  1.00 62.10  ?  148 SER A CB    1 
ATOM   1010  O OG    . SER A 1 148 ? -25.512 -19.422 -17.917  1.00 84.25  ?  148 SER A OG    1 
ATOM   1011  N N     . GLU A 1 149 ? -27.814 -18.011 -15.512  1.00 80.52  ?  149 GLU A N     1 
ATOM   1012  C CA    . GLU A 1 149 ? -28.916 -17.093 -15.777  1.00 77.10  ?  149 GLU A CA    1 
ATOM   1013  C C     . GLU A 1 149 ? -29.066 -16.807 -17.267  1.00 81.57  ?  149 GLU A C     1 
ATOM   1014  O O     . GLU A 1 149 ? -30.176 -16.770 -17.791  1.00 71.02  ?  149 GLU A O     1 
ATOM   1015  C CB    . GLU A 1 149 ? -28.715 -15.784 -15.011  1.00 52.95  ?  149 GLU A CB    1 
ATOM   1016  N N     . GLU A 1 150 ? -27.938 -16.588 -17.933  1.00 89.04  ?  150 GLU A N     1 
ATOM   1017  C CA    . GLU A 1 150 ? -27.912 -16.326 -19.369  1.00 87.31  ?  150 GLU A CA    1 
ATOM   1018  C C     . GLU A 1 150 ? -28.521 -17.470 -20.184  1.00 81.00  ?  150 GLU A C     1 
ATOM   1019  O O     . GLU A 1 150 ? -29.318 -17.244 -21.100  1.00 87.36  ?  150 GLU A O     1 
ATOM   1020  C CB    . GLU A 1 150 ? -26.470 -16.079 -19.823  1.00 82.40  ?  150 GLU A CB    1 
ATOM   1021  C CG    . GLU A 1 150 ? -25.837 -14.812 -19.256  1.00 102.82 ?  150 GLU A CG    1 
ATOM   1022  C CD    . GLU A 1 150 ? -26.378 -13.535 -19.871  1.00 122.14 ?  150 GLU A CD    1 
ATOM   1023  O OE1   . GLU A 1 150 ? -27.211 -13.614 -20.799  1.00 124.89 ?  150 GLU A OE1   1 
ATOM   1024  O OE2   . GLU A 1 150 ? -25.968 -12.445 -19.419  1.00 122.58 -1 150 GLU A OE2   1 
ATOM   1025  N N     . LEU A 1 151 ? -28.157 -18.698 -19.829  1.00 74.40  ?  151 LEU A N     1 
ATOM   1026  C CA    . LEU A 1 151 ? -28.670 -19.876 -20.517  1.00 67.77  ?  151 LEU A CA    1 
ATOM   1027  C C     . LEU A 1 151 ? -30.145 -20.102 -20.208  1.00 71.49  ?  151 LEU A C     1 
ATOM   1028  O O     . LEU A 1 151 ? -30.908 -20.523 -21.079  1.00 80.50  ?  151 LEU A O     1 
ATOM   1029  C CB    . LEU A 1 151 ? -27.857 -21.114 -20.135  1.00 71.75  ?  151 LEU A CB    1 
ATOM   1030  C CG    . LEU A 1 151 ? -26.521 -21.285 -20.861  1.00 63.83  ?  151 LEU A CG    1 
ATOM   1031  C CD1   . LEU A 1 151 ? -25.860 -22.598 -20.474  1.00 65.03  ?  151 LEU A CD1   1 
ATOM   1032  C CD2   . LEU A 1 151 ? -26.712 -21.203 -22.365  1.00 72.56  ?  151 LEU A CD2   1 
ATOM   1033  N N     . LYS A 1 152 ? -30.538 -19.832 -18.967  1.00 67.10  ?  152 LYS A N     1 
ATOM   1034  C CA    . LYS A 1 152 ? -31.945 -19.882 -18.584  1.00 72.02  ?  152 LYS A CA    1 
ATOM   1035  C C     . LYS A 1 152 ? -32.755 -18.899 -19.422  1.00 77.28  ?  152 LYS A C     1 
ATOM   1036  O O     . LYS A 1 152 ? -33.853 -19.213 -19.882  1.00 84.93  ?  152 LYS A O     1 
ATOM   1037  C CB    . LYS A 1 152 ? -32.112 -19.575 -17.094  1.00 73.04  ?  152 LYS A CB    1 
ATOM   1038  N N     . GLU A 1 153 ? -32.199 -17.708 -19.613  1.00 60.89  ?  153 GLU A N     1 
ATOM   1039  C CA    . GLU A 1 153 ? -32.836 -16.671 -20.411  1.00 66.29  ?  153 GLU A CA    1 
ATOM   1040  C C     . GLU A 1 153 ? -32.951 -17.109 -21.864  1.00 76.83  ?  153 GLU A C     1 
ATOM   1041  O O     . GLU A 1 153 ? -33.954 -16.844 -22.526  1.00 80.32  ?  153 GLU A O     1 
ATOM   1042  C CB    . GLU A 1 153 ? -32.055 -15.359 -20.314  1.00 60.82  ?  153 GLU A CB    1 
ATOM   1043  N N     . ALA A 1 154 ? -31.917 -17.785 -22.358  1.00 75.04  ?  154 ALA A N     1 
ATOM   1044  C CA    . ALA A 1 154 ? -31.893 -18.203 -23.754  1.00 68.49  ?  154 ALA A CA    1 
ATOM   1045  C C     . ALA A 1 154 ? -32.722 -19.467 -23.995  1.00 75.28  ?  154 ALA A C     1 
ATOM   1046  O O     . ALA A 1 154 ? -33.229 -19.681 -25.095  1.00 101.03 ?  154 ALA A O     1 
ATOM   1047  C CB    . ALA A 1 154 ? -30.459 -18.421 -24.210  1.00 67.39  ?  154 ALA A CB    1 
ATOM   1048  N N     . PHE A 1 155 ? -32.856 -20.299 -22.966  1.00 63.81  ?  155 PHE A N     1 
ATOM   1049  C CA    . PHE A 1 155 ? -33.603 -21.554 -23.079  1.00 79.27  ?  155 PHE A CA    1 
ATOM   1050  C C     . PHE A 1 155 ? -34.616 -21.791 -21.963  1.00 89.88  ?  155 PHE A C     1 
ATOM   1051  O O     . PHE A 1 155 ? -34.470 -22.737 -21.191  1.00 97.21  ?  155 PHE A O     1 
ATOM   1052  C CB    . PHE A 1 155 ? -32.649 -22.747 -23.136  1.00 76.70  ?  155 PHE A CB    1 
ATOM   1053  C CG    . PHE A 1 155 ? -31.691 -22.711 -24.288  1.00 79.10  ?  155 PHE A CG    1 
ATOM   1054  C CD1   . PHE A 1 155 ? -31.976 -23.403 -25.453  1.00 78.79  ?  155 PHE A CD1   1 
ATOM   1055  C CD2   . PHE A 1 155 ? -30.502 -22.008 -24.205  1.00 76.56  ?  155 PHE A CD2   1 
ATOM   1056  C CE1   . PHE A 1 155 ? -31.101 -23.388 -26.516  1.00 77.44  ?  155 PHE A CE1   1 
ATOM   1057  C CE2   . PHE A 1 155 ? -29.622 -21.990 -25.267  1.00 80.59  ?  155 PHE A CE2   1 
ATOM   1058  C CZ    . PHE A 1 155 ? -29.923 -22.683 -26.423  1.00 81.63  ?  155 PHE A CZ    1 
ATOM   1059  N N     . PRO A 1 156 ? -35.638 -20.931 -21.867  1.00 96.64  ?  156 PRO A N     1 
ATOM   1060  C CA    . PRO A 1 156 ? -36.584 -21.017 -20.748  1.00 101.12 ?  156 PRO A CA    1 
ATOM   1061  C C     . PRO A 1 156 ? -37.363 -22.338 -20.710  1.00 110.23 ?  156 PRO A C     1 
ATOM   1062  O O     . PRO A 1 156 ? -37.275 -23.142 -21.640  1.00 98.88  ?  156 PRO A O     1 
ATOM   1063  C CB    . PRO A 1 156 ? -37.519 -19.833 -20.991  1.00 102.40 ?  156 PRO A CB    1 
ATOM   1064  C CG    . PRO A 1 156 ? -37.492 -19.625 -22.465  1.00 116.71 ?  156 PRO A CG    1 
ATOM   1065  C CD    . PRO A 1 156 ? -36.147 -20.088 -22.964  1.00 96.13  ?  156 PRO A CD    1 
ATOM   1066  N N     . ASN A 1 157 ? -38.121 -22.536 -19.635  1.00 113.52 ?  157 ASN A N     1 
ATOM   1067  C CA    . ASN A 1 157 ? -38.903 -23.752 -19.399  1.00 119.85 ?  157 ASN A CA    1 
ATOM   1068  C C     . ASN A 1 157 ? -38.107 -25.054 -19.512  1.00 116.39 ?  157 ASN A C     1 
ATOM   1069  O O     . ASN A 1 157 ? -38.672 -26.119 -19.764  1.00 112.95 ?  157 ASN A O     1 
ATOM   1070  C CB    . ASN A 1 157 ? -40.092 -23.804 -20.363  1.00 123.75 ?  157 ASN A CB    1 
ATOM   1071  N N     . THR A 1 158 ? -36.795 -24.961 -19.320  1.00 110.01 ?  158 THR A N     1 
ATOM   1072  C CA    . THR A 1 158 ? -35.912 -26.119 -19.386  1.00 104.40 ?  158 THR A CA    1 
ATOM   1073  C C     . THR A 1 158 ? -36.146 -26.965 -18.143  1.00 100.78 ?  158 THR A C     1 
ATOM   1074  O O     . THR A 1 158 ? -35.972 -26.477 -17.027  1.00 96.72  ?  158 THR A O     1 
ATOM   1075  C CB    . THR A 1 158 ? -34.433 -25.719 -19.487  1.00 96.15  ?  158 THR A CB    1 
ATOM   1076  O OG1   . THR A 1 158 ? -34.228 -24.953 -20.680  1.00 97.43  ?  158 THR A OG1   1 
ATOM   1077  C CG2   . THR A 1 158 ? -33.550 -26.958 -19.534  1.00 88.92  ?  158 THR A CG2   1 
ATOM   1078  N N     . ILE A 1 159 ? -36.536 -28.224 -18.312  1.00 99.08  ?  159 ILE A N     1 
ATOM   1079  C CA    . ILE A 1 159 ? -36.651 -29.089 -17.145  1.00 97.37  ?  159 ILE A CA    1 
ATOM   1080  C C     . ILE A 1 159 ? -35.450 -30.008 -16.957  1.00 81.81  ?  159 ILE A C     1 
ATOM   1081  O O     . ILE A 1 159 ? -35.153 -30.840 -17.816  1.00 71.43  ?  159 ILE A O     1 
ATOM   1082  C CB    . ILE A 1 159 ? -37.915 -29.966 -17.232  1.00 96.26  ?  159 ILE A CB    1 
ATOM   1083  C CG1   . ILE A 1 159 ? -39.164 -29.094 -17.353  1.00 87.10  ?  159 ILE A CG1   1 
ATOM   1084  C CG2   . ILE A 1 159 ? -38.008 -30.890 -16.026  1.00 91.04  ?  159 ILE A CG2   1 
ATOM   1085  C CD1   . ILE A 1 159 ? -39.559 -28.433 -16.061  1.00 87.74  ?  159 ILE A CD1   1 
ATOM   1086  N N     . PRO A 1 160 ? -34.762 -29.852 -15.812  1.00 76.20  ?  160 PRO A N     1 
ATOM   1087  C CA    . PRO A 1 160 ? -33.513 -30.534 -15.454  1.00 70.45  ?  160 PRO A CA    1 
ATOM   1088  C C     . PRO A 1 160 ? -33.653 -32.050 -15.396  1.00 66.38  ?  160 PRO A C     1 
ATOM   1089  O O     . PRO A 1 160 ? -34.626 -32.547 -14.830  1.00 66.19  ?  160 PRO A O     1 
ATOM   1090  C CB    . PRO A 1 160 ? -33.191 -29.969 -14.064  1.00 69.16  ?  160 PRO A CB    1 
ATOM   1091  C CG    . PRO A 1 160 ? -33.914 -28.669 -14.009  1.00 70.95  ?  160 PRO A CG    1 
ATOM   1092  C CD    . PRO A 1 160 ? -35.184 -28.916 -14.756  1.00 76.85  ?  160 PRO A CD    1 
ATOM   1093  N N     . ALA A 1 161 ? -32.696 -32.769 -15.974  1.00 72.55  ?  161 ALA A N     1 
ATOM   1094  C CA    . ALA A 1 161 ? -32.728 -34.227 -15.972  1.00 71.53  ?  161 ALA A CA    1 
ATOM   1095  C C     . ALA A 1 161 ? -32.719 -34.755 -14.543  1.00 79.53  ?  161 ALA A C     1 
ATOM   1096  O O     . ALA A 1 161 ? -32.239 -34.081 -13.631  1.00 85.91  ?  161 ALA A O     1 
ATOM   1097  C CB    . ALA A 1 161 ? -31.554 -34.790 -16.754  1.00 74.37  ?  161 ALA A CB    1 
ATOM   1098  N N     . GLU A 1 162 ? -33.253 -35.955 -14.348  1.00 92.39  ?  162 GLU A N     1 
ATOM   1099  C CA    . GLU A 1 162 ? -33.284 -36.563 -13.024  1.00 98.84  ?  162 GLU A CA    1 
ATOM   1100  C C     . GLU A 1 162 ? -31.856 -36.841 -12.573  1.00 97.98  ?  162 GLU A C     1 
ATOM   1101  O O     . GLU A 1 162 ? -31.039 -37.322 -13.358  1.00 92.09  ?  162 GLU A O     1 
ATOM   1102  C CB    . GLU A 1 162 ? -34.108 -37.851 -13.029  1.00 101.21 ?  162 GLU A CB    1 
ATOM   1103  N N     . ARG A 1 163 ? -31.550 -36.542 -11.315  1.00 101.07 ?  163 ARG A N     1 
ATOM   1104  C CA    . ARG A 1 163 ? -30.203 -36.774 -10.814  1.00 103.34 ?  163 ARG A CA    1 
ATOM   1105  C C     . ARG A 1 163 ? -30.192 -37.932 -9.828   1.00 107.84 ?  163 ARG A C     1 
ATOM   1106  O O     . ARG A 1 163 ? -30.966 -37.956 -8.870   1.00 94.15  ?  163 ARG A O     1 
ATOM   1107  C CB    . ARG A 1 163 ? -29.667 -35.505 -10.143  1.00 84.23  ?  163 ARG A CB    1 
ATOM   1108  C CG    . ARG A 1 163 ? -28.247 -35.603 -9.606   1.00 80.14  ?  163 ARG A CG    1 
ATOM   1109  C CD    . ARG A 1 163 ? -27.743 -34.234 -9.166   1.00 81.79  ?  163 ARG A CD    1 
ATOM   1110  N NE    . ARG A 1 163 ? -26.488 -34.311 -8.423   1.00 76.60  ?  163 ARG A NE    1 
ATOM   1111  C CZ    . ARG A 1 163 ? -25.284 -34.163 -8.967   1.00 83.30  ?  163 ARG A CZ    1 
ATOM   1112  N NH1   . ARG A 1 163 ? -25.166 -33.926 -10.266  1.00 84.87  1  163 ARG A NH1   1 
ATOM   1113  N NH2   . ARG A 1 163 ? -24.198 -34.248 -8.211   1.00 73.75  ?  163 ARG A NH2   1 
ATOM   1114  N N     . LEU A 1 164 ? -29.310 -38.894 -10.079  1.00 104.49 ?  164 LEU A N     1 
ATOM   1115  C CA    . LEU A 1 164 ? -29.143 -40.036 -9.191   1.00 94.54  ?  164 LEU A CA    1 
ATOM   1116  C C     . LEU A 1 164 ? -28.707 -39.618 -7.795   1.00 96.27  ?  164 LEU A C     1 
ATOM   1117  O O     . LEU A 1 164 ? -27.687 -38.948 -7.634   1.00 89.93  ?  164 LEU A O     1 
ATOM   1118  C CB    . LEU A 1 164 ? -28.126 -41.022 -9.771   1.00 80.25  ?  164 LEU A CB    1 
ATOM   1119  C CG    . LEU A 1 164 ? -27.667 -42.135 -8.826   1.00 76.12  ?  164 LEU A CG    1 
ATOM   1120  C CD1   . LEU A 1 164 ? -28.832 -43.039 -8.446   1.00 91.52  ?  164 LEU A CD1   1 
ATOM   1121  C CD2   . LEU A 1 164 ? -26.536 -42.945 -9.438   1.00 70.45  ?  164 LEU A CD2   1 
ATOM   1122  N N     . LEU A 1 165 ? -29.473 -40.012 -6.786   1.00 106.11 ?  165 LEU A N     1 
ATOM   1123  C CA    . LEU A 1 165 ? -28.991 -39.899 -5.421   1.00 102.48 ?  165 LEU A CA    1 
ATOM   1124  C C     . LEU A 1 165 ? -28.120 -41.120 -5.144   1.00 99.82  ?  165 LEU A C     1 
ATOM   1125  O O     . LEU A 1 165 ? -28.597 -42.254 -5.185   1.00 98.16  ?  165 LEU A O     1 
ATOM   1126  C CB    . LEU A 1 165 ? -30.152 -39.778 -4.425   1.00 101.01 ?  165 LEU A CB    1 
ATOM   1127  C CG    . LEU A 1 165 ? -31.282 -40.810 -4.426   1.00 119.35 ?  165 LEU A CG    1 
ATOM   1128  C CD1   . LEU A 1 165 ? -31.138 -41.777 -3.260   1.00 116.95 ?  165 LEU A CD1   1 
ATOM   1129  C CD2   . LEU A 1 165 ? -32.637 -40.119 -4.387   1.00 110.87 ?  165 LEU A CD2   1 
ATOM   1130  N N     . VAL A 1 166 ? -26.836 -40.896 -4.892   1.00 97.67  ?  166 VAL A N     1 
ATOM   1131  C CA    . VAL A 1 166 ? -25.901 -42.005 -4.743   1.00 93.95  ?  166 VAL A CA    1 
ATOM   1132  C C     . VAL A 1 166 ? -25.949 -42.514 -3.304   1.00 110.40 ?  166 VAL A C     1 
ATOM   1133  O O     . VAL A 1 166 ? -25.732 -41.758 -2.356   1.00 109.97 ?  166 VAL A O     1 
ATOM   1134  C CB    . VAL A 1 166 ? -24.461 -41.604 -5.137   1.00 83.21  ?  166 VAL A CB    1 
ATOM   1135  C CG1   . VAL A 1 166 ? -24.038 -40.323 -4.435   1.00 89.28  ?  166 VAL A CG1   1 
ATOM   1136  C CG2   . VAL A 1 166 ? -23.491 -42.743 -4.855   1.00 67.37  ?  166 VAL A CG2   1 
ATOM   1137  N N     . THR A 1 167 ? -26.259 -43.796 -3.138   1.00 108.88 ?  167 THR A N     1 
ATOM   1138  C CA    . THR A 1 167 ? -26.459 -44.346 -1.803   1.00 92.18  ?  167 THR A CA    1 
ATOM   1139  C C     . THR A 1 167 ? -26.048 -45.817 -1.739   1.00 98.12  ?  167 THR A C     1 
ATOM   1140  O O     . THR A 1 167 ? -26.023 -46.513 -2.755   1.00 95.78  ?  167 THR A O     1 
ATOM   1141  C CB    . THR A 1 167 ? -27.940 -44.201 -1.364   1.00 79.56  ?  167 THR A CB    1 
ATOM   1142  O OG1   . THR A 1 167 ? -28.443 -42.921 -1.767   1.00 58.86  ?  167 THR A OG1   1 
ATOM   1143  C CG2   . THR A 1 167 ? -28.088 -44.343 0.146    1.00 114.28 ?  167 THR A CG2   1 
ATOM   1144  N N     . GLY A 1 168 ? -25.725 -46.273 -0.531   1.00 97.62  ?  168 GLY A N     1 
ATOM   1145  C CA    . GLY A 1 168 ? -25.378 -47.657 -0.264   1.00 91.89  ?  168 GLY A CA    1 
ATOM   1146  C C     . GLY A 1 168 ? -24.110 -48.097 -0.966   1.00 91.98  ?  168 GLY A C     1 
ATOM   1147  O O     . GLY A 1 168 ? -23.975 -49.253 -1.366   1.00 97.89  ?  168 GLY A O     1 
ATOM   1148  N N     . GLN A 1 169 ? -23.175 -47.166 -1.115   1.00 93.89  ?  169 GLN A N     1 
ATOM   1149  C CA    . GLN A 1 169 ? -21.951 -47.432 -1.854   1.00 99.60  ?  169 GLN A CA    1 
ATOM   1150  C C     . GLN A 1 169 ? -20.860 -47.922 -0.902   1.00 88.55  ?  169 GLN A C     1 
ATOM   1151  O O     . GLN A 1 169 ? -20.596 -47.296 0.124    1.00 74.51  ?  169 GLN A O     1 
ATOM   1152  C CB    . GLN A 1 169 ? -21.508 -46.182 -2.606   1.00 96.49  ?  169 GLN A CB    1 
ATOM   1153  N N     . GLU A 1 170 ? -20.225 -49.038 -1.248   1.00 99.55  ?  170 GLU A N     1 
ATOM   1154  C CA    . GLU A 1 170 ? -19.126 -49.585 -0.453   1.00 92.36  ?  170 GLU A CA    1 
ATOM   1155  C C     . GLU A 1 170 ? -17.759 -49.023 -0.835   1.00 78.76  ?  170 GLU A C     1 
ATOM   1156  O O     . GLU A 1 170 ? -17.526 -48.676 -1.992   1.00 78.89  ?  170 GLU A O     1 
ATOM   1157  C CB    . GLU A 1 170 ? -19.101 -51.110 -0.575   1.00 100.85 ?  170 GLU A CB    1 
ATOM   1158  N N     . ILE A 1 171 ? -16.863 -48.930 0.144    1.00 72.46  ?  171 ILE A N     1 
ATOM   1159  C CA    . ILE A 1 171 ? -15.465 -48.612 -0.133   1.00 76.83  ?  171 ILE A CA    1 
ATOM   1160  C C     . ILE A 1 171 ? -14.830 -49.727 -0.954   1.00 77.29  ?  171 ILE A C     1 
ATOM   1161  O O     . ILE A 1 171 ? -14.677 -50.848 -0.469   1.00 77.91  ?  171 ILE A O     1 
ATOM   1162  C CB    . ILE A 1 171 ? -14.651 -48.421 1.160    1.00 57.92  ?  171 ILE A CB    1 
ATOM   1163  C CG1   . ILE A 1 171 ? -15.358 -47.458 2.114    1.00 70.73  ?  171 ILE A CG1   1 
ATOM   1164  C CG2   . ILE A 1 171 ? -13.276 -47.876 0.836    1.00 54.21  ?  171 ILE A CG2   1 
ATOM   1165  C CD1   . ILE A 1 171 ? -15.798 -46.169 1.467    1.00 60.60  ?  171 ILE A CD1   1 
ATOM   1166  N N     . PRO A 1 172 ? -14.457 -49.424 -2.205   1.00 71.36  ?  172 PRO A N     1 
ATOM   1167  C CA    . PRO A 1 172 ? -14.005 -50.480 -3.117   1.00 72.72  ?  172 PRO A CA    1 
ATOM   1168  C C     . PRO A 1 172 ? -12.596 -51.000 -2.830   1.00 72.83  ?  172 PRO A C     1 
ATOM   1169  O O     . PRO A 1 172 ? -12.292 -52.141 -3.178   1.00 75.27  ?  172 PRO A O     1 
ATOM   1170  C CB    . PRO A 1 172 ? -14.047 -49.792 -4.482   1.00 87.81  ?  172 PRO A CB    1 
ATOM   1171  C CG    . PRO A 1 172 ? -13.813 -48.350 -4.170   1.00 87.79  ?  172 PRO A CG    1 
ATOM   1172  C CD    . PRO A 1 172 ? -14.473 -48.098 -2.847   1.00 67.38  ?  172 PRO A CD    1 
ATOM   1173  N N     . ASP A 1 173 ? -11.764 -50.185 -2.187   1.00 63.33  ?  173 ASP A N     1 
ATOM   1174  C CA    . ASP A 1 173 ? -10.348 -50.512 -2.028   1.00 72.45  ?  173 ASP A CA    1 
ATOM   1175  C C     . ASP A 1 173 ? -9.622  -49.523 -1.122   1.00 83.68  ?  173 ASP A C     1 
ATOM   1176  O O     . ASP A 1 173 ? -9.961  -48.343 -1.083   1.00 88.69  ?  173 ASP A O     1 
ATOM   1177  C CB    . ASP A 1 173 ? -9.653  -50.559 -3.391   1.00 70.75  ?  173 ASP A CB    1 
ATOM   1178  C CG    . ASP A 1 173 ? -8.252  -51.134 -3.311   1.00 82.16  ?  173 ASP A CG    1 
ATOM   1179  O OD1   . ASP A 1 173 ? -8.094  -52.352 -3.541   1.00 86.91  ?  173 ASP A OD1   1 
ATOM   1180  O OD2   . ASP A 1 173 ? -7.310  -50.371 -3.012   1.00 70.50  -1 173 ASP A OD2   1 
ATOM   1181  N N     . SER A 1 174 ? -8.641  -50.020 -0.377   1.00 86.82  ?  174 SER A N     1 
ATOM   1182  C CA    . SER A 1 174 ? -7.850  -49.184 0.521    1.00 77.93  ?  174 SER A CA    1 
ATOM   1183  C C     . SER A 1 174 ? -7.129  -48.048 -0.214   1.00 76.94  ?  174 SER A C     1 
ATOM   1184  O O     . SER A 1 174 ? -6.953  -46.952 0.330    1.00 69.44  ?  174 SER A O     1 
ATOM   1185  C CB    . SER A 1 174 ? -6.836  -50.042 1.281    1.00 83.72  ?  174 SER A CB    1 
ATOM   1186  O OG    . SER A 1 174 ? -5.956  -50.705 0.390    1.00 91.43  ?  174 SER A OG    1 
ATOM   1187  N N     . ASN A 1 175 ? -6.716  -48.303 -1.454   1.00 74.73  ?  175 ASN A N     1 
ATOM   1188  C CA    . ASN A 1 175 ? -6.018  -47.277 -2.217   1.00 76.61  ?  175 ASN A CA    1 
ATOM   1189  C C     . ASN A 1 175 ? -6.959  -46.161 -2.655   1.00 75.93  ?  175 ASN A C     1 
ATOM   1190  O O     . ASN A 1 175 ? -6.530  -45.022 -2.883   1.00 77.28  ?  175 ASN A O     1 
ATOM   1191  C CB    . ASN A 1 175 ? -5.344  -47.901 -3.442   1.00 82.97  ?  175 ASN A CB    1 
ATOM   1192  C CG    . ASN A 1 175 ? -4.148  -48.760 -3.078   1.00 96.81  ?  175 ASN A CG    1 
ATOM   1193  O OD1   . ASN A 1 175 ? -3.406  -48.450 -2.146   1.00 100.85 ?  175 ASN A OD1   1 
ATOM   1194  N ND2   . ASN A 1 175 ? -3.957  -49.850 -3.814   1.00 90.20  ?  175 ASN A ND2   1 
ATOM   1195  N N     . TRP A 1 176 ? -8.247  -46.486 -2.750   1.00 67.43  ?  176 TRP A N     1 
ATOM   1196  C CA    . TRP A 1 176 ? -9.264  -45.473 -2.991   1.00 60.83  ?  176 TRP A CA    1 
ATOM   1197  C C     . TRP A 1 176 ? -9.217  -44.498 -1.832   1.00 57.33  ?  176 TRP A C     1 
ATOM   1198  O O     . TRP A 1 176 ? -9.251  -43.284 -2.013   1.00 51.30  ?  176 TRP A O     1 
ATOM   1199  C CB    . TRP A 1 176 ? -10.660 -46.080 -3.117   1.00 65.16  ?  176 TRP A CB    1 
ATOM   1200  C CG    . TRP A 1 176 ? -11.706 -45.052 -3.406   1.00 74.38  ?  176 TRP A CG    1 
ATOM   1201  C CD1   . TRP A 1 176 ? -12.153 -44.662 -4.636   1.00 70.50  ?  176 TRP A CD1   1 
ATOM   1202  C CD2   . TRP A 1 176 ? -12.397 -44.236 -2.451   1.00 64.68  ?  176 TRP A CD2   1 
ATOM   1203  N NE1   . TRP A 1 176 ? -13.102 -43.677 -4.504   1.00 75.02  ?  176 TRP A NE1   1 
ATOM   1204  C CE2   . TRP A 1 176 ? -13.266 -43.395 -3.173   1.00 72.38  ?  176 TRP A CE2   1 
ATOM   1205  C CE3   . TRP A 1 176 ? -12.373 -44.145 -1.057   1.00 40.41  ?  176 TRP A CE3   1 
ATOM   1206  C CZ2   . TRP A 1 176 ? -14.104 -42.474 -2.546   1.00 64.56  ?  176 TRP A CZ2   1 
ATOM   1207  C CZ3   . TRP A 1 176 ? -13.204 -43.230 -0.438   1.00 54.08  ?  176 TRP A CZ3   1 
ATOM   1208  C CH2   . TRP A 1 176 ? -14.057 -42.408 -1.181   1.00 59.45  ?  176 TRP A CH2   1 
ATOM   1209  N N     . VAL A 1 177 ? -9.155  -45.069 -0.633   1.00 70.19  ?  177 VAL A N     1 
ATOM   1210  C CA    . VAL A 1 177 ? -9.090  -44.312 0.607    1.00 61.76  ?  177 VAL A CA    1 
ATOM   1211  C C     . VAL A 1 177 ? -7.837  -43.454 0.631    1.00 58.78  ?  177 VAL A C     1 
ATOM   1212  O O     . VAL A 1 177 ? -7.881  -42.297 1.040    1.00 55.10  ?  177 VAL A O     1 
ATOM   1213  C CB    . VAL A 1 177 ? -9.109  -45.228 1.846    1.00 45.96  ?  177 VAL A CB    1 
ATOM   1214  C CG1   . VAL A 1 177 ? -9.061  -44.400 3.115    1.00 54.23  ?  177 VAL A CG1   1 
ATOM   1215  C CG2   . VAL A 1 177 ? -10.346 -46.104 1.841    1.00 59.74  ?  177 VAL A CG2   1 
ATOM   1216  N N     . ALA A 1 178 ? -6.720  -44.020 0.184    1.00 49.76  ?  178 ALA A N     1 
ATOM   1217  C CA    . ALA A 1 178 ? -5.477  -43.258 0.130    1.00 49.03  ?  178 ALA A CA    1 
ATOM   1218  C C     . ALA A 1 178 ? -5.597  -42.048 -0.797   1.00 64.98  ?  178 ALA A C     1 
ATOM   1219  O O     . ALA A 1 178 ? -5.150  -40.951 -0.448   1.00 62.96  ?  178 ALA A O     1 
ATOM   1220  C CB    . ALA A 1 178 ? -4.331  -44.151 -0.316   1.00 45.06  ?  178 ALA A CB    1 
ATOM   1221  N N     . GLY A 1 179 ? -6.202  -42.238 -1.966   1.00 62.01  ?  179 GLY A N     1 
ATOM   1222  C CA    . GLY A 1 179 ? -6.368  -41.130 -2.893   1.00 53.59  ?  179 GLY A CA    1 
ATOM   1223  C C     . GLY A 1 179 ? -7.326  -40.067 -2.379   1.00 54.79  ?  179 GLY A C     1 
ATOM   1224  O O     . GLY A 1 179 ? -7.043  -38.859 -2.435   1.00 63.97  ?  179 GLY A O     1 
ATOM   1225  N N     . PHE A 1 180 ? -8.452  -40.525 -1.840   1.00 44.10  ?  180 PHE A N     1 
ATOM   1226  C CA    . PHE A 1 180 ? -9.462  -39.634 -1.282   1.00 48.09  ?  180 PHE A CA    1 
ATOM   1227  C C     . PHE A 1 180 ? -8.892  -38.808 -0.142   1.00 55.21  ?  180 PHE A C     1 
ATOM   1228  O O     . PHE A 1 180 ? -9.182  -37.623 -0.024   1.00 58.88  ?  180 PHE A O     1 
ATOM   1229  C CB    . PHE A 1 180 ? -10.677 -40.424 -0.792   1.00 54.73  ?  180 PHE A CB    1 
ATOM   1230  C CG    . PHE A 1 180 ? -11.880 -39.568 -0.515   1.00 50.34  ?  180 PHE A CG    1 
ATOM   1231  C CD1   . PHE A 1 180 ? -12.518 -38.894 -1.542   1.00 56.01  ?  180 PHE A CD1   1 
ATOM   1232  C CD2   . PHE A 1 180 ? -12.360 -39.421 0.775    1.00 50.04  ?  180 PHE A CD2   1 
ATOM   1233  C CE1   . PHE A 1 180 ? -13.623 -38.099 -1.289   1.00 54.22  ?  180 PHE A CE1   1 
ATOM   1234  C CE2   . PHE A 1 180 ? -13.464 -38.627 1.035    1.00 60.00  ?  180 PHE A CE2   1 
ATOM   1235  C CZ    . PHE A 1 180 ? -14.095 -37.965 -0.000   1.00 45.88  ?  180 PHE A CZ    1 
ATOM   1236  N N     . THR A 1 181 ? -8.096  -39.442 0.709    1.00 55.64  ?  181 THR A N     1 
ATOM   1237  C CA    . THR A 1 181 ? -7.538  -38.753 1.861    1.00 60.75  ?  181 THR A CA    1 
ATOM   1238  C C     . THR A 1 181 ? -6.463  -37.801 1.369    1.00 58.52  ?  181 THR A C     1 
ATOM   1239  O O     . THR A 1 181 ? -6.247  -36.736 1.948    1.00 56.03  ?  181 THR A O     1 
ATOM   1240  C CB    . THR A 1 181 ? -6.949  -39.728 2.892    1.00 62.89  ?  181 THR A CB    1 
ATOM   1241  O OG1   . THR A 1 181 ? -6.121  -40.687 2.222    1.00 75.33  ?  181 THR A OG1   1 
ATOM   1242  C CG2   . THR A 1 181 ? -8.063  -40.456 3.630    1.00 57.28  ?  181 THR A CG2   1 
ATOM   1243  N N     . ALA A 1 182 ? -5.785  -38.196 0.295    1.00 56.30  ?  182 ALA A N     1 
ATOM   1244  C CA    . ALA A 1 182 ? -4.778  -37.337 -0.306   1.00 55.58  ?  182 ALA A CA    1 
ATOM   1245  C C     . ALA A 1 182 ? -5.431  -36.073 -0.853   1.00 52.89  ?  182 ALA A C     1 
ATOM   1246  O O     . ALA A 1 182 ? -4.787  -35.029 -0.944   1.00 49.76  ?  182 ALA A O     1 
ATOM   1247  C CB    . ALA A 1 182 ? -4.031  -38.072 -1.405   1.00 54.29  ?  182 ALA A CB    1 
ATOM   1248  N N     . GLY A 1 183 ? -6.710  -36.166 -1.217   1.00 45.95  ?  183 GLY A N     1 
ATOM   1249  C CA    . GLY A 1 183 ? -7.434  -34.981 -1.654   1.00 47.79  ?  183 GLY A CA    1 
ATOM   1250  C C     . GLY A 1 183 ? -8.067  -34.150 -0.547   1.00 46.84  ?  183 GLY A C     1 
ATOM   1251  O O     . GLY A 1 183 ? -7.831  -32.946 -0.452   1.00 59.28  ?  183 GLY A O     1 
ATOM   1252  N N     . GLU A 1 184 ? -8.872  -34.798 0.290    1.00 48.20  ?  184 GLU A N     1 
ATOM   1253  C CA    . GLU A 1 184 ? -9.734  -34.106 1.251    1.00 58.05  ?  184 GLU A CA    1 
ATOM   1254  C C     . GLU A 1 184 ? -9.244  -34.194 2.681    1.00 53.01  ?  184 GLU A C     1 
ATOM   1255  O O     . GLU A 1 184 ? -9.827  -33.578 3.572    1.00 50.07  ?  184 GLU A O     1 
ATOM   1256  C CB    . GLU A 1 184 ? -11.171 -34.639 1.206    1.00 66.00  ?  184 GLU A CB    1 
ATOM   1257  C CG    . GLU A 1 184 ? -11.771 -34.842 -0.168   1.00 59.39  ?  184 GLU A CG    1 
ATOM   1258  C CD    . GLU A 1 184 ? -12.116 -33.539 -0.883   1.00 61.43  ?  184 GLU A CD    1 
ATOM   1259  O OE1   . GLU A 1 184 ? -11.322 -32.576 -0.832   1.00 62.62  ?  184 GLU A OE1   1 
ATOM   1260  O OE2   . GLU A 1 184 ? -13.199 -33.478 -1.504   1.00 74.41  -1 184 GLU A OE2   1 
ATOM   1261  N N     . GLY A 1 185 ? -8.185  -34.956 2.919    1.00 53.64  ?  185 GLY A N     1 
ATOM   1262  C CA    . GLY A 1 185 ? -7.803  -35.220 4.289    1.00 54.21  ?  185 GLY A CA    1 
ATOM   1263  C C     . GLY A 1 185 ? -6.953  -34.110 4.858    1.00 45.28  ?  185 GLY A C     1 
ATOM   1264  O O     . GLY A 1 185 ? -6.408  -33.283 4.127    1.00 48.46  ?  185 GLY A O     1 
ATOM   1265  N N     . SER A 1 186 ? -6.849  -34.096 6.181    1.00 50.05  ?  186 SER A N     1 
ATOM   1266  C CA    . SER A 1 186 ? -5.995  -33.155 6.877    1.00 56.25  ?  186 SER A CA    1 
ATOM   1267  C C     . SER A 1 186 ? -5.361  -33.811 8.094    1.00 59.02  ?  186 SER A C     1 
ATOM   1268  O O     . SER A 1 186 ? -6.039  -34.444 8.907    1.00 60.61  ?  186 SER A O     1 
ATOM   1269  C CB    . SER A 1 186 ? -6.796  -31.922 7.294    1.00 36.95  ?  186 SER A CB    1 
ATOM   1270  O OG    . SER A 1 186 ? -5.938  -30.863 7.677    1.00 56.05  ?  186 SER A OG    1 
ATOM   1271  N N     . PHE A 1 187 ? -4.051  -33.641 8.209    1.00 54.52  ?  187 PHE A N     1 
ATOM   1272  C CA    . PHE A 1 187 ? -3.299  -34.073 9.374    1.00 55.59  ?  187 PHE A CA    1 
ATOM   1273  C C     . PHE A 1 187 ? -2.775  -32.848 10.102   1.00 65.82  ?  187 PHE A C     1 
ATOM   1274  O O     . PHE A 1 187 ? -1.816  -32.228 9.639    1.00 70.62  ?  187 PHE A O     1 
ATOM   1275  C CB    . PHE A 1 187 ? -2.134  -34.972 8.953    1.00 57.95  ?  187 PHE A CB    1 
ATOM   1276  C CG    . PHE A 1 187 ? -2.550  -36.190 8.180    1.00 46.60  ?  187 PHE A CG    1 
ATOM   1277  C CD1   . PHE A 1 187 ? -2.880  -37.364 8.833    1.00 46.23  ?  187 PHE A CD1   1 
ATOM   1278  C CD2   . PHE A 1 187 ? -2.622  -36.155 6.798    1.00 46.83  ?  187 PHE A CD2   1 
ATOM   1279  C CE1   . PHE A 1 187 ? -3.255  -38.485 8.123    1.00 47.84  ?  187 PHE A CE1   1 
ATOM   1280  C CE2   . PHE A 1 187 ? -3.005  -37.270 6.083    1.00 55.84  ?  187 PHE A CE2   1 
ATOM   1281  C CZ    . PHE A 1 187 ? -3.323  -38.437 6.745    1.00 68.09  ?  187 PHE A CZ    1 
ATOM   1282  N N     . TYR A 1 188 ? -3.378  -32.473 11.226   1.00 61.55  ?  188 TYR A N     1 
ATOM   1283  C CA    . TYR A 1 188 ? -2.873  -31.272 11.888   1.00 68.56  ?  188 TYR A CA    1 
ATOM   1284  C C     . TYR A 1 188 ? -2.721  -31.453 13.388   1.00 62.36  ?  188 TYR A C     1 
ATOM   1285  O O     . TYR A 1 188 ? -3.350  -32.318 13.996   1.00 60.91  ?  188 TYR A O     1 
ATOM   1286  C CB    . TYR A 1 188 ? -3.768  -30.056 11.607   1.00 64.25  ?  188 TYR A CB    1 
ATOM   1287  C CG    . TYR A 1 188 ? -5.216  -30.193 12.019   1.00 55.82  ?  188 TYR A CG    1 
ATOM   1288  C CD1   . TYR A 1 188 ? -6.180  -30.619 11.118   1.00 54.84  ?  188 TYR A CD1   1 
ATOM   1289  C CD2   . TYR A 1 188 ? -5.623  -29.860 13.306   1.00 64.71  ?  188 TYR A CD2   1 
ATOM   1290  C CE1   . TYR A 1 188 ? -7.505  -30.732 11.493   1.00 62.56  ?  188 TYR A CE1   1 
ATOM   1291  C CE2   . TYR A 1 188 ? -6.944  -29.968 13.689   1.00 61.64  ?  188 TYR A CE2   1 
ATOM   1292  C CZ    . TYR A 1 188 ? -7.881  -30.403 12.779   1.00 62.46  ?  188 TYR A CZ    1 
ATOM   1293  O OH    . TYR A 1 188 ? -9.199  -30.516 13.155   1.00 61.40  ?  188 TYR A OH    1 
ATOM   1294  N N     . ILE A 1 189 ? -1.883  -30.608 13.976   1.00 62.99  ?  189 ILE A N     1 
ATOM   1295  C CA    . ILE A 1 189 ? -1.660  -30.617 15.409   1.00 60.76  ?  189 ILE A CA    1 
ATOM   1296  C C     . ILE A 1 189 ? -2.381  -29.442 16.043   1.00 62.17  ?  189 ILE A C     1 
ATOM   1297  O O     . ILE A 1 189 ? -2.126  -28.285 15.709   1.00 71.84  ?  189 ILE A O     1 
ATOM   1298  C CB    . ILE A 1 189 ? -0.161  -30.556 15.751   1.00 61.42  ?  189 ILE A CB    1 
ATOM   1299  C CG1   . ILE A 1 189 ? 0.565   -31.761 15.152   1.00 64.34  ?  189 ILE A CG1   1 
ATOM   1300  C CG2   . ILE A 1 189 ? 0.044   -30.495 17.257   1.00 65.87  ?  189 ILE A CG2   1 
ATOM   1301  C CD1   . ILE A 1 189 ? -0.083  -33.088 15.483   1.00 58.64  ?  189 ILE A CD1   1 
ATOM   1302  N N     . ARG A 1 190 ? -3.290  -29.755 16.957   1.00 63.24  ?  190 ARG A N     1 
ATOM   1303  C CA    . ARG A 1 190 ? -4.072  -28.744 17.644   1.00 64.23  ?  190 ARG A CA    1 
ATOM   1304  C C     . ARG A 1 190 ? -3.432  -28.413 18.982   1.00 68.99  ?  190 ARG A C     1 
ATOM   1305  O O     . ARG A 1 190 ? -3.195  -29.299 19.805   1.00 73.57  ?  190 ARG A O     1 
ATOM   1306  C CB    . ARG A 1 190 ? -5.502  -29.250 17.848   1.00 65.55  ?  190 ARG A CB    1 
ATOM   1307  C CG    . ARG A 1 190 ? -6.432  -28.319 18.603   1.00 61.30  ?  190 ARG A CG    1 
ATOM   1308  C CD    . ARG A 1 190 ? -7.845  -28.431 18.049   1.00 70.28  ?  190 ARG A CD    1 
ATOM   1309  N NE    . ARG A 1 190 ? -8.506  -29.653 18.504   1.00 64.47  ?  190 ARG A NE    1 
ATOM   1310  C CZ    . ARG A 1 190 ? -9.535  -30.225 17.885   1.00 67.34  ?  190 ARG A CZ    1 
ATOM   1311  N NH1   . ARG A 1 190 ? -10.027 -29.689 16.776   1.00 73.80  1  190 ARG A NH1   1 
ATOM   1312  N NH2   . ARG A 1 190 ? -10.071 -31.336 18.372   1.00 48.33  ?  190 ARG A NH2   1 
ATOM   1313  N N     . ILE A 1 191 ? -3.152  -27.131 19.190   1.00 69.64  ?  191 ILE A N     1 
ATOM   1314  C CA    . ILE A 1 191 ? -2.621  -26.651 20.457   1.00 56.54  ?  191 ILE A CA    1 
ATOM   1315  C C     . ILE A 1 191 ? -3.611  -25.670 21.082   1.00 70.44  ?  191 ILE A C     1 
ATOM   1316  O O     . ILE A 1 191 ? -3.990  -24.671 20.469   1.00 69.08  ?  191 ILE A O     1 
ATOM   1317  C CB    . ILE A 1 191 ? -1.215  -26.010 20.291   1.00 55.31  ?  191 ILE A CB    1 
ATOM   1318  C CG1   . ILE A 1 191 ? -1.226  -24.860 19.280   1.00 71.29  ?  191 ILE A CG1   1 
ATOM   1319  C CG2   . ILE A 1 191 ? -0.209  -27.055 19.842   1.00 51.29  ?  191 ILE A CG2   1 
ATOM   1320  C CD1   . ILE A 1 191 ? -1.091  -23.485 19.908   1.00 66.31  ?  191 ILE A CD1   1 
ATOM   1321  N N     . ALA A 1 192 ? -4.074  -25.981 22.288   1.00 80.86  ?  192 ALA A N     1 
ATOM   1322  C CA    . ALA A 1 192 ? -5.061  -25.127 22.938   1.00 80.98  ?  192 ALA A CA    1 
ATOM   1323  C C     . ALA A 1 192 ? -4.510  -24.524 24.218   1.00 81.14  ?  192 ALA A C     1 
ATOM   1324  O O     . ALA A 1 192 ? -4.003  -25.246 25.072   1.00 79.95  ?  192 ALA A O     1 
ATOM   1325  C CB    . ALA A 1 192 ? -6.325  -25.917 23.236   1.00 67.69  ?  192 ALA A CB    1 
ATOM   1326  N N     . LYS A 1 193 ? -4.611  -23.205 24.359   1.00 89.23  ?  193 LYS A N     1 
ATOM   1327  C CA    . LYS A 1 193 ? -4.207  -22.574 25.606   1.00 90.22  ?  193 LYS A CA    1 
ATOM   1328  C C     . LYS A 1 193 ? -5.146  -23.060 26.698   1.00 88.75  ?  193 LYS A C     1 
ATOM   1329  O O     . LYS A 1 193 ? -6.366  -22.951 26.571   1.00 77.66  ?  193 LYS A O     1 
ATOM   1330  C CB    . LYS A 1 193 ? -4.237  -21.049 25.493   1.00 81.45  ?  193 LYS A CB    1 
ATOM   1331  N N     . ASN A 1 194 ? -4.575  -23.597 27.769   1.00 80.04  ?  194 ASN A N     1 
ATOM   1332  C CA    . ASN A 1 194 ? -5.373  -24.234 28.805   1.00 82.41  ?  194 ASN A CA    1 
ATOM   1333  C C     . ASN A 1 194 ? -4.584  -24.289 30.107   1.00 87.63  ?  194 ASN A C     1 
ATOM   1334  O O     . ASN A 1 194 ? -3.631  -25.058 30.234   1.00 82.23  ?  194 ASN A O     1 
ATOM   1335  C CB    . ASN A 1 194 ? -5.802  -25.635 28.356   1.00 71.58  ?  194 ASN A CB    1 
ATOM   1336  C CG    . ASN A 1 194 ? -6.751  -26.313 29.335   1.00 72.41  ?  194 ASN A CG    1 
ATOM   1337  O OD1   . ASN A 1 194 ? -6.685  -26.106 30.547   1.00 92.38  ?  194 ASN A OD1   1 
ATOM   1338  N ND2   . ASN A 1 194 ? -7.645  -27.138 28.802   1.00 65.14  ?  194 ASN A ND2   1 
ATOM   1339  N N     . SER A 1 195 ? -4.986  -23.466 31.068   1.00 91.55  ?  195 SER A N     1 
ATOM   1340  C CA    . SER A 1 195 ? -4.234  -23.303 32.305   1.00 84.83  ?  195 SER A CA    1 
ATOM   1341  C C     . SER A 1 195 ? -4.226  -24.563 33.168   1.00 74.71  ?  195 SER A C     1 
ATOM   1342  O O     . SER A 1 195 ? -3.337  -24.736 34.001   1.00 80.75  ?  195 SER A O     1 
ATOM   1343  C CB    . SER A 1 195 ? -4.798  -22.130 33.111   1.00 75.92  ?  195 SER A CB    1 
ATOM   1344  O OG    . SER A 1 195 ? -6.202  -22.248 33.262   1.00 75.73  ?  195 SER A OG    1 
ATOM   1345  N N     . THR A 1 196 ? -5.207  -25.442 32.973   1.00 68.58  ?  196 THR A N     1 
ATOM   1346  C CA    . THR A 1 196 ? -5.286  -26.658 33.779   1.00 73.46  ?  196 THR A CA    1 
ATOM   1347  C C     . THR A 1 196 ? -4.230  -27.699 33.409   1.00 73.77  ?  196 THR A C     1 
ATOM   1348  O O     . THR A 1 196 ? -4.144  -28.753 34.037   1.00 85.49  ?  196 THR A O     1 
ATOM   1349  C CB    . THR A 1 196 ? -6.674  -27.318 33.651   1.00 60.09  ?  196 THR A CB    1 
ATOM   1350  O OG1   . THR A 1 196 ? -6.813  -27.893 32.347   1.00 62.12  ?  196 THR A OG1   1 
ATOM   1351  C CG2   . THR A 1 196 ? -7.775  -26.294 33.868   1.00 78.93  ?  196 THR A CG2   1 
ATOM   1352  N N     . LEU A 1 197 ? -3.427  -27.400 32.395   1.00 70.60  ?  197 LEU A N     1 
ATOM   1353  C CA    . LEU A 1 197 ? -2.288  -28.241 32.046   1.00 73.71  ?  197 LEU A CA    1 
ATOM   1354  C C     . LEU A 1 197 ? -0.980  -27.606 32.495   1.00 80.68  ?  197 LEU A C     1 
ATOM   1355  O O     . LEU A 1 197 ? -0.845  -26.382 32.485   1.00 74.37  ?  197 LEU A O     1 
ATOM   1356  C CB    . LEU A 1 197 ? -2.267  -28.529 30.547   1.00 74.89  ?  197 LEU A CB    1 
ATOM   1357  C CG    . LEU A 1 197 ? -3.451  -29.387 30.101   1.00 76.92  ?  197 LEU A CG    1 
ATOM   1358  C CD1   . LEU A 1 197 ? -4.210  -28.722 28.979   1.00 72.37  ?  197 LEU A CD1   1 
ATOM   1359  C CD2   . LEU A 1 197 ? -2.980  -30.773 29.685   1.00 69.84  ?  197 LEU A CD2   1 
ATOM   1360  N N     . LYS A 1 198 ? -0.030  -28.444 32.899   1.00 86.29  ?  198 LYS A N     1 
ATOM   1361  C CA    . LYS A 1 198 ? 1.238   -27.971 33.443   1.00 83.04  ?  198 LYS A CA    1 
ATOM   1362  C C     . LYS A 1 198 ? 1.962   -27.068 32.451   1.00 87.51  ?  198 LYS A C     1 
ATOM   1363  O O     . LYS A 1 198 ? 2.510   -26.033 32.829   1.00 84.94  ?  198 LYS A O     1 
ATOM   1364  C CB    . LYS A 1 198 ? 2.131   -29.152 33.826   1.00 76.29  ?  198 LYS A CB    1 
ATOM   1365  N N     . THR A 1 199 ? 1.958   -27.462 31.180   1.00 88.22  ?  199 THR A N     1 
ATOM   1366  C CA    . THR A 1 199 ? 2.630   -26.680 30.150   1.00 88.94  ?  199 THR A CA    1 
ATOM   1367  C C     . THR A 1 199 ? 1.826   -25.439 29.781   1.00 80.28  ?  199 THR A C     1 
ATOM   1368  O O     . THR A 1 199 ? 2.338   -24.529 29.130   1.00 76.14  ?  199 THR A O     1 
ATOM   1369  C CB    . THR A 1 199 ? 2.870   -27.513 28.880   1.00 89.55  ?  199 THR A CB    1 
ATOM   1370  O OG1   . THR A 1 199 ? 1.626   -28.055 28.419   1.00 91.02  ?  199 THR A OG1   1 
ATOM   1371  C CG2   . THR A 1 199 ? 3.839   -28.647 29.164   1.00 89.34  ?  199 THR A CG2   1 
ATOM   1372  N N     . GLY A 1 200 ? 0.561   -25.410 30.188   1.00 77.89  ?  200 GLY A N     1 
ATOM   1373  C CA    . GLY A 1 200 ? -0.317  -24.318 29.815   1.00 76.55  ?  200 GLY A CA    1 
ATOM   1374  C C     . GLY A 1 200 ? -1.060  -24.557 28.515   1.00 87.55  ?  200 GLY A C     1 
ATOM   1375  O O     . GLY A 1 200 ? -1.849  -23.716 28.083   1.00 90.87  ?  200 GLY A O     1 
ATOM   1376  N N     . TYR A 1 201 ? -0.812  -25.705 27.892   1.00 94.30  ?  201 TYR A N     1 
ATOM   1377  C CA    . TYR A 1 201 ? -1.444  -26.032 26.617   1.00 80.79  ?  201 TYR A CA    1 
ATOM   1378  C C     . TYR A 1 201 ? -1.797  -27.510 26.496   1.00 72.82  ?  201 TYR A C     1 
ATOM   1379  O O     . TYR A 1 201 ? -1.004  -28.377 26.868   1.00 70.78  ?  201 TYR A O     1 
ATOM   1380  C CB    . TYR A 1 201 ? -0.527  -25.642 25.450   1.00 75.13  ?  201 TYR A CB    1 
ATOM   1381  C CG    . TYR A 1 201 ? -0.225  -24.164 25.346   1.00 86.30  ?  201 TYR A CG    1 
ATOM   1382  C CD1   . TYR A 1 201 ? -0.971  -23.338 24.516   1.00 83.94  ?  201 TYR A CD1   1 
ATOM   1383  C CD2   . TYR A 1 201 ? 0.830   -23.600 26.052   1.00 95.15  ?  201 TYR A CD2   1 
ATOM   1384  C CE1   . TYR A 1 201 ? -0.692  -21.988 24.414   1.00 76.72  ?  201 TYR A CE1   1 
ATOM   1385  C CE2   . TYR A 1 201 ? 1.117   -22.255 25.956   1.00 92.43  ?  201 TYR A CE2   1 
ATOM   1386  C CZ    . TYR A 1 201 ? 0.355   -21.453 25.136   1.00 79.31  ?  201 TYR A CZ    1 
ATOM   1387  O OH    . TYR A 1 201 ? 0.643   -20.112 25.040   1.00 85.79  ?  201 TYR A OH    1 
ATOM   1388  N N     . GLN A 1 202 ? -2.986  -27.797 25.972   1.00 66.27  ?  202 GLN A N     1 
ATOM   1389  C CA    . GLN A 1 202 ? -3.279  -29.150 25.522   1.00 67.17  ?  202 GLN A CA    1 
ATOM   1390  C C     . GLN A 1 202 ? -2.724  -29.337 24.119   1.00 67.49  ?  202 GLN A C     1 
ATOM   1391  O O     . GLN A 1 202 ? -2.807  -28.438 23.275   1.00 60.94  ?  202 GLN A O     1 
ATOM   1392  C CB    . GLN A 1 202 ? -4.787  -29.425 25.539   1.00 51.64  ?  202 GLN A CB    1 
ATOM   1393  C CG    . GLN A 1 202 ? -5.165  -30.859 25.179   1.00 39.39  ?  202 GLN A CG    1 
ATOM   1394  C CD    . GLN A 1 202 ? -6.667  -31.083 25.143   1.00 46.04  ?  202 GLN A CD    1 
ATOM   1395  O OE1   . GLN A 1 202 ? -7.451  -30.153 25.332   1.00 45.49  ?  202 GLN A OE1   1 
ATOM   1396  N NE2   . GLN A 1 202 ? -7.073  -32.322 24.893   1.00 37.62  ?  202 GLN A NE2   1 
ATOM   1397  N N     . VAL A 1 203 ? -2.176  -30.522 23.878   1.00 67.03  ?  203 VAL A N     1 
ATOM   1398  C CA    . VAL A 1 203 ? -1.688  -30.910 22.565   1.00 45.31  ?  203 VAL A CA    1 
ATOM   1399  C C     . VAL A 1 203 ? -2.451  -32.118 22.044   1.00 60.34  ?  203 VAL A C     1 
ATOM   1400  O O     . VAL A 1 203 ? -2.568  -33.131 22.735   1.00 63.10  ?  203 VAL A O     1 
ATOM   1401  C CB    . VAL A 1 203 ? -0.181  -31.226 22.592   1.00 55.65  ?  203 VAL A CB    1 
ATOM   1402  C CG1   . VAL A 1 203 ? 0.302   -31.622 21.207   1.00 63.61  ?  203 VAL A CG1   1 
ATOM   1403  C CG2   . VAL A 1 203 ? 0.600   -30.026 23.097   1.00 73.04  ?  203 VAL A CG2   1 
ATOM   1404  N N     . GLN A 1 204 ? -2.971  -32.012 20.828   1.00 68.85  ?  204 GLN A N     1 
ATOM   1405  C CA    . GLN A 1 204 ? -3.757  -33.091 20.254   1.00 50.88  ?  204 GLN A CA    1 
ATOM   1406  C C     . GLN A 1 204 ? -3.312  -33.341 18.823   1.00 55.60  ?  204 GLN A C     1 
ATOM   1407  O O     . GLN A 1 204 ? -3.096  -32.402 18.061   1.00 59.51  ?  204 GLN A O     1 
ATOM   1408  C CB    . GLN A 1 204 ? -5.249  -32.752 20.277   1.00 47.71  ?  204 GLN A CB    1 
ATOM   1409  C CG    . GLN A 1 204 ? -5.980  -33.154 21.543   1.00 44.10  ?  204 GLN A CG    1 
ATOM   1410  C CD    . GLN A 1 204 ? -7.460  -32.826 21.480   1.00 53.15  ?  204 GLN A CD    1 
ATOM   1411  O OE1   . GLN A 1 204 ? -7.846  -31.674 21.274   1.00 49.28  ?  204 GLN A OE1   1 
ATOM   1412  N NE2   . GLN A 1 204 ? -8.298  -33.841 21.653   1.00 51.27  ?  204 GLN A NE2   1 
ATOM   1413  N N     . SER A 1 205 ? -3.169  -34.608 18.456   1.00 54.31  ?  205 SER A N     1 
ATOM   1414  C CA    . SER A 1 205 ? -2.942  -34.945 17.062   1.00 48.10  ?  205 SER A CA    1 
ATOM   1415  C C     . SER A 1 205 ? -4.288  -35.233 16.422   1.00 56.25  ?  205 SER A C     1 
ATOM   1416  O O     . SER A 1 205 ? -5.093  -35.986 16.969   1.00 61.55  ?  205 SER A O     1 
ATOM   1417  C CB    . SER A 1 205 ? -2.001  -36.140 16.936   1.00 41.98  ?  205 SER A CB    1 
ATOM   1418  O OG    . SER A 1 205 ? -2.552  -37.287 17.555   1.00 65.58  ?  205 SER A OG    1 
ATOM   1419  N N     . VAL A 1 206 ? -4.541  -34.624 15.270   1.00 55.82  ?  206 VAL A N     1 
ATOM   1420  C CA    . VAL A 1 206 ? -5.853  -34.730 14.649   1.00 57.51  ?  206 VAL A CA    1 
ATOM   1421  C C     . VAL A 1 206 ? -5.783  -35.207 13.206   1.00 56.13  ?  206 VAL A C     1 
ATOM   1422  O O     . VAL A 1 206 ? -5.000  -34.679 12.399   1.00 61.12  ?  206 VAL A O     1 
ATOM   1423  C CB    . VAL A 1 206 ? -6.603  -33.381 14.683   1.00 59.95  ?  206 VAL A CB    1 
ATOM   1424  C CG1   . VAL A 1 206 ? -8.003  -33.537 14.110   1.00 48.41  ?  206 VAL A CG1   1 
ATOM   1425  C CG2   . VAL A 1 206 ? -6.671  -32.840 16.103   1.00 71.72  ?  206 VAL A CG2   1 
ATOM   1426  N N     . PHE A 1 207 ? -6.625  -36.187 12.883   1.00 52.05  ?  207 PHE A N     1 
ATOM   1427  C CA    . PHE A 1 207 ? -6.835  -36.571 11.491   1.00 49.41  ?  207 PHE A CA    1 
ATOM   1428  C C     . PHE A 1 207 ? -8.266  -36.241 11.117   1.00 55.55  ?  207 PHE A C     1 
ATOM   1429  O O     . PHE A 1 207 ? -9.180  -36.457 11.902   1.00 62.58  ?  207 PHE A O     1 
ATOM   1430  C CB    . PHE A 1 207 ? -6.554  -38.056 11.266   1.00 46.99  ?  207 PHE A CB    1 
ATOM   1431  C CG    . PHE A 1 207 ? -7.021  -38.560 9.930    1.00 52.04  ?  207 PHE A CG    1 
ATOM   1432  C CD1   . PHE A 1 207 ? -6.433  -38.112 8.761    1.00 56.62  ?  207 PHE A CD1   1 
ATOM   1433  C CD2   . PHE A 1 207 ? -8.046  -39.488 9.844    1.00 51.00  ?  207 PHE A CD2   1 
ATOM   1434  C CE1   . PHE A 1 207 ? -6.859  -38.572 7.529    1.00 46.34  ?  207 PHE A CE1   1 
ATOM   1435  C CE2   . PHE A 1 207 ? -8.477  -39.954 8.614    1.00 51.84  ?  207 PHE A CE2   1 
ATOM   1436  C CZ    . PHE A 1 207 ? -7.881  -39.495 7.456    1.00 37.46  ?  207 PHE A CZ    1 
ATOM   1437  N N     . GLN A 1 208 ? -8.465  -35.705 9.920    1.00 49.29  ?  208 GLN A N     1 
ATOM   1438  C CA    . GLN A 1 208 ? -9.775  -35.172 9.578    1.00 40.33  ?  208 GLN A CA    1 
ATOM   1439  C C     . GLN A 1 208 ? -10.098 -35.361 8.101    1.00 50.11  ?  208 GLN A C     1 
ATOM   1440  O O     . GLN A 1 208 ? -9.209  -35.310 7.259    1.00 56.86  ?  208 GLN A O     1 
ATOM   1441  C CB    . GLN A 1 208 ? -9.849  -33.691 9.971    1.00 32.14  ?  208 GLN A CB    1 
ATOM   1442  C CG    . GLN A 1 208 ? -11.073 -32.948 9.467    1.00 40.31  ?  208 GLN A CG    1 
ATOM   1443  C CD    . GLN A 1 208 ? -11.090 -31.495 9.904    1.00 52.63  ?  208 GLN A CD    1 
ATOM   1444  O OE1   . GLN A 1 208 ? -10.074 -30.802 9.840    1.00 48.95  ?  208 GLN A OE1   1 
ATOM   1445  N NE2   . GLN A 1 208 ? -12.246 -31.029 10.360   1.00 46.38  ?  208 GLN A NE2   1 
ATOM   1446  N N     . ILE A 1 209 ? -11.367 -35.595 7.783    1.00 45.12  ?  209 ILE A N     1 
ATOM   1447  C CA    . ILE A 1 209 ? -11.800 -35.516 6.395    1.00 40.15  ?  209 ILE A CA    1 
ATOM   1448  C C     . ILE A 1 209 ? -13.057 -34.661 6.347    1.00 35.68  ?  209 ILE A C     1 
ATOM   1449  O O     . ILE A 1 209 ? -13.973 -34.841 7.135    1.00 50.26  ?  209 ILE A O     1 
ATOM   1450  C CB    . ILE A 1 209 ? -12.077 -36.910 5.784    1.00 33.55  ?  209 ILE A CB    1 
ATOM   1451  C CG1   . ILE A 1 209 ? -10.811 -37.771 5.798    1.00 29.69  ?  209 ILE A CG1   1 
ATOM   1452  C CG2   . ILE A 1 209 ? -12.601 -36.779 4.362    1.00 36.61  ?  209 ILE A CG2   1 
ATOM   1453  C CD1   . ILE A 1 209 ? -11.050 -39.214 5.408    1.00 23.63  ?  209 ILE A CD1   1 
ATOM   1454  N N     . THR A 1 210 ? -13.090 -33.726 5.409    1.00 44.82  ?  210 THR A N     1 
ATOM   1455  C CA    . THR A 1 210 ? -14.187 -32.774 5.322    1.00 42.56  ?  210 THR A CA    1 
ATOM   1456  C C     . THR A 1 210 ? -14.969 -32.962 4.032    1.00 60.03  ?  210 THR A C     1 
ATOM   1457  O O     . THR A 1 210 ? -14.380 -33.201 2.978    1.00 81.96  ?  210 THR A O     1 
ATOM   1458  C CB    . THR A 1 210 ? -13.666 -31.323 5.407    1.00 45.06  ?  210 THR A CB    1 
ATOM   1459  O OG1   . THR A 1 210 ? -12.930 -31.152 6.623    1.00 58.29  ?  210 THR A OG1   1 
ATOM   1460  C CG2   . THR A 1 210 ? -14.816 -30.328 5.378    1.00 42.51  ?  210 THR A CG2   1 
ATOM   1461  N N     . GLN A 1 211 ? -16.291 -32.856 4.113    1.00 48.78  ?  211 GLN A N     1 
ATOM   1462  C CA    . GLN A 1 211 ? -17.103 -32.970 2.909    1.00 73.05  ?  211 GLN A CA    1 
ATOM   1463  C C     . GLN A 1 211 ? -18.468 -32.348 3.154    1.00 74.20  ?  211 GLN A C     1 
ATOM   1464  O O     . GLN A 1 211 ? -18.993 -32.429 4.256    1.00 74.57  ?  211 GLN A O     1 
ATOM   1465  C CB    . GLN A 1 211 ? -17.251 -34.438 2.497    1.00 61.11  ?  211 GLN A CB    1 
ATOM   1466  C CG    . GLN A 1 211 ? -17.767 -34.647 1.083    1.00 80.95  ?  211 GLN A CG    1 
ATOM   1467  C CD    . GLN A 1 211 ? -16.671 -34.512 0.040    1.00 79.43  ?  211 GLN A CD    1 
ATOM   1468  O OE1   . GLN A 1 211 ? -15.620 -33.923 0.293    1.00 81.85  ?  211 GLN A OE1   1 
ATOM   1469  N NE2   . GLN A 1 211 ? -16.914 -35.062 -1.145   1.00 64.27  ?  211 GLN A NE2   1 
ATOM   1470  N N     . ASP A 1 212 ? -19.056 -31.761 2.116    1.00 76.63  ?  212 ASP A N     1 
ATOM   1471  C CA    . ASP A 1 212 ? -20.388 -31.168 2.211    1.00 79.08  ?  212 ASP A CA    1 
ATOM   1472  C C     . ASP A 1 212 ? -21.457 -32.181 2.611    1.00 79.41  ?  212 ASP A C     1 
ATOM   1473  O O     . ASP A 1 212 ? -21.336 -33.370 2.325    1.00 58.40  ?  212 ASP A O     1 
ATOM   1474  C CB    . ASP A 1 212 ? -20.769 -30.514 0.880    1.00 96.46  ?  212 ASP A CB    1 
ATOM   1475  N N     . THR A 1 213 ? -22.498 -31.703 3.287    1.00 82.72  ?  213 THR A N     1 
ATOM   1476  C CA    . THR A 1 213 ? -23.529 -32.570 3.855    1.00 77.31  ?  213 THR A CA    1 
ATOM   1477  C C     . THR A 1 213 ? -24.288 -33.274 2.723    1.00 93.86  ?  213 THR A C     1 
ATOM   1478  O O     . THR A 1 213 ? -25.327 -32.790 2.280    1.00 100.20 ?  213 THR A O     1 
ATOM   1479  C CB    . THR A 1 213 ? -24.503 -31.773 4.740    1.00 59.73  ?  213 THR A CB    1 
ATOM   1480  O OG1   . THR A 1 213 ? -23.771 -30.855 5.563    1.00 73.85  ?  213 THR A OG1   1 
ATOM   1481  C CG2   . THR A 1 213 ? -25.316 -32.701 5.621    1.00 68.35  ?  213 THR A CG2   1 
ATOM   1482  N N     . ARG A 1 214 ? -23.774 -34.410 2.250    1.00 76.80  ?  214 ARG A N     1 
ATOM   1483  C CA    . ARG A 1 214 ? -24.460 -35.168 1.194    1.00 75.27  ?  214 ARG A CA    1 
ATOM   1484  C C     . ARG A 1 214 ? -23.997 -36.612 1.051    1.00 79.75  ?  214 ARG A C     1 
ATOM   1485  O O     . ARG A 1 214 ? -24.656 -37.442 0.448    1.00 77.72  ?  214 ARG A O     1 
ATOM   1486  C CB    . ARG A 1 214 ? -24.309 -34.441 -0.142   1.00 86.58  ?  214 ARG A CB    1 
ATOM   1487  C CG    . ARG A 1 214 ? -22.887 -34.375 -0.717   1.00 88.26  ?  214 ARG A CG    1 
ATOM   1488  C CD    . ARG A 1 214 ? -22.851 -33.416 -1.913   1.00 84.41  ?  214 ARG A CD    1 
ATOM   1489  N NE    . ARG A 1 214 ? -21.642 -33.540 -2.723   1.00 80.21  ?  214 ARG A NE    1 
ATOM   1490  C CZ    . ARG A 1 214 ? -21.584 -33.281 -4.027   1.00 93.85  ?  214 ARG A CZ    1 
ATOM   1491  N NH1   . ARG A 1 214 ? -22.671 -32.893 -4.681   1.00 95.54  ?  214 ARG A NH1   1 
ATOM   1492  N NH2   . ARG A 1 214 ? -20.440 -33.427 -4.683   1.00 84.90  ?  214 ARG A NH2   1 
ATOM   1493  N N     . ASP A 1 215 ? -22.820 -36.882 1.578    1.00 77.12  ?  215 ASP A N     1 
ATOM   1494  C CA    . ASP A 1 215 ? -22.245 -38.206 1.506    1.00 84.10  ?  215 ASP A CA    1 
ATOM   1495  C C     . ASP A 1 215 ? -22.018 -38.816 2.873    1.00 87.83  ?  215 ASP A C     1 
ATOM   1496  O O     . ASP A 1 215 ? -21.025 -39.507 3.077    1.00 74.15  ?  215 ASP A O     1 
ATOM   1497  C CB    . ASP A 1 215 ? -20.932 -38.193 0.746    1.00 89.74  ?  215 ASP A CB    1 
ATOM   1498  C CG    . ASP A 1 215 ? -21.129 -38.347 -0.750   1.00 89.52  ?  215 ASP A CG    1 
ATOM   1499  O OD1   . ASP A 1 215 ? -21.848 -39.260 -1.191   1.00 94.00  ?  215 ASP A OD1   1 
ATOM   1500  O OD2   . ASP A 1 215 ? -20.549 -37.568 -1.500   1.00 85.10  ?  215 ASP A OD2   1 
ATOM   1501  N N     . ILE A 1 216 ? -22.915 -38.533 3.813    1.00 91.79  ?  216 ILE A N     1 
ATOM   1502  C CA    . ILE A 1 216 ? -22.792 -39.020 5.189    1.00 75.95  ?  216 ILE A CA    1 
ATOM   1503  C C     . ILE A 1 216 ? -22.867 -40.545 5.284    1.00 70.47  ?  216 ILE A C     1 
ATOM   1504  O O     . ILE A 1 216 ? -22.229 -41.147 6.150    1.00 80.25  ?  216 ILE A O     1 
ATOM   1505  C CB    . ILE A 1 216 ? -23.901 -38.406 6.082    1.00 67.44  ?  216 ILE A CB    1 
ATOM   1506  C CG1   . ILE A 1 216 ? -23.794 -36.884 6.126    1.00 78.12  ?  216 ILE A CG1   1 
ATOM   1507  C CG2   . ILE A 1 216 ? -23.808 -38.932 7.495    1.00 82.79  ?  216 ILE A CG2   1 
ATOM   1508  C CD1   . ILE A 1 216 ? -24.493 -36.147 4.996    1.00 76.35  ?  216 ILE A CD1   1 
ATOM   1509  N N     . GLU A 1 217 ? -23.626 -41.165 4.382    1.00 66.24  ?  217 GLU A N     1 
ATOM   1510  C CA    . GLU A 1 217 ? -23.741 -42.624 4.378    1.00 74.66  ?  217 GLU A CA    1 
ATOM   1511  C C     . GLU A 1 217 ? -22.335 -43.143 4.110    1.00 75.48  ?  217 GLU A C     1 
ATOM   1512  O O     . GLU A 1 217 ? -21.889 -44.117 4.709    1.00 83.06  ?  217 GLU A O     1 
ATOM   1513  C CB    . GLU A 1 217 ? -24.736 -43.107 3.321    1.00 80.32  ?  217 GLU A CB    1 
ATOM   1514  N N     . LEU A 1 218 ? -21.682 -42.503 3.142    1.00 83.19  ?  218 LEU A N     1 
ATOM   1515  C CA    . LEU A 1 218 ? -20.299 -42.799 2.799    1.00 84.32  ?  218 LEU A CA    1 
ATOM   1516  C C     . LEU A 1 218 ? -19.359 -42.538 3.988    1.00 87.02  ?  218 LEU A C     1 
ATOM   1517  O O     . LEU A 1 218 ? -18.520 -43.367 4.305    1.00 90.47  ?  218 LEU A O     1 
ATOM   1518  C CB    . LEU A 1 218 ? -19.864 -41.968 1.582    1.00 80.07  ?  218 LEU A CB    1 
ATOM   1519  C CG    . LEU A 1 218 ? -18.414 -42.047 1.098    1.00 68.08  ?  218 LEU A CG    1 
ATOM   1520  C CD1   . LEU A 1 218 ? -18.021 -43.491 0.862    1.00 69.06  ?  218 LEU A CD1   1 
ATOM   1521  C CD2   . LEU A 1 218 ? -18.215 -41.223 -0.165   1.00 74.39  ?  218 LEU A CD2   1 
ATOM   1522  N N     . MET A 1 219 ? -19.551 -41.406 4.672    1.00 83.08  ?  219 MET A N     1 
ATOM   1523  C CA    . MET A 1 219 ? -18.695 -41.017 5.810    1.00 86.33  ?  219 MET A CA    1 
ATOM   1524  C C     . MET A 1 219 ? -18.733 -42.002 6.976    1.00 83.41  ?  219 MET A C     1 
ATOM   1525  O O     . MET A 1 219 ? -17.691 -42.346 7.562    1.00 82.62  ?  219 MET A O     1 
ATOM   1526  C CB    . MET A 1 219 ? -19.105 -39.629 6.312    1.00 77.53  ?  219 MET A CB    1 
ATOM   1527  C CG    . MET A 1 219 ? -18.949 -38.519 5.286    1.00 76.17  ?  219 MET A CG    1 
ATOM   1528  S SD    . MET A 1 219 ? -17.230 -38.266 4.810    1.00 80.09  ?  219 MET A SD    1 
ATOM   1529  C CE    . MET A 1 219 ? -16.638 -37.350 6.228    1.00 56.12  ?  219 MET A CE    1 
ATOM   1530  N N     . LYS A 1 220 ? -19.932 -42.473 7.293    1.00 84.50  ?  220 LYS A N     1 
ATOM   1531  C CA    . LYS A 1 220 ? -20.082 -43.473 8.330    1.00 82.44  ?  220 LYS A CA    1 
ATOM   1532  C C     . LYS A 1 220 ? -19.389 -44.739 7.857    1.00 81.10  ?  220 LYS A C     1 
ATOM   1533  O O     . LYS A 1 220 ? -18.819 -45.471 8.660    1.00 92.66  ?  220 LYS A O     1 
ATOM   1534  C CB    . LYS A 1 220 ? -21.549 -43.714 8.697    1.00 66.90  ?  220 LYS A CB    1 
ATOM   1535  C CG    . LYS A 1 220 ? -22.187 -42.521 9.401    1.00 61.34  ?  220 LYS A CG    1 
ATOM   1536  C CD    . LYS A 1 220 ? -23.611 -42.799 9.856    1.00 56.17  ?  220 LYS A CD    1 
ATOM   1537  C CE    . LYS A 1 220 ? -24.199 -41.579 10.555   1.00 63.85  ?  220 LYS A CE    1 
ATOM   1538  N NZ    . LYS A 1 220 ? -25.574 -41.819 11.072   1.00 63.95  1  220 LYS A NZ    1 
ATOM   1539  N N     . ASN A 1 221 ? -19.449 -45.005 6.555    1.00 66.09  ?  221 ASN A N     1 
ATOM   1540  C CA    . ASN A 1 221 ? -18.743 -46.160 6.023    1.00 79.73  ?  221 ASN A CA    1 
ATOM   1541  C C     . ASN A 1 221 ? -17.226 -46.005 6.156    1.00 82.77  ?  221 ASN A C     1 
ATOM   1542  O O     . ASN A 1 221 ? -16.532 -47.001 6.315    1.00 81.02  ?  221 ASN A O     1 
ATOM   1543  C CB    . ASN A 1 221 ? -19.122 -46.398 4.560    1.00 82.59  ?  221 ASN A CB    1 
ATOM   1544  N N     . LEU A 1 222 ? -16.699 -44.783 6.047    1.00 83.20  ?  222 LEU A N     1 
ATOM   1545  C CA    . LEU A 1 222 ? -15.258 -44.593 6.246    1.00 84.17  ?  222 LEU A CA    1 
ATOM   1546  C C     . LEU A 1 222 ? -14.902 -44.818 7.705    1.00 85.87  ?  222 LEU A C     1 
ATOM   1547  O O     . LEU A 1 222 ? -13.826 -45.330 8.028    1.00 81.33  ?  222 LEU A O     1 
ATOM   1548  C CB    . LEU A 1 222 ? -14.767 -43.205 5.815    1.00 73.22  ?  222 LEU A CB    1 
ATOM   1549  C CG    . LEU A 1 222 ? -14.491 -42.816 4.358    1.00 76.76  ?  222 LEU A CG    1 
ATOM   1550  C CD1   . LEU A 1 222 ? -13.384 -43.705 3.795    1.00 62.02  ?  222 LEU A CD1   1 
ATOM   1551  C CD2   . LEU A 1 222 ? -15.704 -42.850 3.471    1.00 94.43  ?  222 LEU A CD2   1 
ATOM   1552  N N     . ILE A 1 223 ? -15.824 -44.443 8.588    1.00 85.37  ?  223 ILE A N     1 
ATOM   1553  C CA    . ILE A 1 223 ? -15.621 -44.678 10.012   1.00 83.70  ?  223 ILE A CA    1 
ATOM   1554  C C     . ILE A 1 223 ? -15.602 -46.173 10.298   1.00 86.72  ?  223 ILE A C     1 
ATOM   1555  O O     . ILE A 1 223 ? -14.741 -46.659 11.026   1.00 86.56  ?  223 ILE A O     1 
ATOM   1556  C CB    . ILE A 1 223 ? -16.690 -43.981 10.872   1.00 71.78  ?  223 ILE A CB    1 
ATOM   1557  C CG1   . ILE A 1 223 ? -16.397 -42.482 10.939   1.00 70.79  ?  223 ILE A CG1   1 
ATOM   1558  C CG2   . ILE A 1 223 ? -16.702 -44.550 12.280   1.00 76.25  ?  223 ILE A CG2   1 
ATOM   1559  C CD1   . ILE A 1 223 ? -17.410 -41.692 11.719   1.00 65.28  ?  223 ILE A CD1   1 
ATOM   1560  N N     . SER A 1 224 ? -16.542 -46.899 9.704    1.00 88.13  ?  224 SER A N     1 
ATOM   1561  C CA    . SER A 1 224 ? -16.586 -48.349 9.834    1.00 84.73  ?  224 SER A CA    1 
ATOM   1562  C C     . SER A 1 224 ? -15.350 -49.013 9.233    1.00 77.67  ?  224 SER A C     1 
ATOM   1563  O O     . SER A 1 224 ? -14.831 -49.983 9.780    1.00 82.60  ?  224 SER A O     1 
ATOM   1564  C CB    . SER A 1 224 ? -17.848 -48.899 9.168    1.00 83.83  ?  224 SER A CB    1 
ATOM   1565  O OG    . SER A 1 224 ? -18.049 -50.260 9.501    1.00 92.05  ?  224 SER A OG    1 
ATOM   1566  N N     . TYR A 1 225 ? -14.886 -48.489 8.104    1.00 81.00  ?  225 TYR A N     1 
ATOM   1567  C CA    . TYR A 1 225 ? -13.789 -49.105 7.373    1.00 85.98  ?  225 TYR A CA    1 
ATOM   1568  C C     . TYR A 1 225 ? -12.488 -48.920 8.146    1.00 73.21  ?  225 TYR A C     1 
ATOM   1569  O O     . TYR A 1 225 ? -11.660 -49.829 8.216    1.00 57.65  ?  225 TYR A O     1 
ATOM   1570  C CB    . TYR A 1 225 ? -13.678 -48.508 5.965    1.00 61.12  ?  225 TYR A CB    1 
ATOM   1571  C CG    . TYR A 1 225 ? -12.599 -49.127 5.101    1.00 63.10  ?  225 TYR A CG    1 
ATOM   1572  C CD1   . TYR A 1 225 ? -12.905 -50.143 4.205    1.00 70.51  ?  225 TYR A CD1   1 
ATOM   1573  C CD2   . TYR A 1 225 ? -11.282 -48.688 5.168    1.00 67.15  ?  225 TYR A CD2   1 
ATOM   1574  C CE1   . TYR A 1 225 ? -11.928 -50.714 3.407    1.00 81.66  ?  225 TYR A CE1   1 
ATOM   1575  C CE2   . TYR A 1 225 ? -10.298 -49.254 4.375    1.00 67.43  ?  225 TYR A CE2   1 
ATOM   1576  C CZ    . TYR A 1 225 ? -10.628 -50.266 3.496    1.00 77.56  ?  225 TYR A CZ    1 
ATOM   1577  O OH    . TYR A 1 225 ? -9.658  -50.833 2.703    1.00 64.20  ?  225 TYR A OH    1 
ATOM   1578  N N     . LEU A 1 226 ? -12.311 -47.731 8.716    1.00 73.11  ?  226 LEU A N     1 
ATOM   1579  C CA    . LEU A 1 226 ? -11.111 -47.436 9.490    1.00 73.47  ?  226 LEU A CA    1 
ATOM   1580  C C     . LEU A 1 226 ? -11.284 -47.835 10.951   1.00 92.19  ?  226 LEU A C     1 
ATOM   1581  O O     . LEU A 1 226 ? -10.321 -47.823 11.707   1.00 88.63  ?  226 LEU A O     1 
ATOM   1582  C CB    . LEU A 1 226 ? -10.750 -45.953 9.390    1.00 68.21  ?  226 LEU A CB    1 
ATOM   1583  C CG    . LEU A 1 226 ? -10.355 -45.443 8.003    1.00 78.83  ?  226 LEU A CG    1 
ATOM   1584  C CD1   . LEU A 1 226 ? -10.262 -43.925 7.994    1.00 57.50  ?  226 LEU A CD1   1 
ATOM   1585  C CD2   . LEU A 1 226 ? -9.039  -46.069 7.562    1.00 69.39  ?  226 LEU A CD2   1 
ATOM   1586  N N     . ASN A 1 227 ? -12.531 -48.122 11.324   1.00 95.36  ?  227 ASN A N     1 
ATOM   1587  C CA    . ASN A 1 227 ? -12.967 -48.574 12.657   1.00 81.59  ?  227 ASN A CA    1 
ATOM   1588  C C     . ASN A 1 227 ? -12.763 -47.513 13.747   1.00 80.51  ?  227 ASN A C     1 
ATOM   1589  O O     . ASN A 1 227 ? -12.644 -47.839 14.929   1.00 94.26  ?  227 ASN A O     1 
ATOM   1590  C CB    . ASN A 1 227 ? -12.329 -49.946 13.023   1.00 85.89  ?  227 ASN A CB    1 
ATOM   1591  C CG    . ASN A 1 227 ? -10.885 -49.874 13.555   1.00 106.43 ?  227 ASN A CG    1 
ATOM   1592  O OD1   . ASN A 1 227 ? -10.398 -48.850 14.034   1.00 108.55 ?  227 ASN A OD1   1 
ATOM   1593  N ND2   . ASN A 1 227 ? -10.195 -51.005 13.460   1.00 101.27 ?  227 ASN A ND2   1 
ATOM   1594  N N     . CYS A 1 228 ? -12.798 -46.241 13.350   1.00 76.62  ?  228 CYS A N     1 
ATOM   1595  C CA    . CYS A 1 228 ? -12.682 -45.138 14.305   1.00 71.04  ?  228 CYS A CA    1 
ATOM   1596  C C     . CYS A 1 228 ? -13.149 -43.786 13.754   1.00 62.96  ?  228 CYS A C     1 
ATOM   1597  O O     . CYS A 1 228 ? -13.463 -43.650 12.572   1.00 82.73  ?  228 CYS A O     1 
ATOM   1598  C CB    . CYS A 1 228 ? -11.234 -45.012 14.788   1.00 69.13  ?  228 CYS A CB    1 
ATOM   1599  S SG    . CYS A 1 228 ? -10.017 -44.753 13.479   1.00 74.78  ?  228 CYS A SG    1 
ATOM   1600  N N     . GLY A 1 229 ? -13.192 -42.798 14.643   1.00 50.24  ?  229 GLY A N     1 
ATOM   1601  C CA    . GLY A 1 229 ? -13.534 -41.421 14.321   1.00 49.03  ?  229 GLY A CA    1 
ATOM   1602  C C     . GLY A 1 229 ? -14.962 -41.056 14.689   1.00 59.48  ?  229 GLY A C     1 
ATOM   1603  O O     . GLY A 1 229 ? -15.823 -41.927 14.813   1.00 66.75  ?  229 GLY A O     1 
ATOM   1604  N N     . ASN A 1 230 ? -15.213 -39.760 14.860   1.00 58.23  ?  230 ASN A N     1 
ATOM   1605  C CA    . ASN A 1 230 ? -16.565 -39.243 15.067   1.00 63.63  ?  230 ASN A CA    1 
ATOM   1606  C C     . ASN A 1 230 ? -17.020 -38.244 14.004   1.00 63.35  ?  230 ASN A C     1 
ATOM   1607  O O     . ASN A 1 230 ? -16.201 -37.580 13.377   1.00 70.77  ?  230 ASN A O     1 
ATOM   1608  C CB    . ASN A 1 230 ? -16.664 -38.604 16.453   1.00 81.26  ?  230 ASN A CB    1 
ATOM   1609  C CG    . ASN A 1 230 ? -16.452 -39.607 17.571   1.00 87.78  ?  230 ASN A CG    1 
ATOM   1610  O OD1   . ASN A 1 230 ? -17.289 -40.480 17.804   1.00 93.43  ?  230 ASN A OD1   1 
ATOM   1611  N ND2   . ASN A 1 230 ? -15.324 -39.494 18.262   1.00 81.46  ?  230 ASN A ND2   1 
ATOM   1612  N N     . ILE A 1 231 ? -18.332 -38.140 13.810   1.00 66.91  ?  231 ILE A N     1 
ATOM   1613  C CA    . ILE A 1 231 ? -18.911 -37.135 12.916   1.00 63.96  ?  231 ILE A CA    1 
ATOM   1614  C C     . ILE A 1 231 ? -19.238 -35.800 13.599   1.00 60.68  ?  231 ILE A C     1 
ATOM   1615  O O     . ILE A 1 231 ? -19.895 -35.771 14.640   1.00 76.88  ?  231 ILE A O     1 
ATOM   1616  C CB    . ILE A 1 231 ? -20.209 -37.659 12.256   1.00 57.54  ?  231 ILE A CB    1 
ATOM   1617  C CG1   . ILE A 1 231 ? -19.908 -38.798 11.281   1.00 42.66  ?  231 ILE A CG1   1 
ATOM   1618  C CG2   . ILE A 1 231 ? -20.958 -36.535 11.559   1.00 58.87  ?  231 ILE A CG2   1 
ATOM   1619  C CD1   . ILE A 1 231 ? -20.546 -40.110 11.679   1.00 65.82  ?  231 ILE A CD1   1 
ATOM   1620  N N     . ARG A 1 232 ? -18.778 -34.698 13.011   1.00 65.98  ?  232 ARG A N     1 
ATOM   1621  C CA    . ARG A 1 232 ? -19.107 -33.363 13.512   1.00 62.84  ?  232 ARG A CA    1 
ATOM   1622  C C     . ARG A 1 232 ? -19.830 -32.608 12.390   1.00 77.61  ?  232 ARG A C     1 
ATOM   1623  O O     . ARG A 1 232 ? -19.344 -32.534 11.262   1.00 78.20  ?  232 ARG A O     1 
ATOM   1624  C CB    . ARG A 1 232 ? -17.858 -32.610 14.007   1.00 55.67  ?  232 ARG A CB    1 
ATOM   1625  C CG    . ARG A 1 232 ? -17.312 -31.530 13.078   1.00 69.41  ?  232 ARG A CG    1 
ATOM   1626  C CD    . ARG A 1 232 ? -16.419 -30.539 13.803   1.00 88.93  ?  232 ARG A CD    1 
ATOM   1627  N NE    . ARG A 1 232 ? -16.260 -29.302 13.042   1.00 79.43  ?  232 ARG A NE    1 
ATOM   1628  C CZ    . ARG A 1 232 ? -16.350 -28.083 13.564   1.00 75.92  ?  232 ARG A CZ    1 
ATOM   1629  N NH1   . ARG A 1 232 ? -16.595 -27.929 14.858   1.00 77.09  1  232 ARG A NH1   1 
ATOM   1630  N NH2   . ARG A 1 232 ? -16.207 -27.017 12.789   1.00 81.62  ?  232 ARG A NH2   1 
ATOM   1631  N N     . ILE A 1 233 ? -21.029 -32.110 12.672   1.00 73.13  ?  233 ILE A N     1 
ATOM   1632  C CA    . ILE A 1 233 ? -21.765 -31.345 11.669   1.00 64.31  ?  233 ILE A CA    1 
ATOM   1633  C C     . ILE A 1 233 ? -21.723 -29.848 11.959   1.00 60.11  ?  233 ILE A C     1 
ATOM   1634  O O     . ILE A 1 233 ? -22.111 -29.401 13.038   1.00 66.37  ?  233 ILE A O     1 
ATOM   1635  C CB    . ILE A 1 233 ? -23.232 -31.810 11.574   1.00 66.11  ?  233 ILE A CB    1 
ATOM   1636  C CG1   . ILE A 1 233 ? -23.301 -33.208 10.952   1.00 54.52  ?  233 ILE A CG1   1 
ATOM   1637  C CG2   . ILE A 1 233 ? -24.060 -30.817 10.767   1.00 68.70  ?  233 ILE A CG2   1 
ATOM   1638  C CD1   . ILE A 1 233 ? -24.675 -33.837 11.000   1.00 55.33  ?  233 ILE A CD1   1 
ATOM   1639  N N     . ARG A 1 234 ? -21.246 -29.077 10.987   1.00 65.38  ?  234 ARG A N     1 
ATOM   1640  C CA    . ARG A 1 234 ? -21.303 -27.622 11.070   1.00 74.24  ?  234 ARG A CA    1 
ATOM   1641  C C     . ARG A 1 234 ? -22.174 -27.038 9.962    1.00 90.20  ?  234 ARG A C     1 
ATOM   1642  O O     . ARG A 1 234 ? -21.823 -27.098 8.783    1.00 90.14  ?  234 ARG A O     1 
ATOM   1643  C CB    . ARG A 1 234 ? -19.895 -27.026 11.002   1.00 65.69  ?  234 ARG A CB    1 
ATOM   1644  N N     . THR A 1 245 ? -23.720 -27.297 7.203    1.00 86.88  ?  245 THR A N     1 
ATOM   1645  C CA    . THR A 1 245 ? -23.337 -27.196 5.800    1.00 96.60  ?  245 THR A CA    1 
ATOM   1646  C C     . THR A 1 245 ? -22.276 -28.229 5.432    1.00 94.33  ?  245 THR A C     1 
ATOM   1647  O O     . THR A 1 245 ? -22.430 -28.967 4.458    1.00 90.40  ?  245 THR A O     1 
ATOM   1648  C CB    . THR A 1 245 ? -22.807 -25.791 5.459    1.00 99.73  ?  245 THR A CB    1 
ATOM   1649  O OG1   . THR A 1 245 ? -21.884 -25.366 6.469    1.00 93.69  ?  245 THR A OG1   1 
ATOM   1650  C CG2   . THR A 1 245 ? -23.955 -24.796 5.371    1.00 96.68  ?  245 THR A CG2   1 
ATOM   1651  N N     . CYS A 1 246 ? -21.196 -28.275 6.207    1.00 85.64  ?  246 CYS A N     1 
ATOM   1652  C CA    . CYS A 1 246 ? -20.204 -29.332 6.051    1.00 73.00  ?  246 CYS A CA    1 
ATOM   1653  C C     . CYS A 1 246 ? -20.209 -30.364 7.180    1.00 66.01  ?  246 CYS A C     1 
ATOM   1654  O O     . CYS A 1 246 ? -20.613 -30.076 8.309    1.00 68.01  ?  246 CYS A O     1 
ATOM   1655  C CB    . CYS A 1 246 ? -18.807 -28.717 5.937    1.00 67.23  ?  246 CYS A CB    1 
ATOM   1656  S SG    . CYS A 1 246 ? -18.339 -28.225 4.263    1.00 83.37  ?  246 CYS A SG    1 
ATOM   1657  N N     . VAL A 1 247 ? -19.753 -31.569 6.848    1.00 56.76  ?  247 VAL A N     1 
ATOM   1658  C CA    . VAL A 1 247 ? -19.535 -32.636 7.814    1.00 64.25  ?  247 VAL A CA    1 
ATOM   1659  C C     . VAL A 1 247 ? -18.040 -32.956 7.900    1.00 73.09  ?  247 VAL A C     1 
ATOM   1660  O O     . VAL A 1 247 ? -17.345 -32.996 6.873    1.00 83.13  ?  247 VAL A O     1 
ATOM   1661  C CB    . VAL A 1 247 ? -20.317 -33.909 7.415    1.00 68.11  ?  247 VAL A CB    1 
ATOM   1662  C CG1   . VAL A 1 247 ? -20.040 -35.046 8.384    1.00 81.62  ?  247 VAL A CG1   1 
ATOM   1663  C CG2   . VAL A 1 247 ? -21.807 -33.614 7.330    1.00 74.91  ?  247 VAL A CG2   1 
ATOM   1664  N N     . ASP A 1 248 ? -17.548 -33.173 9.118    1.00 68.88  ?  248 ASP A N     1 
ATOM   1665  C CA    . ASP A 1 248 ? -16.195 -33.674 9.338    1.00 64.00  ?  248 ASP A CA    1 
ATOM   1666  C C     . ASP A 1 248 ? -16.139 -35.073 9.966    1.00 60.40  ?  248 ASP A C     1 
ATOM   1667  O O     . ASP A 1 248 ? -16.830 -35.348 10.947   1.00 64.35  ?  248 ASP A O     1 
ATOM   1668  C CB    . ASP A 1 248 ? -15.423 -32.691 10.220   1.00 65.43  ?  248 ASP A CB    1 
ATOM   1669  C CG    . ASP A 1 248 ? -15.331 -31.306 9.606    1.00 67.63  ?  248 ASP A CG    1 
ATOM   1670  O OD1   . ASP A 1 248 ? -16.121 -30.425 10.007   1.00 81.75  ?  248 ASP A OD1   1 
ATOM   1671  O OD2   . ASP A 1 248 ? -14.473 -31.097 8.723    1.00 66.13  -1 248 ASP A OD2   1 
ATOM   1672  N N     . LEU A 1 249 ? -15.318 -35.948 9.392    1.00 51.16  ?  249 LEU A N     1 
ATOM   1673  C CA    . LEU A 1 249 ? -14.849 -37.156 10.063   1.00 41.23  ?  249 LEU A CA    1 
ATOM   1674  C C     . LEU A 1 249 ? -13.613 -36.774 10.875   1.00 55.47  ?  249 LEU A C     1 
ATOM   1675  O O     . LEU A 1 249 ? -12.620 -36.329 10.304   1.00 56.74  ?  249 LEU A O     1 
ATOM   1676  C CB    . LEU A 1 249 ? -14.537 -38.263 9.049    1.00 35.03  ?  249 LEU A CB    1 
ATOM   1677  C CG    . LEU A 1 249 ? -14.121 -39.659 9.526    1.00 43.46  ?  249 LEU A CG    1 
ATOM   1678  C CD1   . LEU A 1 249 ? -14.412 -40.670 8.433    1.00 54.64  ?  249 LEU A CD1   1 
ATOM   1679  C CD2   . LEU A 1 249 ? -12.645 -39.728 9.911    1.00 35.27  ?  249 LEU A CD2   1 
ATOM   1680  N N     . VAL A 1 250 ? -13.660 -36.943 12.193   1.00 62.39  ?  250 VAL A N     1 
ATOM   1681  C CA    . VAL A 1 250 ? -12.536 -36.550 13.040   1.00 49.28  ?  250 VAL A CA    1 
ATOM   1682  C C     . VAL A 1 250 ? -12.004 -37.676 13.923   1.00 53.03  ?  250 VAL A C     1 
ATOM   1683  O O     . VAL A 1 250 ? -12.743 -38.262 14.711   1.00 56.07  ?  250 VAL A O     1 
ATOM   1684  C CB    . VAL A 1 250 ? -12.914 -35.367 13.957   1.00 38.58  ?  250 VAL A CB    1 
ATOM   1685  C CG1   . VAL A 1 250 ? -11.692 -34.880 14.719   1.00 51.85  ?  250 VAL A CG1   1 
ATOM   1686  C CG2   . VAL A 1 250 ? -13.529 -34.234 13.149   1.00 41.94  ?  250 VAL A CG2   1 
ATOM   1687  N N     . VAL A 1 251 ? -10.715 -37.970 13.782   1.00 58.38  ?  251 VAL A N     1 
ATOM   1688  C CA    . VAL A 1 251 ? -10.033 -38.905 14.665   1.00 50.56  ?  251 VAL A CA    1 
ATOM   1689  C C     . VAL A 1 251 ? -9.073  -38.146 15.578   1.00 53.91  ?  251 VAL A C     1 
ATOM   1690  O O     . VAL A 1 251 ? -8.119  -37.501 15.110   1.00 49.33  ?  251 VAL A O     1 
ATOM   1691  C CB    . VAL A 1 251 ? -9.255  -39.976 13.877   1.00 56.54  ?  251 VAL A CB    1 
ATOM   1692  C CG1   . VAL A 1 251 ? -8.561  -40.933 14.831   1.00 56.58  ?  251 VAL A CG1   1 
ATOM   1693  C CG2   . VAL A 1 251 ? -10.187 -40.729 12.941   1.00 63.56  ?  251 VAL A CG2   1 
ATOM   1694  N N     . THR A 1 252 ? -9.353  -38.226 16.878   1.00 65.82  ?  252 THR A N     1 
ATOM   1695  C CA    . THR A 1 252 ? -8.575  -37.548 17.911   1.00 60.58  ?  252 THR A CA    1 
ATOM   1696  C C     . THR A 1 252 ? -7.958  -38.520 18.914   1.00 61.10  ?  252 THR A C     1 
ATOM   1697  O O     . THR A 1 252 ? -6.983  -38.185 19.587   1.00 62.81  ?  252 THR A O     1 
ATOM   1698  C CB    . THR A 1 252 ? -9.436  -36.533 18.687   1.00 56.55  ?  252 THR A CB    1 
ATOM   1699  O OG1   . THR A 1 252 ? -10.690 -37.131 19.038   1.00 47.71  ?  252 THR A OG1   1 
ATOM   1700  C CG2   . THR A 1 252 ? -9.686  -35.292 17.843   1.00 85.19  ?  252 THR A CG2   1 
ATOM   1701  N N     . ASN A 1 253 ? -8.538  -39.715 19.017   1.00 66.14  ?  253 ASN A N     1 
ATOM   1702  C CA    . ASN A 1 253 ? -8.032  -40.745 19.922   1.00 66.15  ?  253 ASN A CA    1 
ATOM   1703  C C     . ASN A 1 253 ? -6.591  -41.094 19.576   1.00 67.63  ?  253 ASN A C     1 
ATOM   1704  O O     . ASN A 1 253 ? -6.284  -41.457 18.439   1.00 73.70  ?  253 ASN A O     1 
ATOM   1705  C CB    . ASN A 1 253 ? -8.928  -41.988 19.869   1.00 71.83  ?  253 ASN A CB    1 
ATOM   1706  C CG    . ASN A 1 253 ? -8.457  -43.097 20.795   1.00 78.63  ?  253 ASN A CG    1 
ATOM   1707  O OD1   . ASN A 1 253 ? -7.382  -43.669 20.610   1.00 77.05  ?  253 ASN A OD1   1 
ATOM   1708  N ND2   . ASN A 1 253 ? -9.264  -43.403 21.805   1.00 63.21  ?  253 ASN A ND2   1 
ATOM   1709  N N     . LEU A 1 254 ? -5.712  -40.978 20.566   1.00 60.42  ?  254 LEU A N     1 
ATOM   1710  C CA    . LEU A 1 254 ? -4.280  -41.115 20.334   1.00 63.30  ?  254 LEU A CA    1 
ATOM   1711  C C     . LEU A 1 254 ? -3.818  -42.491 19.862   1.00 70.46  ?  254 LEU A C     1 
ATOM   1712  O O     . LEU A 1 254 ? -3.019  -42.577 18.929   1.00 77.74  ?  254 LEU A O     1 
ATOM   1713  C CB    . LEU A 1 254 ? -3.516  -40.752 21.609   1.00 52.58  ?  254 LEU A CB    1 
ATOM   1714  C CG    . LEU A 1 254 ? -1.988  -40.809 21.523   1.00 62.02  ?  254 LEU A CG    1 
ATOM   1715  C CD1   . LEU A 1 254 ? -1.477  -40.022 20.323   1.00 61.75  ?  254 LEU A CD1   1 
ATOM   1716  C CD2   . LEU A 1 254 ? -1.354  -40.304 22.810   1.00 106.73 ?  254 LEU A CD2   1 
ATOM   1717  N N     . ASN A 1 255 ? -4.301  -43.570 20.472   1.00 65.05  ?  255 ASN A N     1 
ATOM   1718  C CA    . ASN A 1 255 ? -3.924  -44.872 19.937   1.00 77.87  ?  255 ASN A CA    1 
ATOM   1719  C C     . ASN A 1 255 ? -4.895  -45.468 18.923   1.00 80.16  ?  255 ASN A C     1 
ATOM   1720  O O     . ASN A 1 255 ? -4.690  -46.596 18.467   1.00 81.33  ?  255 ASN A O     1 
ATOM   1721  C CB    . ASN A 1 255 ? -3.722  -45.865 21.091   1.00 91.55  ?  255 ASN A CB    1 
ATOM   1722  C CG    . ASN A 1 255 ? -4.942  -45.979 21.995   1.00 98.40  ?  255 ASN A CG    1 
ATOM   1723  O OD1   . ASN A 1 255 ? -6.082  -45.990 21.530   1.00 88.70  ?  255 ASN A OD1   1 
ATOM   1724  N ND2   . ASN A 1 255 ? -4.701  -46.069 23.298   1.00 98.55  ?  255 ASN A ND2   1 
ATOM   1725  N N     . ASP A 1 256 ? -5.898  -44.701 18.502   1.00 85.76  ?  256 ASP A N     1 
ATOM   1726  C CA    . ASP A 1 256 ? -6.543  -44.983 17.230   1.00 71.38  ?  256 ASP A CA    1 
ATOM   1727  C C     . ASP A 1 256 ? -5.629  -44.489 16.125   1.00 61.74  ?  256 ASP A C     1 
ATOM   1728  O O     . ASP A 1 256 ? -5.477  -45.128 15.089   1.00 69.95  ?  256 ASP A O     1 
ATOM   1729  C CB    . ASP A 1 256 ? -7.922  -44.325 17.147   1.00 66.36  ?  256 ASP A CB    1 
ATOM   1730  C CG    . ASP A 1 256 ? -8.958  -45.038 17.996   1.00 72.16  ?  256 ASP A CG    1 
ATOM   1731  O OD1   . ASP A 1 256 ? -8.816  -46.262 18.204   1.00 73.42  ?  256 ASP A OD1   1 
ATOM   1732  O OD2   . ASP A 1 256 ? -9.919  -44.381 18.447   1.00 66.05  -1 256 ASP A OD2   1 
ATOM   1733  N N     . ILE A 1 257 ? -5.024  -43.333 16.364   1.00 43.55  ?  257 ILE A N     1 
ATOM   1734  C CA    . ILE A 1 257 ? -4.071  -42.758 15.431   1.00 52.13  ?  257 ILE A CA    1 
ATOM   1735  C C     . ILE A 1 257 ? -2.861  -43.680 15.356   1.00 61.65  ?  257 ILE A C     1 
ATOM   1736  O O     . ILE A 1 257 ? -2.372  -44.012 14.275   1.00 68.89  ?  257 ILE A O     1 
ATOM   1737  C CB    . ILE A 1 257 ? -3.663  -41.337 15.852   1.00 57.24  ?  257 ILE A CB    1 
ATOM   1738  C CG1   . ILE A 1 257 ? -4.703  -40.334 15.351   1.00 58.30  ?  257 ILE A CG1   1 
ATOM   1739  C CG2   . ILE A 1 257 ? -2.274  -40.991 15.329   1.00 54.12  ?  257 ILE A CG2   1 
ATOM   1740  C CD1   . ILE A 1 257 ? -4.766  -39.065 16.155   1.00 60.15  ?  257 ILE A CD1   1 
ATOM   1741  N N     . LYS A 1 258 ? -2.398  -44.091 16.532   1.00 73.41  ?  258 LYS A N     1 
ATOM   1742  C CA    . LYS A 1 258 ? -1.232  -44.955 16.672   1.00 75.19  ?  258 LYS A CA    1 
ATOM   1743  C C     . LYS A 1 258 ? -1.449  -46.355 16.101   1.00 72.66  ?  258 LYS A C     1 
ATOM   1744  O O     . LYS A 1 258 ? -0.581  -46.884 15.404   1.00 60.58  ?  258 LYS A O     1 
ATOM   1745  C CB    . LYS A 1 258 ? -0.827  -45.056 18.145   1.00 53.67  ?  258 LYS A CB    1 
ATOM   1746  N N     . GLU A 1 259 ? -2.601  -46.954 16.389   1.00 63.34  ?  259 GLU A N     1 
ATOM   1747  C CA    . GLU A 1 259 ? -2.795  -48.366 16.065   1.00 71.24  ?  259 GLU A CA    1 
ATOM   1748  C C     . GLU A 1 259 ? -3.700  -48.627 14.861   1.00 79.19  ?  259 GLU A C     1 
ATOM   1749  O O     . GLU A 1 259 ? -3.844  -49.775 14.441   1.00 89.75  ?  259 GLU A O     1 
ATOM   1750  C CB    . GLU A 1 259 ? -3.353  -49.110 17.281   1.00 78.43  ?  259 GLU A CB    1 
ATOM   1751  N N     . LYS A 1 260 ? -4.308  -47.586 14.300   1.00 76.14  ?  260 LYS A N     1 
ATOM   1752  C CA    . LYS A 1 260 ? -5.196  -47.786 13.156   1.00 78.77  ?  260 LYS A CA    1 
ATOM   1753  C C     . LYS A 1 260 ? -4.816  -46.947 11.930   1.00 76.38  ?  260 LYS A C     1 
ATOM   1754  O O     . LYS A 1 260 ? -4.491  -47.484 10.871   1.00 75.19  ?  260 LYS A O     1 
ATOM   1755  C CB    . LYS A 1 260 ? -6.640  -47.461 13.554   1.00 71.35  ?  260 LYS A CB    1 
ATOM   1756  C CG    . LYS A 1 260 ? -7.198  -48.302 14.695   1.00 75.53  ?  260 LYS A CG    1 
ATOM   1757  C CD    . LYS A 1 260 ? -7.092  -49.790 14.432   1.00 84.39  ?  260 LYS A CD    1 
ATOM   1758  C CE    . LYS A 1 260 ? -7.737  -50.575 15.563   1.00 88.52  ?  260 LYS A CE    1 
ATOM   1759  N NZ    . LYS A 1 260 ? -7.925  -52.011 15.223   1.00 98.64  1  260 LYS A NZ    1 
ATOM   1760  N N     . ILE A 1 261 ? -4.859  -45.629 12.093   1.00 65.98  ?  261 ILE A N     1 
ATOM   1761  C CA    . ILE A 1 261 ? -4.582  -44.675 11.018   1.00 61.09  ?  261 ILE A CA    1 
ATOM   1762  C C     . ILE A 1 261 ? -3.174  -44.702 10.406   1.00 68.07  ?  261 ILE A C     1 
ATOM   1763  O O     . ILE A 1 261 ? -3.019  -44.820 9.183    1.00 82.54  ?  261 ILE A O     1 
ATOM   1764  C CB    . ILE A 1 261 ? -4.843  -43.237 11.518   1.00 62.82  ?  261 ILE A CB    1 
ATOM   1765  C CG1   . ILE A 1 261 ? -6.291  -43.088 11.992   1.00 57.05  ?  261 ILE A CG1   1 
ATOM   1766  C CG2   . ILE A 1 261 ? -4.513  -42.219 10.442   1.00 60.03  ?  261 ILE A CG2   1 
ATOM   1767  C CD1   . ILE A 1 261 ? -7.315  -43.398 10.929   1.00 53.05  ?  261 ILE A CD1   1 
ATOM   1768  N N     . ILE A 1 262 ? -2.154  -44.615 11.253   1.00 60.74  ?  262 ILE A N     1 
ATOM   1769  C CA    . ILE A 1 262 ? -0.767  -44.596 10.787   1.00 66.11  ?  262 ILE A CA    1 
ATOM   1770  C C     . ILE A 1 262 ? -0.328  -45.882 10.067   1.00 85.99  ?  262 ILE A C     1 
ATOM   1771  O O     . ILE A 1 262 ? 0.306   -45.794 9.016    1.00 93.21  ?  262 ILE A O     1 
ATOM   1772  C CB    . ILE A 1 262 ? 0.207   -44.294 11.955   1.00 51.52  ?  262 ILE A CB    1 
ATOM   1773  C CG1   . ILE A 1 262 ? 0.154   -42.807 12.315   1.00 62.41  ?  262 ILE A CG1   1 
ATOM   1774  C CG2   . ILE A 1 262 ? 1.630   -44.693 11.597   1.00 58.26  ?  262 ILE A CG2   1 
ATOM   1775  C CD1   . ILE A 1 262 ? 1.250   -42.360 13.263   1.00 75.31  ?  262 ILE A CD1   1 
ATOM   1776  N N     . PRO A 1 263 ? -0.658  -47.072 10.607   1.00 78.56  ?  263 PRO A N     1 
ATOM   1777  C CA    . PRO A 1 263 ? -0.290  -48.261 9.829    1.00 80.80  ?  263 PRO A CA    1 
ATOM   1778  C C     . PRO A 1 263 ? -0.988  -48.284 8.470    1.00 88.02  ?  263 PRO A C     1 
ATOM   1779  O O     . PRO A 1 263 ? -0.392  -48.677 7.454    1.00 90.73  ?  263 PRO A O     1 
ATOM   1780  C CB    . PRO A 1 263 ? -0.779  -49.411 10.710   1.00 93.07  ?  263 PRO A CB    1 
ATOM   1781  C CG    . PRO A 1 263 ? -0.670  -48.868 12.091   1.00 90.41  ?  263 PRO A CG    1 
ATOM   1782  C CD    . PRO A 1 263 ? -1.148  -47.447 11.947   1.00 78.28  ?  263 PRO A CD    1 
ATOM   1783  N N     . PHE A 1 264 ? -2.235  -47.822 8.460    1.00 79.93  ?  264 PHE A N     1 
ATOM   1784  C CA    . PHE A 1 264 ? -3.029  -47.780 7.243    1.00 80.25  ?  264 PHE A CA    1 
ATOM   1785  C C     . PHE A 1 264 ? -2.351  -46.907 6.202    1.00 78.15  ?  264 PHE A C     1 
ATOM   1786  O O     . PHE A 1 264 ? -2.181  -47.332 5.061    1.00 87.76  ?  264 PHE A O     1 
ATOM   1787  C CB    . PHE A 1 264 ? -4.439  -47.262 7.524    1.00 75.41  ?  264 PHE A CB    1 
ATOM   1788  C CG    . PHE A 1 264 ? -5.338  -47.279 6.321    1.00 74.64  ?  264 PHE A CG    1 
ATOM   1789  C CD1   . PHE A 1 264 ? -6.046  -48.422 5.985    1.00 84.93  ?  264 PHE A CD1   1 
ATOM   1790  C CD2   . PHE A 1 264 ? -5.470  -46.155 5.523    1.00 75.51  ?  264 PHE A CD2   1 
ATOM   1791  C CE1   . PHE A 1 264 ? -6.872  -48.441 4.877    1.00 81.86  ?  264 PHE A CE1   1 
ATOM   1792  C CE2   . PHE A 1 264 ? -6.292  -46.170 4.414    1.00 80.25  ?  264 PHE A CE2   1 
ATOM   1793  C CZ    . PHE A 1 264 ? -6.995  -47.314 4.091    1.00 81.99  ?  264 PHE A CZ    1 
ATOM   1794  N N     . PHE A 1 265 ? -1.961  -45.692 6.573    1.00 76.64  ?  265 PHE A N     1 
ATOM   1795  C CA    . PHE A 1 265 ? -1.438  -44.792 5.554    1.00 83.64  ?  265 PHE A CA    1 
ATOM   1796  C C     . PHE A 1 265 ? 0.042   -45.077 5.321    1.00 86.29  ?  265 PHE A C     1 
ATOM   1797  O O     . PHE A 1 265 ? 0.655   -44.518 4.411    1.00 80.15  ?  265 PHE A O     1 
ATOM   1798  C CB    . PHE A 1 265 ? -1.650  -43.328 5.938    1.00 83.44  ?  265 PHE A CB    1 
ATOM   1799  C CG    . PHE A 1 265 ? -3.081  -42.885 5.868    1.00 80.59  ?  265 PHE A CG    1 
ATOM   1800  C CD1   . PHE A 1 265 ? -3.762  -42.897 4.662    1.00 67.04  ?  265 PHE A CD1   1 
ATOM   1801  C CD2   . PHE A 1 265 ? -3.743  -42.447 7.000    1.00 75.54  ?  265 PHE A CD2   1 
ATOM   1802  C CE1   . PHE A 1 265 ? -5.077  -42.489 4.590    1.00 64.77  ?  265 PHE A CE1   1 
ATOM   1803  C CE2   . PHE A 1 265 ? -5.060  -42.035 6.934    1.00 68.33  ?  265 PHE A CE2   1 
ATOM   1804  C CZ    . PHE A 1 265 ? -5.727  -42.057 5.728    1.00 69.30  ?  265 PHE A CZ    1 
ATOM   1805  N N     . ASN A 1 266 ? 0.609   -45.951 6.147    1.00 86.01  ?  266 ASN A N     1 
ATOM   1806  C CA    . ASN A 1 266 ? 1.975   -46.412 5.942    1.00 95.15  ?  266 ASN A CA    1 
ATOM   1807  C C     . ASN A 1 266 ? 1.967   -47.460 4.840    1.00 97.22  ?  266 ASN A C     1 
ATOM   1808  O O     . ASN A 1 266 ? 2.904   -47.564 4.048    1.00 90.41  ?  266 ASN A O     1 
ATOM   1809  C CB    . ASN A 1 266 ? 2.572   -46.976 7.230    1.00 87.38  ?  266 ASN A CB    1 
ATOM   1810  C CG    . ASN A 1 266 ? 3.299   -45.922 8.043    1.00 84.95  ?  266 ASN A CG    1 
ATOM   1811  O OD1   . ASN A 1 266 ? 3.301   -44.743 7.689    1.00 76.96  ?  266 ASN A OD1   1 
ATOM   1812  N ND2   . ASN A 1 266 ? 3.922   -46.343 9.138    1.00 87.81  ?  266 ASN A ND2   1 
ATOM   1813  N N     . LYS A 1 267 ? 0.887   -48.237 4.807    1.00 93.06  ?  267 LYS A N     1 
ATOM   1814  C CA    . LYS A 1 267 ? 0.697   -49.267 3.788    1.00 94.73  ?  267 LYS A CA    1 
ATOM   1815  C C     . LYS A 1 267 ? -0.011  -48.704 2.556    1.00 92.01  ?  267 LYS A C     1 
ATOM   1816  O O     . LYS A 1 267 ? 0.284   -49.088 1.424    1.00 88.56  ?  267 LYS A O     1 
ATOM   1817  C CB    . LYS A 1 267 ? -0.077  -50.454 4.361    1.00 96.62  ?  267 LYS A CB    1 
ATOM   1818  C CG    . LYS A 1 267 ? 0.732   -51.295 5.342    1.00 104.28 ?  267 LYS A CG    1 
ATOM   1819  C CD    . LYS A 1 267 ? 2.120   -51.621 4.791    1.00 96.63  ?  267 LYS A CD    1 
ATOM   1820  C CE    . LYS A 1 267 ? 3.224   -50.950 5.601    1.00 93.17  ?  267 LYS A CE    1 
ATOM   1821  N NZ    . LYS A 1 267 ? 4.520   -50.924 4.866    1.00 94.08  1  267 LYS A NZ    1 
ATOM   1822  N N     . ASN A 1 268 ? -0.944  -47.789 2.793    1.00 88.56  ?  268 ASN A N     1 
ATOM   1823  C CA    . ASN A 1 268 ? -1.690  -47.131 1.729    1.00 76.52  ?  268 ASN A CA    1 
ATOM   1824  C C     . ASN A 1 268 ? -1.248  -45.678 1.644    1.00 77.99  ?  268 ASN A C     1 
ATOM   1825  O O     . ASN A 1 268 ? -1.727  -44.825 2.389    1.00 74.35  ?  268 ASN A O     1 
ATOM   1826  C CB    . ASN A 1 268 ? -3.194  -47.228 1.977    1.00 62.38  ?  268 ASN A CB    1 
ATOM   1827  C CG    . ASN A 1 268 ? -3.652  -48.654 2.197    1.00 79.90  ?  268 ASN A CG    1 
ATOM   1828  O OD1   . ASN A 1 268 ? -3.745  -49.440 1.255    1.00 93.81  ?  268 ASN A OD1   1 
ATOM   1829  N ND2   . ASN A 1 268 ? -3.943  -48.996 3.447    1.00 78.69  ?  268 ASN A ND2   1 
ATOM   1830  N N     . HIS A 1 269 ? -0.335  -45.405 0.718    1.00 68.80  ?  269 HIS A N     1 
ATOM   1831  C CA    . HIS A 1 269 ? 0.470   -44.194 0.775    1.00 66.47  ?  269 HIS A CA    1 
ATOM   1832  C C     . HIS A 1 269 ? -0.308  -42.938 0.408    1.00 46.89  ?  269 HIS A C     1 
ATOM   1833  O O     . HIS A 1 269 ? -1.053  -42.913 -0.571   1.00 72.52  ?  269 HIS A O     1 
ATOM   1834  C CB    . HIS A 1 269 ? 1.664   -44.324 -0.178   1.00 73.80  ?  269 HIS A CB    1 
ATOM   1835  C CG    . HIS A 1 269 ? 2.652   -45.376 0.219    1.00 86.72  ?  269 HIS A CG    1 
ATOM   1836  N ND1   . HIS A 1 269 ? 2.274   -46.613 0.695    1.00 80.35  ?  269 HIS A ND1   1 
ATOM   1837  C CD2   . HIS A 1 269 ? 4.006   -45.382 0.192    1.00 95.95  ?  269 HIS A CD2   1 
ATOM   1838  C CE1   . HIS A 1 269 ? 3.352   -47.332 0.953    1.00 103.61 ?  269 HIS A CE1   1 
ATOM   1839  N NE2   . HIS A 1 269 ? 4.416   -46.607 0.657    1.00 120.20 ?  269 HIS A NE2   1 
ATOM   1840  N N     . ILE A 1 270 ? -0.118  -41.894 1.207    1.00 54.74  ?  270 ILE A N     1 
ATOM   1841  C CA    . ILE A 1 270 ? -0.554  -40.552 0.854    1.00 53.37  ?  270 ILE A CA    1 
ATOM   1842  C C     . ILE A 1 270 ? 0.327   -40.059 -0.287   1.00 58.52  ?  270 ILE A C     1 
ATOM   1843  O O     . ILE A 1 270 ? 1.530   -40.320 -0.293   1.00 58.22  ?  270 ILE A O     1 
ATOM   1844  C CB    . ILE A 1 270 ? -0.467  -39.591 2.062    1.00 58.93  ?  270 ILE A CB    1 
ATOM   1845  C CG1   . ILE A 1 270 ? -1.433  -40.029 3.166    1.00 57.55  ?  270 ILE A CG1   1 
ATOM   1846  C CG2   . ILE A 1 270 ? -0.729  -38.149 1.645    1.00 47.48  ?  270 ILE A CG2   1 
ATOM   1847  C CD1   . ILE A 1 270 ? -2.893  -39.870 2.805    1.00 61.99  ?  270 ILE A CD1   1 
ATOM   1848  N N     . ILE A 1 271 ? -0.252  -39.350 -1.251   1.00 70.95  ?  271 ILE A N     1 
ATOM   1849  C CA    . ILE A 1 271 ? 0.553   -38.781 -2.323   1.00 52.43  ?  271 ILE A CA    1 
ATOM   1850  C C     . ILE A 1 271 ? 0.595   -37.260 -2.219   1.00 46.22  ?  271 ILE A C     1 
ATOM   1851  O O     . ILE A 1 271 ? -0.251  -36.650 -1.566   1.00 61.42  ?  271 ILE A O     1 
ATOM   1852  C CB    . ILE A 1 271 ? 0.020   -39.199 -3.706   1.00 64.42  ?  271 ILE A CB    1 
ATOM   1853  C CG1   . ILE A 1 271 ? -1.426  -38.736 -3.888   1.00 85.95  ?  271 ILE A CG1   1 
ATOM   1854  C CG2   . ILE A 1 271 ? 0.102   -40.707 -3.870   1.00 60.96  ?  271 ILE A CG2   1 
ATOM   1855  C CD1   . ILE A 1 271 ? -2.004  -39.067 -5.252   1.00 65.98  ?  271 ILE A CD1   1 
ATOM   1856  N N     . GLY A 1 272 ? 1.581   -36.655 -2.872   1.00 48.67  ?  272 GLY A N     1 
ATOM   1857  C CA    . GLY A 1 272 ? 1.694   -35.210 -2.939   1.00 46.79  ?  272 GLY A CA    1 
ATOM   1858  C C     . GLY A 1 272 ? 2.374   -34.652 -1.701   1.00 48.55  ?  272 GLY A C     1 
ATOM   1859  O O     . GLY A 1 272 ? 2.798   -35.414 -0.837   1.00 62.50  ?  272 GLY A O     1 
ATOM   1860  N N     . VAL A 1 273 ? 2.492   -33.327 -1.624   1.00 43.75  ?  273 VAL A N     1 
ATOM   1861  C CA    . VAL A 1 273 ? 3.124   -32.649 -0.487   1.00 50.35  ?  273 VAL A CA    1 
ATOM   1862  C C     . VAL A 1 273 ? 2.489   -33.066 0.847    1.00 59.67  ?  273 VAL A C     1 
ATOM   1863  O O     . VAL A 1 273 ? 3.145   -33.099 1.917    1.00 61.12  ?  273 VAL A O     1 
ATOM   1864  C CB    . VAL A 1 273 ? 3.033   -31.117 -0.660   1.00 48.33  ?  273 VAL A CB    1 
ATOM   1865  C CG1   . VAL A 1 273 ? 3.459   -30.389 0.604    1.00 58.19  ?  273 VAL A CG1   1 
ATOM   1866  C CG2   . VAL A 1 273 ? 3.891   -30.673 -1.835   1.00 71.92  ?  273 VAL A CG2   1 
ATOM   1867  N N     . LYS A 1 274 ? 1.203   -33.405 0.780    1.00 57.93  ?  274 LYS A N     1 
ATOM   1868  C CA    . LYS A 1 274 ? 0.495   -33.835 1.971    1.00 56.85  ?  274 LYS A CA    1 
ATOM   1869  C C     . LYS A 1 274 ? 1.161   -35.068 2.561    1.00 62.11  ?  274 LYS A C     1 
ATOM   1870  O O     . LYS A 1 274 ? 0.929   -35.390 3.718    1.00 66.03  ?  274 LYS A O     1 
ATOM   1871  C CB    . LYS A 1 274 ? -0.973  -34.123 1.654    1.00 48.25  ?  274 LYS A CB    1 
ATOM   1872  N N     . LEU A 1 275 ? 1.937   -35.793 1.755    1.00 59.06  ?  275 LEU A N     1 
ATOM   1873  C CA    . LEU A 1 275 ? 2.683   -36.927 2.283    1.00 60.81  ?  275 LEU A CA    1 
ATOM   1874  C C     . LEU A 1 275 ? 3.724   -36.426 3.278    1.00 64.38  ?  275 LEU A C     1 
ATOM   1875  O O     . LEU A 1 275 ? 3.967   -37.049 4.309    1.00 76.60  ?  275 LEU A O     1 
ATOM   1876  C CB    . LEU A 1 275 ? 3.353   -37.724 1.162    1.00 61.10  ?  275 LEU A CB    1 
ATOM   1877  N N     . GLN A 1 276 ? 4.342   -35.291 2.947    1.00 59.57  ?  276 GLN A N     1 
ATOM   1878  C CA    . GLN A 1 276 ? 5.353   -34.678 3.806    1.00 73.21  ?  276 GLN A CA    1 
ATOM   1879  C C     . GLN A 1 276 ? 4.725   -34.129 5.077    1.00 78.14  ?  276 GLN A C     1 
ATOM   1880  O O     . GLN A 1 276 ? 5.280   -34.258 6.186    1.00 87.35  ?  276 GLN A O     1 
ATOM   1881  C CB    . GLN A 1 276 ? 6.094   -33.567 3.059    1.00 63.47  ?  276 GLN A CB    1 
ATOM   1882  N N     . ASP A 1 277 ? 3.529   -33.565 4.915    1.00 69.53  ?  277 ASP A N     1 
ATOM   1883  C CA    . ASP A 1 277 ? 2.804   -33.054 6.076    1.00 56.94  ?  277 ASP A CA    1 
ATOM   1884  C C     . ASP A 1 277 ? 2.440   -34.226 6.974    1.00 53.30  ?  277 ASP A C     1 
ATOM   1885  O O     . ASP A 1 277 ? 2.513   -34.137 8.199    1.00 67.02  ?  277 ASP A O     1 
ATOM   1886  C CB    . ASP A 1 277 ? 1.555   -32.275 5.660    1.00 60.55  ?  277 ASP A CB    1 
ATOM   1887  C CG    . ASP A 1 277 ? 1.885   -31.012 4.888    1.00 75.93  ?  277 ASP A CG    1 
ATOM   1888  O OD1   . ASP A 1 277 ? 2.841   -30.309 5.279    1.00 80.13  ?  277 ASP A OD1   1 
ATOM   1889  O OD2   . ASP A 1 277 ? 1.185   -30.718 3.897    1.00 76.69  -1 277 ASP A OD2   1 
ATOM   1890  N N     . TYR A 1 278 ? 2.040   -35.320 6.340    1.00 56.00  ?  278 TYR A N     1 
ATOM   1891  C CA    . TYR A 1 278 ? 1.731   -36.568 7.019    1.00 51.49  ?  278 TYR A CA    1 
ATOM   1892  C C     . TYR A 1 278 ? 2.925   -37.058 7.823    1.00 66.55  ?  278 TYR A C     1 
ATOM   1893  O O     . TYR A 1 278 ? 2.774   -37.463 8.967    1.00 73.93  ?  278 TYR A O     1 
ATOM   1894  C CB    . TYR A 1 278 ? 1.297   -37.632 6.010    1.00 53.24  ?  278 TYR A CB    1 
ATOM   1895  C CG    . TYR A 1 278 ? 1.092   -39.004 6.606    1.00 41.43  ?  278 TYR A CG    1 
ATOM   1896  C CD1   . TYR A 1 278 ? 0.027   -39.262 7.457    1.00 43.57  ?  278 TYR A CD1   1 
ATOM   1897  C CD2   . TYR A 1 278 ? 1.961   -40.045 6.309    1.00 56.06  ?  278 TYR A CD2   1 
ATOM   1898  C CE1   . TYR A 1 278 ? -0.162  -40.517 8.004    1.00 57.93  ?  278 TYR A CE1   1 
ATOM   1899  C CE2   . TYR A 1 278 ? 1.778   -41.304 6.847    1.00 67.14  ?  278 TYR A CE2   1 
ATOM   1900  C CZ    . TYR A 1 278 ? 0.717   -41.534 7.695    1.00 68.44  ?  278 TYR A CZ    1 
ATOM   1901  O OH    . TYR A 1 278 ? 0.530   -42.789 8.229    1.00 74.17  ?  278 TYR A OH    1 
ATOM   1902  N N     . ARG A 1 279 ? 4.103   -37.056 7.204    1.00 69.35  ?  279 ARG A N     1 
ATOM   1903  C CA    . ARG A 1 279 ? 5.325   -37.512 7.867    1.00 72.22  ?  279 ARG A CA    1 
ATOM   1904  C C     . ARG A 1 279 ? 5.646   -36.679 9.112    1.00 72.00  ?  279 ARG A C     1 
ATOM   1905  O O     . ARG A 1 279 ? 5.932   -37.230 10.188   1.00 74.93  ?  279 ARG A O     1 
ATOM   1906  C CB    . ARG A 1 279 ? 6.507   -37.478 6.896    1.00 84.62  ?  279 ARG A CB    1 
ATOM   1907  C CG    . ARG A 1 279 ? 6.442   -38.532 5.797    1.00 92.82  ?  279 ARG A CG    1 
ATOM   1908  C CD    . ARG A 1 279 ? 6.273   -39.936 6.363    1.00 94.87  ?  279 ARG A CD    1 
ATOM   1909  N NE    . ARG A 1 279 ? 7.516   -40.469 6.913    1.00 104.54 ?  279 ARG A NE    1 
ATOM   1910  C CZ    . ARG A 1 279 ? 7.575   -41.347 7.909    1.00 104.35 ?  279 ARG A CZ    1 
ATOM   1911  N NH1   . ARG A 1 279 ? 6.459   -41.792 8.471    1.00 99.45  1  279 ARG A NH1   1 
ATOM   1912  N NH2   . ARG A 1 279 ? 8.750   -41.780 8.346    1.00 94.37  ?  279 ARG A NH2   1 
ATOM   1913  N N     . ASP A 1 280 ? 5.576   -35.355 8.973    1.00 63.34  ?  280 ASP A N     1 
ATOM   1914  C CA    . ASP A 1 280 ? 5.806   -34.475 10.122   1.00 66.06  ?  280 ASP A CA    1 
ATOM   1915  C C     . ASP A 1 280 ? 4.779   -34.737 11.223   1.00 68.67  ?  280 ASP A C     1 
ATOM   1916  O O     . ASP A 1 280 ? 5.113   -34.790 12.417   1.00 71.07  ?  280 ASP A O     1 
ATOM   1917  C CB    . ASP A 1 280 ? 5.753   -33.004 9.702    1.00 59.21  ?  280 ASP A CB    1 
ATOM   1918  C CG    . ASP A 1 280 ? 6.999   -32.561 8.962    1.00 77.22  ?  280 ASP A CG    1 
ATOM   1919  O OD1   . ASP A 1 280 ? 8.008   -33.296 8.993    1.00 69.37  ?  280 ASP A OD1   1 
ATOM   1920  O OD2   . ASP A 1 280 ? 6.970   -31.469 8.355    1.00 91.75  -1 280 ASP A OD2   1 
ATOM   1921  N N     . TRP A 1 281 ? 3.532   -34.919 10.803   1.00 64.29  ?  281 TRP A N     1 
ATOM   1922  C CA    . TRP A 1 281 ? 2.435   -35.222 11.708   1.00 55.52  ?  281 TRP A CA    1 
ATOM   1923  C C     . TRP A 1 281 ? 2.713   -36.506 12.487   1.00 60.28  ?  281 TRP A C     1 
ATOM   1924  O O     . TRP A 1 281 ? 2.506   -36.562 13.701   1.00 66.23  ?  281 TRP A O     1 
ATOM   1925  C CB    . TRP A 1 281 ? 1.140   -35.337 10.898   1.00 51.81  ?  281 TRP A CB    1 
ATOM   1926  C CG    . TRP A 1 281 ? -0.119  -35.510 11.683   1.00 54.17  ?  281 TRP A CG    1 
ATOM   1927  C CD1   . TRP A 1 281 ? -0.811  -34.541 12.346   1.00 59.80  ?  281 TRP A CD1   1 
ATOM   1928  C CD2   . TRP A 1 281 ? -0.872  -36.718 11.836   1.00 38.40  ?  281 TRP A CD2   1 
ATOM   1929  N NE1   . TRP A 1 281 ? -1.935  -35.076 12.927   1.00 51.62  ?  281 TRP A NE1   1 
ATOM   1930  C CE2   . TRP A 1 281 ? -1.996  -36.412 12.628   1.00 37.85  ?  281 TRP A CE2   1 
ATOM   1931  C CE3   . TRP A 1 281 ? -0.698  -38.033 11.394   1.00 37.70  ?  281 TRP A CE3   1 
ATOM   1932  C CZ2   . TRP A 1 281 ? -2.940  -37.371 12.985   1.00 42.94  ?  281 TRP A CZ2   1 
ATOM   1933  C CZ3   . TRP A 1 281 ? -1.637  -38.983 11.749   1.00 30.37  ?  281 TRP A CZ3   1 
ATOM   1934  C CH2   . TRP A 1 281 ? -2.743  -38.648 12.537   1.00 37.85  ?  281 TRP A CH2   1 
ATOM   1935  N N     . CYS A 1 282 ? 3.205   -37.522 11.782   1.00 60.07  ?  282 CYS A N     1 
ATOM   1936  C CA    . CYS A 1 282 ? 3.619   -38.781 12.392   1.00 68.94  ?  282 CYS A CA    1 
ATOM   1937  C C     . CYS A 1 282 ? 4.696   -38.550 13.439   1.00 77.42  ?  282 CYS A C     1 
ATOM   1938  O O     . CYS A 1 282 ? 4.671   -39.150 14.517   1.00 71.90  ?  282 CYS A O     1 
ATOM   1939  C CB    . CYS A 1 282 ? 4.119   -39.759 11.328   1.00 72.33  ?  282 CYS A CB    1 
ATOM   1940  S SG    . CYS A 1 282 ? 2.812   -40.504 10.330   1.00 101.74 ?  282 CYS A SG    1 
ATOM   1941  N N     . LYS A 1 283 ? 5.647   -37.678 13.110   1.00 68.90  ?  283 LYS A N     1 
ATOM   1942  C CA    . LYS A 1 283 ? 6.769   -37.414 14.004   1.00 76.51  ?  283 LYS A CA    1 
ATOM   1943  C C     . LYS A 1 283 ? 6.272   -36.791 15.306   1.00 69.23  ?  283 LYS A C     1 
ATOM   1944  O O     . LYS A 1 283 ? 6.701   -37.168 16.409   1.00 60.85  ?  283 LYS A O     1 
ATOM   1945  C CB    . LYS A 1 283 ? 7.794   -36.500 13.331   1.00 65.36  ?  283 LYS A CB    1 
ATOM   1946  N N     . VAL A 1 284 ? 5.340   -35.850 15.174   1.00 61.36  ?  284 VAL A N     1 
ATOM   1947  C CA    . VAL A 1 284 ? 4.775   -35.202 16.348   1.00 48.82  ?  284 VAL A CA    1 
ATOM   1948  C C     . VAL A 1 284 ? 3.951   -36.201 17.160   1.00 59.22  ?  284 VAL A C     1 
ATOM   1949  O O     . VAL A 1 284 ? 3.978   -36.174 18.390   1.00 67.12  ?  284 VAL A O     1 
ATOM   1950  C CB    . VAL A 1 284 ? 3.905   -33.992 15.957   1.00 44.71  ?  284 VAL A CB    1 
ATOM   1951  C CG1   . VAL A 1 284 ? 3.106   -33.495 17.147   1.00 42.22  ?  284 VAL A CG1   1 
ATOM   1952  C CG2   . VAL A 1 284 ? 4.779   -32.878 15.412   1.00 52.68  ?  284 VAL A CG2   1 
ATOM   1953  N N     . VAL A 1 285 ? 3.243   -37.097 16.476   1.00 52.54  ?  285 VAL A N     1 
ATOM   1954  C CA    . VAL A 1 285 ? 2.476   -38.135 17.164   1.00 65.36  ?  285 VAL A CA    1 
ATOM   1955  C C     . VAL A 1 285 ? 3.413   -39.012 17.992   1.00 72.40  ?  285 VAL A C     1 
ATOM   1956  O O     . VAL A 1 285 ? 3.095   -39.402 19.120   1.00 63.03  ?  285 VAL A O     1 
ATOM   1957  C CB    . VAL A 1 285 ? 1.680   -39.017 16.171   1.00 59.33  ?  285 VAL A CB    1 
ATOM   1958  C CG1   . VAL A 1 285 ? 1.109   -40.246 16.868   1.00 69.37  ?  285 VAL A CG1   1 
ATOM   1959  C CG2   . VAL A 1 285 ? 0.570   -38.217 15.515   1.00 45.32  ?  285 VAL A CG2   1 
ATOM   1960  N N     . THR A 1 286 ? 4.582   -39.296 17.423   1.00 78.74  ?  286 THR A N     1 
ATOM   1961  C CA    . THR A 1 286 ? 5.626   -40.042 18.116   1.00 72.34  ?  286 THR A CA    1 
ATOM   1962  C C     . THR A 1 286 ? 6.064   -39.310 19.375   1.00 65.37  ?  286 THR A C     1 
ATOM   1963  O O     . THR A 1 286 ? 6.150   -39.906 20.449   1.00 76.61  ?  286 THR A O     1 
ATOM   1964  C CB    . THR A 1 286 ? 6.851   -40.290 17.218   1.00 77.59  ?  286 THR A CB    1 
ATOM   1965  O OG1   . THR A 1 286 ? 6.448   -41.005 16.043   1.00 92.67  ?  286 THR A OG1   1 
ATOM   1966  C CG2   . THR A 1 286 ? 7.897   -41.106 17.963   1.00 55.08  ?  286 THR A CG2   1 
ATOM   1967  N N     . LEU A 1 287 ? 6.344   -38.016 19.236   1.00 62.64  ?  287 LEU A N     1 
ATOM   1968  C CA    . LEU A 1 287 ? 6.730   -37.196 20.386   1.00 64.65  ?  287 LEU A CA    1 
ATOM   1969  C C     . LEU A 1 287 ? 5.665   -37.192 21.484   1.00 70.27  ?  287 LEU A C     1 
ATOM   1970  O O     . LEU A 1 287 ? 5.987   -37.243 22.671   1.00 74.96  ?  287 LEU A O     1 
ATOM   1971  C CB    . LEU A 1 287 ? 7.025   -35.761 19.948   1.00 56.23  ?  287 LEU A CB    1 
ATOM   1972  C CG    . LEU A 1 287 ? 8.171   -35.584 18.951   1.00 81.07  ?  287 LEU A CG    1 
ATOM   1973  C CD1   . LEU A 1 287 ? 8.243   -34.143 18.474   1.00 71.51  ?  287 LEU A CD1   1 
ATOM   1974  C CD2   . LEU A 1 287 ? 9.493   -36.020 19.568   1.00 86.78  ?  287 LEU A CD2   1 
ATOM   1975  N N     . ILE A 1 288 ? 4.400   -37.137 21.082   1.00 72.80  ?  288 ILE A N     1 
ATOM   1976  C CA    . ILE A 1 288 ? 3.281   -37.141 22.021   1.00 71.27  ?  288 ILE A CA    1 
ATOM   1977  C C     . ILE A 1 288 ? 3.172   -38.469 22.764   1.00 61.15  ?  288 ILE A C     1 
ATOM   1978  O O     . ILE A 1 288 ? 2.998   -38.494 23.982   1.00 66.82  ?  288 ILE A O     1 
ATOM   1979  C CB    . ILE A 1 288 ? 1.945   -36.851 21.310   1.00 80.14  ?  288 ILE A CB    1 
ATOM   1980  C CG1   . ILE A 1 288 ? 1.949   -35.439 20.725   1.00 68.17  ?  288 ILE A CG1   1 
ATOM   1981  C CG2   . ILE A 1 288 ? 0.776   -37.014 22.273   1.00 66.93  ?  288 ILE A CG2   1 
ATOM   1982  C CD1   . ILE A 1 288 ? 0.651   -35.058 20.054   1.00 59.88  ?  288 ILE A CD1   1 
ATOM   1983  N N     . ASP A 1 289 ? 3.355   -39.563 22.049   1.00 66.90  ?  289 ASP A N     1 
ATOM   1984  C CA    . ASP A 1 289 ? 3.266   -40.897 22.621   1.00 71.15  ?  289 ASP A CA    1 
ATOM   1985  C C     . ASP A 1 289 ? 4.268   -41.085 23.701   1.00 78.27  ?  289 ASP A C     1 
ATOM   1986  O O     . ASP A 1 289 ? 4.084   -41.862 24.618   1.00 67.08  ?  289 ASP A O     1 
ATOM   1987  C CB    . ASP A 1 289 ? 3.561   -41.941 21.563   1.00 67.79  ?  289 ASP A CB    1 
ATOM   1988  C CG    . ASP A 1 289 ? 3.103   -43.305 21.967   1.00 80.87  ?  289 ASP A CG    1 
ATOM   1989  O OD1   . ASP A 1 289 ? 2.810   -43.510 23.151   1.00 86.69  ?  289 ASP A OD1   1 
ATOM   1990  O OD2   . ASP A 1 289 ? 3.023   -44.181 21.099   1.00 84.53  -1 289 ASP A OD2   1 
ATOM   1991  N N     . ASN A 1 290 ? 5.380   -40.406 23.550   1.00 78.51  ?  290 ASN A N     1 
ATOM   1992  C CA    . ASN A 1 290 ? 6.447   -40.486 24.540   1.00 71.81  ?  290 ASN A CA    1 
ATOM   1993  C C     . ASN A 1 290 ? 6.379   -39.349 25.554   1.00 61.38  ?  290 ASN A C     1 
ATOM   1994  O O     . ASN A 1 290 ? 7.360   -39.061 26.242   1.00 65.67  ?  290 ASN A O     1 
ATOM   1995  C CB    . ASN A 1 290 ? 7.812   -40.492 23.854   1.00 78.82  ?  290 ASN A CB    1 
ATOM   1996  C CG    . ASN A 1 290 ? 8.035   -41.733 23.016   1.00 82.67  ?  290 ASN A CG    1 
ATOM   1997  O OD1   . ASN A 1 290 ? 7.620   -42.831 23.390   1.00 80.47  ?  290 ASN A OD1   1 
ATOM   1998  N ND2   . ASN A 1 290 ? 8.694   -41.567 21.875   1.00 76.06  ?  290 ASN A ND2   1 
ATOM   1999  N N     . LYS A 1 291 ? 5.218   -38.701 25.623   1.00 61.74  ?  291 LYS A N     1 
ATOM   2000  C CA    . LYS A 1 291 ? 4.912   -37.706 26.651   1.00 66.58  ?  291 LYS A CA    1 
ATOM   2001  C C     . LYS A 1 291 ? 5.807   -36.466 26.611   1.00 63.14  ?  291 LYS A C     1 
ATOM   2002  O O     . LYS A 1 291 ? 5.860   -35.706 27.577   1.00 79.45  ?  291 LYS A O     1 
ATOM   2003  C CB    . LYS A 1 291 ? 4.987   -38.347 28.042   1.00 60.23  ?  291 LYS A CB    1 
ATOM   2004  N N     . GLU A 1 292 ? 6.501   -36.257 25.497   1.00 48.40  ?  292 GLU A N     1 
ATOM   2005  C CA    . GLU A 1 292 ? 7.402   -35.114 25.367   1.00 53.70  ?  292 GLU A CA    1 
ATOM   2006  C C     . GLU A 1 292 ? 6.619   -33.811 25.207   1.00 60.85  ?  292 GLU A C     1 
ATOM   2007  O O     . GLU A 1 292 ? 7.164   -32.722 25.380   1.00 64.36  ?  292 GLU A O     1 
ATOM   2008  C CB    . GLU A 1 292 ? 8.351   -35.310 24.183   1.00 54.01  ?  292 GLU A CB    1 
ATOM   2009  N N     . HIS A 1 293 ? 5.339   -33.939 24.871   1.00 64.09  ?  293 HIS A N     1 
ATOM   2010  C CA    . HIS A 1 293 ? 4.425   -32.803 24.761   1.00 63.77  ?  293 HIS A CA    1 
ATOM   2011  C C     . HIS A 1 293 ? 4.095   -32.215 26.131   1.00 74.00  ?  293 HIS A C     1 
ATOM   2012  O O     . HIS A 1 293 ? 3.540   -31.120 26.232   1.00 82.12  ?  293 HIS A O     1 
ATOM   2013  C CB    . HIS A 1 293 ? 3.135   -33.210 24.044   1.00 57.83  ?  293 HIS A CB    1 
ATOM   2014  C CG    . HIS A 1 293 ? 2.329   -34.234 24.779   1.00 57.43  ?  293 HIS A CG    1 
ATOM   2015  N ND1   . HIS A 1 293 ? 2.804   -35.498 25.055   1.00 65.12  ?  293 HIS A ND1   1 
ATOM   2016  C CD2   . HIS A 1 293 ? 1.078   -34.182 25.293   1.00 59.59  ?  293 HIS A CD2   1 
ATOM   2017  C CE1   . HIS A 1 293 ? 1.880   -36.180 25.708   1.00 58.15  ?  293 HIS A CE1   1 
ATOM   2018  N NE2   . HIS A 1 293 ? 0.823   -35.404 25.865   1.00 65.82  ?  293 HIS A NE2   1 
ATOM   2019  N N     . LEU A 1 294 ? 4.437   -32.955 27.180   1.00 73.75  ?  294 LEU A N     1 
ATOM   2020  C CA    . LEU A 1 294 ? 4.165   -32.545 28.554   1.00 74.35  ?  294 LEU A CA    1 
ATOM   2021  C C     . LEU A 1 294 ? 5.311   -31.746 29.174   1.00 79.22  ?  294 LEU A C     1 
ATOM   2022  O O     . LEU A 1 294 ? 5.300   -31.462 30.371   1.00 96.48  ?  294 LEU A O     1 
ATOM   2023  C CB    . LEU A 1 294 ? 3.870   -33.772 29.418   1.00 72.94  ?  294 LEU A CB    1 
ATOM   2024  C CG    . LEU A 1 294 ? 2.679   -34.628 28.982   1.00 69.42  ?  294 LEU A CG    1 
ATOM   2025  C CD1   . LEU A 1 294 ? 2.652   -35.948 29.739   1.00 59.92  ?  294 LEU A CD1   1 
ATOM   2026  C CD2   . LEU A 1 294 ? 1.373   -33.870 29.169   1.00 71.92  ?  294 LEU A CD2   1 
ATOM   2027  N N     . THR A 1 295 ? 6.296   -31.385 28.358   1.00 84.27  ?  295 THR A N     1 
ATOM   2028  C CA    . THR A 1 295 ? 7.390   -30.534 28.814   1.00 70.55  ?  295 THR A CA    1 
ATOM   2029  C C     . THR A 1 295 ? 7.415   -29.243 28.000   1.00 87.97  ?  295 THR A C     1 
ATOM   2030  O O     . THR A 1 295 ? 6.966   -29.216 26.854   1.00 97.79  ?  295 THR A O     1 
ATOM   2031  C CB    . THR A 1 295 ? 8.759   -31.240 28.700   1.00 75.65  ?  295 THR A CB    1 
ATOM   2032  O OG1   . THR A 1 295 ? 9.156   -31.308 27.325   1.00 65.73  ?  295 THR A OG1   1 
ATOM   2033  C CG2   . THR A 1 295 ? 8.685   -32.647 29.270   1.00 80.40  ?  295 THR A CG2   1 
ATOM   2034  N N     . SER A 1 296 ? 7.935   -28.177 28.602   1.00 89.79  ?  296 SER A N     1 
ATOM   2035  C CA    . SER A 1 296 ? 8.048   -26.881 27.935   1.00 93.98  ?  296 SER A CA    1 
ATOM   2036  C C     . SER A 1 296 ? 8.892   -26.952 26.665   1.00 90.18  ?  296 SER A C     1 
ATOM   2037  O O     . SER A 1 296 ? 8.493   -26.442 25.615   1.00 93.97  ?  296 SER A O     1 
ATOM   2038  C CB    . SER A 1 296 ? 8.636   -25.843 28.893   1.00 105.61 ?  296 SER A CB    1 
ATOM   2039  O OG    . SER A 1 296 ? 9.922   -26.232 29.344   1.00 112.21 ?  296 SER A OG    1 
ATOM   2040  N N     . GLU A 1 297 ? 10.058  -27.584 26.769   1.00 91.62  ?  297 GLU A N     1 
ATOM   2041  C CA    . GLU A 1 297 ? 10.973  -27.707 25.639   1.00 87.61  ?  297 GLU A CA    1 
ATOM   2042  C C     . GLU A 1 297 ? 10.314  -28.470 24.495   1.00 89.79  ?  297 GLU A C     1 
ATOM   2043  O O     . GLU A 1 297 ? 10.371  -28.046 23.337   1.00 94.24  ?  297 GLU A O     1 
ATOM   2044  C CB    . GLU A 1 297 ? 12.266  -28.406 26.067   1.00 88.46  ?  297 GLU A CB    1 
ATOM   2045  N N     . GLY A 1 298 ? 9.688   -29.595 24.830   1.00 83.71  ?  298 GLY A N     1 
ATOM   2046  C CA    . GLY A 1 298 ? 8.993   -30.401 23.845   1.00 80.18  ?  298 GLY A CA    1 
ATOM   2047  C C     . GLY A 1 298 ? 7.832   -29.654 23.218   1.00 81.25  ?  298 GLY A C     1 
ATOM   2048  O O     . GLY A 1 298 ? 7.583   -29.779 22.022   1.00 89.35  ?  298 GLY A O     1 
ATOM   2049  N N     . LEU A 1 299 ? 7.106   -28.890 24.030   1.00 77.39  ?  299 LEU A N     1 
ATOM   2050  C CA    . LEU A 1 299 ? 5.996   -28.084 23.530   1.00 75.10  ?  299 LEU A CA    1 
ATOM   2051  C C     . LEU A 1 299 ? 6.480   -27.040 22.524   1.00 88.56  ?  299 LEU A C     1 
ATOM   2052  O O     . LEU A 1 299 ? 5.836   -26.802 21.498   1.00 92.20  ?  299 LEU A O     1 
ATOM   2053  C CB    . LEU A 1 299 ? 5.261   -27.404 24.684   1.00 72.73  ?  299 LEU A CB    1 
ATOM   2054  C CG    . LEU A 1 299 ? 4.124   -26.462 24.283   1.00 73.31  ?  299 LEU A CG    1 
ATOM   2055  C CD1   . LEU A 1 299 ? 3.103   -27.189 23.425   1.00 77.61  ?  299 LEU A CD1   1 
ATOM   2056  C CD2   . LEU A 1 299 ? 3.462   -25.865 25.513   1.00 92.08  ?  299 LEU A CD2   1 
ATOM   2057  N N     . GLU A 1 300 ? 7.618   -26.420 22.829   1.00 92.83  ?  300 GLU A N     1 
ATOM   2058  C CA    . GLU A 1 300 ? 8.259   -25.488 21.905   1.00 86.89  ?  300 GLU A CA    1 
ATOM   2059  C C     . GLU A 1 300 ? 8.633   -26.196 20.608   1.00 93.30  ?  300 GLU A C     1 
ATOM   2060  O O     . GLU A 1 300 ? 8.415   -25.666 19.514   1.00 96.40  ?  300 GLU A O     1 
ATOM   2061  C CB    . GLU A 1 300 ? 9.499   -24.861 22.544   1.00 86.98  ?  300 GLU A CB    1 
ATOM   2062  N N     . LYS A 1 301 ? 9.199   -27.392 20.746   1.00 84.47  ?  301 LYS A N     1 
ATOM   2063  C CA    . LYS A 1 301 ? 9.545   -28.235 19.604   1.00 90.31  ?  301 LYS A CA    1 
ATOM   2064  C C     . LYS A 1 301 ? 8.332   -28.431 18.699   1.00 96.63  ?  301 LYS A C     1 
ATOM   2065  O O     . LYS A 1 301 ? 8.393   -28.189 17.490   1.00 86.19  ?  301 LYS A O     1 
ATOM   2066  C CB    . LYS A 1 301 ? 10.087  -29.587 20.074   1.00 71.24  ?  301 LYS A CB    1 
ATOM   2067  N N     . ILE A 1 302 ? 7.231   -28.871 19.300   1.00 91.80  ?  302 ILE A N     1 
ATOM   2068  C CA    . ILE A 1 302 ? 6.017   -29.174 18.557   1.00 84.56  ?  302 ILE A CA    1 
ATOM   2069  C C     . ILE A 1 302 ? 5.467   -27.921 17.887   1.00 89.02  ?  302 ILE A C     1 
ATOM   2070  O O     . ILE A 1 302 ? 5.093   -27.972 16.724   1.00 93.24  ?  302 ILE A O     1 
ATOM   2071  C CB    . ILE A 1 302 ? 4.935   -29.793 19.463   1.00 80.09  ?  302 ILE A CB    1 
ATOM   2072  C CG1   . ILE A 1 302 ? 5.353   -31.199 19.894   1.00 62.84  ?  302 ILE A CG1   1 
ATOM   2073  C CG2   . ILE A 1 302 ? 3.598   -29.857 18.741   1.00 85.00  ?  302 ILE A CG2   1 
ATOM   2074  C CD1   . ILE A 1 302 ? 4.397   -31.845 20.867   1.00 66.23  ?  302 ILE A CD1   1 
ATOM   2075  N N     . GLN A 1 303 ? 5.388   -26.812 18.619   1.00 84.77  ?  303 GLN A N     1 
ATOM   2076  C CA    . GLN A 1 303 ? 4.974   -25.544 18.016   1.00 89.95  ?  303 GLN A CA    1 
ATOM   2077  C C     . GLN A 1 303 ? 5.818   -25.219 16.778   1.00 95.18  ?  303 GLN A C     1 
ATOM   2078  O O     . GLN A 1 303 ? 5.294   -24.803 15.736   1.00 86.76  ?  303 GLN A O     1 
ATOM   2079  C CB    . GLN A 1 303 ? 5.073   -24.406 19.034   1.00 87.29  ?  303 GLN A CB    1 
ATOM   2080  C CG    . GLN A 1 303 ? 4.893   -23.015 18.437   1.00 109.08 ?  303 GLN A CG    1 
ATOM   2081  C CD    . GLN A 1 303 ? 3.484   -22.765 17.931   1.00 106.65 ?  303 GLN A CD    1 
ATOM   2082  O OE1   . GLN A 1 303 ? 2.529   -23.411 18.366   1.00 84.09  ?  303 GLN A OE1   1 
ATOM   2083  N NE2   . GLN A 1 303 ? 3.348   -21.821 17.006   1.00 99.97  ?  303 GLN A NE2   1 
ATOM   2084  N N     . LYS A 1 304 ? 7.125   -25.435 16.903   1.00 98.92  ?  304 LYS A N     1 
ATOM   2085  C CA    . LYS A 1 304 ? 8.063   -25.184 15.813   1.00 93.43  ?  304 LYS A CA    1 
ATOM   2086  C C     . LYS A 1 304 ? 7.779   -26.061 14.597   1.00 94.19  ?  304 LYS A C     1 
ATOM   2087  O O     . LYS A 1 304 ? 7.822   -25.591 13.460   1.00 107.90 ?  304 LYS A O     1 
ATOM   2088  C CB    . LYS A 1 304 ? 9.502   -25.403 16.286   1.00 83.08  ?  304 LYS A CB    1 
ATOM   2089  N N     . ILE A 1 305 ? 7.489   -27.336 14.843   1.00 93.77  ?  305 ILE A N     1 
ATOM   2090  C CA    . ILE A 1 305 ? 7.155   -28.273 13.772   1.00 93.18  ?  305 ILE A CA    1 
ATOM   2091  C C     . ILE A 1 305 ? 5.839   -27.888 13.097   1.00 85.24  ?  305 ILE A C     1 
ATOM   2092  O O     . ILE A 1 305 ? 5.743   -27.853 11.871   1.00 86.57  ?  305 ILE A O     1 
ATOM   2093  C CB    . ILE A 1 305 ? 7.058   -29.718 14.296   1.00 91.02  ?  305 ILE A CB    1 
ATOM   2094  C CG1   . ILE A 1 305 ? 8.373   -30.132 14.960   1.00 100.65 ?  305 ILE A CG1   1 
ATOM   2095  C CG2   . ILE A 1 305 ? 6.710   -30.670 13.163   1.00 73.35  ?  305 ILE A CG2   1 
ATOM   2096  C CD1   . ILE A 1 305 ? 8.301   -31.456 15.689   1.00 100.34 ?  305 ILE A CD1   1 
ATOM   2097  N N     . LYS A 1 306 ? 4.835   -27.605 13.920   1.00 81.18  ?  306 LYS A N     1 
ATOM   2098  C CA    . LYS A 1 306 ? 3.507   -27.196 13.477   1.00 87.45  ?  306 LYS A CA    1 
ATOM   2099  C C     . LYS A 1 306 ? 3.591   -25.979 12.569   1.00 93.77  ?  306 LYS A C     1 
ATOM   2100  O O     . LYS A 1 306 ? 2.881   -25.892 11.567   1.00 94.04  ?  306 LYS A O     1 
ATOM   2101  C CB    . LYS A 1 306 ? 2.606   -26.897 14.678   1.00 67.65  ?  306 LYS A CB    1 
ATOM   2102  N N     . GLU A 1 307 ? 4.460   -25.038 12.926   1.00 93.45  ?  307 GLU A N     1 
ATOM   2103  C CA    . GLU A 1 307 ? 4.596   -23.802 12.163   1.00 96.96  ?  307 GLU A CA    1 
ATOM   2104  C C     . GLU A 1 307 ? 5.144   -24.084 10.763   1.00 100.02 ?  307 GLU A C     1 
ATOM   2105  O O     . GLU A 1 307 ? 5.019   -23.258 9.859    1.00 115.20 ?  307 GLU A O     1 
ATOM   2106  C CB    . GLU A 1 307 ? 5.505   -22.815 12.898   1.00 102.37 ?  307 GLU A CB    1 
ATOM   2107  N N     . GLY A 1 308 ? 5.752   -25.255 10.592   1.00 94.76  ?  308 GLY A N     1 
ATOM   2108  C CA    . GLY A 1 308 ? 6.310   -25.659 9.313    1.00 104.21 ?  308 GLY A CA    1 
ATOM   2109  C C     . GLY A 1 308 ? 5.434   -26.636 8.548    1.00 98.23  ?  308 GLY A C     1 
ATOM   2110  O O     . GLY A 1 308 ? 5.852   -27.187 7.529    1.00 89.95  ?  308 GLY A O     1 
ATOM   2111  N N     . MET A 1 309 ? 4.215   -26.851 9.037    1.00 96.27  ?  309 MET A N     1 
ATOM   2112  C CA    . MET A 1 309 ? 3.286   -27.795 8.414    1.00 84.55  ?  309 MET A CA    1 
ATOM   2113  C C     . MET A 1 309 ? 2.170   -27.092 7.648    1.00 86.97  ?  309 MET A C     1 
ATOM   2114  O O     . MET A 1 309 ? 1.839   -25.940 7.934    1.00 85.43  ?  309 MET A O     1 
ATOM   2115  C CB    . MET A 1 309 ? 2.670   -28.724 9.463    1.00 70.25  ?  309 MET A CB    1 
ATOM   2116  C CG    . MET A 1 309 ? 3.646   -29.680 10.119   1.00 77.43  ?  309 MET A CG    1 
ATOM   2117  S SD    . MET A 1 309 ? 2.870   -30.593 11.466   1.00 102.12 ?  309 MET A SD    1 
ATOM   2118  C CE    . MET A 1 309 ? 1.743   -31.646 10.557   1.00 47.70  ?  309 MET A CE    1 
ATOM   2119  N N     . ASN A 1 310 ? 1.591   -27.808 6.685    1.00 75.68  ?  310 ASN A N     1 
ATOM   2120  C CA    . ASN A 1 310 ? 0.398   -27.360 5.969    1.00 72.64  ?  310 ASN A CA    1 
ATOM   2121  C C     . ASN A 1 310 ? 0.547   -25.969 5.364    1.00 87.27  ?  310 ASN A C     1 
ATOM   2122  O O     . ASN A 1 310 ? 1.452   -25.728 4.565    1.00 100.76 ?  310 ASN A O     1 
ATOM   2123  C CB    . ASN A 1 310 ? -0.819  -27.392 6.895    1.00 64.40  ?  310 ASN A CB    1 
ATOM   2124  C CG    . ASN A 1 310 ? -1.126  -28.787 7.406    1.00 74.28  ?  310 ASN A CG    1 
ATOM   2125  O OD1   . ASN A 1 310 ? -0.858  -29.781 6.730    1.00 74.98  ?  310 ASN A OD1   1 
ATOM   2126  N ND2   . ASN A 1 310 ? -1.690  -28.868 8.605    1.00 81.79  ?  310 ASN A ND2   1 
ATOM   2127  N N     . ARG A 1 311 ? -0.347  -25.060 5.738    1.00 86.87  ?  311 ARG A N     1 
ATOM   2128  C CA    . ARG A 1 311 ? -0.350  -23.710 5.184    1.00 86.49  ?  311 ARG A CA    1 
ATOM   2129  C C     . ARG A 1 311 ? 0.933   -22.937 5.478    1.00 87.09  ?  311 ARG A C     1 
ATOM   2130  O O     . ARG A 1 311 ? 1.296   -22.029 4.731    1.00 91.74  ?  311 ARG A O     1 
ATOM   2131  C CB    . ARG A 1 311 ? -1.551  -22.922 5.711    1.00 78.95  ?  311 ARG A CB    1 
ATOM   2132  C CG    . ARG A 1 311 ? -2.788  -23.015 4.834    1.00 73.29  ?  311 ARG A CG    1 
ATOM   2133  C CD    . ARG A 1 311 ? -4.015  -22.437 5.527    1.00 85.07  ?  311 ARG A CD    1 
ATOM   2134  N NE    . ARG A 1 311 ? -3.712  -21.215 6.268    1.00 99.25  ?  311 ARG A NE    1 
ATOM   2135  C CZ    . ARG A 1 311 ? -3.697  -21.130 7.595    1.00 100.29 ?  311 ARG A CZ    1 
ATOM   2136  N NH1   . ARG A 1 311 ? -3.970  -22.198 8.330    1.00 89.17  1  311 ARG A NH1   1 
ATOM   2137  N NH2   . ARG A 1 311 ? -3.404  -19.979 8.186    1.00 98.53  ?  311 ARG A NH2   1 
ATOM   2138  N N     . GLY A 1 312 ? 1.624   -23.288 6.558    1.00 87.29  ?  312 GLY A N     1 
ATOM   2139  C CA    . GLY A 1 312 ? 2.852   -22.592 6.886    1.00 91.53  ?  312 GLY A CA    1 
ATOM   2140  C C     . GLY A 1 312 ? 4.055   -23.124 6.133    1.00 92.43  ?  312 GLY A C     1 
ATOM   2141  O O     . GLY A 1 312 ? 5.151   -22.575 6.240    1.00 103.81 ?  312 GLY A O     1 
ATOM   2142  N N     . ARG A 1 313 ? 3.857   -24.196 5.372    1.00 84.57  ?  313 ARG A N     1 
ATOM   2143  C CA    . ARG A 1 313 ? 4.937   -24.755 4.570    1.00 89.28  ?  313 ARG A CA    1 
ATOM   2144  C C     . ARG A 1 313 ? 5.179   -23.822 3.389    1.00 100.70 ?  313 ARG A C     1 
ATOM   2145  O O     . ARG A 1 313 ? 4.229   -23.402 2.727    1.00 108.58 ?  313 ARG A O     1 
ATOM   2146  C CB    . ARG A 1 313 ? 4.600   -26.171 4.097    1.00 84.30  ?  313 ARG A CB    1 
ATOM   2147  C CG    . ARG A 1 313 ? 5.733   -26.877 3.364    1.00 72.84  ?  313 ARG A CG    1 
ATOM   2148  C CD    . ARG A 1 313 ? 5.405   -28.344 3.117    1.00 80.14  ?  313 ARG A CD    1 
ATOM   2149  N NE    . ARG A 1 313 ? 5.191   -29.084 4.359    1.00 83.38  ?  313 ARG A NE    1 
ATOM   2150  C CZ    . ARG A 1 313 ? 6.165   -29.499 5.163    1.00 92.15  ?  313 ARG A CZ    1 
ATOM   2151  N NH1   . ARG A 1 313 ? 7.431   -29.253 4.857    1.00 105.26 1  313 ARG A NH1   1 
ATOM   2152  N NH2   . ARG A 1 313 ? 5.872   -30.159 6.275    1.00 91.37  ?  313 ARG A NH2   1 
ATOM   2153  N N     . SER A 1 314 ? 6.437   -23.495 3.117    1.00 107.02 ?  314 SER A N     1 
ATOM   2154  C CA    . SER A 1 314 ? 6.745   -22.526 2.071    1.00 102.24 ?  314 SER A CA    1 
ATOM   2155  C C     . SER A 1 314 ? 6.680   -23.164 0.687    1.00 103.94 ?  314 SER A C     1 
ATOM   2156  O O     . SER A 1 314 ? 7.695   -23.289 0.001    1.00 106.30 ?  314 SER A O     1 
ATOM   2157  C CB    . SER A 1 314 ? 8.122   -21.903 2.304    1.00 109.00 ?  314 SER A CB    1 
ATOM   2158  O OG    . SER A 1 314 ? 8.114   -21.079 3.458    1.00 107.99 ?  314 SER A OG    1 
ATOM   2159  O "O5'" . DG  B 2 1   ? -11.395 -29.877 45.385   1.00 89.45  ?  1   DG  B "O5'" 1 
ATOM   2160  C "C5'" . DG  B 2 1   ? -10.536 -28.826 45.810   1.00 98.72  ?  1   DG  B "C5'" 1 
ATOM   2161  C "C4'" . DG  B 2 1   ? -9.124  -29.029 45.284   1.00 77.08  ?  1   DG  B "C4'" 1 
ATOM   2162  O "O4'" . DG  B 2 1   ? -8.893  -30.443 45.041   1.00 70.20  ?  1   DG  B "O4'" 1 
ATOM   2163  C "C3'" . DG  B 2 1   ? -8.827  -28.338 43.961   1.00 92.44  ?  1   DG  B "C3'" 1 
ATOM   2164  O "O3'" . DG  B 2 1   ? -7.441  -28.026 43.883   1.00 96.58  ?  1   DG  B "O3'" 1 
ATOM   2165  C "C2'" . DG  B 2 1   ? -9.221  -29.408 42.950   1.00 92.88  ?  1   DG  B "C2'" 1 
ATOM   2166  C "C1'" . DG  B 2 1   ? -8.744  -30.673 43.652   1.00 72.16  ?  1   DG  B "C1'" 1 
ATOM   2167  N N9    . DG  B 2 1   ? -9.511  -31.864 43.298   1.00 62.36  ?  1   DG  B N9    1 
ATOM   2168  C C8    . DG  B 2 1   ? -10.878 -32.001 43.317   1.00 70.77  ?  1   DG  B C8    1 
ATOM   2169  N N7    . DG  B 2 1   ? -11.288 -33.180 42.941   1.00 70.19  ?  1   DG  B N7    1 
ATOM   2170  C C5    . DG  B 2 1   ? -10.120 -33.866 42.636   1.00 62.83  ?  1   DG  B C5    1 
ATOM   2171  C C6    . DG  B 2 1   ? -9.936  -35.190 42.169   1.00 53.36  ?  1   DG  B C6    1 
ATOM   2172  O O6    . DG  B 2 1   ? -10.801 -36.045 41.926   1.00 45.44  ?  1   DG  B O6    1 
ATOM   2173  N N1    . DG  B 2 1   ? -8.587  -35.488 41.985   1.00 47.08  ?  1   DG  B N1    1 
ATOM   2174  C C2    . DG  B 2 1   ? -7.549  -34.617 42.223   1.00 48.52  ?  1   DG  B C2    1 
ATOM   2175  N N2    . DG  B 2 1   ? -6.314  -35.087 41.991   1.00 45.13  ?  1   DG  B N2    1 
ATOM   2176  N N3    . DG  B 2 1   ? -7.708  -33.374 42.663   1.00 46.32  ?  1   DG  B N3    1 
ATOM   2177  C C4    . DG  B 2 1   ? -9.016  -33.068 42.846   1.00 55.94  ?  1   DG  B C4    1 
ATOM   2178  P P     . DG  B 2 2   ? -6.850  -27.236 42.614   1.00 123.86 ?  2   DG  B P     1 
ATOM   2179  O OP1   . DG  B 2 2   ? -5.927  -26.195 43.120   1.00 108.37 ?  2   DG  B OP1   1 
ATOM   2180  O OP2   . DG  B 2 2   ? -7.984  -26.856 41.742   1.00 114.51 -1 2   DG  B OP2   1 
ATOM   2181  O "O5'" . DG  B 2 2   ? -5.995  -28.345 41.846   1.00 87.61  ?  2   DG  B "O5'" 1 
ATOM   2182  C "C5'" . DG  B 2 2   ? -4.890  -28.952 42.498   1.00 89.28  ?  2   DG  B "C5'" 1 
ATOM   2183  C "C4'" . DG  B 2 2   ? -4.157  -29.899 41.566   1.00 78.77  ?  2   DG  B "C4'" 1 
ATOM   2184  O "O4'" . DG  B 2 2   ? -4.957  -31.092 41.354   1.00 64.71  ?  2   DG  B "O4'" 1 
ATOM   2185  C "C3'" . DG  B 2 2   ? -3.843  -29.341 40.180   1.00 85.86  ?  2   DG  B "C3'" 1 
ATOM   2186  O "O3'" . DG  B 2 2   ? -2.530  -29.727 39.806   1.00 88.77  ?  2   DG  B "O3'" 1 
ATOM   2187  C "C2'" . DG  B 2 2   ? -4.908  -29.971 39.286   1.00 74.74  ?  2   DG  B "C2'" 1 
ATOM   2188  C "C1'" . DG  B 2 2   ? -5.142  -31.307 39.972   1.00 61.49  ?  2   DG  B "C1'" 1 
ATOM   2189  N N9    . DG  B 2 2   ? -6.485  -31.846 39.763   1.00 52.32  ?  2   DG  B N9    1 
ATOM   2190  C C8    . DG  B 2 2   ? -7.683  -31.204 39.971   1.00 54.76  ?  2   DG  B C8    1 
ATOM   2191  N N7    . DG  B 2 2   ? -8.723  -31.941 39.687   1.00 46.65  ?  2   DG  B N7    1 
ATOM   2192  C C5    . DG  B 2 2   ? -8.177  -33.141 39.247   1.00 42.32  ?  2   DG  B C5    1 
ATOM   2193  C C6    . DG  B 2 2   ? -8.813  -34.326 38.796   1.00 46.49  ?  2   DG  B C6    1 
ATOM   2194  O O6    . DG  B 2 2   ? -10.027 -34.557 38.692   1.00 47.37  ?  2   DG  B O6    1 
ATOM   2195  N N1    . DG  B 2 2   ? -7.884  -35.305 38.444   1.00 35.72  ?  2   DG  B N1    1 
ATOM   2196  C C2    . DG  B 2 2   ? -6.518  -35.155 38.520   1.00 38.74  ?  2   DG  B C2    1 
ATOM   2197  N N2    . DG  B 2 2   ? -5.780  -36.204 38.139   1.00 38.23  ?  2   DG  B N2    1 
ATOM   2198  N N3    . DG  B 2 2   ? -5.915  -34.053 38.938   1.00 45.24  ?  2   DG  B N3    1 
ATOM   2199  C C4    . DG  B 2 2   ? -6.802  -33.093 39.284   1.00 46.80  ?  2   DG  B C4    1 
ATOM   2200  P P     . DT  B 2 3   ? -1.809  -29.070 38.530   1.00 81.65  ?  3   DT  B P     1 
ATOM   2201  O OP1   . DT  B 2 3   ? -0.368  -28.948 38.842   1.00 63.25  ?  3   DT  B OP1   1 
ATOM   2202  O OP2   . DT  B 2 3   ? -2.588  -27.876 38.128   1.00 66.04  -1 3   DT  B OP2   1 
ATOM   2203  O "O5'" . DT  B 2 3   ? -1.986  -30.176 37.391   1.00 79.24  ?  3   DT  B "O5'" 1 
ATOM   2204  C "C5'" . DT  B 2 3   ? -1.454  -31.480 37.604   1.00 64.96  ?  3   DT  B "C5'" 1 
ATOM   2205  C "C4'" . DT  B 2 3   ? -1.898  -32.441 36.517   1.00 79.80  ?  3   DT  B "C4'" 1 
ATOM   2206  O "O4'" . DT  B 2 3   ? -3.281  -32.803 36.717   1.00 78.03  ?  3   DT  B "O4'" 1 
ATOM   2207  C "C3'" . DT  B 2 3   ? -1.800  -31.900 35.088   1.00 74.81  ?  3   DT  B "C3'" 1 
ATOM   2208  O "O3'" . DT  B 2 3   ? -0.776  -32.614 34.387   1.00 73.75  ?  3   DT  B "O3'" 1 
ATOM   2209  C "C2'" . DT  B 2 3   ? -3.201  -32.131 34.484   1.00 51.88  ?  3   DT  B "C2'" 1 
ATOM   2210  C "C1'" . DT  B 2 3   ? -3.843  -33.103 35.468   1.00 57.06  ?  3   DT  B "C1'" 1 
ATOM   2211  N N1    . DT  B 2 3   ? -5.338  -32.981 35.583   1.00 46.81  ?  3   DT  B N1    1 
ATOM   2212  C C2    . DT  B 2 3   ? -6.120  -34.100 35.401   1.00 49.52  ?  3   DT  B C2    1 
ATOM   2213  O O2    . DT  B 2 3   ? -5.665  -35.189 35.107   1.00 57.26  ?  3   DT  B O2    1 
ATOM   2214  N N3    . DT  B 2 3   ? -7.469  -33.890 35.546   1.00 50.08  ?  3   DT  B N3    1 
ATOM   2215  C C4    . DT  B 2 3   ? -8.101  -32.702 35.871   1.00 43.54  ?  3   DT  B C4    1 
ATOM   2216  O O4    . DT  B 2 3   ? -9.323  -32.616 35.984   1.00 35.39  ?  3   DT  B O4    1 
ATOM   2217  C C5    . DT  B 2 3   ? -7.221  -31.571 36.070   1.00 39.66  ?  3   DT  B C5    1 
ATOM   2218  C C7    . DT  B 2 3   ? -7.790  -30.228 36.427   1.00 36.07  ?  3   DT  B C7    1 
ATOM   2219  C C6    . DT  B 2 3   ? -5.898  -31.764 35.925   1.00 44.32  ?  3   DT  B C6    1 
ATOM   2220  P P     . DC  B 2 4   ? -0.364  -32.218 32.885   1.00 88.09  ?  4   DC  B P     1 
ATOM   2221  O OP1   . DC  B 2 4   ? 1.015   -32.705 32.654   1.00 73.03  ?  4   DC  B OP1   1 
ATOM   2222  O OP2   . DC  B 2 4   ? -0.685  -30.788 32.680   1.00 87.64  -1 4   DC  B OP2   1 
ATOM   2223  O "O5'" . DC  B 2 4   ? -1.362  -33.081 31.989   1.00 69.70  ?  4   DC  B "O5'" 1 
ATOM   2224  C "C5'" . DC  B 2 4   ? -1.306  -34.498 32.058   1.00 60.35  ?  4   DC  B "C5'" 1 
ATOM   2225  C "C4'" . DC  B 2 4   ? -2.600  -35.109 31.566   1.00 66.66  ?  4   DC  B "C4'" 1 
ATOM   2226  O "O4'" . DC  B 2 4   ? -3.702  -34.609 32.327   1.00 67.78  ?  4   DC  B "O4'" 1 
ATOM   2227  C "C3'" . DC  B 2 4   ? -2.983  -34.771 30.140   1.00 69.61  ?  4   DC  B "C3'" 1 
ATOM   2228  O "O3'" . DC  B 2 4   ? -2.265  -35.621 29.228   1.00 69.84  ?  4   DC  B "O3'" 1 
ATOM   2229  C "C2'" . DC  B 2 4   ? -4.495  -35.059 30.145   1.00 59.23  ?  4   DC  B "C2'" 1 
ATOM   2230  C "C1'" . DC  B 2 4   ? -4.871  -34.974 31.638   1.00 49.21  ?  4   DC  B "C1'" 1 
ATOM   2231  N N1    . DC  B 2 4   ? -5.948  -33.990 31.934   1.00 37.03  ?  4   DC  B N1    1 
ATOM   2232  C C2    . DC  B 2 4   ? -7.262  -34.440 32.028   1.00 48.24  ?  4   DC  B C2    1 
ATOM   2233  O O2    . DC  B 2 4   ? -7.485  -35.646 31.882   1.00 55.13  ?  4   DC  B O2    1 
ATOM   2234  N N3    . DC  B 2 4   ? -8.250  -33.548 32.295   1.00 42.63  ?  4   DC  B N3    1 
ATOM   2235  C C4    . DC  B 2 4   ? -7.956  -32.256 32.451   1.00 43.81  ?  4   DC  B C4    1 
ATOM   2236  N N4    . DC  B 2 4   ? -8.962  -31.412 32.709   1.00 47.21  ?  4   DC  B N4    1 
ATOM   2237  C C5    . DC  B 2 4   ? -6.616  -31.774 32.349   1.00 45.60  ?  4   DC  B C5    1 
ATOM   2238  C C6    . DC  B 2 4   ? -5.653  -32.668 32.088   1.00 43.79  ?  4   DC  B C6    1 
ATOM   2239  P P     . DT  B 2 5   ? -2.553  -35.578 27.644   1.00 61.24  ?  5   DT  B P     1 
ATOM   2240  O OP1   . DT  B 2 5   ? -1.497  -36.380 26.989   1.00 64.35  ?  5   DT  B OP1   1 
ATOM   2241  O OP2   . DT  B 2 5   ? -2.740  -34.162 27.254   1.00 53.61  -1 5   DT  B OP2   1 
ATOM   2242  O "O5'" . DT  B 2 5   ? -3.952  -36.337 27.474   1.00 44.90  ?  5   DT  B "O5'" 1 
ATOM   2243  C "C5'" . DT  B 2 5   ? -4.076  -37.715 27.806   1.00 45.16  ?  5   DT  B "C5'" 1 
ATOM   2244  C "C4'" . DT  B 2 5   ? -5.407  -38.257 27.315   1.00 49.51  ?  5   DT  B "C4'" 1 
ATOM   2245  O "O4'" . DT  B 2 5   ? -6.487  -37.578 28.015   1.00 52.40  ?  5   DT  B "O4'" 1 
ATOM   2246  C "C3'" . DT  B 2 5   ? -5.683  -38.070 25.824   1.00 57.33  ?  5   DT  B "C3'" 1 
ATOM   2247  O "O3'" . DT  B 2 5   ? -6.245  -39.264 25.280   1.00 63.17  ?  5   DT  B "O3'" 1 
ATOM   2248  C "C2'" . DT  B 2 5   ? -6.664  -36.903 25.771   1.00 58.57  ?  5   DT  B "C2'" 1 
ATOM   2249  C "C1'" . DT  B 2 5   ? -7.413  -37.055 27.084   1.00 48.95  ?  5   DT  B "C1'" 1 
ATOM   2250  N N1    . DT  B 2 5   ? -7.948  -35.760 27.611   1.00 37.19  ?  5   DT  B N1    1 
ATOM   2251  C C2    . DT  B 2 5   ? -9.285  -35.657 27.926   1.00 48.58  ?  5   DT  B C2    1 
ATOM   2252  O O2    . DT  B 2 5   ? -10.078 -36.570 27.781   1.00 59.26  ?  5   DT  B O2    1 
ATOM   2253  N N3    . DT  B 2 5   ? -9.670  -34.426 28.399   1.00 43.00  ?  5   DT  B N3    1 
ATOM   2254  C C4    . DT  B 2 5   ? -8.862  -33.319 28.599   1.00 43.57  ?  5   DT  B C4    1 
ATOM   2255  O O4    . DT  B 2 5   ? -9.297  -32.257 29.035   1.00 39.86  ?  5   DT  B O4    1 
ATOM   2256  C C5    . DT  B 2 5   ? -7.470  -33.501 28.258   1.00 42.15  ?  5   DT  B C5    1 
ATOM   2257  C C7    . DT  B 2 5   ? -6.497  -32.372 28.430   1.00 42.80  ?  5   DT  B C7    1 
ATOM   2258  C C6    . DT  B 2 5   ? -7.086  -34.698 27.788   1.00 35.33  ?  5   DT  B C6    1 
ATOM   2259  P P     . DA  B 2 6   ? -6.587  -39.364 23.713   1.00 61.58  ?  6   DA  B P     1 
ATOM   2260  O OP1   . DA  B 2 6   ? -6.462  -40.783 23.315   1.00 59.77  ?  6   DA  B OP1   1 
ATOM   2261  O OP2   . DA  B 2 6   ? -5.812  -38.326 22.996   1.00 58.67  -1 6   DA  B OP2   1 
ATOM   2262  O "O5'" . DA  B 2 6   ? -8.132  -38.951 23.671   1.00 52.77  ?  6   DA  B "O5'" 1 
ATOM   2263  C "C5'" . DA  B 2 6   ? -9.093  -39.742 24.361   1.00 57.86  ?  6   DA  B "C5'" 1 
ATOM   2264  C "C4'" . DA  B 2 6   ? -10.489 -39.166 24.201   1.00 75.61  ?  6   DA  B "C4'" 1 
ATOM   2265  O "O4'" . DA  B 2 6   ? -10.581 -37.922 24.935   1.00 82.81  ?  6   DA  B "O4'" 1 
ATOM   2266  C "C3'" . DA  B 2 6   ? -10.924 -38.864 22.768   1.00 65.09  ?  6   DA  B "C3'" 1 
ATOM   2267  O "O3'" . DA  B 2 6   ? -12.207 -39.429 22.527   1.00 71.38  ?  6   DA  B "O3'" 1 
ATOM   2268  C "C2'" . DA  B 2 6   ? -10.956 -37.333 22.701   1.00 54.45  ?  6   DA  B "C2'" 1 
ATOM   2269  C "C1'" . DA  B 2 6   ? -11.217 -36.945 24.150   1.00 65.85  ?  6   DA  B "C1'" 1 
ATOM   2270  N N9    . DA  B 2 6   ? -10.655 -35.650 24.515   1.00 56.76  ?  6   DA  B N9    1 
ATOM   2271  C C8    . DA  B 2 6   ? -9.365  -35.232 24.337   1.00 56.33  ?  6   DA  B C8    1 
ATOM   2272  N N7    . DA  B 2 6   ? -9.137  -34.018 24.776   1.00 52.90  ?  6   DA  B N7    1 
ATOM   2273  C C5    . DA  B 2 6   ? -10.358 -33.615 25.288   1.00 51.75  ?  6   DA  B C5    1 
ATOM   2274  C C6    . DA  B 2 6   ? -10.780 -32.423 25.906   1.00 49.92  ?  6   DA  B C6    1 
ATOM   2275  N N6    . DA  B 2 6   ? -9.974  -31.377 26.112   1.00 43.33  ?  6   DA  B N6    1 
ATOM   2276  N N1    . DA  B 2 6   ? -12.069 -32.343 26.299   1.00 54.38  ?  6   DA  B N1    1 
ATOM   2277  C C2    . DA  B 2 6   ? -12.873 -33.392 26.087   1.00 55.41  ?  6   DA  B C2    1 
ATOM   2278  N N3    . DA  B 2 6   ? -12.590 -34.565 25.520   1.00 58.88  ?  6   DA  B N3    1 
ATOM   2279  C C4    . DA  B 2 6   ? -11.304 -34.611 25.139   1.00 57.24  ?  6   DA  B C4    1 
ATOM   2280  P P     . DA  B 2 7   ? -12.833 -39.404 21.048   1.00 72.28  ?  7   DA  B P     1 
ATOM   2281  O OP1   . DA  B 2 7   ? -13.802 -40.519 20.965   1.00 49.07  ?  7   DA  B OP1   1 
ATOM   2282  O OP2   . DA  B 2 7   ? -11.714 -39.325 20.082   1.00 82.32  -1 7   DA  B OP2   1 
ATOM   2283  O "O5'" . DA  B 2 7   ? -13.648 -38.028 20.989   1.00 60.95  ?  7   DA  B "O5'" 1 
ATOM   2284  C "C5'" . DA  B 2 7   ? -14.764 -37.825 21.846   1.00 50.98  ?  7   DA  B "C5'" 1 
ATOM   2285  C "C4'" . DA  B 2 7   ? -15.277 -36.400 21.745   1.00 61.10  ?  7   DA  B "C4'" 1 
ATOM   2286  O "O4'" . DA  B 2 7   ? -14.331 -35.482 22.365   1.00 61.09  ?  7   DA  B "O4'" 1 
ATOM   2287  C "C3'" . DA  B 2 7   ? -15.473 -35.872 20.312   1.00 80.73  ?  7   DA  B "C3'" 1 
ATOM   2288  O "O3'" . DA  B 2 7   ? -16.646 -35.078 20.240   1.00 75.63  ?  7   DA  B "O3'" 1 
ATOM   2289  C "C2'" . DA  B 2 7   ? -14.255 -34.975 20.137   1.00 77.34  ?  7   DA  B "C2'" 1 
ATOM   2290  C "C1'" . DA  B 2 7   ? -14.241 -34.369 21.518   1.00 60.38  ?  7   DA  B "C1'" 1 
ATOM   2291  N N9    . DA  B 2 7   ? -13.071 -33.558 21.834   1.00 67.34  ?  7   DA  B N9    1 
ATOM   2292  C C8    . DA  B 2 7   ? -11.787 -33.733 21.399   1.00 63.57  ?  7   DA  B C8    1 
ATOM   2293  N N7    . DA  B 2 7   ? -10.953 -32.812 21.835   1.00 57.97  ?  7   DA  B N7    1 
ATOM   2294  C C5    . DA  B 2 7   ? -11.754 -31.971 22.594   1.00 58.87  ?  7   DA  B C5    1 
ATOM   2295  C C6    . DA  B 2 7   ? -11.483 -30.795 23.329   1.00 59.27  ?  7   DA  B C6    1 
ATOM   2296  N N6    . DA  B 2 7   ? -10.268 -30.241 23.429   1.00 64.41  ?  7   DA  B N6    1 
ATOM   2297  N N1    . DA  B 2 7   ? -12.516 -30.214 23.972   1.00 55.67  ?  7   DA  B N1    1 
ATOM   2298  C C2    . DA  B 2 7   ? -13.731 -30.759 23.878   1.00 52.05  ?  7   DA  B C2    1 
ATOM   2299  N N3    . DA  B 2 7   ? -14.106 -31.850 23.221   1.00 60.49  ?  7   DA  B N3    1 
ATOM   2300  C C4    . DA  B 2 7   ? -13.061 -32.414 22.595   1.00 62.51  ?  7   DA  B C4    1 
ATOM   2301  P P     . DA  B 2 8   ? -18.039 -35.692 19.730   1.00 88.38  ?  8   DA  B P     1 
ATOM   2302  O OP1   . DA  B 2 8   ? -18.319 -36.912 20.519   1.00 79.61  ?  8   DA  B OP1   1 
ATOM   2303  O OP2   . DA  B 2 8   ? -17.984 -35.773 18.255   1.00 88.53  -1 8   DA  B OP2   1 
ATOM   2304  O "O5'" . DA  B 2 8   ? -19.102 -34.567 20.131   1.00 52.74  ?  8   DA  B "O5'" 1 
ATOM   2305  C "C5'" . DA  B 2 8   ? -19.368 -34.292 21.493   1.00 67.64  ?  8   DA  B "C5'" 1 
ATOM   2306  C "C4'" . DA  B 2 8   ? -19.428 -32.795 21.750   1.00 82.35  ?  8   DA  B "C4'" 1 
ATOM   2307  O "O4'" . DA  B 2 8   ? -18.088 -32.258 21.909   1.00 75.13  ?  8   DA  B "O4'" 1 
ATOM   2308  C "C3'" . DA  B 2 8   ? -20.096 -31.953 20.657   1.00 76.25  ?  8   DA  B "C3'" 1 
ATOM   2309  O "O3'" . DA  B 2 8   ? -20.909 -30.969 21.261   1.00 99.69  ?  8   DA  B "O3'" 1 
ATOM   2310  C "C2'" . DA  B 2 8   ? -18.905 -31.308 19.956   1.00 76.49  ?  8   DA  B "C2'" 1 
ATOM   2311  C "C1'" . DA  B 2 8   ? -17.977 -31.089 21.136   1.00 63.52  ?  8   DA  B "C1'" 1 
ATOM   2312  N N9    . DA  B 2 8   ? -16.582 -30.895 20.772   1.00 67.17  ?  8   DA  B N9    1 
ATOM   2313  C C8    . DA  B 2 8   ? -15.805 -31.724 20.017   1.00 71.18  ?  8   DA  B C8    1 
ATOM   2314  N N7    . DA  B 2 8   ? -14.579 -31.291 19.849   1.00 64.43  ?  8   DA  B N7    1 
ATOM   2315  C C5    . DA  B 2 8   ? -14.553 -30.089 20.537   1.00 57.80  ?  8   DA  B C5    1 
ATOM   2316  C C6    . DA  B 2 8   ? -13.537 -29.135 20.740   1.00 59.44  ?  8   DA  B C6    1 
ATOM   2317  N N6    . DA  B 2 8   ? -12.306 -29.262 20.243   1.00 65.23  ?  8   DA  B N6    1 
ATOM   2318  N N1    . DA  B 2 8   ? -13.838 -28.044 21.476   1.00 55.19  ?  8   DA  B N1    1 
ATOM   2319  C C2    . DA  B 2 8   ? -15.076 -27.925 21.973   1.00 67.17  ?  8   DA  B C2    1 
ATOM   2320  N N3    . DA  B 2 8   ? -16.113 -28.756 21.849   1.00 69.75  ?  8   DA  B N3    1 
ATOM   2321  C C4    . DA  B 2 8   ? -15.780 -29.828 21.111   1.00 61.23  ?  8   DA  B C4    1 
ATOM   2322  P P     . DC  B 2 9   ? -22.011 -30.169 20.410   1.00 90.58  ?  9   DC  B P     1 
ATOM   2323  O OP1   . DC  B 2 9   ? -23.206 -30.000 21.267   1.00 109.40 ?  9   DC  B OP1   1 
ATOM   2324  O OP2   . DC  B 2 9   ? -22.134 -30.831 19.093   1.00 80.17  -1 9   DC  B OP2   1 
ATOM   2325  O "O5'" . DC  B 2 9   ? -21.336 -28.737 20.176   1.00 69.32  ?  9   DC  B "O5'" 1 
ATOM   2326  C "C5'" . DC  B 2 9   ? -20.901 -27.980 21.298   1.00 80.82  ?  9   DC  B "C5'" 1 
ATOM   2327  C "C4'" . DC  B 2 9   ? -19.932 -26.888 20.880   1.00 90.32  ?  9   DC  B "C4'" 1 
ATOM   2328  O "O4'" . DC  B 2 9   ? -18.679 -27.475 20.475   1.00 86.87  ?  9   DC  B "O4'" 1 
ATOM   2329  C "C3'" . DC  B 2 9   ? -20.371 -26.024 19.689   1.00 96.47  ?  9   DC  B "C3'" 1 
ATOM   2330  O "O3'" . DC  B 2 9   ? -20.658 -24.706 20.141   1.00 117.19 ?  9   DC  B "O3'" 1 
ATOM   2331  C "C2'" . DC  B 2 9   ? -19.154 -26.045 18.744   1.00 96.60  ?  9   DC  B "C2'" 1 
ATOM   2332  C "C1'" . DC  B 2 9   ? -18.046 -26.533 19.664   1.00 85.95  ?  9   DC  B "C1'" 1 
ATOM   2333  N N1    . DC  B 2 9   ? -16.924 -27.196 18.938   1.00 79.53  ?  9   DC  B N1    1 
ATOM   2334  C C2    . DC  B 2 9   ? -15.662 -26.592 18.921   1.00 74.28  ?  9   DC  B C2    1 
ATOM   2335  O O2    . DC  B 2 9   ? -15.501 -25.523 19.517   1.00 83.08  ?  9   DC  B O2    1 
ATOM   2336  N N3    . DC  B 2 9   ? -14.649 -27.201 18.253   1.00 67.14  ?  9   DC  B N3    1 
ATOM   2337  C C4    . DC  B 2 9   ? -14.869 -28.359 17.623   1.00 71.90  ?  9   DC  B C4    1 
ATOM   2338  N N4    . DC  B 2 9   ? -13.844 -28.926 16.978   1.00 74.68  ?  9   DC  B N4    1 
ATOM   2339  C C5    . DC  B 2 9   ? -16.151 -28.987 17.628   1.00 61.11  ?  9   DC  B C5    1 
ATOM   2340  C C6    . DC  B 2 9   ? -17.139 -28.376 18.289   1.00 67.28  ?  9   DC  B C6    1 
ATOM   2341  P P     . DG  B 2 10  ? -21.202 -23.591 19.120   1.00 122.45 ?  10  DG  B P     1 
ATOM   2342  O OP1   . DG  B 2 10  ? -21.993 -22.614 19.900   1.00 120.68 ?  10  DG  B OP1   1 
ATOM   2343  O OP2   . DG  B 2 10  ? -21.822 -24.293 17.974   1.00 104.49 -1 10  DG  B OP2   1 
ATOM   2344  O "O5'" . DG  B 2 10  ? -19.878 -22.870 18.589   1.00 102.35 ?  10  DG  B "O5'" 1 
ATOM   2345  C "C5'" . DG  B 2 10  ? -18.941 -22.326 19.513   1.00 96.64  ?  10  DG  B "C5'" 1 
ATOM   2346  C "C4'" . DG  B 2 10  ? -17.797 -21.657 18.775   1.00 97.99  ?  10  DG  B "C4'" 1 
ATOM   2347  O "O4'" . DG  B 2 10  ? -16.864 -22.656 18.303   1.00 97.03  ?  10  DG  B "O4'" 1 
ATOM   2348  C "C3'" . DG  B 2 10  ? -18.218 -20.847 17.541   1.00 109.27 ?  10  DG  B "C3'" 1 
ATOM   2349  O "O3'" . DG  B 2 10  ? -17.772 -19.509 17.672   1.00 119.93 ?  10  DG  B "O3'" 1 
ATOM   2350  C "C2'" . DG  B 2 10  ? -17.516 -21.558 16.376   1.00 95.15  ?  10  DG  B "C2'" 1 
ATOM   2351  C "C1'" . DG  B 2 10  ? -16.343 -22.217 17.080   1.00 84.06  ?  10  DG  B "C1'" 1 
ATOM   2352  N N9    . DG  B 2 10  ? -15.798 -23.365 16.362   1.00 75.14  ?  10  DG  B N9    1 
ATOM   2353  C C8    . DG  B 2 10  ? -16.432 -24.556 16.099   1.00 75.69  ?  10  DG  B C8    1 
ATOM   2354  N N7    . DG  B 2 10  ? -15.695 -25.399 15.428   1.00 67.90  ?  10  DG  B N7    1 
ATOM   2355  C C5    . DG  B 2 10  ? -14.499 -24.720 15.226   1.00 64.96  ?  10  DG  B C5    1 
ATOM   2356  C C6    . DG  B 2 10  ? -13.319 -25.129 14.557   1.00 62.86  ?  10  DG  B C6    1 
ATOM   2357  O O6    . DG  B 2 10  ? -13.091 -26.208 13.994   1.00 62.24  ?  10  DG  B O6    1 
ATOM   2358  N N1    . DG  B 2 10  ? -12.340 -24.136 14.584   1.00 60.03  ?  10  DG  B N1    1 
ATOM   2359  C C2    . DG  B 2 10  ? -12.488 -22.906 15.182   1.00 66.48  ?  10  DG  B C2    1 
ATOM   2360  N N2    . DG  B 2 10  ? -11.437 -22.078 15.107   1.00 71.67  ?  10  DG  B N2    1 
ATOM   2361  N N3    . DG  B 2 10  ? -13.588 -22.512 15.810   1.00 66.27  ?  10  DG  B N3    1 
ATOM   2362  C C4    . DG  B 2 10  ? -14.548 -23.466 15.793   1.00 67.19  ?  10  DG  B C4    1 
ATOM   2363  P P     . DT  B 2 11  ? -18.219 -18.390 16.608   1.00 133.54 ?  11  DT  B P     1 
ATOM   2364  O OP1   . DT  B 2 11  ? -18.066 -17.070 17.261   1.00 129.11 ?  11  DT  B OP1   1 
ATOM   2365  O OP2   . DT  B 2 11  ? -19.533 -18.790 16.057   1.00 103.11 -1 11  DT  B OP2   1 
ATOM   2366  O "O5'" . DT  B 2 11  ? -17.138 -18.512 15.435   1.00 104.48 ?  11  DT  B "O5'" 1 
ATOM   2367  C "C5'" . DT  B 2 11  ? -15.763 -18.329 15.721   1.00 90.21  ?  11  DT  B "C5'" 1 
ATOM   2368  C "C4'" . DT  B 2 11  ? -14.931 -18.372 14.452   1.00 105.18 ?  11  DT  B "C4'" 1 
ATOM   2369  O "O4'" . DT  B 2 11  ? -14.598 -19.754 14.134   1.00 101.28 ?  11  DT  B "O4'" 1 
ATOM   2370  C "C3'" . DT  B 2 11  ? -15.612 -17.816 13.191   1.00 113.27 ?  11  DT  B "C3'" 1 
ATOM   2371  O "O3'" . DT  B 2 11  ? -14.663 -17.103 12.433   1.00 118.36 ?  11  DT  B "O3'" 1 
ATOM   2372  C "C2'" . DT  B 2 11  ? -15.998 -19.086 12.444   1.00 92.44  ?  11  DT  B "C2'" 1 
ATOM   2373  C "C1'" . DT  B 2 11  ? -14.775 -19.923 12.752   1.00 83.90  ?  11  DT  B "C1'" 1 
ATOM   2374  N N1    . DT  B 2 11  ? -14.919 -21.364 12.424   1.00 59.08  ?  11  DT  B N1    1 
ATOM   2375  C C2    . DT  B 2 11  ? -13.821 -22.043 11.963   1.00 63.34  ?  11  DT  B C2    1 
ATOM   2376  O O2    . DT  B 2 11  ? -12.716 -21.537 11.868   1.00 64.74  ?  11  DT  B O2    1 
ATOM   2377  N N3    . DT  B 2 11  ? -14.045 -23.354 11.665   1.00 59.92  ?  11  DT  B N3    1 
ATOM   2378  C C4    . DT  B 2 11  ? -15.236 -24.041 11.736   1.00 54.70  ?  11  DT  B C4    1 
ATOM   2379  O O4    . DT  B 2 11  ? -15.324 -25.229 11.429   1.00 57.43  ?  11  DT  B O4    1 
ATOM   2380  C C5    . DT  B 2 11  ? -16.365 -23.265 12.197   1.00 47.99  ?  11  DT  B C5    1 
ATOM   2381  C C7    . DT  B 2 11  ? -17.718 -23.901 12.321   1.00 50.97  ?  11  DT  B C7    1 
ATOM   2382  C C6    . DT  B 2 11  ? -16.157 -21.972 12.505   1.00 53.32  ?  11  DT  B C6    1 
ATOM   2383  P P     . DC  B 2 12  ? -15.010 -15.654 11.835   1.00 121.05 ?  12  DC  B P     1 
ATOM   2384  O OP1   . DC  B 2 12  ? -15.190 -14.730 12.976   1.00 115.44 ?  12  DC  B OP1   1 
ATOM   2385  O OP2   . DC  B 2 12  ? -16.092 -15.818 10.838   1.00 118.04 -1 12  DC  B OP2   1 
ATOM   2386  O "O5'" . DC  B 2 12  ? -13.670 -15.255 11.063   1.00 121.66 ?  12  DC  B "O5'" 1 
ATOM   2387  C "C5'" . DC  B 2 12  ? -12.426 -15.371 11.735   1.00 103.64 ?  12  DC  B "C5'" 1 
ATOM   2388  C "C4'" . DC  B 2 12  ? -11.323 -15.789 10.778   1.00 120.17 ?  12  DC  B "C4'" 1 
ATOM   2389  O "O4'" . DC  B 2 12  ? -11.441 -17.215 10.532   1.00 116.15 ?  12  DC  B "O4'" 1 
ATOM   2390  C "C3'" . DC  B 2 12  ? -11.368 -15.112 9.404    1.00 124.23 ?  12  DC  B "C3'" 1 
ATOM   2391  O "O3'" . DC  B 2 12  ? -10.048 -14.687 9.034    1.00 124.39 ?  12  DC  B "O3'" 1 
ATOM   2392  C "C2'" . DC  B 2 12  ? -11.933 -16.195 8.482    1.00 112.03 ?  12  DC  B "C2'" 1 
ATOM   2393  C "C1'" . DC  B 2 12  ? -11.446 -17.475 9.146    1.00 106.90 ?  12  DC  B "C1'" 1 
ATOM   2394  N N1    . DC  B 2 12  ? -12.364 -18.640 8.912    1.00 94.42  ?  12  DC  B N1    1 
ATOM   2395  C C2    . DC  B 2 12  ? -11.880 -19.807 8.306    1.00 79.87  ?  12  DC  B C2    1 
ATOM   2396  O O2    . DC  B 2 12  ? -10.690 -19.867 7.974    1.00 76.42  ?  12  DC  B O2    1 
ATOM   2397  N N3    . DC  B 2 12  ? -12.733 -20.847 8.111    1.00 70.51  ?  12  DC  B N3    1 
ATOM   2398  C C4    . DC  B 2 12  ? -14.011 -20.744 8.487    1.00 67.25  ?  12  DC  B C4    1 
ATOM   2399  N N4    . DC  B 2 12  ? -14.814 -21.792 8.276    1.00 51.63  ?  12  DC  B N4    1 
ATOM   2400  C C5    . DC  B 2 12  ? -14.520 -19.564 9.100    1.00 77.01  ?  12  DC  B C5    1 
ATOM   2401  C C6    . DC  B 2 12  ? -13.672 -18.548 9.290    1.00 89.84  ?  12  DC  B C6    1 
ATOM   2402  P P     . DG  B 2 13  ? -9.830  -13.542 7.922    1.00 161.17 ?  13  DG  B P     1 
ATOM   2403  O OP1   . DG  B 2 13  ? -9.005  -12.481 8.540    1.00 157.28 ?  13  DG  B OP1   1 
ATOM   2404  O OP2   . DG  B 2 13  ? -11.166 -13.209 7.377    1.00 138.23 -1 13  DG  B OP2   1 
ATOM   2405  O "O5'" . DG  B 2 13  ? -8.996  -14.248 6.744    1.00 146.34 ?  13  DG  B "O5'" 1 
ATOM   2406  C "C5'" . DG  B 2 13  ? -7.978  -15.179 7.087    1.00 132.32 ?  13  DG  B "C5'" 1 
ATOM   2407  C "C4'" . DG  B 2 13  ? -7.436  -15.935 5.879    1.00 134.14 ?  13  DG  B "C4'" 1 
ATOM   2408  O "O4'" . DG  B 2 13  ? -8.314  -17.066 5.643    1.00 121.84 ?  13  DG  B "O4'" 1 
ATOM   2409  C "C3'" . DG  B 2 13  ? -7.399  -15.156 4.562    1.00 137.64 ?  13  DG  B "C3'" 1 
ATOM   2410  O "O3'" . DG  B 2 13  ? -6.192  -15.482 3.815    1.00 148.70 ?  13  DG  B "O3'" 1 
ATOM   2411  C "C2'" . DG  B 2 13  ? -8.689  -15.576 3.862    1.00 120.75 ?  13  DG  B "C2'" 1 
ATOM   2412  C "C1'" . DG  B 2 13  ? -8.895  -17.001 4.354    1.00 110.10 ?  13  DG  B "C1'" 1 
ATOM   2413  N N9    . DG  B 2 13  ? -10.315 -17.276 4.541    1.00 92.95  ?  13  DG  B N9    1 
ATOM   2414  C C8    . DG  B 2 13  ? -11.255 -16.388 5.004    1.00 100.32 ?  13  DG  B C8    1 
ATOM   2415  N N7    . DG  B 2 13  ? -12.450 -16.892 5.098    1.00 90.52  ?  13  DG  B N7    1 
ATOM   2416  C C5    . DG  B 2 13  ? -12.293 -18.209 4.696    1.00 89.21  ?  13  DG  B C5    1 
ATOM   2417  C C6    . DG  B 2 13  ? -13.247 -19.245 4.599    1.00 88.94  ?  13  DG  B C6    1 
ATOM   2418  O O6    . DG  B 2 13  ? -14.460 -19.199 4.857    1.00 81.03  ?  13  DG  B O6    1 
ATOM   2419  N N1    . DG  B 2 13  ? -12.672 -20.432 4.148    1.00 72.45  ?  13  DG  B N1    1 
ATOM   2420  C C2    . DG  B 2 13  ? -11.341 -20.591 3.833    1.00 75.31  ?  13  DG  B C2    1 
ATOM   2421  N N2    . DG  B 2 13  ? -10.971 -21.809 3.415    1.00 75.89  ?  13  DG  B N2    1 
ATOM   2422  N N3    . DG  B 2 13  ? -10.436 -19.625 3.921    1.00 72.37  ?  13  DG  B N3    1 
ATOM   2423  C C4    . DG  B 2 13  ? -10.980 -18.466 4.358    1.00 79.37  ?  13  DG  B C4    1 
ATOM   2424  P P     . DT  B 2 14  ? -6.077  -14.819 2.366    1.00 154.59 ?  14  DT  B P     1 
ATOM   2425  O OP1   . DT  B 2 14  ? -4.839  -14.022 2.320    1.00 152.09 ?  14  DT  B OP1   1 
ATOM   2426  O OP2   . DT  B 2 14  ? -7.373  -14.159 2.081    1.00 125.76 -1 14  DT  B OP2   1 
ATOM   2427  O "O5'" . DT  B 2 14  ? -5.894  -16.066 1.398    1.00 135.20 ?  14  DT  B "O5'" 1 
ATOM   2428  C "C5'" . DT  B 2 14  ? -4.924  -17.085 1.706    1.00 124.67 ?  14  DT  B "C5'" 1 
ATOM   2429  C "C4'" . DT  B 2 14  ? -5.157  -18.309 0.853    1.00 113.27 ?  14  DT  B "C4'" 1 
ATOM   2430  O "O4'" . DT  B 2 14  ? -6.499  -18.810 1.054    1.00 118.72 ?  14  DT  B "O4'" 1 
ATOM   2431  C "C3'" . DT  B 2 14  ? -5.051  -18.051 -0.643   1.00 107.96 ?  14  DT  B "C3'" 1 
ATOM   2432  O "O3'" . DT  B 2 14  ? -4.723  -19.286 -1.243   1.00 101.91 ?  14  DT  B "O3'" 1 
ATOM   2433  C "C2'" . DT  B 2 14  ? -6.479  -17.765 -1.035   1.00 100.68 ?  14  DT  B "C2'" 1 
ATOM   2434  C "C1'" . DT  B 2 14  ? -7.201  -18.778 -0.177   1.00 108.19 ?  14  DT  B "C1'" 1 
ATOM   2435  N N1    . DT  B 2 14  ? -8.589  -18.408 0.100    1.00 104.17 ?  14  DT  B N1    1 
ATOM   2436  C C2    . DT  B 2 14  ? -9.479  -19.404 0.430    1.00 87.23  ?  14  DT  B C2    1 
ATOM   2437  O O2    . DT  B 2 14  ? -9.156  -20.573 0.538    1.00 74.61  ?  14  DT  B O2    1 
ATOM   2438  N N3    . DT  B 2 14  ? -10.765 -18.975 0.642    1.00 85.21  ?  14  DT  B N3    1 
ATOM   2439  C C4    . DT  B 2 14  ? -11.236 -17.680 0.549    1.00 94.78  ?  14  DT  B C4    1 
ATOM   2440  O O4    . DT  B 2 14  ? -12.419 -17.443 0.772    1.00 83.60  ?  14  DT  B O4    1 
ATOM   2441  C C5    . DT  B 2 14  ? -10.247 -16.688 0.187    1.00 98.76  ?  14  DT  B C5    1 
ATOM   2442  C C7    . DT  B 2 14  ? -10.665 -15.258 0.068    1.00 110.18 ?  14  DT  B C7    1 
ATOM   2443  C C6    . DT  B 2 14  ? -8.991  -17.097 -0.022   1.00 97.42  ?  14  DT  B C6    1 
ATOM   2444  P P     . DA  B 2 15  ? -3.411  -19.411 -2.150   1.00 123.60 ?  15  DA  B P     1 
ATOM   2445  O OP1   . DA  B 2 15  ? -2.226  -19.248 -1.270   1.00 135.21 ?  15  DA  B OP1   1 
ATOM   2446  O OP2   . DA  B 2 15  ? -3.579  -18.523 -3.328   1.00 113.22 -1 15  DA  B OP2   1 
ATOM   2447  O "O5'" . DA  B 2 15  ? -3.461  -20.924 -2.647   1.00 94.86  ?  15  DA  B "O5'" 1 
ATOM   2448  C "C5'" . DA  B 2 15  ? -3.326  -22.013 -1.715   1.00 76.54  ?  15  DA  B "C5'" 1 
ATOM   2449  C "C4'" . DA  B 2 15  ? -4.580  -22.856 -1.712   1.00 83.92  ?  15  DA  B "C4'" 1 
ATOM   2450  O "O4'" . DA  B 2 15  ? -5.740  -21.993 -1.662   1.00 86.99  ?  15  DA  B "O4'" 1 
ATOM   2451  C "C3'" . DA  B 2 15  ? -4.763  -23.732 -2.951   1.00 68.89  ?  15  DA  B "C3'" 1 
ATOM   2452  O "O3'" . DA  B 2 15  ? -5.392  -24.968 -2.597   1.00 54.34  ?  15  DA  B "O3'" 1 
ATOM   2453  C "C2'" . DA  B 2 15  ? -5.679  -22.900 -3.829   1.00 78.30  ?  15  DA  B "C2'" 1 
ATOM   2454  C "C1'" . DA  B 2 15  ? -6.555  -22.196 -2.808   1.00 81.36  ?  15  DA  B "C1'" 1 
ATOM   2455  N N9    . DA  B 2 15  ? -7.051  -20.890 -3.241   1.00 88.12  ?  15  DA  B N9    1 
ATOM   2456  C C8    . DA  B 2 15  ? -6.332  -19.859 -3.796   1.00 95.53  ?  15  DA  B C8    1 
ATOM   2457  N N7    . DA  B 2 15  ? -7.056  -18.805 -4.084   1.00 88.50  ?  15  DA  B N7    1 
ATOM   2458  C C5    . DA  B 2 15  ? -8.338  -19.164 -3.694   1.00 78.06  ?  15  DA  B C5    1 
ATOM   2459  C C6    . DA  B 2 15  ? -9.572  -18.481 -3.735   1.00 80.23  ?  15  DA  B C6    1 
ATOM   2460  N N6    . DA  B 2 15  ? -9.715  -17.241 -4.209   1.00 93.35  ?  15  DA  B N6    1 
ATOM   2461  N N1    . DA  B 2 15  ? -10.667 -19.124 -3.265   1.00 65.98  ?  15  DA  B N1    1 
ATOM   2462  C C2    . DA  B 2 15  ? -10.523 -20.371 -2.788   1.00 76.45  ?  15  DA  B C2    1 
ATOM   2463  N N3    . DA  B 2 15  ? -9.418  -21.116 -2.698   1.00 83.51  ?  15  DA  B N3    1 
ATOM   2464  C C4    . DA  B 2 15  ? -8.349  -20.448 -3.172   1.00 81.74  ?  15  DA  B C4    1 
ATOM   2465  P P     . DT  B 2 16  ? -5.134  -26.278 -3.478   1.00 93.50  ?  16  DT  B P     1 
ATOM   2466  O OP1   . DT  B 2 16  ? -3.840  -26.840 -3.014   1.00 107.03 ?  16  DT  B OP1   1 
ATOM   2467  O OP2   . DT  B 2 16  ? -5.312  -25.926 -4.910   1.00 96.23  -1 16  DT  B OP2   1 
ATOM   2468  O "O5'" . DT  B 2 16  ? -6.296  -27.283 -3.057   1.00 77.19  ?  16  DT  B "O5'" 1 
ATOM   2469  O OP1   . DC  C 3 1   ? -14.977 -23.959 -51.486  1.00 54.39  ?  1   DC  C OP1   1 
ATOM   2470  O OP2   . DC  C 3 1   ? -18.186 -27.286 -47.911  1.00 75.39  ?  1   DC  C OP2   1 
ATOM   2471  O "O5'" . DC  C 3 1   ? -16.829 -19.464 -44.391  1.00 93.37  ?  1   DC  C "O5'" 1 
ATOM   2472  C "C5'" . DC  C 3 1   ? -17.915 -20.051 -45.101  1.00 79.24  ?  1   DC  C "C5'" 1 
ATOM   2473  C "C4'" . DC  C 3 1   ? -18.175 -21.466 -44.613  1.00 76.10  ?  1   DC  C "C4'" 1 
ATOM   2474  O "O4'" . DC  C 3 1   ? -17.248 -22.389 -45.223  1.00 56.55  ?  1   DC  C "O4'" 1 
ATOM   2475  C "C3'" . DC  C 3 1   ? -17.998 -21.656 -43.115  1.00 81.06  ?  1   DC  C "C3'" 1 
ATOM   2476  O "O3'" . DC  C 3 1   ? -19.197 -21.250 -42.413  1.00 86.07  ?  1   DC  C "O3'" 1 
ATOM   2477  C "C2'" . DC  C 3 1   ? -17.745 -23.159 -43.017  1.00 74.52  ?  1   DC  C "C2'" 1 
ATOM   2478  C "C1'" . DC  C 3 1   ? -17.013 -23.466 -44.334  1.00 57.95  ?  1   DC  C "C1'" 1 
ATOM   2479  N N1    . DC  C 3 1   ? -15.549 -23.697 -44.185  1.00 42.78  ?  1   DC  C N1    1 
ATOM   2480  C C2    . DC  C 3 1   ? -15.071 -25.009 -44.182  1.00 43.74  ?  1   DC  C C2    1 
ATOM   2481  O O2    . DC  C 3 1   ? -15.874 -25.936 -44.317  1.00 53.49  ?  1   DC  C O2    1 
ATOM   2482  N N3    . DC  C 3 1   ? -13.745 -25.229 -44.038  1.00 30.95  ?  1   DC  C N3    1 
ATOM   2483  C C4    . DC  C 3 1   ? -12.913 -24.200 -43.899  1.00 38.26  ?  1   DC  C C4    1 
ATOM   2484  N N4    . DC  C 3 1   ? -11.611 -24.469 -43.760  1.00 40.51  ?  1   DC  C N4    1 
ATOM   2485  C C5    . DC  C 3 1   ? -13.379 -22.848 -43.895  1.00 42.68  ?  1   DC  C C5    1 
ATOM   2486  C C6    . DC  C 3 1   ? -14.695 -22.645 -44.038  1.00 40.90  ?  1   DC  C C6    1 
ATOM   2487  P P     . DA  C 3 2   ? -20.549 -22.134 -42.451  1.00 107.30 ?  2   DA  C P     1 
ATOM   2488  O OP1   . DA  C 3 2   ? -20.767 -22.750 -43.780  1.00 96.83  ?  2   DA  C OP1   1 
ATOM   2489  O OP2   . DA  C 3 2   ? -21.605 -21.269 -41.880  1.00 88.51  -1 2   DA  C OP2   1 
ATOM   2490  O "O5'" . DA  C 3 2   ? -20.272 -23.287 -41.373  1.00 75.87  ?  2   DA  C "O5'" 1 
ATOM   2491  C "C5'" . DA  C 3 2   ? -20.772 -24.622 -41.533  1.00 70.65  ?  2   DA  C "C5'" 1 
ATOM   2492  C "C4'" . DA  C 3 2   ? -20.068 -25.553 -40.552  1.00 65.81  ?  2   DA  C "C4'" 1 
ATOM   2493  O "O4'" . DA  C 3 2   ? -18.630 -25.545 -40.790  1.00 61.61  ?  2   DA  C "O4'" 1 
ATOM   2494  C "C3'" . DA  C 3 2   ? -20.243 -25.153 -39.080  1.00 64.65  ?  2   DA  C "C3'" 1 
ATOM   2495  O "O3'" . DA  C 3 2   ? -20.197 -26.287 -38.234  1.00 53.64  ?  2   DA  C "O3'" 1 
ATOM   2496  C "C2'" . DA  C 3 2   ? -18.979 -24.337 -38.846  1.00 72.47  ?  2   DA  C "C2'" 1 
ATOM   2497  C "C1'" . DA  C 3 2   ? -18.004 -25.249 -39.564  1.00 56.87  ?  2   DA  C "C1'" 1 
ATOM   2498  N N9    . DA  C 3 2   ? -16.673 -24.700 -39.789  1.00 44.71  ?  2   DA  C N9    1 
ATOM   2499  C C8    . DA  C 3 2   ? -16.311 -23.383 -39.815  1.00 59.89  ?  2   DA  C C8    1 
ATOM   2500  N N7    . DA  C 3 2   ? -15.024 -23.194 -39.995  1.00 60.73  ?  2   DA  C N7    1 
ATOM   2501  C C5    . DA  C 3 2   ? -14.502 -24.477 -40.035  1.00 50.98  ?  2   DA  C C5    1 
ATOM   2502  C C6    . DA  C 3 2   ? -13.188 -24.965 -40.190  1.00 49.49  ?  2   DA  C C6    1 
ATOM   2503  N N6    . DA  C 3 2   ? -12.121 -24.174 -40.340  1.00 47.24  ?  2   DA  C N6    1 
ATOM   2504  N N1    . DA  C 3 2   ? -13.014 -26.304 -40.185  1.00 44.09  ?  2   DA  C N1    1 
ATOM   2505  C C2    . DA  C 3 2   ? -14.084 -27.092 -40.032  1.00 43.96  ?  2   DA  C C2    1 
ATOM   2506  N N3    . DA  C 3 2   ? -15.362 -26.750 -39.882  1.00 40.19  ?  2   DA  C N3    1 
ATOM   2507  C C4    . DA  C 3 2   ? -15.503 -25.415 -39.891  1.00 41.96  ?  2   DA  C C4    1 
ATOM   2508  P P     . DA  C 3 3   ? -21.527 -26.987 -37.673  1.00 51.61  ?  3   DA  C P     1 
ATOM   2509  O OP1   . DA  C 3 3   ? -22.399 -27.298 -38.826  1.00 59.33  ?  3   DA  C OP1   1 
ATOM   2510  O OP2   . DA  C 3 3   ? -22.046 -26.179 -36.548  1.00 84.37  -1 3   DA  C OP2   1 
ATOM   2511  O "O5'" . DA  C 3 3   ? -20.960 -28.359 -37.080  1.00 55.87  ?  3   DA  C "O5'" 1 
ATOM   2512  C "C5'" . DA  C 3 3   ? -20.235 -29.253 -37.896  1.00 41.54  ?  3   DA  C "C5'" 1 
ATOM   2513  C "C4'" . DA  C 3 3   ? -18.937 -29.663 -37.212  1.00 40.07  ?  3   DA  C "C4'" 1 
ATOM   2514  O "O4'" . DA  C 3 3   ? -17.894 -28.716 -37.529  1.00 46.41  ?  3   DA  C "O4'" 1 
ATOM   2515  C "C3'" . DA  C 3 3   ? -18.980 -29.755 -35.674  1.00 61.31  ?  3   DA  C "C3'" 1 
ATOM   2516  O "O3'" . DA  C 3 3   ? -18.742 -31.099 -35.268  1.00 70.33  ?  3   DA  C "O3'" 1 
ATOM   2517  C "C2'" . DA  C 3 3   ? -17.869 -28.809 -35.187  1.00 52.55  ?  3   DA  C "C2'" 1 
ATOM   2518  C "C1'" . DA  C 3 3   ? -17.024 -28.610 -36.433  1.00 44.74  ?  3   DA  C "C1'" 1 
ATOM   2519  N N9    . DA  C 3 3   ? -16.326 -27.328 -36.492  1.00 38.71  ?  3   DA  C N9    1 
ATOM   2520  C C8    . DA  C 3 3   ? -16.874 -26.077 -36.418  1.00 39.57  ?  3   DA  C C8    1 
ATOM   2521  N N7    . DA  C 3 3   ? -15.989 -25.107 -36.494  1.00 40.51  ?  3   DA  C N7    1 
ATOM   2522  C C5    . DA  C 3 3   ? -14.777 -25.771 -36.606  1.00 42.50  ?  3   DA  C C5    1 
ATOM   2523  C C6    . DA  C 3 3   ? -13.443 -25.317 -36.720  1.00 46.80  ?  3   DA  C C6    1 
ATOM   2524  N N6    . DA  C 3 3   ? -13.093 -24.024 -36.741  1.00 38.11  ?  3   DA  C N6    1 
ATOM   2525  N N1    . DA  C 3 3   ? -12.477 -26.251 -36.814  1.00 52.69  ?  3   DA  C N1    1 
ATOM   2526  C C2    . DA  C 3 3   ? -12.817 -27.543 -36.794  1.00 49.40  ?  3   DA  C C2    1 
ATOM   2527  N N3    . DA  C 3 3   ? -14.025 -28.088 -36.693  1.00 39.35  ?  3   DA  C N3    1 
ATOM   2528  C C4    . DA  C 3 3   ? -14.970 -27.140 -36.601  1.00 39.76  ?  3   DA  C C4    1 
ATOM   2529  P P     . DA  C 3 4   ? -18.699 -31.512 -33.712  1.00 45.72  ?  4   DA  C P     1 
ATOM   2530  O OP1   . DA  C 3 4   ? -19.147 -32.917 -33.596  1.00 51.02  ?  4   DA  C OP1   1 
ATOM   2531  O OP2   . DA  C 3 4   ? -19.401 -30.461 -32.942  1.00 30.88  -1 4   DA  C OP2   1 
ATOM   2532  O "O5'" . DA  C 3 4   ? -17.135 -31.419 -33.371  1.00 29.92  ?  4   DA  C "O5'" 1 
ATOM   2533  C "C5'" . DA  C 3 4   ? -16.218 -32.208 -34.117  1.00 24.25  ?  4   DA  C "C5'" 1 
ATOM   2534  C "C4'" . DA  C 3 4   ? -14.785 -31.993 -33.663  1.00 29.99  ?  4   DA  C "C4'" 1 
ATOM   2535  O "O4'" . DA  C 3 4   ? -14.344 -30.669 -34.058  1.00 42.12  ?  4   DA  C "O4'" 1 
ATOM   2536  C "C3'" . DA  C 3 4   ? -14.548 -32.086 -32.156  1.00 42.76  ?  4   DA  C "C3'" 1 
ATOM   2537  O "O3'" . DA  C 3 4   ? -13.483 -32.999 -31.909  1.00 45.73  ?  4   DA  C "O3'" 1 
ATOM   2538  C "C2'" . DA  C 3 4   ? -14.189 -30.668 -31.717  1.00 48.18  ?  4   DA  C "C2'" 1 
ATOM   2539  C "C1'" . DA  C 3 4   ? -13.654 -30.056 -32.992  1.00 26.81  ?  4   DA  C "C1'" 1 
ATOM   2540  N N9    . DA  C 3 4   ? -13.814 -28.606 -33.066  1.00 33.62  ?  4   DA  C N9    1 
ATOM   2541  C C8    . DA  C 3 4   ? -14.963 -27.882 -32.901  1.00 42.08  ?  4   DA  C C8    1 
ATOM   2542  N N7    . DA  C 3 4   ? -14.790 -26.582 -33.011  1.00 39.72  ?  4   DA  C N7    1 
ATOM   2543  C C5    . DA  C 3 4   ? -13.432 -26.449 -33.248  1.00 38.95  ?  4   DA  C C5    1 
ATOM   2544  C C6    . DA  C 3 4   ? -12.604 -25.326 -33.454  1.00 41.17  ?  4   DA  C C6    1 
ATOM   2545  N N6    . DA  C 3 4   ? -13.047 -24.063 -33.456  1.00 44.94  ?  4   DA  C N6    1 
ATOM   2546  N N1    . DA  C 3 4   ? -11.294 -25.554 -33.660  1.00 39.96  ?  4   DA  C N1    1 
ATOM   2547  C C2    . DA  C 3 4   ? -10.843 -26.810 -33.661  1.00 43.19  ?  4   DA  C C2    1 
ATOM   2548  N N3    . DA  C 3 4   ? -11.517 -27.939 -33.482  1.00 41.53  ?  4   DA  C N3    1 
ATOM   2549  C C4    . DA  C 3 4   ? -12.818 -27.687 -33.277  1.00 36.92  ?  4   DA  C C4    1 
ATOM   2550  P P     . DT  C 3 5   ? -13.084 -33.397 -30.407  1.00 61.77  ?  5   DT  C P     1 
ATOM   2551  O OP1   . DT  C 3 5   ? -12.453 -34.734 -30.466  1.00 56.67  ?  5   DT  C OP1   1 
ATOM   2552  O OP2   . DT  C 3 5   ? -14.258 -33.178 -29.533  1.00 53.73  -1 5   DT  C OP2   1 
ATOM   2553  O "O5'" . DT  C 3 5   ? -11.967 -32.313 -30.020  1.00 55.84  ?  5   DT  C "O5'" 1 
ATOM   2554  C "C5'" . DT  C 3 5   ? -10.797 -32.161 -30.826  1.00 36.72  ?  5   DT  C "C5'" 1 
ATOM   2555  C "C4'" . DT  C 3 5   ? -9.977  -30.956 -30.380  1.00 40.36  ?  5   DT  C "C4'" 1 
ATOM   2556  O "O4'" . DT  C 3 5   ? -10.610 -29.711 -30.798  1.00 44.84  ?  5   DT  C "O4'" 1 
ATOM   2557  C "C3'" . DT  C 3 5   ? -9.782  -30.817 -28.861  1.00 60.92  ?  5   DT  C "C3'" 1 
ATOM   2558  O "O3'" . DT  C 3 5   ? -8.515  -30.256 -28.599  1.00 76.69  ?  5   DT  C "O3'" 1 
ATOM   2559  C "C2'" . DT  C 3 5   ? -10.836 -29.775 -28.519  1.00 59.26  ?  5   DT  C "C2'" 1 
ATOM   2560  C "C1'" . DT  C 3 5   ? -10.569 -28.856 -29.686  1.00 41.29  ?  5   DT  C "C1'" 1 
ATOM   2561  N N1    . DT  C 3 5   ? -11.492 -27.703 -29.841  1.00 43.77  ?  5   DT  C N1    1 
ATOM   2562  C C2    . DT  C 3 5   ? -10.963 -26.504 -30.245  1.00 48.69  ?  5   DT  C C2    1 
ATOM   2563  O O2    . DT  C 3 5   ? -9.780  -26.348 -30.494  1.00 46.99  ?  5   DT  C O2    1 
ATOM   2564  N N3    . DT  C 3 5   ? -11.864 -25.485 -30.347  1.00 48.97  ?  5   DT  C N3    1 
ATOM   2565  C C4    . DT  C 3 5   ? -13.217 -25.534 -30.090  1.00 55.53  ?  5   DT  C C4    1 
ATOM   2566  O O4    . DT  C 3 5   ? -13.942 -24.547 -30.219  1.00 63.51  ?  5   DT  C O4    1 
ATOM   2567  C C5    . DT  C 3 5   ? -13.716 -26.825 -29.662  1.00 53.97  ?  5   DT  C C5    1 
ATOM   2568  C C7    . DT  C 3 5   ? -15.173 -27.008 -29.351  1.00 55.99  ?  5   DT  C C7    1 
ATOM   2569  C C6    . DT  C 3 5   ? -12.835 -27.839 -29.554  1.00 42.40  ?  5   DT  C C6    1 
ATOM   2570  P P     . DG  C 3 6   ? -7.345  -31.083 -27.882  1.00 85.46  ?  6   DG  C P     1 
ATOM   2571  O OP1   . DG  C 3 6   ? -7.102  -32.304 -28.684  1.00 47.99  ?  6   DG  C OP1   1 
ATOM   2572  O OP2   . DG  C 3 6   ? -7.659  -31.187 -26.439  1.00 72.56  -1 6   DG  C OP2   1 
ATOM   2573  O "O5'" . DG  C 3 6   ? -6.083  -30.119 -28.058  1.00 47.21  ?  6   DG  C "O5'" 1 
ATOM   2574  C "C5'" . DG  C 3 6   ? -5.705  -29.650 -29.343  1.00 46.29  ?  6   DG  C "C5'" 1 
ATOM   2575  C "C4'" . DG  C 3 6   ? -5.161  -28.228 -29.275  1.00 52.13  ?  6   DG  C "C4'" 1 
ATOM   2576  O "O4'" . DG  C 3 6   ? -6.245  -27.262 -29.387  1.00 48.75  ?  6   DG  C "O4'" 1 
ATOM   2577  C "C3'" . DG  C 3 6   ? -4.398  -27.883 -27.999  1.00 50.47  ?  6   DG  C "C3'" 1 
ATOM   2578  O "O3'" . DG  C 3 6   ? -3.265  -27.101 -28.303  1.00 70.46  ?  6   DG  C "O3'" 1 
ATOM   2579  C "C2'" . DG  C 3 6   ? -5.425  -27.071 -27.202  1.00 53.18  ?  6   DG  C "C2'" 1 
ATOM   2580  C "C1'" . DG  C 3 6   ? -6.187  -26.348 -28.310  1.00 51.83  ?  6   DG  C "C1'" 1 
ATOM   2581  N N9    . DG  C 3 6   ? -7.561  -25.980 -27.947  1.00 54.51  ?  6   DG  C N9    1 
ATOM   2582  C C8    . DG  C 3 6   ? -8.581  -26.844 -27.636  1.00 58.54  ?  6   DG  C C8    1 
ATOM   2583  N N7    . DG  C 3 6   ? -9.708  -26.248 -27.365  1.00 60.31  ?  6   DG  C N7    1 
ATOM   2584  C C5    . DG  C 3 6   ? -9.429  -24.897 -27.517  1.00 49.05  ?  6   DG  C C5    1 
ATOM   2585  C C6    . DG  C 3 6   ? -10.275 -23.770 -27.355  1.00 52.73  ?  6   DG  C C6    1 
ATOM   2586  O O6    . DG  C 3 6   ? -11.471 -23.750 -27.036  1.00 64.04  ?  6   DG  C O6    1 
ATOM   2587  N N1    . DG  C 3 6   ? -9.606  -22.577 -27.604  1.00 46.40  ?  6   DG  C N1    1 
ATOM   2588  C C2    . DG  C 3 6   ? -8.283  -22.480 -27.960  1.00 50.55  ?  6   DG  C C2    1 
ATOM   2589  N N2    . DG  C 3 6   ? -7.819  -21.235 -28.157  1.00 48.49  ?  6   DG  C N2    1 
ATOM   2590  N N3    . DG  C 3 6   ? -7.471  -23.530 -28.118  1.00 55.85  ?  6   DG  C N3    1 
ATOM   2591  C C4    . DG  C 3 6   ? -8.112  -24.706 -27.880  1.00 49.27  ?  6   DG  C C4    1 
ATOM   2592  P P     . DC  C 3 7   ? -2.190  -26.785 -27.153  1.00 63.32  ?  7   DC  C P     1 
ATOM   2593  O OP1   . DC  C 3 7   ? -0.904  -26.472 -27.813  1.00 95.44  ?  7   DC  C OP1   1 
ATOM   2594  O OP2   . DC  C 3 7   ? -2.258  -27.879 -26.160  1.00 57.31  -1 7   DC  C OP2   1 
ATOM   2595  O "O5'" . DC  C 3 7   ? -2.740  -25.463 -26.452  1.00 45.33  ?  7   DC  C "O5'" 1 
ATOM   2596  C "C5'" . DC  C 3 7   ? -2.792  -24.265 -27.203  1.00 64.11  ?  7   DC  C "C5'" 1 
ATOM   2597  C "C4'" . DC  C 3 7   ? -3.470  -23.157 -26.427  1.00 64.79  ?  7   DC  C "C4'" 1 
ATOM   2598  O "O4'" . DC  C 3 7   ? -4.876  -23.435 -26.301  1.00 65.77  ?  7   DC  C "O4'" 1 
ATOM   2599  C "C3'" . DC  C 3 7   ? -2.945  -22.958 -25.004  1.00 53.61  ?  7   DC  C "C3'" 1 
ATOM   2600  O "O3'" . DC  C 3 7   ? -2.260  -21.722 -24.937  1.00 57.10  ?  7   DC  C "O3'" 1 
ATOM   2601  C "C2'" . DC  C 3 7   ? -4.209  -22.970 -24.119  1.00 53.52  ?  7   DC  C "C2'" 1 
ATOM   2602  C "C1'" . DC  C 3 7   ? -5.334  -22.815 -25.134  1.00 48.85  ?  7   DC  C "C1'" 1 
ATOM   2603  N N1    . DC  C 3 7   ? -6.626  -23.455 -24.735  1.00 44.02  ?  7   DC  C N1    1 
ATOM   2604  C C2    . DC  C 3 7   ? -7.760  -22.658 -24.569  1.00 40.98  ?  7   DC  C C2    1 
ATOM   2605  O O2    . DC  C 3 7   ? -7.656  -21.441 -24.721  1.00 43.15  ?  7   DC  C O2    1 
ATOM   2606  N N3    . DC  C 3 7   ? -8.934  -23.242 -24.221  1.00 42.62  ?  7   DC  C N3    1 
ATOM   2607  C C4    . DC  C 3 7   ? -8.997  -24.565 -24.063  1.00 50.96  ?  7   DC  C C4    1 
ATOM   2608  N N4    . DC  C 3 7   ? -10.176 -25.100 -23.724  1.00 51.76  ?  7   DC  C N4    1 
ATOM   2609  C C5    . DC  C 3 7   ? -7.852  -25.400 -24.244  1.00 44.39  ?  7   DC  C C5    1 
ATOM   2610  C C6    . DC  C 3 7   ? -6.700  -24.809 -24.582  1.00 43.70  ?  7   DC  C C6    1 
ATOM   2611  P P     . DT  C 3 8   ? -1.459  -21.290 -23.614  1.00 61.80  ?  8   DT  C P     1 
ATOM   2612  O OP1   . DT  C 3 8   ? -0.276  -20.508 -24.035  1.00 65.08  ?  8   DT  C OP1   1 
ATOM   2613  O OP2   . DT  C 3 8   ? -1.283  -22.497 -22.775  1.00 65.97  -1 8   DT  C OP2   1 
ATOM   2614  O "O5'" . DT  C 3 8   ? -2.473  -20.320 -22.860  1.00 57.74  ?  8   DT  C "O5'" 1 
ATOM   2615  C "C5'" . DT  C 3 8   ? -3.044  -19.248 -23.583  1.00 45.83  ?  8   DT  C "C5'" 1 
ATOM   2616  C "C4'" . DT  C 3 8   ? -4.172  -18.600 -22.812  1.00 64.20  ?  8   DT  C "C4'" 1 
ATOM   2617  O "O4'" . DT  C 3 8   ? -5.314  -19.484 -22.773  1.00 71.06  ?  8   DT  C "O4'" 1 
ATOM   2618  C "C3'" . DT  C 3 8   ? -3.849  -18.273 -21.346  1.00 71.77  ?  8   DT  C "C3'" 1 
ATOM   2619  O "O3'" . DT  C 3 8   ? -3.992  -16.885 -21.164  1.00 77.86  ?  8   DT  C "O3'" 1 
ATOM   2620  C "C2'" . DT  C 3 8   ? -4.898  -19.068 -20.549  1.00 53.24  ?  8   DT  C "C2'" 1 
ATOM   2621  C "C1'" . DT  C 3 8   ? -5.999  -19.232 -21.580  1.00 57.44  ?  8   DT  C "C1'" 1 
ATOM   2622  N N1    . DT  C 3 8   ? -6.918  -20.380 -21.307  1.00 44.87  ?  8   DT  C N1    1 
ATOM   2623  C C2    . DT  C 3 8   ? -8.273  -20.151 -21.212  1.00 44.20  ?  8   DT  C C2    1 
ATOM   2624  O O2    . DT  C 3 8   ? -8.776  -19.048 -21.332  1.00 43.59  ?  8   DT  C O2    1 
ATOM   2625  N N3    . DT  C 3 8   ? -9.025  -21.267 -20.965  1.00 37.72  ?  8   DT  C N3    1 
ATOM   2626  C C4    . DT  C 3 8   ? -8.573  -22.564 -20.810  1.00 38.45  ?  8   DT  C C4    1 
ATOM   2627  O O4    . DT  C 3 8   ? -9.333  -23.503 -20.590  1.00 37.29  ?  8   DT  C O4    1 
ATOM   2628  C C5    . DT  C 3 8   ? -7.145  -22.736 -20.924  1.00 33.38  ?  8   DT  C C5    1 
ATOM   2629  C C7    . DT  C 3 8   ? -6.538  -24.099 -20.775  1.00 33.87  ?  8   DT  C C7    1 
ATOM   2630  C C6    . DT  C 3 8   ? -6.394  -21.649 -21.165  1.00 38.33  ?  8   DT  C C6    1 
ATOM   2631  P P     . DC  C 3 9   ? -3.261  -16.105 -19.965  1.00 93.13  ?  9   DC  C P     1 
ATOM   2632  O OP1   . DC  C 3 9   ? -2.357  -15.096 -20.559  1.00 97.44  ?  9   DC  C OP1   1 
ATOM   2633  O OP2   . DC  C 3 9   ? -2.732  -17.105 -19.010  1.00 53.85  -1 9   DC  C OP2   1 
ATOM   2634  O "O5'" . DC  C 3 9   ? -4.480  -15.357 -19.271  1.00 65.67  ?  9   DC  C "O5'" 1 
ATOM   2635  C "C5'" . DC  C 3 9   ? -5.434  -14.743 -20.112  1.00 72.72  ?  9   DC  C "C5'" 1 
ATOM   2636  C "C4'" . DC  C 3 9   ? -6.801  -14.774 -19.474  1.00 77.55  ?  9   DC  C "C4'" 1 
ATOM   2637  O "O4'" . DC  C 3 9   ? -7.318  -16.126 -19.509  1.00 75.27  ?  9   DC  C "O4'" 1 
ATOM   2638  C "C3'" . DC  C 3 9   ? -6.835  -14.346 -18.006  1.00 72.88  ?  9   DC  C "C3'" 1 
ATOM   2639  O "O3'" . DC  C 3 9   ? -7.723  -13.263 -17.881  1.00 76.38  ?  9   DC  C "O3'" 1 
ATOM   2640  C "C2'" . DC  C 3 9   ? -7.350  -15.585 -17.262  1.00 71.14  ?  9   DC  C "C2'" 1 
ATOM   2641  C "C1'" . DC  C 3 9   ? -8.094  -16.324 -18.360  1.00 74.71  ?  9   DC  C "C1'" 1 
ATOM   2642  N N1    . DC  C 3 9   ? -8.222  -17.789 -18.106  1.00 62.92  ?  9   DC  C N1    1 
ATOM   2643  C C2    . DC  C 3 9   ? -9.490  -18.374 -18.096  1.00 54.86  ?  9   DC  C C2    1 
ATOM   2644  O O2    . DC  C 3 9   ? -10.475 -17.667 -18.335  1.00 56.26  ?  9   DC  C O2    1 
ATOM   2645  N N3    . DC  C 3 9   ? -9.600  -19.705 -17.854  1.00 43.79  ?  9   DC  C N3    1 
ATOM   2646  C C4    . DC  C 3 9   ? -8.506  -20.430 -17.609  1.00 44.00  ?  9   DC  C C4    1 
ATOM   2647  N N4    . DC  C 3 9   ? -8.661  -21.738 -17.371  1.00 45.97  ?  9   DC  C N4    1 
ATOM   2648  C C5    . DC  C 3 9   ? -7.204  -19.846 -17.598  1.00 40.61  ?  9   DC  C C5    1 
ATOM   2649  C C6    . DC  C 3 9   ? -7.111  -18.534 -17.843  1.00 52.86  ?  9   DC  C C6    1 
ATOM   2650  P P     . DC  C 3 10  ? -7.857  -12.449 -16.506  1.00 88.75  ?  10  DC  C P     1 
ATOM   2651  O OP1   . DC  C 3 10  ? -7.885  -11.007 -16.839  1.00 85.42  ?  10  DC  C OP1   1 
ATOM   2652  O OP2   . DC  C 3 10  ? -6.847  -12.969 -15.558  1.00 77.83  -1 10  DC  C OP2   1 
ATOM   2653  O "O5'" . DC  C 3 10  ? -9.295  -12.885 -15.977  1.00 56.93  ?  10  DC  C "O5'" 1 
ATOM   2654  C "C5'" . DC  C 3 10  ? -10.450 -12.636 -16.755  1.00 73.84  ?  10  DC  C "C5'" 1 
ATOM   2655  C "C4'" . DC  C 3 10  ? -11.654 -13.248 -16.078  1.00 82.25  ?  10  DC  C "C4'" 1 
ATOM   2656  O "O4'" . DC  C 3 10  ? -11.516 -14.689 -16.102  1.00 66.98  ?  10  DC  C "O4'" 1 
ATOM   2657  C "C3'" . DC  C 3 10  ? -11.794 -12.858 -14.606  1.00 70.03  ?  10  DC  C "C3'" 1 
ATOM   2658  O "O3'" . DC  C 3 10  ? -13.044 -12.222 -14.393  1.00 68.02  ?  10  DC  C "O3'" 1 
ATOM   2659  C "C2'" . DC  C 3 10  ? -11.696 -14.185 -13.839  1.00 61.66  ?  10  DC  C "C2'" 1 
ATOM   2660  C "C1'" . DC  C 3 10  ? -12.022 -15.217 -14.906  1.00 67.37  ?  10  DC  C "C1'" 1 
ATOM   2661  N N1    . DC  C 3 10  ? -11.365 -16.536 -14.658  1.00 63.29  ?  10  DC  C N1    1 
ATOM   2662  C C2    . DC  C 3 10  ? -12.125 -17.615 -14.194  1.00 59.42  ?  10  DC  C C2    1 
ATOM   2663  O O2    . DC  C 3 10  ? -13.336 -17.458 -14.006  1.00 65.19  ?  10  DC  C O2    1 
ATOM   2664  N N3    . DC  C 3 10  ? -11.509 -18.804 -13.969  1.00 52.22  ?  10  DC  C N3    1 
ATOM   2665  C C4    . DC  C 3 10  ? -10.197 -18.927 -14.188  1.00 54.54  ?  10  DC  C C4    1 
ATOM   2666  N N4    . DC  C 3 10  ? -9.630  -20.114 -13.954  1.00 51.50  ?  10  DC  C N4    1 
ATOM   2667  C C5    . DC  C 3 10  ? -9.407  -17.837 -14.657  1.00 59.33  ?  10  DC  C C5    1 
ATOM   2668  C C6    . DC  C 3 10  ? -10.025 -16.672 -14.875  1.00 63.64  ?  10  DC  C C6    1 
ATOM   2669  P P     . DT  C 3 11  ? -13.349 -11.506 -12.990  1.00 88.34  ?  11  DT  C P     1 
ATOM   2670  O OP1   . DT  C 3 11  ? -14.303 -10.405 -13.248  1.00 86.50  ?  11  DT  C OP1   1 
ATOM   2671  O OP2   . DT  C 3 11  ? -12.047 -11.222 -12.342  1.00 80.45  -1 11  DT  C OP2   1 
ATOM   2672  O "O5'" . DT  C 3 11  ? -14.091 -12.644 -12.152  1.00 110.37 ?  11  DT  C "O5'" 1 
ATOM   2673  C "C5'" . DT  C 3 11  ? -15.291 -13.225 -12.642  1.00 97.35  ?  11  DT  C "C5'" 1 
ATOM   2674  C "C4'" . DT  C 3 11  ? -15.913 -14.117 -11.586  1.00 95.71  ?  11  DT  C "C4'" 1 
ATOM   2675  O "O4'" . DT  C 3 11  ? -15.195 -15.374 -11.552  1.00 99.33  ?  11  DT  C "O4'" 1 
ATOM   2676  C "C3'" . DT  C 3 11  ? -15.893 -13.563 -10.158  1.00 80.69  ?  11  DT  C "C3'" 1 
ATOM   2677  O "O3'" . DT  C 3 11  ? -17.196 -13.713 -9.582   1.00 97.04  ?  11  DT  C "O3'" 1 
ATOM   2678  C "C2'" . DT  C 3 11  ? -14.841 -14.433 -9.455   1.00 71.23  ?  11  DT  C "C2'" 1 
ATOM   2679  C "C1'" . DT  C 3 11  ? -14.960 -15.743 -10.221  1.00 73.88  ?  11  DT  C "C1'" 1 
ATOM   2680  N N1    . DT  C 3 11  ? -13.717 -16.582 -10.199  1.00 64.06  ?  11  DT  C N1    1 
ATOM   2681  C C2    . DT  C 3 11  ? -13.801 -17.898 -9.811   1.00 70.71  ?  11  DT  C C2    1 
ATOM   2682  O O2    . DT  C 3 11  ? -14.841 -18.425 -9.462   1.00 83.83  ?  11  DT  C O2    1 
ATOM   2683  N N3    . DT  C 3 11  ? -12.613 -18.583 -9.840   1.00 62.07  ?  11  DT  C N3    1 
ATOM   2684  C C4    . DT  C 3 11  ? -11.376 -18.096 -10.216  1.00 61.26  ?  11  DT  C C4    1 
ATOM   2685  O O4    . DT  C 3 11  ? -10.365 -18.796 -10.207  1.00 57.71  ?  11  DT  C O4    1 
ATOM   2686  C C5    . DT  C 3 11  ? -11.357 -16.708 -10.621  1.00 68.25  ?  11  DT  C C5    1 
ATOM   2687  C C7    . DT  C 3 11  ? -10.071 -16.065 -11.052  1.00 67.36  ?  11  DT  C C7    1 
ATOM   2688  C C6    . DT  C 3 11  ? -12.516 -16.028 -10.597  1.00 68.07  ?  11  DT  C C6    1 
ATOM   2689  P P     . DA  C 3 12  ? -17.623 -12.961 -8.224   1.00 105.04 ?  12  DA  C P     1 
ATOM   2690  O OP1   . DA  C 3 12  ? -18.987 -12.424 -8.414   1.00 114.37 ?  12  DA  C OP1   1 
ATOM   2691  O OP2   . DA  C 3 12  ? -16.518 -12.054 -7.841   1.00 78.08  -1 12  DA  C OP2   1 
ATOM   2692  O "O5'" . DA  C 3 12  ? -17.674 -14.135 -7.141   1.00 99.35  ?  12  DA  C "O5'" 1 
ATOM   2693  C "C5'" . DA  C 3 12  ? -18.279 -15.381 -7.466   1.00 104.54 ?  12  DA  C "C5'" 1 
ATOM   2694  C "C4'" . DA  C 3 12  ? -17.947 -16.417 -6.409   1.00 92.04  ?  12  DA  C "C4'" 1 
ATOM   2695  O "O4'" . DA  C 3 12  ? -16.650 -16.989 -6.734   1.00 87.79  ?  12  DA  C "O4'" 1 
ATOM   2696  C "C3'" . DA  C 3 12  ? -17.798 -15.886 -4.978   1.00 100.47 ?  12  DA  C "C3'" 1 
ATOM   2697  O "O3'" . DA  C 3 12  ? -18.286 -16.854 -4.044   1.00 121.42 ?  12  DA  C "O3'" 1 
ATOM   2698  C "C2'" . DA  C 3 12  ? -16.297 -15.711 -4.849   1.00 89.00  ?  12  DA  C "C2'" 1 
ATOM   2699  C "C1'" . DA  C 3 12  ? -15.829 -16.940 -5.592   1.00 76.70  ?  12  DA  C "C1'" 1 
ATOM   2700  N N9    . DA  C 3 12  ? -14.449 -16.829 -6.032   1.00 66.10  ?  12  DA  C N9    1 
ATOM   2701  C C8    . DA  C 3 12  ? -13.795 -15.691 -6.419   1.00 85.42  ?  12  DA  C C8    1 
ATOM   2702  N N7    . DA  C 3 12  ? -12.549 -15.894 -6.778   1.00 93.55  ?  12  DA  C N7    1 
ATOM   2703  C C5    . DA  C 3 12  ? -12.384 -17.262 -6.635   1.00 76.55  ?  12  DA  C C5    1 
ATOM   2704  C C6    . DA  C 3 12  ? -11.288 -18.123 -6.860   1.00 69.40  ?  12  DA  C C6    1 
ATOM   2705  N N6    . DA  C 3 12  ? -10.092 -17.713 -7.297   1.00 68.15  ?  12  DA  C N6    1 
ATOM   2706  N N1    . DA  C 3 12  ? -11.471 -19.431 -6.618   1.00 60.29  ?  12  DA  C N1    1 
ATOM   2707  C C2    . DA  C 3 12  ? -12.660 -19.853 -6.179   1.00 64.86  ?  12  DA  C C2    1 
ATOM   2708  N N3    . DA  C 3 12  ? -13.757 -19.149 -5.932   1.00 62.46  ?  12  DA  C N3    1 
ATOM   2709  C C4    . DA  C 3 12  ? -13.551 -17.850 -6.182   1.00 60.85  ?  12  DA  C C4    1 
ATOM   2710  P P     . DT  C 3 13  ? -19.758 -16.773 -3.401   1.00 137.40 ?  13  DT  C P     1 
ATOM   2711  O OP1   . DT  C 3 13  ? -20.727 -16.581 -4.503   1.00 100.40 ?  13  DT  C OP1   1 
ATOM   2712  O OP2   . DT  C 3 13  ? -19.721 -15.821 -2.270   1.00 107.15 -1 13  DT  C OP2   1 
ATOM   2713  O "O5'" . DT  C 3 13  ? -19.956 -18.246 -2.798   1.00 105.82 ?  13  DT  C "O5'" 1 
ATOM   2714  C "C5'" . DT  C 3 13  ? -20.000 -19.376 -3.668   1.00 103.28 ?  13  DT  C "C5'" 1 
ATOM   2715  C "C4'" . DT  C 3 13  ? -19.120 -20.508 -3.153   1.00 92.35  ?  13  DT  C "C4'" 1 
ATOM   2716  O "O4'" . DT  C 3 13  ? -17.731 -20.133 -3.351   1.00 88.82  ?  13  DT  C "O4'" 1 
ATOM   2717  C "C3'" . DT  C 3 13  ? -19.248 -20.841 -1.662   1.00 96.04  ?  13  DT  C "C3'" 1 
ATOM   2718  O "O3'" . DT  C 3 13  ? -19.089 -22.258 -1.454   1.00 94.05  ?  13  DT  C "O3'" 1 
ATOM   2719  C "C2'" . DT  C 3 13  ? -18.086 -20.052 -1.061   1.00 101.35 ?  13  DT  C "C2'" 1 
ATOM   2720  C "C1'" . DT  C 3 13  ? -17.035 -20.261 -2.136   1.00 98.07  ?  13  DT  C "C1'" 1 
ATOM   2721  N N1    . DT  C 3 13  ? -15.952 -19.233 -2.121   1.00 101.40 ?  13  DT  C N1    1 
ATOM   2722  C C2    . DT  C 3 13  ? -14.677 -19.598 -2.484   1.00 99.33  ?  13  DT  C C2    1 
ATOM   2723  O O2    . DT  C 3 13  ? -14.378 -20.731 -2.817   1.00 103.05 ?  13  DT  C O2    1 
ATOM   2724  N N3    . DT  C 3 13  ? -13.757 -18.582 -2.445   1.00 84.91  ?  13  DT  C N3    1 
ATOM   2725  C C4    . DT  C 3 13  ? -13.980 -17.265 -2.086   1.00 82.53  ?  13  DT  C C4    1 
ATOM   2726  O O4    . DT  C 3 13  ? -13.085 -16.426 -2.082   1.00 67.72  ?  13  DT  C O4    1 
ATOM   2727  C C5    . DT  C 3 13  ? -15.340 -16.947 -1.718   1.00 98.34  ?  13  DT  C C5    1 
ATOM   2728  C C7    . DT  C 3 13  ? -15.703 -15.550 -1.309   1.00 101.19 ?  13  DT  C C7    1 
ATOM   2729  C C6    . DT  C 3 13  ? -16.251 -17.935 -1.755   1.00 100.67 ?  13  DT  C C6    1 
ATOM   2730  P P     . DA  C 3 14  ? -20.370 -23.192 -1.170   1.00 103.15 ?  14  DA  C P     1 
ATOM   2731  O OP1   . DA  C 3 14  ? -21.559 -22.474 -1.680   1.00 109.38 -1 14  DA  C OP1   1 
ATOM   2732  O OP2   . DA  C 3 14  ? -20.322 -23.613 0.247    1.00 96.52  ?  14  DA  C OP2   1 
ATOM   2733  O "O5'" . DA  C 3 14  ? -20.150 -24.480 -2.103   1.00 96.75  ?  14  DA  C "O5'" 1 
ATOM   2734  C "C5'" . DA  C 3 14  ? -19.934 -25.789 -1.537   1.00 88.89  ?  14  DA  C "C5'" 1 
ATOM   2735  C "C4'" . DA  C 3 14  ? -18.481 -26.221 -1.684   1.00 89.61  ?  14  DA  C "C4'" 1 
ATOM   2736  O "O4'" . DA  C 3 14  ? -17.638 -25.087 -1.404   1.00 82.61  ?  14  DA  C "O4'" 1 
ATOM   2737  C "C3'" . DA  C 3 14  ? -18.014 -27.364 -0.772   1.00 83.33  ?  14  DA  C "C3'" 1 
ATOM   2738  O "O3'" . DA  C 3 14  ? -17.051 -28.168 -1.542   1.00 90.02  ?  14  DA  C "O3'" 1 
ATOM   2739  C "C2'" . DA  C 3 14  ? -17.374 -26.572 0.369    1.00 75.75  ?  14  DA  C "C2'" 1 
ATOM   2740  C "C1'" . DA  C 3 14  ? -16.737 -25.400 -0.381   1.00 73.20  ?  14  DA  C "C1'" 1 
ATOM   2741  N N9    . DA  C 3 14  ? -16.605 -24.188 0.424    1.00 79.42  ?  14  DA  C N9    1 
ATOM   2742  C C8    . DA  C 3 14  ? -17.520 -23.687 1.307    1.00 85.71  ?  14  DA  C C8    1 
ATOM   2743  N N7    . DA  C 3 14  ? -17.159 -22.552 1.859    1.00 88.36  ?  14  DA  C N7    1 
ATOM   2744  C C5    . DA  C 3 14  ? -15.940 -22.268 1.268    1.00 78.43  ?  14  DA  C C5    1 
ATOM   2745  C C6    . DA  C 3 14  ? -15.038 -21.194 1.421    1.00 85.49  ?  14  DA  C C6    1 
ATOM   2746  N N6    . DA  C 3 14  ? -15.245 -20.170 2.255    1.00 92.31  ?  14  DA  C N6    1 
ATOM   2747  N N1    . DA  C 3 14  ? -13.910 -21.216 0.681    1.00 87.09  ?  14  DA  C N1    1 
ATOM   2748  C C2    . DA  C 3 14  ? -13.705 -22.243 -0.153   1.00 86.33  ?  14  DA  C C2    1 
ATOM   2749  N N3    . DA  C 3 14  ? -14.478 -23.305 -0.382   1.00 91.42  ?  14  DA  C N3    1 
ATOM   2750  C C4    . DA  C 3 14  ? -15.590 -23.257 0.367    1.00 82.19  ?  14  DA  C C4    1 
ATOM   2751  P P     . DC  C 3 15  ? -16.717 -29.734 -1.263   1.00 101.15 ?  15  DC  C P     1 
ATOM   2752  O OP1   . DC  C 3 15  ? -16.062 -30.221 -2.497   1.00 98.29  ?  15  DC  C OP1   1 
ATOM   2753  O OP2   . DC  C 3 15  ? -18.007 -30.327 -0.856   1.00 86.57  -1 15  DC  C OP2   1 
ATOM   2754  O "O5'" . DC  C 3 15  ? -15.691 -29.985 -0.037   1.00 92.67  ?  15  DC  C "O5'" 1 
ATOM   2755  C "C5'" . DC  C 3 15  ? -15.402 -29.108 1.021    1.00 81.80  ?  15  DC  C "C5'" 1 
ATOM   2756  C "C4'" . DC  C 3 15  ? -14.227 -28.204 0.695    1.00 85.67  ?  15  DC  C "C4'" 1 
ATOM   2757  O "O4'" . DC  C 3 15  ? -14.497 -26.882 1.219    1.00 86.14  ?  15  DC  C "O4'" 1 
ATOM   2758  C "C3'" . DC  C 3 15  ? -12.883 -28.616 1.325    1.00 62.88  ?  15  DC  C "C3'" 1 
ATOM   2759  O "O3'" . DC  C 3 15  ? -11.846 -28.508 0.337    1.00 93.97  ?  15  DC  C "O3'" 1 
ATOM   2760  C "C2'" . DC  C 3 15  ? -12.714 -27.617 2.465    1.00 57.95  ?  15  DC  C "C2'" 1 
ATOM   2761  C "C1'" . DC  C 3 15  ? -13.341 -26.393 1.842    1.00 69.63  ?  15  DC  C "C1'" 1 
ATOM   2762  N N1    . DC  C 3 15  ? -13.771 -25.384 2.841    1.00 65.79  ?  15  DC  C N1    1 
ATOM   2763  C C2    . DC  C 3 15  ? -12.874 -24.403 3.271    1.00 66.45  ?  15  DC  C C2    1 
ATOM   2764  O O2    . DC  C 3 15  ? -11.723 -24.398 2.818    1.00 65.25  ?  15  DC  C O2    1 
ATOM   2765  N N3    . DC  C 3 15  ? -13.292 -23.490 4.183    1.00 58.07  ?  15  DC  C N3    1 
ATOM   2766  C C4    . DC  C 3 15  ? -14.543 -23.534 4.649    1.00 68.70  ?  15  DC  C C4    1 
ATOM   2767  N N4    . DC  C 3 15  ? -14.911 -22.613 5.542    1.00 72.94  ?  15  DC  C N4    1 
ATOM   2768  C C5    . DC  C 3 15  ? -15.471 -24.525 4.217    1.00 66.56  ?  15  DC  C C5    1 
ATOM   2769  C C6    . DC  C 3 15  ? -15.047 -25.419 3.321    1.00 59.42  ?  15  DC  C C6    1 
ATOM   2770  P P     . DG  C 3 16  ? -10.316 -28.891 0.661    1.00 85.47  ?  16  DG  C P     1 
ATOM   2771  O OP1   . DG  C 3 16  ? -9.644  -27.619 1.011    1.00 82.48  -1 16  DG  C OP1   1 
ATOM   2772  O OP2   . DG  C 3 16  ? -9.810  -29.679 -0.487   1.00 83.20  ?  16  DG  C OP2   1 
ATOM   2773  O "O5'" . DG  C 3 16  ? -10.381 -29.853 1.941    1.00 69.75  ?  16  DG  C "O5'" 1 
ATOM   2774  C "C5'" . DG  C 3 16  ? -9.178  -30.190 2.662    1.00 75.65  ?  16  DG  C "C5'" 1 
ATOM   2775  C "C4'" . DG  C 3 16  ? -8.540  -28.922 3.211    1.00 68.40  ?  16  DG  C "C4'" 1 
ATOM   2776  O "O4'" . DG  C 3 16  ? -9.579  -28.057 3.709    1.00 59.45  ?  16  DG  C "O4'" 1 
ATOM   2777  C "C3'" . DG  C 3 16  ? -7.560  -29.131 4.372    1.00 55.38  ?  16  DG  C "C3'" 1 
ATOM   2778  O "O3'" . DG  C 3 16  ? -6.321  -28.457 4.114    1.00 51.68  ?  16  DG  C "O3'" 1 
ATOM   2779  C "C2'" . DG  C 3 16  ? -8.318  -28.545 5.577    1.00 55.40  ?  16  DG  C "C2'" 1 
ATOM   2780  C "C1'" . DG  C 3 16  ? -9.162  -27.472 4.906    1.00 45.46  ?  16  DG  C "C1'" 1 
ATOM   2781  N N9    . DG  C 3 16  ? -10.388 -27.152 5.635    1.00 57.16  ?  16  DG  C N9    1 
ATOM   2782  C C8    . DG  C 3 16  ? -11.378 -28.035 5.988    1.00 57.41  ?  16  DG  C C8    1 
ATOM   2783  N N7    . DG  C 3 16  ? -12.380 -27.476 6.604    1.00 57.92  ?  16  DG  C N7    1 
ATOM   2784  C C5    . DG  C 3 16  ? -12.045 -26.130 6.650    1.00 54.15  ?  16  DG  C C5    1 
ATOM   2785  C C6    . DG  C 3 16  ? -12.755 -25.035 7.197    1.00 57.62  ?  16  DG  C C6    1 
ATOM   2786  O O6    . DG  C 3 16  ? -13.854 -25.041 7.775    1.00 49.00  ?  16  DG  C O6    1 
ATOM   2787  N N1    . DG  C 3 16  ? -12.061 -23.840 7.033    1.00 52.09  ?  16  DG  C N1    1 
ATOM   2788  C C2    . DG  C 3 16  ? -10.840 -23.717 6.415    1.00 50.21  ?  16  DG  C C2    1 
ATOM   2789  N N2    . DG  C 3 16  ? -10.331 -22.479 6.351    1.00 56.55  ?  16  DG  C N2    1 
ATOM   2790  N N3    . DG  C 3 16  ? -10.164 -24.735 5.894    1.00 58.15  ?  16  DG  C N3    1 
ATOM   2791  C C4    . DG  C 3 16  ? -10.825 -25.909 6.048    1.00 55.83  ?  16  DG  C C4    1 
ATOM   2792  P P     . DA  C 3 17  ? -5.006  -28.800 4.976    1.00 61.70  ?  17  DA  C P     1 
ATOM   2793  O OP1   . DA  C 3 17  ? -3.826  -28.462 4.149    1.00 65.45  ?  17  DA  C OP1   1 
ATOM   2794  O OP2   . DA  C 3 17  ? -5.151  -30.173 5.508    1.00 66.12  -1 17  DA  C OP2   1 
ATOM   2795  O "O5'" . DA  C 3 17  ? -5.088  -27.770 6.195    1.00 72.87  ?  17  DA  C "O5'" 1 
ATOM   2796  C "C5'" . DA  C 3 17  ? -5.078  -26.372 5.966    1.00 71.67  ?  17  DA  C "C5'" 1 
ATOM   2797  C "C4'" . DA  C 3 17  ? -5.477  -25.645 7.237    1.00 77.94  ?  17  DA  C "C4'" 1 
ATOM   2798  O "O4'" . DA  C 3 17  ? -6.896  -25.800 7.449    1.00 74.22  ?  17  DA  C "O4'" 1 
ATOM   2799  C "C3'" . DA  C 3 17  ? -4.816  -26.127 8.543    1.00 74.71  ?  17  DA  C "C3'" 1 
ATOM   2800  O "O3'" . DA  C 3 17  ? -4.111  -25.048 9.140    1.00 83.37  ?  17  DA  C "O3'" 1 
ATOM   2801  C "C2'" . DA  C 3 17  ? -5.999  -26.558 9.423    1.00 67.91  ?  17  DA  C "C2'" 1 
ATOM   2802  C "C1'" . DA  C 3 17  ? -7.116  -25.731 8.826    1.00 59.69  ?  17  DA  C "C1'" 1 
ATOM   2803  N N9    . DA  C 3 17  ? -8.456  -26.219 9.128    1.00 47.48  ?  17  DA  C N9    1 
ATOM   2804  C C8    . DA  C 3 17  ? -8.890  -27.515 9.144    1.00 52.49  ?  17  DA  C C8    1 
ATOM   2805  N N7    . DA  C 3 17  ? -10.157 -27.643 9.470    1.00 54.85  ?  17  DA  C N7    1 
ATOM   2806  C C5    . DA  C 3 17  ? -10.574 -26.340 9.694    1.00 56.26  ?  17  DA  C C5    1 
ATOM   2807  C C6    . DA  C 3 17  ? -11.811 -25.783 10.081   1.00 56.62  ?  17  DA  C C6    1 
ATOM   2808  N N6    . DA  C 3 17  ? -12.917 -26.504 10.312   1.00 54.22  ?  17  DA  C N6    1 
ATOM   2809  N N1    . DA  C 3 17  ? -11.873 -24.444 10.210   1.00 55.99  ?  17  DA  C N1    1 
ATOM   2810  C C2    . DA  C 3 17  ? -10.777 -23.716 9.983    1.00 63.39  ?  17  DA  C C2    1 
ATOM   2811  N N3    . DA  C 3 17  ? -9.566  -24.121 9.621    1.00 61.33  ?  17  DA  C N3    1 
ATOM   2812  C C4    . DA  C 3 17  ? -9.531  -25.455 9.494    1.00 55.19  ?  17  DA  C C4    1 
ATOM   2813  P P     . DC  C 3 18  ? -2.797  -25.285 10.033   1.00 96.33  ?  18  DC  C P     1 
ATOM   2814  O OP1   . DC  C 3 18  ? -1.641  -24.717 9.303    1.00 85.86  ?  18  DC  C OP1   1 
ATOM   2815  O OP2   . DC  C 3 18  ? -2.778  -26.706 10.447   1.00 84.23  -1 18  DC  C OP2   1 
ATOM   2816  O "O5'" . DC  C 3 18  ? -3.095  -24.386 11.330   1.00 83.08  ?  18  DC  C "O5'" 1 
ATOM   2817  C "C5'" . DC  C 3 18  ? -3.489  -23.023 11.164   1.00 79.29  ?  18  DC  C "C5'" 1 
ATOM   2818  C "C4'" . DC  C 3 18  ? -4.641  -22.654 12.096   1.00 82.11  ?  18  DC  C "C4'" 1 
ATOM   2819  O "O4'" . DC  C 3 18  ? -5.815  -23.416 11.771   1.00 67.91  ?  18  DC  C "O4'" 1 
ATOM   2820  C "C3'" . DC  C 3 18  ? -4.423  -22.909 13.591   1.00 87.10  ?  18  DC  C "C3'" 1 
ATOM   2821  O "O3'" . DC  C 3 18  ? -4.052  -21.699 14.235   1.00 98.98  ?  18  DC  C "O3'" 1 
ATOM   2822  C "C2'" . DC  C 3 18  ? -5.800  -23.390 14.094   1.00 76.56  ?  18  DC  C "C2'" 1 
ATOM   2823  C "C1'" . DC  C 3 18  ? -6.687  -23.278 12.857   1.00 71.05  ?  18  DC  C "C1'" 1 
ATOM   2824  N N1    . DC  C 3 18  ? -7.737  -24.324 12.799   1.00 75.79  ?  18  DC  C N1    1 
ATOM   2825  C C2    . DC  C 3 18  ? -9.067  -23.971 13.043   1.00 69.46  ?  18  DC  C C2    1 
ATOM   2826  O O2    . DC  C 3 18  ? -9.341  -22.785 13.261   1.00 64.89  ?  18  DC  C O2    1 
ATOM   2827  N N3    . DC  C 3 18  ? -10.022 -24.934 13.008   1.00 60.80  ?  18  DC  C N3    1 
ATOM   2828  C C4    . DC  C 3 18  ? -9.678  -26.200 12.764   1.00 63.53  ?  18  DC  C C4    1 
ATOM   2829  N N4    . DC  C 3 18  ? -10.649 -27.118 12.740   1.00 59.53  ?  18  DC  C N4    1 
ATOM   2830  C C5    . DC  C 3 18  ? -8.323  -26.582 12.530   1.00 68.03  ?  18  DC  C C5    1 
ATOM   2831  C C6    . DC  C 3 18  ? -7.394  -25.622 12.566   1.00 76.48  ?  18  DC  C C6    1 
ATOM   2832  P P     . DG  C 3 19  ? -3.720  -21.681 15.808   1.00 108.32 ?  19  DG  C P     1 
ATOM   2833  O OP1   . DG  C 3 19  ? -2.911  -20.472 16.078   1.00 109.10 ?  19  DG  C OP1   1 
ATOM   2834  O OP2   . DG  C 3 19  ? -3.186  -23.015 16.161   1.00 84.00  -1 19  DG  C OP2   1 
ATOM   2835  O "O5'" . DG  C 3 19  ? -5.152  -21.520 16.519   1.00 78.49  ?  19  DG  C "O5'" 1 
ATOM   2836  C "C5'" . DG  C 3 19  ? -5.757  -20.239 16.661   1.00 74.83  ?  19  DG  C "C5'" 1 
ATOM   2837  C "C4'" . DG  C 3 19  ? -7.024  -20.331 17.502   1.00 74.95  ?  19  DG  C "C4'" 1 
ATOM   2838  O "O4'" . DG  C 3 19  ? -7.944  -21.276 16.903   1.00 58.34  ?  19  DG  C "O4'" 1 
ATOM   2839  C "C3'" . DG  C 3 19  ? -6.808  -20.798 18.948   1.00 97.90  ?  19  DG  C "C3'" 1 
ATOM   2840  O "O3'" . DG  C 3 19  ? -7.130  -19.751 19.872   1.00 103.16 ?  19  DG  C "O3'" 1 
ATOM   2841  C "C2'" . DG  C 3 19  ? -7.754  -21.989 19.127   1.00 93.62  ?  19  DG  C "C2'" 1 
ATOM   2842  C "C1'" . DG  C 3 19  ? -8.682  -21.894 17.927   1.00 66.50  ?  19  DG  C "C1'" 1 
ATOM   2843  N N9    . DG  C 3 19  ? -9.182  -23.193 17.481   1.00 69.35  ?  19  DG  C N9    1 
ATOM   2844  C C8    . DG  C 3 19  ? -8.496  -24.158 16.784   1.00 75.22  ?  19  DG  C C8    1 
ATOM   2845  N N7    . DG  C 3 19  ? -9.204  -25.231 16.552   1.00 69.55  ?  19  DG  C N7    1 
ATOM   2846  C C5    . DG  C 3 19  ? -10.430 -24.968 17.153   1.00 66.41  ?  19  DG  C C5    1 
ATOM   2847  C C6    . DG  C 3 19  ? -11.598 -25.765 17.235   1.00 68.41  ?  19  DG  C C6    1 
ATOM   2848  O O6    . DG  C 3 19  ? -11.786 -26.899 16.774   1.00 66.44  ?  19  DG  C O6    1 
ATOM   2849  N N1    . DG  C 3 19  ? -12.618 -25.118 17.934   1.00 69.72  ?  19  DG  C N1    1 
ATOM   2850  C C2    . DG  C 3 19  ? -12.515 -23.859 18.484   1.00 76.85  ?  19  DG  C C2    1 
ATOM   2851  N N2    . DG  C 3 19  ? -13.599 -23.395 19.123   1.00 80.54  ?  19  DG  C N2    1 
ATOM   2852  N N3    . DG  C 3 19  ? -11.425 -23.106 18.413   1.00 74.45  ?  19  DG  C N3    1 
ATOM   2853  C C4    . DG  C 3 19  ? -10.427 -23.721 17.736   1.00 68.67  ?  19  DG  C C4    1 
ATOM   2854  P P     . DT  C 3 20  ? -7.153  -20.061 21.452   1.00 102.81 ?  20  DT  C P     1 
ATOM   2855  O OP1   . DT  C 3 20  ? -6.954  -18.775 22.157   1.00 95.29  ?  20  DT  C OP1   1 
ATOM   2856  O OP2   . DT  C 3 20  ? -6.234  -21.195 21.697   1.00 87.65  -1 20  DT  C OP2   1 
ATOM   2857  O "O5'" . DT  C 3 20  ? -8.644  -20.580 21.743   1.00 65.65  ?  20  DT  C "O5'" 1 
ATOM   2858  C "C5'" . DT  C 3 20  ? -9.771  -19.784 21.384   1.00 75.29  ?  20  DT  C "C5'" 1 
ATOM   2859  C "C4'" . DT  C 3 20  ? -11.030 -20.291 22.075   1.00 89.66  ?  20  DT  C "C4'" 1 
ATOM   2860  O "O4'" . DT  C 3 20  ? -11.448 -21.542 21.474   1.00 83.73  ?  20  DT  C "O4'" 1 
ATOM   2861  C "C3'" . DT  C 3 20  ? -10.890 -20.555 23.576   1.00 97.28  ?  20  DT  C "C3'" 1 
ATOM   2862  O "O3'" . DT  C 3 20  ? -12.033 -20.054 24.269   1.00 104.92 ?  20  DT  C "O3'" 1 
ATOM   2863  C "C2'" . DT  C 3 20  ? -10.805 -22.080 23.663   1.00 85.50  ?  20  DT  C "C2'" 1 
ATOM   2864  C "C1'" . DT  C 3 20  ? -11.650 -22.513 22.474   1.00 71.40  ?  20  DT  C "C1'" 1 
ATOM   2865  N N1    . DT  C 3 20  ? -11.262 -23.839 21.920   1.00 73.62  ?  20  DT  C N1    1 
ATOM   2866  C C2    . DT  C 3 20  ? -12.173 -24.871 21.938   1.00 65.75  ?  20  DT  C C2    1 
ATOM   2867  O O2    . DT  C 3 20  ? -13.299 -24.760 22.391   1.00 57.68  ?  20  DT  C O2    1 
ATOM   2868  N N3    . DT  C 3 20  ? -11.716 -26.047 21.401   1.00 58.53  ?  20  DT  C N3    1 
ATOM   2869  C C4    . DT  C 3 20  ? -10.464 -26.285 20.860   1.00 61.85  ?  20  DT  C C4    1 
ATOM   2870  O O4    . DT  C 3 20  ? -10.141 -27.374 20.402   1.00 54.92  ?  20  DT  C O4    1 
ATOM   2871  C C5    . DT  C 3 20  ? -9.560  -25.160 20.872   1.00 67.90  ?  20  DT  C C5    1 
ATOM   2872  C C7    . DT  C 3 20  ? -8.178  -25.303 20.309   1.00 67.70  ?  20  DT  C C7    1 
ATOM   2873  C C6    . DT  C 3 20  ? -9.997  -24.005 21.394   1.00 72.07  ?  20  DT  C C6    1 
ATOM   2874  P P     . DT  C 3 21  ? -12.214 -20.315 25.846   1.00 98.43  ?  21  DT  C P     1 
ATOM   2875  O OP1   . DT  C 3 21  ? -12.854 -19.117 26.436   1.00 92.99  ?  21  DT  C OP1   1 
ATOM   2876  O OP2   . DT  C 3 21  ? -10.912 -20.790 26.366   1.00 58.54  -1 21  DT  C OP2   1 
ATOM   2877  O "O5'" . DT  C 3 21  ? -13.244 -21.539 25.912   1.00 74.37  ?  21  DT  C "O5'" 1 
ATOM   2878  C "C5'" . DT  C 3 21  ? -14.487 -21.455 25.231   1.00 82.43  ?  21  DT  C "C5'" 1 
ATOM   2879  C "C4'" . DT  C 3 21  ? -15.352 -22.677 25.498   1.00 83.53  ?  21  DT  C "C4'" 1 
ATOM   2880  O "O4'" . DT  C 3 21  ? -14.729 -23.848 24.903   1.00 92.01  ?  21  DT  C "O4'" 1 
ATOM   2881  C "C3'" . DT  C 3 21  ? -15.585 -23.038 26.966   1.00 89.29  ?  21  DT  C "C3'" 1 
ATOM   2882  O "O3'" . DT  C 3 21  ? -16.918 -23.517 27.104   1.00 106.28 ?  21  DT  C "O3'" 1 
ATOM   2883  C "C2'" . DT  C 3 21  ? -14.559 -24.135 27.215   1.00 76.53  ?  21  DT  C "C2'" 1 
ATOM   2884  C "C1'" . DT  C 3 21  ? -14.584 -24.856 25.882   1.00 66.31  ?  21  DT  C "C1'" 1 
ATOM   2885  N N1    . DT  C 3 21  ? -13.340 -25.623 25.593   1.00 63.02  ?  21  DT  C N1    1 
ATOM   2886  C C2    . DT  C 3 21  ? -13.444 -26.929 25.189   1.00 63.92  ?  21  DT  C C2    1 
ATOM   2887  O O2    . DT  C 3 21  ? -14.510 -27.505 25.057   1.00 65.51  ?  21  DT  C O2    1 
ATOM   2888  N N3    . DT  C 3 21  ? -12.249 -27.548 24.945   1.00 58.50  ?  21  DT  C N3    1 
ATOM   2889  C C4    . DT  C 3 21  ? -10.983 -27.008 25.057   1.00 63.87  ?  21  DT  C C4    1 
ATOM   2890  O O4    . DT  C 3 21  ? -9.969  -27.659 24.809   1.00 55.61  ?  21  DT  C O4    1 
ATOM   2891  C C5    . DT  C 3 21  ? -10.940 -25.628 25.485   1.00 69.35  ?  21  DT  C C5    1 
ATOM   2892  C C7    . DT  C 3 21  ? -9.622  -24.929 25.645   1.00 66.43  ?  21  DT  C C7    1 
ATOM   2893  C C6    . DT  C 3 21  ? -12.108 -25.008 25.729   1.00 68.97  ?  21  DT  C C6    1 
ATOM   2894  P P     . DT  C 3 22  ? -17.583 -23.774 28.544   1.00 115.03 ?  22  DT  C P     1 
ATOM   2895  O OP1   . DT  C 3 22  ? -18.903 -23.105 28.558   1.00 121.72 ?  22  DT  C OP1   1 
ATOM   2896  O OP2   . DT  C 3 22  ? -16.570 -23.438 29.570   1.00 73.68  -1 22  DT  C OP2   1 
ATOM   2897  O "O5'" . DT  C 3 22  ? -17.802 -25.360 28.573   1.00 92.74  ?  22  DT  C "O5'" 1 
ATOM   2898  C "C5'" . DT  C 3 22  ? -18.604 -25.973 27.563   1.00 90.64  ?  22  DT  C "C5'" 1 
ATOM   2899  C "C4'" . DT  C 3 22  ? -18.427 -27.480 27.567   1.00 89.87  ?  22  DT  C "C4'" 1 
ATOM   2900  O "O4'" . DT  C 3 22  ? -17.057 -27.781 27.212   1.00 88.61  ?  22  DT  C "O4'" 1 
ATOM   2901  C "C3'" . DT  C 3 22  ? -18.669 -28.172 28.915   1.00 85.74  ?  22  DT  C "C3'" 1 
ATOM   2902  O "O3'" . DT  C 3 22  ? -19.644 -29.205 28.746   1.00 99.68  ?  22  DT  C "O3'" 1 
ATOM   2903  C "C2'" . DT  C 3 22  ? -17.292 -28.725 29.298   1.00 95.45  ?  22  DT  C "C2'" 1 
ATOM   2904  C "C1'" . DT  C 3 22  ? -16.647 -28.904 27.937   1.00 87.92  ?  22  DT  C "C1'" 1 
ATOM   2905  N N1    . DT  C 3 22  ? -15.159 -28.873 27.994   1.00 72.94  ?  22  DT  C N1    1 
ATOM   2906  C C2    . DT  C 3 22  ? -14.437 -29.922 27.477   1.00 68.82  ?  22  DT  C C2    1 
ATOM   2907  O O2    . DT  C 3 22  ? -14.952 -30.907 26.979   1.00 72.46  ?  22  DT  C O2    1 
ATOM   2908  N N3    . DT  C 3 22  ? -13.077 -29.782 27.577   1.00 59.15  ?  22  DT  C N3    1 
ATOM   2909  C C4    . DT  C 3 22  ? -12.383 -28.715 28.121   1.00 59.51  ?  22  DT  C C4    1 
ATOM   2910  O O4    . DT  C 3 22  ? -11.157 -28.678 28.164   1.00 63.06  ?  22  DT  C O4    1 
ATOM   2911  C C5    . DT  C 3 22  ? -13.201 -27.646 28.636   1.00 57.25  ?  22  DT  C C5    1 
ATOM   2912  C C7    . DT  C 3 22  ? -12.560 -26.438 29.251   1.00 66.40  ?  22  DT  C C7    1 
ATOM   2913  C C6    . DT  C 3 22  ? -14.533 -27.773 28.547   1.00 63.41  ?  22  DT  C C6    1 
ATOM   2914  P P     . DA  C 3 23  ? -20.480 -29.755 30.005   1.00 128.88 ?  23  DA  C P     1 
ATOM   2915  O OP1   . DA  C 3 23  ? -21.912 -29.511 29.726   1.00 132.39 ?  23  DA  C OP1   1 
ATOM   2916  O OP2   . DA  C 3 23  ? -19.860 -29.205 31.231   1.00 116.96 -1 23  DA  C OP2   1 
ATOM   2917  O "O5'" . DA  C 3 23  ? -20.226 -31.334 30.004   1.00 104.44 ?  23  DA  C "O5'" 1 
ATOM   2918  C "C5'" . DA  C 3 23  ? -20.352 -32.082 28.793   1.00 103.22 ?  23  DA  C "C5'" 1 
ATOM   2919  C "C4'" . DA  C 3 23  ? -19.639 -33.415 28.917   1.00 98.48  ?  23  DA  C "C4'" 1 
ATOM   2920  O "O4'" . DA  C 3 23  ? -18.219 -33.223 28.714   1.00 91.59  ?  23  DA  C "O4'" 1 
ATOM   2921  C "C3'" . DA  C 3 23  ? -19.798 -34.100 30.275   1.00 101.50 ?  23  DA  C "C3'" 1 
ATOM   2922  O "O3'" . DA  C 3 23  ? -20.168 -35.464 30.092   1.00 98.99  ?  23  DA  C "O3'" 1 
ATOM   2923  C "C2'" . DA  C 3 23  ? -18.414 -33.960 30.921   1.00 89.68  ?  23  DA  C "C2'" 1 
ATOM   2924  C "C1'" . DA  C 3 23  ? -17.497 -33.907 29.709   1.00 75.66  ?  23  DA  C "C1'" 1 
ATOM   2925  N N9    . DA  C 3 23  ? -16.266 -33.156 29.939   1.00 69.35  ?  23  DA  C N9    1 
ATOM   2926  C C8    . DA  C 3 23  ? -16.163 -31.884 30.429   1.00 72.25  ?  23  DA  C C8    1 
ATOM   2927  N N7    . DA  C 3 23  ? -14.929 -31.450 30.524   1.00 60.13  ?  23  DA  C N7    1 
ATOM   2928  C C5    . DA  C 3 23  ? -14.167 -32.513 30.070   1.00 62.99  ?  23  DA  C C5    1 
ATOM   2929  C C6    . DA  C 3 23  ? -12.776 -32.688 29.921   1.00 57.04  ?  23  DA  C C6    1 
ATOM   2930  N N6    . DA  C 3 23  ? -11.879 -31.748 30.238   1.00 48.72  ?  23  DA  C N6    1 
ATOM   2931  N N1    . DA  C 3 23  ? -12.342 -33.873 29.441   1.00 55.54  ?  23  DA  C N1    1 
ATOM   2932  C C2    . DA  C 3 23  ? -13.246 -34.812 29.130   1.00 57.12  ?  23  DA  C C2    1 
ATOM   2933  N N3    . DA  C 3 23  ? -14.576 -34.762 29.222   1.00 54.41  ?  23  DA  C N3    1 
ATOM   2934  C C4    . DA  C 3 23  ? -14.975 -33.575 29.704   1.00 60.01  ?  23  DA  C C4    1 
ATOM   2935  P P     . DG  C 3 24  ? -20.564 -36.373 31.356   1.00 108.50 ?  24  DG  C P     1 
ATOM   2936  O OP1   . DG  C 3 24  ? -21.466 -37.444 30.875   1.00 89.49  ?  24  DG  C OP1   1 
ATOM   2937  O OP2   . DG  C 3 24  ? -21.001 -35.474 32.447   1.00 95.57  -1 24  DG  C OP2   1 
ATOM   2938  O "O5'" . DG  C 3 24  ? -19.178 -37.034 31.788   1.00 100.74 ?  24  DG  C "O5'" 1 
ATOM   2939  C "C5'" . DG  C 3 24  ? -18.349 -37.627 30.808   1.00 101.42 ?  24  DG  C "C5'" 1 
ATOM   2940  C "C4'" . DG  C 3 24  ? -16.971 -37.892 31.375   1.00 101.77 ?  24  DG  C "C4'" 1 
ATOM   2941  O "O4'" . DG  C 3 24  ? -16.188 -36.669 31.384   1.00 105.90 ?  24  DG  C "O4'" 1 
ATOM   2942  C "C3'" . DG  C 3 24  ? -16.922 -38.422 32.822   1.00 98.02  ?  24  DG  C "C3'" 1 
ATOM   2943  O "O3'" . DG  C 3 24  ? -16.054 -39.531 32.875   1.00 93.77  ?  24  DG  C "O3'" 1 
ATOM   2944  C "C2'" . DG  C 3 24  ? -16.321 -37.246 33.588   1.00 85.07  ?  24  DG  C "C2'" 1 
ATOM   2945  C "C1'" . DG  C 3 24  ? -15.381 -36.734 32.524   1.00 85.95  ?  24  DG  C "C1'" 1 
ATOM   2946  N N9    . DG  C 3 24  ? -14.781 -35.438 32.803   1.00 74.82  ?  24  DG  C N9    1 
ATOM   2947  C C8    . DG  C 3 24  ? -15.388 -34.310 33.302   1.00 67.54  ?  24  DG  C C8    1 
ATOM   2948  N N7    . DG  C 3 24  ? -14.563 -33.305 33.452   1.00 59.50  ?  24  DG  C N7    1 
ATOM   2949  C C5    . DG  C 3 24  ? -13.337 -33.809 33.027   1.00 57.06  ?  24  DG  C C5    1 
ATOM   2950  C C6    . DG  C 3 24  ? -12.063 -33.193 32.959   1.00 55.70  ?  24  DG  C C6    1 
ATOM   2951  O O6    . DG  C 3 24  ? -11.751 -32.032 33.263   1.00 61.50  ?  24  DG  C O6    1 
ATOM   2952  N N1    . DG  C 3 24  ? -11.095 -34.070 32.464   1.00 43.04  ?  24  DG  C N1    1 
ATOM   2953  C C2    . DG  C 3 24  ? -11.334 -35.374 32.093   1.00 53.26  ?  24  DG  C C2    1 
ATOM   2954  N N2    . DG  C 3 24  ? -10.288 -36.072 31.642   1.00 42.80  ?  24  DG  C N2    1 
ATOM   2955  N N3    . DG  C 3 24  ? -12.516 -35.955 32.158   1.00 55.09  ?  24  DG  C N3    1 
ATOM   2956  C C4    . DG  C 3 24  ? -13.464 -35.119 32.630   1.00 61.72  ?  24  DG  C C4    1 
ATOM   2957  P P     . DA  C 3 25  ? -16.450 -40.880 33.645   1.00 115.72 ?  25  DA  C P     1 
ATOM   2958  O OP1   . DA  C 3 25  ? -17.604 -41.485 32.943   1.00 119.84 ?  25  DA  C OP1   1 
ATOM   2959  O OP2   . DA  C 3 25  ? -16.546 -40.580 35.091   1.00 96.67  -1 25  DA  C OP2   1 
ATOM   2960  O "O5'" . DA  C 3 25  ? -15.160 -41.792 33.407   1.00 73.13  ?  25  DA  C "O5'" 1 
ATOM   2961  C "C5'" . DA  C 3 25  ? -14.505 -41.754 32.145   1.00 81.07  ?  25  DA  C "C5'" 1 
ATOM   2962  C "C4'" . DA  C 3 25  ? -12.995 -41.846 32.291   1.00 87.11  ?  25  DA  C "C4'" 1 
ATOM   2963  O "O4'" . DA  C 3 25  ? -12.418 -40.522 32.443   1.00 97.29  ?  25  DA  C "O4'" 1 
ATOM   2964  C "C3'" . DA  C 3 25  ? -12.509 -42.677 33.473   1.00 70.84  ?  25  DA  C "C3'" 1 
ATOM   2965  O "O3'" . DA  C 3 25  ? -11.402 -43.477 33.082   1.00 72.91  ?  25  DA  C "O3'" 1 
ATOM   2966  C "C2'" . DA  C 3 25  ? -12.107 -41.618 34.507   1.00 72.83  ?  25  DA  C "C2'" 1 
ATOM   2967  C "C1'" . DA  C 3 25  ? -11.653 -40.454 33.628   1.00 76.85  ?  25  DA  C "C1'" 1 
ATOM   2968  N N9    . DA  C 3 25  ? -11.831 -39.130 34.233   1.00 67.06  ?  25  DA  C N9    1 
ATOM   2969  C C8    . DA  C 3 25  ? -13.000 -38.563 34.660   1.00 72.06  ?  25  DA  C C8    1 
ATOM   2970  N N7    . DA  C 3 25  ? -12.855 -37.352 35.153   1.00 60.27  ?  25  DA  C N7    1 
ATOM   2971  C C5    . DA  C 3 25  ? -11.499 -37.099 35.025   1.00 53.20  ?  25  DA  C C5    1 
ATOM   2972  C C6    . DA  C 3 25  ? -10.701 -35.982 35.360   1.00 50.54  ?  25  DA  C C6    1 
ATOM   2973  N N6    . DA  C 3 25  ? -11.186 -34.865 35.917   1.00 49.53  ?  25  DA  C N6    1 
ATOM   2974  N N1    . DA  C 3 25  ? -9.378  -36.058 35.099   1.00 51.02  ?  25  DA  C N1    1 
ATOM   2975  C C2    . DA  C 3 25  ? -8.894  -37.175 34.542   1.00 50.01  ?  25  DA  C C2    1 
ATOM   2976  N N3    . DA  C 3 25  ? -9.542  -38.285 34.185   1.00 47.51  ?  25  DA  C N3    1 
ATOM   2977  C C4    . DA  C 3 25  ? -10.853 -38.182 34.455   1.00 56.30  ?  25  DA  C C4    1 
ATOM   2978  P P     . DC  C 3 26  ? -10.984 -44.748 33.970   1.00 89.69  ?  26  DC  C P     1 
ATOM   2979  O OP1   . DC  C 3 26  ? -10.507 -45.795 33.041   1.00 81.35  ?  26  DC  C OP1   1 
ATOM   2980  O OP2   . DC  C 3 26  ? -12.099 -45.038 34.899   1.00 96.10  -1 26  DC  C OP2   1 
ATOM   2981  O "O5'" . DC  C 3 26  ? -9.743  -44.233 34.836   1.00 98.40  ?  26  DC  C "O5'" 1 
ATOM   2982  C "C5'" . DC  C 3 26  ? -8.667  -43.544 34.210   1.00 74.19  ?  26  DC  C "C5'" 1 
ATOM   2983  C "C4'" . DC  C 3 26  ? -7.842  -42.787 35.239   1.00 83.42  ?  26  DC  C "C4'" 1 
ATOM   2984  O "O4'" . DC  C 3 26  ? -8.439  -41.508 35.507   1.00 88.09  ?  26  DC  C "O4'" 1 
ATOM   2985  C "C3'" . DC  C 3 26  ? -7.705  -43.475 36.601   1.00 79.26  ?  26  DC  C "C3'" 1 
ATOM   2986  O "O3'" . DC  C 3 26  ? -6.407  -44.043 36.733   1.00 75.94  ?  26  DC  C "O3'" 1 
ATOM   2987  C "C2'" . DC  C 3 26  ? -7.940  -42.350 37.632   1.00 62.59  ?  26  DC  C "C2'" 1 
ATOM   2988  C "C1'" . DC  C 3 26  ? -8.005  -41.091 36.771   1.00 63.65  ?  26  DC  C "C1'" 1 
ATOM   2989  N N1    . DC  C 3 26  ? -8.939  -40.045 37.281   1.00 54.17  ?  26  DC  C N1    1 
ATOM   2990  C C2    . DC  C 3 26  ? -8.451  -38.760 37.529   1.00 49.25  ?  26  DC  C C2    1 
ATOM   2991  O O2    . DC  C 3 26  ? -7.257  -38.526 37.325   1.00 51.76  ?  26  DC  C O2    1 
ATOM   2992  N N3    . DC  C 3 26  ? -9.301  -37.807 37.985   1.00 44.26  ?  26  DC  C N3    1 
ATOM   2993  C C4    . DC  C 3 26  ? -10.586 -38.105 38.190   1.00 52.05  ?  26  DC  C C4    1 
ATOM   2994  N N4    . DC  C 3 26  ? -11.386 -37.133 38.642   1.00 54.19  ?  26  DC  C N4    1 
ATOM   2995  C C5    . DC  C 3 26  ? -11.105 -39.413 37.941   1.00 53.03  ?  26  DC  C C5    1 
ATOM   2996  C C6    . DC  C 3 26  ? -10.254 -40.343 37.490   1.00 51.28  ?  26  DC  C C6    1 
ATOM   2997  O "O5'" . DT  D 4 1   ? -8.050  -28.642 -7.203   1.00 49.56  ?  16  DT  X "O5'" 1 
ATOM   2998  C "C5'" . DT  D 4 1   ? -7.306  -28.175 -6.067   1.00 81.61  ?  16  DT  X "C5'" 1 
ATOM   2999  C "C4'" . DT  D 4 1   ? -8.219  -27.499 -5.070   1.00 92.52  ?  16  DT  X "C4'" 1 
ATOM   3000  O "O4'" . DT  D 4 1   ? -8.039  -26.060 -5.049   1.00 94.20  ?  16  DT  X "O4'" 1 
ATOM   3001  C "C3'" . DT  D 4 1   ? -9.708  -27.725 -5.300   1.00 82.50  ?  16  DT  X "C3'" 1 
ATOM   3002  O "O3'" . DT  D 4 1   ? -10.243 -28.086 -4.033   1.00 81.56  ?  16  DT  X "O3'" 1 
ATOM   3003  C "C2'" . DT  D 4 1   ? -10.201 -26.375 -5.777   1.00 68.03  ?  16  DT  X "C2'" 1 
ATOM   3004  C "C1'" . DT  D 4 1   ? -9.316  -25.446 -5.011   1.00 76.58  ?  16  DT  X "C1'" 1 
ATOM   3005  N N1    . DT  D 4 1   ? -9.220  -24.099 -5.604   1.00 69.68  ?  16  DT  X N1    1 
ATOM   3006  C C2    . DT  D 4 1   ? -10.317 -23.280 -5.472   1.00 67.46  ?  16  DT  X C2    1 
ATOM   3007  O O2    . DT  D 4 1   ? -11.332 -23.617 -4.899   1.00 81.38  ?  16  DT  X O2    1 
ATOM   3008  N N3    . DT  D 4 1   ? -10.173 -22.037 -6.019   1.00 65.47  ?  16  DT  X N3    1 
ATOM   3009  C C4    . DT  D 4 1   ? -9.087  -21.560 -6.714   1.00 69.88  ?  16  DT  X C4    1 
ATOM   3010  O O4    . DT  D 4 1   ? -9.096  -20.412 -7.140   1.00 59.56  ?  16  DT  X O4    1 
ATOM   3011  C C5    . DT  D 4 1   ? -7.965  -22.458 -6.801   1.00 75.53  ?  16  DT  X C5    1 
ATOM   3012  C C7    . DT  D 4 1   ? -6.729  -22.002 -7.507   1.00 86.94  ?  16  DT  X C7    1 
ATOM   3013  C C6    . DT  D 4 1   ? -8.089  -23.675 -6.264   1.00 74.27  ?  16  DT  X C6    1 
ATOM   3014  P P     . DA  D 4 2   ? -11.716 -28.611 -3.916   1.00 101.36 ?  17  DA  X P     1 
ATOM   3015  O OP1   . DA  D 4 2   ? -12.543 -27.453 -3.580   1.00 104.32 ?  17  DA  X OP1   1 
ATOM   3016  O OP2   . DA  D 4 2   ? -12.589 -29.526 -3.211   1.00 67.76  ?  17  DA  X OP2   1 
ATOM   3017  O "O5'" . DA  D 4 2   ? -12.111 -28.912 -5.417   1.00 87.44  ?  17  DA  X "O5'" 1 
ATOM   3018  C "C5'" . DA  D 4 2   ? -13.472 -29.132 -5.730   1.00 83.83  ?  17  DA  X "C5'" 1 
ATOM   3019  C "C4'" . DA  D 4 2   ? -14.120 -27.946 -6.407   1.00 71.06  ?  17  DA  X "C4'" 1 
ATOM   3020  O "O4'" . DA  D 4 2   ? -13.245 -26.841 -6.698   1.00 61.90  ?  17  DA  X "O4'" 1 
ATOM   3021  C "C3'" . DA  D 4 2   ? -14.762 -28.317 -7.734   1.00 51.35  ?  17  DA  X "C3'" 1 
ATOM   3022  O "O3'" . DA  D 4 2   ? -16.144 -28.205 -7.531   1.00 46.78  ?  17  DA  X "O3'" 1 
ATOM   3023  C "C2'" . DA  D 4 2   ? -14.346 -27.212 -8.680   1.00 54.43  ?  17  DA  X "C2'" 1 
ATOM   3024  C "C1'" . DA  D 4 2   ? -13.855 -26.140 -7.753   1.00 57.74  ?  17  DA  X "C1'" 1 
ATOM   3025  N N9    . DA  D 4 2   ? -12.855 -25.290 -8.374   1.00 52.39  ?  17  DA  X N9    1 
ATOM   3026  C C8    . DA  D 4 2   ? -11.671 -25.667 -8.948   1.00 63.25  ?  17  DA  X C8    1 
ATOM   3027  N N7    . DA  D 4 2   ? -10.984 -24.671 -9.446   1.00 54.33  ?  17  DA  X N7    1 
ATOM   3028  C C5    . DA  D 4 2   ? -11.782 -23.566 -9.203   1.00 50.70  ?  17  DA  X C5    1 
ATOM   3029  C C6    . DA  D 4 2   ? -11.604 -22.199 -9.459   1.00 48.29  ?  17  DA  X C6    1 
ATOM   3030  N N6    . DA  D 4 2   ? -10.553 -21.708 -10.105  1.00 46.95  ?  17  DA  X N6    1 
ATOM   3031  N N1    . DA  D 4 2   ? -12.601 -21.356 -9.112   1.00 55.05  ?  17  DA  X N1    1 
ATOM   3032  C C2    . DA  D 4 2   ? -13.675 -21.860 -8.490   1.00 57.16  ?  17  DA  X C2    1 
ATOM   3033  N N3    . DA  D 4 2   ? -13.942 -23.123 -8.167   1.00 51.83  ?  17  DA  X N3    1 
ATOM   3034  C C4    . DA  D 4 2   ? -12.941 -23.934 -8.549   1.00 50.16  ?  17  DA  X C4    1 
ATOM   3035  P P     . DG  D 4 3   ? -17.065 -28.989 -8.422   1.00 68.57  ?  18  DG  X P     1 
ATOM   3036  O OP1   . DG  D 4 3   ? -18.316 -29.143 -7.707   1.00 67.72  ?  18  DG  X OP1   1 
ATOM   3037  O OP2   . DG  D 4 3   ? -16.340 -30.158 -8.892   1.00 57.51  -1 18  DG  X OP2   1 
ATOM   3038  O "O5'" . DG  D 4 3   ? -17.324 -27.981 -9.607   1.00 66.94  ?  18  DG  X "O5'" 1 
ATOM   3039  C "C5'" . DG  D 4 3   ? -18.186 -26.883 -9.370   1.00 53.44  ?  18  DG  X "C5'" 1 
ATOM   3040  C "C4'" . DG  D 4 3   ? -17.929 -25.773 -10.357  1.00 53.46  ?  18  DG  X "C4'" 1 
ATOM   3041  O "O4'" . DG  D 4 3   ? -16.539 -25.441 -10.431  1.00 46.77  ?  18  DG  X "O4'" 1 
ATOM   3042  C "C3'" . DG  D 4 3   ? -18.313 -26.071 -11.797  1.00 53.84  ?  18  DG  X "C3'" 1 
ATOM   3043  O "O3'" . DG  D 4 3   ? -19.588 -25.533 -12.086  1.00 59.47  ?  18  DG  X "O3'" 1 
ATOM   3044  C "C2'" . DG  D 4 3   ? -17.317 -25.255 -12.597  1.00 52.59  ?  18  DG  X "C2'" 1 
ATOM   3045  C "C1'" . DG  D 4 3   ? -16.466 -24.589 -11.537  1.00 38.21  ?  18  DG  X "C1'" 1 
ATOM   3046  N N9    . DG  D 4 3   ? -15.066 -24.395 -11.882  1.00 42.73  ?  18  DG  X N9    1 
ATOM   3047  C C8    . DG  D 4 3   ? -14.097 -25.352 -12.034  1.00 50.12  ?  18  DG  X C8    1 
ATOM   3048  N N7    . DG  D 4 3   ? -12.935 -24.856 -12.354  1.00 46.21  ?  18  DG  X N7    1 
ATOM   3049  C C5    . DG  D 4 3   ? -13.153 -23.490 -12.422  1.00 37.63  ?  18  DG  X C5    1 
ATOM   3050  C C6    . DG  D 4 3   ? -12.265 -22.433 -12.762  1.00 37.99  ?  18  DG  X C6    1 
ATOM   3051  O O6    . DG  D 4 3   ? -11.063 -22.495 -13.027  1.00 36.81  ?  18  DG  X O6    1 
ATOM   3052  N N1    . DG  D 4 3   ? -12.892 -21.196 -12.699  1.00 43.51  ?  18  DG  X N1    1 
ATOM   3053  C C2    . DG  D 4 3   ? -14.217 -21.009 -12.404  1.00 47.29  ?  18  DG  X C2    1 
ATOM   3054  N N2    . DG  D 4 3   ? -14.648 -19.747 -12.429  1.00 59.38  ?  18  DG  X N2    1 
ATOM   3055  N N3    . DG  D 4 3   ? -15.063 -21.986 -12.122  1.00 37.85  ?  18  DG  X N3    1 
ATOM   3056  C C4    . DG  D 4 3   ? -14.468 -23.194 -12.153  1.00 36.26  ?  18  DG  X C4    1 
ATOM   3057  P P     . DG  D 4 4   ? -20.136 -25.682 -13.486  1.00 47.80  ?  19  DG  X P     1 
ATOM   3058  O OP1   . DG  D 4 4   ? -21.613 -25.612 -13.423  1.00 59.24  ?  19  DG  X OP1   1 
ATOM   3059  O OP2   . DG  D 4 4   ? -19.479 -26.864 -14.088  1.00 38.18  -1 19  DG  X OP2   1 
ATOM   3060  O "O5'" . DG  D 4 4   ? -19.561 -24.392 -14.216  1.00 37.81  ?  19  DG  X "O5'" 1 
ATOM   3061  C "C5'" . DG  D 4 4   ? -19.634 -23.152 -13.533  1.00 40.27  ?  19  DG  X "C5'" 1 
ATOM   3062  C "C4'" . DG  D 4 4   ? -18.809 -22.103 -14.238  1.00 46.05  ?  19  DG  X "C4'" 1 
ATOM   3063  O "O4'" . DG  D 4 4   ? -17.415 -22.430 -14.122  1.00 46.57  ?  19  DG  X "O4'" 1 
ATOM   3064  C "C3'" . DG  D 4 4   ? -19.012 -22.006 -15.730  1.00 52.22  ?  19  DG  X "C3'" 1 
ATOM   3065  O "O3'" . DG  D 4 4   ? -20.071 -21.113 -15.991  1.00 62.26  ?  19  DG  X "O3'" 1 
ATOM   3066  C "C2'" . DG  D 4 4   ? -17.659 -21.477 -16.247  1.00 49.04  ?  19  DG  X "C2'" 1 
ATOM   3067  C "C1'" . DG  D 4 4   ? -16.731 -21.613 -15.035  1.00 36.35  ?  19  DG  X "C1'" 1 
ATOM   3068  N N9    . DG  D 4 4   ? -15.462 -22.249 -15.376  1.00 34.56  ?  19  DG  X N9    1 
ATOM   3069  C C8    . DG  D 4 4   ? -15.142 -23.581 -15.268  1.00 39.69  ?  19  DG  X C8    1 
ATOM   3070  N N7    . DG  D 4 4   ? -13.930 -23.857 -15.669  1.00 45.10  ?  19  DG  X N7    1 
ATOM   3071  C C5    . DG  D 4 4   ? -13.418 -22.632 -16.075  1.00 41.34  ?  19  DG  X C5    1 
ATOM   3072  C C6    . DG  D 4 4   ? -12.146 -22.303 -16.604  1.00 38.70  ?  19  DG  X C6    1 
ATOM   3073  O O6    . DG  D 4 4   ? -11.187 -23.055 -16.826  1.00 36.48  ?  19  DG  X O6    1 
ATOM   3074  N N1    . DG  D 4 4   ? -12.041 -20.942 -16.881  1.00 41.05  ?  19  DG  X N1    1 
ATOM   3075  C C2    . DG  D 4 4   ? -13.042 -20.021 -16.673  1.00 52.98  ?  19  DG  X C2    1 
ATOM   3076  N N2    . DG  D 4 4   ? -12.763 -18.756 -17.000  1.00 57.14  ?  19  DG  X N2    1 
ATOM   3077  N N3    . DG  D 4 4   ? -14.234 -20.317 -16.180  1.00 51.98  ?  19  DG  X N3    1 
ATOM   3078  C C4    . DG  D 4 4   ? -14.351 -21.635 -15.904  1.00 44.98  ?  19  DG  X C4    1 
ATOM   3079  P P     . DA  D 4 5   ? -20.763 -21.064 -17.434  1.00 58.89  ?  20  DA  X P     1 
ATOM   3080  O OP1   . DA  D 4 5   ? -22.050 -20.346 -17.286  1.00 61.96  ?  20  DA  X OP1   1 
ATOM   3081  O OP2   . DA  D 4 5   ? -20.731 -22.427 -18.014  1.00 39.98  -1 20  DA  X OP2   1 
ATOM   3082  O "O5'" . DA  D 4 5   ? -19.735 -20.168 -18.258  1.00 52.15  ?  20  DA  X "O5'" 1 
ATOM   3083  C "C5'" . DA  D 4 5   ? -19.461 -18.842 -17.829  1.00 52.88  ?  20  DA  X "C5'" 1 
ATOM   3084  C "C4'" . DA  D 4 5   ? -18.464 -18.189 -18.757  1.00 59.16  ?  20  DA  X "C4'" 1 
ATOM   3085  O "O4'" . DA  D 4 5   ? -17.172 -18.835 -18.620  1.00 52.09  ?  20  DA  X "O4'" 1 
ATOM   3086  C "C3'" . DA  D 4 5   ? -18.835 -18.247 -20.235  1.00 68.29  ?  20  DA  X "C3'" 1 
ATOM   3087  O "O3'" . DA  D 4 5   ? -18.759 -16.952 -20.796  1.00 79.48  ?  20  DA  X "O3'" 1 
ATOM   3088  C "C2'" . DA  D 4 5   ? -17.793 -19.188 -20.847  1.00 67.89  ?  20  DA  X "C2'" 1 
ATOM   3089  C "C1'" . DA  D 4 5   ? -16.616 -19.041 -19.894  1.00 54.95  ?  20  DA  X "C1'" 1 
ATOM   3090  N N9    . DA  D 4 5   ? -15.748 -20.218 -19.848  1.00 47.51  ?  20  DA  X N9    1 
ATOM   3091  C C8    . DA  D 4 5   ? -16.111 -21.501 -19.545  1.00 52.21  ?  20  DA  X C8    1 
ATOM   3092  N N7    . DA  D 4 5   ? -15.116 -22.357 -19.586  1.00 51.21  ?  20  DA  X N7    1 
ATOM   3093  C C5    . DA  D 4 5   ? -14.026 -21.582 -19.945  1.00 46.89  ?  20  DA  X C5    1 
ATOM   3094  C C6    . DA  D 4 5   ? -12.668 -21.893 -20.159  1.00 46.68  ?  20  DA  X C6    1 
ATOM   3095  N N6    . DA  D 4 5   ? -12.164 -23.126 -20.035  1.00 46.54  ?  20  DA  X N6    1 
ATOM   3096  N N1    . DA  D 4 5   ? -11.844 -20.884 -20.506  1.00 43.22  ?  20  DA  X N1    1 
ATOM   3097  C C2    . DA  D 4 5   ? -12.348 -19.651 -20.631  1.00 51.29  ?  20  DA  X C2    1 
ATOM   3098  N N3    . DA  D 4 5   ? -13.602 -19.237 -20.457  1.00 55.21  ?  20  DA  X N3    1 
ATOM   3099  C C4    . DA  D 4 5   ? -14.398 -20.261 -20.112  1.00 49.50  ?  20  DA  X C4    1 
ATOM   3100  P P     . DG  D 4 6   ? -19.329 -16.679 -22.270  1.00 85.50  ?  21  DG  X P     1 
ATOM   3101  O OP1   . DG  D 4 6   ? -19.975 -15.347 -22.260  1.00 80.05  ?  21  DG  X OP1   1 
ATOM   3102  O OP2   . DG  D 4 6   ? -20.101 -17.871 -22.685  1.00 83.57  -1 21  DG  X OP2   1 
ATOM   3103  O "O5'" . DG  D 4 6   ? -18.017 -16.606 -23.174  1.00 67.37  ?  21  DG  X "O5'" 1 
ATOM   3104  C "C5'" . DG  D 4 6   ? -16.980 -15.692 -22.862  1.00 52.70  ?  21  DG  X "C5'" 1 
ATOM   3105  C "C4'" . DG  D 4 6   ? -15.758 -15.976 -23.716  1.00 72.17  ?  21  DG  X "C4'" 1 
ATOM   3106  O "O4'" . DG  D 4 6   ? -15.108 -17.200 -23.276  1.00 59.87  ?  21  DG  X "O4'" 1 
ATOM   3107  C "C3'" . DG  D 4 6   ? -16.050 -16.176 -25.213  1.00 85.00  ?  21  DG  X "C3'" 1 
ATOM   3108  O "O3'" . DG  D 4 6   ? -15.032 -15.558 -25.972  1.00 88.19  ?  21  DG  X "O3'" 1 
ATOM   3109  C "C2'" . DG  D 4 6   ? -15.963 -17.690 -25.365  1.00 69.60  ?  21  DG  X "C2'" 1 
ATOM   3110  C "C1'" . DG  D 4 6   ? -14.805 -17.944 -24.429  1.00 66.00  ?  21  DG  X "C1'" 1 
ATOM   3111  N N9    . DG  D 4 6   ? -14.555 -19.341 -24.101  1.00 54.01  ?  21  DG  X N9    1 
ATOM   3112  C C8    . DG  D 4 6   ? -15.471 -20.325 -23.816  1.00 52.58  ?  21  DG  X C8    1 
ATOM   3113  N N7    . DG  D 4 6   ? -14.920 -21.489 -23.589  1.00 43.65  ?  21  DG  X N7    1 
ATOM   3114  C C5    . DG  D 4 6   ? -13.559 -21.257 -23.758  1.00 38.88  ?  21  DG  X C5    1 
ATOM   3115  C C6    . DG  D 4 6   ? -12.455 -22.139 -23.648  1.00 44.30  ?  21  DG  X C6    1 
ATOM   3116  O O6    . DG  D 4 6   ? -12.461 -23.345 -23.368  1.00 51.68  ?  21  DG  X O6    1 
ATOM   3117  N N1    . DG  D 4 6   ? -11.247 -21.488 -23.901  1.00 45.57  ?  21  DG  X N1    1 
ATOM   3118  C C2    . DG  D 4 6   ? -11.129 -20.153 -24.219  1.00 49.52  ?  21  DG  X C2    1 
ATOM   3119  N N2    . DG  D 4 6   ? -9.891  -19.693 -24.429  1.00 44.58  ?  21  DG  X N2    1 
ATOM   3120  N N3    . DG  D 4 6   ? -12.153 -19.326 -24.324  1.00 45.90  ?  21  DG  X N3    1 
ATOM   3121  C C4    . DG  D 4 6   ? -13.329 -19.943 -24.081  1.00 42.22  ?  21  DG  X C4    1 
ATOM   3122  P P     . DC  D 4 7   ? -15.391 -14.696 -27.276  1.00 77.49  ?  22  DC  X P     1 
ATOM   3123  O OP1   . DC  D 4 7   ? -15.986 -13.421 -26.816  1.00 70.22  ?  22  DC  X OP1   1 
ATOM   3124  O OP2   . DC  D 4 7   ? -16.150 -15.574 -28.194  1.00 65.43  -1 22  DC  X OP2   1 
ATOM   3125  O "O5'" . DC  D 4 7   ? -13.962 -14.395 -27.933  1.00 57.88  ?  22  DC  X "O5'" 1 
ATOM   3126  C "C5'" . DC  D 4 7   ? -12.924 -13.853 -27.130  1.00 45.18  ?  22  DC  X "C5'" 1 
ATOM   3127  C "C4'" . DC  D 4 7   ? -11.557 -14.411 -27.513  1.00 64.87  ?  22  DC  X "C4'" 1 
ATOM   3128  O "O4'" . DC  D 4 7   ? -11.438 -15.798 -27.062  1.00 68.00  ?  22  DC  X "O4'" 1 
ATOM   3129  C "C3'" . DC  D 4 7   ? -11.263 -14.442 -29.016  1.00 70.95  ?  22  DC  X "C3'" 1 
ATOM   3130  O "O3'" . DC  D 4 7   ? -9.897  -14.100 -29.244  1.00 73.93  ?  22  DC  X "O3'" 1 
ATOM   3131  C "C2'" . DC  D 4 7   ? -11.553 -15.886 -29.399  1.00 72.33  ?  22  DC  X "C2'" 1 
ATOM   3132  C "C1'" . DC  D 4 7   ? -11.080 -16.622 -28.160  1.00 65.86  ?  22  DC  X "C1'" 1 
ATOM   3133  N N1    . DC  D 4 7   ? -11.708 -17.977 -28.000  1.00 53.45  ?  22  DC  X N1    1 
ATOM   3134  C C2    . DC  D 4 7   ? -10.901 -19.113 -27.792  1.00 53.98  ?  22  DC  X C2    1 
ATOM   3135  O O2    . DC  D 4 7   ? -9.668  -18.989 -27.746  1.00 54.38  ?  22  DC  X O2    1 
ATOM   3136  N N3    . DC  D 4 7   ? -11.499 -20.326 -27.660  1.00 49.99  ?  22  DC  X N3    1 
ATOM   3137  C C4    . DC  D 4 7   ? -12.830 -20.423 -27.721  1.00 52.58  ?  22  DC  X C4    1 
ATOM   3138  N N4    . DC  D 4 7   ? -13.377 -21.634 -27.581  1.00 51.22  ?  22  DC  X N4    1 
ATOM   3139  C C5    . DC  D 4 7   ? -13.661 -19.282 -27.929  1.00 56.19  ?  22  DC  X C5    1 
ATOM   3140  C C6    . DC  D 4 7   ? -13.065 -18.094 -28.063  1.00 48.72  ?  22  DC  X C6    1 
ATOM   3141  P P     . DA  D 4 8   ? -9.310  -14.017 -30.739  1.00 86.57  ?  23  DA  X P     1 
ATOM   3142  O OP1   . DA  D 4 8   ? -8.406  -12.848 -30.809  1.00 90.63  ?  23  DA  X OP1   1 
ATOM   3143  O OP2   . DA  D 4 8   ? -10.454 -14.127 -31.672  1.00 66.24  -1 23  DA  X OP2   1 
ATOM   3144  O "O5'" . DA  D 4 8   ? -8.445  -15.356 -30.876  1.00 64.81  ?  23  DA  X "O5'" 1 
ATOM   3145  C "C5'" . DA  D 4 8   ? -7.601  -15.750 -29.795  1.00 62.12  ?  23  DA  X "C5'" 1 
ATOM   3146  C "C4'" . DA  D 4 8   ? -6.712  -16.930 -30.159  1.00 55.68  ?  23  DA  X "C4'" 1 
ATOM   3147  O "O4'" . DA  D 4 8   ? -7.420  -18.172 -29.918  1.00 64.68  ?  23  DA  X "O4'" 1 
ATOM   3148  C "C3'" . DA  D 4 8   ? -6.256  -16.990 -31.611  1.00 60.47  ?  23  DA  X "C3'" 1 
ATOM   3149  O "O3'" . DA  D 4 8   ? -4.951  -17.561 -31.669  1.00 55.54  ?  23  DA  X "O3'" 1 
ATOM   3150  C "C2'" . DA  D 4 8   ? -7.308  -17.888 -32.261  1.00 70.85  ?  23  DA  X "C2'" 1 
ATOM   3151  C "C1'" . DA  D 4 8   ? -7.630  -18.862 -31.134  1.00 57.52  ?  23  DA  X "C1'" 1 
ATOM   3152  N N9    . DA  D 4 8   ? -9.008  -19.347 -31.148  1.00 59.01  ?  23  DA  X N9    1 
ATOM   3153  C C8    . DA  D 4 8   ? -10.151 -18.595 -31.194  1.00 53.43  ?  23  DA  X C8    1 
ATOM   3154  N N7    . DA  D 4 8   ? -11.255 -19.308 -31.190  1.00 48.26  ?  23  DA  X N7    1 
ATOM   3155  C C5    . DA  D 4 8   ? -10.804 -20.617 -31.137  1.00 55.84  ?  23  DA  X C5    1 
ATOM   3156  C C6    . DA  D 4 8   ? -11.475 -21.858 -31.107  1.00 55.62  ?  23  DA  X C6    1 
ATOM   3157  N N6    . DA  D 4 8   ? -12.809 -21.984 -31.126  1.00 50.59  ?  23  DA  X N6    1 
ATOM   3158  N N1    . DA  D 4 8   ? -10.718 -22.970 -31.057  1.00 53.55  ?  23  DA  X N1    1 
ATOM   3159  C C2    . DA  D 4 8   ? -9.388  -22.852 -31.032  1.00 51.38  ?  23  DA  X C2    1 
ATOM   3160  N N3    . DA  D 4 8   ? -8.645  -21.749 -31.057  1.00 48.93  ?  23  DA  X N3    1 
ATOM   3161  C C4    . DA  D 4 8   ? -9.421  -20.656 -31.109  1.00 55.99  ?  23  DA  X C4    1 
ATOM   3162  P P     . DT  D 4 9   ? -4.150  -17.677 -33.058  1.00 81.29  ?  24  DT  X P     1 
ATOM   3163  O OP1   . DT  D 4 9   ? -2.725  -17.383 -32.783  1.00 68.04  ?  24  DT  X OP1   1 
ATOM   3164  O OP2   . DT  D 4 9   ? -4.886  -16.890 -34.072  1.00 81.95  -1 24  DT  X OP2   1 
ATOM   3165  O "O5'" . DT  D 4 9   ? -4.290  -19.223 -33.440  1.00 58.23  ?  24  DT  X "O5'" 1 
ATOM   3166  C "C5'" . DT  D 4 9   ? -3.848  -20.209 -32.523  1.00 47.96  ?  24  DT  X "C5'" 1 
ATOM   3167  C "C4'" . DT  D 4 9   ? -4.252  -21.599 -32.976  1.00 59.43  ?  24  DT  X "C4'" 1 
ATOM   3168  O "O4'" . DT  D 4 9   ? -5.685  -21.733 -32.900  1.00 63.63  ?  24  DT  X "O4'" 1 
ATOM   3169  C "C3'" . DT  D 4 9   ? -3.883  -21.970 -34.420  1.00 54.60  ?  24  DT  X "C3'" 1 
ATOM   3170  O "O3'" . DT  D 4 9   ? -2.946  -23.041 -34.387  1.00 58.91  ?  24  DT  X "O3'" 1 
ATOM   3171  C "C2'" . DT  D 4 9   ? -5.211  -22.373 -35.079  1.00 55.20  ?  24  DT  X "C2'" 1 
ATOM   3172  C "C1'" . DT  D 4 9   ? -6.085  -22.653 -33.876  1.00 43.39  ?  24  DT  X "C1'" 1 
ATOM   3173  N N1    . DT  D 4 9   ? -7.536  -22.472 -34.125  1.00 46.97  ?  24  DT  X N1    1 
ATOM   3174  C C2    . DT  D 4 9   ? -8.367  -23.555 -34.022  1.00 51.20  ?  24  DT  X C2    1 
ATOM   3175  O O2    . DT  D 4 9   ? -7.969  -24.681 -33.780  1.00 50.16  ?  24  DT  X O2    1 
ATOM   3176  N N3    . DT  D 4 9   ? -9.686  -23.286 -34.253  1.00 51.19  ?  24  DT  X N3    1 
ATOM   3177  C C4    . DT  D 4 9   ? -10.256 -22.065 -34.540  1.00 51.53  ?  24  DT  X C4    1 
ATOM   3178  O O4    . DT  D 4 9   ? -11.464 -21.934 -34.721  1.00 61.13  ?  24  DT  X O4    1 
ATOM   3179  C C5    . DT  D 4 9   ? -9.332  -20.958 -34.611  1.00 42.93  ?  24  DT  X C5    1 
ATOM   3180  C C7    . DT  D 4 9   ? -9.831  -19.578 -34.919  1.00 38.27  ?  24  DT  X C7    1 
ATOM   3181  C C6    . DT  D 4 9   ? -8.030  -21.210 -34.394  1.00 46.67  ?  24  DT  X C6    1 
ATOM   3182  P P     . DT  D 4 10  ? -2.378  -23.706 -35.734  1.00 83.06  ?  25  DT  X P     1 
ATOM   3183  O OP1   . DT  D 4 10  ? -0.957  -24.045 -35.498  1.00 69.76  ?  25  DT  X OP1   1 
ATOM   3184  O OP2   . DT  D 4 10  ? -2.756  -22.839 -36.873  1.00 86.86  -1 25  DT  X OP2   1 
ATOM   3185  O "O5'" . DT  D 4 10  ? -3.224  -25.062 -35.842  1.00 48.69  ?  25  DT  X "O5'" 1 
ATOM   3186  C "C5'" . DT  D 4 10  ? -3.325  -25.901 -34.697  1.00 59.01  ?  25  DT  X "C5'" 1 
ATOM   3187  C "C4'" . DT  D 4 10  ? -4.349  -27.008 -34.892  1.00 57.92  ?  25  DT  X "C4'" 1 
ATOM   3188  O "O4'" . DT  D 4 10  ? -5.684  -26.443 -34.971  1.00 58.99  ?  25  DT  X "O4'" 1 
ATOM   3189  C "C3'" . DT  D 4 10  ? -4.176  -27.864 -36.149  1.00 61.88  ?  25  DT  X "C3'" 1 
ATOM   3190  O "O3'" . DT  D 4 10  ? -4.259  -29.244 -35.775  1.00 66.30  ?  25  DT  X "O3'" 1 
ATOM   3191  C "C2'" . DT  D 4 10  ? -5.334  -27.431 -37.052  1.00 62.62  ?  25  DT  X "C2'" 1 
ATOM   3192  C "C1'" . DT  D 4 10  ? -6.380  -27.072 -36.020  1.00 57.33  ?  25  DT  X "C1'" 1 
ATOM   3193  N N1    . DT  D 4 10  ? -7.456  -26.155 -36.503  1.00 50.04  ?  25  DT  X N1    1 
ATOM   3194  C C2    . DT  D 4 10  ? -8.764  -26.554 -36.392  1.00 54.85  ?  25  DT  X C2    1 
ATOM   3195  O O2    . DT  D 4 10  ? -9.093  -27.656 -35.989  1.00 63.33  ?  25  DT  X O2    1 
ATOM   3196  N N3    . DT  D 4 10  ? -9.680  -25.644 -36.836  1.00 47.53  ?  25  DT  X N3    1 
ATOM   3197  C C4    . DT  D 4 10  ? -9.435  -24.379 -37.327  1.00 52.08  ?  25  DT  X C4    1 
ATOM   3198  O O4    . DT  D 4 10  ? -10.342 -23.632 -37.688  1.00 58.88  ?  25  DT  X O4    1 
ATOM   3199  C C5    . DT  D 4 10  ? -8.042  -24.000 -37.382  1.00 52.64  ?  25  DT  X C5    1 
ATOM   3200  C C7    . DT  D 4 10  ? -7.648  -22.648 -37.899  1.00 52.08  ?  25  DT  X C7    1 
ATOM   3201  C C6    . DT  D 4 10  ? -7.129  -24.893 -36.960  1.00 52.55  ?  25  DT  X C6    1 
ATOM   3202  P P     . DT  D 4 11  ? -3.797  -30.407 -36.783  1.00 100.00 ?  26  DT  X P     1 
ATOM   3203  O OP1   . DT  D 4 11  ? -2.996  -31.371 -35.996  1.00 77.01  ?  26  DT  X OP1   1 
ATOM   3204  O OP2   . DT  D 4 11  ? -3.213  -29.771 -37.984  1.00 95.95  -1 26  DT  X OP2   1 
ATOM   3205  O "O5'" . DT  D 4 11  ? -5.169  -31.111 -37.215  1.00 83.62  ?  26  DT  X "O5'" 1 
ATOM   3206  C "C5'" . DT  D 4 11  ? -6.181  -31.359 -36.237  1.00 66.87  ?  26  DT  X "C5'" 1 
ATOM   3207  C "C4'" . DT  D 4 11  ? -7.505  -31.687 -36.903  1.00 65.56  ?  26  DT  X "C4'" 1 
ATOM   3208  O "O4'" . DT  D 4 11  ? -8.223  -30.468 -37.197  1.00 67.66  ?  26  DT  X "O4'" 1 
ATOM   3209  C "C3'" . DT  D 4 11  ? -7.388  -32.451 -38.226  1.00 78.59  ?  26  DT  X "C3'" 1 
ATOM   3210  O "O3'" . DT  D 4 11  ? -8.165  -33.642 -38.172  1.00 72.10  ?  26  DT  X "O3'" 1 
ATOM   3211  C "C2'" . DT  D 4 11  ? -7.919  -31.466 -39.275  1.00 85.20  ?  26  DT  X "C2'" 1 
ATOM   3212  C "C1'" . DT  D 4 11  ? -8.850  -30.603 -38.445  1.00 68.27  ?  26  DT  X "C1'" 1 
ATOM   3213  N N1    . DT  D 4 11  ? -9.064  -29.243 -39.003  1.00 66.85  ?  26  DT  X N1    1 
ATOM   3214  C C2    . DT  D 4 11  ? -10.344 -28.754 -39.108  1.00 64.47  ?  26  DT  X C2    1 
ATOM   3215  O O2    . DT  D 4 11  ? -11.331 -29.399 -38.803  1.00 68.32  ?  26  DT  X O2    1 
ATOM   3216  N N3    . DT  D 4 11  ? -10.432 -27.488 -39.621  1.00 50.64  ?  26  DT  X N3    1 
ATOM   3217  C C4    . DT  D 4 11  ? -9.387  -26.669 -40.008  1.00 57.11  ?  26  DT  X C4    1 
ATOM   3218  O O4    . DT  D 4 11  ? -9.568  -25.541 -40.452  1.00 56.33  ?  26  DT  X O4    1 
ATOM   3219  C C5    . DT  D 4 11  ? -8.066  -27.237 -39.851  1.00 64.64  ?  26  DT  X C5    1 
ATOM   3220  C C7    . DT  D 4 11  ? -6.852  -26.445 -40.238  1.00 59.29  ?  26  DT  X C7    1 
ATOM   3221  C C6    . DT  D 4 11  ? -7.971  -28.479 -39.356  1.00 65.07  ?  26  DT  X C6    1 
ATOM   3222  N N     . ASN E 1 16  ? -26.025 -15.665 -94.529  1.00 92.49  ?  16  ASN D N     1 
ATOM   3223  C CA    . ASN E 1 16  ? -24.895 -16.084 -95.350  1.00 97.41  ?  16  ASN D CA    1 
ATOM   3224  C C     . ASN E 1 16  ? -23.628 -16.272 -94.523  1.00 86.57  ?  16  ASN D C     1 
ATOM   3225  O O     . ASN E 1 16  ? -23.277 -15.421 -93.705  1.00 89.05  ?  16  ASN D O     1 
ATOM   3226  C CB    . ASN E 1 16  ? -24.643 -15.068 -96.466  1.00 87.31  ?  16  ASN D CB    1 
ATOM   3227  N N     . ILE E 1 17  ? -22.947 -17.393 -94.741  1.00 81.77  ?  17  ILE D N     1 
ATOM   3228  C CA    . ILE E 1 17  ? -21.745 -17.723 -93.985  1.00 89.34  ?  17  ILE D CA    1 
ATOM   3229  C C     . ILE E 1 17  ? -20.605 -16.756 -94.302  1.00 68.89  ?  17  ILE D C     1 
ATOM   3230  O O     . ILE E 1 17  ? -20.487 -16.264 -95.423  1.00 64.69  ?  17  ILE D O     1 
ATOM   3231  C CB    . ILE E 1 17  ? -21.284 -19.176 -94.271  1.00 87.39  ?  17  ILE D CB    1 
ATOM   3232  C CG1   . ILE E 1 17  ? -20.158 -19.592 -93.319  1.00 84.56  ?  17  ILE D CG1   1 
ATOM   3233  C CG2   . ILE E 1 17  ? -20.859 -19.339 -95.726  1.00 69.67  ?  17  ILE D CG2   1 
ATOM   3234  C CD1   . ILE E 1 17  ? -19.700 -21.019 -93.503  1.00 81.47  ?  17  ILE D CD1   1 
ATOM   3235  N N     . SER E 1 18  ? -19.787 -16.463 -93.298  1.00 84.02  ?  18  SER D N     1 
ATOM   3236  C CA    . SER E 1 18  ? -18.649 -15.577 -93.482  1.00 82.51  ?  18  SER D CA    1 
ATOM   3237  C C     . SER E 1 18  ? -17.485 -16.351 -94.094  1.00 79.28  ?  18  SER D C     1 
ATOM   3238  O O     . SER E 1 18  ? -17.330 -17.544 -93.836  1.00 79.03  ?  18  SER D O     1 
ATOM   3239  C CB    . SER E 1 18  ? -18.238 -14.952 -92.144  1.00 90.88  ?  18  SER D CB    1 
ATOM   3240  O OG    . SER E 1 18  ? -16.882 -14.538 -92.158  1.00 88.02  ?  18  SER D OG    1 
ATOM   3241  N N     . PRO E 1 19  ? -16.663 -15.673 -94.910  1.00 80.55  ?  19  PRO D N     1 
ATOM   3242  C CA    . PRO E 1 19  ? -15.505 -16.295 -95.563  1.00 83.00  ?  19  PRO D CA    1 
ATOM   3243  C C     . PRO E 1 19  ? -14.494 -16.819 -94.549  1.00 76.15  ?  19  PRO D C     1 
ATOM   3244  O O     . PRO E 1 19  ? -13.863 -17.859 -94.759  1.00 81.17  ?  19  PRO D O     1 
ATOM   3245  C CB    . PRO E 1 19  ? -14.912 -15.153 -96.396  1.00 82.05  ?  19  PRO D CB    1 
ATOM   3246  C CG    . PRO E 1 19  ? -15.439 -13.906 -95.770  1.00 92.01  ?  19  PRO D CG    1 
ATOM   3247  C CD    . PRO E 1 19  ? -16.809 -14.259 -95.295  1.00 89.78  ?  19  PRO D CD    1 
ATOM   3248  N N     . TRP E 1 20  ? -14.352 -16.090 -93.448  1.00 72.93  ?  20  TRP D N     1 
ATOM   3249  C CA    . TRP E 1 20  ? -13.428 -16.468 -92.391  1.00 72.53  ?  20  TRP D CA    1 
ATOM   3250  C C     . TRP E 1 20  ? -13.902 -17.708 -91.637  1.00 75.76  ?  20  TRP D C     1 
ATOM   3251  O O     . TRP E 1 20  ? -13.087 -18.480 -91.130  1.00 71.49  ?  20  TRP D O     1 
ATOM   3252  C CB    . TRP E 1 20  ? -13.247 -15.301 -91.420  1.00 74.85  ?  20  TRP D CB    1 
ATOM   3253  C CG    . TRP E 1 20  ? -12.260 -14.280 -91.890  1.00 70.05  ?  20  TRP D CG    1 
ATOM   3254  C CD1   . TRP E 1 20  ? -12.503 -12.960 -92.142  1.00 76.39  ?  20  TRP D CD1   1 
ATOM   3255  C CD2   . TRP E 1 20  ? -10.872 -14.492 -92.166  1.00 71.66  ?  20  TRP D CD2   1 
ATOM   3256  N NE1   . TRP E 1 20  ? -11.351 -12.338 -92.557  1.00 78.72  ?  20  TRP D NE1   1 
ATOM   3257  C CE2   . TRP E 1 20  ? -10.335 -13.257 -92.580  1.00 77.54  ?  20  TRP D CE2   1 
ATOM   3258  C CE3   . TRP E 1 20  ? -10.030 -15.606 -92.102  1.00 75.97  ?  20  TRP D CE3   1 
ATOM   3259  C CZ2   . TRP E 1 20  ? -8.995  -13.107 -92.929  1.00 76.72  ?  20  TRP D CZ2   1 
ATOM   3260  C CZ3   . TRP E 1 20  ? -8.702  -15.455 -92.451  1.00 80.11  ?  20  TRP D CZ3   1 
ATOM   3261  C CH2   . TRP E 1 20  ? -8.197  -14.214 -92.856  1.00 74.58  ?  20  TRP D CH2   1 
ATOM   3262  N N     . THR E 1 21  ? -15.217 -17.899 -91.567  1.00 75.00  ?  21  THR D N     1 
ATOM   3263  C CA    . THR E 1 21  ? -15.775 -19.121 -90.994  1.00 78.41  ?  21  THR D CA    1 
ATOM   3264  C C     . THR E 1 21  ? -15.365 -20.307 -91.859  1.00 71.91  ?  21  THR D C     1 
ATOM   3265  O O     . THR E 1 21  ? -14.986 -21.370 -91.356  1.00 64.88  ?  21  THR D O     1 
ATOM   3266  C CB    . THR E 1 21  ? -17.311 -19.058 -90.890  1.00 86.87  ?  21  THR D CB    1 
ATOM   3267  O OG1   . THR E 1 21  ? -17.696 -17.915 -90.116  1.00 88.14  ?  21  THR D OG1   1 
ATOM   3268  C CG2   . THR E 1 21  ? -17.858 -20.319 -90.235  1.00 85.06  ?  21  THR D CG2   1 
ATOM   3269  N N     . ILE E 1 22  ? -15.432 -20.096 -93.169  1.00 74.42  ?  22  ILE D N     1 
ATOM   3270  C CA    . ILE E 1 22  ? -15.056 -21.100 -94.151  1.00 62.17  ?  22  ILE D CA    1 
ATOM   3271  C C     . ILE E 1 22  ? -13.585 -21.455 -93.994  1.00 59.36  ?  22  ILE D C     1 
ATOM   3272  O O     . ILE E 1 22  ? -13.217 -22.632 -93.947  1.00 52.46  ?  22  ILE D O     1 
ATOM   3273  C CB    . ILE E 1 22  ? -15.319 -20.617 -95.591  1.00 58.20  ?  22  ILE D CB    1 
ATOM   3274  C CG1   . ILE E 1 22  ? -16.819 -20.428 -95.822  1.00 72.46  ?  22  ILE D CG1   1 
ATOM   3275  C CG2   . ILE E 1 22  ? -14.740 -21.597 -96.602  1.00 58.03  ?  22  ILE D CG2   1 
ATOM   3276  C CD1   . ILE E 1 22  ? -17.173 -20.004 -97.231  1.00 93.17  ?  22  ILE D CD1   1 
ATOM   3277  N N     . THR E 1 23  ? -12.748 -20.426 -93.895  1.00 52.01  ?  23  THR D N     1 
ATOM   3278  C CA    . THR E 1 23  ? -11.317 -20.644 -93.759  1.00 53.03  ?  23  THR D CA    1 
ATOM   3279  C C     . THR E 1 23  ? -10.992 -21.373 -92.459  1.00 64.46  ?  23  THR D C     1 
ATOM   3280  O O     . THR E 1 23  ? -10.143 -22.255 -92.446  1.00 70.26  ?  23  THR D O     1 
ATOM   3281  C CB    . THR E 1 23  ? -10.548 -19.304 -93.805  1.00 56.70  ?  23  THR D CB    1 
ATOM   3282  O OG1   . THR E 1 23  ? -10.646 -18.738 -95.118  1.00 71.97  ?  23  THR D OG1   1 
ATOM   3283  C CG2   . THR E 1 23  ? -9.082  -19.501 -93.452  1.00 54.97  ?  23  THR D CG2   1 
ATOM   3284  N N     . GLY E 1 24  ? -11.643 -20.993 -91.365  1.00 68.58  ?  24  GLY D N     1 
ATOM   3285  C CA    . GLY E 1 24  ? -11.449 -21.675 -90.095  1.00 70.74  ?  24  GLY D CA    1 
ATOM   3286  C C     . GLY E 1 24  ? -11.849 -23.143 -90.096  1.00 63.06  ?  24  GLY D C     1 
ATOM   3287  O O     . GLY E 1 24  ? -11.148 -24.024 -89.570  1.00 63.40  ?  24  GLY D O     1 
ATOM   3288  N N     . PHE E 1 25  ? -12.996 -23.408 -90.713  1.00 46.99  ?  25  PHE D N     1 
ATOM   3289  C CA    . PHE E 1 25  ? -13.509 -24.765 -90.817  1.00 47.20  ?  25  PHE D CA    1 
ATOM   3290  C C     . PHE E 1 25  ? -12.622 -25.638 -91.698  1.00 63.04  ?  25  PHE D C     1 
ATOM   3291  O O     . PHE E 1 25  ? -12.418 -26.819 -91.406  1.00 64.18  ?  25  PHE D O     1 
ATOM   3292  C CB    . PHE E 1 25  ? -14.938 -24.741 -91.355  1.00 48.44  ?  25  PHE D CB    1 
ATOM   3293  C CG    . PHE E 1 25  ? -15.671 -26.032 -91.170  1.00 54.77  ?  25  PHE D CG    1 
ATOM   3294  C CD1   . PHE E 1 25  ? -16.152 -26.388 -89.920  1.00 61.07  ?  25  PHE D CD1   1 
ATOM   3295  C CD2   . PHE E 1 25  ? -15.886 -26.887 -92.234  1.00 67.95  ?  25  PHE D CD2   1 
ATOM   3296  C CE1   . PHE E 1 25  ? -16.829 -27.572 -89.734  1.00 65.49  ?  25  PHE D CE1   1 
ATOM   3297  C CE2   . PHE E 1 25  ? -16.565 -28.075 -92.054  1.00 67.77  ?  25  PHE D CE2   1 
ATOM   3298  C CZ    . PHE E 1 25  ? -17.038 -28.417 -90.802  1.00 76.10  ?  25  PHE D CZ    1 
ATOM   3299  N N     . ALA E 1 26  ? -12.091 -25.052 -92.768  1.00 66.78  ?  26  ALA D N     1 
ATOM   3300  C CA    . ALA E 1 26  ? -11.174 -25.769 -93.646  1.00 55.39  ?  26  ALA D CA    1 
ATOM   3301  C C     . ALA E 1 26  ? -9.868  -26.010 -92.904  1.00 67.69  ?  26  ALA D C     1 
ATOM   3302  O O     . ALA E 1 26  ? -9.242  -27.059 -93.038  1.00 72.89  ?  26  ALA D O     1 
ATOM   3303  C CB    . ALA E 1 26  ? -10.930 -24.993 -94.924  1.00 51.49  ?  26  ALA D CB    1 
ATOM   3304  N N     . ASP E 1 27  ? -9.464  -25.003 -92.137  1.00 72.36  ?  27  ASP D N     1 
ATOM   3305  C CA    . ASP E 1 27  ? -8.335  -25.090 -91.221  1.00 65.95  ?  27  ASP D CA    1 
ATOM   3306  C C     . ASP E 1 27  ? -8.467  -26.305 -90.322  1.00 57.87  ?  27  ASP D C     1 
ATOM   3307  O O     . ASP E 1 27  ? -7.474  -26.961 -89.995  1.00 58.49  ?  27  ASP D O     1 
ATOM   3308  C CB    . ASP E 1 27  ? -8.227  -23.826 -90.369  1.00 66.52  ?  27  ASP D CB    1 
ATOM   3309  C CG    . ASP E 1 27  ? -7.066  -22.947 -90.773  1.00 72.77  ?  27  ASP D CG    1 
ATOM   3310  O OD1   . ASP E 1 27  ? -6.002  -23.494 -91.131  1.00 67.59  ?  27  ASP D OD1   1 
ATOM   3311  O OD2   . ASP E 1 27  ? -7.215  -21.708 -90.727  1.00 77.90  -1 27  ASP D OD2   1 
ATOM   3312  N N     . ALA E 1 28  ? -9.698  -26.613 -89.924  1.00 48.31  ?  28  ALA D N     1 
ATOM   3313  C CA    . ALA E 1 28  ? -9.916  -27.782 -89.080  1.00 49.25  ?  28  ALA D CA    1 
ATOM   3314  C C     . ALA E 1 28  ? -9.966  -29.106 -89.854  1.00 55.08  ?  28  ALA D C     1 
ATOM   3315  O O     . ALA E 1 28  ? -9.188  -30.018 -89.567  1.00 61.18  ?  28  ALA D O     1 
ATOM   3316  C CB    . ALA E 1 28  ? -11.199 -27.584 -88.296  1.00 56.34  ?  28  ALA D CB    1 
ATOM   3317  N N     . ASP E 1 29  ? -10.854 -29.222 -90.838  1.00 55.31  ?  29  ASP D N     1 
ATOM   3318  C CA    . ASP E 1 29  ? -11.198 -30.523 -91.447  1.00 68.35  ?  29  ASP D CA    1 
ATOM   3319  C C     . ASP E 1 29  ? -10.759 -30.772 -92.894  1.00 73.51  ?  29  ASP D C     1 
ATOM   3320  O O     . ASP E 1 29  ? -10.968 -31.872 -93.405  1.00 81.36  ?  29  ASP D O     1 
ATOM   3321  C CB    . ASP E 1 29  ? -12.703 -30.829 -91.347  1.00 68.86  ?  29  ASP D CB    1 
ATOM   3322  C CG    . ASP E 1 29  ? -13.182 -31.006 -89.920  1.00 72.70  ?  29  ASP D CG    1 
ATOM   3323  O OD1   . ASP E 1 29  ? -12.367 -30.885 -88.986  1.00 72.44  ?  29  ASP D OD1   1 
ATOM   3324  O OD2   . ASP E 1 29  ? -14.384 -31.293 -89.743  1.00 77.45  -1 29  ASP D OD2   1 
ATOM   3325  N N     . SER E 1 30  ? -10.155 -29.796 -93.561  1.00 52.66  ?  30  SER D N     1 
ATOM   3326  C CA    . SER E 1 30  ? -9.927  -29.952 -94.999  1.00 41.99  ?  30  SER D CA    1 
ATOM   3327  C C     . SER E 1 30  ? -8.584  -30.596 -95.339  1.00 38.33  ?  30  SER D C     1 
ATOM   3328  O O     . SER E 1 30  ? -7.699  -30.715 -94.492  1.00 53.70  ?  30  SER D O     1 
ATOM   3329  C CB    . SER E 1 30  ? -10.028 -28.594 -95.695  1.00 52.30  ?  30  SER D CB    1 
ATOM   3330  O OG    . SER E 1 30  ? -8.869  -27.818 -95.464  1.00 45.89  ?  30  SER D OG    1 
ATOM   3331  N N     . SER E 1 31  ? -8.453  -31.012 -96.596  1.00 56.05  ?  31  SER D N     1 
ATOM   3332  C CA    . SER E 1 31  ? -7.199  -31.543 -97.128  1.00 45.43  ?  31  SER D CA    1 
ATOM   3333  C C     . SER E 1 31  ? -6.809  -31.055 -98.527  1.00 39.96  ?  31  SER D C     1 
ATOM   3334  O O     . SER E 1 31  ? -7.644  -30.965 -99.434  1.00 47.32  ?  31  SER D O     1 
ATOM   3335  C CB    . SER E 1 31  ? -7.253  -33.073 -97.144  1.00 40.08  ?  31  SER D CB    1 
ATOM   3336  O OG    . SER E 1 31  ? -5.990  -33.619 -97.483  1.00 68.42  ?  31  SER D OG    1 
ATOM   3337  N N     . PHE E 1 32  ? -5.526  -30.724 -98.665  1.00 40.53  ?  32  PHE D N     1 
ATOM   3338  C CA    . PHE E 1 32  ? -4.908  -30.412 -99.952  1.00 42.92  ?  32  PHE D CA    1 
ATOM   3339  C C     . PHE E 1 32  ? -4.076  -31.613 -100.403 1.00 46.86  ?  32  PHE D C     1 
ATOM   3340  O O     . PHE E 1 32  ? -3.238  -32.111 -99.652  1.00 51.66  ?  32  PHE D O     1 
ATOM   3341  C CB    . PHE E 1 32  ? -4.007  -29.182 -99.841  1.00 38.69  ?  32  PHE D CB    1 
ATOM   3342  C CG    . PHE E 1 32  ? -4.737  -27.911 -99.523  1.00 42.02  ?  32  PHE D CG    1 
ATOM   3343  C CD1   . PHE E 1 32  ? -5.262  -27.126 -100.535 1.00 51.05  ?  32  PHE D CD1   1 
ATOM   3344  C CD2   . PHE E 1 32  ? -4.892  -27.498 -98.211  1.00 39.80  ?  32  PHE D CD2   1 
ATOM   3345  C CE1   . PHE E 1 32  ? -5.924  -25.951 -100.244 1.00 44.93  ?  32  PHE D CE1   1 
ATOM   3346  C CE2   . PHE E 1 32  ? -5.558  -26.326 -97.914  1.00 47.72  ?  32  PHE D CE2   1 
ATOM   3347  C CZ    . PHE E 1 32  ? -6.076  -25.553 -98.932  1.00 45.02  ?  32  PHE D CZ    1 
ATOM   3348  N N     . MET E 1 33  ? -4.306  -32.076 -101.628 1.00 34.88  ?  33  MET D N     1 
ATOM   3349  C CA    . MET E 1 33  ? -3.732  -33.339 -102.083 1.00 44.62  ?  33  MET D CA    1 
ATOM   3350  C C     . MET E 1 33  ? -3.126  -33.271 -103.482 1.00 50.28  ?  33  MET D C     1 
ATOM   3351  O O     . MET E 1 33  ? -3.567  -32.498 -104.331 1.00 54.49  ?  33  MET D O     1 
ATOM   3352  C CB    . MET E 1 33  ? -4.792  -34.442 -102.056 1.00 49.61  ?  33  MET D CB    1 
ATOM   3353  C CG    . MET E 1 33  ? -5.173  -34.924 -100.671 1.00 42.11  ?  33  MET D CG    1 
ATOM   3354  S SD    . MET E 1 33  ? -6.662  -35.936 -100.705 1.00 52.93  ?  33  MET D SD    1 
ATOM   3355  C CE    . MET E 1 33  ? -7.880  -34.723 -101.212 1.00 36.54  ?  33  MET D CE    1 
ATOM   3356  N N     . LEU E 1 34  ? -2.106  -34.093 -103.703 1.00 49.17  ?  34  LEU D N     1 
ATOM   3357  C CA    . LEU E 1 34  ? -1.526  -34.284 -105.026 1.00 45.06  ?  34  LEU D CA    1 
ATOM   3358  C C     . LEU E 1 34  ? -1.459  -35.774 -105.341 1.00 47.52  ?  34  LEU D C     1 
ATOM   3359  O O     . LEU E 1 34  ? -0.791  -36.533 -104.639 1.00 49.25  ?  34  LEU D O     1 
ATOM   3360  C CB    . LEU E 1 34  ? -0.135  -33.659 -105.100 1.00 50.76  ?  34  LEU D CB    1 
ATOM   3361  C CG    . LEU E 1 34  ? -0.086  -32.132 -105.105 1.00 54.38  ?  34  LEU D CG    1 
ATOM   3362  C CD1   . LEU E 1 34  ? 1.346   -31.664 -104.949 1.00 61.01  ?  34  LEU D CD1   1 
ATOM   3363  C CD2   . LEU E 1 34  ? -0.699  -31.578 -106.380 1.00 55.75  ?  34  LEU D CD2   1 
ATOM   3364  N N     . THR E 1 35  ? -2.157  -36.190 -106.391 1.00 41.41  ?  35  THR D N     1 
ATOM   3365  C CA    . THR E 1 35  ? -2.105  -37.576 -106.837 1.00 40.10  ?  35  THR D CA    1 
ATOM   3366  C C     . THR E 1 35  ? -1.143  -37.776 -108.004 1.00 46.97  ?  35  THR D C     1 
ATOM   3367  O O     . THR E 1 35  ? -1.247  -37.102 -109.038 1.00 55.63  ?  35  THR D O     1 
ATOM   3368  C CB    . THR E 1 35  ? -3.497  -38.079 -107.247 1.00 42.86  ?  35  THR D CB    1 
ATOM   3369  O OG1   . THR E 1 35  ? -4.403  -37.924 -106.149 1.00 44.70  ?  35  THR D OG1   1 
ATOM   3370  C CG2   . THR E 1 35  ? -3.435  -39.544 -107.647 1.00 47.44  ?  35  THR D CG2   1 
ATOM   3371  N N     . VAL E 1 36  ? -0.210  -38.708 -107.818 1.00 38.42  ?  36  VAL D N     1 
ATOM   3372  C CA    . VAL E 1 36  ? 0.733   -39.104 -108.857 1.00 40.78  ?  36  VAL D CA    1 
ATOM   3373  C C     . VAL E 1 36  ? 0.603   -40.598 -109.155 1.00 54.95  ?  36  VAL D C     1 
ATOM   3374  O O     . VAL E 1 36  ? 1.080   -41.440 -108.395 1.00 60.45  ?  36  VAL D O     1 
ATOM   3375  C CB    . VAL E 1 36  ? 2.185   -38.787 -108.451 1.00 42.98  ?  36  VAL D CB    1 
ATOM   3376  C CG1   . VAL E 1 36  ? 3.146   -39.206 -109.550 1.00 54.01  ?  36  VAL D CG1   1 
ATOM   3377  C CG2   . VAL E 1 36  ? 2.339   -37.307 -108.146 1.00 43.73  ?  36  VAL D CG2   1 
ATOM   3378  N N     . SER E 1 37  ? -0.055  -40.909 -110.267 1.00 64.26  ?  37  SER D N     1 
ATOM   3379  C CA    . SER E 1 37  ? -0.389  -42.284 -110.641 1.00 66.68  ?  37  SER D CA    1 
ATOM   3380  C C     . SER E 1 37  ? 0.322   -42.692 -111.929 1.00 49.23  ?  37  SER D C     1 
ATOM   3381  O O     . SER E 1 37  ? 0.364   -41.921 -112.876 1.00 57.76  ?  37  SER D O     1 
ATOM   3382  C CB    . SER E 1 37  ? -1.902  -42.445 -110.800 1.00 76.44  ?  37  SER D CB    1 
ATOM   3383  O OG    . SER E 1 37  ? -2.542  -42.507 -109.537 1.00 82.90  ?  37  SER D OG    1 
ATOM   3384  N N     . LYS E 1 38  ? 0.865   -43.906 -111.969 1.00 54.83  ?  38  LYS D N     1 
ATOM   3385  C CA    . LYS E 1 38  ? 1.502   -44.416 -113.185 1.00 52.45  ?  38  LYS D CA    1 
ATOM   3386  C C     . LYS E 1 38  ? 0.537   -44.445 -114.369 1.00 57.35  ?  38  LYS D C     1 
ATOM   3387  O O     . LYS E 1 38  ? -0.593  -44.921 -114.257 1.00 47.91  ?  38  LYS D O     1 
ATOM   3388  C CB    . LYS E 1 38  ? 2.066   -45.818 -112.943 1.00 37.54  ?  38  LYS D CB    1 
ATOM   3389  N N     . ASP E 1 39  ? 1.004   -43.925 -115.503 1.00 62.93  ?  39  ASP D N     1 
ATOM   3390  C CA    . ASP E 1 39  ? 0.185   -43.797 -116.707 1.00 74.66  ?  39  ASP D CA    1 
ATOM   3391  C C     . ASP E 1 39  ? 1.019   -43.890 -117.987 1.00 74.76  ?  39  ASP D C     1 
ATOM   3392  O O     . ASP E 1 39  ? 1.815   -43.003 -118.290 1.00 68.92  ?  39  ASP D O     1 
ATOM   3393  C CB    . ASP E 1 39  ? -0.590  -42.477 -116.686 1.00 79.09  ?  39  ASP D CB    1 
ATOM   3394  C CG    . ASP E 1 39  ? -1.701  -42.434 -117.722 1.00 85.57  ?  39  ASP D CG    1 
ATOM   3395  O OD1   . ASP E 1 39  ? -2.844  -42.812 -117.385 1.00 94.29  ?  39  ASP D OD1   1 
ATOM   3396  O OD2   . ASP E 1 39  ? -1.434  -42.025 -118.872 1.00 68.98  -1 39  ASP D OD2   1 
ATOM   3397  N N     . SER E 1 40  ? 0.809   -44.968 -118.735 1.00 73.89  ?  40  SER D N     1 
ATOM   3398  C CA    . SER E 1 40  ? 1.531   -45.245 -119.977 1.00 82.42  ?  40  SER D CA    1 
ATOM   3399  C C     . SER E 1 40  ? 1.321   -44.170 -121.045 1.00 85.77  ?  40  SER D C     1 
ATOM   3400  O O     . SER E 1 40  ? 2.196   -43.929 -121.880 1.00 58.58  ?  40  SER D O     1 
ATOM   3401  C CB    . SER E 1 40  ? 1.113   -46.609 -120.531 1.00 80.23  ?  40  SER D CB    1 
ATOM   3402  O OG    . SER E 1 40  ? 0.892   -47.539 -119.484 1.00 70.57  ?  40  SER D OG    1 
ATOM   3403  N N     . LYS E 1 41  ? 0.159   -43.529 -121.014 1.00 85.54  ?  41  LYS D N     1 
ATOM   3404  C CA    . LYS E 1 41  ? -0.248  -42.594 -122.057 1.00 55.58  ?  41  LYS D CA    1 
ATOM   3405  C C     . LYS E 1 41  ? 0.476   -41.251 -121.966 1.00 66.29  ?  41  LYS D C     1 
ATOM   3406  O O     . LYS E 1 41  ? 0.437   -40.461 -122.908 1.00 78.08  ?  41  LYS D O     1 
ATOM   3407  C CB    . LYS E 1 41  ? -1.760  -42.369 -122.002 1.00 41.74  ?  41  LYS D CB    1 
ATOM   3408  N N     . ARG E 1 42  ? 1.146   -40.995 -120.846 1.00 82.60  ?  42  ARG D N     1 
ATOM   3409  C CA    . ARG E 1 42  ? 1.826   -39.717 -120.654 1.00 86.52  ?  42  ARG D CA    1 
ATOM   3410  C C     . ARG E 1 42  ? 3.293   -39.826 -121.060 1.00 68.90  ?  42  ARG D C     1 
ATOM   3411  O O     . ARG E 1 42  ? 3.886   -40.902 -120.989 1.00 63.05  ?  42  ARG D O     1 
ATOM   3412  C CB    . ARG E 1 42  ? 1.756   -39.276 -119.188 1.00 81.18  ?  42  ARG D CB    1 
ATOM   3413  C CG    . ARG E 1 42  ? 0.441   -39.520 -118.467 1.00 70.77  ?  42  ARG D CG    1 
ATOM   3414  C CD    . ARG E 1 42  ? -0.722  -38.750 -119.049 1.00 71.26  ?  42  ARG D CD    1 
ATOM   3415  N NE    . ARG E 1 42  ? -1.924  -38.953 -118.244 1.00 86.92  ?  42  ARG D NE    1 
ATOM   3416  C CZ    . ARG E 1 42  ? -3.036  -38.237 -118.366 1.00 86.08  ?  42  ARG D CZ    1 
ATOM   3417  N NH1   . ARG E 1 42  ? -3.100  -37.262 -119.261 1.00 78.63  1  42  ARG D NH1   1 
ATOM   3418  N NH2   . ARG E 1 42  ? -4.080  -38.490 -117.588 1.00 50.16  ?  42  ARG D NH2   1 
ATOM   3419  N N     . ASN E 1 43  ? 3.872   -38.710 -121.493 1.00 57.14  ?  43  ASN D N     1 
ATOM   3420  C CA    . ASN E 1 43  ? 5.254   -38.704 -121.959 1.00 73.90  ?  43  ASN D CA    1 
ATOM   3421  C C     . ASN E 1 43  ? 6.240   -39.000 -120.834 1.00 68.36  ?  43  ASN D C     1 
ATOM   3422  O O     . ASN E 1 43  ? 7.293   -39.600 -121.054 1.00 61.65  ?  43  ASN D O     1 
ATOM   3423  C CB    . ASN E 1 43  ? 5.591   -37.358 -122.603 1.00 84.30  ?  43  ASN D CB    1 
ATOM   3424  N N     . THR E 1 44  ? 5.887   -38.568 -119.628 1.00 86.15  ?  44  THR D N     1 
ATOM   3425  C CA    . THR E 1 44  ? 6.690   -38.842 -118.441 1.00 76.90  ?  44  THR D CA    1 
ATOM   3426  C C     . THR E 1 44  ? 6.389   -40.217 -117.856 1.00 72.38  ?  44  THR D C     1 
ATOM   3427  O O     . THR E 1 44  ? 7.146   -40.728 -117.030 1.00 61.86  ?  44  THR D O     1 
ATOM   3428  C CB    . THR E 1 44  ? 6.465   -37.775 -117.353 1.00 69.49  ?  44  THR D CB    1 
ATOM   3429  O OG1   . THR E 1 44  ? 5.094   -37.792 -116.938 1.00 77.86  ?  44  THR D OG1   1 
ATOM   3430  C CG2   . THR E 1 44  ? 6.817   -36.390 -117.879 1.00 62.60  ?  44  THR D CG2   1 
ATOM   3431  N N     . GLY E 1 45  ? 5.277   -40.809 -118.280 1.00 75.48  ?  45  GLY D N     1 
ATOM   3432  C CA    . GLY E 1 45  ? 4.851   -42.084 -117.736 1.00 73.73  ?  45  GLY D CA    1 
ATOM   3433  C C     . GLY E 1 45  ? 3.999   -41.921 -116.493 1.00 76.44  ?  45  GLY D C     1 
ATOM   3434  O O     . GLY E 1 45  ? 3.591   -42.906 -115.877 1.00 66.98  ?  45  GLY D O     1 
ATOM   3435  N N     . TRP E 1 46  ? 3.730   -40.674 -116.118 1.00 79.98  ?  46  TRP D N     1 
ATOM   3436  C CA    . TRP E 1 46  ? 2.968   -40.401 -114.908 1.00 59.60  ?  46  TRP D CA    1 
ATOM   3437  C C     . TRP E 1 46  ? 1.883   -39.341 -115.091 1.00 60.40  ?  46  TRP D C     1 
ATOM   3438  O O     . TRP E 1 46  ? 2.019   -38.404 -115.877 1.00 88.50  ?  46  TRP D O     1 
ATOM   3439  C CB    . TRP E 1 46  ? 3.926   -39.997 -113.787 1.00 58.84  ?  46  TRP D CB    1 
ATOM   3440  C CG    . TRP E 1 46  ? 4.847   -41.117 -113.404 1.00 70.13  ?  46  TRP D CG    1 
ATOM   3441  C CD1   . TRP E 1 46  ? 6.044   -41.426 -113.981 1.00 70.61  ?  46  TRP D CD1   1 
ATOM   3442  C CD2   . TRP E 1 46  ? 4.646   -42.077 -112.359 1.00 66.57  ?  46  TRP D CD2   1 
ATOM   3443  N NE1   . TRP E 1 46  ? 6.596   -42.524 -113.367 1.00 72.26  ?  46  TRP D NE1   1 
ATOM   3444  C CE2   . TRP E 1 46  ? 5.759   -42.940 -112.365 1.00 67.34  ?  46  TRP D CE2   1 
ATOM   3445  C CE3   . TRP E 1 46  ? 3.634   -42.289 -111.418 1.00 55.47  ?  46  TRP D CE3   1 
ATOM   3446  C CZ2   . TRP E 1 46  ? 5.889   -43.998 -111.467 1.00 57.96  ?  46  TRP D CZ2   1 
ATOM   3447  C CZ3   . TRP E 1 46  ? 3.763   -43.341 -110.530 1.00 61.75  ?  46  TRP D CZ3   1 
ATOM   3448  C CH2   . TRP E 1 46  ? 4.882   -44.181 -110.560 1.00 59.85  ?  46  TRP D CH2   1 
ATOM   3449  N N     . SER E 1 47  ? 0.806   -39.519 -114.336 1.00 48.20  ?  47  SER D N     1 
ATOM   3450  C CA    . SER E 1 47  ? -0.306  -38.584 -114.259 1.00 55.33  ?  47  SER D CA    1 
ATOM   3451  C C     . SER E 1 47  ? -0.275  -37.860 -112.919 1.00 60.99  ?  47  SER D C     1 
ATOM   3452  O O     . SER E 1 47  ? -0.162  -38.480 -111.861 1.00 64.06  ?  47  SER D O     1 
ATOM   3453  C CB    . SER E 1 47  ? -1.640  -39.309 -114.448 1.00 66.95  ?  47  SER D CB    1 
ATOM   3454  O OG    . SER E 1 47  ? -1.984  -40.053 -113.292 1.00 90.41  ?  47  SER D OG    1 
ATOM   3455  N N     . VAL E 1 48  ? -0.370  -36.539 -112.982 1.00 51.44  ?  48  VAL D N     1 
ATOM   3456  C CA    . VAL E 1 48  ? -0.349  -35.685 -111.803 1.00 43.91  ?  48  VAL D CA    1 
ATOM   3457  C C     . VAL E 1 48  ? -1.582  -34.797 -111.729 1.00 43.92  ?  48  VAL D C     1 
ATOM   3458  O O     . VAL E 1 48  ? -1.942  -34.146 -112.708 1.00 55.25  ?  48  VAL D O     1 
ATOM   3459  C CB    . VAL E 1 48  ? 0.913   -34.803 -111.779 1.00 55.40  ?  48  VAL D CB    1 
ATOM   3460  C CG1   . VAL E 1 48  ? 0.741   -33.633 -110.815 1.00 63.01  ?  48  VAL D CG1   1 
ATOM   3461  C CG2   . VAL E 1 48  ? 2.118   -35.637 -111.400 1.00 57.95  ?  48  VAL D CG2   1 
ATOM   3462  N N     . ARG E 1 49  ? -2.235  -34.775 -110.571 1.00 40.66  ?  49  ARG D N     1 
ATOM   3463  C CA    . ARG E 1 49  ? -3.427  -33.949 -110.425 1.00 38.51  ?  49  ARG D CA    1 
ATOM   3464  C C     . ARG E 1 49  ? -3.585  -33.415 -109.013 1.00 49.05  ?  49  ARG D C     1 
ATOM   3465  O O     . ARG E 1 49  ? -3.262  -34.088 -108.034 1.00 61.14  ?  49  ARG D O     1 
ATOM   3466  C CB    . ARG E 1 49  ? -4.704  -34.720 -110.776 1.00 51.63  ?  49  ARG D CB    1 
ATOM   3467  C CG    . ARG E 1 49  ? -5.010  -35.852 -109.803 1.00 46.70  ?  49  ARG D CG    1 
ATOM   3468  C CD    . ARG E 1 49  ? -6.098  -36.781 -110.295 1.00 45.06  ?  49  ARG D CD    1 
ATOM   3469  N NE    . ARG E 1 49  ? -7.371  -36.066 -110.356 1.00 34.45  ?  49  ARG D NE    1 
ATOM   3470  C CZ    . ARG E 1 49  ? -8.533  -36.623 -110.678 1.00 43.46  ?  49  ARG D CZ    1 
ATOM   3471  N NH1   . ARG E 1 49  ? -8.597  -37.917 -110.958 1.00 46.14  1  49  ARG D NH1   1 
ATOM   3472  N NH2   . ARG E 1 49  ? -9.637  -35.888 -110.696 1.00 36.48  ?  49  ARG D NH2   1 
ATOM   3473  N N     . PRO E 1 50  ? -4.057  -32.168 -108.913 1.00 47.09  ?  50  PRO D N     1 
ATOM   3474  C CA    . PRO E 1 50  ? -4.288  -31.523 -107.623 1.00 55.87  ?  50  PRO D CA    1 
ATOM   3475  C C     . PRO E 1 50  ? -5.726  -31.694 -107.143 1.00 60.33  ?  50  PRO D C     1 
ATOM   3476  O O     . PRO E 1 50  ? -6.644  -31.806 -107.959 1.00 61.19  ?  50  PRO D O     1 
ATOM   3477  C CB    . PRO E 1 50  ? -3.973  -30.059 -107.923 1.00 51.50  ?  50  PRO D CB    1 
ATOM   3478  C CG    . PRO E 1 50  ? -4.371  -29.888 -109.365 1.00 46.93  ?  50  PRO D CG    1 
ATOM   3479  C CD    . PRO E 1 50  ? -4.262  -31.237 -110.038 1.00 35.31  ?  50  PRO D CD    1 
ATOM   3480  N N     . ARG E 1 51  ? -5.910  -31.722 -105.826 1.00 43.20  ?  51  ARG D N     1 
ATOM   3481  C CA    . ARG E 1 51  ? -7.234  -31.829 -105.227 1.00 36.80  ?  51  ARG D CA    1 
ATOM   3482  C C     . ARG E 1 51  ? -7.334  -30.968 -103.976 1.00 48.53  ?  51  ARG D C     1 
ATOM   3483  O O     . ARG E 1 51  ? -6.376  -30.846 -103.213 1.00 45.78  ?  51  ARG D O     1 
ATOM   3484  C CB    . ARG E 1 51  ? -7.576  -33.276 -104.847 1.00 40.31  ?  51  ARG D CB    1 
ATOM   3485  C CG    . ARG E 1 51  ? -7.211  -34.369 -105.835 1.00 29.43  ?  51  ARG D CG    1 
ATOM   3486  C CD    . ARG E 1 51  ? -7.548  -35.730 -105.230 1.00 43.88  ?  51  ARG D CD    1 
ATOM   3487  N NE    . ARG E 1 51  ? -6.965  -36.848 -105.964 1.00 36.03  ?  51  ARG D NE    1 
ATOM   3488  C CZ    . ARG E 1 51  ? -7.642  -37.620 -106.807 1.00 42.35  ?  51  ARG D CZ    1 
ATOM   3489  N NH1   . ARG E 1 51  ? -8.932  -37.396 -107.021 1.00 44.54  1  51  ARG D NH1   1 
ATOM   3490  N NH2   . ARG E 1 51  ? -7.039  -38.633 -107.415 1.00 63.79  ?  51  ARG D NH2   1 
ATOM   3491  N N     . PHE E 1 52  ? -8.497  -30.362 -103.779 1.00 55.91  ?  52  PHE D N     1 
ATOM   3492  C CA    . PHE E 1 52  ? -8.843  -29.765 -102.495 1.00 53.82  ?  52  PHE D CA    1 
ATOM   3493  C C     . PHE E 1 52  ? -10.164 -30.353 -102.029 1.00 52.36  ?  52  PHE D C     1 
ATOM   3494  O O     . PHE E 1 52  ? -11.101 -30.444 -102.814 1.00 61.41  ?  52  PHE D O     1 
ATOM   3495  C CB    . PHE E 1 52  ? -8.925  -28.242 -102.568 1.00 52.17  ?  52  PHE D CB    1 
ATOM   3496  C CG    . PHE E 1 52  ? -9.479  -27.617 -101.320 1.00 42.45  ?  52  PHE D CG    1 
ATOM   3497  C CD1   . PHE E 1 52  ? -8.725  -27.584 -100.162 1.00 50.62  ?  52  PHE D CD1   1 
ATOM   3498  C CD2   . PHE E 1 52  ? -10.744 -27.057 -101.305 1.00 49.19  ?  52  PHE D CD2   1 
ATOM   3499  C CE1   . PHE E 1 52  ? -9.221  -27.014 -99.006  1.00 53.72  ?  52  PHE D CE1   1 
ATOM   3500  C CE2   . PHE E 1 52  ? -11.248 -26.481 -100.151 1.00 52.64  ?  52  PHE D CE2   1 
ATOM   3501  C CZ    . PHE E 1 52  ? -10.483 -26.460 -99.000  1.00 50.89  ?  52  PHE D CZ    1 
ATOM   3502  N N     . ARG E 1 53  ? -10.263 -30.756 -100.768 1.00 46.85  ?  53  ARG D N     1 
ATOM   3503  C CA    . ARG E 1 53  ? -11.471 -31.463 -100.356 1.00 45.66  ?  53  ARG D CA    1 
ATOM   3504  C C     . ARG E 1 53  ? -11.826 -31.204 -98.901  1.00 49.95  ?  53  ARG D C     1 
ATOM   3505  O O     . ARG E 1 53  ? -10.951 -31.040 -98.054  1.00 42.77  ?  53  ARG D O     1 
ATOM   3506  C CB    . ARG E 1 53  ? -11.304 -32.968 -100.586 1.00 42.89  ?  53  ARG D CB    1 
ATOM   3507  C CG    . ARG E 1 53  ? -12.600 -33.763 -100.529 1.00 55.80  ?  53  ARG D CG    1 
ATOM   3508  C CD    . ARG E 1 53  ? -12.431 -35.159 -101.112 1.00 52.10  ?  53  ARG D CD    1 
ATOM   3509  N NE    . ARG E 1 53  ? -11.561 -35.992 -100.287 1.00 61.07  ?  53  ARG D NE    1 
ATOM   3510  C CZ    . ARG E 1 53  ? -10.735 -36.916 -100.766 1.00 59.21  ?  53  ARG D CZ    1 
ATOM   3511  N NH1   . ARG E 1 53  ? -10.661 -37.136 -102.072 1.00 26.88  1  53  ARG D NH1   1 
ATOM   3512  N NH2   . ARG E 1 53  ? -9.984  -37.626 -99.936  1.00 70.58  ?  53  ARG D NH2   1 
ATOM   3513  N N     . ILE E 1 54  ? -13.129 -31.169 -98.625  1.00 51.32  ?  54  ILE D N     1 
ATOM   3514  C CA    . ILE E 1 54  ? -13.627 -31.198 -97.254  1.00 63.31  ?  54  ILE D CA    1 
ATOM   3515  C C     . ILE E 1 54  ? -14.612 -32.341 -97.061  1.00 57.86  ?  54  ILE D C     1 
ATOM   3516  O O     . ILE E 1 54  ? -15.555 -32.495 -97.835  1.00 57.70  ?  54  ILE D O     1 
ATOM   3517  C CB    . ILE E 1 54  ? -14.320 -29.870 -96.880  1.00 48.13  ?  54  ILE D CB    1 
ATOM   3518  C CG1   . ILE E 1 54  ? -13.325 -28.709 -96.921  1.00 48.82  ?  54  ILE D CG1   1 
ATOM   3519  C CG2   . ILE E 1 54  ? -14.992 -29.974 -95.516  1.00 60.59  ?  54  ILE D CG2   1 
ATOM   3520  C CD1   . ILE E 1 54  ? -13.979 -27.353 -97.032  1.00 50.29  ?  54  ILE D CD1   1 
ATOM   3521  N N     . GLY E 1 55  ? -14.368 -33.139 -96.027  1.00 50.55  ?  55  GLY D N     1 
ATOM   3522  C CA    . GLY E 1 55  ? -15.215 -34.269 -95.698  1.00 64.79  ?  55  GLY D CA    1 
ATOM   3523  C C     . GLY E 1 55  ? -15.824 -34.092 -94.322  1.00 75.11  ?  55  GLY D C     1 
ATOM   3524  O O     . GLY E 1 55  ? -15.170 -33.606 -93.400  1.00 81.31  ?  55  GLY D O     1 
ATOM   3525  N N     . LEU E 1 56  ? -17.083 -34.489 -94.186  1.00 66.16  ?  56  LEU D N     1 
ATOM   3526  C CA    . LEU E 1 56  ? -17.798 -34.366 -92.922  1.00 58.25  ?  56  LEU D CA    1 
ATOM   3527  C C     . LEU E 1 56  ? -18.754 -35.540 -92.775  1.00 66.10  ?  56  LEU D C     1 
ATOM   3528  O O     . LEU E 1 56  ? -18.958 -36.305 -93.723  1.00 65.18  ?  56  LEU D O     1 
ATOM   3529  C CB    . LEU E 1 56  ? -18.568 -33.048 -92.841  1.00 39.82  ?  56  LEU D CB    1 
ATOM   3530  C CG    . LEU E 1 56  ? -17.810 -31.759 -93.139  1.00 51.04  ?  56  LEU D CG    1 
ATOM   3531  C CD1   . LEU E 1 56  ? -18.760 -30.575 -93.092  1.00 56.17  ?  56  LEU D CD1   1 
ATOM   3532  C CD2   . LEU E 1 56  ? -16.676 -31.586 -92.151  1.00 65.96  ?  56  LEU D CD2   1 
ATOM   3533  N N     . HIS E 1 57  ? -19.332 -35.694 -91.588  1.00 65.23  ?  57  HIS D N     1 
ATOM   3534  C CA    . HIS E 1 57  ? -20.424 -36.643 -91.409  1.00 68.32  ?  57  HIS D CA    1 
ATOM   3535  C C     . HIS E 1 57  ? -21.581 -36.246 -92.322  1.00 69.12  ?  57  HIS D C     1 
ATOM   3536  O O     . HIS E 1 57  ? -21.816 -35.057 -92.551  1.00 54.91  ?  57  HIS D O     1 
ATOM   3537  C CB    . HIS E 1 57  ? -20.878 -36.695 -89.949  1.00 76.29  ?  57  HIS D CB    1 
ATOM   3538  C CG    . HIS E 1 57  ? -21.816 -37.823 -89.647  1.00 79.77  ?  57  HIS D CG    1 
ATOM   3539  N ND1   . HIS E 1 57  ? -23.140 -37.813 -90.028  1.00 79.24  ?  57  HIS D ND1   1 
ATOM   3540  C CD2   . HIS E 1 57  ? -21.617 -39.002 -89.010  1.00 86.92  ?  57  HIS D CD2   1 
ATOM   3541  C CE1   . HIS E 1 57  ? -23.718 -38.934 -89.636  1.00 78.82  ?  57  HIS D CE1   1 
ATOM   3542  N NE2   . HIS E 1 57  ? -22.815 -39.673 -89.016  1.00 84.43  ?  57  HIS D NE2   1 
ATOM   3543  N N     . ASN E 1 58  ? -22.285 -37.243 -92.851  1.00 64.57  ?  58  ASN D N     1 
ATOM   3544  C CA    . ASN E 1 58  ? -23.463 -37.027 -93.689  1.00 61.07  ?  58  ASN D CA    1 
ATOM   3545  C C     . ASN E 1 58  ? -24.451 -36.006 -93.120  1.00 62.42  ?  58  ASN D C     1 
ATOM   3546  O O     . ASN E 1 58  ? -25.018 -35.187 -93.851  1.00 64.99  ?  58  ASN D O     1 
ATOM   3547  C CB    . ASN E 1 58  ? -24.185 -38.359 -93.900  1.00 56.15  ?  58  ASN D CB    1 
ATOM   3548  C CG    . ASN E 1 58  ? -23.549 -39.203 -94.990  1.00 81.66  ?  58  ASN D CG    1 
ATOM   3549  O OD1   . ASN E 1 58  ? -23.056 -38.681 -95.990  1.00 80.55  ?  58  ASN D OD1   1 
ATOM   3550  N ND2   . ASN E 1 58  ? -23.548 -40.517 -94.793  1.00 87.78  ?  58  ASN D ND2   1 
ATOM   3551  N N     . LYS E 1 59  ? -24.553 -35.970 -91.798  1.00 83.90  ?  59  LYS D N     1 
ATOM   3552  C CA    . LYS E 1 59  ? -25.508 -35.101 -91.125  1.00 86.59  ?  59  LYS D CA    1 
ATOM   3553  C C     . LYS E 1 59  ? -25.209 -33.638 -91.405  1.00 83.74  ?  59  LYS D C     1 
ATOM   3554  O O     . LYS E 1 59  ? -26.049 -32.769 -91.172  1.00 84.27  ?  59  LYS D O     1 
ATOM   3555  C CB    . LYS E 1 59  ? -25.496 -35.362 -89.617  1.00 56.23  ?  59  LYS D CB    1 
ATOM   3556  N N     . ASP E 1 60  ? -24.009 -33.365 -91.903  1.00 76.93  ?  60  ASP D N     1 
ATOM   3557  C CA    . ASP E 1 60  ? -23.598 -31.992 -92.097  1.00 79.18  ?  60  ASP D CA    1 
ATOM   3558  C C     . ASP E 1 60  ? -23.448 -31.641 -93.576  1.00 76.57  ?  60  ASP D C     1 
ATOM   3559  O O     . ASP E 1 60  ? -22.745 -30.676 -93.906  1.00 67.22  ?  60  ASP D O     1 
ATOM   3560  C CB    . ASP E 1 60  ? -22.270 -31.747 -91.379  1.00 68.81  ?  60  ASP D CB    1 
ATOM   3561  C CG    . ASP E 1 60  ? -22.459 -31.269 -89.962  1.00 75.27  ?  60  ASP D CG    1 
ATOM   3562  O OD1   . ASP E 1 60  ? -23.492 -30.627 -89.693  1.00 90.08  ?  60  ASP D OD1   1 
ATOM   3563  O OD2   . ASP E 1 60  ? -21.578 -31.538 -89.119  1.00 70.79  -1 60  ASP D OD2   1 
ATOM   3564  N N     . VAL E 1 61  ? -24.150 -32.358 -94.460  1.00 73.15  ?  61  VAL D N     1 
ATOM   3565  C CA    . VAL E 1 61  ? -24.166 -31.953 -95.873  1.00 70.44  ?  61  VAL D CA    1 
ATOM   3566  C C     . VAL E 1 61  ? -24.535 -30.484 -96.067  1.00 81.00  ?  61  VAL D C     1 
ATOM   3567  O O     . VAL E 1 61  ? -23.964 -29.793 -96.918  1.00 88.14  ?  61  VAL D O     1 
ATOM   3568  C CB    . VAL E 1 61  ? -25.150 -32.806 -96.720  1.00 71.08  ?  61  VAL D CB    1 
ATOM   3569  C CG1   . VAL E 1 61  ? -25.181 -32.326 -98.163  1.00 83.55  ?  61  VAL D CG1   1 
ATOM   3570  C CG2   . VAL E 1 61  ? -24.794 -34.274 -96.663  1.00 70.32  ?  61  VAL D CG2   1 
ATOM   3571  N N     . THR E 1 62  ? -25.440 -29.996 -95.226  1.00 76.47  ?  62  THR D N     1 
ATOM   3572  C CA    . THR E 1 62  ? -25.889 -28.614 -95.309  1.00 88.26  ?  62  THR D CA    1 
ATOM   3573  C C     . THR E 1 62  ? -24.761 -27.597 -95.193  1.00 83.60  ?  62  THR D C     1 
ATOM   3574  O O     . THR E 1 62  ? -24.736 -26.612 -95.942  1.00 83.39  ?  62  THR D O     1 
ATOM   3575  C CB    . THR E 1 62  ? -26.925 -28.305 -94.211  1.00 88.59  ?  62  THR D CB    1 
ATOM   3576  O OG1   . THR E 1 62  ? -26.314 -28.439 -92.921  1.00 82.74  ?  62  THR D OG1   1 
ATOM   3577  C CG2   . THR E 1 62  ? -28.104 -29.260 -94.308  1.00 91.68  ?  62  THR D CG2   1 
ATOM   3578  N N     . ILE E 1 63  ? -23.751 -27.914 -94.384  1.00 82.78  ?  63  ILE D N     1 
ATOM   3579  C CA    . ILE E 1 63  ? -22.606 -27.019 -94.249  1.00 86.91  ?  63  ILE D CA    1 
ATOM   3580  C C     . ILE E 1 63  ? -21.914 -26.864 -95.587  1.00 84.68  ?  63  ILE D C     1 
ATOM   3581  O O     . ILE E 1 63  ? -21.636 -25.744 -96.035  1.00 68.56  ?  63  ILE D O     1 
ATOM   3582  C CB    . ILE E 1 63  ? -21.599 -27.537 -93.202  1.00 46.73  ?  63  ILE D CB    1 
ATOM   3583  N N     . LEU E 1 64  ? -21.737 -27.987 -96.267  1.00 79.26  ?  64  LEU D N     1 
ATOM   3584  C CA    . LEU E 1 64  ? -21.065 -27.993 -97.548  1.00 65.20  ?  64  LEU D CA    1 
ATOM   3585  C C     . LEU E 1 64  ? -21.854 -27.156 -98.537  1.00 79.01  ?  64  LEU D C     1 
ATOM   3586  O O     . LEU E 1 64  ? -21.275 -26.351 -99.278  1.00 77.51  ?  64  LEU D O     1 
ATOM   3587  C CB    . LEU E 1 64  ? -20.902 -29.422 -98.068  1.00 63.45  ?  64  LEU D CB    1 
ATOM   3588  C CG    . LEU E 1 64  ? -20.222 -30.413 -97.123  1.00 64.32  ?  64  LEU D CG    1 
ATOM   3589  C CD1   . LEU E 1 64  ? -20.046 -31.762 -97.797  1.00 63.20  ?  64  LEU D CD1   1 
ATOM   3590  C CD2   . LEU E 1 64  ? -18.881 -29.866 -96.666  1.00 65.17  ?  64  LEU D CD2   1 
ATOM   3591  N N     . LYS E 1 65  ? -23.179 -27.243 -98.458  1.00 76.77  ?  65  LYS D N     1 
ATOM   3592  C CA    . LYS E 1 65  ? -24.001 -26.469 -99.373  1.00 79.64  ?  65  LYS D CA    1 
ATOM   3593  C C     . LYS E 1 65  ? -23.801 -24.982 -99.163  1.00 80.11  ?  65  LYS D C     1 
ATOM   3594  O O     . LYS E 1 65  ? -23.657 -24.234 -100.137 1.00 79.71  ?  65  LYS D O     1 
ATOM   3595  C CB    . LYS E 1 65  ? -25.477 -26.829 -99.200  1.00 76.24  ?  65  LYS D CB    1 
ATOM   3596  N N     . SER E 1 66  ? -23.635 -24.576 -97.910  1.00 85.54  ?  66  SER D N     1 
ATOM   3597  C CA    . SER E 1 66  ? -23.435 -23.166 -97.628  1.00 88.32  ?  66  SER D CA    1 
ATOM   3598  C C     . SER E 1 66  ? -22.135 -22.729 -98.273  1.00 85.46  ?  66  SER D C     1 
ATOM   3599  O O     . SER E 1 66  ? -22.095 -21.715 -98.980  1.00 84.59  ?  66  SER D O     1 
ATOM   3600  C CB    . SER E 1 66  ? -23.411 -22.904 -96.121  1.00 84.95  ?  66  SER D CB    1 
ATOM   3601  O OG    . SER E 1 66  ? -23.288 -21.519 -95.848  1.00 85.66  ?  66  SER D OG    1 
ATOM   3602  N N     . ILE E 1 67  ? -21.118 -23.574 -98.152  1.00 83.75  ?  67  ILE D N     1 
ATOM   3603  C CA    . ILE E 1 67  ? -19.833 -23.273 -98.754  1.00 88.84  ?  67  ILE D CA    1 
ATOM   3604  C C     . ILE E 1 67  ? -20.002 -23.206 -100.258 1.00 88.76  ?  67  ILE D C     1 
ATOM   3605  O O     . ILE E 1 67  ? -19.554 -22.247 -100.897 1.00 83.09  ?  67  ILE D O     1 
ATOM   3606  C CB    . ILE E 1 67  ? -18.764 -24.319 -98.394  1.00 88.24  ?  67  ILE D CB    1 
ATOM   3607  C CG1   . ILE E 1 67  ? -18.385 -24.203 -96.917  1.00 80.62  ?  67  ILE D CG1   1 
ATOM   3608  C CG2   . ILE E 1 67  ? -17.533 -24.148 -99.270  1.00 86.62  ?  67  ILE D CG2   1 
ATOM   3609  C CD1   . ILE E 1 67  ? -17.479 -25.312 -96.434  1.00 79.22  ?  67  ILE D CD1   1 
ATOM   3610  N N     . ARG E 1 68  ? -20.712 -24.185 -100.809 1.00 79.35  ?  68  ARG D N     1 
ATOM   3611  C CA    . ARG E 1 68  ? -20.960 -24.203 -102.238 1.00 85.13  ?  68  ARG D CA    1 
ATOM   3612  C C     . ARG E 1 68  ? -21.667 -22.921 -102.643 1.00 91.25  ?  68  ARG D C     1 
ATOM   3613  O O     . ARG E 1 68  ? -21.216 -22.220 -103.564 1.00 87.52  ?  68  ARG D O     1 
ATOM   3614  C CB    . ARG E 1 68  ? -21.796 -25.427 -102.621 1.00 86.71  ?  68  ARG D CB    1 
ATOM   3615  C CG    . ARG E 1 68  ? -22.475 -25.340 -103.978 1.00 69.87  ?  68  ARG D CG    1 
ATOM   3616  C CD    . ARG E 1 68  ? -21.490 -25.585 -105.107 1.00 72.44  ?  68  ARG D CD    1 
ATOM   3617  N NE    . ARG E 1 68  ? -21.814 -24.811 -106.301 1.00 93.67  ?  68  ARG D NE    1 
ATOM   3618  C CZ    . ARG E 1 68  ? -21.420 -25.133 -107.529 1.00 91.07  ?  68  ARG D CZ    1 
ATOM   3619  N NH1   . ARG E 1 68  ? -20.683 -26.217 -107.729 1.00 84.69  1  68  ARG D NH1   1 
ATOM   3620  N NH2   . ARG E 1 68  ? -21.762 -24.370 -108.558 1.00 93.57  ?  68  ARG D NH2   1 
ATOM   3621  N N     . GLU E 1 69  ? -22.640 -22.516 -101.832 1.00 97.85  ?  69  GLU D N     1 
ATOM   3622  C CA    . GLU E 1 69  ? -23.427 -21.339 -102.153 1.00 94.58  ?  69  GLU D CA    1 
ATOM   3623  C C     . GLU E 1 69  ? -22.527 -20.128 -102.106 1.00 90.18  ?  69  GLU D C     1 
ATOM   3624  O O     . GLU E 1 69  ? -22.679 -19.205 -102.907 1.00 84.90  ?  69  GLU D O     1 
ATOM   3625  C CB    . GLU E 1 69  ? -24.602 -21.181 -101.186 1.00 84.34  ?  69  GLU D CB    1 
ATOM   3626  N N     . TYR E 1 70  ? -21.596 -20.121 -101.162 1.00 83.77  ?  70  TYR D N     1 
ATOM   3627  C CA    . TYR E 1 70  ? -20.665 -19.016 -101.098 1.00 78.90  ?  70  TYR D CA    1 
ATOM   3628  C C     . TYR E 1 70  ? -19.810 -18.956 -102.363 1.00 74.35  ?  70  TYR D C     1 
ATOM   3629  O O     . TYR E 1 70  ? -19.702 -17.899 -102.986 1.00 71.69  ?  70  TYR D O     1 
ATOM   3630  C CB    . TYR E 1 70  ? -19.769 -19.122 -99.862  1.00 78.31  ?  70  TYR D CB    1 
ATOM   3631  C CG    . TYR E 1 70  ? -18.895 -17.905 -99.645  1.00 71.17  ?  70  TYR D CG    1 
ATOM   3632  C CD1   . TYR E 1 70  ? -19.334 -16.843 -98.866  1.00 62.59  ?  70  TYR D CD1   1 
ATOM   3633  C CD2   . TYR E 1 70  ? -17.639 -17.812 -100.231 1.00 73.21  ?  70  TYR D CD2   1 
ATOM   3634  C CE1   . TYR E 1 70  ? -18.547 -15.724 -98.674  1.00 72.41  ?  70  TYR D CE1   1 
ATOM   3635  C CE2   . TYR E 1 70  ? -16.842 -16.700 -100.039 1.00 76.10  ?  70  TYR D CE2   1 
ATOM   3636  C CZ    . TYR E 1 70  ? -17.302 -15.658 -99.261  1.00 80.50  ?  70  TYR D CZ    1 
ATOM   3637  O OH    . TYR E 1 70  ? -16.510 -14.550 -99.063  1.00 84.51  ?  70  TYR D OH    1 
ATOM   3638  N N     . LEU E 1 71  ? -19.202 -20.079 -102.746 1.00 79.02  ?  71  LEU D N     1 
ATOM   3639  C CA    . LEU E 1 71  ? -18.180 -20.004 -103.795 1.00 79.28  ?  71  LEU D CA    1 
ATOM   3640  C C     . LEU E 1 71  ? -18.680 -20.110 -105.233 1.00 76.90  ?  71  LEU D C     1 
ATOM   3641  O O     . LEU E 1 71  ? -18.009 -19.656 -106.160 1.00 77.44  ?  71  LEU D O     1 
ATOM   3642  C CB    . LEU E 1 71  ? -17.119 -21.081 -103.555 1.00 70.42  ?  71  LEU D CB    1 
ATOM   3643  C CG    . LEU E 1 71  ? -16.326 -20.931 -102.254 1.00 68.94  ?  71  LEU D CG    1 
ATOM   3644  C CD1   . LEU E 1 71  ? -15.580 -22.213 -101.920 1.00 63.80  ?  71  LEU D CD1   1 
ATOM   3645  C CD2   . LEU E 1 71  ? -15.365 -19.753 -102.340 1.00 57.00  ?  71  LEU D CD2   1 
ATOM   3646  N N     . GLY E 1 72  ? -19.854 -20.698 -105.419 1.00 81.90  ?  72  GLY D N     1 
ATOM   3647  C CA    . GLY E 1 72  ? -20.369 -20.927 -106.756 1.00 78.72  ?  72  GLY D CA    1 
ATOM   3648  C C     . GLY E 1 72  ? -19.562 -22.010 -107.447 1.00 68.66  ?  72  GLY D C     1 
ATOM   3649  O O     . GLY E 1 72  ? -19.432 -22.015 -108.671 1.00 93.27  ?  72  GLY D O     1 
ATOM   3650  N N     . ALA E 1 73  ? -19.023 -22.934 -106.656 1.00 75.49  ?  73  ALA D N     1 
ATOM   3651  C CA    . ALA E 1 73  ? -18.139 -23.975 -107.170 1.00 75.41  ?  73  ALA D CA    1 
ATOM   3652  C C     . ALA E 1 73  ? -18.005 -25.107 -106.158 1.00 76.79  ?  73  ALA D C     1 
ATOM   3653  O O     . ALA E 1 73  ? -18.298 -24.927 -104.976 1.00 71.89  ?  73  ALA D O     1 
ATOM   3654  C CB    . ALA E 1 73  ? -16.771 -23.399 -107.507 1.00 57.94  ?  73  ALA D CB    1 
ATOM   3655  N N     . GLY E 1 74  ? -17.556 -26.270 -106.620 1.00 67.67  ?  74  GLY D N     1 
ATOM   3656  C CA    . GLY E 1 74  ? -17.409 -27.413 -105.740 1.00 47.96  ?  74  GLY D CA    1 
ATOM   3657  C C     . GLY E 1 74  ? -18.400 -28.514 -106.058 1.00 40.65  ?  74  GLY D C     1 
ATOM   3658  O O     . GLY E 1 74  ? -19.543 -28.239 -106.419 1.00 51.65  ?  74  GLY D O     1 
ATOM   3659  N N     . ILE E 1 75  ? -17.968 -29.764 -105.927 1.00 41.12  ?  75  ILE D N     1 
ATOM   3660  C CA    . ILE E 1 75  ? -18.850 -30.891 -106.208 1.00 37.38  ?  75  ILE D CA    1 
ATOM   3661  C C     . ILE E 1 75  ? -19.155 -31.649 -104.921 1.00 45.56  ?  75  ILE D C     1 
ATOM   3662  O O     . ILE E 1 75  ? -18.249 -32.119 -104.235 1.00 58.99  ?  75  ILE D O     1 
ATOM   3663  C CB    . ILE E 1 75  ? -18.234 -31.855 -107.238 1.00 46.98  ?  75  ILE D CB    1 
ATOM   3664  C CG1   . ILE E 1 75  ? -18.004 -31.134 -108.568 1.00 40.81  ?  75  ILE D CG1   1 
ATOM   3665  C CG2   . ILE E 1 75  ? -19.127 -33.067 -107.433 1.00 36.01  ?  75  ILE D CG2   1 
ATOM   3666  C CD1   . ILE E 1 75  ? -17.323 -31.988 -109.617 1.00 56.54  ?  75  ILE D CD1   1 
ATOM   3667  N N     . ILE E 1 76  ? -20.442 -31.770 -104.609 1.00 50.23  ?  76  ILE D N     1 
ATOM   3668  C CA    . ILE E 1 76  ? -20.887 -32.427 -103.385 1.00 45.72  ?  76  ILE D CA    1 
ATOM   3669  C C     . ILE E 1 76  ? -21.310 -33.876 -103.621 1.00 53.12  ?  76  ILE D C     1 
ATOM   3670  O O     . ILE E 1 76  ? -22.038 -34.178 -104.567 1.00 76.67  ?  76  ILE D O     1 
ATOM   3671  C CB    . ILE E 1 76  ? -22.053 -31.649 -102.742 1.00 35.75  ?  76  ILE D CB    1 
ATOM   3672  C CG1   . ILE E 1 76  ? -21.615 -30.218 -102.422 1.00 41.71  ?  76  ILE D CG1   1 
ATOM   3673  C CG2   . ILE E 1 76  ? -22.553 -32.355 -101.491 1.00 51.24  ?  76  ILE D CG2   1 
ATOM   3674  C CD1   . ILE E 1 76  ? -22.604 -29.443 -101.581 1.00 56.67  ?  76  ILE D CD1   1 
ATOM   3675  N N     . THR E 1 77  ? -20.850 -34.763 -102.743 1.00 52.76  ?  77  THR D N     1 
ATOM   3676  C CA    . THR E 1 77  ? -21.224 -36.171 -102.767 1.00 53.76  ?  77  THR D CA    1 
ATOM   3677  C C     . THR E 1 77  ? -21.625 -36.644 -101.374 1.00 58.54  ?  77  THR D C     1 
ATOM   3678  O O     . THR E 1 77  ? -21.172 -36.098 -100.370 1.00 56.32  ?  77  THR D O     1 
ATOM   3679  C CB    . THR E 1 77  ? -20.075 -37.057 -103.286 1.00 56.06  ?  77  THR D CB    1 
ATOM   3680  O OG1   . THR E 1 77  ? -18.875 -36.762 -102.559 1.00 74.03  ?  77  THR D OG1   1 
ATOM   3681  C CG2   . THR E 1 77  ? -19.836 -36.810 -104.765 1.00 69.52  ?  77  THR D CG2   1 
ATOM   3682  N N     . SER E 1 78  ? -22.479 -37.659 -101.323 1.00 69.56  ?  78  SER D N     1 
ATOM   3683  C CA    . SER E 1 78  ? -22.916 -38.239 -100.059 1.00 56.11  ?  78  SER D CA    1 
ATOM   3684  C C     . SER E 1 78  ? -23.018 -39.755 -100.165 1.00 65.90  ?  78  SER D C     1 
ATOM   3685  O O     . SER E 1 78  ? -23.829 -40.281 -100.928 1.00 78.41  ?  78  SER D O     1 
ATOM   3686  C CB    . SER E 1 78  ? -24.257 -37.648 -99.623  1.00 76.06  ?  78  SER D CB    1 
ATOM   3687  O OG    . SER E 1 78  ? -24.554 -37.989 -98.279  1.00 70.23  ?  78  SER D OG    1 
ATOM   3688  N N     . ASP E 1 79  ? -22.189 -40.452 -99.396  1.00 56.35  ?  79  ASP D N     1 
ATOM   3689  C CA    . ASP E 1 79  ? -22.234 -41.907 -99.338  1.00 54.68  ?  79  ASP D CA    1 
ATOM   3690  C C     . ASP E 1 79  ? -21.935 -42.379 -97.921  1.00 70.73  ?  79  ASP D C     1 
ATOM   3691  O O     . ASP E 1 79  ? -22.798 -42.298 -97.048  1.00 83.76  ?  79  ASP D O     1 
ATOM   3692  C CB    . ASP E 1 79  ? -21.239 -42.519 -100.325 1.00 54.88  ?  79  ASP D CB    1 
ATOM   3693  N N     . ILE E 1 80  ? -20.724 -42.871 -97.683  1.00 67.77  ?  80  ILE D N     1 
ATOM   3694  C CA    . ILE E 1 80  ? -20.350 -43.262 -96.330  1.00 66.35  ?  80  ILE D CA    1 
ATOM   3695  C C     . ILE E 1 80  ? -20.014 -42.003 -95.540  1.00 62.59  ?  80  ILE D C     1 
ATOM   3696  O O     . ILE E 1 80  ? -20.063 -41.984 -94.309  1.00 59.03  ?  80  ILE D O     1 
ATOM   3697  C CB    . ILE E 1 80  ? -19.149 -44.231 -96.324  1.00 61.96  ?  80  ILE D CB    1 
ATOM   3698  C CG1   . ILE E 1 80  ? -19.332 -45.318 -97.386  1.00 70.41  ?  80  ILE D CG1   1 
ATOM   3699  C CG2   . ILE E 1 80  ? -18.962 -44.854 -94.948  1.00 64.29  ?  80  ILE D CG2   1 
ATOM   3700  C CD1   . ILE E 1 80  ? -18.150 -46.256 -97.508  1.00 81.36  ?  80  ILE D CD1   1 
ATOM   3701  N N     . ASP E 1 81  ? -19.696 -40.941 -96.272  1.00 68.25  ?  81  ASP D N     1 
ATOM   3702  C CA    . ASP E 1 81  ? -19.556 -39.609 -95.701  1.00 67.84  ?  81  ASP D CA    1 
ATOM   3703  C C     . ASP E 1 81  ? -20.033 -38.544 -96.688  1.00 70.82  ?  81  ASP D C     1 
ATOM   3704  O O     . ASP E 1 81  ? -20.445 -38.861 -97.805  1.00 76.33  ?  81  ASP D O     1 
ATOM   3705  C CB    . ASP E 1 81  ? -18.105 -39.357 -95.264  1.00 66.62  ?  81  ASP D CB    1 
ATOM   3706  C CG    . ASP E 1 81  ? -17.112 -39.392 -96.420  1.00 78.86  ?  81  ASP D CG    1 
ATOM   3707  O OD1   . ASP E 1 81  ? -17.528 -39.454 -97.597  1.00 74.25  ?  81  ASP D OD1   1 
ATOM   3708  O OD2   . ASP E 1 81  ? -15.895 -39.355 -96.143  1.00 81.50  -1 81  ASP D OD2   1 
ATOM   3709  N N     . ALA E 1 82  ? -19.976 -37.285 -96.273  1.00 62.17  ?  82  ALA D N     1 
ATOM   3710  C CA    . ALA E 1 82  ? -20.341 -36.180 -97.149  1.00 48.39  ?  82  ALA D CA    1 
ATOM   3711  C C     . ALA E 1 82  ? -19.095 -35.406 -97.539  1.00 59.72  ?  82  ALA D C     1 
ATOM   3712  O O     . ALA E 1 82  ? -18.277 -35.090 -96.689  1.00 60.35  ?  82  ALA D O     1 
ATOM   3713  C CB    . ALA E 1 82  ? -21.343 -35.270 -96.473  1.00 49.79  ?  82  ALA D CB    1 
ATOM   3714  N N     . ARG E 1 83  ? -18.937 -35.103 -98.821  1.00 65.84  ?  83  ARG D N     1 
ATOM   3715  C CA    . ARG E 1 83  ? -17.718 -34.445 -99.276  1.00 48.03  ?  83  ARG D CA    1 
ATOM   3716  C C     . ARG E 1 83  ? -18.027 -33.319 -100.246 1.00 44.60  ?  83  ARG D C     1 
ATOM   3717  O O     . ARG E 1 83  ? -18.934 -33.430 -101.061 1.00 53.72  ?  83  ARG D O     1 
ATOM   3718  C CB    . ARG E 1 83  ? -16.779 -35.450 -99.950  1.00 35.03  ?  83  ARG D CB    1 
ATOM   3719  C CG    . ARG E 1 83  ? -16.235 -36.545 -99.050  1.00 51.50  ?  83  ARG D CG    1 
ATOM   3720  C CD    . ARG E 1 83  ? -15.422 -37.543 -99.863  1.00 50.76  ?  83  ARG D CD    1 
ATOM   3721  N NE    . ARG E 1 83  ? -14.731 -38.523 -99.031  1.00 54.77  ?  83  ARG D NE    1 
ATOM   3722  C CZ    . ARG E 1 83  ? -13.568 -39.083 -99.348  1.00 57.26  ?  83  ARG D CZ    1 
ATOM   3723  N NH1   . ARG E 1 83  ? -12.965 -38.765 -100.486 1.00 59.21  1  83  ARG D NH1   1 
ATOM   3724  N NH2   . ARG E 1 83  ? -13.011 -39.969 -98.533  1.00 53.57  ?  83  ARG D NH2   1 
ATOM   3725  N N     . ILE E 1 84  ? -17.273 -32.232 -100.152 1.00 44.02  ?  84  ILE D N     1 
ATOM   3726  C CA    . ILE E 1 84  ? -17.205 -31.271 -101.241 1.00 39.39  ?  84  ILE D CA    1 
ATOM   3727  C C     . ILE E 1 84  ? -15.782 -31.264 -101.802 1.00 50.98  ?  84  ILE D C     1 
ATOM   3728  O O     . ILE E 1 84  ? -14.799 -31.232 -101.049 1.00 58.63  ?  84  ILE D O     1 
ATOM   3729  C CB    . ILE E 1 84  ? -17.643 -29.854 -100.793 1.00 43.14  ?  84  ILE D CB    1 
ATOM   3730  C CG1   . ILE E 1 84  ? -17.715 -28.916 -101.999 1.00 34.69  ?  84  ILE D CG1   1 
ATOM   3731  C CG2   . ILE E 1 84  ? -16.717 -29.293 -99.720  1.00 57.77  ?  84  ILE D CG2   1 
ATOM   3732  C CD1   . ILE E 1 84  ? -18.099 -27.496 -101.649 1.00 49.27  ?  84  ILE D CD1   1 
ATOM   3733  N N     . ARG E 1 85  ? -15.676 -31.348 -103.126 1.00 52.03  ?  85  ARG D N     1 
ATOM   3734  C CA    . ARG E 1 85  ? -14.371 -31.458 -103.765 1.00 47.26  ?  85  ARG D CA    1 
ATOM   3735  C C     . ARG E 1 85  ? -14.141 -30.432 -104.871 1.00 49.76  ?  85  ARG D C     1 
ATOM   3736  O O     . ARG E 1 85  ? -15.073 -30.000 -105.554 1.00 49.88  ?  85  ARG D O     1 
ATOM   3737  C CB    . ARG E 1 85  ? -14.161 -32.859 -104.348 1.00 49.53  ?  85  ARG D CB    1 
ATOM   3738  C CG    . ARG E 1 85  ? -15.066 -33.202 -105.518 1.00 45.72  ?  85  ARG D CG    1 
ATOM   3739  C CD    . ARG E 1 85  ? -14.854 -34.639 -105.968 1.00 47.84  ?  85  ARG D CD    1 
ATOM   3740  N NE    . ARG E 1 85  ? -15.371 -34.871 -107.313 1.00 39.31  ?  85  ARG D NE    1 
ATOM   3741  C CZ    . ARG E 1 85  ? -16.550 -35.423 -107.577 1.00 49.56  ?  85  ARG D CZ    1 
ATOM   3742  N NH1   . ARG E 1 85  ? -17.343 -35.804 -106.586 1.00 67.62  1  85  ARG D NH1   1 
ATOM   3743  N NH2   . ARG E 1 85  ? -16.937 -35.592 -108.834 1.00 62.82  ?  85  ARG D NH2   1 
ATOM   3744  N N     . PHE E 1 86  ? -12.876 -30.060 -105.022 1.00 52.03  ?  86  PHE D N     1 
ATOM   3745  C CA    . PHE E 1 86  ? -12.410 -29.130 -106.038 1.00 57.30  ?  86  PHE D CA    1 
ATOM   3746  C C     . PHE E 1 86  ? -11.251 -29.824 -106.743 1.00 54.94  ?  86  PHE D C     1 
ATOM   3747  O O     . PHE E 1 86  ? -10.209 -30.089 -106.134 1.00 49.20  ?  86  PHE D O     1 
ATOM   3748  C CB    . PHE E 1 86  ? -11.984 -27.789 -105.435 1.00 56.22  ?  86  PHE D CB    1 
ATOM   3749  C CG    . PHE E 1 86  ? -13.074 -27.094 -104.662 1.00 50.47  ?  86  PHE D CG    1 
ATOM   3750  C CD1   . PHE E 1 86  ? -13.431 -27.524 -103.395 1.00 51.48  ?  86  PHE D CD1   1 
ATOM   3751  C CD2   . PHE E 1 86  ? -13.750 -26.018 -105.212 1.00 65.29  ?  86  PHE D CD2   1 
ATOM   3752  C CE1   . PHE E 1 86  ? -14.433 -26.889 -102.689 1.00 56.71  ?  86  PHE D CE1   1 
ATOM   3753  C CE2   . PHE E 1 86  ? -14.752 -25.377 -104.510 1.00 69.25  ?  86  PHE D CE2   1 
ATOM   3754  C CZ    . PHE E 1 86  ? -15.095 -25.815 -103.247 1.00 59.04  ?  86  PHE D CZ    1 
ATOM   3755  N N     . GLU E 1 87  ? -11.444 -30.136 -108.021 1.00 48.42  ?  87  GLU D N     1 
ATOM   3756  C CA    . GLU E 1 87  ? -10.482 -30.940 -108.764 1.00 49.01  ?  87  GLU D CA    1 
ATOM   3757  C C     . GLU E 1 87  ? -10.149 -30.333 -110.124 1.00 58.13  ?  87  GLU D C     1 
ATOM   3758  O O     . GLU E 1 87  ? -9.063  -30.558 -110.659 1.00 59.76  ?  87  GLU D O     1 
ATOM   3759  C CB    . GLU E 1 87  ? -11.026 -32.362 -108.934 1.00 51.34  ?  87  GLU D CB    1 
ATOM   3760  C CG    . GLU E 1 87  ? -11.146 -33.131 -107.621 1.00 47.71  ?  87  GLU D CG    1 
ATOM   3761  C CD    . GLU E 1 87  ? -11.486 -34.596 -107.816 1.00 48.57  ?  87  GLU D CD    1 
ATOM   3762  O OE1   . GLU E 1 87  ? -12.007 -34.946 -108.895 1.00 58.87  ?  87  GLU D OE1   1 
ATOM   3763  O OE2   . GLU E 1 87  ? -11.244 -35.395 -106.886 1.00 51.75  -1 87  GLU D OE2   1 
ATOM   3764  N N     . SER E 1 88  ? -11.081 -29.566 -110.684 1.00 64.55  ?  88  SER D N     1 
ATOM   3765  C CA    . SER E 1 88  ? -10.843 -28.900 -111.962 1.00 47.02  ?  88  SER D CA    1 
ATOM   3766  C C     . SER E 1 88  ? -9.986  -27.657 -111.751 1.00 50.81  ?  88  SER D C     1 
ATOM   3767  O O     . SER E 1 88  ? -9.975  -27.085 -110.660 1.00 54.58  ?  88  SER D O     1 
ATOM   3768  C CB    . SER E 1 88  ? -12.165 -28.524 -112.630 1.00 44.77  ?  88  SER D CB    1 
ATOM   3769  O OG    . SER E 1 88  ? -12.767 -27.421 -111.974 1.00 39.12  ?  88  SER D OG    1 
ATOM   3770  N N     . LEU E 1 89  ? -9.255  -27.250 -112.785 1.00 61.45  ?  89  LEU D N     1 
ATOM   3771  C CA    . LEU E 1 89  ? -8.373  -26.095 -112.662 1.00 60.48  ?  89  LEU D CA    1 
ATOM   3772  C C     . LEU E 1 89  ? -9.109  -24.801 -112.311 1.00 59.32  ?  89  LEU D C     1 
ATOM   3773  O O     . LEU E 1 89  ? -8.611  -23.997 -111.528 1.00 61.33  ?  89  LEU D O     1 
ATOM   3774  C CB    . LEU E 1 89  ? -7.595  -25.896 -113.967 1.00 51.29  ?  89  LEU D CB    1 
ATOM   3775  C CG    . LEU E 1 89  ? -6.524  -26.936 -114.309 1.00 48.15  ?  89  LEU D CG    1 
ATOM   3776  C CD1   . LEU E 1 89  ? -5.918  -26.659 -115.674 1.00 67.70  ?  89  LEU D CD1   1 
ATOM   3777  C CD2   . LEU E 1 89  ? -5.442  -26.976 -113.247 1.00 55.58  ?  89  LEU D CD2   1 
ATOM   3778  N N     . LYS E 1 90  ? -10.286 -24.600 -112.898 1.00 60.39  ?  90  LYS D N     1 
ATOM   3779  C CA    . LYS E 1 90  ? -11.112 -23.430 -112.596 1.00 61.86  ?  90  LYS D CA    1 
ATOM   3780  C C     . LYS E 1 90  ? -11.573 -23.350 -111.138 1.00 66.55  ?  90  LYS D C     1 
ATOM   3781  O O     . LYS E 1 90  ? -11.497 -22.295 -110.488 1.00 69.98  ?  90  LYS D O     1 
ATOM   3782  C CB    . LYS E 1 90  ? -12.333 -23.407 -113.520 1.00 53.59  ?  90  LYS D CB    1 
ATOM   3783  N N     . GLU E 1 91  ? -11.999 -24.496 -110.615 1.00 51.31  ?  91  GLU D N     1 
ATOM   3784  C CA    . GLU E 1 91  ? -12.474 -24.584 -109.244 1.00 50.11  ?  91  GLU D CA    1 
ATOM   3785  C C     . GLU E 1 91  ? -11.337 -24.387 -108.262 1.00 61.10  ?  91  GLU D C     1 
ATOM   3786  O O     . GLU E 1 91  ? -11.479 -23.685 -107.252 1.00 64.83  ?  91  GLU D O     1 
ATOM   3787  C CB    . GLU E 1 91  ? -13.155 -25.932 -109.004 1.00 53.37  ?  91  GLU D CB    1 
ATOM   3788  N N     . LEU E 1 92  ? -10.202 -25.007 -108.557 1.00 52.55  ?  92  LEU D N     1 
ATOM   3789  C CA    . LEU E 1 92  ? -9.072  -24.881 -107.666 1.00 48.99  ?  92  LEU D CA    1 
ATOM   3790  C C     . LEU E 1 92  ? -8.591  -23.440 -107.733 1.00 60.37  ?  92  LEU D C     1 
ATOM   3791  O O     . LEU E 1 92  ? -8.084  -22.910 -106.754 1.00 54.01  ?  92  LEU D O     1 
ATOM   3792  C CB    . LEU E 1 92  ? -7.970  -25.864 -108.051 1.00 39.51  ?  92  LEU D CB    1 
ATOM   3793  C CG    . LEU E 1 92  ? -8.301  -27.312 -107.681 1.00 51.90  ?  92  LEU D CG    1 
ATOM   3794  C CD1   . LEU E 1 92  ? -7.318  -28.278 -108.313 1.00 56.97  ?  92  LEU D CD1   1 
ATOM   3795  C CD2   . LEU E 1 92  ? -8.325  -27.476 -106.171 1.00 58.18  ?  92  LEU D CD2   1 
ATOM   3796  N N     . GLU E 1 93  ? -8.757  -22.810 -108.895 1.00 72.74  ?  93  GLU D N     1 
ATOM   3797  C CA    . GLU E 1 93  ? -8.421  -21.399 -109.050 1.00 69.93  ?  93  GLU D CA    1 
ATOM   3798  C C     . GLU E 1 93  ? -9.270  -20.564 -108.097 1.00 78.42  ?  93  GLU D C     1 
ATOM   3799  O O     . GLU E 1 93  ? -8.778  -19.632 -107.453 1.00 83.40  ?  93  GLU D O     1 
ATOM   3800  C CB    . GLU E 1 93  ? -8.628  -20.943 -110.495 1.00 70.82  ?  93  GLU D CB    1 
ATOM   3801  N N     . VAL E 1 94  ? -10.552 -20.919 -108.010 1.00 67.92  ?  94  VAL D N     1 
ATOM   3802  C CA    . VAL E 1 94  ? -11.472 -20.265 -107.078 1.00 61.44  ?  94  VAL D CA    1 
ATOM   3803  C C     . VAL E 1 94  ? -11.025 -20.444 -105.626 1.00 65.04  ?  94  VAL D C     1 
ATOM   3804  O O     . VAL E 1 94  ? -11.041 -19.498 -104.826 1.00 67.51  ?  94  VAL D O     1 
ATOM   3805  C CB    . VAL E 1 94  ? -12.910 -20.798 -107.237 1.00 66.18  ?  94  VAL D CB    1 
ATOM   3806  C CG1   . VAL E 1 94  ? -13.824 -20.197 -106.182 1.00 67.52  ?  94  VAL D CG1   1 
ATOM   3807  C CG2   . VAL E 1 94  ? -13.434 -20.496 -108.634 1.00 57.23  ?  94  VAL D CG2   1 
ATOM   3808  N N     . VAL E 1 95  ? -10.588 -21.660 -105.311 1.00 64.57  ?  95  VAL D N     1 
ATOM   3809  C CA    . VAL E 1 95  ? -10.089 -21.990 -103.977 1.00 49.93  ?  95  VAL D CA    1 
ATOM   3810  C C     . VAL E 1 95  ? -8.855  -21.169 -103.614 1.00 61.95  ?  95  VAL D C     1 
ATOM   3811  O O     . VAL E 1 95  ? -8.782  -20.582 -102.528 1.00 65.01  ?  95  VAL D O     1 
ATOM   3812  C CB    . VAL E 1 95  ? -9.746  -23.488 -103.864 1.00 42.09  ?  95  VAL D CB    1 
ATOM   3813  C CG1   . VAL E 1 95  ? -9.023  -23.773 -102.563 1.00 44.87  ?  95  VAL D CG1   1 
ATOM   3814  C CG2   . VAL E 1 95  ? -11.004 -24.325 -103.966 1.00 46.14  ?  95  VAL D CG2   1 
ATOM   3815  N N     . ILE E 1 96  ? -7.892  -21.122 -104.530 1.00 71.11  ?  96  ILE D N     1 
ATOM   3816  C CA    . ILE E 1 96  ? -6.664  -20.377 -104.304 1.00 70.08  ?  96  ILE D CA    1 
ATOM   3817  C C     . ILE E 1 96  ? -6.987  -18.898 -104.148 1.00 72.41  ?  96  ILE D C     1 
ATOM   3818  O O     . ILE E 1 96  ? -6.413  -18.236 -103.292 1.00 63.85  ?  96  ILE D O     1 
ATOM   3819  C CB    . ILE E 1 96  ? -5.637  -20.586 -105.445 1.00 57.04  ?  96  ILE D CB    1 
ATOM   3820  C CG1   . ILE E 1 96  ? -4.916  -21.924 -105.271 1.00 50.10  ?  96  ILE D CG1   1 
ATOM   3821  C CG2   . ILE E 1 96  ? -4.584  -19.494 -105.436 1.00 69.97  ?  96  ILE D CG2   1 
ATOM   3822  C CD1   . ILE E 1 96  ? -5.033  -22.855 -106.449 1.00 48.12  ?  96  ILE D CD1   1 
ATOM   3823  N N     . ASN E 1 97  ? -7.895  -18.375 -104.968 1.00 72.71  ?  97  ASN D N     1 
ATOM   3824  C CA    . ASN E 1 97  ? -8.269  -16.969 -104.850 1.00 74.51  ?  97  ASN D CA    1 
ATOM   3825  C C     . ASN E 1 97  ? -8.865  -16.686 -103.468 1.00 78.04  ?  97  ASN D C     1 
ATOM   3826  O O     . ASN E 1 97  ? -8.547  -15.670 -102.823 1.00 82.50  ?  97  ASN D O     1 
ATOM   3827  C CB    . ASN E 1 97  ? -9.263  -16.578 -105.945 1.00 78.81  ?  97  ASN D CB    1 
ATOM   3828  N N     . HIS E 1 98  ? -9.681  -17.626 -102.991 1.00 81.42  ?  98  HIS D N     1 
ATOM   3829  C CA    . HIS E 1 98  ? -10.288 -17.489 -101.671 1.00 77.15  ?  98  HIS D CA    1 
ATOM   3830  C C     . HIS E 1 98  ? -9.247  -17.482 -100.558 1.00 65.36  ?  98  HIS D C     1 
ATOM   3831  O O     . HIS E 1 98  ? -9.251  -16.584 -99.717  1.00 68.72  ?  98  HIS D O     1 
ATOM   3832  C CB    . HIS E 1 98  ? -11.299 -18.608 -101.415 1.00 71.32  ?  98  HIS D CB    1 
ATOM   3833  C CG    . HIS E 1 98  ? -11.862 -18.598 -100.027 1.00 73.15  ?  98  HIS D CG    1 
ATOM   3834  N ND1   . HIS E 1 98  ? -12.829 -17.704 -99.623  1.00 80.63  ?  98  HIS D ND1   1 
ATOM   3835  C CD2   . HIS E 1 98  ? -11.582 -19.363 -98.946  1.00 76.21  ?  98  HIS D CD2   1 
ATOM   3836  C CE1   . HIS E 1 98  ? -13.126 -17.924 -98.354  1.00 81.94  ?  98  HIS D CE1   1 
ATOM   3837  N NE2   . HIS E 1 98  ? -12.383 -18.925 -97.919  1.00 69.69  ?  98  HIS D NE2   1 
ATOM   3838  N N     . PHE E 1 99  ? -8.357  -18.471 -100.541 1.00 62.26  ?  99  PHE D N     1 
ATOM   3839  C CA    . PHE E 1 99  ? -7.420  -18.566 -99.426  1.00 57.82  ?  99  PHE D CA    1 
ATOM   3840  C C     . PHE E 1 99  ? -6.337  -17.500 -99.539  1.00 69.40  ?  99  PHE D C     1 
ATOM   3841  O O     . PHE E 1 99  ? -5.687  -17.161 -98.553  1.00 59.37  ?  99  PHE D O     1 
ATOM   3842  C CB    . PHE E 1 99  ? -6.783  -19.954 -99.345  1.00 55.97  ?  99  PHE D CB    1 
ATOM   3843  C CG    . PHE E 1 99  ? -7.699  -21.011 -98.800  1.00 62.90  ?  99  PHE D CG    1 
ATOM   3844  C CD1   . PHE E 1 99  ? -8.222  -20.898 -97.522  1.00 73.22  ?  99  PHE D CD1   1 
ATOM   3845  C CD2   . PHE E 1 99  ? -8.019  -22.128 -99.552  1.00 60.50  ?  99  PHE D CD2   1 
ATOM   3846  C CE1   . PHE E 1 99  ? -9.063  -21.869 -97.011  1.00 59.03  ?  99  PHE D CE1   1 
ATOM   3847  C CE2   . PHE E 1 99  ? -8.858  -23.105 -99.045  1.00 62.86  ?  99  PHE D CE2   1 
ATOM   3848  C CZ    . PHE E 1 99  ? -9.379  -22.976 -97.773  1.00 63.11  ?  99  PHE D CZ    1 
ATOM   3849  N N     . ASP E 1 100 ? -6.129  -16.981 -100.745 1.00 82.27  ?  100 ASP D N     1 
ATOM   3850  C CA    . ASP E 1 100 ? -5.261  -15.826 -100.915 1.00 81.68  ?  100 ASP D CA    1 
ATOM   3851  C C     . ASP E 1 100 ? -5.923  -14.615 -100.281 1.00 69.05  ?  100 ASP D C     1 
ATOM   3852  O O     . ASP E 1 100 ? -5.248  -13.747 -99.730  1.00 58.57  ?  100 ASP D O     1 
ATOM   3853  C CB    . ASP E 1 100 ? -4.958  -15.571 -102.391 1.00 84.24  ?  100 ASP D CB    1 
ATOM   3854  C CG    . ASP E 1 100 ? -3.892  -16.503 -102.935 1.00 77.46  ?  100 ASP D CG    1 
ATOM   3855  O OD1   . ASP E 1 100 ? -3.282  -17.241 -102.134 1.00 59.87  ?  100 ASP D OD1   1 
ATOM   3856  O OD2   . ASP E 1 100 ? -3.665  -16.496 -104.164 1.00 83.18  -1 100 ASP D OD2   1 
ATOM   3857  N N     . LYS E 1 101 ? -7.252  -14.558 -100.353 1.00 68.06  ?  101 LYS D N     1 
ATOM   3858  C CA    . LYS E 1 101 ? -7.949  -13.404 -99.797  1.00 77.93  ?  101 LYS D CA    1 
ATOM   3859  C C     . LYS E 1 101 ? -8.227  -13.611 -98.305  1.00 86.35  ?  101 LYS D C     1 
ATOM   3860  O O     . LYS E 1 101 ? -8.143  -12.678 -97.506  1.00 89.03  ?  101 LYS D O     1 
ATOM   3861  C CB    . LYS E 1 101 ? -9.255  -13.146 -100.552 1.00 72.79  ?  101 LYS D CB    1 
ATOM   3862  N N     . TYR E 1 102 ? -8.558  -14.848 -97.948  1.00 80.99  ?  102 TYR D N     1 
ATOM   3863  C CA    . TYR E 1 102 ? -8.903  -15.215 -96.576  1.00 57.85  ?  102 TYR D CA    1 
ATOM   3864  C C     . TYR E 1 102 ? -8.038  -16.371 -96.065  1.00 56.35  ?  102 TYR D C     1 
ATOM   3865  O O     . TYR E 1 102 ? -8.504  -17.507 -96.001  1.00 53.18  ?  102 TYR D O     1 
ATOM   3866  C CB    . TYR E 1 102 ? -10.388 -15.560 -96.489  1.00 59.34  ?  102 TYR D CB    1 
ATOM   3867  C CG    . TYR E 1 102 ? -11.268 -14.429 -96.974  1.00 75.57  ?  102 TYR D CG    1 
ATOM   3868  C CD1   . TYR E 1 102 ? -11.661 -13.409 -96.117  1.00 83.38  ?  102 TYR D CD1   1 
ATOM   3869  C CD2   . TYR E 1 102 ? -11.701 -14.379 -98.292  1.00 78.16  ?  102 TYR D CD2   1 
ATOM   3870  C CE1   . TYR E 1 102 ? -12.461 -12.371 -96.561  1.00 82.69  ?  102 TYR D CE1   1 
ATOM   3871  C CE2   . TYR E 1 102 ? -12.500 -13.346 -98.745  1.00 91.95  ?  102 TYR D CE2   1 
ATOM   3872  C CZ    . TYR E 1 102 ? -12.880 -12.347 -97.875  1.00 94.19  ?  102 TYR D CZ    1 
ATOM   3873  O OH    . TYR E 1 102 ? -13.674 -11.317 -98.327  1.00 103.62 ?  102 TYR D OH    1 
ATOM   3874  N N     . PRO E 1 103 ? -6.777  -16.089 -95.704  1.00 57.69  ?  103 PRO D N     1 
ATOM   3875  C CA    . PRO E 1 103 ? -5.763  -17.132 -95.484  1.00 60.86  ?  103 PRO D CA    1 
ATOM   3876  C C     . PRO E 1 103 ? -5.969  -18.027 -94.259  1.00 61.76  ?  103 PRO D C     1 
ATOM   3877  O O     . PRO E 1 103 ? -6.420  -17.580 -93.205  1.00 70.06  ?  103 PRO D O     1 
ATOM   3878  C CB    . PRO E 1 103 ? -4.462  -16.327 -95.324  1.00 50.80  ?  103 PRO D CB    1 
ATOM   3879  C CG    . PRO E 1 103 ? -4.762  -14.966 -95.858  1.00 58.95  ?  103 PRO D CG    1 
ATOM   3880  C CD    . PRO E 1 103 ? -6.207  -14.737 -95.590  1.00 63.06  ?  103 PRO D CD    1 
ATOM   3881  N N     . LEU E 1 104 ? -5.623  -19.301 -94.439  1.00 64.20  ?  104 LEU D N     1 
ATOM   3882  C CA    . LEU E 1 104 ? -5.533  -20.289 -93.364  1.00 50.55  ?  104 LEU D CA    1 
ATOM   3883  C C     . LEU E 1 104 ? -4.521  -19.859 -92.320  1.00 50.66  ?  104 LEU D C     1 
ATOM   3884  O O     . LEU E 1 104 ? -3.578  -19.132 -92.627  1.00 41.34  ?  104 LEU D O     1 
ATOM   3885  C CB    . LEU E 1 104 ? -5.152  -21.667 -93.912  1.00 51.01  ?  104 LEU D CB    1 
ATOM   3886  C CG    . LEU E 1 104 ? -6.038  -22.297 -94.984  1.00 53.90  ?  104 LEU D CG    1 
ATOM   3887  C CD1   . LEU E 1 104 ? -5.224  -23.233 -95.858  1.00 59.80  ?  104 LEU D CD1   1 
ATOM   3888  C CD2   . LEU E 1 104 ? -7.180  -23.046 -94.325  1.00 58.63  ?  104 LEU D CD2   1 
ATOM   3889  N N     . ILE E 1 105 ? -4.712  -20.309 -91.082  1.00 70.61  ?  105 ILE D N     1 
ATOM   3890  C CA    . ILE E 1 105 ? -3.793  -19.928 -90.022  1.00 58.02  ?  105 ILE D CA    1 
ATOM   3891  C C     . ILE E 1 105 ? -3.252  -21.131 -89.238  1.00 52.78  ?  105 ILE D C     1 
ATOM   3892  O O     . ILE E 1 105 ? -2.371  -20.979 -88.391  1.00 61.07  ?  105 ILE D O     1 
ATOM   3893  C CB    . ILE E 1 105 ? -4.516  -18.965 -89.025  1.00 50.32  ?  105 ILE D CB    1 
ATOM   3894  C CG1   . ILE E 1 105 ? -5.410  -17.965 -89.765  1.00 69.08  ?  105 ILE D CG1   1 
ATOM   3895  C CG2   . ILE E 1 105 ? -3.543  -18.218 -88.151  1.00 65.53  ?  105 ILE D CG2   1 
ATOM   3896  C CD1   . ILE E 1 105 ? -4.649  -16.890 -90.516  1.00 77.38  ?  105 ILE D CD1   1 
ATOM   3897  N N     . THR E 1 106 ? -3.741  -22.334 -89.533  1.00 48.64  ?  106 THR D N     1 
ATOM   3898  C CA    . THR E 1 106 ? -3.087  -23.538 -89.021  1.00 50.84  ?  106 THR D CA    1 
ATOM   3899  C C     . THR E 1 106 ? -1.912  -23.948 -89.910  1.00 67.35  ?  106 THR D C     1 
ATOM   3900  O O     . THR E 1 106 ? -1.622  -23.285 -90.907  1.00 68.02  ?  106 THR D O     1 
ATOM   3901  C CB    . THR E 1 106 ? -4.068  -24.711 -88.897  1.00 50.94  ?  106 THR D CB    1 
ATOM   3902  O OG1   . THR E 1 106 ? -4.504  -25.112 -90.201  1.00 68.14  ?  106 THR D OG1   1 
ATOM   3903  C CG2   . THR E 1 106 ? -5.276  -24.302 -88.074  1.00 57.14  ?  106 THR D CG2   1 
ATOM   3904  N N     . GLN E 1 107 ? -1.243  -25.040 -89.545  1.00 66.96  ?  107 GLN D N     1 
ATOM   3905  C CA    . GLN E 1 107 ? -0.134  -25.575 -90.338  1.00 66.82  ?  107 GLN D CA    1 
ATOM   3906  C C     . GLN E 1 107 ? -0.506  -26.017 -91.756  1.00 60.24  ?  107 GLN D C     1 
ATOM   3907  O O     . GLN E 1 107 ? 0.365   -26.146 -92.621  1.00 67.43  ?  107 GLN D O     1 
ATOM   3908  C CB    . GLN E 1 107 ? 0.508   -26.757 -89.610  1.00 62.83  ?  107 GLN D CB    1 
ATOM   3909  C CG    . GLN E 1 107 ? 1.162   -26.402 -88.289  1.00 80.74  ?  107 GLN D CG    1 
ATOM   3910  C CD    . GLN E 1 107 ? 2.639   -26.743 -88.267  1.00 85.63  ?  107 GLN D CD    1 
ATOM   3911  O OE1   . GLN E 1 107 ? 3.031   -27.874 -88.558  1.00 74.53  ?  107 GLN D OE1   1 
ATOM   3912  N NE2   . GLN E 1 107 ? 3.467   -25.764 -87.925  1.00 89.52  ?  107 GLN D NE2   1 
ATOM   3913  N N     . LYS E 1 108 ? -1.798  -26.216 -92.006  1.00 50.64  ?  108 LYS D N     1 
ATOM   3914  C CA    . LYS E 1 108 ? -2.267  -26.571 -93.343  1.00 68.99  ?  108 LYS D CA    1 
ATOM   3915  C C     . LYS E 1 108 ? -2.002  -25.500 -94.390  1.00 67.70  ?  108 LYS D C     1 
ATOM   3916  O O     . LYS E 1 108 ? -1.923  -25.803 -95.585  1.00 73.61  ?  108 LYS D O     1 
ATOM   3917  C CB    . LYS E 1 108 ? -3.766  -26.883 -93.306  1.00 66.36  ?  108 LYS D CB    1 
ATOM   3918  N N     . ARG E 1 109 ? -1.784  -24.270 -93.934  1.00 64.72  ?  109 ARG D N     1 
ATOM   3919  C CA    . ARG E 1 109 ? -1.346  -23.201 -94.818  1.00 69.96  ?  109 ARG D CA    1 
ATOM   3920  C C     . ARG E 1 109 ? -0.067  -23.584 -95.544  1.00 65.39  ?  109 ARG D C     1 
ATOM   3921  O O     . ARG E 1 109 ? 0.066   -23.347 -96.747  1.00 65.37  ?  109 ARG D O     1 
ATOM   3922  C CB    . ARG E 1 109 ? -1.139  -21.905 -94.029  1.00 60.63  ?  109 ARG D CB    1 
ATOM   3923  N N     . ALA E 1 110 ? 0.819   -24.293 -94.853  1.00 49.91  ?  110 ALA D N     1 
ATOM   3924  C CA    . ALA E 1 110 ? 2.071   -24.675 -95.476  1.00 53.40  ?  110 ALA D CA    1 
ATOM   3925  C C     . ALA E 1 110 ? 1.790   -25.724 -96.533  1.00 74.49  ?  110 ALA D C     1 
ATOM   3926  O O     . ALA E 1 110 ? 2.323   -25.647 -97.649  1.00 76.51  ?  110 ALA D O     1 
ATOM   3927  C CB    . ALA E 1 110 ? 3.052   -25.201 -94.439  1.00 51.58  ?  110 ALA D CB    1 
ATOM   3928  N N     . ASP E 1 111 ? 0.855   -26.622 -96.233  1.00 63.38  ?  111 ASP D N     1 
ATOM   3929  C CA    . ASP E 1 111 ? 0.461   -27.615 -97.214  1.00 49.58  ?  111 ASP D CA    1 
ATOM   3930  C C     . ASP E 1 111 ? -0.137  -26.886 -98.400  1.00 47.92  ?  111 ASP D C     1 
ATOM   3931  O O     . ASP E 1 111 ? 0.220   -27.152 -99.556  1.00 51.53  ?  111 ASP D O     1 
ATOM   3932  C CB    . ASP E 1 111 ? -0.551  -28.600 -96.621  1.00 48.21  ?  111 ASP D CB    1 
ATOM   3933  C CG    . ASP E 1 111 ? 0.055   -29.499 -95.560  1.00 57.95  ?  111 ASP D CG    1 
ATOM   3934  O OD1   . ASP E 1 111 ? 1.102   -30.123 -95.831  1.00 68.61  ?  111 ASP D OD1   1 
ATOM   3935  O OD2   . ASP E 1 111 ? -0.522  -29.588 -94.454  1.00 69.62  -1 111 ASP D OD2   1 
ATOM   3936  N N     . TYR E 1 112 ? -0.906  -25.846 -98.091  1.00 48.78  ?  112 TYR D N     1 
ATOM   3937  C CA    . TYR E 1 112 ? -1.552  -25.058 -99.121  1.00 55.83  ?  112 TYR D CA    1 
ATOM   3938  C C     . TYR E 1 112 ? -0.506  -24.456 -100.025 1.00 56.06  ?  112 TYR D C     1 
ATOM   3939  O O     . TYR E 1 112 ? -0.619  -24.534 -101.254 1.00 41.10  ?  112 TYR D O     1 
ATOM   3940  C CB    . TYR E 1 112 ? -2.413  -23.963 -98.487  1.00 50.17  ?  112 TYR D CB    1 
ATOM   3941  C CG    . TYR E 1 112 ? -2.943  -22.930 -99.455  1.00 42.55  ?  112 TYR D CG    1 
ATOM   3942  C CD1   . TYR E 1 112 ? -3.994  -23.220 -100.312 1.00 42.28  ?  112 TYR D CD1   1 
ATOM   3943  C CD2   . TYR E 1 112 ? -2.396  -21.654 -99.500  1.00 48.42  ?  112 TYR D CD2   1 
ATOM   3944  C CE1   . TYR E 1 112 ? -4.477  -22.275 -101.195 1.00 53.27  ?  112 TYR D CE1   1 
ATOM   3945  C CE2   . TYR E 1 112 ? -2.874  -20.703 -100.374 1.00 42.25  ?  112 TYR D CE2   1 
ATOM   3946  C CZ    . TYR E 1 112 ? -3.912  -21.017 -101.220 1.00 58.06  ?  112 TYR D CZ    1 
ATOM   3947  O OH    . TYR E 1 112 ? -4.395  -20.065 -102.088 1.00 55.89  ?  112 TYR D OH    1 
ATOM   3948  N N     . LEU E 1 113 ? 0.581   -23.984 -99.429  1.00 55.53  ?  113 LEU D N     1 
ATOM   3949  C CA    . LEU E 1 113 ? 1.566   -23.287 -100.225 1.00 60.32  ?  113 LEU D CA    1 
ATOM   3950  C C     . LEU E 1 113 ? 2.257   -24.263 -101.155 1.00 59.30  ?  113 LEU D C     1 
ATOM   3951  O O     . LEU E 1 113 ? 2.401   -23.980 -102.352 1.00 47.01  ?  113 LEU D O     1 
ATOM   3952  C CB    . LEU E 1 113 ? 2.589   -22.593 -99.327  1.00 54.88  ?  113 LEU D CB    1 
ATOM   3953  C CG    . LEU E 1 113 ? 2.098   -21.328 -98.624  1.00 50.58  ?  113 LEU D CG    1 
ATOM   3954  C CD1   . LEU E 1 113 ? 3.181   -20.768 -97.717  1.00 51.10  ?  113 LEU D CD1   1 
ATOM   3955  C CD2   . LEU E 1 113 ? 1.646   -20.292 -99.639  1.00 54.67  ?  113 LEU D CD2   1 
ATOM   3956  N N     . LEU E 1 114 ? 2.509   -25.472 -100.660 1.00 50.78  ?  114 LEU D N     1 
ATOM   3957  C CA    . LEU E 1 114 ? 3.080   -26.490 -101.522 1.00 41.44  ?  114 LEU D CA    1 
ATOM   3958  C C     . LEU E 1 114 ? 2.105   -26.781 -102.637 1.00 53.13  ?  114 LEU D C     1 
ATOM   3959  O O     . LEU E 1 114 ? 2.452   -26.696 -103.827 1.00 61.21  ?  114 LEU D O     1 
ATOM   3960  C CB    . LEU E 1 114 ? 3.397   -27.762 -100.735 1.00 38.13  ?  114 LEU D CB    1 
ATOM   3961  C CG    . LEU E 1 114 ? 4.495   -27.649 -99.677  1.00 47.55  ?  114 LEU D CG    1 
ATOM   3962  C CD1   . LEU E 1 114 ? 4.448   -28.837 -98.731  1.00 52.18  ?  114 LEU D CD1   1 
ATOM   3963  C CD2   . LEU E 1 114 ? 5.861   -27.536 -100.329 1.00 60.10  ?  114 LEU D CD2   1 
ATOM   3964  N N     . PHE E 1 115 ? 0.852   -26.968 -102.247 1.00 46.65  ?  115 PHE D N     1 
ATOM   3965  C CA    . PHE E 1 115 ? -0.197  -27.221 -103.205 1.00 34.41  ?  115 PHE D CA    1 
ATOM   3966  C C     . PHE E 1 115 ? -0.260  -26.122 -104.241 1.00 45.30  ?  115 PHE D C     1 
ATOM   3967  O O     . PHE E 1 115 ? -0.278  -26.409 -105.446 1.00 55.87  ?  115 PHE D O     1 
ATOM   3968  C CB    . PHE E 1 115 ? -1.533  -27.344 -102.468 1.00 38.09  ?  115 PHE D CB    1 
ATOM   3969  C CG    . PHE E 1 115 ? -2.721  -27.509 -103.366 1.00 40.73  ?  115 PHE D CG    1 
ATOM   3970  C CD1   . PHE E 1 115 ? -3.080  -28.755 -103.849 1.00 44.05  ?  115 PHE D CD1   1 
ATOM   3971  C CD2   . PHE E 1 115 ? -3.503  -26.414 -103.697 1.00 41.32  ?  115 PHE D CD2   1 
ATOM   3972  C CE1   . PHE E 1 115 ? -4.184  -28.902 -104.664 1.00 44.80  ?  115 PHE D CE1   1 
ATOM   3973  C CE2   . PHE E 1 115 ? -4.607  -26.555 -104.511 1.00 42.18  ?  115 PHE D CE2   1 
ATOM   3974  C CZ    . PHE E 1 115 ? -4.949  -27.800 -104.995 1.00 47.89  ?  115 PHE D CZ    1 
ATOM   3975  N N     . LYS E 1 116 ? -0.118  -24.876 -103.805 1.00 45.47  ?  116 LYS D N     1 
ATOM   3976  C CA    . LYS E 1 116 ? -0.288  -23.810 -104.769 1.00 41.75  ?  116 LYS D CA    1 
ATOM   3977  C C     . LYS E 1 116 ? 0.826   -23.821 -105.788 1.00 54.08  ?  116 LYS D C     1 
ATOM   3978  O O     . LYS E 1 116 ? 0.556   -23.740 -106.994 1.00 53.62  ?  116 LYS D O     1 
ATOM   3979  C CB    . LYS E 1 116 ? -0.342  -22.452 -104.063 1.00 36.12  ?  116 LYS D CB    1 
ATOM   3980  N N     . LYS E 1 117 ? 2.043   -24.111 -105.339 1.00 57.25  ?  117 LYS D N     1 
ATOM   3981  C CA    . LYS E 1 117 ? 3.142   -24.167 -106.283 1.00 54.09  ?  117 LYS D CA    1 
ATOM   3982  C C     . LYS E 1 117 ? 2.916   -25.267 -107.293 1.00 53.67  ?  117 LYS D C     1 
ATOM   3983  O O     . LYS E 1 117 ? 3.022   -25.035 -108.507 1.00 51.75  ?  117 LYS D O     1 
ATOM   3984  C CB    . LYS E 1 117 ? 4.470   -24.383 -105.553 1.00 48.95  ?  117 LYS D CB    1 
ATOM   3985  N N     . ALA E 1 118 ? 2.431   -26.406 -106.813 1.00 53.50  ?  118 ALA D N     1 
ATOM   3986  C CA    . ALA E 1 118 ? 2.204   -27.513 -107.717 1.00 47.42  ?  118 ALA D CA    1 
ATOM   3987  C C     . ALA E 1 118 ? 1.137   -27.142 -108.711 1.00 47.73  ?  118 ALA D C     1 
ATOM   3988  O O     . ALA E 1 118 ? 1.311   -27.335 -109.919 1.00 51.48  ?  118 ALA D O     1 
ATOM   3989  C CB    . ALA E 1 118 ? 1.812   -28.758 -106.951 1.00 47.79  ?  118 ALA D CB    1 
ATOM   3990  N N     . PHE E 1 119 ? 0.093   -26.492 -108.211 1.00 43.58  ?  119 PHE D N     1 
ATOM   3991  C CA    . PHE E 1 119 ? -0.998  -26.097 -109.075 1.00 49.10  ?  119 PHE D CA    1 
ATOM   3992  C C     . PHE E 1 119 ? -0.506  -25.217 -110.201 1.00 49.96  ?  119 PHE D C     1 
ATOM   3993  O O     . PHE E 1 119 ? -0.845  -25.439 -111.366 1.00 60.65  ?  119 PHE D O     1 
ATOM   3994  C CB    . PHE E 1 119 ? -2.072  -25.368 -108.269 1.00 40.79  ?  119 PHE D CB    1 
ATOM   3995  C CG    . PHE E 1 119 ? -3.110  -24.686 -109.112 1.00 32.62  ?  119 PHE D CG    1 
ATOM   3996  C CD1   . PHE E 1 119 ? -4.156  -25.405 -109.666 1.00 30.22  ?  119 PHE D CD1   1 
ATOM   3997  C CD2   . PHE E 1 119 ? -3.042  -23.323 -109.346 1.00 45.24  ?  119 PHE D CD2   1 
ATOM   3998  C CE1   . PHE E 1 119 ? -5.116  -24.776 -110.436 1.00 41.15  ?  119 PHE D CE1   1 
ATOM   3999  C CE2   . PHE E 1 119 ? -3.997  -22.689 -110.116 1.00 51.78  ?  119 PHE D CE2   1 
ATOM   4000  C CZ    . PHE E 1 119 ? -5.036  -23.417 -110.662 1.00 36.39  ?  119 PHE D CZ    1 
ATOM   4001  N N     . TYR E 1 120 ? 0.402   -24.308 -109.870 1.00 52.45  ?  120 TYR D N     1 
ATOM   4002  C CA    . TYR E 1 120 ? 0.896   -23.386 -110.874 1.00 56.14  ?  120 TYR D CA    1 
ATOM   4003  C C     . TYR E 1 120 ? 1.692   -24.163 -111.912 1.00 60.73  ?  120 TYR D C     1 
ATOM   4004  O O     . TYR E 1 120 ? 1.455   -24.017 -113.118 1.00 55.83  ?  120 TYR D O     1 
ATOM   4005  C CB    . TYR E 1 120 ? 1.692   -22.269 -110.207 1.00 62.48  ?  120 TYR D CB    1 
ATOM   4006  C CG    . TYR E 1 120 ? 0.784   -21.093 -109.921 1.00 66.52  ?  120 TYR D CG    1 
ATOM   4007  C CD1   . TYR E 1 120 ? -0.053  -21.109 -108.811 1.00 70.36  ?  120 TYR D CD1   1 
ATOM   4008  C CD2   . TYR E 1 120 ? 0.718   -20.003 -110.774 1.00 81.75  ?  120 TYR D CD2   1 
ATOM   4009  C CE1   . TYR E 1 120 ? -0.907  -20.062 -108.542 1.00 61.13  ?  120 TYR D CE1   1 
ATOM   4010  C CE2   . TYR E 1 120 ? -0.139  -18.944 -110.512 1.00 92.43  ?  120 TYR D CE2   1 
ATOM   4011  C CZ    . TYR E 1 120 ? -0.948  -18.982 -109.392 1.00 81.68  ?  120 TYR D CZ    1 
ATOM   4012  O OH    . TYR E 1 120 ? -1.805  -17.941 -109.115 1.00 89.84  ?  120 TYR D OH    1 
ATOM   4013  N N     . LEU E 1 121 ? 2.549   -25.059 -111.431 1.00 57.52  ?  121 LEU D N     1 
ATOM   4014  C CA    . LEU E 1 121 ? 3.329   -25.931 -112.299 1.00 47.31  ?  121 LEU D CA    1 
ATOM   4015  C C     . LEU E 1 121 ? 2.368   -26.674 -113.208 1.00 46.88  ?  121 LEU D C     1 
ATOM   4016  O O     . LEU E 1 121 ? 2.614   -26.818 -114.404 1.00 56.51  ?  121 LEU D O     1 
ATOM   4017  C CB    . LEU E 1 121 ? 4.191   -26.904 -111.496 1.00 53.47  ?  121 LEU D CB    1 
ATOM   4018  C CG    . LEU E 1 121 ? 5.370   -26.279 -110.749 1.00 50.30  ?  121 LEU D CG    1 
ATOM   4019  C CD1   . LEU E 1 121 ? 6.003   -27.292 -109.811 1.00 65.71  ?  121 LEU D CD1   1 
ATOM   4020  C CD2   . LEU E 1 121 ? 6.398   -25.730 -111.726 1.00 54.91  ?  121 LEU D CD2   1 
ATOM   4021  N N     . ILE E 1 122 ? 1.272   -27.151 -112.634 1.00 51.43  ?  122 ILE D N     1 
ATOM   4022  C CA    . ILE E 1 122 ? 0.294   -27.901 -113.400 1.00 48.18  ?  122 ILE D CA    1 
ATOM   4023  C C     . ILE E 1 122 ? -0.443  -26.959 -114.354 1.00 53.89  ?  122 ILE D C     1 
ATOM   4024  O O     . ILE E 1 122 ? -0.657  -27.300 -115.520 1.00 51.46  ?  122 ILE D O     1 
ATOM   4025  C CB    . ILE E 1 122 ? -0.704  -28.627 -112.484 1.00 37.68  ?  122 ILE D CB    1 
ATOM   4026  C CG1   . ILE E 1 122 ? 0.032   -29.662 -111.631 1.00 41.40  ?  122 ILE D CG1   1 
ATOM   4027  C CG2   . ILE E 1 122 ? -1.789  -29.306 -113.302 1.00 41.19  ?  122 ILE D CG2   1 
ATOM   4028  C CD1   . ILE E 1 122 ? -0.719  -30.079 -110.391 1.00 51.07  ?  122 ILE D CD1   1 
ATOM   4029  N N     . LYS E 1 123 ? -0.836  -25.786 -113.862 1.00 52.80  ?  123 LYS D N     1 
ATOM   4030  C CA    . LYS E 1 123 ? -1.543  -24.810 -114.693 1.00 56.08  ?  123 LYS D CA    1 
ATOM   4031  C C     . LYS E 1 123 ? -0.739  -24.445 -115.944 1.00 66.37  ?  123 LYS D C     1 
ATOM   4032  O O     . LYS E 1 123 ? -1.301  -24.255 -117.024 1.00 45.61  ?  123 LYS D O     1 
ATOM   4033  C CB    . LYS E 1 123 ? -1.867  -23.546 -113.890 1.00 58.79  ?  123 LYS D CB    1 
ATOM   4034  C CG    . LYS E 1 123 ? -2.020  -22.292 -114.740 1.00 84.79  ?  123 LYS D CG    1 
ATOM   4035  C CD    . LYS E 1 123 ? -2.201  -21.047 -113.892 1.00 87.25  ?  123 LYS D CD    1 
ATOM   4036  C CE    . LYS E 1 123 ? -0.921  -20.235 -113.840 1.00 100.70 ?  123 LYS D CE    1 
ATOM   4037  N NZ    . LYS E 1 123 ? -0.550  -19.698 -115.180 1.00 108.10 1  123 LYS D NZ    1 
ATOM   4038  N N     . ASN E 1 124 ? 0.580   -24.377 -115.794 1.00 74.76  ?  124 ASN D N     1 
ATOM   4039  C CA    . ASN E 1 124 ? 1.469   -24.001 -116.888 1.00 73.57  ?  124 ASN D CA    1 
ATOM   4040  C C     . ASN E 1 124 ? 1.950   -25.206 -117.693 1.00 67.23  ?  124 ASN D C     1 
ATOM   4041  O O     . ASN E 1 124 ? 2.791   -25.068 -118.582 1.00 70.35  ?  124 ASN D O     1 
ATOM   4042  C CB    . ASN E 1 124 ? 2.673   -23.227 -116.348 1.00 78.28  ?  124 ASN D CB    1 
ATOM   4043  C CG    . ASN E 1 124 ? 2.286   -21.881 -115.765 1.00 87.60  ?  124 ASN D CG    1 
ATOM   4044  O OD1   . ASN E 1 124 ? 1.237   -21.327 -116.095 1.00 87.23  ?  124 ASN D OD1   1 
ATOM   4045  N ND2   . ASN E 1 124 ? 3.132   -21.351 -114.890 1.00 87.61  ?  124 ASN D ND2   1 
ATOM   4046  N N     . LYS E 1 125 ? 1.426   -26.383 -117.353 1.00 63.15  ?  125 LYS D N     1 
ATOM   4047  C CA    . LYS E 1 125 ? 1.696   -27.622 -118.086 1.00 48.03  ?  125 LYS D CA    1 
ATOM   4048  C C     . LYS E 1 125 ? 3.162   -28.043 -118.005 1.00 43.21  ?  125 LYS D C     1 
ATOM   4049  O O     . LYS E 1 125 ? 3.632   -28.851 -118.804 1.00 54.26  ?  125 LYS D O     1 
ATOM   4050  C CB    . LYS E 1 125 ? 1.267   -27.481 -119.549 1.00 49.38  ?  125 LYS D CB    1 
ATOM   4051  C CG    . LYS E 1 125 ? -0.232  -27.604 -119.762 1.00 48.67  ?  125 LYS D CG    1 
ATOM   4052  C CD    . LYS E 1 125 ? -0.596  -27.509 -121.232 1.00 52.13  ?  125 LYS D CD    1 
ATOM   4053  C CE    . LYS E 1 125 ? -2.101  -27.563 -121.433 1.00 48.54  ?  125 LYS D CE    1 
ATOM   4054  N NZ    . LYS E 1 125 ? -2.678  -28.873 -121.023 1.00 49.11  1  125 LYS D NZ    1 
ATOM   4055  N N     . GLU E 1 126 ? 3.875   -27.485 -117.033 1.00 39.25  ?  126 GLU D N     1 
ATOM   4056  C CA    . GLU E 1 126 ? 5.263   -27.848 -116.767 1.00 49.18  ?  126 GLU D CA    1 
ATOM   4057  C C     . GLU E 1 126 ? 5.368   -29.249 -116.169 1.00 57.23  ?  126 GLU D C     1 
ATOM   4058  O O     . GLU E 1 126 ? 6.444   -29.844 -116.144 1.00 67.30  ?  126 GLU D O     1 
ATOM   4059  C CB    . GLU E 1 126 ? 5.918   -26.830 -115.832 1.00 61.74  ?  126 GLU D CB    1 
ATOM   4060  C CG    . GLU E 1 126 ? 6.014   -25.428 -116.412 1.00 74.56  ?  126 GLU D CG    1 
ATOM   4061  C CD    . GLU E 1 126 ? 6.997   -24.555 -115.656 1.00 87.73  ?  126 GLU D CD    1 
ATOM   4062  O OE1   . GLU E 1 126 ? 7.941   -25.108 -115.051 1.00 66.92  ?  126 GLU D OE1   1 
ATOM   4063  O OE2   . GLU E 1 126 ? 6.827   -23.318 -115.668 1.00 96.84  -1 126 GLU D OE2   1 
ATOM   4064  N N     . HIS E 1 127 ? 4.242   -29.771 -115.692 1.00 62.51  ?  127 HIS D N     1 
ATOM   4065  C CA    . HIS E 1 127 ? 4.191   -31.118 -115.134 1.00 55.53  ?  127 HIS D CA    1 
ATOM   4066  C C     . HIS E 1 127 ? 4.336   -32.190 -116.208 1.00 64.09  ?  127 HIS D C     1 
ATOM   4067  O O     . HIS E 1 127 ? 4.495   -33.372 -115.898 1.00 57.80  ?  127 HIS D O     1 
ATOM   4068  C CB    . HIS E 1 127 ? 2.886   -31.322 -114.362 1.00 48.67  ?  127 HIS D CB    1 
ATOM   4069  C CG    . HIS E 1 127 ? 1.671   -31.403 -115.231 1.00 43.21  ?  127 HIS D CG    1 
ATOM   4070  N ND1   . HIS E 1 127 ? 1.231   -30.343 -115.993 1.00 46.21  ?  127 HIS D ND1   1 
ATOM   4071  C CD2   . HIS E 1 127 ? 0.792   -32.410 -115.443 1.00 43.69  ?  127 HIS D CD2   1 
ATOM   4072  C CE1   . HIS E 1 127 ? 0.139   -30.697 -116.647 1.00 38.49  ?  127 HIS D CE1   1 
ATOM   4073  N NE2   . HIS E 1 127 ? -0.149  -31.946 -116.330 1.00 39.48  ?  127 HIS D NE2   1 
ATOM   4074  N N     . LEU E 1 128 ? 4.268   -31.777 -117.470 1.00 63.45  ?  128 LEU D N     1 
ATOM   4075  C CA    . LEU E 1 128 ? 4.333   -32.713 -118.585 1.00 46.36  ?  128 LEU D CA    1 
ATOM   4076  C C     . LEU E 1 128 ? 5.786   -32.932 -118.996 1.00 59.16  ?  128 LEU D C     1 
ATOM   4077  O O     . LEU E 1 128 ? 6.069   -33.535 -120.032 1.00 73.60  ?  128 LEU D O     1 
ATOM   4078  C CB    . LEU E 1 128 ? 3.508   -32.212 -119.766 1.00 41.30  ?  128 LEU D CB    1 
ATOM   4079  C CG    . LEU E 1 128 ? 2.012   -32.086 -119.479 1.00 36.16  ?  128 LEU D CG    1 
ATOM   4080  C CD1   . LEU E 1 128 ? 1.263   -31.592 -120.704 1.00 53.38  ?  128 LEU D CD1   1 
ATOM   4081  C CD2   . LEU E 1 128 ? 1.454   -33.415 -119.004 1.00 47.05  ?  128 LEU D CD2   1 
ATOM   4082  N N     . THR E 1 129 ? 6.701   -32.425 -118.176 1.00 57.01  ?  129 THR D N     1 
ATOM   4083  C CA    . THR E 1 129 ? 8.131   -32.587 -118.397 1.00 56.79  ?  129 THR D CA    1 
ATOM   4084  C C     . THR E 1 129 ? 8.683   -33.442 -117.264 1.00 71.88  ?  129 THR D C     1 
ATOM   4085  O O     . THR E 1 129 ? 8.085   -33.499 -116.191 1.00 85.75  ?  129 THR D O     1 
ATOM   4086  C CB    . THR E 1 129 ? 8.857   -31.224 -118.434 1.00 67.31  ?  129 THR D CB    1 
ATOM   4087  O OG1   . THR E 1 129 ? 8.113   -30.304 -119.241 1.00 70.74  ?  129 THR D OG1   1 
ATOM   4088  C CG2   . THR E 1 129 ? 10.271  -31.365 -118.989 1.00 88.36  ?  129 THR D CG2   1 
ATOM   4089  N N     . GLU E 1 130 ? 9.809   -34.112 -117.493 1.00 59.67  ?  130 GLU D N     1 
ATOM   4090  C CA    . GLU E 1 130 ? 10.486  -34.822 -116.414 1.00 65.07  ?  130 GLU D CA    1 
ATOM   4091  C C     . GLU E 1 130 ? 10.886  -33.878 -115.284 1.00 75.74  ?  130 GLU D C     1 
ATOM   4092  O O     . GLU E 1 130 ? 10.766  -34.218 -114.104 1.00 90.04  ?  130 GLU D O     1 
ATOM   4093  C CB    . GLU E 1 130 ? 11.722  -35.549 -116.949 1.00 52.23  ?  130 GLU D CB    1 
ATOM   4094  N N     . GLU E 1 131 ? 11.341  -32.684 -115.654 1.00 73.63  ?  131 GLU D N     1 
ATOM   4095  C CA    . GLU E 1 131 ? 11.805  -31.704 -114.678 1.00 90.38  ?  131 GLU D CA    1 
ATOM   4096  C C     . GLU E 1 131 ? 10.679  -31.208 -113.780 1.00 86.42  ?  131 GLU D C     1 
ATOM   4097  O O     . GLU E 1 131 ? 10.797  -31.201 -112.545 1.00 94.30  ?  131 GLU D O     1 
ATOM   4098  C CB    . GLU E 1 131 ? 12.449  -30.518 -115.398 1.00 95.83  ?  131 GLU D CB    1 
ATOM   4099  C CG    . GLU E 1 131 ? 13.019  -29.458 -114.474 1.00 114.80 ?  131 GLU D CG    1 
ATOM   4100  C CD    . GLU E 1 131 ? 13.773  -28.380 -115.226 1.00 138.60 ?  131 GLU D CD    1 
ATOM   4101  O OE1   . GLU E 1 131 ? 13.588  -27.188 -114.903 1.00 143.51 ?  131 GLU D OE1   1 
ATOM   4102  O OE2   . GLU E 1 131 ? 14.555  -28.726 -116.136 1.00 158.21 -1 131 GLU D OE2   1 
ATOM   4103  N N     . GLY E 1 132 ? 9.576   -30.816 -114.410 1.00 78.65  ?  132 GLY D N     1 
ATOM   4104  C CA    . GLY E 1 132 ? 8.440   -30.298 -113.677 1.00 82.98  ?  132 GLY D CA    1 
ATOM   4105  C C     . GLY E 1 132 ? 7.830   -31.376 -112.814 1.00 77.32  ?  132 GLY D C     1 
ATOM   4106  O O     . GLY E 1 132 ? 7.412   -31.118 -111.685 1.00 68.55  ?  132 GLY D O     1 
ATOM   4107  N N     . LEU E 1 133 ? 7.784   -32.592 -113.349 1.00 74.46  ?  133 LEU D N     1 
ATOM   4108  C CA    . LEU E 1 133 ? 7.263   -33.722 -112.599 1.00 66.92  ?  133 LEU D CA    1 
ATOM   4109  C C     . LEU E 1 133 ? 8.093   -33.959 -111.347 1.00 60.54  ?  133 LEU D C     1 
ATOM   4110  O O     . LEU E 1 133 ? 7.554   -34.080 -110.245 1.00 71.64  ?  133 LEU D O     1 
ATOM   4111  C CB    . LEU E 1 133 ? 7.256   -34.982 -113.466 1.00 73.35  ?  133 LEU D CB    1 
ATOM   4112  C CG    . LEU E 1 133 ? 6.892   -36.296 -112.773 1.00 64.65  ?  133 LEU D CG    1 
ATOM   4113  C CD1   . LEU E 1 133 ? 5.530   -36.181 -112.127 1.00 70.96  ?  133 LEU D CD1   1 
ATOM   4114  C CD2   . LEU E 1 133 ? 6.926   -37.465 -113.742 1.00 68.53  ?  133 LEU D CD2   1 
ATOM   4115  N N     . ASN E 1 134 ? 9.413   -33.986 -111.519 1.00 66.20  ?  134 ASN D N     1 
ATOM   4116  C CA    . ASN E 1 134 ? 10.311  -34.164 -110.385 1.00 67.87  ?  134 ASN D CA    1 
ATOM   4117  C C     . ASN E 1 134 ? 10.139  -33.072 -109.336 1.00 71.25  ?  134 ASN D C     1 
ATOM   4118  O O     . ASN E 1 134 ? 10.163  -33.347 -108.128 1.00 79.97  ?  134 ASN D O     1 
ATOM   4119  C CB    . ASN E 1 134 ? 11.763  -34.208 -110.864 1.00 70.24  ?  134 ASN D CB    1 
ATOM   4120  C CG    . ASN E 1 134 ? 12.145  -35.558 -111.444 1.00 75.28  ?  134 ASN D CG    1 
ATOM   4121  O OD1   . ASN E 1 134 ? 12.602  -35.650 -112.584 1.00 83.23  ?  134 ASN D OD1   1 
ATOM   4122  N ND2   . ASN E 1 134 ? 11.955  -36.615 -110.663 1.00 79.64  ?  134 ASN D ND2   1 
ATOM   4123  N N     . GLN E 1 135 ? 9.912   -31.841 -109.792 1.00 60.24  ?  135 GLN D N     1 
ATOM   4124  C CA    . GLN E 1 135 ? 9.770   -30.737 -108.852 1.00 68.70  ?  135 GLN D CA    1 
ATOM   4125  C C     . GLN E 1 135 ? 8.470   -30.920 -108.078 1.00 67.02  ?  135 GLN D C     1 
ATOM   4126  O O     . GLN E 1 135 ? 8.406   -30.677 -106.863 1.00 54.85  ?  135 GLN D O     1 
ATOM   4127  C CB    . GLN E 1 135 ? 9.795   -29.389 -109.572 1.00 62.09  ?  135 GLN D CB    1 
ATOM   4128  C CG    . GLN E 1 135 ? 9.679   -28.196 -108.634 1.00 76.93  ?  135 GLN D CG    1 
ATOM   4129  C CD    . GLN E 1 135 ? 10.109  -26.896 -109.284 1.00 92.51  ?  135 GLN D CD    1 
ATOM   4130  O OE1   . GLN E 1 135 ? 10.156  -26.786 -110.509 1.00 96.18  ?  135 GLN D OE1   1 
ATOM   4131  N NE2   . GLN E 1 135 ? 10.430  -25.902 -108.462 1.00 86.11  ?  135 GLN D NE2   1 
ATOM   4132  N N     . ILE E 1 136 ? 7.437   -31.363 -108.792 1.00 65.58  ?  136 ILE D N     1 
ATOM   4133  C CA    . ILE E 1 136 ? 6.148   -31.624 -108.172 1.00 53.70  ?  136 ILE D CA    1 
ATOM   4134  C C     . ILE E 1 136 ? 6.327   -32.661 -107.079 1.00 53.23  ?  136 ILE D C     1 
ATOM   4135  O O     . ILE E 1 136 ? 5.775   -32.514 -105.998 1.00 66.71  ?  136 ILE D O     1 
ATOM   4136  C CB    . ILE E 1 136 ? 5.102   -32.093 -109.188 1.00 58.08  ?  136 ILE D CB    1 
ATOM   4137  C CG1   . ILE E 1 136 ? 4.685   -30.916 -110.065 1.00 53.95  ?  136 ILE D CG1   1 
ATOM   4138  C CG2   . ILE E 1 136 ? 3.874   -32.637 -108.482 1.00 49.82  ?  136 ILE D CG2   1 
ATOM   4139  C CD1   . ILE E 1 136 ? 3.528   -31.219 -110.962 1.00 50.01  ?  136 ILE D CD1   1 
ATOM   4140  N N     . LEU E 1 137 ? 7.091   -33.712 -107.362 1.00 47.78  ?  137 LEU D N     1 
ATOM   4141  C CA    . LEU E 1 137 ? 7.378   -34.710 -106.333 1.00 58.94  ?  137 LEU D CA    1 
ATOM   4142  C C     . LEU E 1 137 ? 8.119   -34.104 -105.149 1.00 62.82  ?  137 LEU D C     1 
ATOM   4143  O O     . LEU E 1 137 ? 7.897   -34.520 -104.011 1.00 69.26  ?  137 LEU D O     1 
ATOM   4144  C CB    . LEU E 1 137 ? 8.140   -35.914 -106.881 1.00 60.73  ?  137 LEU D CB    1 
ATOM   4145  C CG    . LEU E 1 137 ? 7.247   -36.981 -107.524 1.00 65.43  ?  137 LEU D CG    1 
ATOM   4146  C CD1   . LEU E 1 137 ? 6.518   -36.524 -108.768 1.00 66.02  ?  137 LEU D CD1   1 
ATOM   4147  C CD2   . LEU E 1 137 ? 8.053   -38.223 -107.796 1.00 67.98  ?  137 LEU D CD2   1 
ATOM   4148  N N     . THR E 1 138 ? 9.003   -33.140 -105.401 1.00 57.08  ?  138 THR D N     1 
ATOM   4149  C CA    . THR E 1 138 ? 9.658   -32.479 -104.276 1.00 65.90  ?  138 THR D CA    1 
ATOM   4150  C C     . THR E 1 138 ? 8.609   -31.759 -103.428 1.00 68.00  ?  138 THR D C     1 
ATOM   4151  O O     . THR E 1 138 ? 8.737   -31.698 -102.205 1.00 65.15  ?  138 THR D O     1 
ATOM   4152  C CB    . THR E 1 138 ? 10.736  -31.468 -104.725 1.00 65.90  ?  138 THR D CB    1 
ATOM   4153  O OG1   . THR E 1 138 ? 10.108  -30.326 -105.321 1.00 59.92  ?  138 THR D OG1   1 
ATOM   4154  C CG2   . THR E 1 138 ? 11.682  -32.098 -105.730 1.00 84.37  ?  138 THR D CG2   1 
ATOM   4155  N N     . LEU E 1 139 ? 7.576   -31.218 -104.070 1.00 56.11  ?  139 LEU D N     1 
ATOM   4156  C CA    . LEU E 1 139 ? 6.498   -30.556 -103.331 1.00 55.18  ?  139 LEU D CA    1 
ATOM   4157  C C     . LEU E 1 139 ? 5.633   -31.551 -102.541 1.00 64.12  ?  139 LEU D C     1 
ATOM   4158  O O     . LEU E 1 139 ? 5.340   -31.339 -101.363 1.00 72.11  ?  139 LEU D O     1 
ATOM   4159  C CB    . LEU E 1 139 ? 5.615   -29.737 -104.272 1.00 43.56  ?  139 LEU D CB    1 
ATOM   4160  C CG    . LEU E 1 139 ? 6.309   -28.608 -105.033 1.00 56.43  ?  139 LEU D CG    1 
ATOM   4161  C CD1   . LEU E 1 139 ? 5.382   -28.013 -106.076 1.00 47.09  ?  139 LEU D CD1   1 
ATOM   4162  C CD2   . LEU E 1 139 ? 6.778   -27.537 -104.063 1.00 45.39  ?  139 LEU D CD2   1 
ATOM   4163  N N     . LYS E 1 140 ? 5.229   -32.630 -103.209 1.00 50.41  ?  140 LYS D N     1 
ATOM   4164  C CA    . LYS E 1 140 ? 4.406   -33.691 -102.630 1.00 49.42  ?  140 LYS D CA    1 
ATOM   4165  C C     . LYS E 1 140 ? 5.091   -34.373 -101.452 1.00 65.65  ?  140 LYS D C     1 
ATOM   4166  O O     . LYS E 1 140 ? 4.430   -34.818 -100.512 1.00 72.42  ?  140 LYS D O     1 
ATOM   4167  C CB    . LYS E 1 140 ? 4.044   -34.728 -103.698 1.00 48.22  ?  140 LYS D CB    1 
ATOM   4168  C CG    . LYS E 1 140 ? 3.085   -35.811 -103.216 1.00 51.45  ?  140 LYS D CG    1 
ATOM   4169  C CD    . LYS E 1 140 ? 2.661   -36.727 -104.353 1.00 48.32  ?  140 LYS D CD    1 
ATOM   4170  C CE    . LYS E 1 140 ? 2.020   -38.005 -103.832 1.00 46.92  ?  140 LYS D CE    1 
ATOM   4171  N NZ    . LYS E 1 140 ? 0.785   -37.732 -103.047 1.00 44.95  1  140 LYS D NZ    1 
ATOM   4172  N N     . ALA E 1 141 ? 6.415   -34.473 -101.519 1.00 65.97  ?  141 ALA D N     1 
ATOM   4173  C CA    . ALA E 1 141 ? 7.190   -35.146 -100.482 1.00 65.10  ?  141 ALA D CA    1 
ATOM   4174  C C     . ALA E 1 141 ? 6.983   -34.466 -99.133  1.00 57.30  ?  141 ALA D C     1 
ATOM   4175  O O     . ALA E 1 141 ? 7.062   -35.108 -98.087  1.00 69.61  ?  141 ALA D O     1 
ATOM   4176  C CB    . ALA E 1 141 ? 8.662   -35.166 -100.848 1.00 69.33  ?  141 ALA D CB    1 
ATOM   4177  N N     . SER E 1 142 ? 6.726   -33.163 -99.168  1.00 67.98  ?  142 SER D N     1 
ATOM   4178  C CA    . SER E 1 142 ? 6.562   -32.373 -97.953  1.00 65.14  ?  142 SER D CA    1 
ATOM   4179  C C     . SER E 1 142 ? 5.082   -32.103 -97.680  1.00 69.43  ?  142 SER D C     1 
ATOM   4180  O O     . SER E 1 142 ? 4.728   -31.490 -96.673  1.00 78.47  ?  142 SER D O     1 
ATOM   4181  C CB    . SER E 1 142 ? 7.333   -31.055 -98.058  1.00 66.50  ?  142 SER D CB    1 
ATOM   4182  O OG    . SER E 1 142 ? 8.721   -31.289 -98.217  1.00 82.30  ?  142 SER D OG    1 
ATOM   4183  N N     . LEU E 1 143 ? 4.223   -32.571 -98.581  1.00 72.20  ?  143 LEU D N     1 
ATOM   4184  C CA    . LEU E 1 143 ? 2.784   -32.346 -98.473  1.00 59.72  ?  143 LEU D CA    1 
ATOM   4185  C C     . LEU E 1 143 ? 2.110   -33.500 -97.742  1.00 67.72  ?  143 LEU D C     1 
ATOM   4186  O O     . LEU E 1 143 ? 2.222   -34.651 -98.167  1.00 65.26  ?  143 LEU D O     1 
ATOM   4187  C CB    . LEU E 1 143 ? 2.162   -32.179 -99.860  1.00 46.13  ?  143 LEU D CB    1 
ATOM   4188  C CG    . LEU E 1 143 ? 0.642   -32.024 -99.926  1.00 40.70  ?  143 LEU D CG    1 
ATOM   4189  C CD1   . LEU E 1 143 ? 0.216   -30.700 -99.334  1.00 32.45  ?  143 LEU D CD1   1 
ATOM   4190  C CD2   . LEU E 1 143 ? 0.144   -32.156 -101.355 1.00 64.96  ?  143 LEU D CD2   1 
ATOM   4191  N N     . ASN E 1 144 ? 1.383   -33.175 -96.673  1.00 64.76  ?  144 ASN D N     1 
ATOM   4192  C CA    . ASN E 1 144 ? 0.695   -34.176 -95.858  1.00 50.82  ?  144 ASN D CA    1 
ATOM   4193  C C     . ASN E 1 144 ? 1.610   -35.348 -95.518  1.00 54.13  ?  144 ASN D C     1 
ATOM   4194  O O     . ASN E 1 144 ? 2.622   -35.177 -94.842  1.00 66.01  ?  144 ASN D O     1 
ATOM   4195  C CB    . ASN E 1 144 ? -0.569  -34.677 -96.562  1.00 45.71  ?  144 ASN D CB    1 
ATOM   4196  C CG    . ASN E 1 144 ? -1.514  -33.551 -96.935  1.00 53.06  ?  144 ASN D CG    1 
ATOM   4197  O OD1   . ASN E 1 144 ? -1.517  -32.490 -96.310  1.00 40.26  ?  144 ASN D OD1   1 
ATOM   4198  N ND2   . ASN E 1 144 ? -2.330  -33.780 -97.956  1.00 68.19  ?  144 ASN D ND2   1 
ATOM   4199  N N     . LEU E 1 145 ? 1.246   -36.536 -95.984  1.00 47.96  ?  145 LEU D N     1 
ATOM   4200  C CA    . LEU E 1 145 ? 1.938   -37.757 -95.590  1.00 53.57  ?  145 LEU D CA    1 
ATOM   4201  C C     . LEU E 1 145 ? 3.177   -37.999 -96.451  1.00 51.73  ?  145 LEU D C     1 
ATOM   4202  O O     . LEU E 1 145 ? 3.908   -38.966 -96.237  1.00 54.68  ?  145 LEU D O     1 
ATOM   4203  C CB    . LEU E 1 145 ? 0.999   -38.961 -95.666  1.00 53.33  ?  145 LEU D CB    1 
ATOM   4204  C CG    . LEU E 1 145 ? -0.203  -38.921 -94.720  1.00 51.17  ?  145 LEU D CG    1 
ATOM   4205  C CD1   . LEU E 1 145 ? -0.926  -40.259 -94.714  1.00 47.53  ?  145 LEU D CD1   1 
ATOM   4206  C CD2   . LEU E 1 145 ? 0.234   -38.532 -93.319  1.00 41.35  ?  145 LEU D CD2   1 
ATOM   4207  N N     . GLY E 1 146 ? 3.410   -37.123 -97.424  1.00 53.43  ?  146 GLY D N     1 
ATOM   4208  C CA    . GLY E 1 146 ? 4.606   -37.223 -98.242  1.00 78.08  ?  146 GLY D CA    1 
ATOM   4209  C C     . GLY E 1 146 ? 4.520   -38.321 -99.284  1.00 75.23  ?  146 GLY D C     1 
ATOM   4210  O O     . GLY E 1 146 ? 3.426   -38.754 -99.650  1.00 72.58  ?  146 GLY D O     1 
ATOM   4211  N N     . LEU E 1 147 ? 5.674   -38.766 -99.772  1.00 63.35  ?  147 LEU D N     1 
ATOM   4212  C CA    . LEU E 1 147 ? 5.710   -39.731 -100.862 1.00 65.52  ?  147 LEU D CA    1 
ATOM   4213  C C     . LEU E 1 147 ? 5.540   -41.129 -100.293 1.00 56.02  ?  147 LEU D C     1 
ATOM   4214  O O     . LEU E 1 147 ? 6.135   -41.472 -99.272  1.00 64.45  ?  147 LEU D O     1 
ATOM   4215  C CB    . LEU E 1 147 ? 7.024   -39.632 -101.640 1.00 64.21  ?  147 LEU D CB    1 
ATOM   4216  C CG    . LEU E 1 147 ? 7.364   -38.300 -102.308 1.00 55.87  ?  147 LEU D CG    1 
ATOM   4217  C CD1   . LEU E 1 147 ? 8.468   -38.490 -103.331 1.00 58.89  ?  147 LEU D CD1   1 
ATOM   4218  C CD2   . LEU E 1 147 ? 6.134   -37.698 -102.961 1.00 61.39  ?  147 LEU D CD2   1 
ATOM   4219  N N     . SER E 1 148 ? 4.720   -41.932 -100.962 1.00 61.84  ?  148 SER D N     1 
ATOM   4220  C CA    . SER E 1 148 ? 4.608   -43.351 -100.653 1.00 66.27  ?  148 SER D CA    1 
ATOM   4221  C C     . SER E 1 148 ? 5.879   -44.130 -100.971 1.00 76.82  ?  148 SER D C     1 
ATOM   4222  O O     . SER E 1 148 ? 6.756   -43.650 -101.690 1.00 81.25  ?  148 SER D O     1 
ATOM   4223  C CB    . SER E 1 148 ? 3.427   -43.960 -101.411 1.00 69.97  ?  148 SER D CB    1 
ATOM   4224  O OG    . SER E 1 148 ? 3.649   -43.924 -102.810 1.00 80.69  ?  148 SER D OG    1 
ATOM   4225  N N     . GLU E 1 149 ? 5.963   -45.335 -100.416 1.00 83.62  ?  149 GLU D N     1 
ATOM   4226  C CA    . GLU E 1 149 ? 7.061   -46.255 -100.687 1.00 83.16  ?  149 GLU D CA    1 
ATOM   4227  C C     . GLU E 1 149 ? 7.198   -46.541 -102.178 1.00 83.63  ?  149 GLU D C     1 
ATOM   4228  O O     . GLU E 1 149 ? 8.304   -46.581 -102.710 1.00 71.02  ?  149 GLU D O     1 
ATOM   4229  C CB    . GLU E 1 149 ? 6.861   -47.564 -99.920  1.00 52.47  ?  149 GLU D CB    1 
ATOM   4230  N N     . GLU E 1 150 ? 6.065   -46.757 -102.837 1.00 87.97  ?  150 GLU D N     1 
ATOM   4231  C CA    . GLU E 1 150 ? 6.032   -47.017 -104.272 1.00 84.20  ?  150 GLU D CA    1 
ATOM   4232  C C     . GLU E 1 150 ? 6.639   -45.869 -105.080 1.00 87.72  ?  150 GLU D C     1 
ATOM   4233  O O     . GLU E 1 150 ? 7.434   -46.090 -106.000 1.00 95.59  ?  150 GLU D O     1 
ATOM   4234  C CB    . GLU E 1 150 ? 4.589   -47.260 -104.724 1.00 80.12  ?  150 GLU D CB    1 
ATOM   4235  C CG    . GLU E 1 150 ? 3.954   -48.526 -104.158 1.00 93.70  ?  150 GLU D CG    1 
ATOM   4236  C CD    . GLU E 1 150 ? 4.492   -49.802 -104.780 1.00 118.16 ?  150 GLU D CD    1 
ATOM   4237  O OE1   . GLU E 1 150 ? 5.321   -49.721 -105.710 1.00 115.09 ?  150 GLU D OE1   1 
ATOM   4238  O OE2   . GLU E 1 150 ? 4.081   -50.893 -104.332 1.00 118.19 -1 150 GLU D OE2   1 
ATOM   4239  N N     . LEU E 1 151 ? 6.276   -44.643 -104.715 1.00 82.97  ?  151 LEU D N     1 
ATOM   4240  C CA    . LEU E 1 151 ? 6.788   -43.461 -105.398 1.00 77.24  ?  151 LEU D CA    1 
ATOM   4241  C C     . LEU E 1 151 ? 8.263   -43.231 -105.092 1.00 79.09  ?  151 LEU D C     1 
ATOM   4242  O O     . LEU E 1 151 ? 9.022   -42.803 -105.962 1.00 86.34  ?  151 LEU D O     1 
ATOM   4243  C CB    . LEU E 1 151 ? 5.973   -42.225 -105.008 1.00 75.90  ?  151 LEU D CB    1 
ATOM   4244  C CG    . LEU E 1 151 ? 4.636   -42.046 -105.732 1.00 77.13  ?  151 LEU D CG    1 
ATOM   4245  C CD1   . LEU E 1 151 ? 3.979   -40.735 -105.335 1.00 79.17  ?  151 LEU D CD1   1 
ATOM   4246  C CD2   . LEU E 1 151 ? 4.828   -42.117 -107.237 1.00 74.61  ?  151 LEU D CD2   1 
ATOM   4247  N N     . LYS E 1 152 ? 8.662   -43.507 -103.854 1.00 73.99  ?  152 LYS D N     1 
ATOM   4248  C CA    . LYS E 1 152 ? 10.070  -43.454 -103.479 1.00 75.43  ?  152 LYS D CA    1 
ATOM   4249  C C     . LYS E 1 152 ? 10.880  -44.433 -104.324 1.00 79.26  ?  152 LYS D C     1 
ATOM   4250  O O     . LYS E 1 152 ? 11.975  -44.116 -104.789 1.00 84.65  ?  152 LYS D O     1 
ATOM   4251  C CB    . LYS E 1 152 ? 10.246  -43.762 -101.991 1.00 83.77  ?  152 LYS D CB    1 
ATOM   4252  N N     . GLU E 1 153 ? 10.325  -45.625 -104.514 1.00 68.83  ?  153 GLU D N     1 
ATOM   4253  C CA    . GLU E 1 153 ? 10.959  -46.661 -105.315 1.00 73.17  ?  153 GLU D CA    1 
ATOM   4254  C C     . GLU E 1 153 ? 11.066  -46.227 -106.771 1.00 83.98  ?  153 GLU D C     1 
ATOM   4255  O O     . GLU E 1 153 ? 12.068  -46.493 -107.434 1.00 90.77  ?  153 GLU D O     1 
ATOM   4256  C CB    . GLU E 1 153 ? 10.182  -47.975 -105.211 1.00 68.48  ?  153 GLU D CB    1 
ATOM   4257  N N     . ALA E 1 154 ? 10.031  -45.554 -107.264 1.00 78.80  ?  154 ALA D N     1 
ATOM   4258  C CA    . ALA E 1 154 ? 10.004  -45.143 -108.662 1.00 74.20  ?  154 ALA D CA    1 
ATOM   4259  C C     . ALA E 1 154 ? 10.832  -43.880 -108.908 1.00 82.38  ?  154 ALA D C     1 
ATOM   4260  O O     . ALA E 1 154 ? 11.339  -43.668 -110.010 1.00 99.20  ?  154 ALA D O     1 
ATOM   4261  C CB    . ALA E 1 154 ? 8.569   -44.929 -109.117 1.00 76.73  ?  154 ALA D CB    1 
ATOM   4262  N N     . PHE E 1 155 ? 10.964  -43.045 -107.881 1.00 78.93  ?  155 PHE D N     1 
ATOM   4263  C CA    . PHE E 1 155 ? 11.708  -41.789 -107.995 1.00 87.53  ?  155 PHE D CA    1 
ATOM   4264  C C     . PHE E 1 155 ? 12.719  -41.549 -106.877 1.00 91.93  ?  155 PHE D C     1 
ATOM   4265  O O     . PHE E 1 155 ? 12.570  -40.604 -106.103 1.00 97.74  ?  155 PHE D O     1 
ATOM   4266  C CB    . PHE E 1 155 ? 10.751  -40.600 -108.055 1.00 83.35  ?  155 PHE D CB    1 
ATOM   4267  C CG    . PHE E 1 155 ? 9.796   -40.642 -109.209 1.00 79.35  ?  155 PHE D CG    1 
ATOM   4268  C CD1   . PHE E 1 155 ? 10.080  -39.953 -110.375 1.00 74.22  ?  155 PHE D CD1   1 
ATOM   4269  C CD2   . PHE E 1 155 ? 8.610   -41.349 -109.125 1.00 77.55  ?  155 PHE D CD2   1 
ATOM   4270  C CE1   . PHE E 1 155 ? 9.206   -39.975 -111.438 1.00 73.72  ?  155 PHE D CE1   1 
ATOM   4271  C CE2   . PHE E 1 155 ? 7.732   -41.374 -110.186 1.00 77.18  ?  155 PHE D CE2   1 
ATOM   4272  C CZ    . PHE E 1 155 ? 8.031   -40.685 -111.343 1.00 74.14  ?  155 PHE D CZ    1 
ATOM   4273  N N     . PRO E 1 156 ? 13.742  -42.408 -106.778 1.00 96.61  ?  156 PRO D N     1 
ATOM   4274  C CA    . PRO E 1 156 ? 14.687  -42.320 -105.659 1.00 94.75  ?  156 PRO D CA    1 
ATOM   4275  C C     . PRO E 1 156 ? 15.467  -40.998 -105.621 1.00 103.67 ?  156 PRO D C     1 
ATOM   4276  O O     . PRO E 1 156 ? 15.380  -40.195 -106.551 1.00 101.17 ?  156 PRO D O     1 
ATOM   4277  C CB    . PRO E 1 156 ? 15.622  -43.505 -105.900 1.00 107.54 ?  156 PRO D CB    1 
ATOM   4278  C CG    . PRO E 1 156 ? 15.596  -43.715 -107.374 1.00 125.79 ?  156 PRO D CG    1 
ATOM   4279  C CD    . PRO E 1 156 ? 14.251  -43.252 -107.873 1.00 104.99 ?  156 PRO D CD    1 
ATOM   4280  N N     . ASN E 1 157 ? 16.227  -40.801 -104.546 1.00 102.90 ?  157 ASN D N     1 
ATOM   4281  C CA    . ASN E 1 157 ? 17.010  -39.586 -104.308 1.00 106.57 ?  157 ASN D CA    1 
ATOM   4282  C C     . ASN E 1 157 ? 16.215  -38.281 -104.412 1.00 103.72 ?  157 ASN D C     1 
ATOM   4283  O O     . ASN E 1 157 ? 16.782  -37.217 -104.663 1.00 99.36  ?  157 ASN D O     1 
ATOM   4284  C CB    . ASN E 1 157 ? 18.197  -39.531 -105.273 1.00 106.55 ?  157 ASN D CB    1 
ATOM   4285  N N     . THR E 1 158 ? 14.904  -38.374 -104.217 1.00 98.65  ?  158 THR D N     1 
ATOM   4286  C CA    . THR E 1 158 ? 14.017  -37.218 -104.274 1.00 95.19  ?  158 THR D CA    1 
ATOM   4287  C C     . THR E 1 158 ? 14.251  -36.374 -103.027 1.00 95.66  ?  158 THR D C     1 
ATOM   4288  O O     . THR E 1 158 ? 14.085  -36.867 -101.912 1.00 92.60  ?  158 THR D O     1 
ATOM   4289  C CB    . THR E 1 158 ? 12.538  -37.622 -104.375 1.00 84.93  ?  158 THR D CB    1 
ATOM   4290  O OG1   . THR E 1 158 ? 12.332  -38.381 -105.573 1.00 88.08  ?  158 THR D OG1   1 
ATOM   4291  C CG2   . THR E 1 158 ? 11.652  -36.386 -104.412 1.00 79.10  ?  158 THR D CG2   1 
ATOM   4292  N N     . ILE E 1 159 ? 14.636  -35.114 -103.195 1.00 92.24  ?  159 ILE D N     1 
ATOM   4293  C CA    . ILE E 1 159 ? 14.753  -34.247 -102.028 1.00 94.07  ?  159 ILE D CA    1 
ATOM   4294  C C     . ILE E 1 159 ? 13.550  -33.332 -101.836 1.00 84.72  ?  159 ILE D C     1 
ATOM   4295  O O     . ILE E 1 159 ? 13.244  -32.504 -102.695 1.00 68.61  ?  159 ILE D O     1 
ATOM   4296  C CB    . ILE E 1 159 ? 16.013  -33.365 -102.123 1.00 97.32  ?  159 ILE D CB    1 
ATOM   4297  C CG1   . ILE E 1 159 ? 17.265  -34.232 -102.257 1.00 88.81  ?  159 ILE D CG1   1 
ATOM   4298  C CG2   . ILE E 1 159 ? 16.108  -32.439 -100.919 1.00 101.82 ?  159 ILE D CG2   1 
ATOM   4299  C CD1   . ILE E 1 159 ? 17.677  -34.898 -100.970 1.00 93.18  ?  159 ILE D CD1   1 
ATOM   4300  N N     . PRO E 1 160 ? 12.867  -33.489 -100.687 1.00 76.93  ?  160 PRO D N     1 
ATOM   4301  C CA    . PRO E 1 160 ? 11.617  -32.807 -100.332 1.00 64.77  ?  160 PRO D CA    1 
ATOM   4302  C C     . PRO E 1 160 ? 11.756  -31.290 -100.283 1.00 62.60  ?  160 PRO D C     1 
ATOM   4303  O O     . PRO E 1 160 ? 12.729  -30.789 -99.717  1.00 61.08  ?  160 PRO D O     1 
ATOM   4304  C CB    . PRO E 1 160 ? 11.298  -33.366 -98.939  1.00 63.18  ?  160 PRO D CB    1 
ATOM   4305  C CG    . PRO E 1 160 ? 12.024  -34.665 -98.878  1.00 64.67  ?  160 PRO D CG    1 
ATOM   4306  C CD    . PRO E 1 160 ? 13.292  -34.418 -99.628  1.00 73.99  ?  160 PRO D CD    1 
ATOM   4307  N N     . ALA E 1 161 ? 10.799  -30.574 -100.865 1.00 65.52  ?  161 ALA D N     1 
ATOM   4308  C CA    . ALA E 1 161 ? 10.831  -29.117 -100.872 1.00 65.83  ?  161 ALA D CA    1 
ATOM   4309  C C     . ALA E 1 161 ? 10.827  -28.581 -99.445  1.00 82.20  ?  161 ALA D C     1 
ATOM   4310  O O     . ALA E 1 161 ? 10.351  -29.251 -98.529  1.00 83.43  ?  161 ALA D O     1 
ATOM   4311  C CB    . ALA E 1 161 ? 9.654   -28.559 -101.653 1.00 65.17  ?  161 ALA D CB    1 
ATOM   4312  N N     . GLU E 1 162 ? 11.362  -27.380 -99.258  1.00 95.20  ?  162 GLU D N     1 
ATOM   4313  C CA    . GLU E 1 162 ? 11.395  -26.769 -97.935  1.00 91.76  ?  162 GLU D CA    1 
ATOM   4314  C C     . GLU E 1 162 ? 9.967   -26.493 -97.484  1.00 93.24  ?  162 GLU D C     1 
ATOM   4315  O O     . GLU E 1 162 ? 9.149   -26.015 -98.269  1.00 88.15  ?  162 GLU D O     1 
ATOM   4316  C CB    . GLU E 1 162 ? 12.217  -25.479 -97.945  1.00 93.55  ?  162 GLU D CB    1 
ATOM   4317  N N     . ARG E 1 163 ? 9.662   -26.790 -96.225  1.00 101.80 ?  163 ARG D N     1 
ATOM   4318  C CA    . ARG E 1 163 ? 8.315   -26.560 -95.724  1.00 94.34  ?  163 ARG D CA    1 
ATOM   4319  C C     . ARG E 1 163 ? 8.304   -25.402 -94.739  1.00 100.57 ?  163 ARG D C     1 
ATOM   4320  O O     . ARG E 1 163 ? 9.074   -25.380 -93.778  1.00 90.34  ?  163 ARG D O     1 
ATOM   4321  C CB    . ARG E 1 163 ? 7.784   -27.832 -95.055  1.00 72.84  ?  163 ARG D CB    1 
ATOM   4322  C CG    . ARG E 1 163 ? 6.365   -27.748 -94.516  1.00 68.63  ?  163 ARG D CG    1 
ATOM   4323  C CD    . ARG E 1 163 ? 5.881   -29.128 -94.081  1.00 70.91  ?  163 ARG D CD    1 
ATOM   4324  N NE    . ARG E 1 163 ? 4.627   -29.077 -93.333  1.00 74.63  ?  163 ARG D NE    1 
ATOM   4325  C CZ    . ARG E 1 163 ? 3.424   -29.242 -93.874  1.00 81.69  ?  163 ARG D CZ    1 
ATOM   4326  N NH1   . ARG E 1 163 ? 3.304   -29.473 -95.175  1.00 82.33  1  163 ARG D NH1   1 
ATOM   4327  N NH2   . ARG E 1 163 ? 2.340   -29.180 -93.113  1.00 74.29  ?  163 ARG D NH2   1 
ATOM   4328  N N     . LEU E 1 164 ? 7.423   -24.438 -94.991  1.00 103.48 ?  164 LEU D N     1 
ATOM   4329  C CA    . LEU E 1 164 ? 7.255   -23.296 -94.101  1.00 99.42  ?  164 LEU D CA    1 
ATOM   4330  C C     . LEU E 1 164 ? 6.813   -23.718 -92.708  1.00 95.82  ?  164 LEU D C     1 
ATOM   4331  O O     . LEU E 1 164 ? 5.791   -24.387 -92.555  1.00 88.49  ?  164 LEU D O     1 
ATOM   4332  C CB    . LEU E 1 164 ? 6.244   -22.306 -94.685  1.00 89.20  ?  164 LEU D CB    1 
ATOM   4333  C CG    . LEU E 1 164 ? 5.784   -21.193 -93.739  1.00 79.58  ?  164 LEU D CG    1 
ATOM   4334  C CD1   . LEU E 1 164 ? 6.951   -20.293 -93.352  1.00 90.03  ?  164 LEU D CD1   1 
ATOM   4335  C CD2   . LEU E 1 164 ? 4.660   -20.379 -94.358  1.00 64.66  ?  164 LEU D CD2   1 
ATOM   4336  N N     . LEU E 1 165 ? 7.574   -23.329 -91.692  1.00 104.33 ?  165 LEU D N     1 
ATOM   4337  C CA    . LEU E 1 165 ? 7.084   -23.450 -90.330  1.00 95.67  ?  165 LEU D CA    1 
ATOM   4338  C C     . LEU E 1 165 ? 6.212   -22.228 -90.052  1.00 98.03  ?  165 LEU D C     1 
ATOM   4339  O O     . LEU E 1 165 ? 6.690   -21.095 -90.081  1.00 97.63  ?  165 LEU D O     1 
ATOM   4340  C CB    . LEU E 1 165 ? 8.236   -23.578 -89.326  1.00 84.87  ?  165 LEU D CB    1 
ATOM   4341  C CG    . LEU E 1 165 ? 9.370   -22.550 -89.310  1.00 108.90 ?  165 LEU D CG    1 
ATOM   4342  C CD1   . LEU E 1 165 ? 9.218   -21.589 -88.140  1.00 107.15 ?  165 LEU D CD1   1 
ATOM   4343  C CD2   . LEU E 1 165 ? 10.722  -23.248 -89.259  1.00 88.92  ?  165 LEU D CD2   1 
ATOM   4344  N N     . VAL E 1 166 ? 4.926   -22.454 -89.807  1.00 100.11 ?  166 VAL D N     1 
ATOM   4345  C CA    . VAL E 1 166 ? 3.991   -21.345 -89.658  1.00 98.68  ?  166 VAL D CA    1 
ATOM   4346  C C     . VAL E 1 166 ? 4.033   -20.843 -88.217  1.00 110.37 ?  166 VAL D C     1 
ATOM   4347  O O     . VAL E 1 166 ? 3.810   -21.603 -87.274  1.00 99.27  ?  166 VAL D O     1 
ATOM   4348  C CB    . VAL E 1 166 ? 2.553   -21.744 -90.063  1.00 87.80  ?  166 VAL D CB    1 
ATOM   4349  C CG1   . VAL E 1 166 ? 2.127   -23.029 -89.372  1.00 92.32  ?  166 VAL D CG1   1 
ATOM   4350  C CG2   . VAL E 1 166 ? 1.580   -20.606 -89.780  1.00 80.46  ?  166 VAL D CG2   1 
ATOM   4351  N N     . THR E 1 167 ? 4.344   -19.562 -88.046  1.00 108.79 ?  167 THR D N     1 
ATOM   4352  C CA    . THR E 1 167 ? 4.541   -19.016 -86.710  1.00 99.69  ?  167 THR D CA    1 
ATOM   4353  C C     . THR E 1 167 ? 4.131   -17.545 -86.641  1.00 101.74 ?  167 THR D C     1 
ATOM   4354  O O     . THR E 1 167 ? 4.107   -16.846 -87.655  1.00 99.85  ?  167 THR D O     1 
ATOM   4355  C CB    . THR E 1 167 ? 6.021   -19.162 -86.266  1.00 91.60  ?  167 THR D CB    1 
ATOM   4356  O OG1   . THR E 1 167 ? 6.525   -20.441 -86.671  1.00 63.83  ?  167 THR D OG1   1 
ATOM   4357  C CG2   . THR E 1 167 ? 6.165   -19.023 -84.754  1.00 109.60 ?  167 THR D CG2   1 
ATOM   4358  N N     . GLY E 1 168 ? 3.807   -17.093 -85.433  1.00 89.83  ?  168 GLY D N     1 
ATOM   4359  C CA    . GLY E 1 168 ? 3.460   -15.709 -85.166  1.00 83.65  ?  168 GLY D CA    1 
ATOM   4360  C C     . GLY E 1 168 ? 2.193   -15.273 -85.870  1.00 95.08  ?  168 GLY D C     1 
ATOM   4361  O O     . GLY E 1 168 ? 2.058   -14.120 -86.278  1.00 110.73 ?  168 GLY D O     1 
ATOM   4362  N N     . GLN E 1 169 ? 1.262   -16.207 -86.020  1.00 95.78  ?  169 GLN D N     1 
ATOM   4363  C CA    . GLN E 1 169 ? 0.038   -15.945 -86.760  1.00 100.58 ?  169 GLN D CA    1 
ATOM   4364  C C     . GLN E 1 169 ? -1.054  -15.455 -85.808  1.00 95.41  ?  169 GLN D C     1 
ATOM   4365  O O     . GLN E 1 169 ? -1.317  -16.081 -84.781  1.00 74.12  ?  169 GLN D O     1 
ATOM   4366  C CB    . GLN E 1 169 ? -0.400  -17.197 -87.509  1.00 97.96  ?  169 GLN D CB    1 
ATOM   4367  N N     . GLU E 1 170 ? -1.690  -14.341 -86.155  1.00 107.39 ?  170 GLU D N     1 
ATOM   4368  C CA    . GLU E 1 170 ? -2.791  -13.794 -85.362  1.00 90.63  ?  170 GLU D CA    1 
ATOM   4369  C C     . GLU E 1 170 ? -4.156  -14.357 -85.745  1.00 77.88  ?  170 GLU D C     1 
ATOM   4370  O O     . GLU E 1 170 ? -4.387  -14.713 -86.900  1.00 82.42  ?  170 GLU D O     1 
ATOM   4371  C CB    . GLU E 1 170 ? -2.818  -12.268 -85.486  1.00 100.66 ?  170 GLU D CB    1 
ATOM   4372  N N     . ILE E 1 171 ? -5.053  -14.449 -84.767  1.00 76.14  ?  171 ILE D N     1 
ATOM   4373  C CA    . ILE E 1 171 ? -6.449  -14.768 -85.050  1.00 76.02  ?  171 ILE D CA    1 
ATOM   4374  C C     . ILE E 1 171 ? -7.077  -13.654 -85.877  1.00 75.52  ?  171 ILE D C     1 
ATOM   4375  O O     . ILE E 1 171 ? -7.230  -12.532 -85.394  1.00 72.57  ?  171 ILE D O     1 
ATOM   4376  C CB    . ILE E 1 171 ? -7.267  -14.957 -83.762  1.00 66.49  ?  171 ILE D CB    1 
ATOM   4377  C CG1   . ILE E 1 171 ? -6.561  -15.919 -82.804  1.00 72.37  ?  171 ILE D CG1   1 
ATOM   4378  C CG2   . ILE E 1 171 ? -8.637  -15.503 -84.094  1.00 52.94  ?  171 ILE D CG2   1 
ATOM   4379  C CD1   . ILE E 1 171 ? -6.113  -17.215 -83.446  1.00 74.72  ?  171 ILE D CD1   1 
ATOM   4380  N N     . PRO E 1 172 ? -7.444  -13.959 -87.129  1.00 71.86  ?  172 PRO D N     1 
ATOM   4381  C CA    . PRO E 1 172 ? -7.889  -12.911 -88.054  1.00 70.48  ?  172 PRO D CA    1 
ATOM   4382  C C     . PRO E 1 172 ? -9.298  -12.383 -87.786  1.00 70.05  ?  172 PRO D C     1 
ATOM   4383  O O     . PRO E 1 172 ? -9.593  -11.243 -88.147  1.00 78.65  ?  172 PRO D O     1 
ATOM   4384  C CB    . PRO E 1 172 ? -7.842  -13.614 -89.411  1.00 86.64  ?  172 PRO D CB    1 
ATOM   4385  C CG    . PRO E 1 172 ? -8.081  -15.052 -89.085  1.00 82.59  ?  172 PRO D CG    1 
ATOM   4386  C CD    . PRO E 1 172 ? -7.429  -15.292 -87.757  1.00 64.87  ?  172 PRO D CD    1 
ATOM   4387  N N     . ASP E 1 173 ? -10.139 -13.188 -87.143  1.00 63.98  ?  173 ASP D N     1 
ATOM   4388  C CA    . ASP E 1 173 ? -11.555 -12.856 -87.001  1.00 76.61  ?  173 ASP D CA    1 
ATOM   4389  C C     . ASP E 1 173 ? -12.286 -13.835 -86.089  1.00 82.87  ?  173 ASP D C     1 
ATOM   4390  O O     . ASP E 1 173 ? -11.949 -15.016 -86.038  1.00 81.47  ?  173 ASP D O     1 
ATOM   4391  C CB    . ASP E 1 173 ? -12.238 -12.828 -88.370  1.00 76.73  ?  173 ASP D CB    1 
ATOM   4392  C CG    . ASP E 1 173 ? -13.638 -12.250 -88.311  1.00 89.04  ?  173 ASP D CG    1 
ATOM   4393  O OD1   . ASP E 1 173 ? -13.792 -11.036 -88.563  1.00 99.43  ?  173 ASP D OD1   1 
ATOM   4394  O OD2   . ASP E 1 173 ? -14.584 -13.007 -88.006  1.00 82.59  -1 173 ASP D OD2   1 
ATOM   4395  N N     . SER E 1 174 ? -13.272 -13.331 -85.355  1.00 85.17  ?  174 SER D N     1 
ATOM   4396  C CA    . SER E 1 174 ? -14.064 -14.164 -84.455  1.00 77.55  ?  174 SER D CA    1 
ATOM   4397  C C     . SER E 1 174 ? -14.772 -15.303 -85.193  1.00 72.62  ?  174 SER D C     1 
ATOM   4398  O O     . SER E 1 174 ? -14.949 -16.398 -84.648  1.00 63.76  ?  174 SER D O     1 
ATOM   4399  C CB    . SER E 1 174 ? -15.088 -13.309 -83.706  1.00 83.42  ?  174 SER D CB    1 
ATOM   4400  O OG    . SER E 1 174 ? -15.969 -12.659 -84.605  1.00 92.75  ?  174 SER D OG    1 
ATOM   4401  N N     . ASN E 1 175 ? -15.175 -15.051 -86.436  1.00 73.23  ?  175 ASN D N     1 
ATOM   4402  C CA    . ASN E 1 175 ? -15.861 -16.080 -87.204  1.00 79.09  ?  175 ASN D CA    1 
ATOM   4403  C C     . ASN E 1 175 ? -14.911 -17.193 -87.636  1.00 74.02  ?  175 ASN D C     1 
ATOM   4404  O O     . ASN E 1 175 ? -15.334 -18.333 -87.861  1.00 73.43  ?  175 ASN D O     1 
ATOM   4405  C CB    . ASN E 1 175 ? -16.528 -15.458 -88.432  1.00 82.03  ?  175 ASN D CB    1 
ATOM   4406  C CG    . ASN E 1 175 ? -17.731 -14.605 -88.076  1.00 92.29  ?  175 ASN D CG    1 
ATOM   4407  O OD1   . ASN E 1 175 ? -18.479 -14.919 -87.150  1.00 96.16  ?  175 ASN D OD1   1 
ATOM   4408  N ND2   . ASN E 1 175 ? -17.918 -13.513 -88.808  1.00 90.78  ?  175 ASN D ND2   1 
ATOM   4409  N N     . TRP E 1 176 ? -13.623 -16.866 -87.723  1.00 66.69  ?  176 TRP D N     1 
ATOM   4410  C CA    . TRP E 1 176 ? -12.603 -17.877 -87.956  1.00 57.49  ?  176 TRP D CA    1 
ATOM   4411  C C     . TRP E 1 176 ? -12.654 -18.852 -86.797  1.00 56.86  ?  176 TRP D C     1 
ATOM   4412  O O     . TRP E 1 176 ? -12.616 -20.067 -86.978  1.00 49.96  ?  176 TRP D O     1 
ATOM   4413  C CB    . TRP E 1 176 ? -11.209 -17.265 -88.081  1.00 66.78  ?  176 TRP D CB    1 
ATOM   4414  C CG    . TRP E 1 176 ? -10.156 -18.288 -88.359  1.00 73.40  ?  176 TRP D CG    1 
ATOM   4415  C CD1   . TRP E 1 176 ? -9.701  -18.686 -89.583  1.00 69.69  ?  176 TRP D CD1   1 
ATOM   4416  C CD2   . TRP E 1 176 ? -9.454  -19.078 -87.393  1.00 63.56  ?  176 TRP D CD2   1 
ATOM   4417  N NE1   . TRP E 1 176 ? -8.742  -19.660 -89.437  1.00 75.52  ?  176 TRP D NE1   1 
ATOM   4418  C CE2   . TRP E 1 176 ? -8.575  -19.920 -88.102  1.00 68.19  ?  176 TRP D CE2   1 
ATOM   4419  C CE3   . TRP E 1 176 ? -9.476  -19.148 -85.998  1.00 48.85  ?  176 TRP D CE3   1 
ATOM   4420  C CZ2   . TRP E 1 176 ? -7.727  -20.821 -87.461  1.00 61.47  ?  176 TRP D CZ2   1 
ATOM   4421  C CZ3   . TRP E 1 176 ? -8.635  -20.043 -85.364  1.00 65.83  ?  176 TRP D CZ3   1 
ATOM   4422  C CH2   . TRP E 1 176 ? -7.772  -20.867 -86.095  1.00 65.07  ?  176 TRP D CH2   1 
ATOM   4423  N N     . VAL E 1 177 ? -12.725 -18.281 -85.598  1.00 71.47  ?  177 VAL D N     1 
ATOM   4424  C CA    . VAL E 1 177 ? -12.796 -19.036 -84.357  1.00 56.28  ?  177 VAL D CA    1 
ATOM   4425  C C     . VAL E 1 177 ? -14.049 -19.895 -84.340  1.00 53.20  ?  177 VAL D C     1 
ATOM   4426  O O     . VAL E 1 177 ? -14.012 -21.048 -83.919  1.00 46.94  ?  177 VAL D O     1 
ATOM   4427  C CB    . VAL E 1 177 ? -12.790 -18.120 -83.123  1.00 46.08  ?  177 VAL D CB    1 
ATOM   4428  C CG1   . VAL E 1 177 ? -12.840 -18.947 -81.851  1.00 62.29  ?  177 VAL D CG1   1 
ATOM   4429  C CG2   . VAL E 1 177 ? -11.558 -17.242 -83.126  1.00 65.60  ?  177 VAL D CG2   1 
ATOM   4430  N N     . ALA E 1 178 ? -15.161 -19.326 -84.798  1.00 42.69  ?  178 ALA D N     1 
ATOM   4431  C CA    . ALA E 1 178 ? -16.405 -20.082 -84.862  1.00 44.02  ?  178 ALA D CA    1 
ATOM   4432  C C     . ALA E 1 178 ? -16.283 -21.294 -85.784  1.00 56.70  ?  178 ALA D C     1 
ATOM   4433  O O     . ALA E 1 178 ? -16.723 -22.392 -85.432  1.00 62.05  ?  178 ALA D O     1 
ATOM   4434  C CB    . ALA E 1 178 ? -17.542 -19.185 -85.320  1.00 40.03  ?  178 ALA D CB    1 
ATOM   4435  N N     . GLY E 1 179 ? -15.667 -21.110 -86.948  1.00 64.54  ?  179 GLY D N     1 
ATOM   4436  C CA    . GLY E 1 179 ? -15.501 -22.222 -87.868  1.00 59.27  ?  179 GLY D CA    1 
ATOM   4437  C C     . GLY E 1 179 ? -14.555 -23.283 -87.332  1.00 57.76  ?  179 GLY D C     1 
ATOM   4438  O O     . GLY E 1 179 ? -14.842 -24.489 -87.384  1.00 63.87  ?  179 GLY D O     1 
ATOM   4439  N N     . PHE E 1 180 ? -13.433 -22.827 -86.783  1.00 44.58  ?  180 PHE D N     1 
ATOM   4440  C CA    . PHE E 1 180 ? -12.439 -23.724 -86.206  1.00 50.77  ?  180 PHE D CA    1 
ATOM   4441  C C     . PHE E 1 180 ? -13.015 -24.544 -85.067  1.00 59.63  ?  180 PHE D C     1 
ATOM   4442  O O     . PHE E 1 180 ? -12.727 -25.729 -84.946  1.00 65.00  ?  180 PHE D O     1 
ATOM   4443  C CB    . PHE E 1 180 ? -11.220 -22.944 -85.711  1.00 59.09  ?  180 PHE D CB    1 
ATOM   4444  C CG    . PHE E 1 180 ? -10.031 -23.815 -85.412  1.00 50.88  ?  180 PHE D CG    1 
ATOM   4445  C CD1   . PHE E 1 180 ? -9.391  -24.510 -86.424  1.00 60.95  ?  180 PHE D CD1   1 
ATOM   4446  C CD2   . PHE E 1 180 ? -9.566  -23.951 -84.116  1.00 45.64  ?  180 PHE D CD2   1 
ATOM   4447  C CE1   . PHE E 1 180 ? -8.300  -25.319 -86.148  1.00 60.58  ?  180 PHE D CE1   1 
ATOM   4448  C CE2   . PHE E 1 180 ? -8.476  -24.758 -83.833  1.00 58.19  ?  180 PHE D CE2   1 
ATOM   4449  C CZ    . PHE E 1 180 ? -7.844  -25.442 -84.852  1.00 47.82  ?  180 PHE D CZ    1 
ATOM   4450  N N     . THR E 1 181 ? -13.813 -23.908 -84.217  1.00 56.96  ?  181 THR D N     1 
ATOM   4451  C CA    . THR E 1 181 ? -14.371 -24.603 -83.070  1.00 59.08  ?  181 THR D CA    1 
ATOM   4452  C C     . THR E 1 181 ? -15.445 -25.552 -83.569  1.00 58.60  ?  181 THR D C     1 
ATOM   4453  O O     . THR E 1 181 ? -15.663 -26.619 -82.996  1.00 64.35  ?  181 THR D O     1 
ATOM   4454  C CB    . THR E 1 181 ? -14.958 -23.635 -82.034  1.00 55.98  ?  181 THR D CB    1 
ATOM   4455  O OG1   . THR E 1 181 ? -15.787 -22.673 -82.695  1.00 64.78  ?  181 THR D OG1   1 
ATOM   4456  C CG2   . THR E 1 181 ? -13.841 -22.913 -81.300  1.00 57.89  ?  181 THR D CG2   1 
ATOM   4457  N N     . ALA E 1 182 ? -16.122 -25.148 -84.641  1.00 52.88  ?  182 ALA D N     1 
ATOM   4458  C CA    . ALA E 1 182 ? -17.129 -26.001 -85.250  1.00 49.70  ?  182 ALA D CA    1 
ATOM   4459  C C     . ALA E 1 182 ? -16.485 -27.263 -85.811  1.00 52.19  ?  182 ALA D C     1 
ATOM   4460  O O     . ALA E 1 182 ? -17.134 -28.305 -85.905  1.00 48.30  ?  182 ALA D O     1 
ATOM   4461  C CB    . ALA E 1 182 ? -17.876 -25.253 -86.342  1.00 54.14  ?  182 ALA D CB    1 
ATOM   4462  N N     . GLY E 1 183 ? -15.208 -27.175 -86.179  1.00 47.49  ?  183 GLY D N     1 
ATOM   4463  C CA    . GLY E 1 183 ? -14.495 -28.360 -86.631  1.00 45.28  ?  183 GLY D CA    1 
ATOM   4464  C C     . GLY E 1 183 ? -13.864 -29.202 -85.533  1.00 46.07  ?  183 GLY D C     1 
ATOM   4465  O O     . GLY E 1 183 ? -14.102 -30.407 -85.450  1.00 53.04  ?  183 GLY D O     1 
ATOM   4466  N N     . GLU E 1 184 ? -13.053 -28.562 -84.696  1.00 47.97  ?  184 GLU D N     1 
ATOM   4467  C CA    . GLU E 1 184 ? -12.191 -29.261 -83.741  1.00 60.94  ?  184 GLU D CA    1 
ATOM   4468  C C     . GLU E 1 184 ? -12.673 -29.176 -82.303  1.00 55.77  ?  184 GLU D C     1 
ATOM   4469  O O     . GLU E 1 184 ? -12.087 -29.796 -81.418  1.00 57.62  ?  184 GLU D O     1 
ATOM   4470  C CB    . GLU E 1 184 ? -10.751 -28.738 -83.801  1.00 65.88  ?  184 GLU D CB    1 
ATOM   4471  C CG    . GLU E 1 184 ? -10.164 -28.543 -85.187  1.00 57.01  ?  184 GLU D CG    1 
ATOM   4472  C CD    . GLU E 1 184 ? -9.838  -29.850 -85.904  1.00 59.06  ?  184 GLU D CD    1 
ATOM   4473  O OE1   . GLU E 1 184 ? -10.544 -30.861 -85.701  1.00 53.09  ?  184 GLU D OE1   1 
ATOM   4474  O OE2   . GLU E 1 184 ? -8.852  -29.868 -86.672  1.00 78.38  -1 184 GLU D OE2   1 
ATOM   4475  N N     . GLY E 1 185 ? -13.729 -28.412 -82.056  1.00 55.43  ?  185 GLY D N     1 
ATOM   4476  C CA    . GLY E 1 185 ? -14.108 -28.148 -80.685  1.00 51.71  ?  185 GLY D CA    1 
ATOM   4477  C C     . GLY E 1 185 ? -14.962 -29.254 -80.111  1.00 45.74  ?  185 GLY D C     1 
ATOM   4478  O O     . GLY E 1 185 ? -15.503 -30.086 -80.839  1.00 46.46  ?  185 GLY D O     1 
ATOM   4479  N N     . SER E 1 186 ? -15.064 -29.264 -78.788  1.00 56.10  ?  186 SER D N     1 
ATOM   4480  C CA    . SER E 1 186 ? -15.922 -30.201 -78.088  1.00 56.80  ?  186 SER D CA    1 
ATOM   4481  C C     . SER E 1 186 ? -16.553 -29.548 -76.869  1.00 51.45  ?  186 SER D C     1 
ATOM   4482  O O     . SER E 1 186 ? -15.872 -28.918 -76.056  1.00 56.65  ?  186 SER D O     1 
ATOM   4483  C CB    . SER E 1 186 ? -15.125 -31.436 -77.670  1.00 45.88  ?  186 SER D CB    1 
ATOM   4484  O OG    . SER E 1 186 ? -15.988 -32.490 -77.283  1.00 58.32  ?  186 SER D OG    1 
ATOM   4485  N N     . PHE E 1 187 ? -17.864 -29.715 -76.754  1.00 52.93  ?  187 PHE D N     1 
ATOM   4486  C CA    . PHE E 1 187 ? -18.615 -29.286 -75.585  1.00 52.98  ?  187 PHE D CA    1 
ATOM   4487  C C     . PHE E 1 187 ? -19.140 -30.516 -74.863  1.00 60.33  ?  187 PHE D C     1 
ATOM   4488  O O     . PHE E 1 187 ? -20.099 -31.134 -75.330  1.00 56.27  ?  187 PHE D O     1 
ATOM   4489  C CB    . PHE E 1 187 ? -19.777 -28.382 -75.996  1.00 52.57  ?  187 PHE D CB    1 
ATOM   4490  C CG    . PHE E 1 187 ? -19.359 -27.164 -76.764  1.00 43.77  ?  187 PHE D CG    1 
ATOM   4491  C CD1   . PHE E 1 187 ? -19.022 -25.995 -76.107  1.00 47.55  ?  187 PHE D CD1   1 
ATOM   4492  C CD2   . PHE E 1 187 ? -19.296 -27.193 -78.144  1.00 35.86  ?  187 PHE D CD2   1 
ATOM   4493  C CE1   . PHE E 1 187 ? -18.644 -24.874 -76.814  1.00 44.91  ?  187 PHE D CE1   1 
ATOM   4494  C CE2   . PHE E 1 187 ? -18.912 -26.079 -78.856  1.00 51.09  ?  187 PHE D CE2   1 
ATOM   4495  C CZ    . PHE E 1 187 ? -18.584 -24.917 -78.190  1.00 55.30  ?  187 PHE D CZ    1 
ATOM   4496  N N     . TYR E 1 188 ? -18.536 -30.898 -73.742  1.00 59.97  ?  188 TYR D N     1 
ATOM   4497  C CA    . TYR E 1 188 ? -19.035 -32.101 -73.079  1.00 66.42  ?  188 TYR D CA    1 
ATOM   4498  C C     . TYR E 1 188 ? -19.181 -31.919 -71.577  1.00 60.56  ?  188 TYR D C     1 
ATOM   4499  O O     . TYR E 1 188 ? -18.554 -31.051 -70.975  1.00 56.84  ?  188 TYR D O     1 
ATOM   4500  C CB    . TYR E 1 188 ? -18.143 -33.318 -73.370  1.00 56.28  ?  188 TYR D CB    1 
ATOM   4501  C CG    . TYR E 1 188 ? -16.691 -33.184 -72.971  1.00 51.53  ?  188 TYR D CG    1 
ATOM   4502  C CD1   . TYR E 1 188 ? -15.734 -32.761 -73.881  1.00 50.10  ?  188 TYR D CD1   1 
ATOM   4503  C CD2   . TYR E 1 188 ? -16.274 -33.516 -71.686  1.00 74.30  ?  188 TYR D CD2   1 
ATOM   4504  C CE1   . TYR E 1 188 ? -14.406 -32.651 -73.518  1.00 55.56  ?  188 TYR D CE1   1 
ATOM   4505  C CE2   . TYR E 1 188 ? -14.949 -33.411 -71.315  1.00 68.09  ?  188 TYR D CE2   1 
ATOM   4506  C CZ    . TYR E 1 188 ? -14.019 -32.979 -72.235  1.00 53.51  ?  188 TYR D CZ    1 
ATOM   4507  O OH    . TYR E 1 188 ? -12.698 -32.870 -71.870  1.00 58.66  ?  188 TYR D OH    1 
ATOM   4508  N N     . ILE E 1 189 ? -20.014 -32.766 -70.984  1.00 59.61  ?  189 ILE D N     1 
ATOM   4509  C CA    . ILE E 1 189 ? -20.233 -32.758 -69.548  1.00 53.65  ?  189 ILE D CA    1 
ATOM   4510  C C     . ILE E 1 189 ? -19.506 -33.928 -68.910  1.00 59.58  ?  189 ILE D C     1 
ATOM   4511  O O     . ILE E 1 189 ? -19.752 -35.088 -69.242  1.00 65.34  ?  189 ILE D O     1 
ATOM   4512  C CB    . ILE E 1 189 ? -21.730 -32.827 -69.196  1.00 47.01  ?  189 ILE D CB    1 
ATOM   4513  C CG1   . ILE E 1 189 ? -22.469 -31.622 -69.780  1.00 48.01  ?  189 ILE D CG1   1 
ATOM   4514  C CG2   . ILE E 1 189 ? -21.922 -32.889 -67.689  1.00 73.00  ?  189 ILE D CG2   1 
ATOM   4515  C CD1   . ILE E 1 189 ? -21.828 -30.293 -69.444  1.00 53.30  ?  189 ILE D CD1   1 
ATOM   4516  N N     . ARG E 1 190 ? -18.599 -33.607 -67.997  1.00 59.85  ?  190 ARG D N     1 
ATOM   4517  C CA    . ARG E 1 190 ? -17.811 -34.609 -67.305  1.00 67.91  ?  190 ARG D CA    1 
ATOM   4518  C C     . ARG E 1 190 ? -18.460 -34.931 -65.970  1.00 70.68  ?  190 ARG D C     1 
ATOM   4519  O O     . ARG E 1 190 ? -18.705 -34.042 -65.153  1.00 66.44  ?  190 ARG D O     1 
ATOM   4520  C CB    . ARG E 1 190 ? -16.385 -34.095 -67.092  1.00 65.27  ?  190 ARG D CB    1 
ATOM   4521  C CG    . ARG E 1 190 ? -15.458 -35.026 -66.329  1.00 62.43  ?  190 ARG D CG    1 
ATOM   4522  C CD    . ARG E 1 190 ? -14.037 -34.918 -66.865  1.00 71.52  ?  190 ARG D CD    1 
ATOM   4523  N NE    . ARG E 1 190 ? -13.379 -33.697 -66.401  1.00 66.09  ?  190 ARG D NE    1 
ATOM   4524  C CZ    . ARG E 1 190 ? -12.342 -33.127 -67.007  1.00 64.40  ?  190 ARG D CZ    1 
ATOM   4525  N NH1   . ARG E 1 190 ? -11.840 -33.665 -68.110  1.00 78.12  1  190 ARG D NH1   1 
ATOM   4526  N NH2   . ARG E 1 190 ? -11.809 -32.017 -66.514  1.00 50.37  ?  190 ARG D NH2   1 
ATOM   4527  N N     . ILE E 1 191 ? -18.737 -36.213 -65.759  1.00 72.53  ?  191 ILE D N     1 
ATOM   4528  C CA    . ILE E 1 191 ? -19.276 -36.690 -64.495  1.00 57.46  ?  191 ILE D CA    1 
ATOM   4529  C C     . ILE E 1 191 ? -18.282 -37.661 -63.862  1.00 72.64  ?  191 ILE D C     1 
ATOM   4530  O O     . ILE E 1 191 ? -17.890 -38.658 -64.471  1.00 73.99  ?  191 ILE D O     1 
ATOM   4531  C CB    . ILE E 1 191 ? -20.675 -37.341 -64.669  1.00 48.95  ?  191 ILE D CB    1 
ATOM   4532  C CG1   . ILE E 1 191 ? -20.647 -38.491 -65.680  1.00 67.48  ?  191 ILE D CG1   1 
ATOM   4533  C CG2   . ILE E 1 191 ? -21.684 -36.302 -65.131  1.00 38.89  ?  191 ILE D CG2   1 
ATOM   4534  C CD1   . ILE E 1 191 ? -20.774 -39.867 -65.053  1.00 66.89  ?  191 ILE D CD1   1 
ATOM   4535  N N     . ALA E 1 192 ? -17.832 -37.343 -62.655  1.00 83.39  ?  192 ALA D N     1 
ATOM   4536  C CA    . ALA E 1 192 ? -16.843 -38.186 -61.996  1.00 85.87  ?  192 ALA D CA    1 
ATOM   4537  C C     . ALA E 1 192 ? -17.398 -38.790 -60.718  1.00 84.40  ?  192 ALA D C     1 
ATOM   4538  O O     . ALA E 1 192 ? -17.919 -38.074 -59.870  1.00 80.68  ?  192 ALA D O     1 
ATOM   4539  C CB    . ALA E 1 192 ? -15.589 -37.383 -61.691  1.00 73.67  ?  192 ALA D CB    1 
ATOM   4540  N N     . LYS E 1 193 ? -17.284 -40.108 -60.578  1.00 90.96  ?  193 LYS D N     1 
ATOM   4541  C CA    . LYS E 1 193 ? -17.689 -40.745 -59.336  1.00 86.75  ?  193 LYS D CA    1 
ATOM   4542  C C     . LYS E 1 193 ? -16.761 -40.252 -58.239  1.00 89.59  ?  193 LYS D C     1 
ATOM   4543  O O     . LYS E 1 193 ? -15.539 -40.347 -58.362  1.00 84.32  ?  193 LYS D O     1 
ATOM   4544  C CB    . LYS E 1 193 ? -17.641 -42.270 -59.452  1.00 83.64  ?  193 LYS D CB    1 
ATOM   4545  N N     . ASN E 1 194 ? -17.342 -39.723 -57.169  1.00 82.66  ?  194 ASN D N     1 
ATOM   4546  C CA    . ASN E 1 194 ? -16.553 -39.080 -56.130  1.00 82.25  ?  194 ASN D CA    1 
ATOM   4547  C C     . ASN E 1 194 ? -17.343 -39.036 -54.829  1.00 89.00  ?  194 ASN D C     1 
ATOM   4548  O O     . ASN E 1 194 ? -18.306 -38.278 -54.699  1.00 81.14  ?  194 ASN D O     1 
ATOM   4549  C CB    . ASN E 1 194 ? -16.138 -37.673 -56.575  1.00 69.54  ?  194 ASN D CB    1 
ATOM   4550  C CG    . ASN E 1 194 ? -15.198 -36.987 -55.591  1.00 70.24  ?  194 ASN D CG    1 
ATOM   4551  O OD1   . ASN E 1 194 ? -15.266 -37.198 -54.380  1.00 86.44  ?  194 ASN D OD1   1 
ATOM   4552  N ND2   . ASN E 1 194 ? -14.311 -36.154 -56.120  1.00 65.04  ?  194 ASN D ND2   1 
ATOM   4553  N N     . SER E 1 195 ? -16.929 -39.858 -53.871  1.00 89.58  ?  195 SER D N     1 
ATOM   4554  C CA    . SER E 1 195 ? -17.675 -40.034 -52.634  1.00 83.67  ?  195 SER D CA    1 
ATOM   4555  C C     . SER E 1 195 ? -17.693 -38.778 -51.765  1.00 74.63  ?  195 SER D C     1 
ATOM   4556  O O     . SER E 1 195 ? -18.584 -38.615 -50.931  1.00 70.72  ?  195 SER D O     1 
ATOM   4557  C CB    . SER E 1 195 ? -17.095 -41.205 -51.838  1.00 70.92  ?  195 SER D CB    1 
ATOM   4558  O OG    . SER E 1 195 ? -15.692 -41.072 -51.694  1.00 70.74  ?  195 SER D OG    1 
ATOM   4559  N N     . THR E 1 196 ? -16.721 -37.889 -51.959  1.00 68.36  ?  196 THR D N     1 
ATOM   4560  C CA    . THR E 1 196 ? -16.650 -36.674 -51.149  1.00 72.61  ?  196 THR D CA    1 
ATOM   4561  C C     . THR E 1 196 ? -17.714 -35.640 -51.510  1.00 73.05  ?  196 THR D C     1 
ATOM   4562  O O     . THR E 1 196 ? -17.802 -34.586 -50.881  1.00 80.67  ?  196 THR D O     1 
ATOM   4563  C CB    . THR E 1 196 ? -15.270 -36.001 -51.280  1.00 57.41  ?  196 THR D CB    1 
ATOM   4564  O OG1   . THR E 1 196 ? -15.144 -35.424 -52.585  1.00 56.76  ?  196 THR D OG1   1 
ATOM   4565  C CG2   . THR E 1 196 ? -14.158 -37.017 -51.072  1.00 68.93  ?  196 THR D CG2   1 
ATOM   4566  N N     . LEU E 1 197 ? -18.517 -35.941 -52.524  1.00 68.92  ?  197 LEU D N     1 
ATOM   4567  C CA    . LEU E 1 197 ? -19.663 -35.108 -52.867  1.00 65.83  ?  197 LEU D CA    1 
ATOM   4568  C C     . LEU E 1 197 ? -20.969 -35.751 -52.421  1.00 70.20  ?  197 LEU D C     1 
ATOM   4569  O O     . LEU E 1 197 ? -21.099 -36.977 -52.429  1.00 64.35  ?  197 LEU D O     1 
ATOM   4570  C CB    . LEU E 1 197 ? -19.684 -34.807 -54.362  1.00 65.47  ?  197 LEU D CB    1 
ATOM   4571  C CG    . LEU E 1 197 ? -18.503 -33.933 -54.785  1.00 73.60  ?  197 LEU D CG    1 
ATOM   4572  C CD1   . LEU E 1 197 ? -17.729 -34.576 -55.910  1.00 73.78  ?  197 LEU D CD1   1 
ATOM   4573  C CD2   . LEU E 1 197 ? -18.978 -32.540 -55.179  1.00 63.25  ?  197 LEU D CD2   1 
ATOM   4574  N N     . LYS E 1 198 ? -21.923 -34.917 -52.015  1.00 68.24  ?  198 LYS D N     1 
ATOM   4575  C CA    . LYS E 1 198 ? -23.189 -35.395 -51.473  1.00 55.60  ?  198 LYS D CA    1 
ATOM   4576  C C     . LYS E 1 198 ? -23.911 -36.295 -52.469  1.00 69.86  ?  198 LYS D C     1 
ATOM   4577  O O     . LYS E 1 198 ? -24.458 -37.332 -52.095  1.00 69.07  ?  198 LYS D O     1 
ATOM   4578  C CB    . LYS E 1 198 ? -24.086 -34.217 -51.086  1.00 41.44  ?  198 LYS D CB    1 
ATOM   4579  N N     . THR E 1 199 ? -23.906 -35.898 -53.739  1.00 83.77  ?  199 THR D N     1 
ATOM   4580  C CA    . THR E 1 199 ? -24.576 -36.679 -54.771  1.00 76.82  ?  199 THR D CA    1 
ATOM   4581  C C     . THR E 1 199 ? -23.769 -37.918 -55.141  1.00 75.80  ?  199 THR D C     1 
ATOM   4582  O O     . THR E 1 199 ? -24.278 -38.830 -55.791  1.00 71.12  ?  199 THR D O     1 
ATOM   4583  C CB    . THR E 1 199 ? -24.818 -35.845 -56.039  1.00 83.91  ?  199 THR D CB    1 
ATOM   4584  O OG1   . THR E 1 199 ? -23.575 -35.297 -56.496  1.00 91.89  ?  199 THR D OG1   1 
ATOM   4585  C CG2   . THR E 1 199 ? -25.789 -34.714 -55.751  1.00 80.87  ?  199 THR D CG2   1 
ATOM   4586  N N     . GLY E 1 200 ? -22.505 -37.943 -54.733  1.00 78.26  ?  200 GLY D N     1 
ATOM   4587  C CA    . GLY E 1 200 ? -21.621 -39.032 -55.103  1.00 77.67  ?  200 GLY D CA    1 
ATOM   4588  C C     . GLY E 1 200 ? -20.875 -38.792 -56.400  1.00 91.09  ?  200 GLY D C     1 
ATOM   4589  O O     . GLY E 1 200 ? -20.080 -39.630 -56.827  1.00 97.77  ?  200 GLY D O     1 
ATOM   4590  N N     . TYR E 1 201 ? -21.126 -37.647 -57.028  1.00 95.40  ?  201 TYR D N     1 
ATOM   4591  C CA    . TYR E 1 201 ? -20.489 -37.323 -58.301  1.00 83.97  ?  201 TYR D CA    1 
ATOM   4592  C C     . TYR E 1 201 ? -20.146 -35.843 -58.421  1.00 73.95  ?  201 TYR D C     1 
ATOM   4593  O O     . TYR E 1 201 ? -20.948 -34.981 -58.058  1.00 67.75  ?  201 TYR D O     1 
ATOM   4594  C CB    . TYR E 1 201 ? -21.398 -37.724 -59.469  1.00 80.84  ?  201 TYR D CB    1 
ATOM   4595  C CG    . TYR E 1 201 ? -21.691 -39.206 -59.564  1.00 89.21  ?  201 TYR D CG    1 
ATOM   4596  C CD1   . TYR E 1 201 ? -20.936 -40.032 -60.384  1.00 87.20  ?  201 TYR D CD1   1 
ATOM   4597  C CD2   . TYR E 1 201 ? -22.747 -39.772 -58.860  1.00 101.26 ?  201 TYR D CD2   1 
ATOM   4598  C CE1   . TYR E 1 201 ? -21.206 -41.385 -60.479  1.00 84.80  ?  201 TYR D CE1   1 
ATOM   4599  C CE2   . TYR E 1 201 ? -23.025 -41.121 -58.949  1.00 98.68  ?  201 TYR D CE2   1 
ATOM   4600  C CZ    . TYR E 1 201 ? -22.253 -41.923 -59.760  1.00 86.95  ?  201 TYR D CZ    1 
ATOM   4601  O OH    . TYR E 1 201 ? -22.531 -43.267 -59.849  1.00 82.65  ?  201 TYR D OH    1 
ATOM   4602  N N     . GLN E 1 202 ? -18.955 -35.547 -58.936  1.00 71.22  ?  202 GLN D N     1 
ATOM   4603  C CA    . GLN E 1 202 ? -18.664 -34.194 -59.385  1.00 68.36  ?  202 GLN D CA    1 
ATOM   4604  C C     . GLN E 1 202 ? -19.209 -34.008 -60.794  1.00 66.44  ?  202 GLN D C     1 
ATOM   4605  O O     . GLN E 1 202 ? -19.115 -34.907 -61.635  1.00 66.31  ?  202 GLN D O     1 
ATOM   4606  C CB    . GLN E 1 202 ? -17.156 -33.925 -59.351  1.00 50.45  ?  202 GLN D CB    1 
ATOM   4607  C CG    . GLN E 1 202 ? -16.757 -32.500 -59.701  1.00 44.81  ?  202 GLN D CG    1 
ATOM   4608  C CD    . GLN E 1 202 ? -15.252 -32.306 -59.714  1.00 49.95  ?  202 GLN D CD    1 
ATOM   4609  O OE1   . GLN E 1 202 ? -14.491 -33.255 -59.518  1.00 47.36  ?  202 GLN D OE1   1 
ATOM   4610  N NE2   . GLN E 1 202 ? -14.816 -31.072 -59.935  1.00 34.21  ?  202 GLN D NE2   1 
ATOM   4611  N N     . VAL E 1 203 ? -19.761 -32.826 -61.045  1.00 58.69  ?  203 VAL D N     1 
ATOM   4612  C CA    . VAL E 1 203 ? -20.237 -32.446 -62.367  1.00 44.10  ?  203 VAL D CA    1 
ATOM   4613  C C     . VAL E 1 203 ? -19.480 -31.235 -62.893  1.00 54.67  ?  203 VAL D C     1 
ATOM   4614  O O     . VAL E 1 203 ? -19.377 -30.215 -62.211  1.00 60.02  ?  203 VAL D O     1 
ATOM   4615  C CB    . VAL E 1 203 ? -21.748 -32.143 -62.359  1.00 54.75  ?  203 VAL D CB    1 
ATOM   4616  C CG1   . VAL E 1 203 ? -22.219 -31.750 -63.750  1.00 51.46  ?  203 VAL D CG1   1 
ATOM   4617  C CG2   . VAL E 1 203 ? -22.524 -33.349 -61.858  1.00 61.80  ?  203 VAL D CG2   1 
ATOM   4618  N N     . GLN E 1 204 ? -18.950 -31.345 -64.104  1.00 59.08  ?  204 GLN D N     1 
ATOM   4619  C CA    . GLN E 1 204 ? -18.169 -30.262 -64.680  1.00 48.47  ?  204 GLN D CA    1 
ATOM   4620  C C     . GLN E 1 204 ? -18.603 -30.029 -66.118  1.00 51.79  ?  204 GLN D C     1 
ATOM   4621  O O     . GLN E 1 204 ? -18.804 -30.975 -66.872  1.00 55.60  ?  204 GLN D O     1 
ATOM   4622  C CB    . GLN E 1 204 ? -16.674 -30.584 -64.633  1.00 47.44  ?  204 GLN D CB    1 
ATOM   4623  C CG    . GLN E 1 204 ? -15.968 -30.159 -63.359  1.00 49.98  ?  204 GLN D CG    1 
ATOM   4624  C CD    . GLN E 1 204 ? -14.485 -30.472 -63.396  1.00 56.92  ?  204 GLN D CD    1 
ATOM   4625  O OE1   . GLN E 1 204 ? -14.084 -31.622 -63.582  1.00 50.12  ?  204 GLN D OE1   1 
ATOM   4626  N NE2   . GLN E 1 204 ? -13.661 -29.447 -63.218  1.00 49.29  ?  204 GLN D NE2   1 
ATOM   4627  N N     . SER E 1 205 ? -18.753 -28.767 -66.499  1.00 56.16  ?  205 SER D N     1 
ATOM   4628  C CA    . SER E 1 205 ? -18.972 -28.442 -67.899  1.00 45.83  ?  205 SER D CA    1 
ATOM   4629  C C     . SER E 1 205 ? -17.623 -28.148 -68.532  1.00 49.69  ?  205 SER D C     1 
ATOM   4630  O O     . SER E 1 205 ? -16.825 -27.385 -67.986  1.00 54.75  ?  205 SER D O     1 
ATOM   4631  C CB    . SER E 1 205 ? -19.925 -27.257 -68.045  1.00 36.81  ?  205 SER D CB    1 
ATOM   4632  O OG    . SER E 1 205 ? -19.394 -26.099 -67.432  1.00 57.28  ?  205 SER D OG    1 
ATOM   4633  N N     . VAL E 1 206 ? -17.362 -28.763 -69.679  1.00 53.41  ?  206 VAL D N     1 
ATOM   4634  C CA    . VAL E 1 206 ? -16.049 -28.660 -70.297  1.00 53.59  ?  206 VAL D CA    1 
ATOM   4635  C C     . VAL E 1 206 ? -16.122 -28.187 -71.742  1.00 55.77  ?  206 VAL D C     1 
ATOM   4636  O O     . VAL E 1 206 ? -16.909 -28.714 -72.546  1.00 54.50  ?  206 VAL D O     1 
ATOM   4637  C CB    . VAL E 1 206 ? -15.304 -30.013 -70.260  1.00 52.05  ?  206 VAL D CB    1 
ATOM   4638  C CG1   . VAL E 1 206 ? -13.903 -29.865 -70.827  1.00 47.29  ?  206 VAL D CG1   1 
ATOM   4639  C CG2   . VAL E 1 206 ? -15.243 -30.551 -68.840  1.00 66.90  ?  206 VAL D CG2   1 
ATOM   4640  N N     . PHE E 1 207 ? -15.279 -27.208 -72.064  1.00 54.58  ?  207 PHE D N     1 
ATOM   4641  C CA    . PHE E 1 207 ? -15.064 -26.815 -73.451  1.00 42.39  ?  207 PHE D CA    1 
ATOM   4642  C C     . PHE E 1 207 ? -13.632 -27.142 -73.836  1.00 54.04  ?  207 PHE D C     1 
ATOM   4643  O O     . PHE E 1 207 ? -12.715 -26.938 -73.050  1.00 62.52  ?  207 PHE D O     1 
ATOM   4644  C CB    . PHE E 1 207 ? -15.347 -25.326 -73.654  1.00 44.20  ?  207 PHE D CB    1 
ATOM   4645  C CG    . PHE E 1 207 ? -14.879 -24.798 -74.979  1.00 47.72  ?  207 PHE D CG    1 
ATOM   4646  C CD1   . PHE E 1 207 ? -15.462 -25.227 -76.155  1.00 51.56  ?  207 PHE D CD1   1 
ATOM   4647  C CD2   . PHE E 1 207 ? -13.863 -23.858 -75.044  1.00 52.43  ?  207 PHE D CD2   1 
ATOM   4648  C CE1   . PHE E 1 207 ? -15.037 -24.741 -77.375  1.00 47.04  ?  207 PHE D CE1   1 
ATOM   4649  C CE2   . PHE E 1 207 ? -13.434 -23.366 -76.261  1.00 38.64  ?  207 PHE D CE2   1 
ATOM   4650  C CZ    . PHE E 1 207 ? -14.022 -23.808 -77.428  1.00 42.24  ?  207 PHE D CZ    1 
ATOM   4651  N N     . GLN E 1 208 ? -13.439 -27.665 -75.040  1.00 53.18  ?  208 GLN D N     1 
ATOM   4652  C CA    . GLN E 1 208 ? -12.132 -28.198 -75.401  1.00 45.27  ?  208 GLN D CA    1 
ATOM   4653  C C     . GLN E 1 208 ? -11.812 -27.995 -76.877  1.00 48.15  ?  208 GLN D C     1 
ATOM   4654  O O     . GLN E 1 208 ? -12.703 -28.047 -77.716  1.00 59.18  ?  208 GLN D O     1 
ATOM   4655  C CB    . GLN E 1 208 ? -12.066 -29.687 -75.037  1.00 39.51  ?  208 GLN D CB    1 
ATOM   4656  C CG    . GLN E 1 208 ? -10.850 -30.431 -75.563  1.00 46.53  ?  208 GLN D CG    1 
ATOM   4657  C CD    . GLN E 1 208 ? -10.840 -31.893 -75.158  1.00 54.21  ?  208 GLN D CD    1 
ATOM   4658  O OE1   . GLN E 1 208 ? -11.860 -32.579 -75.232  1.00 45.14  ?  208 GLN D OE1   1 
ATOM   4659  N NE2   . GLN E 1 208 ? -9.685  -32.375 -74.716  1.00 49.37  ?  208 GLN D NE2   1 
ATOM   4660  N N     . ILE E 1 209 ? -10.543 -27.758 -77.196  1.00 49.14  ?  209 ILE D N     1 
ATOM   4661  C CA    . ILE E 1 209 ? -10.108 -27.826 -78.586  1.00 43.63  ?  209 ILE D CA    1 
ATOM   4662  C C     . ILE E 1 209 ? -8.847  -28.677 -78.644  1.00 40.63  ?  209 ILE D C     1 
ATOM   4663  O O     . ILE E 1 209 ? -7.931  -28.498 -77.851  1.00 57.56  ?  209 ILE D O     1 
ATOM   4664  C CB    . ILE E 1 209 ? -9.832  -26.425 -79.182  1.00 37.81  ?  209 ILE D CB    1 
ATOM   4665  C CG1   . ILE E 1 209 ? -11.098 -25.565 -79.157  1.00 33.36  ?  209 ILE D CG1   1 
ATOM   4666  C CG2   . ILE E 1 209 ? -9.305  -26.538 -80.604  1.00 42.97  ?  209 ILE D CG2   1 
ATOM   4667  C CD1   . ILE E 1 209 ? -10.860 -24.117 -79.532  1.00 23.31  ?  209 ILE D CD1   1 
ATOM   4668  N N     . THR E 1 210 ? -8.804  -29.609 -79.586  1.00 47.01  ?  210 THR D N     1 
ATOM   4669  C CA    . THR E 1 210 ? -7.692  -30.545 -79.668  1.00 44.25  ?  210 THR D CA    1 
ATOM   4670  C C     . THR E 1 210 ? -6.900  -30.359 -80.955  1.00 62.49  ?  210 THR D C     1 
ATOM   4671  O O     . THR E 1 210 ? -7.483  -30.138 -82.016  1.00 83.78  ?  210 THR D O     1 
ATOM   4672  C CB    . THR E 1 210 ? -8.193  -32.003 -79.573  1.00 47.76  ?  210 THR D CB    1 
ATOM   4673  O OG1   . THR E 1 210 ? -8.927  -32.176 -78.355  1.00 55.93  ?  210 THR D OG1   1 
ATOM   4674  C CG2   . THR E 1 210 ? -7.030  -32.982 -79.597  1.00 52.50  ?  210 THR D CG2   1 
ATOM   4675  N N     . GLN E 1 211 ? -5.576  -30.450 -80.868  1.00 57.90  ?  211 GLN D N     1 
ATOM   4676  C CA    . GLN E 1 211 ? -4.758  -30.343 -82.071  1.00 77.40  ?  211 GLN D CA    1 
ATOM   4677  C C     . GLN E 1 211 ? -3.389  -30.948 -81.794  1.00 79.27  ?  211 GLN D C     1 
ATOM   4678  O O     . GLN E 1 211 ? -2.880  -30.833 -80.690  1.00 75.58  ?  211 GLN D O     1 
ATOM   4679  C CB    . GLN E 1 211 ? -4.629  -28.880 -82.506  1.00 65.61  ?  211 GLN D CB    1 
ATOM   4680  C CG    . GLN E 1 211 ? -4.111  -28.687 -83.920  1.00 86.61  ?  211 GLN D CG    1 
ATOM   4681  C CD    . GLN E 1 211 ? -5.202  -28.853 -84.965  1.00 82.89  ?  211 GLN D CD    1 
ATOM   4682  O OE1   . GLN E 1 211 ? -6.246  -29.453 -84.704  1.00 83.65  ?  211 GLN D OE1   1 
ATOM   4683  N NE2   . GLN E 1 211 ? -4.965  -28.318 -86.157  1.00 62.00  ?  211 GLN D NE2   1 
ATOM   4684  N N     . ASP E 1 212 ? -2.779  -31.552 -82.809  1.00 80.07  ?  212 ASP D N     1 
ATOM   4685  C CA    . ASP E 1 212 ? -1.441  -32.131 -82.679  1.00 85.94  ?  212 ASP D CA    1 
ATOM   4686  C C     . ASP E 1 212 ? -0.360  -31.117 -82.289  1.00 81.93  ?  212 ASP D C     1 
ATOM   4687  O O     . ASP E 1 212 ? -0.467  -29.933 -82.608  1.00 65.14  ?  212 ASP D O     1 
ATOM   4688  C CB    . ASP E 1 212 ? -1.056  -32.831 -83.990  1.00 105.45 ?  212 ASP D CB    1 
ATOM   4689  C CG    . ASP E 1 212 ? 0.295   -33.520 -83.915  1.00 99.36  ?  212 ASP D CG    1 
ATOM   4690  O OD1   . ASP E 1 212 ? 1.320   -32.866 -84.204  1.00 96.79  ?  212 ASP D OD1   1 
ATOM   4691  O OD2   . ASP E 1 212 ? 0.331   -34.720 -83.564  1.00 82.70  -1 212 ASP D OD2   1 
ATOM   4692  N N     . THR E 1 213 ? 0.668   -31.595 -81.589  1.00 80.73  ?  213 THR D N     1 
ATOM   4693  C CA    . THR E 1 213 ? 1.702   -30.729 -81.034  1.00 79.53  ?  213 THR D CA    1 
ATOM   4694  C C     . THR E 1 213 ? 2.498   -30.057 -82.147  1.00 93.64  ?  213 THR D C     1 
ATOM   4695  O O     . THR E 1 213 ? 3.560   -30.548 -82.537  1.00 102.40 ?  213 THR D O     1 
ATOM   4696  C CB    . THR E 1 213 ? 2.691   -31.504 -80.129  1.00 72.82  ?  213 THR D CB    1 
ATOM   4697  O OG1   . THR E 1 213 ? 3.292   -32.567 -80.878  1.00 89.06  ?  213 THR D OG1   1 
ATOM   4698  C CG2   . THR E 1 213 ? 1.983   -32.092 -78.927  1.00 81.12  ?  213 THR D CG2   1 
ATOM   4699  N N     . ARG E 1 214 ? 1.994   -28.936 -82.656  1.00 81.95  ?  214 ARG D N     1 
ATOM   4700  C CA    . ARG E 1 214 ? 2.704   -28.188 -83.692  1.00 81.34  ?  214 ARG D CA    1 
ATOM   4701  C C     . ARG E 1 214 ? 2.215   -26.748 -83.781  1.00 82.34  ?  214 ARG D C     1 
ATOM   4702  O O     . ARG E 1 214 ? 2.906   -25.877 -84.303  1.00 82.01  ?  214 ARG D O     1 
ATOM   4703  C CB    . ARG E 1 214 ? 2.543   -28.881 -85.048  1.00 82.82  ?  214 ARG D CB    1 
ATOM   4704  N N     . ASP E 1 215 ? 1.023   -26.495 -83.259  1.00 77.21  ?  215 ASP D N     1 
ATOM   4705  C CA    . ASP E 1 215 ? 0.413   -25.165 -83.267  1.00 86.82  ?  215 ASP D CA    1 
ATOM   4706  C C     . ASP E 1 215 ? 0.154   -24.670 -81.847  1.00 86.04  ?  215 ASP D C     1 
ATOM   4707  O O     . ASP E 1 215 ? -0.832  -23.979 -81.599  1.00 75.76  ?  215 ASP D O     1 
ATOM   4708  C CB    . ASP E 1 215 ? -0.891  -25.172 -84.076  1.00 86.04  ?  215 ASP D CB    1 
ATOM   4709  C CG    . ASP E 1 215 ? -0.667  -24.908 -85.555  1.00 86.50  ?  215 ASP D CG    1 
ATOM   4710  O OD1   . ASP E 1 215 ? -1.364  -25.525 -86.384  1.00 86.60  ?  215 ASP D OD1   1 
ATOM   4711  O OD2   . ASP E 1 215 ? 0.244   -24.114 -85.894  1.00 92.77  -1 215 ASP D OD2   1 
ATOM   4712  N N     . ILE E 1 216 ? 1.045   -25.019 -80.919  1.00 84.06  ?  216 ILE D N     1 
ATOM   4713  C CA    . ILE E 1 216 ? 0.857   -24.632 -79.525  1.00 76.84  ?  216 ILE D CA    1 
ATOM   4714  C C     . ILE E 1 216 ? 0.902   -23.109 -79.393  1.00 70.65  ?  216 ILE D C     1 
ATOM   4715  O O     . ILE E 1 216 ? 0.223   -22.539 -78.540  1.00 83.89  ?  216 ILE D O     1 
ATOM   4716  C CB    . ILE E 1 216 ? 1.941   -25.260 -78.603  1.00 74.74  ?  216 ILE D CB    1 
ATOM   4717  C CG1   . ILE E 1 216 ? 1.938   -26.793 -78.687  1.00 74.32  ?  216 ILE D CG1   1 
ATOM   4718  C CG2   . ILE E 1 216 ? 1.751   -24.817 -77.159  1.00 77.60  ?  216 ILE D CG2   1 
ATOM   4719  C CD1   . ILE E 1 216 ? 2.771   -27.369 -79.818  1.00 72.56  ?  216 ILE D CD1   1 
ATOM   4720  N N     . GLU E 1 217 ? 1.691   -22.451 -80.242  1.00 63.11  ?  217 GLU D N     1 
ATOM   4721  C CA    . GLU E 1 217 ? 1.785   -20.995 -80.206  1.00 70.36  ?  217 GLU D CA    1 
ATOM   4722  C C     . GLU E 1 217 ? 0.402   -20.436 -80.521  1.00 71.52  ?  217 GLU D C     1 
ATOM   4723  O O     . GLU E 1 217 ? -0.100  -19.511 -79.866  1.00 84.22  ?  217 GLU D O     1 
ATOM   4724  C CB    . GLU E 1 217 ? 2.825   -20.478 -81.202  1.00 76.47  ?  217 GLU D CB    1 
ATOM   4725  N N     . LEU E 1 218 ? -0.207  -21.032 -81.540  1.00 72.12  ?  218 LEU D N     1 
ATOM   4726  C CA    . LEU E 1 218 ? -1.555  -20.698 -81.963  1.00 72.02  ?  218 LEU D CA    1 
ATOM   4727  C C     . LEU E 1 218 ? -2.546  -20.951 -80.833  1.00 81.03  ?  218 LEU D C     1 
ATOM   4728  O O     . LEU E 1 218 ? -3.399  -20.117 -80.567  1.00 90.45  ?  218 LEU D O     1 
ATOM   4729  C CB    . LEU E 1 218 ? -1.949  -21.507 -83.201  1.00 82.29  ?  218 LEU D CB    1 
ATOM   4730  C CG    . LEU E 1 218 ? -3.381  -21.336 -83.711  1.00 74.93  ?  218 LEU D CG    1 
ATOM   4731  C CD1   . LEU E 1 218 ? -3.683  -19.861 -83.927  1.00 80.70  ?  218 LEU D CD1   1 
ATOM   4732  C CD2   . LEU E 1 218 ? -3.612  -22.132 -84.985  1.00 65.20  ?  218 LEU D CD2   1 
ATOM   4733  N N     . MET E 1 219 ? -2.405  -22.085 -80.149  1.00 81.91  ?  219 MET D N     1 
ATOM   4734  C CA    . MET E 1 219 ? -3.312  -22.456 -79.060  1.00 85.55  ?  219 MET D CA    1 
ATOM   4735  C C     . MET E 1 219 ? -3.260  -21.427 -77.939  1.00 79.77  ?  219 MET D C     1 
ATOM   4736  O O     . MET E 1 219 ? -4.297  -21.030 -77.383  1.00 82.28  ?  219 MET D O     1 
ATOM   4737  C CB    . MET E 1 219 ? -2.955  -23.842 -78.517  1.00 70.01  ?  219 MET D CB    1 
ATOM   4738  C CG    . MET E 1 219 ? -3.071  -24.958 -79.542  1.00 74.25  ?  219 MET D CG    1 
ATOM   4739  S SD    . MET E 1 219 ? -4.754  -25.215 -80.136  1.00 73.04  ?  219 MET D SD    1 
ATOM   4740  C CE    . MET E 1 219 ? -5.457  -26.114 -78.759  1.00 58.16  ?  219 MET D CE    1 
ATOM   4741  N N     . LYS E 1 220 ? -2.050  -20.980 -77.624  1.00 82.27  ?  220 LYS D N     1 
ATOM   4742  C CA    . LYS E 1 220 ? -1.876  -19.942 -76.625  1.00 83.98  ?  220 LYS D CA    1 
ATOM   4743  C C     . LYS E 1 220 ? -2.524  -18.667 -77.139  1.00 79.47  ?  220 LYS D C     1 
ATOM   4744  O O     . LYS E 1 220 ? -3.077  -17.894 -76.357  1.00 92.53  ?  220 LYS D O     1 
ATOM   4745  C CB    . LYS E 1 220 ? -0.401  -19.724 -76.277  1.00 69.70  ?  220 LYS D CB    1 
ATOM   4746  C CG    . LYS E 1 220 ? 0.222   -20.898 -75.535  1.00 64.58  ?  220 LYS D CG    1 
ATOM   4747  C CD    . LYS E 1 220 ? 1.655   -20.620 -75.110  1.00 65.16  ?  220 LYS D CD    1 
ATOM   4748  C CE    . LYS E 1 220 ? 2.241   -21.815 -74.369  1.00 68.27  ?  220 LYS D CE    1 
ATOM   4749  N NZ    . LYS E 1 220 ? 3.626   -21.560 -73.885  1.00 65.85  1  220 LYS D NZ    1 
ATOM   4750  N N     . ASN E 1 221 ? -2.453  -18.434 -78.448  1.00 56.11  ?  221 ASN D N     1 
ATOM   4751  C CA    . ASN E 1 221 ? -3.128  -17.261 -78.988  1.00 67.87  ?  221 ASN D CA    1 
ATOM   4752  C C     . ASN E 1 221 ? -4.651  -17.371 -78.843  1.00 73.11  ?  221 ASN D C     1 
ATOM   4753  O O     . ASN E 1 221 ? -5.320  -16.356 -78.673  1.00 74.62  ?  221 ASN D O     1 
ATOM   4754  C CB    . ASN E 1 221 ? -2.752  -17.051 -80.455  1.00 80.59  ?  221 ASN D CB    1 
ATOM   4755  N N     . LEU E 1 222 ? -5.207  -18.581 -78.937  1.00 77.70  ?  222 LEU D N     1 
ATOM   4756  C CA    . LEU E 1 222 ? -6.650  -18.751 -78.731  1.00 83.23  ?  222 LEU D CA    1 
ATOM   4757  C C     . LEU E 1 222 ? -7.011  -18.515 -77.273  1.00 91.22  ?  222 LEU D C     1 
ATOM   4758  O O     . LEU E 1 222 ? -8.084  -17.994 -76.959  1.00 91.44  ?  222 LEU D O     1 
ATOM   4759  C CB    . LEU E 1 222 ? -7.151  -20.136 -79.160  1.00 70.36  ?  222 LEU D CB    1 
ATOM   4760  C CG    . LEU E 1 222 ? -7.430  -20.516 -80.619  1.00 79.69  ?  222 LEU D CG    1 
ATOM   4761  C CD1   . LEU E 1 222 ? -8.529  -19.616 -81.178  1.00 78.35  ?  222 LEU D CD1   1 
ATOM   4762  C CD2   . LEU E 1 222 ? -6.213  -20.473 -81.503  1.00 92.56  ?  222 LEU D CD2   1 
ATOM   4763  N N     . ILE E 1 223 ? -6.097  -18.893 -76.383  1.00 81.45  ?  223 ILE D N     1 
ATOM   4764  C CA    . ILE E 1 223 ? -6.292  -18.654 -74.958  1.00 79.43  ?  223 ILE D CA    1 
ATOM   4765  C C     . ILE E 1 223 ? -6.296  -17.160 -74.676  1.00 86.32  ?  223 ILE D C     1 
ATOM   4766  O O     . ILE E 1 223 ? -7.148  -16.663 -73.943  1.00 88.21  ?  223 ILE D O     1 
ATOM   4767  C CB    . ILE E 1 223 ? -5.220  -19.358 -74.103  1.00 75.48  ?  223 ILE D CB    1 
ATOM   4768  C CG1   . ILE E 1 223 ? -5.519  -20.855 -74.032  1.00 73.52  ?  223 ILE D CG1   1 
ATOM   4769  C CG2   . ILE E 1 223 ? -5.193  -18.789 -72.694  1.00 77.64  ?  223 ILE D CG2   1 
ATOM   4770  C CD1   . ILE E 1 223 ? -4.503  -21.650 -73.256  1.00 62.17  ?  223 ILE D CD1   1 
ATOM   4771  N N     . SER E 1 224 ? -5.429  -16.416 -75.317  1.00 85.05  ?  224 SER D N     1 
ATOM   4772  C CA    . SER E 1 224 ? -5.427  -15.002 -75.063  1.00 74.93  ?  224 SER D CA    1 
ATOM   4773  C C     . SER E 1 224 ? -6.610  -14.367 -75.719  1.00 75.32  ?  224 SER D C     1 
ATOM   4774  O O     . SER E 1 224 ? -7.178  -13.452 -75.194  1.00 78.53  ?  224 SER D O     1 
ATOM   4775  C CB    . SER E 1 224 ? -4.165  -14.382 -75.604  1.00 79.52  ?  224 SER D CB    1 
ATOM   4776  O OG    . SER E 1 224 ? -3.067  -15.250 -75.412  1.00 86.31  ?  224 SER D OG    1 
ATOM   4777  N N     . TYR E 1 225 ? -7.003  -14.866 -76.874  1.00 81.73  ?  225 TYR D N     1 
ATOM   4778  C CA    . TYR E 1 225 ? -8.105  -14.248 -77.601  1.00 83.54  ?  225 TYR D CA    1 
ATOM   4779  C C     . TYR E 1 225 ? -9.409  -14.422 -76.829  1.00 75.01  ?  225 TYR D C     1 
ATOM   4780  O O     . TYR E 1 225 ? -10.234 -13.509 -76.769  1.00 61.97  ?  225 TYR D O     1 
ATOM   4781  C CB    . TYR E 1 225 ? -8.223  -14.850 -79.006  1.00 66.15  ?  225 TYR D CB    1 
ATOM   4782  C CG    . TYR E 1 225 ? -9.306  -14.234 -79.868  1.00 70.50  ?  225 TYR D CG    1 
ATOM   4783  C CD1   . TYR E 1 225 ? -9.004  -13.222 -80.770  1.00 79.90  ?  225 TYR D CD1   1 
ATOM   4784  C CD2   . TYR E 1 225 ? -10.623 -14.673 -79.794  1.00 68.59  ?  225 TYR D CD2   1 
ATOM   4785  C CE1   . TYR E 1 225 ? -9.984  -12.655 -81.566  1.00 90.11  ?  225 TYR D CE1   1 
ATOM   4786  C CE2   . TYR E 1 225 ? -11.610 -14.111 -80.585  1.00 71.65  ?  225 TYR D CE2   1 
ATOM   4787  C CZ    . TYR E 1 225 ? -11.284 -13.103 -81.469  1.00 89.48  ?  225 TYR D CZ    1 
ATOM   4788  O OH    . TYR E 1 225 ? -12.258 -12.539 -82.261  1.00 77.26  ?  225 TYR D OH    1 
ATOM   4789  N N     . LEU E 1 226 ? -9.596  -15.607 -76.255  1.00 72.33  ?  226 LEU D N     1 
ATOM   4790  C CA    . LEU E 1 226 ? -10.797 -15.896 -75.480  1.00 72.35  ?  226 LEU D CA    1 
ATOM   4791  C C     . LEU E 1 226 ? -10.626 -15.498 -74.019  1.00 92.12  ?  226 LEU D C     1 
ATOM   4792  O O     . LEU E 1 226 ? -11.591 -15.511 -73.266  1.00 86.33  ?  226 LEU D O     1 
ATOM   4793  C CB    . LEU E 1 226 ? -11.171 -17.376 -75.580  1.00 67.72  ?  226 LEU D CB    1 
ATOM   4794  C CG    . LEU E 1 226 ? -11.573 -17.880 -76.967  1.00 74.74  ?  226 LEU D CG    1 
ATOM   4795  C CD1   . LEU E 1 226 ? -11.681 -19.398 -76.979  1.00 46.17  ?  226 LEU D CD1   1 
ATOM   4796  C CD2   . LEU E 1 226 ? -12.884 -17.240 -77.405  1.00 65.93  ?  226 LEU D CD2   1 
ATOM   4797  N N     . ASN E 1 227 ? -9.379  -15.214 -73.641  1.00 92.77  ?  227 ASN D N     1 
ATOM   4798  C CA    . ASN E 1 227 ? -8.950  -14.766 -72.305  1.00 79.98  ?  227 ASN D CA    1 
ATOM   4799  C C     . ASN E 1 227 ? -9.159  -15.833 -71.221  1.00 72.47  ?  227 ASN D C     1 
ATOM   4800  O O     . ASN E 1 227 ? -9.288  -15.513 -70.039  1.00 95.04  ?  227 ASN D O     1 
ATOM   4801  C CB    . ASN E 1 227 ? -9.592  -13.396 -71.936  1.00 76.92  ?  227 ASN D CB    1 
ATOM   4802  C CG    . ASN E 1 227 ? -11.038 -13.472 -71.409  1.00 94.08  ?  227 ASN D CG    1 
ATOM   4803  O OD1   . ASN E 1 227 ? -11.526 -14.498 -70.936  1.00 98.18  ?  227 ASN D OD1   1 
ATOM   4804  N ND2   . ASN E 1 227 ? -11.729 -12.341 -71.502  1.00 90.18  ?  227 ASN D ND2   1 
ATOM   4805  N N     . CYS E 1 228 ? -9.118  -17.102 -71.624  1.00 61.55  ?  228 CYS D N     1 
ATOM   4806  C CA    . CYS E 1 228 ? -9.238  -18.208 -70.674  1.00 65.79  ?  228 CYS D CA    1 
ATOM   4807  C C     . CYS E 1 228 ? -8.760  -19.559 -71.218  1.00 68.38  ?  228 CYS D C     1 
ATOM   4808  O O     . CYS E 1 228 ? -8.437  -19.697 -72.398  1.00 83.82  ?  228 CYS D O     1 
ATOM   4809  C CB    . CYS E 1 228 ? -10.692 -18.341 -70.214  1.00 67.55  ?  228 CYS D CB    1 
ATOM   4810  S SG    . CYS E 1 228 ? -11.880 -18.601 -71.552  1.00 75.73  ?  228 CYS D SG    1 
ATOM   4811  N N     . GLY E 1 229 ? -8.722  -20.546 -70.326  1.00 48.53  ?  229 GLY D N     1 
ATOM   4812  C CA    . GLY E 1 229 ? -8.374  -21.922 -70.646  1.00 47.93  ?  229 GLY D CA    1 
ATOM   4813  C C     . GLY E 1 229 ? -6.947  -22.281 -70.268  1.00 50.33  ?  229 GLY D C     1 
ATOM   4814  O O     . GLY E 1 229 ? -6.090  -21.409 -70.139  1.00 56.03  ?  229 GLY D O     1 
ATOM   4815  N N     . ASN E 1 230 ? -6.694  -23.577 -70.096  1.00 52.47  ?  230 ASN D N     1 
ATOM   4816  C CA    . ASN E 1 230 ? -5.343  -24.092 -69.881  1.00 65.18  ?  230 ASN D CA    1 
ATOM   4817  C C     . ASN E 1 230 ? -4.888  -25.088 -70.947  1.00 63.00  ?  230 ASN D C     1 
ATOM   4818  O O     . ASN E 1 230 ? -5.707  -25.750 -71.577  1.00 68.65  ?  230 ASN D O     1 
ATOM   4819  C CB    . ASN E 1 230 ? -5.247  -24.733 -68.495  1.00 85.20  ?  230 ASN D CB    1 
ATOM   4820  C CG    . ASN E 1 230 ? -5.465  -23.733 -67.377  1.00 89.01  ?  230 ASN D CG    1 
ATOM   4821  O OD1   . ASN E 1 230 ? -4.631  -22.857 -67.142  1.00 96.53  ?  230 ASN D OD1   1 
ATOM   4822  N ND2   . ASN E 1 230 ? -6.590  -23.855 -66.683  1.00 82.59  ?  230 ASN D ND2   1 
ATOM   4823  N N     . ILE E 1 231 ? -3.576  -25.193 -71.137  1.00 66.95  ?  231 ILE D N     1 
ATOM   4824  C CA    . ILE E 1 231 ? -2.995  -26.193 -72.034  1.00 70.07  ?  231 ILE D CA    1 
ATOM   4825  C C     . ILE E 1 231 ? -2.677  -27.527 -71.350  1.00 62.45  ?  231 ILE D C     1 
ATOM   4826  O O     . ILE E 1 231 ? -2.025  -27.560 -70.306  1.00 72.93  ?  231 ILE D O     1 
ATOM   4827  C CB    . ILE E 1 231 ? -1.695  -25.671 -72.688  1.00 66.17  ?  231 ILE D CB    1 
ATOM   4828  C CG1   . ILE E 1 231 ? -1.995  -24.537 -73.669  1.00 44.98  ?  231 ILE D CG1   1 
ATOM   4829  C CG2   . ILE E 1 231 ? -0.947  -26.795 -73.387  1.00 56.71  ?  231 ILE D CG2   1 
ATOM   4830  C CD1   . ILE E 1 231 ? -1.366  -23.225 -73.271  1.00 65.85  ?  231 ILE D CD1   1 
ATOM   4831  N N     . ARG E 1 232 ? -3.137  -28.624 -71.947  1.00 67.27  ?  232 ARG D N     1 
ATOM   4832  C CA    . ARG E 1 232 ? -2.824  -29.963 -71.449  1.00 66.77  ?  232 ARG D CA    1 
ATOM   4833  C C     . ARG E 1 232 ? -2.090  -30.713 -72.567  1.00 83.91  ?  232 ARG D C     1 
ATOM   4834  O O     . ARG E 1 232 ? -2.559  -30.777 -73.703  1.00 82.11  ?  232 ARG D O     1 
ATOM   4835  C CB    . ARG E 1 232 ? -4.085  -30.709 -70.976  1.00 62.63  ?  232 ARG D CB    1 
ATOM   4836  C CG    . ARG E 1 232 ? -4.612  -31.799 -71.902  1.00 67.68  ?  232 ARG D CG    1 
ATOM   4837  C CD    . ARG E 1 232 ? -5.539  -32.765 -71.182  1.00 89.32  ?  232 ARG D CD    1 
ATOM   4838  N NE    . ARG E 1 232 ? -5.690  -34.017 -71.919  1.00 82.21  ?  232 ARG D NE    1 
ATOM   4839  C CZ    . ARG E 1 232 ? -5.631  -35.225 -71.368  1.00 79.48  ?  232 ARG D CZ    1 
ATOM   4840  N NH1   . ARG E 1 232 ? -5.424  -35.354 -70.065  1.00 82.15  1  232 ARG D NH1   1 
ATOM   4841  N NH2   . ARG E 1 232 ? -5.764  -36.306 -72.123  1.00 87.97  ?  232 ARG D NH2   1 
ATOM   4842  N N     . ILE E 1 233 ? -0.900  -31.219 -72.266  1.00 83.88  ?  233 ILE D N     1 
ATOM   4843  C CA    . ILE E 1 233 ? -0.141  -31.979 -73.253  1.00 67.11  ?  233 ILE D CA    1 
ATOM   4844  C C     . ILE E 1 233 ? -0.199  -33.477 -72.978  1.00 66.02  ?  233 ILE D C     1 
ATOM   4845  O O     . ILE E 1 233 ? 0.163   -33.936 -71.896  1.00 73.04  ?  233 ILE D O     1 
ATOM   4846  C CB    . ILE E 1 233 ? 1.331   -31.525 -73.290  1.00 56.58  ?  233 ILE D CB    1 
ATOM   4847  C CG1   . ILE E 1 233 ? 1.435   -30.112 -73.869  1.00 49.48  ?  233 ILE D CG1   1 
ATOM   4848  C CG2   . ILE E 1 233 ? 2.180   -32.512 -74.082  1.00 63.55  ?  233 ILE D CG2   1 
ATOM   4849  C CD1   . ILE E 1 233 ? 2.811   -29.501 -73.752  1.00 42.63  ?  233 ILE D CD1   1 
ATOM   4850  N N     . ARG E 1 234 ? -0.655  -34.236 -73.970  1.00 74.63  ?  234 ARG D N     1 
ATOM   4851  C CA    . ARG E 1 234 ? -0.607  -35.691 -73.894  1.00 80.56  ?  234 ARG D CA    1 
ATOM   4852  C C     . ARG E 1 234 ? 0.290   -36.276 -74.980  1.00 86.96  ?  234 ARG D C     1 
ATOM   4853  O O     . ARG E 1 234 ? 0.004   -36.149 -76.170  1.00 97.62  ?  234 ARG D O     1 
ATOM   4854  C CB    . ARG E 1 234 ? -2.017  -36.277 -74.002  1.00 64.04  ?  234 ARG D CB    1 
ATOM   4855  N N     . THR E 1 245 ? 1.842   -35.996 -77.750  1.00 98.85  ?  245 THR D N     1 
ATOM   4856  C CA    . THR E 1 245 ? 1.461   -36.107 -79.153  1.00 95.84  ?  245 THR D CA    1 
ATOM   4857  C C     . THR E 1 245 ? 0.401   -35.076 -79.527  1.00 96.73  ?  245 THR D C     1 
ATOM   4858  O O     . THR E 1 245 ? 0.546   -34.360 -80.518  1.00 95.91  ?  245 THR D O     1 
ATOM   4859  C CB    . THR E 1 245 ? 0.931   -37.516 -79.484  1.00 96.16  ?  245 THR D CB    1 
ATOM   4860  O OG1   . THR E 1 245 ? 0.006   -37.934 -78.472  1.00 83.96  ?  245 THR D OG1   1 
ATOM   4861  C CG2   . THR E 1 245 ? 2.078   -38.512 -79.563  1.00 85.16  ?  245 THR D CG2   1 
ATOM   4862  N N     . CYS E 1 246 ? -0.679  -35.025 -78.753  1.00 90.47  ?  246 CYS D N     1 
ATOM   4863  C CA    . CYS E 1 246 ? -1.673  -33.967 -78.908  1.00 79.57  ?  246 CYS D CA    1 
ATOM   4864  C C     . CYS E 1 246 ? -1.675  -32.931 -77.778  1.00 75.16  ?  246 CYS D C     1 
ATOM   4865  O O     . CYS E 1 246 ? -1.269  -33.216 -76.647  1.00 80.74  ?  246 CYS D O     1 
ATOM   4866  C CB    . CYS E 1 246 ? -3.068  -34.585 -79.028  1.00 79.82  ?  246 CYS D CB    1 
ATOM   4867  S SG    . CYS E 1 246 ? -3.532  -35.071 -80.707  1.00 79.20  ?  246 CYS D SG    1 
ATOM   4868  N N     . VAL E 1 247 ? -2.136  -31.727 -78.111  1.00 68.00  ?  247 VAL D N     1 
ATOM   4869  C CA    . VAL E 1 247 ? -2.363  -30.659 -77.145  1.00 72.79  ?  247 VAL D CA    1 
ATOM   4870  C C     . VAL E 1 247 ? -3.858  -30.351 -77.067  1.00 77.99  ?  247 VAL D C     1 
ATOM   4871  O O     . VAL E 1 247 ? -4.548  -30.314 -78.097  1.00 84.62  ?  247 VAL D O     1 
ATOM   4872  C CB    . VAL E 1 247 ? -1.602  -29.368 -77.534  1.00 65.80  ?  247 VAL D CB    1 
ATOM   4873  C CG1   . VAL E 1 247 ? -1.902  -28.241 -76.560  1.00 78.93  ?  247 VAL D CG1   1 
ATOM   4874  C CG2   . VAL E 1 247 ? -0.114  -29.627 -77.616  1.00 69.28  ?  247 VAL D CG2   1 
ATOM   4875  N N     . ASP E 1 248 ? -4.355  -30.136 -75.850  1.00 68.16  ?  248 ASP D N     1 
ATOM   4876  C CA    . ASP E 1 248 ? -5.710  -29.645 -75.638  1.00 61.74  ?  248 ASP D CA    1 
ATOM   4877  C C     . ASP E 1 248 ? -5.766  -28.245 -75.014  1.00 60.42  ?  248 ASP D C     1 
ATOM   4878  O O     . ASP E 1 248 ? -5.074  -27.970 -74.031  1.00 72.58  ?  248 ASP D O     1 
ATOM   4879  C CB    . ASP E 1 248 ? -6.478  -30.631 -74.756  1.00 62.05  ?  248 ASP D CB    1 
ATOM   4880  C CG    . ASP E 1 248 ? -6.558  -32.019 -75.366  1.00 62.59  ?  248 ASP D CG    1 
ATOM   4881  O OD1   . ASP E 1 248 ? -5.765  -32.896 -74.964  1.00 75.21  ?  248 ASP D OD1   1 
ATOM   4882  O OD2   . ASP E 1 248 ? -7.414  -32.233 -76.249  1.00 59.17  -1 248 ASP D OD2   1 
ATOM   4883  N N     . LEU E 1 249 ? -6.584  -27.370 -75.590  1.00 47.34  ?  249 LEU D N     1 
ATOM   4884  C CA    . LEU E 1 249 ? -7.049  -26.161 -74.918  1.00 38.17  ?  249 LEU D CA    1 
ATOM   4885  C C     . LEU E 1 249 ? -8.285  -26.550 -74.111  1.00 58.15  ?  249 LEU D C     1 
ATOM   4886  O O     . LEU E 1 249 ? -9.277  -26.995 -74.687  1.00 53.20  ?  249 LEU D O     1 
ATOM   4887  C CB    . LEU E 1 249 ? -7.360  -25.047 -75.923  1.00 39.59  ?  249 LEU D CB    1 
ATOM   4888  C CG    . LEU E 1 249 ? -7.771  -23.650 -75.439  1.00 50.21  ?  249 LEU D CG    1 
ATOM   4889  C CD1   . LEU E 1 249 ? -7.479  -22.631 -76.529  1.00 54.80  ?  249 LEU D CD1   1 
ATOM   4890  C CD2   . LEU E 1 249 ? -9.243  -23.581 -75.044  1.00 47.89  ?  249 LEU D CD2   1 
ATOM   4891  N N     . VAL E 1 250 ? -8.237  -26.387 -72.792  1.00 69.71  ?  250 VAL D N     1 
ATOM   4892  C CA    . VAL E 1 250 ? -9.359  -26.789 -71.946  1.00 56.43  ?  250 VAL D CA    1 
ATOM   4893  C C     . VAL E 1 250 ? -9.898  -25.670 -71.055  1.00 60.64  ?  250 VAL D C     1 
ATOM   4894  O O     . VAL E 1 250 ? -9.162  -25.084 -70.262  1.00 64.30  ?  250 VAL D O     1 
ATOM   4895  C CB    . VAL E 1 250 ? -8.971  -27.973 -71.037  1.00 46.10  ?  250 VAL D CB    1 
ATOM   4896  C CG1   . VAL E 1 250 ? -10.190 -28.475 -70.278  1.00 59.81  ?  250 VAL D CG1   1 
ATOM   4897  C CG2   . VAL E 1 250 ? -8.349  -29.095 -71.854  1.00 47.40  ?  250 VAL D CG2   1 
ATOM   4898  N N     . VAL E 1 251 ? -11.188 -25.383 -71.195  1.00 62.44  ?  251 VAL D N     1 
ATOM   4899  C CA    . VAL E 1 251 ? -11.875 -24.457 -70.306  1.00 61.45  ?  251 VAL D CA    1 
ATOM   4900  C C     . VAL E 1 251 ? -12.836 -25.217 -69.392  1.00 60.33  ?  251 VAL D C     1 
ATOM   4901  O O     . VAL E 1 251 ? -13.792 -25.858 -69.861  1.00 55.32  ?  251 VAL D O     1 
ATOM   4902  C CB    . VAL E 1 251 ? -12.658 -23.386 -71.090  1.00 65.26  ?  251 VAL D CB    1 
ATOM   4903  C CG1   . VAL E 1 251 ? -13.366 -22.440 -70.130  1.00 74.08  ?  251 VAL D CG1   1 
ATOM   4904  C CG2   . VAL E 1 251 ? -11.730 -22.623 -72.022  1.00 56.69  ?  251 VAL D CG2   1 
ATOM   4905  N N     . THR E 1 252 ? -12.558 -25.142 -68.091  1.00 67.01  ?  252 THR D N     1 
ATOM   4906  C CA    . THR E 1 252 ? -13.340 -25.822 -67.061  1.00 55.88  ?  252 THR D CA    1 
ATOM   4907  C C     . THR E 1 252 ? -13.958 -24.854 -66.053  1.00 58.56  ?  252 THR D C     1 
ATOM   4908  O O     . THR E 1 252 ? -14.935 -25.189 -65.382  1.00 57.90  ?  252 THR D O     1 
ATOM   4909  C CB    . THR E 1 252 ? -12.484 -26.844 -66.288  1.00 56.08  ?  252 THR D CB    1 
ATOM   4910  O OG1   . THR E 1 252 ? -11.230 -26.251 -65.928  1.00 52.55  ?  252 THR D OG1   1 
ATOM   4911  C CG2   . THR E 1 252 ? -12.237 -28.083 -67.138  1.00 73.13  ?  252 THR D CG2   1 
ATOM   4912  N N     . ASN E 1 253 ? -13.377 -23.660 -65.942  1.00 64.44  ?  253 ASN D N     1 
ATOM   4913  C CA    . ASN E 1 253 ? -13.880 -22.631 -65.032  1.00 51.71  ?  253 ASN D CA    1 
ATOM   4914  C C     . ASN E 1 253 ? -15.319 -22.276 -65.384  1.00 54.59  ?  253 ASN D C     1 
ATOM   4915  O O     . ASN E 1 253 ? -15.624 -21.915 -66.520  1.00 68.06  ?  253 ASN D O     1 
ATOM   4916  C CB    . ASN E 1 253 ? -12.979 -21.392 -65.073  1.00 65.72  ?  253 ASN D CB    1 
ATOM   4917  C CG    . ASN E 1 253 ? -13.450 -20.285 -64.141  1.00 73.42  ?  253 ASN D CG    1 
ATOM   4918  O OD1   . ASN E 1 253 ? -14.521 -19.705 -64.328  1.00 69.11  ?  253 ASN D OD1   1 
ATOM   4919  N ND2   . ASN E 1 253 ? -12.646 -19.989 -63.126  1.00 59.23  ?  253 ASN D ND2   1 
ATOM   4920  N N     . LEU E 1 254 ? -16.200 -22.391 -64.397  1.00 58.01  ?  254 LEU D N     1 
ATOM   4921  C CA    . LEU E 1 254 ? -17.630 -22.251 -64.630  1.00 60.13  ?  254 LEU D CA    1 
ATOM   4922  C C     . LEU E 1 254 ? -18.087 -20.873 -65.106  1.00 61.29  ?  254 LEU D C     1 
ATOM   4923  O O     . LEU E 1 254 ? -18.887 -20.786 -66.037  1.00 72.08  ?  254 LEU D O     1 
ATOM   4924  C CB    . LEU E 1 254 ? -18.395 -22.612 -63.353  1.00 51.34  ?  254 LEU D CB    1 
ATOM   4925  C CG    . LEU E 1 254 ? -19.923 -22.555 -63.426  1.00 63.95  ?  254 LEU D CG    1 
ATOM   4926  C CD1   . LEU E 1 254 ? -20.441 -23.342 -64.619  1.00 50.61  ?  254 LEU D CD1   1 
ATOM   4927  C CD2   . LEU E 1 254 ? -20.543 -23.065 -62.134  1.00 105.90 ?  254 LEU D CD2   1 
ATOM   4928  N N     . ASN E 1 255 ? -17.600 -19.793 -64.501  1.00 66.24  ?  255 ASN D N     1 
ATOM   4929  C CA    . ASN E 1 255 ? -17.974 -18.489 -65.038  1.00 73.95  ?  255 ASN D CA    1 
ATOM   4930  C C     . ASN E 1 255 ? -17.006 -17.895 -66.057  1.00 75.56  ?  255 ASN D C     1 
ATOM   4931  O O     . ASN E 1 255 ? -17.214 -16.769 -66.515  1.00 79.91  ?  255 ASN D O     1 
ATOM   4932  C CB    . ASN E 1 255 ? -18.167 -17.494 -63.885  1.00 96.00  ?  255 ASN D CB    1 
ATOM   4933  C CG    . ASN E 1 255 ? -16.942 -17.382 -62.986  1.00 104.52 ?  255 ASN D CG    1 
ATOM   4934  O OD1   . ASN E 1 255 ? -15.804 -17.377 -63.456  1.00 86.42  ?  255 ASN D OD1   1 
ATOM   4935  N ND2   . ASN E 1 255 ? -17.177 -17.292 -61.681  1.00 103.28 ?  255 ASN D ND2   1 
ATOM   4936  N N     . ASP E 1 256 ? -16.006 -18.663 -66.482  1.00 82.50  ?  256 ASP D N     1 
ATOM   4937  C CA    . ASP E 1 256 ? -15.366 -18.382 -67.759  1.00 70.03  ?  256 ASP D CA    1 
ATOM   4938  C C     . ASP E 1 256 ? -16.289 -18.874 -68.856  1.00 54.96  ?  256 ASP D C     1 
ATOM   4939  O O     . ASP E 1 256 ? -16.446 -18.238 -69.893  1.00 70.90  ?  256 ASP D O     1 
ATOM   4940  C CB    . ASP E 1 256 ? -13.992 -19.047 -67.855  1.00 63.12  ?  256 ASP D CB    1 
ATOM   4941  C CG    . ASP E 1 256 ? -12.945 -18.343 -67.012  1.00 71.05  ?  256 ASP D CG    1 
ATOM   4942  O OD1   . ASP E 1 256 ? -13.076 -17.119 -66.798  1.00 78.52  ?  256 ASP D OD1   1 
ATOM   4943  O OD2   . ASP E 1 256 ? -11.984 -19.009 -66.573  1.00 58.08  -1 256 ASP D OD2   1 
ATOM   4944  N N     . ILE E 1 257 ? -16.895 -20.028 -68.608  1.00 41.86  ?  257 ILE D N     1 
ATOM   4945  C CA    . ILE E 1 257 ? -17.855 -20.607 -69.529  1.00 48.31  ?  257 ILE D CA    1 
ATOM   4946  C C     . ILE E 1 257 ? -19.066 -19.685 -69.601  1.00 56.05  ?  257 ILE D C     1 
ATOM   4947  O O     . ILE E 1 257 ? -19.564 -19.361 -70.679  1.00 63.62  ?  257 ILE D O     1 
ATOM   4948  C CB    . ILE E 1 257 ? -18.263 -22.022 -69.087  1.00 47.53  ?  257 ILE D CB    1 
ATOM   4949  C CG1   . ILE E 1 257 ? -17.216 -23.034 -69.557  1.00 59.56  ?  257 ILE D CG1   1 
ATOM   4950  C CG2   . ILE E 1 257 ? -19.657 -22.374 -69.594  1.00 47.16  ?  257 ILE D CG2   1 
ATOM   4951  C CD1   . ILE E 1 257 ? -17.164 -24.285 -68.724  1.00 59.83  ?  257 ILE D CD1   1 
ATOM   4952  N N     . LYS E 1 258 ? -19.523 -19.266 -68.425  1.00 70.72  ?  258 LYS D N     1 
ATOM   4953  C CA    . LYS E 1 258 ? -20.688 -18.401 -68.285  1.00 73.93  ?  258 LYS D CA    1 
ATOM   4954  C C     . LYS E 1 258 ? -20.475 -17.003 -68.862  1.00 65.55  ?  258 LYS D C     1 
ATOM   4955  O O     . LYS E 1 258 ? -21.341 -16.476 -69.565  1.00 48.65  ?  258 LYS D O     1 
ATOM   4956  C CB    . LYS E 1 258 ? -21.086 -18.294 -66.811  1.00 49.57  ?  258 LYS D CB    1 
ATOM   4957  N N     . GLU E 1 259 ? -19.323 -16.404 -68.573  1.00 50.75  ?  259 GLU D N     1 
ATOM   4958  C CA    . GLU E 1 259 ? -19.130 -14.995 -68.899  1.00 54.46  ?  259 GLU D CA    1 
ATOM   4959  C C     . GLU E 1 259 ? -18.225 -14.732 -70.101  1.00 71.50  ?  259 GLU D C     1 
ATOM   4960  O O     . GLU E 1 259 ? -18.085 -13.585 -70.520  1.00 80.44  ?  259 GLU D O     1 
ATOM   4961  C CB    . GLU E 1 259 ? -18.573 -14.250 -67.683  1.00 86.01  ?  259 GLU D CB    1 
ATOM   4962  N N     . LYS E 1 260 ? -17.613 -15.772 -70.661  1.00 71.46  ?  260 LYS D N     1 
ATOM   4963  C CA    . LYS E 1 260 ? -16.726 -15.564 -71.803  1.00 70.90  ?  260 LYS D CA    1 
ATOM   4964  C C     . LYS E 1 260 ? -17.101 -16.401 -73.032  1.00 68.33  ?  260 LYS D C     1 
ATOM   4965  O O     . LYS E 1 260 ? -17.430 -15.863 -74.088  1.00 68.11  ?  260 LYS D O     1 
ATOM   4966  C CB    . LYS E 1 260 ? -15.281 -15.884 -71.404  1.00 65.05  ?  260 LYS D CB    1 
ATOM   4967  C CG    . LYS E 1 260 ? -14.727 -15.046 -70.259  1.00 64.49  ?  260 LYS D CG    1 
ATOM   4968  C CD    . LYS E 1 260 ? -14.842 -13.557 -70.516  1.00 79.81  ?  260 LYS D CD    1 
ATOM   4969  C CE    . LYS E 1 260 ? -14.203 -12.771 -69.382  1.00 83.74  ?  260 LYS D CE    1 
ATOM   4970  N NZ    . LYS E 1 260 ? -14.022 -11.333 -69.717  1.00 96.89  1  260 LYS D NZ    1 
ATOM   4971  N N     . ILE E 1 261 ? -17.049 -17.719 -72.871  1.00 57.61  ?  261 ILE D N     1 
ATOM   4972  C CA    . ILE E 1 261 ? -17.319 -18.674 -73.946  1.00 61.36  ?  261 ILE D CA    1 
ATOM   4973  C C     . ILE E 1 261 ? -18.729 -18.657 -74.556  1.00 71.01  ?  261 ILE D C     1 
ATOM   4974  O O     . ILE E 1 261 ? -18.888 -18.539 -75.778  1.00 78.48  ?  261 ILE D O     1 
ATOM   4975  C CB    . ILE E 1 261 ? -17.043 -20.109 -73.446  1.00 67.10  ?  261 ILE D CB    1 
ATOM   4976  C CG1   . ILE E 1 261 ? -15.594 -20.241 -72.970  1.00 54.92  ?  261 ILE D CG1   1 
ATOM   4977  C CG2   . ILE E 1 261 ? -17.365 -21.132 -74.521  1.00 65.03  ?  261 ILE D CG2   1 
ATOM   4978  C CD1   . ILE E 1 261 ? -14.573 -19.920 -74.032  1.00 57.22  ?  261 ILE D CD1   1 
ATOM   4979  N N     . ILE E 1 262 ? -19.746 -18.753 -73.706  1.00 64.34  ?  262 ILE D N     1 
ATOM   4980  C CA    . ILE E 1 262 ? -21.134 -18.782 -74.169  1.00 64.58  ?  262 ILE D CA    1 
ATOM   4981  C C     . ILE E 1 262 ? -21.574 -17.495 -74.884  1.00 80.63  ?  262 ILE D C     1 
ATOM   4982  O O     . ILE E 1 262 ? -22.211 -17.580 -75.933  1.00 86.98  ?  262 ILE D O     1 
ATOM   4983  C CB    . ILE E 1 262 ? -22.107 -19.093 -73.002  1.00 48.87  ?  262 ILE D CB    1 
ATOM   4984  C CG1   . ILE E 1 262 ? -22.043 -20.580 -72.645  1.00 56.97  ?  262 ILE D CG1   1 
ATOM   4985  C CG2   . ILE E 1 262 ? -23.533 -18.703 -73.362  1.00 57.86  ?  262 ILE D CG2   1 
ATOM   4986  C CD1   . ILE E 1 262 ? -23.136 -21.037 -71.699  1.00 68.26  ?  262 ILE D CD1   1 
ATOM   4987  N N     . PRO E 1 263 ? -21.246 -16.307 -74.340  1.00 79.28  ?  263 PRO D N     1 
ATOM   4988  C CA    . PRO E 1 263 ? -21.615 -15.116 -75.115  1.00 82.22  ?  263 PRO D CA    1 
ATOM   4989  C C     . PRO E 1 263 ? -20.919 -15.091 -76.475  1.00 82.61  ?  263 PRO D C     1 
ATOM   4990  O O     . PRO E 1 263 ? -21.517 -14.693 -77.487  1.00 84.95  ?  263 PRO D O     1 
ATOM   4991  C CB    . PRO E 1 263 ? -21.126 -13.968 -74.231  1.00 88.22  ?  263 PRO D CB    1 
ATOM   4992  C CG    . PRO E 1 263 ? -21.234 -14.515 -72.852  1.00 86.86  ?  263 PRO D CG    1 
ATOM   4993  C CD    . PRO E 1 263 ? -20.755 -15.935 -72.999  1.00 72.76  ?  263 PRO D CD    1 
ATOM   4994  N N     . PHE E 1 264 ? -19.670 -15.552 -76.492  1.00 70.45  ?  264 PHE D N     1 
ATOM   4995  C CA    . PHE E 1 264 ? -18.884 -15.588 -77.715  1.00 76.70  ?  264 PHE D CA    1 
ATOM   4996  C C     . PHE E 1 264 ? -19.564 -16.458 -78.757  1.00 77.58  ?  264 PHE D C     1 
ATOM   4997  O O     . PHE E 1 264 ? -19.741 -16.029 -79.896  1.00 87.72  ?  264 PHE D O     1 
ATOM   4998  C CB    . PHE E 1 264 ? -17.470 -16.107 -77.446  1.00 72.26  ?  264 PHE D CB    1 
ATOM   4999  C CG    . PHE E 1 264 ? -16.580 -16.087 -78.656  1.00 70.65  ?  264 PHE D CG    1 
ATOM   5000  C CD1   . PHE E 1 264 ? -15.873 -14.943 -78.993  1.00 83.30  ?  264 PHE D CD1   1 
ATOM   5001  C CD2   . PHE E 1 264 ? -16.455 -17.207 -79.462  1.00 77.52  ?  264 PHE D CD2   1 
ATOM   5002  C CE1   . PHE E 1 264 ? -15.055 -14.918 -80.109  1.00 82.74  ?  264 PHE D CE1   1 
ATOM   5003  C CE2   . PHE E 1 264 ? -15.640 -17.188 -80.579  1.00 79.83  ?  264 PHE D CE2   1 
ATOM   5004  C CZ    . PHE E 1 264 ? -14.939 -16.042 -80.902  1.00 79.94  ?  264 PHE D CZ    1 
ATOM   5005  N N     . PHE E 1 265 ? -19.949 -17.675 -78.387  1.00 77.22  ?  265 PHE D N     1 
ATOM   5006  C CA    . PHE E 1 265 ? -20.474 -18.573 -79.405  1.00 70.45  ?  265 PHE D CA    1 
ATOM   5007  C C     . PHE E 1 265 ? -21.954 -18.293 -79.629  1.00 74.91  ?  265 PHE D C     1 
ATOM   5008  O O     . PHE E 1 265 ? -22.573 -18.853 -80.533  1.00 80.15  ?  265 PHE D O     1 
ATOM   5009  C CB    . PHE E 1 265 ? -20.253 -20.036 -79.023  1.00 74.64  ?  265 PHE D CB    1 
ATOM   5010  C CG    . PHE E 1 265 ? -18.819 -20.467 -79.102  1.00 75.50  ?  265 PHE D CG    1 
ATOM   5011  C CD1   . PHE E 1 265 ? -18.146 -20.448 -80.312  1.00 66.04  ?  265 PHE D CD1   1 
ATOM   5012  C CD2   . PHE E 1 265 ? -18.145 -20.898 -77.973  1.00 82.94  ?  265 PHE D CD2   1 
ATOM   5013  C CE1   . PHE E 1 265 ? -16.827 -20.843 -80.393  1.00 64.88  ?  265 PHE D CE1   1 
ATOM   5014  C CE2   . PHE E 1 265 ? -16.824 -21.296 -78.048  1.00 75.37  ?  265 PHE D CE2   1 
ATOM   5015  C CZ    . PHE E 1 265 ? -16.166 -21.268 -79.259  1.00 66.63  ?  265 PHE D CZ    1 
ATOM   5016  N N     . ASN E 1 266 ? -22.518 -17.422 -78.797  1.00 82.31  ?  266 ASN D N     1 
ATOM   5017  C CA    . ASN E 1 266 ? -23.885 -16.964 -78.995  1.00 96.70  ?  266 ASN D CA    1 
ATOM   5018  C C     . ASN E 1 266 ? -23.882 -15.913 -80.092  1.00 93.37  ?  266 ASN D C     1 
ATOM   5019  O O     . ASN E 1 266 ? -24.822 -15.807 -80.880  1.00 86.93  ?  266 ASN D O     1 
ATOM   5020  C CB    . ASN E 1 266 ? -24.478 -16.404 -77.703  1.00 97.00  ?  266 ASN D CB    1 
ATOM   5021  C CG    . ASN E 1 266 ? -25.198 -17.462 -76.890  1.00 92.76  ?  266 ASN D CG    1 
ATOM   5022  O OD1   . ASN E 1 266 ? -25.199 -18.640 -77.245  1.00 91.01  ?  266 ASN D OD1   1 
ATOM   5023  N ND2   . ASN E 1 266 ? -25.817 -17.045 -75.791  1.00 87.24  ?  266 ASN D ND2   1 
ATOM   5024  N N     . LYS E 1 267 ? -22.803 -15.135 -80.125  1.00 89.19  ?  267 LYS D N     1 
ATOM   5025  C CA    . LYS E 1 267 ? -22.616 -14.102 -81.141  1.00 89.92  ?  267 LYS D CA    1 
ATOM   5026  C C     . LYS E 1 267 ? -21.913 -14.657 -82.376  1.00 84.69  ?  267 LYS D C     1 
ATOM   5027  O O     . LYS E 1 267 ? -22.213 -14.267 -83.504  1.00 82.83  ?  267 LYS D O     1 
ATOM   5028  C CB    . LYS E 1 267 ? -21.837 -12.920 -80.566  1.00 90.95  ?  267 LYS D CB    1 
ATOM   5029  C CG    . LYS E 1 267 ? -22.634 -12.083 -79.573  1.00 101.11 ?  267 LYS D CG    1 
ATOM   5030  C CD    . LYS E 1 267 ? -24.026 -11.751 -80.105  1.00 101.93 ?  267 LYS D CD    1 
ATOM   5031  C CE    . LYS E 1 267 ? -25.121 -12.423 -79.283  1.00 99.82  ?  267 LYS D CE    1 
ATOM   5032  N NZ    . LYS E 1 267 ? -26.427 -12.442 -79.999  1.00 103.80 1  267 LYS D NZ    1 
ATOM   5033  N N     . ASN E 1 268 ? -20.976 -15.570 -82.147  1.00 82.66  ?  268 ASN D N     1 
ATOM   5034  C CA    . ASN E 1 268 ? -20.234 -16.221 -83.218  1.00 62.56  ?  268 ASN D CA    1 
ATOM   5035  C C     . ASN E 1 268 ? -20.673 -17.672 -83.304  1.00 68.26  ?  268 ASN D C     1 
ATOM   5036  O O     . ASN E 1 268 ? -20.186 -18.526 -82.565  1.00 68.08  ?  268 ASN D O     1 
ATOM   5037  C CB    . ASN E 1 268 ? -18.729 -16.121 -82.981  1.00 53.85  ?  268 ASN D CB    1 
ATOM   5038  C CG    . ASN E 1 268 ? -18.273 -14.695 -82.758  1.00 79.64  ?  268 ASN D CG    1 
ATOM   5039  O OD1   . ASN E 1 268 ? -18.189 -13.906 -83.699  1.00 97.31  ?  268 ASN D OD1   1 
ATOM   5040  N ND2   . ASN E 1 268 ? -17.976 -14.356 -81.509  1.00 71.40  ?  268 ASN D ND2   1 
ATOM   5041  N N     . HIS E 1 269 ? -21.592 -17.945 -84.224  1.00 67.93  ?  269 HIS D N     1 
ATOM   5042  C CA    . HIS E 1 269 ? -22.393 -19.158 -84.166  1.00 67.31  ?  269 HIS D CA    1 
ATOM   5043  C C     . HIS E 1 269 ? -21.605 -20.402 -84.546  1.00 57.41  ?  269 HIS D C     1 
ATOM   5044  O O     . HIS E 1 269 ? -20.863 -20.411 -85.528  1.00 65.81  ?  269 HIS D O     1 
ATOM   5045  C CB    . HIS E 1 269 ? -23.600 -19.031 -85.100  1.00 73.66  ?  269 HIS D CB    1 
ATOM   5046  C CG    . HIS E 1 269 ? -24.589 -17.988 -84.680  1.00 92.82  ?  269 HIS D CG    1 
ATOM   5047  N ND1   . HIS E 1 269 ? -24.212 -16.751 -84.203  1.00 87.77  ?  269 HIS D ND1   1 
ATOM   5048  C CD2   . HIS E 1 269 ? -25.944 -17.994 -84.680  1.00 104.40 ?  269 HIS D CD2   1 
ATOM   5049  C CE1   . HIS E 1 269 ? -25.290 -16.043 -83.920  1.00 105.90 ?  269 HIS D CE1   1 
ATOM   5050  N NE2   . HIS E 1 269 ? -26.354 -16.774 -84.199  1.00 120.47 ?  269 HIS D NE2   1 
ATOM   5051  N N     . ILE E 1 270 ? -21.780 -21.454 -83.753  1.00 66.39  ?  270 ILE D N     1 
ATOM   5052  C CA    . ILE E 1 270 ? -21.326 -22.784 -84.125  1.00 64.12  ?  270 ILE D CA    1 
ATOM   5053  C C     . ILE E 1 270 ? -22.201 -23.270 -85.272  1.00 59.66  ?  270 ILE D C     1 
ATOM   5054  O O     . ILE E 1 270 ? -23.409 -23.032 -85.275  1.00 53.02  ?  270 ILE D O     1 
ATOM   5055  C CB    . ILE E 1 270 ? -21.401 -23.762 -82.929  1.00 59.81  ?  270 ILE D CB    1 
ATOM   5056  C CG1   . ILE E 1 270 ? -20.433 -23.330 -81.826  1.00 58.00  ?  270 ILE D CG1   1 
ATOM   5057  C CG2   . ILE E 1 270 ? -21.122 -25.194 -83.364  1.00 59.87  ?  270 ILE D CG2   1 
ATOM   5058  C CD1   . ILE E 1 270 ? -18.974 -23.476 -82.198  1.00 58.59  ?  270 ILE D CD1   1 
ATOM   5059  N N     . ILE E 1 271 ? -21.605 -23.953 -86.243  1.00 66.85  ?  271 ILE D N     1 
ATOM   5060  C CA    . ILE E 1 271 ? -22.388 -24.519 -87.330  1.00 56.30  ?  271 ILE D CA    1 
ATOM   5061  C C     . ILE E 1 271 ? -22.409 -26.039 -87.259  1.00 43.73  ?  271 ILE D C     1 
ATOM   5062  O O     . ILE E 1 271 ? -21.569 -26.659 -86.608  1.00 45.79  ?  271 ILE D O     1 
ATOM   5063  C CB    . ILE E 1 271 ? -21.857 -24.069 -88.704  1.00 62.00  ?  271 ILE D CB    1 
ATOM   5064  C CG1   . ILE E 1 271 ? -20.406 -24.514 -88.896  1.00 86.25  ?  271 ILE D CG1   1 
ATOM   5065  C CG2   . ILE E 1 271 ? -21.967 -22.561 -88.845  1.00 53.49  ?  271 ILE D CG2   1 
ATOM   5066  C CD1   . ILE E 1 271 ? -19.834 -24.150 -90.254  1.00 44.74  ?  271 ILE D CD1   1 
ATOM   5067  N N     . GLY E 1 272 ? -23.381 -26.627 -87.943  1.00 45.31  ?  272 GLY D N     1 
ATOM   5068  C CA    . GLY E 1 272 ? -23.501 -28.065 -88.064  1.00 42.73  ?  272 GLY D CA    1 
ATOM   5069  C C     . GLY E 1 272 ? -24.203 -28.660 -86.861  1.00 49.13  ?  272 GLY D C     1 
ATOM   5070  O O     . GLY E 1 272 ? -24.620 -27.931 -85.964  1.00 70.15  ?  272 GLY D O     1 
ATOM   5071  N N     . VAL E 1 273 ? -24.332 -29.984 -86.842  1.00 50.33  ?  273 VAL D N     1 
ATOM   5072  C CA    . VAL E 1 273 ? -24.997 -30.685 -85.744  1.00 54.75  ?  273 VAL D CA    1 
ATOM   5073  C C     . VAL E 1 273 ? -24.438 -30.374 -84.350  1.00 61.62  ?  273 VAL D C     1 
ATOM   5074  O O     . VAL E 1 273 ? -25.184 -30.349 -83.365  1.00 68.92  ?  273 VAL D O     1 
ATOM   5075  C CB    . VAL E 1 273 ? -24.924 -32.213 -85.982  1.00 61.95  ?  273 VAL D CB    1 
ATOM   5076  C CG1   . VAL E 1 273 ? -25.378 -32.995 -84.754  1.00 65.36  ?  273 VAL D CG1   1 
ATOM   5077  C CG2   . VAL E 1 273 ? -25.766 -32.594 -87.189  1.00 71.56  ?  273 VAL D CG2   1 
ATOM   5078  N N     . LYS E 1 274 ? -23.145 -30.069 -84.274  1.00 60.00  ?  274 LYS D N     1 
ATOM   5079  C CA    . LYS E 1 274 ? -22.514 -29.748 -82.994  1.00 64.53  ?  274 LYS D CA    1 
ATOM   5080  C C     . LYS E 1 274 ? -23.119 -28.545 -82.277  1.00 67.89  ?  274 LYS D C     1 
ATOM   5081  O O     . LYS E 1 274 ? -23.067 -28.461 -81.045  1.00 83.07  ?  274 LYS D O     1 
ATOM   5082  C CB    . LYS E 1 274 ? -21.017 -29.506 -83.199  1.00 50.85  ?  274 LYS D CB    1 
ATOM   5083  N N     . LEU E 1 275 ? -23.813 -27.697 -83.030  1.00 57.87  ?  275 LEU D N     1 
ATOM   5084  C CA    . LEU E 1 275 ? -24.490 -26.548 -82.447  1.00 62.45  ?  275 LEU D CA    1 
ATOM   5085  C C     . LEU E 1 275 ? -25.568 -27.012 -81.494  1.00 70.61  ?  275 LEU D C     1 
ATOM   5086  O O     . LEU E 1 275 ? -25.714 -26.471 -80.395  1.00 78.64  ?  275 LEU D O     1 
ATOM   5087  C CB    . LEU E 1 275 ? -25.091 -25.659 -83.538  1.00 67.50  ?  275 LEU D CB    1 
ATOM   5088  N N     . GLN E 1 276 ? -26.246 -28.090 -81.863  1.00 64.84  ?  276 GLN D N     1 
ATOM   5089  C CA    . GLN E 1 276 ? -27.297 -28.612 -81.015  1.00 84.87  ?  276 GLN D CA    1 
ATOM   5090  C C     . GLN E 1 276 ? -26.675 -29.158 -79.741  1.00 81.73  ?  276 GLN D C     1 
ATOM   5091  O O     . GLN E 1 276 ? -27.197 -28.920 -78.646  1.00 75.87  ?  276 GLN D O     1 
ATOM   5092  C CB    . GLN E 1 276 ? -28.092 -29.699 -81.740  1.00 84.39  ?  276 GLN D CB    1 
ATOM   5093  N N     . ASP E 1 277 ? -25.502 -29.777 -79.862  1.00 77.93  ?  277 ASP D N     1 
ATOM   5094  C CA    . ASP E 1 277 ? -24.832 -30.275 -78.672  1.00 55.21  ?  277 ASP D CA    1 
ATOM   5095  C C     . ASP E 1 277 ? -24.460 -29.084 -77.819  1.00 48.48  ?  277 ASP D C     1 
ATOM   5096  O O     . ASP E 1 277 ? -24.711 -29.075 -76.608  1.00 71.13  ?  277 ASP D O     1 
ATOM   5097  C CB    . ASP E 1 277 ? -23.590 -31.098 -79.021  1.00 55.12  ?  277 ASP D CB    1 
ATOM   5098  C CG    . ASP E 1 277 ? -23.924 -32.370 -79.772  1.00 75.57  ?  277 ASP D CG    1 
ATOM   5099  O OD1   . ASP E 1 277 ? -24.910 -33.039 -79.400  1.00 82.22  ?  277 ASP D OD1   1 
ATOM   5100  O OD2   . ASP E 1 277 ? -23.195 -32.706 -80.729  1.00 82.88  -1 277 ASP D OD2   1 
ATOM   5101  N N     . TYR E 1 278 ? -24.005 -28.026 -78.485  1.00 48.78  ?  278 TYR D N     1 
ATOM   5102  C CA    . TYR E 1 278 ? -23.676 -26.792 -77.799  1.00 54.74  ?  278 TYR D CA    1 
ATOM   5103  C C     . TYR E 1 278 ? -24.894 -26.311 -77.042  1.00 72.37  ?  278 TYR D C     1 
ATOM   5104  O O     . TYR E 1 278 ? -24.808 -26.020 -75.844  1.00 74.36  ?  278 TYR D O     1 
ATOM   5105  C CB    . TYR E 1 278 ? -23.197 -25.733 -78.795  1.00 53.37  ?  278 TYR D CB    1 
ATOM   5106  C CG    . TYR E 1 278 ? -22.968 -24.362 -78.201  1.00 46.58  ?  278 TYR D CG    1 
ATOM   5107  C CD1   . TYR E 1 278 ? -21.915 -24.123 -77.331  1.00 52.21  ?  278 TYR D CD1   1 
ATOM   5108  C CD2   . TYR E 1 278 ? -23.805 -23.302 -78.524  1.00 62.21  ?  278 TYR D CD2   1 
ATOM   5109  C CE1   . TYR E 1 278 ? -21.707 -22.867 -76.789  1.00 67.23  ?  278 TYR D CE1   1 
ATOM   5110  C CE2   . TYR E 1 278 ? -23.604 -22.044 -77.992  1.00 73.74  ?  278 TYR D CE2   1 
ATOM   5111  C CZ    . TYR E 1 278 ? -22.555 -21.832 -77.124  1.00 74.86  ?  278 TYR D CZ    1 
ATOM   5112  O OH    . TYR E 1 278 ? -22.350 -20.578 -76.597  1.00 80.78  ?  278 TYR D OH    1 
ATOM   5113  N N     . ARG E 1 279 ? -26.043 -26.315 -77.709  1.00 75.91  ?  279 ARG D N     1 
ATOM   5114  C CA    . ARG E 1 279 ? -27.253 -25.850 -77.060  1.00 74.89  ?  279 ARG D CA    1 
ATOM   5115  C C     . ARG E 1 279 ? -27.547 -26.699 -75.827  1.00 68.34  ?  279 ARG D C     1 
ATOM   5116  O O     . ARG E 1 279 ? -27.722 -26.159 -74.727  1.00 68.29  ?  279 ARG D O     1 
ATOM   5117  C CB    . ARG E 1 279 ? -28.435 -25.891 -78.031  1.00 72.73  ?  279 ARG D CB    1 
ATOM   5118  C CG    . ARG E 1 279 ? -28.366 -24.851 -79.145  1.00 80.49  ?  279 ARG D CG    1 
ATOM   5119  C CD    . ARG E 1 279 ? -28.194 -23.440 -78.602  1.00 89.32  ?  279 ARG D CD    1 
ATOM   5120  N NE    . ARG E 1 279 ? -29.437 -22.894 -78.067  1.00 96.85  ?  279 ARG D NE    1 
ATOM   5121  C CZ    . ARG E 1 279 ? -29.498 -22.000 -77.085  1.00 100.08 ?  279 ARG D CZ    1 
ATOM   5122  N NH1   . ARG E 1 279 ? -28.383 -21.550 -76.526  1.00 104.99 1  279 ARG D NH1   1 
ATOM   5123  N NH2   . ARG E 1 279 ? -30.673 -21.556 -76.662  1.00 94.25  ?  279 ARG D NH2   1 
ATOM   5124  N N     . ASP E 1 280 ? -27.470 -28.021 -75.980  1.00 61.10  ?  280 ASP D N     1 
ATOM   5125  C CA    . ASP E 1 280 ? -27.687 -28.901 -74.840  1.00 61.30  ?  280 ASP D CA    1 
ATOM   5126  C C     . ASP E 1 280 ? -26.659 -28.628 -73.767  1.00 66.74  ?  280 ASP D C     1 
ATOM   5127  O O     . ASP E 1 280 ? -26.993 -28.520 -72.583  1.00 66.63  ?  280 ASP D O     1 
ATOM   5128  C CB    . ASP E 1 280 ? -27.619 -30.373 -75.259  1.00 60.34  ?  280 ASP D CB    1 
ATOM   5129  C CG    . ASP E 1 280 ? -28.860 -30.833 -75.997  1.00 77.18  ?  280 ASP D CG    1 
ATOM   5130  O OD1   . ASP E 1 280 ? -29.878 -30.110 -75.967  1.00 73.32  ?  280 ASP D OD1   1 
ATOM   5131  O OD2   . ASP E 1 280 ? -28.817 -31.923 -76.604  1.00 81.63  -1 280 ASP D OD2   1 
ATOM   5132  N N     . TRP E 1 281 ? -25.420 -28.437 -74.201  1.00 65.41  ?  281 TRP D N     1 
ATOM   5133  C CA    . TRP E 1 281 ? -24.348 -28.133 -73.280  1.00 58.02  ?  281 TRP D CA    1 
ATOM   5134  C C     . TRP E 1 281 ? -24.654 -26.860 -72.504  1.00 63.13  ?  281 TRP D C     1 
ATOM   5135  O O     . TRP E 1 281 ? -24.624 -26.863 -71.261  1.00 65.22  ?  281 TRP D O     1 
ATOM   5136  C CB    . TRP E 1 281 ? -23.040 -28.007 -74.072  1.00 49.15  ?  281 TRP D CB    1 
ATOM   5137  C CG    . TRP E 1 281 ? -21.786 -27.828 -73.280  1.00 50.50  ?  281 TRP D CG    1 
ATOM   5138  C CD1   . TRP E 1 281 ? -21.090 -28.795 -72.616  1.00 54.97  ?  281 TRP D CD1   1 
ATOM   5139  C CD2   . TRP E 1 281 ? -21.035 -26.617 -73.126  1.00 38.45  ?  281 TRP D CD2   1 
ATOM   5140  N NE1   . TRP E 1 281 ? -19.970 -28.255 -72.031  1.00 48.98  ?  281 TRP D NE1   1 
ATOM   5141  C CE2   . TRP E 1 281 ? -19.913 -26.919 -72.331  1.00 37.44  ?  281 TRP D CE2   1 
ATOM   5142  C CE3   . TRP E 1 281 ? -21.213 -25.303 -73.570  1.00 36.09  ?  281 TRP D CE3   1 
ATOM   5143  C CZ2   . TRP E 1 281 ? -18.973 -25.957 -71.971  1.00 37.11  ?  281 TRP D CZ2   1 
ATOM   5144  C CZ3   . TRP E 1 281 ? -20.277 -24.349 -73.212  1.00 33.94  ?  281 TRP D CZ3   1 
ATOM   5145  C CH2   . TRP E 1 281 ? -19.173 -24.681 -72.420  1.00 37.67  ?  281 TRP D CH2   1 
ATOM   5146  N N     . CYS E 1 282 ? -25.141 -25.846 -73.219  1.00 62.14  ?  282 CYS D N     1 
ATOM   5147  C CA    . CYS E 1 282 ? -25.544 -24.605 -72.570  1.00 68.91  ?  282 CYS D CA    1 
ATOM   5148  C C     . CYS E 1 282 ? -26.601 -24.849 -71.515  1.00 73.70  ?  282 CYS D C     1 
ATOM   5149  O O     . CYS E 1 282 ? -26.487 -24.362 -70.384  1.00 65.84  ?  282 CYS D O     1 
ATOM   5150  C CB    . CYS E 1 282 ? -26.058 -23.602 -73.605  1.00 74.08  ?  282 CYS D CB    1 
ATOM   5151  S SG    . CYS E 1 282 ? -24.767 -22.831 -74.605  1.00 99.31  ?  282 CYS D SG    1 
ATOM   5152  N N     . LYS E 1 283 ? -27.558 -25.705 -71.847  1.00 68.58  ?  283 LYS D N     1 
ATOM   5153  C CA    . LYS E 1 283 ? -28.661 -25.959 -70.945  1.00 73.32  ?  283 LYS D CA    1 
ATOM   5154  C C     . LYS E 1 283 ? -28.149 -26.582 -69.659  1.00 69.46  ?  283 LYS D C     1 
ATOM   5155  O O     . LYS E 1 283 ? -28.494 -26.129 -68.560  1.00 66.30  ?  283 LYS D O     1 
ATOM   5156  C CB    . LYS E 1 283 ? -29.701 -26.866 -71.606  1.00 68.14  ?  283 LYS D CB    1 
ATOM   5157  N N     . VAL E 1 284 ? -27.221 -27.523 -69.792  1.00 65.55  ?  284 VAL D N     1 
ATOM   5158  C CA    . VAL E 1 284 ? -26.686 -28.160 -68.603  1.00 44.33  ?  284 VAL D CA    1 
ATOM   5159  C C     . VAL E 1 284 ? -25.894 -27.159 -67.785  1.00 56.77  ?  284 VAL D C     1 
ATOM   5160  O O     . VAL E 1 284 ? -26.010 -27.130 -66.553  1.00 68.29  ?  284 VAL D O     1 
ATOM   5161  C CB    . VAL E 1 284 ? -25.802 -29.369 -68.960  1.00 46.74  ?  284 VAL D CB    1 
ATOM   5162  C CG1   . VAL E 1 284 ? -25.037 -29.849 -67.739  1.00 47.14  ?  284 VAL D CG1   1 
ATOM   5163  C CG2   . VAL E 1 284 ? -26.655 -30.492 -69.518  1.00 52.83  ?  284 VAL D CG2   1 
ATOM   5164  N N     . VAL E 1 285 ? -25.186 -26.265 -68.468  1.00 51.29  ?  285 VAL D N     1 
ATOM   5165  C CA    . VAL E 1 285 ? -24.438 -25.242 -67.760  1.00 64.08  ?  285 VAL D CA    1 
ATOM   5166  C C     . VAL E 1 285 ? -25.382 -24.388 -66.925  1.00 68.55  ?  285 VAL D C     1 
ATOM   5167  O O     . VAL E 1 285 ? -25.105 -24.116 -65.749  1.00 68.73  ?  285 VAL D O     1 
ATOM   5168  C CB    . VAL E 1 285 ? -23.649 -24.340 -68.735  1.00 65.01  ?  285 VAL D CB    1 
ATOM   5169  C CG1   . VAL E 1 285 ? -23.085 -23.124 -68.010  1.00 65.84  ?  285 VAL D CG1   1 
ATOM   5170  C CG2   . VAL E 1 285 ? -22.531 -25.126 -69.402  1.00 51.59  ?  285 VAL D CG2   1 
ATOM   5171  N N     . THR E 1 286 ? -26.556 -24.095 -67.479  1.00 72.78  ?  286 THR D N     1 
ATOM   5172  C CA    . THR E 1 286 ? -27.560 -23.350 -66.734  1.00 69.97  ?  286 THR D CA    1 
ATOM   5173  C C     . THR E 1 286 ? -27.947 -24.099 -65.471  1.00 70.67  ?  286 THR D C     1 
ATOM   5174  O O     . THR E 1 286 ? -27.870 -23.545 -64.366  1.00 69.22  ?  286 THR D O     1 
ATOM   5175  C CB    . THR E 1 286 ? -28.818 -23.081 -67.581  1.00 64.85  ?  286 THR D CB    1 
ATOM   5176  O OG1   . THR E 1 286 ? -28.457 -22.360 -68.765  1.00 93.05  ?  286 THR D OG1   1 
ATOM   5177  C CG2   . THR E 1 286 ? -29.826 -22.267 -66.789  1.00 65.89  ?  286 THR D CG2   1 
ATOM   5178  N N     . LEU E 1 287 ? -28.240 -25.387 -65.626  1.00 66.33  ?  287 LEU D N     1 
ATOM   5179  C CA    . LEU E 1 287 ? -28.592 -26.228 -64.492  1.00 63.95  ?  287 LEU D CA    1 
ATOM   5180  C C     . LEU E 1 287 ? -27.474 -26.216 -63.467  1.00 72.61  ?  287 LEU D C     1 
ATOM   5181  O O     . LEU E 1 287 ? -27.730 -26.188 -62.263  1.00 71.41  ?  287 LEU D O     1 
ATOM   5182  C CB    . LEU E 1 287 ? -28.890 -27.658 -64.946  1.00 58.22  ?  287 LEU D CB    1 
ATOM   5183  C CG    . LEU E 1 287 ? -30.059 -27.812 -65.921  1.00 78.55  ?  287 LEU D CG    1 
ATOM   5184  C CD1   . LEU E 1 287 ? -30.149 -29.243 -66.429  1.00 62.06  ?  287 LEU D CD1   1 
ATOM   5185  C CD2   . LEU E 1 287 ? -31.368 -27.382 -65.272  1.00 94.18  ?  287 LEU D CD2   1 
ATOM   5186  N N     . ILE E 1 288 ? -26.235 -26.235 -63.941  1.00 75.74  ?  288 ILE D N     1 
ATOM   5187  C CA    . ILE E 1 288 ? -25.105 -26.208 -63.028  1.00 70.07  ?  288 ILE D CA    1 
ATOM   5188  C C     . ILE E 1 288 ? -25.041 -24.870 -62.295  1.00 61.63  ?  288 ILE D C     1 
ATOM   5189  O O     . ILE E 1 288 ? -24.854 -24.836 -61.078  1.00 60.98  ?  288 ILE D O     1 
ATOM   5190  C CB    . ILE E 1 288 ? -23.779 -26.476 -63.755  1.00 74.67  ?  288 ILE D CB    1 
ATOM   5191  C CG1   . ILE E 1 288 ? -23.774 -27.901 -64.308  1.00 62.69  ?  288 ILE D CG1   1 
ATOM   5192  C CG2   . ILE E 1 288 ? -22.605 -26.286 -62.808  1.00 63.11  ?  288 ILE D CG2   1 
ATOM   5193  C CD1   . ILE E 1 288 ? -22.490 -28.284 -64.997  1.00 62.00  ?  288 ILE D CD1   1 
ATOM   5194  N N     . ASP E 1 289 ? -25.281 -23.795 -63.010  1.00 65.19  ?  289 ASP D N     1 
ATOM   5195  C CA    . ASP E 1 289 ? -25.223 -22.477 -62.429  1.00 68.94  ?  289 ASP D CA    1 
ATOM   5196  C C     . ASP E 1 289 ? -26.194 -22.312 -61.307  1.00 75.07  ?  289 ASP D C     1 
ATOM   5197  O O     . ASP E 1 289 ? -25.971 -21.574 -60.369  1.00 65.21  ?  289 ASP D O     1 
ATOM   5198  C CB    . ASP E 1 289 ? -25.556 -21.450 -63.480  1.00 57.36  ?  289 ASP D CB    1 
ATOM   5199  C CG    . ASP E 1 289 ? -25.123 -20.091 -63.087  1.00 76.86  ?  289 ASP D CG    1 
ATOM   5200  O OD1   . ASP E 1 289 ? -24.812 -19.901 -61.905  1.00 91.65  ?  289 ASP D OD1   1 
ATOM   5201  O OD2   . ASP E 1 289 ? -25.072 -19.210 -63.951  1.00 84.06  -1 289 ASP D OD2   1 
ATOM   5202  N N     . ASN E 1 290 ? -27.315 -22.976 -61.437  1.00 71.84  ?  290 ASN D N     1 
ATOM   5203  C CA    . ASN E 1 290 ? -28.358 -22.906 -60.420  1.00 60.92  ?  290 ASN D CA    1 
ATOM   5204  C C     . ASN E 1 290 ? -28.270 -24.033 -59.395  1.00 57.86  ?  290 ASN D C     1 
ATOM   5205  O O     . ASN E 1 290 ? -29.239 -24.314 -58.689  1.00 55.32  ?  290 ASN D O     1 
ATOM   5206  C CB    . ASN E 1 290 ? -29.739 -22.901 -61.078  1.00 65.64  ?  290 ASN D CB    1 
ATOM   5207  C CG    . ASN E 1 290 ? -29.984 -21.652 -61.902  1.00 82.10  ?  290 ASN D CG    1 
ATOM   5208  O OD1   . ASN E 1 290 ? -29.563 -20.556 -61.526  1.00 78.14  ?  290 ASN D OD1   1 
ATOM   5209  N ND2   . ASN E 1 290 ? -30.669 -21.809 -63.029  1.00 82.26  ?  290 ASN D ND2   1 
ATOM   5210  N N     . LYS E 1 291 ? -27.108 -24.680 -59.336  1.00 59.37  ?  291 LYS D N     1 
ATOM   5211  C CA    . LYS E 1 291 ? -26.794 -25.663 -58.299  1.00 59.20  ?  291 LYS D CA    1 
ATOM   5212  C C     . LYS E 1 291 ? -27.694 -26.899 -58.325  1.00 59.41  ?  291 LYS D C     1 
ATOM   5213  O O     . LYS E 1 291 ? -27.745 -27.653 -57.353  1.00 73.58  ?  291 LYS D O     1 
ATOM   5214  C CB    . LYS E 1 291 ? -26.854 -25.010 -56.914  1.00 56.45  ?  291 LYS D CB    1 
ATOM   5215  N N     . GLU E 1 292 ? -28.395 -27.110 -59.434  1.00 55.09  ?  292 GLU D N     1 
ATOM   5216  C CA    . GLU E 1 292 ? -29.303 -28.247 -59.558  1.00 55.02  ?  292 GLU D CA    1 
ATOM   5217  C C     . GLU E 1 292 ? -28.527 -29.554 -59.714  1.00 62.55  ?  292 GLU D C     1 
ATOM   5218  O O     . GLU E 1 292 ? -29.075 -30.640 -59.532  1.00 70.42  ?  292 GLU D O     1 
ATOM   5219  C CB    . GLU E 1 292 ? -30.251 -28.051 -60.744  1.00 56.98  ?  292 GLU D CB    1 
ATOM   5220  N N     . HIS E 1 293 ? -27.247 -29.433 -60.052  1.00 64.05  ?  293 HIS D N     1 
ATOM   5221  C CA    . HIS E 1 293 ? -26.339 -30.574 -60.159  1.00 69.43  ?  293 HIS D CA    1 
ATOM   5222  C C     . HIS E 1 293 ? -26.010 -31.159 -58.786  1.00 71.62  ?  293 HIS D C     1 
ATOM   5223  O O     . HIS E 1 293 ? -25.455 -32.254 -58.684  1.00 72.24  ?  293 HIS D O     1 
ATOM   5224  C CB    . HIS E 1 293 ? -25.048 -30.179 -60.879  1.00 56.42  ?  293 HIS D CB    1 
ATOM   5225  C CG    . HIS E 1 293 ? -24.235 -29.157 -60.150  1.00 53.39  ?  293 HIS D CG    1 
ATOM   5226  N ND1   . HIS E 1 293 ? -24.700 -27.888 -59.878  1.00 58.32  ?  293 HIS D ND1   1 
ATOM   5227  C CD2   . HIS E 1 293 ? -22.984 -29.217 -59.635  1.00 46.20  ?  293 HIS D CD2   1 
ATOM   5228  C CE1   . HIS E 1 293 ? -23.771 -27.211 -59.228  1.00 49.65  ?  293 HIS D CE1   1 
ATOM   5229  N NE2   . HIS E 1 293 ? -22.720 -27.994 -59.068  1.00 48.14  ?  293 HIS D NE2   1 
ATOM   5230  N N     . LEU E 1 294 ? -26.345 -30.415 -57.737  1.00 68.58  ?  294 LEU D N     1 
ATOM   5231  C CA    . LEU E 1 294 ? -26.072 -30.825 -56.362  1.00 75.77  ?  294 LEU D CA    1 
ATOM   5232  C C     . LEU E 1 294 ? -27.219 -31.618 -55.735  1.00 77.87  ?  294 LEU D C     1 
ATOM   5233  O O     . LEU E 1 294 ? -27.204 -31.900 -54.537  1.00 87.26  ?  294 LEU D O     1 
ATOM   5234  C CB    . LEU E 1 294 ? -25.767 -29.598 -55.500  1.00 71.36  ?  294 LEU D CB    1 
ATOM   5235  C CG    . LEU E 1 294 ? -24.573 -28.744 -55.932  1.00 62.72  ?  294 LEU D CG    1 
ATOM   5236  C CD1   . LEU E 1 294 ? -24.544 -27.427 -55.171  1.00 53.34  ?  294 LEU D CD1   1 
ATOM   5237  C CD2   . LEU E 1 294 ? -23.271 -29.508 -55.740  1.00 60.72  ?  294 LEU D CD2   1 
ATOM   5238  N N     . THR E 1 295 ? -28.208 -31.977 -56.546  1.00 82.25  ?  295 THR D N     1 
ATOM   5239  C CA    . THR E 1 295 ? -29.305 -32.824 -56.088  1.00 66.93  ?  295 THR D CA    1 
ATOM   5240  C C     . THR E 1 295 ? -29.330 -34.112 -56.908  1.00 88.19  ?  295 THR D C     1 
ATOM   5241  O O     . THR E 1 295 ? -28.880 -34.133 -58.054  1.00 101.05 ?  295 THR D O     1 
ATOM   5242  C CB    . THR E 1 295 ? -30.672 -32.114 -56.195  1.00 67.68  ?  295 THR D CB    1 
ATOM   5243  O OG1   . THR E 1 295 ? -31.073 -32.039 -57.569  1.00 71.55  ?  295 THR D OG1   1 
ATOM   5244  C CG2   . THR E 1 295 ? -30.591 -30.709 -55.622  1.00 76.80  ?  295 THR D CG2   1 
ATOM   5245  N N     . SER E 1 296 ? -29.851 -35.181 -56.313  1.00 89.05  ?  296 SER D N     1 
ATOM   5246  C CA    . SER E 1 296 ? -29.962 -36.474 -56.988  1.00 95.44  ?  296 SER D CA    1 
ATOM   5247  C C     . SER E 1 296 ? -30.802 -36.400 -58.262  1.00 98.47  ?  296 SER D C     1 
ATOM   5248  O O     . SER E 1 296 ? -30.396 -36.904 -59.313  1.00 100.61 ?  296 SER D O     1 
ATOM   5249  C CB    . SER E 1 296 ? -30.555 -37.516 -56.036  1.00 96.89  ?  296 SER D CB    1 
ATOM   5250  O OG    . SER E 1 296 ? -31.841 -37.125 -55.589  1.00 104.47 ?  296 SER D OG    1 
ATOM   5251  N N     . GLU E 1 297 ? -31.968 -35.769 -58.160  1.00 97.83  ?  297 GLU D N     1 
ATOM   5252  C CA    . GLU E 1 297 ? -32.881 -35.641 -59.292  1.00 97.09  ?  297 GLU D CA    1 
ATOM   5253  C C     . GLU E 1 297 ? -32.221 -34.875 -60.435  1.00 89.85  ?  297 GLU D C     1 
ATOM   5254  O O     . GLU E 1 297 ? -32.279 -35.295 -61.595  1.00 88.61  ?  297 GLU D O     1 
ATOM   5255  C CB    . GLU E 1 297 ? -34.174 -34.945 -58.863  1.00 98.63  ?  297 GLU D CB    1 
ATOM   5256  N N     . GLY E 1 298 ? -31.593 -33.753 -60.097  1.00 80.01  ?  298 GLY D N     1 
ATOM   5257  C CA    . GLY E 1 298 ? -30.899 -32.946 -61.082  1.00 75.25  ?  298 GLY D CA    1 
ATOM   5258  C C     . GLY E 1 298 ? -29.743 -33.700 -61.712  1.00 84.32  ?  298 GLY D C     1 
ATOM   5259  O O     . GLY E 1 298 ? -29.499 -33.578 -62.911  1.00 93.41  ?  298 GLY D O     1 
ATOM   5260  N N     . LEU E 1 299 ? -29.021 -34.470 -60.903  1.00 75.14  ?  299 LEU D N     1 
ATOM   5261  C CA    . LEU E 1 299 ? -27.917 -35.282 -61.407  1.00 72.67  ?  299 LEU D CA    1 
ATOM   5262  C C     . LEU E 1 299 ? -28.410 -36.323 -62.412  1.00 85.13  ?  299 LEU D C     1 
ATOM   5263  O O     . LEU E 1 299 ? -27.769 -36.563 -63.440  1.00 94.21  ?  299 LEU D O     1 
ATOM   5264  C CB    . LEU E 1 299 ? -27.180 -35.968 -60.257  1.00 73.14  ?  299 LEU D CB    1 
ATOM   5265  C CG    . LEU E 1 299 ? -26.052 -36.914 -60.672  1.00 70.45  ?  299 LEU D CG    1 
ATOM   5266  C CD1   . LEU E 1 299 ? -25.035 -36.187 -61.535  1.00 70.42  ?  299 LEU D CD1   1 
ATOM   5267  C CD2   . LEU E 1 299 ? -25.381 -37.521 -59.452  1.00 89.20  ?  299 LEU D CD2   1 
ATOM   5268  N N     . GLU E 1 300 ? -29.552 -36.935 -62.109  1.00 87.22  ?  300 GLU D N     1 
ATOM   5269  C CA    . GLU E 1 300 ? -30.196 -37.860 -63.037  1.00 89.42  ?  300 GLU D CA    1 
ATOM   5270  C C     . GLU E 1 300 ? -30.561 -37.147 -64.334  1.00 91.76  ?  300 GLU D C     1 
ATOM   5271  O O     . GLU E 1 300 ? -30.341 -37.675 -65.429  1.00 89.39  ?  300 GLU D O     1 
ATOM   5272  C CB    . GLU E 1 300 ? -31.442 -38.482 -62.402  1.00 78.81  ?  300 GLU D CB    1 
ATOM   5273  N N     . LYS E 1 301 ? -31.121 -35.947 -64.197  1.00 85.13  ?  301 LYS D N     1 
ATOM   5274  C CA    . LYS E 1 301 ? -31.458 -35.102 -65.340  1.00 85.13  ?  301 LYS D CA    1 
ATOM   5275  C C     . LYS E 1 301 ? -30.242 -34.910 -66.244  1.00 98.66  ?  301 LYS D C     1 
ATOM   5276  O O     . LYS E 1 301 ? -30.302 -35.148 -67.454  1.00 89.24  ?  301 LYS D O     1 
ATOM   5277  C CB    . LYS E 1 301 ? -31.993 -33.747 -64.872  1.00 60.73  ?  301 LYS D CB    1 
ATOM   5278  N N     . ILE E 1 302 ? -29.140 -34.475 -65.640  1.00 94.49  ?  302 ILE D N     1 
ATOM   5279  C CA    . ILE E 1 302 ? -27.922 -34.177 -66.380  1.00 88.74  ?  302 ILE D CA    1 
ATOM   5280  C C     . ILE E 1 302 ? -27.374 -35.430 -67.051  1.00 88.18  ?  302 ILE D C     1 
ATOM   5281  O O     . ILE E 1 302 ? -26.995 -35.379 -68.213  1.00 89.55  ?  302 ILE D O     1 
ATOM   5282  C CB    . ILE E 1 302 ? -26.840 -33.564 -65.469  1.00 84.07  ?  302 ILE D CB    1 
ATOM   5283  C CG1   . ILE E 1 302 ? -27.253 -32.158 -65.034  1.00 68.23  ?  302 ILE D CG1   1 
ATOM   5284  C CG2   . ILE E 1 302 ? -25.500 -33.505 -66.185  1.00 90.96  ?  302 ILE D CG2   1 
ATOM   5285  C CD1   . ILE E 1 302 ? -26.296 -31.519 -64.056  1.00 72.30  ?  302 ILE D CD1   1 
ATOM   5286  N N     . GLN E 1 303 ? -27.301 -36.540 -66.319  1.00 83.26  ?  303 GLN D N     1 
ATOM   5287  C CA    . GLN E 1 303 ? -26.890 -37.810 -66.920  1.00 87.59  ?  303 GLN D CA    1 
ATOM   5288  C C     . GLN E 1 303 ? -27.729 -38.132 -68.160  1.00 90.02  ?  303 GLN D C     1 
ATOM   5289  O O     . GLN E 1 303 ? -27.203 -38.547 -69.201  1.00 84.55  ?  303 GLN D O     1 
ATOM   5290  C CB    . GLN E 1 303 ? -27.000 -38.946 -65.900  1.00 79.08  ?  303 GLN D CB    1 
ATOM   5291  C CG    . GLN E 1 303 ? -26.823 -40.338 -66.491  1.00 104.62 ?  303 GLN D CG    1 
ATOM   5292  C CD    . GLN E 1 303 ? -25.411 -40.594 -66.986  1.00 103.79 ?  303 GLN D CD    1 
ATOM   5293  O OE1   . GLN E 1 303 ? -24.458 -39.950 -66.545  1.00 90.78  ?  303 GLN D OE1   1 
ATOM   5294  N NE2   . GLN E 1 303 ? -25.270 -41.540 -67.907  1.00 88.28  ?  303 GLN D NE2   1 
ATOM   5295  N N     . LYS E 1 304 ? -29.037 -37.912 -68.039  1.00 97.40  ?  304 LYS D N     1 
ATOM   5296  C CA    . LYS E 1 304 ? -29.975 -38.160 -69.131  1.00 87.49  ?  304 LYS D CA    1 
ATOM   5297  C C     . LYS E 1 304 ? -29.683 -37.284 -70.345  1.00 88.97  ?  304 LYS D C     1 
ATOM   5298  O O     . LYS E 1 304 ? -29.725 -37.753 -71.482  1.00 102.88 ?  304 LYS D O     1 
ATOM   5299  C CB    . LYS E 1 304 ? -31.414 -37.936 -68.661  1.00 87.28  ?  304 LYS D CB    1 
ATOM   5300  N N     . ILE E 1 305 ? -29.387 -36.012 -70.096  1.00 89.39  ?  305 ILE D N     1 
ATOM   5301  C CA    . ILE E 1 305 ? -29.044 -35.076 -71.166  1.00 92.98  ?  305 ILE D CA    1 
ATOM   5302  C C     . ILE E 1 305 ? -27.731 -35.470 -71.839  1.00 80.71  ?  305 ILE D C     1 
ATOM   5303  O O     . ILE E 1 305 ? -27.632 -35.502 -73.065  1.00 80.05  ?  305 ILE D O     1 
ATOM   5304  C CB    . ILE E 1 305 ? -28.938 -33.633 -70.644  1.00 91.87  ?  305 ILE D CB    1 
ATOM   5305  C CG1   . ILE E 1 305 ? -30.253 -33.208 -69.988  1.00 94.68  ?  305 ILE D CG1   1 
ATOM   5306  C CG2   . ILE E 1 305 ? -28.582 -32.685 -71.776  1.00 76.20  ?  305 ILE D CG2   1 
ATOM   5307  C CD1   . ILE E 1 305 ? -30.173 -31.885 -69.261  1.00 91.64  ?  305 ILE D CD1   1 
ATOM   5308  N N     . LYS E 1 306 ? -26.731 -35.762 -71.014  1.00 77.03  ?  306 LYS D N     1 
ATOM   5309  C CA    . LYS E 1 306 ? -25.407 -36.179 -71.458  1.00 79.49  ?  306 LYS D CA    1 
ATOM   5310  C C     . LYS E 1 306 ? -25.503 -37.392 -72.370  1.00 87.12  ?  306 LYS D C     1 
ATOM   5311  O O     . LYS E 1 306 ? -24.797 -37.477 -73.374  1.00 99.36  ?  306 LYS D O     1 
ATOM   5312  C CB    . LYS E 1 306 ? -24.510 -36.491 -70.258  1.00 65.31  ?  306 LYS D CB    1 
ATOM   5313  N N     . GLU E 1 307 ? -26.378 -38.329 -72.017  1.00 83.64  ?  307 GLU D N     1 
ATOM   5314  C CA    . GLU E 1 307 ? -26.519 -39.559 -72.788  1.00 89.91  ?  307 GLU D CA    1 
ATOM   5315  C C     . GLU E 1 307 ? -27.065 -39.264 -74.187  1.00 97.08  ?  307 GLU D C     1 
ATOM   5316  O O     . GLU E 1 307 ? -26.944 -40.084 -75.097  1.00 108.16 ?  307 GLU D O     1 
ATOM   5317  C CB    . GLU E 1 307 ? -27.434 -40.546 -72.061  1.00 83.84  ?  307 GLU D CB    1 
ATOM   5318  N N     . GLY E 1 308 ? -27.667 -38.089 -74.349  1.00 88.23  ?  308 GLY D N     1 
ATOM   5319  C CA    . GLY E 1 308 ? -28.221 -37.674 -75.626  1.00 99.54  ?  308 GLY D CA    1 
ATOM   5320  C C     . GLY E 1 308 ? -27.340 -36.694 -76.384  1.00 98.44  ?  308 GLY D C     1 
ATOM   5321  O O     . GLY E 1 308 ? -27.757 -36.135 -77.398  1.00 86.19  ?  308 GLY D O     1 
ATOM   5322  N N     . MET E 1 309 ? -26.122 -36.484 -75.892  1.00 99.03  ?  309 MET D N     1 
ATOM   5323  C CA    . MET E 1 309 ? -25.192 -35.539 -76.510  1.00 86.20  ?  309 MET D CA    1 
ATOM   5324  C C     . MET E 1 309 ? -24.077 -36.243 -77.276  1.00 91.42  ?  309 MET D C     1 
ATOM   5325  O O     . MET E 1 309 ? -23.752 -37.398 -76.994  1.00 85.28  ?  309 MET D O     1 
ATOM   5326  C CB    . MET E 1 309 ? -24.573 -34.614 -75.461  1.00 72.68  ?  309 MET D CB    1 
ATOM   5327  C CG    . MET E 1 309 ? -25.544 -33.656 -74.799  1.00 80.06  ?  309 MET D CG    1 
ATOM   5328  S SD    . MET E 1 309 ? -24.753 -32.754 -73.453  1.00 97.67  ?  309 MET D SD    1 
ATOM   5329  C CE    . MET E 1 309 ? -23.624 -31.705 -74.365  1.00 40.07  ?  309 MET D CE    1 
ATOM   5330  N N     . ASN E 1 310 ? -23.495 -35.527 -78.237  1.00 81.95  ?  310 ASN D N     1 
ATOM   5331  C CA    . ASN E 1 310 ? -22.301 -35.977 -78.950  1.00 75.29  ?  310 ASN D CA    1 
ATOM   5332  C C     . ASN E 1 310 ? -22.447 -37.368 -79.556  1.00 85.97  ?  310 ASN D C     1 
ATOM   5333  O O     . ASN E 1 310 ? -23.350 -37.611 -80.355  1.00 96.11  ?  310 ASN D O     1 
ATOM   5334  C CB    . ASN E 1 310 ? -21.087 -35.945 -78.020  1.00 65.89  ?  310 ASN D CB    1 
ATOM   5335  C CG    . ASN E 1 310 ? -20.781 -34.550 -77.510  1.00 71.84  ?  310 ASN D CG    1 
ATOM   5336  O OD1   . ASN E 1 310 ? -21.046 -33.558 -78.188  1.00 70.90  ?  310 ASN D OD1   1 
ATOM   5337  N ND2   . ASN E 1 310 ? -20.225 -34.468 -76.307  1.00 82.37  ?  310 ASN D ND2   1 
ATOM   5338  N N     . ARG E 1 311 ? -21.551 -38.274 -79.177  1.00 82.04  ?  311 ARG D N     1 
ATOM   5339  C CA    . ARG E 1 311 ? -21.544 -39.624 -79.729  1.00 86.00  ?  311 ARG D CA    1 
ATOM   5340  C C     . ARG E 1 311 ? -22.826 -40.401 -79.439  1.00 92.77  ?  311 ARG D C     1 
ATOM   5341  O O     . ARG E 1 311 ? -23.183 -41.309 -80.189  1.00 94.79  ?  311 ARG D O     1 
ATOM   5342  C CB    . ARG E 1 311 ? -20.345 -40.410 -79.194  1.00 90.17  ?  311 ARG D CB    1 
ATOM   5343  C CG    . ARG E 1 311 ? -19.100 -40.320 -80.060  1.00 90.66  ?  311 ARG D CG    1 
ATOM   5344  C CD    . ARG E 1 311 ? -17.882 -40.900 -79.353  1.00 104.10 ?  311 ARG D CD    1 
ATOM   5345  N NE    . ARG E 1 311 ? -18.195 -42.121 -78.615  1.00 112.17 ?  311 ARG D NE    1 
ATOM   5346  C CZ    . ARG E 1 311 ? -18.227 -42.205 -77.288  1.00 103.78 ?  311 ARG D CZ    1 
ATOM   5347  N NH1   . ARG E 1 311 ? -17.963 -41.136 -76.550  1.00 90.78  1  311 ARG D NH1   1 
ATOM   5348  N NH2   . ARG E 1 311 ? -18.528 -43.355 -76.700  1.00 108.88 ?  311 ARG D NH2   1 
ATOM   5349  N N     . GLY E 1 312 ? -23.520 -40.050 -78.361  1.00 92.22  ?  312 GLY D N     1 
ATOM   5350  C CA    . GLY E 1 312 ? -24.748 -40.748 -78.034  1.00 99.94  ?  312 GLY D CA    1 
ATOM   5351  C C     . GLY E 1 312 ? -25.954 -40.221 -78.787  1.00 100.59 ?  312 GLY D C     1 
ATOM   5352  O O     . GLY E 1 312 ? -27.048 -40.774 -78.680  1.00 114.39 ?  312 GLY D O     1 
ATOM   5353  N N     . ARG E 1 313 ? -25.759 -39.150 -79.550  1.00 91.88  ?  313 ARG D N     1 
ATOM   5354  C CA    . ARG E 1 313 ? -26.840 -38.593 -80.353  1.00 102.89 ?  313 ARG D CA    1 
ATOM   5355  C C     . ARG E 1 313 ? -27.082 -39.525 -81.535  1.00 107.40 ?  313 ARG D C     1 
ATOM   5356  O O     . ARG E 1 313 ? -26.134 -39.945 -82.198  1.00 114.16 ?  313 ARG D O     1 
ATOM   5357  C CB    . ARG E 1 313 ? -26.505 -37.176 -80.826  1.00 96.04  ?  313 ARG D CB    1 
ATOM   5358  C CG    . ARG E 1 313 ? -27.640 -36.475 -81.559  1.00 79.08  ?  313 ARG D CG    1 
ATOM   5359  C CD    . ARG E 1 313 ? -27.315 -35.007 -81.806  1.00 94.22  ?  313 ARG D CD    1 
ATOM   5360  N NE    . ARG E 1 313 ? -27.104 -34.270 -80.562  1.00 94.02  ?  313 ARG D NE    1 
ATOM   5361  C CZ    . ARG E 1 313 ? -28.079 -33.859 -79.757  1.00 91.90  ?  313 ARG D CZ    1 
ATOM   5362  N NH1   . ARG E 1 313 ? -29.344 -34.110 -80.064  1.00 102.12 1  313 ARG D NH1   1 
ATOM   5363  N NH2   . ARG E 1 313 ? -27.789 -33.201 -78.643  1.00 91.70  ?  313 ARG D NH2   1 
ATOM   5364  N N     . SER E 1 314 ? -28.341 -39.851 -81.805  1.00 110.40 ?  314 SER D N     1 
ATOM   5365  C CA    . SER E 1 314 ? -28.650 -40.819 -82.853  1.00 116.73 ?  314 SER D CA    1 
ATOM   5366  C C     . SER E 1 314 ? -28.584 -40.178 -84.236  1.00 117.97 ?  314 SER D C     1 
ATOM   5367  O O     . SER E 1 314 ? -29.604 -40.011 -84.903  1.00 119.63 ?  314 SER D O     1 
ATOM   5368  C CB    . SER E 1 314 ? -30.028 -41.440 -82.622  1.00 131.16 ?  314 SER D CB    1 
ATOM   5369  O OG    . SER E 1 314 ? -30.025 -42.267 -81.471  1.00 127.55 ?  314 SER D OG    1 
ATOM   5370  O "O5'" . DG  F 2 1   ? -10.498 -33.465 -39.540  1.00 81.78  ?  1   DG  E "O5'" 1 
ATOM   5371  C "C5'" . DG  F 2 1   ? -11.359 -34.510 -39.100  1.00 88.64  ?  1   DG  E "C5'" 1 
ATOM   5372  C "C4'" . DG  F 2 1   ? -12.770 -34.305 -39.624  1.00 75.32  ?  1   DG  E "C4'" 1 
ATOM   5373  O "O4'" . DG  F 2 1   ? -12.988 -32.895 -39.897  1.00 71.24  ?  1   DG  E "O4'" 1 
ATOM   5374  C "C3'" . DG  F 2 1   ? -13.085 -35.018 -40.932  1.00 79.01  ?  1   DG  E "C3'" 1 
ATOM   5375  O "O3'" . DG  F 2 1   ? -14.482 -35.302 -40.999  1.00 73.24  ?  1   DG  E "O3'" 1 
ATOM   5376  C "C2'" . DG  F 2 1   ? -12.673 -33.982 -41.967  1.00 85.74  ?  1   DG  E "C2'" 1 
ATOM   5377  C "C1'" . DG  F 2 1   ? -13.141 -32.701 -41.292  1.00 74.35  ?  1   DG  E "C1'" 1 
ATOM   5378  N N9    . DG  F 2 1   ? -12.404 -31.506 -41.692  1.00 64.81  ?  1   DG  E N9    1 
ATOM   5379  C C8    . DG  F 2 1   ? -11.040 -31.340 -41.737  1.00 67.94  ?  1   DG  E C8    1 
ATOM   5380  N N7    . DG  F 2 1   ? -10.676 -30.157 -42.155  1.00 75.37  ?  1   DG  E N7    1 
ATOM   5381  C C5    . DG  F 2 1   ? -11.877 -29.508 -42.425  1.00 67.17  ?  1   DG  E C5    1 
ATOM   5382  C C6    . DG  F 2 1   ? -12.125 -28.198 -42.914  1.00 61.07  ?  1   DG  E C6    1 
ATOM   5383  O O6    . DG  F 2 1   ? -11.303 -27.317 -43.215  1.00 52.98  ?  1   DG  E O6    1 
ATOM   5384  N N1    . DG  F 2 1   ? -13.494 -27.948 -43.044  1.00 48.40  ?  1   DG  E N1    1 
ATOM   5385  C C2    . DG  F 2 1   ? -14.490 -28.851 -42.740  1.00 53.47  ?  1   DG  E C2    1 
ATOM   5386  N N2    . DG  F 2 1   ? -15.751 -28.436 -42.924  1.00 42.15  ?  1   DG  E N2    1 
ATOM   5387  N N3    . DG  F 2 1   ? -14.267 -30.072 -42.282  1.00 53.89  ?  1   DG  E N3    1 
ATOM   5388  C C4    . DG  F 2 1   ? -12.946 -30.331 -42.151  1.00 61.60  ?  1   DG  E C4    1 
ATOM   5389  P P     . DG  F 2 2   ? -15.098 -36.106 -42.248  1.00 110.78 ?  2   DG  E P     1 
ATOM   5390  O OP1   . DG  F 2 2   ? -16.050 -37.102 -41.708  1.00 90.90  ?  2   DG  E OP1   1 
ATOM   5391  O OP2   . DG  F 2 2   ? -13.974 -36.542 -43.107  1.00 113.30 -1 2   DG  E OP2   1 
ATOM   5392  O "O5'" . DG  F 2 2   ? -15.927 -34.999 -43.054  1.00 84.94  ?  2   DG  E "O5'" 1 
ATOM   5393  C "C5'" . DG  F 2 2   ? -17.032 -34.359 -42.426  1.00 78.20  ?  2   DG  E "C5'" 1 
ATOM   5394  C "C4'" . DG  F 2 2   ? -17.755 -33.421 -43.379  1.00 75.91  ?  2   DG  E "C4'" 1 
ATOM   5395  O "O4'" . DG  F 2 2   ? -16.941 -32.240 -43.613  1.00 69.07  ?  2   DG  E "O4'" 1 
ATOM   5396  C "C3'" . DG  F 2 2   ? -18.075 -33.999 -44.759  1.00 81.28  ?  2   DG  E "C3'" 1 
ATOM   5397  O "O3'" . DG  F 2 2   ? -19.391 -33.608 -45.143  1.00 86.70  ?  2   DG  E "O3'" 1 
ATOM   5398  C "C2'" . DG  F 2 2   ? -17.001 -33.398 -45.661  1.00 66.99  ?  2   DG  E "C2'" 1 
ATOM   5399  C "C1'" . DG  F 2 2   ? -16.751 -32.053 -44.999  1.00 58.06  ?  2   DG  E "C1'" 1 
ATOM   5400  N N9    . DG  F 2 2   ? -15.403 -31.528 -45.220  1.00 51.23  ?  2   DG  E N9    1 
ATOM   5401  C C8    . DG  F 2 2   ? -14.210 -32.175 -45.000  1.00 54.67  ?  2   DG  E C8    1 
ATOM   5402  N N7    . DG  F 2 2   ? -13.164 -31.452 -45.301  1.00 49.05  ?  2   DG  E N7    1 
ATOM   5403  C C5    . DG  F 2 2   ? -13.701 -30.258 -45.767  1.00 42.88  ?  2   DG  E C5    1 
ATOM   5404  C C6    . DG  F 2 2   ? -13.058 -29.089 -46.246  1.00 45.65  ?  2   DG  E C6    1 
ATOM   5405  O O6    . DG  F 2 2   ? -11.841 -28.868 -46.355  1.00 48.69  ?  2   DG  E O6    1 
ATOM   5406  N N1    . DG  F 2 2   ? -13.981 -28.112 -46.618  1.00 37.91  ?  2   DG  E N1    1 
ATOM   5407  C C2    . DG  F 2 2   ? -15.348 -28.252 -46.537  1.00 39.97  ?  2   DG  E C2    1 
ATOM   5408  N N2    . DG  F 2 2   ? -16.081 -27.208 -46.941  1.00 37.41  ?  2   DG  E N2    1 
ATOM   5409  N N3    . DG  F 2 2   ? -15.957 -29.338 -46.094  1.00 46.19  ?  2   DG  E N3    1 
ATOM   5410  C C4    . DG  F 2 2   ? -15.077 -30.296 -45.728  1.00 46.07  ?  2   DG  E C4    1 
ATOM   5411  P P     . DT  F 2 3   ? -20.120 -34.277 -46.410  1.00 78.74  ?  3   DT  E P     1 
ATOM   5412  O OP1   . DT  F 2 3   ? -21.560 -34.382 -46.087  1.00 67.28  ?  3   DT  E OP1   1 
ATOM   5413  O OP2   . DT  F 2 3   ? -19.358 -35.485 -46.802  1.00 65.03  -1 3   DT  E OP2   1 
ATOM   5414  O "O5'" . DT  F 2 3   ? -19.941 -33.191 -47.569  1.00 71.43  ?  3   DT  E "O5'" 1 
ATOM   5415  C "C5'" . DT  F 2 3   ? -20.469 -31.880 -47.371  1.00 62.22  ?  3   DT  E "C5'" 1 
ATOM   5416  C "C4'" . DT  F 2 3   ? -20.029 -30.929 -48.471  1.00 75.55  ?  3   DT  E "C4'" 1 
ATOM   5417  O "O4'" . DT  F 2 3   ? -18.648 -30.557 -48.284  1.00 74.26  ?  3   DT  E "O4'" 1 
ATOM   5418  C "C3'" . DT  F 2 3   ? -20.134 -31.483 -49.895  1.00 63.97  ?  3   DT  E "C3'" 1 
ATOM   5419  O "O3'" . DT  F 2 3   ? -21.160 -30.774 -50.597  1.00 63.49  ?  3   DT  E "O3'" 1 
ATOM   5420  C "C2'" . DT  F 2 3   ? -18.737 -31.254 -50.509  1.00 46.88  ?  3   DT  E "C2'" 1 
ATOM   5421  C "C1'" . DT  F 2 3   ? -18.095 -30.268 -49.540  1.00 42.50  ?  3   DT  E "C1'" 1 
ATOM   5422  N N1    . DT  F 2 3   ? -16.600 -30.382 -49.435  1.00 36.46  ?  3   DT  E N1    1 
ATOM   5423  C C2    . DT  F 2 3   ? -15.822 -29.262 -49.634  1.00 43.00  ?  3   DT  E C2    1 
ATOM   5424  O O2    . DT  F 2 3   ? -16.282 -28.177 -49.939  1.00 41.98  ?  3   DT  E O2    1 
ATOM   5425  N N3    . DT  F 2 3   ? -14.472 -29.466 -49.494  1.00 48.33  ?  3   DT  E N3    1 
ATOM   5426  C C4    . DT  F 2 3   ? -13.836 -30.648 -49.157  1.00 37.05  ?  3   DT  E C4    1 
ATOM   5427  O O4    . DT  F 2 3   ? -12.613 -30.729 -49.051  1.00 34.35  ?  3   DT  E O4    1 
ATOM   5428  C C5    . DT  F 2 3   ? -14.710 -31.779 -48.940  1.00 34.41  ?  3   DT  E C5    1 
ATOM   5429  C C7    . DT  F 2 3   ? -14.137 -33.115 -48.571  1.00 27.26  ?  3   DT  E C7    1 
ATOM   5430  C C6    . DT  F 2 3   ? -16.034 -31.591 -49.080  1.00 37.30  ?  3   DT  E C6    1 
ATOM   5431  P P     . DC  F 2 4   ? -21.579 -31.179 -52.095  1.00 87.14  ?  4   DC  E P     1 
ATOM   5432  O OP1   . DC  F 2 4   ? -22.959 -30.692 -52.321  1.00 66.91  ?  4   DC  E OP1   1 
ATOM   5433  O OP2   . DC  F 2 4   ? -21.263 -32.611 -52.296  1.00 81.08  -1 4   DC  E OP2   1 
ATOM   5434  O "O5'" . DC  F 2 4   ? -20.580 -30.321 -52.996  1.00 64.60  ?  4   DC  E "O5'" 1 
ATOM   5435  C "C5'" . DC  F 2 4   ? -20.633 -28.906 -52.927  1.00 54.55  ?  4   DC  E "C5'" 1 
ATOM   5436  C "C4'" . DC  F 2 4   ? -19.340 -28.291 -53.420  1.00 53.95  ?  4   DC  E "C4'" 1 
ATOM   5437  O "O4'" . DC  F 2 4   ? -18.235 -28.786 -52.659  1.00 61.28  ?  4   DC  E "O4'" 1 
ATOM   5438  C "C3'" . DC  F 2 4   ? -18.954 -28.624 -54.844  1.00 58.53  ?  4   DC  E "C3'" 1 
ATOM   5439  O "O3'" . DC  F 2 4   ? -19.673 -27.774 -55.750  1.00 60.41  ?  4   DC  E "O3'" 1 
ATOM   5440  C "C2'" . DC  F 2 4   ? -17.443 -28.332 -54.840  1.00 53.02  ?  4   DC  E "C2'" 1 
ATOM   5441  C "C1'" . DC  F 2 4   ? -17.068 -28.416 -53.349  1.00 42.82  ?  4   DC  E "C1'" 1 
ATOM   5442  N N1    . DC  F 2 4   ? -15.978 -29.389 -53.046  1.00 39.55  ?  4   DC  E N1    1 
ATOM   5443  C C2    . DC  F 2 4   ? -14.668 -28.924 -52.954  1.00 44.25  ?  4   DC  E C2    1 
ATOM   5444  O O2    . DC  F 2 4   ? -14.457 -27.717 -53.112  1.00 52.44  ?  4   DC  E O2    1 
ATOM   5445  N N3    . DC  F 2 4   ? -13.672 -29.803 -52.677  1.00 35.39  ?  4   DC  E N3    1 
ATOM   5446  C C4    . DC  F 2 4   ? -13.953 -31.096 -52.508  1.00 37.98  ?  4   DC  E C4    1 
ATOM   5447  N N4    . DC  F 2 4   ? -12.939 -31.927 -52.240  1.00 38.88  ?  4   DC  E N4    1 
ATOM   5448  C C5    . DC  F 2 4   ? -15.289 -31.593 -52.605  1.00 41.12  ?  4   DC  E C5    1 
ATOM   5449  C C6    . DC  F 2 4   ? -16.261 -30.712 -52.877  1.00 39.50  ?  4   DC  E C6    1 
ATOM   5450  P P     . DT  F 2 5   ? -19.383 -27.808 -57.332  1.00 55.91  ?  5   DT  E P     1 
ATOM   5451  O OP1   . DT  F 2 5   ? -20.440 -27.004 -57.984  1.00 50.26  ?  5   DT  E OP1   1 
ATOM   5452  O OP2   . DT  F 2 5   ? -19.190 -29.223 -57.728  1.00 35.48  -1 5   DT  E OP2   1 
ATOM   5453  O "O5'" . DT  F 2 5   ? -17.986 -27.041 -57.486  1.00 37.54  ?  5   DT  E "O5'" 1 
ATOM   5454  C "C5'" . DT  F 2 5   ? -17.871 -25.662 -57.139  1.00 39.25  ?  5   DT  E "C5'" 1 
ATOM   5455  C "C4'" . DT  F 2 5   ? -16.540 -25.110 -57.613  1.00 45.32  ?  5   DT  E "C4'" 1 
ATOM   5456  O "O4'" . DT  F 2 5   ? -15.461 -25.786 -56.909  1.00 50.04  ?  5   DT  E "O4'" 1 
ATOM   5457  C "C3'" . DT  F 2 5   ? -16.253 -25.283 -59.103  1.00 56.57  ?  5   DT  E "C3'" 1 
ATOM   5458  O "O3'" . DT  F 2 5   ? -15.694 -24.084 -59.636  1.00 59.99  ?  5   DT  E "O3'" 1 
ATOM   5459  C "C2'" . DT  F 2 5   ? -15.264 -26.444 -59.156  1.00 53.28  ?  5   DT  E "C2'" 1 
ATOM   5460  C "C1'" . DT  F 2 5   ? -14.526 -26.297 -57.836  1.00 46.29  ?  5   DT  E "C1'" 1 
ATOM   5461  N N1    . DT  F 2 5   ? -13.991 -27.589 -57.313  1.00 34.44  ?  5   DT  E N1    1 
ATOM   5462  C C2    . DT  F 2 5   ? -12.658 -27.687 -56.987  1.00 43.07  ?  5   DT  E C2    1 
ATOM   5463  O O2    . DT  F 2 5   ? -11.869 -26.768 -57.122  1.00 53.45  ?  5   DT  E O2    1 
ATOM   5464  N N3    . DT  F 2 5   ? -12.272 -28.917 -56.516  1.00 37.37  ?  5   DT  E N3    1 
ATOM   5465  C C4    . DT  F 2 5   ? -13.075 -30.029 -56.328  1.00 41.35  ?  5   DT  E C4    1 
ATOM   5466  O O4    . DT  F 2 5   ? -12.639 -31.091 -55.893  1.00 39.83  ?  5   DT  E O4    1 
ATOM   5467  C C5    . DT  F 2 5   ? -14.465 -29.852 -56.680  1.00 41.12  ?  5   DT  E C5    1 
ATOM   5468  C C7    . DT  F 2 5   ? -15.434 -30.986 -56.519  1.00 40.59  ?  5   DT  E C7    1 
ATOM   5469  C C6    . DT  F 2 5   ? -14.849 -28.655 -57.148  1.00 36.73  ?  5   DT  E C6    1 
ATOM   5470  P P     . DA  F 2 6   ? -15.348 -23.978 -61.201  1.00 58.13  ?  6   DA  E P     1 
ATOM   5471  O OP1   . DA  F 2 6   ? -15.477 -22.554 -61.588  1.00 53.06  ?  6   DA  E OP1   1 
ATOM   5472  O OP2   . DA  F 2 6   ? -16.121 -25.015 -61.922  1.00 49.94  -1 6   DA  E OP2   1 
ATOM   5473  O "O5'" . DA  F 2 6   ? -13.802 -24.385 -61.248  1.00 46.36  ?  6   DA  E "O5'" 1 
ATOM   5474  C "C5'" . DA  F 2 6   ? -12.838 -23.598 -60.557  1.00 49.37  ?  6   DA  E "C5'" 1 
ATOM   5475  C "C4'" . DA  F 2 6   ? -11.443 -24.177 -60.728  1.00 61.56  ?  6   DA  E "C4'" 1 
ATOM   5476  O "O4'" . DA  F 2 6   ? -11.345 -25.422 -60.000  1.00 78.29  ?  6   DA  E "O4'" 1 
ATOM   5477  C "C3'" . DA  F 2 6   ? -11.017 -24.474 -62.164  1.00 60.22  ?  6   DA  E "C3'" 1 
ATOM   5478  O "O3'" . DA  F 2 6   ? -9.734  -23.911 -62.407  1.00 69.94  ?  6   DA  E "O3'" 1 
ATOM   5479  C "C2'" . DA  F 2 6   ? -10.987 -26.004 -62.238  1.00 51.23  ?  6   DA  E "C2'" 1 
ATOM   5480  C "C1'" . DA  F 2 6   ? -10.714 -26.397 -60.794  1.00 54.36  ?  6   DA  E "C1'" 1 
ATOM   5481  N N9    . DA  F 2 6   ? -11.272 -27.694 -60.425  1.00 45.97  ?  6   DA  E N9    1 
ATOM   5482  C C8    . DA  F 2 6   ? -12.563 -28.110 -60.590  1.00 51.99  ?  6   DA  E C8    1 
ATOM   5483  N N7    . DA  F 2 6   ? -12.788 -29.325 -60.149  1.00 51.35  ?  6   DA  E N7    1 
ATOM   5484  C C5    . DA  F 2 6   ? -11.561 -29.732 -59.655  1.00 46.61  ?  6   DA  E C5    1 
ATOM   5485  C C6    . DA  F 2 6   ? -11.134 -30.927 -59.047  1.00 47.11  ?  6   DA  E C6    1 
ATOM   5486  N N6    . DA  F 2 6   ? -11.939 -31.973 -58.834  1.00 37.39  ?  6   DA  E N6    1 
ATOM   5487  N N1    . DA  F 2 6   ? -9.840  -31.010 -58.671  1.00 49.58  ?  6   DA  E N1    1 
ATOM   5488  C C2    . DA  F 2 6   ? -9.036  -29.962 -58.891  1.00 51.08  ?  6   DA  E C2    1 
ATOM   5489  N N3    . DA  F 2 6   ? -9.324  -28.787 -59.449  1.00 55.66  ?  6   DA  E N3    1 
ATOM   5490  C C4    . DA  F 2 6   ? -10.615 -28.737 -59.814  1.00 50.96  ?  6   DA  E C4    1 
ATOM   5491  P P     . DA  F 2 7   ? -9.111  -23.931 -63.887  1.00 70.93  ?  7   DA  E P     1 
ATOM   5492  O OP1   . DA  F 2 7   ? -8.137  -22.820 -63.973  1.00 43.36  ?  7   DA  E OP1   1 
ATOM   5493  O OP2   . DA  F 2 7   ? -10.234 -24.005 -64.848  1.00 67.69  -1 7   DA  E OP2   1 
ATOM   5494  O "O5'" . DA  F 2 7   ? -8.302  -25.310 -63.948  1.00 65.99  ?  7   DA  E "O5'" 1 
ATOM   5495  C "C5'" . DA  F 2 7   ? -7.187  -25.519 -63.091  1.00 56.80  ?  7   DA  E "C5'" 1 
ATOM   5496  C "C4'" . DA  F 2 7   ? -6.680  -26.947 -63.195  1.00 65.94  ?  7   DA  E "C4'" 1 
ATOM   5497  O "O4'" . DA  F 2 7   ? -7.631  -27.861 -62.578  1.00 54.53  ?  7   DA  E "O4'" 1 
ATOM   5498  C "C3'" . DA  F 2 7   ? -6.483  -27.471 -64.629  1.00 78.79  ?  7   DA  E "C3'" 1 
ATOM   5499  O "O3'" . DA  F 2 7   ? -5.311  -28.266 -64.696  1.00 72.56  ?  7   DA  E "O3'" 1 
ATOM   5500  C "C2'" . DA  F 2 7   ? -7.706  -28.362 -64.809  1.00 71.90  ?  7   DA  E "C2'" 1 
ATOM   5501  C "C1'" . DA  F 2 7   ? -7.726  -28.971 -63.428  1.00 56.08  ?  7   DA  E "C1'" 1 
ATOM   5502  N N9    . DA  F 2 7   ? -8.902  -29.779 -63.114  1.00 61.87  ?  7   DA  E N9    1 
ATOM   5503  C C8    . DA  F 2 7   ? -10.187 -29.597 -63.546  1.00 64.36  ?  7   DA  E C8    1 
ATOM   5504  N N7    . DA  F 2 7   ? -11.023 -30.519 -63.116  1.00 51.05  ?  7   DA  E N7    1 
ATOM   5505  C C5    . DA  F 2 7   ? -10.222 -31.374 -62.374  1.00 42.50  ?  7   DA  E C5    1 
ATOM   5506  C C6    . DA  F 2 7   ? -10.493 -32.558 -61.656  1.00 54.32  ?  7   DA  E C6    1 
ATOM   5507  N N6    . DA  F 2 7   ? -11.711 -33.110 -61.557  1.00 63.39  ?  7   DA  E N6    1 
ATOM   5508  N N1    . DA  F 2 7   ? -9.460  -33.152 -61.030  1.00 58.75  ?  7   DA  E N1    1 
ATOM   5509  C C2    . DA  F 2 7   ? -8.243  -32.611 -61.122  1.00 52.83  ?  7   DA  E C2    1 
ATOM   5510  N N3    . DA  F 2 7   ? -7.867  -31.512 -61.764  1.00 49.52  ?  7   DA  E N3    1 
ATOM   5511  C C4    . DA  F 2 7   ? -8.912  -30.935 -62.375  1.00 47.75  ?  7   DA  E C4    1 
ATOM   5512  P P     . DA  F 2 8   ? -3.918  -27.646 -65.199  1.00 96.75  ?  8   DA  E P     1 
ATOM   5513  O OP1   . DA  F 2 8   ? -3.649  -26.423 -64.409  1.00 82.11  ?  8   DA  E OP1   1 
ATOM   5514  O OP2   . DA  F 2 8   ? -3.966  -27.567 -66.674  1.00 88.27  -1 8   DA  E OP2   1 
ATOM   5515  O "O5'" . DA  F 2 8   ? -2.846  -28.764 -64.798  1.00 58.17  ?  8   DA  E "O5'" 1 
ATOM   5516  C "C5'" . DA  F 2 8   ? -2.579  -29.040 -63.436  1.00 65.20  ?  8   DA  E "C5'" 1 
ATOM   5517  C "C4'" . DA  F 2 8   ? -2.504  -30.536 -63.181  1.00 76.90  ?  8   DA  E "C4'" 1 
ATOM   5518  O "O4'" . DA  F 2 8   ? -3.842  -31.083 -63.033  1.00 72.58  ?  8   DA  E "O4'" 1 
ATOM   5519  C "C3'" . DA  F 2 8   ? -1.824  -31.368 -64.274  1.00 79.72  ?  8   DA  E "C3'" 1 
ATOM   5520  O "O3'" . DA  F 2 8   ? -0.999  -32.347 -63.676  1.00 102.49 ?  8   DA  E "O3'" 1 
ATOM   5521  C "C2'" . DA  F 2 8   ? -3.007  -32.021 -64.982  1.00 81.79  ?  8   DA  E "C2'" 1 
ATOM   5522  C "C1'" . DA  F 2 8   ? -3.941  -32.252 -63.808  1.00 65.20  ?  8   DA  E "C1'" 1 
ATOM   5523  N N9    . DA  F 2 8   ? -5.332  -32.443 -64.191  1.00 63.96  ?  8   DA  E N9    1 
ATOM   5524  C C8    . DA  F 2 8   ? -6.097  -31.612 -64.957  1.00 67.39  ?  8   DA  E C8    1 
ATOM   5525  N N7    . DA  F 2 8   ? -7.323  -32.040 -65.137  1.00 64.61  ?  8   DA  E N7    1 
ATOM   5526  C C5    . DA  F 2 8   ? -7.366  -33.233 -64.435  1.00 62.99  ?  8   DA  E C5    1 
ATOM   5527  C C6    . DA  F 2 8   ? -8.391  -34.177 -64.231  1.00 66.98  ?  8   DA  E C6    1 
ATOM   5528  N N6    . DA  F 2 8   ? -9.617  -34.049 -64.743  1.00 70.15  ?  8   DA  E N6    1 
ATOM   5529  N N1    . DA  F 2 8   ? -8.105  -35.261 -63.478  1.00 54.41  ?  8   DA  E N1    1 
ATOM   5530  C C2    . DA  F 2 8   ? -6.873  -35.383 -62.966  1.00 65.18  ?  8   DA  E C2    1 
ATOM   5531  N N3    . DA  F 2 8   ? -5.830  -34.562 -63.090  1.00 66.89  ?  8   DA  E N3    1 
ATOM   5532  C C4    . DA  F 2 8   ? -6.148  -33.496 -63.844  1.00 57.05  ?  8   DA  E C4    1 
ATOM   5533  P P     . DC  F 2 9   ? 0.109   -33.127 -64.539  1.00 86.19  ?  9   DC  E P     1 
ATOM   5534  O OP1   . DC  F 2 9   ? 1.314   -33.285 -63.694  1.00 103.04 ?  9   DC  E OP1   1 
ATOM   5535  O OP2   . DC  F 2 9   ? 0.212   -32.454 -65.852  1.00 71.84  -1 9   DC  E OP2   1 
ATOM   5536  O "O5'" . DC  F 2 9   ? -0.553  -34.563 -64.781  1.00 64.19  ?  9   DC  E "O5'" 1 
ATOM   5537  C "C5'" . DC  F 2 9   ? -0.975  -35.331 -63.663  1.00 81.97  ?  9   DC  E "C5'" 1 
ATOM   5538  C "C4'" . DC  F 2 9   ? -1.937  -36.429 -64.080  1.00 89.36  ?  9   DC  E "C4'" 1 
ATOM   5539  O "O4'" . DC  F 2 9   ? -3.200  -35.851 -64.467  1.00 86.77  ?  9   DC  E "O4'" 1 
ATOM   5540  C "C3'" . DC  F 2 9   ? -1.506  -37.284 -65.280  1.00 101.38 ?  9   DC  E "C3'" 1 
ATOM   5541  O "O3'" . DC  F 2 9   ? -1.209  -38.599 -64.835  1.00 118.67 ?  9   DC  E "O3'" 1 
ATOM   5542  C "C2'" . DC  F 2 9   ? -2.732  -37.265 -66.214  1.00 97.70  ?  9   DC  E "C2'" 1 
ATOM   5543  C "C1'" . DC  F 2 9   ? -3.834  -36.793 -65.279  1.00 85.80  ?  9   DC  E "C1'" 1 
ATOM   5544  N N1    . DC  F 2 9   ? -4.968  -36.134 -65.986  1.00 72.56  ?  9   DC  E N1    1 
ATOM   5545  C C2    . DC  F 2 9   ? -6.227  -36.746 -65.995  1.00 70.39  ?  9   DC  E C2    1 
ATOM   5546  O O2    . DC  F 2 9   ? -6.375  -37.821 -65.405  1.00 78.68  ?  9   DC  E O2    1 
ATOM   5547  N N3    . DC  F 2 9   ? -7.251  -36.138 -66.647  1.00 65.54  ?  9   DC  E N3    1 
ATOM   5548  C C4    . DC  F 2 9   ? -7.044  -34.973 -67.269  1.00 70.25  ?  9   DC  E C4    1 
ATOM   5549  N N4    . DC  F 2 9   ? -8.079  -34.407 -67.899  1.00 75.63  ?  9   DC  E N4    1 
ATOM   5550  C C5    . DC  F 2 9   ? -5.766  -34.337 -67.273  1.00 61.52  ?  9   DC  E C5    1 
ATOM   5551  C C6    . DC  F 2 9   ? -4.767  -34.947 -66.628  1.00 63.34  ?  9   DC  E C6    1 
ATOM   5552  P P     . DG  F 2 10  ? -0.671  -39.715 -65.859  1.00 125.91 ?  10  DG  E P     1 
ATOM   5553  O OP1   . DG  F 2 10  ? 0.133   -40.687 -65.085  1.00 118.68 ?  10  DG  E OP1   1 
ATOM   5554  O OP2   . DG  F 2 10  ? -0.069  -39.014 -67.015  1.00 92.01  -1 10  DG  E OP2   1 
ATOM   5555  O "O5'" . DG  F 2 10  ? -2.000  -40.439 -66.372  1.00 103.35 ?  10  DG  E "O5'" 1 
ATOM   5556  C "C5'" . DG  F 2 10  ? -2.926  -40.979 -65.432  1.00 97.28  ?  10  DG  E "C5'" 1 
ATOM   5557  C "C4'" . DG  F 2 10  ? -4.077  -41.652 -66.153  1.00 99.29  ?  10  DG  E "C4'" 1 
ATOM   5558  O "O4'" . DG  F 2 10  ? -5.011  -40.653 -66.624  1.00 96.51  ?  10  DG  E "O4'" 1 
ATOM   5559  C "C3'" . DG  F 2 10  ? -3.672  -42.472 -67.385  1.00 105.69 ?  10  DG  E "C3'" 1 
ATOM   5560  O "O3'" . DG  F 2 10  ? -4.118  -43.811 -67.238  1.00 119.20 ?  10  DG  E "O3'" 1 
ATOM   5561  C "C2'" . DG  F 2 10  ? -4.381  -41.767 -68.548  1.00 100.15 ?  10  DG  E "C2'" 1 
ATOM   5562  C "C1'" . DG  F 2 10  ? -5.544  -41.098 -67.839  1.00 82.90  ?  10  DG  E "C1'" 1 
ATOM   5563  N N9    . DG  F 2 10  ? -6.084  -39.949 -68.560  1.00 78.51  ?  10  DG  E N9    1 
ATOM   5564  C C8    . DG  F 2 10  ? -5.442  -38.766 -68.834  1.00 78.79  ?  10  DG  E C8    1 
ATOM   5565  N N7    . DG  F 2 10  ? -6.173  -37.922 -69.510  1.00 73.84  ?  10  DG  E N7    1 
ATOM   5566  C C5    . DG  F 2 10  ? -7.372  -38.596 -69.710  1.00 70.41  ?  10  DG  E C5    1 
ATOM   5567  C C6    . DG  F 2 10  ? -8.550  -38.187 -70.385  1.00 64.48  ?  10  DG  E C6    1 
ATOM   5568  O O6    . DG  F 2 10  ? -8.773  -37.110 -70.957  1.00 56.29  ?  10  DG  E O6    1 
ATOM   5569  N N1    . DG  F 2 10  ? -9.533  -39.176 -70.354  1.00 59.37  ?  10  DG  E N1    1 
ATOM   5570  C C2    . DG  F 2 10  ? -9.392  -40.403 -69.748  1.00 71.69  ?  10  DG  E C2    1 
ATOM   5571  N N2    . DG  F 2 10  ? -10.445 -41.227 -69.819  1.00 77.43  ?  10  DG  E N2    1 
ATOM   5572  N N3    . DG  F 2 10  ? -8.295  -40.797 -69.115  1.00 73.06  ?  10  DG  E N3    1 
ATOM   5573  C C4    . DG  F 2 10  ? -7.330  -39.847 -69.136  1.00 74.47  ?  10  DG  E C4    1 
ATOM   5574  P P     . DT  F 2 11  ? -3.683  -44.937 -68.299  1.00 139.60 ?  11  DT  E P     1 
ATOM   5575  O OP1   . DT  F 2 11  ? -3.828  -46.253 -67.639  1.00 142.66 ?  11  DT  E OP1   1 
ATOM   5576  O OP2   . DT  F 2 11  ? -2.377  -44.535 -68.867  1.00 103.86 -1 11  DT  E OP2   1 
ATOM   5577  O "O5'" . DT  F 2 11  ? -4.775  -44.826 -69.463  1.00 114.72 ?  11  DT  E "O5'" 1 
ATOM   5578  C "C5'" . DT  F 2 11  ? -6.151  -45.010 -69.168  1.00 95.38  ?  11  DT  E "C5'" 1 
ATOM   5579  C "C4'" . DT  F 2 11  ? -6.987  -44.974 -70.435  1.00 112.46 ?  11  DT  E "C4'" 1 
ATOM   5580  O "O4'" . DT  F 2 11  ? -7.323  -43.595 -70.755  1.00 107.59 ?  11  DT  E "O4'" 1 
ATOM   5581  C "C3'" . DT  F 2 11  ? -6.306  -45.535 -71.696  1.00 121.04 ?  11  DT  E "C3'" 1 
ATOM   5582  O "O3'" . DT  F 2 11  ? -7.253  -46.258 -72.458  1.00 129.16 ?  11  DT  E "O3'" 1 
ATOM   5583  C "C2'" . DT  F 2 11  ? -5.925  -44.266 -72.447  1.00 104.99 ?  11  DT  E "C2'" 1 
ATOM   5584  C "C1'" . DT  F 2 11  ? -7.149  -43.429 -72.138  1.00 93.19  ?  11  DT  E "C1'" 1 
ATOM   5585  N N1    . DT  F 2 11  ? -7.007  -41.989 -72.469  1.00 74.00  ?  11  DT  E N1    1 
ATOM   5586  C C2    . DT  F 2 11  ? -8.106  -41.313 -72.930  1.00 78.43  ?  11  DT  E C2    1 
ATOM   5587  O O2    . DT  F 2 11  ? -9.210  -41.821 -73.027  1.00 75.89  ?  11  DT  E O2    1 
ATOM   5588  N N3    . DT  F 2 11  ? -7.882  -40.001 -73.233  1.00 78.01  ?  11  DT  E N3    1 
ATOM   5589  C C4    . DT  F 2 11  ? -6.692  -39.312 -73.161  1.00 69.25  ?  11  DT  E C4    1 
ATOM   5590  O O4    . DT  F 2 11  ? -6.605  -38.124 -73.471  1.00 69.63  ?  11  DT  E O4    1 
ATOM   5591  C C5    . DT  F 2 11  ? -5.562  -40.087 -72.696  1.00 70.92  ?  11  DT  E C5    1 
ATOM   5592  C C7    . DT  F 2 11  ? -4.209  -39.450 -72.571  1.00 70.19  ?  11  DT  E C7    1 
ATOM   5593  C C6    . DT  F 2 11  ? -5.770  -41.379 -72.385  1.00 72.31  ?  11  DT  E C6    1 
ATOM   5594  P P     . DC  F 2 12  ? -6.898  -47.708 -73.053  1.00 136.32 ?  12  DC  E P     1 
ATOM   5595  O OP1   . DC  F 2 12  ? -6.716  -48.627 -71.908  1.00 123.58 ?  12  DC  E OP1   1 
ATOM   5596  O OP2   . DC  F 2 12  ? -5.816  -47.540 -74.047  1.00 134.34 -1 12  DC  E OP2   1 
ATOM   5597  O "O5'" . DC  F 2 12  ? -8.232  -48.117 -73.833  1.00 131.38 ?  12  DC  E "O5'" 1 
ATOM   5598  C "C5'" . DC  F 2 12  ? -9.479  -48.005 -73.172  1.00 114.43 ?  12  DC  E "C5'" 1 
ATOM   5599  C "C4'" . DC  F 2 12  ? -10.578 -47.596 -74.139  1.00 132.30 ?  12  DC  E "C4'" 1 
ATOM   5600  O "O4'" . DC  F 2 12  ? -10.466 -46.171 -74.393  1.00 130.20 ?  12  DC  E "O4'" 1 
ATOM   5601  C "C3'" . DC  F 2 12  ? -10.524 -48.276 -75.511  1.00 141.98 ?  12  DC  E "C3'" 1 
ATOM   5602  O "O3'" . DC  F 2 12  ? -11.843 -48.702 -75.881  1.00 151.53 ?  12  DC  E "O3'" 1 
ATOM   5603  C "C2'" . DC  F 2 12  ? -9.959  -47.196 -76.434  1.00 123.17 ?  12  DC  E "C2'" 1 
ATOM   5604  C "C1'" . DC  F 2 12  ? -10.455 -45.916 -75.780  1.00 119.04 ?  12  DC  E "C1'" 1 
ATOM   5605  N N1    . DC  F 2 12  ? -9.529  -44.756 -76.009  1.00 105.17 ?  12  DC  E N1    1 
ATOM   5606  C C2    . DC  F 2 12  ? -10.000 -43.585 -76.617  1.00 94.00  ?  12  DC  E C2    1 
ATOM   5607  O O2    . DC  F 2 12  ? -11.189 -43.513 -76.951  1.00 90.67  ?  12  DC  E O2    1 
ATOM   5608  N N3    . DC  F 2 12  ? -9.136  -42.552 -76.808  1.00 86.30  ?  12  DC  E N3    1 
ATOM   5609  C C4    . DC  F 2 12  ? -7.860  -42.667 -76.429  1.00 77.58  ?  12  DC  E C4    1 
ATOM   5610  N N4    . DC  F 2 12  ? -7.046  -41.626 -76.637  1.00 62.01  ?  12  DC  E N4    1 
ATOM   5611  C C5    . DC  F 2 12  ? -7.363  -43.853 -75.817  1.00 84.09  ?  12  DC  E C5    1 
ATOM   5612  C C6    . DC  F 2 12  ? -8.222  -44.861 -75.630  1.00 100.01 ?  12  DC  E C6    1 
ATOM   5613  P P     . DG  F 2 13  ? -12.075 -49.847 -76.988  1.00 175.54 ?  13  DG  E P     1 
ATOM   5614  O OP1   . DG  F 2 13  ? -12.896 -50.920 -76.381  1.00 179.05 ?  13  DG  E OP1   1 
ATOM   5615  O OP2   . DG  F 2 13  ? -10.746 -50.184 -77.547  1.00 132.64 -1 13  DG  E OP2   1 
ATOM   5616  O "O5'" . DG  F 2 13  ? -12.909 -49.125 -78.155  1.00 151.93 ?  13  DG  E "O5'" 1 
ATOM   5617  C "C5'" . DG  F 2 13  ? -13.921 -48.173 -77.812  1.00 137.95 ?  13  DG  E "C5'" 1 
ATOM   5618  C "C4'" . DG  F 2 13  ? -14.462 -47.412 -79.017  1.00 146.15 ?  13  DG  E "C4'" 1 
ATOM   5619  O "O4'" . DG  F 2 13  ? -13.573 -46.292 -79.257  1.00 135.18 ?  13  DG  E "O4'" 1 
ATOM   5620  C "C3'" . DG  F 2 13  ? -14.521 -48.191 -80.336  1.00 135.65 ?  13  DG  E "C3'" 1 
ATOM   5621  O "O3'" . DG  F 2 13  ? -15.741 -47.836 -81.065  1.00 142.32 ?  13  DG  E "O3'" 1 
ATOM   5622  C "C2'" . DG  F 2 13  ? -13.226 -47.787 -81.043  1.00 118.45 ?  13  DG  E "C2'" 1 
ATOM   5623  C "C1'" . DG  F 2 13  ? -13.002 -46.364 -80.548  1.00 115.39 ?  13  DG  E "C1'" 1 
ATOM   5624  N N9    . DG  F 2 13  ? -11.578 -46.100 -80.374  1.00 104.91 ?  13  DG  E N9    1 
ATOM   5625  C C8    . DG  F 2 13  ? -10.640 -46.994 -79.916  1.00 111.19 ?  13  DG  E C8    1 
ATOM   5626  N N7    . DG  F 2 13  ? -9.440  -46.498 -79.837  1.00 102.26 ?  13  DG  E N7    1 
ATOM   5627  C C5    . DG  F 2 13  ? -9.590  -45.183 -80.247  1.00 105.36 ?  13  DG  E C5    1 
ATOM   5628  C C6    . DG  F 2 13  ? -8.627  -44.159 -80.359  1.00 102.80 ?  13  DG  E C6    1 
ATOM   5629  O O6    . DG  F 2 13  ? -7.413  -44.220 -80.111  1.00 87.52  ?  13  DG  E O6    1 
ATOM   5630  N N1    . DG  F 2 13  ? -9.191  -42.968 -80.812  1.00 92.56  ?  13  DG  E N1    1 
ATOM   5631  C C2    . DG  F 2 13  ? -10.522 -42.795 -81.116  1.00 91.24  ?  13  DG  E C2    1 
ATOM   5632  N N2    . DG  F 2 13  ? -10.882 -41.575 -81.538  1.00 78.37  ?  13  DG  E N2    1 
ATOM   5633  N N3    . DG  F 2 13  ? -11.440 -43.751 -81.014  1.00 95.68  ?  13  DG  E N3    1 
ATOM   5634  C C4    . DG  F 2 13  ? -10.904 -44.916 -80.574  1.00 100.92 ?  13  DG  E C4    1 
ATOM   5635  P P     . DT  F 2 14  ? -16.141 -48.553 -82.451  1.00 167.99 ?  14  DT  E P     1 
ATOM   5636  O OP1   . DT  F 2 14  ? -17.535 -49.051 -82.269  1.00 158.97 ?  14  DT  E OP1   1 
ATOM   5637  O OP2   . DT  F 2 14  ? -15.016 -49.447 -82.815  1.00 145.10 -1 14  DT  E OP2   1 
ATOM   5638  O "O5'" . DT  F 2 14  ? -16.167 -47.353 -83.508  1.00 144.49 ?  14  DT  E "O5'" 1 
ATOM   5639  C "C5'" . DT  F 2 14  ? -16.723 -46.097 -83.122  1.00 136.47 ?  14  DT  E "C5'" 1 
ATOM   5640  C "C4'" . DT  F 2 14  ? -16.421 -45.039 -84.158  1.00 119.37 ?  14  DT  E "C4'" 1 
ATOM   5641  O "O4'" . DT  F 2 14  ? -15.077 -44.558 -83.932  1.00 120.06 ?  14  DT  E "O4'" 1 
ATOM   5642  C "C3'" . DT  F 2 14  ? -16.450 -45.509 -85.619  1.00 109.51 ?  14  DT  E "C3'" 1 
ATOM   5643  O "O3'" . DT  F 2 14  ? -16.834 -44.468 -86.475  1.00 105.47 ?  14  DT  E "O3'" 1 
ATOM   5644  C "C2'" . DT  F 2 14  ? -14.999 -45.824 -85.863  1.00 104.94 ?  14  DT  E "C2'" 1 
ATOM   5645  C "C1'" . DT  F 2 14  ? -14.346 -44.672 -85.119  1.00 105.61 ?  14  DT  E "C1'" 1 
ATOM   5646  N N1    . DT  F 2 14  ? -12.963 -45.007 -84.769  1.00 100.37 ?  14  DT  E N1    1 
ATOM   5647  C C2    . DT  F 2 14  ? -12.009 -44.019 -84.671  1.00 98.62  ?  14  DT  E C2    1 
ATOM   5648  O O2    . DT  F 2 14  ? -12.257 -42.833 -84.788  1.00 95.65  ?  14  DT  E O2    1 
ATOM   5649  N N3    . DT  F 2 14  ? -10.746 -44.481 -84.389  1.00 100.42 ?  14  DT  E N3    1 
ATOM   5650  C C4    . DT  F 2 14  ? -10.351 -45.805 -84.228  1.00 104.55 ?  14  DT  E C4    1 
ATOM   5651  O O4    . DT  F 2 14  ? -9.191  -46.119 -83.982  1.00 96.11  ?  14  DT  E O4    1 
ATOM   5652  C C5    . DT  F 2 14  ? -11.400 -46.785 -84.371  1.00 103.68 ?  14  DT  E C5    1 
ATOM   5653  C C7    . DT  F 2 14  ? -11.101 -48.253 -84.221  1.00 109.00 ?  14  DT  E C7    1 
ATOM   5654  C C6    . DT  F 2 14  ? -12.633 -46.341 -84.640  1.00 96.03  ?  14  DT  E C6    1 
ATOM   5655  P P     . DA  F 2 15  ? -18.321 -44.099 -86.908  1.00 125.89 ?  15  DA  E P     1 
ATOM   5656  O OP1   . DA  F 2 15  ? -19.206 -44.142 -85.728  1.00 121.40 ?  15  DA  E OP1   1 
ATOM   5657  O OP2   . DA  F 2 15  ? -18.634 -44.918 -88.111  1.00 129.92 -1 15  DA  E OP2   1 
ATOM   5658  O "O5'" . DA  F 2 15  ? -18.074 -42.566 -87.302  1.00 103.85 ?  15  DA  E "O5'" 1 
ATOM   5659  C "C5'" . DA  F 2 15  ? -17.799 -41.587 -86.292  1.00 93.25  ?  15  DA  E "C5'" 1 
ATOM   5660  C "C4'" . DA  F 2 15  ? -16.679 -40.628 -86.721  1.00 88.64  ?  15  DA  E "C4'" 1 
ATOM   5661  O "O4'" . DA  F 2 15  ? -15.404 -41.334 -86.790  1.00 87.43  ?  15  DA  E "O4'" 1 
ATOM   5662  C "C3'" . DA  F 2 15  ? -16.840 -39.964 -88.080  1.00 80.40  ?  15  DA  E "C3'" 1 
ATOM   5663  O "O3'" . DA  F 2 15  ? -16.133 -38.749 -88.090  1.00 62.05  ?  15  DA  E "O3'" 1 
ATOM   5664  C "C2'" . DA  F 2 15  ? -16.162 -40.989 -88.999  1.00 82.50  ?  15  DA  E "C2'" 1 
ATOM   5665  C "C1'" . DA  F 2 15  ? -14.969 -41.411 -88.140  1.00 79.56  ?  15  DA  E "C1'" 1 
ATOM   5666  N N9    . DA  F 2 15  ? -14.449 -42.767 -88.415  1.00 84.66  ?  15  DA  E N9    1 
ATOM   5667  C C8    . DA  F 2 15  ? -15.146 -43.852 -88.877  1.00 90.60  ?  15  DA  E C8    1 
ATOM   5668  N N7    . DA  F 2 15  ? -14.409 -44.934 -89.036  1.00 91.90  ?  15  DA  E N7    1 
ATOM   5669  C C5    . DA  F 2 15  ? -13.144 -44.537 -88.629  1.00 85.54  ?  15  DA  E C5    1 
ATOM   5670  C C6    . DA  F 2 15  ? -11.908 -45.220 -88.549  1.00 82.30  ?  15  DA  E C6    1 
ATOM   5671  N N6    . DA  F 2 15  ? -11.748 -46.503 -88.892  1.00 89.08  ?  15  DA  E N6    1 
ATOM   5672  N N1    . DA  F 2 15  ? -10.839 -44.527 -88.100  1.00 71.74  ?  15  DA  E N1    1 
ATOM   5673  C C2    . DA  F 2 15  ? -11.001 -43.243 -87.758  1.00 77.28  ?  15  DA  E C2    1 
ATOM   5674  N N3    . DA  F 2 15  ? -12.105 -42.498 -87.788  1.00 82.96  ?  15  DA  E N3    1 
ATOM   5675  C C4    . DA  F 2 15  ? -13.151 -43.209 -88.237  1.00 83.59  ?  15  DA  E C4    1 
ATOM   5676  P P     . DT  F 2 16  ? -16.931 -37.367 -87.984  1.00 91.06  ?  16  DT  E P     1 
ATOM   5677  O OP1   . DT  F 2 16  ? -17.705 -37.391 -86.724  1.00 96.12  ?  16  DT  E OP1   1 
ATOM   5678  O OP2   . DT  F 2 16  ? -17.607 -37.160 -89.290  1.00 85.36  -1 16  DT  E OP2   1 
ATOM   5679  O "O5'" . DT  F 2 16  ? -15.777 -36.278 -87.802  1.00 83.97  ?  16  DT  E "O5'" 1 
ATOM   5680  O OP1   . DC  G 3 1   ? -6.716  -39.092 -136.568 1.00 63.54  ?  1   DC  F OP1   1 
ATOM   5681  O OP2   . DC  G 3 1   ? -3.650  -36.228 -132.992 1.00 70.48  ?  1   DC  F OP2   1 
ATOM   5682  O "O5'" . DC  G 3 1   ? -5.207  -43.847 -129.167 1.00 79.24  ?  1   DC  F "O5'" 1 
ATOM   5683  C "C5'" . DC  G 3 1   ? -4.095  -43.380 -129.923 1.00 74.26  ?  1   DC  F "C5'" 1 
ATOM   5684  C "C4'" . DC  G 3 1   ? -3.740  -41.954 -129.537 1.00 74.28  ?  1   DC  F "C4'" 1 
ATOM   5685  O "O4'" . DC  G 3 1   ? -4.653  -41.034 -130.176 1.00 60.91  ?  1   DC  F "O4'" 1 
ATOM   5686  C "C3'" . DC  G 3 1   ? -3.854  -41.645 -128.055 1.00 81.02  ?  1   DC  F "C3'" 1 
ATOM   5687  O "O3'" . DC  G 3 1   ? -2.650  -42.031 -127.361 1.00 78.66  ?  1   DC  F "O3'" 1 
ATOM   5688  C "C2'" . DC  G 3 1   ? -4.065  -40.133 -128.048 1.00 75.03  ?  1   DC  F "C2'" 1 
ATOM   5689  C "C1'" . DC  G 3 1   ? -4.817  -39.887 -129.361 1.00 60.62  ?  1   DC  F "C1'" 1 
ATOM   5690  N N1    . DC  G 3 1   ? -6.269  -39.627 -129.176 1.00 48.69  ?  1   DC  F N1    1 
ATOM   5691  C C2    . DC  G 3 1   ? -6.732  -38.307 -129.132 1.00 52.22  ?  1   DC  F C2    1 
ATOM   5692  O O2    . DC  G 3 1   ? -5.921  -37.379 -129.235 1.00 56.88  ?  1   DC  F O2    1 
ATOM   5693  N N3    . DC  G 3 1   ? -8.057  -38.082 -128.961 1.00 42.77  ?  1   DC  F N3    1 
ATOM   5694  C C4    . DC  G 3 1   ? -8.898  -39.110 -128.849 1.00 44.46  ?  1   DC  F C4    1 
ATOM   5695  N N4    . DC  G 3 1   ? -10.196 -38.838 -128.686 1.00 51.07  ?  1   DC  F N4    1 
ATOM   5696  C C5    . DC  G 3 1   ? -8.446  -40.462 -128.900 1.00 52.96  ?  1   DC  F C5    1 
ATOM   5697  C C6    . DC  G 3 1   ? -7.137  -40.672 -129.064 1.00 49.03  ?  1   DC  F C6    1 
ATOM   5698  P P     . DA  G 3 2   ? -1.317  -41.123 -127.396 1.00 101.13 ?  2   DA  F P     1 
ATOM   5699  O OP1   . DA  G 3 2   ? -1.115  -40.509 -128.729 1.00 91.87  ?  2   DA  F OP1   1 
ATOM   5700  O OP2   . DA  G 3 2   ? -0.251  -41.983 -126.835 1.00 76.39  -1 2   DA  F OP2   1 
ATOM   5701  O "O5'" . DA  G 3 2   ? -1.598  -39.998 -126.294 1.00 74.43  ?  2   DA  F "O5'" 1 
ATOM   5702  C "C5'" . DA  G 3 2   ? -1.104  -38.658 -126.438 1.00 70.79  ?  2   DA  F "C5'" 1 
ATOM   5703  C "C4'" . DA  G 3 2   ? -1.812  -37.743 -125.450 1.00 66.83  ?  2   DA  F "C4'" 1 
ATOM   5704  O "O4'" . DA  G 3 2   ? -3.245  -37.752 -125.702 1.00 59.59  ?  2   DA  F "O4'" 1 
ATOM   5705  C "C3'" . DA  G 3 2   ? -1.643  -38.158 -123.985 1.00 67.59  ?  2   DA  F "C3'" 1 
ATOM   5706  O "O3'" . DA  G 3 2   ? -1.694  -37.031 -123.132 1.00 63.92  ?  2   DA  F "O3'" 1 
ATOM   5707  C "C2'" . DA  G 3 2   ? -2.909  -38.981 -123.771 1.00 74.67  ?  2   DA  F "C2'" 1 
ATOM   5708  C "C1'" . DA  G 3 2   ? -3.881  -38.065 -124.488 1.00 61.08  ?  2   DA  F "C1'" 1 
ATOM   5709  N N9    . DA  G 3 2   ? -5.205  -38.620 -124.747 1.00 51.86  ?  2   DA  F N9    1 
ATOM   5710  C C8    . DA  G 3 2   ? -5.557  -39.939 -124.803 1.00 68.21  ?  2   DA  F C8    1 
ATOM   5711  N N7    . DA  G 3 2   ? -6.839  -40.134 -125.009 1.00 66.65  ?  2   DA  F N7    1 
ATOM   5712  C C5    . DA  G 3 2   ? -7.371  -38.855 -125.031 1.00 55.68  ?  2   DA  F C5    1 
ATOM   5713  C C6    . DA  G 3 2   ? -8.686  -38.372 -125.196 1.00 55.10  ?  2   DA  F C6    1 
ATOM   5714  N N6    . DA  G 3 2   ? -9.745  -39.167 -125.379 1.00 50.12  ?  2   DA  F N6    1 
ATOM   5715  N N1    . DA  G 3 2   ? -8.870  -37.036 -125.166 1.00 43.72  ?  2   DA  F N1    1 
ATOM   5716  C C2    . DA  G 3 2   ? -7.808  -36.243 -124.979 1.00 44.23  ?  2   DA  F C2    1 
ATOM   5717  N N3    . DA  G 3 2   ? -6.530  -36.579 -124.818 1.00 46.43  ?  2   DA  F N3    1 
ATOM   5718  C C4    . DA  G 3 2   ? -6.379  -37.912 -124.852 1.00 46.35  ?  2   DA  F C4    1 
ATOM   5719  P P     . DA  G 3 3   ? -0.366  -36.337 -122.560 1.00 61.04  ?  3   DA  F P     1 
ATOM   5720  O OP1   . DA  G 3 3   ? 0.506   -36.018 -123.713 1.00 54.16  ?  3   DA  F OP1   1 
ATOM   5721  O OP2   . DA  G 3 3   ? 0.148   -37.158 -121.442 1.00 91.02  -1 3   DA  F OP2   1 
ATOM   5722  O "O5'" . DA  G 3 3   ? -0.933  -34.968 -121.959 1.00 71.01  ?  3   DA  F "O5'" 1 
ATOM   5723  C "C5'" . DA  G 3 3   ? -1.653  -34.068 -122.778 1.00 64.80  ?  3   DA  F "C5'" 1 
ATOM   5724  C "C4'" . DA  G 3 3   ? -2.954  -33.661 -122.101 1.00 55.97  ?  3   DA  F "C4'" 1 
ATOM   5725  O "O4'" . DA  G 3 3   ? -3.999  -34.603 -122.429 1.00 55.21  ?  3   DA  F "O4'" 1 
ATOM   5726  C "C3'" . DA  G 3 3   ? -2.917  -33.576 -120.566 1.00 61.13  ?  3   DA  F "C3'" 1 
ATOM   5727  O "O3'" . DA  G 3 3   ? -3.156  -32.239 -120.166 1.00 71.69  ?  3   DA  F "O3'" 1 
ATOM   5728  C "C2'" . DA  G 3 3   ? -4.031  -34.521 -120.086 1.00 51.53  ?  3   DA  F "C2'" 1 
ATOM   5729  C "C1'" . DA  G 3 3   ? -4.873  -34.712 -121.336 1.00 50.29  ?  3   DA  F "C1'" 1 
ATOM   5730  N N9    . DA  G 3 3   ? -5.571  -35.993 -121.406 1.00 42.88  ?  3   DA  F N9    1 
ATOM   5731  C C8    . DA  G 3 3   ? -5.024  -37.244 -121.339 1.00 42.68  ?  3   DA  F C8    1 
ATOM   5732  N N7    . DA  G 3 3   ? -5.909  -38.213 -121.419 1.00 39.01  ?  3   DA  F N7    1 
ATOM   5733  C C5    . DA  G 3 3   ? -7.121  -37.548 -121.518 1.00 41.56  ?  3   DA  F C5    1 
ATOM   5734  C C6    . DA  G 3 3   ? -8.456  -37.999 -121.627 1.00 44.63  ?  3   DA  F C6    1 
ATOM   5735  N N6    . DA  G 3 3   ? -8.807  -39.291 -121.657 1.00 40.28  ?  3   DA  F N6    1 
ATOM   5736  N N1    . DA  G 3 3   ? -9.422  -37.064 -121.706 1.00 47.44  ?  3   DA  F N1    1 
ATOM   5737  C C2    . DA  G 3 3   ? -9.080  -35.772 -121.678 1.00 44.66  ?  3   DA  F C2    1 
ATOM   5738  N N3    . DA  G 3 3   ? -7.872  -35.229 -121.581 1.00 40.73  ?  3   DA  F N3    1 
ATOM   5739  C C4    . DA  G 3 3   ? -6.928  -36.179 -121.504 1.00 41.28  ?  3   DA  F C4    1 
ATOM   5740  P P     . DA  G 3 4   ? -3.208  -31.819 -118.614 1.00 51.50  ?  4   DA  F P     1 
ATOM   5741  O OP1   . DA  G 3 4   ? -2.748  -30.418 -118.503 1.00 52.03  ?  4   DA  F OP1   1 
ATOM   5742  O OP2   . DA  G 3 4   ? -2.523  -32.871 -117.831 1.00 31.90  -1 4   DA  F OP2   1 
ATOM   5743  O "O5'" . DA  G 3 4   ? -4.773  -31.910 -118.289 1.00 32.27  ?  4   DA  F "O5'" 1 
ATOM   5744  C "C5'" . DA  G 3 4   ? -5.685  -31.125 -119.046 1.00 34.72  ?  4   DA  F "C5'" 1 
ATOM   5745  C "C4'" . DA  G 3 4   ? -7.119  -31.343 -118.599 1.00 45.49  ?  4   DA  F "C4'" 1 
ATOM   5746  O "O4'" . DA  G 3 4   ? -7.551  -32.671 -118.990 1.00 49.99  ?  4   DA  F "O4'" 1 
ATOM   5747  C "C3'" . DA  G 3 4   ? -7.360  -31.244 -117.093 1.00 39.36  ?  4   DA  F "C3'" 1 
ATOM   5748  O "O3'" . DA  G 3 4   ? -8.429  -30.334 -116.851 1.00 39.29  ?  4   DA  F "O3'" 1 
ATOM   5749  C "C2'" . DA  G 3 4   ? -7.715  -32.661 -116.648 1.00 42.17  ?  4   DA  F "C2'" 1 
ATOM   5750  C "C1'" . DA  G 3 4   ? -8.241  -33.282 -117.922 1.00 26.76  ?  4   DA  F "C1'" 1 
ATOM   5751  N N9    . DA  G 3 4   ? -8.066  -34.729 -117.989 1.00 28.63  ?  4   DA  F N9    1 
ATOM   5752  C C8    . DA  G 3 4   ? -6.910  -35.439 -117.816 1.00 35.32  ?  4   DA  F C8    1 
ATOM   5753  N N7    . DA  G 3 4   ? -7.069  -36.740 -117.919 1.00 35.48  ?  4   DA  F N7    1 
ATOM   5754  C C5    . DA  G 3 4   ? -8.426  -36.889 -118.156 1.00 34.82  ?  4   DA  F C5    1 
ATOM   5755  C C6    . DA  G 3 4   ? -9.242  -38.021 -118.356 1.00 36.03  ?  4   DA  F C6    1 
ATOM   5756  N N6    . DA  G 3 4   ? -8.785  -39.280 -118.349 1.00 39.14  ?  4   DA  F N6    1 
ATOM   5757  N N1    . DA  G 3 4   ? -10.553 -37.808 -118.565 1.00 34.47  ?  4   DA  F N1    1 
ATOM   5758  C C2    . DA  G 3 4   ? -11.017 -36.557 -118.574 1.00 38.50  ?  4   DA  F C2    1 
ATOM   5759  N N3    . DA  G 3 4   ? -10.355 -35.421 -118.401 1.00 35.93  ?  4   DA  F N3    1 
ATOM   5760  C C4    . DA  G 3 4   ? -9.052  -35.658 -118.193 1.00 33.06  ?  4   DA  F C4    1 
ATOM   5761  P P     . DT  G 3 5   ? -8.829  -29.932 -115.351 1.00 63.08  ?  5   DT  F P     1 
ATOM   5762  O OP1   . DT  G 3 5   ? -9.464  -28.597 -115.411 1.00 48.99  ?  5   DT  F OP1   1 
ATOM   5763  O OP2   . DT  G 3 5   ? -7.652  -30.147 -114.479 1.00 61.46  -1 5   DT  F OP2   1 
ATOM   5764  O "O5'" . DT  G 3 5   ? -9.942  -31.017 -114.960 1.00 55.95  ?  5   DT  F "O5'" 1 
ATOM   5765  C "C5'" . DT  G 3 5   ? -11.110 -31.176 -115.763 1.00 41.41  ?  5   DT  F "C5'" 1 
ATOM   5766  C "C4'" . DT  G 3 5   ? -11.924 -32.382 -115.312 1.00 48.96  ?  5   DT  F "C4'" 1 
ATOM   5767  O "O4'" . DT  G 3 5   ? -11.286 -33.624 -115.730 1.00 50.61  ?  5   DT  F "O4'" 1 
ATOM   5768  C "C3'" . DT  G 3 5   ? -12.112 -32.517 -113.793 1.00 59.11  ?  5   DT  F "C3'" 1 
ATOM   5769  O "O3'" . DT  G 3 5   ? -13.375 -33.081 -113.527 1.00 75.72  ?  5   DT  F "O3'" 1 
ATOM   5770  C "C2'" . DT  G 3 5   ? -11.052 -33.556 -113.453 1.00 59.23  ?  5   DT  F "C2'" 1 
ATOM   5771  C "C1'" . DT  G 3 5   ? -11.320 -34.478 -114.618 1.00 35.50  ?  5   DT  F "C1'" 1 
ATOM   5772  N N1    . DT  G 3 5   ? -10.394 -35.628 -114.773 1.00 35.39  ?  5   DT  F N1    1 
ATOM   5773  C C2    . DT  G 3 5   ? -10.922 -36.828 -115.174 1.00 40.38  ?  5   DT  F C2    1 
ATOM   5774  O O2    . DT  G 3 5   ? -12.104 -36.986 -115.425 1.00 37.15  ?  5   DT  F O2    1 
ATOM   5775  N N3    . DT  G 3 5   ? -10.021 -37.845 -115.274 1.00 40.66  ?  5   DT  F N3    1 
ATOM   5776  C C4    . DT  G 3 5   ? -8.670  -37.798 -115.017 1.00 46.86  ?  5   DT  F C4    1 
ATOM   5777  O O4    . DT  G 3 5   ? -7.944  -38.785 -115.145 1.00 59.42  ?  5   DT  F O4    1 
ATOM   5778  C C5    . DT  G 3 5   ? -8.171  -36.506 -114.590 1.00 39.70  ?  5   DT  F C5    1 
ATOM   5779  C C7    . DT  G 3 5   ? -6.714  -36.325 -114.279 1.00 48.51  ?  5   DT  F C7    1 
ATOM   5780  C C6    . DT  G 3 5   ? -9.052  -35.492 -114.485 1.00 31.74  ?  5   DT  F C6    1 
ATOM   5781  P P     . DG  G 3 6   ? -14.545 -32.255 -112.807 1.00 85.80  ?  6   DG  F P     1 
ATOM   5782  O OP1   . DG  G 3 6   ? -14.790 -31.031 -113.603 1.00 46.64  ?  6   DG  F OP1   1 
ATOM   5783  O OP2   . DG  G 3 6   ? -14.227 -32.157 -111.364 1.00 75.94  -1 6   DG  F OP2   1 
ATOM   5784  O "O5'" . DG  G 3 6   ? -15.802 -33.225 -112.983 1.00 51.76  ?  6   DG  F "O5'" 1 
ATOM   5785  C "C5'" . DG  G 3 6   ? -16.169 -33.690 -114.272 1.00 50.07  ?  6   DG  F "C5'" 1 
ATOM   5786  C "C4'" . DG  G 3 6   ? -16.707 -35.115 -114.219 1.00 58.75  ?  6   DG  F "C4'" 1 
ATOM   5787  O "O4'" . DG  G 3 6   ? -15.615 -36.075 -114.321 1.00 63.31  ?  6   DG  F "O4'" 1 
ATOM   5788  C "C3'" . DG  G 3 6   ? -17.482 -35.473 -112.954 1.00 50.69  ?  6   DG  F "C3'" 1 
ATOM   5789  O "O3'" . DG  G 3 6   ? -18.605 -36.260 -113.280 1.00 62.35  ?  6   DG  F "O3'" 1 
ATOM   5790  C "C2'" . DG  G 3 6   ? -16.464 -36.285 -112.150 1.00 53.71  ?  6   DG  F "C2'" 1 
ATOM   5791  C "C1'" . DG  G 3 6   ? -15.683 -36.997 -113.251 1.00 51.01  ?  6   DG  F "C1'" 1 
ATOM   5792  N N9    . DG  G 3 6   ? -14.317 -37.368 -112.863 1.00 46.56  ?  6   DG  F N9    1 
ATOM   5793  C C8    . DG  G 3 6   ? -13.302 -36.509 -112.524 1.00 51.40  ?  6   DG  F C8    1 
ATOM   5794  N N7    . DG  G 3 6   ? -12.182 -37.110 -112.233 1.00 53.46  ?  6   DG  F N7    1 
ATOM   5795  C C5    . DG  G 3 6   ? -12.459 -38.459 -112.408 1.00 48.39  ?  6   DG  F C5    1 
ATOM   5796  C C6    . DG  G 3 6   ? -11.617 -39.589 -112.243 1.00 52.39  ?  6   DG  F C6    1 
ATOM   5797  O O6    . DG  G 3 6   ? -10.427 -39.617 -111.898 1.00 59.59  ?  6   DG  F O6    1 
ATOM   5798  N N1    . DG  G 3 6   ? -12.284 -40.778 -112.521 1.00 49.01  ?  6   DG  F N1    1 
ATOM   5799  C C2    . DG  G 3 6   ? -13.600 -40.868 -112.906 1.00 50.25  ?  6   DG  F C2    1 
ATOM   5800  N N2    . DG  G 3 6   ? -14.060 -42.111 -113.130 1.00 46.15  ?  6   DG  F N2    1 
ATOM   5801  N N3    . DG  G 3 6   ? -14.406 -39.815 -113.070 1.00 48.82  ?  6   DG  F N3    1 
ATOM   5802  C C4    . DG  G 3 6   ? -13.768 -38.643 -112.802 1.00 45.08  ?  6   DG  F C4    1 
ATOM   5803  P P     . DC  G 3 7   ? -19.693 -36.592 -112.147 1.00 69.22  ?  7   DC  F P     1 
ATOM   5804  O OP1   . DC  G 3 7   ? -20.969 -36.914 -112.822 1.00 82.28  ?  7   DC  F OP1   1 
ATOM   5805  O OP2   . DC  G 3 7   ? -19.645 -35.502 -111.148 1.00 56.06  -1 7   DC  F OP2   1 
ATOM   5806  O "O5'" . DC  G 3 7   ? -19.138 -37.914 -111.451 1.00 49.19  ?  7   DC  F "O5'" 1 
ATOM   5807  C "C5'" . DC  G 3 7   ? -19.065 -39.104 -112.209 1.00 61.21  ?  7   DC  F "C5'" 1 
ATOM   5808  C "C4'" . DC  G 3 7   ? -18.386 -40.213 -111.434 1.00 65.45  ?  7   DC  F "C4'" 1 
ATOM   5809  O "O4'" . DC  G 3 7   ? -16.982 -39.926 -111.288 1.00 65.05  ?  7   DC  F "O4'" 1 
ATOM   5810  C "C3'" . DC  G 3 7   ? -18.926 -40.430 -110.019 1.00 61.11  ?  7   DC  F "C3'" 1 
ATOM   5811  O "O3'" . DC  G 3 7   ? -19.598 -41.669 -109.970 1.00 63.28  ?  7   DC  F "O3'" 1 
ATOM   5812  C "C2'" . DC  G 3 7   ? -17.675 -40.417 -109.118 1.00 61.31  ?  7   DC  F "C2'" 1 
ATOM   5813  C "C1'" . DC  G 3 7   ? -16.535 -40.555 -110.120 1.00 54.28  ?  7   DC  F "C1'" 1 
ATOM   5814  N N1    . DC  G 3 7   ? -15.253 -39.913 -109.692 1.00 49.49  ?  7   DC  F N1    1 
ATOM   5815  C C2    . DC  G 3 7   ? -14.117 -40.707 -109.518 1.00 46.95  ?  7   DC  F C2    1 
ATOM   5816  O O2    . DC  G 3 7   ? -14.210 -41.924 -109.697 1.00 45.34  ?  7   DC  F O2    1 
ATOM   5817  N N3    . DC  G 3 7   ? -12.952 -40.121 -109.142 1.00 50.75  ?  7   DC  F N3    1 
ATOM   5818  C C4    . DC  G 3 7   ? -12.901 -38.799 -108.957 1.00 55.28  ?  7   DC  F C4    1 
ATOM   5819  N N4    . DC  G 3 7   ? -11.733 -38.262 -108.589 1.00 51.18  ?  7   DC  F N4    1 
ATOM   5820  C C5    . DC  G 3 7   ? -14.050 -37.970 -109.142 1.00 50.47  ?  7   DC  F C5    1 
ATOM   5821  C C6    . DC  G 3 7   ? -15.192 -38.562 -109.510 1.00 47.11  ?  7   DC  F C6    1 
ATOM   5822  P P     . DT  G 3 8   ? -20.408 -42.113 -108.658 1.00 59.91  ?  8   DT  F P     1 
ATOM   5823  O OP1   . DT  G 3 8   ? -21.582 -42.901 -109.093 1.00 56.05  ?  8   DT  F OP1   1 
ATOM   5824  O OP2   . DT  G 3 8   ? -20.599 -40.909 -107.819 1.00 66.16  -1 8   DT  F OP2   1 
ATOM   5825  O "O5'" . DT  G 3 8   ? -19.393 -43.077 -107.897 1.00 59.09  ?  8   DT  F "O5'" 1 
ATOM   5826  C "C5'" . DT  G 3 8   ? -18.804 -44.141 -108.618 1.00 42.16  ?  8   DT  F "C5'" 1 
ATOM   5827  C "C4'" . DT  G 3 8   ? -17.679 -44.785 -107.838 1.00 71.58  ?  8   DT  F "C4'" 1 
ATOM   5828  O "O4'" . DT  G 3 8   ? -16.540 -43.895 -107.783 1.00 79.49  ?  8   DT  F "O4'" 1 
ATOM   5829  C "C3'" . DT  G 3 8   ? -18.015 -45.119 -106.377 1.00 75.82  ?  8   DT  F "C3'" 1 
ATOM   5830  O "O3'" . DT  G 3 8   ? -17.866 -46.508 -106.194 1.00 80.80  ?  8   DT  F "O3'" 1 
ATOM   5831  C "C2'" . DT  G 3 8   ? -16.978 -44.324 -105.564 1.00 56.36  ?  8   DT  F "C2'" 1 
ATOM   5832  C "C1'" . DT  G 3 8   ? -15.867 -44.151 -106.582 1.00 52.45  ?  8   DT  F "C1'" 1 
ATOM   5833  N N1    . DT  G 3 8   ? -14.948 -43.010 -106.287 1.00 44.67  ?  8   DT  F N1    1 
ATOM   5834  C C2    . DT  G 3 8   ? -13.596 -43.246 -106.175 1.00 46.78  ?  8   DT  F C2    1 
ATOM   5835  O O2    . DT  G 3 8   ? -13.098 -44.352 -106.297 1.00 43.63  ?  8   DT  F O2    1 
ATOM   5836  N N3    . DT  G 3 8   ? -12.842 -42.136 -105.905 1.00 39.82  ?  8   DT  F N3    1 
ATOM   5837  C C4    . DT  G 3 8   ? -13.291 -40.839 -105.744 1.00 41.06  ?  8   DT  F C4    1 
ATOM   5838  O O4    . DT  G 3 8   ? -12.530 -39.906 -105.503 1.00 39.88  ?  8   DT  F O4    1 
ATOM   5839  C C5    . DT  G 3 8   ? -14.717 -40.659 -105.877 1.00 41.74  ?  8   DT  F C5    1 
ATOM   5840  C C7    . DT  G 3 8   ? -15.321 -39.295 -105.723 1.00 47.95  ?  8   DT  F C7    1 
ATOM   5841  C C6    . DT  G 3 8   ? -15.468 -41.740 -106.140 1.00 44.07  ?  8   DT  F C6    1 
ATOM   5842  P P     . DC  G 3 9   ? -18.606 -47.290 -105.001 1.00 95.16  ?  9   DC  F P     1 
ATOM   5843  O OP1   . DC  G 3 9   ? -19.505 -48.299 -105.604 1.00 86.81  ?  9   DC  F OP1   1 
ATOM   5844  O OP2   . DC  G 3 9   ? -19.144 -46.291 -104.048 1.00 70.83  -1 9   DC  F OP2   1 
ATOM   5845  O "O5'" . DC  G 3 9   ? -17.391 -48.033 -104.292 1.00 67.02  ?  9   DC  F "O5'" 1 
ATOM   5846  C "C5'" . DC  G 3 9   ? -16.425 -48.649 -105.120 1.00 78.25  ?  9   DC  F "C5'" 1 
ATOM   5847  C "C4'" . DC  G 3 9   ? -15.063 -48.614 -104.470 1.00 81.13  ?  9   DC  F "C4'" 1 
ATOM   5848  O "O4'" . DC  G 3 9   ? -14.542 -47.266 -104.511 1.00 76.18  ?  9   DC  F "O4'" 1 
ATOM   5849  C "C3'" . DC  G 3 9   ? -15.041 -49.033 -102.998 1.00 74.56  ?  9   DC  F "C3'" 1 
ATOM   5850  O "O3'" . DC  G 3 9   ? -14.155 -50.113 -102.858 1.00 77.29  ?  9   DC  F "O3'" 1 
ATOM   5851  C "C2'" . DC  G 3 9   ? -14.530 -47.789 -102.261 1.00 72.86  ?  9   DC  F "C2'" 1 
ATOM   5852  C "C1'" . DC  G 3 9   ? -13.776 -47.060 -103.359 1.00 72.35  ?  9   DC  F "C1'" 1 
ATOM   5853  N N1    . DC  G 3 9   ? -13.652 -45.597 -103.119 1.00 61.02  ?  9   DC  F N1    1 
ATOM   5854  C C2    . DC  G 3 9   ? -12.385 -45.011 -103.105 1.00 56.88  ?  9   DC  F C2    1 
ATOM   5855  O O2    . DC  G 3 9   ? -11.396 -45.718 -103.329 1.00 54.39  ?  9   DC  F O2    1 
ATOM   5856  N N3    . DC  G 3 9   ? -12.279 -43.677 -102.874 1.00 45.50  ?  9   DC  F N3    1 
ATOM   5857  C C4    . DC  G 3 9   ? -13.377 -42.952 -102.646 1.00 41.92  ?  9   DC  F C4    1 
ATOM   5858  N N4    . DC  G 3 9   ? -13.227 -41.642 -102.419 1.00 50.88  ?  9   DC  F N4    1 
ATOM   5859  C C5    . DC  G 3 9   ? -14.678 -43.538 -102.641 1.00 38.21  ?  9   DC  F C5    1 
ATOM   5860  C C6    . DC  G 3 9   ? -14.766 -44.852 -102.873 1.00 48.31  ?  9   DC  F C6    1 
ATOM   5861  P P     . DC  G 3 10  ? -14.031 -50.921 -101.478 1.00 96.82  ?  10  DC  F P     1 
ATOM   5862  O OP1   . DC  G 3 10  ? -14.000 -52.366 -101.798 1.00 96.48  ?  10  DC  F OP1   1 
ATOM   5863  O OP2   . DC  G 3 10  ? -15.048 -50.391 -100.544 1.00 84.69  -1 10  DC  F OP2   1 
ATOM   5864  O "O5'" . DC  G 3 10  ? -12.601 -50.480 -100.934 1.00 65.75  ?  10  DC  F "O5'" 1 
ATOM   5865  C "C5'" . DC  G 3 10  ? -11.439 -50.728 -101.700 1.00 81.97  ?  10  DC  F "C5'" 1 
ATOM   5866  C "C4'" . DC  G 3 10  ? -10.243 -50.115 -101.011 1.00 86.09  ?  10  DC  F "C4'" 1 
ATOM   5867  O "O4'" . DC  G 3 10  ? -10.386 -48.674 -101.027 1.00 68.58  ?  10  DC  F "O4'" 1 
ATOM   5868  C "C3'" . DC  G 3 10  ? -10.110 -50.510 -99.539  1.00 68.37  ?  10  DC  F "C3'" 1 
ATOM   5869  O "O3'" . DC  G 3 10  ? -8.859  -51.142 -99.322  1.00 62.45  ?  10  DC  F "O3'" 1 
ATOM   5870  C "C2'" . DC  G 3 10  ? -10.217 -49.189 -98.766  1.00 61.95  ?  10  DC  F "C2'" 1 
ATOM   5871  C "C1'" . DC  G 3 10  ? -9.889  -48.151 -99.824  1.00 61.57  ?  10  DC  F "C1'" 1 
ATOM   5872  N N1    . DC  G 3 10  ? -10.548 -46.837 -99.567  1.00 58.22  ?  10  DC  F N1    1 
ATOM   5873  C C2    . DC  G 3 10  ? -9.788  -45.765 -99.091  1.00 55.37  ?  10  DC  F C2    1 
ATOM   5874  O O2    . DC  G 3 10  ? -8.577  -45.926 -98.909  1.00 57.61  ?  10  DC  F O2    1 
ATOM   5875  N N3    . DC  G 3 10  ? -10.402 -44.577 -98.851  1.00 51.72  ?  10  DC  F N3    1 
ATOM   5876  C C4    . DC  G 3 10  ? -11.716 -44.451 -99.065  1.00 53.82  ?  10  DC  F C4    1 
ATOM   5877  N N4    . DC  G 3 10  ? -12.283 -43.266 -98.816  1.00 46.80  ?  10  DC  F N4    1 
ATOM   5878  C C5    . DC  G 3 10  ? -12.507 -45.537 -99.543  1.00 53.85  ?  10  DC  F C5    1 
ATOM   5879  C C6    . DC  G 3 10  ? -11.889 -46.700 -99.775  1.00 58.47  ?  10  DC  F C6    1 
ATOM   5880  P P     . DT  G 3 11  ? -8.555  -51.861 -97.920  1.00 102.97 ?  11  DT  F P     1 
ATOM   5881  O OP1   . DT  G 3 11  ? -7.593  -52.957 -98.177  1.00 99.29  ?  11  DT  F OP1   1 
ATOM   5882  O OP2   . DT  G 3 11  ? -9.858  -52.149 -97.278  1.00 86.23  -1 11  DT  F OP2   1 
ATOM   5883  O "O5'" . DT  G 3 11  ? -7.817  -50.720 -97.081  1.00 110.68 ?  11  DT  F "O5'" 1 
ATOM   5884  C "C5'" . DT  G 3 11  ? -6.619  -50.135 -97.572  1.00 94.62  ?  11  DT  F "C5'" 1 
ATOM   5885  C "C4'" . DT  G 3 11  ? -6.000  -49.240 -96.516  1.00 92.76  ?  11  DT  F "C4'" 1 
ATOM   5886  O "O4'" . DT  G 3 11  ? -6.724  -47.988 -96.483  1.00 94.58  ?  11  DT  F "O4'" 1 
ATOM   5887  C "C3'" . DT  G 3 11  ? -6.017  -49.795 -95.088  1.00 81.38  ?  11  DT  F "C3'" 1 
ATOM   5888  O "O3'" . DT  G 3 11  ? -4.712  -49.640 -94.513  1.00 97.98  ?  11  DT  F "O3'" 1 
ATOM   5889  C "C2'" . DT  G 3 11  ? -7.073  -48.929 -94.385  1.00 70.90  ?  11  DT  F "C2'" 1 
ATOM   5890  C "C1'" . DT  G 3 11  ? -6.961  -47.619 -95.153  1.00 66.85  ?  11  DT  F "C1'" 1 
ATOM   5891  N N1    . DT  G 3 11  ? -8.207  -46.786 -95.134  1.00 55.24  ?  11  DT  F N1    1 
ATOM   5892  C C2    . DT  G 3 11  ? -8.129  -45.469 -94.746  1.00 66.39  ?  11  DT  F C2    1 
ATOM   5893  O O2    . DT  G 3 11  ? -7.092  -44.941 -94.390  1.00 79.79  ?  11  DT  F O2    1 
ATOM   5894  N N3    . DT  G 3 11  ? -9.318  -44.789 -94.780  1.00 55.16  ?  11  DT  F N3    1 
ATOM   5895  C C4    . DT  G 3 11  ? -10.552 -45.278 -95.163  1.00 47.38  ?  11  DT  F C4    1 
ATOM   5896  O O4    . DT  G 3 11  ? -11.564 -44.581 -95.157  1.00 40.81  ?  11  DT  F O4    1 
ATOM   5897  C C5    . DT  G 3 11  ? -10.565 -46.665 -95.570  1.00 52.61  ?  11  DT  F C5    1 
ATOM   5898  C C7    . DT  G 3 11  ? -11.846 -47.310 -96.008  1.00 52.53  ?  11  DT  F C7    1 
ATOM   5899  C C6    . DT  G 3 11  ? -9.404  -47.342 -95.541  1.00 53.75  ?  11  DT  F C6    1 
ATOM   5900  P P     . DA  G 3 12  ? -4.277  -50.390 -93.155  1.00 106.22 ?  12  DA  F P     1 
ATOM   5901  O OP1   . DA  G 3 12  ? -2.910  -50.922 -93.347  1.00 105.97 ?  12  DA  F OP1   1 
ATOM   5902  O OP2   . DA  G 3 12  ? -5.377  -51.304 -92.769  1.00 76.06  -1 12  DA  F OP2   1 
ATOM   5903  O "O5'" . DA  G 3 12  ? -4.227  -49.218 -92.069  1.00 101.52 ?  12  DA  F "O5'" 1 
ATOM   5904  C "C5'" . DA  G 3 12  ? -3.629  -47.970 -92.395  1.00 107.29 ?  12  DA  F "C5'" 1 
ATOM   5905  C "C4'" . DA  G 3 12  ? -3.959  -46.936 -91.335  1.00 87.59  ?  12  DA  F "C4'" 1 
ATOM   5906  O "O4'" . DA  G 3 12  ? -5.261  -46.376 -91.653  1.00 78.43  ?  12  DA  F "O4'" 1 
ATOM   5907  C "C3'" . DA  G 3 12  ? -4.094  -47.468 -89.902  1.00 101.72 ?  12  DA  F "C3'" 1 
ATOM   5908  O "O3'" . DA  G 3 12  ? -3.604  -46.497 -88.969  1.00 122.86 ?  12  DA  F "O3'" 1 
ATOM   5909  C "C2'" . DA  G 3 12  ? -5.593  -47.655 -89.765  1.00 92.02  ?  12  DA  F "C2'" 1 
ATOM   5910  C "C1'" . DA  G 3 12  ? -6.075  -46.431 -90.508  1.00 73.54  ?  12  DA  F "C1'" 1 
ATOM   5911  N N9    . DA  G 3 12  ? -7.453  -46.560 -90.948  1.00 64.16  ?  12  DA  F N9    1 
ATOM   5912  C C8    . DA  G 3 12  ? -8.097  -47.705 -91.330  1.00 78.12  ?  12  DA  F C8    1 
ATOM   5913  N N7    . DA  G 3 12  ? -9.342  -47.514 -91.697  1.00 77.86  ?  12  DA  F N7    1 
ATOM   5914  C C5    . DA  G 3 12  ? -9.512  -46.146 -91.573  1.00 66.44  ?  12  DA  F C5    1 
ATOM   5915  C C6    . DA  G 3 12  ? -10.607 -45.294 -91.815  1.00 64.54  ?  12  DA  F C6    1 
ATOM   5916  N N6    . DA  G 3 12  ? -11.800 -45.713 -92.254  1.00 64.95  ?  12  DA  F N6    1 
ATOM   5917  N N1    . DA  G 3 12  ? -10.427 -43.986 -91.591  1.00 56.73  ?  12  DA  F N1    1 
ATOM   5918  C C2    . DA  G 3 12  ? -9.243  -43.551 -91.149  1.00 62.54  ?  12  DA  F C2    1 
ATOM   5919  N N3    . DA  G 3 12  ? -8.147  -44.245 -90.887  1.00 63.01  ?  12  DA  F N3    1 
ATOM   5920  C C4    . DA  G 3 12  ? -8.350  -45.547 -91.121  1.00 59.69  ?  12  DA  F C4    1 
ATOM   5921  P P     . DT  G 3 13  ? -2.125  -46.570 -88.341  1.00 137.89 ?  13  DT  F P     1 
ATOM   5922  O OP1   . DT  G 3 13  ? -1.168  -46.752 -89.455  1.00 98.07  ?  13  DT  F OP1   1 
ATOM   5923  O OP2   . DT  G 3 13  ? -2.144  -47.528 -87.214  1.00 116.52 -1 13  DT  F OP2   1 
ATOM   5924  O "O5'" . DT  G 3 13  ? -1.926  -45.098 -87.732  1.00 116.18 ?  13  DT  F "O5'" 1 
ATOM   5925  C "C5'" . DT  G 3 13  ? -1.899  -43.963 -88.597  1.00 113.40 ?  13  DT  F "C5'" 1 
ATOM   5926  C "C4'" . DT  G 3 13  ? -2.777  -42.837 -88.063  1.00 100.91 ?  13  DT  F "C4'" 1 
ATOM   5927  O "O4'" . DT  G 3 13  ? -4.168  -43.215 -88.237  1.00 99.69  ?  13  DT  F "O4'" 1 
ATOM   5928  C "C3'" . DT  G 3 13  ? -2.627  -42.507 -86.572  1.00 95.81  ?  13  DT  F "C3'" 1 
ATOM   5929  O "O3'" . DT  G 3 13  ? -2.791  -41.091 -86.362  1.00 92.57  ?  13  DT  F "O3'" 1 
ATOM   5930  C "C2'" . DT  G 3 13  ? -3.773  -43.302 -85.952  1.00 96.96  ?  13  DT  F "C2'" 1 
ATOM   5931  C "C1'" . DT  G 3 13  ? -4.842  -43.093 -87.007  1.00 97.50  ?  13  DT  F "C1'" 1 
ATOM   5932  N N1    . DT  G 3 13  ? -5.926  -44.118 -86.971  1.00 100.88 ?  13  DT  F N1    1 
ATOM   5933  C C2    . DT  G 3 13  ? -7.208  -43.750 -87.305  1.00 101.38 ?  13  DT  F C2    1 
ATOM   5934  O O2    . DT  G 3 13  ? -7.514  -42.614 -87.622  1.00 104.89 ?  13  DT  F O2    1 
ATOM   5935  N N3    . DT  G 3 13  ? -8.128  -44.764 -87.249  1.00 90.05  ?  13  DT  F N3    1 
ATOM   5936  C C4    . DT  G 3 13  ? -7.899  -46.084 -86.905  1.00 87.19  ?  13  DT  F C4    1 
ATOM   5937  O O4    . DT  G 3 13  ? -8.795  -46.922 -86.885  1.00 75.94  ?  13  DT  F O4    1 
ATOM   5938  C C5    . DT  G 3 13  ? -6.531  -46.406 -86.571  1.00 96.54  ?  13  DT  F C5    1 
ATOM   5939  C C7    . DT  G 3 13  ? -6.161  -47.807 -86.180  1.00 104.24 ?  13  DT  F C7    1 
ATOM   5940  C C6    . DT  G 3 13  ? -5.620  -45.420 -86.622  1.00 96.92  ?  13  DT  F C6    1 
ATOM   5941  P P     . DA  G 3 14  ? -1.512  -40.149 -86.097  1.00 107.81 ?  14  DA  F P     1 
ATOM   5942  O OP1   . DA  G 3 14  ? -0.325  -40.863 -86.616  1.00 118.19 -1 14  DA  F OP1   1 
ATOM   5943  O OP2   . DA  G 3 14  ? -1.549  -39.727 -84.680  1.00 101.54 ?  14  DA  F OP2   1 
ATOM   5944  O "O5'" . DA  G 3 14  ? -1.749  -38.865 -87.033  1.00 95.83  ?  14  DA  F "O5'" 1 
ATOM   5945  C "C5'" . DA  G 3 14  ? -1.966  -37.554 -86.473  1.00 89.69  ?  14  DA  F "C5'" 1 
ATOM   5946  C "C4'" . DA  G 3 14  ? -3.421  -37.125 -86.613  1.00 91.46  ?  14  DA  F "C4'" 1 
ATOM   5947  O "O4'" . DA  G 3 14  ? -4.262  -38.259 -86.322  1.00 91.06  ?  14  DA  F "O4'" 1 
ATOM   5948  C "C3'" . DA  G 3 14  ? -3.886  -35.978 -85.704  1.00 89.63  ?  14  DA  F "C3'" 1 
ATOM   5949  O "O3'" . DA  G 3 14  ? -4.854  -35.182 -86.473  1.00 88.03  ?  14  DA  F "O3'" 1 
ATOM   5950  C "C2'" . DA  G 3 14  ? -4.518  -36.765 -84.555  1.00 78.55  ?  14  DA  F "C2'" 1 
ATOM   5951  C "C1'" . DA  G 3 14  ? -5.156  -37.940 -85.296  1.00 80.72  ?  14  DA  F "C1'" 1 
ATOM   5952  N N9    . DA  G 3 14  ? -5.284  -39.148 -84.485  1.00 76.34  ?  14  DA  F N9    1 
ATOM   5953  C C8    . DA  G 3 14  ? -4.363  -39.647 -83.606  1.00 86.13  ?  14  DA  F C8    1 
ATOM   5954  N N7    . DA  G 3 14  ? -4.723  -40.777 -83.045  1.00 91.60  ?  14  DA  F N7    1 
ATOM   5955  C C5    . DA  G 3 14  ? -5.950  -41.058 -83.620  1.00 79.25  ?  14  DA  F C5    1 
ATOM   5956  C C6    . DA  G 3 14  ? -6.856  -42.124 -83.451  1.00 86.44  ?  14  DA  F C6    1 
ATOM   5957  N N6    . DA  G 3 14  ? -6.645  -43.145 -82.614  1.00 94.46  ?  14  DA  F N6    1 
ATOM   5958  N N1    . DA  G 3 14  ? -7.992  -42.100 -84.178  1.00 85.15  ?  14  DA  F N1    1 
ATOM   5959  C C2    . DA  G 3 14  ? -8.201  -41.076 -85.015  1.00 83.70  ?  14  DA  F C2    1 
ATOM   5960  N N3    . DA  G 3 14  ? -7.425  -40.021 -85.259  1.00 88.60  ?  14  DA  F N3    1 
ATOM   5961  C C4    . DA  G 3 14  ? -6.305  -40.072 -84.522  1.00 77.33  ?  14  DA  F C4    1 
ATOM   5962  P P     . DC  G 3 15  ? -5.192  -33.617 -86.201  1.00 107.49 ?  15  DC  F P     1 
ATOM   5963  O OP1   . DC  G 3 15  ? -5.853  -33.142 -87.437  1.00 96.32  ?  15  DC  F OP1   1 
ATOM   5964  O OP2   . DC  G 3 15  ? -3.903  -33.018 -85.801  1.00 94.19  -1 15  DC  F OP2   1 
ATOM   5965  O "O5'" . DC  G 3 15  ? -6.214  -33.359 -84.971  1.00 94.53  ?  15  DC  F "O5'" 1 
ATOM   5966  C "C5'" . DC  G 3 15  ? -6.499  -34.231 -83.907  1.00 84.35  ?  15  DC  F "C5'" 1 
ATOM   5967  C "C4'" . DC  G 3 15  ? -7.676  -35.136 -84.226  1.00 86.69  ?  15  DC  F "C4'" 1 
ATOM   5968  O "O4'" . DC  G 3 15  ? -7.403  -36.456 -83.694  1.00 79.35  ?  15  DC  F "O4'" 1 
ATOM   5969  C "C3'" . DC  G 3 15  ? -9.021  -34.722 -83.594  1.00 61.85  ?  15  DC  F "C3'" 1 
ATOM   5970  O "O3'" . DC  G 3 15  ? -10.064 -34.835 -84.580  1.00 89.26  ?  15  DC  F "O3'" 1 
ATOM   5971  C "C2'" . DC  G 3 15  ? -9.185  -35.715 -82.447  1.00 56.73  ?  15  DC  F "C2'" 1 
ATOM   5972  C "C1'" . DC  G 3 15  ? -8.557  -36.941 -83.065  1.00 66.91  ?  15  DC  F "C1'" 1 
ATOM   5973  N N1    . DC  G 3 15  ? -8.127  -37.943 -82.061  1.00 65.41  ?  15  DC  F N1    1 
ATOM   5974  C C2    . DC  G 3 15  ? -9.023  -38.921 -81.622  1.00 67.63  ?  15  DC  F C2    1 
ATOM   5975  O O2    . DC  G 3 15  ? -10.176 -38.929 -82.072  1.00 65.79  ?  15  DC  F O2    1 
ATOM   5976  N N3    . DC  G 3 15  ? -8.605  -39.828 -80.705  1.00 60.49  ?  15  DC  F N3    1 
ATOM   5977  C C4    . DC  G 3 15  ? -7.353  -39.782 -80.243  1.00 71.25  ?  15  DC  F C4    1 
ATOM   5978  N N4    . DC  G 3 15  ? -6.984  -40.698 -79.345  1.00 74.52  ?  15  DC  F N4    1 
ATOM   5979  C C5    . DC  G 3 15  ? -6.425  -38.795 -80.684  1.00 65.57  ?  15  DC  F C5    1 
ATOM   5980  C C6    . DC  G 3 15  ? -6.849  -37.906 -81.584  1.00 60.07  ?  15  DC  F C6    1 
ATOM   5981  P P     . DG  G 3 16  ? -11.595 -34.454 -84.252  1.00 79.27  ?  16  DG  F P     1 
ATOM   5982  O OP1   . DG  G 3 16  ? -12.258 -35.730 -83.898  1.00 70.36  -1 16  DG  F OP1   1 
ATOM   5983  O OP2   . DG  G 3 16  ? -12.110 -33.668 -85.397  1.00 83.78  ?  16  DG  F OP2   1 
ATOM   5984  O "O5'" . DG  G 3 16  ? -11.532 -33.489 -82.974  1.00 69.15  ?  16  DG  F "O5'" 1 
ATOM   5985  C "C5'" . DG  G 3 16  ? -12.738 -33.151 -82.245  1.00 74.64  ?  16  DG  F "C5'" 1 
ATOM   5986  C "C4'" . DG  G 3 16  ? -13.374 -34.419 -81.690  1.00 75.04  ?  16  DG  F "C4'" 1 
ATOM   5987  O "O4'" . DG  G 3 16  ? -12.335 -35.285 -81.198  1.00 69.10  ?  16  DG  F "O4'" 1 
ATOM   5988  C "C3'" . DG  G 3 16  ? -14.350 -34.209 -80.521  1.00 56.42  ?  16  DG  F "C3'" 1 
ATOM   5989  O "O3'" . DG  G 3 16  ? -15.590 -34.885 -80.769  1.00 53.26  ?  16  DG  F "O3'" 1 
ATOM   5990  C "C2'" . DG  G 3 16  ? -13.585 -34.794 -79.321  1.00 51.80  ?  16  DG  F "C2'" 1 
ATOM   5991  C "C1'" . DG  G 3 16  ? -12.748 -35.868 -79.997  1.00 46.55  ?  16  DG  F "C1'" 1 
ATOM   5992  N N9    . DG  G 3 16  ? -11.522 -36.195 -79.277  1.00 59.61  ?  16  DG  F N9    1 
ATOM   5993  C C8    . DG  G 3 16  ? -10.524 -35.318 -78.927  1.00 63.50  ?  16  DG  F C8    1 
ATOM   5994  N N7    . DG  G 3 16  ? -9.522  -35.886 -78.319  1.00 62.42  ?  16  DG  F N7    1 
ATOM   5995  C C5    . DG  G 3 16  ? -9.863  -37.230 -78.281  1.00 55.59  ?  16  DG  F C5    1 
ATOM   5996  C C6    . DG  G 3 16  ? -9.156  -38.332 -77.746  1.00 56.50  ?  16  DG  F C6    1 
ATOM   5997  O O6    . DG  G 3 16  ? -8.054  -38.335 -77.176  1.00 51.74  ?  16  DG  F O6    1 
ATOM   5998  N N1    . DG  G 3 16  ? -9.857  -39.524 -77.915  1.00 56.79  ?  16  DG  F N1    1 
ATOM   5999  C C2    . DG  G 3 16  ? -11.083 -39.636 -78.527  1.00 59.42  ?  16  DG  F C2    1 
ATOM   6000  N N2    . DG  G 3 16  ? -11.600 -40.872 -78.597  1.00 62.39  ?  16  DG  F N2    1 
ATOM   6001  N N3    . DG  G 3 16  ? -11.757 -38.611 -79.036  1.00 55.45  ?  16  DG  F N3    1 
ATOM   6002  C C4    . DG  G 3 16  ? -11.088 -37.442 -78.878  1.00 55.89  ?  16  DG  F C4    1 
ATOM   6003  P P     . DA  G 3 17  ? -16.902 -34.544 -79.901  1.00 62.40  ?  17  DA  F P     1 
ATOM   6004  O OP1   . DA  G 3 17  ? -18.080 -34.891 -80.727  1.00 71.47  ?  17  DA  F OP1   1 
ATOM   6005  O OP2   . DA  G 3 17  ? -16.764 -33.172 -79.367  1.00 67.33  -1 17  DA  F OP2   1 
ATOM   6006  O "O5'" . DA  G 3 17  ? -16.821 -35.571 -78.679  1.00 80.17  ?  17  DA  F "O5'" 1 
ATOM   6007  C "C5'" . DA  G 3 17  ? -16.833 -36.969 -78.905  1.00 81.19  ?  17  DA  F "C5'" 1 
ATOM   6008  C "C4'" . DA  G 3 17  ? -16.435 -37.699 -77.634  1.00 83.05  ?  17  DA  F "C4'" 1 
ATOM   6009  O "O4'" . DA  G 3 17  ? -15.016 -37.544 -77.422  1.00 77.70  ?  17  DA  F "O4'" 1 
ATOM   6010  C "C3'" . DA  G 3 17  ? -17.095 -37.219 -76.325  1.00 80.29  ?  17  DA  F "C3'" 1 
ATOM   6011  O "O3'" . DA  G 3 17  ? -17.802 -38.299 -75.732  1.00 91.06  ?  17  DA  F "O3'" 1 
ATOM   6012  C "C2'" . DA  G 3 17  ? -15.912 -36.792 -75.445  1.00 69.76  ?  17  DA  F "C2'" 1 
ATOM   6013  C "C1'" . DA  G 3 17  ? -14.794 -37.617 -76.046  1.00 56.89  ?  17  DA  F "C1'" 1 
ATOM   6014  N N9    . DA  G 3 17  ? -13.458 -37.123 -75.749  1.00 44.66  ?  17  DA  F N9    1 
ATOM   6015  C C8    . DA  G 3 17  ? -13.032 -35.824 -75.732  1.00 47.87  ?  17  DA  F C8    1 
ATOM   6016  N N7    . DA  G 3 17  ? -11.762 -35.689 -75.417  1.00 51.52  ?  17  DA  F N7    1 
ATOM   6017  C C5    . DA  G 3 17  ? -11.335 -36.990 -75.206  1.00 55.02  ?  17  DA  F C5    1 
ATOM   6018  C C6    . DA  G 3 17  ? -10.089 -37.541 -74.836  1.00 52.07  ?  17  DA  F C6    1 
ATOM   6019  N N6    . DA  G 3 17  ? -8.986  -36.815 -74.609  1.00 48.02  ?  17  DA  F N6    1 
ATOM   6020  N N1    . DA  G 3 17  ? -10.017 -38.880 -74.718  1.00 53.41  ?  17  DA  F N1    1 
ATOM   6021  C C2    . DA  G 3 17  ? -11.110 -39.615 -74.939  1.00 60.48  ?  17  DA  F C2    1 
ATOM   6022  N N3    . DA  G 3 17  ? -12.327 -39.215 -75.286  1.00 57.21  ?  17  DA  F N3    1 
ATOM   6023  C C4    . DA  G 3 17  ? -12.373 -37.881 -75.402  1.00 53.18  ?  17  DA  F C4    1 
ATOM   6024  P P     . DC  G 3 18  ? -19.115 -38.063 -74.837  1.00 86.75  ?  18  DC  F P     1 
ATOM   6025  O OP1   . DC  G 3 18  ? -20.274 -38.623 -75.569  1.00 79.87  ?  18  DC  F OP1   1 
ATOM   6026  O OP2   . DC  G 3 18  ? -19.127 -36.646 -74.411  1.00 72.80  -1 18  DC  F OP2   1 
ATOM   6027  O "O5'" . DC  G 3 18  ? -18.817 -38.969 -73.546  1.00 86.49  ?  18  DC  F "O5'" 1 
ATOM   6028  C "C5'" . DC  G 3 18  ? -18.427 -40.329 -73.719  1.00 85.12  ?  18  DC  F "C5'" 1 
ATOM   6029  C "C4'" . DC  G 3 18  ? -17.276 -40.700 -72.790  1.00 88.85  ?  18  DC  F "C4'" 1 
ATOM   6030  O "O4'" . DC  G 3 18  ? -16.102 -39.937 -73.115  1.00 78.66  ?  18  DC  F "O4'" 1 
ATOM   6031  C "C3'" . DC  G 3 18  ? -17.494 -40.446 -71.297  1.00 83.29  ?  18  DC  F "C3'" 1 
ATOM   6032  O "O3'" . DC  G 3 18  ? -17.863 -41.653 -70.656  1.00 91.70  ?  18  DC  F "O3'" 1 
ATOM   6033  C "C2'" . DC  G 3 18  ? -16.117 -39.967 -70.793  1.00 73.92  ?  18  DC  F "C2'" 1 
ATOM   6034  C "C1'" . DC  G 3 18  ? -15.230 -40.079 -72.029  1.00 69.04  ?  18  DC  F "C1'" 1 
ATOM   6035  N N1    . DC  G 3 18  ? -14.184 -39.032 -72.084  1.00 75.04  ?  18  DC  F N1    1 
ATOM   6036  C C2    . DC  G 3 18  ? -12.854 -39.385 -71.844  1.00 68.99  ?  18  DC  F C2    1 
ATOM   6037  O O2    . DC  G 3 18  ? -12.578 -40.572 -71.641  1.00 65.87  ?  18  DC  F O2    1 
ATOM   6038  N N3    . DC  G 3 18  ? -11.901 -38.420 -71.875  1.00 60.45  ?  18  DC  F N3    1 
ATOM   6039  C C4    . DC  G 3 18  ? -12.246 -37.152 -72.106  1.00 65.92  ?  18  DC  F C4    1 
ATOM   6040  N N4    . DC  G 3 18  ? -11.276 -36.233 -72.125  1.00 66.60  ?  18  DC  F N4    1 
ATOM   6041  C C5    . DC  G 3 18  ? -13.603 -36.770 -72.331  1.00 71.47  ?  18  DC  F C5    1 
ATOM   6042  C C6    . DC  G 3 18  ? -14.531 -37.732 -72.301  1.00 80.52  ?  18  DC  F C6    1 
ATOM   6043  P P     . DG  G 3 19  ? -18.195 -41.667 -69.084  1.00 93.09  ?  19  DG  F P     1 
ATOM   6044  O OP1   . DG  G 3 19  ? -19.000 -42.878 -68.812  1.00 87.80  ?  19  DG  F OP1   1 
ATOM   6045  O OP2   . DG  G 3 19  ? -18.732 -40.332 -68.740  1.00 74.08  -1 19  DG  F OP2   1 
ATOM   6046  O "O5'" . DG  G 3 19  ? -16.761 -41.822 -68.375  1.00 72.90  ?  19  DG  F "O5'" 1 
ATOM   6047  C "C5'" . DG  G 3 19  ? -16.154 -43.100 -68.231  1.00 73.01  ?  19  DG  F "C5'" 1 
ATOM   6048  C "C4'" . DG  G 3 19  ? -14.886 -43.003 -67.392  1.00 69.47  ?  19  DG  F "C4'" 1 
ATOM   6049  O "O4'" . DG  G 3 19  ? -13.967 -42.059 -67.995  1.00 57.40  ?  19  DG  F "O4'" 1 
ATOM   6050  C "C3'" . DG  G 3 19  ? -15.104 -42.529 -65.950  1.00 97.46  ?  19  DG  F "C3'" 1 
ATOM   6051  O "O3'" . DG  G 3 19  ? -14.782 -43.570 -65.023  1.00 105.04 ?  19  DG  F "O3'" 1 
ATOM   6052  C "C2'" . DG  G 3 19  ? -14.158 -41.337 -65.775  1.00 91.91  ?  19  DG  F "C2'" 1 
ATOM   6053  C "C1'" . DG  G 3 19  ? -13.230 -41.436 -66.975  1.00 63.17  ?  19  DG  F "C1'" 1 
ATOM   6054  N N9    . DG  G 3 19  ? -12.732 -40.140 -67.428  1.00 66.97  ?  19  DG  F N9    1 
ATOM   6055  C C8    . DG  G 3 19  ? -13.419 -39.179 -68.130  1.00 75.37  ?  19  DG  F C8    1 
ATOM   6056  N N7    . DG  G 3 19  ? -12.712 -38.108 -68.371  1.00 71.97  ?  19  DG  F N7    1 
ATOM   6057  C C5    . DG  G 3 19  ? -11.484 -38.368 -67.775  1.00 61.74  ?  19  DG  F C5    1 
ATOM   6058  C C6    . DG  G 3 19  ? -10.315 -37.571 -67.705  1.00 63.67  ?  19  DG  F C6    1 
ATOM   6059  O O6    . DG  G 3 19  ? -10.128 -36.440 -68.173  1.00 65.84  ?  19  DG  F O6    1 
ATOM   6060  N N1    . DG  G 3 19  ? -9.292  -38.213 -67.007  1.00 62.75  ?  19  DG  F N1    1 
ATOM   6061  C C2    . DG  G 3 19  ? -9.393  -39.468 -66.449  1.00 78.03  ?  19  DG  F C2    1 
ATOM   6062  N N2    . DG  G 3 19  ? -8.305  -39.928 -65.814  1.00 84.08  ?  19  DG  F N2    1 
ATOM   6063  N N3    . DG  G 3 19  ? -10.483 -40.223 -66.509  1.00 76.79  ?  19  DG  F N3    1 
ATOM   6064  C C4    . DG  G 3 19  ? -11.485 -39.611 -67.185  1.00 64.79  ?  19  DG  F C4    1 
ATOM   6065  P P     . DT  G 3 20  ? -14.761 -43.254 -63.445  1.00 95.64  ?  20  DT  F P     1 
ATOM   6066  O OP1   . DT  G 3 20  ? -14.968 -44.532 -62.729  1.00 103.19 ?  20  DT  F OP1   1 
ATOM   6067  O OP2   . DT  G 3 20  ? -15.678 -42.115 -63.216  1.00 77.50  -1 20  DT  F OP2   1 
ATOM   6068  O "O5'" . DT  G 3 20  ? -13.272 -42.734 -63.158  1.00 60.75  ?  20  DT  F "O5'" 1 
ATOM   6069  C "C5'" . DT  G 3 20  ? -12.146 -43.531 -63.515  1.00 78.02  ?  20  DT  F "C5'" 1 
ATOM   6070  C "C4'" . DT  G 3 20  ? -10.888 -43.023 -62.825  1.00 91.91  ?  20  DT  F "C4'" 1 
ATOM   6071  O "O4'" . DT  G 3 20  ? -10.471 -41.773 -63.429  1.00 87.13  ?  20  DT  F "O4'" 1 
ATOM   6072  C "C3'" . DT  G 3 20  ? -11.030 -42.758 -61.325  1.00 104.13 ?  20  DT  F "C3'" 1 
ATOM   6073  O "O3'" . DT  G 3 20  ? -9.887  -43.260 -60.635  1.00 114.04 ?  20  DT  F "O3'" 1 
ATOM   6074  C "C2'" . DT  G 3 20  ? -11.115 -41.232 -61.240  1.00 86.95  ?  20  DT  F "C2'" 1 
ATOM   6075  C "C1'" . DT  G 3 20  ? -10.269 -40.800 -62.431  1.00 76.00  ?  20  DT  F "C1'" 1 
ATOM   6076  N N1    . DT  G 3 20  ? -10.658 -39.475 -62.990  1.00 80.21  ?  20  DT  F N1    1 
ATOM   6077  C C2    . DT  G 3 20  ? -9.747  -38.442 -62.976  1.00 73.20  ?  20  DT  F C2    1 
ATOM   6078  O O2    . DT  G 3 20  ? -8.622  -38.548 -62.519  1.00 68.64  ?  20  DT  F O2    1 
ATOM   6079  N N3    . DT  G 3 20  ? -10.205 -37.269 -63.517  1.00 60.81  ?  20  DT  F N3    1 
ATOM   6080  C C4    . DT  G 3 20  ? -11.455 -37.033 -64.062  1.00 61.11  ?  20  DT  F C4    1 
ATOM   6081  O O4    . DT  G 3 20  ? -11.776 -35.944 -64.526  1.00 58.30  ?  20  DT  F O4    1 
ATOM   6082  C C5    . DT  G 3 20  ? -12.359 -38.157 -64.048  1.00 64.95  ?  20  DT  F C5    1 
ATOM   6083  C C7    . DT  G 3 20  ? -13.739 -38.017 -64.615  1.00 68.52  ?  20  DT  F C7    1 
ATOM   6084  C C6    . DT  G 3 20  ? -11.922 -39.311 -63.521  1.00 73.57  ?  20  DT  F C6    1 
ATOM   6085  P P     . DT  G 3 21  ? -9.696  -43.006 -59.057  1.00 97.92  ?  21  DT  F P     1 
ATOM   6086  O OP1   . DT  G 3 21  ? -9.051  -44.206 -58.480  1.00 104.33 ?  21  DT  F OP1   1 
ATOM   6087  O OP2   . DT  G 3 21  ? -10.994 -42.536 -58.521  1.00 72.06  -1 21  DT  F OP2   1 
ATOM   6088  O "O5'" . DT  G 3 21  ? -8.667  -41.782 -58.997  1.00 65.94  ?  21  DT  F "O5'" 1 
ATOM   6089  C "C5'" . DT  G 3 21  ? -7.433  -41.865 -59.690  1.00 84.60  ?  21  DT  F "C5'" 1 
ATOM   6090  C "C4'" . DT  G 3 21  ? -6.568  -40.644 -59.427  1.00 82.59  ?  21  DT  F "C4'" 1 
ATOM   6091  O "O4'" . DT  G 3 21  ? -7.203  -39.471 -60.008  1.00 96.42  ?  21  DT  F "O4'" 1 
ATOM   6092  C "C3'" . DT  G 3 21  ? -6.320  -40.288 -57.962  1.00 83.47  ?  21  DT  F "C3'" 1 
ATOM   6093  O "O3'" . DT  G 3 21  ? -4.985  -39.807 -57.843  1.00 103.09 ?  21  DT  F "O3'" 1 
ATOM   6094  C "C2'" . DT  G 3 21  ? -7.347  -39.197 -57.692  1.00 72.84  ?  21  DT  F "C2'" 1 
ATOM   6095  C "C1'" . DT  G 3 21  ? -7.340  -38.470 -59.021  1.00 72.93  ?  21  DT  F "C1'" 1 
ATOM   6096  N N1    . DT  G 3 21  ? -8.585  -37.696 -59.292  1.00 74.39  ?  21  DT  F N1    1 
ATOM   6097  C C2    . DT  G 3 21  ? -8.479  -36.386 -59.682  1.00 76.48  ?  21  DT  F C2    1 
ATOM   6098  O O2    . DT  G 3 21  ? -7.411  -35.810 -59.803  1.00 78.07  ?  21  DT  F O2    1 
ATOM   6099  N N3    . DT  G 3 21  ? -9.672  -35.759 -59.911  1.00 69.44  ?  21  DT  F N3    1 
ATOM   6100  C C4    . DT  G 3 21  ? -10.939 -36.296 -59.808  1.00 63.76  ?  21  DT  F C4    1 
ATOM   6101  O O4    . DT  G 3 21  ? -11.953 -35.636 -60.046  1.00 52.52  ?  21  DT  F O4    1 
ATOM   6102  C C5    . DT  G 3 21  ? -10.986 -37.683 -59.402  1.00 72.80  ?  21  DT  F C5    1 
ATOM   6103  C C7    . DT  G 3 21  ? -12.306 -38.382 -59.252  1.00 75.48  ?  21  DT  F C7    1 
ATOM   6104  C C6    . DT  G 3 21  ? -9.818  -38.311 -59.168  1.00 76.84  ?  21  DT  F C6    1 
ATOM   6105  P P     . DT  G 3 22  ? -4.297  -39.549 -56.415  1.00 127.66 ?  22  DT  F P     1 
ATOM   6106  O OP1   . DT  G 3 22  ? -2.973  -40.210 -56.425  1.00 135.76 ?  22  DT  F OP1   1 
ATOM   6107  O OP2   . DT  G 3 22  ? -5.287  -39.886 -55.368  1.00 84.17  -1 22  DT  F OP2   1 
ATOM   6108  O "O5'" . DT  G 3 22  ? -4.084  -37.963 -56.397  1.00 97.22  ?  22  DT  F "O5'" 1 
ATOM   6109  C "C5'" . DT  G 3 22  ? -3.301  -37.353 -57.422  1.00 87.88  ?  22  DT  F "C5'" 1 
ATOM   6110  C "C4'" . DT  G 3 22  ? -3.484  -35.848 -57.426  1.00 95.84  ?  22  DT  F "C4'" 1 
ATOM   6111  O "O4'" . DT  G 3 22  ? -4.861  -35.552 -57.764  1.00 98.63  ?  22  DT  F "O4'" 1 
ATOM   6112  C "C3'" . DT  G 3 22  ? -3.226  -35.147 -56.086  1.00 94.80  ?  22  DT  F "C3'" 1 
ATOM   6113  O "O3'" . DT  G 3 22  ? -2.257  -34.113 -56.266  1.00 107.24 ?  22  DT  F "O3'" 1 
ATOM   6114  C "C2'" . DT  G 3 22  ? -4.598  -34.594 -55.688  1.00 97.21  ?  22  DT  F "C2'" 1 
ATOM   6115  C "C1'" . DT  G 3 22  ? -5.263  -34.425 -57.040  1.00 93.72  ?  22  DT  F "C1'" 1 
ATOM   6116  N N1    . DT  G 3 22  ? -6.749  -34.452 -56.959  1.00 79.95  ?  22  DT  F N1    1 
ATOM   6117  C C2    . DT  G 3 22  ? -7.477  -33.407 -57.475  1.00 74.42  ?  22  DT  F C2    1 
ATOM   6118  O O2    . DT  G 3 22  ? -6.970  -32.435 -58.004  1.00 78.27  ?  22  DT  F O2    1 
ATOM   6119  N N3    . DT  G 3 22  ? -8.835  -33.540 -57.347  1.00 67.08  ?  22  DT  F N3    1 
ATOM   6120  C C4    . DT  G 3 22  ? -9.522  -34.593 -56.769  1.00 71.47  ?  22  DT  F C4    1 
ATOM   6121  O O4    . DT  G 3 22  ? -10.747 -34.622 -56.701  1.00 77.22  ?  22  DT  F O4    1 
ATOM   6122  C C5    . DT  G 3 22  ? -8.697  -35.655 -56.250  1.00 72.29  ?  22  DT  F C5    1 
ATOM   6123  C C7    . DT  G 3 22  ? -9.330  -36.849 -55.599  1.00 81.38  ?  22  DT  F C7    1 
ATOM   6124  C C6    . DT  G 3 22  ? -7.367  -35.536 -56.369  1.00 73.31  ?  22  DT  F C6    1 
ATOM   6125  P P     . DA  G 3 23  ? -1.417  -33.566 -55.010  1.00 129.57 ?  23  DA  F P     1 
ATOM   6126  O OP1   . DA  G 3 23  ? 0.013   -33.803 -55.302  1.00 137.62 ?  23  DA  F OP1   1 
ATOM   6127  O OP2   . DA  G 3 23  ? -2.026  -34.128 -53.785  1.00 119.80 -1 23  DA  F OP2   1 
ATOM   6128  O "O5'" . DA  G 3 23  ? -1.677  -31.987 -55.004  1.00 102.24 ?  23  DA  F "O5'" 1 
ATOM   6129  C "C5'" . DA  G 3 23  ? -1.559  -31.235 -56.210  1.00 96.24  ?  23  DA  F "C5'" 1 
ATOM   6130  C "C4'" . DA  G 3 23  ? -2.280  -29.906 -56.080  1.00 97.67  ?  23  DA  F "C4'" 1 
ATOM   6131  O "O4'" . DA  G 3 23  ? -3.697  -30.108 -56.284  1.00 87.12  ?  23  DA  F "O4'" 1 
ATOM   6132  C "C3'" . DA  G 3 23  ? -2.126  -29.225 -54.717  1.00 94.27  ?  23  DA  F "C3'" 1 
ATOM   6133  O "O3'" . DA  G 3 23  ? -1.762  -27.856 -54.892  1.00 94.80  ?  23  DA  F "O3'" 1 
ATOM   6134  C "C2'" . DA  G 3 23  ? -3.510  -29.378 -54.073  1.00 78.97  ?  23  DA  F "C2'" 1 
ATOM   6135  C "C1'" . DA  G 3 23  ? -4.424  -29.434 -55.288  1.00 74.48  ?  23  DA  F "C1'" 1 
ATOM   6136  N N9    . DA  G 3 23  ? -5.650  -30.194 -55.062  1.00 66.76  ?  23  DA  F N9    1 
ATOM   6137  C C8    . DA  G 3 23  ? -5.745  -31.468 -54.576  1.00 69.60  ?  23  DA  F C8    1 
ATOM   6138  N N7    . DA  G 3 23  ? -6.976  -31.911 -54.485  1.00 61.17  ?  23  DA  F N7    1 
ATOM   6139  C C5    . DA  G 3 23  ? -7.745  -30.852 -54.938  1.00 57.16  ?  23  DA  F C5    1 
ATOM   6140  C C6    . DA  G 3 23  ? -9.137  -30.686 -55.088  1.00 50.95  ?  23  DA  F C6    1 
ATOM   6141  N N6    . DA  G 3 23  ? -10.029 -31.633 -54.776  1.00 42.92  ?  23  DA  F N6    1 
ATOM   6142  N N1    . DA  G 3 23  ? -9.579  -29.503 -55.567  1.00 51.34  ?  23  DA  F N1    1 
ATOM   6143  C C2    . DA  G 3 23  ? -8.681  -28.557 -55.874  1.00 57.99  ?  23  DA  F C2    1 
ATOM   6144  N N3    . DA  G 3 23  ? -7.351  -28.599 -55.779  1.00 56.57  ?  23  DA  F N3    1 
ATOM   6145  C C4    . DA  G 3 23  ? -6.944  -29.784 -55.299  1.00 57.06  ?  23  DA  F C4    1 
ATOM   6146  P P     . DG  G 3 24  ? -1.373  -26.949 -53.622  1.00 107.65 ?  24  DG  F P     1 
ATOM   6147  O OP1   . DG  G 3 24  ? -0.480  -25.869 -54.098  1.00 81.34  ?  24  DG  F OP1   1 
ATOM   6148  O OP2   . DG  G 3 24  ? -0.927  -27.848 -52.534  1.00 107.86 -1 24  DG  F OP2   1 
ATOM   6149  O "O5'" . DG  G 3 24  ? -2.761  -26.297 -53.187  1.00 91.25  ?  24  DG  F "O5'" 1 
ATOM   6150  C "C5'" . DG  G 3 24  ? -3.589  -25.703 -54.167  1.00 80.10  ?  24  DG  F "C5'" 1 
ATOM   6151  C "C4'" . DG  G 3 24  ? -4.969  -25.442 -53.603  1.00 86.88  ?  24  DG  F "C4'" 1 
ATOM   6152  O "O4'" . DG  G 3 24  ? -5.746  -26.670 -53.596  1.00 91.08  ?  24  DG  F "O4'" 1 
ATOM   6153  C "C3'" . DG  G 3 24  ? -5.020  -24.915 -52.156  1.00 102.52 ?  24  DG  F "C3'" 1 
ATOM   6154  O "O3'" . DG  G 3 24  ? -5.890  -23.808 -52.101  1.00 96.97  ?  24  DG  F "O3'" 1 
ATOM   6155  C "C2'" . DG  G 3 24  ? -5.618  -26.094 -51.393  1.00 97.06  ?  24  DG  F "C2'" 1 
ATOM   6156  C "C1'" . DG  G 3 24  ? -6.555  -26.610 -52.459  1.00 84.09  ?  24  DG  F "C1'" 1 
ATOM   6157  N N9    . DG  G 3 24  ? -7.143  -27.914 -52.180  1.00 69.26  ?  24  DG  F N9    1 
ATOM   6158  C C8    . DG  G 3 24  ? -6.524  -29.034 -51.678  1.00 68.04  ?  24  DG  F C8    1 
ATOM   6159  N N7    . DG  G 3 24  ? -7.336  -30.048 -51.528  1.00 58.05  ?  24  DG  F N7    1 
ATOM   6160  C C5    . DG  G 3 24  ? -8.567  -29.561 -51.956  1.00 54.03  ?  24  DG  F C5    1 
ATOM   6161  C C6    . DG  G 3 24  ? -9.833  -30.194 -52.028  1.00 48.45  ?  24  DG  F C6    1 
ATOM   6162  O O6    . DG  G 3 24  ? -10.130 -31.359 -51.720  1.00 41.02  ?  24  DG  F O6    1 
ATOM   6163  N N1    . DG  G 3 24  ? -10.811 -29.331 -52.526  1.00 44.74  ?  24  DG  F N1    1 
ATOM   6164  C C2    . DG  G 3 24  ? -10.588 -28.024 -52.899  1.00 54.50  ?  24  DG  F C2    1 
ATOM   6165  N N2    . DG  G 3 24  ? -11.643 -27.341 -53.353  1.00 47.22  ?  24  DG  F N2    1 
ATOM   6166  N N3    . DG  G 3 24  ? -9.414  -27.427 -52.833  1.00 54.84  ?  24  DG  F N3    1 
ATOM   6167  C C4    . DG  G 3 24  ? -8.456  -28.250 -52.356  1.00 57.60  ?  24  DG  F C4    1 
ATOM   6168  P P     . DA  G 3 25  ? -5.496  -22.459 -51.328  1.00 110.07 ?  25  DA  F P     1 
ATOM   6169  O OP1   . DA  G 3 25  ? -4.339  -21.854 -52.026  1.00 113.60 ?  25  DA  F OP1   1 
ATOM   6170  O OP2   . DA  G 3 25  ? -5.400  -22.760 -49.882  1.00 102.93 -1 25  DA  F OP2   1 
ATOM   6171  O "O5'" . DA  G 3 25  ? -6.787  -21.551 -51.568  1.00 64.38  ?  25  DA  F "O5'" 1 
ATOM   6172  C "C5'" . DA  G 3 25  ? -7.436  -21.593 -52.832  1.00 77.60  ?  25  DA  F "C5'" 1 
ATOM   6173  C "C4'" . DA  G 3 25  ? -8.947  -21.505 -52.693  1.00 80.66  ?  25  DA  F "C4'" 1 
ATOM   6174  O "O4'" . DA  G 3 25  ? -9.519  -22.831 -52.535  1.00 84.98  ?  25  DA  F "O4'" 1 
ATOM   6175  C "C3'" . DA  G 3 25  ? -9.438  -20.670 -51.517  1.00 71.53  ?  25  DA  F "C3'" 1 
ATOM   6176  O "O3'" . DA  G 3 25  ? -10.544 -19.872 -51.913  1.00 77.22  ?  25  DA  F "O3'" 1 
ATOM   6177  C "C2'" . DA  G 3 25  ? -9.844  -21.725 -50.479  1.00 73.94  ?  25  DA  F "C2'" 1 
ATOM   6178  C "C1'" . DA  G 3 25  ? -10.289 -22.896 -51.354  1.00 74.52  ?  25  DA  F "C1'" 1 
ATOM   6179  N N9    . DA  G 3 25  ? -10.108 -24.216 -50.736  1.00 64.36  ?  25  DA  F N9    1 
ATOM   6180  C C8    . DA  G 3 25  ? -8.938  -24.772 -50.294  1.00 63.84  ?  25  DA  F C8    1 
ATOM   6181  N N7    . DA  G 3 25  ? -9.079  -25.983 -49.801  1.00 51.11  ?  25  DA  F N7    1 
ATOM   6182  C C5    . DA  G 3 25  ? -10.430 -26.253 -49.958  1.00 46.20  ?  25  DA  F C5    1 
ATOM   6183  C C6    . DA  G 3 25  ? -11.221 -27.381 -49.641  1.00 48.82  ?  25  DA  F C6    1 
ATOM   6184  N N6    . DA  G 3 25  ? -10.733 -28.492 -49.075  1.00 50.04  ?  25  DA  F N6    1 
ATOM   6185  N N1    . DA  G 3 25  ? -12.539 -27.322 -49.931  1.00 49.33  ?  25  DA  F N1    1 
ATOM   6186  C C2    . DA  G 3 25  ? -13.024 -26.210 -50.497  1.00 48.85  ?  25  DA  F C2    1 
ATOM   6187  N N3    . DA  G 3 25  ? -12.383 -25.092 -50.840  1.00 44.70  ?  25  DA  F N3    1 
ATOM   6188  C C4    . DA  G 3 25  ? -11.077 -25.178 -50.541  1.00 50.45  ?  25  DA  F C4    1 
ATOM   6189  P P     . DC  G 3 26  ? -10.965 -18.598 -51.030  1.00 94.67  ?  26  DC  F P     1 
ATOM   6190  O OP1   . DC  G 3 26  ? -11.445 -17.554 -51.962  1.00 76.88  ?  26  DC  F OP1   1 
ATOM   6191  O OP2   . DC  G 3 26  ? -9.852  -18.298 -50.102  1.00 104.56 -1 26  DC  F OP2   1 
ATOM   6192  O "O5'" . DC  G 3 26  ? -12.208 -19.115 -50.168  1.00 93.94  ?  26  DC  F "O5'" 1 
ATOM   6193  C "C5'" . DC  G 3 26  ? -13.277 -19.807 -50.801  1.00 72.69  ?  26  DC  F "C5'" 1 
ATOM   6194  C "C4'" . DC  G 3 26  ? -14.106 -20.567 -49.779  1.00 77.42  ?  26  DC  F "C4'" 1 
ATOM   6195  O "O4'" . DC  G 3 26  ? -13.506 -21.845 -49.510  1.00 81.92  ?  26  DC  F "O4'" 1 
ATOM   6196  C "C3'" . DC  G 3 26  ? -14.256 -19.883 -48.416  1.00 85.56  ?  26  DC  F "C3'" 1 
ATOM   6197  O "O3'" . DC  G 3 26  ? -15.557 -19.319 -48.292  1.00 85.32  ?  26  DC  F "O3'" 1 
ATOM   6198  C "C2'" . DC  G 3 26  ? -14.024 -21.008 -47.387  1.00 65.68  ?  26  DC  F "C2'" 1 
ATOM   6199  C "C1'" . DC  G 3 26  ? -13.947 -22.265 -48.249  1.00 64.99  ?  26  DC  F "C1'" 1 
ATOM   6200  N N1    . DC  G 3 26  ? -13.018 -23.312 -47.730  1.00 51.70  ?  26  DC  F N1    1 
ATOM   6201  C C2    . DC  G 3 26  ? -13.510 -24.595 -47.489  1.00 48.71  ?  26  DC  F C2    1 
ATOM   6202  O O2    . DC  G 3 26  ? -14.701 -24.827 -47.714  1.00 45.69  ?  26  DC  F O2    1 
ATOM   6203  N N3    . DC  G 3 26  ? -12.668 -25.549 -47.021  1.00 42.99  ?  26  DC  F N3    1 
ATOM   6204  C C4    . DC  G 3 26  ? -11.387 -25.253 -46.795  1.00 51.19  ?  26  DC  F C4    1 
ATOM   6205  N N4    . DC  G 3 26  ? -10.593 -26.227 -46.331  1.00 52.22  ?  26  DC  F N4    1 
ATOM   6206  C C5    . DC  G 3 26  ? -10.863 -23.945 -47.033  1.00 49.80  ?  26  DC  F C5    1 
ATOM   6207  C C6    . DC  G 3 26  ? -11.707 -23.013 -47.497  1.00 45.18  ?  26  DC  F C6    1 
ATOM   6208  O "O5'" . DT  H 4 1   ? -13.367 -34.782 -92.883  1.00 56.89  ?  16  DT  G "O5'" 1 
ATOM   6209  C "C5'" . DT  H 4 1   ? -14.247 -35.024 -91.783  1.00 66.05  ?  16  DT  G "C5'" 1 
ATOM   6210  C "C4'" . DT  H 4 1   ? -13.517 -35.787 -90.703  1.00 85.15  ?  16  DT  G "C4'" 1 
ATOM   6211  O "O4'" . DT  H 4 1   ? -13.804 -37.194 -90.791  1.00 91.23  ?  16  DT  G "O4'" 1 
ATOM   6212  C "C3'" . DT  H 4 1   ? -11.996 -35.673 -90.740  1.00 74.51  ?  16  DT  G "C3'" 1 
ATOM   6213  O "O3'" . DT  H 4 1   ? -11.701 -34.855 -89.614  1.00 87.66  ?  16  DT  G "O3'" 1 
ATOM   6214  C "C2'" . DT  H 4 1   ? -11.509 -37.114 -90.671  1.00 64.33  ?  16  DT  G "C2'" 1 
ATOM   6215  C "C1'" . DT  H 4 1   ? -12.714 -37.900 -90.246  1.00 69.91  ?  16  DT  G "C1'" 1 
ATOM   6216  N N1    . DT  H 4 1   ? -12.736 -39.279 -90.771  1.00 67.75  ?  16  DT  G N1    1 
ATOM   6217  C C2    . DT  H 4 1   ? -11.589 -40.024 -90.641  1.00 59.53  ?  16  DT  G C2    1 
ATOM   6218  O O2    . DT  H 4 1   ? -10.569 -39.591 -90.147  1.00 64.82  ?  16  DT  G O2    1 
ATOM   6219  N N3    . DT  H 4 1   ? -11.676 -41.297 -91.132  1.00 60.27  ?  16  DT  G N3    1 
ATOM   6220  C C4    . DT  H 4 1   ? -12.754 -41.866 -91.773  1.00 66.31  ?  16  DT  G C4    1 
ATOM   6221  O O4    . DT  H 4 1   ? -12.697 -43.036 -92.128  1.00 56.72  ?  16  DT  G O4    1 
ATOM   6222  C C5    . DT  H 4 1   ? -13.935 -41.050 -91.836  1.00 75.18  ?  16  DT  G C5    1 
ATOM   6223  C C7    . DT  H 4 1   ? -15.168 -41.614 -92.466  1.00 74.24  ?  16  DT  G C7    1 
ATOM   6224  C C6    . DT  H 4 1   ? -13.866 -39.804 -91.358  1.00 75.33  ?  16  DT  G C6    1 
ATOM   6225  P P     . DA  H 4 2   ? -10.241 -34.694 -89.076  1.00 106.35 ?  17  DA  G P     1 
ATOM   6226  O OP1   . DA  H 4 2   ? -9.995  -35.816 -88.160  1.00 96.90  ?  17  DA  G OP1   1 
ATOM   6227  O OP2   . DA  H 4 2   ? -9.420  -33.823 -88.265  1.00 78.60  ?  17  DA  G OP2   1 
ATOM   6228  O "O5'" . DA  H 4 2   ? -9.340  -34.800 -90.375  1.00 67.34  ?  17  DA  G "O5'" 1 
ATOM   6229  C "C5'" . DA  H 4 2   ? -7.988  -35.201 -90.187  1.00 64.14  ?  17  DA  G "C5'" 1 
ATOM   6230  C "C4'" . DA  H 4 2   ? -7.470  -36.023 -91.341  1.00 68.28  ?  17  DA  G "C4'" 1 
ATOM   6231  O "O4'" . DA  H 4 2   ? -8.320  -37.132 -91.693  1.00 60.35  ?  17  DA  G "O4'" 1 
ATOM   6232  C "C3'" . DA  H 4 2   ? -7.212  -35.264 -92.640  1.00 47.55  ?  17  DA  G "C3'" 1 
ATOM   6233  O "O3'" . DA  H 4 2   ? -5.864  -35.577 -92.893  1.00 38.58  ?  17  DA  G "O3'" 1 
ATOM   6234  C "C2'" . DA  H 4 2   ? -7.996  -36.045 -93.673  1.00 42.60  ?  17  DA  G "C2'" 1 
ATOM   6235  C "C1'" . DA  H 4 2   ? -8.029  -37.406 -93.035  1.00 46.93  ?  17  DA  G "C1'" 1 
ATOM   6236  N N9    . DA  H 4 2   ? -9.048  -38.310 -93.540  1.00 40.88  ?  17  DA  G N9    1 
ATOM   6237  C C8    . DA  H 4 2   ? -10.296 -37.991 -94.001  1.00 50.91  ?  17  DA  G C8    1 
ATOM   6238  N N7    . DA  H 4 2   ? -10.993 -39.025 -94.399  1.00 46.15  ?  17  DA  G N7    1 
ATOM   6239  C C5    . DA  H 4 2   ? -10.134 -40.095 -94.211  1.00 40.16  ?  17  DA  G C5    1 
ATOM   6240  C C6    . DA  H 4 2   ? -10.281 -41.477 -94.426  1.00 40.05  ?  17  DA  G C6    1 
ATOM   6241  N N6    . DA  H 4 2   ? -11.382 -42.032 -94.931  1.00 35.96  ?  17  DA  G N6    1 
ATOM   6242  N N1    . DA  H 4 2   ? -9.229  -42.274 -94.142  1.00 44.27  ?  17  DA  G N1    1 
ATOM   6243  C C2    . DA  H 4 2   ? -8.121  -41.714 -93.637  1.00 47.73  ?  17  DA  G C2    1 
ATOM   6244  N N3    . DA  H 4 2   ? -7.869  -40.433 -93.378  1.00 44.90  ?  17  DA  G N3    1 
ATOM   6245  C C4    . DA  H 4 2   ? -8.934  -39.669 -93.677  1.00 42.30  ?  17  DA  G C4    1 
ATOM   6246  P P     . DG  H 4 3   ? -4.914  -34.511 -93.368  1.00 57.06  ?  18  DG  G P     1 
ATOM   6247  O OP1   . DG  H 4 3   ? -4.013  -34.222 -92.276  1.00 51.02  ?  18  DG  G OP1   1 
ATOM   6248  O OP2   . DG  H 4 3   ? -5.700  -33.447 -93.944  1.00 56.70  -1 18  DG  G OP2   1 
ATOM   6249  O "O5'" . DG  H 4 3   ? -4.119  -35.298 -94.480  1.00 62.45  ?  18  DG  G "O5'" 1 
ATOM   6250  C "C5'" . DG  H 4 3   ? -3.670  -36.618 -94.172  1.00 49.64  ?  18  DG  G "C5'" 1 
ATOM   6251  C "C4'" . DG  H 4 3   ? -3.949  -37.602 -95.285  1.00 58.09  ?  18  DG  G "C4'" 1 
ATOM   6252  O "O4'" . DG  H 4 3   ? -5.340  -37.941 -95.392  1.00 51.46  ?  18  DG  G "O4'" 1 
ATOM   6253  C "C3'" . DG  H 4 3   ? -3.536  -37.194 -96.696  1.00 49.70  ?  18  DG  G "C3'" 1 
ATOM   6254  O "O3'" . DG  H 4 3   ? -2.313  -37.835 -97.027  1.00 55.31  ?  18  DG  G "O3'" 1 
ATOM   6255  C "C2'" . DG  H 4 3   ? -4.620  -37.801 -97.569  1.00 49.69  ?  18  DG  G "C2'" 1 
ATOM   6256  C "C1'" . DG  H 4 3   ? -5.422  -38.643 -96.599  1.00 31.35  ?  18  DG  G "C1'" 1 
ATOM   6257  N N9    . DG  H 4 3   ? -6.828  -38.850 -96.922  1.00 35.02  ?  18  DG  G N9    1 
ATOM   6258  C C8    . DG  H 4 3   ? -7.799  -37.896 -97.077  1.00 40.64  ?  18  DG  G C8    1 
ATOM   6259  N N7    . DG  H 4 3   ? -8.969  -38.398 -97.360  1.00 31.93  ?  18  DG  G N7    1 
ATOM   6260  C C5    . DG  H 4 3   ? -8.753  -39.765 -97.406  1.00 35.92  ?  18  DG  G C5    1 
ATOM   6261  C C6    . DG  H 4 3   ? -9.652  -40.830 -97.693  1.00 35.24  ?  18  DG  G C6    1 
ATOM   6262  O O6    . DG  H 4 3   ? -10.856 -40.771 -97.951  1.00 33.95  ?  18  DG  G O6    1 
ATOM   6263  N N1    . DG  H 4 3   ? -9.022  -42.066 -97.629  1.00 32.66  ?  18  DG  G N1    1 
ATOM   6264  C C2    . DG  H 4 3   ? -7.693  -42.249 -97.350  1.00 41.57  ?  18  DG  G C2    1 
ATOM   6265  N N2    . DG  H 4 3   ? -7.264  -43.512 -97.351  1.00 48.63  ?  18  DG  G N2    1 
ATOM   6266  N N3    . DG  H 4 3   ? -6.839  -41.266 -97.109  1.00 33.72  ?  18  DG  G N3    1 
ATOM   6267  C C4    . DG  H 4 3   ? -7.433  -40.058 -97.153  1.00 32.54  ?  18  DG  G C4    1 
ATOM   6268  P P     . DG  H 4 4   ? -1.733  -37.663 -98.423  1.00 68.51  ?  19  DG  G P     1 
ATOM   6269  O OP1   . DG  H 4 4   ? -0.258  -37.761 -98.350  1.00 60.11  ?  19  DG  G OP1   1 
ATOM   6270  O OP2   . DG  H 4 4   ? -2.365  -36.456 -99.003  1.00 45.81  -1 19  DG  G OP2   1 
ATOM   6271  O "O5'" . DG  H 4 4   ? -2.317  -38.935 -99.182  1.00 38.57  ?  19  DG  G "O5'" 1 
ATOM   6272  C "C5'" . DG  H 4 4   ? -2.259  -40.184 -98.518  1.00 43.11  ?  19  DG  G "C5'" 1 
ATOM   6273  C "C4'" . DG  H 4 4   ? -3.082  -41.231 -99.233  1.00 46.16  ?  19  DG  G "C4'" 1 
ATOM   6274  O "O4'" . DG  H 4 4   ? -4.478  -40.910 -99.122  1.00 53.21  ?  19  DG  G "O4'" 1 
ATOM   6275  C "C3'" . DG  H 4 4   ? -2.875  -41.327 -100.726 1.00 48.11  ?  19  DG  G "C3'" 1 
ATOM   6276  O "O3'" . DG  H 4 4   ? -1.814  -42.221 -100.982 1.00 56.27  ?  19  DG  G "O3'" 1 
ATOM   6277  C "C2'" . DG  H 4 4   ? -4.226  -41.854 -101.252 1.00 46.72  ?  19  DG  G "C2'" 1 
ATOM   6278  C "C1'" . DG  H 4 4   ? -5.157  -41.725 -100.042 1.00 38.68  ?  19  DG  G "C1'" 1 
ATOM   6279  N N9    . DG  H 4 4   ? -6.432  -41.096 -100.377 1.00 35.45  ?  19  DG  G N9    1 
ATOM   6280  C C8    . DG  H 4 4   ? -6.761  -39.767 -100.259 1.00 37.73  ?  19  DG  G C8    1 
ATOM   6281  N N7    . DG  H 4 4   ? -7.980  -39.498 -100.645 1.00 41.04  ?  19  DG  G N7    1 
ATOM   6282  C C5    . DG  H 4 4   ? -8.490  -40.726 -101.043 1.00 38.78  ?  19  DG  G C5    1 
ATOM   6283  C C6    . DG  H 4 4   ? -9.768  -41.063 -101.554 1.00 34.13  ?  19  DG  G C6    1 
ATOM   6284  O O6    . DG  H 4 4   ? -10.733 -40.315 -101.763 1.00 31.21  ?  19  DG  G O6    1 
ATOM   6285  N N1    . DG  H 4 4   ? -9.868  -42.425 -101.830 1.00 36.10  ?  19  DG  G N1    1 
ATOM   6286  C C2    . DG  H 4 4   ? -8.860  -43.341 -101.635 1.00 48.61  ?  19  DG  G C2    1 
ATOM   6287  N N2    . DG  H 4 4   ? -9.136  -44.610 -101.957 1.00 47.32  ?  19  DG  G N2    1 
ATOM   6288  N N3    . DG  H 4 4   ? -7.662  -43.038 -101.158 1.00 51.52  ?  19  DG  G N3    1 
ATOM   6289  C C4    . DG  H 4 4   ? -7.548  -41.719 -100.884 1.00 44.57  ?  19  DG  G C4    1 
ATOM   6290  P P     . DA  H 4 5   ? -1.118  -42.271 -102.423 1.00 59.45  ?  20  DA  G P     1 
ATOM   6291  O OP1   . DA  H 4 5   ? 0.170   -42.987 -102.278 1.00 54.05  ?  20  DA  G OP1   1 
ATOM   6292  O OP2   . DA  H 4 5   ? -1.153  -40.908 -103.005 1.00 36.51  -1 20  DA  G OP2   1 
ATOM   6293  O "O5'" . DA  H 4 5   ? -2.143  -43.172 -103.247 1.00 53.66  ?  20  DA  G "O5'" 1 
ATOM   6294  C "C5'" . DA  H 4 5   ? -2.413  -44.500 -102.814 1.00 51.61  ?  20  DA  G "C5'" 1 
ATOM   6295  C "C4'" . DA  H 4 5   ? -3.407  -45.156 -103.744 1.00 59.55  ?  20  DA  G "C4'" 1 
ATOM   6296  O "O4'" . DA  H 4 5   ? -4.698  -44.514 -103.609 1.00 53.69  ?  20  DA  G "O4'" 1 
ATOM   6297  C "C3'" . DA  H 4 5   ? -3.032  -45.096 -105.220 1.00 66.91  ?  20  DA  G "C3'" 1 
ATOM   6298  O "O3'" . DA  H 4 5   ? -3.101  -46.391 -105.784 1.00 73.27  ?  20  DA  G "O3'" 1 
ATOM   6299  C "C2'" . DA  H 4 5   ? -4.075  -44.156 -105.832 1.00 68.10  ?  20  DA  G "C2'" 1 
ATOM   6300  C "C1'" . DA  H 4 5   ? -5.253  -44.306 -104.882 1.00 49.80  ?  20  DA  G "C1'" 1 
ATOM   6301  N N9    . DA  H 4 5   ? -6.113  -43.127 -104.822 1.00 48.70  ?  20  DA  G N9    1 
ATOM   6302  C C8    . DA  H 4 5   ? -5.741  -41.849 -104.509 1.00 49.37  ?  20  DA  G C8    1 
ATOM   6303  N N7    . DA  H 4 5   ? -6.731  -40.987 -104.536 1.00 49.91  ?  20  DA  G N7    1 
ATOM   6304  C C5    . DA  H 4 5   ? -7.827  -41.752 -104.898 1.00 47.93  ?  20  DA  G C5    1 
ATOM   6305  C C6    . DA  H 4 5   ? -9.185  -41.433 -105.103 1.00 47.91  ?  20  DA  G C6    1 
ATOM   6306  N N6    . DA  H 4 5   ? -9.683  -40.200 -104.965 1.00 46.52  ?  20  DA  G N6    1 
ATOM   6307  N N1    . DA  H 4 5   ? -10.014 -42.434 -105.458 1.00 45.43  ?  20  DA  G N1    1 
ATOM   6308  C C2    . DA  H 4 5   ? -9.517  -43.668 -105.596 1.00 56.81  ?  20  DA  G C2    1 
ATOM   6309  N N3    . DA  H 4 5   ? -8.264  -44.090 -105.431 1.00 59.57  ?  20  DA  G N3    1 
ATOM   6310  C C4    . DA  H 4 5   ? -7.462  -43.073 -105.079 1.00 50.81  ?  20  DA  G C4    1 
ATOM   6311  P P     . DG  H 4 6   ? -2.522  -46.650 -107.258 1.00 91.31  ?  21  DG  G P     1 
ATOM   6312  O OP1   . DG  H 4 6   ? -1.863  -47.975 -107.253 1.00 88.42  ?  21  DG  G OP1   1 
ATOM   6313  O OP2   . DG  H 4 6   ? -1.757  -45.447 -107.655 1.00 80.27  -1 21  DG  G OP2   1 
ATOM   6314  O "O5'" . DG  H 4 6   ? -3.828  -46.726 -108.175 1.00 84.47  ?  21  DG  G "O5'" 1 
ATOM   6315  C "C5'" . DG  H 4 6   ? -4.863  -47.651 -107.881 1.00 64.30  ?  21  DG  G "C5'" 1 
ATOM   6316  C "C4'" . DG  H 4 6   ? -6.078  -47.367 -108.745 1.00 78.75  ?  21  DG  G "C4'" 1 
ATOM   6317  O "O4'" . DG  H 4 6   ? -6.748  -46.158 -108.300 1.00 78.12  ?  21  DG  G "O4'" 1 
ATOM   6318  C "C3'" . DG  H 4 6   ? -5.774  -47.149 -110.237 1.00 87.45  ?  21  DG  G "C3'" 1 
ATOM   6319  O "O3'" . DG  H 4 6   ? -6.787  -47.769 -111.003 1.00 91.22  ?  21  DG  G "O3'" 1 
ATOM   6320  C "C2'" . DG  H 4 6   ? -5.873  -45.632 -110.372 1.00 72.04  ?  21  DG  G "C2'" 1 
ATOM   6321  C "C1'" . DG  H 4 6   ? -7.045  -45.402 -109.447 1.00 72.06  ?  21  DG  G "C1'" 1 
ATOM   6322  N N9    . DG  H 4 6   ? -7.316  -44.017 -109.092 1.00 63.78  ?  21  DG  G N9    1 
ATOM   6323  C C8    . DG  H 4 6   ? -6.416  -43.029 -108.772 1.00 60.57  ?  21  DG  G C8    1 
ATOM   6324  N N7    . DG  H 4 6   ? -6.983  -41.877 -108.525 1.00 56.92  ?  21  DG  G N7    1 
ATOM   6325  C C5    . DG  H 4 6   ? -8.339  -42.118 -108.725 1.00 52.86  ?  21  DG  G C5    1 
ATOM   6326  C C6    . DG  H 4 6   ? -9.454  -41.249 -108.616 1.00 54.69  ?  21  DG  G C6    1 
ATOM   6327  O O6    . DG  H 4 6   ? -9.465  -40.050 -108.308 1.00 56.82  ?  21  DG  G O6    1 
ATOM   6328  N N1    . DG  H 4 6   ? -10.651 -41.907 -108.908 1.00 56.68  ?  21  DG  G N1    1 
ATOM   6329  C C2    . DG  H 4 6   ? -10.749 -43.235 -109.260 1.00 59.23  ?  21  DG  G C2    1 
ATOM   6330  N N2    . DG  H 4 6   ? -11.979 -43.703 -109.506 1.00 52.86  ?  21  DG  G N2    1 
ATOM   6331  N N3    . DG  H 4 6   ? -9.714  -44.050 -109.364 1.00 50.60  ?  21  DG  G N3    1 
ATOM   6332  C C4    . DG  H 4 6   ? -8.549  -43.426 -109.084 1.00 50.48  ?  21  DG  G C4    1 
ATOM   6333  P P     . DC  H 4 7   ? -6.433  -48.624 -112.313 1.00 87.75  ?  22  DC  G P     1 
ATOM   6334  O OP1   . DC  H 4 7   ? -5.832  -49.900 -111.864 1.00 84.12  ?  22  DC  G OP1   1 
ATOM   6335  O OP2   . DC  H 4 7   ? -5.685  -47.745 -113.240 1.00 78.28  -1 22  DC  G OP2   1 
ATOM   6336  O "O5'" . DC  H 4 7   ? -7.869  -48.920 -112.957 1.00 76.15  ?  22  DC  G "O5'" 1 
ATOM   6337  C "C5'" . DC  H 4 7   ? -8.893  -49.463 -112.137 1.00 61.24  ?  22  DC  G "C5'" 1 
ATOM   6338  C "C4'" . DC  H 4 7   ? -10.267 -48.906 -112.494 1.00 77.06  ?  22  DC  G "C4'" 1 
ATOM   6339  O "O4'" . DC  H 4 7   ? -10.380 -47.516 -112.045 1.00 77.96  ?  22  DC  G "O4'" 1 
ATOM   6340  C "C3'" . DC  H 4 7   ? -10.590 -48.877 -113.990 1.00 69.93  ?  22  DC  G "C3'" 1 
ATOM   6341  O "O3'" . DC  H 4 7   ? -11.959 -49.218 -114.186 1.00 62.72  ?  22  DC  G "O3'" 1 
ATOM   6342  C "C2'" . DC  H 4 7   ? -10.310 -47.435 -114.385 1.00 72.33  ?  22  DC  G "C2'" 1 
ATOM   6343  C "C1'" . DC  H 4 7   ? -10.761 -46.696 -113.141 1.00 74.35  ?  22  DC  G "C1'" 1 
ATOM   6344  N N1    . DC  H 4 7   ? -10.140 -45.335 -113.001 1.00 64.67  ?  22  DC  G N1    1 
ATOM   6345  C C2    . DC  H 4 7   ? -10.953 -44.205 -112.784 1.00 64.17  ?  22  DC  G C2    1 
ATOM   6346  O O2    . DC  H 4 7   ? -12.184 -44.340 -112.709 1.00 67.69  ?  22  DC  G O2    1 
ATOM   6347  N N3    . DC  H 4 7   ? -10.364 -42.986 -112.670 1.00 56.92  ?  22  DC  G N3    1 
ATOM   6348  C C4    . DC  H 4 7   ? -9.036  -42.876 -112.762 1.00 56.52  ?  22  DC  G C4    1 
ATOM   6349  N N4    . DC  H 4 7   ? -8.501  -41.658 -112.640 1.00 53.68  ?  22  DC  G N4    1 
ATOM   6350  C C5    . DC  H 4 7   ? -8.198  -44.010 -112.983 1.00 59.41  ?  22  DC  G C5    1 
ATOM   6351  C C6    . DC  H 4 7   ? -8.786  -45.204 -113.097 1.00 56.47  ?  22  DC  G C6    1 
ATOM   6352  P P     . DA  H 4 8   ? -12.575 -49.302 -115.667 1.00 76.99  ?  23  DA  G P     1 
ATOM   6353  O OP1   . DA  H 4 8   ? -13.485 -50.468 -115.716 1.00 83.95  ?  23  DA  G OP1   1 
ATOM   6354  O OP2   . DA  H 4 8   ? -11.449 -49.198 -116.622 1.00 79.11  -1 23  DA  G OP2   1 
ATOM   6355  O "O5'" . DA  H 4 8   ? -13.441 -47.962 -115.786 1.00 64.49  ?  23  DA  G "O5'" 1 
ATOM   6356  C "C5'" . DA  H 4 8   ? -14.265 -47.568 -114.692 1.00 69.45  ?  23  DA  G "C5'" 1 
ATOM   6357  C "C4'" . DA  H 4 8   ? -15.154 -46.385 -115.043 1.00 60.81  ?  23  DA  G "C4'" 1 
ATOM   6358  O "O4'" . DA  H 4 8   ? -14.437 -45.147 -114.810 1.00 61.37  ?  23  DA  G "O4'" 1 
ATOM   6359  C "C3'" . DA  H 4 8   ? -15.627 -46.325 -116.489 1.00 68.44  ?  23  DA  G "C3'" 1 
ATOM   6360  O "O3'" . DA  H 4 8   ? -16.934 -45.753 -116.540 1.00 72.24  ?  23  DA  G "O3'" 1 
ATOM   6361  C "C2'" . DA  H 4 8   ? -14.579 -45.431 -117.152 1.00 73.31  ?  23  DA  G "C2'" 1 
ATOM   6362  C "C1'" . DA  H 4 8   ? -14.239 -44.458 -116.028 1.00 65.55  ?  23  DA  G "C1'" 1 
ATOM   6363  N N9    . DA  H 4 8   ? -12.858 -43.980 -116.059 1.00 63.70  ?  23  DA  G N9    1 
ATOM   6364  C C8    . DA  H 4 8   ? -11.720 -44.737 -116.118 1.00 58.79  ?  23  DA  G C8    1 
ATOM   6365  N N7    . DA  H 4 8   ? -10.613 -44.028 -116.126 1.00 54.87  ?  23  DA  G N7    1 
ATOM   6366  C C5    . DA  H 4 8   ? -11.058 -42.718 -116.063 1.00 56.60  ?  23  DA  G C5    1 
ATOM   6367  C C6    . DA  H 4 8   ? -10.383 -41.480 -116.037 1.00 53.94  ?  23  DA  G C6    1 
ATOM   6368  N N6    . DA  H 4 8   ? -9.049  -41.356 -116.070 1.00 53.64  ?  23  DA  G N6    1 
ATOM   6369  N N1    . DA  H 4 8   ? -11.135 -40.366 -115.974 1.00 49.54  ?  23  DA  G N1    1 
ATOM   6370  C C2    . DA  H 4 8   ? -12.465 -40.480 -115.933 1.00 51.19  ?  23  DA  G C2    1 
ATOM   6371  N N3    . DA  H 4 8   ? -13.211 -41.580 -115.954 1.00 55.40  ?  23  DA  G N3    1 
ATOM   6372  C C4    . DA  H 4 8   ? -12.440 -42.674 -116.018 1.00 58.65  ?  23  DA  G C4    1 
ATOM   6373  P P     . DT  H 4 9   ? -17.735 -45.644 -117.930 1.00 82.83  ?  24  DT  G P     1 
ATOM   6374  O OP1   . DT  H 4 9   ? -19.158 -45.942 -117.655 1.00 81.85  ?  24  DT  G OP1   1 
ATOM   6375  O OP2   . DT  H 4 9   ? -16.995 -46.431 -118.941 1.00 94.52  -1 24  DT  G OP2   1 
ATOM   6376  O "O5'" . DT  H 4 9   ? -17.597 -44.099 -118.318 1.00 64.37  ?  24  DT  G "O5'" 1 
ATOM   6377  C "C5'" . DT  H 4 9   ? -18.046 -43.107 -117.406 1.00 64.68  ?  24  DT  G "C5'" 1 
ATOM   6378  C "C4'" . DT  H 4 9   ? -17.640 -41.719 -117.865 1.00 74.52  ?  24  DT  G "C4'" 1 
ATOM   6379  O "O4'" . DT  H 4 9   ? -16.210 -41.583 -117.776 1.00 71.26  ?  24  DT  G "O4'" 1 
ATOM   6380  C "C3'" . DT  H 4 9   ? -17.998 -41.359 -119.316 1.00 61.45  ?  24  DT  G "C3'" 1 
ATOM   6381  O "O3'" . DT  H 4 9   ? -18.938 -40.290 -119.307 1.00 63.06  ?  24  DT  G "O3'" 1 
ATOM   6382  C "C2'" . DT  H 4 9   ? -16.662 -40.959 -119.966 1.00 60.94  ?  24  DT  G "C2'" 1 
ATOM   6383  C "C1'" . DT  H 4 9   ? -15.800 -40.669 -118.754 1.00 52.50  ?  24  DT  G "C1'" 1 
ATOM   6384  N N1    . DT  H 4 9   ? -14.348 -40.858 -118.986 1.00 49.34  ?  24  DT  G N1    1 
ATOM   6385  C C2    . DT  H 4 9   ? -13.513 -39.778 -118.883 1.00 50.11  ?  24  DT  G C2    1 
ATOM   6386  O O2    . DT  H 4 9   ? -13.907 -38.649 -118.652 1.00 44.89  ?  24  DT  G O2    1 
ATOM   6387  N N3    . DT  H 4 9   ? -12.194 -40.056 -119.096 1.00 50.53  ?  24  DT  G N3    1 
ATOM   6388  C C4    . DT  H 4 9   ? -11.626 -41.282 -119.367 1.00 53.28  ?  24  DT  G C4    1 
ATOM   6389  O O4    . DT  H 4 9   ? -10.416 -41.420 -119.533 1.00 61.03  ?  24  DT  G O4    1 
ATOM   6390  C C5    . DT  H 4 9   ? -12.555 -42.385 -119.440 1.00 47.76  ?  24  DT  G C5    1 
ATOM   6391  C C7    . DT  H 4 9   ? -12.062 -43.771 -119.731 1.00 48.21  ?  24  DT  G C7    1 
ATOM   6392  C C6    . DT  H 4 9   ? -13.857 -42.124 -119.240 1.00 49.87  ?  24  DT  G C6    1 
ATOM   6393  P P     . DT  H 4 10  ? -19.490 -39.643 -120.670 1.00 96.52  ?  25  DT  G P     1 
ATOM   6394  O OP1   . DT  H 4 10  ? -20.916 -39.302 -120.465 1.00 92.90  ?  25  DT  G OP1   1 
ATOM   6395  O OP2   . DT  H 4 10  ? -19.096 -40.524 -121.793 1.00 91.16  -1 25  DT  G OP2   1 
ATOM   6396  O "O5'" . DT  H 4 10  ? -18.646 -38.285 -120.782 1.00 61.45  ?  25  DT  G "O5'" 1 
ATOM   6397  C "C5'" . DT  H 4 10  ? -18.562 -37.433 -119.644 1.00 70.81  ?  25  DT  G "C5'" 1 
ATOM   6398  C "C4'" . DT  H 4 10  ? -17.538 -36.324 -119.837 1.00 71.40  ?  25  DT  G "C4'" 1 
ATOM   6399  O "O4'" . DT  H 4 10  ? -16.202 -36.891 -119.898 1.00 72.43  ?  25  DT  G "O4'" 1 
ATOM   6400  C "C3'" . DT  H 4 10  ? -17.698 -35.481 -121.105 1.00 69.83  ?  25  DT  G "C3'" 1 
ATOM   6401  O "O3'" . DT  H 4 10  ? -17.624 -34.096 -120.746 1.00 76.72  ?  25  DT  G "O3'" 1 
ATOM   6402  C "C2'" . DT  H 4 10  ? -16.530 -35.921 -121.990 1.00 65.61  ?  25  DT  G "C2'" 1 
ATOM   6403  C "C1'" . DT  H 4 10  ? -15.493 -36.273 -120.944 1.00 66.52  ?  25  DT  G "C1'" 1 
ATOM   6404  N N1    . DT  H 4 10  ? -14.422 -37.205 -121.413 1.00 61.43  ?  25  DT  G N1    1 
ATOM   6405  C C2    . DT  H 4 10  ? -13.110 -36.821 -121.292 1.00 60.12  ?  25  DT  G C2    1 
ATOM   6406  O O2    . DT  H 4 10  ? -12.772 -35.725 -120.882 1.00 63.92  ?  25  DT  G O2    1 
ATOM   6407  N N3    . DT  H 4 10  ? -12.201 -37.744 -121.726 1.00 46.33  ?  25  DT  G N3    1 
ATOM   6408  C C4    . DT  H 4 10  ? -12.456 -39.005 -122.223 1.00 49.30  ?  25  DT  G C4    1 
ATOM   6409  O O4    . DT  H 4 10  ? -11.556 -39.763 -122.576 1.00 52.00  ?  25  DT  G O4    1 
ATOM   6410  C C5    . DT  H 4 10  ? -13.854 -39.365 -122.294 1.00 57.08  ?  25  DT  G C5    1 
ATOM   6411  C C7    . DT  H 4 10  ? -14.260 -40.712 -122.817 1.00 56.65  ?  25  DT  G C7    1 
ATOM   6412  C C6    . DT  H 4 10  ? -14.761 -38.461 -121.880 1.00 59.17  ?  25  DT  G C6    1 
ATOM   6413  P P     . DT  H 4 11  ? -18.078 -32.944 -121.771 1.00 111.81 ?  26  DT  G P     1 
ATOM   6414  O OP1   . DT  H 4 11  ? -18.890 -31.974 -121.002 1.00 90.95  ?  26  DT  G OP1   1 
ATOM   6415  O OP2   . DT  H 4 11  ? -18.644 -33.591 -122.975 1.00 97.08  -1 26  DT  G OP2   1 
ATOM   6416  O "O5'" . DT  H 4 11  ? -16.706 -32.237 -122.194 1.00 92.90  ?  26  DT  G "O5'" 1 
ATOM   6417  C "C5'" . DT  H 4 11  ? -15.707 -31.975 -121.206 1.00 88.13  ?  26  DT  G "C5'" 1 
ATOM   6418  C "C4'" . DT  H 4 11  ? -14.377 -31.645 -121.857 1.00 83.06  ?  26  DT  G "C4'" 1 
ATOM   6419  O "O4'" . DT  H 4 11  ? -13.654 -32.864 -122.137 1.00 85.99  ?  26  DT  G "O4'" 1 
ATOM   6420  C "C3'" . DT  H 4 11  ? -14.481 -30.890 -123.186 1.00 85.75  ?  26  DT  G "C3'" 1 
ATOM   6421  O "O3'" . DT  H 4 11  ? -13.709 -29.695 -123.129 1.00 79.44  ?  26  DT  G "O3'" 1 
ATOM   6422  C "C2'" . DT  H 4 11  ? -13.935 -31.879 -124.223 1.00 86.77  ?  26  DT  G "C2'" 1 
ATOM   6423  C "C1'" . DT  H 4 11  ? -13.012 -32.736 -123.378 1.00 71.11  ?  26  DT  G "C1'" 1 
ATOM   6424  N N1    . DT  H 4 11  ? -12.801 -34.098 -123.921 1.00 59.67  ?  26  DT  G N1    1 
ATOM   6425  C C2    . DT  H 4 11  ? -11.525 -34.596 -124.005 1.00 57.42  ?  26  DT  G C2    1 
ATOM   6426  O O2    . DT  H 4 11  ? -10.538 -33.957 -123.687 1.00 56.94  ?  26  DT  G O2    1 
ATOM   6427  N N3    . DT  H 4 11  ? -11.439 -35.868 -124.507 1.00 50.00  ?  26  DT  G N3    1 
ATOM   6428  C C4    . DT  H 4 11  ? -12.487 -36.681 -124.905 1.00 65.05  ?  26  DT  G C4    1 
ATOM   6429  O O4    . DT  H 4 11  ? -12.310 -37.815 -125.340 1.00 65.16  ?  26  DT  G O4    1 
ATOM   6430  C C5    . DT  H 4 11  ? -13.804 -36.101 -124.772 1.00 68.57  ?  26  DT  G C5    1 
ATOM   6431  C C7    . DT  H 4 11  ? -15.021 -36.884 -125.172 1.00 66.94  ?  26  DT  G C7    1 
ATOM   6432  C C6    . DT  H 4 11  ? -13.896 -34.854 -124.286 1.00 65.56  ?  26  DT  G C6    1 
ATOM   6433  N N     . ASN I 1 16  ? -48.038 -80.666 -44.197  1.00 107.05 ?  16  ASN H N     1 
ATOM   6434  C CA    . ASN I 1 16  ? -46.897 -80.252 -43.389  1.00 95.60  ?  16  ASN H CA    1 
ATOM   6435  C C     . ASN I 1 16  ? -45.637 -80.069 -44.228  1.00 85.24  ?  16  ASN H C     1 
ATOM   6436  O O     . ASN I 1 16  ? -45.297 -80.921 -45.050  1.00 93.09  ?  16  ASN H O     1 
ATOM   6437  C CB    . ASN I 1 16  ? -46.638 -81.269 -42.276  1.00 78.50  ?  16  ASN H CB    1 
ATOM   6438  N N     . ILE I 1 17  ? -44.949 -78.951 -44.015  1.00 80.49  ?  17  ILE H N     1 
ATOM   6439  C CA    . ILE I 1 17  ? -43.751 -78.625 -44.780  1.00 87.60  ?  17  ILE H CA    1 
ATOM   6440  C C     . ILE I 1 17  ? -42.619 -79.602 -44.463  1.00 75.78  ?  17  ILE H C     1 
ATOM   6441  O O     . ILE I 1 17  ? -42.499 -80.090 -43.339  1.00 73.98  ?  17  ILE H O     1 
ATOM   6442  C CB    . ILE I 1 17  ? -43.282 -77.173 -44.501  1.00 90.51  ?  17  ILE H CB    1 
ATOM   6443  C CG1   . ILE I 1 17  ? -42.165 -76.763 -45.465  1.00 96.62  ?  17  ILE H CG1   1 
ATOM   6444  C CG2   . ILE I 1 17  ? -42.845 -77.007 -43.050  1.00 80.18  ?  17  ILE H CG2   1 
ATOM   6445  C CD1   . ILE I 1 17  ? -41.698 -75.336 -45.289  1.00 99.46  ?  17  ILE H CD1   1 
ATOM   6446  N N     . SER I 1 18  ? -41.805 -79.906 -45.468  1.00 88.62  ?  18  SER H N     1 
ATOM   6447  C CA    . SER I 1 18  ? -40.677 -80.805 -45.282  1.00 90.18  ?  18  SER H CA    1 
ATOM   6448  C C     . SER I 1 18  ? -39.498 -80.056 -44.667  1.00 80.28  ?  18  SER H C     1 
ATOM   6449  O O     . SER I 1 18  ? -39.319 -78.865 -44.918  1.00 76.27  ?  18  SER H O     1 
ATOM   6450  C CB    . SER I 1 18  ? -40.274 -81.432 -46.622  1.00 95.49  ?  18  SER H CB    1 
ATOM   6451  O OG    . SER I 1 18  ? -38.924 -81.862 -46.611  1.00 97.14  ?  18  SER H OG    1 
ATOM   6452  N N     . PRO I 1 19  ? -38.691 -80.754 -43.854  1.00 79.53  ?  19  PRO H N     1 
ATOM   6453  C CA    . PRO I 1 19  ? -37.523 -80.153 -43.201  1.00 90.96  ?  19  PRO H CA    1 
ATOM   6454  C C     . PRO I 1 19  ? -36.502 -79.646 -44.214  1.00 82.16  ?  19  PRO H C     1 
ATOM   6455  O O     . PRO I 1 19  ? -35.858 -78.613 -44.006  1.00 85.26  ?  19  PRO H O     1 
ATOM   6456  C CB    . PRO I 1 19  ? -36.950 -81.307 -42.368  1.00 90.77  ?  19  PRO H CB    1 
ATOM   6457  C CG    . PRO I 1 19  ? -37.500 -82.545 -42.997  1.00 97.93  ?  19  PRO H CG    1 
ATOM   6458  C CD    . PRO I 1 19  ? -38.863 -82.165 -43.470  1.00 86.53  ?  19  PRO H CD    1 
ATOM   6459  N N     . TRP I 1 20  ? -36.372 -80.376 -45.316  1.00 79.56  ?  20  TRP H N     1 
ATOM   6460  C CA    . TRP I 1 20  ? -35.439 -80.007 -46.368  1.00 80.10  ?  20  TRP H CA    1 
ATOM   6461  C C     . TRP I 1 20  ? -35.897 -78.756 -47.115  1.00 81.02  ?  20  TRP H C     1 
ATOM   6462  O O     . TRP I 1 20  ? -35.071 -77.991 -47.614  1.00 80.04  ?  20  TRP H O     1 
ATOM   6463  C CB    . TRP I 1 20  ? -35.269 -81.169 -47.348  1.00 84.74  ?  20  TRP H CB    1 
ATOM   6464  C CG    . TRP I 1 20  ? -34.298 -82.208 -46.877  1.00 82.11  ?  20  TRP H CG    1 
ATOM   6465  C CD1   . TRP I 1 20  ? -34.561 -83.525 -46.636  1.00 84.23  ?  20  TRP H CD1   1 
ATOM   6466  C CD2   . TRP I 1 20  ? -32.914 -82.013 -46.567  1.00 80.36  ?  20  TRP H CD2   1 
ATOM   6467  N NE1   . TRP I 1 20  ? -33.424 -84.165 -46.206  1.00 94.53  ?  20  TRP H NE1   1 
ATOM   6468  C CE2   . TRP I 1 20  ? -32.399 -83.258 -46.154  1.00 92.38  ?  20  TRP H CE2   1 
ATOM   6469  C CE3   . TRP I 1 20  ? -32.058 -80.908 -46.603  1.00 78.38  ?  20  TRP H CE3   1 
ATOM   6470  C CZ2   . TRP I 1 20  ? -31.068 -83.428 -45.780  1.00 95.55  ?  20  TRP H CZ2   1 
ATOM   6471  C CZ3   . TRP I 1 20  ? -30.738 -81.078 -46.229  1.00 87.46  ?  20  TRP H CZ3   1 
ATOM   6472  C CH2   . TRP I 1 20  ? -30.255 -82.329 -45.826  1.00 88.56  ?  20  TRP H CH2   1 
ATOM   6473  N N     . THR I 1 21  ? -37.209 -78.549 -47.187  1.00 82.33  ?  21  THR H N     1 
ATOM   6474  C CA    . THR I 1 21  ? -37.749 -77.317 -47.755  1.00 85.22  ?  21  THR H CA    1 
ATOM   6475  C C     . THR I 1 21  ? -37.333 -76.134 -46.888  1.00 77.87  ?  21  THR H C     1 
ATOM   6476  O O     . THR I 1 21  ? -36.936 -75.076 -47.388  1.00 73.91  ?  21  THR H O     1 
ATOM   6477  C CB    . THR I 1 21  ? -39.286 -77.364 -47.862  1.00 92.36  ?  21  THR H CB    1 
ATOM   6478  O OG1   . THR I 1 21  ? -39.683 -78.500 -48.641  1.00 93.24  ?  21  THR H OG1   1 
ATOM   6479  C CG2   . THR I 1 21  ? -39.818 -76.095 -48.511  1.00 90.76  ?  21  THR H CG2   1 
ATOM   6480  N N     . ILE I 1 22  ? -37.410 -76.344 -45.579  1.00 75.81  ?  22  ILE H N     1 
ATOM   6481  C CA    . ILE I 1 22  ? -37.031 -75.340 -44.597  1.00 63.86  ?  22  ILE H CA    1 
ATOM   6482  C C     . ILE I 1 22  ? -35.557 -74.999 -44.747  1.00 60.81  ?  22  ILE H C     1 
ATOM   6483  O O     . ILE I 1 22  ? -35.176 -73.824 -44.796  1.00 59.60  ?  22  ILE H O     1 
ATOM   6484  C CB    . ILE I 1 22  ? -37.306 -75.817 -43.158  1.00 65.31  ?  22  ILE H CB    1 
ATOM   6485  C CG1   . ILE I 1 22  ? -38.809 -75.993 -42.933  1.00 78.37  ?  22  ILE H CG1   1 
ATOM   6486  C CG2   . ILE I 1 22  ? -36.724 -74.839 -42.149  1.00 65.72  ?  22  ILE H CG2   1 
ATOM   6487  C CD1   . ILE I 1 22  ? -39.173 -76.410 -41.523  1.00 92.72  ?  22  ILE H CD1   1 
ATOM   6488  N N     . THR I 1 23  ? -34.731 -76.038 -44.838  1.00 57.06  ?  23  THR H N     1 
ATOM   6489  C CA    . THR I 1 23  ? -33.297 -75.836 -44.966  1.00 51.41  ?  23  THR H CA    1 
ATOM   6490  C C     . THR I 1 23  ? -32.955 -75.117 -46.269  1.00 59.90  ?  23  THR H C     1 
ATOM   6491  O O     . THR I 1 23  ? -32.095 -74.247 -46.278  1.00 62.75  ?  23  THR H O     1 
ATOM   6492  C CB    . THR I 1 23  ? -32.541 -77.183 -44.903  1.00 53.73  ?  23  THR H CB    1 
ATOM   6493  O OG1   . THR I 1 23  ? -32.652 -77.737 -43.586  1.00 75.05  ?  23  THR H OG1   1 
ATOM   6494  C CG2   . THR I 1 23  ? -31.071 -77.004 -45.248  1.00 49.60  ?  23  THR H CG2   1 
ATOM   6495  N N     . GLY I 1 24  ? -33.602 -75.492 -47.369  1.00 71.30  ?  24  GLY H N     1 
ATOM   6496  C CA    . GLY I 1 24  ? -33.386 -74.815 -48.640  1.00 71.53  ?  24  GLY H CA    1 
ATOM   6497  C C     . GLY I 1 24  ? -33.768 -73.341 -48.654  1.00 66.63  ?  24  GLY H C     1 
ATOM   6498  O O     . GLY I 1 24  ? -33.049 -72.471 -49.173  1.00 67.03  ?  24  GLY H O     1 
ATOM   6499  N N     . PHE I 1 25  ? -34.920 -73.058 -48.055  1.00 61.54  ?  25  PHE H N     1 
ATOM   6500  C CA    . PHE I 1 25  ? -35.410 -71.692 -47.969  1.00 59.71  ?  25  PHE H CA    1 
ATOM   6501  C C     . PHE I 1 25  ? -34.524 -70.832 -47.078  1.00 61.18  ?  25  PHE H C     1 
ATOM   6502  O O     . PHE I 1 25  ? -34.300 -69.654 -47.367  1.00 57.53  ?  25  PHE H O     1 
ATOM   6503  C CB    . PHE I 1 25  ? -36.848 -71.676 -47.460  1.00 67.24  ?  25  PHE H CB    1 
ATOM   6504  C CG    . PHE I 1 25  ? -37.542 -70.369 -47.673  1.00 65.02  ?  25  PHE H CG    1 
ATOM   6505  C CD1   . PHE I 1 25  ? -37.985 -70.017 -48.937  1.00 66.30  ?  25  PHE H CD1   1 
ATOM   6506  C CD2   . PHE I 1 25  ? -37.746 -69.492 -46.626  1.00 74.01  ?  25  PHE H CD2   1 
ATOM   6507  C CE1   . PHE I 1 25  ? -38.624 -68.818 -49.153  1.00 73.68  ?  25  PHE H CE1   1 
ATOM   6508  C CE2   . PHE I 1 25  ? -38.386 -68.288 -46.835  1.00 69.87  ?  25  PHE H CE2   1 
ATOM   6509  C CZ    . PHE I 1 25  ? -38.826 -67.951 -48.101  1.00 77.75  ?  25  PHE H CZ    1 
ATOM   6510  N N     . ALA I 1 26  ? -34.020 -71.419 -45.996  1.00 60.72  ?  26  ALA H N     1 
ATOM   6511  C CA    . ALA I 1 26  ? -33.105 -70.709 -45.111  1.00 59.20  ?  26  ALA H CA    1 
ATOM   6512  C C     . ALA I 1 26  ? -31.788 -70.494 -45.837  1.00 67.84  ?  26  ALA H C     1 
ATOM   6513  O O     . ALA I 1 26  ? -31.151 -69.450 -45.704  1.00 72.52  ?  26  ALA H O     1 
ATOM   6514  C CB    . ALA I 1 26  ? -32.886 -71.480 -43.821  1.00 55.11  ?  26  ALA H CB    1 
ATOM   6515  N N     . ASP I 1 27  ? -31.391 -71.509 -46.595  1.00 67.49  ?  27  ASP H N     1 
ATOM   6516  C CA    . ASP I 1 27  ? -30.250 -71.438 -47.494  1.00 64.27  ?  27  ASP H CA    1 
ATOM   6517  C C     . ASP I 1 27  ? -30.351 -70.216 -48.398  1.00 55.58  ?  27  ASP H C     1 
ATOM   6518  O O     . ASP I 1 27  ? -29.345 -69.580 -48.704  1.00 58.09  ?  27  ASP H O     1 
ATOM   6519  C CB    . ASP I 1 27  ? -30.151 -72.706 -48.345  1.00 64.66  ?  27  ASP H CB    1 
ATOM   6520  C CG    . ASP I 1 27  ? -29.010 -73.601 -47.923  1.00 71.65  ?  27  ASP H CG    1 
ATOM   6521  O OD1   . ASP I 1 27  ? -27.946 -73.066 -47.549  1.00 70.60  ?  27  ASP H OD1   1 
ATOM   6522  O OD2   . ASP I 1 27  ? -29.174 -74.839 -47.962  1.00 74.35  -1 27  ASP H OD2   1 
ATOM   6523  N N     . ALA I 1 28  ? -31.576 -69.891 -48.808  1.00 49.40  ?  28  ALA H N     1 
ATOM   6524  C CA    . ALA I 1 28  ? -31.771 -68.718 -49.653  1.00 50.31  ?  28  ALA H CA    1 
ATOM   6525  C C     . ALA I 1 28  ? -31.808 -67.390 -48.861  1.00 53.37  ?  28  ALA H C     1 
ATOM   6526  O O     . ALA I 1 28  ? -31.011 -66.499 -49.123  1.00 57.11  ?  28  ALA H O     1 
ATOM   6527  C CB    . ALA I 1 28  ? -33.049 -68.889 -50.454  1.00 52.05  ?  28  ALA H CB    1 
ATOM   6528  N N     . ASP I 1 29  ? -32.705 -67.281 -47.884  1.00 52.07  ?  29  ASP H N     1 
ATOM   6529  C CA    . ASP I 1 29  ? -33.033 -65.974 -47.283  1.00 60.13  ?  29  ASP H CA    1 
ATOM   6530  C C     . ASP I 1 29  ? -32.605 -65.725 -45.837  1.00 79.37  ?  29  ASP H C     1 
ATOM   6531  O O     . ASP I 1 29  ? -32.810 -64.621 -45.332  1.00 88.72  ?  29  ASP H O     1 
ATOM   6532  C CB    . ASP I 1 29  ? -34.524 -65.635 -47.398  1.00 70.32  ?  29  ASP H CB    1 
ATOM   6533  C CG    . ASP I 1 29  ? -34.953 -65.327 -48.813  1.00 79.18  ?  29  ASP H CG    1 
ATOM   6534  O OD1   . ASP I 1 29  ? -34.093 -65.277 -49.716  1.00 81.67  ?  29  ASP H OD1   1 
ATOM   6535  O OD2   . ASP I 1 29  ? -36.161 -65.094 -49.021  1.00 76.71  -1 29  ASP H OD2   1 
ATOM   6536  N N     . SER I 1 30  ? -32.018 -66.704 -45.159  1.00 64.84  ?  30  SER H N     1 
ATOM   6537  C CA    . SER I 1 30  ? -31.804 -66.547 -43.722  1.00 47.62  ?  30  SER H CA    1 
ATOM   6538  C C     . SER I 1 30  ? -30.457 -65.912 -43.379  1.00 40.56  ?  30  SER H C     1 
ATOM   6539  O O     . SER I 1 30  ? -29.567 -65.806 -44.223  1.00 57.40  ?  30  SER H O     1 
ATOM   6540  C CB    . SER I 1 30  ? -31.926 -67.899 -43.022  1.00 58.54  ?  30  SER H CB    1 
ATOM   6541  O OG    . SER I 1 30  ? -30.768 -68.687 -43.240  1.00 51.88  ?  30  SER H OG    1 
ATOM   6542  N N     . SER I 1 31  ? -30.322 -65.493 -42.124  1.00 61.12  ?  31  SER H N     1 
ATOM   6543  C CA    . SER I 1 31  ? -29.063 -64.970 -41.597  1.00 51.86  ?  31  SER H CA    1 
ATOM   6544  C C     . SER I 1 31  ? -28.680 -65.456 -40.199  1.00 38.08  ?  31  SER H C     1 
ATOM   6545  O O     . SER I 1 31  ? -29.519 -65.528 -39.293  1.00 42.32  ?  31  SER H O     1 
ATOM   6546  C CB    . SER I 1 31  ? -29.106 -63.439 -41.590  1.00 47.03  ?  31  SER H CB    1 
ATOM   6547  O OG    . SER I 1 31  ? -27.842 -62.893 -41.254  1.00 73.86  ?  31  SER H OG    1 
ATOM   6548  N N     . PHE I 1 32  ? -27.401 -65.797 -40.053  1.00 41.37  ?  32  PHE H N     1 
ATOM   6549  C CA    . PHE I 1 32  ? -26.786 -66.110 -38.765  1.00 38.17  ?  32  PHE H CA    1 
ATOM   6550  C C     . PHE I 1 32  ? -25.944 -64.917 -38.319  1.00 48.70  ?  32  PHE H C     1 
ATOM   6551  O O     . PHE I 1 32  ? -25.099 -64.430 -39.072  1.00 46.37  ?  32  PHE H O     1 
ATOM   6552  C CB    . PHE I 1 32  ? -25.894 -67.346 -38.869  1.00 39.64  ?  32  PHE H CB    1 
ATOM   6553  C CG    . PHE I 1 32  ? -26.630 -68.611 -39.183  1.00 43.80  ?  32  PHE H CG    1 
ATOM   6554  C CD1   . PHE I 1 32  ? -27.160 -69.387 -38.170  1.00 52.47  ?  32  PHE H CD1   1 
ATOM   6555  C CD2   . PHE I 1 32  ? -26.780 -69.029 -40.495  1.00 42.13  ?  32  PHE H CD2   1 
ATOM   6556  C CE1   . PHE I 1 32  ? -27.830 -70.560 -38.457  1.00 51.36  ?  32  PHE H CE1   1 
ATOM   6557  C CE2   . PHE I 1 32  ? -27.452 -70.198 -40.789  1.00 43.92  ?  32  PHE H CE2   1 
ATOM   6558  C CZ    . PHE I 1 32  ? -27.979 -70.963 -39.770  1.00 48.17  ?  32  PHE H CZ    1 
ATOM   6559  N N     . MET I 1 33  ? -26.168 -64.450 -37.095  1.00 39.12  ?  33  MET H N     1 
ATOM   6560  C CA    . MET I 1 33  ? -25.582 -63.191 -36.645  1.00 43.52  ?  33  MET H CA    1 
ATOM   6561  C C     . MET I 1 33  ? -24.977 -63.257 -35.246  1.00 47.53  ?  33  MET H C     1 
ATOM   6562  O O     . MET I 1 33  ? -25.429 -64.018 -34.390  1.00 57.83  ?  33  MET H O     1 
ATOM   6563  C CB    . MET I 1 33  ? -26.633 -62.078 -36.670  1.00 50.96  ?  33  MET H CB    1 
ATOM   6564  C CG    . MET I 1 33  ? -27.020 -61.590 -38.051  1.00 47.71  ?  33  MET H CG    1 
ATOM   6565  S SD    . MET I 1 33  ? -28.503 -60.567 -38.000  1.00 53.37  ?  33  MET H SD    1 
ATOM   6566  C CE    . MET I 1 33  ? -29.723 -61.772 -37.483  1.00 42.12  ?  33  MET H CE    1 
ATOM   6567  N N     . LEU I 1 34  ? -23.948 -62.444 -35.031  1.00 42.82  ?  34  LEU H N     1 
ATOM   6568  C CA    . LEU I 1 34  ? -23.365 -62.249 -33.710  1.00 42.41  ?  34  LEU H CA    1 
ATOM   6569  C C     . LEU I 1 34  ? -23.287 -60.755 -33.416  1.00 47.29  ?  34  LEU H C     1 
ATOM   6570  O O     . LEU I 1 34  ? -22.612 -60.010 -34.128  1.00 47.65  ?  34  LEU H O     1 
ATOM   6571  C CB    . LEU I 1 34  ? -21.976 -62.884 -33.624  1.00 44.97  ?  34  LEU H CB    1 
ATOM   6572  C CG    . LEU I 1 34  ? -21.905 -64.412 -33.602  1.00 53.45  ?  34  LEU H CG    1 
ATOM   6573  C CD1   . LEU I 1 34  ? -20.464 -64.873 -33.744  1.00 68.80  ?  34  LEU H CD1   1 
ATOM   6574  C CD2   . LEU I 1 34  ? -22.520 -64.965 -32.328  1.00 61.64  ?  34  LEU H CD2   1 
ATOM   6575  N N     . THR I 1 35  ? -23.982 -60.320 -32.373  1.00 38.21  ?  35  THR H N     1 
ATOM   6576  C CA    . THR I 1 35  ? -23.921 -58.928 -31.939  1.00 35.65  ?  35  THR H CA    1 
ATOM   6577  C C     . THR I 1 35  ? -22.962 -58.738 -30.766  1.00 45.57  ?  35  THR H C     1 
ATOM   6578  O O     . THR I 1 35  ? -23.078 -59.412 -29.733  1.00 65.64  ?  35  THR H O     1 
ATOM   6579  C CB    . THR I 1 35  ? -25.315 -58.404 -31.552  1.00 39.91  ?  35  THR H CB    1 
ATOM   6580  O OG1   . THR I 1 35  ? -26.209 -58.556 -32.661  1.00 36.58  ?  35  THR H OG1   1 
ATOM   6581  C CG2   . THR I 1 35  ? -25.243 -56.935 -31.165  1.00 47.09  ?  35  THR H CG2   1 
ATOM   6582  N N     . VAL I 1 36  ? -22.013 -57.821 -30.947  1.00 35.33  ?  36  VAL H N     1 
ATOM   6583  C CA    . VAL I 1 36  ? -21.070 -57.439 -29.900  1.00 44.74  ?  36  VAL H CA    1 
ATOM   6584  C C     . VAL I 1 36  ? -21.171 -55.942 -29.600  1.00 52.12  ?  36  VAL H C     1 
ATOM   6585  O O     . VAL I 1 36  ? -20.674 -55.108 -30.357  1.00 54.01  ?  36  VAL H O     1 
ATOM   6586  C CB    . VAL I 1 36  ? -19.623 -57.786 -30.291  1.00 43.71  ?  36  VAL H CB    1 
ATOM   6587  C CG1   . VAL I 1 36  ? -18.665 -57.385 -29.182  1.00 48.43  ?  36  VAL H CG1   1 
ATOM   6588  C CG2   . VAL I 1 36  ? -19.497 -59.270 -30.588  1.00 41.29  ?  36  VAL H CG2   1 
ATOM   6589  N N     . SER I 1 37  ? -21.830 -55.618 -28.491  1.00 56.91  ?  37  SER H N     1 
ATOM   6590  C CA    . SER I 1 37  ? -22.138 -54.236 -28.117  1.00 58.77  ?  37  SER H CA    1 
ATOM   6591  C C     . SER I 1 37  ? -21.427 -53.836 -26.826  1.00 55.12  ?  37  SER H C     1 
ATOM   6592  O O     . SER I 1 37  ? -21.404 -54.603 -25.874  1.00 62.59  ?  37  SER H O     1 
ATOM   6593  C CB    . SER I 1 37  ? -23.648 -54.045 -27.966  1.00 72.12  ?  37  SER H CB    1 
ATOM   6594  O OG    . SER I 1 37  ? -24.280 -53.969 -29.232  1.00 82.42  ?  37  SER H OG    1 
ATOM   6595  N N     . LYS I 1 38  ? -20.865 -52.630 -26.786  1.00 57.59  ?  38  LYS H N     1 
ATOM   6596  C CA    . LYS I 1 38  ? -20.227 -52.126 -25.568  1.00 54.22  ?  38  LYS H CA    1 
ATOM   6597  C C     . LYS I 1 38  ? -21.199 -52.078 -24.389  1.00 66.35  ?  38  LYS H C     1 
ATOM   6598  O O     . LYS I 1 38  ? -22.319 -51.585 -24.510  1.00 62.59  ?  38  LYS H O     1 
ATOM   6599  C CB    . LYS I 1 38  ? -19.639 -50.735 -25.813  1.00 48.22  ?  38  LYS H CB    1 
ATOM   6600  N N     . ASP I 1 39  ? -20.748 -52.601 -23.250  1.00 70.61  ?  39  ASP H N     1 
ATOM   6601  C CA    . ASP I 1 39  ? -21.577 -52.713 -22.050  1.00 74.01  ?  39  ASP H CA    1 
ATOM   6602  C C     . ASP I 1 39  ? -20.756 -52.628 -20.760  1.00 77.23  ?  39  ASP H C     1 
ATOM   6603  O O     . ASP I 1 39  ? -19.965 -53.519 -20.453  1.00 68.68  ?  39  ASP H O     1 
ATOM   6604  C CB    . ASP I 1 39  ? -22.373 -54.020 -22.072  1.00 80.04  ?  39  ASP H CB    1 
ATOM   6605  C CG    . ASP I 1 39  ? -23.491 -54.042 -21.041  1.00 87.25  ?  39  ASP H CG    1 
ATOM   6606  O OD1   . ASP I 1 39  ? -24.617 -53.615 -21.376  1.00 91.46  ?  39  ASP H OD1   1 
ATOM   6607  O OD2   . ASP I 1 39  ? -23.247 -54.486 -19.898  1.00 76.78  -1 39  ASP H OD2   1 
ATOM   6608  N N     . SER I 1 40  ? -20.962 -51.548 -20.014  1.00 80.52  ?  40  SER H N     1 
ATOM   6609  C CA    . SER I 1 40  ? -20.249 -51.280 -18.765  1.00 85.43  ?  40  SER H CA    1 
ATOM   6610  C C     . SER I 1 40  ? -20.488 -52.358 -17.706  1.00 89.20  ?  40  SER H C     1 
ATOM   6611  O O     . SER I 1 40  ? -19.628 -52.615 -16.862  1.00 65.14  ?  40  SER H O     1 
ATOM   6612  C CB    . SER I 1 40  ? -20.658 -49.914 -18.209  1.00 76.15  ?  40  SER H CB    1 
ATOM   6613  O OG    . SER I 1 40  ? -20.861 -48.979 -19.253  1.00 75.73  ?  40  SER H OG    1 
ATOM   6614  N N     . LYS I 1 41  ? -21.658 -52.983 -17.755  1.00 89.91  ?  41  LYS H N     1 
ATOM   6615  C CA    . LYS I 1 41  ? -22.086 -53.919 -16.722  1.00 59.03  ?  41  LYS H CA    1 
ATOM   6616  C C     . LYS I 1 41  ? -21.376 -55.269 -16.817  1.00 69.50  ?  41  LYS H C     1 
ATOM   6617  O O     . LYS I 1 41  ? -21.436 -56.067 -15.882  1.00 87.16  ?  41  LYS H O     1 
ATOM   6618  C CB    . LYS I 1 41  ? -23.600 -54.127 -16.794  1.00 40.29  ?  41  LYS H CB    1 
ATOM   6619  N N     . ARG I 1 42  ? -20.698 -55.527 -17.931  1.00 85.63  ?  42  ARG H N     1 
ATOM   6620  C CA    . ARG I 1 42  ? -20.032 -56.813 -18.117  1.00 95.70  ?  42  ARG H CA    1 
ATOM   6621  C C     . ARG I 1 42  ? -18.567 -56.727 -17.699  1.00 87.23  ?  42  ARG H C     1 
ATOM   6622  O O     . ARG I 1 42  ? -17.957 -55.660 -17.765  1.00 83.86  ?  42  ARG H O     1 
ATOM   6623  C CB    . ARG I 1 42  ? -20.099 -57.253 -19.582  1.00 88.51  ?  42  ARG H CB    1 
ATOM   6624  C CG    . ARG I 1 42  ? -21.412 -56.989 -20.298  1.00 75.01  ?  42  ARG H CG    1 
ATOM   6625  C CD    . ARG I 1 42  ? -22.579 -57.748 -19.708  1.00 73.41  ?  42  ARG H CD    1 
ATOM   6626  N NE    . ARG I 1 42  ? -23.785 -57.527 -20.500  1.00 68.66  ?  42  ARG H NE    1 
ATOM   6627  C CZ    . ARG I 1 42  ? -24.905 -58.230 -20.372  1.00 69.01  ?  42  ARG H CZ    1 
ATOM   6628  N NH1   . ARG I 1 42  ? -24.974 -59.211 -19.484  1.00 73.50  1  42  ARG H NH1   1 
ATOM   6629  N NH2   . ARG I 1 42  ? -25.952 -57.956 -21.137  1.00 46.99  ?  42  ARG H NH2   1 
ATOM   6630  N N     . ASN I 1 43  ? -18.007 -57.852 -17.262  1.00 88.40  ?  43  ASN H N     1 
ATOM   6631  C CA    . ASN I 1 43  ? -16.628 -57.879 -16.784  1.00 97.20  ?  43  ASN H CA    1 
ATOM   6632  C C     . ASN I 1 43  ? -15.624 -57.597 -17.898  1.00 96.72  ?  43  ASN H C     1 
ATOM   6633  O O     . ASN I 1 43  ? -14.568 -57.009 -17.666  1.00 97.70  ?  43  ASN H O     1 
ATOM   6634  C CB    . ASN I 1 43  ? -16.317 -59.229 -16.135  1.00 91.60  ?  43  ASN H CB    1 
ATOM   6635  N N     . THR I 1 44  ? -15.967 -58.023 -19.110  1.00 94.13  ?  44  THR H N     1 
ATOM   6636  C CA    . THR I 1 44  ? -15.143 -57.760 -20.284  1.00 95.51  ?  44  THR H CA    1 
ATOM   6637  C C     . THR I 1 44  ? -15.421 -56.380 -20.866  1.00 89.99  ?  44  THR H C     1 
ATOM   6638  O O     . THR I 1 44  ? -14.647 -55.871 -21.678  1.00 80.26  ?  44  THR H O     1 
ATOM   6639  C CB    . THR I 1 44  ? -15.366 -58.819 -21.380  1.00 89.27  ?  44  THR H CB    1 
ATOM   6640  O OG1   . THR I 1 44  ? -16.730 -58.779 -21.818  1.00 88.99  ?  44  THR H OG1   1 
ATOM   6641  C CG2   . THR I 1 44  ? -15.042 -60.210 -20.853  1.00 91.04  ?  44  THR H CG2   1 
ATOM   6642  N N     . GLY I 1 45  ? -16.530 -55.778 -20.448  1.00 90.23  ?  45  GLY H N     1 
ATOM   6643  C CA    . GLY I 1 45  ? -16.940 -54.496 -20.990  1.00 89.36  ?  45  GLY H CA    1 
ATOM   6644  C C     . GLY I 1 45  ? -17.784 -54.646 -22.241  1.00 81.47  ?  45  GLY H C     1 
ATOM   6645  O O     . GLY I 1 45  ? -18.178 -53.655 -22.855  1.00 75.93  ?  45  GLY H O     1 
ATOM   6646  N N     . TRP I 1 46  ? -18.065 -55.888 -22.621  1.00 79.72  ?  46  TRP H N     1 
ATOM   6647  C CA    . TRP I 1 46  ? -18.823 -56.148 -23.838  1.00 72.32  ?  46  TRP H CA    1 
ATOM   6648  C C     . TRP I 1 46  ? -19.918 -57.197 -23.655  1.00 65.11  ?  46  TRP H C     1 
ATOM   6649  O O     . TRP I 1 46  ? -19.789 -58.136 -22.869  1.00 86.03  ?  46  TRP H O     1 
ATOM   6650  C CB    . TRP I 1 46  ? -17.867 -56.566 -24.957  1.00 75.38  ?  46  TRP H CB    1 
ATOM   6651  C CG    . TRP I 1 46  ? -16.924 -55.463 -25.338  1.00 78.09  ?  46  TRP H CG    1 
ATOM   6652  C CD1   . TRP I 1 46  ? -15.723 -55.175 -24.759  1.00 83.09  ?  46  TRP H CD1   1 
ATOM   6653  C CD2   . TRP I 1 46  ? -17.102 -54.502 -26.387  1.00 66.86  ?  46  TRP H CD2   1 
ATOM   6654  N NE1   . TRP I 1 46  ? -15.147 -54.089 -25.372  1.00 72.94  ?  46  TRP H NE1   1 
ATOM   6655  C CE2   . TRP I 1 46  ? -15.973 -53.660 -26.378  1.00 66.85  ?  46  TRP H CE2   1 
ATOM   6656  C CE3   . TRP I 1 46  ? -18.107 -54.272 -27.331  1.00 65.10  ?  46  TRP H CE3   1 
ATOM   6657  C CZ2   . TRP I 1 46  ? -15.820 -52.607 -27.277  1.00 61.25  ?  46  TRP H CZ2   1 
ATOM   6658  C CZ3   . TRP I 1 46  ? -17.954 -53.224 -28.220  1.00 68.71  ?  46  TRP H CZ3   1 
ATOM   6659  C CH2   . TRP I 1 46  ? -16.819 -52.406 -28.188  1.00 60.05  ?  46  TRP H CH2   1 
ATOM   6660  N N     . SER I 1 47  ? -20.994 -57.011 -24.410  1.00 50.55  ?  47  SER H N     1 
ATOM   6661  C CA    . SER I 1 47  ? -22.114 -57.938 -24.486  1.00 53.82  ?  47  SER H CA    1 
ATOM   6662  C C     . SER I 1 47  ? -22.086 -58.666 -25.827  1.00 67.28  ?  47  SER H C     1 
ATOM   6663  O O     . SER I 1 47  ? -21.970 -58.048 -26.888  1.00 63.32  ?  47  SER H O     1 
ATOM   6664  C CB    . SER I 1 47  ? -23.442 -57.203 -24.299  1.00 55.77  ?  47  SER H CB    1 
ATOM   6665  O OG    . SER I 1 47  ? -23.780 -56.463 -25.458  1.00 85.56  ?  47  SER H OG    1 
ATOM   6666  N N     . VAL I 1 48  ? -22.191 -59.986 -25.762  1.00 55.61  ?  48  VAL H N     1 
ATOM   6667  C CA    . VAL I 1 48  ? -22.174 -60.840 -26.942  1.00 41.85  ?  48  VAL H CA    1 
ATOM   6668  C C     . VAL I 1 48  ? -23.415 -61.716 -27.020  1.00 41.39  ?  48  VAL H C     1 
ATOM   6669  O O     . VAL I 1 48  ? -23.785 -62.363 -26.041  1.00 62.22  ?  48  VAL H O     1 
ATOM   6670  C CB    . VAL I 1 48  ? -20.920 -61.736 -26.958  1.00 54.00  ?  48  VAL H CB    1 
ATOM   6671  C CG1   . VAL I 1 48  ? -21.098 -62.907 -27.921  1.00 60.94  ?  48  VAL H CG1   1 
ATOM   6672  C CG2   . VAL I 1 48  ? -19.700 -60.919 -27.329  1.00 66.30  ?  48  VAL H CG2   1 
ATOM   6673  N N     . ARG I 1 49  ? -24.065 -61.730 -28.180  1.00 43.21  ?  49  ARG H N     1 
ATOM   6674  C CA    . ARG I 1 49  ? -25.266 -62.543 -28.337  1.00 39.57  ?  49  ARG H CA    1 
ATOM   6675  C C     . ARG I 1 49  ? -25.439 -63.077 -29.749  1.00 47.83  ?  49  ARG H C     1 
ATOM   6676  O O     . ARG I 1 49  ? -25.115 -62.409 -30.731  1.00 51.35  ?  49  ARG H O     1 
ATOM   6677  C CB    . ARG I 1 49  ? -26.531 -61.754 -27.986  1.00 46.49  ?  49  ARG H CB    1 
ATOM   6678  C CG    . ARG I 1 49  ? -26.821 -60.612 -28.950  1.00 45.64  ?  49  ARG H CG    1 
ATOM   6679  C CD    . ARG I 1 49  ? -27.897 -59.685 -28.435  1.00 48.26  ?  49  ARG H CD    1 
ATOM   6680  N NE    . ARG I 1 49  ? -29.169 -60.400 -28.380  1.00 33.42  ?  49  ARG H NE    1 
ATOM   6681  C CZ    . ARG I 1 49  ? -30.329 -59.852 -28.039  1.00 46.92  ?  49  ARG H CZ    1 
ATOM   6682  N NH1   . ARG I 1 49  ? -30.393 -58.565 -27.726  1.00 52.97  1  49  ARG H NH1   1 
ATOM   6683  N NH2   . ARG I 1 49  ? -31.430 -60.590 -28.028  1.00 42.36  ?  49  ARG H NH2   1 
ATOM   6684  N N     . PRO I 1 50  ? -25.928 -64.319 -29.846  1.00 50.06  ?  50  PRO H N     1 
ATOM   6685  C CA    . PRO I 1 50  ? -26.176 -64.967 -31.132  1.00 54.18  ?  50  PRO H CA    1 
ATOM   6686  C C     . PRO I 1 50  ? -27.616 -64.781 -31.609  1.00 55.06  ?  50  PRO H C     1 
ATOM   6687  O O     . PRO I 1 50  ? -28.529 -64.655 -30.790  1.00 60.30  ?  50  PRO H O     1 
ATOM   6688  C CB    . PRO I 1 50  ? -25.880 -66.434 -30.827  1.00 50.50  ?  50  PRO H CB    1 
ATOM   6689  C CG    . PRO I 1 50  ? -26.271 -66.593 -29.385  1.00 46.52  ?  50  PRO H CG    1 
ATOM   6690  C CD    . PRO I 1 50  ? -26.140 -65.243 -28.717  1.00 37.52  ?  50  PRO H CD    1 
ATOM   6691  N N     . ARG I 1 51  ? -27.807 -64.758 -32.924  1.00 36.68  ?  51  ARG H N     1 
ATOM   6692  C CA    . ARG I 1 51  ? -29.133 -64.639 -33.521  1.00 32.62  ?  51  ARG H CA    1 
ATOM   6693  C C     . ARG I 1 51  ? -29.242 -65.508 -34.767  1.00 46.20  ?  51  ARG H C     1 
ATOM   6694  O O     . ARG I 1 51  ? -28.283 -65.643 -35.526  1.00 52.32  ?  51  ARG H O     1 
ATOM   6695  C CB    . ARG I 1 51  ? -29.462 -63.193 -33.912  1.00 40.75  ?  51  ARG H CB    1 
ATOM   6696  C CG    . ARG I 1 51  ? -29.086 -62.088 -32.939  1.00 27.39  ?  51  ARG H CG    1 
ATOM   6697  C CD    . ARG I 1 51  ? -29.422 -60.740 -33.575  1.00 39.49  ?  51  ARG H CD    1 
ATOM   6698  N NE    . ARG I 1 51  ? -28.838 -59.598 -32.877  1.00 33.84  ?  51  ARG H NE    1 
ATOM   6699  C CZ    . ARG I 1 51  ? -29.516 -58.804 -32.056  1.00 38.80  ?  51  ARG H CZ    1 
ATOM   6700  N NH1   . ARG I 1 51  ? -30.804 -59.029 -31.831  1.00 42.73  1  51  ARG H NH1   1 
ATOM   6701  N NH2   . ARG I 1 51  ? -28.917 -57.769 -31.481  1.00 60.90  ?  51  ARG H NH2   1 
ATOM   6702  N N     . PHE I 1 52  ? -30.409 -66.104 -34.968  1.00 52.30  ?  52  PHE H N     1 
ATOM   6703  C CA    . PHE I 1 52  ? -30.748 -66.703 -36.255  1.00 50.53  ?  52  PHE H CA    1 
ATOM   6704  C C     . PHE I 1 52  ? -32.061 -66.102 -36.726  1.00 42.27  ?  52  PHE H C     1 
ATOM   6705  O O     . PHE I 1 52  ? -32.997 -65.995 -35.946  1.00 56.63  ?  52  PHE H O     1 
ATOM   6706  C CB    . PHE I 1 52  ? -30.847 -68.225 -36.187  1.00 57.44  ?  52  PHE H CB    1 
ATOM   6707  C CG    . PHE I 1 52  ? -31.394 -68.840 -37.444  1.00 40.53  ?  52  PHE H CG    1 
ATOM   6708  C CD1   . PHE I 1 52  ? -30.625 -68.877 -38.593  1.00 50.08  ?  52  PHE H CD1   1 
ATOM   6709  C CD2   . PHE I 1 52  ? -32.665 -69.383 -37.478  1.00 48.39  ?  52  PHE H CD2   1 
ATOM   6710  C CE1   . PHE I 1 52  ? -31.114 -69.435 -39.759  1.00 50.56  ?  52  PHE H CE1   1 
ATOM   6711  C CE2   . PHE I 1 52  ? -33.162 -69.947 -38.641  1.00 54.62  ?  52  PHE H CE2   1 
ATOM   6712  C CZ    . PHE I 1 52  ? -32.383 -69.972 -39.783  1.00 51.56  ?  52  PHE H CZ    1 
ATOM   6713  N N     . ARG I 1 53  ? -32.152 -65.698 -37.986  1.00 44.81  ?  53  ARG H N     1 
ATOM   6714  C CA    . ARG I 1 53  ? -33.350 -64.976 -38.402  1.00 44.61  ?  53  ARG H CA    1 
ATOM   6715  C C     . ARG I 1 53  ? -33.707 -65.236 -39.856  1.00 46.03  ?  53  ARG H C     1 
ATOM   6716  O O     . ARG I 1 53  ? -32.832 -65.410 -40.700  1.00 51.98  ?  53  ARG H O     1 
ATOM   6717  C CB    . ARG I 1 53  ? -33.153 -63.473 -38.180  1.00 47.71  ?  53  ARG H CB    1 
ATOM   6718  C CG    . ARG I 1 53  ? -34.427 -62.644 -38.236  1.00 56.26  ?  53  ARG H CG    1 
ATOM   6719  C CD    . ARG I 1 53  ? -34.201 -61.254 -37.658  1.00 45.24  ?  53  ARG H CD    1 
ATOM   6720  N NE    . ARG I 1 53  ? -33.304 -60.462 -38.497  1.00 52.94  ?  53  ARG H NE    1 
ATOM   6721  C CZ    . ARG I 1 53  ? -32.437 -59.568 -38.034  1.00 54.41  ?  53  ARG H CZ    1 
ATOM   6722  N NH1   . ARG I 1 53  ? -32.341 -59.341 -36.733  1.00 31.71  1  53  ARG H NH1   1 
ATOM   6723  N NH2   . ARG I 1 53  ? -31.667 -58.897 -38.879  1.00 65.11  ?  53  ARG H NH2   1 
ATOM   6724  N N     . ILE I 1 54  ? -35.008 -65.255 -40.138  1.00 47.23  ?  54  ILE H N     1 
ATOM   6725  C CA    . ILE I 1 54  ? -35.498 -65.226 -41.513  1.00 57.73  ?  54  ILE H CA    1 
ATOM   6726  C C     . ILE I 1 54  ? -36.467 -64.070 -41.723  1.00 56.20  ?  54  ILE H C     1 
ATOM   6727  O O     . ILE I 1 54  ? -37.417 -63.899 -40.959  1.00 64.43  ?  54  ILE H O     1 
ATOM   6728  C CB    . ILE I 1 54  ? -36.211 -66.546 -41.883  1.00 39.26  ?  54  ILE H CB    1 
ATOM   6729  C CG1   . ILE I 1 54  ? -35.234 -67.722 -41.829  1.00 42.42  ?  54  ILE H CG1   1 
ATOM   6730  C CG2   . ILE I 1 54  ? -36.873 -66.442 -43.251  1.00 58.71  ?  54  ILE H CG2   1 
ATOM   6731  C CD1   . ILE I 1 54  ? -35.909 -69.068 -41.714  1.00 50.23  ?  54  ILE H CD1   1 
ATOM   6732  N N     . GLY I 1 55  ? -36.202 -63.280 -42.758  1.00 50.99  ?  55  GLY H N     1 
ATOM   6733  C CA    . GLY I 1 55  ? -37.031 -62.141 -43.099  1.00 64.44  ?  55  GLY H CA    1 
ATOM   6734  C C     . GLY I 1 55  ? -37.637 -62.312 -44.477  1.00 69.57  ?  55  GLY H C     1 
ATOM   6735  O O     . GLY I 1 55  ? -36.984 -62.799 -45.398  1.00 81.52  ?  55  GLY H O     1 
ATOM   6736  N N     . LEU I 1 56  ? -38.894 -61.907 -44.615  1.00 57.54  ?  56  LEU H N     1 
ATOM   6737  C CA    . LEU I 1 56  ? -39.607 -62.022 -45.882  1.00 61.09  ?  56  LEU H CA    1 
ATOM   6738  C C     . LEU I 1 56  ? -40.550 -60.839 -46.028  1.00 65.56  ?  56  LEU H C     1 
ATOM   6739  O O     . LEU I 1 56  ? -40.750 -60.078 -45.077  1.00 59.07  ?  56  LEU H O     1 
ATOM   6740  C CB    . LEU I 1 56  ? -40.391 -63.332 -45.967  1.00 38.42  ?  56  LEU H CB    1 
ATOM   6741  C CG    . LEU I 1 56  ? -39.649 -64.631 -45.670  1.00 45.25  ?  56  LEU H CG    1 
ATOM   6742  C CD1   . LEU I 1 56  ? -40.608 -65.807 -45.721  1.00 54.09  ?  56  LEU H CD1   1 
ATOM   6743  C CD2   . LEU I 1 56  ? -38.512 -64.811 -46.653  1.00 72.99  ?  56  LEU H CD2   1 
ATOM   6744  N N     . HIS I 1 57  ? -41.124 -60.677 -47.215  1.00 65.94  ?  57  HIS H N     1 
ATOM   6745  C CA    . HIS I 1 57  ? -42.205 -59.717 -47.397  1.00 68.07  ?  57  HIS H CA    1 
ATOM   6746  C C     . HIS I 1 57  ? -43.366 -60.107 -46.485  1.00 72.93  ?  57  HIS H C     1 
ATOM   6747  O O     . HIS I 1 57  ? -43.612 -61.295 -46.261  1.00 66.07  ?  57  HIS H O     1 
ATOM   6748  C CB    . HIS I 1 57  ? -42.656 -59.661 -48.856  1.00 76.24  ?  57  HIS H CB    1 
ATOM   6749  C CG    . HIS I 1 57  ? -43.579 -58.521 -49.159  1.00 87.25  ?  57  HIS H CG    1 
ATOM   6750  N ND1   . HIS I 1 57  ? -44.904 -58.514 -48.779  1.00 88.51  ?  57  HIS H ND1   1 
ATOM   6751  C CD2   . HIS I 1 57  ? -43.364 -57.345 -49.796  1.00 88.78  ?  57  HIS H CD2   1 
ATOM   6752  C CE1   . HIS I 1 57  ? -45.466 -57.385 -49.171  1.00 83.95  ?  57  HIS H CE1   1 
ATOM   6753  N NE2   . HIS I 1 57  ? -44.554 -56.658 -49.791  1.00 87.23  ?  57  HIS H NE2   1 
ATOM   6754  N N     . ASN I 1 58  ? -44.062 -59.106 -45.954  1.00 66.54  ?  58  ASN H N     1 
ATOM   6755  C CA    . ASN I 1 58  ? -45.242 -59.315 -45.116  1.00 64.17  ?  58  ASN H CA    1 
ATOM   6756  C C     . ASN I 1 58  ? -46.242 -60.330 -45.674  1.00 67.75  ?  58  ASN H C     1 
ATOM   6757  O O     . ASN I 1 58  ? -46.806 -61.143 -44.935  1.00 66.04  ?  58  ASN H O     1 
ATOM   6758  C CB    . ASN I 1 58  ? -45.955 -57.979 -44.903  1.00 61.03  ?  58  ASN H CB    1 
ATOM   6759  C CG    . ASN I 1 58  ? -45.314 -57.137 -43.817  1.00 85.75  ?  58  ASN H CG    1 
ATOM   6760  O OD1   . ASN I 1 58  ? -44.821 -57.660 -42.817  1.00 85.22  ?  58  ASN H OD1   1 
ATOM   6761  N ND2   . ASN I 1 58  ? -45.308 -55.824 -44.014  1.00 89.83  ?  58  ASN H ND2   1 
ATOM   6762  N N     . LYS I 1 59  ? -46.355 -60.369 -46.996  1.00 92.04  ?  59  LYS H N     1 
ATOM   6763  C CA    . LYS I 1 59  ? -47.323 -61.232 -47.657  1.00 93.47  ?  59  LYS H CA    1 
ATOM   6764  C C     . LYS I 1 59  ? -47.044 -62.700 -47.379  1.00 91.35  ?  59  LYS H C     1 
ATOM   6765  O O     . LYS I 1 59  ? -47.897 -63.557 -47.610  1.00 79.37  ?  59  LYS H O     1 
ATOM   6766  C CB    . LYS I 1 59  ? -47.321 -60.974 -49.166  1.00 74.00  ?  59  LYS H CB    1 
ATOM   6767  N N     . ASP I 1 60  ? -45.845 -62.992 -46.889  1.00 92.45  ?  60  ASP H N     1 
ATOM   6768  C CA    . ASP I 1 60  ? -45.455 -64.373 -46.698  1.00 90.55  ?  60  ASP H CA    1 
ATOM   6769  C C     . ASP I 1 60  ? -45.298 -64.724 -45.219  1.00 77.86  ?  60  ASP H C     1 
ATOM   6770  O O     . ASP I 1 60  ? -44.608 -65.701 -44.894  1.00 62.93  ?  60  ASP H O     1 
ATOM   6771  C CB    . ASP I 1 60  ? -44.140 -64.640 -47.431  1.00 80.30  ?  60  ASP H CB    1 
ATOM   6772  C CG    . ASP I 1 60  ? -44.356 -65.119 -48.845  1.00 77.82  ?  60  ASP H CG    1 
ATOM   6773  O OD1   . ASP I 1 60  ? -45.404 -65.744 -49.097  1.00 86.65  ?  60  ASP H OD1   1 
ATOM   6774  O OD2   . ASP I 1 60  ? -43.486 -64.863 -49.704  1.00 77.36  -1 60  ASP H OD2   1 
ATOM   6775  N N     . VAL I 1 61  ? -45.983 -63.993 -44.331  1.00 79.55  ?  61  VAL H N     1 
ATOM   6776  C CA    . VAL I 1 61  ? -45.996 -64.394 -42.916  1.00 75.42  ?  61  VAL H CA    1 
ATOM   6777  C C     . VAL I 1 61  ? -46.387 -65.856 -42.710  1.00 77.61  ?  61  VAL H C     1 
ATOM   6778  O O     . VAL I 1 61  ? -45.819 -66.549 -41.859  1.00 80.45  ?  61  VAL H O     1 
ATOM   6779  C CB    . VAL I 1 61  ? -46.964 -63.525 -42.066  1.00 75.62  ?  61  VAL H CB    1 
ATOM   6780  C CG1   . VAL I 1 61  ? -46.993 -64.002 -40.621  1.00 97.56  ?  61  VAL H CG1   1 
ATOM   6781  C CG2   . VAL I 1 61  ? -46.593 -62.061 -42.127  1.00 76.09  ?  61  VAL H CG2   1 
ATOM   6782  N N     . THR I 1 62  ? -47.305 -66.336 -43.541  1.00 83.30  ?  62  THR H N     1 
ATOM   6783  C CA    . THR I 1 62  ? -47.772 -67.711 -43.445  1.00 89.45  ?  62  THR H CA    1 
ATOM   6784  C C     . THR I 1 62  ? -46.658 -68.743 -43.561  1.00 85.92  ?  62  THR H C     1 
ATOM   6785  O O     . THR I 1 62  ? -46.641 -69.724 -42.806  1.00 84.65  ?  62  THR H O     1 
ATOM   6786  C CB    . THR I 1 62  ? -48.821 -68.015 -44.536  1.00 86.88  ?  62  THR H CB    1 
ATOM   6787  O OG1   . THR I 1 62  ? -48.215 -67.905 -45.831  1.00 77.22  ?  62  THR H OG1   1 
ATOM   6788  C CG2   . THR I 1 62  ? -49.987 -67.044 -44.442  1.00 78.44  ?  62  THR H CG2   1 
ATOM   6789  N N     . ILE I 1 63  ? -45.650 -68.445 -44.380  1.00 80.59  ?  63  ILE H N     1 
ATOM   6790  C CA    . ILE I 1 63  ? -44.517 -69.355 -44.515  1.00 84.62  ?  63  ILE H CA    1 
ATOM   6791  C C     . ILE I 1 63  ? -43.815 -69.510 -43.182  1.00 83.40  ?  63  ILE H C     1 
ATOM   6792  O O     . ILE I 1 63  ? -43.548 -70.630 -42.729  1.00 69.15  ?  63  ILE H O     1 
ATOM   6793  C CB    . ILE I 1 63  ? -43.513 -68.858 -45.575  1.00 59.52  ?  63  ILE H CB    1 
ATOM   6794  N N     . LEU I 1 64  ? -43.618 -68.385 -42.511  1.00 80.97  ?  64  LEU H N     1 
ATOM   6795  C CA    . LEU I 1 64  ? -42.935 -68.380 -41.236  1.00 70.03  ?  64  LEU H CA    1 
ATOM   6796  C C     . LEU I 1 64  ? -43.732 -69.198 -40.237  1.00 74.85  ?  64  LEU H C     1 
ATOM   6797  O O     . LEU I 1 64  ? -43.163 -70.005 -39.493  1.00 74.91  ?  64  LEU H O     1 
ATOM   6798  C CB    . LEU I 1 64  ? -42.744 -66.951 -40.725  1.00 67.40  ?  64  LEU H CB    1 
ATOM   6799  C CG    . LEU I 1 64  ? -42.055 -65.972 -41.678  1.00 69.81  ?  64  LEU H CG    1 
ATOM   6800  C CD1   . LEU I 1 64  ? -41.854 -64.622 -41.010  1.00 71.21  ?  64  LEU H CD1   1 
ATOM   6801  C CD2   . LEU I 1 64  ? -40.726 -66.540 -42.145  1.00 65.85  ?  64  LEU H CD2   1 
ATOM   6802  N N     . LYS I 1 65  ? -45.057 -69.091 -40.311  1.00 69.62  ?  65  LYS H N     1 
ATOM   6803  C CA    . LYS I 1 65  ? -45.890 -69.845 -39.390  1.00 76.77  ?  65  LYS H CA    1 
ATOM   6804  C C     . LYS I 1 65  ? -45.716 -71.336 -39.593  1.00 75.92  ?  65  LYS H C     1 
ATOM   6805  O O     . LYS I 1 65  ? -45.590 -72.082 -38.614  1.00 72.45  ?  65  LYS H O     1 
ATOM   6806  C CB    . LYS I 1 65  ? -47.361 -69.459 -39.560  1.00 75.13  ?  65  LYS H CB    1 
ATOM   6807  N N     . SER I 1 66  ? -45.558 -71.753 -40.843  1.00 77.71  ?  66  SER H N     1 
ATOM   6808  C CA    . SER I 1 66  ? -45.383 -73.168 -41.114  1.00 83.47  ?  66  SER H CA    1 
ATOM   6809  C C     . SER I 1 66  ? -44.089 -73.618 -40.465  1.00 85.62  ?  66  SER H C     1 
ATOM   6810  O O     . SER I 1 66  ? -44.062 -74.629 -39.753  1.00 81.37  ?  66  SER H O     1 
ATOM   6811  C CB    . SER I 1 66  ? -45.363 -73.445 -42.617  1.00 87.20  ?  66  SER H CB    1 
ATOM   6812  O OG    . SER I 1 66  ? -45.264 -74.834 -42.874  1.00 91.05  ?  66  SER H OG    1 
ATOM   6813  N N     . ILE I 1 67  ? -43.058 -72.790 -40.593  1.00 82.79  ?  67  ILE H N     1 
ATOM   6814  C CA    . ILE I 1 67  ? -41.777 -73.105 -39.988  1.00 84.28  ?  67  ILE H CA    1 
ATOM   6815  C C     . ILE I 1 67  ? -41.952 -73.152 -38.484  1.00 85.17  ?  67  ILE H C     1 
ATOM   6816  O O     . ILE I 1 67  ? -41.518 -74.110 -37.834  1.00 83.06  ?  67  ILE H O     1 
ATOM   6817  C CB    . ILE I 1 67  ? -40.692 -72.080 -40.358  1.00 79.30  ?  67  ILE H CB    1 
ATOM   6818  C CG1   . ILE I 1 67  ? -40.306 -72.225 -41.829  1.00 78.02  ?  67  ILE H CG1   1 
ATOM   6819  C CG2   . ILE I 1 67  ? -39.467 -72.261 -39.478  1.00 84.10  ?  67  ILE H CG2   1 
ATOM   6820  C CD1   . ILE I 1 67  ? -39.382 -71.137 -42.325  1.00 71.16  ?  67  ILE H CD1   1 
ATOM   6821  N N     . ARG I 1 68  ? -42.646 -72.156 -37.945  1.00 76.98  ?  68  ARG H N     1 
ATOM   6822  C CA    . ARG I 1 68  ? -42.897 -72.122 -36.517  1.00 77.51  ?  68  ARG H CA    1 
ATOM   6823  C C     . ARG I 1 68  ? -43.628 -73.389 -36.108  1.00 85.08  ?  68  ARG H C     1 
ATOM   6824  O O     . ARG I 1 68  ? -43.191 -74.093 -35.184  1.00 82.00  ?  68  ARG H O     1 
ATOM   6825  C CB    . ARG I 1 68  ? -43.711 -70.881 -36.143  1.00 78.83  ?  68  ARG H CB    1 
ATOM   6826  C CG    . ARG I 1 68  ? -44.394 -70.951 -34.786  1.00 69.46  ?  68  ARG H CG    1 
ATOM   6827  C CD    . ARG I 1 68  ? -43.409 -70.719 -33.653  1.00 71.16  ?  68  ARG H CD    1 
ATOM   6828  N NE    . ARG I 1 68  ? -43.752 -71.486 -32.459  1.00 86.34  ?  68  ARG H NE    1 
ATOM   6829  C CZ    . ARG I 1 68  ? -43.358 -71.168 -31.230  1.00 81.52  ?  68  ARG H CZ    1 
ATOM   6830  N NH1   . ARG I 1 68  ? -42.603 -70.096 -31.029  1.00 81.20  1  68  ARG H NH1   1 
ATOM   6831  N NH2   . ARG I 1 68  ? -43.718 -71.921 -30.200  1.00 73.58  ?  68  ARG H NH2   1 
ATOM   6832  N N     . GLU I 1 69  ? -44.606 -73.781 -36.921  1.00 90.00  ?  69  GLU H N     1 
ATOM   6833  C CA    . GLU I 1 69  ? -45.416 -74.943 -36.599  1.00 85.05  ?  69  GLU H CA    1 
ATOM   6834  C C     . GLU I 1 69  ? -44.535 -76.168 -36.639  1.00 84.53  ?  69  GLU H C     1 
ATOM   6835  O O     . GLU I 1 69  ? -44.707 -77.086 -35.837  1.00 87.98  ?  69  GLU H O     1 
ATOM   6836  C CB    . GLU I 1 69  ? -46.590 -75.084 -37.570  1.00 80.03  ?  69  GLU H CB    1 
ATOM   6837  N N     . TYR I 1 70  ? -43.600 -76.193 -37.579  1.00 79.17  ?  70  TYR H N     1 
ATOM   6838  C CA    . TYR I 1 70  ? -42.684 -77.311 -37.635  1.00 76.13  ?  70  TYR H CA    1 
ATOM   6839  C C     . TYR I 1 70  ? -41.833 -77.383 -36.368  1.00 74.38  ?  70  TYR H C     1 
ATOM   6840  O O     . TYR I 1 70  ? -41.740 -78.438 -35.741  1.00 71.01  ?  70  TYR H O     1 
ATOM   6841  C CB    . TYR I 1 70  ? -41.781 -77.221 -38.867  1.00 75.79  ?  70  TYR H CB    1 
ATOM   6842  C CG    . TYR I 1 70  ? -40.919 -78.448 -39.076  1.00 76.55  ?  70  TYR H CG    1 
ATOM   6843  C CD1   . TYR I 1 70  ? -41.365 -79.510 -39.852  1.00 78.14  ?  70  TYR H CD1   1 
ATOM   6844  C CD2   . TYR I 1 70  ? -39.665 -78.550 -38.485  1.00 81.53  ?  70  TYR H CD2   1 
ATOM   6845  C CE1   . TYR I 1 70  ? -40.585 -80.638 -40.035  1.00 87.79  ?  70  TYR H CE1   1 
ATOM   6846  C CE2   . TYR I 1 70  ? -38.877 -79.671 -38.668  1.00 84.73  ?  70  TYR H CE2   1 
ATOM   6847  C CZ    . TYR I 1 70  ? -39.342 -80.712 -39.442  1.00 95.19  ?  70  TYR H CZ    1 
ATOM   6848  O OH    . TYR I 1 70  ? -38.559 -81.827 -39.631  1.00 105.98 ?  70  TYR H OH    1 
ATOM   6849  N N     . LEU I 1 71  ? -41.209 -76.268 -35.988  1.00 78.19  ?  71  LEU H N     1 
ATOM   6850  C CA    . LEU I 1 71  ? -40.190 -76.359 -34.939  1.00 69.96  ?  71  LEU H CA    1 
ATOM   6851  C C     . LEU I 1 71  ? -40.690 -76.245 -33.504  1.00 73.51  ?  71  LEU H C     1 
ATOM   6852  O O     . LEU I 1 71  ? -40.026 -76.704 -32.574  1.00 73.14  ?  71  LEU H O     1 
ATOM   6853  C CB    . LEU I 1 71  ? -39.114 -75.299 -35.180  1.00 71.26  ?  71  LEU H CB    1 
ATOM   6854  C CG    . LEU I 1 71  ? -38.331 -75.472 -36.484  1.00 70.87  ?  71  LEU H CG    1 
ATOM   6855  C CD1   . LEU I 1 71  ? -37.564 -74.207 -36.830  1.00 59.82  ?  71  LEU H CD1   1 
ATOM   6856  C CD2   . LEU I 1 71  ? -37.393 -76.668 -36.394  1.00 62.28  ?  71  LEU H CD2   1 
ATOM   6857  N N     . GLY I 1 72  ? -41.855 -75.639 -33.322  1.00 81.45  ?  72  GLY H N     1 
ATOM   6858  C CA    . GLY I 1 72  ? -42.370 -75.401 -31.987  1.00 75.72  ?  72  GLY H CA    1 
ATOM   6859  C C     . GLY I 1 72  ? -41.546 -74.330 -31.297  1.00 68.11  ?  72  GLY H C     1 
ATOM   6860  O O     . GLY I 1 72  ? -41.419 -74.324 -30.072  1.00 94.89  ?  72  GLY H O     1 
ATOM   6861  N N     . ALA I 1 73  ? -40.993 -73.417 -32.089  1.00 69.03  ?  73  ALA H N     1 
ATOM   6862  C CA    . ALA I 1 73  ? -40.094 -72.388 -31.576  1.00 69.75  ?  73  ALA H CA    1 
ATOM   6863  C C     . ALA I 1 73  ? -39.942 -71.264 -32.591  1.00 78.37  ?  73  ALA H C     1 
ATOM   6864  O O     . ALA I 1 73  ? -40.237 -71.443 -33.774  1.00 68.30  ?  73  ALA H O     1 
ATOM   6865  C CB    . ALA I 1 73  ? -38.735 -72.985 -31.235  1.00 48.93  ?  73  ALA H CB    1 
ATOM   6866  N N     . GLY I 1 74  ? -39.479 -70.106 -32.132  1.00 71.94  ?  74  GLY H N     1 
ATOM   6867  C CA    . GLY I 1 74  ? -39.314 -68.969 -33.017  1.00 51.32  ?  74  GLY H CA    1 
ATOM   6868  C C     . GLY I 1 74  ? -40.297 -67.860 -32.702  1.00 48.81  ?  74  GLY H C     1 
ATOM   6869  O O     . GLY I 1 74  ? -41.443 -68.128 -32.342  1.00 65.64  ?  74  GLY H O     1 
ATOM   6870  N N     . ILE I 1 75  ? -39.857 -66.613 -32.831  1.00 47.64  ?  75  ILE H N     1 
ATOM   6871  C CA    . ILE I 1 75  ? -40.735 -65.482 -32.554  1.00 47.60  ?  75  ILE H CA    1 
ATOM   6872  C C     . ILE I 1 75  ? -41.026 -64.727 -33.848  1.00 52.85  ?  75  ILE H C     1 
ATOM   6873  O O     . ILE I 1 75  ? -40.112 -64.265 -34.531  1.00 53.47  ?  75  ILE H O     1 
ATOM   6874  C CB    . ILE I 1 75  ? -40.122 -64.521 -31.519  1.00 44.77  ?  75  ILE H CB    1 
ATOM   6875  C CG1   . ILE I 1 75  ? -39.905 -65.242 -30.188  1.00 41.41  ?  75  ILE H CG1   1 
ATOM   6876  C CG2   . ILE I 1 75  ? -41.012 -63.305 -31.329  1.00 40.41  ?  75  ILE H CG2   1 
ATOM   6877  C CD1   . ILE I 1 75  ? -39.228 -64.390 -29.136  1.00 59.84  ?  75  ILE H CD1   1 
ATOM   6878  N N     . ILE I 1 76  ? -42.310 -64.602 -34.169  1.00 55.28  ?  76  ILE H N     1 
ATOM   6879  C CA    . ILE I 1 76  ? -42.743 -63.949 -35.400  1.00 49.06  ?  76  ILE H CA    1 
ATOM   6880  C C     . ILE I 1 76  ? -43.156 -62.496 -35.169  1.00 57.95  ?  76  ILE H C     1 
ATOM   6881  O O     . ILE I 1 76  ? -43.876 -62.184 -34.220  1.00 79.09  ?  76  ILE H O     1 
ATOM   6882  C CB    . ILE I 1 76  ? -43.912 -64.720 -36.052  1.00 31.87  ?  76  ILE H CB    1 
ATOM   6883  C CG1   . ILE I 1 76  ? -43.483 -66.154 -36.371  1.00 38.98  ?  76  ILE H CG1   1 
ATOM   6884  C CG2   . ILE I 1 76  ? -44.394 -64.011 -37.310  1.00 58.24  ?  76  ILE H CG2   1 
ATOM   6885  C CD1   . ILE I 1 76  ? -44.472 -66.922 -37.219  1.00 52.43  ?  76  ILE H CD1   1 
ATOM   6886  N N     . THR I 1 77  ? -42.686 -61.617 -36.048  1.00 52.05  ?  77  THR H N     1 
ATOM   6887  C CA    . THR I 1 77  ? -43.050 -60.207 -36.027  1.00 57.50  ?  77  THR H CA    1 
ATOM   6888  C C     . THR I 1 77  ? -43.445 -59.736 -37.420  1.00 65.80  ?  77  THR H C     1 
ATOM   6889  O O     . THR I 1 77  ? -42.994 -60.284 -38.424  1.00 66.53  ?  77  THR H O     1 
ATOM   6890  C CB    . THR I 1 77  ? -41.895 -59.331 -35.516  1.00 63.82  ?  77  THR H CB    1 
ATOM   6891  O OG1   . THR I 1 77  ? -40.704 -59.637 -36.251  1.00 71.96  ?  77  THR H OG1   1 
ATOM   6892  C CG2   . THR I 1 77  ? -41.651 -59.577 -34.036  1.00 74.53  ?  77  THR H CG2   1 
ATOM   6893  N N     . SER I 1 78  ? -44.294 -58.716 -37.469  1.00 81.60  ?  78  SER H N     1 
ATOM   6894  C CA    . SER I 1 78  ? -44.728 -58.132 -38.731  1.00 64.45  ?  78  SER H CA    1 
ATOM   6895  C C     . SER I 1 78  ? -44.822 -56.614 -38.620  1.00 74.18  ?  78  SER H C     1 
ATOM   6896  O O     . SER I 1 78  ? -45.627 -56.085 -37.853  1.00 91.74  ?  78  SER H O     1 
ATOM   6897  C CB    . SER I 1 78  ? -46.073 -58.717 -39.163  1.00 68.24  ?  78  SER H CB    1 
ATOM   6898  O OG    . SER I 1 78  ? -46.370 -58.372 -40.505  1.00 71.58  ?  78  SER H OG    1 
ATOM   6899  N N     . ASP I 1 79  ? -43.988 -55.921 -39.388  1.00 64.91  ?  79  ASP H N     1 
ATOM   6900  C CA    . ASP I 1 79  ? -44.022 -54.465 -39.445  1.00 62.31  ?  79  ASP H CA    1 
ATOM   6901  C C     . ASP I 1 79  ? -43.717 -53.994 -40.862  1.00 77.96  ?  79  ASP H C     1 
ATOM   6902  O O     . ASP I 1 79  ? -44.578 -54.071 -41.738  1.00 86.69  ?  79  ASP H O     1 
ATOM   6903  C CB    . ASP I 1 79  ? -43.026 -53.861 -38.454  1.00 57.87  ?  79  ASP H CB    1 
ATOM   6904  N N     . ILE I 1 80  ? -42.501 -53.510 -41.095  1.00 68.95  ?  80  ILE H N     1 
ATOM   6905  C CA    . ILE I 1 80  ? -42.115 -53.119 -42.446  1.00 69.05  ?  80  ILE H CA    1 
ATOM   6906  C C     . ILE I 1 80  ? -41.781 -54.378 -43.239  1.00 64.73  ?  80  ILE H C     1 
ATOM   6907  O O     . ILE I 1 80  ? -41.813 -54.390 -44.469  1.00 67.68  ?  80  ILE H O     1 
ATOM   6908  C CB    . ILE I 1 80  ? -40.906 -52.159 -42.442  1.00 71.89  ?  80  ILE H CB    1 
ATOM   6909  C CG1   . ILE I 1 80  ? -41.084 -51.079 -41.373  1.00 71.21  ?  80  ILE H CG1   1 
ATOM   6910  C CG2   . ILE I 1 80  ? -40.703 -51.532 -43.816  1.00 80.97  ?  80  ILE H CG2   1 
ATOM   6911  C CD1   . ILE I 1 80  ? -39.896 -50.152 -41.242  1.00 86.47  ?  80  ILE H CD1   1 
ATOM   6912  N N     . ASP I 1 81  ? -41.475 -55.445 -42.510  1.00 75.42  ?  81  ASP H N     1 
ATOM   6913  C CA    . ASP I 1 81  ? -41.338 -56.776 -43.085  1.00 70.34  ?  81  ASP H CA    1 
ATOM   6914  C C     . ASP I 1 81  ? -41.825 -57.842 -42.107  1.00 73.29  ?  81  ASP H C     1 
ATOM   6915  O O     . ASP I 1 81  ? -42.242 -57.529 -40.992  1.00 81.17  ?  81  ASP H O     1 
ATOM   6916  C CB    . ASP I 1 81  ? -39.886 -57.035 -43.513  1.00 68.48  ?  81  ASP H CB    1 
ATOM   6917  C CG    . ASP I 1 81  ? -38.902 -57.010 -42.348  1.00 86.62  ?  81  ASP H CG    1 
ATOM   6918  O OD1   . ASP I 1 81  ? -39.326 -56.950 -41.174  1.00 79.24  ?  81  ASP H OD1   1 
ATOM   6919  O OD2   . ASP I 1 81  ? -37.683 -57.053 -42.617  1.00 82.31  -1 81  ASP H OD2   1 
ATOM   6920  N N     . ALA I 1 82  ? -41.772 -59.100 -42.528  1.00 68.39  ?  82  ALA H N     1 
ATOM   6921  C CA    . ALA I 1 82  ? -42.148 -60.206 -41.659  1.00 55.69  ?  82  ALA H CA    1 
ATOM   6922  C C     . ALA I 1 82  ? -40.912 -60.997 -41.262  1.00 59.56  ?  82  ALA H C     1 
ATOM   6923  O O     . ALA I 1 82  ? -40.092 -61.325 -42.104  1.00 65.19  ?  82  ALA H O     1 
ATOM   6924  C CB    . ALA I 1 82  ? -43.152 -61.103 -42.346  1.00 59.55  ?  82  ALA H CB    1 
ATOM   6925  N N     . ARG I 1 83  ? -40.771 -61.304 -39.979  1.00 67.08  ?  83  ARG H N     1 
ATOM   6926  C CA    . ARG I 1 83  ? -39.564 -61.977 -39.512  1.00 57.10  ?  83  ARG H CA    1 
ATOM   6927  C C     . ARG I 1 83  ? -39.883 -63.102 -38.543  1.00 53.80  ?  83  ARG H C     1 
ATOM   6928  O O     . ARG I 1 83  ? -40.793 -62.988 -37.730  1.00 64.71  ?  83  ARG H O     1 
ATOM   6929  C CB    . ARG I 1 83  ? -38.611 -60.983 -38.839  1.00 50.72  ?  83  ARG H CB    1 
ATOM   6930  C CG    . ARG I 1 83  ? -38.043 -59.904 -39.748  1.00 61.63  ?  83  ARG H CG    1 
ATOM   6931  C CD    . ARG I 1 83  ? -37.215 -58.914 -38.941  1.00 58.43  ?  83  ARG H CD    1 
ATOM   6932  N NE    . ARG I 1 83  ? -36.503 -57.955 -39.781  1.00 52.83  ?  83  ARG H NE    1 
ATOM   6933  C CZ    . ARG I 1 83  ? -35.331 -57.415 -39.463  1.00 55.31  ?  83  ARG H CZ    1 
ATOM   6934  N NH1   . ARG I 1 83  ? -34.740 -57.738 -38.321  1.00 52.49  1  83  ARG H NH1   1 
ATOM   6935  N NH2   . ARG I 1 83  ? -34.751 -56.548 -40.282  1.00 59.56  ?  83  ARG H NH2   1 
ATOM   6936  N N     . ILE I 1 84  ? -39.130 -64.191 -38.636  1.00 41.65  ?  84  ILE H N     1 
ATOM   6937  C CA    . ILE I 1 84  ? -39.072 -65.150 -37.544  1.00 44.63  ?  84  ILE H CA    1 
ATOM   6938  C C     . ILE I 1 84  ? -37.652 -65.159 -36.974  1.00 52.77  ?  84  ILE H C     1 
ATOM   6939  O O     . ILE I 1 84  ? -36.666 -65.195 -37.720  1.00 54.98  ?  84  ILE H O     1 
ATOM   6940  C CB    . ILE I 1 84  ? -39.507 -66.567 -37.996  1.00 42.59  ?  84  ILE H CB    1 
ATOM   6941  C CG1   . ILE I 1 84  ? -39.583 -67.509 -36.794  1.00 34.55  ?  84  ILE H CG1   1 
ATOM   6942  C CG2   . ILE I 1 84  ? -38.573 -67.128 -39.061  1.00 54.69  ?  84  ILE H CG2   1 
ATOM   6943  C CD1   . ILE I 1 84  ? -39.964 -68.927 -37.151  1.00 40.87  ?  84  ILE H CD1   1 
ATOM   6944  N N     . ARG I 1 85  ? -37.553 -65.070 -35.649  1.00 56.62  ?  85  ARG H N     1 
ATOM   6945  C CA    . ARG I 1 85  ? -36.250 -64.962 -35.003  1.00 50.95  ?  85  ARG H CA    1 
ATOM   6946  C C     . ARG I 1 85  ? -36.029 -65.982 -33.893  1.00 42.21  ?  85  ARG H C     1 
ATOM   6947  O O     . ARG I 1 85  ? -36.965 -66.407 -33.213  1.00 44.00  ?  85  ARG H O     1 
ATOM   6948  C CB    . ARG I 1 85  ? -36.042 -63.557 -34.428  1.00 50.88  ?  85  ARG H CB    1 
ATOM   6949  C CG    . ARG I 1 85  ? -36.957 -63.203 -33.268  1.00 38.43  ?  85  ARG H CG    1 
ATOM   6950  C CD    . ARG I 1 85  ? -36.745 -61.763 -32.830  1.00 46.51  ?  85  ARG H CD    1 
ATOM   6951  N NE    . ARG I 1 85  ? -37.272 -61.511 -31.492  1.00 50.19  ?  85  ARG H NE    1 
ATOM   6952  C CZ    . ARG I 1 85  ? -38.449 -60.948 -31.245  1.00 51.16  ?  85  ARG H CZ    1 
ATOM   6953  N NH1   . ARG I 1 85  ? -39.231 -60.572 -32.248  1.00 68.61  1  85  ARG H NH1   1 
ATOM   6954  N NH2   . ARG I 1 85  ? -38.846 -60.760 -29.995  1.00 53.62  ?  85  ARG H NH2   1 
ATOM   6955  N N     . PHE I 1 86  ? -34.766 -66.360 -33.736  1.00 46.39  ?  86  PHE H N     1 
ATOM   6956  C CA    . PHE I 1 86  ? -34.312 -67.287 -32.712  1.00 55.29  ?  86  PHE H CA    1 
ATOM   6957  C C     . PHE I 1 86  ? -33.151 -66.605 -31.999  1.00 52.41  ?  86  PHE H C     1 
ATOM   6958  O O     . PHE I 1 86  ? -32.098 -66.365 -32.600  1.00 46.83  ?  86  PHE H O     1 
ATOM   6959  C CB    . PHE I 1 86  ? -33.886 -68.633 -33.305  1.00 56.42  ?  86  PHE H CB    1 
ATOM   6960  C CG    . PHE I 1 86  ? -34.969 -69.327 -34.086  1.00 48.62  ?  86  PHE H CG    1 
ATOM   6961  C CD1   . PHE I 1 86  ? -35.311 -68.902 -35.358  1.00 46.84  ?  86  PHE H CD1   1 
ATOM   6962  C CD2   . PHE I 1 86  ? -35.653 -70.401 -33.539  1.00 64.87  ?  86  PHE H CD2   1 
ATOM   6963  C CE1   . PHE I 1 86  ? -36.306 -69.538 -36.072  1.00 58.42  ?  86  PHE H CE1   1 
ATOM   6964  C CE2   . PHE I 1 86  ? -36.649 -71.042 -34.250  1.00 58.88  ?  86  PHE H CE2   1 
ATOM   6965  C CZ    . PHE I 1 86  ? -36.977 -70.609 -35.518  1.00 64.65  ?  86  PHE H CZ    1 
ATOM   6966  N N     . GLU I 1 87  ? -33.349 -66.284 -30.725  1.00 53.73  ?  87  GLU H N     1 
ATOM   6967  C CA    . GLU I 1 87  ? -32.380 -65.490 -29.979  1.00 44.85  ?  87  GLU H CA    1 
ATOM   6968  C C     . GLU I 1 87  ? -32.071 -66.100 -28.612  1.00 52.07  ?  87  GLU H C     1 
ATOM   6969  O O     . GLU I 1 87  ? -30.985 -65.896 -28.070  1.00 58.50  ?  87  GLU H O     1 
ATOM   6970  C CB    . GLU I 1 87  ? -32.891 -64.053 -29.833  1.00 43.42  ?  87  GLU H CB    1 
ATOM   6971  C CG    . GLU I 1 87  ? -32.973 -63.302 -31.165  1.00 46.34  ?  87  GLU H CG    1 
ATOM   6972  C CD    . GLU I 1 87  ? -33.279 -61.825 -31.006  1.00 46.94  ?  87  GLU H CD    1 
ATOM   6973  O OE1   . GLU I 1 87  ? -33.808 -61.437 -29.945  1.00 42.05  ?  87  GLU H OE1   1 
ATOM   6974  O OE2   . GLU I 1 87  ? -32.996 -61.052 -31.948  1.00 57.75  -1 87  GLU H OE2   1 
ATOM   6975  N N     . SER I 1 88  ? -33.020 -66.848 -28.056  1.00 58.43  ?  88  SER H N     1 
ATOM   6976  C CA    . SER I 1 88  ? -32.796 -67.509 -26.773  1.00 55.34  ?  88  SER H CA    1 
ATOM   6977  C C     . SER I 1 88  ? -31.957 -68.764 -26.989  1.00 56.66  ?  88  SER H C     1 
ATOM   6978  O O     . SER I 1 88  ? -31.960 -69.335 -28.080  1.00 55.67  ?  88  SER H O     1 
ATOM   6979  C CB    . SER I 1 88  ? -34.123 -67.864 -26.102  1.00 57.61  ?  88  SER H CB    1 
ATOM   6980  O OG    . SER I 1 88  ? -34.742 -68.963 -26.749  1.00 60.56  ?  88  SER H OG    1 
ATOM   6981  N N     . LEU I 1 89  ? -31.229 -69.184 -25.960  1.00 61.74  ?  89  LEU H N     1 
ATOM   6982  C CA    . LEU I 1 89  ? -30.363 -70.352 -26.088  1.00 57.88  ?  89  LEU H CA    1 
ATOM   6983  C C     . LEU I 1 89  ? -31.115 -71.637 -26.438  1.00 57.98  ?  89  LEU H C     1 
ATOM   6984  O O     . LEU I 1 89  ? -30.628 -72.448 -27.219  1.00 57.27  ?  89  LEU H O     1 
ATOM   6985  C CB    . LEU I 1 89  ? -29.579 -70.560 -24.789  1.00 57.75  ?  89  LEU H CB    1 
ATOM   6986  C CG    . LEU I 1 89  ? -28.495 -69.527 -24.471  1.00 66.09  ?  89  LEU H CG    1 
ATOM   6987  C CD1   . LEU I 1 89  ? -27.873 -69.797 -23.110  1.00 75.95  ?  89  LEU H CD1   1 
ATOM   6988  C CD2   . LEU I 1 89  ? -27.430 -69.508 -25.554  1.00 67.90  ?  89  LEU H CD2   1 
ATOM   6989  N N     . LYS I 1 90  ? -32.293 -71.822 -25.849  1.00 67.22  ?  90  LYS H N     1 
ATOM   6990  C CA    . LYS I 1 90  ? -33.134 -72.983 -26.148  1.00 67.57  ?  90  LYS H CA    1 
ATOM   6991  C C     . LYS I 1 90  ? -33.595 -73.060 -27.607  1.00 65.32  ?  90  LYS H C     1 
ATOM   6992  O O     . LYS I 1 90  ? -33.541 -74.122 -28.248  1.00 74.65  ?  90  LYS H O     1 
ATOM   6993  C CB    . LYS I 1 90  ? -34.357 -72.988 -25.226  1.00 63.34  ?  90  LYS H CB    1 
ATOM   6994  N N     . GLU I 1 91  ? -34.001 -71.911 -28.138  1.00 55.09  ?  91  GLU H N     1 
ATOM   6995  C CA    . GLU I 1 91  ? -34.471 -71.826 -29.514  1.00 62.75  ?  91  GLU H CA    1 
ATOM   6996  C C     . GLU I 1 91  ? -33.333 -72.047 -30.491  1.00 60.35  ?  91  GLU H C     1 
ATOM   6997  O O     . GLU I 1 91  ? -33.481 -72.757 -31.494  1.00 61.72  ?  91  GLU H O     1 
ATOM   6998  C CB    . GLU I 1 91  ? -35.133 -70.469 -29.766  1.00 63.32  ?  91  GLU H CB    1 
ATOM   6999  N N     . LEU I 1 92  ? -32.189 -71.442 -30.198  1.00 57.97  ?  92  LEU H N     1 
ATOM   7000  C CA    . LEU I 1 92  ? -31.057 -71.592 -31.085  1.00 49.26  ?  92  LEU H CA    1 
ATOM   7001  C C     . LEU I 1 92  ? -30.604 -73.040 -31.003  1.00 59.06  ?  92  LEU H C     1 
ATOM   7002  O O     . LEU I 1 92  ? -30.107 -73.587 -31.975  1.00 64.74  ?  92  LEU H O     1 
ATOM   7003  C CB    . LEU I 1 92  ? -29.934 -70.627 -30.706  1.00 37.89  ?  92  LEU H CB    1 
ATOM   7004  C CG    . LEU I 1 92  ? -30.217 -69.170 -31.079  1.00 48.33  ?  92  LEU H CG    1 
ATOM   7005  C CD1   . LEU I 1 92  ? -29.201 -68.240 -30.445  1.00 47.45  ?  92  LEU H CD1   1 
ATOM   7006  C CD2   . LEU I 1 92  ? -30.231 -69.004 -32.590  1.00 58.30  ?  92  LEU H CD2   1 
ATOM   7007  N N     . GLU I 1 93  ? -30.786 -73.657 -29.837  1.00 70.15  ?  93  GLU H N     1 
ATOM   7008  C CA    . GLU I 1 93  ? -30.476 -75.072 -29.667  1.00 66.46  ?  93  GLU H CA    1 
ATOM   7009  C C     . GLU I 1 93  ? -31.335 -75.903 -30.615  1.00 68.33  ?  93  GLU H C     1 
ATOM   7010  O O     . GLU I 1 93  ? -30.856 -76.853 -31.240  1.00 79.04  ?  93  GLU H O     1 
ATOM   7011  C CB    . GLU I 1 93  ? -30.697 -75.510 -28.216  1.00 72.83  ?  93  GLU H CB    1 
ATOM   7012  N N     . VAL I 1 94  ? -32.610 -75.528 -30.714  1.00 55.55  ?  94  VAL H N     1 
ATOM   7013  C CA    . VAL I 1 94  ? -33.534 -76.177 -31.646  1.00 58.20  ?  94  VAL H CA    1 
ATOM   7014  C C     . VAL I 1 94  ? -33.069 -76.018 -33.094  1.00 63.60  ?  94  VAL H C     1 
ATOM   7015  O O     . VAL I 1 94  ? -33.095 -76.970 -33.889  1.00 68.80  ?  94  VAL H O     1 
ATOM   7016  C CB    . VAL I 1 94  ? -34.965 -75.617 -31.505  1.00 63.93  ?  94  VAL H CB    1 
ATOM   7017  C CG1   . VAL I 1 94  ? -35.881 -76.218 -32.559  1.00 68.96  ?  94  VAL H CG1   1 
ATOM   7018  C CG2   . VAL I 1 94  ? -35.507 -75.891 -30.112  1.00 57.81  ?  94  VAL H CG2   1 
ATOM   7019  N N     . VAL I 1 95  ? -32.607 -74.812 -33.413  1.00 62.93  ?  95  VAL H N     1 
ATOM   7020  C CA    . VAL I 1 95  ? -32.088 -74.502 -34.743  1.00 53.83  ?  95  VAL H CA    1 
ATOM   7021  C C     . VAL I 1 95  ? -30.865 -75.349 -35.086  1.00 57.91  ?  95  VAL H C     1 
ATOM   7022  O O     . VAL I 1 95  ? -30.795 -75.946 -36.165  1.00 66.54  ?  95  VAL H O     1 
ATOM   7023  C CB    . VAL I 1 95  ? -31.720 -73.012 -34.865  1.00 45.55  ?  95  VAL H CB    1 
ATOM   7024  C CG1   . VAL I 1 95  ? -30.987 -72.750 -36.165  1.00 50.21  ?  95  VAL H CG1   1 
ATOM   7025  C CG2   . VAL I 1 95  ? -32.966 -72.158 -34.783  1.00 46.14  ?  95  VAL H CG2   1 
ATOM   7026  N N     . ILE I 1 96  ? -29.913 -75.408 -34.161  1.00 64.35  ?  96  ILE H N     1 
ATOM   7027  C CA    . ILE I 1 96  ? -28.695 -76.178 -34.367  1.00 69.92  ?  96  ILE H CA    1 
ATOM   7028  C C     . ILE I 1 96  ? -29.046 -77.652 -34.517  1.00 67.34  ?  96  ILE H C     1 
ATOM   7029  O O     . ILE I 1 96  ? -28.474 -78.333 -35.357  1.00 66.28  ?  96  ILE H O     1 
ATOM   7030  C CB    . ILE I 1 96  ? -27.678 -75.982 -33.213  1.00 55.23  ?  96  ILE H CB    1 
ATOM   7031  C CG1   . ILE I 1 96  ? -26.934 -74.655 -33.377  1.00 56.40  ?  96  ILE H CG1   1 
ATOM   7032  C CG2   . ILE I 1 96  ? -26.645 -77.094 -33.202  1.00 72.10  ?  96  ILE H CG2   1 
ATOM   7033  C CD1   . ILE I 1 96  ? -27.052 -73.723 -32.199  1.00 51.73  ?  96  ILE H CD1   1 
ATOM   7034  N N     . ASN I 1 97  ? -29.974 -78.150 -33.705  1.00 69.34  ?  97  ASN H N     1 
ATOM   7035  C CA    . ASN I 1 97  ? -30.373 -79.549 -33.821  1.00 73.73  ?  97  ASN H CA    1 
ATOM   7036  C C     . ASN I 1 97  ? -30.954 -79.826 -35.210  1.00 77.42  ?  97  ASN H C     1 
ATOM   7037  O O     . ASN I 1 97  ? -30.644 -80.849 -35.848  1.00 87.42  ?  97  ASN H O     1 
ATOM   7038  C CB    . ASN I 1 97  ? -31.388 -79.917 -32.738  1.00 81.10  ?  97  ASN H CB    1 
ATOM   7039  N N     . HIS I 1 98  ? -31.748 -78.875 -35.702  1.00 80.07  ?  98  HIS H N     1 
ATOM   7040  C CA    . HIS I 1 98  ? -32.339 -79.006 -37.031  1.00 80.22  ?  98  HIS H CA    1 
ATOM   7041  C C     . HIS I 1 98  ? -31.283 -79.036 -38.130  1.00 72.73  ?  98  HIS H C     1 
ATOM   7042  O O     . HIS I 1 98  ? -31.292 -79.935 -38.970  1.00 69.20  ?  98  HIS H O     1 
ATOM   7043  C CB    . HIS I 1 98  ? -33.328 -77.870 -37.302  1.00 63.96  ?  98  HIS H CB    1 
ATOM   7044  C CG    . HIS I 1 98  ? -33.874 -77.871 -38.696  1.00 75.06  ?  98  HIS H CG    1 
ATOM   7045  N ND1   . HIS I 1 98  ? -34.852 -78.749 -39.112  1.00 79.37  ?  98  HIS H ND1   1 
ATOM   7046  C CD2   . HIS I 1 98  ? -33.570 -77.110 -39.773  1.00 79.10  ?  98  HIS H CD2   1 
ATOM   7047  C CE1   . HIS I 1 98  ? -35.131 -78.524 -40.384  1.00 80.79  ?  98  HIS H CE1   1 
ATOM   7048  N NE2   . HIS I 1 98  ? -34.367 -77.534 -40.809  1.00 74.16  ?  98  HIS H NE2   1 
ATOM   7049  N N     . PHE I 1 99  ? -30.377 -78.062 -38.140  1.00 68.23  ?  99  PHE H N     1 
ATOM   7050  C CA    . PHE I 1 99  ? -29.422 -77.987 -39.242  1.00 58.74  ?  99  PHE H CA    1 
ATOM   7051  C C     . PHE I 1 99  ? -28.354 -79.067 -39.111  1.00 73.29  ?  99  PHE H C     1 
ATOM   7052  O O     . PHE I 1 99  ? -27.697 -79.417 -40.089  1.00 66.57  ?  99  PHE H O     1 
ATOM   7053  C CB    . PHE I 1 99  ? -28.767 -76.607 -39.320  1.00 63.37  ?  99  PHE H CB    1 
ATOM   7054  C CG    . PHE I 1 99  ? -29.662 -75.542 -39.886  1.00 75.72  ?  99  PHE H CG    1 
ATOM   7055  C CD1   . PHE I 1 99  ? -30.166 -75.657 -41.171  1.00 73.21  ?  99  PHE H CD1   1 
ATOM   7056  C CD2   . PHE I 1 99  ? -29.983 -74.418 -39.145  1.00 74.24  ?  99  PHE H CD2   1 
ATOM   7057  C CE1   . PHE I 1 99  ? -30.988 -74.681 -41.700  1.00 63.76  ?  99  PHE H CE1   1 
ATOM   7058  C CE2   . PHE I 1 99  ? -30.803 -73.434 -39.672  1.00 66.09  ?  99  PHE H CE2   1 
ATOM   7059  C CZ    . PHE I 1 99  ? -31.305 -73.567 -40.950  1.00 61.45  ?  99  PHE H CZ    1 
ATOM   7060  N N     . ASP I 1 100 ? -28.167 -79.583 -37.900  1.00 80.67  ?  100 ASP H N     1 
ATOM   7061  C CA    . ASP I 1 100 ? -27.316 -80.748 -37.719  1.00 81.17  ?  100 ASP H CA    1 
ATOM   7062  C C     . ASP I 1 100 ? -27.992 -81.949 -38.358  1.00 70.43  ?  100 ASP H C     1 
ATOM   7063  O O     . ASP I 1 100 ? -27.326 -82.828 -38.903  1.00 51.90  ?  100 ASP H O     1 
ATOM   7064  C CB    . ASP I 1 100 ? -27.029 -81.004 -36.239  1.00 89.27  ?  100 ASP H CB    1 
ATOM   7065  C CG    . ASP I 1 100 ? -25.953 -80.085 -35.686  1.00 85.50  ?  100 ASP H CG    1 
ATOM   7066  O OD1   . ASP I 1 100 ? -25.323 -79.356 -36.480  1.00 71.78  ?  100 ASP H OD1   1 
ATOM   7067  O OD2   . ASP I 1 100 ? -25.737 -80.093 -34.456  1.00 73.63  -1 100 ASP H OD2   1 
ATOM   7068  N N     . LYS I 1 101 ? -29.322 -81.984 -38.296  1.00 71.50  ?  101 LYS H N     1 
ATOM   7069  C CA    . LYS I 1 101 ? -30.033 -83.127 -38.858  1.00 78.88  ?  101 LYS H CA    1 
ATOM   7070  C C     . LYS I 1 101 ? -30.301 -82.916 -40.352  1.00 87.66  ?  101 LYS H C     1 
ATOM   7071  O O     . LYS I 1 101 ? -30.228 -83.850 -41.149  1.00 93.70  ?  101 LYS H O     1 
ATOM   7072  C CB    . LYS I 1 101 ? -31.346 -83.366 -38.110  1.00 67.49  ?  101 LYS H CB    1 
ATOM   7073  N N     . TYR I 1 102 ? -30.613 -81.674 -40.712  1.00 83.34  ?  102 TYR H N     1 
ATOM   7074  C CA    . TYR I 1 102 ? -30.945 -81.299 -42.086  1.00 62.23  ?  102 TYR H CA    1 
ATOM   7075  C C     . TYR I 1 102 ? -30.067 -80.152 -42.598  1.00 64.20  ?  102 TYR H C     1 
ATOM   7076  O O     . TYR I 1 102 ? -30.518 -79.010 -42.661  1.00 67.82  ?  102 TYR H O     1 
ATOM   7077  C CB    . TYR I 1 102 ? -32.427 -80.942 -42.186  1.00 63.56  ?  102 TYR H CB    1 
ATOM   7078  C CG    . TYR I 1 102 ? -33.324 -82.067 -41.717  1.00 85.81  ?  102 TYR H CG    1 
ATOM   7079  C CD1   . TYR I 1 102 ? -33.717 -83.078 -42.585  1.00 92.38  ?  102 TYR H CD1   1 
ATOM   7080  C CD2   . TYR I 1 102 ? -33.772 -82.123 -40.404  1.00 91.51  ?  102 TYR H CD2   1 
ATOM   7081  C CE1   . TYR I 1 102 ? -34.533 -84.112 -42.158  1.00 92.25  ?  102 TYR H CE1   1 
ATOM   7082  C CE2   . TYR I 1 102 ? -34.588 -83.151 -39.967  1.00 101.08 ?  102 TYR H CE2   1 
ATOM   7083  C CZ    . TYR I 1 102 ? -34.967 -84.141 -40.848  1.00 107.50 ?  102 TYR H CZ    1 
ATOM   7084  O OH    . TYR I 1 102 ? -35.776 -85.166 -40.412  1.00 126.57 ?  102 TYR H OH    1 
ATOM   7085  N N     . PRO I 1 103 ? -28.809 -80.449 -42.957  1.00 63.22  ?  103 PRO H N     1 
ATOM   7086  C CA    . PRO I 1 103 ? -27.778 -79.424 -43.179  1.00 60.72  ?  103 PRO H CA    1 
ATOM   7087  C C     . PRO I 1 103 ? -27.969 -78.530 -44.407  1.00 61.75  ?  103 PRO H C     1 
ATOM   7088  O O     . PRO I 1 103 ? -28.422 -78.974 -45.462  1.00 75.89  ?  103 PRO H O     1 
ATOM   7089  C CB    . PRO I 1 103 ? -26.491 -80.251 -43.336  1.00 56.67  ?  103 PRO H CB    1 
ATOM   7090  C CG    . PRO I 1 103 ? -26.814 -81.608 -42.798  1.00 61.88  ?  103 PRO H CG    1 
ATOM   7091  C CD    . PRO I 1 103 ? -28.263 -81.811 -43.067  1.00 71.01  ?  103 PRO H CD    1 
ATOM   7092  N N     . LEU I 1 104 ? -27.602 -77.261 -44.232  1.00 65.54  ?  104 LEU H N     1 
ATOM   7093  C CA    . LEU I 1 104 ? -27.496 -76.278 -45.310  1.00 55.71  ?  104 LEU H CA    1 
ATOM   7094  C C     . LEU I 1 104 ? -26.492 -76.723 -46.357  1.00 54.48  ?  104 LEU H C     1 
ATOM   7095  O O     . LEU I 1 104 ? -25.562 -77.469 -46.052  1.00 43.90  ?  104 LEU H O     1 
ATOM   7096  C CB    . LEU I 1 104 ? -27.086 -74.907 -44.765  1.00 61.35  ?  104 LEU H CB    1 
ATOM   7097  C CG    . LEU I 1 104 ? -27.947 -74.245 -43.692  1.00 64.02  ?  104 LEU H CG    1 
ATOM   7098  C CD1   . LEU I 1 104 ? -27.098 -73.326 -42.833  1.00 63.61  ?  104 LEU H CD1   1 
ATOM   7099  C CD2   . LEU I 1 104 ? -29.071 -73.467 -44.350  1.00 65.14  ?  104 LEU H CD2   1 
ATOM   7100  N N     . ILE I 1 105 ? -26.678 -76.271 -47.595  1.00 76.25  ?  105 ILE H N     1 
ATOM   7101  C CA    . ILE I 1 105 ? -25.766 -76.664 -48.657  1.00 69.44  ?  105 ILE H CA    1 
ATOM   7102  C C     . ILE I 1 105 ? -25.210 -75.467 -49.440  1.00 62.10  ?  105 ILE H C     1 
ATOM   7103  O O     . ILE I 1 105 ? -24.336 -75.633 -50.293  1.00 70.28  ?  105 ILE H O     1 
ATOM   7104  C CB    . ILE I 1 105 ? -26.501 -77.615 -49.656  1.00 57.17  ?  105 ILE H CB    1 
ATOM   7105  C CG1   . ILE I 1 105 ? -27.417 -78.598 -48.919  1.00 76.32  ?  105 ILE H CG1   1 
ATOM   7106  C CG2   . ILE I 1 105 ? -25.534 -78.377 -50.526  1.00 62.41  ?  105 ILE H CG2   1 
ATOM   7107  C CD1   . ILE I 1 105 ? -26.678 -79.687 -48.166  1.00 77.67  ?  105 ILE H CD1   1 
ATOM   7108  N N     . THR I 1 106 ? -25.681 -74.257 -49.143  1.00 52.97  ?  106 THR H N     1 
ATOM   7109  C CA    . THR I 1 106 ? -25.011 -73.060 -49.654  1.00 57.52  ?  106 THR H CA    1 
ATOM   7110  C C     . THR I 1 106 ? -23.831 -72.669 -48.765  1.00 60.54  ?  106 THR H C     1 
ATOM   7111  O O     . THR I 1 106 ? -23.553 -73.336 -47.768  1.00 63.49  ?  106 THR H O     1 
ATOM   7112  C CB    . THR I 1 106 ? -25.976 -71.873 -49.775  1.00 52.38  ?  106 THR H CB    1 
ATOM   7113  O OG1   . THR I 1 106 ? -26.402 -71.467 -48.469  1.00 60.25  ?  106 THR H OG1   1 
ATOM   7114  C CG2   . THR I 1 106 ? -27.193 -72.263 -50.596  1.00 62.04  ?  106 THR H CG2   1 
ATOM   7115  N N     . GLN I 1 107 ? -23.145 -71.585 -49.127  1.00 57.22  ?  107 GLN H N     1 
ATOM   7116  C CA    . GLN I 1 107 ? -22.028 -71.067 -48.332  1.00 60.24  ?  107 GLN H CA    1 
ATOM   7117  C C     . GLN I 1 107 ? -22.392 -70.622 -46.914  1.00 65.40  ?  107 GLN H C     1 
ATOM   7118  O O     . GLN I 1 107 ? -21.516 -70.504 -46.053  1.00 68.35  ?  107 GLN H O     1 
ATOM   7119  C CB    . GLN I 1 107 ? -21.366 -69.892 -49.053  1.00 59.47  ?  107 GLN H CB    1 
ATOM   7120  C CG    . GLN I 1 107 ? -20.712 -70.249 -50.372  1.00 83.20  ?  107 GLN H CG    1 
ATOM   7121  C CD    . GLN I 1 107 ? -19.229 -69.930 -50.381  1.00 87.16  ?  107 GLN H CD    1 
ATOM   7122  O OE1   . GLN I 1 107 ? -18.821 -68.808 -50.079  1.00 82.68  ?  107 GLN H OE1   1 
ATOM   7123  N NE2   . GLN I 1 107 ? -18.413 -70.919 -50.725  1.00 84.79  ?  107 GLN H NE2   1 
ATOM   7124  N N     . LYS I 1 108 ? -23.680 -70.406 -46.663  1.00 60.32  ?  108 LYS H N     1 
ATOM   7125  C CA    . LYS I 1 108 ? -24.140 -70.045 -45.324  1.00 68.76  ?  108 LYS H CA    1 
ATOM   7126  C C     . LYS I 1 108 ? -23.883 -71.118 -44.278  1.00 70.21  ?  108 LYS H C     1 
ATOM   7127  O O     . LYS I 1 108 ? -23.794 -70.814 -43.084  1.00 76.21  ?  108 LYS H O     1 
ATOM   7128  C CB    . LYS I 1 108 ? -25.636 -69.718 -45.356  1.00 51.91  ?  108 LYS H CB    1 
ATOM   7129  N N     . ARG I 1 109 ? -23.683 -72.352 -44.731  1.00 62.89  ?  109 ARG H N     1 
ATOM   7130  C CA    . ARG I 1 109 ? -23.253 -73.422 -43.842  1.00 72.14  ?  109 ARG H CA    1 
ATOM   7131  C C     . ARG I 1 109 ? -21.966 -73.052 -43.125  1.00 69.40  ?  109 ARG H C     1 
ATOM   7132  O O     . ARG I 1 109 ? -21.829 -73.286 -41.921  1.00 68.24  ?  109 ARG H O     1 
ATOM   7133  C CB    . ARG I 1 109 ? -23.065 -74.724 -44.623  1.00 62.04  ?  109 ARG H CB    1 
ATOM   7134  N N     . ALA I 1 110 ? -21.075 -72.359 -43.825  1.00 49.98  ?  110 ALA H N     1 
ATOM   7135  C CA    . ALA I 1 110 ? -19.816 -71.992 -43.208  1.00 55.04  ?  110 ALA H CA    1 
ATOM   7136  C C     . ALA I 1 110 ? -20.082 -70.930 -42.161  1.00 75.60  ?  110 ALA H C     1 
ATOM   7137  O O     . ALA I 1 110 ? -19.552 -71.006 -41.045  1.00 78.15  ?  110 ALA H O     1 
ATOM   7138  C CB    . ALA I 1 110 ? -18.832 -71.487 -44.251  1.00 62.47  ?  110 ALA H CB    1 
ATOM   7139  N N     . ASP I 1 111 ? -21.002 -70.022 -42.472  1.00 63.96  ?  111 ASP H N     1 
ATOM   7140  C CA    . ASP I 1 111 ? -21.384 -69.013 -41.504  1.00 55.13  ?  111 ASP H CA    1 
ATOM   7141  C C     . ASP I 1 111 ? -22.000 -69.725 -40.315  1.00 58.45  ?  111 ASP H C     1 
ATOM   7142  O O     . ASP I 1 111 ? -21.642 -69.457 -39.157  1.00 53.72  ?  111 ASP H O     1 
ATOM   7143  C CB    . ASP I 1 111 ? -22.378 -68.018 -42.113  1.00 53.96  ?  111 ASP H CB    1 
ATOM   7144  C CG    . ASP I 1 111 ? -21.753 -67.140 -43.183  1.00 59.51  ?  111 ASP H CG    1 
ATOM   7145  O OD1   . ASP I 1 111 ? -20.697 -66.530 -42.913  1.00 70.94  ?  111 ASP H OD1   1 
ATOM   7146  O OD2   . ASP I 1 111 ? -22.321 -67.057 -44.292  1.00 62.61  -1 111 ASP H OD2   1 
ATOM   7147  N N     . TYR I 1 112 ? -22.784 -70.753 -40.623  1.00 58.82  ?  112 TYR H N     1 
ATOM   7148  C CA    . TYR I 1 112 ? -23.449 -71.526 -39.594  1.00 52.47  ?  112 TYR H CA    1 
ATOM   7149  C C     . TYR I 1 112 ? -22.418 -72.142 -38.683  1.00 55.30  ?  112 TYR H C     1 
ATOM   7150  O O     . TYR I 1 112 ? -22.531 -72.049 -37.456  1.00 56.95  ?  112 TYR H O     1 
ATOM   7151  C CB    . TYR I 1 112 ? -24.326 -72.607 -40.231  1.00 47.07  ?  112 TYR H CB    1 
ATOM   7152  C CG    . TYR I 1 112 ? -24.879 -73.630 -39.269  1.00 40.59  ?  112 TYR H CG    1 
ATOM   7153  C CD1   . TYR I 1 112 ? -25.931 -73.323 -38.421  1.00 53.33  ?  112 TYR H CD1   1 
ATOM   7154  C CD2   . TYR I 1 112 ? -24.354 -74.915 -39.222  1.00 48.76  ?  112 TYR H CD2   1 
ATOM   7155  C CE1   . TYR I 1 112 ? -26.437 -74.261 -37.541  1.00 60.84  ?  112 TYR H CE1   1 
ATOM   7156  C CE2   . TYR I 1 112 ? -24.855 -75.860 -38.352  1.00 46.43  ?  112 TYR H CE2   1 
ATOM   7157  C CZ    . TYR I 1 112 ? -25.894 -75.528 -37.512  1.00 62.43  ?  112 TYR H CZ    1 
ATOM   7158  O OH    . TYR I 1 112 ? -26.401 -76.470 -36.647  1.00 60.40  ?  112 TYR H OH    1 
ATOM   7159  N N     . LEU I 1 113 ? -21.337 -72.636 -39.272  1.00 62.04  ?  113 LEU H N     1 
ATOM   7160  C CA    . LEU I 1 113 ? -20.367 -73.346 -38.470  1.00 65.01  ?  113 LEU H CA    1 
ATOM   7161  C C     . LEU I 1 113 ? -19.663 -72.377 -37.545  1.00 63.07  ?  113 LEU H C     1 
ATOM   7162  O O     . LEU I 1 113 ? -19.532 -72.653 -36.345  1.00 55.27  ?  113 LEU H O     1 
ATOM   7163  C CB    . LEU I 1 113 ? -19.353 -74.065 -39.359  1.00 56.62  ?  113 LEU H CB    1 
ATOM   7164  C CG    . LEU I 1 113 ? -19.862 -75.325 -40.058  1.00 54.88  ?  113 LEU H CG    1 
ATOM   7165  C CD1   . LEU I 1 113 ? -18.785 -75.906 -40.956  1.00 56.07  ?  113 LEU H CD1   1 
ATOM   7166  C CD2   . LEU I 1 113 ? -20.333 -76.352 -39.043  1.00 53.54  ?  113 LEU H CD2   1 
ATOM   7167  N N     . LEU I 1 114 ? -19.388 -71.177 -38.047  1.00 49.31  ?  114 LEU H N     1 
ATOM   7168  C CA    . LEU I 1 114 ? -18.801 -70.164 -37.190  1.00 46.58  ?  114 LEU H CA    1 
ATOM   7169  C C     . LEU I 1 114 ? -19.769 -69.845 -36.077  1.00 61.13  ?  114 LEU H C     1 
ATOM   7170  O O     . LEU I 1 114 ? -19.423 -69.930 -34.886  1.00 61.62  ?  114 LEU H O     1 
ATOM   7171  C CB    . LEU I 1 114 ? -18.462 -68.903 -37.987  1.00 45.47  ?  114 LEU H CB    1 
ATOM   7172  C CG    . LEU I 1 114 ? -17.368 -69.032 -39.047  1.00 55.53  ?  114 LEU H CG    1 
ATOM   7173  C CD1   . LEU I 1 114 ? -17.405 -67.845 -39.993  1.00 55.22  ?  114 LEU H CD1   1 
ATOM   7174  C CD2   . LEU I 1 114 ? -16.002 -69.157 -38.400  1.00 68.02  ?  114 LEU H CD2   1 
ATOM   7175  N N     . PHE I 1 115 ? -21.018 -69.635 -36.467  1.00 55.06  ?  115 PHE H N     1 
ATOM   7176  C CA    . PHE I 1 115 ? -22.062 -69.351 -35.512  1.00 39.27  ?  115 PHE H CA    1 
ATOM   7177  C C     . PHE I 1 115 ? -22.146 -70.442 -34.469  1.00 49.63  ?  115 PHE H C     1 
ATOM   7178  O O     . PHE I 1 115 ? -22.163 -70.147 -33.266  1.00 62.62  ?  115 PHE H O     1 
ATOM   7179  C CB    . PHE I 1 115 ? -23.395 -69.204 -36.247  1.00 41.84  ?  115 PHE H CB    1 
ATOM   7180  C CG    . PHE I 1 115 ? -24.575 -69.002 -35.347  1.00 44.16  ?  115 PHE H CG    1 
ATOM   7181  C CD1   . PHE I 1 115 ? -24.902 -67.742 -34.877  1.00 45.76  ?  115 PHE H CD1   1 
ATOM   7182  C CD2   . PHE I 1 115 ? -25.373 -70.076 -34.989  1.00 42.85  ?  115 PHE H CD2   1 
ATOM   7183  C CE1   . PHE I 1 115 ? -25.997 -67.559 -34.060  1.00 41.47  ?  115 PHE H CE1   1 
ATOM   7184  C CE2   . PHE I 1 115 ? -26.467 -69.899 -34.170  1.00 49.89  ?  115 PHE H CE2   1 
ATOM   7185  C CZ    . PHE I 1 115 ? -26.779 -68.640 -33.704  1.00 53.67  ?  115 PHE H CZ    1 
ATOM   7186  N N     . LYS I 1 116 ? -22.029 -71.694 -34.897  1.00 48.12  ?  116 LYS H N     1 
ATOM   7187  C CA    . LYS I 1 116 ? -22.221 -72.755 -33.929  1.00 52.35  ?  116 LYS H CA    1 
ATOM   7188  C C     . LYS I 1 116 ? -21.108 -72.762 -32.905  1.00 57.35  ?  116 LYS H C     1 
ATOM   7189  O O     . LYS I 1 116 ? -21.383 -72.840 -31.701  1.00 51.09  ?  116 LYS H O     1 
ATOM   7190  C CB    . LYS I 1 116 ? -22.301 -74.114 -34.630  1.00 41.99  ?  116 LYS H CB    1 
ATOM   7191  N N     . LYS I 1 117 ? -19.884 -72.494 -33.348  1.00 61.55  ?  117 LYS H N     1 
ATOM   7192  C CA    . LYS I 1 117 ? -18.791 -72.456 -32.394  1.00 56.05  ?  117 LYS H CA    1 
ATOM   7193  C C     . LYS I 1 117 ? -19.006 -71.350 -31.385  1.00 57.61  ?  117 LYS H C     1 
ATOM   7194  O O     . LYS I 1 117 ? -18.912 -71.581 -30.171  1.00 61.46  ?  117 LYS H O     1 
ATOM   7195  C CB    . LYS I 1 117 ? -17.454 -72.264 -33.112  1.00 55.71  ?  117 LYS H CB    1 
ATOM   7196  N N     . ALA I 1 118 ? -19.469 -70.204 -31.872  1.00 59.59  ?  118 ALA H N     1 
ATOM   7197  C CA    . ALA I 1 118 ? -19.686 -69.089 -30.974  1.00 52.67  ?  118 ALA H CA    1 
ATOM   7198  C C     . ALA I 1 118 ? -20.769 -69.444 -29.987  1.00 56.37  ?  118 ALA H C     1 
ATOM   7199  O O     . ALA I 1 118 ? -20.604 -69.247 -28.777  1.00 53.48  ?  118 ALA H O     1 
ATOM   7200  C CB    . ALA I 1 118 ? -20.054 -67.838 -31.751  1.00 51.70  ?  118 ALA H CB    1 
ATOM   7201  N N     . PHE I 1 119 ? -21.817 -70.084 -30.492  1.00 47.56  ?  119 PHE H N     1 
ATOM   7202  C CA    . PHE I 1 119 ? -22.921 -70.464 -29.637  1.00 53.94  ?  119 PHE H CA    1 
ATOM   7203  C C     . PHE I 1 119 ? -22.447 -71.344 -28.499  1.00 56.65  ?  119 PHE H C     1 
ATOM   7204  O O     . PHE I 1 119 ? -22.792 -71.109 -27.337  1.00 63.11  ?  119 PHE H O     1 
ATOM   7205  C CB    . PHE I 1 119 ? -23.992 -71.188 -30.454  1.00 46.14  ?  119 PHE H CB    1 
ATOM   7206  C CG    . PHE I 1 119 ? -25.047 -71.858 -29.622  1.00 38.44  ?  119 PHE H CG    1 
ATOM   7207  C CD1   . PHE I 1 119 ? -26.093 -71.128 -29.084  1.00 33.43  ?  119 PHE H CD1   1 
ATOM   7208  C CD2   . PHE I 1 119 ? -24.994 -73.221 -29.382  1.00 46.70  ?  119 PHE H CD2   1 
ATOM   7209  C CE1   . PHE I 1 119 ? -27.068 -71.746 -28.325  1.00 48.52  ?  119 PHE H CE1   1 
ATOM   7210  C CE2   . PHE I 1 119 ? -25.964 -73.844 -28.623  1.00 51.17  ?  119 PHE H CE2   1 
ATOM   7211  C CZ    . PHE I 1 119 ? -27.003 -73.105 -28.093  1.00 45.77  ?  119 PHE H CZ    1 
ATOM   7212  N N     . TYR I 1 120 ? -21.545 -72.265 -28.813  1.00 55.69  ?  120 TYR H N     1 
ATOM   7213  C CA    . TYR I 1 120 ? -21.069 -73.184 -27.797  1.00 55.52  ?  120 TYR H CA    1 
ATOM   7214  C C     . TYR I 1 120 ? -20.275 -72.408 -26.758  1.00 66.05  ?  120 TYR H C     1 
ATOM   7215  O O     . TYR I 1 120 ? -20.520 -72.547 -25.553  1.00 67.40  ?  120 TYR H O     1 
ATOM   7216  C CB    . TYR I 1 120 ? -20.279 -74.316 -28.444  1.00 55.76  ?  120 TYR H CB    1 
ATOM   7217  C CG    . TYR I 1 120 ? -21.196 -75.485 -28.725  1.00 67.96  ?  120 TYR H CG    1 
ATOM   7218  C CD1   . TYR I 1 120 ? -22.023 -75.474 -29.843  1.00 73.99  ?  120 TYR H CD1   1 
ATOM   7219  C CD2   . TYR I 1 120 ? -21.282 -76.565 -27.860  1.00 94.63  ?  120 TYR H CD2   1 
ATOM   7220  C CE1   . TYR I 1 120 ? -22.885 -76.517 -30.109  1.00 68.93  ?  120 TYR H CE1   1 
ATOM   7221  C CE2   . TYR I 1 120 ? -22.146 -77.619 -28.118  1.00 111.00 ?  120 TYR H CE2   1 
ATOM   7222  C CZ    . TYR I 1 120 ? -22.944 -77.587 -29.246  1.00 97.76  ?  120 TYR H CZ    1 
ATOM   7223  O OH    . TYR I 1 120 ? -23.807 -78.624 -29.518  1.00 111.44 ?  120 TYR H OH    1 
ATOM   7224  N N     . LEU I 1 121 ? -19.405 -71.522 -27.236  1.00 58.75  ?  121 LEU H N     1 
ATOM   7225  C CA    . LEU I 1 121 ? -18.625 -70.653 -26.365  1.00 55.42  ?  121 LEU H CA    1 
ATOM   7226  C C     . LEU I 1 121 ? -19.589 -69.896 -25.469  1.00 58.53  ?  121 LEU H C     1 
ATOM   7227  O O     . LEU I 1 121 ? -19.352 -69.748 -24.271  1.00 64.48  ?  121 LEU H O     1 
ATOM   7228  C CB    . LEU I 1 121 ? -17.744 -69.694 -27.165  1.00 55.77  ?  121 LEU H CB    1 
ATOM   7229  C CG    . LEU I 1 121 ? -16.567 -70.345 -27.893  1.00 56.67  ?  121 LEU H CG    1 
ATOM   7230  C CD1   . LEU I 1 121 ? -15.904 -69.357 -28.836  1.00 65.69  ?  121 LEU H CD1   1 
ATOM   7231  C CD2   . LEU I 1 121 ? -15.560 -70.899 -26.895  1.00 62.57  ?  121 LEU H CD2   1 
ATOM   7232  N N     . ILE I 1 122 ? -20.676 -69.411 -26.056  1.00 63.53  ?  122 ILE H N     1 
ATOM   7233  C CA    . ILE I 1 122 ? -21.653 -68.650 -25.298  1.00 59.75  ?  122 ILE H CA    1 
ATOM   7234  C C     . ILE I 1 122 ? -22.405 -69.585 -24.348  1.00 58.99  ?  122 ILE H C     1 
ATOM   7235  O O     . ILE I 1 122 ? -22.617 -69.243 -23.183  1.00 50.54  ?  122 ILE H O     1 
ATOM   7236  C CB    . ILE I 1 122 ? -22.638 -67.912 -26.224  1.00 43.06  ?  122 ILE H CB    1 
ATOM   7237  C CG1   . ILE I 1 122 ? -21.887 -66.884 -27.071  1.00 42.55  ?  122 ILE H CG1   1 
ATOM   7238  C CG2   . ILE I 1 122 ? -23.722 -67.222 -25.413  1.00 55.86  ?  122 ILE H CG2   1 
ATOM   7239  C CD1   . ILE I 1 122 ? -22.627 -66.459 -28.317  1.00 64.52  ?  122 ILE H CD1   1 
ATOM   7240  N N     . LYS I 1 123 ? -22.808 -70.755 -24.841  1.00 62.12  ?  123 LYS H N     1 
ATOM   7241  C CA    . LYS I 1 123 ? -23.529 -71.723 -24.010  1.00 66.38  ?  123 LYS H CA    1 
ATOM   7242  C C     . LYS I 1 123 ? -22.731 -72.091 -22.758  1.00 64.14  ?  123 LYS H C     1 
ATOM   7243  O O     . LYS I 1 123 ? -23.296 -72.271 -21.678  1.00 45.27  ?  123 LYS H O     1 
ATOM   7244  C CB    . LYS I 1 123 ? -23.868 -72.987 -24.806  1.00 73.05  ?  123 LYS H CB    1 
ATOM   7245  C CG    . LYS I 1 123 ? -24.039 -74.234 -23.945  1.00 82.20  ?  123 LYS H CG    1 
ATOM   7246  C CD    . LYS I 1 123 ? -24.236 -75.484 -24.780  1.00 92.80  ?  123 LYS H CD    1 
ATOM   7247  C CE    . LYS I 1 123 ? -22.966 -76.313 -24.824  1.00 104.76 ?  123 LYS H CE    1 
ATOM   7248  N NZ    . LYS I 1 123 ? -22.606 -76.840 -23.478  1.00 118.50 1  123 LYS H NZ    1 
ATOM   7249  N N     . ASN I 1 124 ? -21.413 -72.173 -22.906  1.00 73.48  ?  124 ASN H N     1 
ATOM   7250  C CA    . ASN I 1 124 ? -20.534 -72.556 -21.807  1.00 77.67  ?  124 ASN H CA    1 
ATOM   7251  C C     . ASN I 1 124 ? -20.045 -71.356 -21.001  1.00 71.37  ?  124 ASN H C     1 
ATOM   7252  O O     . ASN I 1 124 ? -19.212 -71.505 -20.106  1.00 68.89  ?  124 ASN H O     1 
ATOM   7253  C CB    . ASN I 1 124 ? -19.335 -73.344 -22.339  1.00 85.49  ?  124 ASN H CB    1 
ATOM   7254  C CG    . ASN I 1 124 ? -19.732 -74.687 -22.921  1.00 91.73  ?  124 ASN H CG    1 
ATOM   7255  O OD1   . ASN I 1 124 ? -20.788 -75.230 -22.596  1.00 91.56  ?  124 ASN H OD1   1 
ATOM   7256  N ND2   . ASN I 1 124 ? -18.886 -75.229 -23.789  1.00 79.22  ?  124 ASN H ND2   1 
ATOM   7257  N N     . LYS I 1 125 ? -20.551 -70.172 -21.344  1.00 69.24  ?  125 LYS H N     1 
ATOM   7258  C CA    . LYS I 1 125 ? -20.267 -68.938 -20.606  1.00 54.93  ?  125 LYS H CA    1 
ATOM   7259  C C     . LYS I 1 125 ? -18.793 -68.537 -20.674  1.00 51.92  ?  125 LYS H C     1 
ATOM   7260  O O     . LYS I 1 125 ? -18.317 -67.743 -19.866  1.00 66.26  ?  125 LYS H O     1 
ATOM   7261  C CB    . LYS I 1 125 ? -20.712 -69.077 -19.146  1.00 46.20  ?  125 LYS H CB    1 
ATOM   7262  C CG    . LYS I 1 125 ? -22.213 -68.929 -18.949  1.00 49.99  ?  125 LYS H CG    1 
ATOM   7263  C CD    . LYS I 1 125 ? -22.602 -69.020 -17.483  1.00 66.39  ?  125 LYS H CD    1 
ATOM   7264  C CE    . LYS I 1 125 ? -24.111 -68.940 -17.305  1.00 62.35  ?  125 LYS H CE    1 
ATOM   7265  N NZ    . LYS I 1 125 ? -24.658 -67.621 -17.723  1.00 56.01  1  125 LYS H NZ    1 
ATOM   7266  N N     . GLU I 1 126 ? -18.082 -69.100 -21.645  1.00 42.66  ?  126 GLU H N     1 
ATOM   7267  C CA    . GLU I 1 126 ? -16.685 -68.759 -21.902  1.00 51.33  ?  126 GLU H CA    1 
ATOM   7268  C C     . GLU I 1 126 ? -16.545 -67.356 -22.491  1.00 60.22  ?  126 GLU H C     1 
ATOM   7269  O O     . GLU I 1 126 ? -15.453 -66.789 -22.518  1.00 67.92  ?  126 GLU H O     1 
ATOM   7270  C CB    . GLU I 1 126 ? -16.047 -69.783 -22.841  1.00 63.86  ?  126 GLU H CB    1 
ATOM   7271  C CG    . GLU I 1 126 ? -15.980 -71.190 -22.272  1.00 80.79  ?  126 GLU H CG    1 
ATOM   7272  C CD    . GLU I 1 126 ? -15.011 -72.074 -23.031  1.00 97.41  ?  126 GLU H CD    1 
ATOM   7273  O OE1   . GLU I 1 126 ? -14.054 -71.534 -23.628  1.00 73.02  ?  126 GLU H OE1   1 
ATOM   7274  O OE2   . GLU I 1 126 ? -15.208 -73.307 -23.036  1.00 106.90 -1 126 GLU H OE2   1 
ATOM   7275  N N     . HIS I 1 127 ? -17.657 -66.806 -22.967  1.00 68.59  ?  127 HIS H N     1 
ATOM   7276  C CA    . HIS I 1 127 ? -17.682 -65.454 -23.518  1.00 69.52  ?  127 HIS H CA    1 
ATOM   7277  C C     . HIS I 1 127 ? -17.520 -64.388 -22.437  1.00 66.21  ?  127 HIS H C     1 
ATOM   7278  O O     . HIS I 1 127 ? -17.340 -63.209 -22.742  1.00 62.81  ?  127 HIS H O     1 
ATOM   7279  C CB    . HIS I 1 127 ? -18.975 -65.222 -24.305  1.00 58.21  ?  127 HIS H CB    1 
ATOM   7280  C CG    . HIS I 1 127 ? -20.203 -65.126 -23.456  1.00 49.58  ?  127 HIS H CG    1 
ATOM   7281  N ND1   . HIS I 1 127 ? -20.675 -66.184 -22.708  1.00 51.15  ?  127 HIS H ND1   1 
ATOM   7282  C CD2   . HIS I 1 127 ? -21.068 -64.106 -23.252  1.00 41.58  ?  127 HIS H CD2   1 
ATOM   7283  C CE1   . HIS I 1 127 ? -21.773 -65.816 -22.073  1.00 48.40  ?  127 HIS H CE1   1 
ATOM   7284  N NE2   . HIS I 1 127 ? -22.033 -64.559 -22.386  1.00 51.84  ?  127 HIS H NE2   1 
ATOM   7285  N N     . LEU I 1 128 ? -17.591 -64.804 -21.176  1.00 63.43  ?  128 LEU H N     1 
ATOM   7286  C CA    . LEU I 1 128 ? -17.513 -63.872 -20.057  1.00 54.18  ?  128 LEU H CA    1 
ATOM   7287  C C     . LEU I 1 128 ? -16.053 -63.671 -19.657  1.00 63.16  ?  128 LEU H C     1 
ATOM   7288  O O     . LEU I 1 128 ? -15.754 -63.080 -18.619  1.00 61.11  ?  128 LEU H O     1 
ATOM   7289  C CB    . LEU I 1 128 ? -18.331 -64.371 -18.866  1.00 44.72  ?  128 LEU H CB    1 
ATOM   7290  C CG    . LEU I 1 128 ? -19.836 -64.498 -19.105  1.00 38.63  ?  128 LEU H CG    1 
ATOM   7291  C CD1   . LEU I 1 128 ? -20.547 -64.993 -17.858  1.00 59.26  ?  128 LEU H CD1   1 
ATOM   7292  C CD2   . LEU I 1 128 ? -20.409 -63.169 -19.554  1.00 43.54  ?  128 LEU H CD2   1 
ATOM   7293  N N     . THR I 1 129 ? -15.151 -64.186 -20.488  1.00 64.60  ?  129 THR H N     1 
ATOM   7294  C CA    . THR I 1 129 ? -13.716 -64.040 -20.279  1.00 58.35  ?  129 THR H CA    1 
ATOM   7295  C C     . THR I 1 129 ? -13.166 -63.187 -21.416  1.00 66.52  ?  129 THR H C     1 
ATOM   7296  O O     . THR I 1 129 ? -13.771 -63.124 -22.486  1.00 79.30  ?  129 THR H O     1 
ATOM   7297  C CB    . THR I 1 129 ? -13.002 -65.410 -20.253  1.00 55.88  ?  129 THR H CB    1 
ATOM   7298  O OG1   . THR I 1 129 ? -13.747 -66.326 -19.442  1.00 72.86  ?  129 THR H OG1   1 
ATOM   7299  C CG2   . THR I 1 129 ? -11.581 -65.285 -19.714  1.00 58.00  ?  129 THR H CG2   1 
ATOM   7300  N N     . GLU I 1 130 ? -12.033 -62.527 -21.194  1.00 53.85  ?  130 GLU H N     1 
ATOM   7301  C CA    . GLU I 1 130 ? -11.350 -61.820 -22.271  1.00 61.51  ?  130 GLU H CA    1 
ATOM   7302  C C     . GLU I 1 130 ? -10.965 -62.771 -23.401  1.00 69.95  ?  130 GLU H C     1 
ATOM   7303  O O     . GLU I 1 130 ? -11.075 -62.433 -24.583  1.00 82.84  ?  130 GLU H O     1 
ATOM   7304  C CB    . GLU I 1 130 ? -10.105 -61.106 -21.738  1.00 52.47  ?  130 GLU H CB    1 
ATOM   7305  N N     . GLU I 1 131 ? -10.527 -63.969 -23.023  1.00 68.47  ?  131 GLU H N     1 
ATOM   7306  C CA    . GLU I 1 131 ? -10.075 -64.966 -23.986  1.00 83.28  ?  131 GLU H CA    1 
ATOM   7307  C C     . GLU I 1 131 ? -11.205 -65.452 -24.885  1.00 78.22  ?  131 GLU H C     1 
ATOM   7308  O O     . GLU I 1 131 ? -11.083 -65.470 -26.119  1.00 91.59  ?  131 GLU H O     1 
ATOM   7309  C CB    . GLU I 1 131 ? -9.459  -66.154 -23.244  1.00 93.08  ?  131 GLU H CB    1 
ATOM   7310  C CG    . GLU I 1 131 ? -8.896  -67.241 -24.138  1.00 106.44 ?  131 GLU H CG    1 
ATOM   7311  C CD    . GLU I 1 131 ? -8.173  -68.315 -23.349  1.00 117.64 ?  131 GLU H CD    1 
ATOM   7312  O OE1   . GLU I 1 131 ? -8.376  -69.511 -23.645  1.00 128.21 ?  131 GLU H OE1   1 
ATOM   7313  O OE2   . GLU I 1 131 ? -7.400  -67.962 -22.434  1.00 119.86 -1 131 GLU H OE2   1 
ATOM   7314  N N     . GLY I 1 132 ? -12.317 -65.821 -24.256  1.00 71.81  ?  132 GLY H N     1 
ATOM   7315  C CA    . GLY I 1 132 ? -13.459 -66.327 -24.988  1.00 80.02  ?  132 GLY H CA    1 
ATOM   7316  C C     . GLY I 1 132 ? -14.046 -65.244 -25.861  1.00 77.43  ?  132 GLY H C     1 
ATOM   7317  O O     . GLY I 1 132 ? -14.466 -65.503 -26.989  1.00 77.12  ?  132 GLY H O     1 
ATOM   7318  N N     . LEU I 1 133 ? -14.073 -64.023 -25.335  1.00 72.90  ?  133 LEU H N     1 
ATOM   7319  C CA    . LEU I 1 133 ? -14.572 -62.891 -26.097  1.00 69.35  ?  133 LEU H CA    1 
ATOM   7320  C C     . LEU I 1 133 ? -13.735 -62.674 -27.349  1.00 62.96  ?  133 LEU H C     1 
ATOM   7321  O O     . LEU I 1 133 ? -14.270 -62.557 -28.452  1.00 70.22  ?  133 LEU H O     1 
ATOM   7322  C CB    . LEU I 1 133 ? -14.557 -61.624 -25.240  1.00 78.21  ?  133 LEU H CB    1 
ATOM   7323  C CG    . LEU I 1 133 ? -14.896 -60.308 -25.941  1.00 65.21  ?  133 LEU H CG    1 
ATOM   7324  C CD1   . LEU I 1 133 ? -16.262 -60.404 -26.585  1.00 72.05  ?  133 LEU H CD1   1 
ATOM   7325  C CD2   . LEU I 1 133 ? -14.833 -59.132 -24.983  1.00 78.47  ?  133 LEU H CD2   1 
ATOM   7326  N N     . ASN I 1 134 ? -12.414 -62.662 -27.176  1.00 68.75  ?  134 ASN H N     1 
ATOM   7327  C CA    . ASN I 1 134 ? -11.513 -62.505 -28.311  1.00 66.38  ?  134 ASN H CA    1 
ATOM   7328  C C     . ASN I 1 134 ? -11.691 -63.603 -29.352  1.00 70.53  ?  134 ASN H C     1 
ATOM   7329  O O     . ASN I 1 134 ? -11.657 -63.337 -30.561  1.00 81.17  ?  134 ASN H O     1 
ATOM   7330  C CB    . ASN I 1 134 ? -10.061 -62.467 -27.832  1.00 73.47  ?  134 ASN H CB    1 
ATOM   7331  C CG    . ASN I 1 134 ? -9.668  -61.113 -27.271  1.00 80.36  ?  134 ASN H CG    1 
ATOM   7332  O OD1   . ASN I 1 134 ? -9.213  -61.008 -26.133  1.00 86.34  ?  134 ASN H OD1   1 
ATOM   7333  N ND2   . ASN I 1 134 ? -9.847  -60.067 -28.070  1.00 82.63  ?  134 ASN H ND2   1 
ATOM   7334  N N     . GLN I 1 135 ? -11.929 -64.827 -28.886  1.00 60.37  ?  135 GLN H N     1 
ATOM   7335  C CA    . GLN I 1 135 ? -12.076 -65.935 -29.820  1.00 72.68  ?  135 GLN H CA    1 
ATOM   7336  C C     . GLN I 1 135 ? -13.373 -65.740 -30.598  1.00 71.08  ?  135 GLN H C     1 
ATOM   7337  O O     . GLN I 1 135 ? -13.434 -65.980 -31.815  1.00 61.17  ?  135 GLN H O     1 
ATOM   7338  C CB    . GLN I 1 135 ? -12.063 -67.280 -29.092  1.00 63.59  ?  135 GLN H CB    1 
ATOM   7339  C CG    . GLN I 1 135 ? -12.182 -68.482 -30.017  1.00 79.97  ?  135 GLN H CG    1 
ATOM   7340  C CD    . GLN I 1 135 ? -11.761 -69.777 -29.350  1.00 97.66  ?  135 GLN H CD    1 
ATOM   7341  O OE1   . GLN I 1 135 ? -11.718 -69.872 -28.124  1.00 96.08  ?  135 GLN H OE1   1 
ATOM   7342  N NE2   . GLN I 1 135 ? -11.441 -70.783 -30.158  1.00 102.37 ?  135 GLN H NE2   1 
ATOM   7343  N N     . ILE I 1 136 ? -14.404 -65.285 -29.888  1.00 66.56  ?  136 ILE H N     1 
ATOM   7344  C CA    . ILE I 1 136 ? -15.690 -65.013 -30.513  1.00 59.45  ?  136 ILE H CA    1 
ATOM   7345  C C     . ILE I 1 136 ? -15.500 -63.980 -31.610  1.00 59.65  ?  136 ILE H C     1 
ATOM   7346  O O     . ILE I 1 136 ? -16.053 -64.125 -32.690  1.00 65.21  ?  136 ILE H O     1 
ATOM   7347  C CB    . ILE I 1 136 ? -16.739 -64.533 -29.500  1.00 55.82  ?  136 ILE H CB    1 
ATOM   7348  C CG1   . ILE I 1 136 ? -17.172 -65.702 -28.621  1.00 50.99  ?  136 ILE H CG1   1 
ATOM   7349  C CG2   . ILE I 1 136 ? -17.960 -63.979 -30.212  1.00 56.25  ?  136 ILE H CG2   1 
ATOM   7350  C CD1   . ILE I 1 136 ? -18.334 -65.384 -27.728  1.00 57.20  ?  136 ILE H CD1   1 
ATOM   7351  N N     . LEU I 1 137 ? -14.727 -62.934 -31.331  1.00 54.80  ?  137 LEU H N     1 
ATOM   7352  C CA    . LEU I 1 137 ? -14.430 -61.941 -32.362  1.00 62.21  ?  137 LEU H CA    1 
ATOM   7353  C C     . LEU I 1 137 ? -13.694 -62.550 -33.545  1.00 65.28  ?  137 LEU H C     1 
ATOM   7354  O O     . LEU I 1 137 ? -13.908 -62.131 -34.684  1.00 70.66  ?  137 LEU H O     1 
ATOM   7355  C CB    . LEU I 1 137 ? -13.655 -60.747 -31.813  1.00 66.62  ?  137 LEU H CB    1 
ATOM   7356  C CG    . LEU I 1 137 ? -14.537 -59.670 -31.171  1.00 71.06  ?  137 LEU H CG    1 
ATOM   7357  C CD1   . LEU I 1 137 ? -15.272 -60.118 -29.931  1.00 66.93  ?  137 LEU H CD1   1 
ATOM   7358  C CD2   . LEU I 1 137 ? -13.711 -58.445 -30.895  1.00 75.34  ?  137 LEU H CD2   1 
ATOM   7359  N N     . THR I 1 138 ? -12.817 -63.520 -33.290  1.00 62.02  ?  138 THR H N     1 
ATOM   7360  C CA    . THR I 1 138 ? -12.165 -64.187 -34.413  1.00 71.23  ?  138 THR H CA    1 
ATOM   7361  C C     . THR I 1 138 ? -13.222 -64.899 -35.256  1.00 69.47  ?  138 THR H C     1 
ATOM   7362  O O     . THR I 1 138 ? -13.099 -64.968 -36.479  1.00 61.26  ?  138 THR H O     1 
ATOM   7363  C CB    . THR I 1 138 ? -11.093 -65.202 -33.960  1.00 72.45  ?  138 THR H CB    1 
ATOM   7364  O OG1   . THR I 1 138 ? -11.728 -66.335 -33.356  1.00 72.66  ?  138 THR H OG1   1 
ATOM   7365  C CG2   . THR I 1 138 ? -10.144 -64.573 -32.957  1.00 85.05  ?  138 THR H CG2   1 
ATOM   7366  N N     . LEU I 1 139 ? -14.258 -65.427 -34.608  1.00 66.15  ?  139 LEU H N     1 
ATOM   7367  C CA    . LEU I 1 139 ? -15.345 -66.081 -35.341  1.00 64.55  ?  139 LEU H CA    1 
ATOM   7368  C C     . LEU I 1 139 ? -16.203 -65.084 -36.137  1.00 64.71  ?  139 LEU H C     1 
ATOM   7369  O O     . LEU I 1 139 ? -16.498 -65.302 -37.311  1.00 69.34  ?  139 LEU H O     1 
ATOM   7370  C CB    . LEU I 1 139 ? -16.230 -66.887 -34.391  1.00 54.35  ?  139 LEU H CB    1 
ATOM   7371  C CG    . LEU I 1 139 ? -15.532 -68.015 -33.632  1.00 62.72  ?  139 LEU H CG    1 
ATOM   7372  C CD1   . LEU I 1 139 ? -16.450 -68.605 -32.575  1.00 59.70  ?  139 LEU H CD1   1 
ATOM   7373  C CD2   . LEU I 1 139 ? -15.069 -69.090 -34.604  1.00 57.36  ?  139 LEU H CD2   1 
ATOM   7374  N N     . LYS I 1 140 ? -16.598 -63.998 -35.478  1.00 56.95  ?  140 LYS H N     1 
ATOM   7375  C CA    . LYS I 1 140 ? -17.412 -62.936 -36.068  1.00 52.50  ?  140 LYS H CA    1 
ATOM   7376  C C     . LYS I 1 140 ? -16.717 -62.274 -37.250  1.00 63.49  ?  140 LYS H C     1 
ATOM   7377  O O     . LYS I 1 140 ? -17.368 -61.835 -38.199  1.00 73.00  ?  140 LYS H O     1 
ATOM   7378  C CB    . LYS I 1 140 ? -17.769 -61.882 -35.015  1.00 49.82  ?  140 LYS H CB    1 
ATOM   7379  C CG    . LYS I 1 140 ? -18.718 -60.798 -35.517  1.00 45.93  ?  140 LYS H CG    1 
ATOM   7380  C CD    . LYS I 1 140 ? -19.140 -59.860 -34.398  1.00 45.84  ?  140 LYS H CD    1 
ATOM   7381  C CE    . LYS I 1 140 ? -19.769 -58.587 -34.948  1.00 40.81  ?  140 LYS H CE    1 
ATOM   7382  N NZ    . LYS I 1 140 ? -21.001 -58.865 -35.734  1.00 47.14  1  140 LYS H NZ    1 
ATOM   7383  N N     . ALA I 1 141 ? -15.393 -62.190 -37.177  1.00 63.32  ?  141 ALA H N     1 
ATOM   7384  C CA    . ALA I 1 141 ? -14.604 -61.537 -38.214  1.00 67.44  ?  141 ALA H CA    1 
ATOM   7385  C C     . ALA I 1 141 ? -14.812 -62.226 -39.558  1.00 58.13  ?  141 ALA H C     1 
ATOM   7386  O O     . ALA I 1 141 ? -14.723 -61.595 -40.609  1.00 57.04  ?  141 ALA H O     1 
ATOM   7387  C CB    . ALA I 1 141 ? -13.133 -61.532 -37.839  1.00 68.90  ?  141 ALA H CB    1 
ATOM   7388  N N     . SER I 1 142 ? -15.089 -63.525 -39.516  1.00 62.93  ?  142 SER H N     1 
ATOM   7389  C CA    . SER I 1 142 ? -15.257 -64.318 -40.727  1.00 62.92  ?  142 SER H CA    1 
ATOM   7390  C C     . SER I 1 142 ? -16.740 -64.565 -41.009  1.00 65.51  ?  142 SER H C     1 
ATOM   7391  O O     . SER I 1 142 ? -17.097 -65.178 -42.014  1.00 74.33  ?  142 SER H O     1 
ATOM   7392  C CB    . SER I 1 142 ? -14.510 -65.648 -40.607  1.00 66.31  ?  142 SER H CB    1 
ATOM   7393  O OG    . SER I 1 142 ? -13.119 -65.439 -40.437  1.00 77.81  ?  142 SER H OG    1 
ATOM   7394  N N     . LEU I 1 143 ? -17.596 -64.076 -40.116  1.00 68.35  ?  143 LEU H N     1 
ATOM   7395  C CA    . LEU I 1 143 ? -19.041 -64.273 -40.226  1.00 54.42  ?  143 LEU H CA    1 
ATOM   7396  C C     . LEU I 1 143 ? -19.704 -63.115 -40.964  1.00 66.03  ?  143 LEU H C     1 
ATOM   7397  O O     . LEU I 1 143 ? -19.574 -61.960 -40.552  1.00 63.89  ?  143 LEU H O     1 
ATOM   7398  C CB    . LEU I 1 143 ? -19.667 -64.428 -38.839  1.00 50.76  ?  143 LEU H CB    1 
ATOM   7399  C CG    . LEU I 1 143 ? -21.191 -64.553 -38.777  1.00 46.13  ?  143 LEU H CG    1 
ATOM   7400  C CD1   . LEU I 1 143 ? -21.645 -65.870 -39.371  1.00 38.66  ?  143 LEU H CD1   1 
ATOM   7401  C CD2   . LEU I 1 143 ? -21.687 -64.411 -37.349  1.00 66.14  ?  143 LEU H CD2   1 
ATOM   7402  N N     . ASN I 1 144 ? -20.440 -63.438 -42.028  1.00 70.02  ?  144 ASN H N     1 
ATOM   7403  C CA    . ASN I 1 144 ? -21.122 -62.441 -42.853  1.00 56.06  ?  144 ASN H CA    1 
ATOM   7404  C C     . ASN I 1 144 ? -20.201 -61.281 -43.216  1.00 59.34  ?  144 ASN H C     1 
ATOM   7405  O O     . ASN I 1 144 ? -19.192 -61.469 -43.895  1.00 71.02  ?  144 ASN H O     1 
ATOM   7406  C CB    . ASN I 1 144 ? -22.370 -61.910 -42.140  1.00 45.73  ?  144 ASN H CB    1 
ATOM   7407  C CG    . ASN I 1 144 ? -23.327 -63.015 -41.732  1.00 55.48  ?  144 ASN H CG    1 
ATOM   7408  O OD1   . ASN I 1 144 ? -23.356 -64.087 -42.336  1.00 46.95  ?  144 ASN H OD1   1 
ATOM   7409  N ND2   . ASN I 1 144 ? -24.122 -62.753 -40.702  1.00 64.50  ?  144 ASN H ND2   1 
ATOM   7410  N N     . LEU I 1 145 ? -20.556 -60.084 -42.765  1.00 50.62  ?  145 LEU H N     1 
ATOM   7411  C CA    . LEU I 1 145 ? -19.862 -58.870 -43.174  1.00 56.93  ?  145 LEU H CA    1 
ATOM   7412  C C     . LEU I 1 145 ? -18.625 -58.632 -42.310  1.00 54.35  ?  145 LEU H C     1 
ATOM   7413  O O     . LEU I 1 145 ? -17.888 -57.667 -42.521  1.00 49.63  ?  145 LEU H O     1 
ATOM   7414  C CB    . LEU I 1 145 ? -20.796 -57.661 -43.113  1.00 56.75  ?  145 LEU H CB    1 
ATOM   7415  C CG    . LEU I 1 145 ? -21.997 -57.711 -44.058  1.00 57.53  ?  145 LEU H CG    1 
ATOM   7416  C CD1   . LEU I 1 145 ? -22.719 -56.372 -44.086  1.00 62.93  ?  145 LEU H CD1   1 
ATOM   7417  C CD2   . LEU I 1 145 ? -21.565 -58.124 -45.454  1.00 50.98  ?  145 LEU H CD2   1 
ATOM   7418  N N     . GLY I 1 146 ? -18.405 -59.507 -41.332  1.00 56.84  ?  146 GLY H N     1 
ATOM   7419  C CA    . GLY I 1 146 ? -17.214 -59.419 -40.505  1.00 79.30  ?  146 GLY H CA    1 
ATOM   7420  C C     . GLY I 1 146 ? -17.295 -58.318 -39.466  1.00 69.66  ?  146 GLY H C     1 
ATOM   7421  O O     . GLY I 1 146 ? -18.385 -57.870 -39.111  1.00 62.60  ?  146 GLY H O     1 
ATOM   7422  N N     . LEU I 1 147 ? -16.138 -57.886 -38.972  1.00 65.96  ?  147 LEU H N     1 
ATOM   7423  C CA    . LEU I 1 147 ? -16.091 -56.920 -37.882  1.00 75.05  ?  147 LEU H CA    1 
ATOM   7424  C C     . LEU I 1 147 ? -16.241 -55.515 -38.444  1.00 65.15  ?  147 LEU H C     1 
ATOM   7425  O O     . LEU I 1 147 ? -15.645 -55.177 -39.465  1.00 61.28  ?  147 LEU H O     1 
ATOM   7426  C CB    . LEU I 1 147 ? -14.777 -57.034 -37.106  1.00 65.73  ?  147 LEU H CB    1 
ATOM   7427  C CG    . LEU I 1 147 ? -14.437 -58.363 -36.433  1.00 54.88  ?  147 LEU H CG    1 
ATOM   7428  C CD1   . LEU I 1 147 ? -13.327 -58.166 -35.415  1.00 60.08  ?  147 LEU H CD1   1 
ATOM   7429  C CD2   . LEU I 1 147 ? -15.663 -58.956 -35.772  1.00 63.91  ?  147 LEU H CD2   1 
ATOM   7430  N N     . SER I 1 148 ? -17.048 -54.702 -37.770  1.00 73.65  ?  148 SER H N     1 
ATOM   7431  C CA    . SER I 1 148 ? -17.134 -53.280 -38.075  1.00 70.27  ?  148 SER H CA    1 
ATOM   7432  C C     . SER I 1 148 ? -15.850 -52.524 -37.752  1.00 80.40  ?  148 SER H C     1 
ATOM   7433  O O     . SER I 1 148 ? -14.985 -53.019 -37.029  1.00 87.62  ?  148 SER H O     1 
ATOM   7434  C CB    . SER I 1 148 ? -18.306 -52.651 -37.320  1.00 70.58  ?  148 SER H CB    1 
ATOM   7435  O OG    . SER I 1 148 ? -18.089 -52.694 -35.921  1.00 82.55  ?  148 SER H OG    1 
ATOM   7436  N N     . GLU I 1 149 ? -15.744 -51.320 -38.306  1.00 91.21  ?  149 GLU H N     1 
ATOM   7437  C CA    . GLU I 1 149 ? -14.632 -50.416 -38.034  1.00 92.93  ?  149 GLU H CA    1 
ATOM   7438  C C     . GLU I 1 149 ? -14.490 -50.128 -36.544  1.00 82.85  ?  149 GLU H C     1 
ATOM   7439  O O     . GLU I 1 149 ? -13.385 -50.107 -36.011  1.00 70.26  ?  149 GLU H O     1 
ATOM   7440  C CB    . GLU I 1 149 ? -14.810 -49.106 -38.805  1.00 68.69  ?  149 GLU H CB    1 
ATOM   7441  N N     . GLU I 1 150 ? -15.620 -49.894 -35.886  1.00 82.11  ?  150 GLU H N     1 
ATOM   7442  C CA    . GLU I 1 150 ? -15.650 -49.627 -34.452  1.00 96.75  ?  150 GLU H CA    1 
ATOM   7443  C C     . GLU I 1 150 ? -15.058 -50.777 -33.634  1.00 95.32  ?  150 GLU H C     1 
ATOM   7444  O O     . GLU I 1 150 ? -14.261 -50.561 -32.713  1.00 98.67  ?  150 GLU H O     1 
ATOM   7445  C CB    . GLU I 1 150 ? -17.090 -49.362 -34.004  1.00 98.12  ?  150 GLU H CB    1 
ATOM   7446  C CG    . GLU I 1 150 ? -17.708 -48.090 -34.577  1.00 106.38 ?  150 GLU H CG    1 
ATOM   7447  C CD    . GLU I 1 150 ? -17.156 -46.818 -33.959  1.00 134.87 ?  150 GLU H CD    1 
ATOM   7448  O OE1   . GLU I 1 150 ? -16.330 -46.907 -33.027  1.00 140.62 ?  150 GLU H OE1   1 
ATOM   7449  O OE2   . GLU I 1 150 ? -17.551 -45.723 -34.412  1.00 142.12 -1 150 GLU H OE2   1 
ATOM   7450  N N     . LEU I 1 151 ? -15.436 -52.001 -33.992  1.00 88.13  ?  151 LEU H N     1 
ATOM   7451  C CA    . LEU I 1 151 ? -14.943 -53.188 -33.305  1.00 82.15  ?  151 LEU H CA    1 
ATOM   7452  C C     . LEU I 1 151 ? -13.470 -53.431 -33.605  1.00 85.77  ?  151 LEU H C     1 
ATOM   7453  O O     . LEU I 1 151 ? -12.717 -53.865 -32.732  1.00 95.14  ?  151 LEU H O     1 
ATOM   7454  C CB    . LEU I 1 151 ? -15.770 -54.413 -33.695  1.00 84.71  ?  151 LEU H CB    1 
ATOM   7455  C CG    . LEU I 1 151 ? -17.111 -54.565 -32.975  1.00 78.90  ?  151 LEU H CG    1 
ATOM   7456  C CD1   . LEU I 1 151 ? -17.791 -55.867 -33.367  1.00 81.83  ?  151 LEU H CD1   1 
ATOM   7457  C CD2   . LEU I 1 151 ? -16.922 -54.487 -31.468  1.00 75.89  ?  151 LEU H CD2   1 
ATOM   7458  N N     . LYS I 1 152 ? -13.067 -53.160 -34.843  1.00 73.31  ?  152 LYS H N     1 
ATOM   7459  C CA    . LYS I 1 152 ? -11.659 -53.227 -35.216  1.00 75.49  ?  152 LYS H CA    1 
ATOM   7460  C C     . LYS I 1 152 ? -10.845 -52.257 -34.365  1.00 93.08  ?  152 LYS H C     1 
ATOM   7461  O O     . LYS I 1 152 ? -9.757  -52.587 -33.894  1.00 101.59 ?  152 LYS H O     1 
ATOM   7462  C CB    . LYS I 1 152 ? -11.477 -52.915 -36.702  1.00 77.40  ?  152 LYS H CB    1 
ATOM   7463  N N     . GLU I 1 153 ? -11.390 -51.060 -34.172  1.00 87.41  ?  153 GLU H N     1 
ATOM   7464  C CA    . GLU I 1 153 ? -10.749 -50.031 -33.364  1.00 79.48  ?  153 GLU H CA    1 
ATOM   7465  C C     . GLU I 1 153 ? -10.645 -50.469 -31.910  1.00 80.63  ?  153 GLU H C     1 
ATOM   7466  O O     . GLU I 1 153 ? -9.642  -50.211 -31.246  1.00 89.43  ?  153 GLU H O     1 
ATOM   7467  C CB    . GLU I 1 153 ? -11.517 -48.711 -33.463  1.00 64.58  ?  153 GLU H CB    1 
ATOM   7468  N N     . ALA I 1 154 ? -11.686 -51.134 -31.419  1.00 79.03  ?  154 ALA H N     1 
ATOM   7469  C CA    . ALA I 1 154 ? -11.715 -51.548 -30.021  1.00 85.39  ?  154 ALA H CA    1 
ATOM   7470  C C     . ALA I 1 154 ? -10.896 -52.817 -29.778  1.00 89.50  ?  154 ALA H C     1 
ATOM   7471  O O     . ALA I 1 154 ? -10.390 -53.035 -28.677  1.00 99.72  ?  154 ALA H O     1 
ATOM   7472  C CB    . ALA I 1 154 ? -13.152 -51.754 -29.566  1.00 81.14  ?  154 ALA H CB    1 
ATOM   7473  N N     . PHE I 1 155 ? -10.771 -53.650 -30.807  1.00 77.95  ?  155 PHE H N     1 
ATOM   7474  C CA    . PHE I 1 155 ? -10.036 -54.912 -30.697  1.00 89.48  ?  155 PHE H CA    1 
ATOM   7475  C C     . PHE I 1 155 ? -9.026  -55.159 -31.813  1.00 86.21  ?  155 PHE H C     1 
ATOM   7476  O O     . PHE I 1 155 ? -9.184  -56.099 -32.588  1.00 90.00  ?  155 PHE H O     1 
ATOM   7477  C CB    . PHE I 1 155 ? -11.004 -56.092 -30.643  1.00 85.76  ?  155 PHE H CB    1 
ATOM   7478  C CG    . PHE I 1 155 ? -11.962 -56.044 -29.491  1.00 78.35  ?  155 PHE H CG    1 
ATOM   7479  C CD1   . PHE I 1 155 ? -11.686 -56.740 -28.326  1.00 66.16  ?  155 PHE H CD1   1 
ATOM   7480  C CD2   . PHE I 1 155 ? -13.141 -55.326 -29.574  1.00 78.73  ?  155 PHE H CD2   1 
ATOM   7481  C CE1   . PHE I 1 155 ? -12.562 -56.713 -27.264  1.00 84.66  ?  155 PHE H CE1   1 
ATOM   7482  C CE2   . PHE I 1 155 ? -14.021 -55.295 -28.514  1.00 78.85  ?  155 PHE H CE2   1 
ATOM   7483  C CZ    . PHE I 1 155 ? -13.731 -55.992 -27.358  1.00 82.50  ?  155 PHE H CZ    1 
ATOM   7484  N N     . PRO I 1 156 ? -7.995  -54.310 -31.910  1.00 88.72  ?  156 PRO H N     1 
ATOM   7485  C CA    . PRO I 1 156 ? -7.055  -54.415 -33.033  1.00 94.34  ?  156 PRO H CA    1 
ATOM   7486  C C     . PRO I 1 156 ? -6.293  -55.747 -33.072  1.00 102.16 ?  156 PRO H C     1 
ATOM   7487  O O     . PRO I 1 156 ? -6.387  -56.553 -32.143  1.00 88.16  ?  156 PRO H O     1 
ATOM   7488  C CB    . PRO I 1 156 ? -6.103  -53.243 -32.799  1.00 102.53 ?  156 PRO H CB    1 
ATOM   7489  C CG    . PRO I 1 156 ? -6.122  -53.027 -31.325  1.00 119.75 ?  156 PRO H CG    1 
ATOM   7490  C CD    . PRO I 1 156 ? -7.471  -53.470 -30.819  1.00 99.31  ?  156 PRO H CD    1 
ATOM   7491  N N     . ASN I 1 157 ? -5.543  -55.952 -34.151  1.00 101.95 ?  157 ASN H N     1 
ATOM   7492  C CA    . ASN I 1 157 ? -4.773  -57.173 -34.398  1.00 101.78 ?  157 ASN H CA    1 
ATOM   7493  C C     . ASN I 1 157 ? -5.566  -58.478 -34.284  1.00 99.93  ?  157 ASN H C     1 
ATOM   7494  O O     . ASN I 1 157 ? -4.993  -59.539 -34.037  1.00 92.99  ?  157 ASN H O     1 
ATOM   7495  C CB    . ASN I 1 157 ? -3.573  -57.233 -33.448  1.00 108.62 ?  157 ASN H CB    1 
ATOM   7496  N N     . THR I 1 158 ? -6.880  -58.393 -34.461  1.00 99.14  ?  158 THR H N     1 
ATOM   7497  C CA    . THR I 1 158 ? -7.751  -59.562 -34.393  1.00 96.29  ?  158 THR H CA    1 
ATOM   7498  C C     . THR I 1 158 ? -7.522  -60.396 -35.645  1.00 93.76  ?  158 THR H C     1 
ATOM   7499  O O     . THR I 1 158 ? -7.713  -59.901 -36.755  1.00 93.18  ?  158 THR H O     1 
ATOM   7500  C CB    . THR I 1 158 ? -9.236  -59.188 -34.270  1.00 84.37  ?  158 THR H CB    1 
ATOM   7501  O OG1   . THR I 1 158 ? -9.444  -57.872 -34.797  1.00 88.51  ?  158 THR H OG1   1 
ATOM   7502  C CG2   . THR I 1 158 ? -9.672  -59.223 -32.812  1.00 76.26  ?  158 THR H CG2   1 
ATOM   7503  N N     . ILE I 1 159 ? -7.117  -61.651 -35.489  1.00 90.31  ?  159 ILE H N     1 
ATOM   7504  C CA    . ILE I 1 159 ? -7.008  -62.507 -36.662  1.00 99.70  ?  159 ILE H CA    1 
ATOM   7505  C C     . ILE I 1 159 ? -8.211  -63.429 -36.818  1.00 83.59  ?  159 ILE H C     1 
ATOM   7506  O O     . ILE I 1 159 ? -8.489  -64.259 -35.952  1.00 66.47  ?  159 ILE H O     1 
ATOM   7507  C CB    . ILE I 1 159 ? -5.730  -63.367 -36.606  1.00 101.62 ?  159 ILE H CB    1 
ATOM   7508  C CG1   . ILE I 1 159 ? -4.491  -62.475 -36.498  1.00 87.62  ?  159 ILE H CG1   1 
ATOM   7509  C CG2   . ILE I 1 159 ? -5.647  -64.281 -37.820  1.00 93.27  ?  159 ILE H CG2   1 
ATOM   7510  C CD1   . ILE I 1 159 ? -4.119  -61.786 -37.791  1.00 83.36  ?  159 ILE H CD1   1 
ATOM   7511  N N     . PRO I 1 160 ? -8.925  -63.275 -37.947  1.00 77.17  ?  160 PRO H N     1 
ATOM   7512  C CA    . PRO I 1 160 ? -10.184 -63.952 -38.282  1.00 70.81  ?  160 PRO H CA    1 
ATOM   7513  C C     . PRO I 1 160 ? -10.056 -65.468 -38.337  1.00 66.24  ?  160 PRO H C     1 
ATOM   7514  O O     . PRO I 1 160 ? -9.097  -65.978 -38.917  1.00 73.35  ?  160 PRO H O     1 
ATOM   7515  C CB    . PRO I 1 160 ? -10.526 -63.389 -39.668  1.00 65.36  ?  160 PRO H CB    1 
ATOM   7516  C CG    . PRO I 1 160 ? -9.797  -62.093 -39.739  1.00 64.81  ?  160 PRO H CG    1 
ATOM   7517  C CD    . PRO I 1 160 ? -8.517  -62.345 -39.013  1.00 66.79  ?  160 PRO H CD    1 
ATOM   7518  N N     . ALA I 1 161 ? -11.012 -66.172 -37.740  1.00 74.54  ?  161 ALA H N     1 
ATOM   7519  C CA    . ALA I 1 161 ? -11.001 -67.629 -37.729  1.00 74.71  ?  161 ALA H CA    1 
ATOM   7520  C C     . ALA I 1 161 ? -11.033 -68.165 -39.155  1.00 72.93  ?  161 ALA H C     1 
ATOM   7521  O O     . ALA I 1 161 ? -11.503 -67.486 -40.068  1.00 79.26  ?  161 ALA H O     1 
ATOM   7522  C CB    . ALA I 1 161 ? -12.176 -68.168 -36.930  1.00 72.71  ?  161 ALA H CB    1 
ATOM   7523  N N     . GLU I 1 162 ? -10.519 -69.375 -39.346  1.00 84.71  ?  162 GLU H N     1 
ATOM   7524  C CA    . GLU I 1 162 ? -10.508 -69.992 -40.666  1.00 99.82  ?  162 GLU H CA    1 
ATOM   7525  C C     . GLU I 1 162 ? -11.941 -70.253 -41.112  1.00 97.36  ?  162 GLU H C     1 
ATOM   7526  O O     . GLU I 1 162 ? -12.764 -70.720 -40.324  1.00 79.24  ?  162 GLU H O     1 
ATOM   7527  C CB    . GLU I 1 162 ? -9.703  -71.293 -40.657  1.00 100.99 ?  162 GLU H CB    1 
ATOM   7528  N N     . ARG I 1 163 ? -12.241 -69.956 -42.372  1.00 104.71 ?  163 ARG H N     1 
ATOM   7529  C CA    . ARG I 1 163 ? -13.588 -70.166 -42.881  1.00 96.16  ?  163 ARG H CA    1 
ATOM   7530  C C     . ARG I 1 163 ? -13.607 -71.327 -43.863  1.00 103.85 ?  163 ARG H C     1 
ATOM   7531  O O     . ARG I 1 163 ? -12.827 -71.363 -44.815  1.00 101.48 ?  163 ARG H O     1 
ATOM   7532  C CB    . ARG I 1 163 ? -14.096 -68.890 -43.558  1.00 73.41  ?  163 ARG H CB    1 
ATOM   7533  C CG    . ARG I 1 163 ? -15.511 -68.958 -44.105  1.00 66.20  ?  163 ARG H CG    1 
ATOM   7534  C CD    . ARG I 1 163 ? -15.976 -67.577 -44.550  1.00 70.95  ?  163 ARG H CD    1 
ATOM   7535  N NE    . ARG I 1 163 ? -17.226 -67.623 -45.304  1.00 84.90  ?  163 ARG H NE    1 
ATOM   7536  C CZ    . ARG I 1 163 ? -18.429 -67.446 -44.770  1.00 85.60  ?  163 ARG H CZ    1 
ATOM   7537  N NH1   . ARG I 1 163 ? -18.551 -67.207 -43.471  1.00 87.18  1  163 ARG H NH1   1 
ATOM   7538  N NH2   . ARG I 1 163 ? -19.511 -67.505 -45.534  1.00 82.47  ?  163 ARG H NH2   1 
ATOM   7539  N N     . LEU I 1 164 ? -14.505 -72.277 -43.618  1.00 95.26  ?  164 LEU H N     1 
ATOM   7540  C CA    . LEU I 1 164 ? -14.680 -73.417 -44.506  1.00 91.59  ?  164 LEU H CA    1 
ATOM   7541  C C     . LEU I 1 164 ? -15.099 -72.995 -45.907  1.00 97.19  ?  164 LEU H C     1 
ATOM   7542  O O     . LEU I 1 164 ? -16.107 -72.308 -46.076  1.00 90.47  ?  164 LEU H O     1 
ATOM   7543  C CB    . LEU I 1 164 ? -15.715 -74.386 -43.930  1.00 60.94  ?  164 LEU H CB    1 
ATOM   7544  C CG    . LEU I 1 164 ? -16.182 -75.495 -44.877  1.00 72.43  ?  164 LEU H CG    1 
ATOM   7545  C CD1   . LEU I 1 164 ? -15.027 -76.416 -45.246  1.00 93.33  ?  164 LEU H CD1   1 
ATOM   7546  C CD2   . LEU I 1 164 ? -17.327 -76.286 -44.269  1.00 52.29  ?  164 LEU H CD2   1 
ATOM   7547  N N     . LEU I 1 165 ? -14.333 -73.399 -46.913  1.00 103.25 ?  165 LEU H N     1 
ATOM   7548  C CA    . LEU I 1 165 ? -14.807 -73.278 -48.281  1.00 103.53 ?  165 LEU H CA    1 
ATOM   7549  C C     . LEU I 1 165 ? -15.696 -74.485 -48.574  1.00 104.63 ?  165 LEU H C     1 
ATOM   7550  O O     . LEU I 1 165 ? -15.235 -75.626 -48.541  1.00 102.87 ?  165 LEU H O     1 
ATOM   7551  C CB    . LEU I 1 165 ? -13.641 -73.170 -49.272  1.00 112.26 ?  165 LEU H CB    1 
ATOM   7552  C CG    . LEU I 1 165 ? -12.524 -74.217 -49.269  1.00 130.09 ?  165 LEU H CG    1 
ATOM   7553  C CD1   . LEU I 1 165 ? -12.680 -75.177 -50.438  1.00 137.32 ?  165 LEU H CD1   1 
ATOM   7554  C CD2   . LEU I 1 165 ? -11.161 -73.544 -49.305  1.00 123.46 ?  165 LEU H CD2   1 
ATOM   7555  N N     . VAL I 1 166 ? -16.975 -74.241 -48.836  1.00 104.38 ?  166 VAL H N     1 
ATOM   7556  C CA    . VAL I 1 166 ? -17.921 -75.338 -49.001  1.00 102.10 ?  166 VAL H CA    1 
ATOM   7557  C C     . VAL I 1 166 ? -17.877 -75.845 -50.441  1.00 126.79 ?  166 VAL H C     1 
ATOM   7558  O O     . VAL I 1 166 ? -18.084 -75.086 -51.388  1.00 122.57 ?  166 VAL H O     1 
ATOM   7559  C CB    . VAL I 1 166 ? -19.358 -74.923 -48.611  1.00 91.48  ?  166 VAL H CB    1 
ATOM   7560  C CG1   . VAL I 1 166 ? -19.761 -73.630 -49.303  1.00 93.48  ?  166 VAL H CG1   1 
ATOM   7561  C CG2   . VAL I 1 166 ? -20.341 -76.048 -48.909  1.00 79.96  ?  166 VAL H CG2   1 
ATOM   7562  N N     . THR I 1 167 ? -17.582 -77.131 -50.606  1.00 130.82 ?  167 THR H N     1 
ATOM   7563  C CA    . THR I 1 167 ? -17.386 -77.690 -51.938  1.00 120.75 ?  167 THR H CA    1 
ATOM   7564  C C     . THR I 1 167 ? -17.816 -79.156 -51.989  1.00 126.35 ?  167 THR H C     1 
ATOM   7565  O O     . THR I 1 167 ? -17.851 -79.842 -50.966  1.00 125.65 ?  167 THR H O     1 
ATOM   7566  C CB    . THR I 1 167 ? -15.905 -77.567 -52.382  1.00 109.72 ?  167 THR H CB    1 
ATOM   7567  O OG1   . THR I 1 167 ? -15.384 -76.289 -51.996  1.00 86.25  ?  167 THR H OG1   1 
ATOM   7568  C CG2   . THR I 1 167 ? -15.765 -77.722 -53.892  1.00 135.33 ?  167 THR H CG2   1 
ATOM   7569  N N     . GLY I 1 168 ? -18.141 -79.621 -53.191  1.00 126.83 ?  168 GLY H N     1 
ATOM   7570  C CA    . GLY I 1 168 ? -18.504 -81.004 -53.439  1.00 131.02 ?  168 GLY H CA    1 
ATOM   7571  C C     . GLY I 1 168 ? -19.779 -81.423 -52.737  1.00 135.09 ?  168 GLY H C     1 
ATOM   7572  O O     . GLY I 1 168 ? -19.924 -82.572 -52.318  1.00 146.63 ?  168 GLY H O     1 
ATOM   7573  N N     . GLN I 1 169 ? -20.705 -80.482 -52.602  1.00 126.15 ?  169 GLN H N     1 
ATOM   7574  C CA    . GLN I 1 169 ? -21.935 -80.729 -51.867  1.00 117.14 ?  169 GLN H CA    1 
ATOM   7575  C C     . GLN I 1 169 ? -23.022 -81.222 -52.822  1.00 115.57 ?  169 GLN H C     1 
ATOM   7576  O O     . GLN I 1 169 ? -23.272 -80.605 -53.857  1.00 93.49  ?  169 GLN H O     1 
ATOM   7577  C CB    . GLN I 1 169 ? -22.375 -79.466 -51.135  1.00 108.51 ?  169 GLN H CB    1 
ATOM   7578  N N     . GLU I 1 170 ? -23.670 -82.328 -52.470  1.00 125.88 ?  170 GLU H N     1 
ATOM   7579  C CA    . GLU I 1 170 ? -24.766 -82.868 -53.273  1.00 106.70 ?  170 GLU H CA    1 
ATOM   7580  C C     . GLU I 1 170 ? -26.123 -82.281 -52.899  1.00 96.05  ?  170 GLU H C     1 
ATOM   7581  O O     . GLU I 1 170 ? -26.355 -81.923 -51.745  1.00 104.45 ?  170 GLU H O     1 
ATOM   7582  C CB    . GLU I 1 170 ? -24.814 -84.392 -53.141  1.00 108.99 ?  170 GLU H CB    1 
ATOM   7583  N N     . ILE I 1 171 ? -27.015 -82.176 -53.882  1.00 74.35  ?  171 ILE H N     1 
ATOM   7584  C CA    . ILE I 1 171 ? -28.407 -81.831 -53.609  1.00 84.75  ?  171 ILE H CA    1 
ATOM   7585  C C     . ILE I 1 171 ? -29.064 -82.931 -52.782  1.00 93.80  ?  171 ILE H C     1 
ATOM   7586  O O     . ILE I 1 171 ? -29.240 -84.050 -53.263  1.00 88.43  ?  171 ILE H O     1 
ATOM   7587  C CB    . ILE I 1 171 ? -29.212 -81.628 -54.904  1.00 76.45  ?  171 ILE H CB    1 
ATOM   7588  C CG1   . ILE I 1 171 ? -28.479 -80.682 -55.858  1.00 91.22  ?  171 ILE H CG1   1 
ATOM   7589  C CG2   . ILE I 1 171 ? -30.575 -81.055 -54.584  1.00 74.93  ?  171 ILE H CG2   1 
ATOM   7590  C CD1   . ILE I 1 171 ? -28.011 -79.395 -55.213  1.00 81.14  ?  171 ILE H CD1   1 
ATOM   7591  N N     . PRO I 1 172 ? -29.435 -82.613 -51.533  1.00 90.30  ?  172 PRO H N     1 
ATOM   7592  C CA    . PRO I 1 172 ? -29.908 -83.653 -50.612  1.00 87.19  ?  172 PRO H CA    1 
ATOM   7593  C C     . PRO I 1 172 ? -31.325 -84.153 -50.891  1.00 89.31  ?  172 PRO H C     1 
ATOM   7594  O O     . PRO I 1 172 ? -31.643 -85.285 -50.528  1.00 98.48  ?  172 PRO H O     1 
ATOM   7595  C CB    . PRO I 1 172 ? -29.857 -82.952 -49.253  1.00 97.09  ?  172 PRO H CB    1 
ATOM   7596  C CG    . PRO I 1 172 ? -30.063 -81.510 -49.579  1.00 96.28  ?  172 PRO H CG    1 
ATOM   7597  C CD    . PRO I 1 172 ? -29.396 -81.283 -50.903  1.00 76.76  ?  172 PRO H CD    1 
ATOM   7598  N N     . ASP I 1 173 ? -32.148 -83.334 -51.542  1.00 86.45  ?  173 ASP H N     1 
ATOM   7599  C CA    . ASP I 1 173 ? -33.569 -83.643 -51.696  1.00 90.68  ?  173 ASP H CA    1 
ATOM   7600  C C     . ASP I 1 173 ? -34.282 -82.654 -52.614  1.00 93.77  ?  173 ASP H C     1 
ATOM   7601  O O     . ASP I 1 173 ? -33.928 -81.479 -52.667  1.00 94.85  ?  173 ASP H O     1 
ATOM   7602  C CB    . ASP I 1 173 ? -34.264 -83.663 -50.332  1.00 90.35  ?  173 ASP H CB    1 
ATOM   7603  C CG    . ASP I 1 173 ? -35.674 -84.219 -50.403  1.00 96.05  ?  173 ASP H CG    1 
ATOM   7604  O OD1   . ASP I 1 173 ? -35.850 -85.430 -50.158  1.00 105.54 ?  173 ASP H OD1   1 
ATOM   7605  O OD2   . ASP I 1 173 ? -36.605 -83.444 -50.710  1.00 85.73  -1 173 ASP H OD2   1 
ATOM   7606  N N     . SER I 1 174 ? -35.271 -83.145 -53.354  1.00 100.62 ?  174 SER H N     1 
ATOM   7607  C CA    . SER I 1 174 ? -36.048 -82.304 -54.260  1.00 94.33  ?  174 SER H CA    1 
ATOM   7608  C C     . SER I 1 174 ? -36.754 -81.152 -53.536  1.00 84.73  ?  174 SER H C     1 
ATOM   7609  O O     . SER I 1 174 ? -36.910 -80.057 -54.089  1.00 79.29  ?  174 SER H O     1 
ATOM   7610  C CB    . SER I 1 174 ? -37.073 -83.153 -55.015  1.00 94.88  ?  174 SER H CB    1 
ATOM   7611  O OG    . SER I 1 174 ? -37.965 -83.796 -54.120  1.00 101.15 ?  174 SER H OG    1 
ATOM   7612  N N     . ASN I 1 175 ? -37.176 -81.393 -52.297  1.00 74.29  ?  175 ASN H N     1 
ATOM   7613  C CA    . ASN I 1 175 ? -37.860 -80.351 -51.543  1.00 83.60  ?  175 ASN H CA    1 
ATOM   7614  C C     . ASN I 1 175 ? -36.904 -79.250 -51.102  1.00 84.42  ?  175 ASN H C     1 
ATOM   7615  O O     . ASN I 1 175 ? -37.316 -78.103 -50.882  1.00 83.66  ?  175 ASN H O     1 
ATOM   7616  C CB    . ASN I 1 175 ? -38.556 -80.958 -50.322  1.00 95.74  ?  175 ASN H CB    1 
ATOM   7617  C CG    . ASN I 1 175 ? -39.766 -81.794 -50.695  1.00 102.79 ?  175 ASN H CG    1 
ATOM   7618  O OD1   . ASN I 1 175 ? -40.493 -81.472 -51.634  1.00 109.43 ?  175 ASN H OD1   1 
ATOM   7619  N ND2   . ASN I 1 175 ? -39.985 -82.878 -49.959  1.00 92.58  ?  175 ASN H ND2   1 
ATOM   7620  N N     . TRP I 1 176 ? -35.622 -79.595 -50.998  1.00 78.25  ?  176 TRP H N     1 
ATOM   7621  C CA    . TRP I 1 176 ? -34.590 -78.598 -50.754  1.00 67.48  ?  176 TRP H CA    1 
ATOM   7622  C C     . TRP I 1 176 ? -34.615 -77.628 -51.919  1.00 67.08  ?  176 TRP H C     1 
ATOM   7623  O O     . TRP I 1 176 ? -34.569 -76.413 -51.743  1.00 63.08  ?  176 TRP H O     1 
ATOM   7624  C CB    . TRP I 1 176 ? -33.208 -79.232 -50.611  1.00 72.55  ?  176 TRP H CB    1 
ATOM   7625  C CG    . TRP I 1 176 ? -32.140 -78.227 -50.321  1.00 76.63  ?  176 TRP H CG    1 
ATOM   7626  C CD1   . TRP I 1 176 ? -31.693 -77.838 -49.091  1.00 64.40  ?  176 TRP H CD1   1 
ATOM   7627  C CD2   . TRP I 1 176 ? -31.413 -77.446 -51.277  1.00 68.07  ?  176 TRP H CD2   1 
ATOM   7628  N NE1   . TRP I 1 176 ? -30.717 -76.880 -49.224  1.00 74.19  ?  176 TRP H NE1   1 
ATOM   7629  C CE2   . TRP I 1 176 ? -30.528 -76.620 -50.557  1.00 73.59  ?  176 TRP H CE2   1 
ATOM   7630  C CE3   . TRP I 1 176 ? -31.418 -77.373 -52.673  1.00 50.59  ?  176 TRP H CE3   1 
ATOM   7631  C CZ2   . TRP I 1 176 ? -29.658 -75.732 -51.185  1.00 68.19  ?  176 TRP H CZ2   1 
ATOM   7632  C CZ3   . TRP I 1 176 ? -30.554 -76.491 -53.294  1.00 73.45  ?  176 TRP H CZ3   1 
ATOM   7633  C CH2   . TRP I 1 176 ? -29.686 -75.683 -52.551  1.00 72.80  ?  176 TRP H CH2   1 
ATOM   7634  N N     . VAL I 1 177 ? -34.681 -78.202 -53.117  1.00 78.10  ?  177 VAL H N     1 
ATOM   7635  C CA    . VAL I 1 177 ? -34.727 -77.451 -54.362  1.00 71.80  ?  177 VAL H CA    1 
ATOM   7636  C C     . VAL I 1 177 ? -35.967 -76.572 -54.397  1.00 63.49  ?  177 VAL H C     1 
ATOM   7637  O O     . VAL I 1 177 ? -35.906 -75.421 -54.823  1.00 58.19  ?  177 VAL H O     1 
ATOM   7638  C CB    . VAL I 1 177 ? -34.719 -78.378 -55.595  1.00 60.06  ?  177 VAL H CB    1 
ATOM   7639  C CG1   . VAL I 1 177 ? -34.754 -77.560 -56.874  1.00 59.92  ?  177 VAL H CG1   1 
ATOM   7640  C CG2   . VAL I 1 177 ? -33.498 -79.275 -55.577  1.00 74.19  ?  177 VAL H CG2   1 
ATOM   7641  N N     . ALA I 1 178 ? -37.094 -77.120 -53.951  1.00 51.55  ?  178 ALA H N     1 
ATOM   7642  C CA    . ALA I 1 178 ? -38.329 -76.343 -53.904  1.00 51.63  ?  178 ALA H CA    1 
ATOM   7643  C C     . ALA I 1 178 ? -38.205 -75.128 -52.985  1.00 64.64  ?  178 ALA H C     1 
ATOM   7644  O O     . ALA I 1 178 ? -38.631 -74.026 -53.344  1.00 66.73  ?  178 ALA H O     1 
ATOM   7645  C CB    . ALA I 1 178 ? -39.485 -77.221 -53.459  1.00 48.26  ?  178 ALA H CB    1 
ATOM   7646  N N     . GLY I 1 179 ? -37.608 -75.319 -51.812  1.00 73.47  ?  179 GLY H N     1 
ATOM   7647  C CA    . GLY I 1 179 ? -37.436 -74.213 -50.885  1.00 65.80  ?  179 GLY H CA    1 
ATOM   7648  C C     . GLY I 1 179 ? -36.466 -73.168 -51.411  1.00 67.75  ?  179 GLY H C     1 
ATOM   7649  O O     . GLY I 1 179 ? -36.732 -71.958 -51.362  1.00 75.55  ?  179 GLY H O     1 
ATOM   7650  N N     . PHE I 1 180 ? -35.348 -73.647 -51.950  1.00 61.13  ?  180 PHE H N     1 
ATOM   7651  C CA    . PHE I 1 180 ? -34.327 -72.777 -52.520  1.00 59.29  ?  180 PHE H CA    1 
ATOM   7652  C C     . PHE I 1 180 ? -34.876 -71.946 -53.665  1.00 58.64  ?  180 PHE H C     1 
ATOM   7653  O O     . PHE I 1 180 ? -34.559 -70.769 -53.788  1.00 62.03  ?  180 PHE H O     1 
ATOM   7654  C CB    . PHE I 1 180 ? -33.127 -73.594 -53.004  1.00 60.93  ?  180 PHE H CB    1 
ATOM   7655  C CG    . PHE I 1 180 ? -31.910 -72.762 -53.295  1.00 54.25  ?  180 PHE H CG    1 
ATOM   7656  C CD1   . PHE I 1 180 ? -31.258 -72.086 -52.279  1.00 69.10  ?  180 PHE H CD1   1 
ATOM   7657  C CD2   . PHE I 1 180 ? -31.424 -72.649 -54.587  1.00 52.00  ?  180 PHE H CD2   1 
ATOM   7658  C CE1   . PHE I 1 180 ? -30.140 -71.315 -52.544  1.00 67.02  ?  180 PHE H CE1   1 
ATOM   7659  C CE2   . PHE I 1 180 ? -30.307 -71.879 -54.859  1.00 59.58  ?  180 PHE H CE2   1 
ATOM   7660  C CZ    . PHE I 1 180 ? -29.664 -71.212 -53.835  1.00 55.23  ?  180 PHE H CZ    1 
ATOM   7661  N N     . THR I 1 181 ? -35.683 -72.564 -54.517  1.00 55.96  ?  181 THR H N     1 
ATOM   7662  C CA    . THR I 1 181 ? -36.218 -71.858 -55.668  1.00 61.28  ?  181 THR H CA    1 
ATOM   7663  C C     . THR I 1 181 ? -37.270 -70.882 -55.172  1.00 64.09  ?  181 THR H C     1 
ATOM   7664  O O     . THR I 1 181 ? -37.458 -69.809 -55.744  1.00 65.87  ?  181 THR H O     1 
ATOM   7665  C CB    . THR I 1 181 ? -36.825 -72.813 -56.705  1.00 64.01  ?  181 THR H CB    1 
ATOM   7666  O OG1   . THR I 1 181 ? -37.687 -73.748 -56.046  1.00 76.11  ?  181 THR H OG1   1 
ATOM   7667  C CG2   . THR I 1 181 ? -35.723 -73.568 -57.432  1.00 66.62  ?  181 THR H CG2   1 
ATOM   7668  N N     . ALA I 1 182 ? -37.961 -71.270 -54.103  1.00 54.14  ?  182 ALA H N     1 
ATOM   7669  C CA    . ALA I 1 182 ? -38.952 -70.393 -53.496  1.00 49.65  ?  182 ALA H CA    1 
ATOM   7670  C C     . ALA I 1 182 ? -38.279 -69.145 -52.935  1.00 58.48  ?  182 ALA H C     1 
ATOM   7671  O O     . ALA I 1 182 ? -38.909 -68.092 -52.827  1.00 53.73  ?  182 ALA H O     1 
ATOM   7672  C CB    . ALA I 1 182 ? -39.718 -71.122 -52.407  1.00 63.86  ?  182 ALA H CB    1 
ATOM   7673  N N     . GLY I 1 183 ? -37.004 -69.264 -52.566  1.00 56.84  ?  183 GLY H N     1 
ATOM   7674  C CA    . GLY I 1 183 ? -36.257 -68.101 -52.113  1.00 49.48  ?  183 GLY H CA    1 
ATOM   7675  C C     . GLY I 1 183 ? -35.599 -67.276 -53.209  1.00 55.15  ?  183 GLY H C     1 
ATOM   7676  O O     . GLY I 1 183 ? -35.806 -66.065 -53.293  1.00 59.92  ?  183 GLY H O     1 
ATOM   7677  N N     . GLU I 1 184 ? -34.803 -67.933 -54.050  1.00 56.37  ?  184 GLU H N     1 
ATOM   7678  C CA    . GLU I 1 184 ? -33.922 -67.250 -55.000  1.00 62.52  ?  184 GLU H CA    1 
ATOM   7679  C C     . GLU I 1 184 ? -34.407 -67.313 -56.439  1.00 55.77  ?  184 GLU H C     1 
ATOM   7680  O O     . GLU I 1 184 ? -33.808 -66.701 -57.322  1.00 49.75  ?  184 GLU H O     1 
ATOM   7681  C CB    . GLU I 1 184 ? -32.496 -67.813 -54.946  1.00 66.79  ?  184 GLU H CB    1 
ATOM   7682  C CG    . GLU I 1 184 ? -31.905 -68.040 -53.565  1.00 52.93  ?  184 GLU H CG    1 
ATOM   7683  C CD    . GLU I 1 184 ? -31.540 -66.752 -52.835  1.00 57.00  ?  184 GLU H CD    1 
ATOM   7684  O OE1   . GLU I 1 184 ? -32.317 -65.776 -52.879  1.00 50.37  ?  184 GLU H OE1   1 
ATOM   7685  O OE2   . GLU I 1 184 ? -30.454 -66.714 -52.217  1.00 75.59  -1 184 GLU H OE2   1 
ATOM   7686  N N     . GLY I 1 185 ? -35.480 -68.052 -56.688  1.00 58.79  ?  185 GLY H N     1 
ATOM   7687  C CA    . GLY I 1 185 ? -35.873 -68.303 -58.059  1.00 55.66  ?  185 GLY H CA    1 
ATOM   7688  C C     . GLY I 1 185 ? -36.708 -67.189 -58.646  1.00 51.71  ?  185 GLY H C     1 
ATOM   7689  O O     . GLY I 1 185 ? -37.239 -66.342 -57.927  1.00 55.88  ?  185 GLY H O     1 
ATOM   7690  N N     . SER I 1 186 ? -36.809 -67.192 -59.970  1.00 57.45  ?  186 SER H N     1 
ATOM   7691  C CA    . SER I 1 186 ? -37.652 -66.250 -60.681  1.00 63.89  ?  186 SER H CA    1 
ATOM   7692  C C     . SER I 1 186 ? -38.295 -66.905 -61.895  1.00 59.15  ?  186 SER H C     1 
ATOM   7693  O O     . SER I 1 186 ? -37.624 -67.556 -62.700  1.00 55.82  ?  186 SER H O     1 
ATOM   7694  C CB    . SER I 1 186 ? -36.834 -65.034 -61.119  1.00 52.47  ?  186 SER H CB    1 
ATOM   7695  O OG    . SER I 1 186 ? -37.678 -63.970 -61.521  1.00 67.16  ?  186 SER H OG    1 
ATOM   7696  N N     . PHE I 1 187 ? -39.604 -66.719 -62.010  1.00 59.34  ?  187 PHE H N     1 
ATOM   7697  C CA    . PHE I 1 187 ? -40.359 -67.148 -63.177  1.00 61.18  ?  187 PHE H CA    1 
ATOM   7698  C C     . PHE I 1 187 ? -40.870 -65.919 -63.911  1.00 66.04  ?  187 PHE H C     1 
ATOM   7699  O O     . PHE I 1 187 ? -41.825 -65.290 -63.455  1.00 70.51  ?  187 PHE H O     1 
ATOM   7700  C CB    . PHE I 1 187 ? -41.534 -68.037 -62.769  1.00 64.46  ?  187 PHE H CB    1 
ATOM   7701  C CG    . PHE I 1 187 ? -41.136 -69.260 -61.998  1.00 53.39  ?  187 PHE H CG    1 
ATOM   7702  C CD1   . PHE I 1 187 ? -40.810 -70.432 -62.655  1.00 49.90  ?  187 PHE H CD1   1 
ATOM   7703  C CD2   . PHE I 1 187 ? -41.095 -69.237 -60.617  1.00 41.56  ?  187 PHE H CD2   1 
ATOM   7704  C CE1   . PHE I 1 187 ? -40.454 -71.560 -61.949  1.00 52.10  ?  187 PHE H CE1   1 
ATOM   7705  C CE2   . PHE I 1 187 ? -40.735 -70.361 -59.905  1.00 58.30  ?  187 PHE H CE2   1 
ATOM   7706  C CZ    . PHE I 1 187 ? -40.413 -71.524 -60.572  1.00 68.29  ?  187 PHE H CZ    1 
ATOM   7707  N N     . TYR I 1 188 ? -40.259 -65.555 -65.033  1.00 62.22  ?  188 TYR H N     1 
ATOM   7708  C CA    . TYR I 1 188 ? -40.741 -64.354 -65.711  1.00 65.24  ?  188 TYR H CA    1 
ATOM   7709  C C     . TYR I 1 188 ? -40.883 -64.534 -67.214  1.00 62.56  ?  188 TYR H C     1 
ATOM   7710  O O     . TYR I 1 188 ? -40.269 -65.414 -67.813  1.00 60.17  ?  188 TYR H O     1 
ATOM   7711  C CB    . TYR I 1 188 ? -39.840 -63.148 -65.406  1.00 53.72  ?  188 TYR H CB    1 
ATOM   7712  C CG    . TYR I 1 188 ? -38.386 -63.305 -65.779  1.00 49.22  ?  188 TYR H CG    1 
ATOM   7713  C CD1   . TYR I 1 188 ? -37.455 -63.741 -64.848  1.00 50.26  ?  188 TYR H CD1   1 
ATOM   7714  C CD2   . TYR I 1 188 ? -37.937 -62.987 -67.054  1.00 67.19  ?  188 TYR H CD2   1 
ATOM   7715  C CE1   . TYR I 1 188 ? -36.125 -63.877 -65.181  1.00 55.57  ?  188 TYR H CE1   1 
ATOM   7716  C CE2   . TYR I 1 188 ? -36.606 -63.117 -67.396  1.00 65.11  ?  188 TYR H CE2   1 
ATOM   7717  C CZ    . TYR I 1 188 ? -35.705 -63.562 -66.455  1.00 59.47  ?  188 TYR H CZ    1 
ATOM   7718  O OH    . TYR I 1 188 ? -34.377 -63.698 -66.787  1.00 63.77  ?  188 TYR H OH    1 
ATOM   7719  N N     . ILE I 1 189 ? -41.703 -63.677 -67.811  1.00 63.21  ?  189 ILE H N     1 
ATOM   7720  C CA    . ILE I 1 189 ? -41.915 -63.684 -69.248  1.00 61.67  ?  189 ILE H CA    1 
ATOM   7721  C C     . ILE I 1 189 ? -41.172 -62.522 -69.885  1.00 65.95  ?  189 ILE H C     1 
ATOM   7722  O O     . ILE I 1 189 ? -41.411 -61.358 -69.562  1.00 70.89  ?  189 ILE H O     1 
ATOM   7723  C CB    . ILE I 1 189 ? -43.410 -63.598 -69.604  1.00 58.38  ?  189 ILE H CB    1 
ATOM   7724  C CG1   . ILE I 1 189 ? -44.165 -64.792 -69.018  1.00 55.32  ?  189 ILE H CG1   1 
ATOM   7725  C CG2   . ILE I 1 189 ? -43.597 -63.536 -71.111  1.00 77.97  ?  189 ILE H CG2   1 
ATOM   7726  C CD1   . ILE I 1 189 ? -43.539 -66.128 -69.347  1.00 54.44  ?  189 ILE H CD1   1 
ATOM   7727  N N     . ARG I 1 190 ? -40.263 -62.857 -70.792  1.00 63.74  ?  190 ARG H N     1 
ATOM   7728  C CA    . ARG I 1 190 ? -39.459 -61.865 -71.482  1.00 66.71  ?  190 ARG H CA    1 
ATOM   7729  C C     . ARG I 1 190 ? -40.085 -61.531 -72.827  1.00 76.40  ?  190 ARG H C     1 
ATOM   7730  O O     . ARG I 1 190 ? -40.330 -62.415 -73.648  1.00 76.94  ?  190 ARG H O     1 
ATOM   7731  C CB    . ARG I 1 190 ? -38.038 -62.398 -71.679  1.00 58.29  ?  190 ARG H CB    1 
ATOM   7732  C CG    . ARG I 1 190 ? -37.093 -61.484 -72.437  1.00 60.98  ?  190 ARG H CG    1 
ATOM   7733  C CD    . ARG I 1 190 ? -35.680 -61.612 -71.887  1.00 64.57  ?  190 ARG H CD    1 
ATOM   7734  N NE    . ARG I 1 190 ? -35.038 -62.845 -72.341  1.00 63.13  ?  190 ARG H NE    1 
ATOM   7735  C CZ    . ARG I 1 190 ? -34.016 -63.430 -71.724  1.00 60.23  ?  190 ARG H CZ    1 
ATOM   7736  N NH1   . ARG I 1 190 ? -33.512 -62.895 -70.621  1.00 74.78  1  190 ARG H NH1   1 
ATOM   7737  N NH2   . ARG I 1 190 ? -33.497 -64.551 -72.209  1.00 48.99  ?  190 ARG H NH2   1 
ATOM   7738  N N     . ILE I 1 191 ? -40.341 -60.246 -73.043  1.00 79.27  ?  191 ILE H N     1 
ATOM   7739  C CA    . ILE I 1 191 ? -40.853 -59.764 -74.317  1.00 64.73  ?  191 ILE H CA    1 
ATOM   7740  C C     . ILE I 1 191 ? -39.842 -58.805 -74.941  1.00 79.49  ?  191 ILE H C     1 
ATOM   7741  O O     . ILE I 1 191 ? -39.453 -57.807 -74.332  1.00 73.41  ?  191 ILE H O     1 
ATOM   7742  C CB    . ILE I 1 191 ? -42.249 -59.097 -74.168  1.00 68.57  ?  191 ILE H CB    1 
ATOM   7743  C CG1   . ILE I 1 191 ? -42.227 -57.950 -73.153  1.00 93.36  ?  191 ILE H CG1   1 
ATOM   7744  C CG2   . ILE I 1 191 ? -43.279 -60.124 -73.728  1.00 67.23  ?  191 ILE H CG2   1 
ATOM   7745  C CD1   . ILE I 1 191 ? -42.327 -56.570 -73.778  1.00 87.13  ?  191 ILE H CD1   1 
ATOM   7746  N N     . ALA I 1 192 ? -39.378 -59.131 -76.141  1.00 87.70  ?  192 ALA H N     1 
ATOM   7747  C CA    . ALA I 1 192 ? -38.372 -58.298 -76.789  1.00 82.31  ?  192 ALA H CA    1 
ATOM   7748  C C     . ALA I 1 192 ? -38.913 -57.698 -78.074  1.00 85.60  ?  192 ALA H C     1 
ATOM   7749  O O     . ALA I 1 192 ? -39.430 -58.417 -78.922  1.00 81.04  ?  192 ALA H O     1 
ATOM   7750  C CB    . ALA I 1 192 ? -37.119 -59.108 -77.074  1.00 70.09  ?  192 ALA H CB    1 
ATOM   7751  N N     . LYS I 1 193 ? -38.792 -56.382 -78.223  1.00 92.41  ?  193 LYS H N     1 
ATOM   7752  C CA    . LYS I 1 193 ? -39.185 -55.754 -79.475  1.00 95.93  ?  193 LYS H CA    1 
ATOM   7753  C C     . LYS I 1 193 ? -38.256 -56.255 -80.569  1.00 96.43  ?  193 LYS H C     1 
ATOM   7754  O O     . LYS I 1 193 ? -37.035 -56.160 -80.448  1.00 92.72  ?  193 LYS H O     1 
ATOM   7755  C CB    . LYS I 1 193 ? -39.134 -54.229 -79.367  1.00 94.16  ?  193 LYS H CB    1 
ATOM   7756  N N     . ASN I 1 194 ? -38.838 -56.786 -81.638  1.00 90.62  ?  194 ASN H N     1 
ATOM   7757  C CA    . ASN I 1 194 ? -38.052 -57.437 -82.675  1.00 90.18  ?  194 ASN H CA    1 
ATOM   7758  C C     . ASN I 1 194 ? -38.849 -57.481 -83.974  1.00 95.43  ?  194 ASN H C     1 
ATOM   7759  O O     . ASN I 1 194 ? -39.814 -58.237 -84.098  1.00 85.70  ?  194 ASN H O     1 
ATOM   7760  C CB    . ASN I 1 194 ? -37.642 -58.843 -82.226  1.00 75.06  ?  194 ASN H CB    1 
ATOM   7761  C CG    . ASN I 1 194 ? -36.705 -59.535 -83.207  1.00 80.06  ?  194 ASN H CG    1 
ATOM   7762  O OD1   . ASN I 1 194 ? -36.773 -59.329 -84.418  1.00 94.51  ?  194 ASN H OD1   1 
ATOM   7763  N ND2   . ASN I 1 194 ? -35.820 -60.370 -82.675  1.00 78.98  ?  194 ASN H ND2   1 
ATOM   7764  N N     . SER I 1 195 ? -38.438 -56.663 -84.935  1.00 96.53  ?  195 SER H N     1 
ATOM   7765  C CA    . SER I 1 195 ? -39.188 -56.484 -86.172  1.00 89.42  ?  195 SER H CA    1 
ATOM   7766  C C     . SER I 1 195 ? -39.222 -57.736 -87.047  1.00 84.98  ?  195 SER H C     1 
ATOM   7767  O O     . SER I 1 195 ? -40.114 -57.884 -87.882  1.00 86.48  ?  195 SER H O     1 
ATOM   7768  C CB    . SER I 1 195 ? -38.604 -55.316 -86.969  1.00 89.24  ?  195 SER H CB    1 
ATOM   7769  O OG    . SER I 1 195 ? -37.202 -55.457 -87.118  1.00 95.08  ?  195 SER H OG    1 
ATOM   7770  N N     . THR I 1 196 ? -38.256 -58.632 -86.861  1.00 81.28  ?  196 THR H N     1 
ATOM   7771  C CA    . THR I 1 196 ? -38.193 -59.845 -87.674  1.00 81.46  ?  196 THR H CA    1 
ATOM   7772  C C     . THR I 1 196 ? -39.263 -60.875 -87.312  1.00 79.13  ?  196 THR H C     1 
ATOM   7773  O O     . THR I 1 196 ? -39.356 -61.929 -87.941  1.00 80.01  ?  196 THR H O     1 
ATOM   7774  C CB    . THR I 1 196 ? -36.815 -60.523 -87.552  1.00 72.25  ?  196 THR H CB    1 
ATOM   7775  O OG1   . THR I 1 196 ? -36.680 -61.108 -86.251  1.00 75.46  ?  196 THR H OG1   1 
ATOM   7776  C CG2   . THR I 1 196 ? -35.702 -59.509 -87.764  1.00 89.70  ?  196 THR H CG2   1 
ATOM   7777  N N     . LEU I 1 197 ? -40.063 -60.572 -86.297  1.00 80.85  ?  197 LEU H N     1 
ATOM   7778  C CA    . LEU I 1 197 ? -41.214 -61.398 -85.949  1.00 75.30  ?  197 LEU H CA    1 
ATOM   7779  C C     . LEU I 1 197 ? -42.517 -60.749 -86.393  1.00 76.65  ?  197 LEU H C     1 
ATOM   7780  O O     . LEU I 1 197 ? -42.638 -59.523 -86.386  1.00 70.69  ?  197 LEU H O     1 
ATOM   7781  C CB    . LEU I 1 197 ? -41.235 -61.689 -84.451  1.00 71.20  ?  197 LEU H CB    1 
ATOM   7782  C CG    . LEU I 1 197 ? -40.062 -62.565 -84.008  1.00 70.42  ?  197 LEU H CG    1 
ATOM   7783  C CD1   . LEU I 1 197 ? -39.290 -61.913 -82.883  1.00 71.75  ?  197 LEU H CD1   1 
ATOM   7784  C CD2   . LEU I 1 197 ? -40.552 -63.948 -83.599  1.00 62.73  ?  197 LEU H CD2   1 
ATOM   7785  N N     . LYS I 1 198 ? -43.479 -61.576 -86.794  1.00 77.21  ?  198 LYS H N     1 
ATOM   7786  C CA    . LYS I 1 198 ? -44.743 -61.087 -87.333  1.00 73.60  ?  198 LYS H CA    1 
ATOM   7787  C C     . LYS I 1 198 ? -45.457 -60.177 -86.339  1.00 85.31  ?  198 LYS H C     1 
ATOM   7788  O O     . LYS I 1 198 ? -45.998 -59.139 -86.719  1.00 87.79  ?  198 LYS H O     1 
ATOM   7789  C CB    . LYS I 1 198 ? -45.652 -62.257 -87.717  1.00 55.82  ?  198 LYS H CB    1 
ATOM   7790  N N     . THR I 1 199 ? -45.455 -60.564 -85.066  1.00 92.04  ?  199 THR H N     1 
ATOM   7791  C CA    . THR I 1 199 ? -46.121 -59.769 -84.040  1.00 86.31  ?  199 THR H CA    1 
ATOM   7792  C C     . THR I 1 199 ? -45.311 -58.529 -83.673  1.00 78.33  ?  199 THR H C     1 
ATOM   7793  O O     . THR I 1 199 ? -45.824 -57.609 -83.035  1.00 73.86  ?  199 THR H O     1 
ATOM   7794  C CB    . THR I 1 199 ? -46.370 -60.595 -82.766  1.00 85.39  ?  199 THR H CB    1 
ATOM   7795  O OG1   . THR I 1 199 ? -45.133 -61.150 -82.305  1.00 88.04  ?  199 THR H OG1   1 
ATOM   7796  C CG2   . THR I 1 199 ? -47.350 -61.720 -83.048  1.00 87.76  ?  199 THR H CG2   1 
ATOM   7797  N N     . GLY I 1 200 ? -44.045 -58.507 -84.075  1.00 80.40  ?  200 GLY H N     1 
ATOM   7798  C CA    . GLY I 1 200 ? -43.157 -57.420 -83.709  1.00 78.43  ?  200 GLY H CA    1 
ATOM   7799  C C     . GLY I 1 200 ? -42.415 -57.655 -82.408  1.00 91.92  ?  200 GLY H C     1 
ATOM   7800  O O     . GLY I 1 200 ? -41.617 -56.819 -81.980  1.00 91.63  ?  200 GLY H O     1 
ATOM   7801  N N     . TYR I 1 201 ? -42.675 -58.796 -81.775  1.00 95.87  ?  201 TYR H N     1 
ATOM   7802  C CA    . TYR I 1 201 ? -42.046 -59.123 -80.500  1.00 80.66  ?  201 TYR H CA    1 
ATOM   7803  C C     . TYR I 1 201 ? -41.719 -60.606 -80.375  1.00 66.31  ?  201 TYR H C     1 
ATOM   7804  O O     . TYR I 1 201 ? -42.531 -61.461 -80.732  1.00 60.70  ?  201 TYR H O     1 
ATOM   7805  C CB    . TYR I 1 201 ? -42.949 -58.709 -79.331  1.00 83.61  ?  201 TYR H CB    1 
ATOM   7806  C CG    . TYR I 1 201 ? -43.223 -57.224 -79.238  1.00 91.34  ?  201 TYR H CG    1 
ATOM   7807  C CD1   . TYR I 1 201 ? -42.455 -56.409 -78.418  1.00 89.63  ?  201 TYR H CD1   1 
ATOM   7808  C CD2   . TYR I 1 201 ? -44.272 -56.645 -79.940  1.00 99.90  ?  201 TYR H CD2   1 
ATOM   7809  C CE1   . TYR I 1 201 ? -42.705 -55.053 -78.323  1.00 87.34  ?  201 TYR H CE1   1 
ATOM   7810  C CE2   . TYR I 1 201 ? -44.531 -55.292 -79.851  1.00 100.93 ?  201 TYR H CE2   1 
ATOM   7811  C CZ    . TYR I 1 201 ? -43.746 -54.501 -79.040  1.00 93.07  ?  201 TYR H CZ    1 
ATOM   7812  O OH    . TYR I 1 201 ? -44.003 -53.152 -78.949  1.00 84.96  ?  201 TYR H OH    1 
ATOM   7813  N N     . GLN I 1 202 ? -40.533 -60.911 -79.855  1.00 66.78  ?  202 GLN H N     1 
ATOM   7814  C CA    . GLN I 1 202 ? -40.261 -62.266 -79.403  1.00 62.13  ?  202 GLN H CA    1 
ATOM   7815  C C     . GLN I 1 202 ? -40.815 -62.440 -77.996  1.00 75.25  ?  202 GLN H C     1 
ATOM   7816  O O     . GLN I 1 202 ? -40.711 -61.541 -77.154  1.00 69.60  ?  202 GLN H O     1 
ATOM   7817  C CB    . GLN I 1 202 ? -38.757 -62.553 -79.425  1.00 46.53  ?  202 GLN H CB    1 
ATOM   7818  C CG    . GLN I 1 202 ? -38.377 -63.983 -79.068  1.00 47.12  ?  202 GLN H CG    1 
ATOM   7819  C CD    . GLN I 1 202 ? -36.875 -64.196 -79.044  1.00 51.93  ?  202 GLN H CD    1 
ATOM   7820  O OE1   . GLN I 1 202 ? -36.100 -63.258 -79.237  1.00 49.02  ?  202 GLN H OE1   1 
ATOM   7821  N NE2   . GLN I 1 202 ? -36.456 -65.434 -78.811  1.00 44.24  ?  202 GLN H NE2   1 
ATOM   7822  N N     . VAL I 1 203 ? -41.384 -63.614 -77.748  1.00 76.56  ?  203 VAL H N     1 
ATOM   7823  C CA    . VAL I 1 203 ? -41.874 -63.987 -76.430  1.00 53.71  ?  203 VAL H CA    1 
ATOM   7824  C C     . VAL I 1 203 ? -41.133 -65.207 -75.907  1.00 56.30  ?  203 VAL H C     1 
ATOM   7825  O O     . VAL I 1 203 ? -41.042 -66.226 -76.592  1.00 60.55  ?  203 VAL H O     1 
ATOM   7826  C CB    . VAL I 1 203 ? -43.386 -64.272 -76.447  1.00 67.76  ?  203 VAL H CB    1 
ATOM   7827  C CG1   . VAL I 1 203 ? -43.868 -64.654 -75.056  1.00 58.60  ?  203 VAL H CG1   1 
ATOM   7828  C CG2   . VAL I 1 203 ? -44.146 -63.057 -76.954  1.00 80.12  ?  203 VAL H CG2   1 
ATOM   7829  N N     . GLN I 1 204 ? -40.605 -65.108 -74.695  1.00 70.49  ?  204 GLN H N     1 
ATOM   7830  C CA    . GLN I 1 204 ? -39.838 -66.201 -74.122  1.00 59.44  ?  204 GLN H CA    1 
ATOM   7831  C C     . GLN I 1 204 ? -40.280 -66.432 -72.687  1.00 56.53  ?  204 GLN H C     1 
ATOM   7832  O O     . GLN I 1 204 ? -40.475 -65.483 -71.935  1.00 58.35  ?  204 GLN H O     1 
ATOM   7833  C CB    . GLN I 1 204 ? -38.339 -65.897 -74.164  1.00 57.34  ?  204 GLN H CB    1 
ATOM   7834  C CG    . GLN I 1 204 ? -37.639 -66.326 -75.440  1.00 50.10  ?  204 GLN H CG    1 
ATOM   7835  C CD    . GLN I 1 204 ? -36.151 -66.035 -75.405  1.00 57.45  ?  204 GLN H CD    1 
ATOM   7836  O OE1   . GLN I 1 204 ? -35.732 -64.892 -75.216  1.00 46.16  ?  204 GLN H OE1   1 
ATOM   7837  N NE2   . GLN I 1 204 ? -35.345 -67.073 -75.586  1.00 51.62  ?  204 GLN H NE2   1 
ATOM   7838  N N     . SER I 1 205 ? -40.447 -67.693 -72.308  1.00 56.15  ?  205 SER H N     1 
ATOM   7839  C CA    . SER I 1 205 ? -40.676 -68.012 -70.909  1.00 48.86  ?  205 SER H CA    1 
ATOM   7840  C C     . SER I 1 205 ? -39.337 -68.322 -70.264  1.00 57.84  ?  205 SER H C     1 
ATOM   7841  O O     . SER I 1 205 ? -38.544 -69.097 -70.801  1.00 66.50  ?  205 SER H O     1 
ATOM   7842  C CB    . SER I 1 205 ? -41.638 -69.188 -70.766  1.00 42.11  ?  205 SER H CB    1 
ATOM   7843  O OG    . SER I 1 205 ? -41.109 -70.352 -71.373  1.00 60.36  ?  205 SER H OG    1 
ATOM   7844  N N     . VAL I 1 206 ? -39.079 -67.706 -69.117  1.00 58.61  ?  206 VAL H N     1 
ATOM   7845  C CA    . VAL I 1 206 ? -37.774 -67.824 -68.486  1.00 56.66  ?  206 VAL H CA    1 
ATOM   7846  C C     . VAL I 1 206 ? -37.859 -68.286 -67.037  1.00 59.49  ?  206 VAL H C     1 
ATOM   7847  O O     . VAL I 1 206 ? -38.643 -67.744 -66.240  1.00 57.57  ?  206 VAL H O     1 
ATOM   7848  C CB    . VAL I 1 206 ? -37.011 -66.483 -68.531  1.00 58.16  ?  206 VAL H CB    1 
ATOM   7849  C CG1   . VAL I 1 206 ? -35.619 -66.644 -67.944  1.00 52.38  ?  206 VAL H CG1   1 
ATOM   7850  C CG2   . VAL I 1 206 ? -36.928 -65.963 -69.959  1.00 70.10  ?  206 VAL H CG2   1 
ATOM   7851  N N     . PHE I 1 207 ? -37.030 -69.274 -66.704  1.00 60.43  ?  207 PHE H N     1 
ATOM   7852  C CA    . PHE I 1 207 ? -36.827 -69.656 -65.312  1.00 45.29  ?  207 PHE H CA    1 
ATOM   7853  C C     . PHE I 1 207 ? -35.394 -69.346 -64.925  1.00 52.89  ?  207 PHE H C     1 
ATOM   7854  O O     . PHE I 1 207 ? -34.476 -69.576 -65.703  1.00 65.14  ?  207 PHE H O     1 
ATOM   7855  C CB    . PHE I 1 207 ? -37.128 -71.137 -65.090  1.00 43.78  ?  207 PHE H CB    1 
ATOM   7856  C CG    . PHE I 1 207 ? -36.672 -71.651 -63.756  1.00 51.67  ?  207 PHE H CG    1 
ATOM   7857  C CD1   . PHE I 1 207 ? -37.259 -71.199 -62.589  1.00 53.82  ?  207 PHE H CD1   1 
ATOM   7858  C CD2   . PHE I 1 207 ? -35.658 -72.591 -63.669  1.00 54.11  ?  207 PHE H CD2   1 
ATOM   7859  C CE1   . PHE I 1 207 ? -36.844 -71.668 -61.358  1.00 47.76  ?  207 PHE H CE1   1 
ATOM   7860  C CE2   . PHE I 1 207 ? -35.238 -73.066 -62.440  1.00 49.77  ?  207 PHE H CE2   1 
ATOM   7861  C CZ    . PHE I 1 207 ? -35.833 -72.603 -61.283  1.00 47.19  ?  207 PHE H CZ    1 
ATOM   7862  N N     . GLN I 1 208 ? -35.197 -68.814 -63.726  1.00 53.10  ?  208 GLN H N     1 
ATOM   7863  C CA    . GLN I 1 208 ? -33.882 -68.301 -63.371  1.00 47.77  ?  208 GLN H CA    1 
ATOM   7864  C C     . GLN I 1 208 ? -33.569 -68.496 -61.892  1.00 52.57  ?  208 GLN H C     1 
ATOM   7865  O O     . GLN I 1 208 ? -34.462 -68.425 -61.054  1.00 58.13  ?  208 GLN H O     1 
ATOM   7866  C CB    . GLN I 1 208 ? -33.791 -66.817 -63.750  1.00 40.92  ?  208 GLN H CB    1 
ATOM   7867  C CG    . GLN I 1 208 ? -32.562 -66.088 -63.232  1.00 43.94  ?  208 GLN H CG    1 
ATOM   7868  C CD    . GLN I 1 208 ? -32.532 -64.630 -63.653  1.00 52.83  ?  208 GLN H CD    1 
ATOM   7869  O OE1   . GLN I 1 208 ? -33.541 -63.930 -63.582  1.00 47.13  ?  208 GLN H OE1   1 
ATOM   7870  N NE2   . GLN I 1 208 ? -31.372 -64.169 -64.105  1.00 51.41  ?  208 GLN H NE2   1 
ATOM   7871  N N     . ILE I 1 209 ? -32.304 -68.752 -61.569  1.00 47.22  ?  209 ILE H N     1 
ATOM   7872  C CA    . ILE I 1 209 ? -31.874 -68.679 -60.178  1.00 43.09  ?  209 ILE H CA    1 
ATOM   7873  C C     . ILE I 1 209 ? -30.597 -67.854 -60.117  1.00 39.51  ?  209 ILE H C     1 
ATOM   7874  O O     . ILE I 1 209 ? -29.678 -68.061 -60.898  1.00 49.81  ?  209 ILE H O     1 
ATOM   7875  C CB    . ILE I 1 209 ? -31.628 -70.078 -59.566  1.00 39.78  ?  209 ILE H CB    1 
ATOM   7876  C CG1   . ILE I 1 209 ? -32.911 -70.911 -59.579  1.00 38.03  ?  209 ILE H CG1   1 
ATOM   7877  C CG2   . ILE I 1 209 ? -31.105 -69.959 -58.143  1.00 44.70  ?  209 ILE H CG2   1 
ATOM   7878  C CD1   . ILE I 1 209 ? -32.702 -72.358 -59.188  1.00 32.83  ?  209 ILE H CD1   1 
ATOM   7879  N N     . THR I 1 210 ? -30.542 -66.916 -59.181  1.00 48.82  ?  210 THR H N     1 
ATOM   7880  C CA    . THR I 1 210 ? -29.414 -65.999 -59.095  1.00 45.90  ?  210 THR H CA    1 
ATOM   7881  C C     . THR I 1 210 ? -28.639 -66.195 -57.800  1.00 59.33  ?  210 THR H C     1 
ATOM   7882  O O     . THR I 1 210 ? -29.237 -66.397 -56.743  1.00 83.44  ?  210 THR H O     1 
ATOM   7883  C CB    . THR I 1 210 ? -29.885 -64.533 -59.204  1.00 45.81  ?  210 THR H CB    1 
ATOM   7884  O OG1   . THR I 1 210 ? -30.599 -64.357 -60.434  1.00 54.82  ?  210 THR H OG1   1 
ATOM   7885  C CG2   . THR I 1 210 ? -28.704 -63.577 -59.175  1.00 40.03  ?  210 THR H CG2   1 
ATOM   7886  N N     . GLN I 1 211 ? -27.312 -66.131 -57.876  1.00 50.30  ?  211 GLN H N     1 
ATOM   7887  C CA    . GLN I 1 211 ? -26.500 -66.251 -56.669  1.00 75.17  ?  211 GLN H CA    1 
ATOM   7888  C C     . GLN I 1 211 ? -25.116 -65.676 -56.934  1.00 79.47  ?  211 GLN H C     1 
ATOM   7889  O O     . GLN I 1 211 ? -24.602 -65.798 -58.036  1.00 83.50  ?  211 GLN H O     1 
ATOM   7890  C CB    . GLN I 1 211 ? -26.401 -67.714 -56.228  1.00 64.82  ?  211 GLN H CB    1 
ATOM   7891  C CG    . GLN I 1 211 ? -25.887 -67.914 -54.812  1.00 77.81  ?  211 GLN H CG    1 
ATOM   7892  C CD    . GLN I 1 211 ? -26.969 -67.723 -53.764  1.00 64.58  ?  211 GLN H CD    1 
ATOM   7893  O OE1   . GLN I 1 211 ? -28.001 -67.101 -54.020  1.00 72.44  ?  211 GLN H OE1   1 
ATOM   7894  N NE2   . GLN I 1 211 ? -26.737 -68.261 -52.573  1.00 40.95  ?  211 GLN H NE2   1 
ATOM   7895  N N     . ASP I 1 212 ? -24.501 -65.087 -55.912  1.00 81.54  ?  212 ASP H N     1 
ATOM   7896  C CA    . ASP I 1 212 ? -23.150 -64.540 -56.035  1.00 93.05  ?  212 ASP H CA    1 
ATOM   7897  C C     . ASP I 1 212 ? -22.086 -65.566 -56.419  1.00 92.72  ?  212 ASP H C     1 
ATOM   7898  O O     . ASP I 1 212 ? -22.211 -66.751 -56.111  1.00 66.48  ?  212 ASP H O     1 
ATOM   7899  C CB    . ASP I 1 212 ? -22.736 -63.862 -54.725  1.00 101.53 ?  212 ASP H CB    1 
ATOM   7900  N N     . THR I 1 213 ? -21.050 -65.093 -57.109  1.00 97.65  ?  213 THR H N     1 
ATOM   7901  C CA    . THR I 1 213 ? -20.025 -65.965 -57.660  1.00 85.63  ?  213 THR H CA    1 
ATOM   7902  C C     . THR I 1 213 ? -19.255 -66.640 -56.532  1.00 96.28  ?  213 THR H C     1 
ATOM   7903  O O     . THR I 1 213 ? -18.193 -66.161 -56.128  1.00 103.49 ?  213 THR H O     1 
ATOM   7904  C CB    . THR I 1 213 ? -19.024 -65.197 -58.552  1.00 80.93  ?  213 THR H CB    1 
ATOM   7905  O OG1   . THR I 1 213 ? -18.425 -64.139 -57.794  1.00 91.89  ?  213 THR H OG1   1 
ATOM   7906  C CG2   . THR I 1 213 ? -19.722 -64.599 -59.755  1.00 81.28  ?  213 THR H CG2   1 
ATOM   7907  N N     . ARG I 1 214 ? -19.784 -67.749 -56.024  1.00 78.78  ?  214 ARG H N     1 
ATOM   7908  C CA    . ARG I 1 214 ? -19.102 -68.502 -54.974  1.00 77.55  ?  214 ARG H CA    1 
ATOM   7909  C C     . ARG I 1 214 ? -19.620 -69.930 -54.885  1.00 83.06  ?  214 ARG H C     1 
ATOM   7910  O O     . ARG I 1 214 ? -18.953 -70.811 -54.350  1.00 79.29  ?  214 ARG H O     1 
ATOM   7911  C CB    . ARG I 1 214 ? -19.267 -67.797 -53.625  1.00 82.90  ?  214 ARG H CB    1 
ATOM   7912  N N     . ASP I 1 215 ? -20.810 -70.163 -55.421  1.00 82.08  ?  215 ASP H N     1 
ATOM   7913  C CA    . ASP I 1 215 ? -21.444 -71.483 -55.413  1.00 88.15  ?  215 ASP H CA    1 
ATOM   7914  C C     . ASP I 1 215 ? -21.695 -71.982 -56.833  1.00 91.27  ?  215 ASP H C     1 
ATOM   7915  O O     . ASP I 1 215 ? -22.689 -72.658 -57.086  1.00 86.44  ?  215 ASP H O     1 
ATOM   7916  C CB    . ASP I 1 215 ? -22.760 -71.445 -54.625  1.00 85.95  ?  215 ASP H CB    1 
ATOM   7917  C CG    . ASP I 1 215 ? -22.567 -71.702 -53.141  1.00 88.61  ?  215 ASP H CG    1 
ATOM   7918  O OD1   . ASP I 1 215 ? -23.267 -71.066 -52.329  1.00 82.01  ?  215 ASP H OD1   1 
ATOM   7919  O OD2   . ASP I 1 215 ? -21.678 -72.510 -52.779  1.00 98.77  -1 215 ASP H OD2   1 
ATOM   7920  N N     . ILE I 1 216 ? -20.789 -71.654 -57.755  1.00 89.79  ?  216 ILE H N     1 
ATOM   7921  C CA    . ILE I 1 216 ? -20.971 -72.050 -59.148  1.00 83.09  ?  216 ILE H CA    1 
ATOM   7922  C C     . ILE I 1 216 ? -20.949 -73.575 -59.275  1.00 74.38  ?  216 ILE H C     1 
ATOM   7923  O O     . ILE I 1 216 ? -21.633 -74.137 -60.130  1.00 90.82  ?  216 ILE H O     1 
ATOM   7924  C CB    . ILE I 1 216 ? -19.872 -71.444 -60.066  1.00 72.41  ?  216 ILE H CB    1 
ATOM   7925  C CG1   . ILE I 1 216 ? -19.860 -69.909 -60.000  1.00 74.42  ?  216 ILE H CG1   1 
ATOM   7926  C CG2   . ILE I 1 216 ? -20.056 -71.897 -61.507  1.00 78.78  ?  216 ILE H CG2   1 
ATOM   7927  C CD1   . ILE I 1 216 ? -19.032 -69.330 -58.867  1.00 77.82  ?  216 ILE H CD1   1 
ATOM   7928  N N     . GLU I 1 217 ? -20.176 -74.242 -58.419  1.00 67.44  ?  217 GLU H N     1 
ATOM   7929  C CA    . GLU I 1 217 ? -20.102 -75.700 -58.450  1.00 76.14  ?  217 GLU H CA    1 
ATOM   7930  C C     . GLU I 1 217 ? -21.493 -76.243 -58.141  1.00 76.07  ?  217 GLU H C     1 
ATOM   7931  O O     . GLU I 1 217 ? -22.004 -77.161 -58.798  1.00 91.30  ?  217 GLU H O     1 
ATOM   7932  C CB    . GLU I 1 217 ? -19.074 -76.229 -57.446  1.00 63.63  ?  217 GLU H CB    1 
ATOM   7933  N N     . LEU I 1 218 ? -22.101 -75.638 -57.127  1.00 83.10  ?  218 LEU H N     1 
ATOM   7934  C CA    . LEU I 1 218 ? -23.455 -75.956 -56.710  1.00 86.35  ?  218 LEU H CA    1 
ATOM   7935  C C     . LEU I 1 218 ? -24.437 -75.696 -57.848  1.00 90.10  ?  218 LEU H C     1 
ATOM   7936  O O     . LEU I 1 218 ? -25.298 -76.519 -58.115  1.00 89.94  ?  218 LEU H O     1 
ATOM   7937  C CB    . LEU I 1 218 ? -23.843 -75.140 -55.475  1.00 88.69  ?  218 LEU H CB    1 
ATOM   7938  C CG    . LEU I 1 218 ? -25.277 -75.287 -54.965  1.00 88.87  ?  218 LEU H CG    1 
ATOM   7939  C CD1   . LEU I 1 218 ? -25.601 -76.756 -54.744  1.00 82.89  ?  218 LEU H CD1   1 
ATOM   7940  C CD2   . LEU I 1 218 ? -25.490 -74.489 -53.689  1.00 87.30  ?  218 LEU H CD2   1 
ATOM   7941  N N     . MET I 1 219 ? -24.276 -74.566 -58.535  1.00 91.75  ?  219 MET H N     1 
ATOM   7942  C CA    . MET I 1 219 ? -25.169 -74.186 -59.632  1.00 93.61  ?  219 MET H CA    1 
ATOM   7943  C C     . MET I 1 219 ? -25.121 -75.217 -60.751  1.00 86.37  ?  219 MET H C     1 
ATOM   7944  O O     . MET I 1 219 ? -26.156 -75.600 -61.317  1.00 85.30  ?  219 MET H O     1 
ATOM   7945  C CB    . MET I 1 219 ? -24.791 -72.806 -60.177  1.00 78.09  ?  219 MET H CB    1 
ATOM   7946  C CG    . MET I 1 219 ? -24.903 -71.685 -59.161  1.00 84.14  ?  219 MET H CG    1 
ATOM   7947  S SD    . MET I 1 219 ? -26.593 -71.417 -58.593  1.00 81.76  ?  219 MET H SD    1 
ATOM   7948  C CE    . MET I 1 219 ? -27.268 -70.521 -59.987  1.00 63.03  ?  219 MET H CE    1 
ATOM   7949  N N     . LYS I 1 220 ? -23.914 -75.680 -61.051  1.00 86.25  ?  220 LYS H N     1 
ATOM   7950  C CA    . LYS I 1 220 ? -23.740 -76.720 -62.047  1.00 82.21  ?  220 LYS H CA    1 
ATOM   7951  C C     . LYS I 1 220 ? -24.414 -77.985 -61.539  1.00 81.02  ?  220 LYS H C     1 
ATOM   7952  O O     . LYS I 1 220 ? -24.972 -78.751 -62.326  1.00 97.41  ?  220 LYS H O     1 
ATOM   7953  C CB    . LYS I 1 220 ? -22.261 -76.956 -62.362  1.00 66.07  ?  220 LYS H CB    1 
ATOM   7954  C CG    . LYS I 1 220 ? -21.610 -75.786 -63.088  1.00 66.91  ?  220 LYS H CG    1 
ATOM   7955  C CD    . LYS I 1 220 ? -20.169 -76.072 -63.482  1.00 55.46  ?  220 LYS H CD    1 
ATOM   7956  C CE    . LYS I 1 220 ? -19.561 -74.877 -64.205  1.00 67.16  ?  220 LYS H CE    1 
ATOM   7957  N NZ    . LYS I 1 220 ? -18.168 -75.133 -64.662  1.00 74.12  1  220 LYS H NZ    1 
ATOM   7958  N N     . ASN I 1 221 ? -24.360 -78.218 -60.228  1.00 71.17  ?  221 ASN H N     1 
ATOM   7959  C CA    . ASN I 1 221 ? -25.060 -79.378 -59.691  1.00 81.53  ?  221 ASN H CA    1 
ATOM   7960  C C     . ASN I 1 221 ? -26.580 -79.244 -59.848  1.00 92.86  ?  221 ASN H C     1 
ATOM   7961  O O     . ASN I 1 221 ? -27.263 -80.249 -60.020  1.00 99.31  ?  221 ASN H O     1 
ATOM   7962  C CB    . ASN I 1 221 ? -24.697 -79.594 -58.221  1.00 78.43  ?  221 ASN H CB    1 
ATOM   7963  N N     . LEU I 1 222 ? -27.120 -78.025 -59.759  1.00 92.78  ?  222 LEU H N     1 
ATOM   7964  C CA    . LEU I 1 222 ? -28.559 -77.835 -59.975  1.00 96.15  ?  222 LEU H CA    1 
ATOM   7965  C C     . LEU I 1 222 ? -28.916 -78.064 -61.436  1.00 96.13  ?  222 LEU H C     1 
ATOM   7966  O O     . LEU I 1 222 ? -29.995 -78.568 -61.756  1.00 94.02  ?  222 LEU H O     1 
ATOM   7967  C CB    . LEU I 1 222 ? -29.046 -76.444 -59.546  1.00 85.70  ?  222 LEU H CB    1 
ATOM   7968  C CG    . LEU I 1 222 ? -29.329 -76.079 -58.083  1.00 90.81  ?  222 LEU H CG    1 
ATOM   7969  C CD1   . LEU I 1 222 ? -30.442 -76.970 -57.541  1.00 79.14  ?  222 LEU H CD1   1 
ATOM   7970  C CD2   . LEU I 1 222 ? -28.118 -76.152 -57.193  1.00 107.20 ?  222 LEU H CD2   1 
ATOM   7971  N N     . ILE I 1 223 ? -27.992 -77.699 -62.320  1.00 86.96  ?  223 ILE H N     1 
ATOM   7972  C CA    . ILE I 1 223 ? -28.184 -77.934 -63.746  1.00 89.17  ?  223 ILE H CA    1 
ATOM   7973  C C     . ILE I 1 223 ? -28.207 -79.427 -64.030  1.00 97.11  ?  223 ILE H C     1 
ATOM   7974  O O     . ILE I 1 223 ? -29.062 -79.911 -64.767  1.00 96.91  ?  223 ILE H O     1 
ATOM   7975  C CB    . ILE I 1 223 ? -27.098 -77.245 -64.596  1.00 77.27  ?  223 ILE H CB    1 
ATOM   7976  C CG1   . ILE I 1 223 ? -27.372 -75.744 -64.667  1.00 75.03  ?  223 ILE H CG1   1 
ATOM   7977  C CG2   . ILE I 1 223 ? -27.072 -77.814 -66.005  1.00 77.57  ?  223 ILE H CG2   1 
ATOM   7978  C CD1   . ILE I 1 223 ? -26.338 -74.966 -65.438  1.00 71.43  ?  223 ILE H CD1   1 
ATOM   7979  N N     . SER I 1 224 ? -27.272 -80.153 -63.428  1.00 99.07  ?  224 SER H N     1 
ATOM   7980  C CA    . SER I 1 224 ? -27.239 -81.603 -63.560  1.00 88.89  ?  224 SER H CA    1 
ATOM   7981  C C     . SER I 1 224 ? -28.484 -82.252 -62.962  1.00 87.70  ?  224 SER H C     1 
ATOM   7982  O O     . SER I 1 224 ? -29.015 -83.215 -63.514  1.00 89.19  ?  224 SER H O     1 
ATOM   7983  C CB    . SER I 1 224 ? -25.985 -82.165 -62.891  1.00 90.79  ?  224 SER H CB    1 
ATOM   7984  O OG    . SER I 1 224 ? -25.799 -83.526 -63.228  1.00 95.20  ?  224 SER H OG    1 
ATOM   7985  N N     . TYR I 1 225 ? -28.945 -81.723 -61.833  1.00 93.91  ?  225 TYR H N     1 
ATOM   7986  C CA    . TYR I 1 225 ? -30.052 -82.328 -61.104  1.00 93.26  ?  225 TYR H CA    1 
ATOM   7987  C C     . TYR I 1 225 ? -31.354 -82.137 -61.871  1.00 83.67  ?  225 TYR H C     1 
ATOM   7988  O O     . TYR I 1 225 ? -32.189 -83.040 -61.933  1.00 74.09  ?  225 TYR H O     1 
ATOM   7989  C CB    . TYR I 1 225 ? -30.161 -81.726 -59.698  1.00 80.87  ?  225 TYR H CB    1 
ATOM   7990  C CG    . TYR I 1 225 ? -31.251 -82.328 -58.835  1.00 88.93  ?  225 TYR H CG    1 
ATOM   7991  C CD1   . TYR I 1 225 ? -30.964 -83.344 -57.933  1.00 97.95  ?  225 TYR H CD1   1 
ATOM   7992  C CD2   . TYR I 1 225 ? -32.561 -81.867 -58.906  1.00 86.22  ?  225 TYR H CD2   1 
ATOM   7993  C CE1   . TYR I 1 225 ? -31.952 -83.896 -57.137  1.00 101.34 ?  225 TYR H CE1   1 
ATOM   7994  C CE2   . TYR I 1 225 ? -33.556 -82.413 -58.115  1.00 83.90  ?  225 TYR H CE2   1 
ATOM   7995  C CZ    . TYR I 1 225 ? -33.245 -83.427 -57.232  1.00 92.80  ?  225 TYR H CZ    1 
ATOM   7996  O OH    . TYR I 1 225 ? -34.228 -83.974 -56.441  1.00 82.95  ?  225 TYR H OH    1 
ATOM   7997  N N     . LEU I 1 226 ? -31.526 -80.949 -62.441  1.00 85.55  ?  226 LEU H N     1 
ATOM   7998  C CA    . LEU I 1 226 ? -32.725 -80.640 -63.210  1.00 84.30  ?  226 LEU H CA    1 
ATOM   7999  C C     . LEU I 1 226 ? -32.558 -81.043 -64.670  1.00 95.61  ?  226 LEU H C     1 
ATOM   8000  O O     . LEU I 1 226 ? -33.520 -81.019 -65.427  1.00 89.74  ?  226 LEU H O     1 
ATOM   8001  C CB    . LEU I 1 226 ? -33.070 -79.154 -63.104  1.00 86.13  ?  226 LEU H CB    1 
ATOM   8002  C CG    . LEU I 1 226 ? -33.450 -78.666 -61.704  1.00 85.50  ?  226 LEU H CG    1 
ATOM   8003  C CD1   . LEU I 1 226 ? -33.535 -77.148 -61.661  1.00 52.57  ?  226 LEU H CD1   1 
ATOM   8004  C CD2   . LEU I 1 226 ? -34.762 -79.294 -61.253  1.00 74.93  ?  226 LEU H CD2   1 
ATOM   8005  N N     . ASN I 1 227 ? -31.313 -81.348 -65.041  1.00 100.91 ?  227 ASN H N     1 
ATOM   8006  C CA    . ASN I 1 227 ? -30.882 -81.807 -66.374  1.00 89.47  ?  227 ASN H CA    1 
ATOM   8007  C C     . ASN I 1 227 ? -31.072 -80.736 -67.456  1.00 79.24  ?  227 ASN H C     1 
ATOM   8008  O O     . ASN I 1 227 ? -31.200 -81.049 -68.640  1.00 88.31  ?  227 ASN H O     1 
ATOM   8009  C CB    . ASN I 1 227 ? -31.539 -83.169 -66.744  1.00 86.20  ?  227 ASN H CB    1 
ATOM   8010  C CG    . ASN I 1 227 ? -32.980 -83.077 -67.279  1.00 95.51  ?  227 ASN H CG    1 
ATOM   8011  O OD1   . ASN I 1 227 ? -33.453 -82.047 -67.758  1.00 96.49  ?  227 ASN H OD1   1 
ATOM   8012  N ND2   . ASN I 1 227 ? -33.686 -84.198 -67.185  1.00 94.19  ?  227 ASN H ND2   1 
ATOM   8013  N N     . CYS I 1 228 ? -31.016 -79.470 -67.046  1.00 76.38  ?  228 CYS H N     1 
ATOM   8014  C CA    . CYS I 1 228 ? -31.118 -78.359 -67.989  1.00 71.59  ?  228 CYS H CA    1 
ATOM   8015  C C     . CYS I 1 228 ? -30.625 -77.019 -67.432  1.00 71.77  ?  228 CYS H C     1 
ATOM   8016  O O     . CYS I 1 228 ? -30.310 -76.893 -66.249  1.00 87.54  ?  228 CYS H O     1 
ATOM   8017  C CB    . CYS I 1 228 ? -32.567 -78.206 -68.458  1.00 72.36  ?  228 CYS H CB    1 
ATOM   8018  S SG    . CYS I 1 228 ? -33.766 -77.939 -67.129  1.00 78.32  ?  228 CYS H SG    1 
ATOM   8019  N N     . GLY I 1 229 ? -30.572 -76.028 -68.318  1.00 53.83  ?  229 GLY H N     1 
ATOM   8020  C CA    . GLY I 1 229 ? -30.206 -74.658 -67.995  1.00 50.83  ?  229 GLY H CA    1 
ATOM   8021  C C     . GLY I 1 229 ? -28.775 -74.324 -68.378  1.00 54.08  ?  229 GLY H C     1 
ATOM   8022  O O     . GLY I 1 229 ? -27.933 -75.209 -68.515  1.00 56.67  ?  229 GLY H O     1 
ATOM   8023  N N     . ASN I 1 230 ? -28.503 -73.033 -68.550  1.00 57.57  ?  230 ASN H N     1 
ATOM   8024  C CA    . ASN I 1 230 ? -27.146 -72.538 -68.771  1.00 66.95  ?  230 ASN H CA    1 
ATOM   8025  C C     . ASN I 1 230 ? -26.662 -71.548 -67.714  1.00 61.19  ?  230 ASN H C     1 
ATOM   8026  O O     . ASN I 1 230 ? -27.462 -70.874 -67.075  1.00 68.16  ?  230 ASN H O     1 
ATOM   8027  C CB    . ASN I 1 230 ? -27.052 -71.902 -70.160  1.00 80.77  ?  230 ASN H CB    1 
ATOM   8028  C CG    . ASN I 1 230 ? -27.292 -72.903 -71.274  1.00 80.44  ?  230 ASN H CG    1 
ATOM   8029  O OD1   . ASN I 1 230 ? -26.472 -73.791 -71.513  1.00 86.18  ?  230 ASN H OD1   1 
ATOM   8030  N ND2   . ASN I 1 230 ? -28.422 -72.770 -71.958  1.00 78.52  ?  230 ASN H ND2   1 
ATOM   8031  N N     . ILE I 1 231 ? -25.346 -71.463 -67.536  1.00 65.42  ?  231 ILE H N     1 
ATOM   8032  C CA    . ILE I 1 231 ? -24.747 -70.465 -66.649  1.00 68.24  ?  231 ILE H CA    1 
ATOM   8033  C C     . ILE I 1 231 ? -24.418 -69.142 -67.352  1.00 65.52  ?  231 ILE H C     1 
ATOM   8034  O O     . ILE I 1 231 ? -23.773 -69.129 -68.400  1.00 75.27  ?  231 ILE H O     1 
ATOM   8035  C CB    . ILE I 1 231 ? -23.449 -71.000 -66.001  1.00 68.31  ?  231 ILE H CB    1 
ATOM   8036  C CG1   . ILE I 1 231 ? -23.759 -72.120 -65.008  1.00 48.36  ?  231 ILE H CG1   1 
ATOM   8037  C CG2   . ILE I 1 231 ? -22.682 -69.882 -65.314  1.00 60.90  ?  231 ILE H CG2   1 
ATOM   8038  C CD1   . ILE I 1 231 ? -23.156 -73.447 -65.397  1.00 74.45  ?  231 ILE H CD1   1 
ATOM   8039  N N     . ARG I 1 232 ? -24.861 -68.032 -66.765  1.00 75.21  ?  232 ARG H N     1 
ATOM   8040  C CA    . ARG I 1 232 ? -24.536 -66.700 -67.277  1.00 73.97  ?  232 ARG H CA    1 
ATOM   8041  C C     . ARG I 1 232 ? -23.790 -65.949 -66.167  1.00 82.04  ?  232 ARG H C     1 
ATOM   8042  O O     . ARG I 1 232 ? -24.256 -65.872 -65.030  1.00 82.70  ?  232 ARG H O     1 
ATOM   8043  C CB    . ARG I 1 232 ? -25.790 -65.945 -67.754  1.00 72.16  ?  232 ARG H CB    1 
ATOM   8044  C CG    . ARG I 1 232 ? -26.298 -64.834 -66.842  1.00 79.26  ?  232 ARG H CG    1 
ATOM   8045  C CD    . ARG I 1 232 ? -27.175 -63.839 -67.584  1.00 96.56  ?  232 ARG H CD    1 
ATOM   8046  N NE    . ARG I 1 232 ? -27.298 -62.580 -66.852  1.00 93.87  ?  232 ARG H NE    1 
ATOM   8047  C CZ    . ARG I 1 232 ? -27.183 -61.376 -67.403  1.00 90.40  ?  232 ARG H CZ    1 
ATOM   8048  N NH1   . ARG I 1 232 ? -26.941 -61.257 -68.701  1.00 89.27  1  232 ARG H NH1   1 
ATOM   8049  N NH2   . ARG I 1 232 ? -27.295 -60.289 -66.652  1.00 102.05 ?  232 ARG H NH2   1 
ATOM   8050  N N     . ILE I 1 233 ? -22.596 -65.457 -66.476  1.00 74.08  ?  233 ILE H N     1 
ATOM   8051  C CA    . ILE I 1 233 ? -21.827 -64.697 -65.496  1.00 69.96  ?  233 ILE H CA    1 
ATOM   8052  C C     . ILE I 1 233 ? -21.863 -63.198 -65.771  1.00 67.28  ?  233 ILE H C     1 
ATOM   8053  O O     . ILE I 1 233 ? -21.500 -62.744 -66.855  1.00 68.47  ?  233 ILE H O     1 
ATOM   8054  C CB    . ILE I 1 233 ? -20.360 -65.169 -65.458  1.00 62.17  ?  233 ILE H CB    1 
ATOM   8055  C CG1   . ILE I 1 233 ? -20.273 -66.579 -64.868  1.00 55.22  ?  233 ILE H CG1   1 
ATOM   8056  C CG2   . ILE I 1 233 ? -19.497 -64.186 -64.676  1.00 59.88  ?  233 ILE H CG2   1 
ATOM   8057  C CD1   . ILE I 1 233 ? -18.903 -67.208 -64.979  1.00 45.19  ?  233 ILE H CD1   1 
ATOM   8058  N N     . ARG I 1 234 ? -22.305 -62.434 -64.776  1.00 75.71  ?  234 ARG H N     1 
ATOM   8059  C CA    . ARG I 1 234 ? -22.237 -60.979 -64.847  1.00 84.73  ?  234 ARG H CA    1 
ATOM   8060  C C     . ARG I 1 234 ? -21.330 -60.411 -63.760  1.00 87.39  ?  234 ARG H C     1 
ATOM   8061  O O     . ARG I 1 234 ? -21.670 -60.435 -62.577  1.00 90.53  ?  234 ARG H O     1 
ATOM   8062  C CB    . ARG I 1 234 ? -23.638 -60.372 -64.732  1.00 83.40  ?  234 ARG H CB    1 
ATOM   8063  N N     . THR I 1 245 ? -19.821 -60.678 -60.987  1.00 91.52  ?  245 THR H N     1 
ATOM   8064  C CA    . THR I 1 245 ? -20.221 -60.555 -59.591  1.00 91.31  ?  245 THR H CA    1 
ATOM   8065  C C     . THR I 1 245 ? -21.304 -61.566 -59.224  1.00 93.83  ?  245 THR H C     1 
ATOM   8066  O O     . THR I 1 245 ? -21.184 -62.276 -58.226  1.00 93.15  ?  245 THR H O     1 
ATOM   8067  C CB    . THR I 1 245 ? -20.729 -59.135 -59.271  1.00 84.30  ?  245 THR H CB    1 
ATOM   8068  O OG1   . THR I 1 245 ? -21.629 -58.702 -60.299  1.00 89.33  ?  245 THR H OG1   1 
ATOM   8069  C CG2   . THR I 1 245 ? -19.564 -58.161 -59.178  1.00 74.00  ?  245 THR H CG2   1 
ATOM   8070  N N     . CYS I 1 246 ? -22.374 -61.609 -60.013  1.00 91.44  ?  246 CYS H N     1 
ATOM   8071  C CA    . CYS I 1 246 ? -23.384 -62.652 -59.856  1.00 76.68  ?  246 CYS H CA    1 
ATOM   8072  C C     . CYS I 1 246 ? -23.389 -63.704 -60.970  1.00 75.68  ?  246 CYS H C     1 
ATOM   8073  O O     . CYS I 1 246 ? -22.969 -63.438 -62.101  1.00 75.61  ?  246 CYS H O     1 
ATOM   8074  C CB    . CYS I 1 246 ? -24.771 -62.011 -59.765  1.00 69.21  ?  246 CYS H CB    1 
ATOM   8075  S SG    . CYS I 1 246 ? -25.251 -61.493 -58.103  1.00 95.69  ?  246 CYS H SG    1 
ATOM   8076  N N     . VAL I 1 247 ? -23.869 -64.898 -60.628  1.00 65.87  ?  247 VAL H N     1 
ATOM   8077  C CA    . VAL I 1 247 ? -24.098 -65.972 -61.588  1.00 66.78  ?  247 VAL H CA    1 
ATOM   8078  C C     . VAL I 1 247 ? -25.597 -66.262 -61.677  1.00 75.62  ?  247 VAL H C     1 
ATOM   8079  O O     . VAL I 1 247 ? -26.294 -66.285 -60.651  1.00 85.20  ?  247 VAL H O     1 
ATOM   8080  C CB    . VAL I 1 247 ? -23.355 -67.267 -61.182  1.00 64.58  ?  247 VAL H CB    1 
ATOM   8081  C CG1   . VAL I 1 247 ? -23.654 -68.396 -62.155  1.00 81.28  ?  247 VAL H CG1   1 
ATOM   8082  C CG2   . VAL I 1 247 ? -21.866 -67.023 -61.087  1.00 68.53  ?  247 VAL H CG2   1 
ATOM   8083  N N     . ASP I 1 248 ? -26.089 -66.477 -62.896  1.00 67.05  ?  248 ASP H N     1 
ATOM   8084  C CA    . ASP I 1 248 ? -27.449 -66.954 -63.114  1.00 64.46  ?  248 ASP H CA    1 
ATOM   8085  C C     . ASP I 1 248 ? -27.529 -68.355 -63.735  1.00 58.03  ?  248 ASP H C     1 
ATOM   8086  O O     . ASP I 1 248 ? -26.836 -68.648 -64.711  1.00 63.25  ?  248 ASP H O     1 
ATOM   8087  C CB    . ASP I 1 248 ? -28.205 -65.955 -63.992  1.00 61.46  ?  248 ASP H CB    1 
ATOM   8088  C CG    . ASP I 1 248 ? -28.271 -64.570 -63.372  1.00 59.77  ?  248 ASP H CG    1 
ATOM   8089  O OD1   . ASP I 1 248 ? -27.466 -63.701 -63.769  1.00 73.81  ?  248 ASP H OD1   1 
ATOM   8090  O OD2   . ASP I 1 248 ? -29.124 -64.351 -62.486  1.00 58.55  -1 248 ASP H OD2   1 
ATOM   8091  N N     . LEU I 1 249 ? -28.365 -69.215 -63.161  1.00 53.64  ?  249 LEU H N     1 
ATOM   8092  C CA    . LEU I 1 249 ? -28.848 -70.416 -63.835  1.00 42.44  ?  249 LEU H CA    1 
ATOM   8093  C C     . LEU I 1 249 ? -30.072 -70.008 -64.651  1.00 59.31  ?  249 LEU H C     1 
ATOM   8094  O O     . LEU I 1 249 ? -31.060 -69.546 -64.082  1.00 59.75  ?  249 LEU H O     1 
ATOM   8095  C CB    . LEU I 1 249 ? -29.187 -71.521 -62.829  1.00 52.63  ?  249 LEU H CB    1 
ATOM   8096  C CG    . LEU I 1 249 ? -29.620 -72.911 -63.313  1.00 61.88  ?  249 LEU H CG    1 
ATOM   8097  C CD1   . LEU I 1 249 ? -29.358 -73.933 -62.219  1.00 76.26  ?  249 LEU H CD1   1 
ATOM   8098  C CD2   . LEU I 1 249 ? -31.089 -72.957 -63.727  1.00 44.72  ?  249 LEU H CD2   1 
ATOM   8099  N N     . VAL I 1 250 ? -30.020 -70.174 -65.969  1.00 68.08  ?  250 VAL H N     1 
ATOM   8100  C CA    . VAL I 1 250 ? -31.129 -69.757 -66.824  1.00 49.88  ?  250 VAL H CA    1 
ATOM   8101  C C     . VAL I 1 250 ? -31.678 -70.870 -67.715  1.00 56.78  ?  250 VAL H C     1 
ATOM   8102  O O     . VAL I 1 250 ? -30.947 -71.470 -68.502  1.00 63.33  ?  250 VAL H O     1 
ATOM   8103  C CB    . VAL I 1 250 ? -30.716 -68.581 -67.730  1.00 33.04  ?  250 VAL H CB    1 
ATOM   8104  C CG1   . VAL I 1 250 ? -31.917 -68.066 -68.505  1.00 56.99  ?  250 VAL H CG1   1 
ATOM   8105  C CG2   . VAL I 1 250 ? -30.085 -67.467 -66.909  1.00 37.82  ?  250 VAL H CG2   1 
ATOM   8106  N N     . VAL I 1 251 ? -32.974 -71.137 -67.581  1.00 58.53  ?  251 VAL H N     1 
ATOM   8107  C CA    . VAL I 1 251 ? -33.678 -72.055 -68.466  1.00 54.51  ?  251 VAL H CA    1 
ATOM   8108  C C     . VAL I 1 251 ? -34.624 -71.287 -69.386  1.00 56.48  ?  251 VAL H C     1 
ATOM   8109  O O     . VAL I 1 251 ? -35.567 -70.623 -68.922  1.00 49.54  ?  251 VAL H O     1 
ATOM   8110  C CB    . VAL I 1 251 ? -34.479 -73.109 -67.675  1.00 56.57  ?  251 VAL H CB    1 
ATOM   8111  C CG1   . VAL I 1 251 ? -35.199 -74.052 -68.628  1.00 65.11  ?  251 VAL H CG1   1 
ATOM   8112  C CG2   . VAL I 1 251 ? -33.564 -73.883 -66.741  1.00 61.71  ?  251 VAL H CG2   1 
ATOM   8113  N N     . THR I 1 252 ? -34.348 -71.378 -70.687  1.00 61.98  ?  252 THR H N     1 
ATOM   8114  C CA    . THR I 1 252 ? -35.119 -70.693 -71.721  1.00 57.01  ?  252 THR H CA    1 
ATOM   8115  C C     . THR I 1 252 ? -35.756 -71.660 -72.718  1.00 58.00  ?  252 THR H C     1 
ATOM   8116  O O     . THR I 1 252 ? -36.732 -71.316 -73.384  1.00 56.41  ?  252 THR H O     1 
ATOM   8117  C CB    . THR I 1 252 ? -34.247 -69.694 -72.509  1.00 60.32  ?  252 THR H CB    1 
ATOM   8118  O OG1   . THR I 1 252 ? -33.006 -70.314 -72.870  1.00 56.35  ?  252 THR H OG1   1 
ATOM   8119  C CG2   . THR I 1 252 ? -33.971 -68.452 -71.675  1.00 78.04  ?  252 THR H CG2   1 
ATOM   8120  N N     . ASN I 1 253 ? -35.195 -72.864 -72.819  1.00 65.57  ?  253 ASN H N     1 
ATOM   8121  C CA    . ASN I 1 253 ? -35.716 -73.896 -73.716  1.00 58.43  ?  253 ASN H CA    1 
ATOM   8122  C C     . ASN I 1 253 ? -37.159 -74.235 -73.368  1.00 60.83  ?  253 ASN H C     1 
ATOM   8123  O O     . ASN I 1 253 ? -37.470 -74.588 -72.231  1.00 70.78  ?  253 ASN H O     1 
ATOM   8124  C CB    . ASN I 1 253 ? -34.833 -75.147 -73.664  1.00 68.83  ?  253 ASN H CB    1 
ATOM   8125  C CG    . ASN I 1 253 ? -35.324 -76.255 -74.582  1.00 79.69  ?  253 ASN H CG    1 
ATOM   8126  O OD1   . ASN I 1 253 ? -36.402 -76.816 -74.385  1.00 72.87  ?  253 ASN H OD1   1 
ATOM   8127  N ND2   . ASN I 1 253 ? -34.531 -76.569 -75.601  1.00 70.67  ?  253 ASN H ND2   1 
ATOM   8128  N N     . LEU I 1 254 ? -38.037 -74.120 -74.359  1.00 60.53  ?  254 LEU H N     1 
ATOM   8129  C CA    . LEU I 1 254 ? -39.469 -74.248 -74.128  1.00 64.15  ?  254 LEU H CA    1 
ATOM   8130  C C     . LEU I 1 254 ? -39.938 -75.619 -73.644  1.00 69.36  ?  254 LEU H C     1 
ATOM   8131  O O     . LEU I 1 254 ? -40.738 -75.694 -72.709  1.00 74.86  ?  254 LEU H O     1 
ATOM   8132  C CB    . LEU I 1 254 ? -40.226 -73.895 -75.411  1.00 49.97  ?  254 LEU H CB    1 
ATOM   8133  C CG    . LEU I 1 254 ? -41.756 -73.938 -75.351  1.00 54.27  ?  254 LEU H CG    1 
ATOM   8134  C CD1   . LEU I 1 254 ? -42.285 -73.135 -74.173  1.00 65.73  ?  254 LEU H CD1   1 
ATOM   8135  C CD2   . LEU I 1 254 ? -42.361 -73.443 -76.655  1.00 102.07 ?  254 LEU H CD2   1 
ATOM   8136  N N     . ASN I 1 255 ? -39.457 -76.706 -74.241  1.00 64.77  ?  255 ASN H N     1 
ATOM   8137  C CA    . ASN I 1 255 ? -39.842 -78.001 -73.693  1.00 78.66  ?  255 ASN H CA    1 
ATOM   8138  C C     . ASN I 1 255 ? -38.880 -78.597 -72.669  1.00 81.87  ?  255 ASN H C     1 
ATOM   8139  O O     . ASN I 1 255 ? -39.098 -79.719 -72.206  1.00 79.61  ?  255 ASN H O     1 
ATOM   8140  C CB    . ASN I 1 255 ? -40.050 -79.004 -74.838  1.00 89.28  ?  255 ASN H CB    1 
ATOM   8141  C CG    . ASN I 1 255 ? -38.832 -79.135 -75.743  1.00 101.94 ?  255 ASN H CG    1 
ATOM   8142  O OD1   . ASN I 1 255 ? -37.691 -79.146 -75.281  1.00 91.82  ?  255 ASN H OD1   1 
ATOM   8143  N ND2   . ASN I 1 255 ? -39.076 -79.239 -77.046  1.00 100.55 ?  255 ASN H ND2   1 
ATOM   8144  N N     . ASP I 1 256 ? -37.870 -77.839 -72.248  1.00 87.05  ?  256 ASP H N     1 
ATOM   8145  C CA    . ASP I 1 256 ? -37.237 -78.122 -70.968  1.00 74.23  ?  256 ASP H CA    1 
ATOM   8146  C C     . ASP I 1 256 ? -38.143 -77.614 -69.861  1.00 65.60  ?  256 ASP H C     1 
ATOM   8147  O O     . ASP I 1 256 ? -38.301 -78.250 -68.824  1.00 78.95  ?  256 ASP H O     1 
ATOM   8148  C CB    . ASP I 1 256 ? -35.850 -77.484 -70.885  1.00 71.59  ?  256 ASP H CB    1 
ATOM   8149  C CG    . ASP I 1 256 ? -34.821 -78.220 -71.724  1.00 76.50  ?  256 ASP H CG    1 
ATOM   8150  O OD1   . ASP I 1 256 ? -34.981 -79.443 -71.922  1.00 77.86  ?  256 ASP H OD1   1 
ATOM   8151  O OD2   . ASP I 1 256 ? -33.852 -77.579 -72.181  1.00 64.96  -1 256 ASP H OD2   1 
ATOM   8152  N N     . ILE I 1 257 ? -38.732 -76.447 -70.098  1.00 48.14  ?  257 ILE H N     1 
ATOM   8153  C CA    . ILE I 1 257 ? -39.676 -75.859 -69.163  1.00 50.89  ?  257 ILE H CA    1 
ATOM   8154  C C     . ILE I 1 257 ? -40.896 -76.768 -69.096  1.00 62.96  ?  257 ILE H C     1 
ATOM   8155  O O     . ILE I 1 257 ? -41.394 -77.099 -68.020  1.00 72.87  ?  257 ILE H O     1 
ATOM   8156  C CB    . ILE I 1 257 ? -40.070 -74.431 -69.571  1.00 53.26  ?  257 ILE H CB    1 
ATOM   8157  C CG1   . ILE I 1 257 ? -39.023 -73.440 -69.062  1.00 47.78  ?  257 ILE H CG1   1 
ATOM   8158  C CG2   . ILE I 1 257 ? -41.454 -74.074 -69.040  1.00 45.58  ?  257 ILE H CG2   1 
ATOM   8159  C CD1   . ILE I 1 257 ? -38.950 -72.163 -69.855  1.00 56.69  ?  257 ILE H CD1   1 
ATOM   8160  N N     . LYS I 1 258 ? -41.358 -77.171 -70.277  1.00 73.91  ?  258 LYS H N     1 
ATOM   8161  C CA    . LYS I 1 258 ? -42.533 -78.020 -70.420  1.00 79.17  ?  258 LYS H CA    1 
ATOM   8162  C C     . LYS I 1 258 ? -42.337 -79.423 -69.847  1.00 79.11  ?  258 LYS H C     1 
ATOM   8163  O O     . LYS I 1 258 ? -43.213 -79.939 -69.148  1.00 54.35  ?  258 LYS H O     1 
ATOM   8164  C CB    . LYS I 1 258 ? -42.933 -78.117 -71.894  1.00 59.90  ?  258 LYS H CB    1 
ATOM   8165  N N     . GLU I 1 259 ? -41.192 -80.040 -70.130  1.00 70.82  ?  259 GLU H N     1 
ATOM   8166  C CA    . GLU I 1 259 ? -41.023 -81.453 -69.802  1.00 71.79  ?  259 GLU H CA    1 
ATOM   8167  C C     . GLU I 1 259 ? -40.129 -81.726 -68.592  1.00 83.02  ?  259 GLU H C     1 
ATOM   8168  O O     . GLU I 1 259 ? -40.006 -82.875 -68.169  1.00 97.33  ?  259 GLU H O     1 
ATOM   8169  C CB    . GLU I 1 259 ? -40.472 -82.210 -71.013  1.00 84.88  ?  259 GLU H CB    1 
ATOM   8170  N N     . LYS I 1 260 ? -39.507 -80.694 -68.031  1.00 81.38  ?  260 LYS H N     1 
ATOM   8171  C CA    . LYS I 1 260 ? -38.630 -80.909 -66.881  1.00 81.78  ?  260 LYS H CA    1 
ATOM   8172  C C     . LYS I 1 260 ? -39.005 -80.062 -65.660  1.00 75.55  ?  260 LYS H C     1 
ATOM   8173  O O     . LYS I 1 260 ? -39.348 -80.590 -64.603  1.00 78.01  ?  260 LYS H O     1 
ATOM   8174  C CB    . LYS I 1 260 ? -37.178 -80.608 -67.270  1.00 79.67  ?  260 LYS H CB    1 
ATOM   8175  C CG    . LYS I 1 260 ? -36.630 -81.459 -68.407  1.00 74.39  ?  260 LYS H CG    1 
ATOM   8176  C CD    . LYS I 1 260 ? -36.766 -82.945 -68.148  1.00 86.13  ?  260 LYS H CD    1 
ATOM   8177  C CE    . LYS I 1 260 ? -36.129 -83.741 -69.276  1.00 86.92  ?  260 LYS H CE    1 
ATOM   8178  N NZ    . LYS I 1 260 ? -35.970 -85.181 -68.938  1.00 99.21  1  260 LYS H NZ    1 
ATOM   8179  N N     . ILE I 1 261 ? -38.934 -78.745 -65.826  1.00 67.80  ?  261 ILE H N     1 
ATOM   8180  C CA    . ILE I 1 261 ? -39.203 -77.782 -64.758  1.00 66.30  ?  261 ILE H CA    1 
ATOM   8181  C C     . ILE I 1 261 ? -40.618 -77.786 -64.165  1.00 66.05  ?  261 ILE H C     1 
ATOM   8182  O O     . ILE I 1 261 ? -40.792 -77.898 -62.946  1.00 74.03  ?  261 ILE H O     1 
ATOM   8183  C CB    . ILE I 1 261 ? -38.909 -76.351 -65.255  1.00 69.11  ?  261 ILE H CB    1 
ATOM   8184  C CG1   . ILE I 1 261 ? -37.451 -76.230 -65.706  1.00 63.79  ?  261 ILE H CG1   1 
ATOM   8185  C CG2   . ILE I 1 261 ? -39.232 -75.327 -64.181  1.00 56.90  ?  261 ILE H CG2   1 
ATOM   8186  C CD1   . ILE I 1 261 ? -36.449 -76.558 -64.625  1.00 58.09  ?  261 ILE H CD1   1 
ATOM   8187  N N     . ILE I 1 262 ? -41.624 -77.685 -65.027  1.00 63.64  ?  262 ILE H N     1 
ATOM   8188  C CA    . ILE I 1 262 ? -43.016 -77.642 -64.581  1.00 68.98  ?  262 ILE H CA    1 
ATOM   8189  C C     . ILE I 1 262 ? -43.484 -78.919 -63.862  1.00 82.92  ?  262 ILE H C     1 
ATOM   8190  O O     . ILE I 1 262 ? -44.127 -78.820 -62.817  1.00 83.29  ?  262 ILE H O     1 
ATOM   8191  C CB    . ILE I 1 262 ? -43.967 -77.332 -65.769  1.00 52.94  ?  262 ILE H CB    1 
ATOM   8192  C CG1   . ILE I 1 262 ? -43.871 -75.855 -66.157  1.00 60.33  ?  262 ILE H CG1   1 
ATOM   8193  C CG2   . ILE I 1 262 ? -45.403 -77.707 -65.433  1.00 58.55  ?  262 ILE H CG2   1 
ATOM   8194  C CD1   . ILE I 1 262 ? -44.945 -75.401 -67.129  1.00 76.88  ?  262 ILE H CD1   1 
ATOM   8195  N N     . PRO I 1 263 ? -43.167 -80.116 -64.397  1.00 85.24  ?  263 PRO H N     1 
ATOM   8196  C CA    . PRO I 1 263 ? -43.559 -81.300 -63.623  1.00 82.60  ?  263 PRO H CA    1 
ATOM   8197  C C     . PRO I 1 263 ? -42.874 -81.333 -62.258  1.00 85.05  ?  263 PRO H C     1 
ATOM   8198  O O     . PRO I 1 263 ? -43.482 -81.719 -61.248  1.00 86.01  ?  263 PRO H O     1 
ATOM   8199  C CB    . PRO I 1 263 ? -43.078 -82.457 -64.500  1.00 91.99  ?  263 PRO H CB    1 
ATOM   8200  C CG    . PRO I 1 263 ? -43.165 -81.912 -65.881  1.00 87.40  ?  263 PRO H CG    1 
ATOM   8201  C CD    . PRO I 1 263 ? -42.668 -80.499 -65.732  1.00 83.42  ?  263 PRO H CD    1 
ATOM   8202  N N     . PHE I 1 264 ? -41.621 -80.887 -62.240  1.00 74.37  ?  264 PHE H N     1 
ATOM   8203  C CA    . PHE I 1 264 ? -40.834 -80.856 -61.017  1.00 84.48  ?  264 PHE H CA    1 
ATOM   8204  C C     . PHE I 1 264 ? -41.501 -79.975 -59.976  1.00 83.35  ?  264 PHE H C     1 
ATOM   8205  O O     . PHE I 1 264 ? -41.681 -80.399 -58.836  1.00 88.31  ?  264 PHE H O     1 
ATOM   8206  C CB    . PHE I 1 264 ? -39.416 -80.357 -61.297  1.00 76.17  ?  264 PHE H CB    1 
ATOM   8207  C CG    . PHE I 1 264 ? -38.519 -80.381 -60.093  1.00 74.78  ?  264 PHE H CG    1 
ATOM   8208  C CD1   . PHE I 1 264 ? -37.825 -81.532 -59.753  1.00 84.57  ?  264 PHE H CD1   1 
ATOM   8209  C CD2   . PHE I 1 264 ? -38.371 -79.256 -59.299  1.00 75.17  ?  264 PHE H CD2   1 
ATOM   8210  C CE1   . PHE I 1 264 ? -37.000 -81.559 -58.645  1.00 91.02  ?  264 PHE H CE1   1 
ATOM   8211  C CE2   . PHE I 1 264 ? -37.549 -79.278 -58.189  1.00 90.41  ?  264 PHE H CE2   1 
ATOM   8212  C CZ    . PHE I 1 264 ? -36.861 -80.430 -57.862  1.00 95.93  ?  264 PHE H CZ    1 
ATOM   8213  N N     . PHE I 1 265 ? -41.872 -78.754 -60.347  1.00 82.72  ?  265 PHE H N     1 
ATOM   8214  C CA    . PHE I 1 265 ? -42.384 -77.848 -59.329  1.00 79.11  ?  265 PHE H CA    1 
ATOM   8215  C C     . PHE I 1 265 ? -43.869 -78.111 -59.106  1.00 81.99  ?  265 PHE H C     1 
ATOM   8216  O O     . PHE I 1 265 ? -44.480 -77.545 -58.199  1.00 81.57  ?  265 PHE H O     1 
ATOM   8217  C CB    . PHE I 1 265 ? -42.139 -76.389 -59.706  1.00 85.26  ?  265 PHE H CB    1 
ATOM   8218  C CG    . PHE I 1 265 ? -40.698 -75.981 -59.621  1.00 81.28  ?  265 PHE H CG    1 
ATOM   8219  C CD1   . PHE I 1 265 ? -40.030 -76.016 -58.409  1.00 67.62  ?  265 PHE H CD1   1 
ATOM   8220  C CD2   . PHE I 1 265 ? -40.013 -75.556 -60.746  1.00 80.41  ?  265 PHE H CD2   1 
ATOM   8221  C CE1   . PHE I 1 265 ? -38.705 -75.644 -58.321  1.00 61.24  ?  265 PHE H CE1   1 
ATOM   8222  C CE2   . PHE I 1 265 ? -38.685 -75.180 -60.663  1.00 74.02  ?  265 PHE H CE2   1 
ATOM   8223  C CZ    . PHE I 1 265 ? -38.032 -75.224 -59.450  1.00 68.20  ?  265 PHE H CZ    1 
ATOM   8224  N N     . ASN I 1 266 ? -44.443 -78.975 -59.938  1.00 85.99  ?  266 ASN H N     1 
ATOM   8225  C CA    . ASN I 1 266 ? -45.815 -79.417 -59.741  1.00 95.70  ?  266 ASN H CA    1 
ATOM   8226  C C     . ASN I 1 266 ? -45.826 -80.467 -58.641  1.00 95.58  ?  266 ASN H C     1 
ATOM   8227  O O     . ASN I 1 266 ? -46.766 -80.558 -57.852  1.00 84.03  ?  266 ASN H O     1 
ATOM   8228  C CB    . ASN I 1 266 ? -46.416 -79.970 -61.032  1.00 86.96  ?  266 ASN H CB    1 
ATOM   8229  C CG    . ASN I 1 266 ? -47.125 -78.904 -61.844  1.00 77.08  ?  266 ASN H CG    1 
ATOM   8230  O OD1   . ASN I 1 266 ? -47.111 -77.725 -61.489  1.00 75.94  ?  266 ASN H OD1   1 
ATOM   8231  N ND2   . ASN I 1 266 ? -47.756 -79.315 -62.937  1.00 81.56  ?  266 ASN H ND2   1 
ATOM   8232  N N     . LYS I 1 267 ? -44.755 -81.257 -58.605  1.00 98.95  ?  267 LYS H N     1 
ATOM   8233  C CA    . LYS I 1 267 ? -44.582 -82.292 -57.588  1.00 102.45 ?  267 LYS H CA    1 
ATOM   8234  C C     . LYS I 1 267 ? -43.877 -81.740 -56.350  1.00 90.70  ?  267 LYS H C     1 
ATOM   8235  O O     . LYS I 1 267 ? -44.182 -82.127 -55.222  1.00 89.68  ?  267 LYS H O     1 
ATOM   8236  C CB    . LYS I 1 267 ? -43.810 -83.481 -58.161  1.00 101.43 ?  267 LYS H CB    1 
ATOM   8237  C CG    . LYS I 1 267 ? -44.610 -84.310 -59.159  1.00 105.67 ?  267 LYS H CG    1 
ATOM   8238  C CD    . LYS I 1 267 ? -46.006 -84.631 -58.630  1.00 110.24 ?  267 LYS H CD    1 
ATOM   8239  C CE    . LYS I 1 267 ? -47.095 -83.949 -59.451  1.00 111.15 ?  267 LYS H CE    1 
ATOM   8240  N NZ    . LYS I 1 267 ? -48.400 -83.923 -58.733  1.00 111.13 1  267 LYS H NZ    1 
ATOM   8241  N N     . ASN I 1 268 ? -42.934 -80.834 -56.579  1.00 91.28  ?  268 ASN H N     1 
ATOM   8242  C CA    . ASN I 1 268 ? -42.187 -80.184 -55.509  1.00 81.27  ?  268 ASN H CA    1 
ATOM   8243  C C     . ASN I 1 268 ? -42.620 -78.729 -55.432  1.00 79.51  ?  268 ASN H C     1 
ATOM   8244  O O     . ASN I 1 268 ? -42.126 -77.884 -56.176  1.00 77.30  ?  268 ASN H O     1 
ATOM   8245  C CB    . ASN I 1 268 ? -40.683 -80.293 -55.747  1.00 75.05  ?  268 ASN H CB    1 
ATOM   8246  C CG    . ASN I 1 268 ? -40.236 -81.722 -55.968  1.00 87.69  ?  268 ASN H CG    1 
ATOM   8247  O OD1   . ASN I 1 268 ? -40.156 -82.510 -55.027  1.00 106.92 ?  268 ASN H OD1   1 
ATOM   8248  N ND2   . ASN I 1 268 ? -39.939 -82.064 -57.216  1.00 76.98  ?  268 ASN H ND2   1 
ATOM   8249  N N     . HIS I 1 269 ? -43.537 -78.441 -54.515  1.00 72.00  ?  269 HIS H N     1 
ATOM   8250  C CA    . HIS I 1 269 ? -44.330 -77.222 -54.588  1.00 72.10  ?  269 HIS H CA    1 
ATOM   8251  C C     . HIS I 1 269 ? -43.538 -75.976 -54.229  1.00 54.68  ?  269 HIS H C     1 
ATOM   8252  O O     . HIS I 1 269 ? -42.798 -75.953 -53.246  1.00 70.19  ?  269 HIS H O     1 
ATOM   8253  C CB    . HIS I 1 269 ? -45.528 -77.324 -53.639  1.00 76.24  ?  269 HIS H CB    1 
ATOM   8254  C CG    . HIS I 1 269 ? -46.529 -78.367 -54.026  1.00 84.56  ?  269 HIS H CG    1 
ATOM   8255  N ND1   . HIS I 1 269 ? -46.166 -79.615 -54.487  1.00 81.06  ?  269 HIS H ND1   1 
ATOM   8256  C CD2   . HIS I 1 269 ? -47.883 -78.356 -53.999  1.00 82.20  ?  269 HIS H CD2   1 
ATOM   8257  C CE1   . HIS I 1 269 ? -47.253 -80.322 -54.738  1.00 98.48  ?  269 HIS H CE1   1 
ATOM   8258  N NE2   . HIS I 1 269 ? -48.308 -79.581 -54.450  1.00 108.08 ?  269 HIS H NE2   1 
ATOM   8259  N N     . ILE I 1 270 ? -43.709 -74.935 -55.038  1.00 62.76  ?  270 ILE H N     1 
ATOM   8260  C CA    . ILE I 1 270 ? -43.253 -73.602 -54.683  1.00 63.77  ?  270 ILE H CA    1 
ATOM   8261  C C     . ILE I 1 270 ? -44.132 -73.095 -53.546  1.00 61.69  ?  270 ILE H C     1 
ATOM   8262  O O     . ILE I 1 270 ? -45.340 -73.332 -53.545  1.00 54.00  ?  270 ILE H O     1 
ATOM   8263  C CB    . ILE I 1 270 ? -43.317 -72.642 -55.893  1.00 59.37  ?  270 ILE H CB    1 
ATOM   8264  C CG1   . ILE I 1 270 ? -42.349 -73.098 -56.988  1.00 61.60  ?  270 ILE H CG1   1 
ATOM   8265  C CG2   . ILE I 1 270 ? -43.032 -71.205 -55.476  1.00 57.26  ?  270 ILE H CG2   1 
ATOM   8266  C CD1   . ILE I 1 270 ? -40.890 -72.959 -56.614  1.00 61.47  ?  270 ILE H CD1   1 
ATOM   8267  N N     . ILE I 1 271 ? -43.538 -72.401 -52.582  1.00 69.21  ?  271 ILE H N     1 
ATOM   8268  C CA    . ILE I 1 271 ? -44.321 -71.813 -51.504  1.00 61.07  ?  271 ILE H CA    1 
ATOM   8269  C C     . ILE I 1 271 ? -44.329 -70.294 -51.592  1.00 49.39  ?  271 ILE H C     1 
ATOM   8270  O O     . ILE I 1 271 ? -43.483 -69.691 -52.251  1.00 48.64  ?  271 ILE H O     1 
ATOM   8271  C CB    . ILE I 1 271 ? -43.795 -72.242 -50.123  1.00 60.94  ?  271 ILE H CB    1 
ATOM   8272  C CG1   . ILE I 1 271 ? -42.343 -71.801 -49.941  1.00 82.09  ?  271 ILE H CG1   1 
ATOM   8273  C CG2   . ILE I 1 271 ? -43.916 -73.746 -49.955  1.00 56.07  ?  271 ILE H CG2   1 
ATOM   8274  C CD1   . ILE I 1 271 ? -41.772 -72.140 -48.581  1.00 69.80  ?  271 ILE H CD1   1 
ATOM   8275  N N     . GLY I 1 272 ? -45.297 -69.684 -50.921  1.00 56.63  ?  272 GLY H N     1 
ATOM   8276  C CA    . GLY I 1 272 ? -45.381 -68.241 -50.829  1.00 50.32  ?  272 GLY H CA    1 
ATOM   8277  C C     . GLY I 1 272 ? -46.056 -67.640 -52.042  1.00 52.46  ?  272 GLY H C     1 
ATOM   8278  O O     . GLY I 1 272 ? -46.504 -68.368 -52.928  1.00 60.02  ?  272 GLY H O     1 
ATOM   8279  N N     . VAL I 1 273 ? -46.142 -66.312 -52.077  1.00 53.56  ?  273 VAL H N     1 
ATOM   8280  C CA    . VAL I 1 273 ? -46.773 -65.612 -53.190  1.00 51.19  ?  273 VAL H CA    1 
ATOM   8281  C C     . VAL I 1 273 ? -46.187 -65.987 -54.552  1.00 56.60  ?  273 VAL H C     1 
ATOM   8282  O O     . VAL I 1 273 ? -46.899 -65.996 -55.559  1.00 66.17  ?  273 VAL H O     1 
ATOM   8283  C CB    . VAL I 1 273 ? -46.653 -64.078 -52.999  1.00 62.36  ?  273 VAL H CB    1 
ATOM   8284  C CG1   . VAL I 1 273 ? -47.067 -63.318 -54.257  1.00 60.53  ?  273 VAL H CG1   1 
ATOM   8285  C CG2   . VAL I 1 273 ? -47.487 -63.629 -51.811  1.00 85.73  ?  273 VAL H CG2   1 
ATOM   8286  N N     . LYS I 1 274 ? -44.903 -66.335 -54.582  1.00 55.19  ?  274 LYS H N     1 
ATOM   8287  C CA    . LYS I 1 274 ? -44.272 -66.720 -55.840  1.00 60.36  ?  274 LYS H CA    1 
ATOM   8288  C C     . LYS I 1 274 ? -44.909 -67.931 -56.512  1.00 61.89  ?  274 LYS H C     1 
ATOM   8289  O O     . LYS I 1 274 ? -44.854 -68.058 -57.737  1.00 77.44  ?  274 LYS H O     1 
ATOM   8290  C CB    . LYS I 1 274 ? -42.783 -66.999 -55.614  1.00 46.69  ?  274 LYS H CB    1 
ATOM   8291  N N     . LEU I 1 275 ? -45.628 -68.739 -55.738  1.00 54.84  ?  275 LEU H N     1 
ATOM   8292  C CA    . LEU I 1 275 ? -46.327 -69.880 -56.311  1.00 64.27  ?  275 LEU H CA    1 
ATOM   8293  C C     . LEU I 1 275 ? -47.382 -69.392 -57.272  1.00 68.03  ?  275 LEU H C     1 
ATOM   8294  O O     . LEU I 1 275 ? -47.526 -69.918 -58.376  1.00 75.39  ?  275 LEU H O     1 
ATOM   8295  C CB    . LEU I 1 275 ? -46.960 -70.743 -55.217  1.00 66.16  ?  275 LEU H CB    1 
ATOM   8296  N N     . GLN I 1 276 ? -48.031 -68.298 -56.901  1.00 61.44  ?  276 GLN H N     1 
ATOM   8297  C CA    . GLN I 1 276 ? -49.060 -67.741 -57.749  1.00 77.61  ?  276 GLN H CA    1 
ATOM   8298  C C     . GLN I 1 276 ? -48.416 -67.197 -59.008  1.00 75.80  ?  276 GLN H C     1 
ATOM   8299  O O     . GLN I 1 276 ? -48.927 -67.421 -60.110  1.00 76.00  ?  276 GLN H O     1 
ATOM   8300  C CB    . GLN I 1 276 ? -49.832 -66.642 -57.016  1.00 68.95  ?  276 GLN H CB    1 
ATOM   8301  N N     . ASP I 1 277 ? -47.232 -66.606 -58.867  1.00 66.79  ?  277 ASP H N     1 
ATOM   8302  C CA    . ASP I 1 277 ? -46.546 -66.108 -60.044  1.00 51.87  ?  277 ASP H CA    1 
ATOM   8303  C C     . ASP I 1 277 ? -46.195 -67.296 -60.904  1.00 53.73  ?  277 ASP H C     1 
ATOM   8304  O O     . ASP I 1 277 ? -46.460 -67.299 -62.113  1.00 72.88  ?  277 ASP H O     1 
ATOM   8305  C CB    . ASP I 1 277 ? -45.286 -65.325 -59.675  1.00 54.81  ?  277 ASP H CB    1 
ATOM   8306  C CG    . ASP I 1 277 ? -45.589 -64.061 -58.904  1.00 69.37  ?  277 ASP H CG    1 
ATOM   8307  O OD1   . ASP I 1 277 ? -46.555 -63.358 -59.265  1.00 75.00  ?  277 ASP H OD1   1 
ATOM   8308  O OD2   . ASP I 1 277 ? -44.852 -63.766 -57.940  1.00 77.08  -1 277 ASP H OD2   1 
ATOM   8309  N N     . TYR I 1 278 ? -45.764 -68.364 -60.241  1.00 54.34  ?  278 TYR H N     1 
ATOM   8310  C CA    . TYR I 1 278 ? -45.454 -69.599 -60.930  1.00 52.63  ?  278 TYR H CA    1 
ATOM   8311  C C     . TYR I 1 278 ? -46.668 -70.060 -61.701  1.00 67.91  ?  278 TYR H C     1 
ATOM   8312  O O     . TYR I 1 278 ? -46.574 -70.336 -62.901  1.00 75.27  ?  278 TYR H O     1 
ATOM   8313  C CB    . TYR I 1 278 ? -45.003 -70.672 -59.940  1.00 54.70  ?  278 TYR H CB    1 
ATOM   8314  C CG    . TYR I 1 278 ? -44.796 -72.036 -60.551  1.00 47.46  ?  278 TYR H CG    1 
ATOM   8315  C CD1   . TYR I 1 278 ? -43.739 -72.279 -61.416  1.00 51.24  ?  278 TYR H CD1   1 
ATOM   8316  C CD2   . TYR I 1 278 ? -45.657 -73.085 -60.257  1.00 64.17  ?  278 TYR H CD2   1 
ATOM   8317  C CE1   . TYR I 1 278 ? -43.548 -73.526 -61.977  1.00 57.74  ?  278 TYR H CE1   1 
ATOM   8318  C CE2   . TYR I 1 278 ? -45.473 -74.337 -60.809  1.00 74.28  ?  278 TYR H CE2   1 
ATOM   8319  C CZ    . TYR I 1 278 ? -44.418 -74.551 -61.669  1.00 68.83  ?  278 TYR H CZ    1 
ATOM   8320  O OH    . TYR I 1 278 ? -44.226 -75.798 -62.219  1.00 77.90  ?  278 TYR H OH    1 
ATOM   8321  N N     . ARG I 1 279 ? -47.823 -70.048 -61.046  1.00 70.51  ?  279 ARG H N     1 
ATOM   8322  C CA    . ARG I 1 279 ? -49.032 -70.497 -61.711  1.00 72.14  ?  279 ARG H CA    1 
ATOM   8323  C C     . ARG I 1 279 ? -49.310 -69.649 -62.947  1.00 68.45  ?  279 ARG H C     1 
ATOM   8324  O O     . ARG I 1 279 ? -49.476 -70.192 -64.048  1.00 65.49  ?  279 ARG H O     1 
ATOM   8325  C CB    . ARG I 1 279 ? -50.224 -70.448 -60.754  1.00 70.47  ?  279 ARG H CB    1 
ATOM   8326  C CG    . ARG I 1 279 ? -50.178 -71.490 -59.643  1.00 77.56  ?  279 ARG H CG    1 
ATOM   8327  C CD    . ARG I 1 279 ? -50.012 -72.902 -60.181  1.00 80.95  ?  279 ARG H CD    1 
ATOM   8328  N NE    . ARG I 1 279 ? -51.253 -73.438 -60.732  1.00 90.78  ?  279 ARG H NE    1 
ATOM   8329  C CZ    . ARG I 1 279 ? -51.308 -74.334 -61.713  1.00 87.82  ?  279 ARG H CZ    1 
ATOM   8330  N NH1   . ARG I 1 279 ? -50.189 -74.798 -62.253  1.00 83.66  1  279 ARG H NH1   1 
ATOM   8331  N NH2   . ARG I 1 279 ? -52.481 -74.768 -62.152  1.00 77.60  ?  279 ARG H NH2   1 
ATOM   8332  N N     . ASP I 1 280 ? -49.228 -68.327 -62.800  1.00 60.05  ?  280 ASP H N     1 
ATOM   8333  C CA    . ASP I 1 280 ? -49.434 -67.456 -63.949  1.00 63.87  ?  280 ASP H CA    1 
ATOM   8334  C C     . ASP I 1 280 ? -48.407 -67.743 -65.017  1.00 70.13  ?  280 ASP H C     1 
ATOM   8335  O O     . ASP I 1 280 ? -48.741 -67.864 -66.201  1.00 72.14  ?  280 ASP H O     1 
ATOM   8336  C CB    . ASP I 1 280 ? -49.369 -65.982 -63.545  1.00 59.14  ?  280 ASP H CB    1 
ATOM   8337  C CG    . ASP I 1 280 ? -50.615 -65.518 -62.824  1.00 76.60  ?  280 ASP H CG    1 
ATOM   8338  O OD1   . ASP I 1 280 ? -51.630 -66.244 -62.861  1.00 61.06  ?  280 ASP H OD1   1 
ATOM   8339  O OD2   . ASP I 1 280 ? -50.581 -64.424 -62.224  1.00 87.54  -1 280 ASP H OD2   1 
ATOM   8340  N N     . TRP I 1 281 ? -47.170 -67.936 -64.579  1.00 62.33  ?  281 TRP H N     1 
ATOM   8341  C CA    . TRP I 1 281 ? -46.099 -68.253 -65.496  1.00 55.43  ?  281 TRP H CA    1 
ATOM   8342  C C     . TRP I 1 281 ? -46.404 -69.529 -66.269  1.00 64.42  ?  281 TRP H C     1 
ATOM   8343  O O     . TRP I 1 281 ? -46.366 -69.531 -67.511  1.00 63.04  ?  281 TRP H O     1 
ATOM   8344  C CB    . TRP I 1 281 ? -44.800 -68.383 -64.694  1.00 53.42  ?  281 TRP H CB    1 
ATOM   8345  C CG    . TRP I 1 281 ? -43.536 -68.574 -65.465  1.00 53.92  ?  281 TRP H CG    1 
ATOM   8346  C CD1   . TRP I 1 281 ? -42.826 -67.616 -66.125  1.00 57.47  ?  281 TRP H CD1   1 
ATOM   8347  C CD2   . TRP I 1 281 ? -42.785 -69.788 -65.589  1.00 41.14  ?  281 TRP H CD2   1 
ATOM   8348  N NE1   . TRP I 1 281 ? -41.697 -68.165 -66.683  1.00 54.60  ?  281 TRP H NE1   1 
ATOM   8349  C CE2   . TRP I 1 281 ? -41.648 -69.497 -66.367  1.00 40.45  ?  281 TRP H CE2   1 
ATOM   8350  C CE3   . TRP I 1 281 ? -42.974 -71.097 -65.134  1.00 38.65  ?  281 TRP H CE3   1 
ATOM   8351  C CZ2   . TRP I 1 281 ? -40.704 -70.466 -66.700  1.00 46.70  ?  281 TRP H CZ2   1 
ATOM   8352  C CZ3   . TRP I 1 281 ? -42.033 -72.057 -65.464  1.00 38.75  ?  281 TRP H CZ3   1 
ATOM   8353  C CH2   . TRP I 1 281 ? -40.914 -71.737 -66.240  1.00 51.90  ?  281 TRP H CH2   1 
ATOM   8354  N N     . CYS I 1 282 ? -46.893 -70.543 -65.555  1.00 61.77  ?  282 CYS H N     1 
ATOM   8355  C CA    . CYS I 1 282 ? -47.296 -71.783 -66.206  1.00 59.98  ?  282 CYS H CA    1 
ATOM   8356  C C     . CYS I 1 282 ? -48.348 -71.542 -67.262  1.00 71.84  ?  282 CYS H C     1 
ATOM   8357  O O     . CYS I 1 282 ? -48.235 -72.033 -68.391  1.00 77.32  ?  282 CYS H O     1 
ATOM   8358  C CB    . CYS I 1 282 ? -47.813 -72.791 -65.180  1.00 64.81  ?  282 CYS H CB    1 
ATOM   8359  S SG    . CYS I 1 282 ? -46.524 -73.564 -64.184  1.00 107.73 ?  282 CYS H SG    1 
ATOM   8360  N N     . LYS I 1 283 ? -49.306 -70.687 -66.931  1.00 70.85  ?  283 LYS H N     1 
ATOM   8361  C CA    . LYS I 1 283 ? -50.406 -70.438 -67.835  1.00 77.96  ?  283 LYS H CA    1 
ATOM   8362  C C     . LYS I 1 283 ? -49.888 -69.821 -69.117  1.00 65.95  ?  283 LYS H C     1 
ATOM   8363  O O     . LYS I 1 283 ? -50.219 -70.286 -70.216  1.00 53.19  ?  283 LYS H O     1 
ATOM   8364  C CB    . LYS I 1 283 ? -51.447 -69.527 -67.181  1.00 62.45  ?  283 LYS H CB    1 
ATOM   8365  N N     . VAL I 1 284 ? -48.961 -68.879 -68.984  1.00 57.64  ?  284 VAL H N     1 
ATOM   8366  C CA    . VAL I 1 284 ? -48.431 -68.258 -70.179  1.00 44.45  ?  284 VAL H CA    1 
ATOM   8367  C C     . VAL I 1 284 ? -47.642 -69.261 -70.992  1.00 56.98  ?  284 VAL H C     1 
ATOM   8368  O O     . VAL I 1 284 ? -47.792 -69.322 -72.219  1.00 72.11  ?  284 VAL H O     1 
ATOM   8369  C CB    . VAL I 1 284 ? -47.541 -67.050 -69.834  1.00 50.01  ?  284 VAL H CB    1 
ATOM   8370  C CG1   . VAL I 1 284 ? -46.765 -66.589 -71.057  1.00 53.54  ?  284 VAL H CG1   1 
ATOM   8371  C CG2   . VAL I 1 284 ? -48.387 -65.917 -69.280  1.00 48.89  ?  284 VAL H CG2   1 
ATOM   8372  N N     . VAL I 1 285 ? -46.921 -70.142 -70.308  1.00 54.04  ?  285 VAL H N     1 
ATOM   8373  C CA    . VAL I 1 285 ? -46.177 -71.162 -71.022  1.00 60.39  ?  285 VAL H CA    1 
ATOM   8374  C C     . VAL I 1 285 ? -47.116 -72.032 -71.840  1.00 67.22  ?  285 VAL H C     1 
ATOM   8375  O O     . VAL I 1 285 ? -46.858 -72.292 -73.023  1.00 70.22  ?  285 VAL H O     1 
ATOM   8376  C CB    . VAL I 1 285 ? -45.368 -72.051 -70.054  1.00 73.21  ?  285 VAL H CB    1 
ATOM   8377  C CG1   . VAL I 1 285 ? -44.814 -73.270 -70.778  1.00 65.52  ?  285 VAL H CG1   1 
ATOM   8378  C CG2   . VAL I 1 285 ? -44.247 -71.252 -69.407  1.00 63.69  ?  285 VAL H CG2   1 
ATOM   8379  N N     . THR I 1 286 ? -48.276 -72.342 -71.266  1.00 70.72  ?  286 THR H N     1 
ATOM   8380  C CA    . THR I 1 286 ? -49.271 -73.108 -71.999  1.00 73.61  ?  286 THR H CA    1 
ATOM   8381  C C     . THR I 1 286 ? -49.700 -72.391 -73.265  1.00 65.54  ?  286 THR H C     1 
ATOM   8382  O O     . THR I 1 286 ? -49.611 -72.952 -74.363  1.00 70.92  ?  286 THR H O     1 
ATOM   8383  C CB    . THR I 1 286 ? -50.514 -73.391 -71.132  1.00 70.23  ?  286 THR H CB    1 
ATOM   8384  O OG1   . THR I 1 286 ? -50.124 -74.086 -69.941  1.00 82.18  ?  286 THR H OG1   1 
ATOM   8385  C CG2   . THR I 1 286 ? -51.522 -74.229 -71.900  1.00 64.31  ?  286 THR H CG2   1 
ATOM   8386  N N     . LEU I 1 287 ? -50.036 -71.115 -73.119  1.00 60.89  ?  287 LEU H N     1 
ATOM   8387  C CA    . LEU I 1 287 ? -50.433 -70.298 -74.255  1.00 62.22  ?  287 LEU H CA    1 
ATOM   8388  C C     . LEU I 1 287 ? -49.318 -70.278 -75.296  1.00 64.22  ?  287 LEU H C     1 
ATOM   8389  O O     . LEU I 1 287 ? -49.588 -70.317 -76.497  1.00 64.36  ?  287 LEU H O     1 
ATOM   8390  C CB    . LEU I 1 287 ? -50.847 -68.898 -73.794  1.00 52.44  ?  287 LEU H CB    1 
ATOM   8391  C CG    . LEU I 1 287 ? -49.965 -67.660 -73.846  1.00 51.64  ?  287 LEU H CG    1 
ATOM   8392  C CD1   . LEU I 1 287 ? -49.981 -67.058 -75.239  1.00 69.17  ?  287 LEU H CD1   1 
ATOM   8393  C CD2   . LEU I 1 287 ? -50.495 -66.675 -72.825  1.00 47.70  ?  287 LEU H CD2   1 
ATOM   8394  N N     . ILE I 1 288 ? -48.073 -70.215 -74.840  1.00 60.69  ?  288 ILE H N     1 
ATOM   8395  C CA    . ILE I 1 288 ? -46.949 -70.206 -75.766  1.00 58.23  ?  288 ILE H CA    1 
ATOM   8396  C C     . ILE I 1 288 ? -46.860 -71.539 -76.502  1.00 60.01  ?  288 ILE H C     1 
ATOM   8397  O O     . ILE I 1 288 ? -46.676 -71.566 -77.719  1.00 61.05  ?  288 ILE H O     1 
ATOM   8398  C CB    . ILE I 1 288 ? -45.621 -69.905 -75.058  1.00 63.85  ?  288 ILE H CB    1 
ATOM   8399  C CG1   . ILE I 1 288 ? -45.637 -68.477 -74.515  1.00 57.94  ?  288 ILE H CG1   1 
ATOM   8400  C CG2   . ILE I 1 288 ? -44.455 -70.060 -76.021  1.00 54.52  ?  288 ILE H CG2   1 
ATOM   8401  C CD1   . ILE I 1 288 ? -44.352 -68.068 -73.846  1.00 58.42  ?  288 ILE H CD1   1 
ATOM   8402  N N     . ASP I 1 289 ? -46.985 -72.640 -75.764  1.00 65.64  ?  289 ASP H N     1 
ATOM   8403  C CA    . ASP I 1 289 ? -46.923 -73.975 -76.360  1.00 67.57  ?  289 ASP H CA    1 
ATOM   8404  C C     . ASP I 1 289 ? -47.964 -74.134 -77.476  1.00 76.76  ?  289 ASP H C     1 
ATOM   8405  O O     . ASP I 1 289 ? -47.742 -74.855 -78.449  1.00 77.75  ?  289 ASP H O     1 
ATOM   8406  C CB    . ASP I 1 289 ? -47.123 -75.049 -75.287  1.00 62.55  ?  289 ASP H CB    1 
ATOM   8407  C CG    . ASP I 1 289 ? -46.770 -76.446 -75.778  1.00 68.02  ?  289 ASP H CG    1 
ATOM   8408  O OD1   . ASP I 1 289 ? -46.423 -76.611 -76.966  1.00 86.07  ?  289 ASP H OD1   1 
ATOM   8409  O OD2   . ASP I 1 289 ? -46.839 -77.391 -74.965  1.00 86.00  -1 289 ASP H OD2   1 
ATOM   8410  N N     . ASN I 1 290 ? -49.086 -73.436 -77.346  1.00 72.57  ?  290 ASN H N     1 
ATOM   8411  C CA    . ASN I 1 290 ? -50.142 -73.497 -78.350  1.00 70.12  ?  290 ASN H CA    1 
ATOM   8412  C C     . ASN I 1 290 ? -50.051 -72.367 -79.372  1.00 62.15  ?  290 ASN H C     1 
ATOM   8413  O O     . ASN I 1 290 ? -51.025 -72.067 -80.064  1.00 61.71  ?  290 ASN H O     1 
ATOM   8414  C CB    . ASN I 1 290 ? -51.514 -73.482 -77.677  1.00 74.35  ?  290 ASN H CB    1 
ATOM   8415  C CG    . ASN I 1 290 ? -51.763 -74.721 -76.842  1.00 80.22  ?  290 ASN H CG    1 
ATOM   8416  O OD1   . ASN I 1 290 ? -51.363 -75.826 -77.215  1.00 80.08  ?  290 ASN H OD1   1 
ATOM   8417  N ND2   . ASN I 1 290 ? -52.420 -74.546 -75.702  1.00 80.73  ?  290 ASN H ND2   1 
ATOM   8418  N N     . LYS I 1 291 ? -48.879 -71.737 -79.437  1.00 65.48  ?  291 LYS H N     1 
ATOM   8419  C CA    . LYS I 1 291 ? -48.554 -70.755 -80.473  1.00 62.33  ?  291 LYS H CA    1 
ATOM   8420  C C     . LYS I 1 291 ? -49.425 -69.499 -80.450  1.00 64.21  ?  291 LYS H C     1 
ATOM   8421  O O     . LYS I 1 291 ? -49.461 -68.749 -81.426  1.00 74.17  ?  291 LYS H O     1 
ATOM   8422  C CB    . LYS I 1 291 ? -48.633 -71.405 -81.858  1.00 47.48  ?  291 LYS H CB    1 
ATOM   8423  N N     . GLU I 1 292 ? -50.119 -69.266 -79.341  1.00 57.26  ?  292 GLU H N     1 
ATOM   8424  C CA    . GLU I 1 292 ? -51.000 -68.108 -79.224  1.00 58.51  ?  292 GLU H CA    1 
ATOM   8425  C C     . GLU I 1 292 ? -50.198 -66.814 -79.074  1.00 59.38  ?  292 GLU H C     1 
ATOM   8426  O O     . GLU I 1 292 ? -50.728 -65.719 -79.259  1.00 71.08  ?  292 GLU H O     1 
ATOM   8427  C CB    . GLU I 1 292 ? -51.955 -68.277 -78.040  1.00 59.02  ?  292 GLU H CB    1 
ATOM   8428  N N     . HIS I 1 293 ? -48.919 -66.953 -78.737  1.00 58.13  ?  293 HIS H N     1 
ATOM   8429  C CA    . HIS I 1 293 ? -47.998 -65.821 -78.639  1.00 66.11  ?  293 HIS H CA    1 
ATOM   8430  C C     . HIS I 1 293 ? -47.659 -65.242 -80.013  1.00 75.26  ?  293 HIS H C     1 
ATOM   8431  O O     . HIS I 1 293 ? -47.097 -64.150 -80.115  1.00 76.60  ?  293 HIS H O     1 
ATOM   8432  C CB    . HIS I 1 293 ? -46.708 -66.227 -77.919  1.00 54.44  ?  293 HIS H CB    1 
ATOM   8433  C CG    . HIS I 1 293 ? -45.906 -67.262 -78.643  1.00 54.28  ?  293 HIS H CG    1 
ATOM   8434  N ND1   . HIS I 1 293 ? -46.384 -68.528 -78.908  1.00 61.12  ?  293 HIS H ND1   1 
ATOM   8435  C CD2   . HIS I 1 293 ? -44.652 -67.220 -79.152  1.00 50.54  ?  293 HIS H CD2   1 
ATOM   8436  C CE1   . HIS I 1 293 ? -45.460 -69.219 -79.552  1.00 54.72  ?  293 HIS H CE1   1 
ATOM   8437  N NE2   . HIS I 1 293 ? -44.400 -68.448 -79.713  1.00 59.05  ?  293 HIS H NE2   1 
ATOM   8438  N N     . LEU I 1 294 ? -47.999 -65.984 -81.062  1.00 74.01  ?  294 LEU H N     1 
ATOM   8439  C CA    . LEU I 1 294 ? -47.717 -65.576 -82.436  1.00 73.51  ?  294 LEU H CA    1 
ATOM   8440  C C     . LEU I 1 294 ? -48.855 -64.775 -83.068  1.00 85.30  ?  294 LEU H C     1 
ATOM   8441  O O     . LEU I 1 294 ? -48.834 -64.496 -84.267  1.00 98.86  ?  294 LEU H O     1 
ATOM   8442  C CB    . LEU I 1 294 ? -47.415 -66.804 -83.298  1.00 70.74  ?  294 LEU H CB    1 
ATOM   8443  C CG    . LEU I 1 294 ? -46.227 -67.663 -82.860  1.00 66.14  ?  294 LEU H CG    1 
ATOM   8444  C CD1   . LEU I 1 294 ? -46.203 -68.978 -83.624  1.00 57.67  ?  294 LEU H CD1   1 
ATOM   8445  C CD2   . LEU I 1 294 ? -44.921 -66.906 -83.045  1.00 63.40  ?  294 LEU H CD2   1 
ATOM   8446  N N     . THR I 1 295 ? -49.844 -64.406 -82.261  1.00 87.08  ?  295 THR H N     1 
ATOM   8447  C CA    . THR I 1 295 ? -50.931 -63.552 -82.728  1.00 72.94  ?  295 THR H CA    1 
ATOM   8448  C C     . THR I 1 295 ? -50.948 -62.259 -81.917  1.00 94.40  ?  295 THR H C     1 
ATOM   8449  O O     . THR I 1 295 ? -50.504 -62.234 -80.768  1.00 105.08 ?  295 THR H O     1 
ATOM   8450  C CB    . THR I 1 295 ? -52.302 -64.249 -82.619  1.00 79.11  ?  295 THR H CB    1 
ATOM   8451  O OG1   . THR I 1 295 ? -52.709 -64.307 -81.246  1.00 85.54  ?  295 THR H OG1   1 
ATOM   8452  C CG2   . THR I 1 295 ? -52.231 -65.660 -83.181  1.00 77.56  ?  295 THR H CG2   1 
ATOM   8453  N N     . SER I 1 296 ? -51.458 -61.190 -82.522  1.00 89.75  ?  296 SER H N     1 
ATOM   8454  C CA    . SER I 1 296 ? -51.562 -59.892 -81.857  1.00 102.27 ?  296 SER H CA    1 
ATOM   8455  C C     . SER I 1 296 ? -52.408 -59.954 -80.588  1.00 104.94 ?  296 SER H C     1 
ATOM   8456  O O     . SER I 1 296 ? -52.005 -59.445 -79.538  1.00 104.50 ?  296 SER H O     1 
ATOM   8457  C CB    . SER I 1 296 ? -52.141 -58.852 -82.818  1.00 103.91 ?  296 SER H CB    1 
ATOM   8458  O OG    . SER I 1 296 ? -53.430 -59.235 -83.267  1.00 112.44 ?  296 SER H OG    1 
ATOM   8459  N N     . GLU I 1 297 ? -53.577 -60.579 -80.691  1.00 103.97 ?  297 GLU H N     1 
ATOM   8460  C CA    . GLU I 1 297 ? -54.495 -60.693 -79.563  1.00 106.45 ?  297 GLU H CA    1 
ATOM   8461  C C     . GLU I 1 297 ? -53.840 -61.455 -78.416  1.00 101.99 ?  297 GLU H C     1 
ATOM   8462  O O     . GLU I 1 297 ? -53.897 -61.029 -77.259  1.00 103.35 ?  297 GLU H O     1 
ATOM   8463  C CB    . GLU I 1 297 ? -55.790 -61.387 -79.990  1.00 102.14 ?  297 GLU H CB    1 
ATOM   8464  N N     . GLY I 1 298 ? -53.216 -62.582 -78.747  1.00 93.40  ?  298 GLY H N     1 
ATOM   8465  C CA    . GLY I 1 298 ? -52.524 -63.389 -77.760  1.00 92.17  ?  298 GLY H CA    1 
ATOM   8466  C C     . GLY I 1 298 ? -51.364 -62.640 -77.131  1.00 86.88  ?  298 GLY H C     1 
ATOM   8467  O O     . GLY I 1 298 ? -51.111 -62.772 -75.937  1.00 92.95  ?  298 GLY H O     1 
ATOM   8468  N N     . LEU I 1 299 ? -50.638 -61.876 -77.941  1.00 83.61  ?  299 LEU H N     1 
ATOM   8469  C CA    . LEU I 1 299 ? -49.528 -61.068 -77.444  1.00 80.53  ?  299 LEU H CA    1 
ATOM   8470  C C     . LEU I 1 299 ? -50.011 -60.019 -76.441  1.00 93.25  ?  299 LEU H C     1 
ATOM   8471  O O     . LEU I 1 299 ? -49.366 -59.778 -75.416  1.00 103.08 ?  299 LEU H O     1 
ATOM   8472  C CB    . LEU I 1 299 ? -48.792 -60.393 -78.602  1.00 82.33  ?  299 LEU H CB    1 
ATOM   8473  C CG    . LEU I 1 299 ? -47.655 -59.451 -78.203  1.00 80.62  ?  299 LEU H CG    1 
ATOM   8474  C CD1   . LEU I 1 299 ? -46.639 -60.181 -77.340  1.00 87.29  ?  299 LEU H CD1   1 
ATOM   8475  C CD2   . LEU I 1 299 ? -46.988 -58.865 -79.435  1.00 94.25  ?  299 LEU H CD2   1 
ATOM   8476  N N     . GLU I 1 300 ? -51.152 -59.403 -76.746  1.00 98.21  ?  300 GLU H N     1 
ATOM   8477  C CA    . GLU I 1 300 ? -51.798 -58.467 -75.829  1.00 94.95  ?  300 GLU H CA    1 
ATOM   8478  C C     . GLU I 1 300 ? -52.162 -59.175 -74.529  1.00 93.32  ?  300 GLU H C     1 
ATOM   8479  O O     . GLU I 1 300 ? -51.949 -58.643 -73.435  1.00 91.97  ?  300 GLU H O     1 
ATOM   8480  C CB    . GLU I 1 300 ? -53.042 -57.851 -76.471  1.00 88.60  ?  300 GLU H CB    1 
ATOM   8481  N N     . LYS I 1 301 ? -52.713 -60.378 -74.669  1.00 85.87  ?  301 LYS H N     1 
ATOM   8482  C CA    . LYS I 1 301 ? -53.050 -61.231 -73.535  1.00 83.41  ?  301 LYS H CA    1 
ATOM   8483  C C     . LYS I 1 301 ? -51.826 -61.403 -72.638  1.00 97.97  ?  301 LYS H C     1 
ATOM   8484  O O     . LYS I 1 301 ? -51.889 -61.172 -71.426  1.00 96.93  ?  301 LYS H O     1 
ATOM   8485  C CB    . LYS I 1 301 ? -53.572 -62.590 -74.006  1.00 66.12  ?  301 LYS H CB    1 
ATOM   8486  N N     . ILE I 1 302 ? -50.713 -61.809 -73.245  1.00 92.26  ?  302 ILE H N     1 
ATOM   8487  C CA    . ILE I 1 302 ? -49.493 -62.083 -72.500  1.00 85.55  ?  302 ILE H CA    1 
ATOM   8488  C C     . ILE I 1 302 ? -48.973 -60.839 -71.808  1.00 92.86  ?  302 ILE H C     1 
ATOM   8489  O O     . ILE I 1 302 ? -48.616 -60.894 -70.639  1.00 94.03  ?  302 ILE H O     1 
ATOM   8490  C CB    . ILE I 1 302 ? -48.359 -62.594 -73.414  1.00 85.54  ?  302 ILE H CB    1 
ATOM   8491  C CG1   . ILE I 1 302 ? -48.674 -63.970 -73.982  1.00 79.59  ?  302 ILE H CG1   1 
ATOM   8492  C CG2   . ILE I 1 302 ? -47.030 -62.625 -72.668  1.00 92.74  ?  302 ILE H CG2   1 
ATOM   8493  C CD1   . ILE I 1 302 ? -47.629 -64.447 -74.957  1.00 86.23  ?  302 ILE H CD1   1 
ATOM   8494  N N     . GLN I 1 303 ? -48.913 -59.724 -72.530  1.00 90.43  ?  303 GLN H N     1 
ATOM   8495  C CA    . GLN I 1 303 ? -48.523 -58.457 -71.919  1.00 96.80  ?  303 GLN H CA    1 
ATOM   8496  C C     . GLN I 1 303 ? -49.373 -58.154 -70.681  1.00 91.22  ?  303 GLN H C     1 
ATOM   8497  O O     . GLN I 1 303 ? -48.857 -57.748 -69.631  1.00 84.59  ?  303 GLN H O     1 
ATOM   8498  C CB    . GLN I 1 303 ? -48.642 -57.322 -72.938  1.00 88.44  ?  303 GLN H CB    1 
ATOM   8499  C CG    . GLN I 1 303 ? -48.485 -55.930 -72.354  1.00 108.93 ?  303 GLN H CG    1 
ATOM   8500  C CD    . GLN I 1 303 ? -47.074 -55.665 -71.860  1.00 107.51 ?  303 GLN H CD    1 
ATOM   8501  O OE1   . GLN I 1 303 ? -46.119 -56.306 -72.300  1.00 99.02  ?  303 GLN H OE1   1 
ATOM   8502  N NE2   . GLN I 1 303 ? -46.936 -54.713 -70.945  1.00 107.51 ?  303 GLN H NE2   1 
ATOM   8503  N N     . LYS I 1 304 ? -50.678 -58.385 -70.811  1.00 94.69  ?  304 LYS H N     1 
ATOM   8504  C CA    . LYS I 1 304 ? -51.617 -58.153 -69.718  1.00 89.18  ?  304 LYS H CA    1 
ATOM   8505  C C     . LYS I 1 304 ? -51.337 -59.038 -68.507  1.00 86.99  ?  304 LYS H C     1 
ATOM   8506  O O     . LYS I 1 304 ? -51.382 -58.574 -67.368  1.00 99.83  ?  304 LYS H O     1 
ATOM   8507  C CB    . LYS I 1 304 ? -53.053 -58.374 -70.198  1.00 94.69  ?  304 LYS H CB    1 
ATOM   8508  N N     . ILE I 1 305 ? -51.047 -60.311 -68.760  1.00 89.07  ?  305 ILE H N     1 
ATOM   8509  C CA    . ILE I 1 305 ? -50.718 -61.252 -67.691  1.00 98.37  ?  305 ILE H CA    1 
ATOM   8510  C C     . ILE I 1 305 ? -49.405 -60.880 -67.006  1.00 89.79  ?  305 ILE H C     1 
ATOM   8511  O O     . ILE I 1 305 ? -49.314 -60.848 -65.779  1.00 93.49  ?  305 ILE H O     1 
ATOM   8512  C CB    . ILE I 1 305 ? -50.629 -62.695 -68.218  1.00 97.22  ?  305 ILE H CB    1 
ATOM   8513  C CG1   . ILE I 1 305 ? -51.949 -63.100 -68.876  1.00 101.56 ?  305 ILE H CG1   1 
ATOM   8514  C CG2   . ILE I 1 305 ? -50.285 -63.651 -67.088  1.00 92.33  ?  305 ILE H CG2   1 
ATOM   8515  C CD1   . ILE I 1 305 ? -51.889 -64.420 -69.609  1.00 91.59  ?  305 ILE H CD1   1 
ATOM   8516  N N     . LYS I 1 306 ? -48.396 -60.602 -67.825  1.00 88.58  ?  306 LYS H N     1 
ATOM   8517  C CA    . LYS I 1 306 ? -47.067 -60.205 -67.378  1.00 92.71  ?  306 LYS H CA    1 
ATOM   8518  C C     . LYS I 1 306 ? -47.146 -58.991 -66.467  1.00 97.44  ?  306 LYS H C     1 
ATOM   8519  O O     . LYS I 1 306 ? -46.441 -58.914 -65.460  1.00 97.73  ?  306 LYS H O     1 
ATOM   8520  C CB    . LYS I 1 306 ? -46.162 -59.909 -68.576  1.00 81.83  ?  306 LYS H CB    1 
ATOM   8521  N N     . GLU I 1 307 ? -48.005 -58.042 -66.826  1.00 93.48  ?  307 GLU H N     1 
ATOM   8522  C CA    . GLU I 1 307 ? -48.133 -56.809 -66.059  1.00 95.11  ?  307 GLU H CA    1 
ATOM   8523  C C     . GLU I 1 307 ? -48.690 -57.096 -64.662  1.00 102.61 ?  307 GLU H C     1 
ATOM   8524  O O     . GLU I 1 307 ? -48.563 -56.276 -63.753  1.00 112.96 ?  307 GLU H O     1 
ATOM   8525  C CB    . GLU I 1 307 ? -49.030 -55.811 -66.792  1.00 86.59  ?  307 GLU H CB    1 
ATOM   8526  N N     . GLY I 1 308 ? -49.309 -58.263 -64.502  1.00 93.94  ?  308 GLY H N     1 
ATOM   8527  C CA    . GLY I 1 308 ? -49.875 -58.670 -63.228  1.00 93.53  ?  308 GLY H CA    1 
ATOM   8528  C C     . GLY I 1 308 ? -49.012 -59.661 -62.464  1.00 90.41  ?  308 GLY H C     1 
ATOM   8529  O O     . GLY I 1 308 ? -49.442 -60.216 -61.454  1.00 88.04  ?  308 GLY H O     1 
ATOM   8530  N N     . MET I 1 309 ? -47.793 -59.886 -62.947  1.00 89.99  ?  309 MET H N     1 
ATOM   8531  C CA    . MET I 1 309 ? -46.882 -60.843 -62.321  1.00 80.96  ?  309 MET H CA    1 
ATOM   8532  C C     . MET I 1 309 ? -45.763 -60.152 -61.548  1.00 87.83  ?  309 MET H C     1 
ATOM   8533  O O     . MET I 1 309 ? -45.420 -59.003 -61.831  1.00 88.36  ?  309 MET H O     1 
ATOM   8534  C CB    . MET I 1 309 ? -46.269 -61.776 -63.367  1.00 76.91  ?  309 MET H CB    1 
ATOM   8535  C CG    . MET I 1 309 ? -47.252 -62.719 -64.032  1.00 91.85  ?  309 MET H CG    1 
ATOM   8536  S SD    . MET I 1 309 ? -46.476 -63.637 -65.377  1.00 107.48 ?  309 MET H SD    1 
ATOM   8537  C CE    . MET I 1 309 ? -45.367 -64.704 -64.461  1.00 44.37  ?  309 MET H CE    1 
ATOM   8538  N N     . ASN I 1 310 ? -45.197 -60.874 -60.582  1.00 77.51  ?  310 ASN H N     1 
ATOM   8539  C CA    . ASN I 1 310 ? -44.003 -60.438 -59.860  1.00 73.99  ?  310 ASN H CA    1 
ATOM   8540  C C     . ASN I 1 310 ? -44.123 -59.045 -59.250  1.00 81.16  ?  310 ASN H C     1 
ATOM   8541  O O     . ASN I 1 310 ? -45.023 -58.783 -58.454  1.00 93.62  ?  310 ASN H O     1 
ATOM   8542  C CB    . ASN I 1 310 ? -42.782 -60.489 -60.780  1.00 71.38  ?  310 ASN H CB    1 
ATOM   8543  C CG    . ASN I 1 310 ? -42.492 -61.888 -61.286  1.00 75.72  ?  310 ASN H CG    1 
ATOM   8544  O OD1   . ASN I 1 310 ? -42.777 -62.877 -60.609  1.00 78.39  ?  310 ASN H OD1   1 
ATOM   8545  N ND2   . ASN I 1 310 ? -41.919 -61.979 -62.480  1.00 83.40  ?  310 ASN H ND2   1 
ATOM   8546  N N     . ARG I 1 311 ? -43.205 -58.160 -59.626  1.00 74.35  ?  311 ARG H N     1 
ATOM   8547  C CA    . ARG I 1 311 ? -43.161 -56.810 -59.076  1.00 78.44  ?  311 ARG H CA    1 
ATOM   8548  C C     . ARG I 1 311 ? -44.425 -56.002 -59.368  1.00 88.29  ?  311 ARG H C     1 
ATOM   8549  O O     . ARG I 1 311 ? -44.762 -55.083 -58.622  1.00 96.98  ?  311 ARG H O     1 
ATOM   8550  C CB    . ARG I 1 311 ? -41.938 -56.063 -59.613  1.00 66.86  ?  311 ARG H CB    1 
ATOM   8551  N N     . GLY I 1 312 ? -45.128 -56.339 -60.446  1.00 86.61  ?  312 GLY H N     1 
ATOM   8552  C CA    . GLY I 1 312 ? -46.340 -55.615 -60.778  1.00 86.53  ?  312 GLY H CA    1 
ATOM   8553  C C     . GLY I 1 312 ? -47.558 -56.113 -60.024  1.00 91.40  ?  312 GLY H C     1 
ATOM   8554  O O     . GLY I 1 312 ? -48.641 -55.538 -60.137  1.00 98.42  ?  312 GLY H O     1 
ATOM   8555  N N     . ARG I 1 313 ? -47.388 -57.185 -59.256  1.00 91.11  ?  313 ARG H N     1 
ATOM   8556  C CA    . ARG I 1 313 ? -48.480 -57.718 -58.452  1.00 98.67  ?  313 ARG H CA    1 
ATOM   8557  C C     . ARG I 1 313 ? -48.708 -56.776 -57.271  1.00 104.99 ?  313 ARG H C     1 
ATOM   8558  O O     . ARG I 1 313 ? -47.753 -56.372 -56.607  1.00 101.44 ?  313 ARG H O     1 
ATOM   8559  C CB    . ARG I 1 313 ? -48.171 -59.139 -57.972  1.00 87.89  ?  313 ARG H CB    1 
ATOM   8560  C CG    . ARG I 1 313 ? -49.316 -59.822 -57.236  1.00 80.46  ?  313 ARG H CG    1 
ATOM   8561  C CD    . ARG I 1 313 ? -49.013 -61.294 -56.981  1.00 87.59  ?  313 ARG H CD    1 
ATOM   8562  N NE    . ARG I 1 313 ? -48.812 -62.049 -58.215  1.00 78.37  ?  313 ARG H NE    1 
ATOM   8563  C CZ    . ARG I 1 313 ? -49.792 -62.456 -59.014  1.00 75.90  ?  313 ARG H CZ    1 
ATOM   8564  N NH1   . ARG I 1 313 ? -51.053 -62.186 -58.709  1.00 77.41  1  313 ARG H NH1   1 
ATOM   8565  N NH2   . ARG I 1 313 ? -49.511 -63.131 -60.120  1.00 92.24  ?  313 ARG H NH2   1 
ATOM   8566  N N     . SER I 1 314 ? -49.960 -56.425 -57.004  1.00 107.29 ?  314 SER H N     1 
ATOM   8567  C CA    . SER I 1 314 ? -50.253 -55.449 -55.960  1.00 96.97  ?  314 SER H CA    1 
ATOM   8568  C C     . SER I 1 314 ? -50.204 -56.085 -54.575  1.00 103.91 ?  314 SER H C     1 
ATOM   8569  O O     . SER I 1 314 ? -51.200 -56.103 -53.853  1.00 110.82 ?  314 SER H O     1 
ATOM   8570  C CB    . SER I 1 314 ? -51.616 -54.798 -56.196  1.00 104.19 ?  314 SER H CB    1 
ATOM   8571  O OG    . SER I 1 314 ? -51.590 -53.974 -57.348  1.00 98.35  ?  314 SER H OG    1 
ATOM   8572  O "O5'" . DG  J 2 1   ? -32.078 -63.212 -99.303  1.00 88.68  ?  1   DG  I "O5'" 1 
ATOM   8573  C "C5'" . DG  J 2 1   ? -32.922 -62.154 -99.739  1.00 98.26  ?  1   DG  I "C5'" 1 
ATOM   8574  C "C4'" . DG  J 2 1   ? -34.334 -62.330 -99.208  1.00 81.83  ?  1   DG  I "C4'" 1 
ATOM   8575  O "O4'" . DG  J 2 1   ? -34.572 -63.737 -98.929  1.00 74.89  ?  1   DG  I "O4'" 1 
ATOM   8576  C "C3'" . DG  J 2 1   ? -34.625 -61.607 -97.901  1.00 80.65  ?  1   DG  I "C3'" 1 
ATOM   8577  O "O3'" . DG  J 2 1   ? -36.013 -61.291 -97.826  1.00 79.17  ?  1   DG  I "O3'" 1 
ATOM   8578  C "C2'" . DG  J 2 1   ? -34.228 -62.652 -96.867  1.00 88.59  ?  1   DG  I "C2'" 1 
ATOM   8579  C "C1'" . DG  J 2 1   ? -34.720 -63.929 -97.535  1.00 71.86  ?  1   DG  I "C1'" 1 
ATOM   8580  N N9    . DG  J 2 1   ? -33.965 -65.119 -97.150  1.00 66.17  ?  1   DG  I N9    1 
ATOM   8581  C C8    . DG  J 2 1   ? -32.599 -65.258 -97.121  1.00 71.41  ?  1   DG  I C8    1 
ATOM   8582  N N7    . DG  J 2 1   ? -32.203 -66.435 -96.721  1.00 71.88  ?  1   DG  I N7    1 
ATOM   8583  C C5    . DG  J 2 1   ? -33.383 -67.115 -96.448  1.00 67.57  ?  1   DG  I C5    1 
ATOM   8584  C C6    . DG  J 2 1   ? -33.586 -68.434 -95.975  1.00 67.94  ?  1   DG  I C6    1 
ATOM   8585  O O6    . DG  J 2 1   ? -32.733 -69.289 -95.695  1.00 62.37  ?  1   DG  I O6    1 
ATOM   8586  N N1    . DG  J 2 1   ? -34.942 -68.726 -95.832  1.00 60.81  ?  1   DG  I N1    1 
ATOM   8587  C C2    . DG  J 2 1   ? -35.969 -67.853 -96.111  1.00 59.44  ?  1   DG  I C2    1 
ATOM   8588  N N2    . DG  J 2 1   ? -37.213 -68.317 -95.918  1.00 65.29  ?  1   DG  I N2    1 
ATOM   8589  N N3    . DG  J 2 1   ? -35.791 -66.617 -96.559  1.00 57.81  ?  1   DG  I N3    1 
ATOM   8590  C C4    . DG  J 2 1   ? -34.477 -66.317 -96.702  1.00 64.31  ?  1   DG  I C4    1 
ATOM   8591  P P     . DG  J 2 2   ? -36.601 -60.469 -96.576  1.00 118.38 ?  2   DG  I P     1 
ATOM   8592  O OP1   . DG  J 2 2   ? -37.533 -59.451 -97.109  1.00 84.58  ?  2   DG  I OP1   1 
ATOM   8593  O OP2   . DG  J 2 2   ? -35.462 -60.061 -95.724  1.00 119.51 -1 2   DG  I OP2   1 
ATOM   8594  O "O5'" . DG  J 2 2   ? -37.449 -61.558 -95.767  1.00 96.99  ?  2   DG  I "O5'" 1 
ATOM   8595  C "C5'" . DG  J 2 2   ? -38.565 -62.168 -96.395  1.00 95.92  ?  2   DG  I "C5'" 1 
ATOM   8596  C "C4'" . DG  J 2 2   ? -39.308 -63.095 -95.449  1.00 82.05  ?  2   DG  I "C4'" 1 
ATOM   8597  O "O4'" . DG  J 2 2   ? -38.520 -64.295 -95.220  1.00 72.11  ?  2   DG  I "O4'" 1 
ATOM   8598  C "C3'" . DG  J 2 2   ? -39.619 -62.521 -94.067  1.00 84.03  ?  2   DG  I "C3'" 1 
ATOM   8599  O "O3'" . DG  J 2 2   ? -40.942 -62.890 -93.693  1.00 94.11  ?  2   DG  I "O3'" 1 
ATOM   8600  C "C2'" . DG  J 2 2   ? -38.561 -63.151 -93.165  1.00 73.53  ?  2   DG  I "C2'" 1 
ATOM   8601  C "C1'" . DG  J 2 2   ? -38.338 -64.496 -93.835  1.00 58.91  ?  2   DG  I "C1'" 1 
ATOM   8602  N N9    . DG  J 2 2   ? -37.000 -65.045 -93.615  1.00 57.94  ?  2   DG  I N9    1 
ATOM   8603  C C8    . DG  J 2 2   ? -35.796 -64.415 -93.823  1.00 59.48  ?  2   DG  I C8    1 
ATOM   8604  N N7    . DG  J 2 2   ? -34.763 -65.160 -93.531  1.00 52.95  ?  2   DG  I N7    1 
ATOM   8605  C C5    . DG  J 2 2   ? -35.320 -66.357 -93.096  1.00 52.49  ?  2   DG  I C5    1 
ATOM   8606  C C6    . DG  J 2 2   ? -34.696 -67.546 -92.644  1.00 55.88  ?  2   DG  I C6    1 
ATOM   8607  O O6    . DG  J 2 2   ? -33.484 -67.788 -92.535  1.00 56.47  ?  2   DG  I O6    1 
ATOM   8608  N N1    . DG  J 2 2   ? -35.635 -68.518 -92.299  1.00 52.79  ?  2   DG  I N1    1 
ATOM   8609  C C2    . DG  J 2 2   ? -36.999 -68.357 -92.381  1.00 53.68  ?  2   DG  I C2    1 
ATOM   8610  N N2    . DG  J 2 2   ? -37.748 -69.400 -92.006  1.00 56.24  ?  2   DG  I N2    1 
ATOM   8611  N N3    . DG  J 2 2   ? -37.591 -67.251 -92.801  1.00 54.76  ?  2   DG  I N3    1 
ATOM   8612  C C4    . DG  J 2 2   ? -36.695 -66.298 -93.140  1.00 55.01  ?  2   DG  I C4    1 
ATOM   8613  P P     . DT  J 2 3   ? -41.665 -62.220 -92.423  1.00 73.05  ?  3   DT  I P     1 
ATOM   8614  O OP1   . DT  J 2 3   ? -43.102 -62.074 -92.746  1.00 64.32  ?  3   DT  I OP1   1 
ATOM   8615  O OP2   . DT  J 2 3   ? -40.873 -61.039 -92.010  1.00 54.88  -1 3   DT  I OP2   1 
ATOM   8616  O "O5'" . DT  J 2 3   ? -41.506 -63.327 -91.281  1.00 68.23  ?  3   DT  I "O5'" 1 
ATOM   8617  C "C5'" . DT  J 2 3   ? -42.052 -64.625 -91.501  1.00 59.14  ?  3   DT  I "C5'" 1 
ATOM   8618  C "C4'" . DT  J 2 3   ? -41.629 -65.599 -90.417  1.00 72.98  ?  3   DT  I "C4'" 1 
ATOM   8619  O "O4'" . DT  J 2 3   ? -40.252 -65.985 -90.609  1.00 76.35  ?  3   DT  I "O4'" 1 
ATOM   8620  C "C3'" . DT  J 2 3   ? -41.730 -65.062 -88.988  1.00 73.30  ?  3   DT  I "C3'" 1 
ATOM   8621  O "O3'" . DT  J 2 3   ? -42.763 -65.763 -88.301  1.00 70.22  ?  3   DT  I "O3'" 1 
ATOM   8622  C "C2'" . DT  J 2 3   ? -40.338 -65.325 -88.375  1.00 58.53  ?  3   DT  I "C2'" 1 
ATOM   8623  C "C1'" . DT  J 2 3   ? -39.706 -66.305 -89.359  1.00 54.02  ?  3   DT  I "C1'" 1 
ATOM   8624  N N1    . DT  J 2 3   ? -38.211 -66.204 -89.456  1.00 47.57  ?  3   DT  I N1    1 
ATOM   8625  C C2    . DT  J 2 3   ? -37.447 -67.337 -89.281  1.00 53.94  ?  3   DT  I C2    1 
ATOM   8626  O O2    . DT  J 2 3   ? -37.921 -68.428 -89.030  1.00 63.47  ?  3   DT  I O2    1 
ATOM   8627  N N3    . DT  J 2 3   ? -36.095 -67.143 -89.399  1.00 55.33  ?  3   DT  I N3    1 
ATOM   8628  C C4    . DT  J 2 3   ? -35.442 -65.956 -89.678  1.00 53.73  ?  3   DT  I C4    1 
ATOM   8629  O O4    . DT  J 2 3   ? -34.218 -65.884 -89.765  1.00 59.53  ?  3   DT  I O4    1 
ATOM   8630  C C5    . DT  J 2 3   ? -36.302 -64.808 -89.859  1.00 49.41  ?  3   DT  I C5    1 
ATOM   8631  C C7    . DT  J 2 3   ? -35.711 -63.465 -90.166  1.00 41.95  ?  3   DT  I C7    1 
ATOM   8632  C C6    . DT  J 2 3   ? -37.629 -64.986 -89.744  1.00 49.04  ?  3   DT  I C6    1 
ATOM   8633  P P     . DC  J 2 4   ? -43.181 -65.365 -86.802  1.00 81.66  ?  4   DC  I P     1 
ATOM   8634  O OP1   . DC  J 2 4   ? -44.568 -65.835 -86.591  1.00 65.85  ?  4   DC  I OP1   1 
ATOM   8635  O OP2   . DC  J 2 4   ? -42.845 -63.937 -86.597  1.00 79.42  -1 4   DC  I OP2   1 
ATOM   8636  O "O5'" . DC  J 2 4   ? -42.197 -66.236 -85.897  1.00 69.92  ?  4   DC  I "O5'" 1 
ATOM   8637  C "C5'" . DC  J 2 4   ? -42.256 -67.650 -85.964  1.00 58.62  ?  4   DC  I "C5'" 1 
ATOM   8638  C "C4'" . DC  J 2 4   ? -40.967 -68.263 -85.456  1.00 59.13  ?  4   DC  I "C4'" 1 
ATOM   8639  O "O4'" . DC  J 2 4   ? -39.854 -67.768 -86.204  1.00 64.45  ?  4   DC  I "O4'" 1 
ATOM   8640  C "C3'" . DC  J 2 4   ? -40.599 -67.925 -84.027  1.00 73.60  ?  4   DC  I "C3'" 1 
ATOM   8641  O "O3'" . DC  J 2 4   ? -41.327 -68.772 -83.131  1.00 77.43  ?  4   DC  I "O3'" 1 
ATOM   8642  C "C2'" . DC  J 2 4   ? -39.088 -68.218 -84.012  1.00 62.60  ?  4   DC  I "C2'" 1 
ATOM   8643  C "C1'" . DC  J 2 4   ? -38.694 -68.137 -85.499  1.00 56.89  ?  4   DC  I "C1'" 1 
ATOM   8644  N N1    . DC  J 2 4   ? -37.606 -67.159 -85.778  1.00 54.21  ?  4   DC  I N1    1 
ATOM   8645  C C2    . DC  J 2 4   ? -36.294 -67.620 -85.851  1.00 58.07  ?  4   DC  I C2    1 
ATOM   8646  O O2    . DC  J 2 4   ? -36.084 -68.828 -85.710  1.00 64.67  ?  4   DC  I O2    1 
ATOM   8647  N N3    . DC  J 2 4   ? -35.295 -66.735 -86.099  1.00 51.97  ?  4   DC  I N3    1 
ATOM   8648  C C4    . DC  J 2 4   ? -35.575 -65.440 -86.252  1.00 49.92  ?  4   DC  I C4    1 
ATOM   8649  N N4    . DC  J 2 4   ? -34.557 -64.603 -86.490  1.00 59.82  ?  4   DC  I N4    1 
ATOM   8650  C C5    . DC  J 2 4   ? -36.912 -64.946 -86.166  1.00 53.71  ?  4   DC  I C5    1 
ATOM   8651  C C6    . DC  J 2 4   ? -37.887 -65.833 -85.925  1.00 56.36  ?  4   DC  I C6    1 
ATOM   8652  P P     . DT  J 2 5   ? -41.060 -68.733 -81.545  1.00 52.77  ?  5   DT  I P     1 
ATOM   8653  O OP1   . DT  J 2 5   ? -42.125 -69.533 -80.901  1.00 66.06  ?  5   DT  I OP1   1 
ATOM   8654  O OP2   . DT  J 2 5   ? -40.872 -67.318 -81.155  1.00 47.75  -1 5   DT  I OP2   1 
ATOM   8655  O "O5'" . DT  J 2 5   ? -39.663 -69.495 -81.363  1.00 50.85  ?  5   DT  I "O5'" 1 
ATOM   8656  C "C5'" . DT  J 2 5   ? -39.538 -70.873 -81.704  1.00 46.63  ?  5   DT  I "C5'" 1 
ATOM   8657  C "C4'" . DT  J 2 5   ? -38.217 -71.424 -81.200  1.00 58.06  ?  5   DT  I "C4'" 1 
ATOM   8658  O "O4'" . DT  J 2 5   ? -37.122 -70.744 -81.878  1.00 57.92  ?  5   DT  I "O4'" 1 
ATOM   8659  C "C3'" . DT  J 2 5   ? -37.963 -71.247 -79.702  1.00 65.25  ?  5   DT  I "C3'" 1 
ATOM   8660  O "O3'" . DT  J 2 5   ? -37.418 -72.444 -79.153  1.00 60.75  ?  5   DT  I "O3'" 1 
ATOM   8661  C "C2'" . DT  J 2 5   ? -36.977 -70.087 -79.624  1.00 61.53  ?  5   DT  I "C2'" 1 
ATOM   8662  C "C1'" . DT  J 2 5   ? -36.209 -70.234 -80.926  1.00 63.09  ?  5   DT  I "C1'" 1 
ATOM   8663  N N1    . DT  J 2 5   ? -35.645 -68.943 -81.425  1.00 50.86  ?  5   DT  I N1    1 
ATOM   8664  C C2    . DT  J 2 5   ? -34.301 -68.858 -81.707  1.00 60.39  ?  5   DT  I C2    1 
ATOM   8665  O O2    . DT  J 2 5   ? -33.527 -69.788 -81.560  1.00 65.80  ?  5   DT  I O2    1 
ATOM   8666  N N3    . DT  J 2 5   ? -33.886 -67.629 -82.153  1.00 55.64  ?  5   DT  I N3    1 
ATOM   8667  C C4    . DT  J 2 5   ? -34.668 -66.506 -82.351  1.00 53.51  ?  5   DT  I C4    1 
ATOM   8668  O O4    . DT  J 2 5   ? -34.205 -65.447 -82.760  1.00 61.10  ?  5   DT  I O4    1 
ATOM   8669  C C5    . DT  J 2 5   ? -36.068 -66.666 -82.042  1.00 49.03  ?  5   DT  I C5    1 
ATOM   8670  C C7    . DT  J 2 5   ? -37.015 -65.516 -82.219  1.00 52.65  ?  5   DT  I C7    1 
ATOM   8671  C C6    . DT  J 2 5   ? -36.484 -67.863 -81.600  1.00 47.23  ?  5   DT  I C6    1 
ATOM   8672  P P     . DA  J 2 6   ? -37.106 -72.540 -77.581  1.00 59.73  ?  6   DA  I P     1 
ATOM   8673  O OP1   . DA  J 2 6   ? -37.255 -73.958 -77.183  1.00 65.32  ?  6   DA  I OP1   1 
ATOM   8674  O OP2   . DA  J 2 6   ? -37.892 -71.493 -76.889  1.00 55.95  -1 6   DA  I OP2   1 
ATOM   8675  O "O5'" . DA  J 2 6   ? -35.559 -72.136 -77.508  1.00 54.26  ?  6   DA  I "O5'" 1 
ATOM   8676  C "C5'" . DA  J 2 6   ? -34.591 -72.937 -78.178  1.00 51.37  ?  6   DA  I "C5'" 1 
ATOM   8677  C "C4'" . DA  J 2 6   ? -33.189 -72.377 -77.996  1.00 64.71  ?  6   DA  I "C4'" 1 
ATOM   8678  O "O4'" . DA  J 2 6   ? -33.065 -71.141 -78.735  1.00 79.43  ?  6   DA  I "O4'" 1 
ATOM   8679  C "C3'" . DA  J 2 6   ? -32.771 -72.072 -76.558  1.00 72.18  ?  6   DA  I "C3'" 1 
ATOM   8680  O "O3'" . DA  J 2 6   ? -31.498 -72.654 -76.299  1.00 78.15  ?  6   DA  I "O3'" 1 
ATOM   8681  C "C2'" . DA  J 2 6   ? -32.719 -70.542 -76.499  1.00 59.98  ?  6   DA  I "C2'" 1 
ATOM   8682  C "C1'" . DA  J 2 6   ? -32.428 -70.169 -77.944  1.00 60.12  ?  6   DA  I "C1'" 1 
ATOM   8683  N N9    . DA  J 2 6   ? -32.961 -68.867 -78.328  1.00 56.87  ?  6   DA  I N9    1 
ATOM   8684  C C8    . DA  J 2 6   ? -34.246 -68.430 -78.178  1.00 58.39  ?  6   DA  I C8    1 
ATOM   8685  N N7    . DA  J 2 6   ? -34.448 -67.215 -78.629  1.00 56.96  ?  6   DA  I N7    1 
ATOM   8686  C C5    . DA  J 2 6   ? -33.210 -66.831 -79.117  1.00 56.32  ?  6   DA  I C5    1 
ATOM   8687  C C6    . DA  J 2 6   ? -32.758 -65.647 -79.732  1.00 57.93  ?  6   DA  I C6    1 
ATOM   8688  N N6    . DA  J 2 6   ? -33.544 -64.590 -79.961  1.00 54.70  ?  6   DA  I N6    1 
ATOM   8689  N N1    . DA  J 2 6   ? -31.460 -65.589 -80.099  1.00 56.22  ?  6   DA  I N1    1 
ATOM   8690  C C2    . DA  J 2 6   ? -30.676 -66.649 -79.866  1.00 58.56  ?  6   DA  I C2    1 
ATOM   8691  N N3    . DA  J 2 6   ? -30.988 -67.814 -79.299  1.00 66.88  ?  6   DA  I N3    1 
ATOM   8692  C C4    . DA  J 2 6   ? -32.282 -67.840 -78.944  1.00 63.76  ?  6   DA  I C4    1 
ATOM   8693  P P     . DA  J 2 7   ? -30.882 -72.633 -74.816  1.00 64.71  ?  7   DA  I P     1 
ATOM   8694  O OP1   . DA  J 2 7   ? -29.938 -73.768 -74.719  1.00 44.84  ?  7   DA  I OP1   1 
ATOM   8695  O OP2   . DA  J 2 7   ? -32.008 -72.525 -73.862  1.00 60.48  -1 7   DA  I OP2   1 
ATOM   8696  O "O5'" . DA  J 2 7   ? -30.043 -71.270 -74.757  1.00 59.84  ?  7   DA  I "O5'" 1 
ATOM   8697  C "C5'" . DA  J 2 7   ? -28.914 -71.090 -75.610  1.00 60.60  ?  7   DA  I "C5'" 1 
ATOM   8698  C "C4'" . DA  J 2 7   ? -28.375 -69.673 -75.511  1.00 65.58  ?  7   DA  I "C4'" 1 
ATOM   8699  O "O4'" . DA  J 2 7   ? -29.300 -68.741 -76.140  1.00 61.84  ?  7   DA  I "O4'" 1 
ATOM   8700  C "C3'" . DA  J 2 7   ? -28.176 -69.145 -74.080  1.00 76.23  ?  7   DA  I "C3'" 1 
ATOM   8701  O "O3'" . DA  J 2 7   ? -26.987 -68.373 -74.007  1.00 73.14  ?  7   DA  I "O3'" 1 
ATOM   8702  C "C2'" . DA  J 2 7   ? -29.380 -68.226 -73.913  1.00 79.52  ?  7   DA  I "C2'" 1 
ATOM   8703  C "C1'" . DA  J 2 7   ? -29.376 -67.625 -75.296  1.00 57.07  ?  7   DA  I "C1'" 1 
ATOM   8704  N N9    . DA  J 2 7   ? -30.533 -66.798 -75.624  1.00 63.71  ?  7   DA  I N9    1 
ATOM   8705  C C8    . DA  J 2 7   ? -31.823 -66.954 -75.200  1.00 69.10  ?  7   DA  I C8    1 
ATOM   8706  N N7    . DA  J 2 7   ? -32.638 -66.020 -75.643  1.00 62.33  ?  7   DA  I N7    1 
ATOM   8707  C C5    . DA  J 2 7   ? -31.816 -65.185 -76.384  1.00 54.68  ?  7   DA  I C5    1 
ATOM   8708  C C6    . DA  J 2 7   ? -32.058 -64.000 -77.113  1.00 58.46  ?  7   DA  I C6    1 
ATOM   8709  N N6    . DA  J 2 7   ? -33.264 -63.424 -77.226  1.00 67.78  ?  7   DA  I N6    1 
ATOM   8710  N N1    . DA  J 2 7   ? -31.008 -63.430 -77.735  1.00 60.19  ?  7   DA  I N1    1 
ATOM   8711  C C2    . DA  J 2 7   ? -29.803 -63.995 -77.629  1.00 57.21  ?  7   DA  I C2    1 
ATOM   8712  N N3    . DA  J 2 7   ? -29.454 -65.096 -76.976  1.00 59.53  ?  7   DA  I N3    1 
ATOM   8713  C C4    . DA  J 2 7   ? -30.515 -65.648 -76.370  1.00 56.02  ?  7   DA  I C4    1 
ATOM   8714  P P     . DA  J 2 8   ? -25.608 -69.015 -73.491  1.00 96.11  ?  8   DA  I P     1 
ATOM   8715  O OP1   . DA  J 2 8   ? -25.351 -70.243 -74.276  1.00 72.94  ?  8   DA  I OP1   1 
ATOM   8716  O OP2   . DA  J 2 8   ? -25.673 -69.088 -72.016  1.00 94.78  -1 8   DA  I OP2   1 
ATOM   8717  O "O5'" . DA  J 2 8   ? -24.517 -67.915 -73.890  1.00 48.10  ?  8   DA  I "O5'" 1 
ATOM   8718  C "C5'" . DA  J 2 8   ? -24.236 -67.647 -75.249  1.00 63.14  ?  8   DA  I "C5'" 1 
ATOM   8719  C "C4'" . DA  J 2 8   ? -24.141 -66.152 -75.506  1.00 81.67  ?  8   DA  I "C4'" 1 
ATOM   8720  O "O4'" . DA  J 2 8   ? -25.472 -65.590 -75.668  1.00 80.32  ?  8   DA  I "O4'" 1 
ATOM   8721  C "C3'" . DA  J 2 8   ? -23.463 -65.324 -74.408  1.00 71.97  ?  8   DA  I "C3'" 1 
ATOM   8722  O "O3'" . DA  J 2 8   ? -22.624 -64.356 -75.003  1.00 94.40  ?  8   DA  I "O3'" 1 
ATOM   8723  C "C2'" . DA  J 2 8   ? -24.646 -64.658 -73.712  1.00 76.61  ?  8   DA  I "C2'" 1 
ATOM   8724  C "C1'" . DA  J 2 8   ? -25.566 -64.419 -74.895  1.00 71.21  ?  8   DA  I "C1'" 1 
ATOM   8725  N N9    . DA  J 2 8   ? -26.961 -64.211 -74.528  1.00 68.48  ?  8   DA  I N9    1 
ATOM   8726  C C8    . DA  J 2 8   ? -27.742 -65.034 -73.770  1.00 71.94  ?  8   DA  I C8    1 
ATOM   8727  N N7    . DA  J 2 8   ? -28.966 -64.594 -73.601  1.00 70.47  ?  8   DA  I N7    1 
ATOM   8728  C C5    . DA  J 2 8   ? -28.989 -63.397 -74.300  1.00 67.71  ?  8   DA  I C5    1 
ATOM   8729  C C6    . DA  J 2 8   ? -30.003 -62.441 -74.509  1.00 68.59  ?  8   DA  I C6    1 
ATOM   8730  N N6    . DA  J 2 8   ? -31.235 -62.559 -74.009  1.00 73.88  ?  8   DA  I N6    1 
ATOM   8731  N N1    . DA  J 2 8   ? -29.700 -61.357 -75.255  1.00 57.99  ?  8   DA  I N1    1 
ATOM   8732  C C2    . DA  J 2 8   ? -28.462 -61.247 -75.755  1.00 68.54  ?  8   DA  I C2    1 
ATOM   8733  N N3    . DA  J 2 8   ? -27.427 -62.079 -75.625  1.00 70.38  ?  8   DA  I N3    1 
ATOM   8734  C C4    . DA  J 2 8   ? -27.762 -63.145 -74.879  1.00 61.98  ?  8   DA  I C4    1 
ATOM   8735  P P     . DC  J 2 9   ? -21.515 -63.583 -74.135  1.00 80.95  ?  9   DC  I P     1 
ATOM   8736  O OP1   . DC  J 2 9   ? -20.303 -63.441 -74.972  1.00 101.91 ?  9   DC  I OP1   1 
ATOM   8737  O OP2   . DC  J 2 9   ? -21.427 -64.255 -72.821  1.00 77.63  -1 9   DC  I OP2   1 
ATOM   8738  O "O5'" . DC  J 2 9   ? -22.165 -62.138 -73.903  1.00 61.69  ?  9   DC  I "O5'" 1 
ATOM   8739  C "C5'" . DC  J 2 9   ? -22.570 -61.370 -75.028  1.00 89.45  ?  9   DC  I "C5'" 1 
ATOM   8740  C "C4'" . DC  J 2 9   ? -23.525 -60.259 -74.626  1.00 90.12  ?  9   DC  I "C4'" 1 
ATOM   8741  O "O4'" . DC  J 2 9   ? -24.799 -60.819 -74.248  1.00 84.57  ?  9   DC  I "O4'" 1 
ATOM   8742  C "C3'" . DC  J 2 9   ? -23.095 -59.401 -73.429  1.00 95.65  ?  9   DC  I "C3'" 1 
ATOM   8743  O "O3'" . DC  J 2 9   ? -22.781 -58.090 -73.883  1.00 115.32 ?  9   DC  I "O3'" 1 
ATOM   8744  C "C2'" . DC  J 2 9   ? -24.329 -59.400 -72.505  1.00 100.48 ?  9   DC  I "C2'" 1 
ATOM   8745  C "C1'" . DC  J 2 9   ? -25.428 -59.864 -73.448  1.00 88.01  ?  9   DC  I "C1'" 1 
ATOM   8746  N N1    . DC  J 2 9   ? -26.581 -60.503 -72.753  1.00 74.47  ?  9   DC  I N1    1 
ATOM   8747  C C2    . DC  J 2 9   ? -27.830 -59.870 -72.761  1.00 73.82  ?  9   DC  I C2    1 
ATOM   8748  O O2    . DC  J 2 9   ? -27.951 -58.791 -73.350  1.00 83.55  ?  9   DC  I O2    1 
ATOM   8749  N N3    . DC  J 2 9   ? -28.872 -60.460 -72.123  1.00 64.22  ?  9   DC  I N3    1 
ATOM   8750  C C4    . DC  J 2 9   ? -28.693 -61.629 -71.501  1.00 69.19  ?  9   DC  I C4    1 
ATOM   8751  N N4    . DC  J 2 9   ? -29.746 -62.177 -70.886  1.00 82.34  ?  9   DC  I N4    1 
ATOM   8752  C C5    . DC  J 2 9   ? -27.427 -62.288 -71.482  1.00 63.49  ?  9   DC  I C5    1 
ATOM   8753  C C6    . DC  J 2 9   ? -26.410 -61.695 -72.114  1.00 66.83  ?  9   DC  I C6    1 
ATOM   8754  P P     . DG  J 2 10  ? -22.237 -56.972 -72.865  1.00 120.01 ?  10  DG  I P     1 
ATOM   8755  O OP1   . DG  J 2 10  ? -21.422 -56.012 -73.641  1.00 110.75 ?  10  DG  I OP1   1 
ATOM   8756  O OP2   . DG  J 2 10  ? -21.645 -57.670 -71.703  1.00 119.23 -1 10  DG  I OP2   1 
ATOM   8757  O "O5'" . DG  J 2 10  ? -23.561 -56.231 -72.362  1.00 102.84 ?  10  DG  I "O5'" 1 
ATOM   8758  C "C5'" . DG  J 2 10  ? -24.479 -55.690 -73.306  1.00 104.01 ?  10  DG  I "C5'" 1 
ATOM   8759  C "C4'" . DG  J 2 10  ? -25.627 -55.002 -72.592  1.00 111.92 ?  10  DG  I "C4'" 1 
ATOM   8760  O "O4'" . DG  J 2 10  ? -26.574 -55.989 -72.121  1.00 107.43 ?  10  DG  I "O4'" 1 
ATOM   8761  C "C3'" . DG  J 2 10  ? -25.218 -54.181 -71.362  1.00 108.64 ?  10  DG  I "C3'" 1 
ATOM   8762  O "O3'" . DG  J 2 10  ? -25.652 -52.840 -71.514  1.00 119.89 ?  10  DG  I "O3'" 1 
ATOM   8763  C "C2'" . DG  J 2 10  ? -25.940 -54.872 -70.199  1.00 100.45 ?  10  DG  I "C2'" 1 
ATOM   8764  C "C1'" . DG  J 2 10  ? -27.108 -55.532 -70.910  1.00 91.94  ?  10  DG  I "C1'" 1 
ATOM   8765  N N9    . DG  J 2 10  ? -27.668 -56.667 -70.184  1.00 90.80  ?  10  DG  I N9    1 
ATOM   8766  C C8    . DG  J 2 10  ? -27.042 -57.857 -69.896  1.00 90.31  ?  10  DG  I C8    1 
ATOM   8767  N N7    . DG  J 2 10  ? -27.790 -58.686 -69.220  1.00 82.34  ?  10  DG  I N7    1 
ATOM   8768  C C5    . DG  J 2 10  ? -28.984 -57.997 -69.039  1.00 81.65  ?  10  DG  I C5    1 
ATOM   8769  C C6    . DG  J 2 10  ? -30.172 -58.390 -68.375  1.00 75.26  ?  10  DG  I C6    1 
ATOM   8770  O O6    . DG  J 2 10  ? -30.410 -59.459 -67.798  1.00 64.17  ?  10  DG  I O6    1 
ATOM   8771  N N1    . DG  J 2 10  ? -31.146 -57.392 -68.424  1.00 77.67  ?  10  DG  I N1    1 
ATOM   8772  C C2    . DG  J 2 10  ? -30.987 -56.170 -69.038  1.00 83.76  ?  10  DG  I C2    1 
ATOM   8773  N N2    . DG  J 2 10  ? -32.034 -55.335 -68.984  1.00 89.65  ?  10  DG  I N2    1 
ATOM   8774  N N3    . DG  J 2 10  ? -29.878 -55.792 -69.662  1.00 83.01  ?  10  DG  I N3    1 
ATOM   8775  C C4    . DG  J 2 10  ? -28.923 -56.752 -69.623  1.00 85.48  ?  10  DG  I C4    1 
ATOM   8776  P P     . DT  J 2 11  ? -25.210 -51.715 -70.456  1.00 117.19 ?  11  DT  I P     1 
ATOM   8777  O OP1   . DT  J 2 11  ? -25.340 -50.400 -71.123  1.00 120.34 ?  11  DT  I OP1   1 
ATOM   8778  O OP2   . DT  J 2 11  ? -23.909 -52.125 -69.882  1.00 89.53  -1 11  DT  I OP2   1 
ATOM   8779  O "O5'" . DT  J 2 11  ? -26.304 -51.809 -69.294  1.00 108.66 ?  11  DT  I "O5'" 1 
ATOM   8780  C "C5'" . DT  J 2 11  ? -27.676 -51.614 -69.591  1.00 100.33 ?  11  DT  I "C5'" 1 
ATOM   8781  C "C4'" . DT  J 2 11  ? -28.514 -51.633 -68.324  1.00 115.13 ?  11  DT  I "C4'" 1 
ATOM   8782  O "O4'" . DT  J 2 11  ? -28.873 -53.003 -67.993  1.00 108.89 ?  11  DT  I "O4'" 1 
ATOM   8783  C "C3'" . DT  J 2 11  ? -27.826 -51.071 -67.069  1.00 115.35 ?  11  DT  I "C3'" 1 
ATOM   8784  O "O3'" . DT  J 2 11  ? -28.765 -50.337 -66.323  1.00 123.71 ?  11  DT  I "O3'" 1 
ATOM   8785  C "C2'" . DT  J 2 11  ? -27.465 -52.340 -66.306  1.00 103.58 ?  11  DT  I "C2'" 1 
ATOM   8786  C "C1'" . DT  J 2 11  ? -28.702 -53.160 -66.609  1.00 92.34  ?  11  DT  I "C1'" 1 
ATOM   8787  N N1    . DT  J 2 11  ? -28.589 -54.602 -66.265  1.00 80.25  ?  11  DT  I N1    1 
ATOM   8788  C C2    . DT  J 2 11  ? -29.702 -55.250 -65.797  1.00 86.42  ?  11  DT  I C2    1 
ATOM   8789  O O2    . DT  J 2 11  ? -30.792 -54.715 -65.695  1.00 88.58  ?  11  DT  I O2    1 
ATOM   8790  N N3    . DT  J 2 11  ? -29.509 -56.565 -65.490  1.00 86.96  ?  11  DT  I N3    1 
ATOM   8791  C C4    . DT  J 2 11  ? -28.336 -57.284 -65.565  1.00 86.19  ?  11  DT  I C4    1 
ATOM   8792  O O4    . DT  J 2 11  ? -28.277 -58.472 -65.250  1.00 87.53  ?  11  DT  I O4    1 
ATOM   8793  C C5    . DT  J 2 11  ? -27.191 -56.539 -66.042  1.00 79.08  ?  11  DT  I C5    1 
ATOM   8794  C C7    . DT  J 2 11  ? -25.855 -57.209 -66.174  1.00 80.26  ?  11  DT  I C7    1 
ATOM   8795  C C6    . DT  J 2 11  ? -27.369 -55.243 -66.358  1.00 81.01  ?  11  DT  I C6    1 
ATOM   8796  P P     . DC  J 2 12  ? -28.401 -48.886 -65.743  1.00 134.79 ?  12  DC  I P     1 
ATOM   8797  O OP1   . DC  J 2 12  ? -28.204 -47.974 -66.892  1.00 125.46 ?  12  DC  I OP1   1 
ATOM   8798  O OP2   . DC  J 2 12  ? -27.333 -49.052 -64.732  1.00 125.05 -1 12  DC  I OP2   1 
ATOM   8799  O "O5'" . DC  J 2 12  ? -29.738 -48.468 -64.983  1.00 126.31 ?  12  DC  I "O5'" 1 
ATOM   8800  C "C5'" . DC  J 2 12  ? -30.971 -48.587 -65.661  1.00 111.10 ?  12  DC  I "C5'" 1 
ATOM   8801  C "C4'" . DC  J 2 12  ? -32.079 -48.983 -64.706  1.00 129.60 ?  12  DC  I "C4'" 1 
ATOM   8802  O "O4'" . DC  J 2 12  ? -31.979 -50.408 -64.430  1.00 127.81 ?  12  DC  I "O4'" 1 
ATOM   8803  C "C3'" . DC  J 2 12  ? -32.033 -48.280 -63.349  1.00 134.68 ?  12  DC  I "C3'" 1 
ATOM   8804  O "O3'" . DC  J 2 12  ? -33.341 -47.850 -63.008  1.00 131.91 ?  12  DC  I "O3'" 1 
ATOM   8805  C "C2'" . DC  J 2 12  ? -31.491 -49.349 -62.399  1.00 120.45 ?  12  DC  I "C2'" 1 
ATOM   8806  C "C1'" . DC  J 2 12  ? -31.988 -50.636 -63.038  1.00 120.95 ?  12  DC  I "C1'" 1 
ATOM   8807  N N1    . DC  J 2 12  ? -31.092 -51.804 -62.754  1.00 108.43 ?  12  DC  I N1    1 
ATOM   8808  C C2    . DC  J 2 12  ? -31.603 -52.943 -62.119  1.00 93.98  ?  12  DC  I C2    1 
ATOM   8809  O O2    . DC  J 2 12  ? -32.800 -52.977 -61.811  1.00 88.81  ?  12  DC  I O2    1 
ATOM   8810  N N3    . DC  J 2 12  ? -30.768 -53.986 -61.870  1.00 88.00  ?  12  DC  I N3    1 
ATOM   8811  C C4    . DC  J 2 12  ? -29.481 -53.912 -62.220  1.00 85.78  ?  12  DC  I C4    1 
ATOM   8812  N N4    . DC  J 2 12  ? -28.696 -54.962 -61.953  1.00 78.07  ?  12  DC  I N4    1 
ATOM   8813  C C5    . DC  J 2 12  ? -28.942 -52.758 -62.860  1.00 88.61  ?  12  DC  I C5    1 
ATOM   8814  C C6    . DC  J 2 12  ? -29.773 -51.739 -63.103  1.00 101.13 ?  12  DC  I C6    1 
ATOM   8815  P P     . DG  J 2 13  ? -33.575 -46.683 -61.928  1.00 139.06 ?  13  DG  I P     1 
ATOM   8816  O OP1   . DG  J 2 13  ? -34.413 -45.639 -62.558  1.00 153.11 ?  13  DG  I OP1   1 
ATOM   8817  O OP2   . DG  J 2 13  ? -32.252 -46.334 -61.360  1.00 108.84 -1 13  DG  I OP2   1 
ATOM   8818  O "O5'" . DG  J 2 13  ? -34.415 -47.397 -60.776  1.00 134.07 ?  13  DG  I "O5'" 1 
ATOM   8819  C "C5'" . DG  J 2 13  ? -35.404 -48.343 -61.145  1.00 127.23 ?  13  DG  I "C5'" 1 
ATOM   8820  C "C4'" . DG  J 2 13  ? -35.935 -49.089 -59.942  1.00 133.78 ?  13  DG  I "C4'" 1 
ATOM   8821  O "O4'" . DG  J 2 13  ? -35.046 -50.208 -59.675  1.00 124.27 ?  13  DG  I "O4'" 1 
ATOM   8822  C "C3'" . DG  J 2 13  ? -35.990 -48.280 -58.653  1.00 125.41 ?  13  DG  I "C3'" 1 
ATOM   8823  O "O3'" . DG  J 2 13  ? -37.167 -48.611 -57.926  1.00 133.16 ?  13  DG  I "O3'" 1 
ATOM   8824  C "C2'" . DG  J 2 13  ? -34.702 -48.671 -57.928  1.00 117.42 ?  13  DG  I "C2'" 1 
ATOM   8825  C "C1'" . DG  J 2 13  ? -34.480 -50.108 -58.382  1.00 109.59 ?  13  DG  I "C1'" 1 
ATOM   8826  N N9    . DG  J 2 13  ? -33.054 -50.405 -58.526  1.00 101.91 ?  13  DG  I N9    1 
ATOM   8827  C C8    . DG  J 2 13  ? -32.092 -49.543 -58.998  1.00 102.93 ?  13  DG  I C8    1 
ATOM   8828  N N7    . DG  J 2 13  ? -30.899 -50.061 -59.039  1.00 96.89  ?  13  DG  I N7    1 
ATOM   8829  C C5    . DG  J 2 13  ? -31.073 -51.357 -58.579  1.00 105.53 ?  13  DG  I C5    1 
ATOM   8830  C C6    . DG  J 2 13  ? -30.126 -52.393 -58.409  1.00 102.10 ?  13  DG  I C6    1 
ATOM   8831  O O6    . DG  J 2 13  ? -28.907 -52.364 -58.638  1.00 92.58  ?  13  DG  I O6    1 
ATOM   8832  N N1    . DG  J 2 13  ? -30.716 -53.556 -57.917  1.00 89.48  ?  13  DG  I N1    1 
ATOM   8833  C C2    . DG  J 2 13  ? -32.054 -53.697 -57.628  1.00 89.96  ?  13  DG  I C2    1 
ATOM   8834  N N2    . DG  J 2 13  ? -32.436 -54.895 -57.161  1.00 86.36  ?  13  DG  I N2    1 
ATOM   8835  N N3    . DG  J 2 13  ? -32.957 -52.732 -57.784  1.00 92.39  ?  13  DG  I N3    1 
ATOM   8836  C C4    . DG  J 2 13  ? -32.397 -51.593 -58.262  1.00 102.49 ?  13  DG  I C4    1 
ATOM   8837  P P     . DT  J 2 14  ? -37.536 -47.844 -56.561  1.00 153.40 ?  14  DT  I P     1 
ATOM   8838  O OP1   . DT  J 2 14  ? -38.910 -47.319 -56.682  1.00 141.35 ?  14  DT  I OP1   1 
ATOM   8839  O OP2   . DT  J 2 14  ? -36.419 -46.926 -56.229  1.00 123.63 -1 14  DT  I OP2   1 
ATOM   8840  O "O5'" . DT  J 2 14  ? -37.529 -49.014 -55.486  1.00 139.22 ?  14  DT  I "O5'" 1 
ATOM   8841  C "C5'" . DT  J 2 14  ? -38.075 -50.277 -55.842  1.00 130.83 ?  14  DT  I "C5'" 1 
ATOM   8842  C "C4'" . DT  J 2 14  ? -37.755 -51.302 -54.782  1.00 118.77 ?  14  DT  I "C4'" 1 
ATOM   8843  O "O4'" . DT  J 2 14  ? -36.428 -51.841 -54.990  1.00 115.11 ?  14  DT  I "O4'" 1 
ATOM   8844  C "C3'" . DT  J 2 14  ? -37.776 -50.760 -53.354  1.00 109.33 ?  14  DT  I "C3'" 1 
ATOM   8845  O "O3'" . DT  J 2 14  ? -38.173 -51.758 -52.502  1.00 92.89  ?  14  DT  I "O3'" 1 
ATOM   8846  C "C2'" . DT  J 2 14  ? -36.297 -50.485 -53.116  1.00 108.70 ?  14  DT  I "C2'" 1 
ATOM   8847  C "C1'" . DT  J 2 14  ? -35.692 -51.699 -53.801  1.00 110.78 ?  14  DT  I "C1'" 1 
ATOM   8848  N N1    . DT  J 2 14  ? -34.267 -51.528 -54.135  1.00 101.57 ?  14  DT  I N1    1 
ATOM   8849  C C2    . DT  J 2 14  ? -33.431 -52.623 -54.120  1.00 99.20  ?  14  DT  I C2    1 
ATOM   8850  O O2    . DT  J 2 14  ? -33.819 -53.758 -53.908  1.00 94.62  ?  14  DT  I O2    1 
ATOM   8851  N N3    . DT  J 2 14  ? -32.122 -52.343 -54.420  1.00 102.54 ?  14  DT  I N3    1 
ATOM   8852  C C4    . DT  J 2 14  ? -31.582 -51.096 -54.686  1.00 102.59 ?  14  DT  I C4    1 
ATOM   8853  O O4    . DT  J 2 14  ? -30.396 -50.935 -54.935  1.00 96.88  ?  14  DT  I O4    1 
ATOM   8854  C C5    . DT  J 2 14  ? -32.513 -49.995 -54.649  1.00 103.93 ?  14  DT  I C5    1 
ATOM   8855  C C7    . DT  J 2 14  ? -32.041 -48.598 -54.922  1.00 109.08 ?  14  DT  I C7    1 
ATOM   8856  C C6    . DT  J 2 14  ? -33.790 -50.261 -54.367  1.00 96.33  ?  14  DT  I C6    1 
ATOM   8857  P P     . DA  J 2 15  ? -39.695 -52.072 -52.117  1.00 113.61 ?  15  DA  I P     1 
ATOM   8858  O OP1   . DA  J 2 15  ? -40.556 -52.044 -53.319  1.00 122.48 ?  15  DA  I OP1   1 
ATOM   8859  O OP2   . DA  J 2 15  ? -40.058 -51.289 -50.909  1.00 117.63 -1 15  DA  I OP2   1 
ATOM   8860  O "O5'" . DA  J 2 15  ? -39.488 -53.582 -51.692  1.00 93.46  ?  15  DA  I "O5'" 1 
ATOM   8861  C "C5'" . DA  J 2 15  ? -39.187 -54.524 -52.698  1.00 93.80  ?  15  DA  I "C5'" 1 
ATOM   8862  C "C4'" . DA  J 2 15  ? -38.100 -55.485 -52.234  1.00 90.77  ?  15  DA  I "C4'" 1 
ATOM   8863  O "O4'" . DA  J 2 15  ? -36.839 -54.781 -52.084  1.00 91.83  ?  15  DA  I "O4'" 1 
ATOM   8864  C "C3'" . DA  J 2 15  ? -38.344 -56.164 -50.902  1.00 73.30  ?  15  DA  I "C3'" 1 
ATOM   8865  O "O3'" . DA  J 2 15  ? -37.648 -57.379 -50.882  1.00 56.94  ?  15  DA  I "O3'" 1 
ATOM   8866  C "C2'" . DA  J 2 15  ? -37.719 -55.155 -49.929  1.00 81.20  ?  15  DA  I "C2'" 1 
ATOM   8867  C "C1'" . DA  J 2 15  ? -36.475 -54.721 -50.715  1.00 81.90  ?  15  DA  I "C1'" 1 
ATOM   8868  N N9    . DA  J 2 15  ? -36.004 -53.361 -50.433  1.00 84.39  ?  15  DA  I N9    1 
ATOM   8869  C C8    . DA  J 2 15  ? -36.747 -52.291 -50.011  1.00 90.31  ?  15  DA  I C8    1 
ATOM   8870  N N7    . DA  J 2 15  ? -36.048 -51.185 -49.863  1.00 96.23  ?  15  DA  I N7    1 
ATOM   8871  C C5    . DA  J 2 15  ? -34.760 -51.554 -50.218  1.00 92.53  ?  15  DA  I C5    1 
ATOM   8872  C C6    . DA  J 2 15  ? -33.542 -50.837 -50.274  1.00 94.66  ?  15  DA  I C6    1 
ATOM   8873  N N6    . DA  J 2 15  ? -33.430 -49.542 -49.956  1.00 97.00  ?  15  DA  I N6    1 
ATOM   8874  N N1    . DA  J 2 15  ? -32.440 -51.508 -50.671  1.00 85.48  ?  15  DA  I N1    1 
ATOM   8875  C C2    . DA  J 2 15  ? -32.554 -52.804 -50.987  1.00 77.72  ?  15  DA  I C2    1 
ATOM   8876  N N3    . DA  J 2 15  ? -33.637 -53.578 -50.975  1.00 74.85  ?  15  DA  I N3    1 
ATOM   8877  C C4    . DA  J 2 15  ? -34.716 -52.888 -50.578  1.00 81.87  ?  15  DA  I C4    1 
ATOM   8878  P P     . DT  J 2 16  ? -38.425 -58.737 -50.522  1.00 86.77  ?  16  DT  I P     1 
ATOM   8879  O OP1   . DT  J 2 16  ? -37.615 -59.865 -51.028  1.00 70.48  ?  16  DT  I OP1   1 
ATOM   8880  O OP2   . DT  J 2 16  ? -39.817 -58.602 -50.989  1.00 94.24  -1 16  DT  I OP2   1 
ATOM   8881  O "O5'" . DT  J 2 16  ? -38.455 -58.724 -48.925  1.00 81.20  ?  16  DT  I "O5'" 1 
ATOM   8882  O OP1   . DC  K 3 1   ? -28.743 -57.210 -2.189   1.00 64.21  ?  1   DC  J OP1   1 
ATOM   8883  O OP2   . DC  K 3 1   ? -25.693 -60.328 -5.942   1.00 69.23  ?  1   DC  J OP2   1 
ATOM   8884  O "O5'" . DC  K 3 1   ? -27.072 -52.571 -9.591   1.00 69.34  ?  1   DC  J "O5'" 1 
ATOM   8885  C "C5'" . DC  K 3 1   ? -25.967 -53.023 -8.814   1.00 66.50  ?  1   DC  J "C5'" 1 
ATOM   8886  C "C4'" . DC  K 3 1   ? -25.617 -54.460 -9.157   1.00 61.40  ?  1   DC  J "C4'" 1 
ATOM   8887  O "O4'" . DC  K 3 1   ? -26.547 -55.354 -8.506   1.00 54.61  ?  1   DC  J "O4'" 1 
ATOM   8888  C "C3'" . DC  K 3 1   ? -25.715 -54.807 -10.631  1.00 82.32  ?  1   DC  J "C3'" 1 
ATOM   8889  O "O3'" . DC  K 3 1   ? -24.497 -54.448 -11.315  1.00 93.89  ?  1   DC  J "O3'" 1 
ATOM   8890  C "C2'" . DC  K 3 1   ? -25.935 -56.318 -10.598  1.00 74.98  ?  1   DC  J "C2'" 1 
ATOM   8891  C "C1'" . DC  K 3 1   ? -26.708 -56.522 -9.290   1.00 50.68  ?  1   DC  J "C1'" 1 
ATOM   8892  N N1    . DC  K 3 1   ? -28.160 -56.783 -9.489   1.00 36.56  ?  1   DC  J N1    1 
ATOM   8893  C C2    . DC  K 3 1   ? -28.626 -58.103 -9.494   1.00 40.35  ?  1   DC  J C2    1 
ATOM   8894  O O2    . DC  K 3 1   ? -27.819 -59.026 -9.335   1.00 48.20  ?  1   DC  J O2    1 
ATOM   8895  N N3    . DC  K 3 1   ? -29.949 -58.332 -9.683   1.00 36.31  ?  1   DC  J N3    1 
ATOM   8896  C C4    . DC  K 3 1   ? -30.785 -57.306 -9.853   1.00 40.59  ?  1   DC  J C4    1 
ATOM   8897  N N4    . DC  K 3 1   ? -32.081 -57.580 -10.033  1.00 46.43  ?  1   DC  J N4    1 
ATOM   8898  C C5    . DC  K 3 1   ? -30.328 -55.953 -9.847   1.00 46.37  ?  1   DC  J C5    1 
ATOM   8899  C C6    . DC  K 3 1   ? -29.020 -55.741 -9.664   1.00 39.82  ?  1   DC  J C6    1 
ATOM   8900  P P     . DA  K 3 2   ? -23.177 -55.373 -11.254  1.00 115.42 ?  2   DA  J P     1 
ATOM   8901  O OP1   . DA  K 3 2   ? -22.998 -55.980 -9.914   1.00 93.11  ?  2   DA  J OP1   1 
ATOM   8902  O OP2   . DA  K 3 2   ? -22.094 -54.527 -11.804  1.00 99.13  -1 2   DA  J OP2   1 
ATOM   8903  O "O5'" . DA  K 3 2   ? -23.457 -56.494 -12.362  1.00 81.54  ?  2   DA  J "O5'" 1 
ATOM   8904  C "C5'" . DA  K 3 2   ? -22.984 -57.843 -12.221  1.00 75.42  ?  2   DA  J "C5'" 1 
ATOM   8905  C "C4'" . DA  K 3 2   ? -23.699 -58.737 -13.225  1.00 65.92  ?  2   DA  J "C4'" 1 
ATOM   8906  O "O4'" . DA  K 3 2   ? -25.134 -58.705 -12.987  1.00 58.20  ?  2   DA  J "O4'" 1 
ATOM   8907  C "C3'" . DA  K 3 2   ? -23.512 -58.312 -14.686  1.00 74.78  ?  2   DA  J "C3'" 1 
ATOM   8908  O "O3'" . DA  K 3 2   ? -23.576 -59.433 -15.548  1.00 69.82  ?  2   DA  J "O3'" 1 
ATOM   8909  C "C2'" . DA  K 3 2   ? -24.759 -57.462 -14.901  1.00 78.66  ?  2   DA  J "C2'" 1 
ATOM   8910  C "C1'" . DA  K 3 2   ? -25.753 -58.368 -14.203  1.00 58.70  ?  2   DA  J "C1'" 1 
ATOM   8911  N N9    . DA  K 3 2   ? -27.066 -57.791 -13.946  1.00 44.74  ?  2   DA  J N9    1 
ATOM   8912  C C8    . DA  K 3 2   ? -27.392 -56.466 -13.877  1.00 55.98  ?  2   DA  J C8    1 
ATOM   8913  N N7    . DA  K 3 2   ? -28.671 -56.247 -13.681  1.00 52.65  ?  2   DA  J N7    1 
ATOM   8914  C C5    . DA  K 3 2   ? -29.230 -57.515 -13.687  1.00 44.74  ?  2   DA  J C5    1 
ATOM   8915  C C6    . DA  K 3 2   ? -30.556 -57.971 -13.544  1.00 49.88  ?  2   DA  J C6    1 
ATOM   8916  N N6    . DA  K 3 2   ? -31.600 -57.156 -13.361  1.00 43.10  ?  2   DA  J N6    1 
ATOM   8917  N N1    . DA  K 3 2   ? -30.767 -59.303 -13.598  1.00 46.93  ?  2   DA  J N1    1 
ATOM   8918  C C2    . DA  K 3 2   ? -29.720 -60.115 -13.786  1.00 43.50  ?  2   DA  J C2    1 
ATOM   8919  N N3    . DA  K 3 2   ? -28.433 -59.804 -13.928  1.00 35.63  ?  2   DA  J N3    1 
ATOM   8920  C C4    . DA  K 3 2   ? -28.255 -58.475 -13.869  1.00 36.35  ?  2   DA  J C4    1 
ATOM   8921  P P     . DA  K 3 3   ? -22.256 -60.146 -16.116  1.00 70.02  ?  3   DA  J P     1 
ATOM   8922  O OP1   . DA  K 3 3   ? -21.385 -60.486 -14.968  1.00 54.34  ?  3   DA  J OP1   1 
ATOM   8923  O OP2   . DA  K 3 3   ? -21.736 -59.321 -17.229  1.00 84.52  -1 3   DA  J OP2   1 
ATOM   8924  O "O5'" . DA  K 3 3   ? -22.839 -61.503 -16.726  1.00 69.03  ?  3   DA  J "O5'" 1 
ATOM   8925  C "C5'" . DA  K 3 3   ? -23.577 -62.398 -15.915  1.00 59.30  ?  3   DA  J "C5'" 1 
ATOM   8926  C "C4'" . DA  K 3 3   ? -24.880 -62.790 -16.599  1.00 49.29  ?  3   DA  J "C4'" 1 
ATOM   8927  O "O4'" . DA  K 3 3   ? -25.915 -61.837 -16.273  1.00 52.93  ?  3   DA  J "O4'" 1 
ATOM   8928  C "C3'" . DA  K 3 3   ? -24.834 -62.869 -18.135  1.00 69.70  ?  3   DA  J "C3'" 1 
ATOM   8929  O "O3'" . DA  K 3 3   ? -25.082 -64.207 -18.547  1.00 83.30  ?  3   DA  J "O3'" 1 
ATOM   8930  C "C2'" . DA  K 3 3   ? -25.938 -61.912 -18.617  1.00 54.45  ?  3   DA  J "C2'" 1 
ATOM   8931  C "C1'" . DA  K 3 3   ? -26.785 -61.717 -17.370  1.00 52.66  ?  3   DA  J "C1'" 1 
ATOM   8932  N N9    . DA  K 3 3   ? -27.474 -60.429 -17.299  1.00 45.24  ?  3   DA  J N9    1 
ATOM   8933  C C8    . DA  K 3 3   ? -26.917 -59.182 -17.361  1.00 43.58  ?  3   DA  J C8    1 
ATOM   8934  N N7    . DA  K 3 3   ? -27.794 -58.206 -17.278  1.00 42.11  ?  3   DA  J N7    1 
ATOM   8935  C C5    . DA  K 3 3   ? -29.012 -58.862 -17.176  1.00 41.12  ?  3   DA  J C5    1 
ATOM   8936  C C6    . DA  K 3 3   ? -30.342 -58.399 -17.062  1.00 42.41  ?  3   DA  J C6    1 
ATOM   8937  N N6    . DA  K 3 3   ? -30.681 -57.104 -17.030  1.00 41.93  ?  3   DA  J N6    1 
ATOM   8938  N N1    . DA  K 3 3   ? -31.317 -59.326 -16.980  1.00 45.15  ?  3   DA  J N1    1 
ATOM   8939  C C2    . DA  K 3 3   ? -30.986 -60.620 -17.011  1.00 46.28  ?  3   DA  J C2    1 
ATOM   8940  N N3    . DA  K 3 3   ? -29.782 -61.174 -17.113  1.00 42.76  ?  3   DA  J N3    1 
ATOM   8941  C C4    . DA  K 3 3   ? -28.830 -60.232 -17.193  1.00 39.85  ?  3   DA  J C4    1 
ATOM   8942  P P     . DA  K 3 4   ? -25.128 -64.617 -20.102  1.00 53.23  ?  4   DA  J P     1 
ATOM   8943  O OP1   . DA  K 3 4   ? -24.695 -66.027 -20.215  1.00 57.05  ?  4   DA  J OP1   1 
ATOM   8944  O OP2   . DA  K 3 4   ? -24.419 -63.573 -20.876  1.00 50.72  -1 4   DA  J OP2   1 
ATOM   8945  O "O5'" . DA  K 3 4   ? -26.690 -64.511 -20.435  1.00 32.95  ?  4   DA  J "O5'" 1 
ATOM   8946  C "C5'" . DA  K 3 4   ? -27.607 -65.296 -19.685  1.00 39.10  ?  4   DA  J "C5'" 1 
ATOM   8947  C "C4'" . DA  K 3 4   ? -29.038 -65.069 -20.131  1.00 48.05  ?  4   DA  J "C4'" 1 
ATOM   8948  O "O4'" . DA  K 3 4   ? -29.458 -63.739 -19.730  1.00 54.43  ?  4   DA  J "O4'" 1 
ATOM   8949  C "C3'" . DA  K 3 4   ? -29.283 -65.156 -21.637  1.00 44.84  ?  4   DA  J "C3'" 1 
ATOM   8950  O "O3'" . DA  K 3 4   ? -30.359 -66.063 -21.882  1.00 47.14  ?  4   DA  J "O3'" 1 
ATOM   8951  C "C2'" . DA  K 3 4   ? -29.627 -63.732 -22.072  1.00 47.78  ?  4   DA  J "C2'" 1 
ATOM   8952  C "C1'" . DA  K 3 4   ? -30.145 -63.115 -20.790  1.00 39.64  ?  4   DA  J "C1'" 1 
ATOM   8953  N N9    . DA  K 3 4   ? -29.954 -61.669 -20.708  1.00 38.61  ?  4   DA  J N9    1 
ATOM   8954  C C8    . DA  K 3 4   ? -28.790 -60.968 -20.875  1.00 46.34  ?  4   DA  J C8    1 
ATOM   8955  N N7    . DA  K 3 4   ? -28.935 -59.667 -20.752  1.00 47.93  ?  4   DA  J N7    1 
ATOM   8956  C C5    . DA  K 3 4   ? -30.288 -59.506 -20.503  1.00 42.75  ?  4   DA  J C5    1 
ATOM   8957  C C6    . DA  K 3 4   ? -31.091 -58.368 -20.282  1.00 41.63  ?  4   DA  J C6    1 
ATOM   8958  N N6    . DA  K 3 4   ? -30.622 -57.113 -20.272  1.00 40.67  ?  4   DA  J N6    1 
ATOM   8959  N N1    . DA  K 3 4   ? -32.403 -58.569 -20.067  1.00 37.44  ?  4   DA  J N1    1 
ATOM   8960  C C2    . DA  K 3 4   ? -32.881 -59.815 -20.073  1.00 40.86  ?  4   DA  J C2    1 
ATOM   8961  N N3    . DA  K 3 4   ? -32.232 -60.957 -20.267  1.00 41.51  ?  4   DA  J N3    1 
ATOM   8962  C C4    . DA  K 3 4   ? -30.928 -60.731 -20.480  1.00 39.48  ?  4   DA  J C4    1 
ATOM   8963  P P     . DT  K 3 5   ? -30.766 -66.457 -23.382  1.00 63.32  ?  5   DT  J P     1 
ATOM   8964  O OP1   . DT  K 3 5   ? -31.405 -67.790 -23.325  1.00 61.56  ?  5   DT  J OP1   1 
ATOM   8965  O OP2   . DT  K 3 5   ? -29.589 -66.249 -24.255  1.00 67.96  -1 5   DT  J OP2   1 
ATOM   8966  O "O5'" . DT  K 3 5   ? -31.878 -65.369 -23.766  1.00 56.50  ?  5   DT  J "O5'" 1 
ATOM   8967  C "C5'" . DT  K 3 5   ? -33.045 -65.211 -22.961  1.00 45.36  ?  5   DT  J "C5'" 1 
ATOM   8968  C "C4'" . DT  K 3 5   ? -33.852 -64.000 -23.409  1.00 42.19  ?  5   DT  J "C4'" 1 
ATOM   8969  O "O4'" . DT  K 3 5   ? -33.202 -62.768 -22.989  1.00 48.75  ?  5   DT  J "O4'" 1 
ATOM   8970  C "C3'" . DT  K 3 5   ? -34.038 -63.863 -24.928  1.00 57.25  ?  5   DT  J "C3'" 1 
ATOM   8971  O "O3'" . DT  K 3 5   ? -35.297 -63.290 -25.204  1.00 73.75  ?  5   DT  J "O3'" 1 
ATOM   8972  C "C2'" . DT  K 3 5   ? -32.968 -62.832 -25.264  1.00 62.05  ?  5   DT  J "C2'" 1 
ATOM   8973  C "C1'" . DT  K 3 5   ? -33.226 -61.909 -24.097  1.00 38.57  ?  5   DT  J "C1'" 1 
ATOM   8974  N N1    . DT  K 3 5   ? -32.274 -60.785 -23.928  1.00 41.03  ?  5   DT  J N1    1 
ATOM   8975  C C2    . DT  K 3 5   ? -32.770 -59.575 -23.511  1.00 46.00  ?  5   DT  J C2    1 
ATOM   8976  O O2    . DT  K 3 5   ? -33.949 -59.386 -23.264  1.00 40.81  ?  5   DT  J O2    1 
ATOM   8977  N N3    . DT  K 3 5   ? -31.840 -58.586 -23.392  1.00 43.00  ?  5   DT  J N3    1 
ATOM   8978  C C4    . DT  K 3 5   ? -30.489 -58.669 -23.644  1.00 55.32  ?  5   DT  J C4    1 
ATOM   8979  O O4    . DT  K 3 5   ? -29.738 -57.704 -23.500  1.00 62.54  ?  5   DT  J O4    1 
ATOM   8980  C C5    . DT  K 3 5   ? -30.024 -59.969 -24.084  1.00 53.49  ?  5   DT  J C5    1 
ATOM   8981  C C7    . DT  K 3 5   ? -28.571 -60.188 -24.389  1.00 63.90  ?  5   DT  J C7    1 
ATOM   8982  C C6    . DT  K 3 5   ? -30.933 -60.956 -24.207  1.00 38.75  ?  5   DT  J C6    1 
ATOM   8983  P P     . DG  K 3 6   ? -36.467 -64.113 -25.927  1.00 87.23  ?  6   DG  J P     1 
ATOM   8984  O OP1   . DG  K 3 6   ? -36.730 -65.322 -25.115  1.00 39.66  ?  6   DG  J OP1   1 
ATOM   8985  O OP2   . DG  K 3 6   ? -36.144 -64.233 -27.368  1.00 80.99  -1 6   DG  J OP2   1 
ATOM   8986  O "O5'" . DG  K 3 6   ? -37.717 -63.134 -25.767  1.00 47.47  ?  6   DG  J "O5'" 1 
ATOM   8987  C "C5'" . DG  K 3 6   ? -38.095 -62.655 -24.490  1.00 44.76  ?  6   DG  J "C5'" 1 
ATOM   8988  C "C4'" . DG  K 3 6   ? -38.617 -61.228 -24.578  1.00 51.39  ?  6   DG  J "C4'" 1 
ATOM   8989  O "O4'" . DG  K 3 6   ? -37.517 -60.278 -24.476  1.00 56.13  ?  6   DG  J "O4'" 1 
ATOM   8990  C "C3'" . DG  K 3 6   ? -39.367 -60.886 -25.862  1.00 46.70  ?  6   DG  J "C3'" 1 
ATOM   8991  O "O3'" . DG  K 3 6   ? -40.481 -60.082 -25.567  1.00 67.72  ?  6   DG  J "O3'" 1 
ATOM   8992  C "C2'" . DG  K 3 6   ? -38.324 -60.102 -26.665  1.00 49.00  ?  6   DG  J "C2'" 1 
ATOM   8993  C "C1'" . DG  K 3 6   ? -37.555 -59.377 -25.564  1.00 39.93  ?  6   DG  J "C1'" 1 
ATOM   8994  N N9    . DG  K 3 6   ? -36.175 -59.035 -25.929  1.00 41.66  ?  6   DG  J N9    1 
ATOM   8995  C C8    . DG  K 3 6   ? -35.167 -59.917 -26.225  1.00 45.07  ?  6   DG  J C8    1 
ATOM   8996  N N7    . DG  K 3 6   ? -34.031 -59.341 -26.504  1.00 45.15  ?  6   DG  J N7    1 
ATOM   8997  C C5    . DG  K 3 6   ? -34.292 -57.983 -26.377  1.00 37.76  ?  6   DG  J C5    1 
ATOM   8998  C C6    . DG  K 3 6   ? -33.430 -56.871 -26.558  1.00 43.60  ?  6   DG  J C6    1 
ATOM   8999  O O6    . DG  K 3 6   ? -32.232 -56.871 -26.875  1.00 46.74  ?  6   DG  J O6    1 
ATOM   9000  N N1    . DG  K 3 6   ? -34.085 -55.665 -26.332  1.00 39.86  ?  6   DG  J N1    1 
ATOM   9001  C C2    . DG  K 3 6   ? -35.407 -55.545 -25.979  1.00 40.70  ?  6   DG  J C2    1 
ATOM   9002  N N2    . DG  K 3 6   ? -35.856 -54.290 -25.804  1.00 39.51  ?  6   DG  J N2    1 
ATOM   9003  N N3    . DG  K 3 6   ? -36.233 -56.581 -25.803  1.00 42.60  ?  6   DG  J N3    1 
ATOM   9004  C C4    . DG  K 3 6   ? -35.607 -57.769 -26.019  1.00 35.94  ?  6   DG  J C4    1 
ATOM   9005  P P     . DC  K 3 7   ? -41.555 -59.755 -26.715  1.00 62.29  ?  7   DC  J P     1 
ATOM   9006  O OP1   . DC  K 3 7   ? -42.829 -59.398 -26.054  1.00 84.62  ?  7   DC  J OP1   1 
ATOM   9007  O OP2   . DC  K 3 7   ? -41.522 -60.867 -27.690  1.00 48.42  -1 7   DC  J OP2   1 
ATOM   9008  O "O5'" . DC  K 3 7   ? -40.977 -58.453 -27.431  1.00 43.61  ?  7   DC  J "O5'" 1 
ATOM   9009  C "C5'" . DC  K 3 7   ? -40.891 -57.254 -26.692  1.00 57.42  ?  7   DC  J "C5'" 1 
ATOM   9010  C "C4'" . DC  K 3 7   ? -40.196 -56.163 -27.479  1.00 62.96  ?  7   DC  J "C4'" 1 
ATOM   9011  O "O4'" . DC  K 3 7   ? -38.792 -56.467 -27.624  1.00 63.74  ?  7   DC  J "O4'" 1 
ATOM   9012  C "C3'" . DC  K 3 7   ? -40.732 -55.956 -28.897  1.00 57.00  ?  7   DC  J "C3'" 1 
ATOM   9013  O "O3'" . DC  K 3 7   ? -41.390 -54.710 -28.955  1.00 58.44  ?  7   DC  J "O3'" 1 
ATOM   9014  C "C2'" . DC  K 3 7   ? -39.482 -55.990 -29.799  1.00 56.22  ?  7   DC  J "C2'" 1 
ATOM   9015  C "C1'" . DC  K 3 7   ? -38.340 -55.853 -28.801  1.00 52.83  ?  7   DC  J "C1'" 1 
ATOM   9016  N N1    . DC  K 3 7   ? -37.057 -56.504 -29.235  1.00 46.46  ?  7   DC  J N1    1 
ATOM   9017  C C2    . DC  K 3 7   ? -35.920 -55.714 -29.424  1.00 42.26  ?  7   DC  J C2    1 
ATOM   9018  O O2    . DC  K 3 7   ? -36.007 -54.497 -29.254  1.00 41.64  ?  7   DC  J O2    1 
ATOM   9019  N N3    . DC  K 3 7   ? -34.760 -56.305 -29.810  1.00 41.30  ?  7   DC  J N3    1 
ATOM   9020  C C4    . DC  K 3 7   ? -34.714 -57.628 -29.989  1.00 47.99  ?  7   DC  J C4    1 
ATOM   9021  N N4    . DC  K 3 7   ? -33.550 -58.168 -30.365  1.00 43.47  ?  7   DC  J N4    1 
ATOM   9022  C C5    . DC  K 3 7   ? -35.863 -58.454 -29.789  1.00 42.09  ?  7   DC  J C5    1 
ATOM   9023  C C6    . DC  K 3 7   ? -37.001 -57.857 -29.413  1.00 43.79  ?  7   DC  J C6    1 
ATOM   9024  P P     . DT  K 3 8   ? -42.194 -54.261 -30.269  1.00 55.95  ?  8   DT  J P     1 
ATOM   9025  O OP1   . DT  K 3 8   ? -43.361 -53.465 -29.831  1.00 66.97  ?  8   DT  J OP1   1 
ATOM   9026  O OP2   . DT  K 3 8   ? -42.398 -55.461 -31.112  1.00 53.03  -1 8   DT  J OP2   1 
ATOM   9027  O "O5'" . DT  K 3 8   ? -41.164 -53.309 -31.024  1.00 60.99  ?  8   DT  J "O5'" 1 
ATOM   9028  C "C5'" . DT  K 3 8   ? -40.571 -52.252 -30.291  1.00 46.33  ?  8   DT  J "C5'" 1 
ATOM   9029  C "C4'" . DT  K 3 8   ? -39.429 -51.613 -31.051  1.00 66.80  ?  8   DT  J "C4'" 1 
ATOM   9030  O "O4'" . DT  K 3 8   ? -38.300 -52.514 -31.094  1.00 73.75  ?  8   DT  J "O4'" 1 
ATOM   9031  C "C3'" . DT  K 3 8   ? -39.741 -51.266 -32.514  1.00 73.40  ?  8   DT  J "C3'" 1 
ATOM   9032  O "O3'" . DT  K 3 8   ? -39.577 -49.878 -32.687  1.00 83.69  ?  8   DT  J "O3'" 1 
ATOM   9033  C "C2'" . DT  K 3 8   ? -38.700 -52.067 -33.315  1.00 54.15  ?  8   DT  J "C2'" 1 
ATOM   9034  C "C1'" . DT  K 3 8   ? -37.606 -52.258 -32.282  1.00 53.78  ?  8   DT  J "C1'" 1 
ATOM   9035  N N1    . DT  K 3 8   ? -36.705 -53.414 -32.569  1.00 50.74  ?  8   DT  J N1    1 
ATOM   9036  C C2    . DT  K 3 8   ? -35.346 -53.206 -32.654  1.00 52.04  ?  8   DT  J C2    1 
ATOM   9037  O O2    . DT  K 3 8   ? -34.824 -52.113 -32.504  1.00 48.66  ?  8   DT  J O2    1 
ATOM   9038  N N3    . DT  K 3 8   ? -34.612 -54.330 -32.922  1.00 40.63  ?  8   DT  J N3    1 
ATOM   9039  C C4    . DT  K 3 8   ? -35.086 -55.615 -33.112  1.00 41.85  ?  8   DT  J C4    1 
ATOM   9040  O O4    . DT  K 3 8   ? -34.342 -56.562 -33.350  1.00 42.65  ?  8   DT  J O4    1 
ATOM   9041  C C5    . DT  K 3 8   ? -36.518 -55.764 -33.010  1.00 41.99  ?  8   DT  J C5    1 
ATOM   9042  C C7    . DT  K 3 8   ? -37.149 -57.112 -33.197  1.00 43.45  ?  8   DT  J C7    1 
ATOM   9043  C C6    . DT  K 3 8   ? -37.250 -54.670 -32.748  1.00 46.21  ?  8   DT  J C6    1 
ATOM   9044  P P     . DC  K 3 9   ? -40.298 -49.088 -33.886  1.00 88.06  ?  9   DC  J P     1 
ATOM   9045  O OP1   . DC  K 3 9   ? -41.202 -48.079 -33.291  1.00 94.66  ?  9   DC  J OP1   1 
ATOM   9046  O OP2   . DC  K 3 9   ? -40.823 -50.086 -34.845  1.00 49.73  -1 9   DC  J OP2   1 
ATOM   9047  O "O5'" . DC  K 3 9   ? -39.074 -48.349 -34.582  1.00 60.70  ?  9   DC  J "O5'" 1 
ATOM   9048  C "C5'" . DC  K 3 9   ? -38.111 -47.739 -33.749  1.00 69.28  ?  9   DC  J "C5'" 1 
ATOM   9049  C "C4'" . DC  K 3 9   ? -36.749 -47.784 -34.394  1.00 65.90  ?  9   DC  J "C4'" 1 
ATOM   9050  O "O4'" . DC  K 3 9   ? -36.241 -49.138 -34.353  1.00 62.65  ?  9   DC  J "O4'" 1 
ATOM   9051  C "C3'" . DC  K 3 9   ? -36.716 -47.367 -35.865  1.00 71.16  ?  9   DC  J "C3'" 1 
ATOM   9052  O "O3'" . DC  K 3 9   ? -35.820 -46.294 -36.003  1.00 78.79  ?  9   DC  J "O3'" 1 
ATOM   9053  C "C2'" . DC  K 3 9   ? -36.216 -48.614 -36.603  1.00 74.12  ?  9   DC  J "C2'" 1 
ATOM   9054  C "C1'" . DC  K 3 9   ? -35.473 -49.350 -35.503  1.00 65.06  ?  9   DC  J "C1'" 1 
ATOM   9055  N N1    . DC  K 3 9   ? -35.362 -50.813 -35.746  1.00 51.75  ?  9   DC  J N1    1 
ATOM   9056  C C2    . DC  K 3 9   ? -34.101 -51.408 -35.758  1.00 48.19  ?  9   DC  J C2    1 
ATOM   9057  O O2    . DC  K 3 9   ? -33.109 -50.706 -35.533  1.00 53.93  ?  9   DC  J O2    1 
ATOM   9058  N N3    . DC  K 3 9   ? -34.004 -52.742 -35.989  1.00 39.90  ?  9   DC  J N3    1 
ATOM   9059  C C4    . DC  K 3 9   ? -35.107 -53.459 -36.217  1.00 41.21  ?  9   DC  J C4    1 
ATOM   9060  N N4    . DC  K 3 9   ? -34.967 -54.770 -36.444  1.00 49.44  ?  9   DC  J N4    1 
ATOM   9061  C C5    . DC  K 3 9   ? -36.403 -52.863 -36.224  1.00 35.38  ?  9   DC  J C5    1 
ATOM   9062  C C6    . DC  K 3 9   ? -36.482 -51.549 -35.992  1.00 44.94  ?  9   DC  J C6    1 
ATOM   9063  P P     . DC  K 3 10  ? -35.682 -45.493 -37.385  1.00 88.89  ?  10  DC  J P     1 
ATOM   9064  O OP1   . DC  K 3 10  ? -35.639 -44.047 -37.075  1.00 85.40  ?  10  DC  J OP1   1 
ATOM   9065  O OP2   . DC  K 3 10  ? -36.698 -46.017 -38.324  1.00 66.53  -1 10  DC  J OP2   1 
ATOM   9066  O "O5'" . DC  K 3 10  ? -34.248 -45.951 -37.911  1.00 52.35  ?  10  DC  J "O5'" 1 
ATOM   9067  C "C5'" . DC  K 3 10  ? -33.089 -45.706 -37.132  1.00 66.10  ?  10  DC  J "C5'" 1 
ATOM   9068  C "C4'" . DC  K 3 10  ? -31.889 -46.337 -37.800  1.00 81.40  ?  10  DC  J "C4'" 1 
ATOM   9069  O "O4'" . DC  K 3 10  ? -32.038 -47.777 -37.766  1.00 66.03  ?  10  DC  J "O4'" 1 
ATOM   9070  C "C3'" . DC  K 3 10  ? -31.737 -45.961 -39.276  1.00 85.66  ?  10  DC  J "C3'" 1 
ATOM   9071  O "O3'" . DC  K 3 10  ? -30.482 -45.342 -39.489  1.00 81.06  ?  10  DC  J "O3'" 1 
ATOM   9072  C "C2'" . DC  K 3 10  ? -31.843 -47.292 -40.033  1.00 67.39  ?  10  DC  J "C2'" 1 
ATOM   9073  C "C1'" . DC  K 3 10  ? -31.530 -48.318 -38.957  1.00 69.35  ?  10  DC  J "C1'" 1 
ATOM   9074  N N1    . DC  K 3 10  ? -32.193 -49.634 -39.205  1.00 63.23  ?  10  DC  J N1    1 
ATOM   9075  C C2    . DC  K 3 10  ? -31.435 -50.718 -39.659  1.00 56.90  ?  10  DC  J C2    1 
ATOM   9076  O O2    . DC  K 3 10  ? -30.221 -50.570 -39.831  1.00 62.05  ?  10  DC  J O2    1 
ATOM   9077  N N3    . DC  K 3 10  ? -32.055 -51.905 -39.889  1.00 46.18  ?  10  DC  J N3    1 
ATOM   9078  C C4    . DC  K 3 10  ? -33.371 -52.018 -39.686  1.00 48.78  ?  10  DC  J C4    1 
ATOM   9079  N N4    . DC  K 3 10  ? -33.943 -53.202 -39.922  1.00 44.75  ?  10  DC  J N4    1 
ATOM   9080  C C5    . DC  K 3 10  ? -34.159 -50.921 -39.230  1.00 55.40  ?  10  DC  J C5    1 
ATOM   9081  C C6    . DC  K 3 10  ? -33.537 -49.760 -39.008  1.00 64.01  ?  10  DC  J C6    1 
ATOM   9082  P P     . DT  K 3 11  ? -30.162 -44.643 -40.897  1.00 97.42  ?  11  DT  J P     1 
ATOM   9083  O OP1   . DT  K 3 11  ? -29.203 -43.546 -40.644  1.00 114.37 ?  11  DT  J OP1   1 
ATOM   9084  O OP2   . DT  K 3 11  ? -31.456 -44.360 -41.562  1.00 86.78  -1 11  DT  J OP2   1 
ATOM   9085  O "O5'" . DT  K 3 11  ? -29.427 -45.798 -41.718  1.00 115.18 ?  11  DT  J "O5'" 1 
ATOM   9086  C "C5'" . DT  K 3 11  ? -28.237 -46.388 -41.216  1.00 103.44 ?  11  DT  J "C5'" 1 
ATOM   9087  C "C4'" . DT  K 3 11  ? -27.625 -47.297 -42.261  1.00 98.29  ?  11  DT  J "C4'" 1 
ATOM   9088  O "O4'" . DT  K 3 11  ? -28.362 -48.542 -42.290  1.00 99.90  ?  11  DT  J "O4'" 1 
ATOM   9089  C "C3'" . DT  K 3 11  ? -27.630 -46.752 -43.693  1.00 82.24  ?  11  DT  J "C3'" 1 
ATOM   9090  O "O3'" . DT  K 3 11  ? -26.327 -46.925 -44.259  1.00 103.57 ?  11  DT  J "O3'" 1 
ATOM   9091  C "C2'" . DT  K 3 11  ? -28.691 -47.611 -44.395  1.00 69.62  ?  11  DT  J "C2'" 1 
ATOM   9092  C "C1'" . DT  K 3 11  ? -28.596 -48.917 -43.620  1.00 74.90  ?  11  DT  J "C1'" 1 
ATOM   9093  N N1    . DT  K 3 11  ? -29.852 -49.736 -43.640  1.00 67.67  ?  11  DT  J N1    1 
ATOM   9094  C C2    . DT  K 3 11  ? -29.787 -51.055 -44.020  1.00 75.53  ?  11  DT  J C2    1 
ATOM   9095  O O2    . DT  K 3 11  ? -28.754 -51.599 -44.366  1.00 89.93  ?  11  DT  J O2    1 
ATOM   9096  N N3    . DT  K 3 11  ? -30.986 -51.721 -43.989  1.00 66.13  ?  11  DT  J N3    1 
ATOM   9097  C C4    . DT  K 3 11  ? -32.217 -51.212 -43.617  1.00 61.05  ?  11  DT  J C4    1 
ATOM   9098  O O4    . DT  K 3 11  ? -33.239 -51.894 -43.624  1.00 45.12  ?  11  DT  J O4    1 
ATOM   9099  C C5    . DT  K 3 11  ? -32.214 -49.823 -43.219  1.00 67.16  ?  11  DT  J C5    1 
ATOM   9100  C C7    . DT  K 3 11  ? -33.489 -49.157 -42.793  1.00 67.37  ?  11  DT  J C7    1 
ATOM   9101  C C6    . DT  K 3 11  ? -31.044 -49.161 -43.245  1.00 68.60  ?  11  DT  J C6    1 
ATOM   9102  P P     . DA  K 3 12  ? -25.880 -46.188 -45.619  1.00 117.49 ?  12  DA  J P     1 
ATOM   9103  O OP1   . DA  K 3 12  ? -24.509 -45.671 -45.421  1.00 124.33 ?  12  DA  J OP1   1 
ATOM   9104  O OP2   . DA  K 3 12  ? -26.968 -45.266 -46.014  1.00 88.75  -1 12  DA  J OP2   1 
ATOM   9105  O "O5'" . DA  K 3 12  ? -25.836 -47.364 -46.699  1.00 108.50 ?  12  DA  J "O5'" 1 
ATOM   9106  C "C5'" . DA  K 3 12  ? -25.252 -48.615 -46.367  1.00 108.56 ?  12  DA  J "C5'" 1 
ATOM   9107  C "C4'" . DA  K 3 12  ? -25.586 -49.644 -47.427  1.00 94.42  ?  12  DA  J "C4'" 1 
ATOM   9108  O "O4'" . DA  K 3 12  ? -26.895 -50.195 -47.116  1.00 87.33  ?  12  DA  J "O4'" 1 
ATOM   9109  C "C3'" . DA  K 3 12  ? -25.709 -49.105 -48.858  1.00 106.10 ?  12  DA  J "C3'" 1 
ATOM   9110  O "O3'" . DA  K 3 12  ? -25.220 -50.074 -49.787  1.00 125.64 ?  12  DA  J "O3'" 1 
ATOM   9111  C "C2'" . DA  K 3 12  ? -27.207 -48.910 -49.003  1.00 93.30  ?  12  DA  J "C2'" 1 
ATOM   9112  C "C1'" . DA  K 3 12  ? -27.702 -50.133 -48.266  1.00 80.20  ?  12  DA  J "C1'" 1 
ATOM   9113  N N9    . DA  K 3 12  ? -29.083 -49.994 -47.835  1.00 67.86  ?  12  DA  J N9    1 
ATOM   9114  C C8    . DA  K 3 12  ? -29.718 -48.844 -47.454  1.00 80.97  ?  12  DA  J C8    1 
ATOM   9115  N N7    . DA  K 3 12  ? -30.969 -49.024 -47.099  1.00 84.42  ?  12  DA  J N7    1 
ATOM   9116  C C5    . DA  K 3 12  ? -31.155 -50.390 -47.236  1.00 70.38  ?  12  DA  J C5    1 
ATOM   9117  C C6    . DA  K 3 12  ? -32.264 -51.229 -47.011  1.00 70.01  ?  12  DA  J C6    1 
ATOM   9118  N N6    . DA  K 3 12  ? -33.455 -50.797 -46.580  1.00 77.58  ?  12  DA  J N6    1 
ATOM   9119  N N1    . DA  K 3 12  ? -32.100 -52.540 -47.245  1.00 64.03  ?  12  DA  J N1    1 
ATOM   9120  C C2    . DA  K 3 12  ? -30.917 -52.985 -47.679  1.00 70.69  ?  12  DA  J C2    1 
ATOM   9121  N N3    . DA  K 3 12  ? -29.809 -52.301 -47.924  1.00 68.45  ?  12  DA  J N3    1 
ATOM   9122  C C4    . DA  K 3 12  ? -29.996 -50.998 -47.682  1.00 64.30  ?  12  DA  J C4    1 
ATOM   9123  P P     . DT  K 3 13  ? -23.733 -49.996 -50.396  1.00 145.87 ?  13  DT  J P     1 
ATOM   9124  O OP1   . DT  K 3 13  ? -22.785 -49.816 -49.275  1.00 106.10 ?  13  DT  J OP1   1 
ATOM   9125  O OP2   . DT  K 3 13  ? -23.740 -49.045 -51.529  1.00 123.71 -1 13  DT  J OP2   1 
ATOM   9126  O "O5'" . DT  K 3 13  ? -23.521 -51.460 -51.007  1.00 121.38 ?  13  DT  J "O5'" 1 
ATOM   9127  C "C5'" . DT  K 3 13  ? -23.505 -52.600 -50.152  1.00 113.28 ?  13  DT  J "C5'" 1 
ATOM   9128  C "C4'" . DT  K 3 13  ? -24.369 -53.710 -50.726  1.00 102.67 ?  13  DT  J "C4'" 1 
ATOM   9129  O "O4'" . DT  K 3 13  ? -25.764 -53.339 -50.574  1.00 93.15  ?  13  DT  J "O4'" 1 
ATOM   9130  C "C3'" . DT  K 3 13  ? -24.171 -53.993 -52.217  1.00 90.17  ?  13  DT  J "C3'" 1 
ATOM   9131  O "O3'" . DT  K 3 13  ? -24.323 -55.387 -52.481  1.00 82.33  ?  13  DT  J "O3'" 1 
ATOM   9132  C "C2'" . DT  K 3 13  ? -25.312 -53.192 -52.842  1.00 97.53  ?  13  DT  J "C2'" 1 
ATOM   9133  C "C1'" . DT  K 3 13  ? -26.409 -53.433 -51.818  1.00 97.33  ?  13  DT  J "C1'" 1 
ATOM   9134  N N1    . DT  K 3 13  ? -27.483 -52.401 -51.844  1.00 101.35 ?  13  DT  J N1    1 
ATOM   9135  C C2    . DT  K 3 13  ? -28.772 -52.765 -51.538  1.00 100.53 ?  13  DT  J C2    1 
ATOM   9136  O O2    . DT  K 3 13  ? -29.093 -53.903 -51.246  1.00 107.30 ?  13  DT  J O2    1 
ATOM   9137  N N3    . DT  K 3 13  ? -29.681 -51.740 -51.581  1.00 89.78  ?  13  DT  J N3    1 
ATOM   9138  C C4    . DT  K 3 13  ? -29.436 -50.416 -51.895  1.00 88.98  ?  13  DT  J C4    1 
ATOM   9139  O O4    . DT  K 3 13  ? -30.324 -49.569 -51.908  1.00 71.97  ?  13  DT  J O4    1 
ATOM   9140  C C5    . DT  K 3 13  ? -28.062 -50.101 -52.205  1.00 104.83 ?  13  DT  J C5    1 
ATOM   9141  C C7    . DT  K 3 13  ? -27.673 -48.696 -52.562  1.00 111.81 ?  13  DT  J C7    1 
ATOM   9142  C C6    . DT  K 3 13  ? -27.162 -51.096 -52.163  1.00 103.28 ?  13  DT  J C6    1 
ATOM   9143  P P     . DA  K 3 14  ? -23.039 -56.325 -52.728  1.00 102.15 ?  14  DA  J P     1 
ATOM   9144  O OP1   . DA  K 3 14  ? -21.882 -55.679 -52.068  1.00 111.54 -1 14  DA  J OP1   1 
ATOM   9145  O OP2   . DA  K 3 14  ? -22.979 -56.645 -54.171  1.00 98.31  ?  14  DA  J OP2   1 
ATOM   9146  O "O5'" . DA  K 3 14  ? -23.387 -57.668 -51.923  1.00 103.00 ?  14  DA  J "O5'" 1 
ATOM   9147  C "C5'" . DA  K 3 14  ? -23.608 -58.884 -52.642  1.00 102.12 ?  14  DA  J "C5'" 1 
ATOM   9148  C "C4'" . DA  K 3 14  ? -25.094 -59.185 -52.717  1.00 92.86  ?  14  DA  J "C4'" 1 
ATOM   9149  O "O4'" . DA  K 3 14  ? -25.844 -57.953 -52.856  1.00 88.21  ?  14  DA  J "O4'" 1 
ATOM   9150  C "C3'" . DA  K 3 14  ? -25.537 -60.091 -53.864  1.00 87.25  ?  14  DA  J "C3'" 1 
ATOM   9151  O "O3'" . DA  K 3 14  ? -26.629 -60.909 -53.439  1.00 80.86  ?  14  DA  J "O3'" 1 
ATOM   9152  C "C2'" . DA  K 3 14  ? -25.997 -59.076 -54.905  1.00 91.42  ?  14  DA  J "C2'" 1 
ATOM   9153  C "C1'" . DA  K 3 14  ? -26.645 -58.025 -54.010  1.00 85.37  ?  14  DA  J "C1'" 1 
ATOM   9154  N N9    . DA  K 3 14  ? -26.751 -56.689 -54.591  1.00 88.38  ?  14  DA  J N9    1 
ATOM   9155  C C8    . DA  K 3 14  ? -25.792 -56.000 -55.283  1.00 93.00  ?  14  DA  J C8    1 
ATOM   9156  N N7    . DA  K 3 14  ? -26.181 -54.809 -55.678  1.00 94.39  ?  14  DA  J N7    1 
ATOM   9157  C C5    . DA  K 3 14  ? -27.483 -54.712 -55.210  1.00 92.41  ?  14  DA  J C5    1 
ATOM   9158  C C6    . DA  K 3 14  ? -28.451 -53.692 -55.300  1.00 95.75  ?  14  DA  J C6    1 
ATOM   9159  N N6    . DA  K 3 14  ? -28.231 -52.532 -55.922  1.00 97.53  ?  14  DA  J N6    1 
ATOM   9160  N N1    . DA  K 3 14  ? -29.656 -53.915 -54.723  1.00 98.36  ?  14  DA  J N1    1 
ATOM   9161  C C2    . DA  K 3 14  ? -29.864 -55.083 -54.102  1.00 89.46  ?  14  DA  J C2    1 
ATOM   9162  N N3    . DA  K 3 14  ? -29.030 -56.113 -53.954  1.00 82.27  ?  14  DA  J N3    1 
ATOM   9163  C C4    . DA  K 3 14  ? -27.847 -55.860 -54.537  1.00 87.00  ?  14  DA  J C4    1 
ATOM   9164  P P     . DC  K 3 15  ? -26.422 -62.404 -52.883  1.00 96.64  ?  15  DC  J P     1 
ATOM   9165  O OP1   . DC  K 3 15  ? -26.643 -62.338 -51.417  1.00 113.75 ?  15  DC  J OP1   1 
ATOM   9166  O OP2   . DC  K 3 15  ? -25.144 -62.932 -53.401  1.00 101.62 -1 15  DC  J OP2   1 
ATOM   9167  O "O5'" . DC  K 3 15  ? -27.625 -63.239 -53.563  1.00 91.20  ?  15  DC  J "O5'" 1 
ATOM   9168  C "C5'" . DC  K 3 15  ? -28.239 -62.743 -54.764  1.00 83.98  ?  15  DC  J "C5'" 1 
ATOM   9169  C "C4'" . DC  K 3 15  ? -29.376 -61.778 -54.441  1.00 89.19  ?  15  DC  J "C4'" 1 
ATOM   9170  O "O4'" . DC  K 3 15  ? -29.041 -60.459 -54.934  1.00 85.47  ?  15  DC  J "O4'" 1 
ATOM   9171  C "C3'" . DC  K 3 15  ? -30.747 -62.104 -55.067  1.00 73.01  ?  15  DC  J "C3'" 1 
ATOM   9172  O "O3'" . DC  K 3 15  ? -31.783 -61.950 -54.091  1.00 90.42  ?  15  DC  J "O3'" 1 
ATOM   9173  C "C2'" . DC  K 3 15  ? -30.864 -61.083 -56.200  1.00 62.72  ?  15  DC  J "C2'" 1 
ATOM   9174  C "C1'" . DC  K 3 15  ? -30.176 -59.905 -55.549  1.00 71.24  ?  15  DC  J "C1'" 1 
ATOM   9175  N N1    . DC  K 3 15  ? -29.736 -58.868 -56.507  1.00 68.94  ?  15  DC  J N1    1 
ATOM   9176  C C2    . DC  K 3 15  ? -30.624 -57.854 -56.879  1.00 73.94  ?  15  DC  J C2    1 
ATOM   9177  O O2    . DC  K 3 15  ? -31.760 -57.837 -56.386  1.00 67.28  ?  15  DC  J O2    1 
ATOM   9178  N N3    . DC  K 3 15  ? -30.206 -56.906 -57.757  1.00 70.91  ?  15  DC  J N3    1 
ATOM   9179  C C4    . DC  K 3 15  ? -28.969 -56.963 -58.259  1.00 78.64  ?  15  DC  J C4    1 
ATOM   9180  N N4    . DC  K 3 15  ? -28.600 -56.013 -59.124  1.00 79.94  ?  15  DC  J N4    1 
ATOM   9181  C C5    . DC  K 3 15  ? -28.058 -57.998 -57.896  1.00 69.90  ?  15  DC  J C5    1 
ATOM   9182  C C6    . DC  K 3 15  ? -28.484 -58.922 -57.034  1.00 67.66  ?  15  DC  J C6    1 
ATOM   9183  P P     . DG  K 3 16  ? -33.321 -62.232 -54.471  1.00 91.38  ?  16  DG  J P     1 
ATOM   9184  O OP1   . DG  K 3 16  ? -33.871 -60.898 -54.811  1.00 87.90  -1 16  DG  J OP1   1 
ATOM   9185  O OP2   . DG  K 3 16  ? -33.939 -63.030 -53.385  1.00 74.70  ?  16  DG  J OP2   1 
ATOM   9186  O "O5'" . DG  K 3 16  ? -33.263 -63.148 -55.785  1.00 68.97  ?  16  DG  J "O5'" 1 
ATOM   9187  C "C5'" . DG  K 3 16  ? -34.461 -63.398 -56.548  1.00 70.03  ?  16  DG  J "C5'" 1 
ATOM   9188  C "C4'" . DG  K 3 16  ? -35.055 -62.089 -57.070  1.00 72.67  ?  16  DG  J "C4'" 1 
ATOM   9189  O "O4'" . DG  K 3 16  ? -33.991 -61.224 -57.524  1.00 67.25  ?  16  DG  J "O4'" 1 
ATOM   9190  C "C3'" . DG  K 3 16  ? -36.019 -62.246 -58.257  1.00 62.01  ?  16  DG  J "C3'" 1 
ATOM   9191  O "O3'" . DG  K 3 16  ? -37.256 -61.554 -58.003  1.00 58.79  ?  16  DG  J "O3'" 1 
ATOM   9192  C "C2'" . DG  K 3 16  ? -35.236 -61.632 -59.428  1.00 61.13  ?  16  DG  J "C2'" 1 
ATOM   9193  C "C1'" . DG  K 3 16  ? -34.387 -60.591 -58.713  1.00 56.21  ?  16  DG  J "C1'" 1 
ATOM   9194  N N9    . DG  K 3 16  ? -33.157 -60.249 -59.423  1.00 67.36  ?  16  DG  J N9    1 
ATOM   9195  C C8    . DG  K 3 16  ? -32.170 -61.123 -59.802  1.00 67.37  ?  16  DG  J C8    1 
ATOM   9196  N N7    . DG  K 3 16  ? -31.161 -60.548 -60.391  1.00 61.71  ?  16  DG  J N7    1 
ATOM   9197  C C5    . DG  K 3 16  ? -31.486 -59.201 -60.391  1.00 53.22  ?  16  DG  J C5    1 
ATOM   9198  C C6    . DG  K 3 16  ? -30.764 -58.093 -60.894  1.00 55.73  ?  16  DG  J C6    1 
ATOM   9199  O O6    . DG  K 3 16  ? -29.661 -58.089 -61.462  1.00 50.25  ?  16  DG  J O6    1 
ATOM   9200  N N1    . DG  K 3 16  ? -31.450 -56.899 -60.692  1.00 51.75  ?  16  DG  J N1    1 
ATOM   9201  C C2    . DG  K 3 16  ? -32.675 -56.790 -60.078  1.00 57.78  ?  16  DG  J C2    1 
ATOM   9202  N N2    . DG  K 3 16  ? -33.177 -55.552 -59.974  1.00 68.70  ?  16  DG  J N2    1 
ATOM   9203  N N3    . DG  K 3 16  ? -33.363 -57.821 -59.598  1.00 57.46  ?  16  DG  J N3    1 
ATOM   9204  C C4    . DG  K 3 16  ? -32.709 -58.993 -59.789  1.00 58.16  ?  16  DG  J C4    1 
ATOM   9205  P P     . DA  K 3 17  ? -38.560 -61.857 -58.899  1.00 70.52  ?  17  DA  J P     1 
ATOM   9206  O OP1   . DA  K 3 17  ? -39.757 -61.532 -58.093  1.00 85.51  ?  17  DA  J OP1   1 
ATOM   9207  O OP2   . DA  K 3 17  ? -38.413 -63.215 -59.458  1.00 65.05  -1 17  DA  J OP2   1 
ATOM   9208  O "O5'" . DA  K 3 17  ? -38.470 -60.810 -60.102  1.00 73.55  ?  17  DA  J "O5'" 1 
ATOM   9209  C "C5'" . DA  K 3 17  ? -38.481 -59.416 -59.865  1.00 76.08  ?  17  DA  J "C5'" 1 
ATOM   9210  C "C4'" . DA  K 3 17  ? -38.072 -58.692 -61.133  1.00 76.92  ?  17  DA  J "C4'" 1 
ATOM   9211  O "O4'" . DA  K 3 17  ? -36.655 -58.865 -61.333  1.00 69.58  ?  17  DA  J "O4'" 1 
ATOM   9212  C "C3'" . DA  K 3 17  ? -38.726 -59.174 -62.444  1.00 78.30  ?  17  DA  J "C3'" 1 
ATOM   9213  O "O3'" . DA  K 3 17  ? -39.423 -58.101 -63.050  1.00 82.91  ?  17  DA  J "O3'" 1 
ATOM   9214  C "C2'" . DA  K 3 17  ? -37.540 -59.616 -63.312  1.00 73.32  ?  17  DA  J "C2'" 1 
ATOM   9215  C "C1'" . DA  K 3 17  ? -36.418 -58.801 -62.705  1.00 64.58  ?  17  DA  J "C1'" 1 
ATOM   9216  N N9    . DA  K 3 17  ? -35.090 -59.332 -62.975  1.00 59.97  ?  17  DA  J N9    1 
ATOM   9217  C C8    . DA  K 3 17  ? -34.700 -60.643 -62.980  1.00 57.33  ?  17  DA  J C8    1 
ATOM   9218  N N7    . DA  K 3 17  ? -33.428 -60.815 -63.263  1.00 56.69  ?  17  DA  J N7    1 
ATOM   9219  C C5    . DA  K 3 17  ? -32.958 -59.526 -63.459  1.00 59.01  ?  17  DA  J C5    1 
ATOM   9220  C C6    . DA  K 3 17  ? -31.688 -59.012 -63.793  1.00 58.45  ?  17  DA  J C6    1 
ATOM   9221  N N6    . DA  K 3 17  ? -30.602 -59.771 -63.993  1.00 51.24  ?  17  DA  J N6    1 
ATOM   9222  N N1    . DA  K 3 17  ? -31.572 -57.676 -63.905  1.00 61.01  ?  17  DA  J N1    1 
ATOM   9223  C C2    . DA  K 3 17  ? -32.648 -56.909 -63.711  1.00 68.32  ?  17  DA  J C2    1 
ATOM   9224  N N3    . DA  K 3 17  ? -33.885 -57.273 -63.397  1.00 65.50  ?  17  DA  J N3    1 
ATOM   9225  C C4    . DA  K 3 17  ? -33.974 -58.605 -63.286  1.00 62.39  ?  17  DA  J C4    1 
ATOM   9226  P P     . DC  K 3 18  ? -40.728 -58.345 -63.953  1.00 91.69  ?  18  DC  J P     1 
ATOM   9227  O OP1   . DC  K 3 18  ? -41.889 -57.774 -63.234  1.00 81.63  ?  18  DC  J OP1   1 
ATOM   9228  O OP2   . DC  K 3 18  ? -40.741 -59.766 -64.366  1.00 82.08  -1 18  DC  J OP2   1 
ATOM   9229  O "O5'" . DC  K 3 18  ? -40.415 -57.454 -65.250  1.00 93.99  ?  18  DC  J "O5'" 1 
ATOM   9230  C "C5'" . DC  K 3 18  ? -40.021 -56.095 -65.084  1.00 91.23  ?  18  DC  J "C5'" 1 
ATOM   9231  C "C4'" . DC  K 3 18  ? -38.859 -55.740 -66.006  1.00 95.10  ?  18  DC  J "C4'" 1 
ATOM   9232  O "O4'" . DC  K 3 18  ? -37.696 -56.511 -65.661  1.00 83.72  ?  18  DC  J "O4'" 1 
ATOM   9233  C "C3'" . DC  K 3 18  ? -39.063 -56.006 -67.500  1.00 87.18  ?  18  DC  J "C3'" 1 
ATOM   9234  O "O3'" . DC  K 3 18  ? -39.418 -54.799 -68.153  1.00 99.40  ?  18  DC  J "O3'" 1 
ATOM   9235  C "C2'" . DC  K 3 18  ? -37.684 -56.501 -67.983  1.00 74.36  ?  18  DC  J "C2'" 1 
ATOM   9236  C "C1'" . DC  K 3 18  ? -36.810 -56.387 -66.737  1.00 73.11  ?  18  DC  J "C1'" 1 
ATOM   9237  N N1    . DC  K 3 18  ? -35.770 -57.443 -66.657  1.00 75.65  ?  18  DC  J N1    1 
ATOM   9238  C C2    . DC  K 3 18  ? -34.434 -57.104 -66.886  1.00 72.57  ?  18  DC  J C2    1 
ATOM   9239  O O2    . DC  K 3 18  ? -34.146 -55.923 -67.108  1.00 74.23  ?  18  DC  J O2    1 
ATOM   9240  N N3    . DC  K 3 18  ? -33.490 -58.075 -66.831  1.00 64.49  ?  18  DC  J N3    1 
ATOM   9241  C C4    . DC  K 3 18  ? -33.848 -59.337 -66.583  1.00 70.96  ?  18  DC  J C4    1 
ATOM   9242  N N4    . DC  K 3 18  ? -32.885 -60.263 -66.540  1.00 67.11  ?  18  DC  J N4    1 
ATOM   9243  C C5    . DC  K 3 18  ? -35.209 -59.704 -66.366  1.00 78.09  ?  18  DC  J C5    1 
ATOM   9244  C C6    . DC  K 3 18  ? -36.129 -58.736 -66.420  1.00 81.18  ?  18  DC  J C6    1 
ATOM   9245  P P     . DG  K 3 19  ? -39.736 -54.784 -69.729  1.00 105.75 ?  19  DG  J P     1 
ATOM   9246  O OP1   . DG  K 3 19  ? -40.528 -53.566 -70.009  1.00 102.50 ?  19  DG  J OP1   1 
ATOM   9247  O OP2   . DG  K 3 19  ? -40.279 -56.114 -70.085  1.00 82.71  -1 19  DG  J OP2   1 
ATOM   9248  O "O5'" . DG  K 3 19  ? -38.296 -54.638 -70.423  1.00 74.34  ?  19  DG  J "O5'" 1 
ATOM   9249  C "C5'" . DG  K 3 19  ? -37.678 -53.366 -70.560  1.00 66.60  ?  19  DG  J "C5'" 1 
ATOM   9250  C "C4'" . DG  K 3 19  ? -36.406 -53.478 -71.387  1.00 72.35  ?  19  DG  J "C4'" 1 
ATOM   9251  O "O4'" . DG  K 3 19  ? -35.506 -54.435 -70.776  1.00 68.31  ?  19  DG  J "O4'" 1 
ATOM   9252  C "C3'" . DG  K 3 19  ? -36.619 -53.948 -72.830  1.00 103.09 ?  19  DG  J "C3'" 1 
ATOM   9253  O "O3'" . DG  K 3 19  ? -36.275 -52.909 -73.750  1.00 109.15 ?  19  DG  J "O3'" 1 
ATOM   9254  C "C2'" . DG  K 3 19  ? -35.688 -55.153 -72.998  1.00 93.93  ?  19  DG  J "C2'" 1 
ATOM   9255  C "C1'" . DG  K 3 19  ? -34.769 -55.068 -71.791  1.00 79.08  ?  19  DG  J "C1'" 1 
ATOM   9256  N N9    . DG  K 3 19  ? -34.296 -56.372 -71.334  1.00 77.03  ?  19  DG  J N9    1 
ATOM   9257  C C8    . DG  K 3 19  ? -35.006 -57.321 -70.640  1.00 79.69  ?  19  DG  J C8    1 
ATOM   9258  N N7    . DG  K 3 19  ? -34.320 -58.405 -70.395  1.00 77.84  ?  19  DG  J N7    1 
ATOM   9259  C C5    . DG  K 3 19  ? -33.085 -58.168 -70.986  1.00 75.34  ?  19  DG  J C5    1 
ATOM   9260  C C6    . DG  K 3 19  ? -31.931 -58.989 -71.053  1.00 74.73  ?  19  DG  J C6    1 
ATOM   9261  O O6    . DG  K 3 19  ? -31.769 -60.124 -70.585  1.00 76.50  ?  19  DG  J O6    1 
ATOM   9262  N N1    . DG  K 3 19  ? -30.893 -58.367 -71.747  1.00 75.24  ?  19  DG  J N1    1 
ATOM   9263  C C2    . DG  K 3 19  ? -30.966 -57.110 -72.305  1.00 86.12  ?  19  DG  J C2    1 
ATOM   9264  N N2    . DG  K 3 19  ? -29.867 -56.672 -72.935  1.00 92.74  ?  19  DG  J N2    1 
ATOM   9265  N N3    . DG  K 3 19  ? -32.042 -56.334 -72.248  1.00 86.47  ?  19  DG  J N3    1 
ATOM   9266  C C4    . DG  K 3 19  ? -33.058 -56.926 -71.576  1.00 76.88  ?  19  DG  J C4    1 
ATOM   9267  P P     . DT  K 3 20  ? -36.242 -53.222 -75.328  1.00 99.25  ?  20  DT  J P     1 
ATOM   9268  O OP1   . DT  K 3 20  ? -36.418 -51.937 -76.041  1.00 110.61 ?  20  DT  J OP1   1 
ATOM   9269  O OP2   . DT  K 3 20  ? -37.177 -54.340 -75.580  1.00 94.25  -1 20  DT  J OP2   1 
ATOM   9270  O "O5'" . DT  K 3 20  ? -34.757 -53.761 -75.597  1.00 80.13  ?  20  DT  J "O5'" 1 
ATOM   9271  C "C5'" . DT  K 3 20  ? -33.624 -52.981 -75.225  1.00 85.09  ?  20  DT  J "C5'" 1 
ATOM   9272  C "C4'" . DT  K 3 20  ? -32.368 -53.510 -75.902  1.00 94.08  ?  20  DT  J "C4'" 1 
ATOM   9273  O "O4'" . DT  K 3 20  ? -31.971 -54.763 -75.291  1.00 83.25  ?  20  DT  J "O4'" 1 
ATOM   9274  C "C3'" . DT  K 3 20  ? -32.502 -53.775 -77.402  1.00 103.31 ?  20  DT  J "C3'" 1 
ATOM   9275  O "O3'" . DT  K 3 20  ? -31.347 -53.296 -78.083  1.00 107.95 ?  20  DT  J "O3'" 1 
ATOM   9276  C "C2'" . DT  K 3 20  ? -32.607 -55.301 -77.484  1.00 89.42  ?  20  DT  J "C2'" 1 
ATOM   9277  C "C1'" . DT  K 3 20  ? -31.774 -55.741 -76.286  1.00 76.33  ?  20  DT  J "C1'" 1 
ATOM   9278  N N1    . DT  K 3 20  ? -32.175 -57.065 -75.726  1.00 83.49  ?  20  DT  J N1    1 
ATOM   9279  C C2    . DT  K 3 20  ? -31.272 -58.106 -75.738  1.00 76.60  ?  20  DT  J C2    1 
ATOM   9280  O O2    . DT  K 3 20  ? -30.147 -58.009 -76.196  1.00 70.49  ?  20  DT  J O2    1 
ATOM   9281  N N3    . DT  K 3 20  ? -31.739 -59.275 -75.196  1.00 64.40  ?  20  DT  J N3    1 
ATOM   9282  C C4    . DT  K 3 20  ? -32.991 -59.499 -74.651  1.00 69.06  ?  20  DT  J C4    1 
ATOM   9283  O O4    . DT  K 3 20  ? -33.321 -60.584 -74.186  1.00 72.32  ?  20  DT  J O4    1 
ATOM   9284  C C5    . DT  K 3 20  ? -33.884 -58.367 -74.665  1.00 74.22  ?  20  DT  J C5    1 
ATOM   9285  C C7    . DT  K 3 20  ? -35.266 -58.496 -74.099  1.00 76.30  ?  20  DT  J C7    1 
ATOM   9286  C C6    . DT  K 3 20  ? -33.439 -57.218 -75.194  1.00 82.75  ?  20  DT  J C6    1 
ATOM   9287  P P     . DT  K 3 21  ? -31.152 -53.558 -79.658  1.00 102.13 ?  21  DT  J P     1 
ATOM   9288  O OP1   . DT  K 3 21  ? -30.478 -52.372 -80.233  1.00 99.96  ?  21  DT  J OP1   1 
ATOM   9289  O OP2   . DT  K 3 21  ? -32.454 -54.005 -80.201  1.00 66.42  -1 21  DT  J OP2   1 
ATOM   9290  O "O5'" . DT  K 3 21  ? -30.146 -54.800 -79.707  1.00 70.91  ?  21  DT  J "O5'" 1 
ATOM   9291  C "C5'" . DT  K 3 21  ? -28.916 -54.738 -79.007  1.00 76.43  ?  21  DT  J "C5'" 1 
ATOM   9292  C "C4'" . DT  K 3 21  ? -28.074 -55.976 -79.262  1.00 78.51  ?  21  DT  J "C4'" 1 
ATOM   9293  O "O4'" . DT  K 3 21  ? -28.735 -57.133 -78.681  1.00 85.09  ?  21  DT  J "O4'" 1 
ATOM   9294  C "C3'" . DT  K 3 21  ? -27.826 -56.338 -80.726  1.00 83.57  ?  21  DT  J "C3'" 1 
ATOM   9295  O "O3'" . DT  K 3 21  ? -26.502 -56.845 -80.840  1.00 98.81  ?  21  DT  J "O3'" 1 
ATOM   9296  C "C2'" . DT  K 3 21  ? -28.873 -57.410 -80.997  1.00 68.29  ?  21  DT  J "C2'" 1 
ATOM   9297  C "C1'" . DT  K 3 21  ? -28.886 -58.134 -79.665  1.00 72.00  ?  21  DT  J "C1'" 1 
ATOM   9298  N N1    . DT  K 3 21  ? -30.147 -58.878 -79.397  1.00 72.16  ?  21  DT  J N1    1 
ATOM   9299  C C2    . DT  K 3 21  ? -30.070 -60.188 -78.999  1.00 72.21  ?  21  DT  J C2    1 
ATOM   9300  O O2    . DT  K 3 21  ? -29.014 -60.783 -78.861  1.00 70.97  ?  21  DT  J O2    1 
ATOM   9301  N N3    . DT  K 3 21  ? -31.277 -60.788 -78.773  1.00 64.24  ?  21  DT  J N3    1 
ATOM   9302  C C4    . DT  K 3 21  ? -32.532 -60.227 -78.893  1.00 62.90  ?  21  DT  J C4    1 
ATOM   9303  O O4    . DT  K 3 21  ? -33.559 -60.863 -78.659  1.00 56.84  ?  21  DT  J O4    1 
ATOM   9304  C C5    . DT  K 3 21  ? -32.548 -58.843 -79.311  1.00 64.91  ?  21  DT  J C5    1 
ATOM   9305  C C7    . DT  K 3 21  ? -33.852 -58.122 -79.479  1.00 65.20  ?  21  DT  J C7    1 
ATOM   9306  C C6    . DT  K 3 21  ? -31.366 -58.240 -79.539  1.00 70.24  ?  21  DT  J C6    1 
ATOM   9307  P P     . DT  K 3 22  ? -25.813 -57.113 -82.266  1.00 112.38 ?  22  DT  J P     1 
ATOM   9308  O OP1   . DT  K 3 22  ? -24.477 -56.475 -82.248  1.00 115.84 ?  22  DT  J OP1   1 
ATOM   9309  O OP2   . DT  K 3 22  ? -26.797 -56.751 -83.310  1.00 75.61  -1 22  DT  J OP2   1 
ATOM   9310  O "O5'" . DT  K 3 22  ? -25.628 -58.703 -82.297  1.00 82.99  ?  22  DT  J "O5'" 1 
ATOM   9311  C "C5'" . DT  K 3 22  ? -24.863 -59.336 -81.276  1.00 83.08  ?  22  DT  J "C5'" 1 
ATOM   9312  C "C4'" . DT  K 3 22  ? -25.070 -60.839 -81.290  1.00 92.04  ?  22  DT  J "C4'" 1 
ATOM   9313  O "O4'" . DT  K 3 22  ? -26.453 -61.119 -80.962  1.00 93.57  ?  22  DT  J "O4'" 1 
ATOM   9314  C "C3'" . DT  K 3 22  ? -24.814 -61.528 -82.636  1.00 82.71  ?  22  DT  J "C3'" 1 
ATOM   9315  O "O3'" . DT  K 3 22  ? -23.862 -62.579 -82.452  1.00 98.80  ?  22  DT  J "O3'" 1 
ATOM   9316  C "C2'" . DT  K 3 22  ? -26.193 -62.057 -83.050  1.00 96.34  ?  22  DT  J "C2'" 1 
ATOM   9317  C "C1'" . DT  K 3 22  ? -26.866 -62.232 -81.702  1.00 90.86  ?  22  DT  J "C1'" 1 
ATOM   9318  N N1    . DT  K 3 22  ? -28.354 -62.188 -81.781  1.00 75.02  ?  22  DT  J N1    1 
ATOM   9319  C C2    . DT  K 3 22  ? -29.092 -63.235 -81.282  1.00 72.65  ?  22  DT  J C2    1 
ATOM   9320  O O2    . DT  K 3 22  ? -28.591 -64.228 -80.785  1.00 74.49  ?  22  DT  J O2    1 
ATOM   9321  N N3    . DT  K 3 22  ? -30.450 -63.086 -81.401  1.00 66.39  ?  22  DT  J N3    1 
ATOM   9322  C C4    . DT  K 3 22  ? -31.129 -62.009 -81.948  1.00 62.32  ?  22  DT  J C4    1 
ATOM   9323  O O4    . DT  K 3 22  ? -32.354 -61.964 -82.008  1.00 64.18  ?  22  DT  J O4    1 
ATOM   9324  C C5    . DT  K 3 22  ? -30.296 -60.943 -82.443  1.00 57.05  ?  22  DT  J C5    1 
ATOM   9325  C C7    . DT  K 3 22  ? -30.920 -59.727 -83.057  1.00 69.46  ?  22  DT  J C7    1 
ATOM   9326  C C6    . DT  K 3 22  ? -28.965 -61.080 -82.335  1.00 67.25  ?  22  DT  J C6    1 
ATOM   9327  P P     . DA  K 3 23  ? -23.012 -63.134 -83.698  1.00 130.52 ?  23  DA  J P     1 
ATOM   9328  O OP1   . DA  K 3 23  ? -21.581 -62.918 -83.388  1.00 128.51 ?  23  DA  J OP1   1 
ATOM   9329  O OP2   . DA  K 3 23  ? -23.597 -62.559 -84.929  1.00 118.02 -1 23  DA  J OP2   1 
ATOM   9330  O "O5'" . DA  K 3 23  ? -23.293 -64.709 -83.712  1.00 103.58 ?  23  DA  J "O5'" 1 
ATOM   9331  C "C5'" . DA  K 3 23  ? -23.202 -65.463 -82.505  1.00 95.07  ?  23  DA  J "C5'" 1 
ATOM   9332  C "C4'" . DA  K 3 23  ? -23.937 -66.784 -82.643  1.00 91.77  ?  23  DA  J "C4'" 1 
ATOM   9333  O "O4'" . DA  K 3 23  ? -25.355 -66.568 -82.460  1.00 94.27  ?  23  DA  J "O4'" 1 
ATOM   9334  C "C3'" . DA  K 3 23  ? -23.769 -67.470 -84.000  1.00 96.66  ?  23  DA  J "C3'" 1 
ATOM   9335  O "O3'" . DA  K 3 23  ? -23.425 -68.842 -83.815  1.00 95.69  ?  23  DA  J "O3'" 1 
ATOM   9336  C "C2'" . DA  K 3 23  ? -25.142 -67.306 -84.666  1.00 88.22  ?  23  DA  J "C2'" 1 
ATOM   9337  C "C1'" . DA  K 3 23  ? -26.073 -67.238 -83.465  1.00 84.23  ?  23  DA  J "C1'" 1 
ATOM   9338  N N9    . DA  K 3 23  ? -27.291 -66.472 -83.711  1.00 79.00  ?  23  DA  J N9    1 
ATOM   9339  C C8    . DA  K 3 23  ? -27.373 -65.199 -84.202  1.00 81.07  ?  23  DA  J C8    1 
ATOM   9340  N N7    . DA  K 3 23  ? -28.600 -64.750 -84.309  1.00 77.61  ?  23  DA  J N7    1 
ATOM   9341  C C5    . DA  K 3 23  ? -29.379 -65.800 -83.856  1.00 75.12  ?  23  DA  J C5    1 
ATOM   9342  C C6    . DA  K 3 23  ? -30.773 -65.955 -83.716  1.00 69.32  ?  23  DA  J C6    1 
ATOM   9343  N N6    . DA  K 3 23  ? -31.654 -65.004 -84.043  1.00 57.09  ?  23  DA  J N6    1 
ATOM   9344  N N1    . DA  K 3 23  ? -31.227 -67.132 -83.234  1.00 71.29  ?  23  DA  J N1    1 
ATOM   9345  C C2    . DA  K 3 23  ? -30.339 -68.082 -82.912  1.00 74.51  ?  23  DA  J C2    1 
ATOM   9346  N N3    . DA  K 3 23  ? -29.008 -68.050 -82.996  1.00 71.81  ?  23  DA  J N3    1 
ATOM   9347  C C4    . DA  K 3 23  ? -28.589 -66.871 -83.480  1.00 73.43  ?  23  DA  J C4    1 
ATOM   9348  P P     . DG  K 3 24  ? -23.026 -69.758 -85.076  1.00 113.75 ?  24  DG  J P     1 
ATOM   9349  O OP1   . DG  K 3 24  ? -22.145 -70.840 -84.581  1.00 82.54  ?  24  DG  J OP1   1 
ATOM   9350  O OP2   . DG  K 3 24  ? -22.556 -68.861 -86.155  1.00 97.88  -1 24  DG  J OP2   1 
ATOM   9351  O "O5'" . DG  K 3 24  ? -24.416 -70.398 -85.532  1.00 98.31  ?  24  DG  J "O5'" 1 
ATOM   9352  C "C5'" . DG  K 3 24  ? -25.268 -70.979 -84.564  1.00 100.02 ?  24  DG  J "C5'" 1 
ATOM   9353  C "C4'" . DG  K 3 24  ? -26.647 -71.229 -85.142  1.00 100.65 ?  24  DG  J "C4'" 1 
ATOM   9354  O "O4'" . DG  K 3 24  ? -27.416 -69.997 -85.162  1.00 104.33 ?  24  DG  J "O4'" 1 
ATOM   9355  C "C3'" . DG  K 3 24  ? -26.695 -71.764 -86.587  1.00 102.43 ?  24  DG  J "C3'" 1 
ATOM   9356  O "O3'" . DG  K 3 24  ? -27.579 -72.862 -86.641  1.00 97.90  ?  24  DG  J "O3'" 1 
ATOM   9357  C "C2'" . DG  K 3 24  ? -27.275 -70.584 -87.363  1.00 93.39  ?  24  DG  J "C2'" 1 
ATOM   9358  C "C1'" . DG  K 3 24  ? -28.216 -70.057 -86.307  1.00 97.49  ?  24  DG  J "C1'" 1 
ATOM   9359  N N9    . DG  K 3 24  ? -28.801 -68.755 -86.597  1.00 90.74  ?  24  DG  J N9    1 
ATOM   9360  C C8    . DG  K 3 24  ? -28.179 -67.636 -87.101  1.00 82.22  ?  24  DG  J C8    1 
ATOM   9361  N N7    . DG  K 3 24  ? -28.992 -66.622 -87.258  1.00 71.61  ?  24  DG  J N7    1 
ATOM   9362  C C5    . DG  K 3 24  ? -30.222 -67.106 -86.824  1.00 71.23  ?  24  DG  J C5    1 
ATOM   9363  C C6    . DG  K 3 24  ? -31.488 -66.473 -86.755  1.00 69.01  ?  24  DG  J C6    1 
ATOM   9364  O O6    . DG  K 3 24  ? -31.787 -65.309 -87.066  1.00 72.85  ?  24  DG  J O6    1 
ATOM   9365  N N1    . DG  K 3 24  ? -32.465 -67.333 -86.250  1.00 64.91  ?  24  DG  J N1    1 
ATOM   9366  C C2    . DG  K 3 24  ? -32.242 -68.638 -85.871  1.00 68.70  ?  24  DG  J C2    1 
ATOM   9367  N N2    . DG  K 3 24  ? -33.296 -69.319 -85.410  1.00 60.77  ?  24  DG  J N2    1 
ATOM   9368  N N3    . DG  K 3 24  ? -31.069 -69.235 -85.936  1.00 67.73  ?  24  DG  J N3    1 
ATOM   9369  C C4    . DG  K 3 24  ? -30.112 -68.415 -86.418  1.00 77.65  ?  24  DG  J C4    1 
ATOM   9370  P P     . DA  K 3 25  ? -27.200 -74.221 -87.404  1.00 115.62 ?  25  DA  J P     1 
ATOM   9371  O OP1   . DA  K 3 25  ? -26.056 -74.840 -86.698  1.00 117.21 ?  25  DA  J OP1   1 
ATOM   9372  O OP2   . DA  K 3 25  ? -27.097 -73.928 -88.851  1.00 103.25 -1 25  DA  J OP2   1 
ATOM   9373  O "O5'" . DA  K 3 25  ? -28.506 -75.113 -87.168  1.00 71.49  ?  25  DA  J "O5'" 1 
ATOM   9374  C "C5'" . DA  K 3 25  ? -29.166 -75.062 -85.909  1.00 87.04  ?  25  DA  J "C5'" 1 
ATOM   9375  C "C4'" . DA  K 3 25  ? -30.678 -75.131 -86.058  1.00 90.58  ?  25  DA  J "C4'" 1 
ATOM   9376  O "O4'" . DA  K 3 25  ? -31.233 -73.798 -86.217  1.00 90.11  ?  25  DA  J "O4'" 1 
ATOM   9377  C "C3'" . DA  K 3 25  ? -31.175 -75.958 -87.238  1.00 85.25  ?  25  DA  J "C3'" 1 
ATOM   9378  O "O3'" . DA  K 3 25  ? -32.297 -76.741 -86.847  1.00 84.34  ?  25  DA  J "O3'" 1 
ATOM   9379  C "C2'" . DA  K 3 25  ? -31.558 -74.897 -88.277  1.00 84.09  ?  25  DA  J "C2'" 1 
ATOM   9380  C "C1'" . DA  K 3 25  ? -31.994 -73.722 -87.403  1.00 80.25  ?  25  DA  J "C1'" 1 
ATOM   9381  N N9    . DA  K 3 25  ? -31.792 -72.404 -88.015  1.00 70.22  ?  25  DA  J N9    1 
ATOM   9382  C C8    . DA  K 3 25  ? -30.612 -71.860 -88.445  1.00 76.81  ?  25  DA  J C8    1 
ATOM   9383  N N7    . DA  K 3 25  ? -30.736 -70.648 -88.941  1.00 67.60  ?  25  DA  J N7    1 
ATOM   9384  C C5    . DA  K 3 25  ? -32.087 -70.370 -88.810  1.00 62.15  ?  25  DA  J C5    1 
ATOM   9385  C C6    . DA  K 3 25  ? -32.865 -69.238 -89.146  1.00 61.98  ?  25  DA  J C6    1 
ATOM   9386  N N6    . DA  K 3 25  ? -32.360 -68.133 -89.707  1.00 64.94  ?  25  DA  J N6    1 
ATOM   9387  N N1    . DA  K 3 25  ? -34.187 -69.288 -88.881  1.00 63.35  ?  25  DA  J N1    1 
ATOM   9388  C C2    . DA  K 3 25  ? -34.691 -70.395 -88.320  1.00 66.72  ?  25  DA  J C2    1 
ATOM   9389  N N3    . DA  K 3 25  ? -34.063 -71.516 -87.961  1.00 56.14  ?  25  DA  J N3    1 
ATOM   9390  C C4    . DA  K 3 25  ? -32.751 -71.438 -88.235  1.00 63.34  ?  25  DA  J C4    1 
ATOM   9391  P P     . DC  K 3 26  ? -32.736 -78.009 -87.732  1.00 99.07  ?  26  DC  J P     1 
ATOM   9392  O OP1   . DC  K 3 26  ? -33.232 -79.046 -86.800  1.00 91.59  ?  26  DC  J OP1   1 
ATOM   9393  O OP2   . DC  K 3 26  ? -31.625 -78.323 -88.658  1.00 109.61 -1 26  DC  J OP2   1 
ATOM   9394  O "O5'" . DC  K 3 26  ? -33.967 -77.472 -88.599  1.00 101.85 ?  26  DC  J "O5'" 1 
ATOM   9395  C "C5'" . DC  K 3 26  ? -35.028 -76.762 -87.972  1.00 86.89  ?  26  DC  J "C5'" 1 
ATOM   9396  C "C4'" . DC  K 3 26  ? -35.842 -75.989 -88.996  1.00 82.68  ?  26  DC  J "C4'" 1 
ATOM   9397  O "O4'" . DC  K 3 26  ? -35.219 -74.722 -89.266  1.00 83.27  ?  26  DC  J "O4'" 1 
ATOM   9398  C "C3'" . DC  K 3 26  ? -35.999 -76.671 -90.359  1.00 92.57  ?  26  DC  J "C3'" 1 
ATOM   9399  O "O3'" . DC  K 3 26  ? -37.309 -77.214 -90.486  1.00 99.01  ?  26  DC  J "O3'" 1 
ATOM   9400  C "C2'" . DC  K 3 26  ? -35.745 -75.551 -91.389  1.00 73.36  ?  26  DC  J "C2'" 1 
ATOM   9401  C "C1'" . DC  K 3 26  ? -35.649 -74.294 -90.527  1.00 72.47  ?  26  DC  J "C1'" 1 
ATOM   9402  N N1    . DC  K 3 26  ? -34.696 -73.266 -91.044  1.00 61.07  ?  26  DC  J N1    1 
ATOM   9403  C C2    . DC  K 3 26  ? -35.160 -71.972 -91.287  1.00 54.69  ?  26  DC  J C2    1 
ATOM   9404  O O2    . DC  K 3 26  ? -36.345 -71.712 -91.063  1.00 56.77  ?  26  DC  J O2    1 
ATOM   9405  N N3    . DC  K 3 26  ? -34.296 -71.037 -91.753  1.00 48.97  ?  26  DC  J N3    1 
ATOM   9406  C C4    . DC  K 3 26  ? -33.022 -71.361 -91.976  1.00 57.78  ?  26  DC  J C4    1 
ATOM   9407  N N4    . DC  K 3 26  ? -32.207 -70.405 -92.438  1.00 50.81  ?  26  DC  J N4    1 
ATOM   9408  C C5    . DC  K 3 26  ? -32.528 -72.680 -91.738  1.00 61.64  ?  26  DC  J C5    1 
ATOM   9409  C C6    . DC  K 3 26  ? -33.392 -73.592 -91.276  1.00 62.01  ?  26  DC  J C6    1 
ATOM   9410  O "O5'" . DT  L 4 1   ? -34.987 -61.731 -46.058  1.00 56.35  ?  16  DT  K "O5'" 1 
ATOM   9411  C "C5'" . DT  L 4 1   ? -35.965 -61.359 -47.032  1.00 65.16  ?  16  DT  K "C5'" 1 
ATOM   9412  C "C4'" . DT  L 4 1   ? -35.328 -60.501 -48.099  1.00 81.72  ?  16  DT  K "C4'" 1 
ATOM   9413  O "O4'" . DT  L 4 1   ? -35.542 -59.098 -47.843  1.00 89.75  ?  16  DT  K "O4'" 1 
ATOM   9414  C "C3'" . DT  L 4 1   ? -33.817 -60.659 -48.232  1.00 73.58  ?  16  DT  K "C3'" 1 
ATOM   9415  O "O3'" . DT  L 4 1   ? -33.546 -61.288 -49.480  1.00 71.28  ?  16  DT  K "O3'" 1 
ATOM   9416  C "C2'" . DT  L 4 1   ? -33.281 -59.236 -48.206  1.00 66.13  ?  16  DT  K "C2'" 1 
ATOM   9417  C "C1'" . DT  L 4 1   ? -34.506 -58.411 -48.501  1.00 69.26  ?  16  DT  K "C1'" 1 
ATOM   9418  N N1    . DT  L 4 1   ? -34.491 -57.012 -48.030  1.00 64.68  ?  16  DT  K N1    1 
ATOM   9419  C C2    . DT  L 4 1   ? -33.347 -56.289 -48.252  1.00 59.95  ?  16  DT  K C2    1 
ATOM   9420  O O2    . DT  L 4 1   ? -32.357 -56.760 -48.772  1.00 69.53  ?  16  DT  K O2    1 
ATOM   9421  N N3    . DT  L 4 1   ? -33.398 -54.991 -47.828  1.00 62.79  ?  16  DT  K N3    1 
ATOM   9422  C C4    . DT  L 4 1   ? -34.453 -54.354 -47.217  1.00 65.29  ?  16  DT  K C4    1 
ATOM   9423  O O4    . DT  L 4 1   ? -34.349 -53.177 -46.892  1.00 57.91  ?  16  DT  K O4    1 
ATOM   9424  C C5    . DT  L 4 1   ? -35.630 -55.163 -47.027  1.00 69.17  ?  16  DT  K C5    1 
ATOM   9425  C C7    . DT  L 4 1   ? -36.832 -54.548 -46.383  1.00 66.03  ?  16  DT  K C7    1 
ATOM   9426  C C6    . DT  L 4 1   ? -35.595 -56.437 -47.441  1.00 69.53  ?  16  DT  K C6    1 
ATOM   9427  P P     . DA  L 4 2   ? -32.257 -62.218 -49.614  1.00 91.72  ?  17  DA  K P     1 
ATOM   9428  O OP1   . DA  L 4 2   ? -31.218 -61.457 -50.353  1.00 89.07  ?  17  DA  K OP1   1 
ATOM   9429  O OP2   . DA  L 4 2   ? -32.236 -63.611 -50.128  1.00 75.88  ?  17  DA  K OP2   1 
ATOM   9430  O "O5'" . DA  L 4 2   ? -31.639 -62.158 -48.158  1.00 82.89  ?  17  DA  K "O5'" 1 
ATOM   9431  C "C5'" . DA  L 4 2   ? -30.231 -62.330 -48.004  1.00 83.04  ?  17  DA  K "C5'" 1 
ATOM   9432  C "C4'" . DA  L 4 2   ? -29.535 -61.121 -47.419  1.00 74.97  ?  17  DA  K "C4'" 1 
ATOM   9433  O "O4'" . DA  L 4 2   ? -30.398 -60.005 -47.125  1.00 64.86  ?  17  DA  K "O4'" 1 
ATOM   9434  C "C3'" . DA  L 4 2   ? -28.810 -61.431 -46.115  1.00 52.72  ?  17  DA  K "C3'" 1 
ATOM   9435  O "O3'" . DA  L 4 2   ? -27.430 -61.317 -46.339  1.00 51.71  ?  17  DA  K "O3'" 1 
ATOM   9436  C "C2'" . DA  L 4 2   ? -29.204 -60.308 -45.180  1.00 54.83  ?  17  DA  K "C2'" 1 
ATOM   9437  C "C1'" . DA  L 4 2   ? -29.753 -59.270 -46.116  1.00 58.06  ?  17  DA  K "C1'" 1 
ATOM   9438  N N9    . DA  L 4 2   ? -30.739 -58.408 -45.488  1.00 51.28  ?  17  DA  K N9    1 
ATOM   9439  C C8    . DA  L 4 2   ? -31.947 -58.765 -44.952  1.00 59.94  ?  17  DA  K C8    1 
ATOM   9440  N N7    . DA  L 4 2   ? -32.621 -57.760 -44.452  1.00 53.76  ?  17  DA  K N7    1 
ATOM   9441  C C5    . DA  L 4 2   ? -31.794 -56.669 -44.664  1.00 47.87  ?  17  DA  K C5    1 
ATOM   9442  C C6    . DA  L 4 2   ? -31.932 -55.307 -44.364  1.00 46.28  ?  17  DA  K C6    1 
ATOM   9443  N N6    . DA  L 4 2   ? -32.998 -54.796 -43.763  1.00 45.99  ?  17  DA  K N6    1 
ATOM   9444  N N1    . DA  L 4 2   ? -30.922 -54.478 -44.704  1.00 51.60  ?  17  DA  K N1    1 
ATOM   9445  C C2    . DA  L 4 2   ? -29.849 -54.997 -45.313  1.00 59.63  ?  17  DA  K C2    1 
ATOM   9446  N N3    . DA  L 4 2   ? -29.605 -56.261 -45.651  1.00 55.85  ?  17  DA  K N3    1 
ATOM   9447  C C4    . DA  L 4 2   ? -30.631 -57.055 -45.300  1.00 49.11  ?  17  DA  K C4    1 
ATOM   9448  P P     . DG  L 4 3   ? -26.524 -62.070 -45.419  1.00 71.97  ?  18  DG  K P     1 
ATOM   9449  O OP1   . DG  L 4 3   ? -25.251 -62.248 -46.098  1.00 72.60  ?  18  DG  K OP1   1 
ATOM   9450  O OP2   . DG  L 4 3   ? -27.267 -63.221 -44.943  1.00 69.62  -1 18  DG  K OP2   1 
ATOM   9451  O "O5'" . DG  L 4 3   ? -26.289 -61.048 -44.242  1.00 69.63  ?  18  DG  K "O5'" 1 
ATOM   9452  C "C5'" . DG  L 4 3   ? -25.532 -59.880 -44.510  1.00 55.13  ?  18  DG  K "C5'" 1 
ATOM   9453  C "C4'" . DG  L 4 3   ? -25.806 -58.820 -43.474  1.00 59.97  ?  18  DG  K "C4'" 1 
ATOM   9454  O "O4'" . DG  L 4 3   ? -27.201 -58.504 -43.395  1.00 53.10  ?  18  DG  K "O4'" 1 
ATOM   9455  C "C3'" . DG  L 4 3   ? -25.418 -59.169 -42.044  1.00 55.38  ?  18  DG  K "C3'" 1 
ATOM   9456  O "O3'" . DG  L 4 3   ? -24.112 -58.686 -41.772  1.00 60.89  ?  18  DG  K "O3'" 1 
ATOM   9457  C "C2'" . DG  L 4 3   ? -26.430 -58.397 -41.217  1.00 49.27  ?  18  DG  K "C2'" 1 
ATOM   9458  C "C1'" . DG  L 4 3   ? -27.278 -57.691 -42.262  1.00 41.68  ?  18  DG  K "C1'" 1 
ATOM   9459  N N9    . DG  L 4 3   ? -28.680 -57.483 -41.930  1.00 42.37  ?  18  DG  K N9    1 
ATOM   9460  C C8    . DG  L 4 3   ? -29.662 -58.427 -41.779  1.00 48.85  ?  18  DG  K C8    1 
ATOM   9461  N N7    . DG  L 4 3   ? -30.818 -57.915 -41.457  1.00 46.09  ?  18  DG  K N7    1 
ATOM   9462  C C5    . DG  L 4 3   ? -30.582 -56.552 -41.389  1.00 36.34  ?  18  DG  K C5    1 
ATOM   9463  C C6    . DG  L 4 3   ? -31.450 -55.484 -41.032  1.00 36.43  ?  18  DG  K C6    1 
ATOM   9464  O O6    . DG  L 4 3   ? -32.656 -55.528 -40.780  1.00 36.61  ?  18  DG  K O6    1 
ATOM   9465  N N1    . DG  L 4 3   ? -30.810 -54.255 -41.107  1.00 43.28  ?  18  DG  K N1    1 
ATOM   9466  C C2    . DG  L 4 3   ? -29.482 -54.085 -41.403  1.00 51.07  ?  18  DG  K C2    1 
ATOM   9467  N N2    . DG  L 4 3   ? -29.033 -52.829 -41.379  1.00 60.54  ?  18  DG  K N2    1 
ATOM   9468  N N3    . DG  L 4 3   ? -28.651 -55.074 -41.686  1.00 43.61  ?  18  DG  K N3    1 
ATOM   9469  C C4    . DG  L 4 3   ? -29.263 -56.273 -41.659  1.00 38.99  ?  18  DG  K C4    1 
ATOM   9470  P P     . DG  L 4 4   ? -23.544 -58.869 -40.387  1.00 41.49  ?  19  DG  K P     1 
ATOM   9471  O OP1   . DG  L 4 4   ? -22.066 -58.814 -40.442  1.00 63.93  ?  19  DG  K OP1   1 
ATOM   9472  O OP2   . DG  L 4 4   ? -24.213 -60.055 -39.808  1.00 46.47  -1 19  DG  K OP2   1 
ATOM   9473  O "O5'" . DG  L 4 4   ? -24.109 -57.584 -39.635  1.00 46.93  ?  19  DG  K "O5'" 1 
ATOM   9474  C "C5'" . DG  L 4 4   ? -24.018 -56.331 -40.292  1.00 45.07  ?  19  DG  K "C5'" 1 
ATOM   9475  C "C4'" . DG  L 4 4   ? -24.832 -55.279 -39.573  1.00 50.83  ?  19  DG  K "C4'" 1 
ATOM   9476  O "O4'" . DG  L 4 4   ? -26.229 -55.579 -39.703  1.00 53.83  ?  19  DG  K "O4'" 1 
ATOM   9477  C "C3'" . DG  L 4 4   ? -24.640 -55.201 -38.075  1.00 52.43  ?  19  DG  K "C3'" 1 
ATOM   9478  O "O3'" . DG  L 4 4   ? -23.566 -54.325 -37.797  1.00 61.60  ?  19  DG  K "O3'" 1 
ATOM   9479  C "C2'" . DG  L 4 4   ? -25.988 -54.663 -37.558  1.00 47.51  ?  19  DG  K "C2'" 1 
ATOM   9480  C "C1'" . DG  L 4 4   ? -26.906 -54.767 -38.780  1.00 39.92  ?  19  DG  K "C1'" 1 
ATOM   9481  N N9    . DG  L 4 4   ? -28.189 -55.385 -38.468  1.00 38.23  ?  19  DG  K N9    1 
ATOM   9482  C C8    . DG  L 4 4   ? -28.533 -56.708 -38.609  1.00 40.16  ?  19  DG  K C8    1 
ATOM   9483  N N7    . DG  L 4 4   ? -29.755 -56.970 -38.230  1.00 42.35  ?  19  DG  K N7    1 
ATOM   9484  C C5    . DG  L 4 4   ? -30.246 -55.744 -37.799  1.00 43.43  ?  19  DG  K C5    1 
ATOM   9485  C C6    . DG  L 4 4   ? -31.517 -55.401 -37.274  1.00 36.61  ?  19  DG  K C6    1 
ATOM   9486  O O6    . DG  L 4 4   ? -32.492 -56.139 -37.080  1.00 37.86  ?  19  DG  K O6    1 
ATOM   9487  N N1    . DG  L 4 4   ? -31.595 -54.045 -36.963  1.00 34.50  ?  19  DG  K N1    1 
ATOM   9488  C C2    . DG  L 4 4   ? -30.572 -53.141 -37.139  1.00 52.48  ?  19  DG  K C2    1 
ATOM   9489  N N2    . DG  L 4 4   ? -30.826 -51.878 -36.785  1.00 52.11  ?  19  DG  K N2    1 
ATOM   9490  N N3    . DG  L 4 4   ? -29.383 -53.451 -37.628  1.00 56.24  ?  19  DG  K N3    1 
ATOM   9491  C C4    . DG  L 4 4   ? -29.291 -54.763 -37.935  1.00 49.35  ?  19  DG  K C4    1 
ATOM   9492  P P     . DA  L 4 5   ? -22.884 -54.297 -36.347  1.00 76.30  ?  20  DA  K P     1 
ATOM   9493  O OP1   . DA  L 4 5   ? -21.581 -53.607 -36.473  1.00 84.59  ?  20  DA  K OP1   1 
ATOM   9494  O OP2   . DA  L 4 5   ? -22.947 -55.669 -35.791  1.00 60.65  -1 20  DA  K OP2   1 
ATOM   9495  O "O5'" . DA  L 4 5   ? -23.899 -53.385 -35.518  1.00 63.08  ?  20  DA  K "O5'" 1 
ATOM   9496  C "C5'" . DA  L 4 5   ? -24.142 -52.045 -35.942  1.00 64.89  ?  20  DA  K "C5'" 1 
ATOM   9497  C "C4'" . DA  L 4 5   ? -25.128 -51.367 -35.017  1.00 58.92  ?  20  DA  K "C4'" 1 
ATOM   9498  O "O4'" . DA  L 4 5   ? -26.431 -51.981 -35.164  1.00 51.44  ?  20  DA  K "O4'" 1 
ATOM   9499  C "C3'" . DA  L 4 5   ? -24.769 -51.434 -33.536  1.00 73.06  ?  20  DA  K "C3'" 1 
ATOM   9500  O "O3'" . DA  L 4 5   ? -24.818 -50.135 -32.972  1.00 81.36  ?  20  DA  K "O3'" 1 
ATOM   9501  C "C2'" . DA  L 4 5   ? -25.838 -52.351 -32.935  1.00 66.53  ?  20  DA  K "C2'" 1 
ATOM   9502  C "C1'" . DA  L 4 5   ? -27.002 -52.177 -33.898  1.00 48.26  ?  20  DA  K "C1'" 1 
ATOM   9503  N N9    . DA  L 4 5   ? -27.881 -53.339 -33.966  1.00 43.01  ?  20  DA  K N9    1 
ATOM   9504  C C8    . DA  L 4 5   ? -27.529 -54.625 -34.271  1.00 48.71  ?  20  DA  K C8    1 
ATOM   9505  N N7    . DA  L 4 5   ? -28.536 -55.466 -34.257  1.00 44.71  ?  20  DA  K N7    1 
ATOM   9506  C C5    . DA  L 4 5   ? -29.622 -54.677 -33.921  1.00 44.32  ?  20  DA  K C5    1 
ATOM   9507  C C6    . DA  L 4 5   ? -30.988 -54.967 -33.741  1.00 45.39  ?  20  DA  K C6    1 
ATOM   9508  N N6    . DA  L 4 5   ? -31.508 -56.190 -33.883  1.00 43.62  ?  20  DA  K N6    1 
ATOM   9509  N N1    . DA  L 4 5   ? -31.804 -53.946 -33.408  1.00 40.11  ?  20  DA  K N1    1 
ATOM   9510  C C2    . DA  L 4 5   ? -31.284 -52.722 -33.266  1.00 49.71  ?  20  DA  K C2    1 
ATOM   9511  N N3    . DA  L 4 5   ? -30.021 -52.328 -33.408  1.00 56.78  ?  20  DA  K N3    1 
ATOM   9512  C C4    . DA  L 4 5   ? -29.234 -53.363 -33.739  1.00 48.18  ?  20  DA  K C4    1 
ATOM   9513  P P     . DG  L 4 6   ? -24.252 -49.878 -31.492  1.00 86.22  ?  21  DG  K P     1 
ATOM   9514  O OP1   . DG  L 4 6   ? -23.574 -48.563 -31.498  1.00 80.06  ?  21  DG  K OP1   1 
ATOM   9515  O OP2   . DG  L 4 6   ? -23.506 -51.086 -31.073  1.00 89.84  -1 21  DG  K OP2   1 
ATOM   9516  O "O5'" . DG  L 4 6   ? -25.567 -49.775 -30.593  1.00 77.74  ?  21  DG  K "O5'" 1 
ATOM   9517  C "C5'" . DG  L 4 6   ? -26.584 -48.835 -30.903  1.00 56.67  ?  21  DG  K "C5'" 1 
ATOM   9518  C "C4'" . DG  L 4 6   ? -27.812 -49.101 -30.052  1.00 71.83  ?  21  DG  K "C4'" 1 
ATOM   9519  O "O4'" . DG  L 4 6   ? -28.489 -50.305 -30.503  1.00 64.16  ?  21  DG  K "O4'" 1 
ATOM   9520  C "C3'" . DG  L 4 6   ? -27.529 -49.320 -28.557  1.00 82.28  ?  21  DG  K "C3'" 1 
ATOM   9521  O "O3'" . DG  L 4 6   ? -28.541 -48.687 -27.802  1.00 82.58  ?  21  DG  K "O3'" 1 
ATOM   9522  C "C2'" . DG  L 4 6   ? -27.646 -50.834 -28.420  1.00 72.90  ?  21  DG  K "C2'" 1 
ATOM   9523  C "C1'" . DG  L 4 6   ? -28.808 -51.054 -29.358  1.00 62.66  ?  21  DG  K "C1'" 1 
ATOM   9524  N N9    . DG  L 4 6   ? -29.083 -52.441 -29.709  1.00 51.34  ?  21  DG  K N9    1 
ATOM   9525  C C8    . DG  L 4 6   ? -28.183 -53.434 -30.011  1.00 51.35  ?  21  DG  K C8    1 
ATOM   9526  N N7    . DG  L 4 6   ? -28.752 -54.586 -30.253  1.00 51.60  ?  21  DG  K N7    1 
ATOM   9527  C C5    . DG  L 4 6   ? -30.108 -54.342 -30.063  1.00 41.23  ?  21  DG  K C5    1 
ATOM   9528  C C6    . DG  L 4 6   ? -31.225 -55.210 -30.172  1.00 43.11  ?  21  DG  K C6    1 
ATOM   9529  O O6    . DG  L 4 6   ? -31.239 -56.412 -30.470  1.00 43.16  ?  21  DG  K O6    1 
ATOM   9530  N N1    . DG  L 4 6   ? -32.422 -54.548 -29.892  1.00 44.61  ?  21  DG  K N1    1 
ATOM   9531  C C2    . DG  L 4 6   ? -32.519 -53.217 -29.551  1.00 49.90  ?  21  DG  K C2    1 
ATOM   9532  N N2    . DG  L 4 6   ? -33.749 -52.745 -29.317  1.00 45.96  ?  21  DG  K N2    1 
ATOM   9533  N N3    . DG  L 4 6   ? -31.483 -52.403 -29.448  1.00 45.69  ?  21  DG  K N3    1 
ATOM   9534  C C4    . DG  L 4 6   ? -30.318 -53.030 -29.716  1.00 42.07  ?  21  DG  K C4    1 
ATOM   9535  P P     . DC  L 4 7   ? -28.189 -47.838 -26.488  1.00 80.82  ?  22  DC  K P     1 
ATOM   9536  O OP1   . DC  L 4 7   ? -27.570 -46.569 -26.933  1.00 73.08  ?  22  DC  K OP1   1 
ATOM   9537  O OP2   . DC  L 4 7   ? -27.460 -48.724 -25.553  1.00 69.40  -1 22  DC  K OP2   1 
ATOM   9538  O "O5'" . DC  L 4 7   ? -29.627 -47.525 -25.860  1.00 67.59  ?  22  DC  K "O5'" 1 
ATOM   9539  C "C5'" . DC  L 4 7   ? -30.638 -46.966 -26.687  1.00 48.99  ?  22  DC  K "C5'" 1 
ATOM   9540  C "C4'" . DC  L 4 7   ? -32.022 -47.509 -26.343  1.00 66.69  ?  22  DC  K "C4'" 1 
ATOM   9541  O "O4'" . DC  L 4 7   ? -32.148 -48.892 -26.803  1.00 70.51  ?  22  DC  K "O4'" 1 
ATOM   9542  C "C3'" . DC  L 4 7   ? -32.354 -47.544 -24.849  1.00 76.85  ?  22  DC  K "C3'" 1 
ATOM   9543  O "O3'" . DC  L 4 7   ? -33.719 -47.186 -24.651  1.00 68.59  ?  22  DC  K "O3'" 1 
ATOM   9544  C "C2'" . DC  L 4 7   ? -32.094 -48.993 -24.464  1.00 74.98  ?  22  DC  K "C2'" 1 
ATOM   9545  C "C1'" . DC  L 4 7   ? -32.545 -49.717 -25.718  1.00 70.82  ?  22  DC  K "C1'" 1 
ATOM   9546  N N1    . DC  L 4 7   ? -31.936 -51.083 -25.869  1.00 63.32  ?  22  DC  K N1    1 
ATOM   9547  C C2    . DC  L 4 7   ? -32.759 -52.203 -26.104  1.00 61.38  ?  22  DC  K C2    1 
ATOM   9548  O O2    . DC  L 4 7   ? -33.987 -52.053 -26.186  1.00 62.28  ?  22  DC  K O2    1 
ATOM   9549  N N3    . DC  L 4 7   ? -32.181 -53.427 -26.227  1.00 53.25  ?  22  DC  K N3    1 
ATOM   9550  C C4    . DC  L 4 7   ? -30.854 -53.550 -26.129  1.00 53.18  ?  22  DC  K C4    1 
ATOM   9551  N N4    . DC  L 4 7   ? -30.329 -54.772 -26.261  1.00 46.46  ?  22  DC  K N4    1 
ATOM   9552  C C5    . DC  L 4 7   ? -30.007 -52.427 -25.891  1.00 55.84  ?  22  DC  K C5    1 
ATOM   9553  C C6    . DC  L 4 7   ? -30.584 -51.228 -25.767  1.00 57.06  ?  22  DC  K C6    1 
ATOM   9554  P P     . DA  L 4 8   ? -34.332 -47.105 -23.168  1.00 80.90  ?  23  DA  K P     1 
ATOM   9555  O OP1   . DA  L 4 8   ? -35.224 -45.927 -23.109  1.00 96.11  ?  23  DA  K OP1   1 
ATOM   9556  O OP2   . DA  L 4 8   ? -33.207 -47.235 -22.215  1.00 77.79  -1 23  DA  K OP2   1 
ATOM   9557  O "O5'" . DA  L 4 8   ? -35.215 -48.433 -23.054  1.00 63.55  ?  23  DA  K "O5'" 1 
ATOM   9558  C "C5'" . DA  L 4 8   ? -36.046 -48.811 -24.147  1.00 61.85  ?  23  DA  K "C5'" 1 
ATOM   9559  C "C4'" . DA  L 4 8   ? -36.948 -49.983 -23.794  1.00 56.38  ?  23  DA  K "C4'" 1 
ATOM   9560  O "O4'" . DA  L 4 8   ? -36.247 -51.227 -24.033  1.00 60.57  ?  23  DA  K "O4'" 1 
ATOM   9561  C "C3'" . DA  L 4 8   ? -37.417 -50.040 -22.347  1.00 70.97  ?  23  DA  K "C3'" 1 
ATOM   9562  O "O3'" . DA  L 4 8   ? -38.730 -50.600 -22.297  1.00 70.29  ?  23  DA  K "O3'" 1 
ATOM   9563  C "C2'" . DA  L 4 8   ? -36.376 -50.946 -21.690  1.00 75.66  ?  23  DA  K "C2'" 1 
ATOM   9564  C "C1'" . DA  L 4 8   ? -36.052 -51.920 -22.817  1.00 59.79  ?  23  DA  K "C1'" 1 
ATOM   9565  N N9    . DA  L 4 8   ? -34.677 -52.412 -22.798  1.00 53.14  ?  23  DA  K N9    1 
ATOM   9566  C C8    . DA  L 4 8   ? -33.530 -51.668 -22.746  1.00 55.47  ?  23  DA  K C8    1 
ATOM   9567  N N7    . DA  L 4 8   ? -32.431 -52.388 -22.747  1.00 55.04  ?  23  DA  K N7    1 
ATOM   9568  C C5    . DA  L 4 8   ? -32.891 -53.694 -22.802  1.00 51.58  ?  23  DA  K C5    1 
ATOM   9569  C C6    . DA  L 4 8   ? -32.230 -54.940 -22.829  1.00 51.56  ?  23  DA  K C6    1 
ATOM   9570  N N6    . DA  L 4 8   ? -30.897 -55.079 -22.805  1.00 46.62  ?  23  DA  K N6    1 
ATOM   9571  N N1    . DA  L 4 8   ? -32.997 -56.045 -22.883  1.00 45.15  ?  23  DA  K N1    1 
ATOM   9572  C C2    . DA  L 4 8   ? -34.325 -55.917 -22.911  1.00 43.44  ?  23  DA  K C2    1 
ATOM   9573  N N3    . DA  L 4 8   ? -35.058 -54.809 -22.891  1.00 45.43  ?  23  DA  K N3    1 
ATOM   9574  C C4    . DA  L 4 8   ? -34.274 -53.723 -22.836  1.00 49.49  ?  23  DA  K C4    1 
ATOM   9575  P P     . DT  L 4 9   ? -39.537 -50.705 -20.910  1.00 86.79  ?  24  DT  K P     1 
ATOM   9576  O OP1   . DT  L 4 9   ? -40.957 -50.395 -21.192  1.00 75.87  ?  24  DT  K OP1   1 
ATOM   9577  O OP2   . DT  L 4 9   ? -38.795 -49.921 -19.898  1.00 88.70  -1 24  DT  K OP2   1 
ATOM   9578  O "O5'" . DT  L 4 9   ? -39.418 -52.250 -20.516  1.00 69.17  ?  24  DT  K "O5'" 1 
ATOM   9579  C "C5'" . DT  L 4 9   ? -39.867 -53.242 -21.424  1.00 56.24  ?  24  DT  K "C5'" 1 
ATOM   9580  C "C4'" . DT  L 4 9   ? -39.479 -54.630 -20.949  1.00 68.59  ?  24  DT  K "C4'" 1 
ATOM   9581  O "O4'" . DT  L 4 9   ? -38.047 -54.774 -21.016  1.00 72.74  ?  24  DT  K "O4'" 1 
ATOM   9582  C "C3'" . DT  L 4 9   ? -39.855 -54.976 -19.499  1.00 68.28  ?  24  DT  K "C3'" 1 
ATOM   9583  O "O3'" . DT  L 4 9   ? -40.806 -56.038 -19.511  1.00 67.82  ?  24  DT  K "O3'" 1 
ATOM   9584  C "C2'" . DT  L 4 9   ? -38.532 -55.381 -18.830  1.00 60.00  ?  24  DT  K "C2'" 1 
ATOM   9585  C "C1'" . DT  L 4 9   ? -37.655 -55.685 -20.027  1.00 56.46  ?  24  DT  K "C1'" 1 
ATOM   9586  N N1    . DT  L 4 9   ? -36.202 -55.500 -19.773  1.00 48.96  ?  24  DT  K N1    1 
ATOM   9587  C C2    . DT  L 4 9   ? -35.368 -56.584 -19.859  1.00 47.82  ?  24  DT  K C2    1 
ATOM   9588  O O2    . DT  L 4 9   ? -35.761 -57.713 -20.095  1.00 49.34  ?  24  DT  K O2    1 
ATOM   9589  N N3    . DT  L 4 9   ? -34.052 -56.310 -19.623  1.00 41.25  ?  24  DT  K N3    1 
ATOM   9590  C C4    . DT  L 4 9   ? -33.485 -55.087 -19.342  1.00 46.74  ?  24  DT  K C4    1 
ATOM   9591  O O4    . DT  L 4 9   ? -32.278 -54.954 -19.155  1.00 55.47  ?  24  DT  K O4    1 
ATOM   9592  C C5    . DT  L 4 9   ? -34.411 -53.980 -19.286  1.00 44.29  ?  24  DT  K C5    1 
ATOM   9593  C C7    . DT  L 4 9   ? -33.917 -52.596 -18.987  1.00 48.43  ?  24  DT  K C7    1 
ATOM   9594  C C6    . DT  L 4 9   ? -35.711 -54.236 -19.508  1.00 41.74  ?  24  DT  K C6    1 
ATOM   9595  P P     . DT  L 4 10  ? -41.380 -56.671 -18.149  1.00 94.18  ?  25  DT  K P     1 
ATOM   9596  O OP1   . DT  L 4 10  ? -42.806 -56.994 -18.376  1.00 76.90  ?  25  DT  K OP1   1 
ATOM   9597  O OP2   . DT  L 4 10  ? -40.988 -55.791 -17.024  1.00 82.05  -1 25  DT  K OP2   1 
ATOM   9598  O "O5'" . DT  L 4 10  ? -40.550 -58.035 -18.017  1.00 50.30  ?  25  DT  K "O5'" 1 
ATOM   9599  C "C5'" . DT  L 4 10  ? -40.461 -58.896 -19.148  1.00 66.49  ?  25  DT  K "C5'" 1 
ATOM   9600  C "C4'" . DT  L 4 10  ? -39.451 -60.012 -18.939  1.00 63.86  ?  25  DT  K "C4'" 1 
ATOM   9601  O "O4'" . DT  L 4 10  ? -38.109 -59.460 -18.869  1.00 68.52  ?  25  DT  K "O4'" 1 
ATOM   9602  C "C3'" . DT  L 4 10  ? -39.628 -60.850 -17.670  1.00 51.10  ?  25  DT  K "C3'" 1 
ATOM   9603  O "O3'" . DT  L 4 10  ? -39.561 -62.234 -18.030  1.00 60.31  ?  25  DT  K "O3'" 1 
ATOM   9604  C "C2'" . DT  L 4 10  ? -38.464 -60.415 -16.775  1.00 56.24  ?  25  DT  K "C2'" 1 
ATOM   9605  C "C1'" . DT  L 4 10  ? -37.417 -60.080 -17.813  1.00 45.38  ?  25  DT  K "C1'" 1 
ATOM   9606  N N1    . DT  L 4 10  ? -36.337 -59.158 -17.343  1.00 46.10  ?  25  DT  K N1    1 
ATOM   9607  C C2    . DT  L 4 10  ? -35.030 -59.560 -17.449  1.00 50.88  ?  25  DT  K C2    1 
ATOM   9608  O O2    . DT  L 4 10  ? -34.704 -60.670 -17.830  1.00 57.57  ?  25  DT  K O2    1 
ATOM   9609  N N3    . DT  L 4 10  ? -34.111 -58.642 -17.021  1.00 45.92  ?  25  DT  K N3    1 
ATOM   9610  C C4    . DT  L 4 10  ? -34.355 -57.367 -16.554  1.00 45.96  ?  25  DT  K C4    1 
ATOM   9611  O O4    . DT  L 4 10  ? -33.449 -56.612 -16.206  1.00 46.71  ?  25  DT  K O4    1 
ATOM   9612  C C5    . DT  L 4 10  ? -35.749 -56.987 -16.507  1.00 47.98  ?  25  DT  K C5    1 
ATOM   9613  C C7    . DT  L 4 10  ? -36.144 -55.625 -16.017  1.00 54.59  ?  25  DT  K C7    1 
ATOM   9614  C C6    . DT  L 4 10  ? -36.663 -57.887 -16.913  1.00 48.44  ?  25  DT  K C6    1 
ATOM   9615  P P     . DT  L 4 11  ? -40.029 -63.387 -17.013  1.00 96.68  ?  26  DT  K P     1 
ATOM   9616  O OP1   . DT  L 4 11  ? -40.838 -64.351 -17.791  1.00 74.55  ?  26  DT  K OP1   1 
ATOM   9617  O OP2   . DT  L 4 11  ? -40.603 -62.749 -15.808  1.00 81.39  -1 26  DT  K OP2   1 
ATOM   9618  O "O5'" . DT  L 4 11  ? -38.661 -64.100 -16.587  1.00 74.17  ?  26  DT  K "O5'" 1 
ATOM   9619  C "C5'" . DT  L 4 11  ? -37.658 -64.360 -17.573  1.00 57.57  ?  26  DT  K "C5'" 1 
ATOM   9620  C "C4'" . DT  L 4 11  ? -36.331 -64.697 -16.917  1.00 61.39  ?  26  DT  K "C4'" 1 
ATOM   9621  O "O4'" . DT  L 4 11  ? -35.596 -63.485 -16.633  1.00 67.91  ?  26  DT  K "O4'" 1 
ATOM   9622  C "C3'" . DT  L 4 11  ? -36.444 -65.455 -15.590  1.00 68.19  ?  26  DT  K "C3'" 1 
ATOM   9623  O "O3'" . DT  L 4 11  ? -35.677 -66.651 -15.648  1.00 49.82  ?  26  DT  K "O3'" 1 
ATOM   9624  C "C2'" . DT  L 4 11  ? -35.896 -64.473 -14.549  1.00 72.07  ?  26  DT  K "C2'" 1 
ATOM   9625  C "C1'" . DT  L 4 11  ? -34.962 -63.625 -15.389  1.00 54.81  ?  26  DT  K "C1'" 1 
ATOM   9626  N N1    . DT  L 4 11  ? -34.719 -62.271 -14.836  1.00 55.68  ?  26  DT  K N1    1 
ATOM   9627  C C2    . DT  L 4 11  ? -33.429 -61.809 -14.741  1.00 55.80  ?  26  DT  K C2    1 
ATOM   9628  O O2    . DT  L 4 11  ? -32.459 -62.478 -15.047  1.00 55.68  ?  26  DT  K O2    1 
ATOM   9629  N N3    . DT  L 4 11  ? -33.311 -60.543 -14.229  1.00 48.19  ?  26  DT  K N3    1 
ATOM   9630  C C4    . DT  L 4 11  ? -34.338 -59.700 -13.840  1.00 58.80  ?  26  DT  K C4    1 
ATOM   9631  O O4    . DT  L 4 11  ? -34.131 -58.573 -13.398  1.00 55.78  ?  26  DT  K O4    1 
ATOM   9632  C C5    . DT  L 4 11  ? -35.671 -60.240 -13.990  1.00 67.05  ?  26  DT  K C5    1 
ATOM   9633  C C7    . DT  L 4 11  ? -36.869 -59.422 -13.600  1.00 67.82  ?  26  DT  K C7    1 
ATOM   9634  C C6    . DT  L 4 11  ? -35.795 -61.482 -14.482  1.00 61.07  ?  26  DT  K C6    1 
ATOM   9635  N N     . ASN M 1 16  ? -17.450 -49.063 40.771   1.00 96.40  ?  16  ASN L N     1 
ATOM   9636  C CA    . ASN M 1 16  ? -18.592 -49.471 41.581   1.00 87.50  ?  16  ASN L CA    1 
ATOM   9637  C C     . ASN M 1 16  ? -19.852 -49.658 40.744   1.00 85.51  ?  16  ASN L C     1 
ATOM   9638  O O     . ASN M 1 16  ? -20.191 -48.811 39.918   1.00 98.99  ?  16  ASN L O     1 
ATOM   9639  C CB    . ASN M 1 16  ? -18.850 -48.447 42.688   1.00 68.51  ?  16  ASN L CB    1 
ATOM   9640  N N     . ILE M 1 17  ? -20.540 -50.775 40.962   1.00 85.63  ?  17  ILE L N     1 
ATOM   9641  C CA    . ILE M 1 17  ? -21.739 -51.106 40.200   1.00 94.11  ?  17  ILE L CA    1 
ATOM   9642  C C     . ILE M 1 17  ? -22.869 -50.126 40.513   1.00 77.86  ?  17  ILE L C     1 
ATOM   9643  O O     . ILE M 1 17  ? -22.983 -49.630 41.634   1.00 74.22  ?  17  ILE L O     1 
ATOM   9644  C CB    . ILE M 1 17  ? -22.208 -52.556 40.488   1.00 92.10  ?  17  ILE L CB    1 
ATOM   9645  C CG1   . ILE M 1 17  ? -23.326 -52.971 39.529   1.00 95.91  ?  17  ILE L CG1   1 
ATOM   9646  C CG2   . ILE M 1 17  ? -22.644 -52.711 41.941   1.00 78.05  ?  17  ILE L CG2   1 
ATOM   9647  C CD1   . ILE M 1 17  ? -23.793 -54.397 39.715   1.00 92.51  ?  17  ILE L CD1   1 
ATOM   9648  N N     . SER M 1 18  ? -23.687 -49.826 39.510   1.00 81.62  ?  18  SER L N     1 
ATOM   9649  C CA    . SER M 1 18  ? -24.812 -48.924 39.700   1.00 81.23  ?  18  SER L CA    1 
ATOM   9650  C C     . SER M 1 18  ? -25.987 -49.669 40.324   1.00 72.28  ?  18  SER L C     1 
ATOM   9651  O O     . SER M 1 18  ? -26.168 -50.861 40.076   1.00 73.92  ?  18  SER L O     1 
ATOM   9652  C CB    . SER M 1 18  ? -25.224 -48.300 38.362   1.00 95.27  ?  18  SER L CB    1 
ATOM   9653  O OG    . SER M 1 18  ? -26.574 -47.868 38.384   1.00 91.12  ?  18  SER L OG    1 
ATOM   9654  N N     . PRO M 1 19  ? -26.788 -48.968 41.141   1.00 72.31  ?  19  PRO L N     1 
ATOM   9655  C CA    . PRO M 1 19  ? -27.953 -49.567 41.801   1.00 86.89  ?  19  PRO L CA    1 
ATOM   9656  C C     . PRO M 1 19  ? -28.974 -50.072 40.788   1.00 73.68  ?  19  PRO L C     1 
ATOM   9657  O O     . PRO M 1 19  ? -29.625 -51.099 40.995   1.00 78.21  ?  19  PRO L O     1 
ATOM   9658  C CB    . PRO M 1 19  ? -28.522 -48.413 42.634   1.00 82.41  ?  19  PRO L CB    1 
ATOM   9659  C CG    . PRO M 1 19  ? -27.976 -47.176 42.001   1.00 89.14  ?  19  PRO L CG    1 
ATOM   9660  C CD    . PRO M 1 19  ? -26.615 -47.556 41.521   1.00 80.42  ?  19  PRO L CD    1 
ATOM   9661  N N     . TRP M 1 20  ? -29.101 -49.337 39.690   1.00 69.35  ?  20  TRP L N     1 
ATOM   9662  C CA    . TRP M 1 20  ? -30.030 -49.695 38.632   1.00 73.50  ?  20  TRP L CA    1 
ATOM   9663  C C     . TRP M 1 20  ? -29.572 -50.940 37.877   1.00 72.45  ?  20  TRP L C     1 
ATOM   9664  O O     . TRP M 1 20  ? -30.397 -51.699 37.368   1.00 70.41  ?  20  TRP L O     1 
ATOM   9665  C CB    . TRP M 1 20  ? -30.194 -48.519 37.671   1.00 77.88  ?  20  TRP L CB    1 
ATOM   9666  C CG    . TRP M 1 20  ? -31.169 -47.495 38.161   1.00 72.17  ?  20  TRP L CG    1 
ATOM   9667  C CD1   . TRP M 1 20  ? -30.912 -46.182 38.433   1.00 75.31  ?  20  TRP L CD1   1 
ATOM   9668  C CD2   . TRP M 1 20  ? -32.560 -47.696 38.437   1.00 65.89  ?  20  TRP L CD2   1 
ATOM   9669  N NE1   . TRP M 1 20  ? -32.055 -45.555 38.864   1.00 76.37  ?  20  TRP L NE1   1 
ATOM   9670  C CE2   . TRP M 1 20  ? -33.082 -46.463 38.874   1.00 69.67  ?  20  TRP L CE2   1 
ATOM   9671  C CE3   . TRP M 1 20  ? -33.415 -48.800 38.356   1.00 75.51  ?  20  TRP L CE3   1 
ATOM   9672  C CZ2   . TRP M 1 20  ? -34.419 -46.302 39.229   1.00 76.40  ?  20  TRP L CZ2   1 
ATOM   9673  C CZ3   . TRP M 1 20  ? -34.741 -48.639 38.711   1.00 79.20  ?  20  TRP L CZ3   1 
ATOM   9674  C CH2   . TRP M 1 20  ? -35.231 -47.399 39.139   1.00 71.75  ?  20  TRP L CH2   1 
ATOM   9675  N N     . THR M 1 21  ? -28.260 -51.151 37.809   1.00 72.21  ?  21  THR L N     1 
ATOM   9676  C CA    . THR M 1 21  ? -27.722 -52.380 37.234   1.00 79.77  ?  21  THR L CA    1 
ATOM   9677  C C     . THR M 1 21  ? -28.150 -53.561 38.098   1.00 77.89  ?  21  THR L C     1 
ATOM   9678  O O     . THR M 1 21  ? -28.550 -54.617 37.593   1.00 70.40  ?  21  THR L O     1 
ATOM   9679  C CB    . THR M 1 21  ? -26.182 -52.341 37.130   1.00 83.45  ?  21  THR L CB    1 
ATOM   9680  O OG1   . THR M 1 21  ? -25.777 -51.203 36.358   1.00 87.96  ?  21  THR L OG1   1 
ATOM   9681  C CG2   . THR M 1 21  ? -25.654 -53.609 36.474   1.00 80.40  ?  21  THR L CG2   1 
ATOM   9682  N N     . ILE M 1 22  ? -28.079 -53.355 39.409   1.00 75.50  ?  22  ILE L N     1 
ATOM   9683  C CA    . ILE M 1 22  ? -28.472 -54.360 40.385   1.00 57.19  ?  22  ILE L CA    1 
ATOM   9684  C C     . ILE M 1 22  ? -29.948 -54.693 40.229   1.00 59.69  ?  22  ILE L C     1 
ATOM   9685  O O     . ILE M 1 22  ? -30.333 -55.865 40.167   1.00 59.15  ?  22  ILE L O     1 
ATOM   9686  C CB    . ILE M 1 22  ? -28.199 -53.888 41.826   1.00 63.67  ?  22  ILE L CB    1 
ATOM   9687  C CG1   . ILE M 1 22  ? -26.695 -53.725 42.058   1.00 82.66  ?  22  ILE L CG1   1 
ATOM   9688  C CG2   . ILE M 1 22  ? -28.794 -54.862 42.832   1.00 65.83  ?  22  ILE L CG2   1 
ATOM   9689  C CD1   . ILE M 1 22  ? -26.332 -53.313 43.471   1.00 90.12  ?  22  ILE L CD1   1 
ATOM   9690  N N     . THR M 1 23  ? -30.769 -53.650 40.140   1.00 53.71  ?  23  THR L N     1 
ATOM   9691  C CA    . THR M 1 23  ? -32.202 -53.847 40.007   1.00 48.21  ?  23  THR L CA    1 
ATOM   9692  C C     . THR M 1 23  ? -32.539 -54.561 38.700   1.00 57.95  ?  23  THR L C     1 
ATOM   9693  O O     . THR M 1 23  ? -33.399 -55.430 38.685   1.00 64.82  ?  23  THR L O     1 
ATOM   9694  C CB    . THR M 1 23  ? -32.956 -52.497 40.068   1.00 48.98  ?  23  THR L CB    1 
ATOM   9695  O OG1   . THR M 1 23  ? -32.848 -51.941 41.385   1.00 70.96  ?  23  THR L OG1   1 
ATOM   9696  C CG2   . THR M 1 23  ? -34.426 -52.673 39.719   1.00 49.51  ?  23  THR L CG2   1 
ATOM   9697  N N     . GLY M 1 24  ? -31.888 -54.182 37.604   1.00 64.36  ?  24  GLY L N     1 
ATOM   9698  C CA    . GLY M 1 24  ? -32.098 -54.854 36.329   1.00 63.08  ?  24  GLY L CA    1 
ATOM   9699  C C     . GLY M 1 24  ? -31.719 -56.329 36.298   1.00 57.34  ?  24  GLY L C     1 
ATOM   9700  O O     . GLY M 1 24  ? -32.428 -57.195 35.758   1.00 55.57  ?  24  GLY L O     1 
ATOM   9701  N N     . PHE M 1 25  ? -30.570 -56.613 36.897   1.00 47.61  ?  25  PHE L N     1 
ATOM   9702  C CA    . PHE M 1 25  ? -30.075 -57.975 36.972   1.00 45.58  ?  25  PHE L CA    1 
ATOM   9703  C C     . PHE M 1 25  ? -30.962 -58.846 37.856   1.00 58.69  ?  25  PHE L C     1 
ATOM   9704  O O     . PHE M 1 25  ? -31.188 -60.018 37.552   1.00 63.17  ?  25  PHE L O     1 
ATOM   9705  C CB    . PHE M 1 25  ? -28.632 -57.977 37.464   1.00 53.14  ?  25  PHE L CB    1 
ATOM   9706  C CG    . PHE M 1 25  ? -27.929 -59.275 37.240   1.00 59.51  ?  25  PHE L CG    1 
ATOM   9707  C CD1   . PHE M 1 25  ? -27.500 -59.623 35.971   1.00 56.91  ?  25  PHE L CD1   1 
ATOM   9708  C CD2   . PHE M 1 25  ? -27.670 -60.133 38.286   1.00 69.52  ?  25  PHE L CD2   1 
ATOM   9709  C CE1   . PHE M 1 25  ? -26.847 -60.815 35.749   1.00 56.26  ?  25  PHE L CE1   1 
ATOM   9710  C CE2   . PHE M 1 25  ? -27.016 -61.328 38.073   1.00 70.67  ?  25  PHE L CE2   1 
ATOM   9711  C CZ    . PHE M 1 25  ? -26.602 -61.669 36.803   1.00 72.75  ?  25  PHE L CZ    1 
ATOM   9712  N N     . ALA M 1 26  ? -31.473 -58.268 38.940   1.00 58.99  ?  26  ALA L N     1 
ATOM   9713  C CA    . ALA M 1 26  ? -32.390 -58.980 39.824   1.00 52.06  ?  26  ALA L CA    1 
ATOM   9714  C C     . ALA M 1 26  ? -33.697 -59.188 39.078   1.00 55.36  ?  26  ALA L C     1 
ATOM   9715  O O     . ALA M 1 26  ? -34.346 -60.226 39.206   1.00 56.79  ?  26  ALA L O     1 
ATOM   9716  C CB    . ALA M 1 26  ? -32.621 -58.209 41.114   1.00 53.00  ?  26  ALA L CB    1 
ATOM   9717  N N     . ASP M 1 27  ? -34.078 -58.170 38.316   1.00 64.78  ?  27  ASP L N     1 
ATOM   9718  C CA    . ASP M 1 27  ? -35.207 -58.234 37.400   1.00 63.28  ?  27  ASP L CA    1 
ATOM   9719  C C     . ASP M 1 27  ? -35.099 -59.459 36.501   1.00 48.46  ?  27  ASP L C     1 
ATOM   9720  O O     . ASP M 1 27  ? -36.111 -60.077 36.166   1.00 42.74  ?  27  ASP L O     1 
ATOM   9721  C CB    . ASP M 1 27  ? -35.295 -56.959 36.552   1.00 54.43  ?  27  ASP L CB    1 
ATOM   9722  C CG    . ASP M 1 27  ? -36.446 -56.065 36.963   1.00 67.02  ?  27  ASP L CG    1 
ATOM   9723  O OD1   . ASP M 1 27  ? -37.514 -56.606 37.318   1.00 64.43  ?  27  ASP L OD1   1 
ATOM   9724  O OD2   . ASP M 1 27  ? -36.288 -54.826 36.938   1.00 70.57  -1 27  ASP L OD2   1 
ATOM   9725  N N     . ALA M 1 28  ? -33.874 -59.798 36.106   1.00 37.02  ?  28  ALA L N     1 
ATOM   9726  C CA    . ALA M 1 28  ? -33.686 -60.977 35.271   1.00 37.63  ?  28  ALA L CA    1 
ATOM   9727  C C     . ALA M 1 28  ? -33.666 -62.291 36.070   1.00 48.10  ?  28  ALA L C     1 
ATOM   9728  O O     . ALA M 1 28  ? -34.470 -63.177 35.822   1.00 57.61  ?  28  ALA L O     1 
ATOM   9729  C CB    . ALA M 1 28  ? -32.398 -60.828 34.488   1.00 49.46  ?  28  ALA L CB    1 
ATOM   9730  N N     . ASP M 1 29  ? -32.771 -62.399 37.047   1.00 55.02  ?  29  ASP L N     1 
ATOM   9731  C CA    . ASP M 1 29  ? -32.470 -63.711 37.643   1.00 61.00  ?  29  ASP L CA    1 
ATOM   9732  C C     . ASP M 1 29  ? -32.903 -63.957 39.090   1.00 72.80  ?  29  ASP L C     1 
ATOM   9733  O O     . ASP M 1 29  ? -32.706 -65.064 39.583   1.00 84.62  ?  29  ASP L O     1 
ATOM   9734  C CB    . ASP M 1 29  ? -30.985 -64.067 37.529   1.00 68.83  ?  29  ASP L CB    1 
ATOM   9735  C CG    . ASP M 1 29  ? -30.540 -64.270 36.096   1.00 73.04  ?  29  ASP L CG    1 
ATOM   9736  O OD1   . ASP M 1 29  ? -31.360 -64.113 35.172   1.00 69.18  ?  29  ASP L OD1   1 
ATOM   9737  O OD2   . ASP M 1 29  ? -29.360 -64.617 35.882   1.00 79.22  -1 29  ASP L OD2   1 
ATOM   9738  N N     . SER M 1 30  ? -33.470 -62.975 39.784   1.00 63.21  ?  30  SER L N     1 
ATOM   9739  C CA    . SER M 1 30  ? -33.681 -63.142 41.223   1.00 51.57  ?  30  SER L CA    1 
ATOM   9740  C C     . SER M 1 30  ? -35.037 -63.760 41.549   1.00 47.32  ?  30  SER L C     1 
ATOM   9741  O O     . SER M 1 30  ? -35.920 -63.842 40.696   1.00 59.14  ?  30  SER L O     1 
ATOM   9742  C CB    . SER M 1 30  ? -33.529 -61.799 41.938   1.00 50.60  ?  30  SER L CB    1 
ATOM   9743  O OG    . SER M 1 30  ? -34.670 -60.985 41.737   1.00 42.71  ?  30  SER L OG    1 
ATOM   9744  N N     . SER M 1 31  ? -35.184 -64.192 42.798   1.00 53.00  ?  31  SER L N     1 
ATOM   9745  C CA    . SER M 1 31  ? -36.443 -64.711 43.324   1.00 39.80  ?  31  SER L CA    1 
ATOM   9746  C C     . SER M 1 31  ? -36.826 -64.237 44.721   1.00 36.13  ?  31  SER L C     1 
ATOM   9747  O O     . SER M 1 31  ? -35.983 -64.159 45.623   1.00 45.16  ?  31  SER L O     1 
ATOM   9748  C CB    . SER M 1 31  ? -36.393 -66.237 43.325   1.00 30.64  ?  31  SER L CB    1 
ATOM   9749  O OG    . SER M 1 31  ? -37.652 -66.789 43.657   1.00 60.94  ?  31  SER L OG    1 
ATOM   9750  N N     . PHE M 1 32  ? -38.106 -63.897 44.866   1.00 39.04  ?  32  PHE L N     1 
ATOM   9751  C CA    . PHE M 1 32  ? -38.727 -63.591 46.152   1.00 38.76  ?  32  PHE L CA    1 
ATOM   9752  C C     . PHE M 1 32  ? -39.569 -64.788 46.589   1.00 40.96  ?  32  PHE L C     1 
ATOM   9753  O O     . PHE M 1 32  ? -40.408 -65.273 45.831   1.00 40.45  ?  32  PHE L O     1 
ATOM   9754  C CB    . PHE M 1 32  ? -39.620 -62.355 46.044   1.00 40.45  ?  32  PHE L CB    1 
ATOM   9755  C CG    . PHE M 1 32  ? -38.881 -61.088 45.736   1.00 46.40  ?  32  PHE L CG    1 
ATOM   9756  C CD1   . PHE M 1 32  ? -38.355 -60.311 46.752   1.00 47.57  ?  32  PHE L CD1   1 
ATOM   9757  C CD2   . PHE M 1 32  ? -38.718 -60.670 44.423   1.00 47.86  ?  32  PHE L CD2   1 
ATOM   9758  C CE1   . PHE M 1 32  ? -37.682 -59.138 46.467   1.00 53.70  ?  32  PHE L CE1   1 
ATOM   9759  C CE2   . PHE M 1 32  ? -38.041 -59.501 44.133   1.00 47.61  ?  32  PHE L CE2   1 
ATOM   9760  C CZ    . PHE M 1 32  ? -37.522 -58.735 45.155   1.00 50.03  ?  32  PHE L CZ    1 
ATOM   9761  N N     . MET M 1 33  ? -39.351 -65.260 47.813   1.00 37.76  ?  33  MET L N     1 
ATOM   9762  C CA    . MET M 1 33  ? -39.936 -66.521 48.257   1.00 42.94  ?  33  MET L CA    1 
ATOM   9763  C C     . MET M 1 33  ? -40.550 -66.453 49.653   1.00 46.68  ?  33  MET L C     1 
ATOM   9764  O O     . MET M 1 33  ? -40.106 -65.687 50.508   1.00 52.71  ?  33  MET L O     1 
ATOM   9765  C CB    . MET M 1 33  ? -38.880 -67.631 48.245   1.00 44.79  ?  33  MET L CB    1 
ATOM   9766  C CG    . MET M 1 33  ? -38.468 -68.126 46.874   1.00 37.05  ?  33  MET L CG    1 
ATOM   9767  S SD    . MET M 1 33  ? -36.982 -69.140 46.971   1.00 42.02  ?  33  MET L SD    1 
ATOM   9768  C CE    . MET M 1 33  ? -35.779 -67.925 47.501   1.00 32.29  ?  33  MET L CE    1 
ATOM   9769  N N     . LEU M 1 34  ? -41.580 -67.266 49.866   1.00 45.77  ?  34  LEU L N     1 
ATOM   9770  C CA    . LEU M 1 34  ? -42.167 -67.455 51.187   1.00 47.36  ?  34  LEU L CA    1 
ATOM   9771  C C     . LEU M 1 34  ? -42.253 -68.946 51.493   1.00 47.34  ?  34  LEU L C     1 
ATOM   9772  O O     . LEU M 1 34  ? -42.931 -69.693 50.787   1.00 44.40  ?  34  LEU L O     1 
ATOM   9773  C CB    . LEU M 1 34  ? -43.554 -66.815 51.267   1.00 51.15  ?  34  LEU L CB    1 
ATOM   9774  C CG    . LEU M 1 34  ? -43.616 -65.287 51.286   1.00 52.99  ?  34  LEU L CG    1 
ATOM   9775  C CD1   . LEU M 1 34  ? -45.052 -64.818 51.137   1.00 67.81  ?  34  LEU L CD1   1 
ATOM   9776  C CD2   . LEU M 1 34  ? -43.001 -64.738 52.562   1.00 66.78  ?  34  LEU L CD2   1 
ATOM   9777  N N     . THR M 1 35  ? -41.560 -69.377 52.541   1.00 42.10  ?  35  THR L N     1 
ATOM   9778  C CA    . THR M 1 35  ? -41.627 -70.764 52.987   1.00 37.71  ?  35  THR L CA    1 
ATOM   9779  C C     . THR M 1 35  ? -42.584 -70.950 54.161   1.00 48.75  ?  35  THR L C     1 
ATOM   9780  O O     . THR M 1 35  ? -42.463 -70.275 55.192   1.00 60.24  ?  35  THR L O     1 
ATOM   9781  C CB    . THR M 1 35  ? -40.239 -71.292 53.382   1.00 39.56  ?  35  THR L CB    1 
ATOM   9782  O OG1   . THR M 1 35  ? -39.341 -71.155 52.274   1.00 41.56  ?  35  THR L OG1   1 
ATOM   9783  C CG2   . THR M 1 35  ? -40.322 -72.757 53.780   1.00 48.15  ?  35  THR L CG2   1 
ATOM   9784  N N     . VAL M 1 36  ? -43.533 -71.867 53.985   1.00 40.39  ?  36  VAL L N     1 
ATOM   9785  C CA    . VAL M 1 36  ? -44.473 -72.246 55.035   1.00 47.93  ?  36  VAL L CA    1 
ATOM   9786  C C     . VAL M 1 36  ? -44.360 -73.744 55.325   1.00 54.23  ?  36  VAL L C     1 
ATOM   9787  O O     . VAL M 1 36  ? -44.858 -74.577 54.566   1.00 51.96  ?  36  VAL L O     1 
ATOM   9788  C CB    . VAL M 1 36  ? -45.923 -71.902 54.649   1.00 49.23  ?  36  VAL L CB    1 
ATOM   9789  C CG1   . VAL M 1 36  ? -46.877 -72.307 55.761   1.00 48.65  ?  36  VAL L CG1   1 
ATOM   9790  C CG2   . VAL M 1 36  ? -46.053 -70.416 54.350   1.00 42.72  ?  36  VAL L CG2   1 
ATOM   9791  N N     . SER M 1 37  ? -43.693 -74.069 56.429   1.00 56.80  ?  37  SER L N     1 
ATOM   9792  C CA    . SER M 1 37  ? -43.370 -75.450 56.795   1.00 62.49  ?  37  SER L CA    1 
ATOM   9793  C C     . SER M 1 37  ? -44.071 -75.866 58.087   1.00 57.55  ?  37  SER L C     1 
ATOM   9794  O O     . SER M 1 37  ? -44.103 -75.103 59.042   1.00 67.89  ?  37  SER L O     1 
ATOM   9795  C CB    . SER M 1 37  ? -41.857 -75.625 56.936   1.00 76.95  ?  37  SER L CB    1 
ATOM   9796  O OG    . SER M 1 37  ? -41.229 -75.688 55.666   1.00 79.32  ?  37  SER L OG    1 
ATOM   9797  N N     . LYS M 1 38  ? -44.618 -77.079 58.120   1.00 57.09  ?  38  LYS L N     1 
ATOM   9798  C CA    . LYS M 1 38  ? -45.247 -77.598 59.338   1.00 62.21  ?  38  LYS L CA    1 
ATOM   9799  C C     . LYS M 1 38  ? -44.272 -77.642 60.514   1.00 59.03  ?  38  LYS L C     1 
ATOM   9800  O O     . LYS M 1 38  ? -43.147 -78.126 60.392   1.00 49.12  ?  38  LYS L O     1 
ATOM   9801  C CB    . LYS M 1 38  ? -45.820 -78.994 59.087   1.00 48.12  ?  38  LYS L CB    1 
ATOM   9802  N N     . ASP M 1 39  ? -44.731 -77.129 61.654   1.00 69.36  ?  39  ASP L N     1 
ATOM   9803  C CA    . ASP M 1 39  ? -43.909 -77.010 62.857   1.00 80.58  ?  39  ASP L CA    1 
ATOM   9804  C C     . ASP M 1 39  ? -44.730 -77.106 64.146   1.00 79.52  ?  39  ASP L C     1 
ATOM   9805  O O     . ASP M 1 39  ? -45.533 -76.226 64.452   1.00 69.20  ?  39  ASP L O     1 
ATOM   9806  C CB    . ASP M 1 39  ? -43.128 -75.695 62.838   1.00 85.98  ?  39  ASP L CB    1 
ATOM   9807  C CG    . ASP M 1 39  ? -42.016 -75.663 63.872   1.00 95.92  ?  39  ASP L CG    1 
ATOM   9808  O OD1   . ASP M 1 39  ? -40.875 -76.043 63.532   1.00 102.07 ?  39  ASP L OD1   1 
ATOM   9809  O OD2   . ASP M 1 39  ? -42.282 -75.262 65.025   1.00 86.88  -1 39  ASP L OD2   1 
ATOM   9810  N N     . SER M 1 40  ? -44.512 -78.184 64.893   1.00 88.22  ?  40  SER L N     1 
ATOM   9811  C CA    . SER M 1 40  ? -45.225 -78.456 66.142   1.00 89.06  ?  40  SER L CA    1 
ATOM   9812  C C     . SER M 1 40  ? -44.999 -77.375 67.200   1.00 88.02  ?  40  SER L C     1 
ATOM   9813  O O     . SER M 1 40  ? -45.866 -77.125 68.039   1.00 69.43  ?  40  SER L O     1 
ATOM   9814  C CB    . SER M 1 40  ? -44.801 -79.816 66.704   1.00 71.67  ?  40  SER L CB    1 
ATOM   9815  O OG    . SER M 1 40  ? -44.585 -80.754 65.665   1.00 87.43  ?  40  SER L OG    1 
ATOM   9816  N N     . LYS M 1 41  ? -43.836 -76.736 67.153   1.00 88.06  ?  41  LYS L N     1 
ATOM   9817  C CA    . LYS M 1 41  ? -43.421 -75.794 68.188   1.00 68.02  ?  41  LYS L CA    1 
ATOM   9818  C C     . LYS M 1 41  ? -44.139 -74.447 68.102   1.00 73.37  ?  41  LYS L C     1 
ATOM   9819  O O     . LYS M 1 41  ? -44.085 -73.656 69.043   1.00 74.68  ?  41  LYS L O     1 
ATOM   9820  C CB    . LYS M 1 41  ? -41.909 -75.571 68.117   1.00 60.64  ?  41  LYS L CB    1 
ATOM   9821  N N     . ARG M 1 42  ? -44.819 -74.187 66.990   1.00 90.39  ?  42  ARG L N     1 
ATOM   9822  C CA    . ARG M 1 42  ? -45.493 -72.904 66.812   1.00 98.95  ?  42  ARG L CA    1 
ATOM   9823  C C     . ARG M 1 42  ? -46.957 -73.005 67.231   1.00 83.45  ?  42  ARG L C     1 
ATOM   9824  O O     . ARG M 1 42  ? -47.558 -74.076 67.160   1.00 67.67  ?  42  ARG L O     1 
ATOM   9825  C CB    . ARG M 1 42  ? -45.428 -72.454 65.349   1.00 89.73  ?  42  ARG L CB    1 
ATOM   9826  C CG    . ARG M 1 42  ? -44.114 -72.705 64.626   1.00 78.00  ?  42  ARG L CG    1 
ATOM   9827  C CD    . ARG M 1 42  ? -42.943 -71.947 65.212   1.00 72.48  ?  42  ARG L CD    1 
ATOM   9828  N NE    . ARG M 1 42  ? -41.743 -72.160 64.408   1.00 81.90  ?  42  ARG L NE    1 
ATOM   9829  C CZ    . ARG M 1 42  ? -40.622 -71.458 64.532   1.00 75.63  ?  42  ARG L CZ    1 
ATOM   9830  N NH1   . ARG M 1 42  ? -40.544 -70.485 65.429   1.00 73.84  1  42  ARG L NH1   1 
ATOM   9831  N NH2   . ARG M 1 42  ? -39.581 -71.724 63.754   1.00 50.96  ?  42  ARG L NH2   1 
ATOM   9832  N N     . ASN M 1 43  ? -47.526 -71.888 67.676   1.00 82.87  ?  43  ASN L N     1 
ATOM   9833  C CA    . ASN M 1 43  ? -48.904 -71.873 68.156   1.00 88.56  ?  43  ASN L CA    1 
ATOM   9834  C C     . ASN M 1 43  ? -49.903 -72.154 67.038   1.00 83.42  ?  43  ASN L C     1 
ATOM   9835  O O     . ASN M 1 43  ? -50.958 -72.748 67.263   1.00 78.09  ?  43  ASN L O     1 
ATOM   9836  C CB    . ASN M 1 43  ? -49.225 -70.529 68.813   1.00 91.38  ?  43  ASN L CB    1 
ATOM   9837  N N     . THR M 1 44  ? -49.559 -71.717 65.830   1.00 87.85  ?  44  THR L N     1 
ATOM   9838  C CA    . THR M 1 44  ? -50.377 -71.976 64.651   1.00 84.72  ?  44  THR L CA    1 
ATOM   9839  C C     . THR M 1 44  ? -50.089 -73.351 64.061   1.00 80.06  ?  44  THR L C     1 
ATOM   9840  O O     . THR M 1 44  ? -50.858 -73.859 63.244   1.00 63.72  ?  44  THR L O     1 
ATOM   9841  C CB    . THR M 1 44  ? -50.155 -70.905 63.566   1.00 78.03  ?  44  THR L CB    1 
ATOM   9842  O OG1   . THR M 1 44  ? -48.788 -70.929 63.137   1.00 91.07  ?  44  THR L OG1   1 
ATOM   9843  C CG2   . THR M 1 44  ? -50.490 -69.521 64.104   1.00 75.29  ?  44  THR L CG2   1 
ATOM   9844  N N     . GLY M 1 45  ? -48.978 -73.951 64.478   1.00 85.72  ?  45  GLY L N     1 
ATOM   9845  C CA    . GLY M 1 45  ? -48.562 -75.227 63.929   1.00 80.48  ?  45  GLY L CA    1 
ATOM   9846  C C     . GLY M 1 45  ? -47.715 -75.071 62.682   1.00 81.77  ?  45  GLY L C     1 
ATOM   9847  O O     . GLY M 1 45  ? -47.320 -76.060 62.063   1.00 74.18  ?  45  GLY L O     1 
ATOM   9848  N N     . TRP M 1 46  ? -47.435 -73.827 62.306   1.00 84.45  ?  46  TRP L N     1 
ATOM   9849  C CA    . TRP M 1 46  ? -46.675 -73.568 61.092   1.00 69.83  ?  46  TRP L CA    1 
ATOM   9850  C C     . TRP M 1 46  ? -45.580 -72.518 61.279   1.00 74.44  ?  46  TRP L C     1 
ATOM   9851  O O     . TRP M 1 46  ? -45.712 -71.579 62.066   1.00 89.98  ?  46  TRP L O     1 
ATOM   9852  C CB    . TRP M 1 46  ? -47.632 -73.154 59.972   1.00 66.00  ?  46  TRP L CB    1 
ATOM   9853  C CG    . TRP M 1 46  ? -48.572 -74.262 59.595   1.00 74.50  ?  46  TRP L CG    1 
ATOM   9854  C CD1   . TRP M 1 46  ? -49.774 -74.549 60.176   1.00 75.47  ?  46  TRP L CD1   1 
ATOM   9855  C CD2   . TRP M 1 46  ? -48.390 -75.231 58.554   1.00 70.68  ?  46  TRP L CD2   1 
ATOM   9856  N NE1   . TRP M 1 46  ? -50.346 -75.640 59.568   1.00 68.34  ?  46  TRP L NE1   1 
ATOM   9857  C CE2   . TRP M 1 46  ? -49.519 -76.075 58.567   1.00 70.86  ?  46  TRP L CE2   1 
ATOM   9858  C CE3   . TRP M 1 46  ? -47.385 -75.466 57.613   1.00 60.36  ?  46  TRP L CE3   1 
ATOM   9859  C CZ2   . TRP M 1 46  ? -49.669 -77.135 57.676   1.00 63.07  ?  46  TRP L CZ2   1 
ATOM   9860  C CZ3   . TRP M 1 46  ? -47.534 -76.521 56.731   1.00 63.26  ?  46  TRP L CZ3   1 
ATOM   9861  C CH2   . TRP M 1 46  ? -48.668 -77.341 56.768   1.00 60.63  ?  46  TRP L CH2   1 
ATOM   9862  N N     . SER M 1 47  ? -44.502 -72.702 60.526   1.00 60.31  ?  47  SER L N     1 
ATOM   9863  C CA    . SER M 1 47  ? -43.383 -71.774 60.456   1.00 60.29  ?  47  SER L CA    1 
ATOM   9864  C C     . SER M 1 47  ? -43.410 -71.048 59.117   1.00 67.62  ?  47  SER L C     1 
ATOM   9865  O O     . SER M 1 47  ? -43.521 -71.666 58.057   1.00 66.70  ?  47  SER L O     1 
ATOM   9866  C CB    . SER M 1 47  ? -42.054 -72.507 60.644   1.00 68.91  ?  47  SER L CB    1 
ATOM   9867  O OG    . SER M 1 47  ? -41.712 -73.243 59.483   1.00 99.23  ?  47  SER L OG    1 
ATOM   9868  N N     . VAL M 1 48  ? -43.308 -69.728 59.182   1.00 59.82  ?  48  VAL L N     1 
ATOM   9869  C CA    . VAL M 1 48  ? -43.325 -68.880 58.000   1.00 46.10  ?  48  VAL L CA    1 
ATOM   9870  C C     . VAL M 1 48  ? -42.089 -67.997 57.917   1.00 43.03  ?  48  VAL L C     1 
ATOM   9871  O O     . VAL M 1 48  ? -41.724 -67.341 58.891   1.00 55.62  ?  48  VAL L O     1 
ATOM   9872  C CB    . VAL M 1 48  ? -44.583 -67.987 57.978   1.00 59.29  ?  48  VAL L CB    1 
ATOM   9873  C CG1   . VAL M 1 48  ? -44.407 -66.818 57.012   1.00 72.79  ?  48  VAL L CG1   1 
ATOM   9874  C CG2   . VAL M 1 48  ? -45.801 -68.810 57.607   1.00 66.22  ?  48  VAL L CG2   1 
ATOM   9875  N N     . ARG M 1 49  ? -41.440 -67.988 56.758   1.00 43.19  ?  49  ARG L N     1 
ATOM   9876  C CA    . ARG M 1 49  ? -40.246 -67.166 56.597   1.00 37.87  ?  49  ARG L CA    1 
ATOM   9877  C C     . ARG M 1 49  ? -40.081 -66.644 55.180   1.00 52.07  ?  49  ARG L C     1 
ATOM   9878  O O     . ARG M 1 49  ? -40.404 -67.323 54.205   1.00 53.12  ?  49  ARG L O     1 
ATOM   9879  C CB    . ARG M 1 49  ? -38.969 -67.936 56.949   1.00 44.18  ?  49  ARG L CB    1 
ATOM   9880  C CG    . ARG M 1 49  ? -38.668 -69.080 55.988   1.00 46.79  ?  49  ARG L CG    1 
ATOM   9881  C CD    . ARG M 1 49  ? -37.575 -69.993 56.494   1.00 47.17  ?  49  ARG L CD    1 
ATOM   9882  N NE    . ARG M 1 49  ? -36.311 -69.260 56.532   1.00 29.62  ?  49  ARG L NE    1 
ATOM   9883  C CZ    . ARG M 1 49  ? -35.140 -69.791 56.861   1.00 40.99  ?  49  ARG L CZ    1 
ATOM   9884  N NH1   . ARG M 1 49  ? -35.057 -71.073 57.186   1.00 51.82  1  49  ARG L NH1   1 
ATOM   9885  N NH2   . ARG M 1 49  ? -34.048 -69.038 56.856   1.00 32.93  ?  49  ARG L NH2   1 
ATOM   9886  N N     . PRO M 1 50  ? -39.606 -65.402 55.072   1.00 49.31  ?  50  PRO L N     1 
ATOM   9887  C CA    . PRO M 1 50  ? -39.368 -64.773 53.777   1.00 49.41  ?  50  PRO L CA    1 
ATOM   9888  C C     . PRO M 1 50  ? -37.926 -64.952 53.309   1.00 51.43  ?  50  PRO L C     1 
ATOM   9889  O O     . PRO M 1 50  ? -37.017 -65.047 54.136   1.00 58.35  ?  50  PRO L O     1 
ATOM   9890  C CB    . PRO M 1 50  ? -39.681 -63.303 54.059   1.00 51.71  ?  50  PRO L CB    1 
ATOM   9891  C CG    . PRO M 1 50  ? -39.289 -63.118 55.501   1.00 52.13  ?  50  PRO L CG    1 
ATOM   9892  C CD    . PRO M 1 50  ? -39.404 -64.458 56.187   1.00 39.35  ?  50  PRO L CD    1 
ATOM   9893  N N     . ARG M 1 51  ? -37.724 -64.995 51.997   1.00 43.42  ?  51  ARG L N     1 
ATOM   9894  C CA    . ARG M 1 51  ? -36.385 -65.105 51.433   1.00 40.01  ?  51  ARG L CA    1 
ATOM   9895  C C     . ARG M 1 51  ? -36.284 -64.251 50.180   1.00 48.32  ?  51  ARG L C     1 
ATOM   9896  O O     . ARG M 1 51  ? -37.233 -64.150 49.405   1.00 43.06  ?  51  ARG L O     1 
ATOM   9897  C CB    . ARG M 1 51  ? -36.022 -66.550 51.064   1.00 45.10  ?  51  ARG L CB    1 
ATOM   9898  C CG    . ARG M 1 51  ? -36.400 -67.652 52.033   1.00 35.79  ?  51  ARG L CG    1 
ATOM   9899  C CD    . ARG M 1 51  ? -36.023 -68.994 51.409   1.00 48.11  ?  51  ARG L CD    1 
ATOM   9900  N NE    . ARG M 1 51  ? -36.601 -70.141 52.100   1.00 34.88  ?  51  ARG L NE    1 
ATOM   9901  C CZ    . ARG M 1 51  ? -35.929 -70.921 52.939   1.00 47.83  ?  51  ARG L CZ    1 
ATOM   9902  N NH1   . ARG M 1 51  ? -34.650 -70.678 53.187   1.00 45.59  1  51  ARG L NH1   1 
ATOM   9903  N NH2   . ARG M 1 51  ? -36.527 -71.961 53.505   1.00 73.34  ?  51  ARG L NH2   1 
ATOM   9904  N N     . PHE M 1 52  ? -35.132 -63.627 49.990   1.00 50.28  ?  52  PHE L N     1 
ATOM   9905  C CA    . PHE M 1 52  ? -34.791 -63.037 48.710   1.00 44.30  ?  52  PHE L CA    1 
ATOM   9906  C C     . PHE M 1 52  ? -33.462 -63.578 48.236   1.00 46.28  ?  52  PHE L C     1 
ATOM   9907  O O     . PHE M 1 52  ? -32.517 -63.639 49.012   1.00 52.57  ?  52  PHE L O     1 
ATOM   9908  C CB    . PHE M 1 52  ? -34.741 -61.512 48.779   1.00 49.95  ?  52  PHE L CB    1 
ATOM   9909  C CG    . PHE M 1 52  ? -34.186 -60.872 47.536   1.00 48.12  ?  52  PHE L CG    1 
ATOM   9910  C CD1   . PHE M 1 52  ? -34.920 -60.850 46.367   1.00 48.01  ?  52  PHE L CD1   1 
ATOM   9911  C CD2   . PHE M 1 52  ? -32.931 -60.281 47.545   1.00 49.65  ?  52  PHE L CD2   1 
ATOM   9912  C CE1   . PHE M 1 52  ? -34.416 -60.261 45.219   1.00 50.23  ?  52  PHE L CE1   1 
ATOM   9913  C CE2   . PHE M 1 52  ? -32.422 -59.688 46.400   1.00 55.47  ?  52  PHE L CE2   1 
ATOM   9914  C CZ    . PHE M 1 52  ? -33.167 -59.678 45.236   1.00 50.02  ?  52  PHE L CZ    1 
ATOM   9915  N N     . ARG M 1 53  ? -33.360 -63.981 46.979   1.00 39.87  ?  53  ARG L N     1 
ATOM   9916  C CA    . ARG M 1 53  ? -32.118 -64.623 46.591   1.00 41.94  ?  53  ARG L CA    1 
ATOM   9917  C C     . ARG M 1 53  ? -31.817 -64.341 45.144   1.00 50.25  ?  53  ARG L C     1 
ATOM   9918  O O     . ARG M 1 53  ? -32.720 -64.295 44.314   1.00 56.25  ?  53  ARG L O     1 
ATOM   9919  C CB    . ARG M 1 53  ? -32.230 -66.135 46.793   1.00 38.72  ?  53  ARG L CB    1 
ATOM   9920  C CG    . ARG M 1 53  ? -30.932 -66.922 46.767   1.00 50.15  ?  53  ARG L CG    1 
ATOM   9921  C CD    . ARG M 1 53  ? -31.170 -68.318 47.329   1.00 47.34  ?  53  ARG L CD    1 
ATOM   9922  N NE    . ARG M 1 53  ? -32.029 -69.103 46.442   1.00 46.35  ?  53  ARG L NE    1 
ATOM   9923  C CZ    . ARG M 1 53  ? -32.914 -70.006 46.854   1.00 56.20  ?  53  ARG L CZ    1 
ATOM   9924  N NH1   . ARG M 1 53  ? -33.068 -70.247 48.148   1.00 37.76  1  53  ARG L NH1   1 
ATOM   9925  N NH2   . ARG M 1 53  ? -33.646 -70.669 45.968   1.00 68.96  ?  53  ARG L NH2   1 
ATOM   9926  N N     . ILE M 1 54  ? -30.540 -64.185 44.825   1.00 51.29  ?  54  ILE L N     1 
ATOM   9927  C CA    . ILE M 1 54  ? -30.148 -64.203 43.427   1.00 52.30  ?  54  ILE L CA    1 
ATOM   9928  C C     . ILE M 1 54  ? -29.044 -65.253 43.271   1.00 49.65  ?  54  ILE L C     1 
ATOM   9929  O O     . ILE M 1 54  ? -28.067 -65.273 44.021   1.00 53.24  ?  54  ILE L O     1 
ATOM   9930  C CB    . ILE M 1 54  ? -29.798 -62.788 42.890   1.00 39.58  ?  54  ILE L CB    1 
ATOM   9931  C CG1   . ILE M 1 54  ? -29.211 -62.866 41.488   1.00 65.43  ?  54  ILE L CG1   1 
ATOM   9932  C CG2   . ILE M 1 54  ? -28.927 -62.005 43.825   1.00 43.55  ?  54  ILE L CG2   1 
ATOM   9933  C CD1   . ILE M 1 54  ? -29.302 -61.554 40.776   1.00 73.51  ?  54  ILE L CD1   1 
ATOM   9934  N N     . GLY M 1 55  ? -29.243 -66.120 42.284   1.00 52.79  ?  55  GLY L N     1 
ATOM   9935  C CA    . GLY M 1 55  ? -28.313 -67.182 41.974   1.00 56.27  ?  55  GLY L CA    1 
ATOM   9936  C C     . GLY M 1 55  ? -27.771 -67.047 40.565   1.00 73.40  ?  55  GLY L C     1 
ATOM   9937  O O     . GLY M 1 55  ? -28.426 -66.506 39.674   1.00 83.12  ?  55  GLY L O     1 
ATOM   9938  N N     . LEU M 1 56  ? -26.560 -67.550 40.379   1.00 70.28  ?  56  LEU L N     1 
ATOM   9939  C CA    . LEU M 1 56  ? -25.857 -67.515 39.094   1.00 62.05  ?  56  LEU L CA    1 
ATOM   9940  C C     . LEU M 1 56  ? -24.915 -68.707 38.999   1.00 67.85  ?  56  LEU L C     1 
ATOM   9941  O O     . LEU M 1 56  ? -24.673 -69.391 39.998   1.00 72.26  ?  56  LEU L O     1 
ATOM   9942  C CB    . LEU M 1 56  ? -25.037 -66.241 38.970   1.00 41.66  ?  56  LEU L CB    1 
ATOM   9943  C CG    . LEU M 1 56  ? -25.780 -64.956 39.246   1.00 43.14  ?  56  LEU L CG    1 
ATOM   9944  C CD1   . LEU M 1 56  ? -24.775 -63.807 39.169   1.00 61.95  ?  56  LEU L CD1   1 
ATOM   9945  C CD2   . LEU M 1 56  ? -26.912 -64.833 38.234   1.00 65.29  ?  56  LEU L CD2   1 
ATOM   9946  N N     . HIS M 1 57  ? -24.368 -68.934 37.808   1.00 57.75  ?  57  HIS L N     1 
ATOM   9947  C CA    . HIS M 1 57  ? -23.303 -69.914 37.631   1.00 63.84  ?  57  HIS L CA    1 
ATOM   9948  C C     . HIS M 1 57  ? -22.102 -69.519 38.482   1.00 68.31  ?  57  HIS L C     1 
ATOM   9949  O O     . HIS M 1 57  ? -21.825 -68.330 38.669   1.00 66.54  ?  57  HIS L O     1 
ATOM   9950  C CB    . HIS M 1 57  ? -22.913 -70.048 36.154   1.00 87.14  ?  57  HIS L CB    1 
ATOM   9951  C CG    . HIS M 1 57  ? -22.031 -71.224 35.872   1.00 94.83  ?  57  HIS L CG    1 
ATOM   9952  N ND1   . HIS M 1 57  ? -20.692 -71.262 36.196   1.00 95.31  ?  57  HIS L ND1   1 
ATOM   9953  C CD2   . HIS M 1 57  ? -22.319 -72.426 35.319   1.00 94.68  ?  57  HIS L CD2   1 
ATOM   9954  C CE1   . HIS M 1 57  ? -20.190 -72.432 35.840   1.00 87.66  ?  57  HIS L CE1   1 
ATOM   9955  N NE2   . HIS M 1 57  ? -21.157 -73.156 35.305   1.00 90.62  ?  57  HIS L NE2   1 
ATOM   9956  N N     . ASN M 1 58  ? -21.407 -70.527 39.006   1.00 69.25  ?  58  ASN L N     1 
ATOM   9957  C CA    . ASN M 1 58  ? -20.198 -70.328 39.803   1.00 67.40  ?  58  ASN L CA    1 
ATOM   9958  C C     . ASN M 1 58  ? -19.199 -69.349 39.180   1.00 71.43  ?  58  ASN L C     1 
ATOM   9959  O O     . ASN M 1 58  ? -18.581 -68.548 39.889   1.00 59.01  ?  58  ASN L O     1 
ATOM   9960  C CB    . ASN M 1 58  ? -19.515 -71.688 40.010   1.00 64.56  ?  58  ASN L CB    1 
ATOM   9961  C CG    . ASN M 1 58  ? -20.145 -72.488 41.137   1.00 76.90  ?  58  ASN L CG    1 
ATOM   9962  O OD1   . ASN M 1 58  ? -20.587 -71.930 42.141   1.00 79.65  ?  58  ASN L OD1   1 
ATOM   9963  N ND2   . ASN M 1 58  ? -20.206 -73.804 40.964   1.00 83.20  ?  58  ASN L ND2   1 
ATOM   9964  N N     . LYS M 1 59  ? -19.135 -69.323 37.854   1.00 90.49  ?  59  LYS L N     1 
ATOM   9965  C CA    . LYS M 1 59  ? -18.170 -68.476 37.167   1.00 90.75  ?  59  LYS L CA    1 
ATOM   9966  C C     . LYS M 1 59  ? -18.447 -67.006 37.458   1.00 91.81  ?  59  LYS L C     1 
ATOM   9967  O O     . LYS M 1 59  ? -17.597 -66.146 37.225   1.00 91.16  ?  59  LYS L O     1 
ATOM   9968  C CB    . LYS M 1 59  ? -18.209 -68.729 35.657   1.00 61.83  ?  59  LYS L CB    1 
ATOM   9969  N N     . ASP M 1 60  ? -19.639 -66.723 37.972   1.00 88.61  ?  60  ASP L N     1 
ATOM   9970  C CA    . ASP M 1 60  ? -20.039 -65.348 38.186   1.00 90.01  ?  60  ASP L CA    1 
ATOM   9971  C C     . ASP M 1 60  ? -20.184 -65.012 39.670   1.00 79.83  ?  60  ASP L C     1 
ATOM   9972  O O     . ASP M 1 60  ? -20.875 -64.041 40.010   1.00 63.39  ?  60  ASP L O     1 
ATOM   9973  C CB    . ASP M 1 60  ? -21.368 -65.086 37.476   1.00 81.52  ?  60  ASP L CB    1 
ATOM   9974  C CG    . ASP M 1 60  ? -21.180 -64.590 36.067   1.00 80.27  ?  60  ASP L CG    1 
ATOM   9975  O OD1   . ASP M 1 60  ? -20.143 -63.952 35.807   1.00 86.30  ?  60  ASP L OD1   1 
ATOM   9976  O OD2   . ASP M 1 60  ? -22.065 -64.840 35.221   1.00 74.33  -1 60  ASP L OD2   1 
ATOM   9977  N N     . VAL M 1 61  ? -19.486 -65.743 40.547   1.00 79.08  ?  61  VAL L N     1 
ATOM   9978  C CA    . VAL M 1 61  ? -19.471 -65.349 41.964   1.00 78.40  ?  61  VAL L CA    1 
ATOM   9979  C C     . VAL M 1 61  ? -19.092 -63.886 42.177   1.00 82.01  ?  61  VAL L C     1 
ATOM   9980  O O     . VAL M 1 61  ? -19.668 -63.197 43.028   1.00 83.47  ?  61  VAL L O     1 
ATOM   9981  C CB    . VAL M 1 61  ? -18.492 -66.216 42.800   1.00 84.66  ?  61  VAL L CB    1 
ATOM   9982  C CG1   . VAL M 1 61  ? -18.461 -65.752 44.249   1.00 102.33 ?  61  VAL L CG1   1 
ATOM   9983  C CG2   . VAL M 1 61  ? -18.855 -67.682 42.727   1.00 84.99  ?  61  VAL L CG2   1 
ATOM   9984  N N     . THR M 1 62  ? -18.181 -63.398 41.344   1.00 86.41  ?  62  THR L N     1 
ATOM   9985  C CA    . THR M 1 62  ? -17.720 -62.022 41.441   1.00 96.70  ?  62  THR L CA    1 
ATOM   9986  C C     . THR M 1 62  ? -18.835 -60.990 41.331   1.00 93.15  ?  62  THR L C     1 
ATOM   9987  O O     . THR M 1 62  ? -18.851 -60.013 42.091   1.00 90.30  ?  62  THR L O     1 
ATOM   9988  C CB    . THR M 1 62  ? -16.679 -61.715 40.345   1.00 88.84  ?  62  THR L CB    1 
ATOM   9989  O OG1   . THR M 1 62  ? -17.292 -61.833 39.055   1.00 80.24  ?  62  THR L OG1   1 
ATOM   9990  C CG2   . THR M 1 62  ? -15.510 -62.683 40.436   1.00 89.66  ?  62  THR L CG2   1 
ATOM   9991  N N     . ILE M 1 63  ? -19.846 -61.288 40.517   1.00 89.88  ?  63  ILE L N     1 
ATOM   9992  C CA    . ILE M 1 63  ? -20.978 -60.376 40.388   1.00 90.44  ?  63  ILE L CA    1 
ATOM   9993  C C     . ILE M 1 63  ? -21.675 -60.219 41.723   1.00 84.30  ?  63  ILE L C     1 
ATOM   9994  O O     . ILE M 1 63  ? -21.934 -59.097 42.178   1.00 71.82  ?  63  ILE L O     1 
ATOM   9995  C CB    . ILE M 1 63  ? -21.989 -60.873 39.335   1.00 60.30  ?  63  ILE L CB    1 
ATOM   9996  N N     . LEU M 1 64  ? -21.872 -61.343 42.395   1.00 80.70  ?  64  LEU L N     1 
ATOM   9997  C CA    . LEU M 1 64  ? -22.551 -61.346 43.672   1.00 65.25  ?  64  LEU L CA    1 
ATOM   9998  C C     . LEU M 1 64  ? -21.755 -60.527 44.671   1.00 69.76  ?  64  LEU L C     1 
ATOM   9999  O O     . LEU M 1 64  ? -22.325 -59.721 45.416   1.00 58.60  ?  64  LEU L O     1 
ATOM   10000 C CB    . LEU M 1 64  ? -22.748 -62.774 44.180   1.00 54.31  ?  64  LEU L CB    1 
ATOM   10001 C CG    . LEU M 1 64  ? -23.445 -63.738 43.219   1.00 68.40  ?  64  LEU L CG    1 
ATOM   10002 C CD1   . LEU M 1 64  ? -23.655 -65.091 43.879   1.00 68.76  ?  64  LEU L CD1   1 
ATOM   10003 C CD2   . LEU M 1 64  ? -24.772 -63.158 42.750   1.00 61.80  ?  64  LEU L CD2   1 
ATOM   10004 N N     . LYS M 1 65  ? -20.431 -60.631 44.600   1.00 68.57  ?  65  LYS L N     1 
ATOM   10005 C CA    . LYS M 1 65  ? -19.603 -59.874 45.524   1.00 73.11  ?  65  LYS L CA    1 
ATOM   10006 C C     . LYS M 1 65  ? -19.782 -58.382 45.326   1.00 75.07  ?  65  LYS L C     1 
ATOM   10007 O O     . LYS M 1 65  ? -19.913 -57.640 46.308   1.00 67.44  ?  65  LYS L O     1 
ATOM   10008 C CB    . LYS M 1 65  ? -18.130 -60.254 45.354   1.00 70.21  ?  65  LYS L CB    1 
ATOM   10009 N N     . SER M 1 66  ? -19.940 -57.961 44.077   1.00 76.35  ?  66  SER L N     1 
ATOM   10010 C CA    . SER M 1 66  ? -20.120 -56.546 43.810   1.00 80.42  ?  66  SER L CA    1 
ATOM   10011 C C     . SER M 1 66  ? -21.416 -56.101 44.459   1.00 80.44  ?  66  SER L C     1 
ATOM   10012 O O     . SER M 1 66  ? -21.448 -55.089 45.169   1.00 76.29  ?  66  SER L O     1 
ATOM   10013 C CB    . SER M 1 66  ? -20.138 -56.264 42.308   1.00 88.31  ?  66  SER L CB    1 
ATOM   10014 O OG    . SER M 1 66  ? -20.239 -54.874 42.053   1.00 93.35  ?  66  SER L OG    1 
ATOM   10015 N N     . ILE M 1 67  ? -22.444 -56.931 44.329   1.00 72.87  ?  67  ILE L N     1 
ATOM   10016 C CA    . ILE M 1 67  ? -23.726 -56.620 44.936   1.00 80.64  ?  67  ILE L CA    1 
ATOM   10017 C C     . ILE M 1 67  ? -23.551 -56.574 46.441   1.00 85.23  ?  67  ILE L C     1 
ATOM   10018 O O     . ILE M 1 67  ? -23.991 -55.621 47.093   1.00 76.01  ?  67  ILE L O     1 
ATOM   10019 C CB    . ILE M 1 67  ? -24.808 -57.646 44.566   1.00 80.45  ?  67  ILE L CB    1 
ATOM   10020 C CG1   . ILE M 1 67  ? -25.188 -57.508 43.091   1.00 75.60  ?  67  ILE L CG1   1 
ATOM   10021 C CG2   . ILE M 1 67  ? -26.035 -57.468 45.445   1.00 82.79  ?  67  ILE L CG2   1 
ATOM   10022 C CD1   . ILE M 1 67  ? -26.109 -58.599 42.597   1.00 69.88  ?  67  ILE L CD1   1 
ATOM   10023 N N     . ARG M 1 68  ? -22.855 -57.570 46.978   1.00 79.38  ?  68  ARG L N     1 
ATOM   10024 C CA    . ARG M 1 68  ? -22.601 -57.610 48.407   1.00 73.27  ?  68  ARG L CA    1 
ATOM   10025 C C     . ARG M 1 68  ? -21.871 -56.340 48.813   1.00 79.69  ?  68  ARG L C     1 
ATOM   10026 O O     . ARG M 1 68  ? -22.305 -55.636 49.739   1.00 75.82  ?  68  ARG L O     1 
ATOM   10027 C CB    . ARG M 1 68  ? -21.782 -58.852 48.772   1.00 69.42  ?  68  ARG L CB    1 
ATOM   10028 C CG    . ARG M 1 68  ? -21.094 -58.797 50.127   1.00 64.31  ?  68  ARG L CG    1 
ATOM   10029 C CD    . ARG M 1 68  ? -22.074 -59.041 51.262   1.00 73.70  ?  68  ARG L CD    1 
ATOM   10030 N NE    . ARG M 1 68  ? -21.727 -58.289 52.464   1.00 86.57  ?  68  ARG L NE    1 
ATOM   10031 C CZ    . ARG M 1 68  ? -22.115 -58.621 53.691   1.00 87.28  ?  68  ARG L CZ    1 
ATOM   10032 N NH1   . ARG M 1 68  ? -22.868 -59.696 53.884   1.00 85.18  1  68  ARG L NH1   1 
ATOM   10033 N NH2   . ARG M 1 68  ? -21.751 -57.879 54.728   1.00 85.04  ?  68  ARG L NH2   1 
ATOM   10034 N N     . GLU M 1 69  ? -20.898 -55.948 47.994   1.00 83.26  ?  69  GLU L N     1 
ATOM   10035 C CA    . GLU M 1 69  ? -20.086 -54.785 48.308   1.00 80.93  ?  69  GLU L CA    1 
ATOM   10036 C C     . GLU M 1 69  ? -20.968 -53.559 48.270   1.00 79.64  ?  69  GLU L C     1 
ATOM   10037 O O     . GLU M 1 69  ? -20.790 -52.638 49.067   1.00 85.46  ?  69  GLU L O     1 
ATOM   10038 C CB    . GLU M 1 69  ? -18.920 -54.647 47.327   1.00 76.06  ?  69  GLU L CB    1 
ATOM   10039 N N     . TYR M 1 70  ? -21.911 -53.536 47.337   1.00 73.97  ?  70  TYR L N     1 
ATOM   10040 C CA    . TYR M 1 70  ? -22.826 -52.417 47.286   1.00 71.38  ?  70  TYR L CA    1 
ATOM   10041 C C     . TYR M 1 70  ? -23.668 -52.342 48.560   1.00 72.39  ?  70  TYR L C     1 
ATOM   10042 O O     . TYR M 1 70  ? -23.755 -51.284 49.184   1.00 68.66  ?  70  TYR L O     1 
ATOM   10043 C CB    . TYR M 1 70  ? -23.740 -52.508 46.061   1.00 74.78  ?  70  TYR L CB    1 
ATOM   10044 C CG    . TYR M 1 70  ? -24.600 -51.277 45.862   1.00 72.18  ?  70  TYR L CG    1 
ATOM   10045 C CD1   . TYR M 1 70  ? -24.159 -50.215 45.085   1.00 72.43  ?  70  TYR L CD1   1 
ATOM   10046 C CD2   . TYR M 1 70  ? -25.848 -51.173 46.466   1.00 70.40  ?  70  TYR L CD2   1 
ATOM   10047 C CE1   . TYR M 1 70  ? -24.937 -49.084 44.913   1.00 80.23  ?  70  TYR L CE1   1 
ATOM   10048 C CE2   . TYR M 1 70  ? -26.634 -50.050 46.295   1.00 72.26  ?  70  TYR L CE2   1 
ATOM   10049 C CZ    . TYR M 1 70  ? -26.174 -49.008 45.519   1.00 84.62  ?  70  TYR L CZ    1 
ATOM   10050 O OH    . TYR M 1 70  ? -26.956 -47.890 45.343   1.00 93.97  ?  70  TYR L OH    1 
ATOM   10051 N N     . LEU M 1 71  ? -24.291 -53.456 48.946   1.00 74.44  ?  71  LEU L N     1 
ATOM   10052 C CA    . LEU M 1 71  ? -25.302 -53.366 50.003   1.00 70.53  ?  71  LEU L CA    1 
ATOM   10053 C C     . LEU M 1 71  ? -24.797 -53.480 51.437   1.00 74.23  ?  71  LEU L C     1 
ATOM   10054 O O     . LEU M 1 71  ? -25.458 -53.019 52.368   1.00 71.70  ?  71  LEU L O     1 
ATOM   10055 C CB    . LEU M 1 71  ? -26.384 -54.423 49.770   1.00 62.30  ?  71  LEU L CB    1 
ATOM   10056 C CG    . LEU M 1 71  ? -27.181 -54.251 48.475   1.00 67.25  ?  71  LEU L CG    1 
ATOM   10057 C CD1   . LEU M 1 71  ? -27.954 -55.514 48.136   1.00 68.13  ?  71  LEU L CD1   1 
ATOM   10058 C CD2   . LEU M 1 71  ? -28.117 -53.055 48.575   1.00 58.71  ?  71  LEU L CD2   1 
ATOM   10059 N N     . GLY M 1 72  ? -23.630 -54.084 51.617   1.00 81.30  ?  72  GLY L N     1 
ATOM   10060 C CA    . GLY M 1 72  ? -23.117 -54.320 52.953   1.00 80.37  ?  72  GLY L CA    1 
ATOM   10061 C C     . GLY M 1 72  ? -23.946 -55.395 53.631   1.00 70.63  ?  72  GLY L C     1 
ATOM   10062 O O     . GLY M 1 72  ? -24.089 -55.404 54.854   1.00 97.28  ?  72  GLY L O     1 
ATOM   10063 N N     . ALA M 1 73  ? -24.491 -56.305 52.829   1.00 68.68  ?  73  ALA L N     1 
ATOM   10064 C CA    . ALA M 1 73  ? -25.395 -57.337 53.326   1.00 70.39  ?  73  ALA L CA    1 
ATOM   10065 C C     . ALA M 1 73  ? -25.538 -58.460 52.307   1.00 73.36  ?  73  ALA L C     1 
ATOM   10066 O O     . ALA M 1 73  ? -25.237 -58.278 51.128   1.00 75.10  ?  73  ALA L O     1 
ATOM   10067 C CB    . ALA M 1 73  ? -26.756 -56.742 53.655   1.00 49.96  ?  73  ALA L CB    1 
ATOM   10068 N N     . GLY M 1 74  ? -26.008 -59.618 52.761   1.00 68.95  ?  74  GLY L N     1 
ATOM   10069 C CA    . GLY M 1 74  ? -26.167 -60.757 51.877   1.00 50.43  ?  74  GLY L CA    1 
ATOM   10070 C C     . GLY M 1 74  ? -25.188 -61.862 52.213   1.00 50.59  ?  74  GLY L C     1 
ATOM   10071 O O     . GLY M 1 74  ? -24.046 -61.593 52.580   1.00 69.73  ?  74  GLY L O     1 
ATOM   10072 N N     . ILE M 1 75  ? -25.628 -63.109 52.088   1.00 49.73  ?  75  ILE L N     1 
ATOM   10073 C CA    . ILE M 1 75  ? -24.758 -64.241 52.384   1.00 51.29  ?  75  ILE L CA    1 
ATOM   10074 C C     . ILE M 1 75  ? -24.454 -65.003 51.101   1.00 47.64  ?  75  ILE L C     1 
ATOM   10075 O O     . ILE M 1 75  ? -25.362 -65.458 50.404   1.00 55.10  ?  75  ILE L O     1 
ATOM   10076 C CB    . ILE M 1 75  ? -25.383 -65.191 53.422   1.00 47.59  ?  75  ILE L CB    1 
ATOM   10077 C CG1   . ILE M 1 75  ? -25.599 -64.458 54.746   1.00 31.71  ?  75  ILE L CG1   1 
ATOM   10078 C CG2   . ILE M 1 75  ? -24.499 -66.409 53.632   1.00 39.46  ?  75  ILE L CG2   1 
ATOM   10079 C CD1   . ILE M 1 75  ? -26.286 -65.294 55.804   1.00 51.48  ?  75  ILE L CD1   1 
ATOM   10080 N N     . ILE M 1 76  ? -23.165 -65.134 50.800   1.00 49.56  ?  76  ILE L N     1 
ATOM   10081 C CA    . ILE M 1 76  ? -22.714 -65.796 49.582   1.00 55.89  ?  76  ILE L CA    1 
ATOM   10082 C C     . ILE M 1 76  ? -22.306 -67.250 49.827   1.00 66.91  ?  76  ILE L C     1 
ATOM   10083 O O     . ILE M 1 76  ? -21.598 -67.560 50.785   1.00 84.43  ?  76  ILE L O     1 
ATOM   10084 C CB    . ILE M 1 76  ? -21.537 -65.022 48.948   1.00 45.70  ?  76  ILE L CB    1 
ATOM   10085 C CG1   . ILE M 1 76  ? -21.968 -63.587 48.630   1.00 45.19  ?  76  ILE L CG1   1 
ATOM   10086 C CG2   . ILE M 1 76  ? -21.028 -65.731 47.701   1.00 58.79  ?  76  ILE L CG2   1 
ATOM   10087 C CD1   . ILE M 1 76  ? -20.975 -62.808 47.799   1.00 55.94  ?  76  ILE L CD1   1 
ATOM   1