data_6BFN
# 
_entry.id   6BFN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6BFN         
WWPDB D_1000230818 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6BFN 
_pdbx_database_status.recvd_initial_deposition_date   2017-10-26 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Wang, L.' 1 ? 
'Qiao, Q.' 2 ? 
'Wu, H.'   3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Proc. Natl. Acad. Sci. U.S.A.' 
_citation.journal_id_ASTM           PNASA6 
_citation.journal_id_CSD            0040 
_citation.journal_id_ISSN           1091-6490 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            114 
_citation.language                  ? 
_citation.page_first                13507 
_citation.page_last                 13512 
_citation.title                     'Crystal structure of human IRAK1.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1073/pnas.1714386114 
_citation.pdbx_database_id_PubMed   29208712 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Wang, L.'       1 ? 
primary 'Qiao, Q.'       2 ? 
primary 'Ferrao, R.'     3 ? 
primary 'Shen, C.'       4 ? 
primary 'Hatcher, J.M.'  5 ? 
primary 'Buhrlage, S.J.' 6 ? 
primary 'Gray, N.S.'     7 ? 
primary 'Wu, H.'         8 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6BFN 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     88.059 
_cell.length_a_esd                 ? 
_cell.length_b                     88.059 
_cell.length_b_esd                 ? 
_cell.length_c                     177.034 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        16 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6BFN 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Interleukin-1 receptor-associated kinase 1'                                       37777.289 2   2.7.11.1 ? 
'UNP residues 194-530' ? 
2 non-polymer syn 'N-[2-methoxy-4-(morpholin-4-yl)phenyl]-6-(1H-pyrazol-5-yl)pyridine-2-carboxamide' 379.412   2   ?        ? ? ? 
3 water       nat water                                                                              18.015    156 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        IRAK-1 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GAMGSRPFPFCWPLCEISRGTHNFSEELKIGEGGFGCVYRAVMRNTVYAVKRLKENADLEWTAVKQSFLTEVEQLSRFRH
PNIVDFAGYCAQNGFYCLVYGFLPNGSLEDRLHCQTQACPPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLL
DERLTPKLGDFGLARFSRFAGSSPSQSSMVARTQTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVVLETLAGQRAVKTHG
ARTKYLKDLVEEEAEEAGVALRSTQSTLQAGLAADAWAAPIAMQIYKKHLDPRPGPCPPELGLGLGQLACCCLHRRAKRR
PPMTQVYERLEKLQAVVAGVPG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GAMGSRPFPFCWPLCEISRGTHNFSEELKIGEGGFGCVYRAVMRNTVYAVKRLKENADLEWTAVKQSFLTEVEQLSRFRH
PNIVDFAGYCAQNGFYCLVYGFLPNGSLEDRLHCQTQACPPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLL
DERLTPKLGDFGLARFSRFAGSSPSQSSMVARTQTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVVLETLAGQRAVKTHG
ARTKYLKDLVEEEAEEAGVALRSTQSTLQAGLAADAWAAPIAMQIYKKHLDPRPGPCPPELGLGLGQLACCCLHRRAKRR
PPMTQVYERLEKLQAVVAGVPG
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ALA n 
1 3   MET n 
1 4   GLY n 
1 5   SER n 
1 6   ARG n 
1 7   PRO n 
1 8   PHE n 
1 9   PRO n 
1 10  PHE n 
1 11  CYS n 
1 12  TRP n 
1 13  PRO n 
1 14  LEU n 
1 15  CYS n 
1 16  GLU n 
1 17  ILE n 
1 18  SER n 
1 19  ARG n 
1 20  GLY n 
1 21  THR n 
1 22  HIS n 
1 23  ASN n 
1 24  PHE n 
1 25  SER n 
1 26  GLU n 
1 27  GLU n 
1 28  LEU n 
1 29  LYS n 
1 30  ILE n 
1 31  GLY n 
1 32  GLU n 
1 33  GLY n 
1 34  GLY n 
1 35  PHE n 
1 36  GLY n 
1 37  CYS n 
1 38  VAL n 
1 39  TYR n 
1 40  ARG n 
1 41  ALA n 
1 42  VAL n 
1 43  MET n 
1 44  ARG n 
1 45  ASN n 
1 46  THR n 
1 47  VAL n 
1 48  TYR n 
1 49  ALA n 
1 50  VAL n 
1 51  LYS n 
1 52  ARG n 
1 53  LEU n 
1 54  LYS n 
1 55  GLU n 
1 56  ASN n 
1 57  ALA n 
1 58  ASP n 
1 59  LEU n 
1 60  GLU n 
1 61  TRP n 
1 62  THR n 
1 63  ALA n 
1 64  VAL n 
1 65  LYS n 
1 66  GLN n 
1 67  SER n 
1 68  PHE n 
1 69  LEU n 
1 70  THR n 
1 71  GLU n 
1 72  VAL n 
1 73  GLU n 
1 74  GLN n 
1 75  LEU n 
1 76  SER n 
1 77  ARG n 
1 78  PHE n 
1 79  ARG n 
1 80  HIS n 
1 81  PRO n 
1 82  ASN n 
1 83  ILE n 
1 84  VAL n 
1 85  ASP n 
1 86  PHE n 
1 87  ALA n 
1 88  GLY n 
1 89  TYR n 
1 90  CYS n 
1 91  ALA n 
1 92  GLN n 
1 93  ASN n 
1 94  GLY n 
1 95  PHE n 
1 96  TYR n 
1 97  CYS n 
1 98  LEU n 
1 99  VAL n 
1 100 TYR n 
1 101 GLY n 
1 102 PHE n 
1 103 LEU n 
1 104 PRO n 
1 105 ASN n 
1 106 GLY n 
1 107 SER n 
1 108 LEU n 
1 109 GLU n 
1 110 ASP n 
1 111 ARG n 
1 112 LEU n 
1 113 HIS n 
1 114 CYS n 
1 115 GLN n 
1 116 THR n 
1 117 GLN n 
1 118 ALA n 
1 119 CYS n 
1 120 PRO n 
1 121 PRO n 
1 122 LEU n 
1 123 SER n 
1 124 TRP n 
1 125 PRO n 
1 126 GLN n 
1 127 ARG n 
1 128 LEU n 
1 129 ASP n 
1 130 ILE n 
1 131 LEU n 
1 132 LEU n 
1 133 GLY n 
1 134 THR n 
1 135 ALA n 
1 136 ARG n 
1 137 ALA n 
1 138 ILE n 
1 139 GLN n 
1 140 PHE n 
1 141 LEU n 
1 142 HIS n 
1 143 GLN n 
1 144 ASP n 
1 145 SER n 
1 146 PRO n 
1 147 SER n 
1 148 LEU n 
1 149 ILE n 
1 150 HIS n 
1 151 GLY n 
1 152 ASP n 
1 153 ILE n 
1 154 LYS n 
1 155 SER n 
1 156 SER n 
1 157 ASN n 
1 158 VAL n 
1 159 LEU n 
1 160 LEU n 
1 161 ASP n 
1 162 GLU n 
1 163 ARG n 
1 164 LEU n 
1 165 THR n 
1 166 PRO n 
1 167 LYS n 
1 168 LEU n 
1 169 GLY n 
1 170 ASP n 
1 171 PHE n 
1 172 GLY n 
1 173 LEU n 
1 174 ALA n 
1 175 ARG n 
1 176 PHE n 
1 177 SER n 
1 178 ARG n 
1 179 PHE n 
1 180 ALA n 
1 181 GLY n 
1 182 SER n 
1 183 SER n 
1 184 PRO n 
1 185 SER n 
1 186 GLN n 
1 187 SER n 
1 188 SER n 
1 189 MET n 
1 190 VAL n 
1 191 ALA n 
1 192 ARG n 
1 193 THR n 
1 194 GLN n 
1 195 THR n 
1 196 VAL n 
1 197 ARG n 
1 198 GLY n 
1 199 THR n 
1 200 LEU n 
1 201 ALA n 
1 202 TYR n 
1 203 LEU n 
1 204 PRO n 
1 205 GLU n 
1 206 GLU n 
1 207 TYR n 
1 208 ILE n 
1 209 LYS n 
1 210 THR n 
1 211 GLY n 
1 212 ARG n 
1 213 LEU n 
1 214 ALA n 
1 215 VAL n 
1 216 ASP n 
1 217 THR n 
1 218 ASP n 
1 219 THR n 
1 220 PHE n 
1 221 SER n 
1 222 PHE n 
1 223 GLY n 
1 224 VAL n 
1 225 VAL n 
1 226 VAL n 
1 227 LEU n 
1 228 GLU n 
1 229 THR n 
1 230 LEU n 
1 231 ALA n 
1 232 GLY n 
1 233 GLN n 
1 234 ARG n 
1 235 ALA n 
1 236 VAL n 
1 237 LYS n 
1 238 THR n 
1 239 HIS n 
1 240 GLY n 
1 241 ALA n 
1 242 ARG n 
1 243 THR n 
1 244 LYS n 
1 245 TYR n 
1 246 LEU n 
1 247 LYS n 
1 248 ASP n 
1 249 LEU n 
1 250 VAL n 
1 251 GLU n 
1 252 GLU n 
1 253 GLU n 
1 254 ALA n 
1 255 GLU n 
1 256 GLU n 
1 257 ALA n 
1 258 GLY n 
1 259 VAL n 
1 260 ALA n 
1 261 LEU n 
1 262 ARG n 
1 263 SER n 
1 264 THR n 
1 265 GLN n 
1 266 SER n 
1 267 THR n 
1 268 LEU n 
1 269 GLN n 
1 270 ALA n 
1 271 GLY n 
1 272 LEU n 
1 273 ALA n 
1 274 ALA n 
1 275 ASP n 
1 276 ALA n 
1 277 TRP n 
1 278 ALA n 
1 279 ALA n 
1 280 PRO n 
1 281 ILE n 
1 282 ALA n 
1 283 MET n 
1 284 GLN n 
1 285 ILE n 
1 286 TYR n 
1 287 LYS n 
1 288 LYS n 
1 289 HIS n 
1 290 LEU n 
1 291 ASP n 
1 292 PRO n 
1 293 ARG n 
1 294 PRO n 
1 295 GLY n 
1 296 PRO n 
1 297 CYS n 
1 298 PRO n 
1 299 PRO n 
1 300 GLU n 
1 301 LEU n 
1 302 GLY n 
1 303 LEU n 
1 304 GLY n 
1 305 LEU n 
1 306 GLY n 
1 307 GLN n 
1 308 LEU n 
1 309 ALA n 
1 310 CYS n 
1 311 CYS n 
1 312 CYS n 
1 313 LEU n 
1 314 HIS n 
1 315 ARG n 
1 316 ARG n 
1 317 ALA n 
1 318 LYS n 
1 319 ARG n 
1 320 ARG n 
1 321 PRO n 
1 322 PRO n 
1 323 MET n 
1 324 THR n 
1 325 GLN n 
1 326 VAL n 
1 327 TYR n 
1 328 GLU n 
1 329 ARG n 
1 330 LEU n 
1 331 GLU n 
1 332 LYS n 
1 333 LEU n 
1 334 GLN n 
1 335 ALA n 
1 336 VAL n 
1 337 VAL n 
1 338 ALA n 
1 339 GLY n 
1 340 VAL n 
1 341 PRO n 
1 342 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   342 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'IRAK1, IRAK' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    IRAK1_HUMAN 
_struct_ref.pdbx_db_accession          P51617 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;RPFPFCWPLCEISRGTHNFSEELKIGEGGFGCVYRAVMRNTVYAVKRLKENADLEWTAVKQSFLTEVEQLSRFRHPNIVD
FAGYCAQNGFYCLVYGFLPNGSLEDRLHCQTQACPPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDERLT
PKLGDFGLARFSRFAGSSPSQSSMVARTQTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVVLETLAGQRAVKTHGARTKY
LKDLVEEEAEEAGVALRSTQSTLQAGLAADAWAAPIAMQIYKKHLDPRPGPCPPELGLGLGQLACCCLHRRAKRRPPMTQ
VYERLEKLQAVVAGVPG
;
_struct_ref.pdbx_align_begin           194 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6BFN A 6 ? 342 ? P51617 194 ? 530 ? 194 530 
2 1 6BFN B 6 ? 342 ? P51617 194 ? 530 ? 194 530 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6BFN GLY A 1 ? UNP P51617 ? ? 'expression tag' 189 1  
1 6BFN ALA A 2 ? UNP P51617 ? ? 'expression tag' 190 2  
1 6BFN MET A 3 ? UNP P51617 ? ? 'expression tag' 191 3  
1 6BFN GLY A 4 ? UNP P51617 ? ? 'expression tag' 192 4  
1 6BFN SER A 5 ? UNP P51617 ? ? 'expression tag' 193 5  
2 6BFN GLY B 1 ? UNP P51617 ? ? 'expression tag' 189 6  
2 6BFN ALA B 2 ? UNP P51617 ? ? 'expression tag' 190 7  
2 6BFN MET B 3 ? UNP P51617 ? ? 'expression tag' 191 8  
2 6BFN GLY B 4 ? UNP P51617 ? ? 'expression tag' 192 9  
2 6BFN SER B 5 ? UNP P51617 ? ? 'expression tag' 193 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                            ? 'C3 H7 N O2'     
89.093  
ARG 'L-peptide linking' y ARGININE                                                                           ? 'C6 H15 N4 O2 1' 
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                         ? 'C4 H8 N2 O3'    
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                    ? 'C4 H7 N O4'     
133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                           ? 'C3 H7 N O2 S'   
121.158 
DL1 non-polymer         . 'N-[2-methoxy-4-(morpholin-4-yl)phenyl]-6-(1H-pyrazol-5-yl)pyridine-2-carboxamide' ? 'C20 H21 N5 O3'  
379.412 
GLN 'L-peptide linking' y GLUTAMINE                                                                          ? 'C5 H10 N2 O3'   
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                    ? 'C5 H9 N O4'     
147.129 
GLY 'peptide linking'   y GLYCINE                                                                            ? 'C2 H5 N O2'     
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                          ? 'C6 H10 N3 O2 1' 
156.162 
HOH non-polymer         . WATER                                                                              ? 'H2 O'           
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                         ? 'C6 H13 N O2'    
131.173 
LEU 'L-peptide linking' y LEUCINE                                                                            ? 'C6 H13 N O2'    
131.173 
LYS 'L-peptide linking' y LYSINE                                                                             ? 'C6 H15 N2 O2 1' 
147.195 
MET 'L-peptide linking' y METHIONINE                                                                         ? 'C5 H11 N O2 S'  
149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                      ? 'C9 H11 N O2'    
165.189 
PRO 'L-peptide linking' y PROLINE                                                                            ? 'C5 H9 N O2'     
115.130 
SER 'L-peptide linking' y SERINE                                                                             ? 'C3 H7 N O3'     
105.093 
THR 'L-peptide linking' y THREONINE                                                                          ? 'C4 H9 N O3'     
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                         ? 'C11 H12 N2 O2'  
204.225 
TYR 'L-peptide linking' y TYROSINE                                                                           ? 'C9 H11 N O3'    
181.189 
VAL 'L-peptide linking' y VALINE                                                                             ? 'C5 H11 N O2'    
117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6BFN 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.27 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         45.84 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          EVAPORATION 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '20% PEG3350, 0.2 M calcium chloride, 0.1 M HEPES, pH 7.0' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-06-21 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'single crystal Si(220) side bounce' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 24-ID-E' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.979 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-E 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6BFN 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.26 
_reflns.d_resolution_low                 88.06 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       33471 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  12.4 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            13.3 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.26 
_reflns_shell.d_res_low                   ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6BFN 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.260 
_refine.ls_d_res_low                             78.844 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     33415 
_refine.ls_number_reflns_R_free                  1703 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.96 
_refine.ls_percent_reflns_R_free                 5.10 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1861 
_refine.ls_R_factor_R_free                       0.2269 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1840 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 22.28 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.28 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4695 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         56 
_refine_hist.number_atoms_solvent             156 
_refine_hist.number_atoms_total               4907 
_refine_hist.d_res_high                       2.260 
_refine_hist.d_res_low                        78.844 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.005  ? 4872 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.916  ? 6595 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 14.459 ? 1843 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.033  ? 711  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.004  ? 854  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.2601 2.3266  . . 144 2581 100.00 . . . 0.3497 . 0.2640 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3266 2.4017  . . 153 2573 100.00 . . . 0.2718 . 0.2512 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4017 2.4875  . . 145 2584 100.00 . . . 0.2664 . 0.2250 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4875 2.5871  . . 142 2599 100.00 . . . 0.2981 . 0.2125 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5871 2.7049  . . 133 2614 100.00 . . . 0.2868 . 0.2115 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7049 2.8475  . . 149 2604 100.00 . . . 0.2425 . 0.2014 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8475 3.0259  . . 133 2634 100.00 . . . 0.2612 . 0.2121 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0259 3.2595  . . 168 2595 100.00 . . . 0.2458 . 0.1969 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2595 3.5876  . . 127 2648 100.00 . . . 0.2659 . 0.1832 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5876 4.1067  . . 105 2708 100.00 . . . 0.1789 . 0.1628 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.1067 5.1738  . . 152 2718 100.00 . . . 0.2031 . 0.1497 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.1738 78.8918 . . 152 2854 100.00 . . . 0.1711 . 0.1695 . . . . . . . . . . 
# 
_struct.entry_id                     6BFN 
_struct.title                        'Crystal structure of human IRAK1' 
_struct.pdbx_descriptor              'Interleukin-1 receptor-associated kinase 1 (E.C.2.7.11.1)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6BFN 
_struct_keywords.text            'Interleukin-1 (IL-1) receptor-associated kinases, TRANSFERASE' 
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 PRO A 13  ? HIS A 22  ? PRO A 201 HIS A 210 1 ? 10 
HELX_P HELX_P2  AA2 TRP A 61  ? PHE A 78  ? TRP A 249 PHE A 266 1 ? 18 
HELX_P HELX_P3  AA3 SER A 107 ? CYS A 114 ? SER A 295 CYS A 302 1 ? 8  
HELX_P HELX_P4  AA4 SER A 123 ? ASP A 144 ? SER A 311 ASP A 332 1 ? 22 
HELX_P HELX_P5  AA5 ASP A 170 ? ALA A 174 ? ASP A 358 ALA A 362 5 ? 5  
HELX_P HELX_P6  AA6 THR A 199 ? LEU A 203 ? THR A 387 LEU A 391 5 ? 5  
HELX_P HELX_P7  AA7 PRO A 204 ? THR A 210 ? PRO A 392 THR A 398 1 ? 7  
HELX_P HELX_P8  AA8 ALA A 214 ? GLY A 232 ? ALA A 402 GLY A 420 1 ? 19 
HELX_P HELX_P9  AA9 ASP A 248 ? GLY A 258 ? ASP A 436 GLY A 446 1 ? 11 
HELX_P HELX_P10 AB1 ASP A 275 ? TRP A 277 ? ASP A 463 TRP A 465 5 ? 3  
HELX_P HELX_P11 AB2 ALA A 278 ? HIS A 289 ? ALA A 466 HIS A 477 1 ? 12 
HELX_P HELX_P12 AB3 PRO A 298 ? LEU A 313 ? PRO A 486 LEU A 501 1 ? 16 
HELX_P HELX_P13 AB4 ARG A 316 ? ARG A 320 ? ARG A 504 ARG A 508 5 ? 5  
HELX_P HELX_P14 AB5 PRO A 322 ? GLN A 334 ? PRO A 510 GLN A 522 1 ? 13 
HELX_P HELX_P15 AB6 ALA A 335 ? VAL A 337 ? ALA A 523 VAL A 525 5 ? 3  
HELX_P HELX_P16 AB7 PRO B 13  ? THR B 21  ? PRO B 201 THR B 209 1 ? 9  
HELX_P HELX_P17 AB8 SER B 25  ? GLU B 27  ? SER B 213 GLU B 215 5 ? 3  
HELX_P HELX_P18 AB9 THR B 62  ? PHE B 78  ? THR B 250 PHE B 266 1 ? 17 
HELX_P HELX_P19 AC1 ALA B 91  ? PHE B 95  ? ALA B 279 PHE B 283 5 ? 5  
HELX_P HELX_P20 AC2 SER B 107 ? HIS B 113 ? SER B 295 HIS B 301 1 ? 7  
HELX_P HELX_P21 AC3 SER B 123 ? ASP B 144 ? SER B 311 ASP B 332 1 ? 22 
HELX_P HELX_P22 AC4 THR B 199 ? LEU B 203 ? THR B 387 LEU B 391 5 ? 5  
HELX_P HELX_P23 AC5 PRO B 204 ? LYS B 209 ? PRO B 392 LYS B 397 1 ? 6  
HELX_P HELX_P24 AC6 ALA B 214 ? GLY B 232 ? ALA B 402 GLY B 420 1 ? 19 
HELX_P HELX_P25 AC7 ASP B 248 ? GLY B 258 ? ASP B 436 GLY B 446 1 ? 11 
HELX_P HELX_P26 AC8 TRP B 277 ? HIS B 289 ? TRP B 465 HIS B 477 1 ? 13 
HELX_P HELX_P27 AC9 PRO B 298 ? LEU B 313 ? PRO B 486 LEU B 501 1 ? 16 
HELX_P HELX_P28 AD1 ARG B 316 ? ARG B 320 ? ARG B 504 ARG B 508 5 ? 5  
HELX_P HELX_P29 AD2 PRO B 322 ? ALA B 338 ? PRO B 510 ALA B 526 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 8   A . ? PHE 196 A PRO 9   A ? PRO 197 A 1 4.92  
2 SER 145 A . ? SER 333 A PRO 146 A ? PRO 334 A 1 -2.02 
3 SER 145 B . ? SER 333 B PRO 146 B ? PRO 334 B 1 1.85  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 5 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA5 4 5 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LYS A 29  ? GLU A 32  ? LYS A 217 GLU A 220 
AA1 2 GLY A 36  ? MET A 43  ? GLY A 224 MET A 231 
AA1 3 THR A 46  ? LEU A 53  ? THR A 234 LEU A 241 
AA1 4 PHE A 95  ? GLY A 101 ? PHE A 283 GLY A 289 
AA1 5 PHE A 86  ? GLN A 92  ? PHE A 274 GLN A 280 
AA2 1 LEU A 148 ? ILE A 149 ? LEU A 336 ILE A 337 
AA2 2 ARG A 175 ? PHE A 176 ? ARG A 363 PHE A 364 
AA3 1 VAL A 158 ? LEU A 160 ? VAL A 346 LEU A 348 
AA3 2 PRO A 166 ? LEU A 168 ? PRO A 354 LEU A 356 
AA4 1 VAL A 236 ? HIS A 239 ? VAL A 424 HIS A 427 
AA4 2 ARG A 242 ? TYR A 245 ? ARG A 430 TYR A 433 
AA5 1 LYS B 29  ? GLU B 32  ? LYS B 217 GLU B 220 
AA5 2 GLY B 36  ? MET B 43  ? GLY B 224 MET B 231 
AA5 3 THR B 46  ? LEU B 53  ? THR B 234 LEU B 241 
AA5 4 CYS B 97  ? GLY B 101 ? CYS B 285 GLY B 289 
AA5 5 PHE B 86  ? CYS B 90  ? PHE B 274 CYS B 278 
AA6 1 LEU B 148 ? ILE B 149 ? LEU B 336 ILE B 337 
AA6 2 ARG B 175 ? PHE B 176 ? ARG B 363 PHE B 364 
AA7 1 VAL B 158 ? LEU B 160 ? VAL B 346 LEU B 348 
AA7 2 PRO B 166 ? LEU B 168 ? PRO B 354 LEU B 356 
AA8 1 VAL B 236 ? HIS B 239 ? VAL B 424 HIS B 427 
AA8 2 ARG B 242 ? TYR B 245 ? ARG B 430 TYR B 433 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLY A 31  ? N GLY A 219 O VAL A 38  ? O VAL A 226 
AA1 2 3 N CYS A 37  ? N CYS A 225 O ARG A 52  ? O ARG A 240 
AA1 3 4 N LYS A 51  ? N LYS A 239 O LEU A 98  ? O LEU A 286 
AA1 4 5 O VAL A 99  ? O VAL A 287 N GLY A 88  ? N GLY A 276 
AA2 1 2 N ILE A 149 ? N ILE A 337 O ARG A 175 ? O ARG A 363 
AA3 1 2 N LEU A 159 ? N LEU A 347 O LYS A 167 ? O LYS A 355 
AA4 1 2 N LYS A 237 ? N LYS A 425 O LYS A 244 ? O LYS A 432 
AA5 1 2 N ILE B 30  ? N ILE B 218 O VAL B 38  ? O VAL B 226 
AA5 2 3 N CYS B 37  ? N CYS B 225 O ARG B 52  ? O ARG B 240 
AA5 3 4 N LYS B 51  ? N LYS B 239 O LEU B 98  ? O LEU B 286 
AA5 4 5 O VAL B 99  ? O VAL B 287 N GLY B 88  ? N GLY B 276 
AA6 1 2 N ILE B 149 ? N ILE B 337 O ARG B 175 ? O ARG B 363 
AA7 1 2 N LEU B 159 ? N LEU B 347 O LYS B 167 ? O LYS B 355 
AA8 1 2 N LYS B 237 ? N LYS B 425 O LYS B 244 ? O LYS B 432 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A DL1 601 ? 10 'binding site for residue DL1 A 601' 
AC2 Software B DL1 601 ? 11 'binding site for residue DL1 B 601' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 10 ILE A 30  ? ILE A 218 . ? 1_555 ? 
2  AC1 10 ALA A 49  ? ALA A 237 . ? 1_555 ? 
3  AC1 10 TYR A 100 ? TYR A 288 . ? 1_555 ? 
4  AC1 10 PHE A 102 ? PHE A 290 . ? 1_555 ? 
5  AC1 10 LEU A 103 ? LEU A 291 . ? 1_555 ? 
6  AC1 10 PRO A 104 ? PRO A 292 . ? 1_555 ? 
7  AC1 10 GLY A 106 ? GLY A 294 . ? 1_555 ? 
8  AC1 10 LEU A 159 ? LEU A 347 . ? 1_555 ? 
9  AC1 10 ASP A 170 ? ASP A 358 . ? 1_555 ? 
10 AC1 10 HOH E .   ? HOH A 734 . ? 1_555 ? 
11 AC2 11 ASN A 93  ? ASN A 281 . ? 3_455 ? 
12 AC2 11 ILE B 30  ? ILE B 218 . ? 1_555 ? 
13 AC2 11 ALA B 49  ? ALA B 237 . ? 1_555 ? 
14 AC2 11 TYR B 100 ? TYR B 288 . ? 1_555 ? 
15 AC2 11 PHE B 102 ? PHE B 290 . ? 1_555 ? 
16 AC2 11 LEU B 103 ? LEU B 291 . ? 1_555 ? 
17 AC2 11 PRO B 104 ? PRO B 292 . ? 1_555 ? 
18 AC2 11 GLY B 106 ? GLY B 294 . ? 1_555 ? 
19 AC2 11 LEU B 159 ? LEU B 347 . ? 1_555 ? 
20 AC2 11 ASP B 170 ? ASP B 358 . ? 1_555 ? 
21 AC2 11 HOH F .   ? HOH B 725 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6BFN 
_atom_sites.fract_transf_matrix[1][1]   0.011356 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011356 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005649 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 5   ? -31.473 -11.840 2.530   1.00 88.09  ? 193 SER A N   1 
ATOM   2    C CA  . SER A 1 5   ? -31.890 -10.720 3.366   1.00 87.20  ? 193 SER A CA  1 
ATOM   3    C C   . SER A 1 5   ? -32.717 -11.191 4.560   1.00 82.92  ? 193 SER A C   1 
ATOM   4    O O   . SER A 1 5   ? -33.285 -12.284 4.542   1.00 83.24  ? 193 SER A O   1 
ATOM   5    C CB  . SER A 1 5   ? -32.685 -9.706  2.541   1.00 90.51  ? 193 SER A CB  1 
ATOM   6    O OG  . SER A 1 5   ? -33.036 -8.577  3.322   1.00 90.86  ? 193 SER A OG  1 
ATOM   7    N N   . ARG A 1 6   ? -32.783 -10.354 5.593   1.00 84.96  ? 194 ARG A N   1 
ATOM   8    C CA  . ARG A 1 6   ? -33.467 -10.696 6.837   1.00 78.03  ? 194 ARG A CA  1 
ATOM   9    C C   . ARG A 1 6   ? -34.340 -9.518  7.295   1.00 69.23  ? 194 ARG A C   1 
ATOM   10   O O   . ARG A 1 6   ? -34.329 -8.470  6.650   1.00 66.03  ? 194 ARG A O   1 
ATOM   11   C CB  . ARG A 1 6   ? -32.423 -11.077 7.898   1.00 79.38  ? 194 ARG A CB  1 
ATOM   12   C CG  . ARG A 1 6   ? -31.665 -12.361 7.569   1.00 81.48  ? 194 ARG A CG  1 
ATOM   13   C CD  . ARG A 1 6   ? -30.424 -12.554 8.431   1.00 81.50  ? 194 ARG A CD  1 
ATOM   14   N NE  . ARG A 1 6   ? -29.878 -13.903 8.278   1.00 82.85  ? 194 ARG A NE  1 
ATOM   15   C CZ  . ARG A 1 6   ? -28.583 -14.205 8.337   1.00 80.72  ? 194 ARG A CZ  1 
ATOM   16   N NH1 . ARG A 1 6   ? -28.186 -15.463 8.185   1.00 79.64  ? 194 ARG A NH1 1 
ATOM   17   N NH2 . ARG A 1 6   ? -27.684 -13.251 8.540   1.00 78.78  ? 194 ARG A NH2 1 
ATOM   18   N N   . PRO A 1 7   ? -35.104 -9.680  8.397   1.00 72.51  ? 195 PRO A N   1 
ATOM   19   C CA  . PRO A 1 7   ? -35.833 -8.520  8.936   1.00 66.68  ? 195 PRO A CA  1 
ATOM   20   C C   . PRO A 1 7   ? -34.912 -7.349  9.269   1.00 58.08  ? 195 PRO A C   1 
ATOM   21   O O   . PRO A 1 7   ? -35.257 -6.197  9.008   1.00 52.01  ? 195 PRO A O   1 
ATOM   22   C CB  . PRO A 1 7   ? -36.500 -9.072  10.209  1.00 67.81  ? 195 PRO A CB  1 
ATOM   23   C CG  . PRO A 1 7   ? -35.939 -10.465 10.401  1.00 70.54  ? 195 PRO A CG  1 
ATOM   24   C CD  . PRO A 1 7   ? -35.553 -10.929 9.035   1.00 72.41  ? 195 PRO A CD  1 
ATOM   25   N N   . PHE A 1 8   ? -33.756 -7.649  9.851   1.00 57.81  ? 196 PHE A N   1 
ATOM   26   C CA  . PHE A 1 8   ? -32.697 -6.660  10.012  1.00 52.84  ? 196 PHE A CA  1 
ATOM   27   C C   . PHE A 1 8   ? -31.344 -7.354  9.865   1.00 47.95  ? 196 PHE A C   1 
ATOM   28   O O   . PHE A 1 8   ? -31.207 -8.521  10.234  1.00 47.42  ? 196 PHE A O   1 
ATOM   29   C CB  . PHE A 1 8   ? -32.813 -5.939  11.360  1.00 54.36  ? 196 PHE A CB  1 
ATOM   30   C CG  . PHE A 1 8   ? -32.732 -6.850  12.551  1.00 57.51  ? 196 PHE A CG  1 
ATOM   31   C CD1 . PHE A 1 8   ? -31.533 -7.025  13.225  1.00 59.14  ? 196 PHE A CD1 1 
ATOM   32   C CD2 . PHE A 1 8   ? -33.857 -7.521  13.008  1.00 60.41  ? 196 PHE A CD2 1 
ATOM   33   C CE1 . PHE A 1 8   ? -31.454 -7.857  14.324  1.00 60.24  ? 196 PHE A CE1 1 
ATOM   34   C CE2 . PHE A 1 8   ? -33.784 -8.355  14.108  1.00 62.39  ? 196 PHE A CE2 1 
ATOM   35   C CZ  . PHE A 1 8   ? -32.580 -8.524  14.766  1.00 62.08  ? 196 PHE A CZ  1 
ATOM   36   N N   . PRO A 1 9   ? -30.332 -6.648  9.331   1.00 50.18  ? 197 PRO A N   1 
ATOM   37   C CA  . PRO A 1 9   ? -30.253 -5.235  8.924   1.00 47.99  ? 197 PRO A CA  1 
ATOM   38   C C   . PRO A 1 9   ? -31.154 -4.839  7.752   1.00 43.49  ? 197 PRO A C   1 
ATOM   39   O O   . PRO A 1 9   ? -31.328 -5.609  6.809   1.00 46.97  ? 197 PRO A O   1 
ATOM   40   C CB  . PRO A 1 9   ? -28.780 -5.067  8.518   1.00 49.80  ? 197 PRO A CB  1 
ATOM   41   C CG  . PRO A 1 9   ? -28.069 -6.246  9.084   1.00 52.55  ? 197 PRO A CG  1 
ATOM   42   C CD  . PRO A 1 9   ? -29.063 -7.351  9.082   1.00 53.61  ? 197 PRO A CD  1 
ATOM   43   N N   . PHE A 1 10  ? -31.705 -3.632  7.831   1.00 41.34  ? 198 PHE A N   1 
ATOM   44   C CA  . PHE A 1 10  ? -32.534 -3.052  6.778   1.00 38.38  ? 198 PHE A CA  1 
ATOM   45   C C   . PHE A 1 10  ? -31.769 -2.960  5.458   1.00 39.70  ? 198 PHE A C   1 
ATOM   46   O O   . PHE A 1 10  ? -30.662 -2.430  5.405   1.00 39.23  ? 198 PHE A O   1 
ATOM   47   C CB  . PHE A 1 10  ? -33.025 -1.665  7.213   1.00 34.12  ? 198 PHE A CB  1 
ATOM   48   C CG  . PHE A 1 10  ? -34.088 -1.073  6.324   1.00 36.62  ? 198 PHE A CG  1 
ATOM   49   C CD1 . PHE A 1 10  ? -33.751 -0.453  5.128   1.00 40.19  ? 198 PHE A CD1 1 
ATOM   50   C CD2 . PHE A 1 10  ? -35.422 -1.103  6.704   1.00 34.38  ? 198 PHE A CD2 1 
ATOM   51   C CE1 . PHE A 1 10  ? -34.723 0.104   4.318   1.00 41.37  ? 198 PHE A CE1 1 
ATOM   52   C CE2 . PHE A 1 10  ? -36.401 -0.547  5.899   1.00 36.90  ? 198 PHE A CE2 1 
ATOM   53   C CZ  . PHE A 1 10  ? -36.050 0.058   4.704   1.00 36.97  ? 198 PHE A CZ  1 
ATOM   54   N N   . CYS A 1 11  ? -32.375 -3.470  4.392   1.00 41.94  ? 199 CYS A N   1 
ATOM   55   C CA  . CYS A 1 11  ? -31.748 -3.487  3.074   1.00 41.65  ? 199 CYS A CA  1 
ATOM   56   C C   . CYS A 1 11  ? -32.391 -2.470  2.133   1.00 39.99  ? 199 CYS A C   1 
ATOM   57   O O   . CYS A 1 11  ? -33.607 -2.314  2.120   1.00 42.81  ? 199 CYS A O   1 
ATOM   58   C CB  . CYS A 1 11  ? -31.836 -4.893  2.470   1.00 45.65  ? 199 CYS A CB  1 
ATOM   59   S SG  . CYS A 1 11  ? -31.099 -5.067  0.825   1.00 53.16  ? 199 CYS A SG  1 
ATOM   60   N N   . TRP A 1 12  ? -31.572 -1.797  1.328   1.00 45.06  ? 200 TRP A N   1 
ATOM   61   C CA  . TRP A 1 12  ? -32.071 -0.809  0.371   1.00 44.00  ? 200 TRP A CA  1 
ATOM   62   C C   . TRP A 1 12  ? -31.806 -1.293  -1.044  1.00 49.35  ? 200 TRP A C   1 
ATOM   63   O O   . TRP A 1 12  ? -30.787 -1.929  -1.297  1.00 54.88  ? 200 TRP A O   1 
ATOM   64   C CB  . TRP A 1 12  ? -31.382 0.554   0.538   1.00 39.92  ? 200 TRP A CB  1 
ATOM   65   C CG  . TRP A 1 12  ? -31.650 1.328   1.794   1.00 37.38  ? 200 TRP A CG  1 
ATOM   66   C CD1 . TRP A 1 12  ? -30.999 1.206   2.988   1.00 37.18  ? 200 TRP A CD1 1 
ATOM   67   C CD2 . TRP A 1 12  ? -32.592 2.396   1.961   1.00 37.84  ? 200 TRP A CD2 1 
ATOM   68   N NE1 . TRP A 1 12  ? -31.497 2.112   3.896   1.00 32.35  ? 200 TRP A NE1 1 
ATOM   69   C CE2 . TRP A 1 12  ? -32.476 2.854   3.290   1.00 34.66  ? 200 TRP A CE2 1 
ATOM   70   C CE3 . TRP A 1 12  ? -33.535 2.999   1.121   1.00 42.34  ? 200 TRP A CE3 1 
ATOM   71   C CZ2 . TRP A 1 12  ? -33.269 3.883   3.800   1.00 34.53  ? 200 TRP A CZ2 1 
ATOM   72   C CZ3 . TRP A 1 12  ? -34.319 4.024   1.629   1.00 41.18  ? 200 TRP A CZ3 1 
ATOM   73   C CH2 . TRP A 1 12  ? -34.180 4.455   2.956   1.00 39.36  ? 200 TRP A CH2 1 
ATOM   74   N N   . PRO A 1 13  ? -32.710 -0.975  -1.980  1.00 48.64  ? 201 PRO A N   1 
ATOM   75   C CA  . PRO A 1 13  ? -32.414 -1.237  -3.390  1.00 48.64  ? 201 PRO A CA  1 
ATOM   76   C C   . PRO A 1 13  ? -31.411 -0.229  -3.941  1.00 47.18  ? 201 PRO A C   1 
ATOM   77   O O   . PRO A 1 13  ? -31.429 0.935   -3.540  1.00 45.25  ? 201 PRO A O   1 
ATOM   78   C CB  . PRO A 1 13  ? -33.778 -1.091  -4.069  1.00 50.27  ? 201 PRO A CB  1 
ATOM   79   C CG  . PRO A 1 13  ? -34.547 -0.188  -3.170  1.00 45.35  ? 201 PRO A CG  1 
ATOM   80   C CD  . PRO A 1 13  ? -34.093 -0.509  -1.779  1.00 44.94  ? 201 PRO A CD  1 
ATOM   81   N N   . LEU A 1 14  ? -30.552 -0.676  -4.851  1.00 48.04  ? 202 LEU A N   1 
ATOM   82   C CA  . LEU A 1 14  ? -29.537 0.188   -5.440  1.00 46.98  ? 202 LEU A CA  1 
ATOM   83   C C   . LEU A 1 14  ? -30.155 1.363   -6.186  1.00 50.59  ? 202 LEU A C   1 
ATOM   84   O O   . LEU A 1 14  ? -29.637 2.470   -6.119  1.00 51.34  ? 202 LEU A O   1 
ATOM   85   C CB  . LEU A 1 14  ? -28.634 -0.612  -6.387  1.00 48.08  ? 202 LEU A CB  1 
ATOM   86   C CG  . LEU A 1 14  ? -27.597 0.178   -7.193  1.00 48.39  ? 202 LEU A CG  1 
ATOM   87   C CD1 . LEU A 1 14  ? -26.661 0.953   -6.277  1.00 47.27  ? 202 LEU A CD1 1 
ATOM   88   C CD2 . LEU A 1 14  ? -26.804 -0.746  -8.108  1.00 50.86  ? 202 LEU A CD2 1 
ATOM   89   N N   . CYS A 1 15  ? -31.253 1.125   -6.901  1.00 46.27  ? 203 CYS A N   1 
ATOM   90   C CA  . CYS A 1 15  ? -31.862 2.178   -7.710  1.00 43.22  ? 203 CYS A CA  1 
ATOM   91   C C   . CYS A 1 15  ? -32.371 3.335   -6.847  1.00 43.94  ? 203 CYS A C   1 
ATOM   92   O O   . CYS A 1 15  ? -32.346 4.492   -7.270  1.00 44.40  ? 203 CYS A O   1 
ATOM   93   C CB  . CYS A 1 15  ? -33.000 1.610   -8.566  1.00 44.73  ? 203 CYS A CB  1 
ATOM   94   S SG  . CYS A 1 15  ? -34.389 0.917   -7.642  1.00 55.46  ? 203 CYS A SG  1 
ATOM   95   N N   . GLU A 1 16  ? -32.811 3.023   -5.632  1.00 41.72  ? 204 GLU A N   1 
ATOM   96   C CA  . GLU A 1 16  ? -33.313 4.044   -4.718  1.00 45.56  ? 204 GLU A CA  1 
ATOM   97   C C   . GLU A 1 16  ? -32.177 4.915   -4.178  1.00 44.85  ? 204 GLU A C   1 
ATOM   98   O O   . GLU A 1 16  ? -32.323 6.130   -4.034  1.00 43.53  ? 204 GLU A O   1 
ATOM   99   C CB  . GLU A 1 16  ? -34.081 3.396   -3.564  1.00 48.28  ? 204 GLU A CB  1 
ATOM   100  C CG  . GLU A 1 16  ? -35.007 4.348   -2.822  1.00 54.27  ? 204 GLU A CG  1 
ATOM   101  C CD  . GLU A 1 16  ? -35.977 3.624   -1.903  1.00 59.54  ? 204 GLU A CD  1 
ATOM   102  O OE1 . GLU A 1 16  ? -36.122 2.388   -2.039  1.00 62.25  ? 204 GLU A OE1 1 
ATOM   103  O OE2 . GLU A 1 16  ? -36.596 4.293   -1.046  1.00 58.60  ? 204 GLU A OE2 1 
ATOM   104  N N   . ILE A 1 17  ? -31.042 4.288   -3.888  1.00 43.74  ? 205 ILE A N   1 
ATOM   105  C CA  . ILE A 1 17  ? -29.870 5.013   -3.411  1.00 42.77  ? 205 ILE A CA  1 
ATOM   106  C C   . ILE A 1 17  ? -29.261 5.842   -4.543  1.00 44.42  ? 205 ILE A C   1 
ATOM   107  O O   . ILE A 1 17  ? -28.773 6.951   -4.330  1.00 43.51  ? 205 ILE A O   1 
ATOM   108  C CB  . ILE A 1 17  ? -28.824 4.044   -2.818  1.00 45.29  ? 205 ILE A CB  1 
ATOM   109  C CG1 . ILE A 1 17  ? -29.316 3.527   -1.463  1.00 48.30  ? 205 ILE A CG1 1 
ATOM   110  C CG2 . ILE A 1 17  ? -27.469 4.720   -2.650  1.00 45.22  ? 205 ILE A CG2 1 
ATOM   111  C CD1 . ILE A 1 17  ? -28.286 2.748   -0.693  1.00 48.98  ? 205 ILE A CD1 1 
ATOM   112  N N   . SER A 1 18  ? -29.322 5.302   -5.753  1.00 47.58  ? 206 SER A N   1 
ATOM   113  C CA  . SER A 1 18  ? -28.840 5.995   -6.936  1.00 51.02  ? 206 SER A CA  1 
ATOM   114  C C   . SER A 1 18  ? -29.679 7.236   -7.209  1.00 50.13  ? 206 SER A C   1 
ATOM   115  O O   . SER A 1 18  ? -29.141 8.314   -7.467  1.00 46.78  ? 206 SER A O   1 
ATOM   116  C CB  . SER A 1 18  ? -28.864 5.062   -8.147  1.00 52.57  ? 206 SER A CB  1 
ATOM   117  O OG  . SER A 1 18  ? -28.535 5.768   -9.330  1.00 58.60  ? 206 SER A OG  1 
ATOM   118  N N   . ARG A 1 19  ? -30.999 7.075   -7.151  1.00 47.35  ? 207 ARG A N   1 
ATOM   119  C CA  . ARG A 1 19  ? -31.911 8.198   -7.327  1.00 50.04  ? 207 ARG A CA  1 
ATOM   120  C C   . ARG A 1 19  ? -31.727 9.221   -6.210  1.00 49.17  ? 207 ARG A C   1 
ATOM   121  O O   . ARG A 1 19  ? -31.804 10.426  -6.439  1.00 51.42  ? 207 ARG A O   1 
ATOM   122  C CB  . ARG A 1 19  ? -33.361 7.713   -7.369  1.00 53.08  ? 207 ARG A CB  1 
ATOM   123  C CG  . ARG A 1 19  ? -34.205 8.379   -8.442  1.00 60.63  ? 207 ARG A CG  1 
ATOM   124  C CD  . ARG A 1 19  ? -35.478 7.591   -8.716  1.00 68.62  ? 207 ARG A CD  1 
ATOM   125  N NE  . ARG A 1 19  ? -35.871 7.668   -10.122 1.00 77.42  ? 207 ARG A NE  1 
ATOM   126  C CZ  . ARG A 1 19  ? -36.826 8.464   -10.595 1.00 83.08  ? 207 ARG A CZ  1 
ATOM   127  N NH1 . ARG A 1 19  ? -37.109 8.461   -11.891 1.00 85.79  ? 207 ARG A NH1 1 
ATOM   128  N NH2 . ARG A 1 19  ? -37.504 9.256   -9.775  1.00 84.61  ? 207 ARG A NH2 1 
ATOM   129  N N   . GLY A 1 20  ? -31.473 8.732   -5.001  1.00 49.49  ? 208 GLY A N   1 
ATOM   130  C CA  . GLY A 1 20  ? -31.303 9.603   -3.853  1.00 49.07  ? 208 GLY A CA  1 
ATOM   131  C C   . GLY A 1 20  ? -30.037 10.431  -3.944  1.00 50.64  ? 208 GLY A C   1 
ATOM   132  O O   . GLY A 1 20  ? -29.997 11.572  -3.484  1.00 47.98  ? 208 GLY A O   1 
ATOM   133  N N   . THR A 1 21  ? -28.994 9.837   -4.520  1.00 53.18  ? 209 THR A N   1 
ATOM   134  C CA  . THR A 1 21  ? -27.703 10.501  -4.687  1.00 51.40  ? 209 THR A CA  1 
ATOM   135  C C   . THR A 1 21  ? -27.476 11.125  -6.072  1.00 55.63  ? 209 THR A C   1 
ATOM   136  O O   . THR A 1 21  ? -26.386 11.628  -6.341  1.00 55.76  ? 209 THR A O   1 
ATOM   137  C CB  . THR A 1 21  ? -26.543 9.526   -4.395  1.00 47.84  ? 209 THR A CB  1 
ATOM   138  O OG1 . THR A 1 21  ? -26.669 8.359   -5.216  1.00 48.08  ? 209 THR A OG1 1 
ATOM   139  C CG2 . THR A 1 21  ? -26.556 9.112   -2.929  1.00 43.36  ? 209 THR A CG2 1 
ATOM   140  N N   . HIS A 1 22  ? -28.482 11.071  -6.946  1.00 55.11  ? 210 HIS A N   1 
ATOM   141  C CA  . HIS A 1 22  ? -28.342 11.515  -8.342  1.00 57.48  ? 210 HIS A CA  1 
ATOM   142  C C   . HIS A 1 22  ? -27.200 10.788  -9.046  1.00 58.82  ? 210 HIS A C   1 
ATOM   143  O O   . HIS A 1 22  ? -26.314 11.430  -9.616  1.00 62.65  ? 210 HIS A O   1 
ATOM   144  C CB  . HIS A 1 22  ? -28.096 13.028  -8.439  1.00 60.74  ? 210 HIS A CB  1 
ATOM   145  C CG  . HIS A 1 22  ? -29.240 13.867  -7.960  1.00 67.55  ? 210 HIS A CG  1 
ATOM   146  N ND1 . HIS A 1 22  ? -30.425 13.331  -7.515  1.00 72.98  ? 210 HIS A ND1 1 
ATOM   147  C CD2 . HIS A 1 22  ? -29.369 15.213  -7.860  1.00 69.15  ? 210 HIS A CD2 1 
ATOM   148  C CE1 . HIS A 1 22  ? -31.242 14.311  -7.159  1.00 73.89  ? 210 HIS A CE1 1 
ATOM   149  N NE2 . HIS A 1 22  ? -30.625 15.458  -7.357  1.00 71.64  ? 210 HIS A NE2 1 
ATOM   150  N N   . ASN A 1 23  ? -27.220 9.458   -8.996  1.00 57.79  ? 211 ASN A N   1 
ATOM   151  C CA  . ASN A 1 23  ? -26.134 8.638   -9.530  1.00 61.88  ? 211 ASN A CA  1 
ATOM   152  C C   . ASN A 1 23  ? -24.799 9.051   -8.927  1.00 61.84  ? 211 ASN A C   1 
ATOM   153  O O   . ASN A 1 23  ? -23.787 9.127   -9.627  1.00 63.30  ? 211 ASN A O   1 
ATOM   154  C CB  . ASN A 1 23  ? -26.070 8.730   -11.056 1.00 66.41  ? 211 ASN A CB  1 
ATOM   155  C CG  . ASN A 1 23  ? -27.418 8.519   -11.707 1.00 73.29  ? 211 ASN A CG  1 
ATOM   156  O OD1 . ASN A 1 23  ? -27.956 9.422   -12.346 1.00 78.82  ? 211 ASN A OD1 1 
ATOM   157  N ND2 . ASN A 1 23  ? -27.973 7.323   -11.548 1.00 73.14  ? 211 ASN A ND2 1 
ATOM   158  N N   . PHE A 1 24  ? -24.818 9.319   -7.623  1.00 61.17  ? 212 PHE A N   1 
ATOM   159  C CA  . PHE A 1 24  ? -23.633 9.725   -6.880  1.00 55.46  ? 212 PHE A CA  1 
ATOM   160  C C   . PHE A 1 24  ? -22.991 10.977  -7.465  1.00 59.31  ? 212 PHE A C   1 
ATOM   161  O O   . PHE A 1 24  ? -21.803 10.994  -7.781  1.00 60.52  ? 212 PHE A O   1 
ATOM   162  C CB  . PHE A 1 24  ? -22.634 8.571   -6.827  1.00 52.81  ? 212 PHE A CB  1 
ATOM   163  C CG  . PHE A 1 24  ? -23.219 7.309   -6.273  1.00 52.36  ? 212 PHE A CG  1 
ATOM   164  C CD1 . PHE A 1 24  ? -23.303 7.115   -4.903  1.00 50.44  ? 212 PHE A CD1 1 
ATOM   165  C CD2 . PHE A 1 24  ? -23.713 6.329   -7.119  1.00 55.37  ? 212 PHE A CD2 1 
ATOM   166  C CE1 . PHE A 1 24  ? -23.853 5.958   -4.387  1.00 52.95  ? 212 PHE A CE1 1 
ATOM   167  C CE2 . PHE A 1 24  ? -24.267 5.167   -6.610  1.00 57.40  ? 212 PHE A CE2 1 
ATOM   168  C CZ  . PHE A 1 24  ? -24.338 4.982   -5.242  1.00 56.07  ? 212 PHE A CZ  1 
ATOM   169  N N   . SER A 1 25  ? -23.803 12.021  -7.606  1.00 59.67  ? 213 SER A N   1 
ATOM   170  C CA  . SER A 1 25  ? -23.352 13.317  -8.098  1.00 61.98  ? 213 SER A CA  1 
ATOM   171  C C   . SER A 1 25  ? -22.236 13.911  -7.243  1.00 62.57  ? 213 SER A C   1 
ATOM   172  O O   . SER A 1 25  ? -22.189 13.703  -6.030  1.00 61.66  ? 213 SER A O   1 
ATOM   173  C CB  . SER A 1 25  ? -24.526 14.296  -8.161  1.00 64.12  ? 213 SER A CB  1 
ATOM   174  O OG  . SER A 1 25  ? -24.070 15.616  -8.402  1.00 69.68  ? 213 SER A OG  1 
ATOM   175  N N   . GLU A 1 26  ? -21.339 14.649  -7.888  1.00 60.05  ? 214 GLU A N   1 
ATOM   176  C CA  . GLU A 1 26  ? -20.222 15.280  -7.199  1.00 64.05  ? 214 GLU A CA  1 
ATOM   177  C C   . GLU A 1 26  ? -20.666 16.485  -6.367  1.00 68.19  ? 214 GLU A C   1 
ATOM   178  O O   . GLU A 1 26  ? -20.008 16.847  -5.392  1.00 70.20  ? 214 GLU A O   1 
ATOM   179  C CB  . GLU A 1 26  ? -19.153 15.698  -8.208  1.00 68.92  ? 214 GLU A CB  1 
ATOM   180  C CG  . GLU A 1 26  ? -18.337 14.542  -8.760  1.00 73.47  ? 214 GLU A CG  1 
ATOM   181  C CD  . GLU A 1 26  ? -17.053 14.318  -7.985  1.00 78.40  ? 214 GLU A CD  1 
ATOM   182  O OE1 . GLU A 1 26  ? -16.246 15.267  -7.891  1.00 80.88  ? 214 GLU A OE1 1 
ATOM   183  O OE2 . GLU A 1 26  ? -16.852 13.199  -7.466  1.00 79.89  ? 214 GLU A OE2 1 
ATOM   184  N N   . GLU A 1 27  ? -21.782 17.102  -6.750  1.00 68.68  ? 215 GLU A N   1 
ATOM   185  C CA  . GLU A 1 27  ? -22.321 18.233  -5.995  1.00 73.24  ? 215 GLU A CA  1 
ATOM   186  C C   . GLU A 1 27  ? -23.008 17.746  -4.720  1.00 65.93  ? 215 GLU A C   1 
ATOM   187  O O   . GLU A 1 27  ? -23.143 18.490  -3.748  1.00 64.90  ? 215 GLU A O   1 
ATOM   188  C CB  . GLU A 1 27  ? -23.294 19.047  -6.858  1.00 84.94  ? 215 GLU A CB  1 
ATOM   189  C CG  . GLU A 1 27  ? -23.989 20.212  -6.140  1.00 93.91  ? 215 GLU A CG  1 
ATOM   190  C CD  . GLU A 1 27  ? -23.026 21.291  -5.658  1.00 100.14 ? 215 GLU A CD  1 
ATOM   191  O OE1 . GLU A 1 27  ? -22.487 21.161  -4.536  1.00 100.62 ? 215 GLU A OE1 1 
ATOM   192  O OE2 . GLU A 1 27  ? -22.818 22.277  -6.399  1.00 102.61 ? 215 GLU A OE2 1 
ATOM   193  N N   . LEU A 1 28  ? -23.428 16.485  -4.726  1.00 65.46  ? 216 LEU A N   1 
ATOM   194  C CA  . LEU A 1 28  ? -24.063 15.879  -3.559  1.00 58.38  ? 216 LEU A CA  1 
ATOM   195  C C   . LEU A 1 28  ? -23.025 15.214  -2.664  1.00 54.59  ? 216 LEU A C   1 
ATOM   196  O O   . LEU A 1 28  ? -23.362 14.588  -1.658  1.00 50.53  ? 216 LEU A O   1 
ATOM   197  C CB  . LEU A 1 28  ? -25.129 14.866  -3.983  1.00 53.43  ? 216 LEU A CB  1 
ATOM   198  C CG  . LEU A 1 28  ? -26.560 15.409  -4.031  1.00 53.57  ? 216 LEU A CG  1 
ATOM   199  C CD1 . LEU A 1 28  ? -26.653 16.611  -4.960  1.00 58.53  ? 216 LEU A CD1 1 
ATOM   200  C CD2 . LEU A 1 28  ? -27.550 14.330  -4.450  1.00 52.73  ? 216 LEU A CD2 1 
ATOM   201  N N   . LYS A 1 29  ? -21.757 15.373  -3.027  1.00 53.22  ? 217 LYS A N   1 
ATOM   202  C CA  . LYS A 1 29  ? -20.677 14.688  -2.334  1.00 53.04  ? 217 LYS A CA  1 
ATOM   203  C C   . LYS A 1 29  ? -20.161 15.572  -1.212  1.00 53.46  ? 217 LYS A C   1 
ATOM   204  O O   . LYS A 1 29  ? -19.575 16.626  -1.453  1.00 59.40  ? 217 LYS A O   1 
ATOM   205  C CB  . LYS A 1 29  ? -19.563 14.347  -3.326  1.00 58.64  ? 217 LYS A CB  1 
ATOM   206  C CG  . LYS A 1 29  ? -18.384 13.566  -2.778  1.00 62.87  ? 217 LYS A CG  1 
ATOM   207  C CD  . LYS A 1 29  ? -17.644 12.897  -3.931  1.00 69.19  ? 217 LYS A CD  1 
ATOM   208  C CE  . LYS A 1 29  ? -16.241 12.474  -3.545  1.00 73.72  ? 217 LYS A CE  1 
ATOM   209  N NZ  . LYS A 1 29  ? -15.326 13.640  -3.423  1.00 76.61  ? 217 LYS A NZ  1 
ATOM   210  N N   . ILE A 1 30  ? -20.423 15.149  0.020   1.00 48.54  ? 218 ILE A N   1 
ATOM   211  C CA  . ILE A 1 30  ? -20.032 15.918  1.192   1.00 48.37  ? 218 ILE A CA  1 
ATOM   212  C C   . ILE A 1 30  ? -18.743 15.436  1.849   1.00 49.56  ? 218 ILE A C   1 
ATOM   213  O O   . ILE A 1 30  ? -18.266 16.049  2.808   1.00 50.43  ? 218 ILE A O   1 
ATOM   214  C CB  . ILE A 1 30  ? -21.159 15.916  2.235   1.00 46.11  ? 218 ILE A CB  1 
ATOM   215  C CG1 . ILE A 1 30  ? -21.416 14.498  2.750   1.00 44.31  ? 218 ILE A CG1 1 
ATOM   216  C CG2 . ILE A 1 30  ? -22.428 16.497  1.626   1.00 47.57  ? 218 ILE A CG2 1 
ATOM   217  C CD1 . ILE A 1 30  ? -22.628 14.392  3.672   1.00 40.84  ? 218 ILE A CD1 1 
ATOM   218  N N   . GLY A 1 31  ? -18.167 14.351  1.341   1.00 44.72  ? 219 GLY A N   1 
ATOM   219  C CA  . GLY A 1 31  ? -16.921 13.874  1.916   1.00 45.28  ? 219 GLY A CA  1 
ATOM   220  C C   . GLY A 1 31  ? -16.239 12.779  1.125   1.00 53.45  ? 219 GLY A C   1 
ATOM   221  O O   . GLY A 1 31  ? -16.831 12.204  0.219   1.00 56.88  ? 219 GLY A O   1 
ATOM   222  N N   . GLU A 1 32  ? -14.975 12.518  1.443   1.00 55.77  ? 220 GLU A N   1 
ATOM   223  C CA  . GLU A 1 32  ? -14.264 11.376  0.877   1.00 66.93  ? 220 GLU A CA  1 
ATOM   224  C C   . GLU A 1 32  ? -13.085 10.982  1.757   1.00 68.65  ? 220 GLU A C   1 
ATOM   225  O O   . GLU A 1 32  ? -12.636 11.765  2.590   1.00 71.53  ? 220 GLU A O   1 
ATOM   226  C CB  . GLU A 1 32  ? -13.793 11.673  -0.549  1.00 76.72  ? 220 GLU A CB  1 
ATOM   227  C CG  . GLU A 1 32  ? -12.866 12.861  -0.686  1.00 84.99  ? 220 GLU A CG  1 
ATOM   228  C CD  . GLU A 1 32  ? -12.427 13.076  -2.123  1.00 93.74  ? 220 GLU A CD  1 
ATOM   229  O OE1 . GLU A 1 32  ? -13.027 12.456  -3.028  1.00 95.96  ? 220 GLU A OE1 1 
ATOM   230  O OE2 . GLU A 1 32  ? -11.479 13.859  -2.349  1.00 97.25  ? 220 GLU A OE2 1 
ATOM   231  N N   . GLY A 1 33  ? -12.584 9.768   1.564   1.00 71.53  ? 221 GLY A N   1 
ATOM   232  C CA  . GLY A 1 33  ? -11.485 9.267   2.368   1.00 72.35  ? 221 GLY A CA  1 
ATOM   233  C C   . GLY A 1 33  ? -10.957 7.938   1.865   1.00 72.85  ? 221 GLY A C   1 
ATOM   234  O O   . GLY A 1 33  ? -11.210 7.550   0.722   1.00 73.51  ? 221 GLY A O   1 
ATOM   235  N N   . GLY A 1 34  ? -10.206 7.247   2.716   1.00 71.74  ? 222 GLY A N   1 
ATOM   236  C CA  . GLY A 1 34  ? -9.633  5.963   2.358   1.00 72.42  ? 222 GLY A CA  1 
ATOM   237  C C   . GLY A 1 34  ? -10.689 4.927   2.029   1.00 69.26  ? 222 GLY A C   1 
ATOM   238  O O   . GLY A 1 34  ? -10.535 4.151   1.088   1.00 70.94  ? 222 GLY A O   1 
ATOM   239  N N   . PHE A 1 35  ? -11.769 4.924   2.803   1.00 65.45  ? 223 PHE A N   1 
ATOM   240  C CA  . PHE A 1 35  ? -12.862 3.973   2.618   1.00 64.36  ? 223 PHE A CA  1 
ATOM   241  C C   . PHE A 1 35  ? -13.587 4.147   1.283   1.00 59.70  ? 223 PHE A C   1 
ATOM   242  O O   . PHE A 1 35  ? -13.952 3.168   0.628   1.00 59.66  ? 223 PHE A O   1 
ATOM   243  C CB  . PHE A 1 35  ? -13.871 4.104   3.766   1.00 66.16  ? 223 PHE A CB  1 
ATOM   244  C CG  . PHE A 1 35  ? -14.317 5.519   4.021   1.00 69.15  ? 223 PHE A CG  1 
ATOM   245  C CD1 . PHE A 1 35  ? -15.402 6.056   3.345   1.00 71.12  ? 223 PHE A CD1 1 
ATOM   246  C CD2 . PHE A 1 35  ? -13.649 6.315   4.935   1.00 69.03  ? 223 PHE A CD2 1 
ATOM   247  C CE1 . PHE A 1 35  ? -15.807 7.360   3.573   1.00 69.42  ? 223 PHE A CE1 1 
ATOM   248  C CE2 . PHE A 1 35  ? -14.053 7.617   5.167   1.00 68.86  ? 223 PHE A CE2 1 
ATOM   249  C CZ  . PHE A 1 35  ? -15.133 8.138   4.485   1.00 68.06  ? 223 PHE A CZ  1 
ATOM   250  N N   . GLY A 1 36  ? -13.789 5.399   0.887   1.00 63.53  ? 224 GLY A N   1 
ATOM   251  C CA  . GLY A 1 36  ? -14.700 5.716   -0.194  1.00 60.86  ? 224 GLY A CA  1 
ATOM   252  C C   . GLY A 1 36  ? -15.233 7.129   -0.054  1.00 57.56  ? 224 GLY A C   1 
ATOM   253  O O   . GLY A 1 36  ? -14.585 7.984   0.544   1.00 57.43  ? 224 GLY A O   1 
ATOM   254  N N   . CYS A 1 37  ? -16.410 7.381   -0.617  1.00 54.76  ? 225 CYS A N   1 
ATOM   255  C CA  . CYS A 1 37  ? -16.972 8.728   -0.623  1.00 48.47  ? 225 CYS A CA  1 
ATOM   256  C C   . CYS A 1 37  ? -18.286 8.811   0.149   1.00 45.35  ? 225 CYS A C   1 
ATOM   257  O O   . CYS A 1 37  ? -18.981 7.817   0.312   1.00 43.71  ? 225 CYS A O   1 
ATOM   258  C CB  . CYS A 1 37  ? -17.175 9.198   -2.063  1.00 49.63  ? 225 CYS A CB  1 
ATOM   259  S SG  . CYS A 1 37  ? -15.690 9.036   -3.092  1.00 82.51  ? 225 CYS A SG  1 
ATOM   260  N N   . VAL A 1 38  ? -18.615 10.006  0.626   1.00 45.42  ? 226 VAL A N   1 
ATOM   261  C CA  . VAL A 1 38  ? -19.825 10.232  1.408   1.00 44.50  ? 226 VAL A CA  1 
ATOM   262  C C   . VAL A 1 38  ? -20.705 11.302  0.765   1.00 45.45  ? 226 VAL A C   1 
ATOM   263  O O   . VAL A 1 38  ? -20.222 12.389  0.416   1.00 45.46  ? 226 VAL A O   1 
ATOM   264  C CB  . VAL A 1 38  ? -19.495 10.656  2.858   1.00 41.07  ? 226 VAL A CB  1 
ATOM   265  C CG1 . VAL A 1 38  ? -20.771 10.845  3.661   1.00 38.53  ? 226 VAL A CG1 1 
ATOM   266  C CG2 . VAL A 1 38  ? -18.595 9.629   3.522   1.00 41.05  ? 226 VAL A CG2 1 
ATOM   267  N N   . TYR A 1 39  ? -21.996 10.983  0.640   1.00 40.16  ? 227 TYR A N   1 
ATOM   268  C CA  . TYR A 1 39  ? -22.979 11.837  -0.025  1.00 38.19  ? 227 TYR A CA  1 
ATOM   269  C C   . TYR A 1 39  ? -24.160 12.206  0.871   1.00 38.75  ? 227 TYR A C   1 
ATOM   270  O O   . TYR A 1 39  ? -24.482 11.493  1.820   1.00 40.43  ? 227 TYR A O   1 
ATOM   271  C CB  . TYR A 1 39  ? -23.525 11.144  -1.277  1.00 40.04  ? 227 TYR A CB  1 
ATOM   272  C CG  . TYR A 1 39  ? -22.475 10.671  -2.251  1.00 48.25  ? 227 TYR A CG  1 
ATOM   273  C CD1 . TYR A 1 39  ? -21.883 9.424   -2.112  1.00 50.90  ? 227 TYR A CD1 1 
ATOM   274  C CD2 . TYR A 1 39  ? -22.087 11.465  -3.323  1.00 54.29  ? 227 TYR A CD2 1 
ATOM   275  C CE1 . TYR A 1 39  ? -20.926 8.987   -3.005  1.00 57.17  ? 227 TYR A CE1 1 
ATOM   276  C CE2 . TYR A 1 39  ? -21.130 11.034  -4.221  1.00 57.53  ? 227 TYR A CE2 1 
ATOM   277  C CZ  . TYR A 1 39  ? -20.555 9.795   -4.056  1.00 59.73  ? 227 TYR A CZ  1 
ATOM   278  O OH  . TYR A 1 39  ? -19.602 9.360   -4.946  1.00 66.53  ? 227 TYR A OH  1 
ATOM   279  N N   . ARG A 1 40  ? -24.813 13.317  0.546   1.00 38.31  ? 228 ARG A N   1 
ATOM   280  C CA  . ARG A 1 40  ? -26.084 13.682  1.164   1.00 39.47  ? 228 ARG A CA  1 
ATOM   281  C C   . ARG A 1 40  ? -27.238 13.241  0.264   1.00 46.06  ? 228 ARG A C   1 
ATOM   282  O O   . ARG A 1 40  ? -27.376 13.719  -0.865  1.00 49.22  ? 228 ARG A O   1 
ATOM   283  C CB  . ARG A 1 40  ? -26.156 15.187  1.419   1.00 41.08  ? 228 ARG A CB  1 
ATOM   284  C CG  . ARG A 1 40  ? -27.457 15.665  2.049   1.00 41.16  ? 228 ARG A CG  1 
ATOM   285  C CD  . ARG A 1 40  ? -27.532 17.187  2.023   1.00 43.46  ? 228 ARG A CD  1 
ATOM   286  N NE  . ARG A 1 40  ? -28.670 17.716  2.769   1.00 43.00  ? 228 ARG A NE  1 
ATOM   287  C CZ  . ARG A 1 40  ? -29.900 17.820  2.275   1.00 45.53  ? 228 ARG A CZ  1 
ATOM   288  N NH1 . ARG A 1 40  ? -30.155 17.417  1.035   1.00 44.29  ? 228 ARG A NH1 1 
ATOM   289  N NH2 . ARG A 1 40  ? -30.875 18.319  3.022   1.00 45.90  ? 228 ARG A NH2 1 
ATOM   290  N N   . ALA A 1 41  ? -28.065 12.332  0.772   1.00 42.56  ? 229 ALA A N   1 
ATOM   291  C CA  . ALA A 1 41  ? -29.156 11.752  -0.006  1.00 43.39  ? 229 ALA A CA  1 
ATOM   292  C C   . ALA A 1 41  ? -30.526 12.059  0.594   1.00 39.94  ? 229 ALA A C   1 
ATOM   293  O O   . ALA A 1 41  ? -30.648 12.351  1.777   1.00 36.95  ? 229 ALA A O   1 
ATOM   294  C CB  . ALA A 1 41  ? -28.969 10.247  -0.125  1.00 40.68  ? 229 ALA A CB  1 
ATOM   295  N N   . VAL A 1 42  ? -31.554 12.008  -0.245  1.00 40.37  ? 230 VAL A N   1 
ATOM   296  C CA  . VAL A 1 42  ? -32.930 12.072  0.225   1.00 37.78  ? 230 VAL A CA  1 
ATOM   297  C C   . VAL A 1 42  ? -33.680 10.851  -0.290  1.00 39.56  ? 230 VAL A C   1 
ATOM   298  O O   . VAL A 1 42  ? -33.842 10.676  -1.496  1.00 43.39  ? 230 VAL A O   1 
ATOM   299  C CB  . VAL A 1 42  ? -33.651 13.351  -0.241  1.00 39.29  ? 230 VAL A CB  1 
ATOM   300  C CG1 . VAL A 1 42  ? -35.095 13.339  0.230   1.00 41.50  ? 230 VAL A CG1 1 
ATOM   301  C CG2 . VAL A 1 42  ? -32.935 14.588  0.274   1.00 35.10  ? 230 VAL A CG2 1 
ATOM   302  N N   . MET A 1 43  ? -34.118 9.992   0.622   1.00 35.83  ? 231 MET A N   1 
ATOM   303  C CA  . MET A 1 43  ? -34.873 8.808   0.236   1.00 35.81  ? 231 MET A CA  1 
ATOM   304  C C   . MET A 1 43  ? -36.061 8.653   1.169   1.00 36.37  ? 231 MET A C   1 
ATOM   305  O O   . MET A 1 43  ? -35.931 8.861   2.378   1.00 31.06  ? 231 MET A O   1 
ATOM   306  C CB  . MET A 1 43  ? -33.988 7.558   0.272   1.00 36.81  ? 231 MET A CB  1 
ATOM   307  C CG  . MET A 1 43  ? -32.724 7.678   -0.567  1.00 40.22  ? 231 MET A CG  1 
ATOM   308  S SD  . MET A 1 43  ? -31.630 6.252   -0.458  0.97 47.56  ? 231 MET A SD  1 
ATOM   309  C CE  . MET A 1 43  ? -31.200 6.274   1.286   1.00 37.53  ? 231 MET A CE  1 
ATOM   310  N N   . ARG A 1 44  ? -37.214 8.300   0.600   1.00 39.07  ? 232 ARG A N   1 
ATOM   311  C CA  . ARG A 1 44  ? -38.459 8.187   1.359   1.00 40.71  ? 232 ARG A CA  1 
ATOM   312  C C   . ARG A 1 44  ? -38.664 9.418   2.237   1.00 38.24  ? 232 ARG A C   1 
ATOM   313  O O   . ARG A 1 44  ? -38.894 9.306   3.448   1.00 36.73  ? 232 ARG A O   1 
ATOM   314  C CB  . ARG A 1 44  ? -38.458 6.912   2.202   1.00 41.62  ? 232 ARG A CB  1 
ATOM   315  C CG  . ARG A 1 44  ? -38.474 5.636   1.366   1.00 47.23  ? 232 ARG A CG  1 
ATOM   316  C CD  . ARG A 1 44  ? -37.749 4.516   2.078   1.00 51.31  ? 232 ARG A CD  1 
ATOM   317  N NE  . ARG A 1 44  ? -38.576 3.329   2.286   1.00 51.83  ? 232 ARG A NE  1 
ATOM   318  C CZ  . ARG A 1 44  ? -38.496 2.221   1.556   1.00 49.19  ? 232 ARG A CZ  1 
ATOM   319  N NH1 . ARG A 1 44  ? -37.632 2.141   0.553   1.00 48.28  ? 232 ARG A NH1 1 
ATOM   320  N NH2 . ARG A 1 44  ? -39.282 1.190   1.834   1.00 50.68  ? 232 ARG A NH2 1 
ATOM   321  N N   . ASN A 1 45  ? -38.525 10.586  1.612   1.00 37.71  ? 233 ASN A N   1 
ATOM   322  C CA  . ASN A 1 45  ? -38.738 11.875  2.265   1.00 35.34  ? 233 ASN A CA  1 
ATOM   323  C C   . ASN A 1 45  ? -37.857 12.093  3.494   1.00 33.92  ? 233 ASN A C   1 
ATOM   324  O O   . ASN A 1 45  ? -38.203 12.866  4.391   1.00 33.45  ? 233 ASN A O   1 
ATOM   325  C CB  . ASN A 1 45  ? -40.210 12.022  2.645   1.00 32.84  ? 233 ASN A CB  1 
ATOM   326  C CG  . ASN A 1 45  ? -41.120 12.053  1.432   1.00 40.20  ? 233 ASN A CG  1 
ATOM   327  O OD1 . ASN A 1 45  ? -41.055 12.975  0.622   1.00 42.46  ? 233 ASN A OD1 1 
ATOM   328  N ND2 . ASN A 1 45  ? -41.982 11.048  1.308   1.00 39.69  ? 233 ASN A ND2 1 
ATOM   329  N N   . THR A 1 46  ? -36.703 11.433  3.512   1.00 30.55  ? 234 THR A N   1 
ATOM   330  C CA  . THR A 1 46  ? -35.806 11.495  4.662   1.00 31.63  ? 234 THR A CA  1 
ATOM   331  C C   . THR A 1 46  ? -34.374 11.784  4.221   1.00 36.30  ? 234 THR A C   1 
ATOM   332  O O   . THR A 1 46  ? -33.898 11.215  3.238   1.00 41.19  ? 234 THR A O   1 
ATOM   333  C CB  . THR A 1 46  ? -35.845 10.179  5.471   1.00 28.65  ? 234 THR A CB  1 
ATOM   334  O OG1 . THR A 1 46  ? -37.203 9.867   5.818   1.00 29.48  ? 234 THR A OG1 1 
ATOM   335  C CG2 . THR A 1 46  ? -35.009 10.296  6.737   1.00 27.42  ? 234 THR A CG2 1 
ATOM   336  N N   . VAL A 1 47  ? -33.691 12.670  4.942   1.00 32.44  ? 235 VAL A N   1 
ATOM   337  C CA  . VAL A 1 47  ? -32.306 13.009  4.622   1.00 32.57  ? 235 VAL A CA  1 
ATOM   338  C C   . VAL A 1 47  ? -31.316 12.059  5.302   1.00 33.69  ? 235 VAL A C   1 
ATOM   339  O O   . VAL A 1 47  ? -31.341 11.880  6.522   1.00 33.12  ? 235 VAL A O   1 
ATOM   340  C CB  . VAL A 1 47  ? -31.969 14.459  5.021   1.00 31.74  ? 235 VAL A CB  1 
ATOM   341  C CG1 . VAL A 1 47  ? -30.537 14.794  4.632   1.00 32.36  ? 235 VAL A CG1 1 
ATOM   342  C CG2 . VAL A 1 47  ? -32.932 15.426  4.351   1.00 34.33  ? 235 VAL A CG2 1 
ATOM   343  N N   . TYR A 1 48  ? -30.448 11.457  4.492   1.00 28.61  ? 236 TYR A N   1 
ATOM   344  C CA  . TYR A 1 48  ? -29.458 10.500  4.963   1.00 29.36  ? 236 TYR A CA  1 
ATOM   345  C C   . TYR A 1 48  ? -28.056 10.874  4.502   1.00 34.40  ? 236 TYR A C   1 
ATOM   346  O O   . TYR A 1 48  ? -27.886 11.649  3.561   1.00 36.56  ? 236 TYR A O   1 
ATOM   347  C CB  . TYR A 1 48  ? -29.773 9.087   4.455   1.00 30.72  ? 236 TYR A CB  1 
ATOM   348  C CG  . TYR A 1 48  ? -31.095 8.499   4.891   1.00 29.63  ? 236 TYR A CG  1 
ATOM   349  C CD1 . TYR A 1 48  ? -31.239 7.920   6.147   1.00 28.05  ? 236 TYR A CD1 1 
ATOM   350  C CD2 . TYR A 1 48  ? -32.187 8.485   4.032   1.00 27.02  ? 236 TYR A CD2 1 
ATOM   351  C CE1 . TYR A 1 48  ? -32.439 7.360   6.542   1.00 24.88  ? 236 TYR A CE1 1 
ATOM   352  C CE2 . TYR A 1 48  ? -33.391 7.929   4.417   1.00 29.73  ? 236 TYR A CE2 1 
ATOM   353  C CZ  . TYR A 1 48  ? -33.513 7.368   5.674   1.00 30.52  ? 236 TYR A CZ  1 
ATOM   354  O OH  . TYR A 1 48  ? -34.712 6.815   6.065   1.00 30.25  ? 236 TYR A OH  1 
ATOM   355  N N   . ALA A 1 49  ? -27.056 10.309  5.170   1.00 28.85  ? 237 ALA A N   1 
ATOM   356  C CA  . ALA A 1 49  ? -25.701 10.269  4.641   1.00 32.71  ? 237 ALA A CA  1 
ATOM   357  C C   . ALA A 1 49  ? -25.453 8.883   4.059   1.00 35.94  ? 237 ALA A C   1 
ATOM   358  O O   . ALA A 1 49  ? -25.782 7.876   4.685   1.00 39.74  ? 237 ALA A O   1 
ATOM   359  C CB  . ALA A 1 49  ? -24.680 10.588  5.720   1.00 26.22  ? 237 ALA A CB  1 
ATOM   360  N N   . VAL A 1 50  ? -24.886 8.827   2.861   1.00 34.07  ? 238 VAL A N   1 
ATOM   361  C CA  . VAL A 1 50  ? -24.590 7.545   2.232   1.00 36.30  ? 238 VAL A CA  1 
ATOM   362  C C   . VAL A 1 50  ? -23.092 7.392   1.984   1.00 40.34  ? 238 VAL A C   1 
ATOM   363  O O   . VAL A 1 50  ? -22.477 8.209   1.301   1.00 41.82  ? 238 VAL A O   1 
ATOM   364  C CB  . VAL A 1 50  ? -25.352 7.378   0.900   1.00 35.43  ? 238 VAL A CB  1 
ATOM   365  C CG1 . VAL A 1 50  ? -24.922 6.101   0.193   1.00 31.62  ? 238 VAL A CG1 1 
ATOM   366  C CG2 . VAL A 1 50  ? -26.849 7.376   1.146   1.00 36.27  ? 238 VAL A CG2 1 
ATOM   367  N N   . LYS A 1 51  ? -22.515 6.340   2.555   1.00 41.32  ? 239 LYS A N   1 
ATOM   368  C CA  . LYS A 1 51  ? -21.109 6.019   2.361   1.00 41.35  ? 239 LYS A CA  1 
ATOM   369  C C   . LYS A 1 51  ? -20.963 4.944   1.291   1.00 43.73  ? 239 LYS A C   1 
ATOM   370  O O   . LYS A 1 51  ? -21.469 3.831   1.434   1.00 44.91  ? 239 LYS A O   1 
ATOM   371  C CB  . LYS A 1 51  ? -20.472 5.557   3.675   1.00 42.62  ? 239 LYS A CB  1 
ATOM   372  C CG  . LYS A 1 51  ? -18.959 5.415   3.618   1.00 47.69  ? 239 LYS A CG  1 
ATOM   373  C CD  . LYS A 1 51  ? -18.337 5.361   5.011   1.00 50.73  ? 239 LYS A CD  1 
ATOM   374  C CE  . LYS A 1 51  ? -18.344 3.957   5.596   1.00 53.36  ? 239 LYS A CE  1 
ATOM   375  N NZ  . LYS A 1 51  ? -17.577 3.895   6.879   1.00 52.62  ? 239 LYS A NZ  1 
ATOM   376  N N   . ARG A 1 52  ? -20.284 5.297   0.208   1.00 42.43  ? 240 ARG A N   1 
ATOM   377  C CA  . ARG A 1 52  ? -19.990 4.362   -0.865  1.00 45.62  ? 240 ARG A CA  1 
ATOM   378  C C   . ARG A 1 52  ? -18.542 3.910   -0.760  1.00 45.04  ? 240 ARG A C   1 
ATOM   379  O O   . ARG A 1 52  ? -17.631 4.735   -0.727  1.00 44.85  ? 240 ARG A O   1 
ATOM   380  C CB  . ARG A 1 52  ? -20.249 5.001   -2.229  1.00 49.10  ? 240 ARG A CB  1 
ATOM   381  C CG  . ARG A 1 52  ? -20.037 4.056   -3.400  1.00 54.96  ? 240 ARG A CG  1 
ATOM   382  C CD  . ARG A 1 52  ? -19.978 4.816   -4.709  1.00 60.81  ? 240 ARG A CD  1 
ATOM   383  N NE  . ARG A 1 52  ? -19.663 3.940   -5.831  1.00 68.34  ? 240 ARG A NE  1 
ATOM   384  C CZ  . ARG A 1 52  ? -19.283 4.373   -7.029  1.00 74.12  ? 240 ARG A CZ  1 
ATOM   385  N NH1 . ARG A 1 52  ? -19.165 5.674   -7.258  1.00 74.70  ? 240 ARG A NH1 1 
ATOM   386  N NH2 . ARG A 1 52  ? -19.014 3.504   -7.994  1.00 78.45  ? 240 ARG A NH2 1 
ATOM   387  N N   . LEU A 1 53  ? -18.339 2.599   -0.701  1.00 44.60  ? 241 LEU A N   1 
ATOM   388  C CA  . LEU A 1 53  ? -17.004 2.030   -0.584  1.00 49.03  ? 241 LEU A CA  1 
ATOM   389  C C   . LEU A 1 53  ? -16.367 1.843   -1.958  1.00 59.63  ? 241 LEU A C   1 
ATOM   390  O O   . LEU A 1 53  ? -17.058 1.513   -2.923  1.00 62.22  ? 241 LEU A O   1 
ATOM   391  C CB  . LEU A 1 53  ? -17.062 0.700   0.162   1.00 46.13  ? 241 LEU A CB  1 
ATOM   392  C CG  . LEU A 1 53  ? -17.710 0.771   1.544   1.00 45.75  ? 241 LEU A CG  1 
ATOM   393  C CD1 . LEU A 1 53  ? -17.653 -0.578  2.232   1.00 47.48  ? 241 LEU A CD1 1 
ATOM   394  C CD2 . LEU A 1 53  ? -17.039 1.839   2.394   1.00 47.98  ? 241 LEU A CD2 1 
ATOM   395  N N   . LYS A 1 54  ? -15.055 2.070   -2.030  1.00 62.54  ? 242 LYS A N   1 
ATOM   396  C CA  . LYS A 1 54  ? -14.281 1.963   -3.270  1.00 66.67  ? 242 LYS A CA  1 
ATOM   397  C C   . LYS A 1 54  ? -14.569 0.686   -4.053  1.00 70.73  ? 242 LYS A C   1 
ATOM   398  O O   . LYS A 1 54  ? -13.930 0.418   -5.072  1.00 76.46  ? 242 LYS A O   1 
ATOM   399  C CB  . LYS A 1 54  ? -12.783 2.030   -2.966  1.00 68.66  ? 242 LYS A CB  1 
ATOM   400  C CG  . LYS A 1 54  ? -12.343 3.254   -2.179  1.00 72.19  ? 242 LYS A CG  1 
ATOM   401  C CD  . LYS A 1 54  ? -12.392 4.522   -3.018  1.00 75.74  ? 242 LYS A CD  1 
ATOM   402  C CE  . LYS A 1 54  ? -11.707 5.678   -2.295  1.00 76.19  ? 242 LYS A CE  1 
ATOM   403  N NZ  . LYS A 1 54  ? -11.764 6.954   -3.062  1.00 75.85  ? 242 LYS A NZ  1 
ATOM   404  N N   . GLU A 1 60  ? -7.684  -3.660  -2.086  1.00 81.33  ? 248 GLU A N   1 
ATOM   405  C CA  . GLU A 1 60  ? -8.315  -4.812  -2.720  1.00 85.99  ? 248 GLU A CA  1 
ATOM   406  C C   . GLU A 1 60  ? -9.802  -4.872  -2.378  1.00 87.38  ? 248 GLU A C   1 
ATOM   407  O O   . GLU A 1 60  ? -10.196 -4.623  -1.239  1.00 85.36  ? 248 GLU A O   1 
ATOM   408  C CB  . GLU A 1 60  ? -7.613  -6.107  -2.305  1.00 88.16  ? 248 GLU A CB  1 
ATOM   409  C CG  . GLU A 1 60  ? -8.120  -7.345  -3.030  1.00 91.78  ? 248 GLU A CG  1 
ATOM   410  C CD  . GLU A 1 60  ? -8.212  -7.153  -4.535  1.00 95.16  ? 248 GLU A CD  1 
ATOM   411  O OE1 . GLU A 1 60  ? -7.209  -6.730  -5.149  1.00 95.55  ? 248 GLU A OE1 1 
ATOM   412  O OE2 . GLU A 1 60  ? -9.293  -7.421  -5.104  1.00 96.72  ? 248 GLU A OE2 1 
ATOM   413  N N   . TRP A 1 61  ? -10.616 -5.213  -3.375  1.00 84.00  ? 249 TRP A N   1 
ATOM   414  C CA  . TRP A 1 61  ? -12.076 -5.153  -3.277  1.00 85.79  ? 249 TRP A CA  1 
ATOM   415  C C   . TRP A 1 61  ? -12.659 -6.004  -2.146  1.00 86.66  ? 249 TRP A C   1 
ATOM   416  O O   . TRP A 1 61  ? -13.606 -5.599  -1.462  1.00 87.63  ? 249 TRP A O   1 
ATOM   417  C CB  . TRP A 1 61  ? -12.694 -5.586  -4.609  1.00 89.52  ? 249 TRP A CB  1 
ATOM   418  C CG  . TRP A 1 61  ? -14.066 -5.036  -4.854  1.00 93.05  ? 249 TRP A CG  1 
ATOM   419  C CD1 . TRP A 1 61  ? -14.831 -4.309  -3.986  1.00 92.30  ? 249 TRP A CD1 1 
ATOM   420  C CD2 . TRP A 1 61  ? -14.834 -5.159  -6.057  1.00 96.52  ? 249 TRP A CD2 1 
ATOM   421  N NE1 . TRP A 1 61  ? -16.028 -3.978  -4.573  1.00 92.85  ? 249 TRP A NE1 1 
ATOM   422  C CE2 . TRP A 1 61  ? -16.055 -4.488  -5.845  1.00 95.23  ? 249 TRP A CE2 1 
ATOM   423  C CE3 . TRP A 1 61  ? -14.608 -5.774  -7.294  1.00 99.07  ? 249 TRP A CE3 1 
ATOM   424  C CZ2 . TRP A 1 61  ? -17.045 -4.415  -6.821  1.00 95.47  ? 249 TRP A CZ2 1 
ATOM   425  C CZ3 . TRP A 1 61  ? -15.593 -5.700  -8.262  1.00 99.40  ? 249 TRP A CZ3 1 
ATOM   426  C CH2 . TRP A 1 61  ? -16.796 -5.026  -8.020  1.00 97.81  ? 249 TRP A CH2 1 
ATOM   427  N N   . THR A 1 62  ? -12.094 -7.187  -1.950  1.00 87.80  ? 250 THR A N   1 
ATOM   428  C CA  . THR A 1 62  ? -12.600 -8.096  -0.930  1.00 86.75  ? 250 THR A CA  1 
ATOM   429  C C   . THR A 1 62  ? -12.287 -7.600  0.489   1.00 79.34  ? 250 THR A C   1 
ATOM   430  O O   . THR A 1 62  ? -12.976 -7.956  1.456   1.00 77.66  ? 250 THR A O   1 
ATOM   431  C CB  . THR A 1 62  ? -12.032 -9.504  -1.128  1.00 92.29  ? 250 THR A CB  1 
ATOM   432  O OG1 . THR A 1 62  ? -12.155 -10.244 0.092   1.00 94.84  ? 250 THR A OG1 1 
ATOM   433  C CG2 . THR A 1 62  ? -10.570 -9.430  -1.552  1.00 92.71  ? 250 THR A CG2 1 
ATOM   434  N N   . ALA A 1 63  ? -11.257 -6.767  0.607   1.00 81.86  ? 251 ALA A N   1 
ATOM   435  C CA  . ALA A 1 63  ? -10.956 -6.110  1.875   1.00 75.09  ? 251 ALA A CA  1 
ATOM   436  C C   . ALA A 1 63  ? -12.060 -5.113  2.242   1.00 70.76  ? 251 ALA A C   1 
ATOM   437  O O   . ALA A 1 63  ? -12.532 -5.082  3.389   1.00 71.80  ? 251 ALA A O   1 
ATOM   438  C CB  . ALA A 1 63  ? -9.608  -5.412  1.806   1.00 72.26  ? 251 ALA A CB  1 
ATOM   439  N N   . VAL A 1 64  ? -12.475 -4.305  1.268   1.00 72.29  ? 252 VAL A N   1 
ATOM   440  C CA  . VAL A 1 64  ? -13.553 -3.350  1.498   1.00 69.75  ? 252 VAL A CA  1 
ATOM   441  C C   . VAL A 1 64  ? -14.854 -4.122  1.708   1.00 63.11  ? 252 VAL A C   1 
ATOM   442  O O   . VAL A 1 64  ? -15.765 -3.642  2.385   1.00 62.31  ? 252 VAL A O   1 
ATOM   443  C CB  . VAL A 1 64  ? -13.694 -2.320  0.333   1.00 72.09  ? 252 VAL A CB  1 
ATOM   444  C CG1 . VAL A 1 64  ? -12.334 -2.006  -0.264  1.00 71.62  ? 252 VAL A CG1 1 
ATOM   445  C CG2 . VAL A 1 64  ? -14.655 -2.804  -0.744  1.00 71.93  ? 252 VAL A CG2 1 
ATOM   446  N N   . LYS A 1 65  ? -14.928 -5.327  1.145   1.00 61.31  ? 253 LYS A N   1 
ATOM   447  C CA  . LYS A 1 65  ? -16.065 -6.206  1.401   1.00 59.72  ? 253 LYS A CA  1 
ATOM   448  C C   . LYS A 1 65  ? -16.099 -6.587  2.881   1.00 58.71  ? 253 LYS A C   1 
ATOM   449  O O   . LYS A 1 65  ? -17.155 -6.549  3.537   1.00 58.19  ? 253 LYS A O   1 
ATOM   450  C CB  . LYS A 1 65  ? -15.982 -7.459  0.525   1.00 63.02  ? 253 LYS A CB  1 
ATOM   451  C CG  . LYS A 1 65  ? -17.247 -8.307  0.486   1.00 66.54  ? 253 LYS A CG  1 
ATOM   452  C CD  . LYS A 1 65  ? -16.992 -9.641  -0.215  1.00 71.46  ? 253 LYS A CD  1 
ATOM   453  C CE  . LYS A 1 65  ? -16.348 -9.454  -1.586  1.00 76.11  ? 253 LYS A CE  1 
ATOM   454  N NZ  . LYS A 1 65  ? -17.223 -8.715  -2.539  1.00 76.99  ? 253 LYS A NZ  1 
ATOM   455  N N   . GLN A 1 66  ? -14.927 -6.940  3.402   1.00 57.79  ? 254 GLN A N   1 
ATOM   456  C CA  . GLN A 1 66  ? -14.802 -7.324  4.806   1.00 57.13  ? 254 GLN A CA  1 
ATOM   457  C C   . GLN A 1 66  ? -15.140 -6.168  5.750   1.00 49.86  ? 254 GLN A C   1 
ATOM   458  O O   . GLN A 1 66  ? -15.866 -6.350  6.736   1.00 44.53  ? 254 GLN A O   1 
ATOM   459  C CB  . GLN A 1 66  ? -13.388 -7.839  5.092   1.00 64.73  ? 254 GLN A CB  1 
ATOM   460  C CG  . GLN A 1 66  ? -13.337 -9.228  5.720   1.00 74.08  ? 254 GLN A CG  1 
ATOM   461  C CD  . GLN A 1 66  ? -13.898 -9.256  7.128   1.00 79.79  ? 254 GLN A CD  1 
ATOM   462  O OE1 . GLN A 1 66  ? -13.163 -9.097  8.103   1.00 83.67  ? 254 GLN A OE1 1 
ATOM   463  N NE2 . GLN A 1 66  ? -15.207 -9.460  7.243   1.00 79.43  ? 254 GLN A NE2 1 
ATOM   464  N N   . SER A 1 67  ? -14.614 -4.982  5.450   1.00 48.91  ? 255 SER A N   1 
ATOM   465  C CA  . SER A 1 67  ? -14.917 -3.815  6.274   1.00 48.35  ? 255 SER A CA  1 
ATOM   466  C C   . SER A 1 67  ? -16.414 -3.494  6.200   1.00 42.85  ? 255 SER A C   1 
ATOM   467  O O   . SER A 1 67  ? -17.022 -3.088  7.196   1.00 42.06  ? 255 SER A O   1 
ATOM   468  C CB  . SER A 1 67  ? -14.078 -2.605  5.849   1.00 51.21  ? 255 SER A CB  1 
ATOM   469  O OG  . SER A 1 67  ? -14.423 -2.152  4.553   1.00 54.17  ? 255 SER A OG  1 
ATOM   470  N N   . PHE A 1 68  ? -17.002 -3.701  5.022   1.00 39.37  ? 256 PHE A N   1 
ATOM   471  C CA  . PHE A 1 68  ? -18.443 -3.525  4.832   1.00 43.14  ? 256 PHE A CA  1 
ATOM   472  C C   . PHE A 1 68  ? -19.238 -4.429  5.773   1.00 44.27  ? 256 PHE A C   1 
ATOM   473  O O   . PHE A 1 68  ? -20.060 -3.952  6.566   1.00 44.38  ? 256 PHE A O   1 
ATOM   474  C CB  . PHE A 1 68  ? -18.828 -3.809  3.373   1.00 44.57  ? 256 PHE A CB  1 
ATOM   475  C CG  . PHE A 1 68  ? -20.314 -3.792  3.113   1.00 49.99  ? 256 PHE A CG  1 
ATOM   476  C CD1 . PHE A 1 68  ? -20.982 -2.596  2.898   1.00 50.04  ? 256 PHE A CD1 1 
ATOM   477  C CD2 . PHE A 1 68  ? -21.039 -4.975  3.066   1.00 52.85  ? 256 PHE A CD2 1 
ATOM   478  C CE1 . PHE A 1 68  ? -22.342 -2.574  2.654   1.00 49.16  ? 256 PHE A CE1 1 
ATOM   479  C CE2 . PHE A 1 68  ? -22.405 -4.962  2.821   1.00 53.47  ? 256 PHE A CE2 1 
ATOM   480  C CZ  . PHE A 1 68  ? -23.056 -3.758  2.615   1.00 52.08  ? 256 PHE A CZ  1 
ATOM   481  N N   . LEU A 1 69  ? -18.979 -5.734  5.691   1.00 46.02  ? 257 LEU A N   1 
ATOM   482  C CA  . LEU A 1 69  ? -19.696 -6.703  6.520   1.00 43.72  ? 257 LEU A CA  1 
ATOM   483  C C   . LEU A 1 69  ? -19.498 -6.421  8.013   1.00 41.35  ? 257 LEU A C   1 
ATOM   484  O O   . LEU A 1 69  ? -20.445 -6.509  8.811   1.00 39.86  ? 257 LEU A O   1 
ATOM   485  C CB  . LEU A 1 69  ? -19.247 -8.129  6.184   1.00 49.35  ? 257 LEU A CB  1 
ATOM   486  C CG  . LEU A 1 69  ? -19.600 -8.662  4.791   1.00 55.29  ? 257 LEU A CG  1 
ATOM   487  C CD1 . LEU A 1 69  ? -19.085 -10.080 4.606   1.00 59.77  ? 257 LEU A CD1 1 
ATOM   488  C CD2 . LEU A 1 69  ? -21.101 -8.615  4.554   1.00 54.47  ? 257 LEU A CD2 1 
ATOM   489  N N   . THR A 1 70  ? -18.268 -6.065  8.379   1.00 43.56  ? 258 THR A N   1 
ATOM   490  C CA  . THR A 1 70  ? -17.947 -5.745  9.768   1.00 41.39  ? 258 THR A CA  1 
ATOM   491  C C   . THR A 1 70  ? -18.759 -4.554  10.276  1.00 40.42  ? 258 THR A C   1 
ATOM   492  O O   . THR A 1 70  ? -19.359 -4.610  11.360  1.00 41.67  ? 258 THR A O   1 
ATOM   493  C CB  . THR A 1 70  ? -16.441 -5.445  9.945   1.00 41.71  ? 258 THR A CB  1 
ATOM   494  O OG1 . THR A 1 70  ? -15.673 -6.612  9.613   1.00 45.17  ? 258 THR A OG1 1 
ATOM   495  C CG2 . THR A 1 70  ? -16.142 -5.035  11.382  1.00 33.96  ? 258 THR A CG2 1 
ATOM   496  N N   . GLU A 1 71  ? -18.784 -3.478  9.491   1.00 38.41  ? 259 GLU A N   1 
ATOM   497  C CA  . GLU A 1 71  ? -19.515 -2.281  9.894   1.00 33.26  ? 259 GLU A CA  1 
ATOM   498  C C   . GLU A 1 71  ? -21.014 -2.569  9.986   1.00 34.71  ? 259 GLU A C   1 
ATOM   499  O O   . GLU A 1 71  ? -21.671 -2.154  10.946  1.00 30.77  ? 259 GLU A O   1 
ATOM   500  C CB  . GLU A 1 71  ? -19.248 -1.118  8.931   1.00 35.91  ? 259 GLU A CB  1 
ATOM   501  C CG  . GLU A 1 71  ? -19.947 0.177   9.348   1.00 39.30  ? 259 GLU A CG  1 
ATOM   502  C CD  . GLU A 1 71  ? -19.251 1.434   8.850   1.00 45.59  ? 259 GLU A CD  1 
ATOM   503  O OE1 . GLU A 1 71  ? -18.399 1.333   7.943   1.00 53.22  ? 259 GLU A OE1 1 
ATOM   504  O OE2 . GLU A 1 71  ? -19.558 2.529   9.370   1.00 44.91  ? 259 GLU A OE2 1 
ATOM   505  N N   . VAL A 1 72  ? -21.551 -3.293  9.004   1.00 40.74  ? 260 VAL A N   1 
ATOM   506  C CA  . VAL A 1 72  ? -22.963 -3.678  9.055   1.00 36.78  ? 260 VAL A CA  1 
ATOM   507  C C   . VAL A 1 72  ? -23.279 -4.445  10.345  1.00 33.24  ? 260 VAL A C   1 
ATOM   508  O O   . VAL A 1 72  ? -24.211 -4.090  11.080  1.00 34.78  ? 260 VAL A O   1 
ATOM   509  C CB  . VAL A 1 72  ? -23.370 -4.532  7.833   1.00 40.90  ? 260 VAL A CB  1 
ATOM   510  C CG1 . VAL A 1 72  ? -24.789 -5.062  7.997   1.00 38.31  ? 260 VAL A CG1 1 
ATOM   511  C CG2 . VAL A 1 72  ? -23.264 -3.712  6.556   1.00 40.05  ? 260 VAL A CG2 1 
ATOM   512  N N   . GLU A 1 73  ? -22.487 -5.473  10.640  1.00 34.66  ? 261 GLU A N   1 
ATOM   513  C CA  . GLU A 1 73  ? -22.720 -6.274  11.844  1.00 40.45  ? 261 GLU A CA  1 
ATOM   514  C C   . GLU A 1 73  ? -22.646 -5.452  13.137  1.00 37.16  ? 261 GLU A C   1 
ATOM   515  O O   . GLU A 1 73  ? -23.574 -5.466  13.970  1.00 42.30  ? 261 GLU A O   1 
ATOM   516  C CB  . GLU A 1 73  ? -21.717 -7.428  11.920  1.00 49.44  ? 261 GLU A CB  1 
ATOM   517  C CG  . GLU A 1 73  ? -21.891 -8.290  13.164  1.00 59.34  ? 261 GLU A CG  1 
ATOM   518  C CD  . GLU A 1 73  ? -20.761 -9.281  13.369  1.00 67.89  ? 261 GLU A CD  1 
ATOM   519  O OE1 . GLU A 1 73  ? -20.008 -9.544  12.406  1.00 70.06  ? 261 GLU A OE1 1 
ATOM   520  O OE2 . GLU A 1 73  ? -20.625 -9.795  14.501  1.00 70.52  ? 261 GLU A OE2 1 
ATOM   521  N N   . GLN A 1 74  ? -21.546 -4.727  13.303  1.00 34.12  ? 262 GLN A N   1 
ATOM   522  C CA  . GLN A 1 74  ? -21.309 -4.034  14.564  1.00 35.01  ? 262 GLN A CA  1 
ATOM   523  C C   . GLN A 1 74  ? -22.264 -2.863  14.772  1.00 32.01  ? 262 GLN A C   1 
ATOM   524  O O   . GLN A 1 74  ? -22.695 -2.606  15.897  1.00 33.06  ? 262 GLN A O   1 
ATOM   525  C CB  . GLN A 1 74  ? -19.853 -3.565  14.648  1.00 37.64  ? 262 GLN A CB  1 
ATOM   526  C CG  . GLN A 1 74  ? -18.835 -4.705  14.554  1.00 39.89  ? 262 GLN A CG  1 
ATOM   527  C CD  . GLN A 1 74  ? -18.959 -5.718  15.684  1.00 44.83  ? 262 GLN A CD  1 
ATOM   528  O OE1 . GLN A 1 74  ? -19.652 -5.487  16.679  1.00 45.94  ? 262 GLN A OE1 1 
ATOM   529  N NE2 . GLN A 1 74  ? -18.278 -6.847  15.536  1.00 48.04  ? 262 GLN A NE2 1 
ATOM   530  N N   . LEU A 1 75  ? -22.607 -2.157  13.699  1.00 32.94  ? 263 LEU A N   1 
ATOM   531  C CA  . LEU A 1 75  ? -23.592 -1.085  13.825  1.00 32.97  ? 263 LEU A CA  1 
ATOM   532  C C   . LEU A 1 75  ? -24.994 -1.662  14.019  1.00 38.03  ? 263 LEU A C   1 
ATOM   533  O O   . LEU A 1 75  ? -25.864 -1.002  14.583  1.00 35.47  ? 263 LEU A O   1 
ATOM   534  C CB  . LEU A 1 75  ? -23.563 -0.154  12.613  1.00 30.40  ? 263 LEU A CB  1 
ATOM   535  C CG  . LEU A 1 75  ? -22.383 0.818   12.547  1.00 31.43  ? 263 LEU A CG  1 
ATOM   536  C CD1 . LEU A 1 75  ? -22.560 1.788   11.391  1.00 31.79  ? 263 LEU A CD1 1 
ATOM   537  C CD2 . LEU A 1 75  ? -22.231 1.573   13.863  1.00 27.54  ? 263 LEU A CD2 1 
ATOM   538  N N   . SER A 1 76  ? -25.221 -2.890  13.559  1.00 38.80  ? 264 SER A N   1 
ATOM   539  C CA  . SER A 1 76  ? -26.475 -3.557  13.898  1.00 42.81  ? 264 SER A CA  1 
ATOM   540  C C   . SER A 1 76  ? -26.522 -3.840  15.398  1.00 46.69  ? 264 SER A C   1 
ATOM   541  O O   . SER A 1 76  ? -27.563 -3.665  16.032  1.00 47.65  ? 264 SER A O   1 
ATOM   542  C CB  . SER A 1 76  ? -26.650 -4.853  13.106  1.00 40.64  ? 264 SER A CB  1 
ATOM   543  O OG  . SER A 1 76  ? -26.931 -4.580  11.745  1.00 40.92  ? 264 SER A OG  1 
ATOM   544  N N   . ARG A 1 77  ? -25.399 -4.276  15.968  1.00 41.96  ? 265 ARG A N   1 
ATOM   545  C CA  . ARG A 1 77  ? -25.369 -4.572  17.405  1.00 39.32  ? 265 ARG A CA  1 
ATOM   546  C C   . ARG A 1 77  ? -25.332 -3.344  18.330  1.00 41.54  ? 265 ARG A C   1 
ATOM   547  O O   . ARG A 1 77  ? -26.107 -3.254  19.286  1.00 46.08  ? 265 ARG A O   1 
ATOM   548  C CB  . ARG A 1 77  ? -24.173 -5.467  17.741  1.00 42.99  ? 265 ARG A CB  1 
ATOM   549  C CG  . ARG A 1 77  ? -23.899 -5.525  19.236  1.00 47.09  ? 265 ARG A CG  1 
ATOM   550  C CD  . ARG A 1 77  ? -22.998 -6.676  19.637  1.00 54.55  ? 265 ARG A CD  1 
ATOM   551  N NE  . ARG A 1 77  ? -22.814 -6.698  21.086  1.00 56.63  ? 265 ARG A NE  1 
ATOM   552  C CZ  . ARG A 1 77  ? -23.684 -7.228  21.941  1.00 55.33  ? 265 ARG A CZ  1 
ATOM   553  N NH1 . ARG A 1 77  ? -23.439 -7.200  23.245  1.00 51.55  ? 265 ARG A NH1 1 
ATOM   554  N NH2 . ARG A 1 77  ? -24.801 -7.787  21.494  1.00 56.62  ? 265 ARG A NH2 1 
ATOM   555  N N   . PHE A 1 78  ? -24.430 -2.406  18.056  1.00 37.79  ? 266 PHE A N   1 
ATOM   556  C CA  . PHE A 1 78  ? -24.200 -1.297  18.978  1.00 35.67  ? 266 PHE A CA  1 
ATOM   557  C C   . PHE A 1 78  ? -24.951 -0.031  18.588  1.00 33.53  ? 266 PHE A C   1 
ATOM   558  O O   . PHE A 1 78  ? -24.709 0.558   17.533  1.00 34.12  ? 266 PHE A O   1 
ATOM   559  C CB  . PHE A 1 78  ? -22.698 -1.004  19.090  1.00 36.82  ? 266 PHE A CB  1 
ATOM   560  C CG  . PHE A 1 78  ? -21.939 -2.050  19.863  1.00 43.01  ? 266 PHE A CG  1 
ATOM   561  C CD1 . PHE A 1 78  ? -21.894 -2.009  21.248  1.00 44.73  ? 266 PHE A CD1 1 
ATOM   562  C CD2 . PHE A 1 78  ? -21.281 -3.076  19.207  1.00 45.32  ? 266 PHE A CD2 1 
ATOM   563  C CE1 . PHE A 1 78  ? -21.202 -2.968  21.964  1.00 48.33  ? 266 PHE A CE1 1 
ATOM   564  C CE2 . PHE A 1 78  ? -20.587 -4.043  19.919  1.00 48.29  ? 266 PHE A CE2 1 
ATOM   565  C CZ  . PHE A 1 78  ? -20.546 -3.987  21.300  1.00 47.94  ? 266 PHE A CZ  1 
ATOM   566  N N   . ARG A 1 79  ? -25.868 0.376   19.461  1.00 34.17  ? 267 ARG A N   1 
ATOM   567  C CA  . ARG A 1 79  ? -26.669 1.576   19.262  1.00 32.09  ? 267 ARG A CA  1 
ATOM   568  C C   . ARG A 1 79  ? -26.539 2.453   20.503  1.00 36.72  ? 267 ARG A C   1 
ATOM   569  O O   . ARG A 1 79  ? -26.789 2.006   21.626  1.00 33.89  ? 267 ARG A O   1 
ATOM   570  C CB  . ARG A 1 79  ? -28.133 1.220   18.982  1.00 30.75  ? 267 ARG A CB  1 
ATOM   571  C CG  . ARG A 1 79  ? -28.312 0.226   17.830  1.00 34.90  ? 267 ARG A CG  1 
ATOM   572  C CD  . ARG A 1 79  ? -29.780 -0.130  17.591  1.00 33.79  ? 267 ARG A CD  1 
ATOM   573  N NE  . ARG A 1 79  ? -30.585 1.052   17.300  1.00 33.28  ? 267 ARG A NE  1 
ATOM   574  C CZ  . ARG A 1 79  ? -31.871 1.022   16.958  1.00 35.56  ? 267 ARG A CZ  1 
ATOM   575  N NH1 . ARG A 1 79  ? -32.506 -0.138  16.838  1.00 31.15  ? 267 ARG A NH1 1 
ATOM   576  N NH2 . ARG A 1 79  ? -32.516 2.161   16.719  1.00 29.54  ? 267 ARG A NH2 1 
ATOM   577  N N   . HIS A 1 80  ? -26.073 3.680   20.291  1.00 32.45  ? 268 HIS A N   1 
ATOM   578  C CA  . HIS A 1 80  ? -25.714 4.575   21.383  1.00 26.75  ? 268 HIS A CA  1 
ATOM   579  C C   . HIS A 1 80  ? -25.964 6.017   20.941  1.00 21.58  ? 268 HIS A C   1 
ATOM   580  O O   . HIS A 1 80  ? -25.845 6.313   19.755  1.00 30.00  ? 268 HIS A O   1 
ATOM   581  C CB  . HIS A 1 80  ? -24.246 4.333   21.773  1.00 23.04  ? 268 HIS A CB  1 
ATOM   582  C CG  . HIS A 1 80  ? -23.838 4.968   23.066  1.00 25.88  ? 268 HIS A CG  1 
ATOM   583  N ND1 . HIS A 1 80  ? -23.338 6.251   23.139  1.00 23.84  ? 268 HIS A ND1 1 
ATOM   584  C CD2 . HIS A 1 80  ? -23.849 4.496   24.335  1.00 24.27  ? 268 HIS A CD2 1 
ATOM   585  C CE1 . HIS A 1 80  ? -23.064 6.543   24.398  1.00 25.18  ? 268 HIS A CE1 1 
ATOM   586  N NE2 . HIS A 1 80  ? -23.365 5.496   25.144  1.00 26.30  ? 268 HIS A NE2 1 
ATOM   587  N N   . PRO A 1 81  ? -26.312 6.918   21.876  1.00 23.98  ? 269 PRO A N   1 
ATOM   588  C CA  . PRO A 1 81  ? -26.504 8.333   21.512  1.00 23.27  ? 269 PRO A CA  1 
ATOM   589  C C   . PRO A 1 81  ? -25.244 8.983   20.915  1.00 24.51  ? 269 PRO A C   1 
ATOM   590  O O   . PRO A 1 81  ? -25.325 9.982   20.207  1.00 25.72  ? 269 PRO A O   1 
ATOM   591  C CB  . PRO A 1 81  ? -26.863 9.001   22.852  1.00 23.75  ? 269 PRO A CB  1 
ATOM   592  C CG  . PRO A 1 81  ? -27.360 7.898   23.714  1.00 25.61  ? 269 PRO A CG  1 
ATOM   593  C CD  . PRO A 1 81  ? -26.627 6.660   23.294  1.00 24.39  ? 269 PRO A CD  1 
ATOM   594  N N   . ASN A 1 82  ? -24.084 8.452   21.278  1.00 24.90  ? 270 ASN A N   1 
ATOM   595  C CA  . ASN A 1 82  ? -22.800 8.910   20.753  1.00 21.69  ? 270 ASN A CA  1 
ATOM   596  C C   . ASN A 1 82  ? -22.234 8.062   19.595  1.00 30.71  ? 270 ASN A C   1 
ATOM   597  O O   . ASN A 1 82  ? -21.066 8.207   19.221  1.00 27.70  ? 270 ASN A O   1 
ATOM   598  C CB  . ASN A 1 82  ? -21.812 9.043   21.905  1.00 19.34  ? 270 ASN A CB  1 
ATOM   599  C CG  . ASN A 1 82  ? -22.228 10.138  22.886  1.00 22.82  ? 270 ASN A CG  1 
ATOM   600  O OD1 . ASN A 1 82  ? -22.482 9.876   24.060  1.00 26.22  ? 270 ASN A OD1 1 
ATOM   601  N ND2 . ASN A 1 82  ? -22.329 11.368  22.391  1.00 22.56  ? 270 ASN A ND2 1 
ATOM   602  N N   . ILE A 1 83  ? -23.030 7.116   19.100  1.00 27.37  ? 271 ILE A N   1 
ATOM   603  C CA  . ILE A 1 83  ? -22.670 6.338   17.910  1.00 23.64  ? 271 ILE A CA  1 
ATOM   604  C C   . ILE A 1 83  ? -23.601 6.670   16.728  1.00 29.99  ? 271 ILE A C   1 
ATOM   605  O O   . ILE A 1 83  ? -24.803 6.867   16.924  1.00 28.97  ? 271 ILE A O   1 
ATOM   606  C CB  . ILE A 1 83  ? -22.713 4.823   18.225  1.00 25.29  ? 271 ILE A CB  1 
ATOM   607  C CG1 . ILE A 1 83  ? -21.655 4.490   19.281  1.00 25.30  ? 271 ILE A CG1 1 
ATOM   608  C CG2 . ILE A 1 83  ? -22.510 3.975   16.970  1.00 25.13  ? 271 ILE A CG2 1 
ATOM   609  C CD1 . ILE A 1 83  ? -21.538 3.016   19.603  1.00 27.16  ? 271 ILE A CD1 1 
ATOM   610  N N   . VAL A 1 84  ? -23.051 6.741   15.511  1.00 28.06  ? 272 VAL A N   1 
ATOM   611  C CA  . VAL A 1 84  ? -23.855 7.066   14.323  1.00 29.62  ? 272 VAL A CA  1 
ATOM   612  C C   . VAL A 1 84  ? -25.035 6.101   14.171  1.00 27.36  ? 272 VAL A C   1 
ATOM   613  O O   . VAL A 1 84  ? -24.915 4.914   14.469  1.00 27.14  ? 272 VAL A O   1 
ATOM   614  C CB  . VAL A 1 84  ? -23.012 7.040   13.014  1.00 25.75  ? 272 VAL A CB  1 
ATOM   615  C CG1 . VAL A 1 84  ? -21.933 8.116   13.045  1.00 28.20  ? 272 VAL A CG1 1 
ATOM   616  C CG2 . VAL A 1 84  ? -22.395 5.670   12.790  1.00 23.65  ? 272 VAL A CG2 1 
ATOM   617  N N   . ASP A 1 85  ? -26.180 6.617   13.735  1.00 26.12  ? 273 ASP A N   1 
ATOM   618  C CA  A ASP A 1 85  ? -27.362 5.783   13.550  0.56 31.69  ? 273 ASP A CA  1 
ATOM   619  C CA  B ASP A 1 85  ? -27.359 5.777   13.553  0.44 31.56  ? 273 ASP A CA  1 
ATOM   620  C C   . ASP A 1 85  ? -27.315 5.076   12.203  1.00 31.89  ? 273 ASP A C   1 
ATOM   621  O O   . ASP A 1 85  ? -27.204 5.716   11.164  1.00 36.18  ? 273 ASP A O   1 
ATOM   622  C CB  A ASP A 1 85  ? -28.642 6.615   13.665  0.56 32.31  ? 273 ASP A CB  1 
ATOM   623  C CB  B ASP A 1 85  ? -28.646 6.595   13.675  0.44 32.56  ? 273 ASP A CB  1 
ATOM   624  C CG  A ASP A 1 85  ? -28.796 7.260   15.031  0.56 37.77  ? 273 ASP A CG  1 
ATOM   625  C CG  B ASP A 1 85  ? -29.883 5.717   13.774  0.44 36.13  ? 273 ASP A CG  1 
ATOM   626  O OD1 A ASP A 1 85  ? -28.615 8.492   15.129  0.56 38.35  ? 273 ASP A OD1 1 
ATOM   627  O OD1 B ASP A 1 85  ? -30.956 6.128   13.284  0.44 44.14  ? 273 ASP A OD1 1 
ATOM   628  O OD2 A ASP A 1 85  ? -29.084 6.533   16.008  0.56 45.06  ? 273 ASP A OD2 1 
ATOM   629  O OD2 B ASP A 1 85  ? -29.784 4.611   14.347  0.44 34.52  ? 273 ASP A OD2 1 
ATOM   630  N N   . PHE A 1 86  ? -27.407 3.754   12.231  1.00 33.81  ? 274 PHE A N   1 
ATOM   631  C CA  . PHE A 1 86  ? -27.332 2.955   11.019  1.00 33.71  ? 274 PHE A CA  1 
ATOM   632  C C   . PHE A 1 86  ? -28.727 2.732   10.431  1.00 33.90  ? 274 PHE A C   1 
ATOM   633  O O   . PHE A 1 86  ? -29.594 2.116   11.050  1.00 34.67  ? 274 PHE A O   1 
ATOM   634  C CB  . PHE A 1 86  ? -26.637 1.624   11.320  1.00 33.67  ? 274 PHE A CB  1 
ATOM   635  C CG  . PHE A 1 86  ? -26.459 0.740   10.122  1.00 33.97  ? 274 PHE A CG  1 
ATOM   636  C CD1 . PHE A 1 86  ? -25.725 1.169   9.031   1.00 34.54  ? 274 PHE A CD1 1 
ATOM   637  C CD2 . PHE A 1 86  ? -27.004 -0.531  10.098  1.00 34.87  ? 274 PHE A CD2 1 
ATOM   638  C CE1 . PHE A 1 86  ? -25.552 0.354   7.934   1.00 36.50  ? 274 PHE A CE1 1 
ATOM   639  C CE2 . PHE A 1 86  ? -26.834 -1.357  8.999   1.00 35.96  ? 274 PHE A CE2 1 
ATOM   640  C CZ  . PHE A 1 86  ? -26.106 -0.914  7.918   1.00 37.81  ? 274 PHE A CZ  1 
ATOM   641  N N   . ALA A 1 87  ? -28.923 3.274   9.234   1.00 30.30  ? 275 ALA A N   1 
ATOM   642  C CA  . ALA A 1 87  ? -30.182 3.236   8.499   1.00 31.29  ? 275 ALA A CA  1 
ATOM   643  C C   . ALA A 1 87  ? -30.251 2.073   7.502   1.00 36.87  ? 275 ALA A C   1 
ATOM   644  O O   . ALA A 1 87  ? -31.202 1.974   6.722   1.00 39.49  ? 275 ALA A O   1 
ATOM   645  C CB  . ALA A 1 87  ? -30.403 4.559   7.781   1.00 30.32  ? 275 ALA A CB  1 
ATOM   646  N N   . GLY A 1 88  ? -29.244 1.202   7.522   1.00 35.89  ? 276 GLY A N   1 
ATOM   647  C CA  . GLY A 1 88  ? -29.187 0.084   6.595   1.00 32.87  ? 276 GLY A CA  1 
ATOM   648  C C   . GLY A 1 88  ? -28.140 0.125   5.492   1.00 37.21  ? 276 GLY A C   1 
ATOM   649  O O   . GLY A 1 88  ? -27.283 1.011   5.454   1.00 37.92  ? 276 GLY A O   1 
ATOM   650  N N   . TYR A 1 89  ? -28.191 -0.874  4.613   1.00 36.68  ? 277 TYR A N   1 
ATOM   651  C CA  . TYR A 1 89  ? -27.112 -1.130  3.661   1.00 40.14  ? 277 TYR A CA  1 
ATOM   652  C C   . TYR A 1 89  ? -27.606 -1.425  2.250   1.00 42.25  ? 277 TYR A C   1 
ATOM   653  O O   . TYR A 1 89  ? -28.768 -1.781  2.046   1.00 45.41  ? 277 TYR A O   1 
ATOM   654  C CB  . TYR A 1 89  ? -26.270 -2.317  4.133   1.00 40.41  ? 277 TYR A CB  1 
ATOM   655  C CG  . TYR A 1 89  ? -26.996 -3.640  3.993   1.00 44.41  ? 277 TYR A CG  1 
ATOM   656  C CD1 . TYR A 1 89  ? -27.934 -4.039  4.936   1.00 45.35  ? 277 TYR A CD1 1 
ATOM   657  C CD2 . TYR A 1 89  ? -26.754 -4.482  2.911   1.00 48.02  ? 277 TYR A CD2 1 
ATOM   658  C CE1 . TYR A 1 89  ? -28.608 -5.238  4.813   1.00 45.64  ? 277 TYR A CE1 1 
ATOM   659  C CE2 . TYR A 1 89  ? -27.425 -5.686  2.779   1.00 49.39  ? 277 TYR A CE2 1 
ATOM   660  C CZ  . TYR A 1 89  ? -28.350 -6.059  3.734   1.00 50.97  ? 277 TYR A CZ  1 
ATOM   661  O OH  . TYR A 1 89  ? -29.022 -7.256  3.612   1.00 50.46  ? 277 TYR A OH  1 
ATOM   662  N N   . CYS A 1 90  ? -26.713 -1.271  1.278   1.00 39.38  ? 278 CYS A N   1 
ATOM   663  C CA  . CYS A 1 90  ? -26.941 -1.810  -0.056  1.00 41.63  ? 278 CYS A CA  1 
ATOM   664  C C   . CYS A 1 90  ? -25.683 -2.477  -0.613  1.00 48.61  ? 278 CYS A C   1 
ATOM   665  O O   . CYS A 1 90  ? -24.660 -1.813  -0.794  1.00 47.15  ? 278 CYS A O   1 
ATOM   666  C CB  . CYS A 1 90  ? -27.400 -0.704  -1.002  1.00 42.03  ? 278 CYS A CB  1 
ATOM   667  S SG  . CYS A 1 90  ? -27.522 -1.217  -2.726  1.00 64.20  ? 278 CYS A SG  1 
ATOM   668  N N   . ALA A 1 91  ? -25.743 -3.783  -0.874  1.00 49.65  ? 279 ALA A N   1 
ATOM   669  C CA  . ALA A 1 91  ? -24.722 -4.416  -1.708  1.00 52.78  ? 279 ALA A CA  1 
ATOM   670  C C   . ALA A 1 91  ? -25.337 -4.978  -2.990  1.00 57.31  ? 279 ALA A C   1 
ATOM   671  O O   . ALA A 1 91  ? -25.978 -6.029  -2.971  1.00 58.13  ? 279 ALA A O   1 
ATOM   672  C CB  . ALA A 1 91  ? -24.009 -5.515  -0.935  1.00 48.01  ? 279 ALA A CB  1 
ATOM   673  N N   . GLN A 1 92  ? -25.083 -4.305  -4.107  1.00 55.20  ? 280 GLN A N   1 
ATOM   674  C CA  . GLN A 1 92  ? -25.607 -4.722  -5.407  1.00 59.19  ? 280 GLN A CA  1 
ATOM   675  C C   . GLN A 1 92  ? -24.684 -4.292  -6.532  1.00 54.51  ? 280 GLN A C   1 
ATOM   676  O O   . GLN A 1 92  ? -24.130 -3.194  -6.484  1.00 53.22  ? 280 GLN A O   1 
ATOM   677  C CB  . GLN A 1 92  ? -26.998 -4.130  -5.658  1.00 67.27  ? 280 GLN A CB  1 
ATOM   678  C CG  . GLN A 1 92  ? -28.154 -4.832  -4.975  1.00 72.48  ? 280 GLN A CG  1 
ATOM   679  C CD  . GLN A 1 92  ? -29.492 -4.248  -5.386  1.00 77.05  ? 280 GLN A CD  1 
ATOM   680  O OE1 . GLN A 1 92  ? -29.678 -3.850  -6.537  1.00 81.06  ? 280 GLN A OE1 1 
ATOM   681  N NE2 . GLN A 1 92  ? -30.428 -4.181  -4.445  1.00 75.73  ? 280 GLN A NE2 1 
ATOM   682  N N   . ASN A 1 93  ? -24.559 -5.137  -7.553  1.00 57.39  ? 281 ASN A N   1 
ATOM   683  C CA  . ASN A 1 93  ? -23.890 -4.770  -8.799  1.00 62.79  ? 281 ASN A CA  1 
ATOM   684  C C   . ASN A 1 93  ? -22.523 -4.116  -8.576  1.00 65.13  ? 281 ASN A C   1 
ATOM   685  O O   . ASN A 1 93  ? -22.171 -3.142  -9.239  1.00 68.80  ? 281 ASN A O   1 
ATOM   686  C CB  . ASN A 1 93  ? -24.799 -3.836  -9.611  1.00 63.87  ? 281 ASN A CB  1 
ATOM   687  C CG  . ASN A 1 93  ? -24.347 -3.676  -11.053 1.00 66.94  ? 281 ASN A CG  1 
ATOM   688  O OD1 . ASN A 1 93  ? -23.702 -4.560  -11.618 1.00 67.73  ? 281 ASN A OD1 1 
ATOM   689  N ND2 . ASN A 1 93  ? -24.678 -2.537  -11.652 1.00 67.08  ? 281 ASN A ND2 1 
ATOM   690  N N   . GLY A 1 94  ? -21.768 -4.640  -7.616  1.00 68.42  ? 282 GLY A N   1 
ATOM   691  C CA  . GLY A 1 94  ? -20.450 -4.110  -7.316  1.00 66.53  ? 282 GLY A CA  1 
ATOM   692  C C   . GLY A 1 94  ? -20.439 -2.860  -6.451  1.00 65.97  ? 282 GLY A C   1 
ATOM   693  O O   . GLY A 1 94  ? -19.372 -2.351  -6.107  1.00 66.97  ? 282 GLY A O   1 
ATOM   694  N N   . PHE A 1 95  ? -21.622 -2.358  -6.104  1.00 62.79  ? 283 PHE A N   1 
ATOM   695  C CA  . PHE A 1 95  ? -21.733 -1.202  -5.216  1.00 59.29  ? 283 PHE A CA  1 
ATOM   696  C C   . PHE A 1 95  ? -21.843 -1.643  -3.758  1.00 57.18  ? 283 PHE A C   1 
ATOM   697  O O   . PHE A 1 95  ? -22.618 -2.541  -3.428  1.00 57.34  ? 283 PHE A O   1 
ATOM   698  C CB  . PHE A 1 95  ? -22.945 -0.337  -5.583  1.00 59.32  ? 283 PHE A CB  1 
ATOM   699  C CG  . PHE A 1 95  ? -22.762 0.482   -6.832  1.00 62.87  ? 283 PHE A CG  1 
ATOM   700  C CD1 . PHE A 1 95  ? -23.074 -0.043  -8.076  1.00 65.76  ? 283 PHE A CD1 1 
ATOM   701  C CD2 . PHE A 1 95  ? -22.297 1.786   -6.759  1.00 65.29  ? 283 PHE A CD2 1 
ATOM   702  C CE1 . PHE A 1 95  ? -22.912 0.712   -9.225  1.00 69.25  ? 283 PHE A CE1 1 
ATOM   703  C CE2 . PHE A 1 95  ? -22.133 2.546   -7.905  1.00 67.98  ? 283 PHE A CE2 1 
ATOM   704  C CZ  . PHE A 1 95  ? -22.441 2.008   -9.140  1.00 69.93  ? 283 PHE A CZ  1 
ATOM   705  N N   . TYR A 1 96  ? -21.066 -1.008  -2.888  1.00 52.51  ? 284 TYR A N   1 
ATOM   706  C CA  . TYR A 1 96  ? -21.189 -1.240  -1.455  1.00 50.58  ? 284 TYR A CA  1 
ATOM   707  C C   . TYR A 1 96  ? -21.532 0.066   -0.751  1.00 47.25  ? 284 TYR A C   1 
ATOM   708  O O   . TYR A 1 96  ? -20.770 1.031   -0.801  1.00 45.21  ? 284 TYR A O   1 
ATOM   709  C CB  . TYR A 1 96  ? -19.907 -1.848  -0.887  1.00 54.89  ? 284 TYR A CB  1 
ATOM   710  C CG  . TYR A 1 96  ? -19.693 -3.283  -1.312  1.00 61.68  ? 284 TYR A CG  1 
ATOM   711  C CD1 . TYR A 1 96  ? -20.328 -4.324  -0.647  1.00 64.79  ? 284 TYR A CD1 1 
ATOM   712  C CD2 . TYR A 1 96  ? -18.865 -3.597  -2.382  1.00 67.53  ? 284 TYR A CD2 1 
ATOM   713  C CE1 . TYR A 1 96  ? -20.142 -5.638  -1.034  1.00 70.76  ? 284 TYR A CE1 1 
ATOM   714  C CE2 . TYR A 1 96  ? -18.673 -4.909  -2.777  1.00 72.69  ? 284 TYR A CE2 1 
ATOM   715  C CZ  . TYR A 1 96  ? -19.313 -5.924  -2.100  1.00 75.01  ? 284 TYR A CZ  1 
ATOM   716  O OH  . TYR A 1 96  ? -19.123 -7.230  -2.490  1.00 80.42  ? 284 TYR A OH  1 
ATOM   717  N N   . CYS A 1 97  ? -22.693 0.090   -0.105  1.00 46.93  ? 285 CYS A N   1 
ATOM   718  C CA  . CYS A 1 97  ? -23.211 1.318   0.480   1.00 41.93  ? 285 CYS A CA  1 
ATOM   719  C C   . CYS A 1 97  ? -23.726 1.138   1.898   1.00 40.44  ? 285 CYS A C   1 
ATOM   720  O O   . CYS A 1 97  ? -24.369 0.143   2.227   1.00 39.60  ? 285 CYS A O   1 
ATOM   721  C CB  . CYS A 1 97  ? -24.326 1.888   -0.397  1.00 42.81  ? 285 CYS A CB  1 
ATOM   722  S SG  . CYS A 1 97  ? -23.762 2.428   -2.022  1.00 60.06  ? 285 CYS A SG  1 
ATOM   723  N N   . LEU A 1 98  ? -23.424 2.126   2.730   1.00 40.91  ? 286 LEU A N   1 
ATOM   724  C CA  . LEU A 1 98  ? -23.920 2.192   4.091   1.00 40.17  ? 286 LEU A CA  1 
ATOM   725  C C   . LEU A 1 98  ? -24.748 3.459   4.243   1.00 36.73  ? 286 LEU A C   1 
ATOM   726  O O   . LEU A 1 98  ? -24.335 4.529   3.813   1.00 35.27  ? 286 LEU A O   1 
ATOM   727  C CB  . LEU A 1 98  ? -22.757 2.162   5.083   1.00 41.96  ? 286 LEU A CB  1 
ATOM   728  C CG  . LEU A 1 98  ? -21.972 0.854   4.982   1.00 46.13  ? 286 LEU A CG  1 
ATOM   729  C CD1 . LEU A 1 98  ? -20.581 0.973   5.583   1.00 42.84  ? 286 LEU A CD1 1 
ATOM   730  C CD2 . LEU A 1 98  ? -22.760 -0.251  5.658   1.00 48.24  ? 286 LEU A CD2 1 
ATOM   731  N N   . VAL A 1 99  ? -25.928 3.335   4.834   1.00 35.94  ? 287 VAL A N   1 
ATOM   732  C CA  . VAL A 1 99  ? -26.816 4.478   4.981   1.00 33.07  ? 287 VAL A CA  1 
ATOM   733  C C   . VAL A 1 99  ? -26.884 4.855   6.456   1.00 32.95  ? 287 VAL A C   1 
ATOM   734  O O   . VAL A 1 99  ? -26.978 3.977   7.306   1.00 31.75  ? 287 VAL A O   1 
ATOM   735  C CB  . VAL A 1 99  ? -28.233 4.173   4.428   1.00 31.28  ? 287 VAL A CB  1 
ATOM   736  C CG1 . VAL A 1 99  ? -29.100 5.418   4.447   1.00 27.87  ? 287 VAL A CG1 1 
ATOM   737  C CG2 . VAL A 1 99  ? -28.139 3.614   3.013   1.00 32.63  ? 287 VAL A CG2 1 
ATOM   738  N N   . TYR A 1 100 ? -26.795 6.152   6.749   1.00 28.06  ? 288 TYR A N   1 
ATOM   739  C CA  . TYR A 1 100 ? -26.851 6.652   8.123   1.00 30.04  ? 288 TYR A CA  1 
ATOM   740  C C   . TYR A 1 100 ? -27.771 7.866   8.245   1.00 30.12  ? 288 TYR A C   1 
ATOM   741  O O   . TYR A 1 100 ? -27.982 8.589   7.277   1.00 29.13  ? 288 TYR A O   1 
ATOM   742  C CB  . TYR A 1 100 ? -25.467 7.066   8.634   1.00 29.71  ? 288 TYR A CB  1 
ATOM   743  C CG  . TYR A 1 100 ? -24.315 6.137   8.353   1.00 30.62  ? 288 TYR A CG  1 
ATOM   744  C CD1 . TYR A 1 100 ? -23.867 5.241   9.318   1.00 31.25  ? 288 TYR A CD1 1 
ATOM   745  C CD2 . TYR A 1 100 ? -23.631 6.195   7.146   1.00 32.43  ? 288 TYR A CD2 1 
ATOM   746  C CE1 . TYR A 1 100 ? -22.791 4.409   9.077   1.00 31.05  ? 288 TYR A CE1 1 
ATOM   747  C CE2 . TYR A 1 100 ? -22.549 5.363   6.896   1.00 33.51  ? 288 TYR A CE2 1 
ATOM   748  C CZ  . TYR A 1 100 ? -22.134 4.472   7.865   1.00 34.06  ? 288 TYR A CZ  1 
ATOM   749  O OH  . TYR A 1 100 ? -21.059 3.643   7.628   1.00 36.78  ? 288 TYR A OH  1 
ATOM   750  N N   . GLY A 1 101 ? -28.293 8.103   9.445   1.00 31.03  ? 289 GLY A N   1 
ATOM   751  C CA  . GLY A 1 101 ? -28.978 9.352   9.722   1.00 30.03  ? 289 GLY A CA  1 
ATOM   752  C C   . GLY A 1 101 ? -28.028 10.509  9.449   1.00 32.77  ? 289 GLY A C   1 
ATOM   753  O O   . GLY A 1 101 ? -26.855 10.460  9.821   1.00 31.04  ? 289 GLY A O   1 
ATOM   754  N N   . PHE A 1 102 ? -28.526 11.542  8.781   1.00 33.58  ? 290 PHE A N   1 
ATOM   755  C CA  . PHE A 1 102 ? -27.695 12.676  8.392   1.00 30.22  ? 290 PHE A CA  1 
ATOM   756  C C   . PHE A 1 102 ? -27.276 13.512  9.601   1.00 33.13  ? 290 PHE A C   1 
ATOM   757  O O   . PHE A 1 102 ? -28.070 13.745  10.508  1.00 35.43  ? 290 PHE A O   1 
ATOM   758  C CB  . PHE A 1 102 ? -28.439 13.540  7.371   1.00 28.99  ? 290 PHE A CB  1 
ATOM   759  C CG  . PHE A 1 102 ? -27.594 14.620  6.755   1.00 29.70  ? 290 PHE A CG  1 
ATOM   760  C CD1 . PHE A 1 102 ? -26.503 14.296  5.965   1.00 31.28  ? 290 PHE A CD1 1 
ATOM   761  C CD2 . PHE A 1 102 ? -27.895 15.959  6.959   1.00 31.62  ? 290 PHE A CD2 1 
ATOM   762  C CE1 . PHE A 1 102 ? -25.720 15.288  5.394   1.00 33.35  ? 290 PHE A CE1 1 
ATOM   763  C CE2 . PHE A 1 102 ? -27.118 16.960  6.389   1.00 34.56  ? 290 PHE A CE2 1 
ATOM   764  C CZ  . PHE A 1 102 ? -26.028 16.624  5.605   1.00 32.67  ? 290 PHE A CZ  1 
ATOM   765  N N   . LEU A 1 103 ? -26.021 13.954  9.608   1.00 33.68  ? 291 LEU A N   1 
ATOM   766  C CA  . LEU A 1 103 ? -25.469 14.741  10.711  1.00 30.72  ? 291 LEU A CA  1 
ATOM   767  C C   . LEU A 1 103 ? -24.909 16.068  10.188  1.00 35.43  ? 291 LEU A C   1 
ATOM   768  O O   . LEU A 1 103 ? -23.736 16.155  9.821   1.00 38.03  ? 291 LEU A O   1 
ATOM   769  C CB  . LEU A 1 103 ? -24.388 13.942  11.446  1.00 31.34  ? 291 LEU A CB  1 
ATOM   770  C CG  . LEU A 1 103 ? -24.905 12.701  12.186  1.00 29.91  ? 291 LEU A CG  1 
ATOM   771  C CD1 . LEU A 1 103 ? -23.775 11.780  12.614  1.00 23.22  ? 291 LEU A CD1 1 
ATOM   772  C CD2 . LEU A 1 103 ? -25.739 13.117  13.395  1.00 25.51  ? 291 LEU A CD2 1 
ATOM   773  N N   . PRO A 1 104 ? -25.761 17.106  10.164  1.00 31.18  ? 292 PRO A N   1 
ATOM   774  C CA  . PRO A 1 104 ? -25.585 18.371  9.429   1.00 38.23  ? 292 PRO A CA  1 
ATOM   775  C C   . PRO A 1 104 ? -24.273 19.128  9.669   1.00 35.86  ? 292 PRO A C   1 
ATOM   776  O O   . PRO A 1 104 ? -23.851 19.863  8.779   1.00 35.50  ? 292 PRO A O   1 
ATOM   777  C CB  . PRO A 1 104 ? -26.769 19.219  9.912   1.00 36.40  ? 292 PRO A CB  1 
ATOM   778  C CG  . PRO A 1 104 ? -27.792 18.221  10.352  1.00 38.75  ? 292 PRO A CG  1 
ATOM   779  C CD  . PRO A 1 104 ? -26.999 17.106  10.962  1.00 33.40  ? 292 PRO A CD  1 
ATOM   780  N N   . ASN A 1 105 ? -23.647 18.971  10.830  1.00 33.30  ? 293 ASN A N   1 
ATOM   781  C CA  . ASN A 1 105 ? -22.434 19.735  11.124  1.00 35.83  ? 293 ASN A CA  1 
ATOM   782  C C   . ASN A 1 105 ? -21.144 19.025  10.716  1.00 31.75  ? 293 ASN A C   1 
ATOM   783  O O   . ASN A 1 105 ? -20.053 19.533  10.961  1.00 31.42  ? 293 ASN A O   1 
ATOM   784  C CB  . ASN A 1 105 ? -22.382 20.106  12.610  1.00 36.39  ? 293 ASN A CB  1 
ATOM   785  C CG  . ASN A 1 105 ? -23.131 21.396  12.911  1.00 41.04  ? 293 ASN A CG  1 
ATOM   786  O OD1 . ASN A 1 105 ? -23.008 22.382  12.182  1.00 44.62  ? 293 ASN A OD1 1 
ATOM   787  N ND2 . ASN A 1 105 ? -23.919 21.390  13.979  1.00 38.54  ? 293 ASN A ND2 1 
ATOM   788  N N   . GLY A 1 106 ? -21.270 17.858  10.093  1.00 31.23  ? 294 GLY A N   1 
ATOM   789  C CA  . GLY A 1 106 ? -20.124 17.181  9.508   1.00 30.56  ? 294 GLY A CA  1 
ATOM   790  C C   . GLY A 1 106 ? -19.126 16.619  10.505  1.00 29.25  ? 294 GLY A C   1 
ATOM   791  O O   . GLY A 1 106 ? -19.442 16.426  11.673  1.00 32.87  ? 294 GLY A O   1 
ATOM   792  N N   . SER A 1 107 ? -17.916 16.345  10.028  1.00 28.24  ? 295 SER A N   1 
ATOM   793  C CA  . SER A 1 107 ? -16.870 15.737  10.849  1.00 32.02  ? 295 SER A CA  1 
ATOM   794  C C   . SER A 1 107 ? -16.151 16.734  11.753  1.00 34.08  ? 295 SER A C   1 
ATOM   795  O O   . SER A 1 107 ? -16.073 17.923  11.455  1.00 33.37  ? 295 SER A O   1 
ATOM   796  C CB  . SER A 1 107 ? -15.840 15.035  9.961   1.00 33.09  ? 295 SER A CB  1 
ATOM   797  O OG  . SER A 1 107 ? -15.107 15.979  9.198   1.00 36.66  ? 295 SER A OG  1 
ATOM   798  N N   . LEU A 1 108 ? -15.623 16.224  12.859  1.00 32.67  ? 296 LEU A N   1 
ATOM   799  C CA  . LEU A 1 108 ? -14.739 16.987  13.731  1.00 30.32  ? 296 LEU A CA  1 
ATOM   800  C C   . LEU A 1 108 ? -13.507 17.478  12.964  1.00 33.37  ? 296 LEU A C   1 
ATOM   801  O O   . LEU A 1 108 ? -13.007 18.586  13.199  1.00 30.50  ? 296 LEU A O   1 
ATOM   802  C CB  . LEU A 1 108 ? -14.313 16.134  14.927  1.00 28.73  ? 296 LEU A CB  1 
ATOM   803  C CG  . LEU A 1 108 ? -13.268 16.737  15.865  1.00 25.48  ? 296 LEU A CG  1 
ATOM   804  C CD1 . LEU A 1 108 ? -13.778 18.024  16.496  1.00 23.98  ? 296 LEU A CD1 1 
ATOM   805  C CD2 . LEU A 1 108 ? -12.870 15.727  16.931  1.00 23.21  ? 296 LEU A CD2 1 
ATOM   806  N N   . GLU A 1 109 ? -13.033 16.649  12.036  1.00 30.77  ? 297 GLU A N   1 
ATOM   807  C CA  . GLU A 1 109 ? -11.889 17.003  11.202  1.00 35.15  ? 297 GLU A CA  1 
ATOM   808  C C   . GLU A 1 109 ? -12.154 18.286  10.412  1.00 37.08  ? 297 GLU A C   1 
ATOM   809  O O   . GLU A 1 109 ? -11.311 19.185  10.367  1.00 34.72  ? 297 GLU A O   1 
ATOM   810  C CB  . GLU A 1 109 ? -11.546 15.862  10.244  1.00 32.51  ? 297 GLU A CB  1 
ATOM   811  C CG  . GLU A 1 109 ? -10.282 16.106  9.428   1.00 40.16  ? 297 GLU A CG  1 
ATOM   812  C CD  . GLU A 1 109 ? -10.015 15.002  8.424   1.00 48.88  ? 297 GLU A CD  1 
ATOM   813  O OE1 . GLU A 1 109 ? -8.906  14.429  8.447   1.00 54.61  ? 297 GLU A OE1 1 
ATOM   814  O OE2 . GLU A 1 109 ? -10.915 14.711  7.608   1.00 51.59  ? 297 GLU A OE2 1 
ATOM   815  N N   . ASP A 1 110 ? -13.331 18.369  9.802   1.00 35.31  ? 298 ASP A N   1 
ATOM   816  C CA  . ASP A 1 110 ? -13.695 19.546  9.021   1.00 36.90  ? 298 ASP A CA  1 
ATOM   817  C C   . ASP A 1 110 ? -13.880 20.774  9.907   1.00 37.18  ? 298 ASP A C   1 
ATOM   818  O O   . ASP A 1 110 ? -13.385 21.851  9.587   1.00 36.39  ? 298 ASP A O   1 
ATOM   819  C CB  . ASP A 1 110 ? -14.965 19.287  8.211   1.00 37.85  ? 298 ASP A CB  1 
ATOM   820  C CG  . ASP A 1 110 ? -14.731 18.350  7.038   1.00 44.59  ? 298 ASP A CG  1 
ATOM   821  O OD1 . ASP A 1 110 ? -13.575 18.237  6.578   1.00 46.22  ? 298 ASP A OD1 1 
ATOM   822  O OD2 . ASP A 1 110 ? -15.708 17.728  6.571   1.00 49.39  ? 298 ASP A OD2 1 
ATOM   823  N N   . ARG A 1 111 ? -14.584 20.619  11.023  1.00 31.99  ? 299 ARG A N   1 
ATOM   824  C CA  . ARG A 1 111 ? -14.800 21.750  11.916  1.00 35.08  ? 299 ARG A CA  1 
ATOM   825  C C   . ARG A 1 111 ? -13.485 22.315  12.450  1.00 32.59  ? 299 ARG A C   1 
ATOM   826  O O   . ARG A 1 111 ? -13.341 23.529  12.579  1.00 36.02  ? 299 ARG A O   1 
ATOM   827  C CB  . ARG A 1 111 ? -15.714 21.358  13.081  1.00 37.24  ? 299 ARG A CB  1 
ATOM   828  C CG  . ARG A 1 111 ? -17.160 21.166  12.670  1.00 41.26  ? 299 ARG A CG  1 
ATOM   829  C CD  . ARG A 1 111 ? -17.692 22.389  11.932  1.00 46.55  ? 299 ARG A CD  1 
ATOM   830  N NE  . ARG A 1 111 ? -18.638 23.148  12.745  1.00 53.20  ? 299 ARG A NE  1 
ATOM   831  C CZ  . ARG A 1 111 ? -18.315 24.210  13.478  1.00 60.46  ? 299 ARG A CZ  1 
ATOM   832  N NH1 . ARG A 1 111 ? -17.064 24.652  13.498  1.00 62.30  ? 299 ARG A NH1 1 
ATOM   833  N NH2 . ARG A 1 111 ? -19.247 24.833  14.187  1.00 63.35  ? 299 ARG A NH2 1 
ATOM   834  N N   . LEU A 1 112 ? -12.537 21.442  12.778  1.00 34.43  ? 300 LEU A N   1 
ATOM   835  C CA  . LEU A 1 112 ? -11.238 21.906  13.259  1.00 37.28  ? 300 LEU A CA  1 
ATOM   836  C C   . LEU A 1 112 ? -10.360 22.515  12.163  1.00 43.44  ? 300 LEU A C   1 
ATOM   837  O O   . LEU A 1 112 ? -9.849  23.625  12.306  1.00 45.65  ? 300 LEU A O   1 
ATOM   838  C CB  . LEU A 1 112 ? -10.473 20.759  13.928  1.00 32.56  ? 300 LEU A CB  1 
ATOM   839  C CG  . LEU A 1 112 ? -10.955 20.287  15.299  1.00 32.75  ? 300 LEU A CG  1 
ATOM   840  C CD1 . LEU A 1 112 ? -10.199 19.034  15.708  1.00 30.37  ? 300 LEU A CD1 1 
ATOM   841  C CD2 . LEU A 1 112 ? -10.784 21.389  16.342  1.00 30.48  ? 300 LEU A CD2 1 
ATOM   842  N N   . HIS A 1 113 ? -10.150 21.754  11.094  1.00 46.19  ? 301 HIS A N   1 
ATOM   843  C CA  . HIS A 1 113 ? -9.131  22.098  10.107  1.00 45.82  ? 301 HIS A CA  1 
ATOM   844  C C   . HIS A 1 113 ? -9.573  22.871  8.864   1.00 56.22  ? 301 HIS A C   1 
ATOM   845  O O   . HIS A 1 113 ? -8.729  23.361  8.113   1.00 58.61  ? 301 HIS A O   1 
ATOM   846  C CB  . HIS A 1 113 ? -8.433  20.810  9.683   1.00 39.05  ? 301 HIS A CB  1 
ATOM   847  C CG  . HIS A 1 113 ? -7.959  19.992  10.842  1.00 38.97  ? 301 HIS A CG  1 
ATOM   848  N ND1 . HIS A 1 113 ? -7.098  20.491  11.797  1.00 38.93  ? 301 HIS A ND1 1 
ATOM   849  C CD2 . HIS A 1 113 ? -8.240  18.722  11.214  1.00 36.87  ? 301 HIS A CD2 1 
ATOM   850  C CE1 . HIS A 1 113 ? -6.862  19.558  12.702  1.00 42.82  ? 301 HIS A CE1 1 
ATOM   851  N NE2 . HIS A 1 113 ? -7.542  18.474  12.372  1.00 38.22  ? 301 HIS A NE2 1 
ATOM   852  N N   . CYS A 1 114 ? -10.874 23.015  8.649   1.00 57.63  ? 302 CYS A N   1 
ATOM   853  C CA  . CYS A 1 114 ? -11.330 23.578  7.382   1.00 66.76  ? 302 CYS A CA  1 
ATOM   854  C C   . CYS A 1 114 ? -11.493 25.085  7.486   1.00 72.67  ? 302 CYS A C   1 
ATOM   855  O O   . CYS A 1 114 ? -12.355 25.593  8.207   1.00 69.08  ? 302 CYS A O   1 
ATOM   856  C CB  . CYS A 1 114 ? -12.642 22.928  6.932   1.00 69.36  ? 302 CYS A CB  1 
ATOM   857  S SG  . CYS A 1 114 ? -13.329 23.556  5.380   1.00 80.87  ? 302 CYS A SG  1 
ATOM   858  N N   . GLN A 1 115 ? -10.644 25.792  6.750   1.00 75.25  ? 303 GLN A N   1 
ATOM   859  C CA  . GLN A 1 115 ? -10.658 27.244  6.729   1.00 87.23  ? 303 GLN A CA  1 
ATOM   860  C C   . GLN A 1 115 ? -11.610 27.712  5.641   1.00 94.68  ? 303 GLN A C   1 
ATOM   861  O O   . GLN A 1 115 ? -12.230 26.892  4.963   1.00 94.73  ? 303 GLN A O   1 
ATOM   862  C CB  . GLN A 1 115 ? -9.251  27.791  6.482   1.00 92.90  ? 303 GLN A CB  1 
ATOM   863  C CG  . GLN A 1 115 ? -8.149  27.018  7.193   1.00 96.07  ? 303 GLN A CG  1 
ATOM   864  C CD  . GLN A 1 115 ? -6.861  26.963  6.391   1.00 100.42 ? 303 GLN A CD  1 
ATOM   865  O OE1 . GLN A 1 115 ? -6.650  27.757  5.473   1.00 101.93 ? 303 GLN A OE1 1 
ATOM   866  N NE2 . GLN A 1 115 ? -5.995  26.013  6.728   1.00 101.62 ? 303 GLN A NE2 1 
ATOM   867  N N   . THR A 1 116 ? -11.750 29.028  5.506   1.00 95.10  ? 304 THR A N   1 
ATOM   868  C CA  . THR A 1 116 ? -12.427 29.649  4.363   1.00 98.22  ? 304 THR A CA  1 
ATOM   869  C C   . THR A 1 116 ? -13.921 29.324  4.272   1.00 98.37  ? 304 THR A C   1 
ATOM   870  O O   . THR A 1 116 ? -14.622 29.872  3.421   1.00 99.20  ? 304 THR A O   1 
ATOM   871  C CB  . THR A 1 116 ? -11.761 29.256  3.016   1.00 124.58 ? 304 THR A CB  1 
ATOM   872  O OG1 . THR A 1 116 ? -12.016 27.875  2.727   1.00 125.14 ? 304 THR A OG1 1 
ATOM   873  C CG2 . THR A 1 116 ? -10.255 29.505  3.057   1.00 123.82 ? 304 THR A CG2 1 
ATOM   874  N N   . GLN A 1 117 ? -14.409 28.435  5.134   1.00 101.29 ? 305 GLN A N   1 
ATOM   875  C CA  . GLN A 1 117 ? -15.789 27.974  5.028   1.00 97.97  ? 305 GLN A CA  1 
ATOM   876  C C   . GLN A 1 117 ? -16.659 28.277  6.248   1.00 90.39  ? 305 GLN A C   1 
ATOM   877  O O   . GLN A 1 117 ? -16.449 27.728  7.331   1.00 86.71  ? 305 GLN A O   1 
ATOM   878  C CB  . GLN A 1 117 ? -15.819 26.466  4.758   1.00 101.00 ? 305 GLN A CB  1 
ATOM   879  C CG  . GLN A 1 117 ? -15.308 26.062  3.382   1.00 104.04 ? 305 GLN A CG  1 
ATOM   880  C CD  . GLN A 1 117 ? -15.665 24.629  3.026   1.00 105.52 ? 305 GLN A CD  1 
ATOM   881  O OE1 . GLN A 1 117 ? -16.484 23.996  3.694   1.00 106.19 ? 305 GLN A OE1 1 
ATOM   882  N NE2 . GLN A 1 117 ? -15.050 24.110  1.968   1.00 107.31 ? 305 GLN A NE2 1 
ATOM   883  N N   . ALA A 1 118 ? -17.634 29.160  6.042   1.00 92.15  ? 306 ALA A N   1 
ATOM   884  C CA  . ALA A 1 118 ? -18.804 29.284  6.910   1.00 86.53  ? 306 ALA A CA  1 
ATOM   885  C C   . ALA A 1 118 ? -18.516 29.477  8.397   1.00 83.59  ? 306 ALA A C   1 
ATOM   886  O O   . ALA A 1 118 ? -17.924 30.474  8.813   1.00 84.50  ? 306 ALA A O   1 
ATOM   887  C CB  . ALA A 1 118 ? -19.700 28.063  6.721   1.00 83.88  ? 306 ALA A CB  1 
ATOM   888  N N   . CYS A 1 119 ? -18.956 28.495  9.178   1.00 79.75  ? 307 CYS A N   1 
ATOM   889  C CA  . CYS A 1 119 ? -19.076 28.582  10.631  1.00 75.16  ? 307 CYS A CA  1 
ATOM   890  C C   . CYS A 1 119 ? -17.813 29.013  11.378  1.00 68.97  ? 307 CYS A C   1 
ATOM   891  O O   . CYS A 1 119 ? -16.696 28.756  10.930  1.00 69.61  ? 307 CYS A O   1 
ATOM   892  C CB  . CYS A 1 119 ? -19.535 27.223  11.173  1.00 74.93  ? 307 CYS A CB  1 
ATOM   893  S SG  . CYS A 1 119 ? -18.696 25.809  10.420  1.00 120.21 ? 307 CYS A SG  1 
ATOM   894  N N   . PRO A 1 120 ? -18.005 29.685  12.526  1.00 67.64  ? 308 PRO A N   1 
ATOM   895  C CA  . PRO A 1 120 ? -16.942 30.076  13.456  1.00 62.12  ? 308 PRO A CA  1 
ATOM   896  C C   . PRO A 1 120 ? -16.210 28.861  14.026  1.00 53.36  ? 308 PRO A C   1 
ATOM   897  O O   . PRO A 1 120 ? -16.727 27.747  13.938  1.00 49.83  ? 308 PRO A O   1 
ATOM   898  C CB  . PRO A 1 120 ? -17.699 30.822  14.563  1.00 64.29  ? 308 PRO A CB  1 
ATOM   899  C CG  . PRO A 1 120 ? -18.949 31.286  13.921  1.00 68.91  ? 308 PRO A CG  1 
ATOM   900  C CD  . PRO A 1 120 ? -19.315 30.207  12.952  1.00 67.46  ? 308 PRO A CD  1 
ATOM   901  N N   . PRO A 1 121 ? -15.007 29.070  14.584  1.00 50.31  ? 309 PRO A N   1 
ATOM   902  C CA  . PRO A 1 121 ? -14.278 27.979  15.239  1.00 44.41  ? 309 PRO A CA  1 
ATOM   903  C C   . PRO A 1 121 ? -15.067 27.363  16.390  1.00 36.44  ? 309 PRO A C   1 
ATOM   904  O O   . PRO A 1 121 ? -15.891 28.037  17.009  1.00 36.89  ? 309 PRO A O   1 
ATOM   905  C CB  . PRO A 1 121 ? -13.014 28.667  15.765  1.00 45.80  ? 309 PRO A CB  1 
ATOM   906  C CG  . PRO A 1 121 ? -12.859 29.884  14.922  1.00 48.42  ? 309 PRO A CG  1 
ATOM   907  C CD  . PRO A 1 121 ? -14.245 30.330  14.595  1.00 48.73  ? 309 PRO A CD  1 
ATOM   908  N N   . LEU A 1 122 ? -14.821 26.087  16.659  1.00 32.59  ? 310 LEU A N   1 
ATOM   909  C CA  . LEU A 1 122 ? -15.354 25.442  17.851  1.00 33.17  ? 310 LEU A CA  1 
ATOM   910  C C   . LEU A 1 122 ? -14.765 26.108  19.078  1.00 33.16  ? 310 LEU A C   1 
ATOM   911  O O   . LEU A 1 122 ? -13.554 26.320  19.140  1.00 35.05  ? 310 LEU A O   1 
ATOM   912  C CB  . LEU A 1 122 ? -15.024 23.949  17.858  1.00 31.24  ? 310 LEU A CB  1 
ATOM   913  C CG  . LEU A 1 122 ? -15.688 23.108  16.772  1.00 33.40  ? 310 LEU A CG  1 
ATOM   914  C CD1 . LEU A 1 122 ? -15.086 21.707  16.728  1.00 28.31  ? 310 LEU A CD1 1 
ATOM   915  C CD2 . LEU A 1 122 ? -17.191 23.049  17.016  1.00 30.53  ? 310 LEU A CD2 1 
ATOM   916  N N   . SER A 1 123 ? -15.604 26.440  20.053  1.00 31.59  ? 311 SER A N   1 
ATOM   917  C CA  . SER A 1 123 ? -15.101 27.054  21.275  1.00 32.28  ? 311 SER A CA  1 
ATOM   918  C C   . SER A 1 123 ? -14.475 25.982  22.156  1.00 28.90  ? 311 SER A C   1 
ATOM   919  O O   . SER A 1 123 ? -14.532 24.799  21.830  1.00 30.93  ? 311 SER A O   1 
ATOM   920  C CB  . SER A 1 123 ? -16.222 27.772  22.025  1.00 32.15  ? 311 SER A CB  1 
ATOM   921  O OG  . SER A 1 123 ? -17.212 26.847  22.440  1.00 38.60  ? 311 SER A OG  1 
ATOM   922  N N   . TRP A 1 124 ? -13.896 26.389  23.280  1.00 26.76  ? 312 TRP A N   1 
ATOM   923  C CA  . TRP A 1 124 ? -13.311 25.428  24.210  1.00 28.98  ? 312 TRP A CA  1 
ATOM   924  C C   . TRP A 1 124 ? -14.369 24.547  24.899  1.00 31.42  ? 312 TRP A C   1 
ATOM   925  O O   . TRP A 1 124 ? -14.181 23.323  24.993  1.00 36.40  ? 312 TRP A O   1 
ATOM   926  C CB  . TRP A 1 124 ? -12.436 26.147  25.247  1.00 26.26  ? 312 TRP A CB  1 
ATOM   927  C CG  . TRP A 1 124 ? -11.129 26.624  24.675  1.00 29.99  ? 312 TRP A CG  1 
ATOM   928  C CD1 . TRP A 1 124 ? -10.699 27.916  24.570  1.00 28.84  ? 312 TRP A CD1 1 
ATOM   929  C CD2 . TRP A 1 124 ? -10.090 25.809  24.117  1.00 30.48  ? 312 TRP A CD2 1 
ATOM   930  N NE1 . TRP A 1 124 ? -9.452  27.953  23.990  1.00 31.37  ? 312 TRP A NE1 1 
ATOM   931  C CE2 . TRP A 1 124 ? -9.058  26.673  23.700  1.00 31.73  ? 312 TRP A CE2 1 
ATOM   932  C CE3 . TRP A 1 124 ? -9.929  24.430  23.932  1.00 30.51  ? 312 TRP A CE3 1 
ATOM   933  C CZ2 . TRP A 1 124 ? -7.881  26.206  23.112  1.00 31.28  ? 312 TRP A CZ2 1 
ATOM   934  C CZ3 . TRP A 1 124 ? -8.761  23.969  23.345  1.00 33.58  ? 312 TRP A CZ3 1 
ATOM   935  C CH2 . TRP A 1 124 ? -7.753  24.857  22.941  1.00 27.84  ? 312 TRP A CH2 1 
ATOM   936  N N   . PRO A 1 125 ? -15.480 25.150  25.384  1.00 31.67  ? 313 PRO A N   1 
ATOM   937  C CA  . PRO A 1 125 ? -16.544 24.287  25.920  1.00 29.49  ? 313 PRO A CA  1 
ATOM   938  C C   . PRO A 1 125 ? -17.065 23.265  24.908  1.00 28.05  ? 313 PRO A C   1 
ATOM   939  O O   . PRO A 1 125 ? -17.319 22.120  25.275  1.00 36.30  ? 313 PRO A O   1 
ATOM   940  C CB  . PRO A 1 125 ? -17.646 25.282  26.295  1.00 29.02  ? 313 PRO A CB  1 
ATOM   941  C CG  . PRO A 1 125 ? -16.905 26.546  26.616  1.00 32.44  ? 313 PRO A CG  1 
ATOM   942  C CD  . PRO A 1 125 ? -15.775 26.579  25.621  1.00 33.06  ? 313 PRO A CD  1 
ATOM   943  N N   . GLN A 1 126 ? -17.202 23.673  23.651  1.00 29.20  ? 314 GLN A N   1 
ATOM   944  C CA  . GLN A 1 126 ? -17.688 22.783  22.602  1.00 27.11  ? 314 GLN A CA  1 
ATOM   945  C C   . GLN A 1 126 ? -16.698 21.637  22.350  1.00 33.33  ? 314 GLN A C   1 
ATOM   946  O O   . GLN A 1 126 ? -17.095 20.474  22.220  1.00 33.01  ? 314 GLN A O   1 
ATOM   947  C CB  . GLN A 1 126 ? -17.960 23.584  21.320  1.00 28.58  ? 314 GLN A CB  1 
ATOM   948  C CG  . GLN A 1 126 ? -19.174 24.520  21.448  1.00 28.35  ? 314 GLN A CG  1 
ATOM   949  C CD  . GLN A 1 126 ? -19.399 25.422  20.239  1.00 35.26  ? 314 GLN A CD  1 
ATOM   950  O OE1 . GLN A 1 126 ? -18.502 25.645  19.423  1.00 35.67  ? 314 GLN A OE1 1 
ATOM   951  N NE2 . GLN A 1 126 ? -20.611 25.953  20.129  1.00 36.68  ? 314 GLN A NE2 1 
ATOM   952  N N   . ARG A 1 127 ? -15.408 21.969  22.314  1.00 29.93  ? 315 ARG A N   1 
ATOM   953  C CA  . ARG A 1 127 ? -14.354 20.970  22.161  1.00 29.60  ? 315 ARG A CA  1 
ATOM   954  C C   . ARG A 1 127 ? -14.385 19.952  23.303  1.00 28.40  ? 315 ARG A C   1 
ATOM   955  O O   . ARG A 1 127 ? -14.269 18.731  23.081  1.00 29.98  ? 315 ARG A O   1 
ATOM   956  C CB  . ARG A 1 127 ? -12.987 21.656  22.083  1.00 29.31  ? 315 ARG A CB  1 
ATOM   957  C CG  . ARG A 1 127 ? -12.753 22.365  20.752  1.00 27.46  ? 315 ARG A CG  1 
ATOM   958  C CD  . ARG A 1 127 ? -11.542 23.280  20.776  1.00 28.14  ? 315 ARG A CD  1 
ATOM   959  N NE  . ARG A 1 127 ? -11.588 24.218  19.658  1.00 32.19  ? 315 ARG A NE  1 
ATOM   960  C CZ  . ARG A 1 127 ? -10.671 24.298  18.698  1.00 30.67  ? 315 ARG A CZ  1 
ATOM   961  N NH1 . ARG A 1 127 ? -9.606  23.509  18.719  1.00 31.77  ? 315 ARG A NH1 1 
ATOM   962  N NH2 . ARG A 1 127 ? -10.818 25.180  17.720  1.00 30.21  ? 315 ARG A NH2 1 
ATOM   963  N N   . LEU A 1 128 ? -14.574 20.458  24.519  1.00 26.79  ? 316 LEU A N   1 
ATOM   964  C CA  . LEU A 1 128 ? -14.683 19.592  25.691  1.00 28.92  ? 316 LEU A CA  1 
ATOM   965  C C   . LEU A 1 128 ? -15.894 18.666  25.598  1.00 31.50  ? 316 LEU A C   1 
ATOM   966  O O   . LEU A 1 128 ? -15.779 17.474  25.870  1.00 31.64  ? 316 LEU A O   1 
ATOM   967  C CB  . LEU A 1 128 ? -14.763 20.422  26.975  1.00 30.14  ? 316 LEU A CB  1 
ATOM   968  C CG  . LEU A 1 128 ? -14.814 19.624  28.283  1.00 33.65  ? 316 LEU A CG  1 
ATOM   969  C CD1 . LEU A 1 128 ? -13.681 18.602  28.353  1.00 31.29  ? 316 LEU A CD1 1 
ATOM   970  C CD2 . LEU A 1 128 ? -14.762 20.560  29.485  1.00 33.55  ? 316 LEU A CD2 1 
ATOM   971  N N   . ASP A 1 129 ? -17.046 19.218  25.220  1.00 28.29  ? 317 ASP A N   1 
ATOM   972  C CA  . ASP A 1 129 ? -18.263 18.422  25.049  1.00 28.97  ? 317 ASP A CA  1 
ATOM   973  C C   . ASP A 1 129 ? -18.084 17.314  24.016  1.00 26.99  ? 317 ASP A C   1 
ATOM   974  O O   . ASP A 1 129 ? -18.493 16.169  24.237  1.00 27.64  ? 317 ASP A O   1 
ATOM   975  C CB  . ASP A 1 129 ? -19.438 19.314  24.643  1.00 32.63  ? 317 ASP A CB  1 
ATOM   976  C CG  . ASP A 1 129 ? -20.163 19.905  25.839  1.00 51.97  ? 317 ASP A CG  1 
ATOM   977  O OD1 . ASP A 1 129 ? -20.058 19.330  26.946  1.00 57.75  ? 317 ASP A OD1 1 
ATOM   978  O OD2 . ASP A 1 129 ? -20.841 20.942  25.672  1.00 58.20  ? 317 ASP A OD2 1 
ATOM   979  N N   . ILE A 1 130 ? -17.462 17.659  22.893  1.00 26.38  ? 318 ILE A N   1 
ATOM   980  C CA  . ILE A 1 130 ? -17.212 16.689  21.835  1.00 27.46  ? 318 ILE A CA  1 
ATOM   981  C C   . ILE A 1 130 ? -16.292 15.562  22.312  1.00 26.80  ? 318 ILE A C   1 
ATOM   982  O O   . ILE A 1 130 ? -16.582 14.369  22.090  1.00 28.72  ? 318 ILE A O   1 
ATOM   983  C CB  . ILE A 1 130 ? -16.610 17.375  20.600  1.00 26.39  ? 318 ILE A CB  1 
ATOM   984  C CG1 . ILE A 1 130 ? -17.668 18.261  19.939  1.00 24.64  ? 318 ILE A CG1 1 
ATOM   985  C CG2 . ILE A 1 130 ? -16.070 16.343  19.616  1.00 22.01  ? 318 ILE A CG2 1 
ATOM   986  C CD1 . ILE A 1 130 ? -17.143 19.116  18.814  1.00 27.51  ? 318 ILE A CD1 1 
ATOM   987  N N   . LEU A 1 131 ? -15.199 15.930  22.984  1.00 26.09  ? 319 LEU A N   1 
ATOM   988  C CA  . LEU A 1 131 ? -14.293 14.909  23.521  1.00 26.30  ? 319 LEU A CA  1 
ATOM   989  C C   . LEU A 1 131 ? -15.019 14.014  24.540  1.00 27.68  ? 319 LEU A C   1 
ATOM   990  O O   . LEU A 1 131 ? -14.853 12.792  24.535  1.00 28.25  ? 319 LEU A O   1 
ATOM   991  C CB  . LEU A 1 131 ? -13.057 15.551  24.158  1.00 23.02  ? 319 LEU A CB  1 
ATOM   992  C CG  . LEU A 1 131 ? -12.096 16.289  23.218  1.00 26.74  ? 319 LEU A CG  1 
ATOM   993  C CD1 . LEU A 1 131 ? -10.953 16.925  24.002  1.00 22.88  ? 319 LEU A CD1 1 
ATOM   994  C CD2 . LEU A 1 131 ? -11.551 15.371  22.129  1.00 24.16  ? 319 LEU A CD2 1 
ATOM   995  N N   . LEU A 1 132 ? -15.838 14.625  25.390  1.00 24.25  ? 320 LEU A N   1 
ATOM   996  C CA  . LEU A 1 132 ? -16.598 13.894  26.404  1.00 24.98  ? 320 LEU A CA  1 
ATOM   997  C C   . LEU A 1 132 ? -17.557 12.878  25.770  1.00 26.65  ? 320 LEU A C   1 
ATOM   998  O O   . LEU A 1 132 ? -17.615 11.726  26.192  1.00 30.86  ? 320 LEU A O   1 
ATOM   999  C CB  . LEU A 1 132 ? -17.371 14.875  27.291  1.00 21.67  ? 320 LEU A CB  1 
ATOM   1000 C CG  . LEU A 1 132 ? -18.270 14.307  28.393  1.00 28.44  ? 320 LEU A CG  1 
ATOM   1001 C CD1 . LEU A 1 132 ? -17.450 13.606  29.472  1.00 26.55  ? 320 LEU A CD1 1 
ATOM   1002 C CD2 . LEU A 1 132 ? -19.127 15.418  29.001  1.00 28.05  ? 320 LEU A CD2 1 
ATOM   1003 N N   . GLY A 1 133 ? -18.301 13.306  24.753  1.00 23.56  ? 321 GLY A N   1 
ATOM   1004 C CA  . GLY A 1 133 ? -19.216 12.410  24.061  1.00 25.86  ? 321 GLY A CA  1 
ATOM   1005 C C   . GLY A 1 133 ? -18.504 11.268  23.354  1.00 24.38  ? 321 GLY A C   1 
ATOM   1006 O O   . GLY A 1 133 ? -18.943 10.102  23.410  1.00 28.08  ? 321 GLY A O   1 
ATOM   1007 N N   . THR A 1 134 ? -17.395 11.599  22.690  1.00 24.23  ? 322 THR A N   1 
ATOM   1008 C CA  . THR A 1 134 ? -16.615 10.580  21.985  1.00 24.39  ? 322 THR A CA  1 
ATOM   1009 C C   . THR A 1 134 ? -16.096 9.524   22.966  1.00 24.89  ? 322 THR A C   1 
ATOM   1010 O O   . THR A 1 134 ? -16.174 8.301   22.722  1.00 25.87  ? 322 THR A O   1 
ATOM   1011 C CB  . THR A 1 134 ? -15.430 11.208  21.233  1.00 26.57  ? 322 THR A CB  1 
ATOM   1012 O OG1 . THR A 1 134 ? -15.914 12.216  20.333  1.00 26.46  ? 322 THR A OG1 1 
ATOM   1013 C CG2 . THR A 1 134 ? -14.682 10.148  20.451  1.00 23.72  ? 322 THR A CG2 1 
ATOM   1014 N N   . ALA A 1 135 ? -15.567 10.015  24.083  1.00 25.53  ? 323 ALA A N   1 
ATOM   1015 C CA  . ALA A 1 135 ? -15.099 9.155   25.154  1.00 26.31  ? 323 ALA A CA  1 
ATOM   1016 C C   . ALA A 1 135 ? -16.239 8.282   25.668  1.00 30.04  ? 323 ALA A C   1 
ATOM   1017 O O   . ALA A 1 135 ? -16.031 7.108   25.945  1.00 25.81  ? 323 ALA A O   1 
ATOM   1018 C CB  . ALA A 1 135 ? -14.499 9.984   26.286  1.00 26.07  ? 323 ALA A CB  1 
ATOM   1019 N N   . ARG A 1 136 ? -17.440 8.851   25.787  1.00 28.05  ? 324 ARG A N   1 
ATOM   1020 C CA  . ARG A 1 136 ? -18.599 8.073   26.222  1.00 23.93  ? 324 ARG A CA  1 
ATOM   1021 C C   . ARG A 1 136 ? -18.861 6.911   25.260  1.00 25.99  ? 324 ARG A C   1 
ATOM   1022 O O   . ARG A 1 136 ? -19.084 5.771   25.688  1.00 25.72  ? 324 ARG A O   1 
ATOM   1023 C CB  . ARG A 1 136 ? -19.851 8.955   26.337  1.00 25.60  ? 324 ARG A CB  1 
ATOM   1024 C CG  . ARG A 1 136 ? -21.014 8.253   27.038  1.00 26.77  ? 324 ARG A CG  1 
ATOM   1025 C CD  . ARG A 1 136 ? -22.274 9.110   27.141  1.00 26.43  ? 324 ARG A CD  1 
ATOM   1026 N NE  . ARG A 1 136 ? -22.085 10.303  27.961  1.00 28.49  ? 324 ARG A NE  1 
ATOM   1027 C CZ  . ARG A 1 136 ? -22.078 11.541  27.478  1.00 31.37  ? 324 ARG A CZ  1 
ATOM   1028 N NH1 . ARG A 1 136 ? -22.261 11.749  26.179  1.00 28.06  ? 324 ARG A NH1 1 
ATOM   1029 N NH2 . ARG A 1 136 ? -21.897 12.573  28.291  1.00 32.32  ? 324 ARG A NH2 1 
ATOM   1030 N N   . ALA A 1 137 ? -18.822 7.195   23.959  1.00 27.61  ? 325 ALA A N   1 
ATOM   1031 C CA  . ALA A 1 137 ? -18.993 6.124   22.968  1.00 26.10  ? 325 ALA A CA  1 
ATOM   1032 C C   . ALA A 1 137 ? -17.940 5.020   23.134  1.00 27.09  ? 325 ALA A C   1 
ATOM   1033 O O   . ALA A 1 137 ? -18.264 3.815   23.201  1.00 28.60  ? 325 ALA A O   1 
ATOM   1034 C CB  . ALA A 1 137 ? -18.936 6.690   21.560  1.00 19.25  ? 325 ALA A CB  1 
ATOM   1035 N N   . ILE A 1 138 ? -16.677 5.431   23.208  1.00 27.71  ? 326 ILE A N   1 
ATOM   1036 C CA  . ILE A 1 138 ? -15.589 4.456   23.274  1.00 29.44  ? 326 ILE A CA  1 
ATOM   1037 C C   . ILE A 1 138 ? -15.639 3.605   24.555  1.00 31.64  ? 326 ILE A C   1 
ATOM   1038 O O   . ILE A 1 138 ? -15.499 2.375   24.495  1.00 29.09  ? 326 ILE A O   1 
ATOM   1039 C CB  . ILE A 1 138 ? -14.221 5.156   23.152  1.00 29.70  ? 326 ILE A CB  1 
ATOM   1040 C CG1 . ILE A 1 138 ? -14.129 5.879   21.803  1.00 28.05  ? 326 ILE A CG1 1 
ATOM   1041 C CG2 . ILE A 1 138 ? -13.077 4.155   23.296  1.00 29.15  ? 326 ILE A CG2 1 
ATOM   1042 C CD1 . ILE A 1 138 ? -13.019 6.898   21.726  1.00 30.34  ? 326 ILE A CD1 1 
ATOM   1043 N N   . GLN A 1 139 ? -15.854 4.243   25.705  1.00 30.16  ? 327 GLN A N   1 
ATOM   1044 C CA  . GLN A 1 139 ? -15.943 3.498   26.963  1.00 31.78  ? 327 GLN A CA  1 
ATOM   1045 C C   . GLN A 1 139 ? -17.170 2.589   26.955  1.00 36.38  ? 327 GLN A C   1 
ATOM   1046 O O   . GLN A 1 139 ? -17.146 1.507   27.554  1.00 35.75  ? 327 GLN A O   1 
ATOM   1047 C CB  . GLN A 1 139 ? -15.972 4.442   28.179  1.00 27.30  ? 327 GLN A CB  1 
ATOM   1048 C CG  . GLN A 1 139 ? -17.196 5.355   28.279  1.00 28.25  ? 327 GLN A CG  1 
ATOM   1049 C CD  . GLN A 1 139 ? -18.360 4.722   29.024  1.00 29.33  ? 327 GLN A CD  1 
ATOM   1050 O OE1 . GLN A 1 139 ? -18.198 4.199   30.129  1.00 29.72  ? 327 GLN A OE1 1 
ATOM   1051 N NE2 . GLN A 1 139 ? -19.541 4.766   28.419  1.00 28.74  ? 327 GLN A NE2 1 
ATOM   1052 N N   . PHE A 1 140 ? -18.234 3.018   26.276  1.00 29.85  ? 328 PHE A N   1 
ATOM   1053 C CA  . PHE A 1 140 ? -19.380 2.133   26.096  1.00 30.83  ? 328 PHE A CA  1 
ATOM   1054 C C   . PHE A 1 140 ? -18.977 0.865   25.338  1.00 32.49  ? 328 PHE A C   1 
ATOM   1055 O O   . PHE A 1 140 ? -19.279 -0.249  25.772  1.00 32.39  ? 328 PHE A O   1 
ATOM   1056 C CB  . PHE A 1 140 ? -20.521 2.839   25.365  1.00 29.63  ? 328 PHE A CB  1 
ATOM   1057 C CG  . PHE A 1 140 ? -21.727 1.965   25.145  1.00 33.91  ? 328 PHE A CG  1 
ATOM   1058 C CD1 . PHE A 1 140 ? -22.618 1.715   26.182  1.00 31.47  ? 328 PHE A CD1 1 
ATOM   1059 C CD2 . PHE A 1 140 ? -21.973 1.397   23.900  1.00 32.55  ? 328 PHE A CD2 1 
ATOM   1060 C CE1 . PHE A 1 140 ? -23.734 0.910   25.985  1.00 31.16  ? 328 PHE A CE1 1 
ATOM   1061 C CE2 . PHE A 1 140 ? -23.088 0.594   23.693  1.00 34.57  ? 328 PHE A CE2 1 
ATOM   1062 C CZ  . PHE A 1 140 ? -23.970 0.349   24.737  1.00 33.40  ? 328 PHE A CZ  1 
ATOM   1063 N N   . LEU A 1 141 ? -18.291 1.029   24.212  1.00 33.18  ? 329 LEU A N   1 
ATOM   1064 C CA  . LEU A 1 141 ? -17.812 -0.142  23.474  1.00 33.53  ? 329 LEU A CA  1 
ATOM   1065 C C   . LEU A 1 141 ? -16.899 -1.045  24.314  1.00 38.56  ? 329 LEU A C   1 
ATOM   1066 O O   . LEU A 1 141 ? -16.992 -2.278  24.244  1.00 34.66  ? 329 LEU A O   1 
ATOM   1067 C CB  . LEU A 1 141 ? -17.074 0.291   22.206  1.00 33.85  ? 329 LEU A CB  1 
ATOM   1068 C CG  . LEU A 1 141 ? -17.914 1.067   21.194  1.00 32.14  ? 329 LEU A CG  1 
ATOM   1069 C CD1 . LEU A 1 141 ? -17.092 1.398   19.962  1.00 33.21  ? 329 LEU A CD1 1 
ATOM   1070 C CD2 . LEU A 1 141 ? -19.160 0.279   20.821  1.00 26.56  ? 329 LEU A CD2 1 
ATOM   1071 N N   . HIS A 1 142 ? -16.018 -0.434  25.104  1.00 36.33  ? 330 HIS A N   1 
ATOM   1072 C CA  . HIS A 1 142 ? -15.067 -1.198  25.911  1.00 35.28  ? 330 HIS A CA  1 
ATOM   1073 C C   . HIS A 1 142 ? -15.721 -1.893  27.105  1.00 39.02  ? 330 HIS A C   1 
ATOM   1074 O O   . HIS A 1 142 ? -15.176 -2.851  27.651  1.00 37.26  ? 330 HIS A O   1 
ATOM   1075 C CB  . HIS A 1 142 ? -13.936 -0.288  26.406  1.00 33.96  ? 330 HIS A CB  1 
ATOM   1076 C CG  . HIS A 1 142 ? -13.012 0.170   25.320  1.00 37.30  ? 330 HIS A CG  1 
ATOM   1077 N ND1 . HIS A 1 142 ? -11.900 0.949   25.567  1.00 39.60  ? 330 HIS A ND1 1 
ATOM   1078 C CD2 . HIS A 1 142 ? -13.033 -0.043  23.985  1.00 34.80  ? 330 HIS A CD2 1 
ATOM   1079 C CE1 . HIS A 1 142 ? -11.278 1.194   24.428  1.00 38.05  ? 330 HIS A CE1 1 
ATOM   1080 N NE2 . HIS A 1 142 ? -11.944 0.604   23.452  1.00 36.31  ? 330 HIS A NE2 1 
ATOM   1081 N N   . GLN A 1 143 ? -16.888 -1.405  27.511  1.00 38.80  ? 331 GLN A N   1 
ATOM   1082 C CA  . GLN A 1 143 ? -17.553 -1.931  28.695  1.00 40.39  ? 331 GLN A CA  1 
ATOM   1083 C C   . GLN A 1 143 ? -18.281 -3.241  28.395  1.00 43.37  ? 331 GLN A C   1 
ATOM   1084 O O   . GLN A 1 143 ? -18.710 -3.944  29.309  1.00 45.78  ? 331 GLN A O   1 
ATOM   1085 C CB  . GLN A 1 143 ? -18.533 -0.892  29.252  1.00 41.89  ? 331 GLN A CB  1 
ATOM   1086 C CG  . GLN A 1 143 ? -19.015 -1.175  30.664  1.00 52.15  ? 331 GLN A CG  1 
ATOM   1087 C CD  . GLN A 1 143 ? -18.672 -0.065  31.640  1.00 62.52  ? 331 GLN A CD  1 
ATOM   1088 O OE1 . GLN A 1 143 ? -18.792 1.126   31.329  1.00 62.28  ? 331 GLN A OE1 1 
ATOM   1089 N NE2 . GLN A 1 143 ? -18.247 -0.452  32.837  1.00 68.54  ? 331 GLN A NE2 1 
ATOM   1090 N N   . ASP A 1 144 ? -18.408 -3.575  27.114  1.00 43.65  ? 332 ASP A N   1 
ATOM   1091 C CA  . ASP A 1 144 ? -19.120 -4.781  26.709  1.00 45.06  ? 332 ASP A CA  1 
ATOM   1092 C C   . ASP A 1 144 ? -18.306 -6.024  27.041  1.00 49.11  ? 332 ASP A C   1 
ATOM   1093 O O   . ASP A 1 144 ? -17.093 -5.942  27.234  1.00 52.28  ? 332 ASP A O   1 
ATOM   1094 C CB  . ASP A 1 144 ? -19.441 -4.742  25.214  1.00 46.62  ? 332 ASP A CB  1 
ATOM   1095 C CG  . ASP A 1 144 ? -20.682 -5.545  24.863  1.00 53.47  ? 332 ASP A CG  1 
ATOM   1096 O OD1 . ASP A 1 144 ? -21.653 -5.527  25.652  1.00 55.62  ? 332 ASP A OD1 1 
ATOM   1097 O OD2 . ASP A 1 144 ? -20.691 -6.195  23.796  1.00 57.12  ? 332 ASP A OD2 1 
ATOM   1098 N N   . SER A 1 145 ? -18.981 -7.167  27.140  1.00 52.31  ? 333 SER A N   1 
ATOM   1099 C CA  . SER A 1 145 ? -18.309 -8.441  27.387  1.00 57.89  ? 333 SER A CA  1 
ATOM   1100 C C   . SER A 1 145 ? -18.478 -9.410  26.213  1.00 57.50  ? 333 SER A C   1 
ATOM   1101 O O   . SER A 1 145 ? -19.572 -9.927  25.993  1.00 59.22  ? 333 SER A O   1 
ATOM   1102 C CB  . SER A 1 145 ? -18.840 -9.080  28.672  1.00 63.82  ? 333 SER A CB  1 
ATOM   1103 O OG  . SER A 1 145 ? -18.159 -10.290 28.953  1.00 74.09  ? 333 SER A OG  1 
ATOM   1104 N N   . PRO A 1 146 ? -17.393 -9.665  25.458  1.00 56.55  ? 334 PRO A N   1 
ATOM   1105 C CA  . PRO A 1 146 ? -16.081 -9.047  25.660  1.00 55.02  ? 334 PRO A CA  1 
ATOM   1106 C C   . PRO A 1 146 ? -16.024 -7.634  25.086  1.00 54.14  ? 334 PRO A C   1 
ATOM   1107 O O   . PRO A 1 146 ? -16.996 -7.177  24.485  1.00 52.99  ? 334 PRO A O   1 
ATOM   1108 C CB  . PRO A 1 146 ? -15.143 -9.981  24.898  1.00 55.18  ? 334 PRO A CB  1 
ATOM   1109 C CG  . PRO A 1 146 ? -15.987 -10.470 23.764  1.00 55.26  ? 334 PRO A CG  1 
ATOM   1110 C CD  . PRO A 1 146 ? -17.388 -10.596 24.314  1.00 54.18  ? 334 PRO A CD  1 
ATOM   1111 N N   . SER A 1 147 ? -14.893 -6.960  25.261  1.00 55.73  ? 335 SER A N   1 
ATOM   1112 C CA  . SER A 1 147 ? -14.731 -5.603  24.760  1.00 48.88  ? 335 SER A CA  1 
ATOM   1113 C C   . SER A 1 147 ? -14.755 -5.572  23.242  1.00 43.55  ? 335 SER A C   1 
ATOM   1114 O O   . SER A 1 147 ? -14.201 -6.451  22.587  1.00 46.04  ? 335 SER A O   1 
ATOM   1115 C CB  . SER A 1 147 ? -13.419 -4.992  25.262  1.00 46.70  ? 335 SER A CB  1 
ATOM   1116 O OG  . SER A 1 147 ? -13.431 -4.821  26.665  1.00 46.45  ? 335 SER A OG  1 
ATOM   1117 N N   . LEU A 1 148 ? -15.400 -4.558  22.682  1.00 39.80  ? 336 LEU A N   1 
ATOM   1118 C CA  . LEU A 1 148 ? -15.248 -4.291  21.263  1.00 40.35  ? 336 LEU A CA  1 
ATOM   1119 C C   . LEU A 1 148 ? -14.137 -3.272  21.085  1.00 41.78  ? 336 LEU A C   1 
ATOM   1120 O O   . LEU A 1 148 ? -14.154 -2.211  21.706  1.00 42.45  ? 336 LEU A O   1 
ATOM   1121 C CB  . LEU A 1 148 ? -16.543 -3.778  20.638  1.00 40.98  ? 336 LEU A CB  1 
ATOM   1122 C CG  . LEU A 1 148 ? -16.435 -3.590  19.123  1.00 39.70  ? 336 LEU A CG  1 
ATOM   1123 C CD1 . LEU A 1 148 ? -16.310 -4.941  18.430  1.00 38.67  ? 336 LEU A CD1 1 
ATOM   1124 C CD2 . LEU A 1 148 ? -17.606 -2.805  18.566  1.00 38.99  ? 336 LEU A CD2 1 
ATOM   1125 N N   . ILE A 1 149 ? -13.164 -3.603  20.246  1.00 38.15  ? 337 ILE A N   1 
ATOM   1126 C CA  . ILE A 1 149 ? -12.101 -2.670  19.914  1.00 38.22  ? 337 ILE A CA  1 
ATOM   1127 C C   . ILE A 1 149 ? -12.414 -2.004  18.577  1.00 37.89  ? 337 ILE A C   1 
ATOM   1128 O O   . ILE A 1 149 ? -12.481 -2.671  17.547  1.00 41.92  ? 337 ILE A O   1 
ATOM   1129 C CB  . ILE A 1 149 ? -10.738 -3.375  19.849  1.00 43.99  ? 337 ILE A CB  1 
ATOM   1130 C CG1 . ILE A 1 149 ? -10.472 -4.126  21.157  1.00 46.59  ? 337 ILE A CG1 1 
ATOM   1131 C CG2 . ILE A 1 149 ? -9.636  -2.367  19.558  1.00 42.68  ? 337 ILE A CG2 1 
ATOM   1132 C CD1 . ILE A 1 149 ? -9.360  -5.137  21.062  1.00 55.04  ? 337 ILE A CD1 1 
ATOM   1133 N N   . HIS A 1 150 ? -12.638 -0.695  18.602  1.00 34.44  ? 338 HIS A N   1 
ATOM   1134 C CA  . HIS A 1 150 ? -13.029 0.037   17.400  1.00 34.73  ? 338 HIS A CA  1 
ATOM   1135 C C   . HIS A 1 150 ? -11.934 -0.002  16.333  1.00 37.81  ? 338 HIS A C   1 
ATOM   1136 O O   . HIS A 1 150 ? -12.175 -0.431  15.204  1.00 39.27  ? 338 HIS A O   1 
ATOM   1137 C CB  . HIS A 1 150 ? -13.380 1.484   17.754  1.00 29.72  ? 338 HIS A CB  1 
ATOM   1138 C CG  . HIS A 1 150 ? -13.983 2.254   16.622  1.00 29.24  ? 338 HIS A CG  1 
ATOM   1139 N ND1 . HIS A 1 150 ? -13.224 2.822   15.622  1.00 29.76  ? 338 HIS A ND1 1 
ATOM   1140 C CD2 . HIS A 1 150 ? -15.271 2.554   16.333  1.00 28.93  ? 338 HIS A CD2 1 
ATOM   1141 C CE1 . HIS A 1 150 ? -14.019 3.438   14.765  1.00 29.86  ? 338 HIS A CE1 1 
ATOM   1142 N NE2 . HIS A 1 150 ? -15.266 3.289   15.174  1.00 30.71  ? 338 HIS A NE2 1 
ATOM   1143 N N   . GLY A 1 151 ? -10.746 0.472   16.701  1.00 35.24  ? 339 GLY A N   1 
ATOM   1144 C CA  . GLY A 1 151 ? -9.536  0.346   15.900  1.00 34.89  ? 339 GLY A CA  1 
ATOM   1145 C C   . GLY A 1 151 ? -9.353  1.379   14.799  1.00 43.66  ? 339 GLY A C   1 
ATOM   1146 O O   . GLY A 1 151 ? -8.243  1.559   14.288  1.00 46.04  ? 339 GLY A O   1 
ATOM   1147 N N   . ASP A 1 152 ? -10.455 2.009   14.398  1.00 38.18  ? 340 ASP A N   1 
ATOM   1148 C CA  . ASP A 1 152 ? -10.468 3.096   13.415  1.00 42.39  ? 340 ASP A CA  1 
ATOM   1149 C C   . ASP A 1 152 ? -10.583 4.543   13.932  1.00 43.14  ? 340 ASP A C   1 
ATOM   1150 O O   . ASP A 1 152 ? -10.827 5.441   13.125  1.00 46.70  ? 340 ASP A O   1 
ATOM   1151 C CB  . ASP A 1 152 ? -11.575 2.858   12.389  1.00 50.38  ? 340 ASP A CB  1 
ATOM   1152 C CG  . ASP A 1 152 ? -11.124 3.179   10.972  1.00 52.66  ? 340 ASP A CG  1 
ATOM   1153 O OD1 . ASP A 1 152 ? -10.045 3.795   10.819  1.00 51.23  ? 340 ASP A OD1 1 
ATOM   1154 O OD2 . ASP A 1 152 ? -11.844 2.818   10.015  1.00 56.36  ? 340 ASP A OD2 1 
ATOM   1155 N N   . ILE A 1 153 ? -10.549 4.775   15.243  1.00 41.21  ? 341 ILE A N   1 
ATOM   1156 C CA  . ILE A 1 153 ? -10.850 6.115   15.771  1.00 35.72  ? 341 ILE A CA  1 
ATOM   1157 C C   . ILE A 1 153 ? -9.980  7.241   15.170  1.00 33.83  ? 341 ILE A C   1 
ATOM   1158 O O   . ILE A 1 153 ? -8.755  7.201   15.242  1.00 33.25  ? 341 ILE A O   1 
ATOM   1159 C CB  . ILE A 1 153 ? -10.691 6.140   17.309  1.00 32.31  ? 341 ILE A CB  1 
ATOM   1160 C CG1 . ILE A 1 153 ? -11.698 5.193   17.966  1.00 29.96  ? 341 ILE A CG1 1 
ATOM   1161 C CG2 . ILE A 1 153 ? -10.868 7.551   17.859  1.00 28.49  ? 341 ILE A CG2 1 
ATOM   1162 C CD1 . ILE A 1 153 ? -11.303 4.771   19.370  1.00 28.10  ? 341 ILE A CD1 1 
ATOM   1163 N N   . LYS A 1 154 ? -10.640 8.251   14.599  1.00 30.02  ? 342 LYS A N   1 
ATOM   1164 C CA  . LYS A 1 154 ? -9.995  9.390   13.925  1.00 31.70  ? 342 LYS A CA  1 
ATOM   1165 C C   . LYS A 1 154 ? -10.922 10.601  14.004  1.00 36.49  ? 342 LYS A C   1 
ATOM   1166 O O   . LYS A 1 154 ? -12.117 10.447  14.251  1.00 37.56  ? 342 LYS A O   1 
ATOM   1167 C CB  . LYS A 1 154 ? -9.688  9.091   12.448  1.00 28.76  ? 342 LYS A CB  1 
ATOM   1168 C CG  . LYS A 1 154 ? -8.854  7.853   12.167  1.00 36.63  ? 342 LYS A CG  1 
ATOM   1169 C CD  . LYS A 1 154 ? -8.555  7.704   10.680  1.00 40.19  ? 342 LYS A CD  1 
ATOM   1170 C CE  . LYS A 1 154 ? -9.819  7.761   9.834   1.00 39.05  ? 342 LYS A CE  1 
ATOM   1171 N NZ  . LYS A 1 154 ? -10.878 6.835   10.326  1.00 40.25  ? 342 LYS A NZ  1 
ATOM   1172 N N   . SER A 1 155 ? -10.398 11.800  13.769  1.00 36.28  ? 343 SER A N   1 
ATOM   1173 C CA  . SER A 1 155 ? -11.250 12.990  13.815  1.00 30.02  ? 343 SER A CA  1 
ATOM   1174 C C   . SER A 1 155 ? -12.251 13.021  12.653  1.00 32.68  ? 343 SER A C   1 
ATOM   1175 O O   . SER A 1 155 ? -13.291 13.676  12.741  1.00 34.35  ? 343 SER A O   1 
ATOM   1176 C CB  . SER A 1 155 ? -10.408 14.267  13.813  1.00 29.18  ? 343 SER A CB  1 
ATOM   1177 O OG  . SER A 1 155 ? -9.728  14.445  12.582  1.00 33.19  ? 343 SER A OG  1 
ATOM   1178 N N   . SER A 1 156 ? -11.951 12.300  11.577  1.00 30.57  ? 344 SER A N   1 
ATOM   1179 C CA  . SER A 1 156 ? -12.840 12.266  10.414  1.00 34.23  ? 344 SER A CA  1 
ATOM   1180 C C   . SER A 1 156 ? -14.104 11.431  10.654  1.00 33.54  ? 344 SER A C   1 
ATOM   1181 O O   . SER A 1 156 ? -15.147 11.708  10.069  1.00 36.66  ? 344 SER A O   1 
ATOM   1182 C CB  . SER A 1 156 ? -12.096 11.738  9.182   1.00 32.84  ? 344 SER A CB  1 
ATOM   1183 O OG  . SER A 1 156 ? -11.614 10.421  9.386   1.00 34.25  ? 344 SER A OG  1 
ATOM   1184 N N   . ASN A 1 157 ? -14.007 10.393  11.480  1.00 28.60  ? 345 ASN A N   1 
ATOM   1185 C CA  . ASN A 1 157 ? -15.187 9.589   11.820  1.00 32.32  ? 345 ASN A CA  1 
ATOM   1186 C C   . ASN A 1 157 ? -15.856 10.001  13.137  1.00 30.32  ? 345 ASN A C   1 
ATOM   1187 O O   . ASN A 1 157 ? -16.693 9.271   13.654  1.00 33.80  ? 345 ASN A O   1 
ATOM   1188 C CB  . ASN A 1 157 ? -14.877 8.086   11.813  1.00 38.16  ? 345 ASN A CB  1 
ATOM   1189 C CG  . ASN A 1 157 ? -13.776 7.706   12.754  1.00 41.63  ? 345 ASN A CG  1 
ATOM   1190 O OD1 . ASN A 1 157 ? -12.636 8.112   12.574  1.00 49.50  ? 345 ASN A OD1 1 
ATOM   1191 N ND2 . ASN A 1 157 ? -14.102 6.890   13.750  1.00 41.20  ? 345 ASN A ND2 1 
ATOM   1192 N N   . VAL A 1 158 ? -15.423 11.109  13.731  1.00 30.33  ? 346 VAL A N   1 
ATOM   1193 C CA  . VAL A 1 158 ? -16.248 11.756  14.754  1.00 25.43  ? 346 VAL A CA  1 
ATOM   1194 C C   . VAL A 1 158 ? -17.138 12.808  14.094  1.00 31.50  ? 346 VAL A C   1 
ATOM   1195 O O   . VAL A 1 158 ? -16.651 13.825  13.597  1.00 35.55  ? 346 VAL A O   1 
ATOM   1196 C CB  . VAL A 1 158 ? -15.410 12.423  15.854  1.00 26.08  ? 346 VAL A CB  1 
ATOM   1197 C CG1 . VAL A 1 158 ? -16.323 13.175  16.833  1.00 24.32  ? 346 VAL A CG1 1 
ATOM   1198 C CG2 . VAL A 1 158 ? -14.566 11.388  16.585  1.00 22.86  ? 346 VAL A CG2 1 
ATOM   1199 N N   . LEU A 1 159 ? -18.446 12.582  14.126  1.00 28.71  ? 347 LEU A N   1 
ATOM   1200 C CA  . LEU A 1 159 ? -19.381 13.399  13.356  1.00 25.88  ? 347 LEU A CA  1 
ATOM   1201 C C   . LEU A 1 159 ? -20.305 14.164  14.289  1.00 26.64  ? 347 LEU A C   1 
ATOM   1202 O O   . LEU A 1 159 ? -20.434 13.815  15.453  1.00 28.00  ? 347 LEU A O   1 
ATOM   1203 C CB  . LEU A 1 159 ? -20.169 12.523  12.383  1.00 30.35  ? 347 LEU A CB  1 
ATOM   1204 C CG  . LEU A 1 159 ? -19.193 11.849  11.413  1.00 37.91  ? 347 LEU A CG  1 
ATOM   1205 C CD1 . LEU A 1 159 ? -19.432 10.354  11.323  1.00 38.20  ? 347 LEU A CD1 1 
ATOM   1206 C CD2 . LEU A 1 159 ? -19.223 12.508  10.039  1.00 37.57  ? 347 LEU A CD2 1 
ATOM   1207 N N   . LEU A 1 160 ? -20.893 15.247  13.797  1.00 24.28  ? 348 LEU A N   1 
ATOM   1208 C CA  . LEU A 1 160 ? -21.575 16.196  14.669  1.00 27.49  ? 348 LEU A CA  1 
ATOM   1209 C C   . LEU A 1 160 ? -22.988 16.524  14.189  1.00 29.29  ? 348 LEU A C   1 
ATOM   1210 O O   . LEU A 1 160 ? -23.187 16.875  13.024  1.00 31.19  ? 348 LEU A O   1 
ATOM   1211 C CB  . LEU A 1 160 ? -20.743 17.479  14.775  1.00 32.87  ? 348 LEU A CB  1 
ATOM   1212 C CG  . LEU A 1 160 ? -19.288 17.290  15.227  1.00 36.39  ? 348 LEU A CG  1 
ATOM   1213 C CD1 . LEU A 1 160 ? -18.423 18.504  14.903  1.00 35.45  ? 348 LEU A CD1 1 
ATOM   1214 C CD2 . LEU A 1 160 ? -19.233 16.976  16.718  1.00 34.41  ? 348 LEU A CD2 1 
ATOM   1215 N N   . ASP A 1 161 ? -23.965 16.419  15.087  1.00 26.82  ? 349 ASP A N   1 
ATOM   1216 C CA  . ASP A 1 161 ? -25.341 16.762  14.738  1.00 33.88  ? 349 ASP A CA  1 
ATOM   1217 C C   . ASP A 1 161 ? -25.580 18.264  14.944  1.00 35.56  ? 349 ASP A C   1 
ATOM   1218 O O   . ASP A 1 161 ? -24.636 19.017  15.173  1.00 36.44  ? 349 ASP A O   1 
ATOM   1219 C CB  . ASP A 1 161 ? -26.347 15.913  15.541  1.00 31.14  ? 349 ASP A CB  1 
ATOM   1220 C CG  . ASP A 1 161 ? -26.465 16.330  17.005  1.00 38.44  ? 349 ASP A CG  1 
ATOM   1221 O OD1 . ASP A 1 161 ? -25.664 17.155  17.498  1.00 41.62  ? 349 ASP A OD1 1 
ATOM   1222 O OD2 . ASP A 1 161 ? -27.373 15.804  17.680  1.00 42.45  ? 349 ASP A OD2 1 
ATOM   1223 N N   . GLU A 1 162 ? -26.839 18.685  14.853  1.00 37.73  ? 350 GLU A N   1 
ATOM   1224 C CA  . GLU A 1 162 ? -27.211 20.097  14.955  1.00 39.19  ? 350 GLU A CA  1 
ATOM   1225 C C   . GLU A 1 162 ? -26.714 20.771  16.234  1.00 35.91  ? 350 GLU A C   1 
ATOM   1226 O O   . GLU A 1 162 ? -26.353 21.947  16.220  1.00 43.39  ? 350 GLU A O   1 
ATOM   1227 C CB  . GLU A 1 162 ? -28.735 20.246  14.866  1.00 42.35  ? 350 GLU A CB  1 
ATOM   1228 C CG  . GLU A 1 162 ? -29.339 19.855  13.523  1.00 47.93  ? 350 GLU A CG  1 
ATOM   1229 C CD  . GLU A 1 162 ? -29.539 18.351  13.357  1.00 53.48  ? 350 GLU A CD  1 
ATOM   1230 O OE1 . GLU A 1 162 ? -28.914 17.562  14.103  1.00 47.07  ? 350 GLU A OE1 1 
ATOM   1231 O OE2 . GLU A 1 162 ? -30.331 17.960  12.470  1.00 59.80  ? 350 GLU A OE2 1 
ATOM   1232 N N   . ARG A 1 163 ? -26.709 20.024  17.333  1.00 26.77  ? 351 ARG A N   1 
ATOM   1233 C CA  . ARG A 1 163 ? -26.306 20.541  18.639  1.00 34.23  ? 351 ARG A CA  1 
ATOM   1234 C C   . ARG A 1 163 ? -24.824 20.290  18.938  1.00 36.07  ? 351 ARG A C   1 
ATOM   1235 O O   . ARG A 1 163 ? -24.369 20.523  20.058  1.00 39.69  ? 351 ARG A O   1 
ATOM   1236 C CB  . ARG A 1 163 ? -27.174 19.935  19.746  1.00 40.28  ? 351 ARG A CB  1 
ATOM   1237 C CG  . ARG A 1 163 ? -28.633 20.375  19.701  1.00 51.94  ? 351 ARG A CG  1 
ATOM   1238 C CD  . ARG A 1 163 ? -29.437 19.817  20.873  1.00 61.24  ? 351 ARG A CD  1 
ATOM   1239 N NE  . ARG A 1 163 ? -28.889 20.213  22.170  1.00 68.51  ? 351 ARG A NE  1 
ATOM   1240 C CZ  . ARG A 1 163 ? -28.218 19.399  22.980  1.00 71.72  ? 351 ARG A CZ  1 
ATOM   1241 N NH1 . ARG A 1 163 ? -28.011 18.135  22.635  1.00 69.29  ? 351 ARG A NH1 1 
ATOM   1242 N NH2 . ARG A 1 163 ? -27.756 19.847  24.139  1.00 75.57  ? 351 ARG A NH2 1 
ATOM   1243 N N   . LEU A 1 164 ? -24.101 19.773  17.944  1.00 34.10  ? 352 LEU A N   1 
ATOM   1244 C CA  . LEU A 1 164 ? -22.693 19.375  18.078  1.00 32.80  ? 352 LEU A CA  1 
ATOM   1245 C C   . LEU A 1 164 ? -22.510 18.194  19.033  1.00 33.62  ? 352 LEU A C   1 
ATOM   1246 O O   . LEU A 1 164 ? -21.487 18.073  19.710  1.00 34.75  ? 352 LEU A O   1 
ATOM   1247 C CB  . LEU A 1 164 ? -21.823 20.559  18.535  1.00 30.43  ? 352 LEU A CB  1 
ATOM   1248 C CG  . LEU A 1 164 ? -21.742 21.737  17.558  1.00 36.10  ? 352 LEU A CG  1 
ATOM   1249 C CD1 . LEU A 1 164 ? -20.885 22.860  18.115  1.00 37.90  ? 352 LEU A CD1 1 
ATOM   1250 C CD2 . LEU A 1 164 ? -21.207 21.277  16.208  1.00 35.60  ? 352 LEU A CD2 1 
ATOM   1251 N N   . THR A 1 165 ? -23.507 17.318  19.068  1.00 33.56  ? 353 THR A N   1 
ATOM   1252 C CA  . THR A 1 165 ? -23.375 16.037  19.749  1.00 30.26  ? 353 THR A CA  1 
ATOM   1253 C C   . THR A 1 165 ? -22.503 15.122  18.893  1.00 30.35  ? 353 THR A C   1 
ATOM   1254 O O   . THR A 1 165 ? -22.796 14.908  17.717  1.00 32.86  ? 353 THR A O   1 
ATOM   1255 C CB  . THR A 1 165 ? -24.753 15.381  20.001  1.00 30.00  ? 353 THR A CB  1 
ATOM   1256 O OG1 . THR A 1 165 ? -25.547 16.242  20.828  1.00 33.60  ? 353 THR A OG1 1 
ATOM   1257 C CG2 . THR A 1 165 ? -24.603 14.019  20.677  1.00 23.48  ? 353 THR A CG2 1 
ATOM   1258 N N   . PRO A 1 166 ? -21.401 14.617  19.466  1.00 25.55  ? 354 PRO A N   1 
ATOM   1259 C CA  . PRO A 1 166 ? -20.524 13.731  18.694  1.00 23.97  ? 354 PRO A CA  1 
ATOM   1260 C C   . PRO A 1 166 ? -21.100 12.325  18.518  1.00 24.12  ? 354 PRO A C   1 
ATOM   1261 O O   . PRO A 1 166 ? -21.689 11.771  19.449  1.00 26.54  ? 354 PRO A O   1 
ATOM   1262 C CB  . PRO A 1 166 ? -19.242 13.697  19.527  1.00 18.73  ? 354 PRO A CB  1 
ATOM   1263 C CG  . PRO A 1 166 ? -19.734 13.869  20.942  1.00 26.37  ? 354 PRO A CG  1 
ATOM   1264 C CD  . PRO A 1 166 ? -20.951 14.771  20.862  1.00 22.34  ? 354 PRO A CD  1 
ATOM   1265 N N   . LYS A 1 167 ? -20.902 11.766  17.328  1.00 22.57  ? 355 LYS A N   1 
ATOM   1266 C CA  . LYS A 1 167 ? -21.268 10.398  17.002  1.00 26.34  ? 355 LYS A CA  1 
ATOM   1267 C C   . LYS A 1 167 ? -20.094 9.722   16.307  1.00 26.83  ? 355 LYS A C   1 
ATOM   1268 O O   . LYS A 1 167 ? -19.635 10.183  15.260  1.00 28.15  ? 355 LYS A O   1 
ATOM   1269 C CB  . LYS A 1 167 ? -22.500 10.349  16.100  1.00 29.05  ? 355 LYS A CB  1 
ATOM   1270 C CG  . LYS A 1 167 ? -23.631 11.256  16.530  1.00 32.37  ? 355 LYS A CG  1 
ATOM   1271 C CD  . LYS A 1 167 ? -24.803 10.462  17.050  1.00 39.32  ? 355 LYS A CD  1 
ATOM   1272 C CE  . LYS A 1 167 ? -25.967 11.380  17.387  1.00 46.58  ? 355 LYS A CE  1 
ATOM   1273 N NZ  . LYS A 1 167 ? -27.168 10.590  17.755  1.00 48.45  ? 355 LYS A NZ  1 
ATOM   1274 N N   . LEU A 1 168 ? -19.619 8.628   16.893  1.00 26.33  ? 356 LEU A N   1 
ATOM   1275 C CA  . LEU A 1 168 ? -18.494 7.870   16.355  1.00 24.23  ? 356 LEU A CA  1 
ATOM   1276 C C   . LEU A 1 168 ? -18.917 6.981   15.189  1.00 29.86  ? 356 LEU A C   1 
ATOM   1277 O O   . LEU A 1 168 ? -19.885 6.222   15.305  1.00 29.01  ? 356 LEU A O   1 
ATOM   1278 C CB  . LEU A 1 168 ? -17.873 7.016   17.460  1.00 23.41  ? 356 LEU A CB  1 
ATOM   1279 C CG  . LEU A 1 168 ? -16.587 6.272   17.120  1.00 27.29  ? 356 LEU A CG  1 
ATOM   1280 C CD1 . LEU A 1 168 ? -15.491 7.265   16.763  1.00 27.53  ? 356 LEU A CD1 1 
ATOM   1281 C CD2 . LEU A 1 168 ? -16.162 5.396   18.285  1.00 25.74  ? 356 LEU A CD2 1 
ATOM   1282 N N   . GLY A 1 169 ? -18.222 7.117   14.059  1.00 31.64  ? 357 GLY A N   1 
ATOM   1283 C CA  . GLY A 1 169 ? -18.438 6.285   12.883  1.00 29.98  ? 357 GLY A CA  1 
ATOM   1284 C C   . GLY A 1 169 ? -17.331 5.299   12.528  1.00 33.66  ? 357 GLY A C   1 
ATOM   1285 O O   . GLY A 1 169 ? -16.441 5.020   13.336  1.00 31.55  ? 357 GLY A O   1 
ATOM   1286 N N   . ASP A 1 170 ? -17.394 4.792   11.293  1.00 30.26  ? 358 ASP A N   1 
ATOM   1287 C CA  . ASP A 1 170 ? -16.375 3.915   10.701  1.00 35.78  ? 358 ASP A CA  1 
ATOM   1288 C C   . ASP A 1 170 ? -16.042 2.685   11.544  1.00 36.25  ? 358 ASP A C   1 
ATOM   1289 O O   . ASP A 1 170 ? -14.918 2.529   12.018  1.00 37.81  ? 358 ASP A O   1 
ATOM   1290 C CB  . ASP A 1 170 ? -15.088 4.703   10.425  1.00 38.87  ? 358 ASP A CB  1 
ATOM   1291 C CG  . ASP A 1 170 ? -15.249 5.720   9.303   1.00 43.67  ? 358 ASP A CG  1 
ATOM   1292 O OD1 . ASP A 1 170 ? -16.317 5.744   8.653   1.00 46.61  ? 358 ASP A OD1 1 
ATOM   1293 O OD2 . ASP A 1 170 ? -14.296 6.492   9.065   1.00 45.06  ? 358 ASP A OD2 1 
ATOM   1294 N N   . PHE A 1 171 ? -17.018 1.798   11.686  1.00 38.37  ? 359 PHE A N   1 
ATOM   1295 C CA  . PHE A 1 171 ? -16.884 0.598   12.507  1.00 36.37  ? 359 PHE A CA  1 
ATOM   1296 C C   . PHE A 1 171 ? -16.346 -0.595  11.718  1.00 34.32  ? 359 PHE A C   1 
ATOM   1297 O O   . PHE A 1 171 ? -16.324 -1.717  12.219  1.00 37.79  ? 359 PHE A O   1 
ATOM   1298 C CB  . PHE A 1 171 ? -18.229 0.246   13.147  1.00 33.22  ? 359 PHE A CB  1 
ATOM   1299 C CG  . PHE A 1 171 ? -18.504 0.999   14.414  1.00 32.07  ? 359 PHE A CG  1 
ATOM   1300 C CD1 . PHE A 1 171 ? -18.751 2.366   14.389  1.00 30.92  ? 359 PHE A CD1 1 
ATOM   1301 C CD2 . PHE A 1 171 ? -18.507 0.344   15.634  1.00 30.67  ? 359 PHE A CD2 1 
ATOM   1302 C CE1 . PHE A 1 171 ? -18.996 3.065   15.560  1.00 30.11  ? 359 PHE A CE1 1 
ATOM   1303 C CE2 . PHE A 1 171 ? -18.758 1.038   16.809  1.00 28.90  ? 359 PHE A CE2 1 
ATOM   1304 C CZ  . PHE A 1 171 ? -19.000 2.398   16.771  1.00 29.12  ? 359 PHE A CZ  1 
ATOM   1305 N N   . GLY A 1 172 ? -15.958 -0.355  10.470  1.00 37.65  ? 360 GLY A N   1 
ATOM   1306 C CA  . GLY A 1 172 ? -15.466 -1.408  9.594   1.00 38.35  ? 360 GLY A CA  1 
ATOM   1307 C C   . GLY A 1 172 ? -14.222 -2.174  10.028  1.00 39.61  ? 360 GLY A C   1 
ATOM   1308 O O   . GLY A 1 172 ? -13.978 -3.284  9.546   1.00 39.40  ? 360 GLY A O   1 
ATOM   1309 N N   . LEU A 1 173 ? -13.399 -1.574  10.883  1.00 38.29  ? 361 LEU A N   1 
ATOM   1310 C CA  . LEU A 1 173 ? -12.219 -2.266  11.404  1.00 41.24  ? 361 LEU A CA  1 
ATOM   1311 C C   . LEU A 1 173 ? -12.415 -2.873  12.795  1.00 41.77  ? 361 LEU A C   1 
ATOM   1312 O O   . LEU A 1 173 ? -11.480 -3.436  13.356  1.00 45.01  ? 361 LEU A O   1 
ATOM   1313 C CB  . LEU A 1 173 ? -11.017 -1.321  11.426  1.00 43.86  ? 361 LEU A CB  1 
ATOM   1314 C CG  . LEU A 1 173 ? -10.568 -0.814  10.054  1.00 45.03  ? 361 LEU A CG  1 
ATOM   1315 C CD1 . LEU A 1 173 ? -9.243  -0.069  10.156  1.00 45.78  ? 361 LEU A CD1 1 
ATOM   1316 C CD2 . LEU A 1 173 ? -10.476 -1.962  9.061   1.00 42.11  ? 361 LEU A CD2 1 
ATOM   1317 N N   . ALA A 1 174 ? -13.613 -2.745  13.358  1.00 39.16  ? 362 ALA A N   1 
ATOM   1318 C CA  . ALA A 1 174 ? -13.856 -3.184  14.733  1.00 41.76  ? 362 ALA A CA  1 
ATOM   1319 C C   . ALA A 1 174 ? -13.658 -4.692  14.928  1.00 44.65  ? 362 ALA A C   1 
ATOM   1320 O O   . ALA A 1 174 ? -14.046 -5.498  14.082  1.00 47.89  ? 362 ALA A O   1 
ATOM   1321 C CB  . ALA A 1 174 ? -15.261 -2.778  15.175  1.00 34.67  ? 362 ALA A CB  1 
ATOM   1322 N N   . ARG A 1 175 ? -13.052 -5.054  16.057  1.00 37.32  ? 363 ARG A N   1 
ATOM   1323 C CA  . ARG A 1 175 ? -12.811 -6.449  16.426  1.00 45.79  ? 363 ARG A CA  1 
ATOM   1324 C C   . ARG A 1 175 ? -13.080 -6.684  17.910  1.00 50.94  ? 363 ARG A C   1 
ATOM   1325 O O   . ARG A 1 175 ? -12.864 -5.797  18.738  1.00 51.68  ? 363 ARG A O   1 
ATOM   1326 C CB  . ARG A 1 175 ? -11.372 -6.863  16.102  1.00 50.23  ? 363 ARG A CB  1 
ATOM   1327 C CG  . ARG A 1 175 ? -11.190 -7.530  14.749  1.00 58.68  ? 363 ARG A CG  1 
ATOM   1328 C CD  . ARG A 1 175 ? -10.812 -6.529  13.670  1.00 66.43  ? 363 ARG A CD  1 
ATOM   1329 N NE  . ARG A 1 175 ? -10.722 -7.152  12.350  1.00 73.60  ? 363 ARG A NE  1 
ATOM   1330 C CZ  . ARG A 1 175 ? -11.689 -7.123  11.437  1.00 77.57  ? 363 ARG A CZ  1 
ATOM   1331 N NH1 . ARG A 1 175 ? -12.829 -6.494  11.690  1.00 76.80  ? 363 ARG A NH1 1 
ATOM   1332 N NH2 . ARG A 1 175 ? -11.512 -7.719  10.266  1.00 81.32  ? 363 ARG A NH2 1 
ATOM   1333 N N   . PHE A 1 176 ? -13.560 -7.879  18.240  1.00 54.85  ? 364 PHE A N   1 
ATOM   1334 C CA  . PHE A 1 176 ? -13.758 -8.275  19.633  1.00 57.15  ? 364 PHE A CA  1 
ATOM   1335 C C   . PHE A 1 176 ? -12.443 -8.654  20.314  1.00 61.74  ? 364 PHE A C   1 
ATOM   1336 O O   . PHE A 1 176 ? -11.469 -9.005  19.650  1.00 60.34  ? 364 PHE A O   1 
ATOM   1337 C CB  . PHE A 1 176 ? -14.748 -9.440  19.726  1.00 54.86  ? 364 PHE A CB  1 
ATOM   1338 C CG  . PHE A 1 176 ? -16.185 -9.012  19.706  1.00 53.91  ? 364 PHE A CG  1 
ATOM   1339 C CD1 . PHE A 1 176 ? -16.764 -8.440  20.828  1.00 57.31  ? 364 PHE A CD1 1 
ATOM   1340 C CD2 . PHE A 1 176 ? -16.957 -9.174  18.568  1.00 51.88  ? 364 PHE A CD2 1 
ATOM   1341 C CE1 . PHE A 1 176 ? -18.092 -8.035  20.817  1.00 59.16  ? 364 PHE A CE1 1 
ATOM   1342 C CE2 . PHE A 1 176 ? -18.284 -8.775  18.549  1.00 54.89  ? 364 PHE A CE2 1 
ATOM   1343 C CZ  . PHE A 1 176 ? -18.853 -8.204  19.675  1.00 56.22  ? 364 PHE A CZ  1 
ATOM   1344 N N   . SER A 1 177 ? -12.424 -8.567  21.642  1.00 64.72  ? 365 SER A N   1 
ATOM   1345 C CA  . SER A 1 177 ? -11.260 -8.966  22.430  1.00 72.39  ? 365 SER A CA  1 
ATOM   1346 C C   . SER A 1 177 ? -11.017 -10.472 22.351  1.00 80.09  ? 365 SER A C   1 
ATOM   1347 O O   . SER A 1 177 ? -11.936 -11.267 22.554  1.00 81.33  ? 365 SER A O   1 
ATOM   1348 C CB  . SER A 1 177 ? -11.428 -8.548  23.893  1.00 71.79  ? 365 SER A CB  1 
ATOM   1349 O OG  . SER A 1 177 ? -11.239 -7.154  24.057  1.00 70.95  ? 365 SER A OG  1 
ATOM   1350 N N   . ARG A 1 178 ? -9.771  -10.844 22.061  1.00 86.24  ? 366 ARG A N   1 
ATOM   1351 C CA  . ARG A 1 178 ? -9.357  -12.244 21.965  1.00 90.39  ? 366 ARG A CA  1 
ATOM   1352 C C   . ARG A 1 178 ? -10.178 -13.011 20.934  1.00 90.42  ? 366 ARG A C   1 
ATOM   1353 O O   . ARG A 1 178 ? -9.906  -12.942 19.734  1.00 90.66  ? 366 ARG A O   1 
ATOM   1354 C CB  . ARG A 1 178 ? -9.454  -12.925 23.332  1.00 93.61  ? 366 ARG A CB  1 
ATOM   1355 C CG  . ARG A 1 178 ? -8.581  -12.280 24.396  1.00 98.51  ? 366 ARG A CG  1 
ATOM   1356 C CD  . ARG A 1 178 ? -8.857  -12.854 25.774  1.00 102.94 ? 366 ARG A CD  1 
ATOM   1357 N NE  . ARG A 1 178 ? -9.261  -11.817 26.720  1.00 103.93 ? 366 ARG A NE  1 
ATOM   1358 C CZ  . ARG A 1 178 ? -9.471  -12.027 28.016  1.00 105.18 ? 366 ARG A CZ  1 
ATOM   1359 N NH1 . ARG A 1 178 ? -9.311  -13.240 28.526  1.00 107.99 ? 366 ARG A NH1 1 
ATOM   1360 N NH2 . ARG A 1 178 ? -9.838  -11.023 28.802  1.00 102.81 ? 366 ARG A NH2 1 
ATOM   1361 N N   . THR A 1 195 ? -1.422  -7.148  8.066   1.00 93.56  ? 383 THR A N   1 
ATOM   1362 C CA  . THR A 1 195 ? -2.540  -7.247  8.997   1.00 91.75  ? 383 THR A CA  1 
ATOM   1363 C C   . THR A 1 195 ? -2.817  -5.906  9.670   1.00 92.49  ? 383 THR A C   1 
ATOM   1364 O O   . THR A 1 195 ? -3.768  -5.774  10.442  1.00 92.13  ? 383 THR A O   1 
ATOM   1365 C CB  . THR A 1 195 ? -2.284  -8.309  10.085  1.00 88.88  ? 383 THR A CB  1 
ATOM   1366 O OG1 . THR A 1 195 ? -3.486  -8.531  10.833  1.00 83.25  ? 383 THR A OG1 1 
ATOM   1367 C CG2 . THR A 1 195 ? -1.180  -7.853  11.031  1.00 89.02  ? 383 THR A CG2 1 
ATOM   1368 N N   . VAL A 1 196 ? -1.989  -4.910  9.366   1.00 90.51  ? 384 VAL A N   1 
ATOM   1369 C CA  . VAL A 1 196 ? -2.140  -3.584  9.955   1.00 85.82  ? 384 VAL A CA  1 
ATOM   1370 C C   . VAL A 1 196 ? -3.145  -2.753  9.160   1.00 81.15  ? 384 VAL A C   1 
ATOM   1371 O O   . VAL A 1 196 ? -2.953  -2.477  7.974   1.00 80.94  ? 384 VAL A O   1 
ATOM   1372 C CB  . VAL A 1 196 ? -0.782  -2.846  10.030  1.00 85.15  ? 384 VAL A CB  1 
ATOM   1373 C CG1 . VAL A 1 196 ? 0.009   -3.024  8.735   1.00 87.14  ? 384 VAL A CG1 1 
ATOM   1374 C CG2 . VAL A 1 196 ? -0.984  -1.370  10.360  1.00 83.00  ? 384 VAL A CG2 1 
ATOM   1375 N N   . ARG A 1 197 ? -4.226  -2.360  9.827   1.00 82.14  ? 385 ARG A N   1 
ATOM   1376 C CA  . ARG A 1 197 ? -5.317  -1.649  9.170   1.00 78.64  ? 385 ARG A CA  1 
ATOM   1377 C C   . ARG A 1 197 ? -5.690  -0.374  9.923   1.00 73.32  ? 385 ARG A C   1 
ATOM   1378 O O   . ARG A 1 197 ? -6.064  -0.416  11.097  1.00 72.47  ? 385 ARG A O   1 
ATOM   1379 C CB  . ARG A 1 197 ? -6.548  -2.551  9.042   1.00 79.78  ? 385 ARG A CB  1 
ATOM   1380 C CG  . ARG A 1 197 ? -6.230  -4.026  8.838   1.00 82.85  ? 385 ARG A CG  1 
ATOM   1381 C CD  . ARG A 1 197 ? -7.495  -4.871  8.829   1.00 83.21  ? 385 ARG A CD  1 
ATOM   1382 N NE  . ARG A 1 197 ? -7.200  -6.297  8.945   1.00 86.34  ? 385 ARG A NE  1 
ATOM   1383 C CZ  . ARG A 1 197 ? -7.219  -6.973  10.090  1.00 87.39  ? 385 ARG A CZ  1 
ATOM   1384 N NH1 . ARG A 1 197 ? -6.934  -8.269  10.100  1.00 89.46  ? 385 ARG A NH1 1 
ATOM   1385 N NH2 . ARG A 1 197 ? -7.526  -6.357  11.224  1.00 85.01  ? 385 ARG A NH2 1 
ATOM   1386 N N   . GLY A 1 198 ? -5.572  0.759   9.243   1.00 69.56  ? 386 GLY A N   1 
ATOM   1387 C CA  . GLY A 1 198 ? -5.974  2.032   9.809   1.00 65.22  ? 386 GLY A CA  1 
ATOM   1388 C C   . GLY A 1 198 ? -5.108  3.164   9.298   1.00 62.88  ? 386 GLY A C   1 
ATOM   1389 O O   . GLY A 1 198 ? -4.296  2.979   8.393   1.00 63.97  ? 386 GLY A O   1 
ATOM   1390 N N   . THR A 1 199 ? -5.279  4.343   9.886   1.00 63.08  ? 387 THR A N   1 
ATOM   1391 C CA  . THR A 1 199 ? -4.437  5.484   9.561   1.00 56.90  ? 387 THR A CA  1 
ATOM   1392 C C   . THR A 1 199 ? -3.329  5.585   10.602  1.00 52.68  ? 387 THR A C   1 
ATOM   1393 O O   . THR A 1 199 ? -3.600  5.795   11.789  1.00 50.11  ? 387 THR A O   1 
ATOM   1394 C CB  . THR A 1 199 ? -5.246  6.793   9.512   1.00 57.26  ? 387 THR A CB  1 
ATOM   1395 O OG1 . THR A 1 199 ? -6.350  6.639   8.611   1.00 58.52  ? 387 THR A OG1 1 
ATOM   1396 C CG2 . THR A 1 199 ? -4.375  7.948   9.044   1.00 57.14  ? 387 THR A CG2 1 
ATOM   1397 N N   . LEU A 1 200 ? -2.086  5.435   10.149  1.00 51.54  ? 388 LEU A N   1 
ATOM   1398 C CA  . LEU A 1 200 ? -0.936  5.337   11.045  1.00 49.78  ? 388 LEU A CA  1 
ATOM   1399 C C   . LEU A 1 200 ? -0.802  6.523   11.996  1.00 45.16  ? 388 LEU A C   1 
ATOM   1400 O O   . LEU A 1 200 ? -0.209  6.399   13.066  1.00 48.57  ? 388 LEU A O   1 
ATOM   1401 C CB  . LEU A 1 200 ? 0.357   5.190   10.237  1.00 51.64  ? 388 LEU A CB  1 
ATOM   1402 C CG  . LEU A 1 200 ? 0.493   3.960   9.336   1.00 54.94  ? 388 LEU A CG  1 
ATOM   1403 C CD1 . LEU A 1 200 ? 1.859   3.949   8.666   1.00 56.43  ? 388 LEU A CD1 1 
ATOM   1404 C CD2 . LEU A 1 200 ? 0.267   2.678   10.121  1.00 54.15  ? 388 LEU A CD2 1 
ATOM   1405 N N   . ALA A 1 201 ? -1.346  7.669   11.602  1.00 43.02  ? 389 ALA A N   1 
ATOM   1406 C CA  . ALA A 1 201 ? -1.273  8.870   12.428  1.00 45.63  ? 389 ALA A CA  1 
ATOM   1407 C C   . ALA A 1 201 ? -1.929  8.655   13.784  1.00 40.57  ? 389 ALA A C   1 
ATOM   1408 O O   . ALA A 1 201 ? -1.491  9.194   14.797  1.00 42.11  ? 389 ALA A O   1 
ATOM   1409 C CB  . ALA A 1 201 ? -1.926  10.035  11.721  1.00 45.78  ? 389 ALA A CB  1 
ATOM   1410 N N   . TYR A 1 202 ? -2.997  7.873   13.783  1.00 41.36  ? 390 TYR A N   1 
ATOM   1411 C CA  . TYR A 1 202 ? -3.792  7.659   14.981  1.00 39.00  ? 390 TYR A CA  1 
ATOM   1412 C C   . TYR A 1 202 ? -3.408  6.391   15.741  1.00 41.87  ? 390 TYR A C   1 
ATOM   1413 O O   . TYR A 1 202 ? -4.047  6.052   16.735  1.00 42.92  ? 390 TYR A O   1 
ATOM   1414 C CB  . TYR A 1 202 ? -5.275  7.641   14.611  1.00 35.66  ? 390 TYR A CB  1 
ATOM   1415 C CG  . TYR A 1 202 ? -5.766  8.999   14.162  1.00 36.42  ? 390 TYR A CG  1 
ATOM   1416 C CD1 . TYR A 1 202 ? -5.715  9.374   12.823  1.00 37.22  ? 390 TYR A CD1 1 
ATOM   1417 C CD2 . TYR A 1 202 ? -6.255  9.918   15.081  1.00 33.74  ? 390 TYR A CD2 1 
ATOM   1418 C CE1 . TYR A 1 202 ? -6.155  10.624  12.412  1.00 32.08  ? 390 TYR A CE1 1 
ATOM   1419 C CE2 . TYR A 1 202 ? -6.692  11.167  14.681  1.00 31.30  ? 390 TYR A CE2 1 
ATOM   1420 C CZ  . TYR A 1 202 ? -6.639  11.513  13.348  1.00 32.64  ? 390 TYR A CZ  1 
ATOM   1421 O OH  . TYR A 1 202 ? -7.078  12.753  12.952  1.00 39.52  ? 390 TYR A OH  1 
ATOM   1422 N N   . LEU A 1 203 ? -2.360  5.701   15.292  1.00 41.43  ? 391 LEU A N   1 
ATOM   1423 C CA  . LEU A 1 203 ? -2.047  4.382   15.841  1.00 40.97  ? 391 LEU A CA  1 
ATOM   1424 C C   . LEU A 1 203 ? -0.693  4.319   16.548  1.00 44.11  ? 391 LEU A C   1 
ATOM   1425 O O   . LEU A 1 203 ? 0.278   4.939   16.111  1.00 43.72  ? 391 LEU A O   1 
ATOM   1426 C CB  . LEU A 1 203 ? -2.081  3.333   14.723  1.00 41.95  ? 391 LEU A CB  1 
ATOM   1427 C CG  . LEU A 1 203 ? -3.448  3.042   14.106  1.00 44.45  ? 391 LEU A CG  1 
ATOM   1428 C CD1 . LEU A 1 203 ? -3.293  2.178   12.870  1.00 47.78  ? 391 LEU A CD1 1 
ATOM   1429 C CD2 . LEU A 1 203 ? -4.350  2.368   15.126  1.00 41.84  ? 391 LEU A CD2 1 
ATOM   1430 N N   . PRO A 1 204 ? -0.627  3.541   17.641  1.00 43.03  ? 392 PRO A N   1 
ATOM   1431 C CA  . PRO A 1 204 ? 0.591   3.379   18.441  1.00 45.50  ? 392 PRO A CA  1 
ATOM   1432 C C   . PRO A 1 204 ? 1.609   2.478   17.757  1.00 52.10  ? 392 PRO A C   1 
ATOM   1433 O O   . PRO A 1 204 ? 1.234   1.635   16.943  1.00 51.10  ? 392 PRO A O   1 
ATOM   1434 C CB  . PRO A 1 204 ? 0.078   2.741   19.734  1.00 47.17  ? 392 PRO A CB  1 
ATOM   1435 C CG  . PRO A 1 204 ? -1.137  1.991   19.315  1.00 48.96  ? 392 PRO A CG  1 
ATOM   1436 C CD  . PRO A 1 204 ? -1.772  2.823   18.232  1.00 44.71  ? 392 PRO A CD  1 
ATOM   1437 N N   . GLU A 1 205 ? 2.881   2.655   18.097  1.00 53.82  ? 393 GLU A N   1 
ATOM   1438 C CA  . GLU A 1 205 ? 3.960   1.929   17.439  1.00 62.70  ? 393 GLU A CA  1 
ATOM   1439 C C   . GLU A 1 205 ? 3.871   0.422   17.672  1.00 63.02  ? 393 GLU A C   1 
ATOM   1440 O O   . GLU A 1 205 ? 4.102   -0.366  16.752  1.00 64.23  ? 393 GLU A O   1 
ATOM   1441 C CB  . GLU A 1 205 ? 5.317   2.455   17.912  1.00 73.96  ? 393 GLU A CB  1 
ATOM   1442 C CG  . GLU A 1 205 ? 6.489   2.031   17.037  1.00 84.47  ? 393 GLU A CG  1 
ATOM   1443 C CD  . GLU A 1 205 ? 6.384   2.551   15.611  1.00 90.77  ? 393 GLU A CD  1 
ATOM   1444 O OE1 . GLU A 1 205 ? 6.962   1.915   14.703  1.00 95.71  ? 393 GLU A OE1 1 
ATOM   1445 O OE2 . GLU A 1 205 ? 5.733   3.597   15.396  1.00 90.71  ? 393 GLU A OE2 1 
ATOM   1446 N N   . GLU A 1 206 ? 3.523   0.023   18.893  1.00 61.57  ? 394 GLU A N   1 
ATOM   1447 C CA  . GLU A 1 206 ? 3.427   -1.395  19.226  1.00 57.38  ? 394 GLU A CA  1 
ATOM   1448 C C   . GLU A 1 206 ? 2.360   -2.098  18.380  1.00 58.31  ? 394 GLU A C   1 
ATOM   1449 O O   . GLU A 1 206 ? 2.463   -3.296  18.122  1.00 59.60  ? 394 GLU A O   1 
ATOM   1450 C CB  . GLU A 1 206 ? 3.141   -1.588  20.722  1.00 56.86  ? 394 GLU A CB  1 
ATOM   1451 C CG  . GLU A 1 206 ? 1.669   -1.776  21.093  1.00 57.92  ? 394 GLU A CG  1 
ATOM   1452 C CD  . GLU A 1 206 ? 0.984   -0.476  21.472  1.00 64.43  ? 394 GLU A CD  1 
ATOM   1453 O OE1 . GLU A 1 206 ? 1.695   0.521   21.722  1.00 66.38  ? 394 GLU A OE1 1 
ATOM   1454 O OE2 . GLU A 1 206 ? -0.268  -0.452  21.521  1.00 67.26  ? 394 GLU A OE2 1 
ATOM   1455 N N   . TYR A 1 207 ? 1.344   -1.358  17.942  1.00 60.71  ? 395 TYR A N   1 
ATOM   1456 C CA  . TYR A 1 207 ? 0.341   -1.925  17.045  1.00 61.75  ? 395 TYR A CA  1 
ATOM   1457 C C   . TYR A 1 207 ? 0.849   -1.981  15.610  1.00 65.30  ? 395 TYR A C   1 
ATOM   1458 O O   . TYR A 1 207 ? 0.620   -2.959  14.900  1.00 72.35  ? 395 TYR A O   1 
ATOM   1459 C CB  . TYR A 1 207 ? -0.967  -1.131  17.082  1.00 56.79  ? 395 TYR A CB  1 
ATOM   1460 C CG  . TYR A 1 207 ? -1.930  -1.578  16.002  1.00 59.51  ? 395 TYR A CG  1 
ATOM   1461 C CD1 . TYR A 1 207 ? -2.584  -2.799  16.095  1.00 61.07  ? 395 TYR A CD1 1 
ATOM   1462 C CD2 . TYR A 1 207 ? -2.165  -0.795  14.879  1.00 60.45  ? 395 TYR A CD2 1 
ATOM   1463 C CE1 . TYR A 1 207 ? -3.449  -3.223  15.108  1.00 60.17  ? 395 TYR A CE1 1 
ATOM   1464 C CE2 . TYR A 1 207 ? -3.035  -1.214  13.886  1.00 60.03  ? 395 TYR A CE2 1 
ATOM   1465 C CZ  . TYR A 1 207 ? -3.675  -2.428  14.008  1.00 61.16  ? 395 TYR A CZ  1 
ATOM   1466 O OH  . TYR A 1 207 ? -4.542  -2.854  13.027  1.00 62.30  ? 395 TYR A OH  1 
ATOM   1467 N N   . ILE A 1 208 ? 1.520   -0.918  15.181  1.00 58.69  ? 396 ILE A N   1 
ATOM   1468 C CA  . ILE A 1 208 ? 2.047   -0.847  13.825  1.00 59.46  ? 396 ILE A CA  1 
ATOM   1469 C C   . ILE A 1 208 ? 3.028   -1.991  13.582  1.00 61.99  ? 396 ILE A C   1 
ATOM   1470 O O   . ILE A 1 208 ? 3.038   -2.592  12.510  1.00 64.85  ? 396 ILE A O   1 
ATOM   1471 C CB  . ILE A 1 208 ? 2.738   0.506   13.554  1.00 59.86  ? 396 ILE A CB  1 
ATOM   1472 C CG1 . ILE A 1 208 ? 1.730   1.651   13.672  1.00 57.39  ? 396 ILE A CG1 1 
ATOM   1473 C CG2 . ILE A 1 208 ? 3.379   0.520   12.176  1.00 60.55  ? 396 ILE A CG2 1 
ATOM   1474 C CD1 . ILE A 1 208 ? 2.323   3.021   13.411  1.00 57.24  ? 396 ILE A CD1 1 
ATOM   1475 N N   . LYS A 1 209 ? 3.822   -2.307  14.601  1.00 61.53  ? 397 LYS A N   1 
ATOM   1476 C CA  . LYS A 1 209 ? 4.793   -3.396  14.521  1.00 70.97  ? 397 LYS A CA  1 
ATOM   1477 C C   . LYS A 1 209 ? 4.106   -4.758  14.628  1.00 77.64  ? 397 LYS A C   1 
ATOM   1478 O O   . LYS A 1 209 ? 4.166   -5.564  13.701  1.00 81.67  ? 397 LYS A O   1 
ATOM   1479 C CB  . LYS A 1 209 ? 5.859   -3.254  15.609  1.00 72.19  ? 397 LYS A CB  1 
ATOM   1480 C CG  . LYS A 1 209 ? 6.607   -1.926  15.576  1.00 76.30  ? 397 LYS A CG  1 
ATOM   1481 C CD  . LYS A 1 209 ? 8.107   -2.126  15.745  1.00 82.94  ? 397 LYS A CD  1 
ATOM   1482 C CE  . LYS A 1 209 ? 8.794   -0.851  16.213  1.00 84.05  ? 397 LYS A CE  1 
ATOM   1483 N NZ  . LYS A 1 209 ? 8.439   -0.524  17.624  1.00 83.97  ? 397 LYS A NZ  1 
ATOM   1484 N N   . THR A 1 210 ? 3.462   -5.010  15.764  1.00 77.71  ? 398 THR A N   1 
ATOM   1485 C CA  . THR A 1 210 ? 2.837   -6.303  16.034  1.00 77.61  ? 398 THR A CA  1 
ATOM   1486 C C   . THR A 1 210 ? 1.559   -6.513  15.225  1.00 77.51  ? 398 THR A C   1 
ATOM   1487 O O   . THR A 1 210 ? 1.493   -7.398  14.373  1.00 79.72  ? 398 THR A O   1 
ATOM   1488 C CB  . THR A 1 210 ? 2.502   -6.458  17.527  1.00 75.46  ? 398 THR A CB  1 
ATOM   1489 O OG1 . THR A 1 210 ? 3.696   -6.303  18.304  1.00 77.40  ? 398 THR A OG1 1 
ATOM   1490 C CG2 . THR A 1 210 ? 1.889   -7.825  17.799  1.00 74.45  ? 398 THR A CG2 1 
ATOM   1491 N N   . GLY A 1 211 ? 0.541   -5.705  15.495  1.00 74.37  ? 399 GLY A N   1 
ATOM   1492 C CA  . GLY A 1 211 ? -0.719  -5.827  14.786  1.00 72.62  ? 399 GLY A CA  1 
ATOM   1493 C C   . GLY A 1 211 ? -1.807  -6.526  15.576  1.00 72.95  ? 399 GLY A C   1 
ATOM   1494 O O   . GLY A 1 211 ? -2.851  -6.881  15.027  1.00 72.04  ? 399 GLY A O   1 
ATOM   1495 N N   . ARG A 1 212 ? -1.568  -6.726  16.868  1.00 71.45  ? 400 ARG A N   1 
ATOM   1496 C CA  . ARG A 1 212 ? -2.600  -7.260  17.747  1.00 76.50  ? 400 ARG A CA  1 
ATOM   1497 C C   . ARG A 1 212 ? -3.245  -6.118  18.523  1.00 76.15  ? 400 ARG A C   1 
ATOM   1498 O O   . ARG A 1 212 ? -2.558  -5.317  19.159  1.00 75.43  ? 400 ARG A O   1 
ATOM   1499 C CB  . ARG A 1 212 ? -2.026  -8.309  18.700  1.00 84.59  ? 400 ARG A CB  1 
ATOM   1500 C CG  . ARG A 1 212 ? -2.764  -9.643  18.657  1.00 89.84  ? 400 ARG A CG  1 
ATOM   1501 C CD  . ARG A 1 212 ? -4.218  -9.484  19.079  1.00 89.61  ? 400 ARG A CD  1 
ATOM   1502 N NE  . ARG A 1 212 ? -5.074  -10.533 18.530  1.00 92.71  ? 400 ARG A NE  1 
ATOM   1503 C CZ  . ARG A 1 212 ? -5.404  -11.650 19.172  1.00 96.09  ? 400 ARG A CZ  1 
ATOM   1504 N NH1 . ARG A 1 212 ? -6.191  -12.544 18.586  1.00 96.81  ? 400 ARG A NH1 1 
ATOM   1505 N NH2 . ARG A 1 212 ? -4.950  -11.874 20.398  1.00 97.29  ? 400 ARG A NH2 1 
ATOM   1506 N N   . LEU A 1 213 ? -4.569  -6.043  18.465  1.00 73.66  ? 401 LEU A N   1 
ATOM   1507 C CA  . LEU A 1 213 ? -5.282  -4.925  19.063  1.00 71.91  ? 401 LEU A CA  1 
ATOM   1508 C C   . LEU A 1 213 ? -5.730  -5.212  20.486  1.00 63.74  ? 401 LEU A C   1 
ATOM   1509 O O   . LEU A 1 213 ? -6.128  -6.330  20.815  1.00 64.37  ? 401 LEU A O   1 
ATOM   1510 C CB  . LEU A 1 213 ? -6.504  -4.549  18.222  1.00 78.57  ? 401 LEU A CB  1 
ATOM   1511 C CG  . LEU A 1 213 ? -6.260  -4.033  16.804  1.00 85.59  ? 401 LEU A CG  1 
ATOM   1512 C CD1 . LEU A 1 213 ? -6.322  -5.172  15.790  1.00 88.58  ? 401 LEU A CD1 1 
ATOM   1513 C CD2 . LEU A 1 213 ? -7.238  -2.919  16.445  1.00 85.31  ? 401 LEU A CD2 1 
ATOM   1514 N N   . ALA A 1 214 ? -5.642  -4.185  21.324  1.00 61.26  ? 402 ALA A N   1 
ATOM   1515 C CA  . ALA A 1 214 ? -6.259  -4.192  22.641  1.00 52.48  ? 402 ALA A CA  1 
ATOM   1516 C C   . ALA A 1 214 ? -7.105  -2.929  22.775  1.00 45.83  ? 402 ALA A C   1 
ATOM   1517 O O   . ALA A 1 214 ? -7.184  -2.133  21.840  1.00 45.16  ? 402 ALA A O   1 
ATOM   1518 C CB  . ALA A 1 214 ? -5.206  -4.266  23.736  1.00 45.53  ? 402 ALA A CB  1 
ATOM   1519 N N   . VAL A 1 215 ? -7.733  -2.739  23.928  1.00 44.01  ? 403 VAL A N   1 
ATOM   1520 C CA  . VAL A 1 215 ? -8.491  -1.517  24.175  1.00 46.00  ? 403 VAL A CA  1 
ATOM   1521 C C   . VAL A 1 215 ? -7.533  -0.318  24.294  1.00 46.68  ? 403 VAL A C   1 
ATOM   1522 O O   . VAL A 1 215 ? -7.907  0.846   24.046  1.00 47.91  ? 403 VAL A O   1 
ATOM   1523 C CB  . VAL A 1 215 ? -9.358  -1.650  25.445  1.00 45.45  ? 403 VAL A CB  1 
ATOM   1524 C CG1 . VAL A 1 215 ? -10.445 -2.697  25.230  1.00 43.41  ? 403 VAL A CG1 1 
ATOM   1525 C CG2 . VAL A 1 215 ? -8.501  -2.019  26.648  1.00 42.34  ? 403 VAL A CG2 1 
ATOM   1526 N N   . ASP A 1 216 ? -6.289  -0.627  24.650  1.00 40.72  ? 404 ASP A N   1 
ATOM   1527 C CA  . ASP A 1 216 ? -5.219  0.362   24.743  1.00 44.39  ? 404 ASP A CA  1 
ATOM   1528 C C   . ASP A 1 216 ? -4.983  1.077   23.418  1.00 39.39  ? 404 ASP A C   1 
ATOM   1529 O O   . ASP A 1 216 ? -4.628  2.257   23.398  1.00 43.44  ? 404 ASP A O   1 
ATOM   1530 C CB  . ASP A 1 216 ? -3.919  -0.306  25.200  1.00 56.81  ? 404 ASP A CB  1 
ATOM   1531 C CG  . ASP A 1 216 ? -4.074  -1.039  26.512  1.00 67.66  ? 404 ASP A CG  1 
ATOM   1532 O OD1 . ASP A 1 216 ? -4.860  -0.571  27.363  1.00 74.25  ? 404 ASP A OD1 1 
ATOM   1533 O OD2 . ASP A 1 216 ? -3.415  -2.083  26.690  1.00 71.69  ? 404 ASP A OD2 1 
ATOM   1534 N N   . THR A 1 217 ? -5.172  0.354   22.318  1.00 38.11  ? 405 THR A N   1 
ATOM   1535 C CA  . THR A 1 217 ? -5.002  0.924   20.988  1.00 40.51  ? 405 THR A CA  1 
ATOM   1536 C C   . THR A 1 217 ? -5.996  2.067   20.793  1.00 36.46  ? 405 THR A C   1 
ATOM   1537 O O   . THR A 1 217 ? -5.620  3.189   20.410  1.00 39.53  ? 405 THR A O   1 
ATOM   1538 C CB  . THR A 1 217 ? -5.196  -0.142  19.890  1.00 45.22  ? 405 THR A CB  1 
ATOM   1539 O OG1 . THR A 1 217 ? -4.437  -1.314  20.216  1.00 48.95  ? 405 THR A OG1 1 
ATOM   1540 C CG2 . THR A 1 217 ? -4.738  0.387   18.543  1.00 47.03  ? 405 THR A CG2 1 
ATOM   1541 N N   . ASP A 1 218 ? -7.263  1.774   21.086  1.00 34.08  ? 406 ASP A N   1 
ATOM   1542 C CA  . ASP A 1 218 ? -8.326  2.773   21.040  1.00 35.63  ? 406 ASP A CA  1 
ATOM   1543 C C   . ASP A 1 218 ? -8.021  3.944   21.964  1.00 34.77  ? 406 ASP A C   1 
ATOM   1544 O O   . ASP A 1 218 ? -8.202  5.102   21.580  1.00 29.86  ? 406 ASP A O   1 
ATOM   1545 C CB  . ASP A 1 218 ? -9.675  2.160   21.423  1.00 38.58  ? 406 ASP A CB  1 
ATOM   1546 C CG  . ASP A 1 218 ? -10.332 1.419   20.274  1.00 43.09  ? 406 ASP A CG  1 
ATOM   1547 O OD1 . ASP A 1 218 ? -9.859  1.543   19.123  1.00 46.15  ? 406 ASP A OD1 1 
ATOM   1548 O OD2 . ASP A 1 218 ? -11.338 0.721   20.526  1.00 42.00  ? 406 ASP A OD2 1 
ATOM   1549 N N   . THR A 1 219 ? -7.567  3.647   23.180  1.00 31.33  ? 407 THR A N   1 
ATOM   1550 C CA  . THR A 1 219 ? -7.211  4.725   24.103  1.00 34.91  ? 407 THR A CA  1 
ATOM   1551 C C   . THR A 1 219 ? -6.151  5.664   23.488  1.00 36.07  ? 407 THR A C   1 
ATOM   1552 O O   . THR A 1 219 ? -6.281  6.890   23.557  1.00 33.38  ? 407 THR A O   1 
ATOM   1553 C CB  . THR A 1 219 ? -6.704  4.168   25.449  1.00 35.53  ? 407 THR A CB  1 
ATOM   1554 O OG1 . THR A 1 219 ? -7.724  3.353   26.038  1.00 38.92  ? 407 THR A OG1 1 
ATOM   1555 C CG2 . THR A 1 219 ? -6.357  5.301   26.407  1.00 30.82  ? 407 THR A CG2 1 
ATOM   1556 N N   . PHE A 1 220 ? -5.123  5.079   22.873  1.00 33.53  ? 408 PHE A N   1 
ATOM   1557 C CA  . PHE A 1 220 ? -4.078  5.850   22.196  1.00 34.86  ? 408 PHE A CA  1 
ATOM   1558 C C   . PHE A 1 220 ? -4.643  6.725   21.075  1.00 32.36  ? 408 PHE A C   1 
ATOM   1559 O O   . PHE A 1 220 ? -4.303  7.921   20.965  1.00 30.50  ? 408 PHE A O   1 
ATOM   1560 C CB  . PHE A 1 220 ? -3.011  4.907   21.634  1.00 37.00  ? 408 PHE A CB  1 
ATOM   1561 C CG  . PHE A 1 220 ? -1.792  5.608   21.102  1.00 38.36  ? 408 PHE A CG  1 
ATOM   1562 C CD1 . PHE A 1 220 ? -1.755  6.073   19.796  1.00 39.58  ? 408 PHE A CD1 1 
ATOM   1563 C CD2 . PHE A 1 220 ? -0.675  5.787   21.905  1.00 41.24  ? 408 PHE A CD2 1 
ATOM   1564 C CE1 . PHE A 1 220 ? -0.633  6.715   19.301  1.00 42.70  ? 408 PHE A CE1 1 
ATOM   1565 C CE2 . PHE A 1 220 ? 0.459   6.424   21.416  1.00 47.62  ? 408 PHE A CE2 1 
ATOM   1566 C CZ  . PHE A 1 220 ? 0.478   6.890   20.110  1.00 45.71  ? 408 PHE A CZ  1 
ATOM   1567 N N   . SER A 1 221 ? -5.494  6.127   20.242  1.00 30.49  ? 409 SER A N   1 
ATOM   1568 C CA  . SER A 1 221 ? -6.141  6.879   19.167  1.00 35.80  ? 409 SER A CA  1 
ATOM   1569 C C   . SER A 1 221 ? -6.913  8.076   19.726  1.00 36.14  ? 409 SER A C   1 
ATOM   1570 O O   . SER A 1 221 ? -6.849  9.194   19.188  1.00 36.21  ? 409 SER A O   1 
ATOM   1571 C CB  . SER A 1 221 ? -7.080  5.978   18.366  1.00 37.15  ? 409 SER A CB  1 
ATOM   1572 O OG  . SER A 1 221 ? -6.398  4.828   17.902  1.00 36.71  ? 409 SER A OG  1 
ATOM   1573 N N   . PHE A 1 222 ? -7.628  7.839   20.820  1.00 35.01  ? 410 PHE A N   1 
ATOM   1574 C CA  . PHE A 1 222 ? -8.373  8.908   21.463  1.00 31.23  ? 410 PHE A CA  1 
ATOM   1575 C C   . PHE A 1 222 ? -7.425  9.989   21.946  1.00 29.83  ? 410 PHE A C   1 
ATOM   1576 O O   . PHE A 1 222 ? -7.740  11.167  21.863  1.00 29.30  ? 410 PHE A O   1 
ATOM   1577 C CB  . PHE A 1 222 ? -9.204  8.394   22.633  1.00 29.69  ? 410 PHE A CB  1 
ATOM   1578 C CG  . PHE A 1 222 ? -10.073 9.450   23.249  1.00 31.92  ? 410 PHE A CG  1 
ATOM   1579 C CD1 . PHE A 1 222 ? -11.213 9.892   22.595  1.00 25.31  ? 410 PHE A CD1 1 
ATOM   1580 C CD2 . PHE A 1 222 ? -9.739  10.023  24.465  1.00 33.14  ? 410 PHE A CD2 1 
ATOM   1581 C CE1 . PHE A 1 222 ? -12.013 10.876  23.151  1.00 29.65  ? 410 PHE A CE1 1 
ATOM   1582 C CE2 . PHE A 1 222 ? -10.537 11.007  25.027  1.00 31.68  ? 410 PHE A CE2 1 
ATOM   1583 C CZ  . PHE A 1 222 ? -11.675 11.434  24.369  1.00 28.04  ? 410 PHE A CZ  1 
ATOM   1584 N N   . GLY A 1 223 ? -6.263  9.583   22.449  1.00 31.73  ? 411 GLY A N   1 
ATOM   1585 C CA  . GLY A 1 223 ? -5.258  10.544  22.871  1.00 30.78  ? 411 GLY A CA  1 
ATOM   1586 C C   . GLY A 1 223 ? -4.844  11.440  21.717  1.00 33.07  ? 411 GLY A C   1 
ATOM   1587 O O   . GLY A 1 223 ? -4.709  12.667  21.866  1.00 34.87  ? 411 GLY A O   1 
ATOM   1588 N N   . VAL A 1 224 ? -4.648  10.829  20.552  1.00 33.37  ? 412 VAL A N   1 
ATOM   1589 C CA  . VAL A 1 224 ? -4.315  11.613  19.369  1.00 31.90  ? 412 VAL A CA  1 
ATOM   1590 C C   . VAL A 1 224 ? -5.449  12.585  19.021  1.00 34.87  ? 412 VAL A C   1 
ATOM   1591 O O   . VAL A 1 224 ? -5.189  13.748  18.714  1.00 32.48  ? 412 VAL A O   1 
ATOM   1592 C CB  . VAL A 1 224 ? -4.006  10.717  18.154  1.00 33.40  ? 412 VAL A CB  1 
ATOM   1593 C CG1 . VAL A 1 224 ? -3.737  11.570  16.920  1.00 33.13  ? 412 VAL A CG1 1 
ATOM   1594 C CG2 . VAL A 1 224 ? -2.806  9.820   18.445  1.00 33.27  ? 412 VAL A CG2 1 
ATOM   1595 N N   . VAL A 1 225 ? -6.701  12.126  19.091  1.00 32.80  ? 413 VAL A N   1 
ATOM   1596 C CA  . VAL A 1 225 ? -7.838  13.015  18.813  1.00 28.57  ? 413 VAL A CA  1 
ATOM   1597 C C   . VAL A 1 225 ? -7.893  14.192  19.806  1.00 30.21  ? 413 VAL A C   1 
ATOM   1598 O O   . VAL A 1 225 ? -8.200  15.324  19.426  1.00 30.43  ? 413 VAL A O   1 
ATOM   1599 C CB  . VAL A 1 225 ? -9.187  12.241  18.832  1.00 30.92  ? 413 VAL A CB  1 
ATOM   1600 C CG1 . VAL A 1 225 ? -10.389 13.202  18.871  1.00 27.11  ? 413 VAL A CG1 1 
ATOM   1601 C CG2 . VAL A 1 225 ? -9.286  11.321  17.622  1.00 25.87  ? 413 VAL A CG2 1 
ATOM   1602 N N   . VAL A 1 226 ? -7.573  13.924  21.068  1.00 26.99  ? 414 VAL A N   1 
ATOM   1603 C CA  . VAL A 1 226 ? -7.498  14.968  22.084  1.00 30.16  ? 414 VAL A CA  1 
ATOM   1604 C C   . VAL A 1 226 ? -6.426  15.994  21.721  1.00 30.95  ? 414 VAL A C   1 
ATOM   1605 O O   . VAL A 1 226 ? -6.681  17.202  21.758  1.00 28.94  ? 414 VAL A O   1 
ATOM   1606 C CB  . VAL A 1 226 ? -7.194  14.393  23.484  1.00 30.71  ? 414 VAL A CB  1 
ATOM   1607 C CG1 . VAL A 1 226 ? -6.840  15.515  24.446  1.00 34.25  ? 414 VAL A CG1 1 
ATOM   1608 C CG2 . VAL A 1 226 ? -8.382  13.607  24.007  1.00 31.95  ? 414 VAL A CG2 1 
ATOM   1609 N N   . LEU A 1 227 ? -5.236  15.515  21.359  1.00 27.36  ? 415 LEU A N   1 
ATOM   1610 C CA  . LEU A 1 227 ? -4.165  16.422  20.938  1.00 30.16  ? 415 LEU A CA  1 
ATOM   1611 C C   . LEU A 1 227 ? -4.584  17.271  19.741  1.00 32.86  ? 415 LEU A C   1 
ATOM   1612 O O   . LEU A 1 227 ? -4.340  18.471  19.713  1.00 30.05  ? 415 LEU A O   1 
ATOM   1613 C CB  . LEU A 1 227 ? -2.896  15.647  20.584  1.00 28.38  ? 415 LEU A CB  1 
ATOM   1614 C CG  . LEU A 1 227 ? -1.817  15.551  21.655  1.00 41.45  ? 415 LEU A CG  1 
ATOM   1615 C CD1 . LEU A 1 227 ? -0.519  15.065  21.028  1.00 43.01  ? 415 LEU A CD1 1 
ATOM   1616 C CD2 . LEU A 1 227 ? -1.617  16.894  22.343  1.00 47.66  ? 415 LEU A CD2 1 
ATOM   1617 N N   . GLU A 1 228 ? -5.207  16.629  18.757  1.00 29.98  ? 416 GLU A N   1 
ATOM   1618 C CA  . GLU A 1 228 ? -5.683  17.297  17.553  1.00 31.35  ? 416 GLU A CA  1 
ATOM   1619 C C   . GLU A 1 228 ? -6.689  18.388  17.895  1.00 30.60  ? 416 GLU A C   1 
ATOM   1620 O O   . GLU A 1 228 ? -6.688  19.460  17.288  1.00 28.04  ? 416 GLU A O   1 
ATOM   1621 C CB  . GLU A 1 228 ? -6.308  16.271  16.597  1.00 34.63  ? 416 GLU A CB  1 
ATOM   1622 C CG  . GLU A 1 228 ? -6.792  16.842  15.273  1.00 39.93  ? 416 GLU A CG  1 
ATOM   1623 C CD  . GLU A 1 228 ? -7.271  15.764  14.312  1.00 39.72  ? 416 GLU A CD  1 
ATOM   1624 O OE1 . GLU A 1 228 ? -7.211  14.568  14.675  1.00 38.63  ? 416 GLU A OE1 1 
ATOM   1625 O OE2 . GLU A 1 228 ? -7.707  16.111  13.193  1.00 36.73  ? 416 GLU A OE2 1 
ATOM   1626 N N   . THR A 1 229 ? -7.541  18.114  18.877  1.00 29.47  ? 417 THR A N   1 
ATOM   1627 C CA  . THR A 1 229 ? -8.554  19.081  19.281  1.00 30.03  ? 417 THR A CA  1 
ATOM   1628 C C   . THR A 1 229 ? -7.924  20.240  20.061  1.00 35.18  ? 417 THR A C   1 
ATOM   1629 O O   . THR A 1 229 ? -8.371  21.383  19.956  1.00 35.75  ? 417 THR A O   1 
ATOM   1630 C CB  . THR A 1 229 ? -9.656  18.406  20.115  1.00 26.68  ? 417 THR A CB  1 
ATOM   1631 O OG1 . THR A 1 229 ? -10.169 17.281  19.391  1.00 26.05  ? 417 THR A OG1 1 
ATOM   1632 C CG2 . THR A 1 229 ? -10.793 19.370  20.388  1.00 27.27  ? 417 THR A CG2 1 
ATOM   1633 N N   . LEU A 1 230 ? -6.874  19.943  20.823  1.00 33.45  ? 418 LEU A N   1 
ATOM   1634 C CA  . LEU A 1 230 ? -6.135  20.970  21.562  1.00 36.22  ? 418 LEU A CA  1 
ATOM   1635 C C   . LEU A 1 230 ? -5.329  21.915  20.664  1.00 35.07  ? 418 LEU A C   1 
ATOM   1636 O O   . LEU A 1 230 ? -5.365  23.135  20.839  1.00 32.91  ? 418 LEU A O   1 
ATOM   1637 C CB  . LEU A 1 230 ? -5.183  20.316  22.564  1.00 39.32  ? 418 LEU A CB  1 
ATOM   1638 C CG  . LEU A 1 230 ? -5.685  20.063  23.984  1.00 42.05  ? 418 LEU A CG  1 
ATOM   1639 C CD1 . LEU A 1 230 ? -4.668  19.234  24.749  1.00 47.14  ? 418 LEU A CD1 1 
ATOM   1640 C CD2 . LEU A 1 230 ? -5.950  21.383  24.692  1.00 40.01  ? 418 LEU A CD2 1 
ATOM   1641 N N   . ALA A 1 231 ? -4.579  21.336  19.730  1.00 35.60  ? 419 ALA A N   1 
ATOM   1642 C CA  . ALA A 1 231 ? -3.623  22.081  18.912  1.00 35.89  ? 419 ALA A CA  1 
ATOM   1643 C C   . ALA A 1 231 ? -4.203  22.665  17.626  1.00 37.94  ? 419 ALA A C   1 
ATOM   1644 O O   . ALA A 1 231 ? -3.581  23.527  17.003  1.00 39.33  ? 419 ALA A O   1 
ATOM   1645 C CB  . ALA A 1 231 ? -2.436  21.181  18.573  1.00 31.92  ? 419 ALA A CB  1 
ATOM   1646 N N   . GLY A 1 232 ? -5.389  22.210  17.234  1.00 37.11  ? 420 GLY A N   1 
ATOM   1647 C CA  . GLY A 1 232 ? -5.959  22.606  15.959  1.00 39.64  ? 420 GLY A CA  1 
ATOM   1648 C C   . GLY A 1 232 ? -5.027  22.269  14.806  1.00 44.11  ? 420 GLY A C   1 
ATOM   1649 O O   . GLY A 1 232 ? -4.942  23.007  13.823  1.00 47.00  ? 420 GLY A O   1 
ATOM   1650 N N   . GLN A 1 233 ? -4.317  21.153  14.943  1.00 41.66  ? 421 GLN A N   1 
ATOM   1651 C CA  . GLN A 1 233 ? -3.356  20.703  13.942  1.00 43.66  ? 421 GLN A CA  1 
ATOM   1652 C C   . GLN A 1 233 ? -3.727  19.321  13.440  1.00 41.35  ? 421 GLN A C   1 
ATOM   1653 O O   . GLN A 1 233 ? -4.193  18.481  14.210  1.00 37.93  ? 421 GLN A O   1 
ATOM   1654 C CB  . GLN A 1 233 ? -1.940  20.676  14.523  1.00 48.65  ? 421 GLN A CB  1 
ATOM   1655 C CG  . GLN A 1 233 ? -1.313  22.038  14.731  1.00 56.54  ? 421 GLN A CG  1 
ATOM   1656 C CD  . GLN A 1 233 ? -0.504  22.483  13.534  1.00 66.58  ? 421 GLN A CD  1 
ATOM   1657 O OE1 . GLN A 1 233 ? 0.694   22.212  13.447  1.00 72.60  ? 421 GLN A OE1 1 
ATOM   1658 N NE2 . GLN A 1 233 ? -1.156  23.164  12.598  1.00 68.01  ? 421 GLN A NE2 1 
ATOM   1659 N N   . ARG A 1 234 ? -3.513  19.083  12.152  1.00 43.05  ? 422 ARG A N   1 
ATOM   1660 C CA  . ARG A 1 234 ? -3.797  17.780  11.570  1.00 43.77  ? 422 ARG A CA  1 
ATOM   1661 C C   . ARG A 1 234 ? -2.874  16.711  12.156  1.00 43.08  ? 422 ARG A C   1 
ATOM   1662 O O   . ARG A 1 234 ? -1.743  17.003  12.547  1.00 43.15  ? 422 ARG A O   1 
ATOM   1663 C CB  . ARG A 1 234 ? -3.667  17.840  10.048  1.00 44.14  ? 422 ARG A CB  1 
ATOM   1664 C CG  . ARG A 1 234 ? -4.689  18.764  9.403   1.00 46.61  ? 422 ARG A CG  1 
ATOM   1665 C CD  . ARG A 1 234 ? -4.642  18.694  7.890   1.00 47.59  ? 422 ARG A CD  1 
ATOM   1666 N NE  . ARG A 1 234 ? -5.623  19.583  7.273   1.00 47.55  ? 422 ARG A NE  1 
ATOM   1667 C CZ  . ARG A 1 234 ? -6.882  19.244  7.012   1.00 48.96  ? 422 ARG A CZ  1 
ATOM   1668 N NH1 . ARG A 1 234 ? -7.326  18.033  7.318   1.00 47.33  ? 422 ARG A NH1 1 
ATOM   1669 N NH2 . ARG A 1 234 ? -7.701  20.118  6.444   1.00 51.98  ? 422 ARG A NH2 1 
ATOM   1670 N N   . ALA A 1 235 ? -3.372  15.479  12.232  1.00 39.52  ? 423 ALA A N   1 
ATOM   1671 C CA  . ALA A 1 235 ? -2.620  14.374  12.819  1.00 40.79  ? 423 ALA A CA  1 
ATOM   1672 C C   . ALA A 1 235 ? -1.333  14.101  12.042  1.00 43.47  ? 423 ALA A C   1 
ATOM   1673 O O   . ALA A 1 235 ? -0.327  13.694  12.618  1.00 43.27  ? 423 ALA A O   1 
ATOM   1674 C CB  . ALA A 1 235 ? -3.481  13.125  12.879  1.00 37.07  ? 423 ALA A CB  1 
ATOM   1675 N N   . VAL A 1 236 ? -1.384  14.321  10.731  1.00 46.51  ? 424 VAL A N   1 
ATOM   1676 C CA  . VAL A 1 236 ? -0.205  14.266  9.870   1.00 50.08  ? 424 VAL A CA  1 
ATOM   1677 C C   . VAL A 1 236 ? -0.029  15.576  9.128   1.00 48.18  ? 424 VAL A C   1 
ATOM   1678 O O   . VAL A 1 236 ? -1.006  16.210  8.731   1.00 47.57  ? 424 VAL A O   1 
ATOM   1679 C CB  . VAL A 1 236 ? -0.291  13.143  8.815   1.00 59.56  ? 424 VAL A CB  1 
ATOM   1680 C CG1 . VAL A 1 236 ? -0.060  11.800  9.439   1.00 66.16  ? 424 VAL A CG1 1 
ATOM   1681 C CG2 . VAL A 1 236 ? -1.629  13.180  8.092   1.00 57.28  ? 424 VAL A CG2 1 
ATOM   1682 N N   . LYS A 1 237 ? 1.216   15.980  8.929   1.00 49.97  ? 425 LYS A N   1 
ATOM   1683 C CA  . LYS A 1 237 ? 1.481   17.101  8.041   1.00 59.80  ? 425 LYS A CA  1 
ATOM   1684 C C   . LYS A 1 237 ? 2.896   16.996  7.511   1.00 69.31  ? 425 LYS A C   1 
ATOM   1685 O O   . LYS A 1 237 ? 3.597   16.033  7.801   1.00 71.95  ? 425 LYS A O   1 
ATOM   1686 C CB  . LYS A 1 237 ? 1.258   18.438  8.751   1.00 62.52  ? 425 LYS A CB  1 
ATOM   1687 C CG  . LYS A 1 237 ? 2.214   18.735  9.890   1.00 67.20  ? 425 LYS A CG  1 
ATOM   1688 C CD  . LYS A 1 237 ? 1.912   20.104  10.485  1.00 71.23  ? 425 LYS A CD  1 
ATOM   1689 C CE  . LYS A 1 237 ? 2.937   20.499  11.537  1.00 76.17  ? 425 LYS A CE  1 
ATOM   1690 N NZ  . LYS A 1 237 ? 2.666   21.856  12.091  1.00 76.95  ? 425 LYS A NZ  1 
ATOM   1691 N N   . THR A 1 238 ? 3.313   17.974  6.719   1.00 73.61  ? 426 THR A N   1 
ATOM   1692 C CA  . THR A 1 238 ? 4.658   17.956  6.171   1.00 78.78  ? 426 THR A CA  1 
ATOM   1693 C C   . THR A 1 238 ? 5.425   19.200  6.579   1.00 83.19  ? 426 THR A C   1 
ATOM   1694 O O   . THR A 1 238 ? 4.993   20.320  6.316   1.00 85.14  ? 426 THR A O   1 
ATOM   1695 C CB  . THR A 1 238 ? 4.651   17.849  4.632   1.00 79.67  ? 426 THR A CB  1 
ATOM   1696 O OG1 . THR A 1 238 ? 3.998   18.994  4.072   1.00 80.66  ? 426 THR A OG1 1 
ATOM   1697 C CG2 . THR A 1 238 ? 3.934   16.581  4.183   1.00 77.78  ? 426 THR A CG2 1 
ATOM   1698 N N   . HIS A 1 239 ? 6.555   18.991  7.243   1.00 84.82  ? 427 HIS A N   1 
ATOM   1699 C CA  . HIS A 1 239 ? 7.493   20.069  7.506   1.00 86.02  ? 427 HIS A CA  1 
ATOM   1700 C C   . HIS A 1 239 ? 8.675   19.892  6.568   1.00 86.22  ? 427 HIS A C   1 
ATOM   1701 O O   . HIS A 1 239 ? 9.462   18.955  6.720   1.00 87.01  ? 427 HIS A O   1 
ATOM   1702 C CB  . HIS A 1 239 ? 7.950   20.062  8.965   1.00 89.32  ? 427 HIS A CB  1 
ATOM   1703 C CG  . HIS A 1 239 ? 8.693   21.296  9.369   1.00 93.14  ? 427 HIS A CG  1 
ATOM   1704 N ND1 . HIS A 1 239 ? 9.679   21.291  10.333  1.00 94.83  ? 427 HIS A ND1 1 
ATOM   1705 C CD2 . HIS A 1 239 ? 8.591   22.577  8.943   1.00 94.32  ? 427 HIS A CD2 1 
ATOM   1706 C CE1 . HIS A 1 239 ? 10.155  22.515  10.479  1.00 95.61  ? 427 HIS A CE1 1 
ATOM   1707 N NE2 . HIS A 1 239 ? 9.511   23.314  9.648   1.00 95.25  ? 427 HIS A NE2 1 
ATOM   1708 N N   . GLY A 1 240 ? 8.793   20.791  5.596   1.00 89.28  ? 428 GLY A N   1 
ATOM   1709 C CA  . GLY A 1 240 ? 9.782   20.640  4.545   1.00 90.03  ? 428 GLY A CA  1 
ATOM   1710 C C   . GLY A 1 240 ? 9.549   19.356  3.771   1.00 88.64  ? 428 GLY A C   1 
ATOM   1711 O O   . GLY A 1 240 ? 8.450   19.113  3.268   1.00 87.25  ? 428 GLY A O   1 
ATOM   1712 N N   . ALA A 1 241 ? 10.587  18.530  3.683   1.00 85.61  ? 429 ALA A N   1 
ATOM   1713 C CA  . ALA A 1 241 ? 10.499  17.240  3.006   1.00 86.01  ? 429 ALA A CA  1 
ATOM   1714 C C   . ALA A 1 241 ? 10.111  16.115  3.969   1.00 84.50  ? 429 ALA A C   1 
ATOM   1715 O O   . ALA A 1 241 ? 10.076  14.946  3.582   1.00 85.12  ? 429 ALA A O   1 
ATOM   1716 C CB  . ALA A 1 241 ? 11.818  16.914  2.319   1.00 88.86  ? 429 ALA A CB  1 
ATOM   1717 N N   . ARG A 1 242 ? 9.829   16.469  5.221   1.00 82.60  ? 430 ARG A N   1 
ATOM   1718 C CA  . ARG A 1 242 ? 9.607   15.473  6.269   1.00 80.03  ? 430 ARG A CA  1 
ATOM   1719 C C   . ARG A 1 242 ? 8.143   15.318  6.671   1.00 78.19  ? 430 ARG A C   1 
ATOM   1720 O O   . ARG A 1 242 ? 7.367   16.271  6.631   1.00 77.25  ? 430 ARG A O   1 
ATOM   1721 C CB  . ARG A 1 242 ? 10.435  15.823  7.506   1.00 82.23  ? 430 ARG A CB  1 
ATOM   1722 C CG  . ARG A 1 242 ? 11.888  15.399  7.423   1.00 91.14  ? 430 ARG A CG  1 
ATOM   1723 C CD  . ARG A 1 242 ? 12.078  13.990  7.958   1.00 95.65  ? 430 ARG A CD  1 
ATOM   1724 N NE  . ARG A 1 242 ? 13.261  13.903  8.809   1.00 100.49 ? 430 ARG A NE  1 
ATOM   1725 C CZ  . ARG A 1 242 ? 13.305  14.334  10.065  1.00 102.40 ? 430 ARG A CZ  1 
ATOM   1726 N NH1 . ARG A 1 242 ? 12.230  14.883  10.617  1.00 101.96 ? 430 ARG A NH1 1 
ATOM   1727 N NH2 . ARG A 1 242 ? 14.422  14.219  10.770  1.00 104.47 ? 430 ARG A NH2 1 
ATOM   1728 N N   . THR A 1 243 ? 7.777   14.100  7.055   1.00 75.21  ? 431 THR A N   1 
ATOM   1729 C CA  . THR A 1 243 ? 6.442   13.818  7.563   1.00 71.19  ? 431 THR A CA  1 
ATOM   1730 C C   . THR A 1 243 ? 6.400   13.991  9.080   1.00 67.68  ? 431 THR A C   1 
ATOM   1731 O O   . THR A 1 243 ? 7.095   13.291  9.813   1.00 70.24  ? 431 THR A O   1 
ATOM   1732 C CB  . THR A 1 243 ? 5.992   12.391  7.196   1.00 72.81  ? 431 THR A CB  1 
ATOM   1733 O OG1 . THR A 1 243 ? 6.071   12.213  5.775   1.00 75.36  ? 431 THR A OG1 1 
ATOM   1734 C CG2 . THR A 1 243 ? 4.562   12.142  7.658   1.00 69.57  ? 431 THR A CG2 1 
ATOM   1735 N N   . LYS A 1 244 ? 5.589   14.937  9.541   1.00 65.48  ? 432 LYS A N   1 
ATOM   1736 C CA  . LYS A 1 244 ? 5.441   15.207  10.965  1.00 62.63  ? 432 LYS A CA  1 
ATOM   1737 C C   . LYS A 1 244 ? 4.133   14.623  11.504  1.00 55.53  ? 432 LYS A C   1 
ATOM   1738 O O   . LYS A 1 244 ? 3.049   14.894  10.969  1.00 52.69  ? 432 LYS A O   1 
ATOM   1739 C CB  . LYS A 1 244 ? 5.494   16.714  11.231  1.00 68.38  ? 432 LYS A CB  1 
ATOM   1740 C CG  . LYS A 1 244 ? 5.982   17.083  12.624  1.00 74.21  ? 432 LYS A CG  1 
ATOM   1741 C CD  . LYS A 1 244 ? 7.480   17.354  12.625  1.00 82.57  ? 432 LYS A CD  1 
ATOM   1742 C CE  . LYS A 1 244 ? 8.084   17.178  14.012  1.00 87.66  ? 432 LYS A CE  1 
ATOM   1743 N NZ  . LYS A 1 244 ? 8.156   15.741  14.405  1.00 89.59  ? 432 LYS A NZ  1 
ATOM   1744 N N   . TYR A 1 245 ? 4.254   13.819  12.560  1.00 51.62  ? 433 TYR A N   1 
ATOM   1745 C CA  . TYR A 1 245 ? 3.112   13.191  13.220  1.00 47.96  ? 433 TYR A CA  1 
ATOM   1746 C C   . TYR A 1 245 ? 2.819   13.852  14.561  1.00 45.30  ? 433 TYR A C   1 
ATOM   1747 O O   . TYR A 1 245 ? 3.713   14.014  15.391  1.00 47.58  ? 433 TYR A O   1 
ATOM   1748 C CB  . TYR A 1 245 ? 3.364   11.696  13.437  1.00 52.35  ? 433 TYR A CB  1 
ATOM   1749 C CG  . TYR A 1 245 ? 3.417   10.878  12.167  1.00 55.77  ? 433 TYR A CG  1 
ATOM   1750 C CD1 . TYR A 1 245 ? 2.258   10.363  11.605  1.00 56.50  ? 433 TYR A CD1 1 
ATOM   1751 C CD2 . TYR A 1 245 ? 4.624   10.614  11.537  1.00 60.21  ? 433 TYR A CD2 1 
ATOM   1752 C CE1 . TYR A 1 245 ? 2.299   9.612   10.448  1.00 58.93  ? 433 TYR A CE1 1 
ATOM   1753 C CE2 . TYR A 1 245 ? 4.673   9.864   10.377  1.00 64.18  ? 433 TYR A CE2 1 
ATOM   1754 C CZ  . TYR A 1 245 ? 3.506   9.368   9.837   1.00 64.37  ? 433 TYR A CZ  1 
ATOM   1755 O OH  . TYR A 1 245 ? 3.545   8.622   8.683   1.00 68.17  ? 433 TYR A OH  1 
ATOM   1756 N N   . LEU A 1 246 ? 1.560   14.218  14.770  1.00 41.37  ? 434 LEU A N   1 
ATOM   1757 C CA  . LEU A 1 246 ? 1.135   14.875  16.001  1.00 41.15  ? 434 LEU A CA  1 
ATOM   1758 C C   . LEU A 1 246 ? 1.329   13.993  17.236  1.00 43.33  ? 434 LEU A C   1 
ATOM   1759 O O   . LEU A 1 246 ? 1.699   14.483  18.305  1.00 45.69  ? 434 LEU A O   1 
ATOM   1760 C CB  . LEU A 1 246 ? -0.327  15.293  15.891  1.00 38.26  ? 434 LEU A CB  1 
ATOM   1761 C CG  . LEU A 1 246 ? -0.861  16.111  17.061  1.00 37.08  ? 434 LEU A CG  1 
ATOM   1762 C CD1 . LEU A 1 246 ? -0.073  17.403  17.194  1.00 35.04  ? 434 LEU A CD1 1 
ATOM   1763 C CD2 . LEU A 1 246 ? -2.335  16.396  16.859  1.00 33.58  ? 434 LEU A CD2 1 
ATOM   1764 N N   . LYS A 1 247 ? 1.089   12.694  17.079  1.00 41.03  ? 435 LYS A N   1 
ATOM   1765 C CA  . LYS A 1 247 ? 1.258   11.731  18.164  1.00 42.75  ? 435 LYS A CA  1 
ATOM   1766 C C   . LYS A 1 247 ? 2.690   11.721  18.713  1.00 49.92  ? 435 LYS A C   1 
ATOM   1767 O O   . LYS A 1 247 ? 2.922   11.321  19.853  1.00 55.25  ? 435 LYS A O   1 
ATOM   1768 C CB  . LYS A 1 247 ? 0.878   10.324  17.690  1.00 43.64  ? 435 LYS A CB  1 
ATOM   1769 C CG  . LYS A 1 247 ? 1.835   9.745   16.650  1.00 47.50  ? 435 LYS A CG  1 
ATOM   1770 C CD  . LYS A 1 247 ? 1.415   8.354   16.192  1.00 47.56  ? 435 LYS A CD  1 
ATOM   1771 C CE  . LYS A 1 247 ? 2.386   7.808   15.152  1.00 47.04  ? 435 LYS A CE  1 
ATOM   1772 N NZ  . LYS A 1 247 ? 2.020   6.439   14.688  1.00 45.81  ? 435 LYS A NZ  1 
ATOM   1773 N N   . ASP A 1 248 ? 3.646   12.168  17.902  1.00 47.82  ? 436 ASP A N   1 
ATOM   1774 C CA  . ASP A 1 248 ? 5.047   12.202  18.318  1.00 46.89  ? 436 ASP A CA  1 
ATOM   1775 C C   . ASP A 1 248 ? 5.366   13.400  19.211  1.00 46.45  ? 436 ASP A C   1 
ATOM   1776 O O   . ASP A 1 248 ? 6.477   13.501  19.737  1.00 43.96  ? 436 ASP A O   1 
ATOM   1777 C CB  . ASP A 1 248 ? 5.974   12.222  17.098  1.00 50.17  ? 436 ASP A CB  1 
ATOM   1778 C CG  . ASP A 1 248 ? 5.900   10.946  16.283  1.00 60.33  ? 436 ASP A CG  1 
ATOM   1779 O OD1 . ASP A 1 248 ? 5.617   9.875   16.862  1.00 62.07  ? 436 ASP A OD1 1 
ATOM   1780 O OD2 . ASP A 1 248 ? 6.130   11.015  15.058  1.00 66.28  ? 436 ASP A OD2 1 
ATOM   1781 N N   . LEU A 1 249 ? 4.404   14.309  19.369  1.00 45.97  ? 437 LEU A N   1 
ATOM   1782 C CA  . LEU A 1 249 ? 4.646   15.552  20.104  1.00 45.86  ? 437 LEU A CA  1 
ATOM   1783 C C   . LEU A 1 249 ? 5.084   15.312  21.550  1.00 41.77  ? 437 LEU A C   1 
ATOM   1784 O O   . LEU A 1 249 ? 6.081   15.881  22.004  1.00 42.06  ? 437 LEU A O   1 
ATOM   1785 C CB  . LEU A 1 249 ? 3.399   16.438  20.084  1.00 47.53  ? 437 LEU A CB  1 
ATOM   1786 C CG  . LEU A 1 249 ? 3.549   17.809  20.748  1.00 51.09  ? 437 LEU A CG  1 
ATOM   1787 C CD1 . LEU A 1 249 ? 4.678   18.597  20.099  1.00 51.79  ? 437 LEU A CD1 1 
ATOM   1788 C CD2 . LEU A 1 249 ? 2.242   18.589  20.691  1.00 50.25  ? 437 LEU A CD2 1 
ATOM   1789 N N   . VAL A 1 250 ? 4.357   14.448  22.252  1.00 39.03  ? 438 VAL A N   1 
ATOM   1790 C CA  . VAL A 1 250 ? 4.597   14.212  23.672  1.00 45.73  ? 438 VAL A CA  1 
ATOM   1791 C C   . VAL A 1 250 ? 6.053   13.826  23.925  1.00 51.67  ? 438 VAL A C   1 
ATOM   1792 O O   . VAL A 1 250 ? 6.773   14.533  24.641  1.00 54.92  ? 438 VAL A O   1 
ATOM   1793 C CB  . VAL A 1 250 ? 3.664   13.107  24.216  1.00 47.21  ? 438 VAL A CB  1 
ATOM   1794 C CG1 . VAL A 1 250 ? 4.039   12.733  25.640  1.00 48.23  ? 438 VAL A CG1 1 
ATOM   1795 C CG2 . VAL A 1 250 ? 2.210   13.561  24.142  1.00 44.71  ? 438 VAL A CG2 1 
ATOM   1796 N N   . GLU A 1 251 ? 6.490   12.746  23.281  1.00 53.03  ? 439 GLU A N   1 
ATOM   1797 C CA  . GLU A 1 251 ? 7.884   12.321  23.328  1.00 57.60  ? 439 GLU A CA  1 
ATOM   1798 C C   . GLU A 1 251 ? 8.809   13.491  23.030  1.00 54.11  ? 439 GLU A C   1 
ATOM   1799 O O   . GLU A 1 251 ? 9.752   13.755  23.780  1.00 54.79  ? 439 GLU A O   1 
ATOM   1800 C CB  . GLU A 1 251 ? 8.140   11.190  22.328  1.00 65.33  ? 439 GLU A CB  1 
ATOM   1801 C CG  . GLU A 1 251 ? 7.542   9.852   22.720  1.00 73.28  ? 439 GLU A CG  1 
ATOM   1802 C CD  . GLU A 1 251 ? 8.410   9.091   23.704  1.00 82.50  ? 439 GLU A CD  1 
ATOM   1803 O OE1 . GLU A 1 251 ? 9.541   9.547   23.983  1.00 83.46  ? 439 GLU A OE1 1 
ATOM   1804 O OE2 . GLU A 1 251 ? 7.962   8.033   24.196  1.00 87.90  ? 439 GLU A OE2 1 
ATOM   1805 N N   . GLU A 1 252 ? 8.504   14.215  21.956  1.00 50.13  ? 440 GLU A N   1 
ATOM   1806 C CA  . GLU A 1 252 ? 9.378   15.288  21.505  1.00 58.51  ? 440 GLU A CA  1 
ATOM   1807 C C   . GLU A 1 252 ? 9.501   16.363  22.574  1.00 54.88  ? 440 GLU A C   1 
ATOM   1808 O O   . GLU A 1 252 ? 10.559  16.972  22.727  1.00 54.14  ? 440 GLU A O   1 
ATOM   1809 C CB  . GLU A 1 252 ? 8.871   15.884  20.190  1.00 67.95  ? 440 GLU A CB  1 
ATOM   1810 C CG  . GLU A 1 252 ? 9.176   15.013  18.979  1.00 81.86  ? 440 GLU A CG  1 
ATOM   1811 C CD  . GLU A 1 252 ? 8.623   15.579  17.684  1.00 92.51  ? 440 GLU A CD  1 
ATOM   1812 O OE1 . GLU A 1 252 ? 8.009   16.668  17.721  1.00 95.88  ? 440 GLU A OE1 1 
ATOM   1813 O OE2 . GLU A 1 252 ? 8.803   14.933  16.628  1.00 96.15  ? 440 GLU A OE2 1 
ATOM   1814 N N   . GLU A 1 253 ? 8.431   16.580  23.332  1.00 57.46  ? 441 GLU A N   1 
ATOM   1815 C CA  . GLU A 1 253 ? 8.503   17.552  24.411  1.00 54.28  ? 441 GLU A CA  1 
ATOM   1816 C C   . GLU A 1 253 ? 9.214   16.933  25.604  1.00 50.30  ? 441 GLU A C   1 
ATOM   1817 O O   . GLU A 1 253 ? 10.015  17.593  26.269  1.00 47.40  ? 441 GLU A O   1 
ATOM   1818 C CB  . GLU A 1 253 ? 7.111   18.051  24.799  1.00 52.32  ? 441 GLU A CB  1 
ATOM   1819 C CG  . GLU A 1 253 ? 6.531   19.058  23.813  1.00 55.69  ? 441 GLU A CG  1 
ATOM   1820 C CD  . GLU A 1 253 ? 7.343   20.344  23.735  1.00 61.53  ? 441 GLU A CD  1 
ATOM   1821 O OE1 . GLU A 1 253 ? 8.008   20.695  24.734  1.00 66.73  ? 441 GLU A OE1 1 
ATOM   1822 O OE2 . GLU A 1 253 ? 7.319   21.004  22.673  1.00 60.18  ? 441 GLU A OE2 1 
ATOM   1823 N N   . ALA A 1 254 ? 8.936   15.655  25.850  1.00 50.18  ? 442 ALA A N   1 
ATOM   1824 C CA  . ALA A 1 254 ? 9.529   14.947  26.976  1.00 56.36  ? 442 ALA A CA  1 
ATOM   1825 C C   . ALA A 1 254 ? 11.052  15.024  26.910  1.00 63.19  ? 442 ALA A C   1 
ATOM   1826 O O   . ALA A 1 254 ? 11.709  15.435  27.870  1.00 66.48  ? 442 ALA A O   1 
ATOM   1827 C CB  . ALA A 1 254 ? 9.065   13.498  26.998  1.00 55.02  ? 442 ALA A CB  1 
ATOM   1828 N N   . GLU A 1 255 ? 11.605  14.663  25.758  1.00 59.43  ? 443 GLU A N   1 
ATOM   1829 C CA  . GLU A 1 255 ? 13.047  14.679  25.584  1.00 68.60  ? 443 GLU A CA  1 
ATOM   1830 C C   . GLU A 1 255 ? 13.603  16.100  25.661  1.00 69.87  ? 443 GLU A C   1 
ATOM   1831 O O   . GLU A 1 255 ? 14.780  16.287  25.968  1.00 74.34  ? 443 GLU A O   1 
ATOM   1832 C CB  . GLU A 1 255 ? 13.441  14.017  24.261  1.00 75.39  ? 443 GLU A CB  1 
ATOM   1833 C CG  . GLU A 1 255 ? 13.708  14.977  23.118  1.00 84.85  ? 443 GLU A CG  1 
ATOM   1834 C CD  . GLU A 1 255 ? 14.490  14.325  21.995  1.00 94.26  ? 443 GLU A CD  1 
ATOM   1835 O OE1 . GLU A 1 255 ? 14.108  14.504  20.819  1.00 96.87  ? 443 GLU A OE1 1 
ATOM   1836 O OE2 . GLU A 1 255 ? 15.489  13.632  22.291  1.00 97.27  ? 443 GLU A OE2 1 
ATOM   1837 N N   . GLU A 1 256 ? 12.767  17.103  25.400  1.00 64.53  ? 444 GLU A N   1 
ATOM   1838 C CA  . GLU A 1 256 ? 13.236  18.474  25.546  1.00 67.62  ? 444 GLU A CA  1 
ATOM   1839 C C   . GLU A 1 256 ? 13.247  18.857  27.022  1.00 66.78  ? 444 GLU A C   1 
ATOM   1840 O O   . GLU A 1 256 ? 14.089  19.636  27.466  1.00 64.52  ? 444 GLU A O   1 
ATOM   1841 C CB  . GLU A 1 256 ? 12.375  19.451  24.745  1.00 71.78  ? 444 GLU A CB  1 
ATOM   1842 C CG  . GLU A 1 256 ? 12.876  20.890  24.818  1.00 79.82  ? 444 GLU A CG  1 
ATOM   1843 C CD  . GLU A 1 256 ? 12.105  21.838  23.919  1.00 85.11  ? 444 GLU A CD  1 
ATOM   1844 O OE1 . GLU A 1 256 ? 11.765  22.950  24.381  1.00 86.80  ? 444 GLU A OE1 1 
ATOM   1845 O OE2 . GLU A 1 256 ? 11.849  21.478  22.750  1.00 87.47  ? 444 GLU A OE2 1 
ATOM   1846 N N   . ALA A 1 257 ? 12.318  18.286  27.783  1.00 68.36  ? 445 ALA A N   1 
ATOM   1847 C CA  . ALA A 1 257 ? 12.200  18.602  29.201  1.00 67.76  ? 445 ALA A CA  1 
ATOM   1848 C C   . ALA A 1 257 ? 13.107  17.715  30.048  1.00 71.18  ? 445 ALA A C   1 
ATOM   1849 O O   . ALA A 1 257 ? 13.289  17.958  31.241  1.00 71.81  ? 445 ALA A O   1 
ATOM   1850 C CB  . ALA A 1 257 ? 10.756  18.464  29.653  1.00 62.80  ? 445 ALA A CB  1 
ATOM   1851 N N   . GLY A 1 258 ? 13.674  16.686  29.427  1.00 72.75  ? 446 GLY A N   1 
ATOM   1852 C CA  . GLY A 1 258 ? 14.552  15.766  30.126  1.00 72.54  ? 446 GLY A CA  1 
ATOM   1853 C C   . GLY A 1 258 ? 13.827  14.851  31.097  1.00 70.29  ? 446 GLY A C   1 
ATOM   1854 O O   . GLY A 1 258 ? 14.355  14.517  32.157  1.00 68.34  ? 446 GLY A O   1 
ATOM   1855 N N   . VAL A 1 259 ? 12.613  14.445  30.738  1.00 68.28  ? 447 VAL A N   1 
ATOM   1856 C CA  . VAL A 1 259 ? 11.853  13.513  31.564  1.00 71.97  ? 447 VAL A CA  1 
ATOM   1857 C C   . VAL A 1 259 ? 11.809  12.133  30.912  1.00 76.55  ? 447 VAL A C   1 
ATOM   1858 O O   . VAL A 1 259 ? 11.802  12.012  29.686  1.00 77.45  ? 447 VAL A O   1 
ATOM   1859 C CB  . VAL A 1 259 ? 10.410  14.018  31.825  1.00 67.27  ? 447 VAL A CB  1 
ATOM   1860 C CG1 . VAL A 1 259 ? 10.432  15.444  32.358  1.00 69.89  ? 447 VAL A CG1 1 
ATOM   1861 C CG2 . VAL A 1 259 ? 9.565   13.930  30.568  1.00 61.33  ? 447 VAL A CG2 1 
ATOM   1862 N N   . ALA A 1 260 ? 11.802  11.093  31.740  1.00 80.85  ? 448 ALA A N   1 
ATOM   1863 C CA  . ALA A 1 260 ? 11.723  9.721   31.247  1.00 81.63  ? 448 ALA A CA  1 
ATOM   1864 C C   . ALA A 1 260 ? 10.275  9.309   31.003  1.00 79.11  ? 448 ALA A C   1 
ATOM   1865 O O   . ALA A 1 260 ? 9.998   8.432   30.185  1.00 80.62  ? 448 ALA A O   1 
ATOM   1866 C CB  . ALA A 1 260 ? 12.389  8.766   32.225  1.00 82.78  ? 448 ALA A CB  1 
ATOM   1867 N N   . ALA A 1 273 ? -0.308  11.188  41.047  1.00 78.87  ? 461 ALA A N   1 
ATOM   1868 C CA  . ALA A 1 273 ? 1.008   10.782  41.528  1.00 81.81  ? 461 ALA A CA  1 
ATOM   1869 C C   . ALA A 1 273 ? 1.740   9.963   40.471  1.00 83.87  ? 461 ALA A C   1 
ATOM   1870 O O   . ALA A 1 273 ? 2.894   10.242  40.143  1.00 83.84  ? 461 ALA A O   1 
ATOM   1871 C CB  . ALA A 1 273 ? 0.880   9.991   42.821  1.00 83.04  ? 461 ALA A CB  1 
ATOM   1872 N N   . ALA A 1 274 ? 1.061   8.951   39.941  1.00 84.46  ? 462 ALA A N   1 
ATOM   1873 C CA  . ALA A 1 274 ? 1.626   8.128   38.880  1.00 85.78  ? 462 ALA A CA  1 
ATOM   1874 C C   . ALA A 1 274 ? 1.600   8.881   37.556  1.00 85.85  ? 462 ALA A C   1 
ATOM   1875 O O   . ALA A 1 274 ? 2.332   8.548   36.626  1.00 87.33  ? 462 ALA A O   1 
ATOM   1876 C CB  . ALA A 1 274 ? 0.868   6.814   38.761  1.00 84.67  ? 462 ALA A CB  1 
ATOM   1877 N N   . ASP A 1 275 ? 0.737   9.888   37.475  1.00 84.40  ? 463 ASP A N   1 
ATOM   1878 C CA  . ASP A 1 275 ? 0.626   10.712  36.277  1.00 76.87  ? 463 ASP A CA  1 
ATOM   1879 C C   . ASP A 1 275 ? 1.440   12.003  36.376  1.00 70.00  ? 463 ASP A C   1 
ATOM   1880 O O   . ASP A 1 275 ? 1.423   12.825  35.458  1.00 68.97  ? 463 ASP A O   1 
ATOM   1881 C CB  . ASP A 1 275 ? -0.841  11.035  35.999  1.00 76.50  ? 463 ASP A CB  1 
ATOM   1882 C CG  . ASP A 1 275 ? -1.677  9.788   35.776  1.00 77.18  ? 463 ASP A CG  1 
ATOM   1883 O OD1 . ASP A 1 275 ? -1.097  8.743   35.404  1.00 77.11  ? 463 ASP A OD1 1 
ATOM   1884 O OD2 . ASP A 1 275 ? -2.911  9.851   35.969  1.00 75.22  ? 463 ASP A OD2 1 
ATOM   1885 N N   . ALA A 1 276 ? 2.146   12.177  37.491  1.00 69.91  ? 464 ALA A N   1 
ATOM   1886 C CA  . ALA A 1 276 ? 2.921   13.392  37.744  1.00 66.50  ? 464 ALA A CA  1 
ATOM   1887 C C   . ALA A 1 276 ? 3.954   13.666  36.652  1.00 62.71  ? 464 ALA A C   1 
ATOM   1888 O O   . ALA A 1 276 ? 4.207   14.822  36.301  1.00 66.12  ? 464 ALA A O   1 
ATOM   1889 C CB  . ALA A 1 276 ? 3.606   13.304  39.102  1.00 66.40  ? 464 ALA A CB  1 
ATOM   1890 N N   . TRP A 1 277 ? 4.530   12.596  36.111  1.00 58.16  ? 465 TRP A N   1 
ATOM   1891 C CA  . TRP A 1 277 ? 5.542   12.689  35.061  1.00 55.91  ? 465 TRP A CA  1 
ATOM   1892 C C   . TRP A 1 277 ? 5.075   13.528  33.873  1.00 57.69  ? 465 TRP A C   1 
ATOM   1893 O O   . TRP A 1 277 ? 5.885   14.136  33.172  1.00 60.69  ? 465 TRP A O   1 
ATOM   1894 C CB  . TRP A 1 277 ? 5.920   11.291  34.568  1.00 56.46  ? 465 TRP A CB  1 
ATOM   1895 C CG  . TRP A 1 277 ? 4.798   10.616  33.831  1.00 60.47  ? 465 TRP A CG  1 
ATOM   1896 C CD1 . TRP A 1 277 ? 3.825   9.828   34.366  1.00 63.82  ? 465 TRP A CD1 1 
ATOM   1897 C CD2 . TRP A 1 277 ? 4.527   10.690  32.425  1.00 63.06  ? 465 TRP A CD2 1 
ATOM   1898 N NE1 . TRP A 1 277 ? 2.967   9.399   33.382  1.00 66.97  ? 465 TRP A NE1 1 
ATOM   1899 C CE2 . TRP A 1 277 ? 3.375   9.916   32.181  1.00 66.44  ? 465 TRP A CE2 1 
ATOM   1900 C CE3 . TRP A 1 277 ? 5.146   11.334  31.349  1.00 63.19  ? 465 TRP A CE3 1 
ATOM   1901 C CZ2 . TRP A 1 277 ? 2.830   9.767   30.905  1.00 64.36  ? 465 TRP A CZ2 1 
ATOM   1902 C CZ3 . TRP A 1 277 ? 4.604   11.186  30.084  1.00 62.59  ? 465 TRP A CZ3 1 
ATOM   1903 C CH2 . TRP A 1 277 ? 3.458   10.408  29.873  1.00 62.74  ? 465 TRP A CH2 1 
ATOM   1904 N N   . ALA A 1 278 ? 3.764   13.545  33.650  1.00 55.26  ? 466 ALA A N   1 
ATOM   1905 C CA  . ALA A 1 278 ? 3.184   14.206  32.491  1.00 54.21  ? 466 ALA A CA  1 
ATOM   1906 C C   . ALA A 1 278 ? 2.977   15.701  32.710  1.00 57.70  ? 466 ALA A C   1 
ATOM   1907 O O   . ALA A 1 278 ? 2.734   16.438  31.755  1.00 58.86  ? 466 ALA A O   1 
ATOM   1908 C CB  . ALA A 1 278 ? 1.864   13.550  32.130  1.00 51.65  ? 466 ALA A CB  1 
ATOM   1909 N N   . ALA A 1 279 ? 3.070   16.144  33.961  1.00 57.63  ? 467 ALA A N   1 
ATOM   1910 C CA  . ALA A 1 279 ? 2.760   17.536  34.293  1.00 56.44  ? 467 ALA A CA  1 
ATOM   1911 C C   . ALA A 1 279 ? 3.590   18.568  33.503  1.00 55.62  ? 467 ALA A C   1 
ATOM   1912 O O   . ALA A 1 279 ? 3.006   19.449  32.867  1.00 53.98  ? 467 ALA A O   1 
ATOM   1913 C CB  . ALA A 1 279 ? 2.914   17.770  35.802  1.00 55.48  ? 467 ALA A CB  1 
ATOM   1914 N N   . PRO A 1 280 ? 4.939   18.471  33.530  1.00 51.15  ? 468 PRO A N   1 
ATOM   1915 C CA  . PRO A 1 280 ? 5.692   19.509  32.810  1.00 52.93  ? 468 PRO A CA  1 
ATOM   1916 C C   . PRO A 1 280 ? 5.415   19.513  31.302  1.00 53.60  ? 468 PRO A C   1 
ATOM   1917 O O   . PRO A 1 280 ? 5.226   20.583  30.712  1.00 57.85  ? 468 PRO A O   1 
ATOM   1918 C CB  . PRO A 1 280 ? 7.156   19.151  33.101  1.00 52.97  ? 468 PRO A CB  1 
ATOM   1919 C CG  . PRO A 1 280 ? 7.140   17.709  33.442  1.00 52.75  ? 468 PRO A CG  1 
ATOM   1920 C CD  . PRO A 1 280 ? 5.838   17.472  34.141  1.00 51.38  ? 468 PRO A CD  1 
ATOM   1921 N N   . ILE A 1 281 ? 5.353   18.327  30.705  1.00 51.72  ? 469 ILE A N   1 
ATOM   1922 C CA  . ILE A 1 281 ? 5.027   18.176  29.291  1.00 47.83  ? 469 ILE A CA  1 
ATOM   1923 C C   . ILE A 1 281 ? 3.731   18.912  28.934  1.00 46.79  ? 469 ILE A C   1 
ATOM   1924 O O   . ILE A 1 281 ? 3.712   19.747  28.021  1.00 46.31  ? 469 ILE A O   1 
ATOM   1925 C CB  . ILE A 1 281 ? 4.902   16.688  28.914  1.00 47.64  ? 469 ILE A CB  1 
ATOM   1926 C CG1 . ILE A 1 281 ? 6.201   15.950  29.258  1.00 52.33  ? 469 ILE A CG1 1 
ATOM   1927 C CG2 . ILE A 1 281 ? 4.554   16.534  27.439  1.00 44.37  ? 469 ILE A CG2 1 
ATOM   1928 C CD1 . ILE A 1 281 ? 6.124   14.446  29.099  1.00 53.09  ? 469 ILE A CD1 1 
ATOM   1929 N N   . ALA A 1 282 ? 2.664   18.619  29.674  1.00 43.71  ? 470 ALA A N   1 
ATOM   1930 C CA  . ALA A 1 282 ? 1.385   19.297  29.482  1.00 45.06  ? 470 ALA A CA  1 
ATOM   1931 C C   . ALA A 1 282 ? 1.577   20.807  29.503  1.00 45.22  ? 470 ALA A C   1 
ATOM   1932 O O   . ALA A 1 282 ? 1.056   21.517  28.630  1.00 40.98  ? 470 ALA A O   1 
ATOM   1933 C CB  . ALA A 1 282 ? 0.378   18.873  30.548  1.00 44.79  ? 470 ALA A CB  1 
ATOM   1934 N N   . MET A 1 283 ? 2.369   21.284  30.467  1.00 43.23  ? 471 MET A N   1 
ATOM   1935 C CA  . MET A 1 283 ? 2.601   22.718  30.607  1.00 40.55  ? 471 MET A CA  1 
ATOM   1936 C C   . MET A 1 283 ? 3.157   23.252  29.295  1.00 43.74  ? 471 MET A C   1 
ATOM   1937 O O   . MET A 1 283 ? 2.639   24.231  28.740  1.00 51.42  ? 471 MET A O   1 
ATOM   1938 C CB  . MET A 1 283 ? 3.548   23.014  31.774  1.00 39.47  ? 471 MET A CB  1 
ATOM   1939 C CG  . MET A 1 283 ? 3.922   24.487  31.937  1.00 44.76  ? 471 MET A CG  1 
ATOM   1940 S SD  . MET A 1 283 ? 2.513   25.595  32.194  1.00 61.96  ? 471 MET A SD  1 
ATOM   1941 C CE  . MET A 1 283 ? 1.885   25.017  33.766  1.00 50.05  ? 471 MET A CE  1 
ATOM   1942 N N   . GLN A 1 284 ? 4.156   22.552  28.764  1.00 40.89  ? 472 GLN A N   1 
ATOM   1943 C CA  . GLN A 1 284 ? 4.755   22.941  27.497  1.00 43.67  ? 472 GLN A CA  1 
ATOM   1944 C C   . GLN A 1 284 ? 3.681   23.025  26.424  1.00 43.98  ? 472 GLN A C   1 
ATOM   1945 O O   . GLN A 1 284 ? 3.570   24.041  25.727  1.00 47.15  ? 472 GLN A O   1 
ATOM   1946 C CB  . GLN A 1 284 ? 5.857   21.961  27.093  1.00 41.15  ? 472 GLN A CB  1 
ATOM   1947 C CG  . GLN A 1 284 ? 7.107   22.114  27.931  1.00 48.98  ? 472 GLN A CG  1 
ATOM   1948 C CD  . GLN A 1 284 ? 7.619   23.538  27.930  1.00 58.27  ? 472 GLN A CD  1 
ATOM   1949 O OE1 . GLN A 1 284 ? 8.187   24.002  26.942  1.00 65.70  ? 472 GLN A OE1 1 
ATOM   1950 N NE2 . GLN A 1 284 ? 7.410   24.245  29.036  1.00 61.28  ? 472 GLN A NE2 1 
ATOM   1951 N N   . ILE A 1 285 ? 2.858   21.983  26.339  1.00 39.78  ? 473 ILE A N   1 
ATOM   1952 C CA  . ILE A 1 285 ? 1.809   21.950  25.332  1.00 41.95  ? 473 ILE A CA  1 
ATOM   1953 C C   . ILE A 1 285 ? 0.975   23.209  25.503  1.00 42.56  ? 473 ILE A C   1 
ATOM   1954 O O   . ILE A 1 285 ? 0.796   23.990  24.555  1.00 43.09  ? 473 ILE A O   1 
ATOM   1955 C CB  . ILE A 1 285 ? 0.943   20.683  25.454  1.00 41.87  ? 473 ILE A CB  1 
ATOM   1956 C CG1 . ILE A 1 285 ? 1.793   19.443  25.171  1.00 43.75  ? 473 ILE A CG1 1 
ATOM   1957 C CG2 . ILE A 1 285 ? -0.250  20.743  24.505  1.00 41.78  ? 473 ILE A CG2 1 
ATOM   1958 C CD1 . ILE A 1 285 ? 1.055   18.129  25.345  1.00 41.49  ? 473 ILE A CD1 1 
ATOM   1959 N N   . TYR A 1 286 ? 0.581   23.458  26.749  1.00 43.14  ? 474 TYR A N   1 
ATOM   1960 C CA  . TYR A 1 286 ? -0.320  24.556  27.045  1.00 43.57  ? 474 TYR A CA  1 
ATOM   1961 C C   . TYR A 1 286 ? 0.327   25.878  26.661  1.00 45.41  ? 474 TYR A C   1 
ATOM   1962 O O   . TYR A 1 286 ? -0.342  26.788  26.170  1.00 46.48  ? 474 TYR A O   1 
ATOM   1963 C CB  . TYR A 1 286 ? -0.699  24.549  28.524  1.00 43.74  ? 474 TYR A CB  1 
ATOM   1964 C CG  . TYR A 1 286 ? -1.535  25.731  28.940  1.00 43.75  ? 474 TYR A CG  1 
ATOM   1965 C CD1 . TYR A 1 286 ? -2.898  25.763  28.682  1.00 42.12  ? 474 TYR A CD1 1 
ATOM   1966 C CD2 . TYR A 1 286 ? -0.963  26.817  29.588  1.00 46.17  ? 474 TYR A CD2 1 
ATOM   1967 C CE1 . TYR A 1 286 ? -3.670  26.845  29.058  1.00 46.41  ? 474 TYR A CE1 1 
ATOM   1968 C CE2 . TYR A 1 286 ? -1.727  27.904  29.971  1.00 50.07  ? 474 TYR A CE2 1 
ATOM   1969 C CZ  . TYR A 1 286 ? -3.080  27.913  29.703  1.00 51.40  ? 474 TYR A CZ  1 
ATOM   1970 O OH  . TYR A 1 286 ? -3.844  28.992  30.082  1.00 55.67  ? 474 TYR A OH  1 
ATOM   1971 N N   . LYS A 1 287 ? 1.638   25.973  26.848  1.00 40.81  ? 475 LYS A N   1 
ATOM   1972 C CA  . LYS A 1 287 ? 2.309   27.238  26.587  1.00 45.93  ? 475 LYS A CA  1 
ATOM   1973 C C   . LYS A 1 287 ? 2.551   27.451  25.104  1.00 44.05  ? 475 LYS A C   1 
ATOM   1974 O O   . LYS A 1 287 ? 2.698   28.584  24.650  1.00 44.89  ? 475 LYS A O   1 
ATOM   1975 C CB  . LYS A 1 287 ? 3.632   27.313  27.351  1.00 49.58  ? 475 LYS A CB  1 
ATOM   1976 C CG  . LYS A 1 287 ? 3.457   27.584  28.836  1.00 57.81  ? 475 LYS A CG  1 
ATOM   1977 C CD  . LYS A 1 287 ? 2.591   28.819  29.063  1.00 64.73  ? 475 LYS A CD  1 
ATOM   1978 C CE  . LYS A 1 287 ? 2.481   29.160  30.543  1.00 72.74  ? 475 LYS A CE  1 
ATOM   1979 N NZ  . LYS A 1 287 ? 1.733   30.430  30.774  1.00 76.11  ? 475 LYS A NZ  1 
ATOM   1980 N N   . LYS A 1 288 ? 2.576   26.366  24.341  1.00 46.26  ? 476 LYS A N   1 
ATOM   1981 C CA  . LYS A 1 288 ? 3.153   26.454  23.006  1.00 44.99  ? 476 LYS A CA  1 
ATOM   1982 C C   . LYS A 1 288 ? 2.176   26.065  21.912  1.00 44.27  ? 476 LYS A C   1 
ATOM   1983 O O   . LYS A 1 288 ? 1.921   26.839  20.994  1.00 50.47  ? 476 LYS A O   1 
ATOM   1984 C CB  . LYS A 1 288 ? 4.432   25.621  22.923  1.00 45.63  ? 476 LYS A CB  1 
ATOM   1985 C CG  . LYS A 1 288 ? 5.588   26.268  23.682  1.00 49.46  ? 476 LYS A CG  1 
ATOM   1986 C CD  . LYS A 1 288 ? 6.928   25.616  23.380  1.00 56.46  ? 476 LYS A CD  1 
ATOM   1987 C CE  . LYS A 1 288 ? 7.010   24.214  23.958  1.00 61.86  ? 476 LYS A CE  1 
ATOM   1988 N NZ  . LYS A 1 288 ? 8.351   23.599  23.741  1.00 66.99  ? 476 LYS A NZ  1 
ATOM   1989 N N   . HIS A 1 289 ? 1.691   24.836  21.984  1.00 41.98  ? 477 HIS A N   1 
ATOM   1990 C CA  . HIS A 1 289 ? 1.022   24.190  20.865  1.00 42.07  ? 477 HIS A CA  1 
ATOM   1991 C C   . HIS A 1 289 ? -0.501  24.351  20.750  1.00 40.34  ? 477 HIS A C   1 
ATOM   1992 O O   . HIS A 1 289 ? -1.103  23.715  19.891  1.00 42.52  ? 477 HIS A O   1 
ATOM   1993 C CB  . HIS A 1 289 ? 1.378   22.705  20.900  1.00 44.59  ? 477 HIS A CB  1 
ATOM   1994 C CG  . HIS A 1 289 ? 2.849   22.454  21.013  1.00 48.01  ? 477 HIS A CG  1 
ATOM   1995 N ND1 . HIS A 1 289 ? 3.738   22.786  20.012  1.00 48.27  ? 477 HIS A ND1 1 
ATOM   1996 C CD2 . HIS A 1 289 ? 3.591   21.926  22.015  1.00 50.95  ? 477 HIS A CD2 1 
ATOM   1997 C CE1 . HIS A 1 289 ? 4.962   22.463  20.389  1.00 51.66  ? 477 HIS A CE1 1 
ATOM   1998 N NE2 . HIS A 1 289 ? 4.901   21.940  21.600  1.00 52.49  ? 477 HIS A NE2 1 
ATOM   1999 N N   . LEU A 1 290 ? -1.136  25.161  21.597  1.00 36.36  ? 478 LEU A N   1 
ATOM   2000 C CA  . LEU A 1 290 ? -2.600  25.289  21.528  1.00 33.24  ? 478 LEU A CA  1 
ATOM   2001 C C   . LEU A 1 290 ? -3.112  26.052  20.295  1.00 34.89  ? 478 LEU A C   1 
ATOM   2002 O O   . LEU A 1 290 ? -2.423  26.898  19.723  1.00 38.00  ? 478 LEU A O   1 
ATOM   2003 C CB  . LEU A 1 290 ? -3.153  25.961  22.791  1.00 35.68  ? 478 LEU A CB  1 
ATOM   2004 C CG  . LEU A 1 290 ? -3.006  25.210  24.119  1.00 39.97  ? 478 LEU A CG  1 
ATOM   2005 C CD1 . LEU A 1 290 ? -3.987  25.745  25.148  1.00 38.84  ? 478 LEU A CD1 1 
ATOM   2006 C CD2 . LEU A 1 290 ? -3.174  23.707  23.948  1.00 35.25  ? 478 LEU A CD2 1 
ATOM   2007 N N   . ASP A 1 291 ? -4.339  25.725  19.901  1.00 31.92  ? 479 ASP A N   1 
ATOM   2008 C CA  . ASP A 1 291 ? -5.044  26.384  18.803  1.00 35.29  ? 479 ASP A CA  1 
ATOM   2009 C C   . ASP A 1 291 ? -5.394  27.831  19.172  1.00 33.40  ? 479 ASP A C   1 
ATOM   2010 O O   . ASP A 1 291 ? -6.039  28.065  20.191  1.00 34.25  ? 479 ASP A O   1 
ATOM   2011 C CB  . ASP A 1 291 ? -6.318  25.590  18.466  1.00 35.79  ? 479 ASP A CB  1 
ATOM   2012 C CG  . ASP A 1 291 ? -6.986  26.039  17.171  1.00 37.61  ? 479 ASP A CG  1 
ATOM   2013 O OD1 . ASP A 1 291 ? -6.652  27.118  16.639  1.00 37.07  ? 479 ASP A OD1 1 
ATOM   2014 O OD2 . ASP A 1 291 ? -7.871  25.302  16.686  1.00 35.67  ? 479 ASP A OD2 1 
ATOM   2015 N N   . PRO A 1 292 ? -4.942  28.803  18.358  1.00 33.07  ? 480 PRO A N   1 
ATOM   2016 C CA  . PRO A 1 292 ? -5.259  30.226  18.542  1.00 36.59  ? 480 PRO A CA  1 
ATOM   2017 C C   . PRO A 1 292 ? -6.713  30.587  18.210  1.00 36.12  ? 480 PRO A C   1 
ATOM   2018 O O   . PRO A 1 292 ? -7.236  31.564  18.744  1.00 31.69  ? 480 PRO A O   1 
ATOM   2019 C CB  . PRO A 1 292 ? -4.300  30.923  17.572  1.00 36.21  ? 480 PRO A CB  1 
ATOM   2020 C CG  . PRO A 1 292 ? -4.112  29.926  16.482  1.00 34.41  ? 480 PRO A CG  1 
ATOM   2021 C CD  . PRO A 1 292 ? -4.067  28.593  17.191  1.00 38.03  ? 480 PRO A CD  1 
ATOM   2022 N N   . ARG A 1 293 ? -7.343  29.820  17.325  1.00 33.63  ? 481 ARG A N   1 
ATOM   2023 C CA  . ARG A 1 293 ? -8.690  30.154  16.842  1.00 37.20  ? 481 ARG A CA  1 
ATOM   2024 C C   . ARG A 1 293 ? -9.778  30.245  17.934  1.00 35.21  ? 481 ARG A C   1 
ATOM   2025 O O   . ARG A 1 293 ? -10.556 31.193  17.925  1.00 35.68  ? 481 ARG A O   1 
ATOM   2026 C CB  . ARG A 1 293 ? -9.112  29.166  15.746  1.00 32.74  ? 481 ARG A CB  1 
ATOM   2027 C CG  . ARG A 1 293 ? -8.574  29.562  14.369  1.00 40.68  ? 481 ARG A CG  1 
ATOM   2028 C CD  . ARG A 1 293 ? -8.688  28.450  13.336  1.00 45.12  ? 481 ARG A CD  1 
ATOM   2029 N NE  . ARG A 1 293 ? -7.749  27.363  13.600  1.00 54.22  ? 481 ARG A NE  1 
ATOM   2030 C CZ  . ARG A 1 293 ? -7.460  26.395  12.734  1.00 61.68  ? 481 ARG A CZ  1 
ATOM   2031 N NH1 . ARG A 1 293 ? -8.033  26.380  11.538  1.00 64.45  ? 481 ARG A NH1 1 
ATOM   2032 N NH2 . ARG A 1 293 ? -6.595  25.444  13.060  1.00 62.82  ? 481 ARG A NH2 1 
ATOM   2033 N N   . PRO A 1 294 ? -9.841  29.278  18.873  1.00 32.78  ? 482 PRO A N   1 
ATOM   2034 C CA  . PRO A 1 294 ? -10.809 29.409  19.974  1.00 30.16  ? 482 PRO A CA  1 
ATOM   2035 C C   . PRO A 1 294 ? -10.469 30.528  20.960  1.00 35.15  ? 482 PRO A C   1 
ATOM   2036 O O   . PRO A 1 294 ? -11.282 30.836  21.824  1.00 36.58  ? 482 PRO A O   1 
ATOM   2037 C CB  . PRO A 1 294 ? -10.750 28.045  20.658  1.00 30.76  ? 482 PRO A CB  1 
ATOM   2038 C CG  . PRO A 1 294 ? -9.389  27.554  20.375  1.00 31.25  ? 482 PRO A CG  1 
ATOM   2039 C CD  . PRO A 1 294 ? -9.045  28.045  19.006  1.00 31.34  ? 482 PRO A CD  1 
ATOM   2040 N N   . GLY A 1 295 ? -9.254  31.059  20.893  1.00 37.70  ? 483 GLY A N   1 
ATOM   2041 C CA  . GLY A 1 295 ? -8.833  32.104  21.810  1.00 31.26  ? 483 GLY A CA  1 
ATOM   2042 C C   . GLY A 1 295 ? -8.088  31.494  22.981  1.00 31.26  ? 483 GLY A C   1 
ATOM   2043 O O   . GLY A 1 295 ? -7.888  30.283  23.012  1.00 30.45  ? 483 GLY A O   1 
ATOM   2044 N N   . PRO A 1 296 ? -7.667  32.327  23.945  1.00 34.24  ? 484 PRO A N   1 
ATOM   2045 C CA  . PRO A 1 296 ? -6.950  31.840  25.128  1.00 39.29  ? 484 PRO A CA  1 
ATOM   2046 C C   . PRO A 1 296 ? -7.727  30.756  25.859  1.00 41.56  ? 484 PRO A C   1 
ATOM   2047 O O   . PRO A 1 296 ? -8.948  30.840  25.998  1.00 41.14  ? 484 PRO A O   1 
ATOM   2048 C CB  . PRO A 1 296 ? -6.795  33.096  26.001  1.00 38.52  ? 484 PRO A CB  1 
ATOM   2049 C CG  . PRO A 1 296 ? -7.726  34.114  25.405  1.00 37.62  ? 484 PRO A CG  1 
ATOM   2050 C CD  . PRO A 1 296 ? -7.804  33.791  23.953  1.00 33.49  ? 484 PRO A CD  1 
ATOM   2051 N N   . CYS A 1 297 ? -7.005  29.734  26.300  1.00 41.55  ? 485 CYS A N   1 
ATOM   2052 C CA  . CYS A 1 297 ? -7.596  28.578  26.952  1.00 39.42  ? 485 CYS A CA  1 
ATOM   2053 C C   . CYS A 1 297 ? -7.445  28.679  28.466  1.00 43.86  ? 485 CYS A C   1 
ATOM   2054 O O   . CYS A 1 297 ? -6.344  28.922  28.958  1.00 47.98  ? 485 CYS A O   1 
ATOM   2055 C CB  . CYS A 1 297 ? -6.936  27.299  26.430  1.00 40.15  ? 485 CYS A CB  1 
ATOM   2056 S SG  . CYS A 1 297 ? -7.620  25.746  27.048  1.00 43.37  ? 485 CYS A SG  1 
ATOM   2057 N N   . PRO A 1 298 ? -8.554  28.511  29.207  1.00 49.79  ? 486 PRO A N   1 
ATOM   2058 C CA  . PRO A 1 298 ? -8.471  28.487  30.672  1.00 50.01  ? 486 PRO A CA  1 
ATOM   2059 C C   . PRO A 1 298 ? -7.473  27.430  31.126  1.00 46.45  ? 486 PRO A C   1 
ATOM   2060 O O   . PRO A 1 298 ? -7.538  26.297  30.646  1.00 44.56  ? 486 PRO A O   1 
ATOM   2061 C CB  . PRO A 1 298 ? -9.896  28.129  31.108  1.00 49.41  ? 486 PRO A CB  1 
ATOM   2062 C CG  . PRO A 1 298 ? -10.760 28.543  29.963  1.00 50.95  ? 486 PRO A CG  1 
ATOM   2063 C CD  . PRO A 1 298 ? -9.933  28.319  28.725  1.00 51.26  ? 486 PRO A CD  1 
ATOM   2064 N N   . PRO A 1 299 ? -6.558  27.801  32.034  1.00 48.85  ? 487 PRO A N   1 
ATOM   2065 C CA  . PRO A 1 299 ? -5.430  26.955  32.446  1.00 47.25  ? 487 PRO A CA  1 
ATOM   2066 C C   . PRO A 1 299 ? -5.853  25.548  32.868  1.00 44.56  ? 487 PRO A C   1 
ATOM   2067 O O   . PRO A 1 299 ? -5.216  24.569  32.481  1.00 44.36  ? 487 PRO A O   1 
ATOM   2068 C CB  . PRO A 1 299 ? -4.839  27.718  33.636  1.00 50.12  ? 487 PRO A CB  1 
ATOM   2069 C CG  . PRO A 1 299 ? -5.217  29.139  33.397  1.00 51.36  ? 487 PRO A CG  1 
ATOM   2070 C CD  . PRO A 1 299 ? -6.563  29.099  32.733  1.00 50.60  ? 487 PRO A CD  1 
ATOM   2071 N N   . GLU A 1 300 ? -6.926  25.461  33.646  1.00 38.50  ? 488 GLU A N   1 
ATOM   2072 C CA  . GLU A 1 300 ? -7.409  24.190  34.175  1.00 43.02  ? 488 GLU A CA  1 
ATOM   2073 C C   . GLU A 1 300 ? -7.788  23.230  33.048  1.00 43.86  ? 488 GLU A C   1 
ATOM   2074 O O   . GLU A 1 300 ? -7.394  22.060  33.047  1.00 46.92  ? 488 GLU A O   1 
ATOM   2075 C CB  . GLU A 1 300 ? -8.609  24.420  35.099  1.00 50.95  ? 488 GLU A CB  1 
ATOM   2076 C CG  . GLU A 1 300 ? -8.425  25.537  36.134  1.00 64.84  ? 488 GLU A CG  1 
ATOM   2077 C CD  . GLU A 1 300 ? -8.660  26.936  35.566  1.00 75.70  ? 488 GLU A CD  1 
ATOM   2078 O OE1 . GLU A 1 300 ? -9.191  27.052  34.440  1.00 77.56  ? 488 GLU A OE1 1 
ATOM   2079 O OE2 . GLU A 1 300 ? -8.307  27.923  36.246  1.00 82.03  ? 488 GLU A OE2 1 
ATOM   2080 N N   . LEU A 1 301 ? -8.542  23.742  32.083  1.00 43.75  ? 489 LEU A N   1 
ATOM   2081 C CA  . LEU A 1 301 ? -8.988  22.946  30.947  1.00 41.24  ? 489 LEU A CA  1 
ATOM   2082 C C   . LEU A 1 301 ? -7.810  22.502  30.082  1.00 40.66  ? 489 LEU A C   1 
ATOM   2083 O O   . LEU A 1 301 ? -7.672  21.320  29.763  1.00 44.21  ? 489 LEU A O   1 
ATOM   2084 C CB  . LEU A 1 301 ? -9.995  23.737  30.108  1.00 38.35  ? 489 LEU A CB  1 
ATOM   2085 C CG  . LEU A 1 301 ? -10.565 23.035  28.873  1.00 41.76  ? 489 LEU A CG  1 
ATOM   2086 C CD1 . LEU A 1 301 ? -11.236 21.724  29.255  1.00 43.06  ? 489 LEU A CD1 1 
ATOM   2087 C CD2 . LEU A 1 301 ? -11.539 23.944  28.141  1.00 40.99  ? 489 LEU A CD2 1 
ATOM   2088 N N   . GLY A 1 302 ? -6.961  23.456  29.714  1.00 38.14  ? 490 GLY A N   1 
ATOM   2089 C CA  . GLY A 1 302 ? -5.823  23.180  28.856  1.00 39.55  ? 490 GLY A CA  1 
ATOM   2090 C C   . GLY A 1 302 ? -4.850  22.181  29.450  1.00 39.30  ? 490 GLY A C   1 
ATOM   2091 O O   . GLY A 1 302 ? -4.422  21.240  28.779  1.00 39.90  ? 490 GLY A O   1 
ATOM   2092 N N   . LEU A 1 303 ? -4.504  22.382  30.716  1.00 39.23  ? 491 LEU A N   1 
ATOM   2093 C CA  . LEU A 1 303 ? -3.562  21.502  31.393  1.00 40.57  ? 491 LEU A CA  1 
ATOM   2094 C C   . LEU A 1 303 ? -4.186  20.132  31.656  1.00 37.97  ? 491 LEU A C   1 
ATOM   2095 O O   . LEU A 1 303 ? -3.528  19.106  31.491  1.00 39.28  ? 491 LEU A O   1 
ATOM   2096 C CB  . LEU A 1 303 ? -3.080  22.135  32.702  1.00 41.15  ? 491 LEU A CB  1 
ATOM   2097 C CG  . LEU A 1 303 ? -2.177  23.366  32.576  1.00 41.01  ? 491 LEU A CG  1 
ATOM   2098 C CD1 . LEU A 1 303 ? -1.954  24.004  33.939  1.00 41.29  ? 491 LEU A CD1 1 
ATOM   2099 C CD2 . LEU A 1 303 ? -0.844  23.008  31.928  1.00 40.04  ? 491 LEU A CD2 1 
ATOM   2100 N N   . GLY A 1 304 ? -5.453  20.116  32.061  1.00 36.71  ? 492 GLY A N   1 
ATOM   2101 C CA  . GLY A 1 304 ? -6.159  18.860  32.247  1.00 38.78  ? 492 GLY A CA  1 
ATOM   2102 C C   . GLY A 1 304 ? -6.175  18.016  30.981  1.00 38.71  ? 492 GLY A C   1 
ATOM   2103 O O   . GLY A 1 304 ? -5.859  16.820  31.008  1.00 36.98  ? 492 GLY A O   1 
ATOM   2104 N N   . LEU A 1 305 ? -6.532  18.648  29.865  1.00 37.21  ? 493 LEU A N   1 
ATOM   2105 C CA  . LEU A 1 305 ? -6.605  17.958  28.582  1.00 36.24  ? 493 LEU A CA  1 
ATOM   2106 C C   . LEU A 1 305 ? -5.223  17.517  28.106  1.00 35.82  ? 493 LEU A C   1 
ATOM   2107 O O   . LEU A 1 305 ? -5.066  16.410  27.599  1.00 38.92  ? 493 LEU A O   1 
ATOM   2108 C CB  . LEU A 1 305 ? -7.269  18.848  27.525  1.00 33.80  ? 493 LEU A CB  1 
ATOM   2109 C CG  . LEU A 1 305 ? -8.783  19.028  27.667  1.00 36.11  ? 493 LEU A CG  1 
ATOM   2110 C CD1 . LEU A 1 305 ? -9.355  19.852  26.520  1.00 35.87  ? 493 LEU A CD1 1 
ATOM   2111 C CD2 . LEU A 1 305 ? -9.473  17.682  27.745  1.00 34.26  ? 493 LEU A CD2 1 
ATOM   2112 N N   . GLY A 1 306 ? -4.224  18.378  28.274  1.00 33.15  ? 494 GLY A N   1 
ATOM   2113 C CA  . GLY A 1 306 ? -2.868  18.033  27.887  1.00 36.90  ? 494 GLY A CA  1 
ATOM   2114 C C   . GLY A 1 306 ? -2.359  16.821  28.650  1.00 41.30  ? 494 GLY A C   1 
ATOM   2115 O O   . GLY A 1 306 ? -1.789  15.889  28.066  1.00 37.01  ? 494 GLY A O   1 
ATOM   2116 N N   . GLN A 1 307 ? -2.582  16.832  29.962  1.00 38.80  ? 495 GLN A N   1 
ATOM   2117 C CA  . GLN A 1 307 ? -2.167  15.731  30.823  1.00 43.05  ? 495 GLN A CA  1 
ATOM   2118 C C   . GLN A 1 307 ? -2.894  14.437  30.454  1.00 40.00  ? 495 GLN A C   1 
ATOM   2119 O O   . GLN A 1 307 ? -2.276  13.366  30.375  1.00 41.10  ? 495 GLN A O   1 
ATOM   2120 C CB  . GLN A 1 307 ? -2.411  16.080  32.293  1.00 46.75  ? 495 GLN A CB  1 
ATOM   2121 C CG  . GLN A 1 307 ? -1.831  15.069  33.265  1.00 60.70  ? 495 GLN A CG  1 
ATOM   2122 C CD  . GLN A 1 307 ? -1.678  15.629  34.664  1.00 72.19  ? 495 GLN A CD  1 
ATOM   2123 O OE1 . GLN A 1 307 ? -2.264  16.658  35.002  1.00 75.67  ? 495 GLN A OE1 1 
ATOM   2124 N NE2 . GLN A 1 307 ? -0.879  14.956  35.485  1.00 76.44  ? 495 GLN A NE2 1 
ATOM   2125 N N   . LEU A 1 308 ? -4.201  14.542  30.227  1.00 34.14  ? 496 LEU A N   1 
ATOM   2126 C CA  . LEU A 1 308 ? -4.984  13.393  29.779  1.00 39.09  ? 496 LEU A CA  1 
ATOM   2127 C C   . LEU A 1 308 ? -4.421  12.809  28.483  1.00 37.67  ? 496 LEU A C   1 
ATOM   2128 O O   . LEU A 1 308 ? -4.308  11.588  28.330  1.00 39.42  ? 496 LEU A O   1 
ATOM   2129 C CB  . LEU A 1 308 ? -6.447  13.785  29.575  1.00 40.17  ? 496 LEU A CB  1 
ATOM   2130 C CG  . LEU A 1 308 ? -7.346  12.655  29.082  1.00 43.29  ? 496 LEU A CG  1 
ATOM   2131 C CD1 . LEU A 1 308 ? -7.522  11.611  30.175  1.00 46.50  ? 496 LEU A CD1 1 
ATOM   2132 C CD2 . LEU A 1 308 ? -8.685  13.195  28.615  1.00 46.24  ? 496 LEU A CD2 1 
ATOM   2133 N N   . ALA A 1 309 ? -4.065  13.692  27.556  1.00 37.68  ? 497 ALA A N   1 
ATOM   2134 C CA  . ALA A 1 309 ? -3.472  13.283  26.289  1.00 37.98  ? 497 ALA A CA  1 
ATOM   2135 C C   . ALA A 1 309 ? -2.152  12.555  26.519  1.00 38.20  ? 497 ALA A C   1 
ATOM   2136 O O   . ALA A 1 309 ? -1.888  11.532  25.889  1.00 37.88  ? 497 ALA A O   1 
ATOM   2137 C CB  . ALA A 1 309 ? -3.265  14.488  25.385  1.00 38.24  ? 497 ALA A CB  1 
ATOM   2138 N N   . CYS A 1 310 ? -1.328  13.076  27.425  1.00 36.02  ? 498 CYS A N   1 
ATOM   2139 C CA  . CYS A 1 310 ? -0.066  12.412  27.741  1.00 38.51  ? 498 CYS A CA  1 
ATOM   2140 C C   . CYS A 1 310 ? -0.319  11.008  28.277  1.00 43.61  ? 498 CYS A C   1 
ATOM   2141 O O   . CYS A 1 310 ? 0.310   10.050  27.834  1.00 48.05  ? 498 CYS A O   1 
ATOM   2142 C CB  . CYS A 1 310 ? 0.747   13.223  28.749  1.00 35.24  ? 498 CYS A CB  1 
ATOM   2143 S SG  . CYS A 1 310 ? 1.357   14.791  28.099  1.00 43.86  ? 498 CYS A SG  1 
ATOM   2144 N N   . CYS A 1 311 ? -1.252  10.886  29.215  1.00 40.64  ? 499 CYS A N   1 
ATOM   2145 C CA  . CYS A 1 311 ? -1.555  9.583   29.797  1.00 41.61  ? 499 CYS A CA  1 
ATOM   2146 C C   . CYS A 1 311 ? -2.069  8.588   28.751  1.00 41.54  ? 499 CYS A C   1 
ATOM   2147 O O   . CYS A 1 311 ? -1.667  7.422   28.752  1.00 36.72  ? 499 CYS A O   1 
ATOM   2148 C CB  . CYS A 1 311 ? -2.571  9.727   30.932  1.00 43.77  ? 499 CYS A CB  1 
ATOM   2149 S SG  . CYS A 1 311 ? -1.928  10.584  32.392  1.00 55.17  ? 499 CYS A SG  1 
ATOM   2150 N N   . CYS A 1 312 ? -2.942  9.049   27.856  1.00 37.53  ? 500 CYS A N   1 
ATOM   2151 C CA  . CYS A 1 312 ? -3.461  8.182   26.795  1.00 38.26  ? 500 CYS A CA  1 
ATOM   2152 C C   . CYS A 1 312 ? -2.393  7.780   25.778  1.00 42.97  ? 500 CYS A C   1 
ATOM   2153 O O   . CYS A 1 312 ? -2.457  6.699   25.194  1.00 41.16  ? 500 CYS A O   1 
ATOM   2154 C CB  . CYS A 1 312 ? -4.620  8.862   26.063  1.00 36.75  ? 500 CYS A CB  1 
ATOM   2155 S SG  . CYS A 1 312 ? -6.094  9.090   27.070  1.00 40.63  ? 500 CYS A SG  1 
ATOM   2156 N N   . LEU A 1 313 ? -1.420  8.658   25.563  1.00 45.10  ? 501 LEU A N   1 
ATOM   2157 C CA  . LEU A 1 313 ? -0.413  8.454   24.525  1.00 44.90  ? 501 LEU A CA  1 
ATOM   2158 C C   . LEU A 1 313 ? 0.818   7.721   25.041  1.00 48.99  ? 501 LEU A C   1 
ATOM   2159 O O   . LEU A 1 313 ? 1.811   7.591   24.323  1.00 53.46  ? 501 LEU A O   1 
ATOM   2160 C CB  . LEU A 1 313 ? -0.006  9.789   23.902  1.00 39.99  ? 501 LEU A CB  1 
ATOM   2161 C CG  . LEU A 1 313 ? -1.077  10.430  23.019  1.00 38.64  ? 501 LEU A CG  1 
ATOM   2162 C CD1 . LEU A 1 313 ? -0.587  11.768  22.489  1.00 41.26  ? 501 LEU A CD1 1 
ATOM   2163 C CD2 . LEU A 1 313 ? -1.472  9.506   21.875  1.00 36.94  ? 501 LEU A CD2 1 
ATOM   2164 N N   . HIS A 1 314 ? 0.757   7.266   26.290  1.00 47.16  ? 502 HIS A N   1 
ATOM   2165 C CA  . HIS A 1 314 ? 1.886   6.596   26.934  1.00 49.84  ? 502 HIS A CA  1 
ATOM   2166 C C   . HIS A 1 314 ? 2.437   5.463   26.068  1.00 51.99  ? 502 HIS A C   1 
ATOM   2167 O O   . HIS A 1 314 ? 1.683   4.670   25.507  1.00 53.93  ? 502 HIS A O   1 
ATOM   2168 C CB  . HIS A 1 314 ? 1.465   6.053   28.304  1.00 54.21  ? 502 HIS A CB  1 
ATOM   2169 C CG  . HIS A 1 314 ? 2.614   5.716   29.205  1.00 63.22  ? 502 HIS A CG  1 
ATOM   2170 N ND1 . HIS A 1 314 ? 3.454   4.648   28.976  1.00 65.66  ? 502 HIS A ND1 1 
ATOM   2171 C CD2 . HIS A 1 314 ? 3.055   6.302   30.344  1.00 65.33  ? 502 HIS A CD2 1 
ATOM   2172 C CE1 . HIS A 1 314 ? 4.367   4.594   29.929  1.00 67.68  ? 502 HIS A CE1 1 
ATOM   2173 N NE2 . HIS A 1 314 ? 4.146   5.586   30.773  1.00 68.04  ? 502 HIS A NE2 1 
ATOM   2174 N N   . ARG A 1 315 ? 3.760   5.412   25.953  1.00 59.62  ? 503 ARG A N   1 
ATOM   2175 C CA  . ARG A 1 315 ? 4.437   4.443   25.095  1.00 62.62  ? 503 ARG A CA  1 
ATOM   2176 C C   . ARG A 1 315 ? 4.188   3.001   25.540  1.00 60.61  ? 503 ARG A C   1 
ATOM   2177 O O   . ARG A 1 315 ? 4.084   2.095   24.713  1.00 59.33  ? 503 ARG A O   1 
ATOM   2178 C CB  . ARG A 1 315 ? 5.940   4.748   25.057  1.00 67.40  ? 503 ARG A CB  1 
ATOM   2179 C CG  . ARG A 1 315 ? 6.844   3.538   24.917  1.00 75.50  ? 503 ARG A CG  1 
ATOM   2180 C CD  . ARG A 1 315 ? 8.047   3.861   24.046  1.00 81.76  ? 503 ARG A CD  1 
ATOM   2181 N NE  . ARG A 1 315 ? 9.252   3.158   24.476  1.00 87.09  ? 503 ARG A NE  1 
ATOM   2182 C CZ  . ARG A 1 315 ? 10.237  3.730   25.160  1.00 93.28  ? 503 ARG A CZ  1 
ATOM   2183 N NH1 . ARG A 1 315 ? 10.155  5.014   25.485  1.00 95.30  ? 503 ARG A NH1 1 
ATOM   2184 N NH2 . ARG A 1 315 ? 11.304  3.026   25.514  1.00 95.39  ? 503 ARG A NH2 1 
ATOM   2185 N N   . ARG A 1 316 ? 4.065   2.799   26.847  1.00 57.24  ? 504 ARG A N   1 
ATOM   2186 C CA  . ARG A 1 316 ? 3.786   1.477   27.384  1.00 58.99  ? 504 ARG A CA  1 
ATOM   2187 C C   . ARG A 1 316 ? 2.275   1.309   27.513  1.00 59.56  ? 504 ARG A C   1 
ATOM   2188 O O   . ARG A 1 316 ? 1.623   1.998   28.303  1.00 57.16  ? 504 ARG A O   1 
ATOM   2189 C CB  . ARG A 1 316 ? 4.489   1.285   28.731  1.00 65.11  ? 504 ARG A CB  1 
ATOM   2190 C CG  . ARG A 1 316 ? 5.165   -0.070  28.893  1.00 74.86  ? 504 ARG A CG  1 
ATOM   2191 C CD  . ARG A 1 316 ? 6.416   0.009   29.765  1.00 80.94  ? 504 ARG A CD  1 
ATOM   2192 N NE  . ARG A 1 316 ? 6.169   0.644   31.057  1.00 86.46  ? 504 ARG A NE  1 
ATOM   2193 C CZ  . ARG A 1 316 ? 6.832   1.706   31.507  1.00 91.95  ? 504 ARG A CZ  1 
ATOM   2194 N NH1 . ARG A 1 316 ? 7.789   2.256   30.770  1.00 94.17  ? 504 ARG A NH1 1 
ATOM   2195 N NH2 . ARG A 1 316 ? 6.542   2.216   32.697  1.00 92.17  ? 504 ARG A NH2 1 
ATOM   2196 N N   . ALA A 1 317 ? 1.728   0.386   26.727  1.00 61.30  ? 505 ALA A N   1 
ATOM   2197 C CA  . ALA A 1 317 ? 0.282   0.210   26.603  1.00 58.29  ? 505 ALA A CA  1 
ATOM   2198 C C   . ALA A 1 317 ? -0.387  -0.147  27.926  1.00 60.78  ? 505 ALA A C   1 
ATOM   2199 O O   . ALA A 1 317 ? -1.558  0.168   28.146  1.00 62.92  ? 505 ALA A O   1 
ATOM   2200 C CB  . ALA A 1 317 ? -0.023  -0.857  25.559  1.00 54.19  ? 505 ALA A CB  1 
ATOM   2201 N N   . LYS A 1 318 ? 0.366   -0.798  28.803  1.00 60.77  ? 506 LYS A N   1 
ATOM   2202 C CA  . LYS A 1 318 ? -0.157  -1.258  30.082  1.00 62.58  ? 506 LYS A CA  1 
ATOM   2203 C C   . LYS A 1 318 ? -0.435  -0.111  31.048  1.00 55.13  ? 506 LYS A C   1 
ATOM   2204 O O   . LYS A 1 318 ? -1.205  -0.270  31.994  1.00 56.81  ? 506 LYS A O   1 
ATOM   2205 C CB  . LYS A 1 318 ? 0.819   -2.252  30.722  1.00 72.83  ? 506 LYS A CB  1 
ATOM   2206 C CG  . LYS A 1 318 ? 0.444   -3.714  30.516  1.00 82.31  ? 506 LYS A CG  1 
ATOM   2207 C CD  . LYS A 1 318 ? 0.220   -4.045  29.045  1.00 86.58  ? 506 LYS A CD  1 
ATOM   2208 C CE  . LYS A 1 318 ? -0.246  -5.484  28.862  1.00 88.49  ? 506 LYS A CE  1 
ATOM   2209 N NZ  . LYS A 1 318 ? -0.523  -5.810  27.434  1.00 87.17  ? 506 LYS A NZ  1 
ATOM   2210 N N   . ARG A 1 319 ? 0.207   1.032   30.827  1.00 52.76  ? 507 ARG A N   1 
ATOM   2211 C CA  . ARG A 1 319 ? 0.005   2.191   31.695  1.00 53.54  ? 507 ARG A CA  1 
ATOM   2212 C C   . ARG A 1 319 ? -1.017  3.207   31.167  1.00 49.38  ? 507 ARG A C   1 
ATOM   2213 O O   . ARG A 1 319 ? -1.265  4.228   31.809  1.00 47.32  ? 507 ARG A O   1 
ATOM   2214 C CB  . ARG A 1 319 ? 1.340   2.887   31.959  1.00 61.35  ? 507 ARG A CB  1 
ATOM   2215 C CG  . ARG A 1 319 ? 2.224   2.139   32.953  1.00 66.86  ? 507 ARG A CG  1 
ATOM   2216 C CD  . ARG A 1 319 ? 3.440   2.958   33.355  1.00 74.08  ? 507 ARG A CD  1 
ATOM   2217 N NE  . ARG A 1 319 ? 3.073   4.267   33.891  1.00 77.46  ? 507 ARG A NE  1 
ATOM   2218 C CZ  . ARG A 1 319 ? 3.941   5.141   34.391  1.00 82.64  ? 507 ARG A CZ  1 
ATOM   2219 N NH1 . ARG A 1 319 ? 5.235   4.850   34.433  1.00 83.46  ? 507 ARG A NH1 1 
ATOM   2220 N NH2 . ARG A 1 319 ? 3.512   6.307   34.855  1.00 84.33  ? 507 ARG A NH2 1 
ATOM   2221 N N   . ARG A 1 320 ? -1.611  2.937   30.010  1.00 46.58  ? 508 ARG A N   1 
ATOM   2222 C CA  . ARG A 1 320 ? -2.690  3.788   29.515  1.00 43.83  ? 508 ARG A CA  1 
ATOM   2223 C C   . ARG A 1 320 ? -3.938  3.546   30.355  1.00 42.31  ? 508 ARG A C   1 
ATOM   2224 O O   . ARG A 1 320 ? -4.265  2.399   30.660  1.00 47.49  ? 508 ARG A O   1 
ATOM   2225 C CB  . ARG A 1 320 ? -2.973  3.519   28.034  1.00 45.02  ? 508 ARG A CB  1 
ATOM   2226 C CG  . ARG A 1 320 ? -1.791  3.819   27.128  1.00 48.27  ? 508 ARG A CG  1 
ATOM   2227 C CD  . ARG A 1 320 ? -2.005  3.315   25.710  1.00 47.80  ? 508 ARG A CD  1 
ATOM   2228 N NE  . ARG A 1 320 ? -0.736  3.269   24.992  1.00 51.91  ? 508 ARG A NE  1 
ATOM   2229 C CZ  . ARG A 1 320 ? -0.533  2.619   23.850  1.00 52.00  ? 508 ARG A CZ  1 
ATOM   2230 N NH1 . ARG A 1 320 ? -1.522  1.949   23.276  1.00 46.89  ? 508 ARG A NH1 1 
ATOM   2231 N NH2 . ARG A 1 320 ? 0.669   2.635   23.286  1.00 51.26  ? 508 ARG A NH2 1 
ATOM   2232 N N   . PRO A 1 321 ? -4.636  4.626   30.741  1.00 39.28  ? 509 PRO A N   1 
ATOM   2233 C CA  . PRO A 1 321 ? -5.837  4.498   31.574  1.00 38.94  ? 509 PRO A CA  1 
ATOM   2234 C C   . PRO A 1 321 ? -6.970  3.791   30.840  1.00 42.52  ? 509 PRO A C   1 
ATOM   2235 O O   . PRO A 1 321 ? -6.993  3.796   29.610  1.00 42.52  ? 509 PRO A O   1 
ATOM   2236 C CB  . PRO A 1 321 ? -6.211  5.952   31.875  1.00 37.63  ? 509 PRO A CB  1 
ATOM   2237 C CG  . PRO A 1 321 ? -5.692  6.710   30.696  1.00 40.88  ? 509 PRO A CG  1 
ATOM   2238 C CD  . PRO A 1 321 ? -4.395  6.022   30.336  1.00 41.11  ? 509 PRO A CD  1 
ATOM   2239 N N   . PRO A 1 322 ? -7.891  3.170   31.592  1.00 43.39  ? 510 PRO A N   1 
ATOM   2240 C CA  . PRO A 1 322 ? -9.129  2.642   31.012  1.00 42.13  ? 510 PRO A CA  1 
ATOM   2241 C C   . PRO A 1 322 ? -10.009 3.787   30.524  1.00 39.33  ? 510 PRO A C   1 
ATOM   2242 O O   . PRO A 1 322 ? -10.038 4.833   31.169  1.00 39.69  ? 510 PRO A O   1 
ATOM   2243 C CB  . PRO A 1 322 ? -9.788  1.900   32.183  1.00 39.54  ? 510 PRO A CB  1 
ATOM   2244 C CG  . PRO A 1 322 ? -8.700  1.690   33.182  1.00 43.64  ? 510 PRO A CG  1 
ATOM   2245 C CD  . PRO A 1 322 ? -7.775  2.852   33.024  1.00 43.49  ? 510 PRO A CD  1 
ATOM   2246 N N   . MET A 1 323 ? -10.717 3.595   29.415  1.00 36.12  ? 511 MET A N   1 
ATOM   2247 C CA  . MET A 1 323 ? -11.518 4.673   28.839  1.00 36.67  ? 511 MET A CA  1 
ATOM   2248 C C   . MET A 1 323 ? -12.650 5.120   29.764  1.00 34.10  ? 511 MET A C   1 
ATOM   2249 O O   . MET A 1 323 ? -13.151 6.231   29.634  1.00 35.03  ? 511 MET A O   1 
ATOM   2250 C CB  . MET A 1 323 ? -12.078 4.257   27.477  1.00 34.58  ? 511 MET A CB  1 
ATOM   2251 C CG  . MET A 1 323 ? -11.062 4.371   26.349  1.00 37.00  ? 511 MET A CG  1 
ATOM   2252 S SD  . MET A 1 323 ? -10.423 6.050   26.136  1.00 33.96  ? 511 MET A SD  1 
ATOM   2253 C CE  . MET A 1 323 ? -11.936 6.975   25.855  1.00 28.02  ? 511 MET A CE  1 
ATOM   2254 N N   . THR A 1 324 ? -13.044 4.263   30.699  1.00 31.96  ? 512 THR A N   1 
ATOM   2255 C CA  . THR A 1 324 ? -13.998 4.660   31.728  1.00 36.12  ? 512 THR A CA  1 
ATOM   2256 C C   . THR A 1 324 ? -13.409 5.775   32.590  1.00 41.19  ? 512 THR A C   1 
ATOM   2257 O O   . THR A 1 324 ? -14.081 6.768   32.898  1.00 43.65  ? 512 THR A O   1 
ATOM   2258 C CB  . THR A 1 324 ? -14.393 3.473   32.624  1.00 38.92  ? 512 THR A CB  1 
ATOM   2259 O OG1 . THR A 1 324 ? -13.210 2.789   33.062  1.00 42.33  ? 512 THR A OG1 1 
ATOM   2260 C CG2 . THR A 1 324 ? -15.291 2.506   31.861  1.00 30.41  ? 512 THR A CG2 1 
ATOM   2261 N N   . GLN A 1 325 ? -12.146 5.605   32.970  1.00 35.73  ? 513 GLN A N   1 
ATOM   2262 C CA  . GLN A 1 325 ? -11.436 6.623   33.728  1.00 39.57  ? 513 GLN A CA  1 
ATOM   2263 C C   . GLN A 1 325 ? -11.247 7.893   32.906  1.00 34.21  ? 513 GLN A C   1 
ATOM   2264 O O   . GLN A 1 325 ? -11.375 8.996   33.427  1.00 32.40  ? 513 GLN A O   1 
ATOM   2265 C CB  . GLN A 1 325 ? -10.078 6.106   34.201  1.00 44.70  ? 513 GLN A CB  1 
ATOM   2266 C CG  . GLN A 1 325 ? -10.158 5.100   35.328  1.00 53.40  ? 513 GLN A CG  1 
ATOM   2267 C CD  . GLN A 1 325 ? -8.814  4.874   35.998  1.00 60.54  ? 513 GLN A CD  1 
ATOM   2268 O OE1 . GLN A 1 325 ? -7.833  5.564   35.704  1.00 58.82  ? 513 GLN A OE1 1 
ATOM   2269 N NE2 . GLN A 1 325 ? -8.762  3.905   36.906  1.00 63.34  ? 513 GLN A NE2 1 
ATOM   2270 N N   . VAL A 1 326 ? -10.937 7.736   31.623  1.00 29.88  ? 514 VAL A N   1 
ATOM   2271 C CA  . VAL A 1 326 ? -10.793 8.885   30.734  1.00 34.69  ? 514 VAL A CA  1 
ATOM   2272 C C   . VAL A 1 326 ? -12.093 9.693   30.693  1.00 35.53  ? 514 VAL A C   1 
ATOM   2273 O O   . VAL A 1 326 ? -12.091 10.925  30.840  1.00 32.28  ? 514 VAL A O   1 
ATOM   2274 C CB  . VAL A 1 326 ? -10.398 8.442   29.309  1.00 32.90  ? 514 VAL A CB  1 
ATOM   2275 C CG1 . VAL A 1 326 ? -10.550 9.589   28.320  1.00 29.72  ? 514 VAL A CG1 1 
ATOM   2276 C CG2 . VAL A 1 326 ? -8.974  7.906   29.301  1.00 29.41  ? 514 VAL A CG2 1 
ATOM   2277 N N   . TYR A 1 327 ? -13.204 8.981   30.522  1.00 34.00  ? 515 TYR A N   1 
ATOM   2278 C CA  . TYR A 1 327 ? -14.515 9.607   30.530  1.00 30.84  ? 515 TYR A CA  1 
ATOM   2279 C C   . TYR A 1 327 ? -14.768 10.331  31.847  1.00 32.13  ? 515 TYR A C   1 
ATOM   2280 O O   . TYR A 1 327 ? -15.229 11.474  31.852  1.00 34.93  ? 515 TYR A O   1 
ATOM   2281 C CB  . TYR A 1 327 ? -15.618 8.578   30.285  1.00 29.59  ? 515 TYR A CB  1 
ATOM   2282 C CG  . TYR A 1 327 ? -16.989 9.191   30.392  1.00 29.49  ? 515 TYR A CG  1 
ATOM   2283 C CD1 . TYR A 1 327 ? -17.566 9.832   29.305  1.00 26.59  ? 515 TYR A CD1 1 
ATOM   2284 C CD2 . TYR A 1 327 ? -17.695 9.160   31.590  1.00 29.74  ? 515 TYR A CD2 1 
ATOM   2285 C CE1 . TYR A 1 327 ? -18.806 10.411  29.400  1.00 29.70  ? 515 TYR A CE1 1 
ATOM   2286 C CE2 . TYR A 1 327 ? -18.942 9.746   31.696  1.00 30.09  ? 515 TYR A CE2 1 
ATOM   2287 C CZ  . TYR A 1 327 ? -19.491 10.367  30.598  1.00 30.07  ? 515 TYR A CZ  1 
ATOM   2288 O OH  . TYR A 1 327 ? -20.733 10.942  30.699  1.00 35.45  ? 515 TYR A OH  1 
ATOM   2289 N N   . GLU A 1 328 ? -14.475 9.662   32.958  1.00 28.98  ? 516 GLU A N   1 
ATOM   2290 C CA  . GLU A 1 328 ? -14.698 10.253  34.279  1.00 38.52  ? 516 GLU A CA  1 
ATOM   2291 C C   . GLU A 1 328 ? -13.901 11.545  34.452  1.00 39.59  ? 516 GLU A C   1 
ATOM   2292 O O   . GLU A 1 328 ? -14.408 12.540  34.985  1.00 38.91  ? 516 GLU A O   1 
ATOM   2293 C CB  . GLU A 1 328 ? -14.336 9.259   35.385  1.00 45.54  ? 516 GLU A CB  1 
ATOM   2294 C CG  . GLU A 1 328 ? -15.339 8.126   35.549  1.00 55.36  ? 516 GLU A CG  1 
ATOM   2295 C CD  . GLU A 1 328 ? -14.860 7.046   36.503  1.00 66.22  ? 516 GLU A CD  1 
ATOM   2296 O OE1 . GLU A 1 328 ? -13.634 6.924   36.711  1.00 70.47  ? 516 GLU A OE1 1 
ATOM   2297 O OE2 . GLU A 1 328 ? -15.713 6.315   37.049  1.00 70.97  ? 516 GLU A OE2 1 
ATOM   2298 N N   . ARG A 1 329 ? -12.662 11.529  33.974  1.00 38.12  ? 517 ARG A N   1 
ATOM   2299 C CA  . ARG A 1 329 ? -11.793 12.695  34.061  1.00 38.76  ? 517 ARG A CA  1 
ATOM   2300 C C   . ARG A 1 329 ? -12.311 13.839  33.193  1.00 35.52  ? 517 ARG A C   1 
ATOM   2301 O O   . ARG A 1 329 ? -12.311 14.985  33.624  1.00 36.72  ? 517 ARG A O   1 
ATOM   2302 C CB  . ARG A 1 329 ? -10.356 12.325  33.676  1.00 44.35  ? 517 ARG A CB  1 
ATOM   2303 C CG  . ARG A 1 329 ? -9.533  11.792  34.850  1.00 51.38  ? 517 ARG A CG  1 
ATOM   2304 C CD  . ARG A 1 329 ? -8.854  10.456  34.557  1.00 56.50  ? 517 ARG A CD  1 
ATOM   2305 N NE  . ARG A 1 329 ? -7.508  10.607  34.008  1.00 64.94  ? 517 ARG A NE  1 
ATOM   2306 C CZ  . ARG A 1 329 ? -6.605  9.631   33.964  1.00 69.30  ? 517 ARG A CZ  1 
ATOM   2307 N NH1 . ARG A 1 329 ? -6.898  8.427   34.442  1.00 70.89  ? 517 ARG A NH1 1 
ATOM   2308 N NH2 . ARG A 1 329 ? -5.404  9.858   33.446  1.00 71.00  ? 517 ARG A NH2 1 
ATOM   2309 N N   . LEU A 1 330 ? -12.765 13.537  31.980  1.00 36.61  ? 518 LEU A N   1 
ATOM   2310 C CA  . LEU A 1 330 ? -13.345 14.583  31.136  1.00 34.08  ? 518 LEU A CA  1 
ATOM   2311 C C   . LEU A 1 330 ? -14.591 15.196  31.791  1.00 35.65  ? 518 LEU A C   1 
ATOM   2312 O O   . LEU A 1 330 ? -14.768 16.427  31.819  1.00 37.25  ? 518 LEU A O   1 
ATOM   2313 C CB  . LEU A 1 330 ? -13.684 14.027  29.752  1.00 27.07  ? 518 LEU A CB  1 
ATOM   2314 C CG  . LEU A 1 330 ? -12.457 13.790  28.868  1.00 30.55  ? 518 LEU A CG  1 
ATOM   2315 C CD1 . LEU A 1 330 ? -12.791 12.931  27.656  1.00 28.66  ? 518 LEU A CD1 1 
ATOM   2316 C CD2 . LEU A 1 330 ? -11.864 15.126  28.432  1.00 28.28  ? 518 LEU A CD2 1 
ATOM   2317 N N   . GLU A 1 331 ? -15.436 14.328  32.340  1.00 29.64  ? 519 GLU A N   1 
ATOM   2318 C CA  . GLU A 1 331 ? -16.658 14.763  33.006  1.00 36.32  ? 519 GLU A CA  1 
ATOM   2319 C C   . GLU A 1 331 ? -16.358 15.661  34.204  1.00 40.66  ? 519 GLU A C   1 
ATOM   2320 O O   . GLU A 1 331 ? -17.040 16.664  34.420  1.00 42.40  ? 519 GLU A O   1 
ATOM   2321 C CB  . GLU A 1 331 ? -17.482 13.558  33.455  1.00 38.70  ? 519 GLU A CB  1 
ATOM   2322 C CG  . GLU A 1 331 ? -18.867 13.923  33.955  1.00 49.87  ? 519 GLU A CG  1 
ATOM   2323 C CD  . GLU A 1 331 ? -19.713 12.706  34.257  1.00 59.59  ? 519 GLU A CD  1 
ATOM   2324 O OE1 . GLU A 1 331 ? -19.144 11.680  34.690  1.00 62.70  ? 519 GLU A OE1 1 
ATOM   2325 O OE2 . GLU A 1 331 ? -20.943 12.774  34.050  1.00 63.73  ? 519 GLU A OE2 1 
ATOM   2326 N N   . LYS A 1 332 ? -15.340 15.303  34.982  1.00 39.84  ? 520 LYS A N   1 
ATOM   2327 C CA  . LYS A 1 332 ? -14.910 16.162  36.081  1.00 45.06  ? 520 LYS A CA  1 
ATOM   2328 C C   . LYS A 1 332 ? -14.383 17.485  35.535  1.00 48.99  ? 520 LYS A C   1 
ATOM   2329 O O   . LYS A 1 332 ? -14.646 18.546  36.104  1.00 53.02  ? 520 LYS A O   1 
ATOM   2330 C CB  . LYS A 1 332 ? -13.842 15.473  36.936  1.00 47.30  ? 520 LYS A CB  1 
ATOM   2331 C CG  . LYS A 1 332 ? -14.376 14.351  37.816  1.00 53.88  ? 520 LYS A CG  1 
ATOM   2332 C CD  . LYS A 1 332 ? -13.271 13.738  38.669  1.00 62.05  ? 520 LYS A CD  1 
ATOM   2333 C CE  . LYS A 1 332 ? -12.191 13.097  37.805  1.00 65.78  ? 520 LYS A CE  1 
ATOM   2334 N NZ  . LYS A 1 332 ? -11.035 12.601  38.606  1.00 68.16  ? 520 LYS A NZ  1 
ATOM   2335 N N   . LEU A 1 333 ? -13.653 17.416  34.423  1.00 47.47  ? 521 LEU A N   1 
ATOM   2336 C CA  . LEU A 1 333 ? -13.092 18.604  33.786  1.00 46.82  ? 521 LEU A CA  1 
ATOM   2337 C C   . LEU A 1 333 ? -14.181 19.550  33.310  1.00 47.70  ? 521 LEU A C   1 
ATOM   2338 O O   . LEU A 1 333 ? -13.948 20.747  33.166  1.00 47.24  ? 521 LEU A O   1 
ATOM   2339 C CB  . LEU A 1 333 ? -12.200 18.225  32.603  1.00 45.86  ? 521 LEU A CB  1 
ATOM   2340 C CG  . LEU A 1 333 ? -10.687 18.206  32.823  1.00 48.89  ? 521 LEU A CG  1 
ATOM   2341 C CD1 . LEU A 1 333 ? -9.965  17.983  31.500  1.00 46.69  ? 521 LEU A CD1 1 
ATOM   2342 C CD2 . LEU A 1 333 ? -10.209 19.490  33.491  1.00 47.01  ? 521 LEU A CD2 1 
ATOM   2343 N N   . GLN A 1 334 ? -15.376 19.018  33.078  1.00 49.32  ? 522 GLN A N   1 
ATOM   2344 C CA  . GLN A 1 334 ? -16.489 19.850  32.621  1.00 52.17  ? 522 GLN A CA  1 
ATOM   2345 C C   . GLN A 1 334 ? -16.864 20.954  33.628  1.00 56.25  ? 522 GLN A C   1 
ATOM   2346 O O   . GLN A 1 334 ? -17.609 21.872  33.295  1.00 54.52  ? 522 GLN A O   1 
ATOM   2347 C CB  . GLN A 1 334 ? -17.707 18.980  32.313  1.00 49.68  ? 522 GLN A CB  1 
ATOM   2348 C CG  . GLN A 1 334 ? -18.625 19.555  31.248  1.00 48.77  ? 522 GLN A CG  1 
ATOM   2349 C CD  . GLN A 1 334 ? -19.720 18.588  30.835  1.00 50.33  ? 522 GLN A CD  1 
ATOM   2350 O OE1 . GLN A 1 334 ? -20.118 17.711  31.603  1.00 51.83  ? 522 GLN A OE1 1 
ATOM   2351 N NE2 . GLN A 1 334 ? -20.208 18.740  29.611  1.00 50.37  ? 522 GLN A NE2 1 
ATOM   2352 N N   . ALA A 1 335 ? -16.341 20.865  34.850  1.00 60.36  ? 523 ALA A N   1 
ATOM   2353 C CA  . ALA A 1 335 ? -16.580 21.875  35.885  1.00 61.78  ? 523 ALA A CA  1 
ATOM   2354 C C   . ALA A 1 335 ? -15.879 23.212  35.619  1.00 67.53  ? 523 ALA A C   1 
ATOM   2355 O O   . ALA A 1 335 ? -16.281 24.245  36.156  1.00 67.79  ? 523 ALA A O   1 
ATOM   2356 C CB  . ALA A 1 335 ? -16.149 21.336  37.241  1.00 59.62  ? 523 ALA A CB  1 
ATOM   2357 N N   . VAL A 1 336 ? -14.834 23.192  34.795  1.00 62.83  ? 524 VAL A N   1 
ATOM   2358 C CA  . VAL A 1 336 ? -14.048 24.397  34.525  1.00 67.98  ? 524 VAL A CA  1 
ATOM   2359 C C   . VAL A 1 336 ? -14.863 25.441  33.761  1.00 73.09  ? 524 VAL A C   1 
ATOM   2360 O O   . VAL A 1 336 ? -14.556 26.633  33.790  1.00 73.28  ? 524 VAL A O   1 
ATOM   2361 C CB  . VAL A 1 336 ? -12.763 24.066  33.726  1.00 66.93  ? 524 VAL A CB  1 
ATOM   2362 C CG1 . VAL A 1 336 ? -13.102 23.665  32.297  1.00 64.60  ? 524 VAL A CG1 1 
ATOM   2363 C CG2 . VAL A 1 336 ? -11.805 25.249  33.734  1.00 67.68  ? 524 VAL A CG2 1 
ATOM   2364 N N   . VAL A 1 337 ? -15.914 24.987  33.089  1.00 72.83  ? 525 VAL A N   1 
ATOM   2365 C CA  . VAL A 1 337 ? -16.759 25.871  32.301  1.00 75.23  ? 525 VAL A CA  1 
ATOM   2366 C C   . VAL A 1 337 ? -18.111 26.053  32.979  1.00 76.78  ? 525 VAL A C   1 
ATOM   2367 O O   . VAL A 1 337 ? -18.479 27.166  33.365  1.00 80.02  ? 525 VAL A O   1 
ATOM   2368 C CB  . VAL A 1 337 ? -16.963 25.336  30.872  1.00 74.87  ? 525 VAL A CB  1 
ATOM   2369 C CG1 . VAL A 1 337 ? -17.909 26.242  30.099  1.00 76.08  ? 525 VAL A CG1 1 
ATOM   2370 C CG2 . VAL A 1 337 ? -15.624 25.216  30.157  1.00 73.63  ? 525 VAL A CG2 1 
ATOM   2371 N N   . ALA A 1 338 ? -18.852 24.956  33.105  1.00 79.01  ? 526 ALA A N   1 
ATOM   2372 C CA  . ALA A 1 338 ? -20.163 24.967  33.746  1.00 77.51  ? 526 ALA A CA  1 
ATOM   2373 C C   . ALA A 1 338 ? -20.100 25.503  35.176  1.00 77.47  ? 526 ALA A C   1 
ATOM   2374 O O   . ALA A 1 338 ? -19.027 25.593  35.774  1.00 77.25  ? 526 ALA A O   1 
ATOM   2375 C CB  . ALA A 1 338 ? -20.763 23.567  33.735  1.00 75.42  ? 526 ALA A CB  1 
ATOM   2376 N N   . ARG B 1 6   ? -24.532 -13.731 12.700  1.00 69.13  ? 194 ARG B N   1 
ATOM   2377 C CA  . ARG B 1 6   ? -25.791 -13.021 12.498  1.00 68.58  ? 194 ARG B CA  1 
ATOM   2378 C C   . ARG B 1 6   ? -26.058 -12.043 13.641  1.00 64.89  ? 194 ARG B C   1 
ATOM   2379 O O   . ARG B 1 6   ? -25.898 -12.392 14.811  1.00 62.35  ? 194 ARG B O   1 
ATOM   2380 C CB  . ARG B 1 6   ? -26.952 -14.009 12.371  1.00 70.26  ? 194 ARG B CB  1 
ATOM   2381 C CG  . ARG B 1 6   ? -28.267 -13.373 11.949  1.00 70.88  ? 194 ARG B CG  1 
ATOM   2382 C CD  . ARG B 1 6   ? -29.439 -13.980 12.700  1.00 72.43  ? 194 ARG B CD  1 
ATOM   2383 N NE  . ARG B 1 6   ? -30.718 -13.414 12.278  1.00 72.58  ? 194 ARG B NE  1 
ATOM   2384 C CZ  . ARG B 1 6   ? -31.531 -13.984 11.395  1.00 73.70  ? 194 ARG B CZ  1 
ATOM   2385 N NH1 . ARG B 1 6   ? -32.677 -13.400 11.069  1.00 73.41  ? 194 ARG B NH1 1 
ATOM   2386 N NH2 . ARG B 1 6   ? -31.200 -15.142 10.838  1.00 75.24  ? 194 ARG B NH2 1 
ATOM   2387 N N   . PRO B 1 7   ? -26.456 -10.808 13.300  1.00 64.74  ? 195 PRO B N   1 
ATOM   2388 C CA  . PRO B 1 7   ? -26.745 -9.765  14.292  1.00 62.76  ? 195 PRO B CA  1 
ATOM   2389 C C   . PRO B 1 7   ? -27.989 -10.045 15.138  1.00 56.78  ? 195 PRO B C   1 
ATOM   2390 O O   . PRO B 1 7   ? -29.029 -10.452 14.618  1.00 56.92  ? 195 PRO B O   1 
ATOM   2391 C CB  . PRO B 1 7   ? -26.956 -8.509  13.433  1.00 62.88  ? 195 PRO B CB  1 
ATOM   2392 C CG  . PRO B 1 7   ? -26.309 -8.821  12.119  1.00 63.81  ? 195 PRO B CG  1 
ATOM   2393 C CD  . PRO B 1 7   ? -26.513 -10.286 11.924  1.00 64.73  ? 195 PRO B CD  1 
ATOM   2394 N N   . PHE B 1 8   ? -27.860 -9.821  16.441  1.00 50.51  ? 196 PHE B N   1 
ATOM   2395 C CA  . PHE B 1 8   ? -28.976 -9.900  17.375  1.00 46.20  ? 196 PHE B CA  1 
ATOM   2396 C C   . PHE B 1 8   ? -29.034 -8.603  18.169  1.00 43.03  ? 196 PHE B C   1 
ATOM   2397 O O   . PHE B 1 8   ? -28.004 -7.967  18.387  1.00 46.91  ? 196 PHE B O   1 
ATOM   2398 C CB  . PHE B 1 8   ? -28.828 -11.097 18.317  1.00 46.38  ? 196 PHE B CB  1 
ATOM   2399 C CG  . PHE B 1 8   ? -29.126 -12.420 17.674  1.00 50.01  ? 196 PHE B CG  1 
ATOM   2400 C CD1 . PHE B 1 8   ? -28.149 -13.098 16.961  1.00 49.98  ? 196 PHE B CD1 1 
ATOM   2401 C CD2 . PHE B 1 8   ? -30.381 -12.997 17.796  1.00 49.70  ? 196 PHE B CD2 1 
ATOM   2402 C CE1 . PHE B 1 8   ? -28.423 -14.321 16.371  1.00 49.99  ? 196 PHE B CE1 1 
ATOM   2403 C CE2 . PHE B 1 8   ? -30.659 -14.220 17.210  1.00 49.91  ? 196 PHE B CE2 1 
ATOM   2404 C CZ  . PHE B 1 8   ? -29.680 -14.880 16.496  1.00 50.00  ? 196 PHE B CZ  1 
ATOM   2405 N N   . PRO B 1 9   ? -30.238 -8.199  18.600  1.00 41.68  ? 197 PRO B N   1 
ATOM   2406 C CA  . PRO B 1 9   ? -30.363 -6.953  19.367  1.00 36.83  ? 197 PRO B CA  1 
ATOM   2407 C C   . PRO B 1 9   ? -29.645 -7.012  20.719  1.00 35.43  ? 197 PRO B C   1 
ATOM   2408 O O   . PRO B 1 9   ? -29.419 -8.094  21.269  1.00 34.80  ? 197 PRO B O   1 
ATOM   2409 C CB  . PRO B 1 9   ? -31.880 -6.801  19.552  1.00 33.03  ? 197 PRO B CB  1 
ATOM   2410 C CG  . PRO B 1 9   ? -32.440 -8.163  19.338  1.00 39.99  ? 197 PRO B CG  1 
ATOM   2411 C CD  . PRO B 1 9   ? -31.543 -8.829  18.342  1.00 42.64  ? 197 PRO B CD  1 
ATOM   2412 N N   . PHE B 1 10  ? -29.295 -5.843  21.240  1.00 28.70  ? 198 PHE B N   1 
ATOM   2413 C CA  . PHE B 1 10  ? -28.520 -5.725  22.470  1.00 30.96  ? 198 PHE B CA  1 
ATOM   2414 C C   . PHE B 1 10  ? -29.317 -6.170  23.705  1.00 33.80  ? 198 PHE B C   1 
ATOM   2415 O O   . PHE B 1 10  ? -30.414 -5.676  23.956  1.00 30.49  ? 198 PHE B O   1 
ATOM   2416 C CB  . PHE B 1 10  ? -28.055 -4.276  22.622  1.00 27.45  ? 198 PHE B CB  1 
ATOM   2417 C CG  . PHE B 1 10  ? -27.013 -4.071  23.675  1.00 29.70  ? 198 PHE B CG  1 
ATOM   2418 C CD1 . PHE B 1 10  ? -27.376 -3.904  25.005  1.00 33.73  ? 198 PHE B CD1 1 
ATOM   2419 C CD2 . PHE B 1 10  ? -25.669 -4.009  23.334  1.00 36.12  ? 198 PHE B CD2 1 
ATOM   2420 C CE1 . PHE B 1 10  ? -26.422 -3.699  25.983  1.00 35.96  ? 198 PHE B CE1 1 
ATOM   2421 C CE2 . PHE B 1 10  ? -24.699 -3.799  24.311  1.00 39.39  ? 198 PHE B CE2 1 
ATOM   2422 C CZ  . PHE B 1 10  ? -25.079 -3.645  25.636  1.00 37.62  ? 198 PHE B CZ  1 
ATOM   2423 N N   . CYS B 1 11  ? -28.755 -7.098  24.477  1.00 32.42  ? 199 CYS B N   1 
ATOM   2424 C CA  . CYS B 1 11  ? -29.432 -7.610  25.672  1.00 35.04  ? 199 CYS B CA  1 
ATOM   2425 C C   . CYS B 1 11  ? -28.824 -7.081  26.979  1.00 38.53  ? 199 CYS B C   1 
ATOM   2426 O O   . CYS B 1 11  ? -27.693 -7.418  27.318  1.00 39.53  ? 199 CYS B O   1 
ATOM   2427 C CB  . CYS B 1 11  ? -29.406 -9.141  25.674  1.00 35.81  ? 199 CYS B CB  1 
ATOM   2428 S SG  . CYS B 1 11  ? -30.138 -9.909  27.148  1.00 41.03  ? 199 CYS B SG  1 
ATOM   2429 N N   . TRP B 1 12  ? -29.583 -6.263  27.710  1.00 38.34  ? 200 TRP B N   1 
ATOM   2430 C CA  . TRP B 1 12  ? -29.133 -5.709  28.995  1.00 37.24  ? 200 TRP B CA  1 
ATOM   2431 C C   . TRP B 1 12  ? -29.341 -6.686  30.154  1.00 39.59  ? 200 TRP B C   1 
ATOM   2432 O O   . TRP B 1 12  ? -30.439 -7.208  30.336  1.00 41.42  ? 200 TRP B O   1 
ATOM   2433 C CB  . TRP B 1 12  ? -29.874 -4.404  29.326  1.00 30.45  ? 200 TRP B CB  1 
ATOM   2434 C CG  . TRP B 1 12  ? -29.498 -3.208  28.504  1.00 29.88  ? 200 TRP B CG  1 
ATOM   2435 C CD1 . TRP B 1 12  ? -30.110 -2.773  27.362  1.00 26.30  ? 200 TRP B CD1 1 
ATOM   2436 C CD2 . TRP B 1 12  ? -28.446 -2.272  28.775  1.00 31.04  ? 200 TRP B CD2 1 
ATOM   2437 N NE1 . TRP B 1 12  ? -29.498 -1.632  26.901  1.00 24.99  ? 200 TRP B NE1 1 
ATOM   2438 C CE2 . TRP B 1 12  ? -28.474 -1.303  27.751  1.00 29.62  ? 200 TRP B CE2 1 
ATOM   2439 C CE3 . TRP B 1 12  ? -27.479 -2.162  29.781  1.00 29.90  ? 200 TRP B CE3 1 
ATOM   2440 C CZ2 . TRP B 1 12  ? -27.571 -0.242  27.700  1.00 30.56  ? 200 TRP B CZ2 1 
ATOM   2441 C CZ3 . TRP B 1 12  ? -26.583 -1.107  29.731  1.00 30.38  ? 200 TRP B CZ3 1 
ATOM   2442 C CH2 . TRP B 1 12  ? -26.635 -0.161  28.698  1.00 32.63  ? 200 TRP B CH2 1 
ATOM   2443 N N   . PRO B 1 13  ? -28.289 -6.927  30.952  1.00 37.02  ? 201 PRO B N   1 
ATOM   2444 C CA  . PRO B 1 13  ? -28.481 -7.695  32.188  1.00 38.32  ? 201 PRO B CA  1 
ATOM   2445 C C   . PRO B 1 13  ? -29.363 -6.933  33.180  1.00 43.20  ? 201 PRO B C   1 
ATOM   2446 O O   . PRO B 1 13  ? -29.216 -5.717  33.338  1.00 42.75  ? 201 PRO B O   1 
ATOM   2447 C CB  . PRO B 1 13  ? -27.058 -7.871  32.727  1.00 39.66  ? 201 PRO B CB  1 
ATOM   2448 C CG  . PRO B 1 13  ? -26.271 -6.786  32.097  1.00 41.20  ? 201 PRO B CG  1 
ATOM   2449 C CD  . PRO B 1 13  ? -26.887 -6.528  30.755  1.00 38.53  ? 201 PRO B CD  1 
ATOM   2450 N N   . LEU B 1 14  ? -30.271 -7.648  33.835  1.00 41.25  ? 202 LEU B N   1 
ATOM   2451 C CA  . LEU B 1 14  ? -31.252 -7.031  34.722  1.00 42.80  ? 202 LEU B CA  1 
ATOM   2452 C C   . LEU B 1 14  ? -30.604 -6.263  35.870  1.00 48.41  ? 202 LEU B C   1 
ATOM   2453 O O   . LEU B 1 14  ? -31.161 -5.281  36.361  1.00 47.09  ? 202 LEU B O   1 
ATOM   2454 C CB  . LEU B 1 14  ? -32.201 -8.095  35.279  1.00 40.14  ? 202 LEU B CB  1 
ATOM   2455 C CG  . LEU B 1 14  ? -33.302 -7.611  36.222  1.00 43.36  ? 202 LEU B CG  1 
ATOM   2456 C CD1 . LEU B 1 14  ? -34.129 -6.512  35.568  1.00 39.03  ? 202 LEU B CD1 1 
ATOM   2457 C CD2 . LEU B 1 14  ? -34.194 -8.774  36.648  1.00 47.44  ? 202 LEU B CD2 1 
ATOM   2458 N N   . CYS B 1 15  ? -29.421 -6.704  36.288  1.00 45.16  ? 203 CYS B N   1 
ATOM   2459 C CA  . CYS B 1 15  ? -28.735 -6.069  37.405  1.00 45.43  ? 203 CYS B CA  1 
ATOM   2460 C C   . CYS B 1 15  ? -28.361 -4.623  37.072  1.00 42.80  ? 203 CYS B C   1 
ATOM   2461 O O   . CYS B 1 15  ? -28.460 -3.738  37.926  1.00 42.93  ? 203 CYS B O   1 
ATOM   2462 C CB  . CYS B 1 15  ? -27.492 -6.878  37.811  1.00 47.55  ? 203 CYS B CB  1 
ATOM   2463 S SG  . CYS B 1 15  ? -26.129 -6.909  36.615  1.00 51.77  ? 203 CYS B SG  1 
ATOM   2464 N N   . GLU B 1 16  ? -27.960 -4.376  35.828  1.00 41.99  ? 204 GLU B N   1 
ATOM   2465 C CA  . GLU B 1 16  ? -27.579 -3.028  35.419  1.00 37.60  ? 204 GLU B CA  1 
ATOM   2466 C C   . GLU B 1 16  ? -28.785 -2.102  35.342  1.00 35.96  ? 204 GLU B C   1 
ATOM   2467 O O   . GLU B 1 16  ? -28.685 -0.917  35.657  1.00 34.35  ? 204 GLU B O   1 
ATOM   2468 C CB  . GLU B 1 16  ? -26.861 -3.047  34.072  1.00 38.50  ? 204 GLU B CB  1 
ATOM   2469 C CG  . GLU B 1 16  ? -25.414 -3.494  34.140  1.00 43.58  ? 204 GLU B CG  1 
ATOM   2470 C CD  . GLU B 1 16  ? -24.663 -3.196  32.858  1.00 46.28  ? 204 GLU B CD  1 
ATOM   2471 O OE1 . GLU B 1 16  ? -24.361 -4.151  32.112  1.00 48.66  ? 204 GLU B OE1 1 
ATOM   2472 O OE2 . GLU B 1 16  ? -24.376 -2.007  32.595  1.00 42.52  ? 204 GLU B OE2 1 
ATOM   2473 N N   . ILE B 1 17  ? -29.919 -2.639  34.911  1.00 33.10  ? 205 ILE B N   1 
ATOM   2474 C CA  . ILE B 1 17  ? -31.137 -1.844  34.819  1.00 34.99  ? 205 ILE B CA  1 
ATOM   2475 C C   . ILE B 1 17  ? -31.675 -1.530  36.212  1.00 39.19  ? 205 ILE B C   1 
ATOM   2476 O O   . ILE B 1 17  ? -32.132 -0.417  36.481  1.00 38.31  ? 205 ILE B O   1 
ATOM   2477 C CB  . ILE B 1 17  ? -32.216 -2.565  34.000  1.00 37.25  ? 205 ILE B CB  1 
ATOM   2478 C CG1 . ILE B 1 17  ? -31.727 -2.770  32.567  1.00 41.46  ? 205 ILE B CG1 1 
ATOM   2479 C CG2 . ILE B 1 17  ? -33.519 -1.776  34.010  1.00 35.02  ? 205 ILE B CG2 1 
ATOM   2480 C CD1 . ILE B 1 17  ? -32.752 -3.394  31.671  1.00 48.26  ? 205 ILE B CD1 1 
ATOM   2481 N N   . SER B 1 18  ? -31.607 -2.521  37.093  1.00 39.40  ? 206 SER B N   1 
ATOM   2482 C CA  . SER B 1 18  ? -32.014 -2.349  38.478  1.00 45.26  ? 206 SER B CA  1 
ATOM   2483 C C   . SER B 1 18  ? -31.167 -1.267  39.139  1.00 41.31  ? 206 SER B C   1 
ATOM   2484 O O   . SER B 1 18  ? -31.698 -0.333  39.736  1.00 41.15  ? 206 SER B O   1 
ATOM   2485 C CB  . SER B 1 18  ? -31.890 -3.672  39.239  1.00 49.90  ? 206 SER B CB  1 
ATOM   2486 O OG  . SER B 1 18  ? -32.331 -3.527  40.577  1.00 57.93  ? 206 SER B OG  1 
ATOM   2487 N N   . ARG B 1 19  ? -29.849 -1.396  39.007  1.00 36.94  ? 207 ARG B N   1 
ATOM   2488 C CA  . ARG B 1 19  ? -28.911 -0.409  39.538  1.00 39.55  ? 207 ARG B CA  1 
ATOM   2489 C C   . ARG B 1 19  ? -29.128 0.985   38.949  1.00 36.05  ? 207 ARG B C   1 
ATOM   2490 O O   . ARG B 1 19  ? -29.067 1.985   39.662  1.00 37.53  ? 207 ARG B O   1 
ATOM   2491 C CB  . ARG B 1 19  ? -27.473 -0.858  39.270  1.00 49.17  ? 207 ARG B CB  1 
ATOM   2492 C CG  . ARG B 1 19  ? -26.405 0.034   39.880  1.00 60.09  ? 207 ARG B CG  1 
ATOM   2493 C CD  . ARG B 1 19  ? -25.090 -0.129  39.132  1.00 72.49  ? 207 ARG B CD  1 
ATOM   2494 N NE  . ARG B 1 19  ? -24.824 -1.528  38.801  1.00 83.34  ? 207 ARG B NE  1 
ATOM   2495 C CZ  . ARG B 1 19  ? -23.951 -1.929  37.881  1.00 90.27  ? 207 ARG B CZ  1 
ATOM   2496 N NH1 . ARG B 1 19  ? -23.255 -1.037  37.188  1.00 91.13  ? 207 ARG B NH1 1 
ATOM   2497 N NH2 . ARG B 1 19  ? -23.778 -3.224  37.650  1.00 93.63  ? 207 ARG B NH2 1 
ATOM   2498 N N   . GLY B 1 20  ? -29.377 1.047   37.646  1.00 35.53  ? 208 GLY B N   1 
ATOM   2499 C CA  . GLY B 1 20  ? -29.519 2.316   36.956  1.00 33.60  ? 208 GLY B CA  1 
ATOM   2500 C C   . GLY B 1 20  ? -30.825 3.031   37.245  1.00 36.67  ? 208 GLY B C   1 
ATOM   2501 O O   . GLY B 1 20  ? -30.932 4.238   37.037  1.00 36.62  ? 208 GLY B O   1 
ATOM   2502 N N   . THR B 1 21  ? -31.834 2.277   37.675  1.00 35.90  ? 209 THR B N   1 
ATOM   2503 C CA  . THR B 1 21  ? -33.115 2.851   38.078  1.00 38.40  ? 209 THR B CA  1 
ATOM   2504 C C   . THR B 1 21  ? -33.272 2.996   39.594  1.00 43.22  ? 209 THR B C   1 
ATOM   2505 O O   . THR B 1 21  ? -34.349 3.359   40.069  1.00 43.30  ? 209 THR B O   1 
ATOM   2506 C CB  . THR B 1 21  ? -34.292 2.025   37.542  1.00 37.23  ? 209 THR B CB  1 
ATOM   2507 O OG1 . THR B 1 21  ? -34.161 0.667   37.973  1.00 39.65  ? 209 THR B OG1 1 
ATOM   2508 C CG2 . THR B 1 21  ? -34.321 2.073   36.019  1.00 37.49  ? 209 THR B CG2 1 
ATOM   2509 N N   . HIS B 1 22  ? -32.215 2.687   40.343  1.00 40.88  ? 210 HIS B N   1 
ATOM   2510 C CA  . HIS B 1 22  ? -32.285 2.625   41.805  1.00 44.18  ? 210 HIS B CA  1 
ATOM   2511 C C   . HIS B 1 22  ? -33.383 1.648   42.219  1.00 46.57  ? 210 HIS B C   1 
ATOM   2512 O O   . HIS B 1 22  ? -34.275 1.986   43.001  1.00 44.65  ? 210 HIS B O   1 
ATOM   2513 C CB  . HIS B 1 22  ? -32.530 4.010   42.420  1.00 46.35  ? 210 HIS B CB  1 
ATOM   2514 C CG  . HIS B 1 22  ? -31.352 4.930   42.326  1.00 56.11  ? 210 HIS B CG  1 
ATOM   2515 N ND1 . HIS B 1 22  ? -31.328 6.026   41.489  1.00 62.87  ? 210 HIS B ND1 1 
ATOM   2516 C CD2 . HIS B 1 22  ? -30.156 4.913   42.957  1.00 62.36  ? 210 HIS B CD2 1 
ATOM   2517 C CE1 . HIS B 1 22  ? -30.167 6.645   41.612  1.00 62.74  ? 210 HIS B CE1 1 
ATOM   2518 N NE2 . HIS B 1 22  ? -29.436 5.991   42.495  1.00 63.05  ? 210 HIS B NE2 1 
ATOM   2519 N N   . ASN B 1 23  ? -33.302 0.441   41.663  1.00 47.63  ? 211 ASN B N   1 
ATOM   2520 C CA  . ASN B 1 23  ? -34.280 -0.621  41.880  1.00 50.42  ? 211 ASN B CA  1 
ATOM   2521 C C   . ASN B 1 23  ? -35.703 -0.186  41.549  1.00 48.81  ? 211 ASN B C   1 
ATOM   2522 O O   . ASN B 1 23  ? -36.622 -0.378  42.347  1.00 51.37  ? 211 ASN B O   1 
ATOM   2523 C CB  . ASN B 1 23  ? -34.204 -1.126  43.320  1.00 59.87  ? 211 ASN B CB  1 
ATOM   2524 C CG  . ASN B 1 23  ? -32.826 -1.655  43.676  1.00 71.94  ? 211 ASN B CG  1 
ATOM   2525 O OD1 . ASN B 1 23  ? -32.456 -2.764  43.288  1.00 76.38  ? 211 ASN B OD1 1 
ATOM   2526 N ND2 . ASN B 1 23  ? -32.058 -0.862  44.417  1.00 75.55  ? 211 ASN B ND2 1 
ATOM   2527 N N   . PHE B 1 24  ? -35.864 0.394   40.361  1.00 46.76  ? 212 PHE B N   1 
ATOM   2528 C CA  . PHE B 1 24  ? -37.152 0.880   39.871  1.00 45.86  ? 212 PHE B CA  1 
ATOM   2529 C C   . PHE B 1 24  ? -37.842 1.773   40.890  1.00 48.49  ? 212 PHE B C   1 
ATOM   2530 O O   . PHE B 1 24  ? -39.032 1.618   41.163  1.00 49.91  ? 212 PHE B O   1 
ATOM   2531 C CB  . PHE B 1 24  ? -38.062 -0.290  39.492  1.00 44.06  ? 212 PHE B CB  1 
ATOM   2532 C CG  . PHE B 1 24  ? -37.508 -1.146  38.397  1.00 47.17  ? 212 PHE B CG  1 
ATOM   2533 C CD1 . PHE B 1 24  ? -37.666 -0.785  37.071  1.00 47.72  ? 212 PHE B CD1 1 
ATOM   2534 C CD2 . PHE B 1 24  ? -36.813 -2.307  38.692  1.00 51.61  ? 212 PHE B CD2 1 
ATOM   2535 C CE1 . PHE B 1 24  ? -37.148 -1.570  36.056  1.00 48.00  ? 212 PHE B CE1 1 
ATOM   2536 C CE2 . PHE B 1 24  ? -36.294 -3.095  37.684  1.00 52.87  ? 212 PHE B CE2 1 
ATOM   2537 C CZ  . PHE B 1 24  ? -36.463 -2.724  36.362  1.00 50.07  ? 212 PHE B CZ  1 
ATOM   2538 N N   . SER B 1 25  ? -37.075 2.701   41.452  1.00 46.58  ? 213 SER B N   1 
ATOM   2539 C CA  . SER B 1 25  ? -37.612 3.697   42.365  1.00 47.63  ? 213 SER B CA  1 
ATOM   2540 C C   . SER B 1 25  ? -38.709 4.515   41.698  1.00 47.38  ? 213 SER B C   1 
ATOM   2541 O O   . SER B 1 25  ? -38.552 4.973   40.563  1.00 41.03  ? 213 SER B O   1 
ATOM   2542 C CB  . SER B 1 25  ? -36.505 4.628   42.856  1.00 51.14  ? 213 SER B CB  1 
ATOM   2543 O OG  . SER B 1 25  ? -37.054 5.741   43.540  1.00 56.72  ? 213 SER B OG  1 
ATOM   2544 N N   . GLU B 1 26  ? -39.814 4.699   42.416  1.00 47.67  ? 214 GLU B N   1 
ATOM   2545 C CA  . GLU B 1 26  ? -40.927 5.516   41.941  1.00 51.34  ? 214 GLU B CA  1 
ATOM   2546 C C   . GLU B 1 26  ? -40.473 6.955   41.680  1.00 48.72  ? 214 GLU B C   1 
ATOM   2547 O O   . GLU B 1 26  ? -41.088 7.678   40.896  1.00 49.06  ? 214 GLU B O   1 
ATOM   2548 C CB  . GLU B 1 26  ? -42.077 5.498   42.957  1.00 54.53  ? 214 GLU B CB  1 
ATOM   2549 C CG  . GLU B 1 26  ? -42.573 4.102   43.334  1.00 59.34  ? 214 GLU B CG  1 
ATOM   2550 C CD  . GLU B 1 26  ? -43.536 3.517   42.312  1.00 64.04  ? 214 GLU B CD  1 
ATOM   2551 O OE1 . GLU B 1 26  ? -44.257 4.296   41.659  1.00 65.45  ? 214 GLU B OE1 1 
ATOM   2552 O OE2 . GLU B 1 26  ? -43.579 2.277   42.163  1.00 67.08  ? 214 GLU B OE2 1 
ATOM   2553 N N   . GLU B 1 27  ? -39.387 7.359   42.332  1.00 43.96  ? 215 GLU B N   1 
ATOM   2554 C CA  . GLU B 1 27  ? -38.854 8.709   42.182  1.00 46.72  ? 215 GLU B CA  1 
ATOM   2555 C C   . GLU B 1 27  ? -38.147 8.921   40.844  1.00 45.79  ? 215 GLU B C   1 
ATOM   2556 O O   . GLU B 1 27  ? -37.975 10.057  40.402  1.00 47.61  ? 215 GLU B O   1 
ATOM   2557 C CB  . GLU B 1 27  ? -37.898 9.020   43.333  1.00 52.27  ? 215 GLU B CB  1 
ATOM   2558 C CG  . GLU B 1 27  ? -38.572 9.001   44.692  1.00 61.06  ? 215 GLU B CG  1 
ATOM   2559 C CD  . GLU B 1 27  ? -37.672 8.463   45.780  1.00 69.31  ? 215 GLU B CD  1 
ATOM   2560 O OE1 . GLU B 1 27  ? -36.582 9.037   45.986  1.00 70.91  ? 215 GLU B OE1 1 
ATOM   2561 O OE2 . GLU B 1 27  ? -38.053 7.461   46.424  1.00 74.40  ? 215 GLU B OE2 1 
ATOM   2562 N N   . LEU B 1 28  ? -37.736 7.834   40.198  1.00 44.81  ? 216 LEU B N   1 
ATOM   2563 C CA  . LEU B 1 28  ? -37.106 7.938   38.886  1.00 42.16  ? 216 LEU B CA  1 
ATOM   2564 C C   . LEU B 1 28  ? -38.125 7.770   37.761  1.00 38.85  ? 216 LEU B C   1 
ATOM   2565 O O   . LEU B 1 28  ? -37.765 7.783   36.582  1.00 37.89  ? 216 LEU B O   1 
ATOM   2566 C CB  . LEU B 1 28  ? -35.984 6.904   38.734  1.00 43.35  ? 216 LEU B CB  1 
ATOM   2567 C CG  . LEU B 1 28  ? -34.752 7.090   39.623  1.00 47.62  ? 216 LEU B CG  1 
ATOM   2568 C CD1 . LEU B 1 28  ? -33.547 6.419   38.993  1.00 50.48  ? 216 LEU B CD1 1 
ATOM   2569 C CD2 . LEU B 1 28  ? -34.473 8.560   39.872  1.00 49.39  ? 216 LEU B CD2 1 
ATOM   2570 N N   . LYS B 1 29  ? -39.397 7.636   38.127  1.00 37.27  ? 217 LYS B N   1 
ATOM   2571 C CA  . LYS B 1 29  ? -40.448 7.411   37.142  1.00 39.07  ? 217 LYS B CA  1 
ATOM   2572 C C   . LYS B 1 29  ? -40.783 8.714   36.425  1.00 38.55  ? 217 LYS B C   1 
ATOM   2573 O O   . LYS B 1 29  ? -41.165 9.698   37.056  1.00 36.73  ? 217 LYS B O   1 
ATOM   2574 C CB  . LYS B 1 29  ? -41.700 6.844   37.818  1.00 39.90  ? 217 LYS B CB  1 
ATOM   2575 C CG  . LYS B 1 29  ? -42.751 6.315   36.861  1.00 49.86  ? 217 LYS B CG  1 
ATOM   2576 C CD  . LYS B 1 29  ? -44.117 6.219   37.528  1.00 58.28  ? 217 LYS B CD  1 
ATOM   2577 C CE  . LYS B 1 29  ? -44.083 5.321   38.748  1.00 65.33  ? 217 LYS B CE  1 
ATOM   2578 N NZ  . LYS B 1 29  ? -43.709 3.916   38.413  1.00 68.28  ? 217 LYS B NZ  1 
ATOM   2579 N N   . ILE B 1 30  ? -40.576 8.737   35.111  1.00 39.64  ? 218 ILE B N   1 
ATOM   2580 C CA  . ILE B 1 30  ? -40.921 9.905   34.309  1.00 34.82  ? 218 ILE B CA  1 
ATOM   2581 C C   . ILE B 1 30  ? -42.218 9.757   33.511  1.00 40.75  ? 218 ILE B C   1 
ATOM   2582 O O   . ILE B 1 30  ? -42.667 10.710  32.871  1.00 42.96  ? 218 ILE B O   1 
ATOM   2583 C CB  . ILE B 1 30  ? -39.778 10.255  33.349  1.00 32.89  ? 218 ILE B CB  1 
ATOM   2584 C CG1 . ILE B 1 30  ? -39.532 9.107   32.367  1.00 32.40  ? 218 ILE B CG1 1 
ATOM   2585 C CG2 . ILE B 1 30  ? -38.512 10.560  34.139  1.00 27.42  ? 218 ILE B CG2 1 
ATOM   2586 C CD1 . ILE B 1 30  ? -38.339 9.322   31.461  1.00 28.71  ? 218 ILE B CD1 1 
ATOM   2587 N N   . GLY B 1 31  ? -42.825 8.576   33.544  1.00 41.53  ? 219 GLY B N   1 
ATOM   2588 C CA  . GLY B 1 31  ? -44.094 8.401   32.853  1.00 39.64  ? 219 GLY B CA  1 
ATOM   2589 C C   . GLY B 1 31  ? -44.843 7.148   33.256  1.00 42.47  ? 219 GLY B C   1 
ATOM   2590 O O   . GLY B 1 31  ? -44.241 6.202   33.743  1.00 39.27  ? 219 GLY B O   1 
ATOM   2591 N N   . GLU B 1 32  ? -46.159 7.141   33.068  1.00 43.12  ? 220 GLU B N   1 
ATOM   2592 C CA  . GLU B 1 32  ? -46.950 5.951   33.368  1.00 53.53  ? 220 GLU B CA  1 
ATOM   2593 C C   . GLU B 1 32  ? -48.217 5.910   32.519  1.00 59.23  ? 220 GLU B C   1 
ATOM   2594 O O   . GLU B 1 32  ? -48.742 6.948   32.121  1.00 61.27  ? 220 GLU B O   1 
ATOM   2595 C CB  . GLU B 1 32  ? -47.303 5.899   34.860  1.00 59.58  ? 220 GLU B CB  1 
ATOM   2596 C CG  . GLU B 1 32  ? -47.917 4.576   35.312  1.00 64.29  ? 220 GLU B CG  1 
ATOM   2597 C CD  . GLU B 1 32  ? -47.911 4.401   36.819  1.00 68.88  ? 220 GLU B CD  1 
ATOM   2598 O OE1 . GLU B 1 32  ? -47.469 5.330   37.530  1.00 71.97  ? 220 GLU B OE1 1 
ATOM   2599 O OE2 . GLU B 1 32  ? -48.345 3.328   37.291  1.00 68.86  ? 220 GLU B OE2 1 
ATOM   2600 N N   . GLY B 1 33  ? -48.706 4.704   32.257  1.00 62.07  ? 221 GLY B N   1 
ATOM   2601 C CA  . GLY B 1 33  ? -49.894 4.507   31.448  1.00 62.93  ? 221 GLY B CA  1 
ATOM   2602 C C   . GLY B 1 33  ? -50.419 3.092   31.592  1.00 63.19  ? 221 GLY B C   1 
ATOM   2603 O O   . GLY B 1 33  ? -50.041 2.375   32.519  1.00 57.36  ? 221 GLY B O   1 
ATOM   2604 N N   . GLY B 1 34  ? -51.305 2.695   30.684  1.00 65.62  ? 222 GLY B N   1 
ATOM   2605 C CA  . GLY B 1 34  ? -51.829 1.342   30.673  1.00 67.40  ? 222 GLY B CA  1 
ATOM   2606 C C   . GLY B 1 34  ? -50.789 0.313   30.261  1.00 67.10  ? 222 GLY B C   1 
ATOM   2607 O O   . GLY B 1 34  ? -50.848 -0.842  30.682  1.00 66.92  ? 222 GLY B O   1 
ATOM   2608 N N   . PHE B 1 35  ? -49.835 0.738   29.437  1.00 61.07  ? 223 PHE B N   1 
ATOM   2609 C CA  . PHE B 1 35  ? -48.770 -0.139  28.953  1.00 60.04  ? 223 PHE B CA  1 
ATOM   2610 C C   . PHE B 1 35  ? -47.788 -0.525  30.056  1.00 52.14  ? 223 PHE B C   1 
ATOM   2611 O O   . PHE B 1 35  ? -47.287 -1.649  30.094  1.00 51.09  ? 223 PHE B O   1 
ATOM   2612 C CB  . PHE B 1 35  ? -48.008 0.534   27.803  1.00 65.62  ? 223 PHE B CB  1 
ATOM   2613 C CG  . PHE B 1 35  ? -47.353 1.841   28.184  1.00 67.09  ? 223 PHE B CG  1 
ATOM   2614 C CD1 . PHE B 1 35  ? -48.067 3.030   28.145  1.00 67.69  ? 223 PHE B CD1 1 
ATOM   2615 C CD2 . PHE B 1 35  ? -46.025 1.879   28.579  1.00 64.97  ? 223 PHE B CD2 1 
ATOM   2616 C CE1 . PHE B 1 35  ? -47.467 4.230   28.496  1.00 66.79  ? 223 PHE B CE1 1 
ATOM   2617 C CE2 . PHE B 1 35  ? -45.423 3.077   28.931  1.00 64.65  ? 223 PHE B CE2 1 
ATOM   2618 C CZ  . PHE B 1 35  ? -46.144 4.252   28.888  1.00 64.98  ? 223 PHE B CZ  1 
ATOM   2619 N N   . GLY B 1 36  ? -47.510 0.420   30.945  1.00 58.26  ? 224 GLY B N   1 
ATOM   2620 C CA  . GLY B 1 36  ? -46.488 0.237   31.955  1.00 55.12  ? 224 GLY B CA  1 
ATOM   2621 C C   . GLY B 1 36  ? -45.921 1.571   32.400  1.00 51.28  ? 224 GLY B C   1 
ATOM   2622 O O   . GLY B 1 36  ? -46.581 2.603   32.284  1.00 50.66  ? 224 GLY B O   1 
ATOM   2623 N N   . CYS B 1 37  ? -44.695 1.549   32.912  1.00 45.43  ? 225 CYS B N   1 
ATOM   2624 C CA  . CYS B 1 37  ? -44.063 2.759   33.422  1.00 44.25  ? 225 CYS B CA  1 
ATOM   2625 C C   . CYS B 1 37  ? -42.768 3.059   32.681  1.00 40.16  ? 225 CYS B C   1 
ATOM   2626 O O   . CYS B 1 37  ? -42.131 2.162   32.145  1.00 38.29  ? 225 CYS B O   1 
ATOM   2627 C CB  . CYS B 1 37  ? -43.786 2.626   34.924  1.00 46.84  ? 225 CYS B CB  1 
ATOM   2628 S SG  . CYS B 1 37  ? -45.146 1.909   35.871  1.00 64.67  ? 225 CYS B SG  1 
ATOM   2629 N N   . VAL B 1 38  ? -42.385 4.329   32.655  1.00 40.00  ? 226 VAL B N   1 
ATOM   2630 C CA  . VAL B 1 38  ? -41.128 4.746   32.055  1.00 36.56  ? 226 VAL B CA  1 
ATOM   2631 C C   . VAL B 1 38  ? -40.266 5.475   33.078  1.00 40.28  ? 226 VAL B C   1 
ATOM   2632 O O   . VAL B 1 38  ? -40.722 6.439   33.716  1.00 47.04  ? 226 VAL B O   1 
ATOM   2633 C CB  . VAL B 1 38  ? -41.349 5.662   30.843  1.00 33.18  ? 226 VAL B CB  1 
ATOM   2634 C CG1 . VAL B 1 38  ? -40.018 5.956   30.156  1.00 29.04  ? 226 VAL B CG1 1 
ATOM   2635 C CG2 . VAL B 1 38  ? -42.321 5.023   29.870  1.00 39.40  ? 226 VAL B CG2 1 
ATOM   2636 N N   . TYR B 1 39  ? -39.021 5.016   33.204  1.00 35.67  ? 227 TYR B N   1 
ATOM   2637 C CA  . TYR B 1 39  ? -38.063 5.554   34.162  1.00 32.65  ? 227 TYR B CA  1 
ATOM   2638 C C   . TYR B 1 39  ? -36.903 6.243   33.450  1.00 36.02  ? 227 TYR B C   1 
ATOM   2639 O O   . TYR B 1 39  ? -36.597 5.931   32.302  1.00 39.16  ? 227 TYR B O   1 
ATOM   2640 C CB  . TYR B 1 39  ? -37.499 4.446   35.062  1.00 30.60  ? 227 TYR B CB  1 
ATOM   2641 C CG  . TYR B 1 39  ? -38.522 3.571   35.754  1.00 35.34  ? 227 TYR B CG  1 
ATOM   2642 C CD1 . TYR B 1 39  ? -39.099 2.492   35.098  1.00 34.13  ? 227 TYR B CD1 1 
ATOM   2643 C CD2 . TYR B 1 39  ? -38.884 3.804   37.077  1.00 38.22  ? 227 TYR B CD2 1 
ATOM   2644 C CE1 . TYR B 1 39  ? -40.028 1.680   35.732  1.00 42.44  ? 227 TYR B CE1 1 
ATOM   2645 C CE2 . TYR B 1 39  ? -39.810 2.999   37.720  1.00 42.21  ? 227 TYR B CE2 1 
ATOM   2646 C CZ  . TYR B 1 39  ? -40.379 1.938   37.042  1.00 45.21  ? 227 TYR B CZ  1 
ATOM   2647 O OH  . TYR B 1 39  ? -41.299 1.131   37.674  1.00 45.02  ? 227 TYR B OH  1 
ATOM   2648 N N   . ARG B 1 40  ? -36.261 7.183   34.134  1.00 33.31  ? 228 ARG B N   1 
ATOM   2649 C CA  . ARG B 1 40  ? -34.967 7.693   33.695  1.00 32.63  ? 228 ARG B CA  1 
ATOM   2650 C C   . ARG B 1 40  ? -33.878 6.885   34.385  1.00 33.19  ? 228 ARG B C   1 
ATOM   2651 O O   . ARG B 1 40  ? -33.898 6.720   35.605  1.00 38.03  ? 228 ARG B O   1 
ATOM   2652 C CB  . ARG B 1 40  ? -34.814 9.179   34.013  1.00 33.65  ? 228 ARG B CB  1 
ATOM   2653 C CG  . ARG B 1 40  ? -33.519 9.804   33.517  1.00 34.09  ? 228 ARG B CG  1 
ATOM   2654 C CD  . ARG B 1 40  ? -33.413 11.243  34.004  1.00 38.09  ? 228 ARG B CD  1 
ATOM   2655 N NE  . ARG B 1 40  ? -32.190 11.913  33.563  1.00 40.25  ? 228 ARG B NE  1 
ATOM   2656 C CZ  . ARG B 1 40  ? -31.012 11.790  34.166  1.00 40.29  ? 228 ARG B CZ  1 
ATOM   2657 N NH1 . ARG B 1 40  ? -30.887 11.005  35.228  1.00 40.78  ? 228 ARG B NH1 1 
ATOM   2658 N NH2 . ARG B 1 40  ? -29.955 12.444  33.703  1.00 40.68  ? 228 ARG B NH2 1 
ATOM   2659 N N   . ALA B 1 41  ? -32.937 6.373   33.603  1.00 28.13  ? 229 ALA B N   1 
ATOM   2660 C CA  . ALA B 1 41  ? -31.882 5.525   34.137  1.00 31.79  ? 229 ALA B CA  1 
ATOM   2661 C C   . ALA B 1 41  ? -30.514 5.984   33.661  1.00 34.95  ? 229 ALA B C   1 
ATOM   2662 O O   . ALA B 1 41  ? -30.388 6.617   32.616  1.00 34.42  ? 229 ALA B O   1 
ATOM   2663 C CB  . ALA B 1 41  ? -32.119 4.076   33.740  1.00 30.39  ? 229 ALA B CB  1 
ATOM   2664 N N   . VAL B 1 42  ? -29.490 5.674   34.445  1.00 36.21  ? 230 VAL B N   1 
ATOM   2665 C CA  . VAL B 1 42  ? -28.115 5.903   34.027  1.00 35.53  ? 230 VAL B CA  1 
ATOM   2666 C C   . VAL B 1 42  ? -27.387 4.567   34.021  1.00 31.83  ? 230 VAL B C   1 
ATOM   2667 O O   . VAL B 1 42  ? -27.292 3.905   35.050  1.00 33.25  ? 230 VAL B O   1 
ATOM   2668 C CB  . VAL B 1 42  ? -27.386 6.900   34.945  1.00 38.04  ? 230 VAL B CB  1 
ATOM   2669 C CG1 . VAL B 1 42  ? -25.927 7.030   34.527  1.00 36.31  ? 230 VAL B CG1 1 
ATOM   2670 C CG2 . VAL B 1 42  ? -28.074 8.257   34.911  1.00 36.67  ? 230 VAL B CG2 1 
ATOM   2671 N N   . MET B 1 43  ? -26.909 4.154   32.851  1.00 29.26  ? 231 MET B N   1 
ATOM   2672 C CA  . MET B 1 43  ? -26.180 2.893   32.721  1.00 30.97  ? 231 MET B CA  1 
ATOM   2673 C C   . MET B 1 43  ? -24.980 3.081   31.808  1.00 33.36  ? 231 MET B C   1 
ATOM   2674 O O   . MET B 1 43  ? -25.089 3.735   30.769  1.00 29.82  ? 231 MET B O   1 
ATOM   2675 C CB  . MET B 1 43  ? -27.086 1.784   32.176  1.00 29.04  ? 231 MET B CB  1 
ATOM   2676 C CG  . MET B 1 43  ? -28.332 1.520   33.013  1.00 31.89  ? 231 MET B CG  1 
ATOM   2677 S SD  . MET B 1 43  ? -29.354 0.195   32.358  1.00 42.20  ? 231 MET B SD  1 
ATOM   2678 C CE  . MET B 1 43  ? -29.861 0.888   30.787  1.00 31.69  ? 231 MET B CE  1 
ATOM   2679 N N   . ARG B 1 44  ? -23.844 2.510   32.206  1.00 38.52  ? 232 ARG B N   1 
ATOM   2680 C CA  . ARG B 1 44  ? -22.589 2.631   31.461  1.00 36.84  ? 232 ARG B CA  1 
ATOM   2681 C C   . ARG B 1 44  ? -22.328 4.083   31.071  1.00 33.36  ? 232 ARG B C   1 
ATOM   2682 O O   . ARG B 1 44  ? -22.033 4.385   29.911  1.00 30.86  ? 232 ARG B O   1 
ATOM   2683 C CB  . ARG B 1 44  ? -22.612 1.719   30.228  1.00 36.37  ? 232 ARG B CB  1 
ATOM   2684 C CG  . ARG B 1 44  ? -22.811 0.254   30.604  1.00 37.36  ? 232 ARG B CG  1 
ATOM   2685 C CD  . ARG B 1 44  ? -22.708 -0.710  29.430  1.00 33.57  ? 232 ARG B CD  1 
ATOM   2686 N NE  . ARG B 1 44  ? -22.976 -2.073  29.885  1.00 36.76  ? 232 ARG B NE  1 
ATOM   2687 C CZ  . ARG B 1 44  ? -22.847 -3.167  29.139  1.00 35.78  ? 232 ARG B CZ  1 
ATOM   2688 N NH1 . ARG B 1 44  ? -22.446 -3.083  27.880  1.00 35.05  ? 232 ARG B NH1 1 
ATOM   2689 N NH2 . ARG B 1 44  ? -23.123 -4.352  29.661  1.00 33.06  ? 232 ARG B NH2 1 
ATOM   2690 N N   . ASN B 1 45  ? -22.483 4.968   32.055  1.00 28.49  ? 233 ASN B N   1 
ATOM   2691 C CA  . ASN B 1 45  ? -22.248 6.405   31.908  1.00 30.27  ? 233 ASN B CA  1 
ATOM   2692 C C   . ASN B 1 45  ? -23.099 7.074   30.829  1.00 32.41  ? 233 ASN B C   1 
ATOM   2693 O O   . ASN B 1 45  ? -22.716 8.104   30.268  1.00 31.53  ? 233 ASN B O   1 
ATOM   2694 C CB  . ASN B 1 45  ? -20.764 6.659   31.643  1.00 27.28  ? 233 ASN B CB  1 
ATOM   2695 C CG  . ASN B 1 45  ? -19.901 6.285   32.830  1.00 32.93  ? 233 ASN B CG  1 
ATOM   2696 O OD1 . ASN B 1 45  ? -20.029 6.867   33.904  1.00 37.12  ? 233 ASN B OD1 1 
ATOM   2697 N ND2 . ASN B 1 45  ? -19.023 5.304   32.647  1.00 34.67  ? 233 ASN B ND2 1 
ATOM   2698 N N   . THR B 1 46  ? -24.272 6.498   30.581  1.00 32.90  ? 234 THR B N   1 
ATOM   2699 C CA  . THR B 1 46  ? -25.183 6.975   29.549  1.00 27.28  ? 234 THR B CA  1 
ATOM   2700 C C   . THR B 1 46  ? -26.614 7.091   30.085  1.00 30.63  ? 234 THR B C   1 
ATOM   2701 O O   . THR B 1 46  ? -27.087 6.220   30.818  1.00 28.45  ? 234 THR B O   1 
ATOM   2702 C CB  . THR B 1 46  ? -25.176 6.038   28.325  1.00 26.43  ? 234 THR B CB  1 
ATOM   2703 O OG1 . THR B 1 46  ? -23.824 5.791   27.910  1.00 30.94  ? 234 THR B OG1 1 
ATOM   2704 C CG2 . THR B 1 46  ? -25.974 6.645   27.173  1.00 23.45  ? 234 THR B CG2 1 
ATOM   2705 N N   . VAL B 1 47  ? -27.296 8.172   29.718  1.00 28.22  ? 235 VAL B N   1 
ATOM   2706 C CA  . VAL B 1 47  ? -28.667 8.405   30.155  1.00 28.46  ? 235 VAL B CA  1 
ATOM   2707 C C   . VAL B 1 47  ? -29.670 7.743   29.206  1.00 32.06  ? 235 VAL B C   1 
ATOM   2708 O O   . VAL B 1 47  ? -29.663 8.004   28.001  1.00 30.17  ? 235 VAL B O   1 
ATOM   2709 C CB  . VAL B 1 47  ? -28.970 9.911   30.247  1.00 29.68  ? 235 VAL B CB  1 
ATOM   2710 C CG1 . VAL B 1 47  ? -30.377 10.145  30.777  1.00 28.05  ? 235 VAL B CG1 1 
ATOM   2711 C CG2 . VAL B 1 47  ? -27.939 10.609  31.133  1.00 27.44  ? 235 VAL B CG2 1 
ATOM   2712 N N   . TYR B 1 48  ? -30.531 6.893   29.764  1.00 27.51  ? 236 TYR B N   1 
ATOM   2713 C CA  . TYR B 1 48  ? -31.540 6.172   29.000  1.00 22.43  ? 236 TYR B CA  1 
ATOM   2714 C C   . TYR B 1 48  ? -32.937 6.363   29.572  1.00 27.73  ? 236 TYR B C   1 
ATOM   2715 O O   . TYR B 1 48  ? -33.098 6.669   30.753  1.00 27.94  ? 236 TYR B O   1 
ATOM   2716 C CB  . TYR B 1 48  ? -31.246 4.669   28.975  1.00 26.04  ? 236 TYR B CB  1 
ATOM   2717 C CG  . TYR B 1 48  ? -29.948 4.256   28.332  1.00 27.21  ? 236 TYR B CG  1 
ATOM   2718 C CD1 . TYR B 1 48  ? -29.831 4.176   26.950  1.00 23.71  ? 236 TYR B CD1 1 
ATOM   2719 C CD2 . TYR B 1 48  ? -28.846 3.908   29.110  1.00 26.71  ? 236 TYR B CD2 1 
ATOM   2720 C CE1 . TYR B 1 48  ? -28.642 3.781   26.355  1.00 25.77  ? 236 TYR B CE1 1 
ATOM   2721 C CE2 . TYR B 1 48  ? -27.657 3.513   28.529  1.00 26.69  ? 236 TYR B CE2 1 
ATOM   2722 C CZ  . TYR B 1 48  ? -27.561 3.451   27.152  1.00 28.43  ? 236 TYR B CZ  1 
ATOM   2723 O OH  . TYR B 1 48  ? -26.382 3.061   26.575  1.00 29.45  ? 236 TYR B OH  1 
ATOM   2724 N N   . ALA B 1 49  ? -33.946 6.154   28.734  1.00 24.20  ? 237 ALA B N   1 
ATOM   2725 C CA  . ALA B 1 49  ? -35.293 5.924   29.226  1.00 26.60  ? 237 ALA B CA  1 
ATOM   2726 C C   . ALA B 1 49  ? -35.533 4.417   29.227  1.00 29.19  ? 237 ALA B C   1 
ATOM   2727 O O   . ALA B 1 49  ? -35.120 3.720   28.301  1.00 29.54  ? 237 ALA B O   1 
ATOM   2728 C CB  . ALA B 1 49  ? -36.331 6.646   28.369  1.00 23.46  ? 237 ALA B CB  1 
ATOM   2729 N N   . VAL B 1 50  ? -36.179 3.916   30.273  1.00 26.50  ? 238 VAL B N   1 
ATOM   2730 C CA  . VAL B 1 50  ? -36.468 2.492   30.384  1.00 29.48  ? 238 VAL B CA  1 
ATOM   2731 C C   . VAL B 1 50  ? -37.963 2.263   30.556  1.00 35.09  ? 238 VAL B C   1 
ATOM   2732 O O   . VAL B 1 50  ? -38.543 2.652   31.572  1.00 38.50  ? 238 VAL B O   1 
ATOM   2733 C CB  . VAL B 1 50  ? -35.724 1.844   31.576  1.00 30.36  ? 238 VAL B CB  1 
ATOM   2734 C CG1 . VAL B 1 50  ? -36.149 0.395   31.742  1.00 30.40  ? 238 VAL B CG1 1 
ATOM   2735 C CG2 . VAL B 1 50  ? -34.217 1.945   31.396  1.00 24.29  ? 238 VAL B CG2 1 
ATOM   2736 N N   . LYS B 1 51  ? -38.578 1.631   29.560  1.00 35.28  ? 239 LYS B N   1 
ATOM   2737 C CA  . LYS B 1 51  ? -39.987 1.269   29.623  1.00 32.31  ? 239 LYS B CA  1 
ATOM   2738 C C   . LYS B 1 51  ? -40.145 -0.141  30.176  1.00 37.04  ? 239 LYS B C   1 
ATOM   2739 O O   . LYS B 1 51  ? -39.613 -1.107  29.632  1.00 38.69  ? 239 LYS B O   1 
ATOM   2740 C CB  . LYS B 1 51  ? -40.652 1.379   28.244  1.00 31.46  ? 239 LYS B CB  1 
ATOM   2741 C CG  . LYS B 1 51  ? -42.139 1.015   28.246  1.00 35.12  ? 239 LYS B CG  1 
ATOM   2742 C CD  . LYS B 1 51  ? -42.871 1.500   26.992  1.00 35.56  ? 239 LYS B CD  1 
ATOM   2743 C CE  . LYS B 1 51  ? -42.592 0.614   25.788  1.00 37.34  ? 239 LYS B CE  1 
ATOM   2744 N NZ  . LYS B 1 51  ? -43.395 1.025   24.599  1.00 36.65  ? 239 LYS B NZ  1 
ATOM   2745 N N   . ARG B 1 52  ? -40.877 -0.237  31.277  1.00 38.85  ? 240 ARG B N   1 
ATOM   2746 C CA  . ARG B 1 52  ? -41.190 -1.501  31.915  1.00 39.28  ? 240 ARG B CA  1 
ATOM   2747 C C   . ARG B 1 52  ? -42.677 -1.797  31.750  1.00 39.49  ? 240 ARG B C   1 
ATOM   2748 O O   . ARG B 1 52  ? -43.526 -1.030  32.213  1.00 40.90  ? 240 ARG B O   1 
ATOM   2749 C CB  . ARG B 1 52  ? -40.806 -1.454  33.392  1.00 39.49  ? 240 ARG B CB  1 
ATOM   2750 C CG  . ARG B 1 52  ? -41.151 -2.700  34.170  1.00 48.60  ? 240 ARG B CG  1 
ATOM   2751 C CD  . ARG B 1 52  ? -40.947 -2.472  35.657  1.00 53.51  ? 240 ARG B CD  1 
ATOM   2752 N NE  . ARG B 1 52  ? -41.395 -3.612  36.446  1.00 59.35  ? 240 ARG B NE  1 
ATOM   2753 C CZ  . ARG B 1 52  ? -41.474 -3.614  37.772  1.00 61.90  ? 240 ARG B CZ  1 
ATOM   2754 N NH1 . ARG B 1 52  ? -41.133 -2.532  38.458  1.00 58.05  ? 240 ARG B NH1 1 
ATOM   2755 N NH2 . ARG B 1 52  ? -41.892 -4.699  38.409  1.00 63.89  ? 240 ARG B NH2 1 
ATOM   2756 N N   . LEU B 1 53  ? -42.985 -2.903  31.078  1.00 37.73  ? 241 LEU B N   1 
ATOM   2757 C CA  . LEU B 1 53  ? -44.367 -3.286  30.803  1.00 41.66  ? 241 LEU B CA  1 
ATOM   2758 C C   . LEU B 1 53  ? -45.019 -3.921  32.029  1.00 47.94  ? 241 LEU B C   1 
ATOM   2759 O O   . LEU B 1 53  ? -44.365 -4.626  32.796  1.00 47.11  ? 241 LEU B O   1 
ATOM   2760 C CB  . LEU B 1 53  ? -44.428 -4.255  29.618  1.00 38.99  ? 241 LEU B CB  1 
ATOM   2761 C CG  . LEU B 1 53  ? -43.833 -3.769  28.295  1.00 43.45  ? 241 LEU B CG  1 
ATOM   2762 C CD1 . LEU B 1 53  ? -43.949 -4.847  27.227  1.00 43.80  ? 241 LEU B CD1 1 
ATOM   2763 C CD2 . LEU B 1 53  ? -44.512 -2.484  27.838  1.00 45.69  ? 241 LEU B CD2 1 
ATOM   2764 N N   . LYS B 1 54  ? -46.316 -3.680  32.198  1.00 51.34  ? 242 LYS B N   1 
ATOM   2765 C CA  . LYS B 1 54  ? -47.059 -4.242  33.323  1.00 57.01  ? 242 LYS B CA  1 
ATOM   2766 C C   . LYS B 1 54  ? -48.031 -5.316  32.845  1.00 59.63  ? 242 LYS B C   1 
ATOM   2767 O O   . LYS B 1 54  ? -48.478 -5.294  31.702  1.00 59.97  ? 242 LYS B O   1 
ATOM   2768 C CB  . LYS B 1 54  ? -47.813 -3.144  34.083  1.00 59.24  ? 242 LYS B CB  1 
ATOM   2769 C CG  . LYS B 1 54  ? -48.805 -2.360  33.237  1.00 62.06  ? 242 LYS B CG  1 
ATOM   2770 C CD  . LYS B 1 54  ? -49.556 -1.323  34.071  1.00 64.22  ? 242 LYS B CD  1 
ATOM   2771 C CE  . LYS B 1 54  ? -48.602 -0.355  34.763  1.00 63.41  ? 242 LYS B CE  1 
ATOM   2772 N NZ  . LYS B 1 54  ? -49.316 0.807   35.366  1.00 61.38  ? 242 LYS B NZ  1 
ATOM   2773 N N   . GLU B 1 55  ? -48.337 -6.266  33.721  1.00 61.72  ? 243 GLU B N   1 
ATOM   2774 C CA  . GLU B 1 55  ? -49.253 -7.355  33.389  1.00 67.98  ? 243 GLU B CA  1 
ATOM   2775 C C   . GLU B 1 55  ? -50.684 -6.866  33.157  1.00 67.58  ? 243 GLU B C   1 
ATOM   2776 O O   . GLU B 1 55  ? -51.202 -6.036  33.905  1.00 68.83  ? 243 GLU B O   1 
ATOM   2777 C CB  . GLU B 1 55  ? -49.241 -8.416  34.495  1.00 76.55  ? 243 GLU B CB  1 
ATOM   2778 C CG  . GLU B 1 55  ? -47.997 -9.302  34.509  1.00 83.85  ? 243 GLU B CG  1 
ATOM   2779 C CD  . GLU B 1 55  ? -46.730 -8.557  34.904  1.00 89.14  ? 243 GLU B CD  1 
ATOM   2780 O OE1 . GLU B 1 55  ? -46.793 -7.699  35.813  1.00 91.05  ? 243 GLU B OE1 1 
ATOM   2781 O OE2 . GLU B 1 55  ? -45.669 -8.829  34.301  1.00 89.52  ? 243 GLU B OE2 1 
ATOM   2782 N N   . TRP B 1 61  ? -50.798 -11.044 29.323  1.00 72.83  ? 249 TRP B N   1 
ATOM   2783 C CA  . TRP B 1 61  ? -50.504 -12.465 29.435  1.00 74.53  ? 249 TRP B CA  1 
ATOM   2784 C C   . TRP B 1 61  ? -49.526 -12.891 28.344  1.00 68.67  ? 249 TRP B C   1 
ATOM   2785 O O   . TRP B 1 61  ? -48.336 -12.555 28.395  1.00 67.62  ? 249 TRP B O   1 
ATOM   2786 C CB  . TRP B 1 61  ? -51.803 -13.282 29.381  1.00 82.35  ? 249 TRP B CB  1 
ATOM   2787 C CG  . TRP B 1 61  ? -52.910 -12.701 28.509  1.00 85.73  ? 249 TRP B CG  1 
ATOM   2788 C CD1 . TRP B 1 61  ? -53.366 -13.212 27.325  1.00 86.08  ? 249 TRP B CD1 1 
ATOM   2789 C CD2 . TRP B 1 61  ? -53.709 -11.530 28.770  1.00 86.27  ? 249 TRP B CD2 1 
ATOM   2790 N NE1 . TRP B 1 61  ? -54.385 -12.435 26.829  1.00 86.63  ? 249 TRP B NE1 1 
ATOM   2791 C CE2 . TRP B 1 61  ? -54.614 -11.395 27.692  1.00 85.71  ? 249 TRP B CE2 1 
ATOM   2792 C CE3 . TRP B 1 61  ? -53.741 -10.577 29.799  1.00 84.57  ? 249 TRP B CE3 1 
ATOM   2793 C CZ2 . TRP B 1 61  ? -55.535 -10.356 27.615  1.00 83.16  ? 249 TRP B CZ2 1 
ATOM   2794 C CZ3 . TRP B 1 61  ? -54.655 -9.542  29.716  1.00 83.08  ? 249 TRP B CZ3 1 
ATOM   2795 C CH2 . TRP B 1 61  ? -55.543 -9.443  28.633  1.00 82.68  ? 249 TRP B CH2 1 
ATOM   2796 N N   . THR B 1 62  ? -50.020 -13.631 27.359  1.00 69.78  ? 250 THR B N   1 
ATOM   2797 C CA  . THR B 1 62  ? -49.214 -13.900 26.180  1.00 62.67  ? 250 THR B CA  1 
ATOM   2798 C C   . THR B 1 62  ? -49.138 -12.616 25.353  1.00 53.87  ? 250 THR B C   1 
ATOM   2799 O O   . THR B 1 62  ? -48.168 -12.371 24.637  1.00 50.28  ? 250 THR B O   1 
ATOM   2800 C CB  . THR B 1 62  ? -49.785 -15.059 25.343  1.00 63.36  ? 250 THR B CB  1 
ATOM   2801 O OG1 . THR B 1 62  ? -49.815 -16.249 26.140  1.00 66.30  ? 250 THR B OG1 1 
ATOM   2802 C CG2 . THR B 1 62  ? -48.924 -15.310 24.121  1.00 61.17  ? 250 THR B CG2 1 
ATOM   2803 N N   . ALA B 1 63  ? -50.158 -11.779 25.498  1.00 55.71  ? 251 ALA B N   1 
ATOM   2804 C CA  . ALA B 1 63  ? -50.233 -10.507 24.791  1.00 48.69  ? 251 ALA B CA  1 
ATOM   2805 C C   . ALA B 1 63  ? -49.085 -9.558  25.145  1.00 43.35  ? 251 ALA B C   1 
ATOM   2806 O O   . ALA B 1 63  ? -48.545 -8.876  24.272  1.00 42.20  ? 251 ALA B O   1 
ATOM   2807 C CB  . ALA B 1 63  ? -51.556 -9.840  25.079  1.00 45.56  ? 251 ALA B CB  1 
ATOM   2808 N N   . VAL B 1 64  ? -48.734 -9.492  26.426  1.00 38.32  ? 252 VAL B N   1 
ATOM   2809 C CA  . VAL B 1 64  ? -47.664 -8.609  26.871  1.00 38.22  ? 252 VAL B CA  1 
ATOM   2810 C C   . VAL B 1 64  ? -46.332 -9.043  26.269  1.00 37.59  ? 252 VAL B C   1 
ATOM   2811 O O   . VAL B 1 64  ? -45.589 -8.231  25.714  1.00 38.38  ? 252 VAL B O   1 
ATOM   2812 C CB  . VAL B 1 64  ? -47.561 -8.579  28.409  1.00 41.09  ? 252 VAL B CB  1 
ATOM   2813 C CG1 . VAL B 1 64  ? -46.367 -7.761  28.838  1.00 38.16  ? 252 VAL B CG1 1 
ATOM   2814 C CG2 . VAL B 1 64  ? -48.813 -7.988  29.002  1.00 46.27  ? 252 VAL B CG2 1 
ATOM   2815 N N   . LYS B 1 65  ? -46.053 -10.337 26.359  1.00 37.09  ? 253 LYS B N   1 
ATOM   2816 C CA  . LYS B 1 65  ? -44.845 -10.900 25.774  1.00 37.08  ? 253 LYS B CA  1 
ATOM   2817 C C   . LYS B 1 65  ? -44.766 -10.645 24.273  1.00 35.86  ? 253 LYS B C   1 
ATOM   2818 O O   . LYS B 1 65  ? -43.717 -10.280 23.750  1.00 35.49  ? 253 LYS B O   1 
ATOM   2819 C CB  . LYS B 1 65  ? -44.768 -12.403 26.059  1.00 36.97  ? 253 LYS B CB  1 
ATOM   2820 C CG  . LYS B 1 65  ? -43.421 -13.002 25.714  1.00 40.46  ? 253 LYS B CG  1 
ATOM   2821 C CD  . LYS B 1 65  ? -43.406 -14.489 25.960  1.00 44.19  ? 253 LYS B CD  1 
ATOM   2822 C CE  . LYS B 1 65  ? -44.277 -15.192 24.953  1.00 44.45  ? 253 LYS B CE  1 
ATOM   2823 N NZ  . LYS B 1 65  ? -44.140 -16.662 25.081  1.00 49.25  ? 253 LYS B NZ  1 
ATOM   2824 N N   . GLN B 1 66  ? -45.889 -10.832 23.589  1.00 33.03  ? 254 GLN B N   1 
ATOM   2825 C CA  . GLN B 1 66  ? -45.964 -10.562 22.156  1.00 34.52  ? 254 GLN B CA  1 
ATOM   2826 C C   . GLN B 1 66  ? -45.663 -9.093  21.834  1.00 39.09  ? 254 GLN B C   1 
ATOM   2827 O O   . GLN B 1 66  ? -44.969 -8.799  20.861  1.00 43.20  ? 254 GLN B O   1 
ATOM   2828 C CB  . GLN B 1 66  ? -47.339 -10.953 21.602  1.00 35.43  ? 254 GLN B CB  1 
ATOM   2829 C CG  . GLN B 1 66  ? -47.542 -12.465 21.502  1.00 41.17  ? 254 GLN B CG  1 
ATOM   2830 C CD  . GLN B 1 66  ? -48.832 -12.848 20.793  1.00 48.43  ? 254 GLN B CD  1 
ATOM   2831 O OE1 . GLN B 1 66  ? -49.676 -12.000 20.512  1.00 52.84  ? 254 GLN B OE1 1 
ATOM   2832 N NE2 . GLN B 1 66  ? -48.986 -14.132 20.497  1.00 47.58  ? 254 GLN B NE2 1 
ATOM   2833 N N   . SER B 1 67  ? -46.168 -8.172  22.652  1.00 34.11  ? 255 SER B N   1 
ATOM   2834 C CA  . SER B 1 67  ? -45.905 -6.748  22.430  1.00 38.25  ? 255 SER B CA  1 
ATOM   2835 C C   . SER B 1 67  ? -44.427 -6.424  22.647  1.00 32.51  ? 255 SER B C   1 
ATOM   2836 O O   . SER B 1 67  ? -43.832 -5.630  21.910  1.00 29.64  ? 255 SER B O   1 
ATOM   2837 C CB  . SER B 1 67  ? -46.774 -5.891  23.351  1.00 39.29  ? 255 SER B CB  1 
ATOM   2838 O OG  . SER B 1 67  ? -48.136 -5.997  22.989  1.00 54.53  ? 255 SER B OG  1 
ATOM   2839 N N   . PHE B 1 68  ? -43.851 -7.051  23.667  1.00 27.98  ? 256 PHE B N   1 
ATOM   2840 C CA  . PHE B 1 68  ? -42.436 -6.905  23.980  1.00 31.94  ? 256 PHE B CA  1 
ATOM   2841 C C   . PHE B 1 68  ? -41.562 -7.331  22.789  1.00 33.01  ? 256 PHE B C   1 
ATOM   2842 O O   . PHE B 1 68  ? -40.743 -6.549  22.273  1.00 32.17  ? 256 PHE B O   1 
ATOM   2843 C CB  . PHE B 1 68  ? -42.112 -7.729  25.233  1.00 26.37  ? 256 PHE B CB  1 
ATOM   2844 C CG  . PHE B 1 68  ? -40.655 -7.766  25.589  1.00 32.02  ? 256 PHE B CG  1 
ATOM   2845 C CD1 . PHE B 1 68  ? -40.052 -6.685  26.207  1.00 29.46  ? 256 PHE B CD1 1 
ATOM   2846 C CD2 . PHE B 1 68  ? -39.896 -8.896  25.329  1.00 29.96  ? 256 PHE B CD2 1 
ATOM   2847 C CE1 . PHE B 1 68  ? -38.713 -6.720  26.546  1.00 31.02  ? 256 PHE B CE1 1 
ATOM   2848 C CE2 . PHE B 1 68  ? -38.557 -8.939  25.662  1.00 33.82  ? 256 PHE B CE2 1 
ATOM   2849 C CZ  . PHE B 1 68  ? -37.962 -7.850  26.271  1.00 32.16  ? 256 PHE B CZ  1 
ATOM   2850 N N   . LEU B 1 69  ? -41.770 -8.566  22.341  1.00 32.45  ? 257 LEU B N   1 
ATOM   2851 C CA  . LEU B 1 69  ? -40.999 -9.123  21.233  1.00 36.00  ? 257 LEU B CA  1 
ATOM   2852 C C   . LEU B 1 69  ? -41.208 -8.322  19.950  1.00 33.71  ? 257 LEU B C   1 
ATOM   2853 O O   . LEU B 1 69  ? -40.247 -8.019  19.238  1.00 28.21  ? 257 LEU B O   1 
ATOM   2854 C CB  . LEU B 1 69  ? -41.365 -10.592 21.015  1.00 34.53  ? 257 LEU B CB  1 
ATOM   2855 C CG  . LEU B 1 69  ? -40.971 -11.532 22.160  1.00 37.64  ? 257 LEU B CG  1 
ATOM   2856 C CD1 . LEU B 1 69  ? -41.385 -12.963 21.853  1.00 37.78  ? 257 LEU B CD1 1 
ATOM   2857 C CD2 . LEU B 1 69  ? -39.472 -11.452 22.438  1.00 35.20  ? 257 LEU B CD2 1 
ATOM   2858 N N   . THR B 1 70  ? -42.462 -7.973  19.670  1.00 32.74  ? 258 THR B N   1 
ATOM   2859 C CA  . THR B 1 70  ? -42.788 -7.167  18.498  1.00 30.26  ? 258 THR B CA  1 
ATOM   2860 C C   . THR B 1 70  ? -42.016 -5.855  18.500  1.00 30.84  ? 258 THR B C   1 
ATOM   2861 O O   . THR B 1 70  ? -41.444 -5.457  17.481  1.00 33.75  ? 258 THR B O   1 
ATOM   2862 C CB  . THR B 1 70  ? -44.289 -6.842  18.422  1.00 31.93  ? 258 THR B CB  1 
ATOM   2863 O OG1 . THR B 1 70  ? -45.048 -8.055  18.395  1.00 34.93  ? 258 THR B OG1 1 
ATOM   2864 C CG2 . THR B 1 70  ? -44.599 -6.024  17.171  1.00 30.74  ? 258 THR B CG2 1 
ATOM   2865 N N   . GLU B 1 71  ? -41.999 -5.178  19.645  1.00 28.76  ? 259 GLU B N   1 
ATOM   2866 C CA  . GLU B 1 71  ? -41.325 -3.891  19.709  1.00 28.48  ? 259 GLU B CA  1 
ATOM   2867 C C   . GLU B 1 71  ? -39.813 -4.052  19.520  1.00 31.84  ? 259 GLU B C   1 
ATOM   2868 O O   . GLU B 1 71  ? -39.191 -3.261  18.795  1.00 30.47  ? 259 GLU B O   1 
ATOM   2869 C CB  . GLU B 1 71  ? -41.626 -3.167  21.025  1.00 30.12  ? 259 GLU B CB  1 
ATOM   2870 C CG  . GLU B 1 71  ? -41.022 -1.767  21.062  1.00 31.76  ? 259 GLU B CG  1 
ATOM   2871 C CD  . GLU B 1 71  ? -41.743 -0.816  22.003  1.00 39.08  ? 259 GLU B CD  1 
ATOM   2872 O OE1 . GLU B 1 71  ? -42.563 -1.287  22.819  1.00 41.28  ? 259 GLU B OE1 1 
ATOM   2873 O OE2 . GLU B 1 71  ? -41.486 0.408   21.922  1.00 37.72  ? 259 GLU B OE2 1 
ATOM   2874 N N   . VAL B 1 72  ? -39.220 -5.072  20.144  1.00 30.87  ? 260 VAL B N   1 
ATOM   2875 C CA  . VAL B 1 72  ? -37.790 -5.318  19.929  1.00 30.98  ? 260 VAL B CA  1 
ATOM   2876 C C   . VAL B 1 72  ? -37.465 -5.568  18.444  1.00 31.37  ? 260 VAL B C   1 
ATOM   2877 O O   . VAL B 1 72  ? -36.539 -4.959  17.886  1.00 33.41  ? 260 VAL B O   1 
ATOM   2878 C CB  . VAL B 1 72  ? -37.274 -6.508  20.761  1.00 28.81  ? 260 VAL B CB  1 
ATOM   2879 C CG1 . VAL B 1 72  ? -35.799 -6.761  20.464  1.00 23.41  ? 260 VAL B CG1 1 
ATOM   2880 C CG2 . VAL B 1 72  ? -37.464 -6.236  22.242  1.00 24.61  ? 260 VAL B CG2 1 
ATOM   2881 N N   . GLU B 1 73  ? -38.237 -6.440  17.803  1.00 26.78  ? 261 GLU B N   1 
ATOM   2882 C CA  . GLU B 1 73  ? -37.999 -6.773  16.399  1.00 32.11  ? 261 GLU B CA  1 
ATOM   2883 C C   . GLU B 1 73  ? -38.146 -5.560  15.480  1.00 32.70  ? 261 GLU B C   1 
ATOM   2884 O O   . GLU B 1 73  ? -37.250 -5.254  14.682  1.00 31.32  ? 261 GLU B O   1 
ATOM   2885 C CB  . GLU B 1 73  ? -38.950 -7.879  15.936  1.00 38.14  ? 261 GLU B CB  1 
ATOM   2886 C CG  . GLU B 1 73  ? -38.913 -8.119  14.430  1.00 47.32  ? 261 GLU B CG  1 
ATOM   2887 C CD  . GLU B 1 73  ? -39.935 -9.143  13.968  1.00 57.18  ? 261 GLU B CD  1 
ATOM   2888 O OE1 . GLU B 1 73  ? -40.561 -9.788  14.836  1.00 63.39  ? 261 GLU B OE1 1 
ATOM   2889 O OE2 . GLU B 1 73  ? -40.115 -9.302  12.740  1.00 58.99  ? 261 GLU B OE2 1 
ATOM   2890 N N   . GLN B 1 74  ? -39.272 -4.862  15.589  1.00 28.42  ? 262 GLN B N   1 
ATOM   2891 C CA  . GLN B 1 74  ? -39.523 -3.772  14.658  1.00 27.85  ? 262 GLN B CA  1 
ATOM   2892 C C   . GLN B 1 74  ? -38.602 -2.577  14.900  1.00 29.40  ? 262 GLN B C   1 
ATOM   2893 O O   . GLN B 1 74  ? -38.189 -1.913  13.950  1.00 24.95  ? 262 GLN B O   1 
ATOM   2894 C CB  . GLN B 1 74  ? -40.987 -3.335  14.721  1.00 30.84  ? 262 GLN B CB  1 
ATOM   2895 C CG  . GLN B 1 74  ? -41.989 -4.447  14.407  1.00 31.29  ? 262 GLN B CG  1 
ATOM   2896 C CD  . GLN B 1 74  ? -41.807 -5.081  13.028  1.00 39.71  ? 262 GLN B CD  1 
ATOM   2897 O OE1 . GLN B 1 74  ? -41.053 -4.592  12.185  1.00 39.58  ? 262 GLN B OE1 1 
ATOM   2898 N NE2 . GLN B 1 74  ? -42.515 -6.181  12.796  1.00 41.43  ? 262 GLN B NE2 1 
ATOM   2899 N N   . LEU B 1 75  ? -38.265 -2.303  16.158  1.00 27.86  ? 263 LEU B N   1 
ATOM   2900 C CA  . LEU B 1 75  ? -37.305 -1.238  16.423  1.00 26.22  ? 263 LEU B CA  1 
ATOM   2901 C C   . LEU B 1 75  ? -35.896 -1.650  15.991  1.00 29.34  ? 263 LEU B C   1 
ATOM   2902 O O   . LEU B 1 75  ? -35.046 -0.789  15.758  1.00 27.21  ? 263 LEU B O   1 
ATOM   2903 C CB  . LEU B 1 75  ? -37.314 -0.843  17.897  1.00 23.59  ? 263 LEU B CB  1 
ATOM   2904 C CG  . LEU B 1 75  ? -38.542 -0.048  18.338  1.00 29.15  ? 263 LEU B CG  1 
ATOM   2905 C CD1 . LEU B 1 75  ? -38.403 0.386   19.785  1.00 27.16  ? 263 LEU B CD1 1 
ATOM   2906 C CD2 . LEU B 1 75  ? -38.754 1.156   17.428  1.00 28.90  ? 263 LEU B CD2 1 
ATOM   2907 N N   . SER B 1 76  ? -35.645 -2.956  15.885  1.00 26.08  ? 264 SER B N   1 
ATOM   2908 C CA  . SER B 1 76  ? -34.384 -3.414  15.304  1.00 31.91  ? 264 SER B CA  1 
ATOM   2909 C C   . SER B 1 76  ? -34.384 -3.212  13.786  1.00 33.85  ? 264 SER B C   1 
ATOM   2910 O O   . SER B 1 76  ? -33.347 -2.898  13.196  1.00 32.94  ? 264 SER B O   1 
ATOM   2911 C CB  . SER B 1 76  ? -34.122 -4.887  15.637  1.00 34.37  ? 264 SER B CB  1 
ATOM   2912 O OG  . SER B 1 76  ? -33.889 -5.058  17.024  1.00 36.09  ? 264 SER B OG  1 
ATOM   2913 N N   . ARG B 1 77  ? -35.543 -3.399  13.156  1.00 29.84  ? 265 ARG B N   1 
ATOM   2914 C CA  . ARG B 1 77  ? -35.648 -3.222  11.708  1.00 30.41  ? 265 ARG B CA  1 
ATOM   2915 C C   . ARG B 1 77  ? -35.709 -1.757  11.286  1.00 32.00  ? 265 ARG B C   1 
ATOM   2916 O O   . ARG B 1 77  ? -35.048 -1.352  10.334  1.00 35.13  ? 265 ARG B O   1 
ATOM   2917 C CB  . ARG B 1 77  ? -36.876 -3.950  11.153  1.00 33.34  ? 265 ARG B CB  1 
ATOM   2918 C CG  . ARG B 1 77  ? -37.168 -3.583  9.700   1.00 38.45  ? 265 ARG B CG  1 
ATOM   2919 C CD  . ARG B 1 77  ? -38.073 -4.580  8.990   1.00 42.85  ? 265 ARG B CD  1 
ATOM   2920 N NE  . ARG B 1 77  ? -38.358 -4.151  7.621   1.00 43.94  ? 265 ARG B NE  1 
ATOM   2921 C CZ  . ARG B 1 77  ? -37.541 -4.340  6.588   1.00 43.01  ? 265 ARG B CZ  1 
ATOM   2922 N NH1 . ARG B 1 77  ? -36.379 -4.955  6.758   1.00 43.69  ? 265 ARG B NH1 1 
ATOM   2923 N NH2 . ARG B 1 77  ? -37.884 -3.912  5.382   1.00 41.86  ? 265 ARG B NH2 1 
ATOM   2924 N N   . PHE B 1 78  ? -36.507 -0.966  11.991  1.00 31.83  ? 266 PHE B N   1 
ATOM   2925 C CA  . PHE B 1 78  ? -36.764 0.401   11.563  1.00 29.35  ? 266 PHE B CA  1 
ATOM   2926 C C   . PHE B 1 78  ? -35.998 1.427   12.386  1.00 30.32  ? 266 PHE B C   1 
ATOM   2927 O O   . PHE B 1 78  ? -36.291 1.665   13.562  1.00 27.40  ? 266 PHE B O   1 
ATOM   2928 C CB  . PHE B 1 78  ? -38.269 0.684   11.600  1.00 26.30  ? 266 PHE B CB  1 
ATOM   2929 C CG  . PHE B 1 78  ? -39.041 -0.064  10.548  1.00 31.71  ? 266 PHE B CG  1 
ATOM   2930 C CD1 . PHE B 1 78  ? -39.088 0.408   9.246   1.00 33.33  ? 266 PHE B CD1 1 
ATOM   2931 C CD2 . PHE B 1 78  ? -39.705 -1.243  10.852  1.00 33.44  ? 266 PHE B CD2 1 
ATOM   2932 C CE1 . PHE B 1 78  ? -39.784 -0.273  8.267   1.00 32.99  ? 266 PHE B CE1 1 
ATOM   2933 C CE2 . PHE B 1 78  ? -40.409 -1.934  9.874   1.00 32.42  ? 266 PHE B CE2 1 
ATOM   2934 C CZ  . PHE B 1 78  ? -40.449 -1.448  8.580   1.00 33.27  ? 266 PHE B CZ  1 
ATOM   2935 N N   . ARG B 1 79  ? -35.008 2.031   11.738  1.00 26.58  ? 267 ARG B N   1 
ATOM   2936 C CA  . ARG B 1 79  ? -34.179 3.056   12.353  1.00 30.87  ? 267 ARG B CA  1 
ATOM   2937 C C   . ARG B 1 79  ? -34.266 4.362   11.579  1.00 33.23  ? 267 ARG B C   1 
ATOM   2938 O O   . ARG B 1 79  ? -33.792 4.460   10.444  1.00 32.50  ? 267 ARG B O   1 
ATOM   2939 C CB  . ARG B 1 79  ? -32.729 2.607   12.416  1.00 31.10  ? 267 ARG B CB  1 
ATOM   2940 C CG  . ARG B 1 79  ? -32.486 1.352   13.203  1.00 38.00  ? 267 ARG B CG  1 
ATOM   2941 C CD  . ARG B 1 79  ? -31.128 1.496   13.824  1.00 42.90  ? 267 ARG B CD  1 
ATOM   2942 N NE  . ARG B 1 79  ? -30.374 0.258   13.895  1.00 48.45  ? 267 ARG B NE  1 
ATOM   2943 C CZ  . ARG B 1 79  ? -29.097 0.221   14.255  1.00 47.04  ? 267 ARG B CZ  1 
ATOM   2944 N NH1 . ARG B 1 79  ? -28.472 1.353   14.566  1.00 42.90  ? 267 ARG B NH1 1 
ATOM   2945 N NH2 . ARG B 1 79  ? -28.452 -0.933  14.305  1.00 43.65  ? 267 ARG B NH2 1 
ATOM   2946 N N   . HIS B 1 80  ? -34.849 5.370   12.210  1.00 33.67  ? 268 HIS B N   1 
ATOM   2947 C CA  . HIS B 1 80  ? -35.230 6.579   11.502  1.00 32.23  ? 268 HIS B CA  1 
ATOM   2948 C C   . HIS B 1 80  ? -35.016 7.776   12.416  1.00 31.85  ? 268 HIS B C   1 
ATOM   2949 O O   . HIS B 1 80  ? -35.200 7.665   13.629  1.00 34.87  ? 268 HIS B O   1 
ATOM   2950 C CB  . HIS B 1 80  ? -36.696 6.465   11.043  1.00 30.93  ? 268 HIS B CB  1 
ATOM   2951 C CG  . HIS B 1 80  ? -37.111 7.500   10.043  1.00 28.28  ? 268 HIS B CG  1 
ATOM   2952 N ND1 . HIS B 1 80  ? -37.629 8.724   10.409  1.00 26.55  ? 268 HIS B ND1 1 
ATOM   2953 C CD2 . HIS B 1 80  ? -37.093 7.490   8.688   1.00 29.09  ? 268 HIS B CD2 1 
ATOM   2954 C CE1 . HIS B 1 80  ? -37.905 9.427   9.324   1.00 31.99  ? 268 HIS B CE1 1 
ATOM   2955 N NE2 . HIS B 1 80  ? -37.588 8.699   8.267   1.00 34.76  ? 268 HIS B NE2 1 
ATOM   2956 N N   . PRO B 1 81  ? -34.618 8.925   11.843  1.00 33.39  ? 269 PRO B N   1 
ATOM   2957 C CA  . PRO B 1 81  ? -34.440 10.163  12.614  1.00 31.53  ? 269 PRO B CA  1 
ATOM   2958 C C   . PRO B 1 81  ? -35.678 10.518  13.441  1.00 32.24  ? 269 PRO B C   1 
ATOM   2959 O O   . PRO B 1 81  ? -35.571 11.147  14.495  1.00 29.30  ? 269 PRO B O   1 
ATOM   2960 C CB  . PRO B 1 81  ? -34.199 11.219  11.532  1.00 34.64  ? 269 PRO B CB  1 
ATOM   2961 C CG  . PRO B 1 81  ? -33.630 10.463  10.382  1.00 36.31  ? 269 PRO B CG  1 
ATOM   2962 C CD  . PRO B 1 81  ? -34.261 9.097   10.423  1.00 33.01  ? 269 PRO B CD  1 
ATOM   2963 N N   . ASN B 1 82  ? -36.843 10.143  12.926  1.00 24.88  ? 270 ASN B N   1 
ATOM   2964 C CA  . ASN B 1 82  ? -38.130 10.383  13.581  1.00 28.54  ? 270 ASN B CA  1 
ATOM   2965 C C   . ASN B 1 82  ? -38.719 9.191   14.359  1.00 29.81  ? 270 ASN B C   1 
ATOM   2966 O O   . ASN B 1 82  ? -39.907 9.186   14.687  1.00 29.44  ? 270 ASN B O   1 
ATOM   2967 C CB  . ASN B 1 82  ? -39.122 10.912  12.552  1.00 31.55  ? 270 ASN B CB  1 
ATOM   2968 C CG  . ASN B 1 82  ? -38.697 12.263  12.005  1.00 34.08  ? 270 ASN B CG  1 
ATOM   2969 O OD1 . ASN B 1 82  ? -38.427 12.407  10.816  1.00 36.96  ? 270 ASN B OD1 1 
ATOM   2970 N ND2 . ASN B 1 82  ? -38.599 13.256  12.889  1.00 32.16  ? 270 ASN B ND2 1 
ATOM   2971 N N   . ILE B 1 83  ? -37.916 8.149   14.562  1.00 25.78  ? 271 ILE B N   1 
ATOM   2972 C CA  . ILE B 1 83  ? -38.314 7.016   15.391  1.00 22.35  ? 271 ILE B CA  1 
ATOM   2973 C C   . ILE B 1 83  ? -37.375 6.905   16.603  1.00 28.22  ? 271 ILE B C   1 
ATOM   2974 O O   . ILE B 1 83  ? -36.178 7.164   16.476  1.00 25.71  ? 271 ILE B O   1 
ATOM   2975 C CB  . ILE B 1 83  ? -38.313 5.712   14.560  1.00 25.27  ? 271 ILE B CB  1 
ATOM   2976 C CG1 . ILE B 1 83  ? -39.423 5.767   13.506  1.00 26.93  ? 271 ILE B CG1 1 
ATOM   2977 C CG2 . ILE B 1 83  ? -38.483 4.477   15.440  1.00 28.08  ? 271 ILE B CG2 1 
ATOM   2978 C CD1 . ILE B 1 83  ? -39.535 4.507   12.655  1.00 25.84  ? 271 ILE B CD1 1 
ATOM   2979 N N   . VAL B 1 84  ? -37.912 6.531   17.767  1.00 24.57  ? 272 VAL B N   1 
ATOM   2980 C CA  . VAL B 1 84  ? -37.114 6.458   18.998  1.00 25.14  ? 272 VAL B CA  1 
ATOM   2981 C C   . VAL B 1 84  ? -35.905 5.544   18.825  1.00 26.15  ? 272 VAL B C   1 
ATOM   2982 O O   . VAL B 1 84  ? -35.938 4.594   18.042  1.00 25.41  ? 272 VAL B O   1 
ATOM   2983 C CB  . VAL B 1 84  ? -37.949 5.964   20.211  1.00 25.35  ? 272 VAL B CB  1 
ATOM   2984 C CG1 . VAL B 1 84  ? -39.043 6.968   20.544  1.00 23.97  ? 272 VAL B CG1 1 
ATOM   2985 C CG2 . VAL B 1 84  ? -38.542 4.590   19.939  1.00 21.55  ? 272 VAL B CG2 1 
ATOM   2986 N N   . ASP B 1 85  ? -34.827 5.855   19.539  1.00 21.84  ? 273 ASP B N   1 
ATOM   2987 C CA  . ASP B 1 85  ? -33.584 5.108   19.383  1.00 27.20  ? 273 ASP B CA  1 
ATOM   2988 C C   . ASP B 1 85  ? -33.535 3.955   20.363  1.00 27.12  ? 273 ASP B C   1 
ATOM   2989 O O   . ASP B 1 85  ? -33.354 4.156   21.560  1.00 35.38  ? 273 ASP B O   1 
ATOM   2990 C CB  . ASP B 1 85  ? -32.369 6.017   19.590  1.00 26.98  ? 273 ASP B CB  1 
ATOM   2991 C CG  . ASP B 1 85  ? -32.369 7.207   18.655  1.00 39.52  ? 273 ASP B CG  1 
ATOM   2992 O OD1 . ASP B 1 85  ? -32.088 7.021   17.450  1.00 46.53  ? 273 ASP B OD1 1 
ATOM   2993 O OD2 . ASP B 1 85  ? -32.658 8.328   19.124  1.00 44.68  ? 273 ASP B OD2 1 
ATOM   2994 N N   . PHE B 1 86  ? -33.641 2.744   19.833  1.00 30.06  ? 274 PHE B N   1 
ATOM   2995 C CA  . PHE B 1 86  ? -33.741 1.540   20.648  1.00 30.12  ? 274 PHE B CA  1 
ATOM   2996 C C   . PHE B 1 86  ? -32.352 1.043   21.057  1.00 30.59  ? 274 PHE B C   1 
ATOM   2997 O O   . PHE B 1 86  ? -31.499 0.761   20.214  1.00 31.15  ? 274 PHE B O   1 
ATOM   2998 C CB  . PHE B 1 86  ? -34.518 0.466   19.879  1.00 26.95  ? 274 PHE B CB  1 
ATOM   2999 C CG  . PHE B 1 86  ? -34.679 -0.826  20.620  1.00 28.64  ? 274 PHE B CG  1 
ATOM   3000 C CD1 . PHE B 1 86  ? -35.491 -0.905  21.744  1.00 29.92  ? 274 PHE B CD1 1 
ATOM   3001 C CD2 . PHE B 1 86  ? -34.034 -1.969  20.182  1.00 28.45  ? 274 PHE B CD2 1 
ATOM   3002 C CE1 . PHE B 1 86  ? -35.646 -2.100  22.426  1.00 30.91  ? 274 PHE B CE1 1 
ATOM   3003 C CE2 . PHE B 1 86  ? -34.185 -3.171  20.861  1.00 33.34  ? 274 PHE B CE2 1 
ATOM   3004 C CZ  . PHE B 1 86  ? -34.994 -3.236  21.983  1.00 30.47  ? 274 PHE B CZ  1 
ATOM   3005 N N   . ALA B 1 87  ? -32.135 1.003   22.369  1.00 29.27  ? 275 ALA B N   1 
ATOM   3006 C CA  . ALA B 1 87  ? -30.879 0.598   23.004  1.00 30.09  ? 275 ALA B CA  1 
ATOM   3007 C C   . ALA B 1 87  ? -30.860 -0.849  23.529  1.00 28.58  ? 275 ALA B C   1 
ATOM   3008 O O   . ALA B 1 87  ? -29.914 -1.245  24.206  1.00 27.81  ? 275 ALA B O   1 
ATOM   3009 C CB  . ALA B 1 87  ? -30.539 1.566   24.136  1.00 31.68  ? 275 ALA B CB  1 
ATOM   3010 N N   . GLY B 1 88  ? -31.897 -1.629  23.239  1.00 31.62  ? 276 GLY B N   1 
ATOM   3011 C CA  . GLY B 1 88  ? -31.984 -2.991  23.751  1.00 31.32  ? 276 GLY B CA  1 
ATOM   3012 C C   . GLY B 1 88  ? -33.057 -3.350  24.772  1.00 31.65  ? 276 GLY B C   1 
ATOM   3013 O O   . GLY B 1 88  ? -33.959 -2.557  25.058  1.00 28.82  ? 276 GLY B O   1 
ATOM   3014 N N   . TYR B 1 89  ? -32.982 -4.583  25.276  1.00 25.01  ? 277 TYR B N   1 
ATOM   3015 C CA  . TYR B 1 89  ? -34.074 -5.194  26.030  1.00 27.44  ? 277 TYR B CA  1 
ATOM   3016 C C   . TYR B 1 89  ? -33.583 -6.025  27.214  1.00 31.85  ? 277 TYR B C   1 
ATOM   3017 O O   . TYR B 1 89  ? -32.440 -6.481  27.229  1.00 32.60  ? 277 TYR B O   1 
ATOM   3018 C CB  . TYR B 1 89  ? -34.900 -6.098  25.108  1.00 26.33  ? 277 TYR B CB  1 
ATOM   3019 C CG  . TYR B 1 89  ? -34.147 -7.358  24.728  1.00 28.89  ? 277 TYR B CG  1 
ATOM   3020 C CD1 . TYR B 1 89  ? -33.229 -7.352  23.684  1.00 30.34  ? 277 TYR B CD1 1 
ATOM   3021 C CD2 . TYR B 1 89  ? -34.331 -8.545  25.434  1.00 30.51  ? 277 TYR B CD2 1 
ATOM   3022 C CE1 . TYR B 1 89  ? -32.525 -8.496  23.341  1.00 30.61  ? 277 TYR B CE1 1 
ATOM   3023 C CE2 . TYR B 1 89  ? -33.632 -9.690  25.103  1.00 34.17  ? 277 TYR B CE2 1 
ATOM   3024 C CZ  . TYR B 1 89  ? -32.731 -9.661  24.055  1.00 34.43  ? 277 TYR B CZ  1 
ATOM   3025 O OH  . TYR B 1 89  ? -32.038 -10.799 23.720  1.00 34.54  ? 277 TYR B OH  1 
ATOM   3026 N N   . CYS B 1 90  ? -34.455 -6.221  28.202  1.00 34.69  ? 278 CYS B N   1 
ATOM   3027 C CA  . CYS B 1 90  ? -34.243 -7.224  29.246  1.00 32.43  ? 278 CYS B CA  1 
ATOM   3028 C C   . CYS B 1 90  ? -35.554 -7.948  29.570  1.00 34.41  ? 278 CYS B C   1 
ATOM   3029 O O   . CYS B 1 90  ? -36.540 -7.310  29.942  1.00 35.00  ? 278 CYS B O   1 
ATOM   3030 C CB  . CYS B 1 90  ? -33.667 -6.575  30.502  1.00 31.97  ? 278 CYS B CB  1 
ATOM   3031 S SG  . CYS B 1 90  ? -33.464 -7.700  31.894  1.00 43.63  ? 278 CYS B SG  1 
ATOM   3032 N N   . ALA B 1 91  ? -35.583 -9.264  29.372  1.00 34.93  ? 279 ALA B N   1 
ATOM   3033 C CA  . ALA B 1 91  ? -36.751 -10.086 29.717  1.00 37.51  ? 279 ALA B CA  1 
ATOM   3034 C C   . ALA B 1 91  ? -36.619 -10.890 31.020  1.00 45.13  ? 279 ALA B C   1 
ATOM   3035 O O   . ALA B 1 91  ? -37.486 -11.704 31.336  1.00 49.45  ? 279 ALA B O   1 
ATOM   3036 C CB  . ALA B 1 91  ? -37.081 -11.015 28.573  1.00 36.64  ? 279 ALA B CB  1 
ATOM   3037 N N   . GLN B 1 92  ? -35.522 -10.709 31.745  1.00 43.75  ? 280 GLN B N   1 
ATOM   3038 C CA  . GLN B 1 92  ? -35.232 -11.547 32.912  1.00 49.11  ? 280 GLN B CA  1 
ATOM   3039 C C   . GLN B 1 92  ? -36.206 -11.400 34.082  1.00 48.82  ? 280 GLN B C   1 
ATOM   3040 O O   . GLN B 1 92  ? -36.707 -10.311 34.363  1.00 43.43  ? 280 GLN B O   1 
ATOM   3041 C CB  . GLN B 1 92  ? -33.817 -11.266 33.423  1.00 53.88  ? 280 GLN B CB  1 
ATOM   3042 C CG  . GLN B 1 92  ? -32.716 -11.797 32.530  1.00 65.50  ? 280 GLN B CG  1 
ATOM   3043 C CD  . GLN B 1 92  ? -31.333 -11.419 33.021  1.00 75.47  ? 280 GLN B CD  1 
ATOM   3044 O OE1 . GLN B 1 92  ? -31.123 -11.185 34.211  1.00 80.59  ? 280 GLN B OE1 1 
ATOM   3045 N NE2 . GLN B 1 92  ? -30.378 -11.359 32.103  1.00 78.70  ? 280 GLN B NE2 1 
ATOM   3046 N N   . ASN B 1 93  ? -36.470 -12.524 34.745  1.00 57.14  ? 281 ASN B N   1 
ATOM   3047 C CA  . ASN B 1 93  ? -37.088 -12.545 36.069  1.00 59.14  ? 281 ASN B CA  1 
ATOM   3048 C C   . ASN B 1 93  ? -38.477 -11.910 36.148  1.00 57.61  ? 281 ASN B C   1 
ATOM   3049 O O   . ASN B 1 93  ? -38.825 -11.288 37.152  1.00 59.62  ? 281 ASN B O   1 
ATOM   3050 C CB  . ASN B 1 93  ? -36.155 -11.856 37.068  1.00 63.61  ? 281 ASN B CB  1 
ATOM   3051 C CG  . ASN B 1 93  ? -36.199 -12.488 38.440  1.00 72.97  ? 281 ASN B CG  1 
ATOM   3052 O OD1 . ASN B 1 93  ? -36.776 -13.559 38.624  1.00 75.83  ? 281 ASN B OD1 1 
ATOM   3053 N ND2 . ASN B 1 93  ? -35.577 -11.832 39.413  1.00 76.94  ? 281 ASN B ND2 1 
ATOM   3054 N N   . GLY B 1 94  ? -39.267 -12.069 35.093  1.00 53.75  ? 282 GLY B N   1 
ATOM   3055 C CA  . GLY B 1 94  ? -40.618 -11.537 35.075  1.00 55.69  ? 282 GLY B CA  1 
ATOM   3056 C C   . GLY B 1 94  ? -40.714 -10.103 34.586  1.00 54.19  ? 282 GLY B C   1 
ATOM   3057 O O   . GLY B 1 94  ? -41.802 -9.609  34.301  1.00 56.27  ? 282 GLY B O   1 
ATOM   3058 N N   . PHE B 1 95  ? -39.573 -9.431  34.488  1.00 49.93  ? 283 PHE B N   1 
ATOM   3059 C CA  . PHE B 1 95  ? -39.540 -8.054  34.009  1.00 46.75  ? 283 PHE B CA  1 
ATOM   3060 C C   . PHE B 1 95  ? -39.486 -8.004  32.489  1.00 47.89  ? 283 PHE B C   1 
ATOM   3061 O O   . PHE B 1 95  ? -38.767 -8.780  31.860  1.00 49.89  ? 283 PHE B O   1 
ATOM   3062 C CB  . PHE B 1 95  ? -38.336 -7.304  34.585  1.00 47.23  ? 283 PHE B CB  1 
ATOM   3063 C CG  . PHE B 1 95  ? -38.432 -7.032  36.058  1.00 55.97  ? 283 PHE B CG  1 
ATOM   3064 C CD1 . PHE B 1 95  ? -38.226 -8.045  36.980  1.00 60.57  ? 283 PHE B CD1 1 
ATOM   3065 C CD2 . PHE B 1 95  ? -38.716 -5.760  36.522  1.00 63.47  ? 283 PHE B CD2 1 
ATOM   3066 C CE1 . PHE B 1 95  ? -38.312 -7.796  38.337  1.00 64.29  ? 283 PHE B CE1 1 
ATOM   3067 C CE2 . PHE B 1 95  ? -38.799 -5.505  37.881  1.00 67.48  ? 283 PHE B CE2 1 
ATOM   3068 C CZ  . PHE B 1 95  ? -38.598 -6.525  38.788  1.00 66.17  ? 283 PHE B CZ  1 
ATOM   3069 N N   . TYR B 1 96  ? -40.262 -7.101  31.900  1.00 42.79  ? 284 TYR B N   1 
ATOM   3070 C CA  . TYR B 1 96  ? -40.113 -6.787  30.488  1.00 39.19  ? 284 TYR B CA  1 
ATOM   3071 C C   . TYR B 1 96  ? -39.617 -5.359  30.370  1.00 35.75  ? 284 TYR B C   1 
ATOM   3072 O O   . TYR B 1 96  ? -40.368 -4.418  30.616  1.00 35.85  ? 284 TYR B O   1 
ATOM   3073 C CB  . TYR B 1 96  ? -41.430 -6.957  29.731  1.00 42.50  ? 284 TYR B CB  1 
ATOM   3074 C CG  . TYR B 1 96  ? -41.902 -8.387  29.632  1.00 47.60  ? 284 TYR B CG  1 
ATOM   3075 C CD1 . TYR B 1 96  ? -42.886 -8.873  30.482  1.00 52.81  ? 284 TYR B CD1 1 
ATOM   3076 C CD2 . TYR B 1 96  ? -41.360 -9.253  28.691  1.00 46.19  ? 284 TYR B CD2 1 
ATOM   3077 C CE1 . TYR B 1 96  ? -43.321 -10.184 30.395  1.00 55.33  ? 284 TYR B CE1 1 
ATOM   3078 C CE2 . TYR B 1 96  ? -41.788 -10.564 28.596  1.00 45.80  ? 284 TYR B CE2 1 
ATOM   3079 C CZ  . TYR B 1 96  ? -42.769 -11.025 29.451  1.00 52.58  ? 284 TYR B CZ  1 
ATOM   3080 O OH  . TYR B 1 96  ? -43.202 -12.327 29.365  1.00 54.69  ? 284 TYR B OH  1 
ATOM   3081 N N   . CYS B 1 97  ? -38.356 -5.201  29.982  1.00 32.76  ? 285 CYS B N   1 
ATOM   3082 C CA  . CYS B 1 97  ? -37.754 -3.878  29.901  1.00 26.71  ? 285 CYS B CA  1 
ATOM   3083 C C   . CYS B 1 97  ? -37.254 -3.560  28.502  1.00 29.95  ? 285 CYS B C   1 
ATOM   3084 O O   . CYS B 1 97  ? -36.642 -4.392  27.833  1.00 33.83  ? 285 CYS B O   1 
ATOM   3085 C CB  . CYS B 1 97  ? -36.608 -3.754  30.902  1.00 31.53  ? 285 CYS B CB  1 
ATOM   3086 S SG  . CYS B 1 97  ? -37.140 -3.766  32.630  1.00 48.64  ? 285 CYS B SG  1 
ATOM   3087 N N   . LEU B 1 98  ? -37.534 -2.339  28.073  1.00 26.97  ? 286 LEU B N   1 
ATOM   3088 C CA  . LEU B 1 98  ? -37.084 -1.828  26.793  1.00 25.96  ? 286 LEU B CA  1 
ATOM   3089 C C   . LEU B 1 98  ? -36.285 -0.560  27.053  1.00 28.69  ? 286 LEU B C   1 
ATOM   3090 O O   . LEU B 1 98  ? -36.740 0.326   27.775  1.00 27.80  ? 286 LEU B O   1 
ATOM   3091 C CB  . LEU B 1 98  ? -38.275 -1.558  25.875  1.00 32.27  ? 286 LEU B CB  1 
ATOM   3092 C CG  . LEU B 1 98  ? -39.150 -2.790  25.622  1.00 37.89  ? 286 LEU B CG  1 
ATOM   3093 C CD1 . LEU B 1 98  ? -40.494 -2.417  25.019  1.00 36.57  ? 286 LEU B CD1 1 
ATOM   3094 C CD2 . LEU B 1 98  ? -38.410 -3.758  24.716  1.00 37.78  ? 286 LEU B CD2 1 
ATOM   3095 N N   . VAL B 1 99  ? -35.087 -0.481  26.489  1.00 25.77  ? 287 VAL B N   1 
ATOM   3096 C CA  . VAL B 1 99  ? -34.214 0.650   26.751  1.00 27.12  ? 287 VAL B CA  1 
ATOM   3097 C C   . VAL B 1 99  ? -34.148 1.542   25.517  1.00 28.59  ? 287 VAL B C   1 
ATOM   3098 O O   . VAL B 1 99  ? -34.118 1.039   24.398  1.00 26.12  ? 287 VAL B O   1 
ATOM   3099 C CB  . VAL B 1 99  ? -32.801 0.178   27.154  1.00 27.82  ? 287 VAL B CB  1 
ATOM   3100 C CG1 . VAL B 1 99  ? -31.950 1.351   27.616  1.00 24.24  ? 287 VAL B CG1 1 
ATOM   3101 C CG2 . VAL B 1 99  ? -32.898 -0.872  28.250  1.00 26.75  ? 287 VAL B CG2 1 
ATOM   3102 N N   . TYR B 1 100 ? -34.147 2.858   25.727  1.00 22.69  ? 288 TYR B N   1 
ATOM   3103 C CA  . TYR B 1 100 ? -34.086 3.832   24.638  1.00 25.54  ? 288 TYR B CA  1 
ATOM   3104 C C   . TYR B 1 100 ? -33.147 4.988   24.975  1.00 26.69  ? 288 TYR B C   1 
ATOM   3105 O O   . TYR B 1 100 ? -32.925 5.296   26.147  1.00 29.11  ? 288 TYR B O   1 
ATOM   3106 C CB  . TYR B 1 100 ? -35.470 4.426   24.324  1.00 24.66  ? 288 TYR B CB  1 
ATOM   3107 C CG  . TYR B 1 100 ? -36.618 3.453   24.199  1.00 27.45  ? 288 TYR B CG  1 
ATOM   3108 C CD1 . TYR B 1 100 ? -37.293 3.001   25.326  1.00 27.76  ? 288 TYR B CD1 1 
ATOM   3109 C CD2 . TYR B 1 100 ? -37.063 3.025   22.951  1.00 26.02  ? 288 TYR B CD2 1 
ATOM   3110 C CE1 . TYR B 1 100 ? -38.361 2.125   25.216  1.00 30.96  ? 288 TYR B CE1 1 
ATOM   3111 C CE2 . TYR B 1 100 ? -38.128 2.150   22.833  1.00 24.89  ? 288 TYR B CE2 1 
ATOM   3112 C CZ  . TYR B 1 100 ? -38.775 1.705   23.968  1.00 28.66  ? 288 TYR B CZ  1 
ATOM   3113 O OH  . TYR B 1 100 ? -39.836 0.836   23.862  1.00 31.67  ? 288 TYR B OH  1 
ATOM   3114 N N   . GLY B 1 101 ? -32.625 5.646   23.946  1.00 25.83  ? 289 GLY B N   1 
ATOM   3115 C CA  . GLY B 1 101 ? -31.928 6.903   24.142  1.00 26.07  ? 289 GLY B CA  1 
ATOM   3116 C C   . GLY B 1 101 ? -32.891 7.891   24.778  1.00 28.53  ? 289 GLY B C   1 
ATOM   3117 O O   . GLY B 1 101 ? -34.048 7.994   24.366  1.00 29.03  ? 289 GLY B O   1 
ATOM   3118 N N   . PHE B 1 102 ? -32.422 8.600   25.798  1.00 31.49  ? 290 PHE B N   1 
ATOM   3119 C CA  . PHE B 1 102 ? -33.262 9.531   26.546  1.00 31.41  ? 290 PHE B CA  1 
ATOM   3120 C C   . PHE B 1 102 ? -33.612 10.767  25.715  1.00 31.66  ? 290 PHE B C   1 
ATOM   3121 O O   . PHE B 1 102 ? -32.738 11.390  25.119  1.00 33.93  ? 290 PHE B O   1 
ATOM   3122 C CB  . PHE B 1 102 ? -32.550 9.934   27.843  1.00 32.35  ? 290 PHE B CB  1 
ATOM   3123 C CG  . PHE B 1 102 ? -33.393 10.754  28.785  1.00 29.25  ? 290 PHE B CG  1 
ATOM   3124 C CD1 . PHE B 1 102 ? -34.456 10.184  29.462  1.00 29.64  ? 290 PHE B CD1 1 
ATOM   3125 C CD2 . PHE B 1 102 ? -33.095 12.087  29.020  1.00 31.52  ? 290 PHE B CD2 1 
ATOM   3126 C CE1 . PHE B 1 102 ? -35.224 10.931  30.339  1.00 29.93  ? 290 PHE B CE1 1 
ATOM   3127 C CE2 . PHE B 1 102 ? -33.862 12.842  29.901  1.00 33.91  ? 290 PHE B CE2 1 
ATOM   3128 C CZ  . PHE B 1 102 ? -34.928 12.260  30.560  1.00 29.26  ? 290 PHE B CZ  1 
ATOM   3129 N N   . LEU B 1 103 ? -34.892 11.122  25.677  1.00 36.38  ? 291 LEU B N   1 
ATOM   3130 C CA  . LEU B 1 103 ? -35.320 12.320  24.956  1.00 33.98  ? 291 LEU B CA  1 
ATOM   3131 C C   . LEU B 1 103 ? -35.853 13.354  25.952  1.00 35.33  ? 291 LEU B C   1 
ATOM   3132 O O   . LEU B 1 103 ? -36.983 13.239  26.433  1.00 33.80  ? 291 LEU B O   1 
ATOM   3133 C CB  . LEU B 1 103 ? -36.375 11.958  23.907  1.00 29.75  ? 291 LEU B CB  1 
ATOM   3134 C CG  . LEU B 1 103 ? -35.895 10.914  22.891  1.00 28.98  ? 291 LEU B CG  1 
ATOM   3135 C CD1 . LEU B 1 103 ? -37.053 10.252  22.158  1.00 25.67  ? 291 LEU B CD1 1 
ATOM   3136 C CD2 . LEU B 1 103 ? -34.937 11.550  21.896  1.00 25.57  ? 291 LEU B CD2 1 
ATOM   3137 N N   . PRO B 1 104 ? -35.042 14.389  26.230  1.00 34.53  ? 292 PRO B N   1 
ATOM   3138 C CA  . PRO B 1 104 ? -35.200 15.269  27.399  1.00 35.05  ? 292 PRO B CA  1 
ATOM   3139 C C   . PRO B 1 104 ? -36.473 16.113  27.442  1.00 36.50  ? 292 PRO B C   1 
ATOM   3140 O O   . PRO B 1 104 ? -36.884 16.492  28.536  1.00 38.25  ? 292 PRO B O   1 
ATOM   3141 C CB  . PRO B 1 104 ? -33.968 16.183  27.313  1.00 32.94  ? 292 PRO B CB  1 
ATOM   3142 C CG  . PRO B 1 104 ? -32.974 15.415  26.508  1.00 36.02  ? 292 PRO B CG  1 
ATOM   3143 C CD  . PRO B 1 104 ? -33.798 14.671  25.496  1.00 34.39  ? 292 PRO B CD  1 
ATOM   3144 N N   . ASN B 1 105 ? -37.085 16.410  26.301  1.00 35.95  ? 293 ASN B N   1 
ATOM   3145 C CA  . ASN B 1 105 ? -38.288 17.245  26.311  1.00 35.69  ? 293 ASN B CA  1 
ATOM   3146 C C   . ASN B 1 105 ? -39.584 16.456  26.462  1.00 33.79  ? 293 ASN B C   1 
ATOM   3147 O O   . ASN B 1 105 ? -40.669 17.031  26.436  1.00 36.64  ? 293 ASN B O   1 
ATOM   3148 C CB  . ASN B 1 105 ? -38.352 18.102  25.048  1.00 38.65  ? 293 ASN B CB  1 
ATOM   3149 C CG  . ASN B 1 105 ? -37.723 19.466  25.245  1.00 45.24  ? 293 ASN B CG  1 
ATOM   3150 O OD1 . ASN B 1 105 ? -37.983 20.143  26.242  1.00 50.19  ? 293 ASN B OD1 1 
ATOM   3151 N ND2 . ASN B 1 105 ? -36.882 19.874  24.303  1.00 43.53  ? 293 ASN B ND2 1 
ATOM   3152 N N   . GLY B 1 106 ? -39.472 15.139  26.613  1.00 32.08  ? 294 GLY B N   1 
ATOM   3153 C CA  . GLY B 1 106 ? -40.623 14.311  26.932  1.00 30.43  ? 294 GLY B CA  1 
ATOM   3154 C C   . GLY B 1 106 ? -41.622 14.098  25.808  1.00 33.00  ? 294 GLY B C   1 
ATOM   3155 O O   . GLY B 1 106 ? -41.277 14.143  24.627  1.00 35.28  ? 294 GLY B O   1 
ATOM   3156 N N   . SER B 1 107 ? -42.875 13.867  26.184  1.00 30.74  ? 295 SER B N   1 
ATOM   3157 C CA  . SER B 1 107 ? -43.912 13.517  25.221  1.00 35.95  ? 295 SER B CA  1 
ATOM   3158 C C   . SER B 1 107 ? -44.675 14.741  24.746  1.00 39.45  ? 295 SER B C   1 
ATOM   3159 O O   . SER B 1 107 ? -44.840 15.710  25.488  1.00 43.38  ? 295 SER B O   1 
ATOM   3160 C CB  . SER B 1 107 ? -44.887 12.500  25.817  1.00 36.33  ? 295 SER B CB  1 
ATOM   3161 O OG  . SER B 1 107 ? -45.651 13.068  26.865  1.00 39.38  ? 295 SER B OG  1 
ATOM   3162 N N   . LEU B 1 108 ? -45.111 14.699  23.491  1.00 37.78  ? 296 LEU B N   1 
ATOM   3163 C CA  . LEU B 1 108 ? -45.966 15.739  22.936  1.00 38.81  ? 296 LEU B CA  1 
ATOM   3164 C C   . LEU B 1 108 ? -47.193 15.968  23.818  1.00 43.52  ? 296 LEU B C   1 
ATOM   3165 O O   . LEU B 1 108 ? -47.668 17.096  23.954  1.00 48.00  ? 296 LEU B O   1 
ATOM   3166 C CB  . LEU B 1 108 ? -46.396 15.372  21.518  1.00 37.02  ? 296 LEU B CB  1 
ATOM   3167 C CG  . LEU B 1 108 ? -47.381 16.337  20.858  1.00 36.88  ? 296 LEU B CG  1 
ATOM   3168 C CD1 . LEU B 1 108 ? -46.762 17.721  20.748  1.00 35.13  ? 296 LEU B CD1 1 
ATOM   3169 C CD2 . LEU B 1 108 ? -47.810 15.821  19.495  1.00 35.60  ? 296 LEU B CD2 1 
ATOM   3170 N N   . GLU B 1 109 ? -47.688 14.889  24.421  1.00 39.67  ? 297 GLU B N   1 
ATOM   3171 C CA  . GLU B 1 109 ? -48.847 14.950  25.304  1.00 46.08  ? 297 GLU B CA  1 
ATOM   3172 C C   . GLU B 1 109 ? -48.610 15.866  26.502  1.00 45.39  ? 297 GLU B C   1 
ATOM   3173 O O   . GLU B 1 109 ? -49.471 16.667  26.855  1.00 43.97  ? 297 GLU B O   1 
ATOM   3174 C CB  . GLU B 1 109 ? -49.218 13.550  25.792  1.00 52.30  ? 297 GLU B CB  1 
ATOM   3175 C CG  . GLU B 1 109 ? -50.429 13.513  26.712  1.00 60.15  ? 297 GLU B CG  1 
ATOM   3176 C CD  . GLU B 1 109 ? -50.551 12.201  27.466  1.00 64.78  ? 297 GLU B CD  1 
ATOM   3177 O OE1 . GLU B 1 109 ? -49.559 11.781  28.103  1.00 64.35  ? 297 GLU B OE1 1 
ATOM   3178 O OE2 . GLU B 1 109 ? -51.637 11.587  27.419  1.00 66.81  ? 297 GLU B OE2 1 
ATOM   3179 N N   . ASP B 1 110 ? -47.439 15.742  27.123  1.00 49.45  ? 298 ASP B N   1 
ATOM   3180 C CA  . ASP B 1 110 ? -47.094 16.572  28.274  1.00 49.12  ? 298 ASP B CA  1 
ATOM   3181 C C   . ASP B 1 110 ? -46.846 18.021  27.874  1.00 47.65  ? 298 ASP B C   1 
ATOM   3182 O O   . ASP B 1 110 ? -47.212 18.939  28.605  1.00 50.13  ? 298 ASP B O   1 
ATOM   3183 C CB  . ASP B 1 110 ? -45.859 16.023  28.992  1.00 51.16  ? 298 ASP B CB  1 
ATOM   3184 C CG  . ASP B 1 110 ? -46.122 14.701  29.689  1.00 57.38  ? 298 ASP B CG  1 
ATOM   3185 O OD1 . ASP B 1 110 ? -47.299 14.386  29.966  1.00 59.46  ? 298 ASP B OD1 1 
ATOM   3186 O OD2 . ASP B 1 110 ? -45.144 13.976  29.967  1.00 62.69  ? 298 ASP B OD2 1 
ATOM   3187 N N   . ARG B 1 111 ? -46.221 18.223  26.717  1.00 43.52  ? 299 ARG B N   1 
ATOM   3188 C CA  . ARG B 1 111 ? -45.922 19.571  26.241  1.00 48.56  ? 299 ARG B CA  1 
ATOM   3189 C C   . ARG B 1 111 ? -47.192 20.328  25.865  1.00 51.57  ? 299 ARG B C   1 
ATOM   3190 O O   . ARG B 1 111 ? -47.278 21.540  26.064  1.00 58.12  ? 299 ARG B O   1 
ATOM   3191 C CB  . ARG B 1 111 ? -44.970 19.528  25.046  1.00 51.36  ? 299 ARG B CB  1 
ATOM   3192 C CG  . ARG B 1 111 ? -43.493 19.475  25.415  1.00 57.78  ? 299 ARG B CG  1 
ATOM   3193 C CD  . ARG B 1 111 ? -43.111 20.613  26.354  1.00 65.80  ? 299 ARG B CD  1 
ATOM   3194 N NE  . ARG B 1 111 ? -41.799 21.177  26.039  1.00 71.34  ? 299 ARG B NE  1 
ATOM   3195 C CZ  . ARG B 1 111 ? -41.613 22.365  25.471  1.00 74.14  ? 299 ARG B CZ  1 
ATOM   3196 N NH1 . ARG B 1 111 ? -42.655 23.125  25.162  1.00 75.15  ? 299 ARG B NH1 1 
ATOM   3197 N NH2 . ARG B 1 111 ? -40.384 22.798  25.219  1.00 75.81  ? 299 ARG B NH2 1 
ATOM   3198 N N   . LEU B 1 112 ? -48.172 19.615  25.316  1.00 49.17  ? 300 LEU B N   1 
ATOM   3199 C CA  . LEU B 1 112 ? -49.452 20.224  24.964  1.00 53.84  ? 300 LEU B CA  1 
ATOM   3200 C C   . LEU B 1 112 ? -50.290 20.574  26.190  1.00 61.83  ? 300 LEU B C   1 
ATOM   3201 O O   . LEU B 1 112 ? -50.737 21.707  26.343  1.00 65.48  ? 300 LEU B O   1 
ATOM   3202 C CB  . LEU B 1 112 ? -50.260 19.296  24.054  1.00 50.52  ? 300 LEU B CB  1 
ATOM   3203 C CG  . LEU B 1 112 ? -49.846 19.186  22.588  1.00 47.31  ? 300 LEU B CG  1 
ATOM   3204 C CD1 . LEU B 1 112 ? -50.751 18.201  21.861  1.00 45.63  ? 300 LEU B CD1 1 
ATOM   3205 C CD2 . LEU B 1 112 ? -49.885 20.550  21.919  1.00 46.01  ? 300 LEU B CD2 1 
ATOM   3206 N N   . HIS B 1 113 ? -50.491 19.594  27.063  1.00 62.15  ? 301 HIS B N   1 
ATOM   3207 C CA  . HIS B 1 113 ? -51.496 19.705  28.114  1.00 67.36  ? 301 HIS B CA  1 
ATOM   3208 C C   . HIS B 1 113 ? -50.930 20.137  29.463  1.00 76.98  ? 301 HIS B C   1 
ATOM   3209 O O   . HIS B 1 113 ? -51.291 21.193  29.981  1.00 82.89  ? 301 HIS B O   1 
ATOM   3210 C CB  . HIS B 1 113 ? -52.234 18.374  28.259  1.00 63.02  ? 301 HIS B CB  1 
ATOM   3211 C CG  . HIS B 1 113 ? -52.771 17.846  26.966  1.00 61.57  ? 301 HIS B CG  1 
ATOM   3212 N ND1 . HIS B 1 113 ? -53.630 18.570  26.167  1.00 62.17  ? 301 HIS B ND1 1 
ATOM   3213 C CD2 . HIS B 1 113 ? -52.565 16.670  26.327  1.00 60.36  ? 301 HIS B CD2 1 
ATOM   3214 C CE1 . HIS B 1 113 ? -53.932 17.863  25.094  1.00 63.05  ? 301 HIS B CE1 1 
ATOM   3215 N NE2 . HIS B 1 113 ? -53.299 16.705  25.166  1.00 61.14  ? 301 HIS B NE2 1 
ATOM   3216 N N   . CYS B 1 114 ? -50.058 19.311  30.031  1.00 70.93  ? 302 CYS B N   1 
ATOM   3217 C CA  . CYS B 1 114 ? -49.543 19.533  31.379  1.00 78.49  ? 302 CYS B CA  1 
ATOM   3218 C C   . CYS B 1 114 ? -48.905 20.907  31.567  1.00 85.60  ? 302 CYS B C   1 
ATOM   3219 O O   . CYS B 1 114 ? -49.250 21.640  32.495  1.00 89.23  ? 302 CYS B O   1 
ATOM   3220 C CB  . CYS B 1 114 ? -48.525 18.447  31.736  1.00 75.70  ? 302 CYS B CB  1 
ATOM   3221 S SG  . CYS B 1 114 ? -47.863 18.590  33.412  1.00 99.66  ? 302 CYS B SG  1 
ATOM   3222 N N   . GLN B 1 115 ? -47.978 21.253  30.682  1.00 79.91  ? 303 GLN B N   1 
ATOM   3223 C CA  . GLN B 1 115 ? -47.218 22.488  30.821  1.00 82.82  ? 303 GLN B CA  1 
ATOM   3224 C C   . GLN B 1 115 ? -47.983 23.687  30.272  1.00 86.60  ? 303 GLN B C   1 
ATOM   3225 O O   . GLN B 1 115 ? -48.497 24.506  31.034  1.00 89.36  ? 303 GLN B O   1 
ATOM   3226 C CB  . GLN B 1 115 ? -45.868 22.352  30.120  1.00 81.69  ? 303 GLN B CB  1 
ATOM   3227 C CG  . GLN B 1 115 ? -45.139 21.064  30.466  1.00 82.47  ? 303 GLN B CG  1 
ATOM   3228 C CD  . GLN B 1 115 ? -43.780 20.965  29.807  1.00 83.15  ? 303 GLN B CD  1 
ATOM   3229 O OE1 . GLN B 1 115 ? -43.168 21.979  29.472  1.00 86.03  ? 303 GLN B OE1 1 
ATOM   3230 N NE2 . GLN B 1 115 ? -43.299 19.739  29.614  1.00 79.69  ? 303 GLN B NE2 1 
ATOM   3231 N N   . CYS B 1 119 ? -42.432 27.546  31.545  1.00 104.16 ? 307 CYS B N   1 
ATOM   3232 C CA  . CYS B 1 119 ? -42.147 26.981  30.230  1.00 101.64 ? 307 CYS B CA  1 
ATOM   3233 C C   . CYS B 1 119 ? -43.251 27.316  29.227  1.00 97.53  ? 307 CYS B C   1 
ATOM   3234 O O   . CYS B 1 119 ? -44.366 26.802  29.333  1.00 99.64  ? 307 CYS B O   1 
ATOM   3235 C CB  . CYS B 1 119 ? -41.970 25.466  30.327  1.00 101.86 ? 307 CYS B CB  1 
ATOM   3236 S SG  . CYS B 1 119 ? -41.587 24.666  28.755  1.00 85.94  ? 307 CYS B SG  1 
ATOM   3237 N N   . PRO B 1 120 ? -42.935 28.175  28.243  1.00 94.43  ? 308 PRO B N   1 
ATOM   3238 C CA  . PRO B 1 120 ? -43.903 28.657  27.249  1.00 86.02  ? 308 PRO B CA  1 
ATOM   3239 C C   . PRO B 1 120 ? -44.488 27.529  26.402  1.00 74.03  ? 308 PRO B C   1 
ATOM   3240 O O   . PRO B 1 120 ? -43.814 26.522  26.181  1.00 70.87  ? 308 PRO B O   1 
ATOM   3241 C CB  . PRO B 1 120 ? -43.073 29.618  26.388  1.00 86.50  ? 308 PRO B CB  1 
ATOM   3242 C CG  . PRO B 1 120 ? -41.665 29.177  26.573  1.00 87.08  ? 308 PRO B CG  1 
ATOM   3243 C CD  . PRO B 1 120 ? -41.582 28.702  27.990  1.00 90.60  ? 308 PRO B CD  1 
ATOM   3244 N N   . PRO B 1 121 ? -45.735 27.697  25.930  1.00 71.06  ? 309 PRO B N   1 
ATOM   3245 C CA  . PRO B 1 121 ? -46.387 26.649  25.139  1.00 66.59  ? 309 PRO B CA  1 
ATOM   3246 C C   . PRO B 1 121 ? -45.715 26.440  23.789  1.00 65.78  ? 309 PRO B C   1 
ATOM   3247 O O   . PRO B 1 121 ? -44.776 27.157  23.443  1.00 66.46  ? 309 PRO B O   1 
ATOM   3248 C CB  . PRO B 1 121 ? -47.813 27.180  24.958  1.00 67.02  ? 309 PRO B CB  1 
ATOM   3249 C CG  . PRO B 1 121 ? -47.686 28.657  25.091  1.00 69.82  ? 309 PRO B CG  1 
ATOM   3250 C CD  . PRO B 1 121 ? -46.599 28.878  26.104  1.00 71.10  ? 309 PRO B CD  1 
ATOM   3251 N N   . LEU B 1 122 ? -46.201 25.467  23.030  1.00 61.96  ? 310 LEU B N   1 
ATOM   3252 C CA  . LEU B 1 122 ? -45.646 25.203  21.715  1.00 57.43  ? 310 LEU B CA  1 
ATOM   3253 C C   . LEU B 1 122 ? -46.207 26.199  20.715  1.00 57.23  ? 310 LEU B C   1 
ATOM   3254 O O   . LEU B 1 122 ? -47.421 26.288  20.535  1.00 60.14  ? 310 LEU B O   1 
ATOM   3255 C CB  . LEU B 1 122 ? -45.952 23.771  21.272  1.00 57.15  ? 310 LEU B CB  1 
ATOM   3256 C CG  . LEU B 1 122 ? -45.295 22.651  22.079  1.00 55.91  ? 310 LEU B CG  1 
ATOM   3257 C CD1 . LEU B 1 122 ? -45.816 21.297  21.629  1.00 56.84  ? 310 LEU B CD1 1 
ATOM   3258 C CD2 . LEU B 1 122 ? -43.781 22.712  21.952  1.00 51.52  ? 310 LEU B CD2 1 
ATOM   3259 N N   . SER B 1 123 ? -45.321 26.953  20.073  1.00 54.31  ? 311 SER B N   1 
ATOM   3260 C CA  . SER B 1 123 ? -45.736 27.888  19.039  1.00 53.36  ? 311 SER B CA  1 
ATOM   3261 C C   . SER B 1 123 ? -46.264 27.107  17.848  1.00 55.27  ? 311 SER B C   1 
ATOM   3262 O O   . SER B 1 123 ? -45.953 25.928  17.684  1.00 57.22  ? 311 SER B O   1 
ATOM   3263 C CB  . SER B 1 123 ? -44.578 28.790  18.615  1.00 53.44  ? 311 SER B CB  1 
ATOM   3264 O OG  . SER B 1 123 ? -43.593 28.055  17.909  1.00 57.00  ? 311 SER B OG  1 
ATOM   3265 N N   . TRP B 1 124 ? -47.069 27.762  17.023  1.00 56.30  ? 312 TRP B N   1 
ATOM   3266 C CA  . TRP B 1 124 ? -47.666 27.101  15.870  1.00 57.96  ? 312 TRP B CA  1 
ATOM   3267 C C   . TRP B 1 124 ? -46.634 26.553  14.869  1.00 58.91  ? 312 TRP B C   1 
ATOM   3268 O O   . TRP B 1 124 ? -46.820 25.451  14.345  1.00 60.21  ? 312 TRP B O   1 
ATOM   3269 C CB  . TRP B 1 124 ? -48.638 28.053  15.179  1.00 60.43  ? 312 TRP B CB  1 
ATOM   3270 C CG  . TRP B 1 124 ? -49.781 28.434  16.065  1.00 64.52  ? 312 TRP B CG  1 
ATOM   3271 C CD1 . TRP B 1 124 ? -49.950 29.617  16.726  1.00 65.28  ? 312 TRP B CD1 1 
ATOM   3272 C CD2 . TRP B 1 124 ? -50.908 27.618  16.408  1.00 66.50  ? 312 TRP B CD2 1 
ATOM   3273 N NE1 . TRP B 1 124 ? -51.120 29.592  17.449  1.00 65.59  ? 312 TRP B NE1 1 
ATOM   3274 C CE2 . TRP B 1 124 ? -51.726 28.375  17.271  1.00 67.51  ? 312 TRP B CE2 1 
ATOM   3275 C CE3 . TRP B 1 124 ? -51.308 26.323  16.063  1.00 64.90  ? 312 TRP B CE3 1 
ATOM   3276 C CZ2 . TRP B 1 124 ? -52.923 27.881  17.792  1.00 68.76  ? 312 TRP B CZ2 1 
ATOM   3277 C CZ3 . TRP B 1 124 ? -52.494 25.833  16.584  1.00 66.58  ? 312 TRP B CZ3 1 
ATOM   3278 C CH2 . TRP B 1 124 ? -53.287 26.610  17.438  1.00 69.02  ? 312 TRP B CH2 1 
ATOM   3279 N N   . PRO B 1 125 ? -45.547 27.303  14.594  1.00 56.75  ? 313 PRO B N   1 
ATOM   3280 C CA  . PRO B 1 125 ? -44.513 26.676  13.762  1.00 53.35  ? 313 PRO B CA  1 
ATOM   3281 C C   . PRO B 1 125 ? -43.921 25.411  14.385  1.00 54.43  ? 313 PRO B C   1 
ATOM   3282 O O   . PRO B 1 125 ? -43.622 24.458  13.656  1.00 56.39  ? 313 PRO B O   1 
ATOM   3283 C CB  . PRO B 1 125 ? -43.451 27.772  13.647  1.00 53.90  ? 313 PRO B CB  1 
ATOM   3284 C CG  . PRO B 1 125 ? -44.228 29.038  13.750  1.00 54.95  ? 313 PRO B CG  1 
ATOM   3285 C CD  . PRO B 1 125 ? -45.302 28.750  14.761  1.00 56.18  ? 313 PRO B CD  1 
ATOM   3286 N N   . GLN B 1 126 ? -43.755 25.403  15.706  1.00 53.22  ? 314 GLN B N   1 
ATOM   3287 C CA  . GLN B 1 126 ? -43.240 24.225  16.404  1.00 49.84  ? 314 GLN B CA  1 
ATOM   3288 C C   . GLN B 1 126 ? -44.189 23.045  16.242  1.00 49.51  ? 314 GLN B C   1 
ATOM   3289 O O   . GLN B 1 126 ? -43.763 21.926  15.936  1.00 49.07  ? 314 GLN B O   1 
ATOM   3290 C CB  . GLN B 1 126 ? -43.026 24.520  17.891  1.00 49.60  ? 314 GLN B CB  1 
ATOM   3291 C CG  . GLN B 1 126 ? -41.770 25.315  18.204  1.00 49.77  ? 314 GLN B CG  1 
ATOM   3292 C CD  . GLN B 1 126 ? -41.710 25.751  19.654  1.00 52.24  ? 314 GLN B CD  1 
ATOM   3293 O OE1 . GLN B 1 126 ? -42.729 25.795  20.344  1.00 56.22  ? 314 GLN B OE1 1 
ATOM   3294 N NE2 . GLN B 1 126 ? -40.512 26.076  20.126  1.00 51.67  ? 314 GLN B NE2 1 
ATOM   3295 N N   . ARG B 1 127 ? -45.476 23.304  16.451  1.00 46.16  ? 315 ARG B N   1 
ATOM   3296 C CA  . ARG B 1 127 ? -46.500 22.283  16.282  1.00 46.64  ? 315 ARG B CA  1 
ATOM   3297 C C   . ARG B 1 127 ? -46.460 21.719  14.869  1.00 47.03  ? 315 ARG B C   1 
ATOM   3298 O O   . ARG B 1 127 ? -46.552 20.503  14.660  1.00 46.83  ? 315 ARG B O   1 
ATOM   3299 C CB  . ARG B 1 127 ? -47.877 22.860  16.591  1.00 48.69  ? 315 ARG B CB  1 
ATOM   3300 C CG  . ARG B 1 127 ? -48.041 23.257  18.042  1.00 52.67  ? 315 ARG B CG  1 
ATOM   3301 C CD  . ARG B 1 127 ? -49.223 24.189  18.249  1.00 53.82  ? 315 ARG B CD  1 
ATOM   3302 N NE  . ARG B 1 127 ? -49.295 24.623  19.640  1.00 56.80  ? 315 ARG B NE  1 
ATOM   3303 C CZ  . ARG B 1 127 ? -50.246 24.255  20.492  1.00 57.13  ? 315 ARG B CZ  1 
ATOM   3304 N NH1 . ARG B 1 127 ? -51.227 23.458  20.093  1.00 55.07  ? 315 ARG B NH1 1 
ATOM   3305 N NH2 . ARG B 1 127 ? -50.224 24.696  21.743  1.00 57.68  ? 315 ARG B NH2 1 
ATOM   3306 N N   . LEU B 1 128 ? -46.295 22.614  13.903  1.00 47.32  ? 316 LEU B N   1 
ATOM   3307 C CA  . LEU B 1 128 ? -46.208 22.214  12.509  1.00 51.86  ? 316 LEU B CA  1 
ATOM   3308 C C   . LEU B 1 128 ? -45.021 21.283  12.278  1.00 49.26  ? 316 LEU B C   1 
ATOM   3309 O O   . LEU B 1 128 ? -45.165 20.237  11.643  1.00 47.29  ? 316 LEU B O   1 
ATOM   3310 C CB  . LEU B 1 128 ? -46.106 23.445  11.608  1.00 56.09  ? 316 LEU B CB  1 
ATOM   3311 C CG  . LEU B 1 128 ? -46.154 23.180  10.105  1.00 57.94  ? 316 LEU B CG  1 
ATOM   3312 C CD1 . LEU B 1 128 ? -47.333 22.282  9.768   1.00 56.65  ? 316 LEU B CD1 1 
ATOM   3313 C CD2 . LEU B 1 128 ? -46.243 24.496  9.351   1.00 59.86  ? 316 LEU B CD2 1 
ATOM   3314 N N   . ASP B 1 129 ? -43.857 21.661  12.806  1.00 46.50  ? 317 ASP B N   1 
ATOM   3315 C CA  . ASP B 1 129 ? -42.644 20.850  12.660  1.00 47.84  ? 317 ASP B CA  1 
ATOM   3316 C C   . ASP B 1 129 ? -42.806 19.459  13.270  1.00 43.05  ? 317 ASP B C   1 
ATOM   3317 O O   . ASP B 1 129 ? -42.467 18.451  12.644  1.00 41.59  ? 317 ASP B O   1 
ATOM   3318 C CB  . ASP B 1 129 ? -41.441 21.549  13.301  1.00 58.16  ? 317 ASP B CB  1 
ATOM   3319 C CG  . ASP B 1 129 ? -41.015 22.797  12.547  1.00 71.01  ? 317 ASP B CG  1 
ATOM   3320 O OD1 . ASP B 1 129 ? -41.391 22.941  11.363  1.00 75.60  ? 317 ASP B OD1 1 
ATOM   3321 O OD2 . ASP B 1 129 ? -40.296 23.633  13.137  1.00 75.40  ? 317 ASP B OD2 1 
ATOM   3322 N N   . ILE B 1 130 ? -43.323 19.417  14.495  1.00 43.62  ? 318 ILE B N   1 
ATOM   3323 C CA  . ILE B 1 130 ? -43.565 18.160  15.196  1.00 36.59  ? 318 ILE B CA  1 
ATOM   3324 C C   . ILE B 1 130 ? -44.500 17.245  14.399  1.00 39.11  ? 318 ILE B C   1 
ATOM   3325 O O   . ILE B 1 130 ? -44.234 16.041  14.238  1.00 35.76  ? 318 ILE B O   1 
ATOM   3326 C CB  . ILE B 1 130 ? -44.155 18.426  16.592  1.00 31.41  ? 318 ILE B CB  1 
ATOM   3327 C CG1 . ILE B 1 130 ? -43.072 18.995  17.513  1.00 29.96  ? 318 ILE B CG1 1 
ATOM   3328 C CG2 . ILE B 1 130 ? -44.748 17.162  17.184  1.00 32.88  ? 318 ILE B CG2 1 
ATOM   3329 C CD1 . ILE B 1 130 ? -43.608 19.539  18.822  1.00 36.26  ? 318 ILE B CD1 1 
ATOM   3330 N N   . LEU B 1 131 ? -45.582 17.825  13.884  1.00 37.31  ? 319 LEU B N   1 
ATOM   3331 C CA  . LEU B 1 131 ? -46.520 17.077  13.055  1.00 39.96  ? 319 LEU B CA  1 
ATOM   3332 C C   . LEU B 1 131 ? -45.848 16.555  11.780  1.00 39.81  ? 319 LEU B C   1 
ATOM   3333 O O   . LEU B 1 131 ? -46.097 15.424  11.354  1.00 40.32  ? 319 LEU B O   1 
ATOM   3334 C CB  . LEU B 1 131 ? -47.734 17.944  12.703  1.00 39.88  ? 319 LEU B CB  1 
ATOM   3335 C CG  . LEU B 1 131 ? -48.684 18.244  13.868  1.00 39.28  ? 319 LEU B CG  1 
ATOM   3336 C CD1 . LEU B 1 131 ? -49.856 19.110  13.422  1.00 42.36  ? 319 LEU B CD1 1 
ATOM   3337 C CD2 . LEU B 1 131 ? -49.178 16.952  14.501  1.00 35.72  ? 319 LEU B CD2 1 
ATOM   3338 N N   . LEU B 1 132 ? -44.986 17.377  11.189  1.00 37.45  ? 320 LEU B N   1 
ATOM   3339 C CA  . LEU B 1 132 ? -44.289 17.006  9.961   1.00 38.62  ? 320 LEU B CA  1 
ATOM   3340 C C   . LEU B 1 132 ? -43.346 15.822  10.188  1.00 38.42  ? 320 LEU B C   1 
ATOM   3341 O O   . LEU B 1 132 ? -43.320 14.881  9.392   1.00 42.10  ? 320 LEU B O   1 
ATOM   3342 C CB  . LEU B 1 132 ? -43.509 18.201  9.404   1.00 39.48  ? 320 LEU B CB  1 
ATOM   3343 C CG  . LEU B 1 132 ? -42.746 17.966  8.094   1.00 42.37  ? 320 LEU B CG  1 
ATOM   3344 C CD1 . LEU B 1 132 ? -43.699 17.812  6.919   1.00 42.44  ? 320 LEU B CD1 1 
ATOM   3345 C CD2 . LEU B 1 132 ? -41.741 19.076  7.827   1.00 42.74  ? 320 LEU B CD2 1 
ATOM   3346 N N   . GLY B 1 133 ? -42.580 15.869  11.275  1.00 34.64  ? 321 GLY B N   1 
ATOM   3347 C CA  . GLY B 1 133 ? -41.651 14.795  11.603  1.00 34.13  ? 321 GLY B CA  1 
ATOM   3348 C C   . GLY B 1 133 ? -42.347 13.490  11.954  1.00 35.87  ? 321 GLY B C   1 
ATOM   3349 O O   . GLY B 1 133 ? -41.923 12.402  11.522  1.00 38.88  ? 321 GLY B O   1 
ATOM   3350 N N   . THR B 1 134 ? -43.419 13.595  12.738  1.00 33.08  ? 322 THR B N   1 
ATOM   3351 C CA  . THR B 1 134 ? -44.238 12.430  13.060  1.00 32.92  ? 322 THR B CA  1 
ATOM   3352 C C   . THR B 1 134 ? -44.788 11.790  11.782  1.00 32.55  ? 322 THR B C   1 
ATOM   3353 O O   . THR B 1 134 ? -44.739 10.556  11.596  1.00 31.72  ? 322 THR B O   1 
ATOM   3354 C CB  . THR B 1 134 ? -45.402 12.807  13.986  1.00 34.66  ? 322 THR B CB  1 
ATOM   3355 O OG1 . THR B 1 134 ? -44.885 13.415  15.176  1.00 30.11  ? 322 THR B OG1 1 
ATOM   3356 C CG2 . THR B 1 134 ? -46.206 11.570  14.360  1.00 35.66  ? 322 THR B CG2 1 
ATOM   3357 N N   . ALA B 1 135 ? -45.292 12.645  10.895  1.00 31.95  ? 323 ALA B N   1 
ATOM   3358 C CA  . ALA B 1 135 ? -45.793 12.188  9.607   1.00 31.92  ? 323 ALA B CA  1 
ATOM   3359 C C   . ALA B 1 135 ? -44.695 11.474  8.819   1.00 33.55  ? 323 ALA B C   1 
ATOM   3360 O O   . ALA B 1 135 ? -44.945 10.440  8.204   1.00 30.76  ? 323 ALA B O   1 
ATOM   3361 C CB  . ALA B 1 135 ? -46.348 13.353  8.807   1.00 30.34  ? 323 ALA B CB  1 
ATOM   3362 N N   . ARG B 1 136 ? -43.481 12.026  8.849   1.00 30.35  ? 324 ARG B N   1 
ATOM   3363 C CA  . ARG B 1 136 ? -42.359 11.434  8.123   1.00 32.40  ? 324 ARG B CA  1 
ATOM   3364 C C   . ARG B 1 136 ? -42.085 10.022  8.618   1.00 33.62  ? 324 ARG B C   1 
ATOM   3365 O O   . ARG B 1 136 ? -41.860 9.104   7.820   1.00 35.97  ? 324 ARG B O   1 
ATOM   3366 C CB  . ARG B 1 136 ? -41.094 12.285  8.262   1.00 29.88  ? 324 ARG B CB  1 
ATOM   3367 C CG  . ARG B 1 136 ? -39.911 11.741  7.461   1.00 32.19  ? 324 ARG B CG  1 
ATOM   3368 C CD  . ARG B 1 136 ? -38.664 12.611  7.603   1.00 30.67  ? 324 ARG B CD  1 
ATOM   3369 N NE  . ARG B 1 136 ? -38.910 13.986  7.176   1.00 35.18  ? 324 ARG B NE  1 
ATOM   3370 C CZ  . ARG B 1 136 ? -38.871 15.040  7.986   1.00 36.30  ? 324 ARG B CZ  1 
ATOM   3371 N NH1 . ARG B 1 136 ? -38.584 14.885  9.273   1.00 28.25  ? 324 ARG B NH1 1 
ATOM   3372 N NH2 . ARG B 1 136 ? -39.116 16.254  7.508   1.00 37.28  ? 324 ARG B NH2 1 
ATOM   3373 N N   . ALA B 1 137 ? -42.108 9.853   9.936   1.00 33.43  ? 325 ALA B N   1 
ATOM   3374 C CA  . ALA B 1 137 ? -41.952 8.522   10.517  1.00 31.75  ? 325 ALA B CA  1 
ATOM   3375 C C   . ALA B 1 137 ? -43.027 7.558   10.000  1.00 32.75  ? 325 ALA B C   1 
ATOM   3376 O O   . ALA B 1 137 ? -42.719 6.463   9.487   1.00 31.37  ? 325 ALA B O   1 
ATOM   3377 C CB  . ALA B 1 137 ? -41.997 8.600   12.031  1.00 27.61  ? 325 ALA B CB  1 
ATOM   3378 N N   . ILE B 1 138 ? -44.289 7.968   10.121  1.00 30.21  ? 326 ILE B N   1 
ATOM   3379 C CA  . ILE B 1 138 ? -45.382 7.072   9.752   1.00 32.95  ? 326 ILE B CA  1 
ATOM   3380 C C   . ILE B 1 138 ? -45.349 6.696   8.260   1.00 35.76  ? 326 ILE B C   1 
ATOM   3381 O O   . ILE B 1 138 ? -45.502 5.517   7.905   1.00 36.59  ? 326 ILE B O   1 
ATOM   3382 C CB  . ILE B 1 138 ? -46.743 7.688   10.106  1.00 32.50  ? 326 ILE B CB  1 
ATOM   3383 C CG1 . ILE B 1 138 ? -46.791 8.014   11.601  1.00 31.40  ? 326 ILE B CG1 1 
ATOM   3384 C CG2 . ILE B 1 138 ? -47.871 6.731   9.739   1.00 30.83  ? 326 ILE B CG2 1 
ATOM   3385 C CD1 . ILE B 1 138 ? -47.894 8.981   11.981  1.00 35.81  ? 326 ILE B CD1 1 
ATOM   3386 N N   . GLN B 1 139 ? -45.127 7.682   7.393   1.00 34.88  ? 327 GLN B N   1 
ATOM   3387 C CA  . GLN B 1 139 ? -45.086 7.416   5.956   1.00 34.14  ? 327 GLN B CA  1 
ATOM   3388 C C   . GLN B 1 139 ? -43.877 6.553   5.620   1.00 36.30  ? 327 GLN B C   1 
ATOM   3389 O O   . GLN B 1 139 ? -43.917 5.762   4.672   1.00 37.89  ? 327 GLN B O   1 
ATOM   3390 C CB  . GLN B 1 139 ? -45.068 8.720   5.138   1.00 35.35  ? 327 GLN B CB  1 
ATOM   3391 C CG  . GLN B 1 139 ? -43.824 9.604   5.320   1.00 36.52  ? 327 GLN B CG  1 
ATOM   3392 C CD  . GLN B 1 139 ? -42.681 9.238   4.380   1.00 34.81  ? 327 GLN B CD  1 
ATOM   3393 O OE1 . GLN B 1 139 ? -42.892 8.970   3.195   1.00 37.87  ? 327 GLN B OE1 1 
ATOM   3394 N NE2 . GLN B 1 139 ? -41.463 9.228   4.910   1.00 31.39  ? 327 GLN B NE2 1 
ATOM   3395 N N   . PHE B 1 140 ? -42.806 6.690   6.399   1.00 28.38  ? 328 PHE B N   1 
ATOM   3396 C CA  . PHE B 1 140 ? -41.658 5.817   6.209   1.00 30.86  ? 328 PHE B CA  1 
ATOM   3397 C C   . PHE B 1 140 ? -42.061 4.373   6.486   1.00 32.35  ? 328 PHE B C   1 
ATOM   3398 O O   . PHE B 1 140 ? -41.725 3.472   5.715   1.00 30.09  ? 328 PHE B O   1 
ATOM   3399 C CB  . PHE B 1 140 ? -40.491 6.229   7.106   1.00 34.20  ? 328 PHE B CB  1 
ATOM   3400 C CG  . PHE B 1 140 ? -39.262 5.387   6.920   1.00 39.44  ? 328 PHE B CG  1 
ATOM   3401 C CD1 . PHE B 1 140 ? -38.422 5.594   5.839   1.00 39.20  ? 328 PHE B CD1 1 
ATOM   3402 C CD2 . PHE B 1 140 ? -38.944 4.388   7.830   1.00 44.27  ? 328 PHE B CD2 1 
ATOM   3403 C CE1 . PHE B 1 140 ? -37.293 4.824   5.663   1.00 40.85  ? 328 PHE B CE1 1 
ATOM   3404 C CE2 . PHE B 1 140 ? -37.812 3.612   7.662   1.00 41.92  ? 328 PHE B CE2 1 
ATOM   3405 C CZ  . PHE B 1 140 ? -36.987 3.831   6.572   1.00 41.56  ? 328 PHE B CZ  1 
ATOM   3406 N N   . LEU B 1 141 ? -42.786 4.152   7.580   1.00 33.87  ? 329 LEU B N   1 
ATOM   3407 C CA  . LEU B 1 141 ? -43.260 2.801   7.885   1.00 28.97  ? 329 LEU B CA  1 
ATOM   3408 C C   . LEU B 1 141 ? -44.148 2.261   6.760   1.00 37.31  ? 329 LEU B C   1 
ATOM   3409 O O   . LEU B 1 141 ? -44.031 1.096   6.370   1.00 38.65  ? 329 LEU B O   1 
ATOM   3410 C CB  . LEU B 1 141 ? -44.019 2.770   9.217   1.00 25.73  ? 329 LEU B CB  1 
ATOM   3411 C CG  . LEU B 1 141 ? -43.214 3.087   10.484  1.00 29.89  ? 329 LEU B CG  1 
ATOM   3412 C CD1 . LEU B 1 141 ? -44.081 2.944   11.731  1.00 30.65  ? 329 LEU B CD1 1 
ATOM   3413 C CD2 . LEU B 1 141 ? -41.971 2.205   10.590  1.00 29.11  ? 329 LEU B CD2 1 
ATOM   3414 N N   . HIS B 1 142 ? -45.020 3.114   6.228   1.00 37.93  ? 330 HIS B N   1 
ATOM   3415 C CA  . HIS B 1 142 ? -45.955 2.681   5.188   1.00 40.48  ? 330 HIS B CA  1 
ATOM   3416 C C   . HIS B 1 142 ? -45.303 2.440   3.818   1.00 43.69  ? 330 HIS B C   1 
ATOM   3417 O O   . HIS B 1 142 ? -45.833 1.678   3.007   1.00 43.18  ? 330 HIS B O   1 
ATOM   3418 C CB  . HIS B 1 142 ? -47.088 3.703   5.045   1.00 38.89  ? 330 HIS B CB  1 
ATOM   3419 C CG  . HIS B 1 142 ? -47.991 3.769   6.236   1.00 38.37  ? 330 HIS B CG  1 
ATOM   3420 N ND1 . HIS B 1 142 ? -49.046 4.652   6.326   1.00 38.21  ? 330 HIS B ND1 1 
ATOM   3421 C CD2 . HIS B 1 142 ? -47.999 3.057   7.390   1.00 36.42  ? 330 HIS B CD2 1 
ATOM   3422 C CE1 . HIS B 1 142 ? -49.664 4.482   7.481   1.00 37.67  ? 330 HIS B CE1 1 
ATOM   3423 N NE2 . HIS B 1 142 ? -49.048 3.519   8.145   1.00 38.32  ? 330 HIS B NE2 1 
ATOM   3424 N N   . GLN B 1 143 ? -44.164 3.080   3.558   1.00 42.17  ? 331 GLN B N   1 
ATOM   3425 C CA  . GLN B 1 143 ? -43.499 2.942   2.261   1.00 41.28  ? 331 GLN B CA  1 
ATOM   3426 C C   . GLN B 1 143 ? -42.814 1.589   2.088   1.00 44.04  ? 331 GLN B C   1 
ATOM   3427 O O   . GLN B 1 143 ? -42.473 1.199   0.972   1.00 50.08  ? 331 GLN B O   1 
ATOM   3428 C CB  . GLN B 1 143 ? -42.472 4.058   2.052   1.00 44.03  ? 331 GLN B CB  1 
ATOM   3429 C CG  . GLN B 1 143 ? -43.061 5.374   1.555   1.00 51.17  ? 331 GLN B CG  1 
ATOM   3430 C CD  . GLN B 1 143 ? -42.164 6.075   0.547   1.00 56.12  ? 331 GLN B CD  1 
ATOM   3431 O OE1 . GLN B 1 143 ? -41.662 5.453   -0.393  1.00 63.39  ? 331 GLN B OE1 1 
ATOM   3432 N NE2 . GLN B 1 143 ? -41.957 7.375   0.739   1.00 51.49  ? 331 GLN B NE2 1 
ATOM   3433 N N   . ASP B 1 144 ? -42.604 0.878   3.191   1.00 41.15  ? 332 ASP B N   1 
ATOM   3434 C CA  . ASP B 1 144 ? -42.046 -0.468  3.131   1.00 43.40  ? 332 ASP B CA  1 
ATOM   3435 C C   . ASP B 1 144 ? -43.028 -1.406  2.432   1.00 46.96  ? 332 ASP B C   1 
ATOM   3436 O O   . ASP B 1 144 ? -44.236 -1.191  2.495   1.00 46.61  ? 332 ASP B O   1 
ATOM   3437 C CB  . ASP B 1 144 ? -41.727 -0.981  4.536   1.00 45.33  ? 332 ASP B CB  1 
ATOM   3438 C CG  . ASP B 1 144 ? -40.424 -1.753  4.594   1.00 50.97  ? 332 ASP B CG  1 
ATOM   3439 O OD1 . ASP B 1 144 ? -39.466 -1.349  3.902   1.00 53.34  ? 332 ASP B OD1 1 
ATOM   3440 O OD2 . ASP B 1 144 ? -40.356 -2.763  5.329   1.00 51.76  ? 332 ASP B OD2 1 
ATOM   3441 N N   . SER B 1 145 ? -42.513 -2.412  1.731   1.00 49.09  ? 333 SER B N   1 
ATOM   3442 C CA  . SER B 1 145 ? -43.370 -3.425  1.115   1.00 54.12  ? 333 SER B CA  1 
ATOM   3443 C C   . SER B 1 145 ? -43.072 -4.821  1.666   1.00 57.75  ? 333 SER B C   1 
ATOM   3444 O O   . SER B 1 145 ? -42.013 -5.384  1.385   1.00 61.99  ? 333 SER B O   1 
ATOM   3445 C CB  . SER B 1 145 ? -43.212 -3.410  -0.407  1.00 53.70  ? 333 SER B CB  1 
ATOM   3446 O OG  . SER B 1 145 ? -44.116 -4.315  -1.018  1.00 56.22  ? 333 SER B OG  1 
ATOM   3447 N N   . PRO B 1 146 ? -44.008 -5.394  2.445   1.00 59.62  ? 334 PRO B N   1 
ATOM   3448 C CA  . PRO B 1 146 ? -45.320 -4.840  2.803   1.00 55.94  ? 334 PRO B CA  1 
ATOM   3449 C C   . PRO B 1 146 ? -45.237 -3.727  3.844   1.00 51.10  ? 334 PRO B C   1 
ATOM   3450 O O   . PRO B 1 146 ? -44.259 -3.650  4.584   1.00 50.56  ? 334 PRO B O   1 
ATOM   3451 C CB  . PRO B 1 146 ? -46.058 -6.049  3.376   1.00 55.06  ? 334 PRO B CB  1 
ATOM   3452 C CG  . PRO B 1 146 ? -44.974 -6.867  3.989   1.00 55.74  ? 334 PRO B CG  1 
ATOM   3453 C CD  . PRO B 1 146 ? -43.781 -6.705  3.081   1.00 58.73  ? 334 PRO B CD  1 
ATOM   3454 N N   . SER B 1 147 ? -46.261 -2.879  3.882   1.00 47.20  ? 335 SER B N   1 
ATOM   3455 C CA  . SER B 1 147 ? -46.319 -1.763  4.818   1.00 41.49  ? 335 SER B CA  1 
ATOM   3456 C C   . SER B 1 147 ? -46.358 -2.226  6.267   1.00 42.03  ? 335 SER B C   1 
ATOM   3457 O O   . SER B 1 147 ? -47.022 -3.208  6.599   1.00 47.10  ? 335 SER B O   1 
ATOM   3458 C CB  . SER B 1 147 ? -47.546 -0.894  4.529   1.00 41.01  ? 335 SER B CB  1 
ATOM   3459 O OG  . SER B 1 147 ? -47.446 -0.271  3.263   1.00 43.12  ? 335 SER B OG  1 
ATOM   3460 N N   . LEU B 1 148 ? -45.644 -1.517  7.131   1.00 38.40  ? 336 LEU B N   1 
ATOM   3461 C CA  . LEU B 1 148 ? -45.771 -1.747  8.562   1.00 37.92  ? 336 LEU B CA  1 
ATOM   3462 C C   . LEU B 1 148 ? -46.869 -0.851  9.126   1.00 39.62  ? 336 LEU B C   1 
ATOM   3463 O O   . LEU B 1 148 ? -46.803 0.374   9.013   1.00 37.25  ? 336 LEU B O   1 
ATOM   3464 C CB  . LEU B 1 148 ? -44.453 -1.485  9.295   1.00 37.69  ? 336 LEU B CB  1 
ATOM   3465 C CG  . LEU B 1 148 ? -44.548 -1.820  10.790  1.00 38.78  ? 336 LEU B CG  1 
ATOM   3466 C CD1 . LEU B 1 148 ? -44.644 -3.327  10.987  1.00 36.99  ? 336 LEU B CD1 1 
ATOM   3467 C CD2 . LEU B 1 148 ? -43.402 -1.236  11.605  1.00 35.97  ? 336 LEU B CD2 1 
ATOM   3468 N N   . ILE B 1 149 ? -47.884 -1.471  9.714   1.00 40.43  ? 337 ILE B N   1 
ATOM   3469 C CA  . ILE B 1 149 ? -48.945 -0.738  10.389  1.00 38.53  ? 337 ILE B CA  1 
ATOM   3470 C C   . ILE B 1 149 ? -48.596 -0.578  11.865  1.00 39.27  ? 337 ILE B C   1 
ATOM   3471 O O   . ILE B 1 149 ? -48.505 -1.563  12.591  1.00 39.09  ? 337 ILE B O   1 
ATOM   3472 C CB  . ILE B 1 149 ? -50.295 -1.457  10.250  1.00 41.23  ? 337 ILE B CB  1 
ATOM   3473 C CG1 . ILE B 1 149 ? -50.579 -1.769  8.779   1.00 41.61  ? 337 ILE B CG1 1 
ATOM   3474 C CG2 . ILE B 1 149 ? -51.413 -0.619  10.862  1.00 40.86  ? 337 ILE B CG2 1 
ATOM   3475 C CD1 . ILE B 1 149 ? -51.656 -2.792  8.578   1.00 42.00  ? 337 ILE B CD1 1 
ATOM   3476 N N   . HIS B 1 150 ? -48.385 0.661   12.299  1.00 40.06  ? 338 HIS B N   1 
ATOM   3477 C CA  . HIS B 1 150 ? -47.952 0.929   13.668  1.00 41.02  ? 338 HIS B CA  1 
ATOM   3478 C C   . HIS B 1 150 ? -49.002 0.508   14.705  1.00 37.32  ? 338 HIS B C   1 
ATOM   3479 O O   . HIS B 1 150 ? -48.729 -0.318  15.576  1.00 31.95  ? 338 HIS B O   1 
ATOM   3480 C CB  . HIS B 1 150 ? -47.609 2.413   13.825  1.00 34.09  ? 338 HIS B CB  1 
ATOM   3481 C CG  . HIS B 1 150 ? -46.996 2.755   15.145  1.00 32.36  ? 338 HIS B CG  1 
ATOM   3482 N ND1 . HIS B 1 150 ? -47.745 2.934   16.288  1.00 32.64  ? 338 HIS B ND1 1 
ATOM   3483 C CD2 . HIS B 1 150 ? -45.705 2.956   15.505  1.00 30.22  ? 338 HIS B CD2 1 
ATOM   3484 C CE1 . HIS B 1 150 ? -46.943 3.230   17.295  1.00 31.03  ? 338 HIS B CE1 1 
ATOM   3485 N NE2 . HIS B 1 150 ? -45.700 3.249   16.847  1.00 29.34  ? 338 HIS B NE2 1 
ATOM   3486 N N   . GLY B 1 151 ? -50.195 1.089   14.616  1.00 35.93  ? 339 GLY B N   1 
ATOM   3487 C CA  . GLY B 1 151 ? -51.327 0.652   15.419  1.00 35.61  ? 339 GLY B CA  1 
ATOM   3488 C C   . GLY B 1 151 ? -51.450 1.276   16.801  1.00 38.43  ? 339 GLY B C   1 
ATOM   3489 O O   . GLY B 1 151 ? -52.528 1.280   17.393  1.00 46.24  ? 339 GLY B O   1 
ATOM   3490 N N   . ASP B 1 152 ? -50.334 1.749   17.344  1.00 35.06  ? 340 ASP B N   1 
ATOM   3491 C CA  . ASP B 1 152 ? -50.314 2.411   18.651  1.00 39.15  ? 340 ASP B CA  1 
ATOM   3492 C C   . ASP B 1 152 ? -50.184 3.941   18.639  1.00 42.22  ? 340 ASP B C   1 
ATOM   3493 O O   . ASP B 1 152 ? -49.876 4.528   19.678  1.00 43.04  ? 340 ASP B O   1 
ATOM   3494 C CB  . ASP B 1 152 ? -49.207 1.825   19.525  1.00 44.19  ? 340 ASP B CB  1 
ATOM   3495 C CG  . ASP B 1 152 ? -49.640 1.675   20.974  1.00 45.60  ? 340 ASP B CG  1 
ATOM   3496 O OD1 . ASP B 1 152 ? -50.638 2.321   21.364  1.00 44.39  ? 340 ASP B OD1 1 
ATOM   3497 O OD2 . ASP B 1 152 ? -48.992 0.912   21.720  1.00 48.44  ? 340 ASP B OD2 1 
ATOM   3498 N N   . ILE B 1 153 ? -50.299 4.580   17.478  1.00 38.99  ? 341 ILE B N   1 
ATOM   3499 C CA  . ILE B 1 153 ? -50.016 6.016   17.396  1.00 36.79  ? 341 ILE B CA  1 
ATOM   3500 C C   . ILE B 1 153 ? -50.862 6.878   18.346  1.00 39.51  ? 341 ILE B C   1 
ATOM   3501 O O   . ILE B 1 153 ? -52.092 6.890   18.271  1.00 41.23  ? 341 ILE B O   1 
ATOM   3502 C CB  . ILE B 1 153 ? -50.220 6.527   15.962  1.00 35.22  ? 341 ILE B CB  1 
ATOM   3503 C CG1 . ILE B 1 153 ? -49.207 5.866   15.027  1.00 37.36  ? 341 ILE B CG1 1 
ATOM   3504 C CG2 . ILE B 1 153 ? -50.080 8.036   15.907  1.00 28.83  ? 341 ILE B CG2 1 
ATOM   3505 C CD1 . ILE B 1 153 ? -49.465 6.119   13.566  1.00 39.65  ? 341 ILE B CD1 1 
ATOM   3506 N N   . LYS B 1 154 ? -50.178 7.622   19.217  1.00 37.83  ? 342 LYS B N   1 
ATOM   3507 C CA  . LYS B 1 154 ? -50.821 8.497   20.198  1.00 35.11  ? 342 LYS B CA  1 
ATOM   3508 C C   . LYS B 1 154 ? -49.914 9.691   20.471  1.00 39.16  ? 342 LYS B C   1 
ATOM   3509 O O   . LYS B 1 154 ? -48.783 9.735   19.990  1.00 44.94  ? 342 LYS B O   1 
ATOM   3510 C CB  . LYS B 1 154 ? -51.107 7.753   21.513  1.00 32.15  ? 342 LYS B CB  1 
ATOM   3511 C CG  . LYS B 1 154 ? -51.891 6.455   21.374  1.00 38.80  ? 342 LYS B CG  1 
ATOM   3512 C CD  . LYS B 1 154 ? -52.130 5.790   22.718  1.00 41.73  ? 342 LYS B CD  1 
ATOM   3513 C CE  . LYS B 1 154 ? -50.822 5.507   23.438  1.00 42.75  ? 342 LYS B CE  1 
ATOM   3514 N NZ  . LYS B 1 154 ? -49.892 4.680   22.618  1.00 43.00  ? 342 LYS B NZ  1 
ATOM   3515 N N   . SER B 1 155 ? -50.380 10.642  21.273  1.00 35.45  ? 343 SER B N   1 
ATOM   3516 C CA  . SER B 1 155 ? -49.556 11.810  21.565  1.00 37.56  ? 343 SER B CA  1 
ATOM   3517 C C   . SER B 1 155 ? -48.555 11.508  22.681  1.00 39.28  ? 343 SER B C   1 
ATOM   3518 O O   . SER B 1 155 ? -47.537 12.188  22.815  1.00 36.20  ? 343 SER B O   1 
ATOM   3519 C CB  . SER B 1 155 ? -50.427 13.020  21.928  1.00 40.31  ? 343 SER B CB  1 
ATOM   3520 O OG  . SER B 1 155 ? -51.104 12.833  23.156  1.00 44.13  ? 343 SER B OG  1 
ATOM   3521 N N   . SER B 1 156 ? -48.838 10.476  23.469  1.00 36.89  ? 344 SER B N   1 
ATOM   3522 C CA  . SER B 1 156 ? -47.961 10.114  24.573  1.00 36.17  ? 344 SER B CA  1 
ATOM   3523 C C   . SER B 1 156 ? -46.699 9.393   24.082  1.00 37.24  ? 344 SER B C   1 
ATOM   3524 O O   . SER B 1 156 ? -45.664 9.442   24.742  1.00 36.21  ? 344 SER B O   1 
ATOM   3525 C CB  . SER B 1 156 ? -48.706 9.245   25.592  1.00 33.73  ? 344 SER B CB  1 
ATOM   3526 O OG  . SER B 1 156 ? -49.117 8.014   25.024  1.00 36.38  ? 344 SER B OG  1 
ATOM   3527 N N   . ASN B 1 157 ? -46.795 8.698   22.949  1.00 34.62  ? 345 ASN B N   1 
ATOM   3528 C CA  . ASN B 1 157 ? -45.619 8.070   22.334  1.00 31.34  ? 345 ASN B CA  1 
ATOM   3529 C C   . ASN B 1 157 ? -44.993 8.893   21.203  1.00 31.73  ? 345 ASN B C   1 
ATOM   3530 O O   . ASN B 1 157 ? -44.213 8.364   20.412  1.00 34.57  ? 345 ASN B O   1 
ATOM   3531 C CB  . ASN B 1 157 ? -45.920 6.642   21.861  1.00 33.31  ? 345 ASN B CB  1 
ATOM   3532 C CG  . ASN B 1 157 ? -47.029 6.571   20.847  1.00 33.37  ? 345 ASN B CG  1 
ATOM   3533 O OD1 . ASN B 1 157 ? -48.177 6.845   21.161  1.00 40.65  ? 345 ASN B OD1 1 
ATOM   3534 N ND2 . ASN B 1 157 ? -46.698 6.160   19.630  1.00 31.44  ? 345 ASN B ND2 1 
ATOM   3535 N N   . VAL B 1 158 ? -45.403 10.150  21.060  1.00 32.59  ? 346 VAL B N   1 
ATOM   3536 C CA  . VAL B 1 158 ? -44.606 11.095  20.277  1.00 28.96  ? 346 VAL B CA  1 
ATOM   3537 C C   . VAL B 1 158 ? -43.659 11.862  21.207  1.00 32.56  ? 346 VAL B C   1 
ATOM   3538 O O   . VAL B 1 158 ? -44.093 12.680  22.018  1.00 33.52  ? 346 VAL B O   1 
ATOM   3539 C CB  . VAL B 1 158 ? -45.479 12.089  19.500  1.00 34.79  ? 346 VAL B CB  1 
ATOM   3540 C CG1 . VAL B 1 158 ? -44.598 13.123  18.795  1.00 33.99  ? 346 VAL B CG1 1 
ATOM   3541 C CG2 . VAL B 1 158 ? -46.340 11.353  18.493  1.00 36.10  ? 346 VAL B CG2 1 
ATOM   3542 N N   . LEU B 1 159 ? -42.360 11.614  21.067  1.00 30.45  ? 347 LEU B N   1 
ATOM   3543 C CA  . LEU B 1 159 ? -41.383 12.106  22.033  1.00 29.74  ? 347 LEU B CA  1 
ATOM   3544 C C   . LEU B 1 159 ? -40.488 13.170  21.421  1.00 33.08  ? 347 LEU B C   1 
ATOM   3545 O O   . LEU B 1 159 ? -40.360 13.251  20.208  1.00 33.47  ? 347 LEU B O   1 
ATOM   3546 C CB  . LEU B 1 159 ? -40.558 10.941  22.571  1.00 30.78  ? 347 LEU B CB  1 
ATOM   3547 C CG  . LEU B 1 159 ? -41.525 10.004  23.294  1.00 38.21  ? 347 LEU B CG  1 
ATOM   3548 C CD1 . LEU B 1 159 ? -41.344 8.563   22.873  1.00 43.30  ? 347 LEU B CD1 1 
ATOM   3549 C CD2 . LEU B 1 159 ? -41.432 10.174  24.802  1.00 39.49  ? 347 LEU B CD2 1 
ATOM   3550 N N   . LEU B 1 160 ? -39.909 14.021  22.260  1.00 33.65  ? 348 LEU B N   1 
ATOM   3551 C CA  . LEU B 1 160 ? -39.207 15.205  21.772  1.00 32.99  ? 348 LEU B CA  1 
ATOM   3552 C C   . LEU B 1 160 ? -37.778 15.310  22.306  1.00 33.66  ? 348 LEU B C   1 
ATOM   3553 O O   . LEU B 1 160 ? -37.554 15.195  23.511  1.00 35.51  ? 348 LEU B O   1 
ATOM   3554 C CB  . LEU B 1 160 ? -40.000 16.457  22.153  1.00 33.18  ? 348 LEU B CB  1 
ATOM   3555 C CG  . LEU B 1 160 ? -41.479 16.420  21.757  1.00 35.42  ? 348 LEU B CG  1 
ATOM   3556 C CD1 . LEU B 1 160 ? -42.261 17.570  22.387  1.00 31.62  ? 348 LEU B CD1 1 
ATOM   3557 C CD2 . LEU B 1 160 ? -41.612 16.442  20.244  1.00 36.78  ? 348 LEU B CD2 1 
ATOM   3558 N N   . ASP B 1 161 ? -36.811 15.535  21.420  1.00 32.48  ? 349 ASP B N   1 
ATOM   3559 C CA  . ASP B 1 161 ? -35.440 15.748  21.880  1.00 36.64  ? 349 ASP B CA  1 
ATOM   3560 C C   . ASP B 1 161 ? -35.214 17.224  22.208  1.00 35.01  ? 349 ASP B C   1 
ATOM   3561 O O   . ASP B 1 161 ? -36.163 18.008  22.250  1.00 34.13  ? 349 ASP B O   1 
ATOM   3562 C CB  . ASP B 1 161 ? -34.408 15.244  20.855  1.00 39.87  ? 349 ASP B CB  1 
ATOM   3563 C CG  . ASP B 1 161 ? -34.384 16.055  19.563  1.00 44.92  ? 349 ASP B CG  1 
ATOM   3564 O OD1 . ASP B 1 161 ? -35.083 17.086  19.452  1.00 43.75  ? 349 ASP B OD1 1 
ATOM   3565 O OD2 . ASP B 1 161 ? -33.633 15.651  18.648  1.00 43.50  ? 349 ASP B OD2 1 
ATOM   3566 N N   . GLU B 1 162 ? -33.957 17.593  22.440  1.00 32.50  ? 350 GLU B N   1 
ATOM   3567 C CA  . GLU B 1 162 ? -33.612 18.943  22.881  1.00 40.58  ? 350 GLU B CA  1 
ATOM   3568 C C   . GLU B 1 162 ? -34.013 20.017  21.866  1.00 43.61  ? 350 GLU B C   1 
ATOM   3569 O O   . GLU B 1 162 ? -34.270 21.163  22.237  1.00 43.22  ? 350 GLU B O   1 
ATOM   3570 C CB  . GLU B 1 162 ? -32.111 19.039  23.172  1.00 47.26  ? 350 GLU B CB  1 
ATOM   3571 C CG  . GLU B 1 162 ? -31.602 18.071  24.235  1.00 58.87  ? 350 GLU B CG  1 
ATOM   3572 C CD  . GLU B 1 162 ? -31.288 16.683  23.683  1.00 69.33  ? 350 GLU B CD  1 
ATOM   3573 O OE1 . GLU B 1 162 ? -30.579 15.916  24.370  1.00 74.53  ? 350 GLU B OE1 1 
ATOM   3574 O OE2 . GLU B 1 162 ? -31.749 16.354  22.569  1.00 70.75  ? 350 GLU B OE2 1 
ATOM   3575 N N   . ARG B 1 163 ? -34.061 19.642  20.590  1.00 42.23  ? 351 ARG B N   1 
ATOM   3576 C CA  . ARG B 1 163 ? -34.472 20.556  19.528  1.00 44.71  ? 351 ARG B CA  1 
ATOM   3577 C C   . ARG B 1 163 ? -35.960 20.428  19.205  1.00 45.23  ? 351 ARG B C   1 
ATOM   3578 O O   . ARG B 1 163 ? -36.438 21.030  18.243  1.00 44.49  ? 351 ARG B O   1 
ATOM   3579 C CB  . ARG B 1 163 ? -33.656 20.313  18.257  1.00 48.71  ? 351 ARG B CB  1 
ATOM   3580 C CG  . ARG B 1 163 ? -32.162 20.531  18.404  1.00 57.07  ? 351 ARG B CG  1 
ATOM   3581 C CD  . ARG B 1 163 ? -31.524 20.919  17.071  1.00 65.41  ? 351 ARG B CD  1 
ATOM   3582 N NE  . ARG B 1 163 ? -32.001 20.100  15.957  1.00 71.22  ? 351 ARG B NE  1 
ATOM   3583 C CZ  . ARG B 1 163 ? -32.739 20.559  14.949  1.00 73.56  ? 351 ARG B CZ  1 
ATOM   3584 N NH1 . ARG B 1 163 ? -33.126 19.740  13.981  1.00 75.31  ? 351 ARG B NH1 1 
ATOM   3585 N NH2 . ARG B 1 163 ? -33.087 21.839  14.905  1.00 72.62  ? 351 ARG B NH2 1 
ATOM   3586 N N   . LEU B 1 164 ? -36.666 19.614  19.991  1.00 46.18  ? 352 LEU B N   1 
ATOM   3587 C CA  . LEU B 1 164 ? -38.078 19.283  19.766  1.00 42.47  ? 352 LEU B CA  1 
ATOM   3588 C C   . LEU B 1 164 ? -38.296 18.519  18.456  1.00 41.76  ? 352 LEU B C   1 
ATOM   3589 O O   . LEU B 1 164 ? -39.331 18.658  17.802  1.00 39.50  ? 352 LEU B O   1 
ATOM   3590 C CB  . LEU B 1 164 ? -38.948 20.542  19.787  1.00 40.86  ? 352 LEU B CB  1 
ATOM   3591 C CG  . LEU B 1 164 ? -39.032 21.304  21.110  1.00 41.92  ? 352 LEU B CG  1 
ATOM   3592 C CD1 . LEU B 1 164 ? -39.736 22.635  20.900  1.00 41.48  ? 352 LEU B CD1 1 
ATOM   3593 C CD2 . LEU B 1 164 ? -39.757 20.477  22.153  1.00 40.51  ? 352 LEU B CD2 1 
ATOM   3594 N N   . THR B 1 165 ? -37.313 17.708  18.085  1.00 42.70  ? 353 THR B N   1 
ATOM   3595 C CA  . THR B 1 165 ? -37.460 16.772  16.976  1.00 40.92  ? 353 THR B CA  1 
ATOM   3596 C C   . THR B 1 165 ? -38.326 15.599  17.426  1.00 35.35  ? 353 THR B C   1 
ATOM   3597 O O   . THR B 1 165 ? -38.028 14.970  18.436  1.00 36.19  ? 353 THR B O   1 
ATOM   3598 C CB  . THR B 1 165 ? -36.086 16.265  16.487  1.00 41.44  ? 353 THR B CB  1 
ATOM   3599 O OG1 . THR B 1 165 ? -35.387 17.337  15.843  1.00 44.94  ? 353 THR B OG1 1 
ATOM   3600 C CG2 . THR B 1 165 ? -36.243 15.108  15.512  1.00 38.90  ? 353 THR B CG2 1 
ATOM   3601 N N   . PRO B 1 166 ? -39.425 15.326  16.700  1.00 33.70  ? 354 PRO B N   1 
ATOM   3602 C CA  . PRO B 1 166 ? -40.334 14.246  17.106  1.00 32.40  ? 354 PRO B CA  1 
ATOM   3603 C C   . PRO B 1 166 ? -39.793 12.851  16.795  1.00 34.16  ? 354 PRO B C   1 
ATOM   3604 O O   . PRO B 1 166 ? -39.198 12.626  15.740  1.00 34.43  ? 354 PRO B O   1 
ATOM   3605 C CB  . PRO B 1 166 ? -41.602 14.535  16.297  1.00 28.88  ? 354 PRO B CB  1 
ATOM   3606 C CG  . PRO B 1 166 ? -41.106 15.218  15.069  1.00 29.95  ? 354 PRO B CG  1 
ATOM   3607 C CD  . PRO B 1 166 ? -39.873 15.998  15.467  1.00 29.89  ? 354 PRO B CD  1 
ATOM   3608 N N   . LYS B 1 167 ? -40.018 11.923  17.719  1.00 31.65  ? 355 LYS B N   1 
ATOM   3609 C CA  . LYS B 1 167 ? -39.610 10.532  17.566  1.00 30.94  ? 355 LYS B CA  1 
ATOM   3610 C C   . LYS B 1 167 ? -40.732 9.615   18.043  1.00 28.87  ? 355 LYS B C   1 
ATOM   3611 O O   . LYS B 1 167 ? -41.204 9.723   19.178  1.00 26.54  ? 355 LYS B O   1 
ATOM   3612 C CB  . LYS B 1 167 ? -38.315 10.261  18.333  1.00 32.77  ? 355 LYS B CB  1 
ATOM   3613 C CG  . LYS B 1 167 ? -37.098 10.983  17.752  1.00 34.13  ? 355 LYS B CG  1 
ATOM   3614 C CD  . LYS B 1 167 ? -35.818 10.619  18.483  1.00 43.25  ? 355 LYS B CD  1 
ATOM   3615 C CE  . LYS B 1 167 ? -34.646 11.497  18.044  1.00 47.62  ? 355 LYS B CE  1 
ATOM   3616 N NZ  . LYS B 1 167 ? -34.156 11.158  16.681  1.00 50.61  ? 355 LYS B NZ  1 
ATOM   3617 N N   . LEU B 1 168 ? -41.161 8.724   17.155  1.00 28.95  ? 356 LEU B N   1 
ATOM   3618 C CA  . LEU B 1 168 ? -42.311 7.862   17.394  1.00 25.31  ? 356 LEU B CA  1 
ATOM   3619 C C   . LEU B 1 168 ? -41.925 6.608   18.173  1.00 26.84  ? 356 LEU B C   1 
ATOM   3620 O O   . LEU B 1 168 ? -41.016 5.881   17.778  1.00 32.27  ? 356 LEU B O   1 
ATOM   3621 C CB  . LEU B 1 168 ? -42.953 7.475   16.060  1.00 33.04  ? 356 LEU B CB  1 
ATOM   3622 C CG  . LEU B 1 168 ? -44.193 6.579   16.106  1.00 35.54  ? 356 LEU B CG  1 
ATOM   3623 C CD1 . LEU B 1 168 ? -45.354 7.285   16.799  1.00 30.26  ? 356 LEU B CD1 1 
ATOM   3624 C CD2 . LEU B 1 168 ? -44.586 6.131   14.705  1.00 34.63  ? 356 LEU B CD2 1 
ATOM   3625 N N   . GLY B 1 169 ? -42.602 6.372   19.292  1.00 28.43  ? 357 GLY B N   1 
ATOM   3626 C CA  . GLY B 1 169 ? -42.363 5.185   20.095  1.00 28.46  ? 357 GLY B CA  1 
ATOM   3627 C C   . GLY B 1 169 ? -43.502 4.179   20.054  1.00 33.05  ? 357 GLY B C   1 
ATOM   3628 O O   . GLY B 1 169 ? -44.345 4.216   19.154  1.00 33.14  ? 357 GLY B O   1 
ATOM   3629 N N   . ASP B 1 170 ? -43.507 3.273   21.033  1.00 30.18  ? 358 ASP B N   1 
ATOM   3630 C CA  . ASP B 1 170 ? -44.582 2.295   21.232  1.00 30.32  ? 358 ASP B CA  1 
ATOM   3631 C C   . ASP B 1 170 ? -44.884 1.432   20.003  1.00 33.02  ? 358 ASP B C   1 
ATOM   3632 O O   . ASP B 1 170 ? -45.993 1.461   19.468  1.00 37.26  ? 358 ASP B O   1 
ATOM   3633 C CB  . ASP B 1 170 ? -45.859 3.013   21.684  1.00 33.76  ? 358 ASP B CB  1 
ATOM   3634 C CG  . ASP B 1 170 ? -45.780 3.499   23.125  1.00 38.68  ? 358 ASP B CG  1 
ATOM   3635 O OD1 . ASP B 1 170 ? -44.713 3.337   23.757  1.00 37.14  ? 358 ASP B OD1 1 
ATOM   3636 O OD2 . ASP B 1 170 ? -46.786 4.053   23.624  1.00 40.72  ? 358 ASP B OD2 1 
ATOM   3637 N N   . PHE B 1 171 ? -43.906 0.633   19.595  1.00 31.18  ? 359 PHE B N   1 
ATOM   3638 C CA  . PHE B 1 171 ? -44.028 -0.231  18.422  1.00 30.42  ? 359 PHE B CA  1 
ATOM   3639 C C   . PHE B 1 171 ? -44.570 -1.618  18.770  1.00 30.09  ? 359 PHE B C   1 
ATOM   3640 O O   . PHE B 1 171 ? -44.535 -2.524  17.943  1.00 34.96  ? 359 PHE B O   1 
ATOM   3641 C CB  . PHE B 1 171 ? -42.677 -0.358  17.711  1.00 26.87  ? 359 PHE B CB  1 
ATOM   3642 C CG  . PHE B 1 171 ? -42.409 0.743   16.723  1.00 26.40  ? 359 PHE B CG  1 
ATOM   3643 C CD1 . PHE B 1 171 ? -42.190 2.043   17.155  1.00 28.69  ? 359 PHE B CD1 1 
ATOM   3644 C CD2 . PHE B 1 171 ? -42.378 0.478   15.364  1.00 30.01  ? 359 PHE B CD2 1 
ATOM   3645 C CE1 . PHE B 1 171 ? -41.943 3.063   16.245  1.00 30.57  ? 359 PHE B CE1 1 
ATOM   3646 C CE2 . PHE B 1 171 ? -42.134 1.486   14.449  1.00 33.59  ? 359 PHE B CE2 1 
ATOM   3647 C CZ  . PHE B 1 171 ? -41.915 2.783   14.889  1.00 33.55  ? 359 PHE B CZ  1 
ATOM   3648 N N   . GLY B 1 172 ? -45.019 -1.790  20.009  1.00 30.98  ? 360 GLY B N   1 
ATOM   3649 C CA  . GLY B 1 172 ? -45.491 -3.076  20.494  1.00 29.32  ? 360 GLY B CA  1 
ATOM   3650 C C   . GLY B 1 172 ? -46.693 -3.687  19.790  1.00 37.52  ? 360 GLY B C   1 
ATOM   3651 O O   . GLY B 1 172 ? -46.876 -4.904  19.840  1.00 41.75  ? 360 GLY B O   1 
ATOM   3652 N N   . LEU B 1 173 ? -47.530 -2.858  19.167  1.00 33.49  ? 361 LEU B N   1 
ATOM   3653 C CA  . LEU B 1 173 ? -48.717 -3.349  18.464  1.00 33.24  ? 361 LEU B CA  1 
ATOM   3654 C C   . LEU B 1 173 ? -48.536 -3.481  16.948  1.00 37.84  ? 361 LEU B C   1 
ATOM   3655 O O   . LEU B 1 173 ? -49.460 -3.892  16.251  1.00 41.74  ? 361 LEU B O   1 
ATOM   3656 C CB  . LEU B 1 173 ? -49.916 -2.439  18.748  1.00 36.42  ? 361 LEU B CB  1 
ATOM   3657 C CG  . LEU B 1 173 ? -50.281 -2.230  20.220  1.00 39.98  ? 361 LEU B CG  1 
ATOM   3658 C CD1 . LEU B 1 173 ? -51.558 -1.415  20.347  1.00 42.14  ? 361 LEU B CD1 1 
ATOM   3659 C CD2 . LEU B 1 173 ? -50.410 -3.560  20.949  1.00 37.89  ? 361 LEU B CD2 1 
ATOM   3660 N N   . ALA B 1 174 ? -47.358 -3.128  16.440  1.00 36.57  ? 362 ALA B N   1 
ATOM   3661 C CA  . ALA B 1 174 ? -47.119 -3.094  14.995  1.00 36.74  ? 362 ALA B CA  1 
ATOM   3662 C C   . ALA B 1 174 ? -47.338 -4.445  14.301  1.00 41.62  ? 362 ALA B C   1 
ATOM   3663 O O   . ALA B 1 174 ? -46.996 -5.496  14.842  1.00 44.93  ? 362 ALA B O   1 
ATOM   3664 C CB  . ALA B 1 174 ? -45.709 -2.592  14.714  1.00 32.62  ? 362 ALA B CB  1 
ATOM   3665 N N   . ARG B 1 175 ? -47.920 -4.399  13.104  1.00 39.24  ? 363 ARG B N   1 
ATOM   3666 C CA  . ARG B 1 175 ? -48.103 -5.580  12.258  1.00 41.03  ? 363 ARG B CA  1 
ATOM   3667 C C   . ARG B 1 175 ? -47.881 -5.211  10.794  1.00 42.42  ? 363 ARG B C   1 
ATOM   3668 O O   . ARG B 1 175 ? -48.194 -4.096  10.378  1.00 41.64  ? 363 ARG B O   1 
ATOM   3669 C CB  . ARG B 1 175 ? -49.507 -6.177  12.421  1.00 41.62  ? 363 ARG B CB  1 
ATOM   3670 C CG  . ARG B 1 175 ? -49.888 -6.599  13.829  1.00 46.03  ? 363 ARG B CG  1 
ATOM   3671 C CD  . ARG B 1 175 ? -49.173 -7.869  14.261  1.00 51.73  ? 363 ARG B CD  1 
ATOM   3672 N NE  . ARG B 1 175 ? -49.669 -8.353  15.548  1.00 55.20  ? 363 ARG B NE  1 
ATOM   3673 C CZ  . ARG B 1 175 ? -49.157 -8.007  16.726  1.00 57.90  ? 363 ARG B CZ  1 
ATOM   3674 N NH1 . ARG B 1 175 ? -48.126 -7.174  16.787  1.00 53.84  ? 363 ARG B NH1 1 
ATOM   3675 N NH2 . ARG B 1 175 ? -49.675 -8.497  17.844  1.00 60.77  ? 363 ARG B NH2 1 
ATOM   3676 N N   . PHE B 1 176 ? -47.351 -6.145  10.011  1.00 44.41  ? 364 PHE B N   1 
ATOM   3677 C CA  . PHE B 1 176 ? -47.220 -5.936  8.572   1.00 45.60  ? 364 PHE B CA  1 
ATOM   3678 C C   . PHE B 1 176 ? -48.564 -6.147  7.884   1.00 49.57  ? 364 PHE B C   1 
ATOM   3679 O O   . PHE B 1 176 ? -49.354 -6.996  8.296   1.00 47.72  ? 364 PHE B O   1 
ATOM   3680 C CB  . PHE B 1 176 ? -46.168 -6.873  7.975   1.00 44.51  ? 364 PHE B CB  1 
ATOM   3681 C CG  . PHE B 1 176 ? -44.752 -6.440  8.234   1.00 43.03  ? 364 PHE B CG  1 
ATOM   3682 C CD1 . PHE B 1 176 ? -44.228 -5.326  7.594   1.00 41.65  ? 364 PHE B CD1 1 
ATOM   3683 C CD2 . PHE B 1 176 ? -43.943 -7.147  9.108   1.00 45.21  ? 364 PHE B CD2 1 
ATOM   3684 C CE1 . PHE B 1 176 ? -42.928 -4.920  7.826   1.00 40.81  ? 364 PHE B CE1 1 
ATOM   3685 C CE2 . PHE B 1 176 ? -42.636 -6.748  9.345   1.00 43.42  ? 364 PHE B CE2 1 
ATOM   3686 C CZ  . PHE B 1 176 ? -42.128 -5.632  8.704   1.00 42.46  ? 364 PHE B CZ  1 
ATOM   3687 N N   . SER B 1 177 ? -48.813 -5.385  6.823   1.00 49.94  ? 365 SER B N   1 
ATOM   3688 C CA  . SER B 1 177 ? -50.095 -5.437  6.125   1.00 57.53  ? 365 SER B CA  1 
ATOM   3689 C C   . SER B 1 177 ? -50.213 -6.685  5.254   1.00 61.20  ? 365 SER B C   1 
ATOM   3690 O O   . SER B 1 177 ? -49.374 -7.584  5.326   1.00 55.58  ? 365 SER B O   1 
ATOM   3691 C CB  . SER B 1 177 ? -50.296 -4.184  5.267   1.00 59.23  ? 365 SER B CB  1 
ATOM   3692 O OG  . SER B 1 177 ? -49.380 -4.151  4.186   1.00 63.43  ? 365 SER B OG  1 
ATOM   3693 N N   . ARG B 1 178 ? -51.273 -6.725  4.448   1.00 59.85  ? 366 ARG B N   1 
ATOM   3694 C CA  . ARG B 1 178 ? -51.575 -7.850  3.563   1.00 65.67  ? 366 ARG B CA  1 
ATOM   3695 C C   . ARG B 1 178 ? -51.844 -9.117  4.363   1.00 68.79  ? 366 ARG B C   1 
ATOM   3696 O O   . ARG B 1 178 ? -52.914 -9.714  4.248   1.00 72.30  ? 366 ARG B O   1 
ATOM   3697 C CB  . ARG B 1 178 ? -50.440 -8.094  2.563   1.00 70.00  ? 366 ARG B CB  1 
ATOM   3698 C CG  . ARG B 1 178 ? -50.716 -9.237  1.604   1.00 78.75  ? 366 ARG B CG  1 
ATOM   3699 C CD  . ARG B 1 178 ? -49.501 -9.590  0.759   1.00 85.58  ? 366 ARG B CD  1 
ATOM   3700 N NE  . ARG B 1 178 ? -48.446 -10.234 1.538   1.00 90.35  ? 366 ARG B NE  1 
ATOM   3701 C CZ  . ARG B 1 178 ? -47.287 -9.661  1.841   1.00 93.33  ? 366 ARG B CZ  1 
ATOM   3702 N NH1 . ARG B 1 178 ? -46.380 -10.320 2.553   1.00 93.55  ? 366 ARG B NH1 1 
ATOM   3703 N NH2 . ARG B 1 178 ? -47.031 -8.429  1.424   1.00 95.50  ? 366 ARG B NH2 1 
ATOM   3704 N N   . THR B 1 195 ? -59.757 -9.429  19.768  1.00 91.18  ? 383 THR B N   1 
ATOM   3705 C CA  . THR B 1 195 ? -58.356 -9.154  19.474  1.00 89.52  ? 383 THR B CA  1 
ATOM   3706 C C   . THR B 1 195 ? -58.222 -7.793  18.783  1.00 87.36  ? 383 THR B C   1 
ATOM   3707 O O   . THR B 1 195 ? -57.656 -7.672  17.694  1.00 87.65  ? 383 THR B O   1 
ATOM   3708 C CB  . THR B 1 195 ? -57.735 -10.269 18.602  1.00 91.04  ? 383 THR B CB  1 
ATOM   3709 O OG1 . THR B 1 195 ? -58.141 -11.548 19.103  1.00 93.27  ? 383 THR B OG1 1 
ATOM   3710 C CG2 . THR B 1 195 ? -56.212 -10.197 18.626  1.00 89.40  ? 383 THR B CG2 1 
ATOM   3711 N N   . VAL B 1 196 ? -58.779 -6.771  19.426  1.00 84.44  ? 384 VAL B N   1 
ATOM   3712 C CA  . VAL B 1 196 ? -58.554 -5.385  19.038  1.00 76.83  ? 384 VAL B CA  1 
ATOM   3713 C C   . VAL B 1 196 ? -57.782 -4.703  20.159  1.00 69.17  ? 384 VAL B C   1 
ATOM   3714 O O   . VAL B 1 196 ? -58.233 -4.671  21.303  1.00 70.73  ? 384 VAL B O   1 
ATOM   3715 C CB  . VAL B 1 196 ? -59.871 -4.628  18.770  1.00 75.23  ? 384 VAL B CB  1 
ATOM   3716 C CG1 . VAL B 1 196 ? -59.620 -3.132  18.693  1.00 71.00  ? 384 VAL B CG1 1 
ATOM   3717 C CG2 . VAL B 1 196 ? -60.525 -5.130  17.492  1.00 77.91  ? 384 VAL B CG2 1 
ATOM   3718 N N   . ARG B 1 197 ? -56.615 -4.165  19.834  1.00 63.24  ? 385 ARG B N   1 
ATOM   3719 C CA  . ARG B 1 197 ? -55.728 -3.636  20.860  1.00 61.68  ? 385 ARG B CA  1 
ATOM   3720 C C   . ARG B 1 197 ? -55.423 -2.155  20.648  1.00 54.79  ? 385 ARG B C   1 
ATOM   3721 O O   . ARG B 1 197 ? -55.585 -1.624  19.549  1.00 54.30  ? 385 ARG B O   1 
ATOM   3722 C CB  . ARG B 1 197 ? -54.429 -4.449  20.896  1.00 68.17  ? 385 ARG B CB  1 
ATOM   3723 C CG  . ARG B 1 197 ? -53.769 -4.627  19.534  1.00 74.58  ? 385 ARG B CG  1 
ATOM   3724 C CD  . ARG B 1 197 ? -53.808 -6.076  19.065  1.00 79.31  ? 385 ARG B CD  1 
ATOM   3725 N NE  . ARG B 1 197 ? -53.469 -6.190  17.648  1.00 82.19  ? 385 ARG B NE  1 
ATOM   3726 C CZ  . ARG B 1 197 ? -53.331 -7.342  16.998  1.00 82.18  ? 385 ARG B CZ  1 
ATOM   3727 N NH1 . ARG B 1 197 ? -53.025 -7.344  15.707  1.00 80.56  ? 385 ARG B NH1 1 
ATOM   3728 N NH2 . ARG B 1 197 ? -53.495 -8.493  17.637  1.00 81.87  ? 385 ARG B NH2 1 
ATOM   3729 N N   . GLY B 1 198 ? -54.973 -1.495  21.710  1.00 54.50  ? 386 GLY B N   1 
ATOM   3730 C CA  . GLY B 1 198 ? -54.661 -0.080  21.651  1.00 51.32  ? 386 GLY B CA  1 
ATOM   3731 C C   . GLY B 1 198 ? -55.663 0.795   22.378  1.00 50.03  ? 386 GLY B C   1 
ATOM   3732 O O   . GLY B 1 198 ? -56.596 0.300   23.013  1.00 49.34  ? 386 GLY B O   1 
ATOM   3733 N N   . THR B 1 199 ? -55.458 2.104   22.285  1.00 49.33  ? 387 THR B N   1 
ATOM   3734 C CA  . THR B 1 199 ? -56.278 3.080   22.994  1.00 48.99  ? 387 THR B CA  1 
ATOM   3735 C C   . THR B 1 199 ? -57.429 3.558   22.121  1.00 49.11  ? 387 THR B C   1 
ATOM   3736 O O   . THR B 1 199 ? -57.213 4.092   21.035  1.00 51.60  ? 387 THR B O   1 
ATOM   3737 C CB  . THR B 1 199 ? -55.434 4.286   23.444  1.00 51.35  ? 387 THR B CB  1 
ATOM   3738 O OG1 . THR B 1 199 ? -54.348 3.827   24.260  1.00 54.70  ? 387 THR B OG1 1 
ATOM   3739 C CG2 . THR B 1 199 ? -56.276 5.276   24.231  1.00 47.54  ? 387 THR B CG2 1 
ATOM   3740 N N   . LEU B 1 200 ? -58.650 3.373   22.615  1.00 48.96  ? 388 LEU B N   1 
ATOM   3741 C CA  . LEU B 1 200 ? -59.864 3.601   21.831  1.00 53.63  ? 388 LEU B CA  1 
ATOM   3742 C C   . LEU B 1 200 ? -60.035 5.030   21.327  1.00 49.36  ? 388 LEU B C   1 
ATOM   3743 O O   . LEU B 1 200 ? -60.715 5.261   20.328  1.00 47.20  ? 388 LEU B O   1 
ATOM   3744 C CB  . LEU B 1 200 ? -61.092 3.217   22.656  1.00 62.58  ? 388 LEU B CB  1 
ATOM   3745 C CG  . LEU B 1 200 ? -61.228 1.736   23.006  1.00 68.40  ? 388 LEU B CG  1 
ATOM   3746 C CD1 . LEU B 1 200 ? -62.422 1.513   23.924  1.00 71.02  ? 388 LEU B CD1 1 
ATOM   3747 C CD2 . LEU B 1 200 ? -61.352 0.902   21.739  1.00 68.28  ? 388 LEU B CD2 1 
ATOM   3748 N N   . ALA B 1 201 ? -59.430 5.986   22.022  1.00 47.98  ? 389 ALA B N   1 
ATOM   3749 C CA  . ALA B 1 201 ? -59.567 7.389   21.651  1.00 50.72  ? 389 ALA B CA  1 
ATOM   3750 C C   . ALA B 1 201 ? -58.917 7.686   20.308  1.00 53.89  ? 389 ALA B C   1 
ATOM   3751 O O   . ALA B 1 201 ? -59.344 8.587   19.588  1.00 59.30  ? 389 ALA B O   1 
ATOM   3752 C CB  . ALA B 1 201 ? -58.969 8.273   22.715  1.00 48.55  ? 389 ALA B CB  1 
ATOM   3753 N N   . TYR B 1 202 ? -57.863 6.944   19.991  1.00 53.18  ? 390 TYR B N   1 
ATOM   3754 C CA  . TYR B 1 202 ? -57.108 7.174   18.768  1.00 46.78  ? 390 TYR B CA  1 
ATOM   3755 C C   . TYR B 1 202 ? -57.491 6.232   17.631  1.00 45.92  ? 390 TYR B C   1 
ATOM   3756 O O   . TYR B 1 202 ? -56.911 6.295   16.552  1.00 50.96  ? 390 TYR B O   1 
ATOM   3757 C CB  . TYR B 1 202 ? -55.614 7.068   19.062  1.00 41.62  ? 390 TYR B CB  1 
ATOM   3758 C CG  . TYR B 1 202 ? -55.113 8.194   19.934  1.00 41.22  ? 390 TYR B CG  1 
ATOM   3759 C CD1 . TYR B 1 202 ? -55.143 8.093   21.319  1.00 41.87  ? 390 TYR B CD1 1 
ATOM   3760 C CD2 . TYR B 1 202 ? -54.621 9.365   19.372  1.00 40.91  ? 390 TYR B CD2 1 
ATOM   3761 C CE1 . TYR B 1 202 ? -54.688 9.124   22.120  1.00 40.84  ? 390 TYR B CE1 1 
ATOM   3762 C CE2 . TYR B 1 202 ? -54.166 10.401  20.163  1.00 41.56  ? 390 TYR B CE2 1 
ATOM   3763 C CZ  . TYR B 1 202 ? -54.201 10.276  21.536  1.00 43.46  ? 390 TYR B CZ  1 
ATOM   3764 O OH  . TYR B 1 202 ? -53.747 11.307  22.326  1.00 46.41  ? 390 TYR B OH  1 
ATOM   3765 N N   . LEU B 1 203 ? -58.481 5.376   17.857  1.00 44.83  ? 391 LEU B N   1 
ATOM   3766 C CA  . LEU B 1 203 ? -58.820 4.366   16.862  1.00 50.37  ? 391 LEU B CA  1 
ATOM   3767 C C   . LEU B 1 203 ? -60.190 4.621   16.259  1.00 56.44  ? 391 LEU B C   1 
ATOM   3768 O O   . LEU B 1 203 ? -61.094 5.106   16.942  1.00 57.75  ? 391 LEU B O   1 
ATOM   3769 C CB  . LEU B 1 203 ? -58.783 2.967   17.484  1.00 51.54  ? 391 LEU B CB  1 
ATOM   3770 C CG  . LEU B 1 203 ? -57.438 2.502   18.049  1.00 52.06  ? 391 LEU B CG  1 
ATOM   3771 C CD1 . LEU B 1 203 ? -57.590 1.149   18.728  1.00 50.05  ? 391 LEU B CD1 1 
ATOM   3772 C CD2 . LEU B 1 203 ? -56.376 2.447   16.957  1.00 50.77  ? 391 LEU B CD2 1 
ATOM   3773 N N   . PRO B 1 204 ? -60.352 4.292   14.967  1.00 58.19  ? 392 PRO B N   1 
ATOM   3774 C CA  . PRO B 1 204 ? -61.660 4.500   14.341  1.00 60.64  ? 392 PRO B CA  1 
ATOM   3775 C C   . PRO B 1 204 ? -62.611 3.382   14.733  1.00 63.77  ? 392 PRO B C   1 
ATOM   3776 O O   . PRO B 1 204 ? -62.172 2.419   15.361  1.00 64.69  ? 392 PRO B O   1 
ATOM   3777 C CB  . PRO B 1 204 ? -61.340 4.462   12.847  1.00 59.87  ? 392 PRO B CB  1 
ATOM   3778 C CG  . PRO B 1 204 ? -60.158 3.547   12.755  1.00 56.99  ? 392 PRO B CG  1 
ATOM   3779 C CD  . PRO B 1 204 ? -59.355 3.770   14.015  1.00 54.39  ? 392 PRO B CD  1 
ATOM   3780 N N   . GLU B 1 205 ? -63.879 3.478   14.353  1.00 63.86  ? 393 GLU B N   1 
ATOM   3781 C CA  . GLU B 1 205 ? -64.847 2.500   14.827  1.00 66.08  ? 393 GLU B CA  1 
ATOM   3782 C C   . GLU B 1 205 ? -64.913 1.284   13.914  1.00 64.28  ? 393 GLU B C   1 
ATOM   3783 O O   . GLU B 1 205 ? -65.413 0.236   14.311  1.00 68.46  ? 393 GLU B O   1 
ATOM   3784 C CB  . GLU B 1 205 ? -66.231 3.138   14.963  1.00 76.21  ? 393 GLU B CB  1 
ATOM   3785 C CG  . GLU B 1 205 ? -66.952 2.776   16.257  1.00 84.89  ? 393 GLU B CG  1 
ATOM   3786 C CD  . GLU B 1 205 ? -67.122 3.966   17.186  1.00 93.21  ? 393 GLU B CD  1 
ATOM   3787 O OE1 . GLU B 1 205 ? -68.099 4.727   17.004  1.00 98.56  ? 393 GLU B OE1 1 
ATOM   3788 O OE2 . GLU B 1 205 ? -66.283 4.141   18.097  1.00 92.84  ? 393 GLU B OE2 1 
ATOM   3789 N N   . GLU B 1 206 ? -64.378 1.409   12.705  1.00 63.98  ? 394 GLU B N   1 
ATOM   3790 C CA  . GLU B 1 206 ? -64.386 0.280   11.785  1.00 64.95  ? 394 GLU B CA  1 
ATOM   3791 C C   . GLU B 1 206 ? -63.292 -0.714  12.177  1.00 67.02  ? 394 GLU B C   1 
ATOM   3792 O O   . GLU B 1 206 ? -63.410 -1.909  11.906  1.00 69.34  ? 394 GLU B O   1 
ATOM   3793 C CB  . GLU B 1 206 ? -64.216 0.741   10.330  1.00 66.89  ? 394 GLU B CB  1 
ATOM   3794 C CG  . GLU B 1 206 ? -62.789 0.697   9.794   1.00 72.57  ? 394 GLU B CG  1 
ATOM   3795 C CD  . GLU B 1 206 ? -62.041 1.998   10.005  1.00 73.64  ? 394 GLU B CD  1 
ATOM   3796 O OE1 . GLU B 1 206 ? -62.696 3.020   10.294  1.00 75.21  ? 394 GLU B OE1 1 
ATOM   3797 O OE2 . GLU B 1 206 ? -60.798 1.999   9.878   1.00 75.62  ? 394 GLU B OE2 1 
ATOM   3798 N N   . TYR B 1 207 ? -62.232 -0.223  12.817  1.00 66.79  ? 395 TYR B N   1 
ATOM   3799 C CA  . TYR B 1 207 ? -61.198 -1.110  13.339  1.00 63.80  ? 395 TYR B CA  1 
ATOM   3800 C C   . TYR B 1 207 ? -61.625 -1.712  14.676  1.00 62.94  ? 395 TYR B C   1 
ATOM   3801 O O   . TYR B 1 207 ? -61.349 -2.877  14.958  1.00 61.27  ? 395 TYR B O   1 
ATOM   3802 C CB  . TYR B 1 207 ? -59.862 -0.379  13.497  1.00 62.53  ? 395 TYR B CB  1 
ATOM   3803 C CG  . TYR B 1 207 ? -58.850 -1.173  14.294  1.00 59.77  ? 395 TYR B CG  1 
ATOM   3804 C CD1 . TYR B 1 207 ? -58.299 -2.342  13.784  1.00 58.50  ? 395 TYR B CD1 1 
ATOM   3805 C CD2 . TYR B 1 207 ? -58.457 -0.763  15.561  1.00 59.19  ? 395 TYR B CD2 1 
ATOM   3806 C CE1 . TYR B 1 207 ? -57.380 -3.079  14.510  1.00 56.32  ? 395 TYR B CE1 1 
ATOM   3807 C CE2 . TYR B 1 207 ? -57.539 -1.492  16.296  1.00 56.63  ? 395 TYR B CE2 1 
ATOM   3808 C CZ  . TYR B 1 207 ? -57.004 -2.650  15.766  1.00 58.22  ? 395 TYR B CZ  1 
ATOM   3809 O OH  . TYR B 1 207 ? -56.092 -3.378  16.496  1.00 58.24  ? 395 TYR B OH  1 
ATOM   3810 N N   . ILE B 1 208 ? -62.297 -0.904  15.492  1.00 62.06  ? 396 ILE B N   1 
ATOM   3811 C CA  . ILE B 1 208 ? -62.801 -1.344  16.790  1.00 65.42  ? 396 ILE B CA  1 
ATOM   3812 C C   . ILE B 1 208 ? -63.776 -2.511  16.651  1.00 73.08  ? 396 ILE B C   1 
ATOM   3813 O O   . ILE B 1 208 ? -63.772 -3.438  17.461  1.00 77.22  ? 396 ILE B O   1 
ATOM   3814 C CB  . ILE B 1 208 ? -63.495 -0.181  17.539  1.00 64.19  ? 396 ILE B CB  1 
ATOM   3815 C CG1 . ILE B 1 208 ? -62.457 0.832   18.020  1.00 64.76  ? 396 ILE B CG1 1 
ATOM   3816 C CG2 . ILE B 1 208 ? -64.294 -0.690  18.726  1.00 62.37  ? 396 ILE B CG2 1 
ATOM   3817 C CD1 . ILE B 1 208 ? -63.059 2.084   18.627  1.00 66.49  ? 396 ILE B CD1 1 
ATOM   3818 N N   . LYS B 1 209 ? -64.595 -2.474  15.606  1.00 68.25  ? 397 LYS B N   1 
ATOM   3819 C CA  . LYS B 1 209 ? -65.625 -3.487  15.414  1.00 74.89  ? 397 LYS B CA  1 
ATOM   3820 C C   . LYS B 1 209 ? -65.183 -4.651  14.526  1.00 76.91  ? 397 LYS B C   1 
ATOM   3821 O O   . LYS B 1 209 ? -65.949 -5.589  14.307  1.00 82.99  ? 397 LYS B O   1 
ATOM   3822 C CB  . LYS B 1 209 ? -66.884 -2.846  14.826  1.00 80.36  ? 397 LYS B CB  1 
ATOM   3823 C CG  . LYS B 1 209 ? -67.720 -2.078  15.839  1.00 86.10  ? 397 LYS B CG  1 
ATOM   3824 C CD  . LYS B 1 209 ? -68.214 -3.000  16.948  1.00 90.67  ? 397 LYS B CD  1 
ATOM   3825 C CE  . LYS B 1 209 ? -69.348 -2.369  17.743  1.00 92.66  ? 397 LYS B CE  1 
ATOM   3826 N NZ  . LYS B 1 209 ? -69.925 -3.316  18.739  1.00 92.23  ? 397 LYS B NZ  1 
ATOM   3827 N N   . THR B 1 210 ? -63.956 -4.598  14.020  1.00 74.72  ? 398 THR B N   1 
ATOM   3828 C CA  . THR B 1 210 ? -63.468 -5.644  13.124  1.00 74.26  ? 398 THR B CA  1 
ATOM   3829 C C   . THR B 1 210 ? -62.153 -6.255  13.594  1.00 70.84  ? 398 THR B C   1 
ATOM   3830 O O   . THR B 1 210 ? -62.085 -7.443  13.902  1.00 70.07  ? 398 THR B O   1 
ATOM   3831 C CB  . THR B 1 210 ? -63.277 -5.115  11.694  1.00 75.99  ? 398 THR B CB  1 
ATOM   3832 O OG1 . THR B 1 210 ? -64.532 -4.645  11.187  1.00 75.62  ? 398 THR B OG1 1 
ATOM   3833 C CG2 . THR B 1 210 ? -62.756 -6.220  10.789  1.00 78.61  ? 398 THR B CG2 1 
ATOM   3834 N N   . GLY B 1 211 ? -61.106 -5.440  13.634  1.00 70.25  ? 399 GLY B N   1 
ATOM   3835 C CA  . GLY B 1 211 ? -59.788 -5.921  13.999  1.00 68.70  ? 399 GLY B CA  1 
ATOM   3836 C C   . GLY B 1 211 ? -58.924 -6.068  12.766  1.00 70.62  ? 399 GLY B C   1 
ATOM   3837 O O   . GLY B 1 211 ? -57.779 -6.511  12.844  1.00 70.58  ? 399 GLY B O   1 
ATOM   3838 N N   . ARG B 1 212 ? -59.489 -5.702  11.621  1.00 68.98  ? 400 ARG B N   1 
ATOM   3839 C CA  . ARG B 1 212 ? -58.759 -5.688  10.360  1.00 73.74  ? 400 ARG B CA  1 
ATOM   3840 C C   . ARG B 1 212 ? -57.599 -4.698  10.444  1.00 72.62  ? 400 ARG B C   1 
ATOM   3841 O O   . ARG B 1 212 ? -57.749 -3.595  10.973  1.00 73.37  ? 400 ARG B O   1 
ATOM   3842 C CB  . ARG B 1 212 ? -59.702 -5.334  9.204   1.00 79.86  ? 400 ARG B CB  1 
ATOM   3843 C CG  . ARG B 1 212 ? -59.231 -4.203  8.300   1.00 84.06  ? 400 ARG B CG  1 
ATOM   3844 C CD  . ARG B 1 212 ? -60.386 -3.634  7.484   1.00 88.73  ? 400 ARG B CD  1 
ATOM   3845 N NE  . ARG B 1 212 ? -59.959 -2.574  6.572   1.00 90.64  ? 400 ARG B NE  1 
ATOM   3846 C CZ  . ARG B 1 212 ? -59.860 -1.290  6.907   1.00 91.41  ? 400 ARG B CZ  1 
ATOM   3847 N NH1 . ARG B 1 212 ? -59.463 -0.397  6.009   1.00 91.22  ? 400 ARG B NH1 1 
ATOM   3848 N NH2 . ARG B 1 212 ? -60.154 -0.899  8.139   1.00 92.52  ? 400 ARG B NH2 1 
ATOM   3849 N N   . LEU B 1 213 ? -56.436 -5.097  9.945   1.00 74.45  ? 401 LEU B N   1 
ATOM   3850 C CA  . LEU B 1 213 ? -55.274 -4.222  9.989   1.00 69.32  ? 401 LEU B CA  1 
ATOM   3851 C C   . LEU B 1 213 ? -55.093 -3.526  8.648   1.00 64.01  ? 401 LEU B C   1 
ATOM   3852 O O   . LEU B 1 213 ? -55.075 -4.168  7.597   1.00 64.17  ? 401 LEU B O   1 
ATOM   3853 C CB  . LEU B 1 213 ? -54.011 -5.003  10.374  1.00 72.31  ? 401 LEU B CB  1 
ATOM   3854 C CG  . LEU B 1 213 ? -53.706 -6.376  9.749   1.00 75.90  ? 401 LEU B CG  1 
ATOM   3855 C CD1 . LEU B 1 213 ? -52.924 -6.273  8.442   1.00 77.23  ? 401 LEU B CD1 1 
ATOM   3856 C CD2 . LEU B 1 213 ? -52.958 -7.245  10.752  1.00 76.22  ? 401 LEU B CD2 1 
ATOM   3857 N N   . ALA B 1 214 ? -54.990 -2.202  8.697   1.00 60.02  ? 402 ALA B N   1 
ATOM   3858 C CA  . ALA B 1 214 ? -54.804 -1.386  7.506   1.00 53.51  ? 402 ALA B CA  1 
ATOM   3859 C C   . ALA B 1 214 ? -54.063 -0.108  7.870   1.00 48.70  ? 402 ALA B C   1 
ATOM   3860 O O   . ALA B 1 214 ? -54.132 0.345   9.010   1.00 49.95  ? 402 ALA B O   1 
ATOM   3861 C CB  . ALA B 1 214 ? -56.151 -1.063  6.859   1.00 49.91  ? 402 ALA B CB  1 
ATOM   3862 N N   . VAL B 1 215 ? -53.362 0.473   6.902   1.00 44.90  ? 403 VAL B N   1 
ATOM   3863 C CA  . VAL B 1 215 ? -52.624 1.716   7.117   1.00 46.32  ? 403 VAL B CA  1 
ATOM   3864 C C   . VAL B 1 215 ? -53.565 2.894   7.420   1.00 48.15  ? 403 VAL B C   1 
ATOM   3865 O O   . VAL B 1 215 ? -53.176 3.887   8.065   1.00 47.94  ? 403 VAL B O   1 
ATOM   3866 C CB  . VAL B 1 215 ? -51.746 2.050   5.893   1.00 48.47  ? 403 VAL B CB  1 
ATOM   3867 C CG1 . VAL B 1 215 ? -50.658 1.002   5.723   1.00 47.93  ? 403 VAL B CG1 1 
ATOM   3868 C CG2 . VAL B 1 215 ? -52.596 2.126   4.636   1.00 48.11  ? 403 VAL B CG2 1 
ATOM   3869 N N   . ASP B 1 216 ? -54.811 2.765   6.965   1.00 45.00  ? 404 ASP B N   1 
ATOM   3870 C CA  . ASP B 1 216 ? -55.838 3.778   7.188   1.00 49.40  ? 404 ASP B CA  1 
ATOM   3871 C C   . ASP B 1 216 ? -56.073 4.011   8.675   1.00 47.00  ? 404 ASP B C   1 
ATOM   3872 O O   . ASP B 1 216 ? -56.459 5.108   9.087   1.00 49.13  ? 404 ASP B O   1 
ATOM   3873 C CB  . ASP B 1 216 ? -57.149 3.368   6.513   1.00 58.83  ? 404 ASP B CB  1 
ATOM   3874 C CG  . ASP B 1 216 ? -56.943 2.856   5.101   1.00 68.79  ? 404 ASP B CG  1 
ATOM   3875 O OD1 . ASP B 1 216 ? -56.109 3.432   4.367   1.00 72.36  ? 404 ASP B OD1 1 
ATOM   3876 O OD2 . ASP B 1 216 ? -57.611 1.869   4.727   1.00 75.25  ? 404 ASP B OD2 1 
ATOM   3877 N N   . THR B 1 217 ? -55.841 2.973   9.474   1.00 44.41  ? 405 THR B N   1 
ATOM   3878 C CA  . THR B 1 217 ? -55.945 3.084   10.924  1.00 46.37  ? 405 THR B CA  1 
ATOM   3879 C C   . THR B 1 217 ? -54.900 4.056   11.468  1.00 42.93  ? 405 THR B C   1 
ATOM   3880 O O   . THR B 1 217 ? -55.224 4.959   12.250  1.00 46.37  ? 405 THR B O   1 
ATOM   3881 C CB  . THR B 1 217 ? -55.773 1.716   11.607  1.00 48.01  ? 405 THR B CB  1 
ATOM   3882 O OG1 . THR B 1 217 ? -56.603 0.749   10.955  1.00 47.96  ? 405 THR B OG1 1 
ATOM   3883 C CG2 . THR B 1 217 ? -56.152 1.799   13.082  1.00 45.73  ? 405 THR B CG2 1 
ATOM   3884 N N   . ASP B 1 218 ? -53.651 3.866   11.047  1.00 41.13  ? 406 ASP B N   1 
ATOM   3885 C CA  . ASP B 1 218 ? -52.568 4.777   11.409  1.00 39.19  ? 406 ASP B CA  1 
ATOM   3886 C C   . ASP B 1 218 ? -52.901 6.198   10.990  1.00 40.06  ? 406 ASP B C   1 
ATOM   3887 O O   . ASP B 1 218 ? -52.683 7.146   11.749  1.00 38.27  ? 406 ASP B O   1 
ATOM   3888 C CB  . ASP B 1 218 ? -51.247 4.353   10.762  1.00 36.78  ? 406 ASP B CB  1 
ATOM   3889 C CG  . ASP B 1 218 ? -50.586 3.195   11.480  1.00 38.52  ? 406 ASP B CG  1 
ATOM   3890 O OD1 . ASP B 1 218 ? -50.984 2.888   12.623  1.00 40.17  ? 406 ASP B OD1 1 
ATOM   3891 O OD2 . ASP B 1 218 ? -49.654 2.601   10.900  1.00 38.90  ? 406 ASP B OD2 1 
ATOM   3892 N N   . THR B 1 219 ? -53.425 6.337   9.773   1.00 41.14  ? 407 THR B N   1 
ATOM   3893 C CA  . THR B 1 219 ? -53.819 7.650   9.263   1.00 44.75  ? 407 THR B CA  1 
ATOM   3894 C C   . THR B 1 219 ? -54.867 8.317   10.169  1.00 41.43  ? 407 THR B C   1 
ATOM   3895 O O   . THR B 1 219 ? -54.756 9.502   10.498  1.00 38.18  ? 407 THR B O   1 
ATOM   3896 C CB  . THR B 1 219 ? -54.370 7.546   7.823   1.00 50.94  ? 407 THR B CB  1 
ATOM   3897 O OG1 . THR B 1 219 ? -53.388 6.932   6.976   1.00 49.87  ? 407 THR B OG1 1 
ATOM   3898 C CG2 . THR B 1 219 ? -54.709 8.924   7.276   1.00 51.79  ? 407 THR B CG2 1 
ATOM   3899 N N   . PHE B 1 220 ? -55.871 7.547   10.582  1.00 45.02  ? 408 PHE B N   1 
ATOM   3900 C CA  . PHE B 1 220 ? -56.890 8.055   11.500  1.00 45.16  ? 408 PHE B CA  1 
ATOM   3901 C C   . PHE B 1 220 ? -56.280 8.516   12.826  1.00 43.51  ? 408 PHE B C   1 
ATOM   3902 O O   . PHE B 1 220 ? -56.546 9.634   13.292  1.00 42.46  ? 408 PHE B O   1 
ATOM   3903 C CB  . PHE B 1 220 ? -57.957 6.992   11.763  1.00 46.61  ? 408 PHE B CB  1 
ATOM   3904 C CG  . PHE B 1 220 ? -59.123 7.494   12.569  1.00 53.16  ? 408 PHE B CG  1 
ATOM   3905 C CD1 . PHE B 1 220 ? -59.119 7.402   13.954  1.00 54.61  ? 408 PHE B CD1 1 
ATOM   3906 C CD2 . PHE B 1 220 ? -60.221 8.065   11.941  1.00 55.40  ? 408 PHE B CD2 1 
ATOM   3907 C CE1 . PHE B 1 220 ? -60.187 7.868   14.697  1.00 57.44  ? 408 PHE B CE1 1 
ATOM   3908 C CE2 . PHE B 1 220 ? -61.298 8.533   12.680  1.00 58.07  ? 408 PHE B CE2 1 
ATOM   3909 C CZ  . PHE B 1 220 ? -61.280 8.434   14.060  1.00 59.56  ? 408 PHE B CZ  1 
ATOM   3910 N N   . SER B 1 221 ? -55.466 7.650   13.429  1.00 41.32  ? 409 SER B N   1 
ATOM   3911 C CA  . SER B 1 221 ? -54.787 7.978   14.683  1.00 38.81  ? 409 SER B CA  1 
ATOM   3912 C C   . SER B 1 221 ? -53.984 9.275   14.569  1.00 37.34  ? 409 SER B C   1 
ATOM   3913 O O   . SER B 1 221 ? -53.993 10.118  15.481  1.00 39.51  ? 409 SER B O   1 
ATOM   3914 C CB  . SER B 1 221 ? -53.868 6.831   15.107  1.00 41.54  ? 409 SER B CB  1 
ATOM   3915 O OG  . SER B 1 221 ? -54.608 5.649   15.362  1.00 45.36  ? 409 SER B OG  1 
ATOM   3916 N N   . PHE B 1 222 ? -53.300 9.437   13.440  1.00 34.57  ? 410 PHE B N   1 
ATOM   3917 C CA  . PHE B 1 222 ? -52.524 10.646  13.203  1.00 38.57  ? 410 PHE B CA  1 
ATOM   3918 C C   . PHE B 1 222 ? -53.445 11.855  13.098  1.00 43.80  ? 410 PHE B C   1 
ATOM   3919 O O   . PHE B 1 222 ? -53.101 12.941  13.557  1.00 44.17  ? 410 PHE B O   1 
ATOM   3920 C CB  . PHE B 1 222 ? -51.670 10.519  11.939  1.00 35.37  ? 410 PHE B CB  1 
ATOM   3921 C CG  . PHE B 1 222 ? -50.848 11.745  11.639  1.00 35.86  ? 410 PHE B CG  1 
ATOM   3922 C CD1 . PHE B 1 222 ? -49.694 12.015  12.359  1.00 36.41  ? 410 PHE B CD1 1 
ATOM   3923 C CD2 . PHE B 1 222 ? -51.232 12.630  10.644  1.00 36.81  ? 410 PHE B CD2 1 
ATOM   3924 C CE1 . PHE B 1 222 ? -48.937 13.147  12.086  1.00 38.98  ? 410 PHE B CE1 1 
ATOM   3925 C CE2 . PHE B 1 222 ? -50.484 13.759  10.368  1.00 38.81  ? 410 PHE B CE2 1 
ATOM   3926 C CZ  . PHE B 1 222 ? -49.332 14.019  11.090  1.00 37.89  ? 410 PHE B CZ  1 
ATOM   3927 N N   . GLY B 1 223 ? -54.614 11.661  12.491  1.00 46.15  ? 411 GLY B N   1 
ATOM   3928 C CA  . GLY B 1 223 ? -55.618 12.710  12.436  1.00 46.50  ? 411 GLY B CA  1 
ATOM   3929 C C   . GLY B 1 223 ? -56.037 13.172  13.821  1.00 46.93  ? 411 GLY B C   1 
ATOM   3930 O O   . GLY B 1 223 ? -56.164 14.379  14.085  1.00 44.21  ? 411 GLY B O   1 
ATOM   3931 N N   . VAL B 1 224 ? -56.247 12.207  14.714  1.00 47.35  ? 412 VAL B N   1 
ATOM   3932 C CA  . VAL B 1 224 ? -56.580 12.525  16.100  1.00 46.63  ? 412 VAL B CA  1 
ATOM   3933 C C   . VAL B 1 224 ? -55.452 13.321  16.749  1.00 48.39  ? 412 VAL B C   1 
ATOM   3934 O O   . VAL B 1 224 ? -55.705 14.306  17.452  1.00 45.77  ? 412 VAL B O   1 
ATOM   3935 C CB  . VAL B 1 224 ? -56.854 11.257  16.935  1.00 46.46  ? 412 VAL B CB  1 
ATOM   3936 C CG1 . VAL B 1 224 ? -57.221 11.631  18.361  1.00 45.28  ? 412 VAL B CG1 1 
ATOM   3937 C CG2 . VAL B 1 224 ? -57.957 10.427  16.298  1.00 45.97  ? 412 VAL B CG2 1 
ATOM   3938 N N   . VAL B 1 225 ? -54.210 12.897  16.504  1.00 46.80  ? 413 VAL B N   1 
ATOM   3939 C CA  . VAL B 1 225 ? -53.038 13.613  17.016  1.00 45.73  ? 413 VAL B CA  1 
ATOM   3940 C C   . VAL B 1 225 ? -52.998 15.068  16.528  1.00 49.11  ? 413 VAL B C   1 
ATOM   3941 O O   . VAL B 1 225 ? -52.699 15.991  17.298  1.00 51.97  ? 413 VAL B O   1 
ATOM   3942 C CB  . VAL B 1 225 ? -51.723 12.900  16.611  1.00 41.31  ? 413 VAL B CB  1 
ATOM   3943 C CG1 . VAL B 1 225 ? -50.513 13.768  16.924  1.00 35.92  ? 413 VAL B CG1 1 
ATOM   3944 C CG2 . VAL B 1 225 ? -51.613 11.552  17.312  1.00 36.95  ? 413 VAL B CG2 1 
ATOM   3945 N N   . VAL B 1 226 ? -53.308 15.268  15.251  1.00 46.26  ? 414 VAL B N   1 
ATOM   3946 C CA  . VAL B 1 226 ? -53.362 16.610  14.679  1.00 48.42  ? 414 VAL B CA  1 
ATOM   3947 C C   . VAL B 1 226 ? -54.426 17.455  15.372  1.00 51.32  ? 414 VAL B C   1 
ATOM   3948 O O   . VAL B 1 226 ? -54.166 18.600  15.754  1.00 51.21  ? 414 VAL B O   1 
ATOM   3949 C CB  . VAL B 1 226 ? -53.649 16.577  13.166  1.00 46.87  ? 414 VAL B CB  1 
ATOM   3950 C CG1 . VAL B 1 226 ? -53.886 17.987  12.632  1.00 41.18  ? 414 VAL B CG1 1 
ATOM   3951 C CG2 . VAL B 1 226 ? -52.502 15.900  12.422  1.00 43.17  ? 414 VAL B CG2 1 
ATOM   3952 N N   . LEU B 1 227 ? -55.619 16.887  15.543  1.00 50.16  ? 415 LEU B N   1 
ATOM   3953 C CA  . LEU B 1 227 ? -56.695 17.607  16.225  1.00 51.61  ? 415 LEU B CA  1 
ATOM   3954 C C   . LEU B 1 227 ? -56.283 17.992  17.639  1.00 52.23  ? 415 LEU B C   1 
ATOM   3955 O O   . LEU B 1 227 ? -56.565 19.095  18.100  1.00 51.51  ? 415 LEU B O   1 
ATOM   3956 C CB  . LEU B 1 227 ? -57.978 16.775  16.272  1.00 52.02  ? 415 LEU B CB  1 
ATOM   3957 C CG  . LEU B 1 227 ? -59.027 17.022  15.186  1.00 54.42  ? 415 LEU B CG  1 
ATOM   3958 C CD1 . LEU B 1 227 ? -60.379 16.512  15.654  1.00 56.39  ? 415 LEU B CD1 1 
ATOM   3959 C CD2 . LEU B 1 227 ? -59.102 18.497  14.818  1.00 54.00  ? 415 LEU B CD2 1 
ATOM   3960 N N   . GLU B 1 228 ? -55.611 17.070  18.319  1.00 52.54  ? 416 GLU B N   1 
ATOM   3961 C CA  . GLU B 1 228 ? -55.138 17.299  19.677  1.00 52.38  ? 416 GLU B CA  1 
ATOM   3962 C C   . GLU B 1 228 ? -54.141 18.452  19.717  1.00 50.70  ? 416 GLU B C   1 
ATOM   3963 O O   . GLU B 1 228 ? -54.181 19.291  20.616  1.00 52.43  ? 416 GLU B O   1 
ATOM   3964 C CB  . GLU B 1 228 ? -54.509 16.021  20.234  1.00 52.99  ? 416 GLU B CB  1 
ATOM   3965 C CG  . GLU B 1 228 ? -54.131 16.088  21.699  1.00 55.95  ? 416 GLU B CG  1 
ATOM   3966 C CD  . GLU B 1 228 ? -53.629 14.758  22.224  1.00 56.25  ? 416 GLU B CD  1 
ATOM   3967 O OE1 . GLU B 1 228 ? -53.223 14.702  23.404  1.00 56.47  ? 416 GLU B OE1 1 
ATOM   3968 O OE2 . GLU B 1 228 ? -53.645 13.769  21.455  1.00 51.61  ? 416 GLU B OE2 1 
ATOM   3969 N N   . THR B 1 229 ? -53.258 18.492  18.725  1.00 49.19  ? 417 THR B N   1 
ATOM   3970 C CA  . THR B 1 229 ? -52.255 19.546  18.629  1.00 47.72  ? 417 THR B CA  1 
ATOM   3971 C C   . THR B 1 229 ? -52.903 20.895  18.318  1.00 51.49  ? 417 THR B C   1 
ATOM   3972 O O   . THR B 1 229 ? -52.428 21.942  18.757  1.00 50.97  ? 417 THR B O   1 
ATOM   3973 C CB  . THR B 1 229 ? -51.203 19.211  17.553  1.00 48.35  ? 417 THR B CB  1 
ATOM   3974 O OG1 . THR B 1 229 ? -50.669 17.904  17.800  1.00 49.61  ? 417 THR B OG1 1 
ATOM   3975 C CG2 . THR B 1 229 ? -50.066 20.217  17.573  1.00 44.33  ? 417 THR B CG2 1 
ATOM   3976 N N   . LEU B 1 230 ? -54.008 20.862  17.581  1.00 53.99  ? 418 LEU B N   1 
ATOM   3977 C CA  . LEU B 1 230 ? -54.732 22.081  17.237  1.00 59.82  ? 418 LEU B CA  1 
ATOM   3978 C C   . LEU B 1 230 ? -55.516 22.633  18.426  1.00 62.69  ? 418 LEU B C   1 
ATOM   3979 O O   . LEU B 1 230 ? -55.272 23.750  18.874  1.00 65.12  ? 418 LEU B O   1 
ATOM   3980 C CB  . LEU B 1 230 ? -55.680 21.832  16.064  1.00 63.30  ? 418 LEU B CB  1 
ATOM   3981 C CG  . LEU B 1 230 ? -55.129 22.122  14.668  1.00 67.19  ? 418 LEU B CG  1 
ATOM   3982 C CD1 . LEU B 1 230 ? -56.179 21.806  13.614  1.00 71.28  ? 418 LEU B CD1 1 
ATOM   3983 C CD2 . LEU B 1 230 ? -54.681 23.572  14.560  1.00 69.04  ? 418 LEU B CD2 1 
ATOM   3984 N N   . ALA B 1 231 ? -56.475 21.852  18.911  1.00 61.61  ? 419 ALA B N   1 
ATOM   3985 C CA  . ALA B 1 231 ? -57.348 22.270  20.003  1.00 64.03  ? 419 ALA B CA  1 
ATOM   3986 C C   . ALA B 1 231 ? -56.610 22.399  21.331  1.00 65.29  ? 419 ALA B C   1 
ATOM   3987 O O   . ALA B 1 231 ? -56.986 23.202  22.183  1.00 64.52  ? 419 ALA B O   1 
ATOM   3988 C CB  . ALA B 1 231 ? -58.503 21.297  20.146  1.00 67.19  ? 419 ALA B CB  1 
ATOM   3989 N N   . GLY B 1 232 ? -55.562 21.602  21.507  1.00 68.55  ? 420 GLY B N   1 
ATOM   3990 C CA  . GLY B 1 232 ? -54.803 21.625  22.742  1.00 67.22  ? 420 GLY B CA  1 
ATOM   3991 C C   . GLY B 1 232 ? -55.538 20.990  23.908  1.00 68.54  ? 420 GLY B C   1 
ATOM   3992 O O   . GLY B 1 232 ? -55.190 21.222  25.066  1.00 69.92  ? 420 GLY B O   1 
ATOM   3993 N N   . GLN B 1 233 ? -56.559 20.191  23.610  1.00 59.72  ? 421 GLN B N   1 
ATOM   3994 C CA  . GLN B 1 233 ? -57.254 19.439  24.648  1.00 63.91  ? 421 GLN B CA  1 
ATOM   3995 C C   . GLN B 1 233 ? -57.148 17.941  24.386  1.00 65.64  ? 421 GLN B C   1 
ATOM   3996 O O   . GLN B 1 233 ? -56.894 17.509  23.262  1.00 67.61  ? 421 GLN B O   1 
ATOM   3997 C CB  . GLN B 1 233 ? -58.720 19.864  24.753  1.00 70.90  ? 421 GLN B CB  1 
ATOM   3998 C CG  . GLN B 1 233 ? -59.511 19.751  23.468  1.00 75.29  ? 421 GLN B CG  1 
ATOM   3999 C CD  . GLN B 1 233 ? -60.921 20.288  23.617  1.00 81.53  ? 421 GLN B CD  1 
ATOM   4000 O OE1 . GLN B 1 233 ? -61.694 19.815  24.451  1.00 82.24  ? 421 GLN B OE1 1 
ATOM   4001 N NE2 . GLN B 1 233 ? -61.260 21.290  22.814  1.00 85.86  ? 421 GLN B NE2 1 
ATOM   4002 N N   . ARG B 1 234 ? -57.343 17.157  25.439  1.00 65.32  ? 422 ARG B N   1 
ATOM   4003 C CA  . ARG B 1 234 ? -57.058 15.728  25.406  1.00 63.82  ? 422 ARG B CA  1 
ATOM   4004 C C   . ARG B 1 234 ? -58.005 14.940  24.506  1.00 60.24  ? 422 ARG B C   1 
ATOM   4005 O O   . ARG B 1 234 ? -59.108 15.392  24.193  1.00 63.52  ? 422 ARG B O   1 
ATOM   4006 C CB  . ARG B 1 234 ? -57.097 15.167  26.826  1.00 65.83  ? 422 ARG B CB  1 
ATOM   4007 C CG  . ARG B 1 234 ? -56.287 15.993  27.805  1.00 69.84  ? 422 ARG B CG  1 
ATOM   4008 C CD  . ARG B 1 234 ? -55.995 15.229  29.075  1.00 75.53  ? 422 ARG B CD  1 
ATOM   4009 N NE  . ARG B 1 234 ? -54.630 15.479  29.522  1.00 81.73  ? 422 ARG B NE  1 
ATOM   4010 C CZ  . ARG B 1 234 ? -53.566 14.837  29.049  1.00 86.60  ? 422 ARG B CZ  1 
ATOM   4011 N NH1 . ARG B 1 234 ? -53.714 13.902  28.117  1.00 87.82  ? 422 ARG B NH1 1 
ATOM   4012 N NH2 . ARG B 1 234 ? -52.356 15.126  29.506  1.00 87.46  ? 422 ARG B NH2 1 
ATOM   4013 N N   . ALA B 1 235 ? -57.557 13.758  24.094  1.00 58.15  ? 423 ALA B N   1 
ATOM   4014 C CA  . ALA B 1 235 ? -58.321 12.909  23.189  1.00 56.26  ? 423 ALA B CA  1 
ATOM   4015 C C   . ALA B 1 235 ? -59.560 12.328  23.866  1.00 54.85  ? 423 ALA B C   1 
ATOM   4016 O O   . ALA B 1 235 ? -60.521 11.957  23.196  1.00 52.77  ? 423 ALA B O   1 
ATOM   4017 C CB  . ALA B 1 235 ? -57.437 11.793  22.646  1.00 53.12  ? 423 ALA B CB  1 
ATOM   4018 N N   . VAL B 1 236 ? -59.518 12.231  25.193  1.00 59.20  ? 424 VAL B N   1 
ATOM   4019 C CA  . VAL B 1 236 ? -60.676 11.821  25.985  1.00 62.08  ? 424 VAL B CA  1 
ATOM   4020 C C   . VAL B 1 236 ? -60.964 12.845  27.073  1.00 66.30  ? 424 VAL B C   1 
ATOM   4021 O O   . VAL B 1 236 ? -60.051 13.334  27.739  1.00 65.24  ? 424 VAL B O   1 
ATOM   4022 C CB  . VAL B 1 236 ? -60.483 10.450  26.663  1.00 63.46  ? 424 VAL B CB  1 
ATOM   4023 C CG1 . VAL B 1 236 ? -61.831 9.790   26.903  1.00 61.46  ? 424 VAL B CG1 1 
ATOM   4024 C CG2 . VAL B 1 236 ? -59.592 9.552   25.836  1.00 64.68  ? 424 VAL B CG2 1 
ATOM   4025 N N   . LYS B 1 237 ? -62.240 13.157  27.253  1.00 65.60  ? 425 LYS B N   1 
ATOM   4026 C CA  . LYS B 1 237 ? -62.676 14.108  28.262  1.00 70.85  ? 425 LYS B CA  1 
ATOM   4027 C C   . LYS B 1 237 ? -63.840 13.538  29.049  1.00 74.37  ? 425 LYS B C   1 
ATOM   4028 O O   . LYS B 1 237 ? -64.587 12.700  28.550  1.00 73.30  ? 425 LYS B O   1 
ATOM   4029 C CB  . LYS B 1 237 ? -63.090 15.433  27.616  1.00 76.02  ? 425 LYS B CB  1 
ATOM   4030 C CG  . LYS B 1 237 ? -62.051 16.533  27.701  1.00 77.55  ? 425 LYS B CG  1 
ATOM   4031 C CD  . LYS B 1 237 ? -62.402 17.698  26.783  1.00 76.38  ? 425 LYS B CD  1 
ATOM   4032 C CE  . LYS B 1 237 ? -63.781 18.268  27.084  1.00 74.40  ? 425 LYS B CE  1 
ATOM   4033 N NZ  . LYS B 1 237 ? -64.092 19.445  26.221  1.00 71.85  ? 425 LYS B NZ  1 
ATOM   4034 N N   . THR B 1 238 ? -63.988 13.986  30.286  1.00 77.13  ? 426 THR B N   1 
ATOM   4035 C CA  . THR B 1 238 ? -65.202 13.711  31.028  1.00 81.36  ? 426 THR B CA  1 
ATOM   4036 C C   . THR B 1 238 ? -66.053 14.969  31.033  1.00 82.82  ? 426 THR B C   1 
ATOM   4037 O O   . THR B 1 238 ? -65.701 15.959  31.672  1.00 84.36  ? 426 THR B O   1 
ATOM   4038 C CB  . THR B 1 238 ? -64.913 13.265  32.471  1.00 83.08  ? 426 THR B CB  1 
ATOM   4039 O OG1 . THR B 1 238 ? -63.873 14.082  33.024  1.00 84.00  ? 426 THR B OG1 1 
ATOM   4040 C CG2 . THR B 1 238 ? -64.474 11.807  32.496  1.00 81.33  ? 426 THR B CG2 1 
ATOM   4041 N N   . HIS B 1 239 ? -67.161 14.932  30.302  1.00 79.15  ? 427 HIS B N   1 
ATOM   4042 C CA  . HIS B 1 239 ? -68.100 16.043  30.291  1.00 76.05  ? 427 HIS B CA  1 
ATOM   4043 C C   . HIS B 1 239 ? -69.352 15.623  31.036  1.00 72.98  ? 427 HIS B C   1 
ATOM   4044 O O   . HIS B 1 239 ? -70.113 14.779  30.562  1.00 70.60  ? 427 HIS B O   1 
ATOM   4045 C CB  . HIS B 1 239 ? -68.432 16.471  28.860  1.00 76.37  ? 427 HIS B CB  1 
ATOM   4046 C CG  . HIS B 1 239 ? -69.434 17.579  28.781  1.00 77.82  ? 427 HIS B CG  1 
ATOM   4047 N ND1 . HIS B 1 239 ? -70.565 17.505  27.998  1.00 79.22  ? 427 HIS B ND1 1 
ATOM   4048 C CD2 . HIS B 1 239 ? -69.481 18.785  29.397  1.00 79.44  ? 427 HIS B CD2 1 
ATOM   4049 C CE1 . HIS B 1 239 ? -71.263 18.620  28.130  1.00 81.47  ? 427 HIS B CE1 1 
ATOM   4050 N NE2 . HIS B 1 239 ? -70.627 19.411  28.975  1.00 81.39  ? 427 HIS B NE2 1 
ATOM   4051 N N   . GLY B 1 240 ? -69.555 16.210  32.211  1.00 75.35  ? 428 GLY B N   1 
ATOM   4052 C CA  . GLY B 1 240 ? -70.625 15.780  33.088  1.00 76.53  ? 428 GLY B CA  1 
ATOM   4053 C C   . GLY B 1 240 ? -70.425 14.330  33.482  1.00 75.07  ? 428 GLY B C   1 
ATOM   4054 O O   . GLY B 1 240 ? -69.384 13.959  34.021  1.00 77.32  ? 428 GLY B O   1 
ATOM   4055 N N   . ALA B 1 241 ? -71.429 13.506  33.208  1.00 74.29  ? 429 ALA B N   1 
ATOM   4056 C CA  . ALA B 1 241 ? -71.348 12.080  33.491  1.00 72.90  ? 429 ALA B CA  1 
ATOM   4057 C C   . ALA B 1 241 ? -70.907 11.283  32.265  1.00 73.06  ? 429 ALA B C   1 
ATOM   4058 O O   . ALA B 1 241 ? -70.844 10.054  32.310  1.00 74.87  ? 429 ALA B O   1 
ATOM   4059 C CB  . ALA B 1 241 ? -72.692 11.567  33.997  1.00 73.72  ? 429 ALA B CB  1 
ATOM   4060 N N   . ARG B 1 242 ? -70.597 11.976  31.174  1.00 72.21  ? 430 ARG B N   1 
ATOM   4061 C CA  . ARG B 1 242 ? -70.357 11.298  29.903  1.00 70.38  ? 430 ARG B CA  1 
ATOM   4062 C C   . ARG B 1 242 ? -68.911 11.347  29.435  1.00 70.59  ? 430 ARG B C   1 
ATOM   4063 O O   . ARG B 1 242 ? -68.160 12.271  29.754  1.00 70.21  ? 430 ARG B O   1 
ATOM   4064 C CB  . ARG B 1 242 ? -71.248 11.888  28.811  1.00 70.92  ? 430 ARG B CB  1 
ATOM   4065 C CG  . ARG B 1 242 ? -72.730 11.781  29.092  1.00 74.20  ? 430 ARG B CG  1 
ATOM   4066 C CD  . ARG B 1 242 ? -73.527 12.477  28.009  1.00 78.63  ? 430 ARG B CD  1 
ATOM   4067 N NE  . ARG B 1 242 ? -73.766 11.615  26.856  1.00 81.71  ? 430 ARG B NE  1 
ATOM   4068 C CZ  . ARG B 1 242 ? -74.908 10.970  26.631  1.00 85.11  ? 430 ARG B CZ  1 
ATOM   4069 N NH1 . ARG B 1 242 ? -75.920 11.090  27.481  1.00 83.29  ? 430 ARG B NH1 1 
ATOM   4070 N NH2 . ARG B 1 242 ? -75.041 10.206  25.556  1.00 88.08  ? 430 ARG B NH2 1 
ATOM   4071 N N   . THR B 1 243 ? -68.538 10.326  28.673  1.00 72.35  ? 431 THR B N   1 
ATOM   4072 C CA  . THR B 1 243 ? -67.240 10.271  28.023  1.00 70.94  ? 431 THR B CA  1 
ATOM   4073 C C   . THR B 1 243 ? -67.312 10.972  26.667  1.00 72.66  ? 431 THR B C   1 
ATOM   4074 O O   . THR B 1 243 ? -68.162 10.647  25.838  1.00 77.61  ? 431 THR B O   1 
ATOM   4075 C CB  . THR B 1 243 ? -66.775 8.815   27.831  1.00 67.31  ? 431 THR B CB  1 
ATOM   4076 O OG1 . THR B 1 243 ? -67.010 8.072   29.036  1.00 67.93  ? 431 THR B OG1 1 
ATOM   4077 C CG2 . THR B 1 243 ? -65.300 8.768   27.479  1.00 62.57  ? 431 THR B CG2 1 
ATOM   4078 N N   . LYS B 1 244 ? -66.427 11.937  26.445  1.00 70.53  ? 432 LYS B N   1 
ATOM   4079 C CA  . LYS B 1 244 ? -66.396 12.663  25.179  1.00 69.10  ? 432 LYS B CA  1 
ATOM   4080 C C   . LYS B 1 244 ? -65.066 12.469  24.451  1.00 65.79  ? 432 LYS B C   1 
ATOM   4081 O O   . LYS B 1 244 ? -63.998 12.705  25.012  1.00 61.05  ? 432 LYS B O   1 
ATOM   4082 C CB  . LYS B 1 244 ? -66.653 14.153  25.411  1.00 70.81  ? 432 LYS B CB  1 
ATOM   4083 C CG  . LYS B 1 244 ? -67.194 14.883  24.196  1.00 74.12  ? 432 LYS B CG  1 
ATOM   4084 C CD  . LYS B 1 244 ? -67.571 16.317  24.534  1.00 75.88  ? 432 LYS B CD  1 
ATOM   4085 C CE  . LYS B 1 244 ? -68.429 16.931  23.442  1.00 78.92  ? 432 LYS B CE  1 
ATOM   4086 N NZ  . LYS B 1 244 ? -69.777 16.293  23.376  1.00 83.01  ? 432 LYS B NZ  1 
ATOM   4087 N N   . TYR B 1 245 ? -65.135 12.037  23.197  1.00 65.74  ? 433 TYR B N   1 
ATOM   4088 C CA  . TYR B 1 245 ? -63.929 11.818  22.405  1.00 61.12  ? 433 TYR B CA  1 
ATOM   4089 C C   . TYR B 1 245 ? -63.669 12.967  21.441  1.00 60.60  ? 433 TYR B C   1 
ATOM   4090 O O   . TYR B 1 245 ? -64.586 13.475  20.798  1.00 67.02  ? 433 TYR B O   1 
ATOM   4091 C CB  . TYR B 1 245 ? -64.026 10.502  21.633  1.00 59.22  ? 433 TYR B CB  1 
ATOM   4092 C CG  . TYR B 1 245 ? -64.096 9.288   22.524  1.00 63.03  ? 433 TYR B CG  1 
ATOM   4093 C CD1 . TYR B 1 245 ? -62.951 8.777   23.123  1.00 61.58  ? 433 TYR B CD1 1 
ATOM   4094 C CD2 . TYR B 1 245 ? -65.306 8.652   22.770  1.00 67.30  ? 433 TYR B CD2 1 
ATOM   4095 C CE1 . TYR B 1 245 ? -63.010 7.666   23.942  1.00 64.76  ? 433 TYR B CE1 1 
ATOM   4096 C CE2 . TYR B 1 245 ? -65.375 7.539   23.586  1.00 69.90  ? 433 TYR B CE2 1 
ATOM   4097 C CZ  . TYR B 1 245 ? -64.223 7.051   24.169  1.00 70.90  ? 433 TYR B CZ  1 
ATOM   4098 O OH  . TYR B 1 245 ? -64.284 5.944   24.983  1.00 75.03  ? 433 TYR B OH  1 
ATOM   4099 N N   . LEU B 1 246 ? -62.408 13.370  21.351  1.00 60.02  ? 434 LEU B N   1 
ATOM   4100 C CA  . LEU B 1 246 ? -61.994 14.430  20.444  1.00 58.45  ? 434 LEU B CA  1 
ATOM   4101 C C   . LEU B 1 246 ? -62.200 14.016  18.991  1.00 61.57  ? 434 LEU B C   1 
ATOM   4102 O O   . LEU B 1 246 ? -62.557 14.839  18.147  1.00 66.35  ? 434 LEU B O   1 
ATOM   4103 C CB  . LEU B 1 246 ? -60.527 14.790  20.689  1.00 52.63  ? 434 LEU B CB  1 
ATOM   4104 C CG  . LEU B 1 246 ? -59.991 16.044  20.003  1.00 51.02  ? 434 LEU B CG  1 
ATOM   4105 C CD1 . LEU B 1 246 ? -60.742 17.275  20.482  1.00 49.32  ? 434 LEU B CD1 1 
ATOM   4106 C CD2 . LEU B 1 246 ? -58.508 16.184  20.275  1.00 48.59  ? 434 LEU B CD2 1 
ATOM   4107 N N   . LYS B 1 247 ? -61.986 12.734  18.709  1.00 60.50  ? 435 LYS B N   1 
ATOM   4108 C CA  . LYS B 1 247 ? -62.106 12.208  17.351  1.00 61.24  ? 435 LYS B CA  1 
ATOM   4109 C C   . LYS B 1 247 ? -63.508 12.398  16.769  1.00 66.24  ? 435 LYS B C   1 
ATOM   4110 O O   . LYS B 1 247 ? -63.673 12.486  15.552  1.00 67.35  ? 435 LYS B O   1 
ATOM   4111 C CB  . LYS B 1 247 ? -61.730 10.723  17.321  1.00 58.14  ? 435 LYS B CB  1 
ATOM   4112 C CG  . LYS B 1 247 ? -62.575 9.848   18.232  1.00 57.77  ? 435 LYS B CG  1 
ATOM   4113 C CD  . LYS B 1 247 ? -62.267 8.372   18.034  1.00 54.43  ? 435 LYS B CD  1 
ATOM   4114 C CE  . LYS B 1 247 ? -63.100 7.512   18.971  1.00 53.07  ? 435 LYS B CE  1 
ATOM   4115 N NZ  . LYS B 1 247 ? -62.968 6.061   18.674  1.00 52.98  ? 435 LYS B NZ  1 
ATOM   4116 N N   . ASP B 1 248 ? -64.511 12.464  17.640  1.00 63.83  ? 436 ASP B N   1 
ATOM   4117 C CA  . ASP B 1 248 ? -65.894 12.638  17.207  1.00 67.84  ? 436 ASP B CA  1 
ATOM   4118 C C   . ASP B 1 248 ? -66.188 14.072  16.781  1.00 72.62  ? 436 ASP B C   1 
ATOM   4119 O O   . ASP B 1 248 ? -67.182 14.321  16.089  1.00 77.30  ? 436 ASP B O   1 
ATOM   4120 C CB  . ASP B 1 248 ? -66.861 12.230  18.320  1.00 68.69  ? 436 ASP B CB  1 
ATOM   4121 C CG  . ASP B 1 248 ? -66.893 10.733  18.547  1.00 73.72  ? 436 ASP B CG  1 
ATOM   4122 O OD1 . ASP B 1 248 ? -66.680 9.976   17.574  1.00 76.28  ? 436 ASP B OD1 1 
ATOM   4123 O OD2 . ASP B 1 248 ? -67.135 10.312  19.698  1.00 75.87  ? 436 ASP B OD2 1 
ATOM   4124 N N   . LEU B 1 249 ? -65.321 15.001  17.186  1.00 75.11  ? 437 LEU B N   1 
ATOM   4125 C CA  . LEU B 1 249 ? -65.558 16.430  16.974  1.00 75.02  ? 437 LEU B CA  1 
ATOM   4126 C C   . LEU B 1 249 ? -65.949 16.748  15.538  1.00 79.02  ? 437 LEU B C   1 
ATOM   4127 O O   . LEU B 1 249 ? -66.915 17.476  15.299  1.00 82.91  ? 437 LEU B O   1 
ATOM   4128 C CB  . LEU B 1 249 ? -64.322 17.245  17.352  1.00 68.70  ? 437 LEU B CB  1 
ATOM   4129 C CG  . LEU B 1 249 ? -64.482 18.757  17.195  1.00 71.26  ? 437 LEU B CG  1 
ATOM   4130 C CD1 . LEU B 1 249 ? -65.571 19.274  18.122  1.00 71.65  ? 437 LEU B CD1 1 
ATOM   4131 C CD2 . LEU B 1 249 ? -63.168 19.466  17.460  1.00 68.27  ? 437 LEU B CD2 1 
ATOM   4132 N N   . VAL B 1 250 ? -65.206 16.180  14.592  1.00 75.49  ? 438 VAL B N   1 
ATOM   4133 C CA  . VAL B 1 250 ? -65.475 16.381  13.173  1.00 78.94  ? 438 VAL B CA  1 
ATOM   4134 C C   . VAL B 1 250 ? -66.939 16.094  12.847  1.00 83.03  ? 438 VAL B C   1 
ATOM   4135 O O   . VAL B 1 250 ? -67.642 16.959  12.317  1.00 84.60  ? 438 VAL B O   1 
ATOM   4136 C CB  . VAL B 1 250 ? -64.561 15.493  12.299  1.00 72.01  ? 438 VAL B CB  1 
ATOM   4137 C CG1 . VAL B 1 250 ? -65.014 15.518  10.849  1.00 74.84  ? 438 VAL B CG1 1 
ATOM   4138 C CG2 . VAL B 1 250 ? -63.121 15.954  12.415  1.00 67.68  ? 438 VAL B CG2 1 
ATOM   4139 N N   . GLU B 1 251 ? -67.408 14.901  13.205  1.00 77.69  ? 439 GLU B N   1 
ATOM   4140 C CA  . GLU B 1 251 ? -68.795 14.533  12.947  1.00 86.78  ? 439 GLU B CA  1 
ATOM   4141 C C   . GLU B 1 251 ? -69.732 15.481  13.683  1.00 87.98  ? 439 GLU B C   1 
ATOM   4142 O O   . GLU B 1 251 ? -70.776 15.870  13.156  1.00 91.53  ? 439 GLU B O   1 
ATOM   4143 C CB  . GLU B 1 251 ? -69.069 13.087  13.368  1.00 94.86  ? 439 GLU B CB  1 
ATOM   4144 C CG  . GLU B 1 251 ? -68.182 12.051  12.691  1.00 103.21 ? 439 GLU B CG  1 
ATOM   4145 C CD  . GLU B 1 251 ? -68.396 11.972  11.190  1.00 112.98 ? 439 GLU B CD  1 
ATOM   4146 O OE1 . GLU B 1 251 ? -69.217 11.139  10.749  1.00 116.13 ? 439 GLU B OE1 1 
ATOM   4147 O OE2 . GLU B 1 251 ? -67.737 12.735  10.451  1.00 116.30 ? 439 GLU B OE2 1 
ATOM   4148 N N   . GLU B 1 252 ? -69.337 15.867  14.894  1.00 88.61  ? 440 GLU B N   1 
ATOM   4149 C CA  . GLU B 1 252 ? -70.151 16.753  15.716  1.00 90.56  ? 440 GLU B CA  1 
ATOM   4150 C C   . GLU B 1 252 ? -70.248 18.129  15.063  1.00 86.54  ? 440 GLU B C   1 
ATOM   4151 O O   . GLU B 1 252 ? -71.231 18.846  15.254  1.00 85.84  ? 440 GLU B O   1 
ATOM   4152 C CB  . GLU B 1 252 ? -69.570 16.861  17.130  1.00 96.09  ? 440 GLU B CB  1 
ATOM   4153 C CG  . GLU B 1 252 ? -70.524 17.434  18.177  1.00 105.49 ? 440 GLU B CG  1 
ATOM   4154 C CD  . GLU B 1 252 ? -71.372 16.371  18.863  1.00 112.57 ? 440 GLU B CD  1 
ATOM   4155 O OE1 . GLU B 1 252 ? -71.729 15.366  18.210  1.00 114.61 ? 440 GLU B OE1 1 
ATOM   4156 O OE2 . GLU B 1 252 ? -71.680 16.540  20.063  1.00 114.96 ? 440 GLU B OE2 1 
ATOM   4157 N N   . GLU B 1 253 ? -69.228 18.493  14.288  1.00 88.19  ? 441 GLU B N   1 
ATOM   4158 C CA  . GLU B 1 253 ? -69.266 19.752  13.554  1.00 88.35  ? 441 GLU B CA  1 
ATOM   4159 C C   . GLU B 1 253 ? -69.865 19.561  12.164  1.00 88.59  ? 441 GLU B C   1 
ATOM   4160 O O   . GLU B 1 253 ? -70.211 20.533  11.490  1.00 88.13  ? 441 GLU B O   1 
ATOM   4161 C CB  . GLU B 1 253 ? -67.867 20.360  13.453  1.00 87.49  ? 441 GLU B CB  1 
ATOM   4162 C CG  . GLU B 1 253 ? -67.248 20.712  14.797  1.00 90.11  ? 441 GLU B CG  1 
ATOM   4163 C CD  . GLU B 1 253 ? -68.068 21.727  15.572  1.00 96.36  ? 441 GLU B CD  1 
ATOM   4164 O OE1 . GLU B 1 253 ? -67.895 22.941  15.331  1.00 97.74  ? 441 GLU B OE1 1 
ATOM   4165 O OE2 . GLU B 1 253 ? -68.884 21.313  16.424  1.00 100.04 ? 441 GLU B OE2 1 
ATOM   4166 N N   . ALA B 1 254 ? -69.998 18.307  11.743  1.00 85.64  ? 442 ALA B N   1 
ATOM   4167 C CA  . ALA B 1 254 ? -70.647 18.010  10.474  1.00 86.28  ? 442 ALA B CA  1 
ATOM   4168 C C   . ALA B 1 254 ? -72.161 18.102  10.627  1.00 92.01  ? 442 ALA B C   1 
ATOM   4169 O O   . ALA B 1 254 ? -72.834 18.776  9.845   1.00 95.69  ? 442 ALA B O   1 
ATOM   4170 C CB  . ALA B 1 254 ? -70.241 16.632  9.972   1.00 81.43  ? 442 ALA B CB  1 
ATOM   4171 N N   . GLU B 1 255 ? -72.684 17.448  11.661  1.00 92.33  ? 443 GLU B N   1 
ATOM   4172 C CA  . GLU B 1 255 ? -74.121 17.434  11.927  1.00 96.04  ? 443 GLU B CA  1 
ATOM   4173 C C   . GLU B 1 255 ? -74.630 18.840  12.216  1.00 96.06  ? 443 GLU B C   1 
ATOM   4174 O O   . GLU B 1 255 ? -75.774 19.174  11.911  1.00 98.96  ? 443 GLU B O   1 
ATOM   4175 C CB  . GLU B 1 255 ? -74.449 16.497  13.098  1.00 98.32  ? 443 GLU B CB  1 
ATOM   4176 C CG  . GLU B 1 255 ? -73.811 16.880  14.430  1.00 100.61 ? 443 GLU B CG  1 
ATOM   4177 C CD  . GLU B 1 255 ? -74.077 15.859  15.526  1.00 103.08 ? 443 GLU B CD  1 
ATOM   4178 O OE1 . GLU B 1 255 ? -74.957 16.110  16.377  1.00 107.42 ? 443 GLU B OE1 1 
ATOM   4179 O OE2 . GLU B 1 255 ? -73.405 14.807  15.538  1.00 100.76 ? 443 GLU B OE2 1 
ATOM   4180 N N   . GLU B 1 256 ? -73.766 19.662  12.798  1.00 93.90  ? 444 GLU B N   1 
ATOM   4181 C CA  . GLU B 1 256 ? -74.103 21.044  13.093  1.00 95.23  ? 444 GLU B CA  1 
ATOM   4182 C C   . GLU B 1 256 ? -74.117 21.862  11.806  1.00 93.42  ? 444 GLU B C   1 
ATOM   4183 O O   . GLU B 1 256 ? -74.887 22.811  11.672  1.00 96.03  ? 444 GLU B O   1 
ATOM   4184 C CB  . GLU B 1 256 ? -73.111 21.626  14.104  1.00 97.63  ? 444 GLU B CB  1 
ATOM   4185 C CG  . GLU B 1 256 ? -73.610 22.852  14.852  1.00 104.02 ? 444 GLU B CG  1 
ATOM   4186 C CD  . GLU B 1 256 ? -73.013 22.961  16.246  1.00 106.59 ? 444 GLU B CD  1 
ATOM   4187 O OE1 . GLU B 1 256 ? -72.314 23.960  16.522  1.00 107.71 ? 444 GLU B OE1 1 
ATOM   4188 O OE2 . GLU B 1 256 ? -73.245 22.048  17.068  1.00 106.80 ? 444 GLU B OE2 1 
ATOM   4189 N N   . ALA B 1 257 ? -73.260 21.490  10.858  1.00 93.44  ? 445 ALA B N   1 
ATOM   4190 C CA  . ALA B 1 257 ? -73.198 22.188  9.578   1.00 91.88  ? 445 ALA B CA  1 
ATOM   4191 C C   . ALA B 1 257 ? -74.009 21.474  8.498   1.00 93.47  ? 445 ALA B C   1 
ATOM   4192 O O   . ALA B 1 257 ? -74.117 21.962  7.373   1.00 93.55  ? 445 ALA B O   1 
ATOM   4193 C CB  . ALA B 1 257 ? -71.754 22.345  9.134   1.00 87.19  ? 445 ALA B CB  1 
ATOM   4194 N N   . GLY B 1 258 ? -74.578 20.322  8.846   1.00 91.77  ? 446 GLY B N   1 
ATOM   4195 C CA  . GLY B 1 258 ? -75.362 19.532  7.910   1.00 93.84  ? 446 GLY B CA  1 
ATOM   4196 C C   . GLY B 1 258 ? -74.589 19.103  6.675   1.00 93.50  ? 446 GLY B C   1 
ATOM   4197 O O   . GLY B 1 258 ? -75.019 19.348  5.548   1.00 93.47  ? 446 GLY B O   1 
ATOM   4198 N N   . VAL B 1 259 ? -73.449 18.452  6.887   1.00 93.20  ? 447 VAL B N   1 
ATOM   4199 C CA  . VAL B 1 259 ? -72.554 18.094  5.792   1.00 94.43  ? 447 VAL B CA  1 
ATOM   4200 C C   . VAL B 1 259 ? -72.428 16.581  5.618   1.00 94.19  ? 447 VAL B C   1 
ATOM   4201 O O   . VAL B 1 259 ? -72.326 15.842  6.599   1.00 93.79  ? 447 VAL B O   1 
ATOM   4202 C CB  . VAL B 1 259 ? -71.148 18.700  6.013   1.00 95.76  ? 447 VAL B CB  1 
ATOM   4203 C CG1 . VAL B 1 259 ? -70.217 18.361  4.855   1.00 93.16  ? 447 VAL B CG1 1 
ATOM   4204 C CG2 . VAL B 1 259 ? -71.246 20.207  6.205   1.00 98.60  ? 447 VAL B CG2 1 
ATOM   4205 N N   . ALA B 1 260 ? -72.451 16.138  4.362   1.00 96.13  ? 448 ALA B N   1 
ATOM   4206 C CA  . ALA B 1 260 ? -72.199 14.743  3.998   1.00 95.85  ? 448 ALA B CA  1 
ATOM   4207 C C   . ALA B 1 260 ? -73.169 13.776  4.667   1.00 98.68  ? 448 ALA B C   1 
ATOM   4208 O O   . ALA B 1 260 ? -73.011 12.558  4.563   1.00 99.97  ? 448 ALA B O   1 
ATOM   4209 C CB  . ALA B 1 260 ? -70.756 14.361  4.335   1.00 88.59  ? 448 ALA B CB  1 
ATOM   4210 N N   . ALA B 1 276 ? -63.712 18.989  -0.949  1.00 94.52  ? 464 ALA B N   1 
ATOM   4211 C CA  . ALA B 1 276 ? -63.405 19.975  0.080   1.00 94.75  ? 464 ALA B CA  1 
ATOM   4212 C C   . ALA B 1 276 ? -64.544 20.088  1.089   1.00 96.88  ? 464 ALA B C   1 
ATOM   4213 O O   . ALA B 1 276 ? -64.855 21.177  1.573   1.00 97.25  ? 464 ALA B O   1 
ATOM   4214 C CB  . ALA B 1 276 ? -63.114 21.328  -0.548  1.00 96.44  ? 464 ALA B CB  1 
ATOM   4215 N N   . TRP B 1 277 ? -65.160 18.950  1.397   1.00 94.68  ? 465 TRP B N   1 
ATOM   4216 C CA  . TRP B 1 277 ? -66.164 18.860  2.453   1.00 96.87  ? 465 TRP B CA  1 
ATOM   4217 C C   . TRP B 1 277 ? -65.582 19.329  3.781   1.00 94.52  ? 465 TRP B C   1 
ATOM   4218 O O   . TRP B 1 277 ? -66.304 19.775  4.674   1.00 95.69  ? 465 TRP B O   1 
ATOM   4219 C CB  . TRP B 1 277 ? -66.663 17.421  2.591   1.00 98.85  ? 465 TRP B CB  1 
ATOM   4220 C CG  . TRP B 1 277 ? -65.600 16.498  3.113   1.00 101.26 ? 465 TRP B CG  1 
ATOM   4221 C CD1 . TRP B 1 277 ? -64.441 16.147  2.483   1.00 101.49 ? 465 TRP B CD1 1 
ATOM   4222 C CD2 . TRP B 1 277 ? -65.591 15.820  4.376   1.00 102.80 ? 465 TRP B CD2 1 
ATOM   4223 N NE1 . TRP B 1 277 ? -63.712 15.292  3.273   1.00 100.38 ? 465 TRP B NE1 1 
ATOM   4224 C CE2 . TRP B 1 277 ? -64.396 15.075  4.441   1.00 100.32 ? 465 TRP B CE2 1 
ATOM   4225 C CE3 . TRP B 1 277 ? -66.477 15.769  5.458   1.00 104.82 ? 465 TRP B CE3 1 
ATOM   4226 C CZ2 . TRP B 1 277 ? -64.064 14.289  5.542   1.00 97.96  ? 465 TRP B CZ2 1 
ATOM   4227 C CZ3 . TRP B 1 277 ? -66.145 14.986  6.551   1.00 102.84 ? 465 TRP B CZ3 1 
ATOM   4228 C CH2 . TRP B 1 277 ? -64.950 14.258  6.584   1.00 99.09  ? 465 TRP B CH2 1 
ATOM   4229 N N   . ALA B 1 278 ? -64.262 19.219  3.894   1.00 92.89  ? 466 ALA B N   1 
ATOM   4230 C CA  . ALA B 1 278 ? -63.548 19.522  5.124   1.00 91.18  ? 466 ALA B CA  1 
ATOM   4231 C C   . ALA B 1 278 ? -63.555 21.007  5.469   1.00 92.31  ? 466 ALA B C   1 
ATOM   4232 O O   . ALA B 1 278 ? -63.778 21.369  6.620   1.00 94.35  ? 466 ALA B O   1 
ATOM   4233 C CB  . ALA B 1 278 ? -62.117 19.021  5.022   1.00 88.87  ? 466 ALA B CB  1 
ATOM   4234 N N   . ALA B 1 279 ? -63.319 21.852  4.467   1.00 95.73  ? 467 ALA B N   1 
ATOM   4235 C CA  . ALA B 1 279 ? -63.091 23.290  4.664   1.00 91.81  ? 467 ALA B CA  1 
ATOM   4236 C C   . ALA B 1 279 ? -64.063 24.004  5.624   1.00 89.71  ? 467 ALA B C   1 
ATOM   4237 O O   . ALA B 1 279 ? -63.614 24.792  6.463   1.00 87.23  ? 467 ALA B O   1 
ATOM   4238 C CB  . ALA B 1 279 ? -63.091 23.999  3.308   1.00 91.80  ? 467 ALA B CB  1 
ATOM   4239 N N   . PRO B 1 280 ? -65.384 23.751  5.508   1.00 89.41  ? 468 PRO B N   1 
ATOM   4240 C CA  . PRO B 1 280 ? -66.265 24.403  6.487   1.00 89.46  ? 468 PRO B CA  1 
ATOM   4241 C C   . PRO B 1 280 ? -65.962 23.980  7.921   1.00 85.27  ? 468 PRO B C   1 
ATOM   4242 O O   . PRO B 1 280 ? -65.863 24.828  8.813   1.00 87.18  ? 468 PRO B O   1 
ATOM   4243 C CB  . PRO B 1 280 ? -67.663 23.933  6.069   1.00 92.75  ? 468 PRO B CB  1 
ATOM   4244 C CG  . PRO B 1 280 ? -67.533 23.593  4.631   1.00 94.05  ? 468 PRO B CG  1 
ATOM   4245 C CD  . PRO B 1 280 ? -66.159 23.018  4.489   1.00 91.25  ? 468 PRO B CD  1 
ATOM   4246 N N   . ILE B 1 281 ? -65.798 22.678  8.130   1.00 86.01  ? 469 ILE B N   1 
ATOM   4247 C CA  . ILE B 1 281 ? -65.477 22.149  9.448   1.00 84.97  ? 469 ILE B CA  1 
ATOM   4248 C C   . ILE B 1 281 ? -64.149 22.725  9.928   1.00 83.05  ? 469 ILE B C   1 
ATOM   4249 O O   . ILE B 1 281 ? -63.986 23.043  11.106  1.00 82.14  ? 469 ILE B O   1 
ATOM   4250 C CB  . ILE B 1 281 ? -65.409 20.610  9.438   1.00 84.48  ? 469 ILE B CB  1 
ATOM   4251 C CG1 . ILE B 1 281 ? -66.692 20.029  8.840   1.00 87.72  ? 469 ILE B CG1 1 
ATOM   4252 C CG2 . ILE B 1 281 ? -65.188 20.076  10.844  1.00 85.05  ? 469 ILE B CG2 1 
ATOM   4253 C CD1 . ILE B 1 281 ? -66.731 18.516  8.814   1.00 87.95  ? 469 ILE B CD1 1 
ATOM   4254 N N   . ALA B 1 282 ? -63.213 22.873  8.996   1.00 81.68  ? 470 ALA B N   1 
ATOM   4255 C CA  . ALA B 1 282 ? -61.917 23.468  9.281   1.00 79.90  ? 470 ALA B CA  1 
ATOM   4256 C C   . ALA B 1 282 ? -62.085 24.889  9.797   1.00 77.92  ? 470 ALA B C   1 
ATOM   4257 O O   . ALA B 1 282 ? -61.400 25.300  10.732  1.00 73.22  ? 470 ALA B O   1 
ATOM   4258 C CB  . ALA B 1 282 ? -61.039 23.451  8.040   1.00 82.36  ? 470 ALA B CB  1 
ATOM   4259 N N   . MET B 1 283 ? -63.004 25.635  9.189   1.00 82.82  ? 471 MET B N   1 
ATOM   4260 C CA  . MET B 1 283 ? -63.282 26.997  9.631   1.00 80.65  ? 471 MET B CA  1 
ATOM   4261 C C   . MET B 1 283 ? -63.889 26.984  11.033  1.00 77.62  ? 471 MET B C   1 
ATOM   4262 O O   . MET B 1 283 ? -63.472 27.751  11.905  1.00 76.89  ? 471 MET B O   1 
ATOM   4263 C CB  . MET B 1 283 ? -64.218 27.710  8.653   1.00 83.44  ? 471 MET B CB  1 
ATOM   4264 C CG  . MET B 1 283 ? -64.114 29.231  8.686   1.00 83.63  ? 471 MET B CG  1 
ATOM   4265 S SD  . MET B 1 283 ? -62.746 29.864  7.695   1.00 103.51 ? 471 MET B SD  1 
ATOM   4266 C CE  . MET B 1 283 ? -63.242 29.318  6.061   1.00 75.41  ? 471 MET B CE  1 
ATOM   4267 N N   . GLN B 1 284 ? -64.863 26.100  11.246  1.00 73.54  ? 472 GLN B N   1 
ATOM   4268 C CA  . GLN B 1 284 ? -65.519 25.979  12.547  1.00 79.23  ? 472 GLN B CA  1 
ATOM   4269 C C   . GLN B 1 284 ? -64.524 25.678  13.666  1.00 76.99  ? 472 GLN B C   1 
ATOM   4270 O O   . GLN B 1 284 ? -64.606 26.251  14.752  1.00 77.95  ? 472 GLN B O   1 
ATOM   4271 C CB  . GLN B 1 284 ? -66.599 24.896  12.513  1.00 86.27  ? 472 GLN B CB  1 
ATOM   4272 C CG  . GLN B 1 284 ? -67.941 25.366  11.971  1.00 98.02  ? 472 GLN B CG  1 
ATOM   4273 C CD  . GLN B 1 284 ? -69.112 24.677  12.649  1.00 106.67 ? 472 GLN B CD  1 
ATOM   4274 O OE1 . GLN B 1 284 ? -69.364 24.883  13.838  1.00 110.51 ? 472 GLN B OE1 1 
ATOM   4275 N NE2 . GLN B 1 284 ? -69.829 23.847  11.898  1.00 108.16 ? 472 GLN B NE2 1 
ATOM   4276 N N   . ILE B 1 285 ? -63.585 24.778  13.396  1.00 79.29  ? 473 ILE B N   1 
ATOM   4277 C CA  . ILE B 1 285 ? -62.539 24.454  14.356  1.00 75.85  ? 473 ILE B CA  1 
ATOM   4278 C C   . ILE B 1 285 ? -61.619 25.654  14.558  1.00 77.58  ? 473 ILE B C   1 
ATOM   4279 O O   . ILE B 1 285 ? -61.275 26.005  15.687  1.00 77.88  ? 473 ILE B O   1 
ATOM   4280 C CB  . ILE B 1 285 ? -61.714 23.237  13.897  1.00 71.91  ? 473 ILE B CB  1 
ATOM   4281 C CG1 . ILE B 1 285 ? -62.615 22.009  13.762  1.00 72.03  ? 473 ILE B CG1 1 
ATOM   4282 C CG2 . ILE B 1 285 ? -60.581 22.956  14.872  1.00 67.37  ? 473 ILE B CG2 1 
ATOM   4283 C CD1 . ILE B 1 285 ? -61.984 20.869  13.000  1.00 71.56  ? 473 ILE B CD1 1 
ATOM   4284 N N   . TYR B 1 286 ? -61.238 26.281  13.449  1.00 75.05  ? 474 TYR B N   1 
ATOM   4285 C CA  . TYR B 1 286 ? -60.360 27.447  13.465  1.00 79.25  ? 474 TYR B CA  1 
ATOM   4286 C C   . TYR B 1 286 ? -60.899 28.553  14.367  1.00 83.13  ? 474 TYR B C   1 
ATOM   4287 O O   . TYR B 1 286 ? -60.143 29.208  15.085  1.00 83.95  ? 474 TYR B O   1 
ATOM   4288 C CB  . TYR B 1 286 ? -60.167 27.983  12.044  1.00 81.70  ? 474 TYR B CB  1 
ATOM   4289 C CG  . TYR B 1 286 ? -59.257 29.187  11.958  1.00 82.55  ? 474 TYR B CG  1 
ATOM   4290 C CD1 . TYR B 1 286 ? -57.882 29.032  11.844  1.00 80.09  ? 474 TYR B CD1 1 
ATOM   4291 C CD2 . TYR B 1 286 ? -59.772 30.478  11.986  1.00 83.65  ? 474 TYR B CD2 1 
ATOM   4292 C CE1 . TYR B 1 286 ? -57.043 30.128  11.765  1.00 80.80  ? 474 TYR B CE1 1 
ATOM   4293 C CE2 . TYR B 1 286 ? -58.941 31.581  11.909  1.00 83.19  ? 474 TYR B CE2 1 
ATOM   4294 C CZ  . TYR B 1 286 ? -57.578 31.400  11.797  1.00 80.98  ? 474 TYR B CZ  1 
ATOM   4295 O OH  . TYR B 1 286 ? -56.745 32.492  11.719  1.00 79.75  ? 474 TYR B OH  1 
ATOM   4296 N N   . LYS B 1 287 ? -62.210 28.759  14.326  1.00 81.11  ? 475 LYS B N   1 
ATOM   4297 C CA  . LYS B 1 287 ? -62.832 29.784  15.152  1.00 84.45  ? 475 LYS B CA  1 
ATOM   4298 C C   . LYS B 1 287 ? -63.062 29.287  16.575  1.00 88.50  ? 475 LYS B C   1 
ATOM   4299 O O   . LYS B 1 287 ? -62.489 29.816  17.527  1.00 92.18  ? 475 LYS B O   1 
ATOM   4300 C CB  . LYS B 1 287 ? -64.152 30.243  14.530  1.00 83.18  ? 475 LYS B CB  1 
ATOM   4301 C CG  . LYS B 1 287 ? -63.996 30.847  13.144  1.00 83.31  ? 475 LYS B CG  1 
ATOM   4302 C CD  . LYS B 1 287 ? -65.277 31.519  12.680  1.00 87.28  ? 475 LYS B CD  1 
ATOM   4303 C CE  . LYS B 1 287 ? -65.102 32.145  11.306  1.00 88.29  ? 475 LYS B CE  1 
ATOM   4304 N NZ  . LYS B 1 287 ? -66.334 32.847  10.855  1.00 92.40  ? 475 LYS B NZ  1 
ATOM   4305 N N   . LYS B 1 288 ? -63.903 28.269  16.712  1.00 85.27  ? 476 LYS B N   1 
ATOM   4306 C CA  . LYS B 1 288 ? -64.325 27.788  18.024  1.00 86.32  ? 476 LYS B CA  1 
ATOM   4307 C C   . LYS B 1 288 ? -63.242 27.052  18.814  1.00 82.41  ? 476 LYS B C   1 
ATOM   4308 O O   . LYS B 1 288 ? -62.977 27.379  19.971  1.00 82.89  ? 476 LYS B O   1 
ATOM   4309 C CB  . LYS B 1 288 ? -65.538 26.866  17.869  1.00 89.83  ? 476 LYS B CB  1 
ATOM   4310 C CG  . LYS B 1 288 ? -66.730 27.502  17.168  1.00 94.84  ? 476 LYS B CG  1 
ATOM   4311 C CD  . LYS B 1 288 ? -67.876 26.508  17.038  1.00 97.98  ? 476 LYS B CD  1 
ATOM   4312 C CE  . LYS B 1 288 ? -69.107 27.152  16.426  1.00 104.12 ? 476 LYS B CE  1 
ATOM   4313 N NZ  . LYS B 1 288 ? -70.234 26.184  16.323  1.00 107.80 ? 476 LYS B NZ  1 
ATOM   4314 N N   . HIS B 1 289 ? -62.630 26.052  18.188  1.00 84.47  ? 477 HIS B N   1 
ATOM   4315 C CA  . HIS B 1 289 ? -61.884 25.032  18.924  1.00 78.19  ? 477 HIS B CA  1 
ATOM   4316 C C   . HIS B 1 289 ? -60.359 25.183  19.019  1.00 75.08  ? 477 HIS B C   1 
ATOM   4317 O O   . HIS B 1 289 ? -59.701 24.320  19.598  1.00 73.53  ? 477 HIS B O   1 
ATOM   4318 C CB  . HIS B 1 289 ? -62.216 23.669  18.320  1.00 76.33  ? 477 HIS B CB  1 
ATOM   4319 C CG  . HIS B 1 289 ? -63.680 23.359  18.317  1.00 78.61  ? 477 HIS B CG  1 
ATOM   4320 N ND1 . HIS B 1 289 ? -64.522 23.750  19.336  1.00 80.63  ? 477 HIS B ND1 1 
ATOM   4321 C CD2 . HIS B 1 289 ? -64.456 22.712  17.415  1.00 79.88  ? 477 HIS B CD2 1 
ATOM   4322 C CE1 . HIS B 1 289 ? -65.752 23.348  19.066  1.00 82.86  ? 477 HIS B CE1 1 
ATOM   4323 N NE2 . HIS B 1 289 ? -65.739 22.717  17.906  1.00 82.61  ? 477 HIS B NE2 1 
ATOM   4324 N N   . LEU B 1 290 ? -59.793 26.252  18.467  1.00 75.68  ? 478 LEU B N   1 
ATOM   4325 C CA  . LEU B 1 290 ? -58.338 26.439  18.505  1.00 72.91  ? 478 LEU B CA  1 
ATOM   4326 C C   . LEU B 1 290 ? -57.784 26.591  19.921  1.00 72.52  ? 478 LEU B C   1 
ATOM   4327 O O   . LEU B 1 290 ? -58.467 27.084  20.816  1.00 73.39  ? 478 LEU B O   1 
ATOM   4328 C CB  . LEU B 1 290 ? -57.927 27.658  17.679  1.00 75.76  ? 478 LEU B CB  1 
ATOM   4329 C CG  . LEU B 1 290 ? -57.671 27.439  16.190  1.00 75.83  ? 478 LEU B CG  1 
ATOM   4330 C CD1 . LEU B 1 290 ? -57.028 28.672  15.578  1.00 76.81  ? 478 LEU B CD1 1 
ATOM   4331 C CD2 . LEU B 1 290 ? -56.801 26.218  15.974  1.00 72.63  ? 478 LEU B CD2 1 
ATOM   4332 N N   . ASP B 1 291 ? -56.538 26.165  20.113  1.00 71.96  ? 479 ASP B N   1 
ATOM   4333 C CA  . ASP B 1 291 ? -55.854 26.323  21.395  1.00 72.79  ? 479 ASP B CA  1 
ATOM   4334 C C   . ASP B 1 291 ? -55.376 27.762  21.564  1.00 74.61  ? 479 ASP B C   1 
ATOM   4335 O O   . ASP B 1 291 ? -54.535 28.231  20.802  1.00 76.77  ? 479 ASP B O   1 
ATOM   4336 C CB  . ASP B 1 291 ? -54.672 25.356  21.499  1.00 71.56  ? 479 ASP B CB  1 
ATOM   4337 C CG  . ASP B 1 291 ? -53.974 25.421  22.846  1.00 73.20  ? 479 ASP B CG  1 
ATOM   4338 O OD1 . ASP B 1 291 ? -54.641 25.724  23.856  1.00 76.04  ? 479 ASP B OD1 1 
ATOM   4339 O OD2 . ASP B 1 291 ? -52.755 25.158  22.895  1.00 73.49  ? 479 ASP B OD2 1 
ATOM   4340 N N   . PRO B 1 292 ? -55.922 28.470  22.563  1.00 73.59  ? 480 PRO B N   1 
ATOM   4341 C CA  . PRO B 1 292 ? -55.605 29.886  22.791  1.00 76.21  ? 480 PRO B CA  1 
ATOM   4342 C C   . PRO B 1 292 ? -54.177 30.147  23.285  1.00 76.57  ? 480 PRO B C   1 
ATOM   4343 O O   . PRO B 1 292 ? -53.607 31.188  22.957  1.00 75.50  ? 480 PRO B O   1 
ATOM   4344 C CB  . PRO B 1 292 ? -56.627 30.302  23.854  1.00 77.17  ? 480 PRO B CB  1 
ATOM   4345 C CG  . PRO B 1 292 ? -56.958 29.041  24.571  1.00 77.19  ? 480 PRO B CG  1 
ATOM   4346 C CD  . PRO B 1 292 ? -56.900 27.956  23.538  1.00 75.34  ? 480 PRO B CD  1 
ATOM   4347 N N   . ARG B 1 293 ? -53.619 29.216  24.055  1.00 75.35  ? 481 ARG B N   1 
ATOM   4348 C CA  . ARG B 1 293 ? -52.342 29.425  24.747  1.00 75.50  ? 481 ARG B CA  1 
ATOM   4349 C C   . ARG B 1 293 ? -51.165 29.898  23.873  1.00 71.66  ? 481 ARG B C   1 
ATOM   4350 O O   . ARG B 1 293 ? -50.458 30.827  24.260  1.00 69.91  ? 481 ARG B O   1 
ATOM   4351 C CB  . ARG B 1 293 ? -51.940 28.143  25.487  1.00 79.07  ? 481 ARG B CB  1 
ATOM   4352 C CG  . ARG B 1 293 ? -52.939 27.719  26.555  1.00 85.53  ? 481 ARG B CG  1 
ATOM   4353 C CD  . ARG B 1 293 ? -52.364 26.657  27.479  1.00 87.78  ? 481 ARG B CD  1 
ATOM   4354 N NE  . ARG B 1 293 ? -51.953 25.462  26.750  1.00 91.26  ? 481 ARG B NE  1 
ATOM   4355 C CZ  . ARG B 1 293 ? -52.742 24.419  26.515  1.00 94.01  ? 481 ARG B CZ  1 
ATOM   4356 N NH1 . ARG B 1 293 ? -53.994 24.418  26.951  1.00 94.63  ? 481 ARG B NH1 1 
ATOM   4357 N NH2 . ARG B 1 293 ? -52.278 23.376  25.841  1.00 94.45  ? 481 ARG B NH2 1 
ATOM   4358 N N   . PRO B 1 294 ? -50.934 29.265  22.706  1.00 74.01  ? 482 PRO B N   1 
ATOM   4359 C CA  . PRO B 1 294 ? -49.818 29.780  21.901  1.00 73.87  ? 482 PRO B CA  1 
ATOM   4360 C C   . PRO B 1 294 ? -50.107 31.150  21.293  1.00 76.65  ? 482 PRO B C   1 
ATOM   4361 O O   . PRO B 1 294 ? -49.181 31.831  20.852  1.00 78.23  ? 482 PRO B O   1 
ATOM   4362 C CB  . PRO B 1 294 ? -49.658 28.724  20.805  1.00 70.87  ? 482 PRO B CB  1 
ATOM   4363 C CG  . PRO B 1 294 ? -50.998 28.113  20.682  1.00 71.15  ? 482 PRO B CG  1 
ATOM   4364 C CD  . PRO B 1 294 ? -51.573 28.099  22.067  1.00 71.98  ? 482 PRO B CD  1 
ATOM   4365 N N   . GLY B 1 295 ? -51.377 31.541  21.270  1.00 76.21  ? 483 GLY B N   1 
ATOM   4366 C CA  . GLY B 1 295 ? -51.784 32.787  20.649  1.00 77.48  ? 483 GLY B CA  1 
ATOM   4367 C C   . GLY B 1 295 ? -52.437 32.543  19.302  1.00 77.79  ? 483 GLY B C   1 
ATOM   4368 O O   . GLY B 1 295 ? -52.686 31.395  18.932  1.00 76.79  ? 483 GLY B O   1 
ATOM   4369 N N   . PRO B 1 296 ? -52.725 33.621  18.559  1.00 78.37  ? 484 PRO B N   1 
ATOM   4370 C CA  . PRO B 1 296 ? -53.361 33.478  17.245  1.00 77.64  ? 484 PRO B CA  1 
ATOM   4371 C C   . PRO B 1 296 ? -52.428 32.823  16.230  1.00 75.80  ? 484 PRO B C   1 
ATOM   4372 O O   . PRO B 1 296 ? -51.214 33.024  16.298  1.00 73.53  ? 484 PRO B O   1 
ATOM   4373 C CB  . PRO B 1 296 ? -53.675 34.923  16.850  1.00 76.95  ? 484 PRO B CB  1 
ATOM   4374 C CG  . PRO B 1 296 ? -52.654 35.733  17.574  1.00 76.51  ? 484 PRO B CG  1 
ATOM   4375 C CD  . PRO B 1 296 ? -52.440 35.030  18.885  1.00 76.93  ? 484 PRO B CD  1 
ATOM   4376 N N   . CYS B 1 297 ? -52.989 32.047  15.308  1.00 73.01  ? 485 CYS B N   1 
ATOM   4377 C CA  . CYS B 1 297 ? -52.192 31.416  14.261  1.00 74.64  ? 485 CYS B CA  1 
ATOM   4378 C C   . CYS B 1 297 ? -52.613 31.920  12.888  1.00 75.16  ? 485 CYS B C   1 
ATOM   4379 O O   . CYS B 1 297 ? -53.784 32.247  12.681  1.00 76.12  ? 485 CYS B O   1 
ATOM   4380 C CB  . CYS B 1 297 ? -52.317 29.888  14.321  1.00 73.90  ? 485 CYS B CB  1 
ATOM   4381 S SG  . CYS B 1 297 ? -53.936 29.218  13.888  1.00 132.49 ? 485 CYS B SG  1 
ATOM   4382 N N   . PRO B 1 298 ? -51.653 31.991  11.949  1.00 78.74  ? 486 PRO B N   1 
ATOM   4383 C CA  . PRO B 1 298 ? -51.934 32.368  10.560  1.00 79.97  ? 486 PRO B CA  1 
ATOM   4384 C C   . PRO B 1 298 ? -53.061 31.526  9.976   1.00 80.29  ? 486 PRO B C   1 
ATOM   4385 O O   . PRO B 1 298 ? -53.069 30.311  10.173  1.00 79.11  ? 486 PRO B O   1 
ATOM   4386 C CB  . PRO B 1 298 ? -50.610 32.091  9.847   1.00 79.49  ? 486 PRO B CB  1 
ATOM   4387 C CG  . PRO B 1 298 ? -49.580 32.268  10.909  1.00 79.01  ? 486 PRO B CG  1 
ATOM   4388 C CD  . PRO B 1 298 ? -50.214 31.759  12.174  1.00 77.92  ? 486 PRO B CD  1 
ATOM   4389 N N   . PRO B 1 299 ? -54.005 32.169  9.274   1.00 79.92  ? 487 PRO B N   1 
ATOM   4390 C CA  . PRO B 1 299 ? -55.225 31.531  8.769   1.00 82.26  ? 487 PRO B CA  1 
ATOM   4391 C C   . PRO B 1 299 ? -54.970 30.263  7.954   1.00 81.52  ? 487 PRO B C   1 
ATOM   4392 O O   . PRO B 1 299 ? -55.658 29.271  8.173   1.00 83.20  ? 487 PRO B O   1 
ATOM   4393 C CB  . PRO B 1 299 ? -55.857 32.621  7.890   1.00 83.55  ? 487 PRO B CB  1 
ATOM   4394 C CG  . PRO B 1 299 ? -54.765 33.617  7.643   1.00 83.65  ? 487 PRO B CG  1 
ATOM   4395 C CD  . PRO B 1 299 ? -53.924 33.582  8.873   1.00 81.68  ? 487 PRO B CD  1 
ATOM   4396 N N   . GLU B 1 300 ? -54.000 30.287  7.046   1.00 80.39  ? 488 GLU B N   1 
ATOM   4397 C CA  . GLU B 1 300 ? -53.750 29.136  6.184   1.00 79.24  ? 488 GLU B CA  1 
ATOM   4398 C C   . GLU B 1 300 ? -53.122 27.965  6.947   1.00 72.83  ? 488 GLU B C   1 
ATOM   4399 O O   . GLU B 1 300 ? -53.273 26.808  6.551   1.00 70.72  ? 488 GLU B O   1 
ATOM   4400 C CB  . GLU B 1 300 ? -52.862 29.531  4.997   1.00 84.74  ? 488 GLU B CB  1 
ATOM   4401 C CG  . GLU B 1 300 ? -51.513 30.128  5.369   1.00 89.38  ? 488 GLU B CG  1 
ATOM   4402 C CD  . GLU B 1 300 ? -51.597 31.605  5.700   1.00 96.21  ? 488 GLU B CD  1 
ATOM   4403 O OE1 . GLU B 1 300 ? -51.954 31.937  6.850   1.00 98.29  ? 488 GLU B OE1 1 
ATOM   4404 O OE2 . GLU B 1 300 ? -51.310 32.434  4.809   1.00 98.61  ? 488 GLU B OE2 1 
ATOM   4405 N N   . LEU B 1 301 ? -52.428 28.266  8.042   1.00 72.03  ? 489 LEU B N   1 
ATOM   4406 C CA  . LEU B 1 301 ? -51.844 27.225  8.884   1.00 69.79  ? 489 LEU B CA  1 
ATOM   4407 C C   . LEU B 1 301 ? -52.946 26.451  9.606   1.00 71.23  ? 489 LEU B C   1 
ATOM   4408 O O   . LEU B 1 301 ? -53.029 25.221  9.506   1.00 69.41  ? 489 LEU B O   1 
ATOM   4409 C CB  . LEU B 1 301 ? -50.865 27.840  9.895   1.00 70.05  ? 489 LEU B CB  1 
ATOM   4410 C CG  . LEU B 1 301 ? -49.912 26.947  10.704  1.00 69.88  ? 489 LEU B CG  1 
ATOM   4411 C CD1 . LEU B 1 301 ? -48.743 27.764  11.222  1.00 71.62  ? 489 LEU B CD1 1 
ATOM   4412 C CD2 . LEU B 1 301 ? -50.606 26.265  11.873  1.00 70.68  ? 489 LEU B CD2 1 
ATOM   4413 N N   . GLY B 1 302 ? -53.795 27.183  10.323  1.00 71.63  ? 490 GLY B N   1 
ATOM   4414 C CA  . GLY B 1 302 ? -54.882 26.587  11.077  1.00 70.27  ? 490 GLY B CA  1 
ATOM   4415 C C   . GLY B 1 302 ? -55.876 25.900  10.165  1.00 73.80  ? 490 GLY B C   1 
ATOM   4416 O O   . GLY B 1 302 ? -56.276 24.760  10.414  1.00 76.70  ? 490 GLY B O   1 
ATOM   4417 N N   . LEU B 1 303 ? -56.275 26.604  9.110   1.00 74.58  ? 491 LEU B N   1 
ATOM   4418 C CA  . LEU B 1 303 ? -57.143 26.050  8.076   1.00 73.00  ? 491 LEU B CA  1 
ATOM   4419 C C   . LEU B 1 303 ? -56.565 24.750  7.536   1.00 70.80  ? 491 LEU B C   1 
ATOM   4420 O O   . LEU B 1 303 ? -57.203 23.707  7.628   1.00 69.18  ? 491 LEU B O   1 
ATOM   4421 C CB  . LEU B 1 303 ? -57.352 27.054  6.939   1.00 73.71  ? 491 LEU B CB  1 
ATOM   4422 C CG  . LEU B 1 303 ? -58.623 27.912  6.969   1.00 77.85  ? 491 LEU B CG  1 
ATOM   4423 C CD1 . LEU B 1 303 ? -59.057 28.229  8.393   1.00 78.72  ? 491 LEU B CD1 1 
ATOM   4424 C CD2 . LEU B 1 303 ? -58.411 29.199  6.183   1.00 77.64  ? 491 LEU B CD2 1 
ATOM   4425 N N   . GLY B 1 304 ? -55.367 24.824  6.962   1.00 69.88  ? 492 GLY B N   1 
ATOM   4426 C CA  . GLY B 1 304 ? -54.698 23.653  6.417   1.00 70.34  ? 492 GLY B CA  1 
ATOM   4427 C C   . GLY B 1 304 ? -54.640 22.459  7.356   1.00 65.83  ? 492 GLY B C   1 
ATOM   4428 O O   . GLY B 1 304 ? -54.987 21.338  6.967   1.00 62.68  ? 492 GLY B O   1 
ATOM   4429 N N   . LEU B 1 305 ? -54.215 22.697  8.595   1.00 66.39  ? 493 LEU B N   1 
ATOM   4430 C CA  . LEU B 1 305 ? -54.143 21.625  9.587   1.00 61.16  ? 493 LEU B CA  1 
ATOM   4431 C C   . LEU B 1 305 ? -55.525 21.041  9.871   1.00 58.86  ? 493 LEU B C   1 
ATOM   4432 O O   . LEU B 1 305 ? -55.673 19.827  10.024  1.00 55.20  ? 493 LEU B O   1 
ATOM   4433 C CB  . LEU B 1 305 ? -53.507 22.126  10.886  1.00 59.37  ? 493 LEU B CB  1 
ATOM   4434 C CG  . LEU B 1 305 ? -51.998 22.383  10.865  1.00 61.23  ? 493 LEU B CG  1 
ATOM   4435 C CD1 . LEU B 1 305 ? -51.505 22.769  12.249  1.00 60.73  ? 493 LEU B CD1 1 
ATOM   4436 C CD2 . LEU B 1 305 ? -51.241 21.167  10.351  1.00 59.72  ? 493 LEU B CD2 1 
ATOM   4437 N N   . GLY B 1 306 ? -56.534 21.907  9.934   1.00 55.64  ? 494 GLY B N   1 
ATOM   4438 C CA  . GLY B 1 306 ? -57.901 21.469  10.154  1.00 57.09  ? 494 GLY B CA  1 
ATOM   4439 C C   . GLY B 1 306 ? -58.414 20.588  9.032   1.00 62.99  ? 494 GLY B C   1 
ATOM   4440 O O   . GLY B 1 306 ? -59.016 19.541  9.277   1.00 64.37  ? 494 GLY B O   1 
ATOM   4441 N N   . GLN B 1 307 ? -58.173 21.016  7.796   1.00 62.44  ? 495 GLN B N   1 
ATOM   4442 C CA  . GLN B 1 307 ? -58.584 20.266  6.615   1.00 68.86  ? 495 GLN B CA  1 
ATOM   4443 C C   . GLN B 1 307 ? -57.905 18.900  6.582   1.00 66.11  ? 495 GLN B C   1 
ATOM   4444 O O   . GLN B 1 307 ? -58.557 17.875  6.347   1.00 68.03  ? 495 GLN B O   1 
ATOM   4445 C CB  . GLN B 1 307 ? -58.261 21.049  5.338   1.00 74.82  ? 495 GLN B CB  1 
ATOM   4446 C CG  . GLN B 1 307 ? -58.892 22.433  5.278   1.00 83.95  ? 495 GLN B CG  1 
ATOM   4447 C CD  . GLN B 1 307 ? -58.683 23.118  3.939   1.00 92.05  ? 495 GLN B CD  1 
ATOM   4448 O OE1 . GLN B 1 307 ? -59.233 22.696  2.922   1.00 95.85  ? 495 GLN B OE1 1 
ATOM   4449 N NE2 . GLN B 1 307 ? -57.884 24.181  3.933   1.00 94.28  ? 495 GLN B NE2 1 
ATOM   4450 N N   . LEU B 1 308 ? -56.596 18.892  6.825   1.00 61.91  ? 496 LEU B N   1 
ATOM   4451 C CA  . LEU B 1 308 ? -55.842 17.643  6.869   1.00 59.29  ? 496 LEU B CA  1 
ATOM   4452 C C   . LEU B 1 308 ? -56.412 16.711  7.932   1.00 56.55  ? 496 LEU B C   1 
ATOM   4453 O O   . LEU B 1 308 ? -56.607 15.516  7.690   1.00 56.54  ? 496 LEU B O   1 
ATOM   4454 C CB  . LEU B 1 308 ? -54.363 17.912  7.139   1.00 58.10  ? 496 LEU B CB  1 
ATOM   4455 C CG  . LEU B 1 308 ? -53.475 16.670  7.098   1.00 59.69  ? 496 LEU B CG  1 
ATOM   4456 C CD1 . LEU B 1 308 ? -53.665 15.935  5.783   1.00 62.52  ? 496 LEU B CD1 1 
ATOM   4457 C CD2 . LEU B 1 308 ? -52.024 17.052  7.287   1.00 58.23  ? 496 LEU B CD2 1 
ATOM   4458 N N   . ALA B 1 309 ? -56.689 17.274  9.104   1.00 55.23  ? 497 ALA B N   1 
ATOM   4459 C CA  . ALA B 1 309 ? -57.296 16.530  10.199  1.00 58.10  ? 497 ALA B CA  1 
ATOM   4460 C C   . ALA B 1 309 ? -58.620 15.887  9.786   1.00 59.83  ? 497 ALA B C   1 
ATOM   4461 O O   . ALA B 1 309 ? -58.834 14.698  10.026  1.00 56.02  ? 497 ALA B O   1 
ATOM   4462 C CB  . ALA B 1 309 ? -57.504 17.439  11.399  1.00 60.72  ? 497 ALA B CB  1 
ATOM   4463 N N   . CYS B 1 310 ? -59.500 16.669  9.163   1.00 63.65  ? 498 CYS B N   1 
ATOM   4464 C CA  . CYS B 1 310 ? -60.799 16.155  8.725   1.00 65.90  ? 498 CYS B CA  1 
ATOM   4465 C C   . CYS B 1 310 ? -60.652 15.029  7.703   1.00 65.26  ? 498 CYS B C   1 
ATOM   4466 O O   . CYS B 1 310 ? -61.327 14.002  7.798   1.00 63.44  ? 498 CYS B O   1 
ATOM   4467 C CB  . CYS B 1 310 ? -61.655 17.280  8.137   1.00 67.81  ? 498 CYS B CB  1 
ATOM   4468 S SG  . CYS B 1 310 ? -62.232 18.490  9.348   1.00 75.95  ? 498 CYS B SG  1 
ATOM   4469 N N   . CYS B 1 311 ? -59.770 15.225  6.727   1.00 64.47  ? 499 CYS B N   1 
ATOM   4470 C CA  . CYS B 1 311 ? -59.521 14.203  5.716   1.00 63.30  ? 499 CYS B CA  1 
ATOM   4471 C C   . CYS B 1 311 ? -58.995 12.911  6.344   1.00 61.01  ? 499 CYS B C   1 
ATOM   4472 O O   . CYS B 1 311 ? -59.387 11.813  5.945   1.00 59.47  ? 499 CYS B O   1 
ATOM   4473 C CB  . CYS B 1 311 ? -58.534 14.719  4.668   1.00 66.37  ? 499 CYS B CB  1 
ATOM   4474 S SG  . CYS B 1 311 ? -59.119 16.155  3.747   1.00 78.20  ? 499 CYS B SG  1 
ATOM   4475 N N   . CYS B 1 312 ? -58.110 13.048  7.328   1.00 58.10  ? 500 CYS B N   1 
ATOM   4476 C CA  . CYS B 1 312 ? -57.563 11.888  8.028   1.00 55.20  ? 500 CYS B CA  1 
ATOM   4477 C C   . CYS B 1 312 ? -58.630 11.156  8.833   1.00 57.62  ? 500 CYS B C   1 
ATOM   4478 O O   . CYS B 1 312 ? -58.579 9.935   8.985   1.00 56.45  ? 500 CYS B O   1 
ATOM   4479 C CB  . CYS B 1 312 ? -56.418 12.306  8.954   1.00 52.20  ? 500 CYS B CB  1 
ATOM   4480 S SG  . CYS B 1 312 ? -54.858 12.653  8.120   1.00 48.90  ? 500 CYS B SG  1 
ATOM   4481 N N   . LEU B 1 313 ? -59.607 11.908  9.330   1.00 57.85  ? 501 LEU B N   1 
ATOM   4482 C CA  . LEU B 1 313 ? -60.598 11.372  10.254  1.00 59.37  ? 501 LEU B CA  1 
ATOM   4483 C C   . LEU B 1 313 ? -61.873 10.872  9.576   1.00 61.60  ? 501 LEU B C   1 
ATOM   4484 O O   . LEU B 1 313 ? -62.835 10.522  10.258  1.00 63.08  ? 501 LEU B O   1 
ATOM   4485 C CB  . LEU B 1 313 ? -60.950 12.423  11.306  1.00 59.71  ? 501 LEU B CB  1 
ATOM   4486 C CG  . LEU B 1 313 ? -59.828 12.756  12.291  1.00 58.79  ? 501 LEU B CG  1 
ATOM   4487 C CD1 . LEU B 1 313 ? -60.283 13.793  13.301  1.00 57.42  ? 501 LEU B CD1 1 
ATOM   4488 C CD2 . LEU B 1 313 ? -59.331 11.500  12.994  1.00 55.47  ? 501 LEU B CD2 1 
ATOM   4489 N N   . HIS B 1 314 ? -61.889 10.856  8.245   1.00 64.79  ? 502 HIS B N   1 
ATOM   4490 C CA  . HIS B 1 314 ? -63.077 10.442  7.495   1.00 67.60  ? 502 HIS B CA  1 
ATOM   4491 C C   . HIS B 1 314 ? -63.597 9.074   7.940   1.00 66.46  ? 502 HIS B C   1 
ATOM   4492 O O   . HIS B 1 314 ? -62.817 8.142   8.144   1.00 60.36  ? 502 HIS B O   1 
ATOM   4493 C CB  . HIS B 1 314 ? -62.781 10.417  5.995   1.00 70.36  ? 502 HIS B CB  1 
ATOM   4494 C CG  . HIS B 1 314 ? -64.003 10.277  5.142   1.00 79.95  ? 502 HIS B CG  1 
ATOM   4495 N ND1 . HIS B 1 314 ? -64.498 9.054   4.743   1.00 83.21  ? 502 HIS B ND1 1 
ATOM   4496 C CD2 . HIS B 1 314 ? -64.832 11.207  4.612   1.00 82.33  ? 502 HIS B CD2 1 
ATOM   4497 C CE1 . HIS B 1 314 ? -65.577 9.237   4.004   1.00 84.64  ? 502 HIS B CE1 1 
ATOM   4498 N NE2 . HIS B 1 314 ? -65.801 10.535  3.909   1.00 84.22  ? 502 HIS B NE2 1 
ATOM   4499 N N   . ARG B 1 315 ? -64.918 8.970   8.085   1.00 69.74  ? 503 ARG B N   1 
ATOM   4500 C CA  . ARG B 1 315 ? -65.565 7.763   8.601   1.00 70.48  ? 503 ARG B CA  1 
ATOM   4501 C C   . ARG B 1 315 ? -65.234 6.526   7.773   1.00 70.31  ? 503 ARG B C   1 
ATOM   4502 O O   . ARG B 1 315 ? -65.031 5.444   8.320   1.00 68.73  ? 503 ARG B O   1 
ATOM   4503 C CB  . ARG B 1 315 ? -67.088 7.958   8.667   1.00 72.12  ? 503 ARG B CB  1 
ATOM   4504 C CG  . ARG B 1 315 ? -67.728 8.450   7.373   1.00 78.08  ? 503 ARG B CG  1 
ATOM   4505 C CD  . ARG B 1 315 ? -69.213 8.759   7.556   1.00 85.77  ? 503 ARG B CD  1 
ATOM   4506 N NE  . ARG B 1 315 ? -69.701 9.726   6.571   1.00 93.12  ? 503 ARG B NE  1 
ATOM   4507 C CZ  . ARG B 1 315 ? -70.446 9.421   5.511   1.00 98.88  ? 503 ARG B CZ  1 
ATOM   4508 N NH1 . ARG B 1 315 ? -70.810 8.165   5.286   1.00 101.00 ? 503 ARG B NH1 1 
ATOM   4509 N NH2 . ARG B 1 315 ? -70.834 10.377  4.676   1.00 100.08 ? 503 ARG B NH2 1 
ATOM   4510 N N   . ARG B 1 316 ? -65.173 6.693   6.456   1.00 69.28  ? 504 ARG B N   1 
ATOM   4511 C CA  . ARG B 1 316 ? -64.837 5.591   5.563   1.00 71.92  ? 504 ARG B CA  1 
ATOM   4512 C C   . ARG B 1 316 ? -63.330 5.544   5.332   1.00 72.74  ? 504 ARG B C   1 
ATOM   4513 O O   . ARG B 1 316 ? -62.743 6.487   4.802   1.00 74.88  ? 504 ARG B O   1 
ATOM   4514 C CB  . ARG B 1 316 ? -65.587 5.728   4.236   1.00 77.31  ? 504 ARG B CB  1 
ATOM   4515 C CG  . ARG B 1 316 ? -67.081 5.975   4.402   1.00 82.31  ? 504 ARG B CG  1 
ATOM   4516 C CD  . ARG B 1 316 ? -67.806 5.997   3.064   1.00 87.93  ? 504 ARG B CD  1 
ATOM   4517 N NE  . ARG B 1 316 ? -68.654 7.178   2.922   1.00 93.53  ? 504 ARG B NE  1 
ATOM   4518 C CZ  . ARG B 1 316 ? -68.426 8.162   2.057   1.00 95.72  ? 504 ARG B CZ  1 
ATOM   4519 N NH1 . ARG B 1 316 ? -69.249 9.202   1.999   1.00 97.73  ? 504 ARG B NH1 1 
ATOM   4520 N NH2 . ARG B 1 316 ? -67.379 8.105   1.245   1.00 95.16  ? 504 ARG B NH2 1 
ATOM   4521 N N   . ALA B 1 317 ? -62.713 4.437   5.735   1.00 75.35  ? 505 ALA B N   1 
ATOM   4522 C CA  . ALA B 1 317 ? -61.258 4.292   5.720   1.00 71.64  ? 505 ALA B CA  1 
ATOM   4523 C C   . ALA B 1 317 ? -60.651 4.459   4.330   1.00 68.12  ? 505 ALA B C   1 
ATOM   4524 O O   . ALA B 1 317 ? -59.508 4.893   4.191   1.00 62.06  ? 505 ALA B O   1 
ATOM   4525 C CB  . ALA B 1 317 ? -60.867 2.937   6.297   1.00 70.18  ? 505 ALA B CB  1 
ATOM   4526 N N   . LYS B 1 318 ? -61.426 4.121   3.306   1.00 68.11  ? 506 LYS B N   1 
ATOM   4527 C CA  . LYS B 1 318 ? -60.934 4.124   1.933   1.00 69.87  ? 506 LYS B CA  1 
ATOM   4528 C C   . LYS B 1 318 ? -60.789 5.544   1.395   1.00 68.24  ? 506 LYS B C   1 
ATOM   4529 O O   . LYS B 1 318 ? -60.104 5.773   0.397   1.00 67.81  ? 506 LYS B O   1 
ATOM   4530 C CB  . LYS B 1 318 ? -61.867 3.313   1.027   1.00 77.13  ? 506 LYS B CB  1 
ATOM   4531 C CG  . LYS B 1 318 ? -62.993 2.583   1.759   1.00 81.54  ? 506 LYS B CG  1 
ATOM   4532 C CD  . LYS B 1 318 ? -62.508 1.313   2.454   1.00 84.26  ? 506 LYS B CD  1 
ATOM   4533 C CE  . LYS B 1 318 ? -63.600 0.726   3.337   1.00 86.25  ? 506 LYS B CE  1 
ATOM   4534 N NZ  . LYS B 1 318 ? -64.103 1.719   4.329   1.00 86.15  ? 506 LYS B NZ  1 
ATOM   4535 N N   . ARG B 1 319 ? -61.440 6.495   2.059   1.00 66.43  ? 507 ARG B N   1 
ATOM   4536 C CA  . ARG B 1 319 ? -61.367 7.895   1.656   1.00 68.10  ? 507 ARG B CA  1 
ATOM   4537 C C   . ARG B 1 319 ? -60.208 8.633   2.322   1.00 63.05  ? 507 ARG B C   1 
ATOM   4538 O O   . ARG B 1 319 ? -59.890 9.764   1.957   1.00 63.74  ? 507 ARG B O   1 
ATOM   4539 C CB  . ARG B 1 319 ? -62.683 8.610   1.967   1.00 74.61  ? 507 ARG B CB  1 
ATOM   4540 C CG  . ARG B 1 319 ? -63.570 8.807   0.751   1.00 82.36  ? 507 ARG B CG  1 
ATOM   4541 C CD  . ARG B 1 319 ? -64.188 10.193  0.749   1.00 89.88  ? 507 ARG B CD  1 
ATOM   4542 N NE  . ARG B 1 319 ? -64.441 10.673  -0.606  1.00 98.09  ? 507 ARG B NE  1 
ATOM   4543 C CZ  . ARG B 1 319 ? -64.857 11.901  -0.898  1.00 104.12 ? 507 ARG B CZ  1 
ATOM   4544 N NH1 . ARG B 1 319 ? -65.069 12.780  0.073   1.00 105.44 ? 507 ARG B NH1 1 
ATOM   4545 N NH2 . ARG B 1 319 ? -65.060 12.252  -2.161  1.00 107.53 ? 507 ARG B NH2 1 
ATOM   4546 N N   . ARG B 1 320 ? -59.577 7.992   3.300   1.00 63.36  ? 508 ARG B N   1 
ATOM   4547 C CA  . ARG B 1 320 ? -58.429 8.584   3.975   1.00 60.01  ? 508 ARG B CA  1 
ATOM   4548 C C   . ARG B 1 320 ? -57.203 8.550   3.070   1.00 58.85  ? 508 ARG B C   1 
ATOM   4549 O O   . ARG B 1 320 ? -56.922 7.532   2.437   1.00 60.62  ? 508 ARG B O   1 
ATOM   4550 C CB  . ARG B 1 320 ? -58.145 7.857   5.290   1.00 57.83  ? 508 ARG B CB  1 
ATOM   4551 C CG  . ARG B 1 320 ? -59.283 7.948   6.291   1.00 58.84  ? 508 ARG B CG  1 
ATOM   4552 C CD  . ARG B 1 320 ? -59.107 6.969   7.437   1.00 57.46  ? 508 ARG B CD  1 
ATOM   4553 N NE  . ARG B 1 320 ? -60.354 6.791   8.172   1.00 61.20  ? 508 ARG B NE  1 
ATOM   4554 C CZ  . ARG B 1 320 ? -60.625 5.743   8.943   1.00 62.76  ? 508 ARG B CZ  1 
ATOM   4555 N NH1 . ARG B 1 320 ? -59.735 4.771   9.083   1.00 60.21  ? 508 ARG B NH1 1 
ATOM   4556 N NH2 . ARG B 1 320 ? -61.792 5.665   9.569   1.00 63.53  ? 508 ARG B NH2 1 
ATOM   4557 N N   . PRO B 1 321 ? -56.473 9.673   3.003   1.00 56.93  ? 509 PRO B N   1 
ATOM   4558 C CA  . PRO B 1 321 ? -55.282 9.815   2.159   1.00 57.85  ? 509 PRO B CA  1 
ATOM   4559 C C   . PRO B 1 321 ? -54.117 8.959   2.639   1.00 58.13  ? 509 PRO B C   1 
ATOM   4560 O O   . PRO B 1 321 ? -54.056 8.638   3.826   1.00 59.84  ? 509 PRO B O   1 
ATOM   4561 C CB  . PRO B 1 321 ? -54.940 11.302  2.294   1.00 55.73  ? 509 PRO B CB  1 
ATOM   4562 C CG  . PRO B 1 321 ? -55.438 11.662  3.651   1.00 53.96  ? 509 PRO B CG  1 
ATOM   4563 C CD  . PRO B 1 321 ? -56.724 10.887  3.799   1.00 57.71  ? 509 PRO B CD  1 
ATOM   4564 N N   . PRO B 1 322 ? -53.205 8.591   1.726   1.00 54.93  ? 510 PRO B N   1 
ATOM   4565 C CA  . PRO B 1 322 ? -51.965 7.914   2.121   1.00 49.56  ? 510 PRO B CA  1 
ATOM   4566 C C   . PRO B 1 322 ? -51.056 8.858   2.900   1.00 47.34  ? 510 PRO B C   1 
ATOM   4567 O O   . PRO B 1 322 ? -51.038 10.058  2.620   1.00 48.17  ? 510 PRO B O   1 
ATOM   4568 C CB  . PRO B 1 322 ? -51.334 7.519   0.784   1.00 50.77  ? 510 PRO B CB  1 
ATOM   4569 C CG  . PRO B 1 322 ? -51.895 8.497   -0.198  1.00 54.81  ? 510 PRO B CG  1 
ATOM   4570 C CD  . PRO B 1 322 ? -53.297 8.771   0.267   1.00 52.20  ? 510 PRO B CD  1 
ATOM   4571 N N   . MET B 1 323 ? -50.310 8.323   3.861   1.00 42.98  ? 511 MET B N   1 
ATOM   4572 C CA  . MET B 1 323 ? -49.489 9.158   4.734   1.00 40.99  ? 511 MET B CA  1 
ATOM   4573 C C   . MET B 1 323 ? -48.396 9.917   3.979   1.00 41.79  ? 511 MET B C   1 
ATOM   4574 O O   . MET B 1 323 ? -47.922 10.951  4.448   1.00 41.91  ? 511 MET B O   1 
ATOM   4575 C CB  . MET B 1 323 ? -48.873 8.313   5.847   1.00 37.19  ? 511 MET B CB  1 
ATOM   4576 C CG  . MET B 1 323 ? -49.845 7.998   6.979   1.00 38.60  ? 511 MET B CG  1 
ATOM   4577 S SD  . MET B 1 323 ? -50.568 9.484   7.716   1.00 41.16  ? 511 MET B SD  1 
ATOM   4578 C CE  . MET B 1 323 ? -49.096 10.383  8.213   1.00 37.88  ? 511 MET B CE  1 
ATOM   4579 N N   . THR B 1 324 ? -48.003 9.415   2.812   1.00 41.32  ? 512 THR B N   1 
ATOM   4580 C CA  . THR B 1 324 ? -47.058 10.139  1.965   1.00 45.79  ? 512 THR B CA  1 
ATOM   4581 C C   . THR B 1 324 ? -47.660 11.472  1.520   1.00 48.18  ? 512 THR B C   1 
ATOM   4582 O O   . THR B 1 324 ? -46.998 12.513  1.578   1.00 51.23  ? 512 THR B O   1 
ATOM   4583 C CB  . THR B 1 324 ? -46.647 9.321   0.724   1.00 48.22  ? 512 THR B CB  1 
ATOM   4584 O OG1 . THR B 1 324 ? -47.815 8.754   0.117   1.00 55.47  ? 512 THR B OG1 1 
ATOM   4585 C CG2 . THR B 1 324 ? -45.691 8.203   1.111   1.00 45.22  ? 512 THR B CG2 1 
ATOM   4586 N N   . GLN B 1 325 ? -48.919 11.433  1.088   1.00 47.60  ? 513 GLN B N   1 
ATOM   4587 C CA  . GLN B 1 325 ? -49.649 12.649  0.738   1.00 51.40  ? 513 GLN B CA  1 
ATOM   4588 C C   . GLN B 1 325 ? -49.729 13.597  1.926   1.00 48.92  ? 513 GLN B C   1 
ATOM   4589 O O   . GLN B 1 325 ? -49.525 14.801  1.783   1.00 47.55  ? 513 GLN B O   1 
ATOM   4590 C CB  . GLN B 1 325 ? -51.066 12.327  0.253   1.00 55.86  ? 513 GLN B CB  1 
ATOM   4591 C CG  . GLN B 1 325 ? -51.169 11.940  -1.209  1.00 64.98  ? 513 GLN B CG  1 
ATOM   4592 C CD  . GLN B 1 325 ? -52.596 12.020  -1.729  1.00 73.00  ? 513 GLN B CD  1 
ATOM   4593 O OE1 . GLN B 1 325 ? -53.433 12.741  -1.180  1.00 71.80  ? 513 GLN B OE1 1 
ATOM   4594 N NE2 . GLN B 1 325 ? -52.879 11.278  -2.792  1.00 78.91  ? 513 GLN B NE2 1 
ATOM   4595 N N   . VAL B 1 326 ? -50.035 13.042  3.095   1.00 46.74  ? 514 VAL B N   1 
ATOM   4596 C CA  . VAL B 1 326 ? -50.159 13.826  4.318   1.00 47.90  ? 514 VAL B CA  1 
ATOM   4597 C C   . VAL B 1 326 ? -48.857 14.564  4.625   1.00 47.12  ? 514 VAL B C   1 
ATOM   4598 O O   . VAL B 1 326 ? -48.857 15.772  4.913   1.00 50.91  ? 514 VAL B O   1 
ATOM   4599 C CB  . VAL B 1 326 ? -50.549 12.932  5.512   1.00 47.70  ? 514 VAL B CB  1 
ATOM   4600 C CG1 . VAL B 1 326 ? -50.487 13.712  6.812   1.00 47.95  ? 514 VAL B CG1 1 
ATOM   4601 C CG2 . VAL B 1 326 ? -51.941 12.347  5.300   1.00 43.23  ? 514 VAL B CG2 1 
ATOM   4602 N N   . TYR B 1 327 ? -47.748 13.835  4.541   1.00 47.15  ? 515 TYR B N   1 
ATOM   4603 C CA  . TYR B 1 327 ? -46.434 14.423  4.752   1.00 45.36  ? 515 TYR B CA  1 
ATOM   4604 C C   . TYR B 1 327 ? -46.178 15.537  3.746   1.00 49.34  ? 515 TYR B C   1 
ATOM   4605 O O   . TYR B 1 327 ? -45.718 16.615  4.113   1.00 56.91  ? 515 TYR B O   1 
ATOM   4606 C CB  . TYR B 1 327 ? -45.331 13.367  4.648   1.00 38.93  ? 515 TYR B CB  1 
ATOM   4607 C CG  . TYR B 1 327 ? -43.943 13.964  4.713   1.00 38.70  ? 515 TYR B CG  1 
ATOM   4608 C CD1 . TYR B 1 327 ? -43.326 14.197  5.934   1.00 34.71  ? 515 TYR B CD1 1 
ATOM   4609 C CD2 . TYR B 1 327 ? -43.257 14.312  3.553   1.00 38.13  ? 515 TYR B CD2 1 
ATOM   4610 C CE1 . TYR B 1 327 ? -42.068 14.754  6.000   1.00 35.55  ? 515 TYR B CE1 1 
ATOM   4611 C CE2 . TYR B 1 327 ? -41.998 14.871  3.611   1.00 39.57  ? 515 TYR B CE2 1 
ATOM   4612 C CZ  . TYR B 1 327 ? -41.407 15.088  4.839   1.00 36.95  ? 515 TYR B CZ  1 
ATOM   4613 O OH  . TYR B 1 327 ? -40.150 15.640  4.905   1.00 38.41  ? 515 TYR B OH  1 
ATOM   4614 N N   . GLU B 1 328 ? -46.467 15.269  2.477   1.00 45.10  ? 516 GLU B N   1 
ATOM   4615 C CA  . GLU B 1 328 ? -46.252 16.268  1.431   1.00 50.63  ? 516 GLU B CA  1 
ATOM   4616 C C   . GLU B 1 328 ? -47.054 17.547  1.682   1.00 47.28  ? 516 GLU B C   1 
ATOM   4617 O O   . GLU B 1 328 ? -46.531 18.653  1.535   1.00 53.38  ? 516 GLU B O   1 
ATOM   4618 C CB  . GLU B 1 328 ? -46.594 15.680  0.064   1.00 55.03  ? 516 GLU B CB  1 
ATOM   4619 C CG  . GLU B 1 328 ? -45.574 14.657  -0.412  1.00 62.43  ? 516 GLU B CG  1 
ATOM   4620 C CD  . GLU B 1 328 ? -46.017 13.919  -1.655  1.00 71.05  ? 516 GLU B CD  1 
ATOM   4621 O OE1 . GLU B 1 328 ? -47.226 13.950  -1.962  1.00 75.32  ? 516 GLU B OE1 1 
ATOM   4622 O OE2 . GLU B 1 328 ? -45.156 13.308  -2.325  1.00 73.65  ? 516 GLU B OE2 1 
ATOM   4623 N N   . ARG B 1 329 ? -48.312 17.394  2.081   1.00 45.49  ? 517 ARG B N   1 
ATOM   4624 C CA  . ARG B 1 329 ? -49.161 18.541  2.398   1.00 49.19  ? 517 ARG B CA  1 
ATOM   4625 C C   . ARG B 1 329 ? -48.590 19.339  3.564   1.00 51.58  ? 517 ARG B C   1 
ATOM   4626 O O   . ARG B 1 329 ? -48.535 20.570  3.515   1.00 57.56  ? 517 ARG B O   1 
ATOM   4627 C CB  . ARG B 1 329 ? -50.587 18.095  2.730   1.00 50.01  ? 517 ARG B CB  1 
ATOM   4628 C CG  . ARG B 1 329 ? -51.370 17.506  1.565   1.00 59.35  ? 517 ARG B CG  1 
ATOM   4629 C CD  . ARG B 1 329 ? -52.836 17.316  1.949   1.00 67.09  ? 517 ARG B CD  1 
ATOM   4630 N NE  . ARG B 1 329 ? -53.507 16.305  1.135   1.00 72.41  ? 517 ARG B NE  1 
ATOM   4631 C CZ  . ARG B 1 329 ? -54.719 15.825  1.395   1.00 75.32  ? 517 ARG B CZ  1 
ATOM   4632 N NH1 . ARG B 1 329 ? -55.395 16.267  2.447   1.00 76.89  ? 517 ARG B NH1 1 
ATOM   4633 N NH2 . ARG B 1 329 ? -55.256 14.904  0.606   1.00 76.24  ? 517 ARG B NH2 1 
ATOM   4634 N N   . LEU B 1 330 ? -48.172 18.636  4.613   1.00 49.56  ? 518 LEU B N   1 
ATOM   4635 C CA  . LEU B 1 330 ? -47.579 19.295  5.773   1.00 51.71  ? 518 LEU B CA  1 
ATOM   4636 C C   . LEU B 1 330 ? -46.316 20.064  5.392   1.00 56.25  ? 518 LEU B C   1 
ATOM   4637 O O   . LEU B 1 330 ? -46.084 21.178  5.870   1.00 58.59  ? 518 LEU B O   1 
ATOM   4638 C CB  . LEU B 1 330 ? -47.261 18.274  6.867   1.00 48.03  ? 518 LEU B CB  1 
ATOM   4639 C CG  . LEU B 1 330 ? -48.454 17.743  7.661   1.00 49.76  ? 518 LEU B CG  1 
ATOM   4640 C CD1 . LEU B 1 330 ? -48.042 16.557  8.517   1.00 47.38  ? 518 LEU B CD1 1 
ATOM   4641 C CD2 . LEU B 1 330 ? -49.046 18.843  8.527   1.00 51.82  ? 518 LEU B CD2 1 
ATOM   4642 N N   . GLU B 1 331 ? -45.509 19.463  4.524   1.00 53.90  ? 519 GLU B N   1 
ATOM   4643 C CA  . GLU B 1 331 ? -44.273 20.076  4.055   1.00 57.84  ? 519 GLU B CA  1 
ATOM   4644 C C   . GLU B 1 331 ? -44.565 21.356  3.276   1.00 55.67  ? 519 GLU B C   1 
ATOM   4645 O O   . GLU B 1 331 ? -43.913 22.387  3.485   1.00 53.40  ? 519 GLU B O   1 
ATOM   4646 C CB  . GLU B 1 331 ? -43.487 19.087  3.191   1.00 62.49  ? 519 GLU B CB  1 
ATOM   4647 C CG  . GLU B 1 331 ? -42.066 19.515  2.870   1.00 65.10  ? 519 GLU B CG  1 
ATOM   4648 C CD  . GLU B 1 331 ? -41.321 18.481  2.049   1.00 69.12  ? 519 GLU B CD  1 
ATOM   4649 O OE1 . GLU B 1 331 ? -41.963 17.522  1.571   1.00 70.54  ? 519 GLU B OE1 1 
ATOM   4650 O OE2 . GLU B 1 331 ? -40.091 18.624  1.884   1.00 71.68  ? 519 GLU B OE2 1 
ATOM   4651 N N   . LYS B 1 332 ? -45.554 21.285  2.386   1.00 57.05  ? 520 LYS B N   1 
ATOM   4652 C CA  . LYS B 1 332 ? -45.998 22.461  1.641   1.00 63.29  ? 520 LYS B CA  1 
ATOM   4653 C C   . LYS B 1 332 ? -46.457 23.567  2.590   1.00 64.34  ? 520 LYS B C   1 
ATOM   4654 O O   . LYS B 1 332 ? -46.101 24.735  2.415   1.00 66.65  ? 520 LYS B O   1 
ATOM   4655 C CB  . LYS B 1 332 ? -47.131 22.103  0.674   1.00 66.11  ? 520 LYS B CB  1 
ATOM   4656 C CG  . LYS B 1 332 ? -46.723 21.194  -0.476  1.00 68.85  ? 520 LYS B CG  1 
ATOM   4657 C CD  . LYS B 1 332 ? -47.834 21.101  -1.514  1.00 73.33  ? 520 LYS B CD  1 
ATOM   4658 C CE  . LYS B 1 332 ? -47.511 20.081  -2.596  1.00 73.96  ? 520 LYS B CE  1 
ATOM   4659 N NZ  . LYS B 1 332 ? -47.544 18.684  -2.077  1.00 73.41  ? 520 LYS B NZ  1 
ATOM   4660 N N   . LEU B 1 333 ? -47.246 23.192  3.594   1.00 66.06  ? 521 LEU B N   1 
ATOM   4661 C CA  . LEU B 1 333 ? -47.707 24.145  4.600   1.00 62.61  ? 521 LEU B CA  1 
ATOM   4662 C C   . LEU B 1 333 ? -46.535 24.809  5.310   1.00 63.42  ? 521 LEU B C   1 
ATOM   4663 O O   . LEU B 1 333 ? -46.555 26.011  5.571   1.00 63.61  ? 521 LEU B O   1 
ATOM   4664 C CB  . LEU B 1 333 ? -48.609 23.457  5.623   1.00 57.15  ? 521 LEU B CB  1 
ATOM   4665 C CG  . LEU B 1 333 ? -50.074 23.277  5.232   1.00 60.61  ? 521 LEU B CG  1 
ATOM   4666 C CD1 . LEU B 1 333 ? -50.768 22.370  6.230   1.00 65.15  ? 521 LEU B CD1 1 
ATOM   4667 C CD2 . LEU B 1 333 ? -50.774 24.625  5.157   1.00 57.89  ? 521 LEU B CD2 1 
ATOM   4668 N N   . GLN B 1 334 ? -45.513 24.019  5.620   1.00 62.56  ? 522 GLN B N   1 
ATOM   4669 C CA  . GLN B 1 334 ? -44.325 24.549  6.274   1.00 66.39  ? 522 GLN B CA  1 
ATOM   4670 C C   . GLN B 1 334 ? -43.633 25.560  5.374   1.00 76.08  ? 522 GLN B C   1 
ATOM   4671 O O   . GLN B 1 334 ? -43.158 26.596  5.840   1.00 78.55  ? 522 GLN B O   1 
ATOM   4672 C CB  . GLN B 1 334 ? -43.360 23.427  6.640   1.00 61.43  ? 522 GLN B CB  1 
ATOM   4673 C CG  . GLN B 1 334 ? -42.249 23.870  7.565   1.00 60.90  ? 522 GLN B CG  1 
ATOM   4674 C CD  . GLN B 1 334 ? -41.066 22.930  7.536   1.00 62.63  ? 522 GLN B CD  1 
ATOM   4675 O OE1 . GLN B 1 334 ? -40.717 22.387  6.487   1.00 64.34  ? 522 GLN B OE1 1 
ATOM   4676 N NE2 . GLN B 1 334 ? -40.442 22.727  8.691   1.00 61.86  ? 522 GLN B NE2 1 
ATOM   4677 N N   . ALA B 1 335 ? -43.577 25.253  4.081   1.00 74.22  ? 523 ALA B N   1 
ATOM   4678 C CA  . ALA B 1 335 ? -43.005 26.183  3.112   1.00 80.16  ? 523 ALA B CA  1 
ATOM   4679 C C   . ALA B 1 335 ? -43.787 27.497  3.096   1.00 86.50  ? 523 ALA B C   1 
ATOM   4680 O O   . ALA B 1 335 ? -43.198 28.579  3.059   1.00 88.38  ? 523 ALA B O   1 
ATOM   4681 C CB  . ALA B 1 335 ? -42.980 25.561  1.724   1.00 80.55  ? 523 ALA B CB  1 
ATOM   4682 N N   . VAL B 1 336 ? -45.113 27.394  3.134   1.00 83.68  ? 524 VAL B N   1 
ATOM   4683 C CA  . VAL B 1 336 ? -45.979 28.573  3.131   1.00 83.70  ? 524 VAL B CA  1 
ATOM   4684 C C   . VAL B 1 336 ? -45.765 29.447  4.367   1.00 83.86  ? 524 VAL B C   1 
ATOM   4685 O O   . VAL B 1 336 ? -45.570 30.658  4.253   1.00 86.52  ? 524 VAL B O   1 
ATOM   4686 C CB  . VAL B 1 336 ? -47.469 28.176  3.052   1.00 81.92  ? 524 VAL B CB  1 
ATOM   4687 C CG1 . VAL B 1 336 ? -48.359 29.400  3.234   1.00 82.17  ? 524 VAL B CG1 1 
ATOM   4688 C CG2 . VAL B 1 336 ? -47.766 27.484  1.730   1.00 80.99  ? 524 VAL B CG2 1 
ATOM   4689 N N   . VAL B 1 337 ? -45.802 28.824  5.542   1.00 87.37  ? 525 VAL B N   1 
ATOM   4690 C CA  . VAL B 1 337 ? -45.615 29.529  6.808   1.00 85.57  ? 525 VAL B CA  1 
ATOM   4691 C C   . VAL B 1 337 ? -44.295 30.301  6.834   1.00 86.38  ? 525 VAL B C   1 
ATOM   4692 O O   . VAL B 1 337 ? -44.225 31.413  7.364   1.00 89.47  ? 525 VAL B O   1 
ATOM   4693 C CB  . VAL B 1 337 ? -45.670 28.548  7.998   1.00 82.40  ? 525 VAL B CB  1 
ATOM   4694 C CG1 . VAL B 1 337 ? -45.340 29.254  9.305   1.00 83.87  ? 525 VAL B CG1 1 
ATOM   4695 C CG2 . VAL B 1 337 ? -47.042 27.907  8.078   1.00 80.70  ? 525 VAL B CG2 1 
ATOM   4696 N N   . ALA B 1 338 ? -43.259 29.716  6.240   1.00 87.56  ? 526 ALA B N   1 
ATOM   4697 C CA  . ALA B 1 338 ? -41.954 30.365  6.149   1.00 87.61  ? 526 ALA B CA  1 
ATOM   4698 C C   . ALA B 1 338 ? -42.041 31.704  5.417   1.00 87.90  ? 526 ALA B C   1 
ATOM   4699 O O   . ALA B 1 338 ? -41.538 31.851  4.303   1.00 86.98  ? 526 ALA B O   1 
ATOM   4700 C CB  . ALA B 1 338 ? -40.959 29.450  5.456   1.00 87.12  ? 526 ALA B CB  1 
HETATM 4701 C CAM . DL1 C 2 .   ? -21.426 19.560  6.317   1.00 48.46  ? 601 DL1 A CAM 1 
HETATM 4702 C CAK . DL1 C 2 .   ? -21.571 20.740  5.365   1.00 54.71  ? 601 DL1 A CAK 1 
HETATM 4703 O OAS . DL1 C 2 .   ? -20.309 21.039  4.741   1.00 54.82  ? 601 DL1 A OAS 1 
HETATM 4704 C CAL . DL1 C 2 .   ? -19.955 19.956  3.864   1.00 54.54  ? 601 DL1 A CAL 1 
HETATM 4705 C CAN . DL1 C 2 .   ? -19.642 18.708  4.679   1.00 50.29  ? 601 DL1 A CAN 1 
HETATM 4706 N NBB . DL1 C 2 .   ? -20.690 18.438  5.691   1.00 45.59  ? 601 DL1 A NBB 1 
HETATM 4707 C CAV . DL1 C 2 .   ? -20.915 17.183  6.102   1.00 40.79  ? 601 DL1 A CAV 1 
HETATM 4708 C CAJ . DL1 C 2 .   ? -19.903 16.237  5.981   1.00 37.09  ? 601 DL1 A CAJ 1 
HETATM 4709 C CBA . DL1 C 2 .   ? -20.137 14.938  6.419   1.00 38.78  ? 601 DL1 A CBA 1 
HETATM 4710 O OAT . DL1 C 2 .   ? -19.204 13.938  6.340   1.00 39.10  ? 601 DL1 A OAT 1 
HETATM 4711 C CAA . DL1 C 2 .   ? -17.942 14.409  5.852   1.00 39.95  ? 601 DL1 A CAA 1 
HETATM 4712 C CAH . DL1 C 2 .   ? -22.145 16.830  6.657   1.00 35.11  ? 601 DL1 A CAH 1 
HETATM 4713 C CAI . DL1 C 2 .   ? -22.370 15.527  7.092   1.00 31.66  ? 601 DL1 A CAI 1 
HETATM 4714 C CAY . DL1 C 2 .   ? -21.364 14.575  6.960   1.00 33.25  ? 601 DL1 A CAY 1 
HETATM 4715 N NAQ . DL1 C 2 .   ? -21.416 13.296  7.355   1.00 32.73  ? 601 DL1 A NAQ 1 
HETATM 4716 C CAU . DL1 C 2 .   ? -22.517 12.655  7.801   1.00 31.32  ? 601 DL1 A CAU 1 
HETATM 4717 O OAB . DL1 C 2 .   ? -23.661 13.104  7.891   1.00 33.42  ? 601 DL1 A OAB 1 
HETATM 4718 C CAW . DL1 C 2 .   ? -22.230 11.360  8.212   1.00 33.34  ? 601 DL1 A CAW 1 
HETATM 4719 N NAP . DL1 C 2 .   ? -21.015 10.848  7.932   1.00 31.20  ? 601 DL1 A NAP 1 
HETATM 4720 C CAE . DL1 C 2 .   ? -23.165 10.622  8.933   1.00 29.50  ? 601 DL1 A CAE 1 
HETATM 4721 C CAC . DL1 C 2 .   ? -22.815 9.341   9.341   1.00 29.48  ? 601 DL1 A CAC 1 
HETATM 4722 C CAF . DL1 C 2 .   ? -21.557 8.835   9.028   1.00 30.15  ? 601 DL1 A CAF 1 
HETATM 4723 C CAX . DL1 C 2 .   ? -20.654 9.613   8.309   1.00 33.27  ? 601 DL1 A CAX 1 
HETATM 4724 C CAZ . DL1 C 2 .   ? -19.430 9.155   8.007   1.00 38.95  ? 601 DL1 A CAZ 1 
HETATM 4725 N NAR . DL1 C 2 .   ? -18.946 7.958   8.330   1.00 38.96  ? 601 DL1 A NAR 1 
HETATM 4726 N NAO . DL1 C 2 .   ? -17.761 7.885   7.895   1.00 41.58  ? 601 DL1 A NAO 1 
HETATM 4727 C CAD . DL1 C 2 .   ? -17.438 9.031   7.285   1.00 40.21  ? 601 DL1 A CAD 1 
HETATM 4728 C CAG . DL1 C 2 .   ? -18.495 9.841   7.356   1.00 40.78  ? 601 DL1 A CAG 1 
HETATM 4729 C CAM . DL1 D 2 .   ? -40.811 13.997  32.156  1.00 46.24  ? 601 DL1 B CAM 1 
HETATM 4730 C CAK . DL1 D 2 .   ? -41.303 15.384  32.547  1.00 52.91  ? 601 DL1 B CAK 1 
HETATM 4731 O OAS . DL1 D 2 .   ? -40.182 16.262  32.741  1.00 54.42  ? 601 DL1 B OAS 1 
HETATM 4732 C CAL . DL1 D 2 .   ? -39.564 16.504  31.459  1.00 53.21  ? 601 DL1 B CAL 1 
HETATM 4733 C CAN . DL1 D 2 .   ? -38.908 15.224  30.953  1.00 46.44  ? 601 DL1 B CAN 1 
HETATM 4734 N NBB . DL1 D 2 .   ? -39.818 14.059  31.064  1.00 40.08  ? 601 DL1 B NBB 1 
HETATM 4735 C CAV . DL1 D 2 .   ? -39.694 13.020  30.222  1.00 37.06  ? 601 DL1 B CAV 1 
HETATM 4736 C CAJ . DL1 D 2 .   ? -40.772 12.168  29.995  1.00 33.69  ? 601 DL1 B CAJ 1 
HETATM 4737 C CBA . DL1 D 2 .   ? -40.622 11.093  29.127  1.00 33.21  ? 601 DL1 B CBA 1 
HETATM 4738 O OAT . DL1 D 2 .   ? -41.637 10.220  28.855  1.00 34.68  ? 601 DL1 B OAT 1 
HETATM 4739 C CAA . DL1 D 2 .   ? -42.890 10.601  29.432  1.00 33.08  ? 601 DL1 B CAA 1 
HETATM 4740 C CAH . DL1 D 2 .   ? -38.477 12.783  29.588  1.00 30.71  ? 601 DL1 B CAH 1 
HETATM 4741 C CAI . DL1 D 2 .   ? -38.331 11.702  28.722  1.00 31.27  ? 601 DL1 B CAI 1 
HETATM 4742 C CAY . DL1 D 2 .   ? -39.403 10.844  28.491  1.00 33.32  ? 601 DL1 B CAY 1 
HETATM 4743 N NAQ . DL1 D 2 .   ? -39.396 9.781   27.667  1.00 34.24  ? 601 DL1 B NAQ 1 
HETATM 4744 C CAU . DL1 D 2 .   ? -38.321 9.338   26.959  1.00 36.86  ? 601 DL1 B CAU 1 
HETATM 4745 O OAB . DL1 D 2 .   ? -37.180 9.809   26.947  1.00 34.77  ? 601 DL1 B OAB 1 
HETATM 4746 C CAW . DL1 D 2 .   ? -38.643 8.250   26.151  1.00 32.95  ? 601 DL1 B CAW 1 
HETATM 4747 N NAP . DL1 D 2 .   ? -39.879 7.740   26.248  1.00 29.85  ? 601 DL1 B NAP 1 
HETATM 4748 C CAE . DL1 D 2 .   ? -37.735 7.714   25.243  1.00 31.27  ? 601 DL1 B CAE 1 
HETATM 4749 C CAC . DL1 D 2 .   ? -38.130 6.639   24.452  1.00 33.03  ? 601 DL1 B CAC 1 
HETATM 4750 C CAF . DL1 D 2 .   ? -39.417 6.129   24.584  1.00 33.75  ? 601 DL1 B CAF 1 
HETATM 4751 C CAX . DL1 D 2 .   ? -40.287 6.704   25.505  1.00 34.20  ? 601 DL1 B CAX 1 
HETATM 4752 C CAZ . DL1 D 2 .   ? -41.535 6.246   25.653  1.00 39.21  ? 601 DL1 B CAZ 1 
HETATM 4753 N NAR . DL1 D 2 .   ? -42.064 5.203   25.022  1.00 38.22  ? 601 DL1 B NAR 1 
HETATM 4754 N NAO . DL1 D 2 .   ? -43.233 5.079   25.397  1.00 39.30  ? 601 DL1 B NAO 1 
HETATM 4755 C CAD . DL1 D 2 .   ? -43.534 6.030   26.286  1.00 40.33  ? 601 DL1 B CAD 1 
HETATM 4756 C CAG . DL1 D 2 .   ? -42.450 6.782   26.452  1.00 40.91  ? 601 DL1 B CAG 1 
HETATM 4757 O O   . HOH E 3 .   ? -17.793 18.055  7.371   1.00 45.58  ? 701 HOH A O   1 
HETATM 4758 O O   . HOH E 3 .   ? -31.737 8.227   13.755  1.00 39.54  ? 702 HOH A O   1 
HETATM 4759 O O   . HOH E 3 .   ? 6.033   10.243  4.538   1.00 75.17  ? 703 HOH A O   1 
HETATM 4760 O O   . HOH E 3 .   ? -27.346 8.249   17.825  1.00 40.32  ? 704 HOH A O   1 
HETATM 4761 O O   . HOH E 3 .   ? -27.631 10.111  13.733  1.00 46.11  ? 705 HOH A O   1 
HETATM 4762 O O   . HOH E 3 .   ? 4.126   1.810   22.352  1.00 59.12  ? 706 HOH A O   1 
HETATM 4763 O O   . HOH E 3 .   ? -6.995  15.880  8.290   1.00 48.98  ? 707 HOH A O   1 
HETATM 4764 O O   . HOH E 3 .   ? -15.946 16.864  4.343   1.00 52.77  ? 708 HOH A O   1 
HETATM 4765 O O   . HOH E 3 .   ? 4.559   11.176  21.662  1.00 56.59  ? 709 HOH A O   1 
HETATM 4766 O O   . HOH E 3 .   ? -29.653 18.739  5.191   1.00 56.62  ? 710 HOH A O   1 
HETATM 4767 O O   . HOH E 3 .   ? -7.595  1.459   27.705  1.00 46.55  ? 711 HOH A O   1 
HETATM 4768 O O   . HOH E 3 .   ? -31.921 4.680   15.733  1.00 47.93  ? 712 HOH A O   1 
HETATM 4769 O O   . HOH E 3 .   ? -0.511  6.595   31.194  1.00 55.65  ? 713 HOH A O   1 
HETATM 4770 O O   . HOH E 3 .   ? -9.799  25.287  14.954  1.00 42.54  ? 714 HOH A O   1 
HETATM 4771 O O   . HOH E 3 .   ? -5.431  28.768  22.634  1.00 36.40  ? 715 HOH A O   1 
HETATM 4772 O O   . HOH E 3 .   ? -15.146 2.951   6.679   1.00 61.61  ? 716 HOH A O   1 
HETATM 4773 O O   . HOH E 3 .   ? -39.303 1.829   4.372   1.00 50.71  ? 717 HOH A O   1 
HETATM 4774 O O   . HOH E 3 .   ? -12.875 24.935  15.277  1.00 40.68  ? 718 HOH A O   1 
HETATM 4775 O O   . HOH E 3 .   ? -14.048 14.901  6.989   1.00 42.77  ? 719 HOH A O   1 
HETATM 4776 O O   . HOH E 3 .   ? -34.152 -6.110  5.393   1.00 52.17  ? 720 HOH A O   1 
HETATM 4777 O O   . HOH E 3 .   ? -22.375 10.765  32.994  1.00 52.42  ? 721 HOH A O   1 
HETATM 4778 O O   . HOH E 3 .   ? -0.186  11.855  14.570  1.00 43.21  ? 722 HOH A O   1 
HETATM 4779 O O   . HOH E 3 .   ? 6.990   13.189  13.735  1.00 57.52  ? 723 HOH A O   1 
HETATM 4780 O O   . HOH E 3 .   ? -31.843 13.075  8.889   1.00 42.15  ? 724 HOH A O   1 
HETATM 4781 O O   . HOH E 3 .   ? -6.084  15.154  11.252  1.00 37.05  ? 725 HOH A O   1 
HETATM 4782 O O   . HOH E 3 .   ? -17.975 19.014  35.963  1.00 60.41  ? 726 HOH A O   1 
HETATM 4783 O O   . HOH E 3 .   ? -4.731  10.887  37.704  1.00 67.71  ? 727 HOH A O   1 
HETATM 4784 O O   . HOH E 3 .   ? -33.878 2.302   7.094   1.00 31.58  ? 728 HOH A O   1 
HETATM 4785 O O   . HOH E 3 .   ? -13.554 0.263   12.925  1.00 34.78  ? 729 HOH A O   1 
HETATM 4786 O O   . HOH E 3 .   ? -34.761 7.398   -3.867  1.00 45.40  ? 730 HOH A O   1 
HETATM 4787 O O   . HOH E 3 .   ? -26.126 9.158   12.142  1.00 31.99  ? 731 HOH A O   1 
HETATM 4788 O O   . HOH E 3 .   ? -34.975 10.083  -3.943  1.00 55.09  ? 732 HOH A O   1 
HETATM 4789 O O   . HOH E 3 .   ? -2.009  21.345  10.697  1.00 48.57  ? 733 HOH A O   1 
HETATM 4790 O O   . HOH E 3 .   ? -19.532 5.608   9.683   1.00 38.42  ? 734 HOH A O   1 
HETATM 4791 O O   . HOH E 3 .   ? -26.206 4.534   17.500  1.00 27.15  ? 735 HOH A O   1 
HETATM 4792 O O   . HOH E 3 .   ? -1.205  24.999  17.068  1.00 45.44  ? 736 HOH A O   1 
HETATM 4793 O O   . HOH E 3 .   ? -8.330  4.254   8.659   1.00 50.83  ? 737 HOH A O   1 
HETATM 4794 O O   . HOH E 3 .   ? -8.532  3.200   17.100  1.00 39.65  ? 738 HOH A O   1 
HETATM 4795 O O   . HOH E 3 .   ? -13.543 9.073   7.857   1.00 46.49  ? 739 HOH A O   1 
HETATM 4796 O O   . HOH E 3 .   ? -38.065 10.966  -1.131  1.00 41.10  ? 740 HOH A O   1 
HETATM 4797 O O   . HOH E 3 .   ? -10.387 1.184   27.920  1.00 41.48  ? 741 HOH A O   1 
HETATM 4798 O O   . HOH E 3 .   ? -22.747 24.929  21.642  1.00 47.93  ? 742 HOH A O   1 
HETATM 4799 O O   . HOH E 3 .   ? -29.287 3.958   17.139  1.00 41.28  ? 743 HOH A O   1 
HETATM 4800 O O   . HOH E 3 .   ? -36.841 15.326  4.610   1.00 47.22  ? 744 HOH A O   1 
HETATM 4801 O O   . HOH E 3 .   ? -22.324 15.114  27.127  1.00 40.59  ? 745 HOH A O   1 
HETATM 4802 O O   . HOH E 3 .   ? -37.013 6.990   -1.901  1.00 41.98  ? 746 HOH A O   1 
HETATM 4803 O O   . HOH E 3 .   ? -18.612 27.297  16.759  1.00 51.34  ? 747 HOH A O   1 
HETATM 4804 O O   . HOH E 3 .   ? -1.247  8.503   8.897   1.00 62.17  ? 748 HOH A O   1 
HETATM 4805 O O   . HOH E 3 .   ? -25.083 20.525  6.308   1.00 43.28  ? 749 HOH A O   1 
HETATM 4806 O O   . HOH E 3 .   ? -25.653 2.392   15.552  1.00 32.50  ? 750 HOH A O   1 
HETATM 4807 O O   . HOH E 3 .   ? -12.662 1.470   30.258  1.00 50.80  ? 751 HOH A O   1 
HETATM 4808 O O   . HOH E 3 .   ? -11.221 32.401  24.210  1.00 41.70  ? 752 HOH A O   1 
HETATM 4809 O O   . HOH E 3 .   ? -30.457 -8.423  5.792   1.00 64.78  ? 753 HOH A O   1 
HETATM 4810 O O   . HOH E 3 .   ? -7.426  4.462   11.784  1.00 52.93  ? 754 HOH A O   1 
HETATM 4811 O O   . HOH E 3 .   ? -35.815 -3.723  3.300   1.00 49.28  ? 755 HOH A O   1 
HETATM 4812 O O   . HOH E 3 .   ? -5.550  12.714  33.724  1.00 55.56  ? 756 HOH A O   1 
HETATM 4813 O O   . HOH E 3 .   ? -15.630 25.201  8.428   1.00 73.51  ? 757 HOH A O   1 
HETATM 4814 O O   . HOH E 3 .   ? -28.876 13.364  17.370  1.00 48.06  ? 758 HOH A O   1 
HETATM 4815 O O   . HOH E 3 .   ? -0.416  27.552  23.047  1.00 42.31  ? 759 HOH A O   1 
HETATM 4816 O O   . HOH E 3 .   ? -8.972  12.428  10.658  1.00 39.34  ? 760 HOH A O   1 
HETATM 4817 O O   . HOH E 3 .   ? -31.176 0.072   9.728   1.00 32.78  ? 761 HOH A O   1 
HETATM 4818 O O   . HOH E 3 .   ? -22.985 13.736  24.179  1.00 28.59  ? 762 HOH A O   1 
HETATM 4819 O O   . HOH E 3 .   ? -7.251  4.727   14.815  1.00 39.77  ? 763 HOH A O   1 
HETATM 4820 O O   . HOH E 3 .   ? -31.944 -1.750  -7.203  1.00 50.54  ? 764 HOH A O   1 
HETATM 4821 O O   . HOH E 3 .   ? -26.635 -8.994  23.456  1.00 45.53  ? 765 HOH A O   1 
HETATM 4822 O O   . HOH E 3 .   ? -16.640 12.195  36.899  1.00 50.57  ? 766 HOH A O   1 
HETATM 4823 O O   . HOH E 3 .   ? -10.095 29.963  35.057  1.00 77.62  ? 767 HOH A O   1 
HETATM 4824 O O   . HOH E 3 .   ? -3.197  25.663  14.973  1.00 47.12  ? 768 HOH A O   1 
HETATM 4825 O O   . HOH E 3 .   ? -6.031  23.379  10.960  1.00 53.14  ? 769 HOH A O   1 
HETATM 4826 O O   . HOH E 3 .   ? -28.927 -4.427  -1.859  1.00 51.98  ? 770 HOH A O   1 
HETATM 4827 O O   . HOH E 3 .   ? -13.582 29.388  23.284  1.00 30.32  ? 771 HOH A O   1 
HETATM 4828 O O   . HOH E 3 .   ? 8.035   27.008  30.108  1.00 69.25  ? 772 HOH A O   1 
HETATM 4829 O O   . HOH E 3 .   ? -4.121  29.420  25.409  1.00 44.38  ? 773 HOH A O   1 
HETATM 4830 O O   . HOH E 3 .   ? -14.736 1.770   8.648   1.00 48.91  ? 774 HOH A O   1 
HETATM 4831 O O   . HOH E 3 .   ? -31.675 -2.986  17.678  1.00 34.33  ? 775 HOH A O   1 
HETATM 4832 O O   . HOH E 3 .   ? -35.100 14.069  7.392   1.00 37.09  ? 776 HOH A O   1 
HETATM 4833 O O   . HOH E 3 .   ? -13.569 3.779   36.354  1.00 59.41  ? 777 HOH A O   1 
HETATM 4834 O O   . HOH E 3 .   ? -6.420  14.895  33.507  1.00 49.06  ? 778 HOH A O   1 
HETATM 4835 O O   . HOH E 3 .   ? -8.296  -5.768  25.069  1.00 46.55  ? 779 HOH A O   1 
HETATM 4836 O O   . HOH E 3 .   ? -16.397 32.636  11.148  1.00 58.45  ? 780 HOH A O   1 
HETATM 4837 O O   . HOH E 3 .   ? -16.811 22.824  8.553   1.00 47.75  ? 781 HOH A O   1 
HETATM 4838 O O   . HOH E 3 .   ? -2.530  30.303  26.788  1.00 46.77  ? 782 HOH A O   1 
HETATM 4839 O O   . HOH E 3 .   ? -15.446 31.295  22.301  1.00 42.54  ? 783 HOH A O   1 
HETATM 4840 O O   . HOH F 3 .   ? -65.331 12.504  13.995  1.00 68.65  ? 701 HOH B O   1 
HETATM 4841 O O   . HOH F 3 .   ? -21.669 -1.849  26.114  1.00 41.44  ? 702 HOH B O   1 
HETATM 4842 O O   . HOH F 3 .   ? -49.995 -7.351  22.396  1.00 50.33  ? 703 HOH B O   1 
HETATM 4843 O O   . HOH F 3 .   ? -24.085 0.021   33.893  1.00 43.44  ? 704 HOH B O   1 
HETATM 4844 O O   . HOH F 3 .   ? -39.902 -4.179  1.396   1.00 51.15  ? 705 HOH B O   1 
HETATM 4845 O O   . HOH F 3 .   ? -30.340 -2.568  14.306  1.00 45.78  ? 706 HOH B O   1 
HETATM 4846 O O   . HOH F 3 .   ? -26.722 2.132   24.267  1.00 30.69  ? 707 HOH B O   1 
HETATM 4847 O O   . HOH F 3 .   ? -40.020 20.194  15.907  1.00 48.50  ? 708 HOH B O   1 
HETATM 4848 O O   . HOH F 3 .   ? -37.892 -2.331  2.174   1.00 55.56  ? 709 HOH B O   1 
HETATM 4849 O O   . HOH F 3 .   ? -48.385 -7.433  19.750  1.00 45.59  ? 710 HOH B O   1 
HETATM 4850 O O   . HOH F 3 .   ? -41.447 1.621   40.345  1.00 50.21  ? 711 HOH B O   1 
HETATM 4851 O O   . HOH F 3 .   ? -42.833 15.021  29.640  1.00 49.22  ? 712 HOH B O   1 
HETATM 4852 O O   . HOH F 3 .   ? -42.707 -6.395  36.663  1.00 62.22  ? 713 HOH B O   1 
HETATM 4853 O O   . HOH F 3 .   ? -39.040 10.865  37.930  1.00 47.36  ? 714 HOH B O   1 
HETATM 4854 O O   . HOH F 3 .   ? -46.736 11.548  28.644  1.00 48.90  ? 715 HOH B O   1 
HETATM 4855 O O   . HOH F 3 .   ? -42.555 -6.239  33.708  1.00 48.08  ? 716 HOH B O   1 
HETATM 4856 O O   . HOH F 3 .   ? -31.230 -9.502  29.412  1.00 55.40  ? 717 HOH B O   1 
HETATM 4857 O O   . HOH F 3 .   ? -46.901 7.777   38.218  1.00 58.05  ? 718 HOH B O   1 
HETATM 4858 O O   . HOH F 3 .   ? -47.172 6.050   25.257  1.00 32.83  ? 719 HOH B O   1 
HETATM 4859 O O   . HOH F 3 .   ? -53.800 2.790   20.386  1.00 43.90  ? 720 HOH B O   1 
HETATM 4860 O O   . HOH F 3 .   ? -67.500 11.818  22.080  1.00 63.33  ? 721 HOH B O   1 
HETATM 4861 O O   . HOH F 3 .   ? -34.376 4.926   7.920   1.00 26.80  ? 722 HOH B O   1 
HETATM 4862 O O   . HOH F 3 .   ? -33.539 8.733   15.836  1.00 34.58  ? 723 HOH B O   1 
HETATM 4863 O O   . HOH F 3 .   ? -21.743 -0.262  35.136  1.00 61.68  ? 724 HOH B O   1 
HETATM 4864 O O   . HOH F 3 .   ? -41.455 3.557   22.997  1.00 30.22  ? 725 HOH B O   1 
HETATM 4865 O O   . HOH F 3 .   ? -47.310 -0.366  18.000  1.00 34.59  ? 726 HOH B O   1 
HETATM 4866 O O   . HOH F 3 .   ? -45.308 11.796  31.532  1.00 44.28  ? 727 HOH B O   1 
HETATM 4867 O O   . HOH F 3 .   ? -28.780 9.926   26.327  1.00 37.07  ? 728 HOH B O   1 
HETATM 4868 O O   . HOH F 3 .   ? -43.775 -3.390  23.997  1.00 38.23  ? 729 HOH B O   1 
HETATM 4869 O O   . HOH F 3 .   ? -52.455 2.070   23.447  1.00 46.74  ? 730 HOH B O   1 
HETATM 4870 O O   . HOH F 3 .   ? -55.708 -1.599  11.964  1.00 64.09  ? 731 HOH B O   1 
HETATM 4871 O O   . HOH F 3 .   ? -31.442 -11.598 14.164  1.00 55.88  ? 732 HOH B O   1 
HETATM 4872 O O   . HOH F 3 .   ? -38.744 15.809  2.585   1.00 52.60  ? 733 HOH B O   1 
HETATM 4873 O O   . HOH F 3 .   ? -41.771 3.255   -2.034  1.00 64.19  ? 734 HOH B O   1 
HETATM 4874 O O   . HOH F 3 .   ? -26.253 0.329   36.008  1.00 41.43  ? 735 HOH B O   1 
HETATM 4875 O O   . HOH F 3 .   ? -30.192 -10.743 21.527  1.00 42.77  ? 736 HOH B O   1 
HETATM 4876 O O   . HOH F 3 .   ? -34.690 7.632   21.673  1.00 25.76  ? 737 HOH B O   1 
HETATM 4877 O O   . HOH F 3 .   ? -35.267 2.474   16.031  1.00 28.12  ? 738 HOH B O   1 
HETATM 4878 O O   . HOH F 3 .   ? -39.577 23.440  15.845  1.00 57.52  ? 739 HOH B O   1 
HETATM 4879 O O   . HOH F 3 .   ? -33.838 1.101   9.360   1.00 29.95  ? 740 HOH B O   1 
HETATM 4880 O O   . HOH F 3 .   ? -31.687 8.848   36.863  1.00 46.85  ? 741 HOH B O   1 
HETATM 4881 O O   . HOH F 3 .   ? -46.517 -0.367  22.258  1.00 42.79  ? 742 HOH B O   1 
HETATM 4882 O O   . HOH F 3 .   ? -32.167 13.554  22.886  1.00 51.82  ? 743 HOH B O   1 
HETATM 4883 O O   . HOH F 3 .   ? -27.140 -0.730  23.749  1.00 44.43  ? 744 HOH B O   1 
HETATM 4884 O O   . HOH F 3 .   ? -45.395 8.881   27.545  1.00 40.60  ? 745 HOH B O   1 
HETATM 4885 O O   . HOH F 3 .   ? -18.655 7.498   36.345  1.00 58.44  ? 746 HOH B O   1 
HETATM 4886 O O   . HOH F 3 .   ? -28.718 2.175   42.509  1.00 49.85  ? 747 HOH B O   1 
HETATM 4887 O O   . HOH F 3 .   ? -29.123 -3.714  19.305  1.00 45.04  ? 748 HOH B O   1 
HETATM 4888 O O   . HOH F 3 .   ? -34.615 5.081   15.187  1.00 27.58  ? 749 HOH B O   1 
HETATM 4889 O O   . HOH F 3 .   ? -33.402 -11.086 28.741  1.00 39.99  ? 750 HOH B O   1 
HETATM 4890 O O   . HOH F 3 .   ? -38.052 16.001  12.070  1.00 32.58  ? 751 HOH B O   1 
HETATM 4891 O O   . HOH F 3 .   ? -53.519 4.358   18.003  1.00 41.54  ? 752 HOH B O   1 
HETATM 4892 O O   . HOH F 3 .   ? -44.986 -7.525  13.709  1.00 45.53  ? 753 HOH B O   1 
HETATM 4893 O O   . HOH F 3 .   ? -28.298 -10.458 30.173  1.00 55.82  ? 754 HOH B O   1 
HETATM 4894 O O   . HOH F 3 .   ? -36.202 20.020  14.827  1.00 52.73  ? 755 HOH B O   1 
HETATM 4895 O O   . HOH F 3 .   ? -54.704 -3.350  24.031  1.00 61.75  ? 756 HOH B O   1 
HETATM 4896 O O   . HOH F 3 .   ? -30.059 -1.812  20.683  1.00 40.61  ? 757 HOH B O   1 
HETATM 4897 O O   . HOH F 3 .   ? -52.175 3.910   15.232  1.00 41.26  ? 758 HOH B O   1 
HETATM 4898 O O   . HOH F 3 .   ? -23.070 4.188   34.912  1.00 36.60  ? 759 HOH B O   1 
HETATM 4899 O O   . HOH F 3 .   ? -59.339 5.673   25.058  1.00 54.97  ? 760 HOH B O   1 
HETATM 4900 O O   . HOH F 3 .   ? -47.161 9.803   31.919  1.00 47.31  ? 761 HOH B O   1 
HETATM 4901 O O   . HOH F 3 .   ? -31.639 -2.414  10.686  1.00 36.43  ? 762 HOH B O   1 
HETATM 4902 O O   . HOH F 3 .   ? -48.844 1.929   24.626  1.00 52.71  ? 763 HOH B O   1 
HETATM 4903 O O   . HOH F 3 .   ? -28.787 -9.917  35.860  1.00 49.28  ? 764 HOH B O   1 
HETATM 4904 O O   . HOH F 3 .   ? -39.315 -6.925  10.812  1.00 45.68  ? 765 HOH B O   1 
HETATM 4905 O O   . HOH F 3 .   ? -29.051 10.459  37.751  1.00 55.20  ? 766 HOH B O   1 
HETATM 4906 O O   . HOH F 3 .   ? -27.171 12.070  35.171  1.00 51.70  ? 767 HOH B O   1 
HETATM 4907 O O   . HOH F 3 .   ? -46.316 -8.711  11.636  1.00 44.86  ? 768 HOH B O   1 
HETATM 4908 O O   . HOH F 3 .   ? -25.739 10.232  27.811  1.00 27.25  ? 769 HOH B O   1 
HETATM 4909 O O   . HOH F 3 .   ? -30.057 12.728  26.558  1.00 44.18  ? 770 HOH B O   1 
HETATM 4910 O O   . HOH F 3 .   ? -24.087 11.095  30.878  1.00 45.09  ? 771 HOH B O   1 
HETATM 4911 O O   . HOH F 3 .   ? -46.957 31.132  17.062  1.00 62.55  ? 772 HOH B O   1 
HETATM 4912 O O   . HOH F 3 .   ? -20.619 2.770   34.624  1.00 45.47  ? 773 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . SER A 5   ? 1.1354 1.1104 1.1012 -0.0223 -0.0017 -0.2440 193 SER A N   
2    C CA  . SER A 5   ? 1.1204 1.1067 1.0862 -0.0181 -0.0091 -0.2221 193 SER A CA  
3    C C   . SER A 5   ? 1.0646 1.0405 1.0457 -0.0170 -0.0162 -0.2104 193 SER A C   
4    O O   . SER A 5   ? 1.0708 1.0340 1.0580 -0.0231 -0.0177 -0.2180 193 SER A O   
5    C CB  . SER A 5   ? 1.1630 1.1697 1.1064 -0.0268 -0.0148 -0.2171 193 SER A CB  
6    O OG  . SER A 5   ? 1.1636 1.1804 1.1084 -0.0218 -0.0209 -0.1970 193 SER A OG  
7    N N   . ARG A 6   ? 1.0867 1.0680 1.0733 -0.0101 -0.0201 -0.1921 194 ARG A N   
8    C CA  . ARG A 6   ? 0.9971 0.9703 0.9974 -0.0086 -0.0256 -0.1796 194 ARG A CA  
9    C C   . ARG A 6   ? 0.8823 0.8717 0.8764 -0.0092 -0.0323 -0.1629 194 ARG A C   
10   O O   . ARG A 6   ? 0.8412 0.8461 0.8217 -0.0099 -0.0329 -0.1607 194 ARG A O   
11   C CB  . ARG A 6   ? 1.0129 0.9719 1.0311 0.0025  -0.0220 -0.1751 194 ARG A CB  
12   C CG  . ARG A 6   ? 1.0418 0.9825 1.0714 0.0041  -0.0160 -0.1908 194 ARG A CG  
13   C CD  . ARG A 6   ? 1.0394 0.9703 1.0867 0.0165  -0.0124 -0.1864 194 ARG A CD  
14   N NE  . ARG A 6   ? 1.0580 0.9689 1.1209 0.0185  -0.0079 -0.1995 194 ARG A NE  
15   C CZ  . ARG A 6   ? 1.0285 0.9329 1.1057 0.0284  -0.0017 -0.2051 194 ARG A CZ  
16   N NH1 . ARG A 6   ? 1.0159 0.9010 1.1091 0.0304  0.0023  -0.2173 194 ARG A NH1 
17   N NH2 . ARG A 6   ? 0.9997 0.9169 1.0766 0.0362  0.0006  -0.1987 194 ARG A NH2 
18   N N   . PRO A 7   ? 0.9216 0.9077 0.9259 -0.0092 -0.0370 -0.1510 195 PRO A N   
19   C CA  . PRO A 7   ? 0.8438 0.8450 0.8447 -0.0079 -0.0417 -0.1358 195 PRO A CA  
20   C C   . PRO A 7   ? 0.7338 0.7413 0.7316 0.0017  -0.0389 -0.1283 195 PRO A C   
21   O O   . PRO A 7   ? 0.6551 0.6772 0.6440 0.0019  -0.0413 -0.1216 195 PRO A O   
22   C CB  . PRO A 7   ? 0.8563 0.8496 0.8706 -0.0083 -0.0445 -0.1260 195 PRO A CB  
23   C CG  . PRO A 7   ? 0.8944 0.8665 0.9194 -0.0084 -0.0416 -0.1343 195 PRO A CG  
24   C CD  . PRO A 7   ? 0.9213 0.8912 0.9388 -0.0126 -0.0385 -0.1518 195 PRO A CD  
25   N N   . PHE A 8   ? 0.7314 0.7276 0.7377 0.0095  -0.0343 -0.1290 196 PHE A N   
26   C CA  . PHE A 8   ? 0.6675 0.6690 0.6711 0.0176  -0.0311 -0.1248 196 PHE A CA  
27   C C   . PHE A 8   ? 0.6066 0.5973 0.6182 0.0229  -0.0249 -0.1344 196 PHE A C   
28   O O   . PHE A 8   ? 0.6007 0.5766 0.6244 0.0234  -0.0243 -0.1386 196 PHE A O   
29   C CB  . PHE A 8   ? 0.6845 0.6877 0.6931 0.0231  -0.0335 -0.1094 196 PHE A CB  
30   C CG  . PHE A 8   ? 0.7245 0.7139 0.7468 0.0254  -0.0343 -0.1046 196 PHE A CG  
31   C CD1 . PHE A 8   ? 0.7449 0.7262 0.7759 0.0329  -0.0320 -0.1026 196 PHE A CD1 
32   C CD2 . PHE A 8   ? 0.7610 0.7465 0.7877 0.0194  -0.0379 -0.1011 196 PHE A CD2 
33   C CE1 . PHE A 8   ? 0.7591 0.7277 0.8019 0.0347  -0.0338 -0.0965 196 PHE A CE1 
34   C CE2 . PHE A 8   ? 0.7868 0.7591 0.8248 0.0206  -0.0389 -0.0953 196 PHE A CE2 
35   C CZ  . PHE A 8   ? 0.7833 0.7468 0.8288 0.0283  -0.0372 -0.0926 196 PHE A CZ  
36   N N   . PRO A 9   ? 0.6342 0.6321 0.6404 0.0268  -0.0203 -0.1377 197 PRO A N   
37   C CA  . PRO A 9   ? 0.6057 0.6189 0.5987 0.0270  -0.0204 -0.1320 197 PRO A CA  
38   C C   . PRO A 9   ? 0.5505 0.5750 0.5270 0.0182  -0.0230 -0.1354 197 PRO A C   
39   O O   . PRO A 9   ? 0.5968 0.6196 0.5683 0.0119  -0.0213 -0.1480 197 PRO A O   
40   C CB  . PRO A 9   ? 0.6276 0.6421 0.6224 0.0320  -0.0132 -0.1388 197 PRO A CB  
41   C CG  . PRO A 9   ? 0.6612 0.6615 0.6740 0.0373  -0.0104 -0.1441 197 PRO A CG  
42   C CD  . PRO A 9   ? 0.6770 0.6669 0.6930 0.0318  -0.0135 -0.1485 197 PRO A CD  
43   N N   . PHE A 10  ? 0.5220 0.5580 0.4906 0.0179  -0.0272 -0.1242 198 PHE A N   
44   C CA  . PHE A 10  ? 0.4854 0.5340 0.4390 0.0105  -0.0311 -0.1239 198 PHE A CA  
45   C C   . PHE A 10  ? 0.5047 0.5588 0.4448 0.0066  -0.0261 -0.1345 198 PHE A C   
46   O O   . PHE A 10  ? 0.4987 0.5543 0.4377 0.0111  -0.0207 -0.1346 198 PHE A O   
47   C CB  . PHE A 10  ? 0.4291 0.4873 0.3801 0.0134  -0.0357 -0.1088 198 PHE A CB  
48   C CG  . PHE A 10  ? 0.4601 0.5314 0.3998 0.0067  -0.0421 -0.1050 198 PHE A CG  
49   C CD1 . PHE A 10  ? 0.5076 0.5880 0.4315 0.0025  -0.0417 -0.1071 198 PHE A CD1 
50   C CD2 . PHE A 10  ? 0.4284 0.5041 0.3738 0.0043  -0.0488 -0.0984 198 PHE A CD2 
51   C CE1 . PHE A 10  ? 0.5218 0.6148 0.4354 -0.0038 -0.0489 -0.1019 198 PHE A CE1 
52   C CE2 . PHE A 10  ? 0.4584 0.5477 0.3958 -0.0014 -0.0557 -0.0939 198 PHE A CE2 
53   C CZ  . PHE A 10  ? 0.4620 0.5596 0.3833 -0.0053 -0.0563 -0.0952 198 PHE A CZ  
54   N N   . CYS A 11  ? 0.5354 0.5936 0.4646 -0.0027 -0.0279 -0.1436 199 CYS A N   
55   C CA  . CYS A 11  ? 0.5349 0.5990 0.4486 -0.0084 -0.0227 -0.1553 199 CYS A CA  
56   C C   . CYS A 11  ? 0.5148 0.5950 0.4095 -0.0156 -0.0286 -0.1483 199 CYS A C   
57   O O   . CYS A 11  ? 0.5491 0.6351 0.4421 -0.0199 -0.0374 -0.1413 199 CYS A O   
58   C CB  . CYS A 11  ? 0.5884 0.6445 0.5017 -0.0149 -0.0195 -0.1731 199 CYS A CB  
59   S SG  . CYS A 11  ? 0.6879 0.7512 0.5806 -0.0232 -0.0114 -0.1909 199 CYS A SG  
60   N N   . TRP A 12  ? 0.5810 0.6689 0.4621 -0.0172 -0.0238 -0.1499 200 TRP A N   
61   C CA  . TRP A 12  ? 0.5691 0.6718 0.4309 -0.0245 -0.0296 -0.1422 200 TRP A CA  
62   C C   . TRP A 12  ? 0.6415 0.7504 0.4832 -0.0354 -0.0254 -0.1568 200 TRP A C   
63   O O   . TRP A 12  ? 0.7130 0.8167 0.5553 -0.0347 -0.0149 -0.1711 200 TRP A O   
64   C CB  . TRP A 12  ? 0.5168 0.6243 0.3759 -0.0192 -0.0281 -0.1295 200 TRP A CB  
65   C CG  . TRP A 12  ? 0.4808 0.5844 0.3551 -0.0098 -0.0323 -0.1142 200 TRP A CG  
66   C CD1 . TRP A 12  ? 0.4760 0.5693 0.3673 -0.0003 -0.0279 -0.1131 200 TRP A CD1 
67   C CD2 . TRP A 12  ? 0.4848 0.5950 0.3581 -0.0090 -0.0415 -0.0982 200 TRP A CD2 
68   N NE1 . TRP A 12  ? 0.4124 0.5054 0.3116 0.0055  -0.0333 -0.0985 200 TRP A NE1 
69   C CE2 . TRP A 12  ? 0.4414 0.5443 0.3311 0.0009  -0.0411 -0.0896 200 TRP A CE2 
70   C CE3 . TRP A 12  ? 0.5419 0.6639 0.4030 -0.0157 -0.0503 -0.0903 200 TRP A CE3 
71   C CZ2 . TRP A 12  ? 0.4371 0.5432 0.3317 0.0047  -0.0479 -0.0749 200 TRP A CZ2 
72   C CZ3 . TRP A 12  ? 0.5237 0.6492 0.3919 -0.0112 -0.0578 -0.0743 200 TRP A CZ3 
73   C CH2 . TRP A 12  ? 0.4978 0.6149 0.3829 -0.0009 -0.0560 -0.0676 200 TRP A CH2 
74   N N   . PRO A 13  ? 0.6344 0.7554 0.4584 -0.0456 -0.0336 -0.1533 201 PRO A N   
75   C CA  . PRO A 13  ? 0.6396 0.7688 0.4399 -0.0574 -0.0298 -0.1659 201 PRO A CA  
76   C C   . PRO A 13  ? 0.6229 0.7601 0.4097 -0.0577 -0.0238 -0.1611 201 PRO A C   
77   O O   . PRO A 13  ? 0.5963 0.7370 0.3859 -0.0525 -0.0282 -0.1436 201 PRO A O   
78   C CB  . PRO A 13  ? 0.6607 0.8016 0.4478 -0.0680 -0.0429 -0.1598 201 PRO A CB  
79   C CG  . PRO A 13  ? 0.5930 0.7358 0.3943 -0.0602 -0.0526 -0.1391 201 PRO A CG  
80   C CD  . PRO A 13  ? 0.5845 0.7125 0.4107 -0.0475 -0.0468 -0.1392 201 PRO A CD  
81   N N   . LEU A 14  ? 0.6375 0.7774 0.4102 -0.0640 -0.0134 -0.1770 202 LEU A N   
82   C CA  . LEU A 14  ? 0.6256 0.7729 0.3867 -0.0653 -0.0061 -0.1726 202 LEU A CA  
83   C C   . LEU A 14  ? 0.6736 0.8332 0.4155 -0.0728 -0.0161 -0.1546 202 LEU A C   
84   O O   . LEU A 14  ? 0.6826 0.8476 0.4204 -0.0707 -0.0154 -0.1426 202 LEU A O   
85   C CB  . LEU A 14  ? 0.6423 0.7868 0.3979 -0.0699 0.0072  -0.1889 202 LEU A CB  
86   C CG  . LEU A 14  ? 0.6475 0.8010 0.3901 -0.0735 0.0156  -0.1854 202 LEU A CG  
87   C CD1 . LEU A 14  ? 0.6289 0.7830 0.3841 -0.0638 0.0205  -0.1790 202 LEU A CD1 
88   C CD2 . LEU A 14  ? 0.6805 0.8323 0.4198 -0.0779 0.0286  -0.2031 202 LEU A CD2 
89   N N   . CYS A 15  ? 0.6211 0.7847 0.3524 -0.0815 -0.0256 -0.1520 203 CYS A N   
90   C CA  . CYS A 15  ? 0.5842 0.7591 0.2987 -0.0886 -0.0357 -0.1345 203 CYS A CA  
91   C C   . CYS A 15  ? 0.5894 0.7681 0.3121 -0.0815 -0.0463 -0.1147 203 CYS A C   
92   O O   . CYS A 15  ? 0.5962 0.7816 0.3091 -0.0835 -0.0508 -0.0985 203 CYS A O   
93   C CB  . CYS A 15  ? 0.6053 0.7843 0.3099 -0.0987 -0.0447 -0.1361 203 CYS A CB  
94   S SG  . CYS A 15  ? 0.7362 0.9123 0.4587 -0.0957 -0.0565 -0.1366 203 CYS A SG  
95   N N   . GLU A 16  ? 0.5563 0.7286 0.3001 -0.0724 -0.0495 -0.1149 204 GLU A N   
96   C CA  . GLU A 16  ? 0.6002 0.7702 0.3605 -0.0625 -0.0575 -0.0950 204 GLU A CA  
97   C C   . GLU A 16  ? 0.5911 0.7552 0.3578 -0.0542 -0.0495 -0.0883 204 GLU A C   
98   O O   . GLU A 16  ? 0.5735 0.7395 0.3411 -0.0510 -0.0551 -0.0708 204 GLU A O   
99   C CB  . GLU A 16  ? 0.6294 0.7908 0.4142 -0.0544 -0.0610 -0.0963 204 GLU A CB  
100  C CG  . GLU A 16  ? 0.6999 0.8628 0.4993 -0.0470 -0.0714 -0.0769 204 GLU A CG  
101  C CD  . GLU A 16  ? 0.7613 0.9199 0.5810 -0.0425 -0.0757 -0.0787 204 GLU A CD  
102  O OE1 . GLU A 16  ? 0.7967 0.9524 0.6162 -0.0475 -0.0733 -0.0935 204 GLU A OE1 
103  O OE2 . GLU A 16  ? 0.7442 0.9021 0.5803 -0.0343 -0.0810 -0.0656 204 GLU A OE2 
104  N N   . ILE A 17  ? 0.5777 0.7343 0.3501 -0.0507 -0.0366 -0.1024 205 ILE A N   
105  C CA  . ILE A 17  ? 0.5645 0.7170 0.3436 -0.0440 -0.0284 -0.0980 205 ILE A CA  
106  C C   . ILE A 17  ? 0.5896 0.7526 0.3455 -0.0532 -0.0257 -0.0931 205 ILE A C   
107  O O   . ILE A 17  ? 0.5778 0.7404 0.3350 -0.0502 -0.0253 -0.0803 205 ILE A O   
108  C CB  . ILE A 17  ? 0.5945 0.7380 0.3881 -0.0378 -0.0160 -0.1144 205 ILE A CB  
109  C CG1 . ILE A 17  ? 0.6285 0.7601 0.4465 -0.0274 -0.0194 -0.1135 205 ILE A CG1 
110  C CG2 . ILE A 17  ? 0.5926 0.7362 0.3891 -0.0342 -0.0066 -0.1123 205 ILE A CG2 
111  C CD1 . ILE A 17  ? 0.6345 0.7564 0.4700 -0.0196 -0.0093 -0.1250 205 ILE A CD1 
112  N N   . SER A 18  ? 0.6338 0.8062 0.3678 -0.0653 -0.0239 -0.1034 206 SER A N   
113  C CA  . SER A 18  ? 0.6818 0.8648 0.3918 -0.0759 -0.0214 -0.0986 206 SER A CA  
114  C C   . SER A 18  ? 0.6718 0.8600 0.3731 -0.0786 -0.0353 -0.0754 206 SER A C   
115  O O   . SER A 18  ? 0.6309 0.8217 0.3247 -0.0804 -0.0344 -0.0628 206 SER A O   
116  C CB  . SER A 18  ? 0.7051 0.8901 0.4021 -0.0858 -0.0166 -0.1119 206 SER A CB  
117  O OG  . SER A 18  ? 0.7856 0.9783 0.4627 -0.0954 -0.0154 -0.1040 206 SER A OG  
118  N N   . ARG A 19  ? 0.6350 0.8246 0.3396 -0.0788 -0.0483 -0.0695 207 ARG A N   
119  C CA  . ARG A 19  ? 0.6684 0.8625 0.3704 -0.0794 -0.0626 -0.0471 207 ARG A CA  
120  C C   . ARG A 19  ? 0.6538 0.8396 0.3747 -0.0672 -0.0640 -0.0330 207 ARG A C   
121  O O   . ARG A 19  ? 0.6834 0.8707 0.3996 -0.0678 -0.0701 -0.0148 207 ARG A O   
122  C CB  . ARG A 19  ? 0.7039 0.9013 0.4115 -0.0805 -0.0752 -0.0450 207 ARG A CB  
123  C CG  . ARG A 19  ? 0.8009 1.0059 0.4967 -0.0880 -0.0871 -0.0292 207 ARG A CG  
124  C CD  . ARG A 19  ? 0.8995 1.1093 0.5985 -0.0919 -0.0967 -0.0328 207 ARG A CD  
125  N NE  . ARG A 19  ? 1.0146 1.2321 0.6950 -0.1034 -0.1019 -0.0286 207 ARG A NE  
126  C CZ  . ARG A 19  ? 1.0841 1.3086 0.7640 -0.1051 -0.1157 -0.0102 207 ARG A CZ  
127  N NH1 . ARG A 19  ? 1.1220 1.3541 0.7837 -0.1162 -0.1198 -0.0078 207 ARG A NH1 
128  N NH2 . ARG A 19  ? 1.0973 1.3216 0.7959 -0.0954 -0.1254 0.0055  207 ARG A NH2 
129  N N   . GLY A 20  ? 0.6539 0.8282 0.3982 -0.0560 -0.0580 -0.0411 208 GLY A N   
130  C CA  . GLY A 20  ? 0.6454 0.8091 0.4101 -0.0440 -0.0581 -0.0298 208 GLY A CA  
131  C C   . GLY A 20  ? 0.6679 0.8290 0.4272 -0.0445 -0.0497 -0.0258 208 GLY A C   
132  O O   . GLY A 20  ? 0.6336 0.7890 0.4005 -0.0393 -0.0530 -0.0110 208 GLY A O   
133  N N   . THR A 21  ? 0.7025 0.8677 0.4503 -0.0507 -0.0383 -0.0398 209 THR A N   
134  C CA  . THR A 21  ? 0.6816 0.8470 0.4245 -0.0527 -0.0288 -0.0379 209 THR A CA  
135  C C   . THR A 21  ? 0.7406 0.9176 0.4556 -0.0664 -0.0292 -0.0306 209 THR A C   
136  O O   . THR A 21  ? 0.7436 0.9227 0.4525 -0.0702 -0.0204 -0.0296 209 THR A O   
137  C CB  . THR A 21  ? 0.6343 0.7983 0.3853 -0.0503 -0.0142 -0.0576 209 THR A CB  
138  O OG1 . THR A 21  ? 0.6391 0.8103 0.3774 -0.0577 -0.0103 -0.0742 209 THR A OG1 
139  C CG2 . THR A 21  ? 0.5724 0.7241 0.3510 -0.0369 -0.0137 -0.0614 209 THR A CG2 
140  N N   . HIS A 22  ? 0.7369 0.9223 0.4349 -0.0746 -0.0395 -0.0253 210 HIS A N   
141  C CA  . HIS A 22  ? 0.7722 0.9674 0.4443 -0.0882 -0.0402 -0.0187 210 HIS A CA  
142  C C   . HIS A 22  ? 0.7909 0.9901 0.4538 -0.0949 -0.0243 -0.0367 210 HIS A C   
143  O O   . HIS A 22  ? 0.8417 1.0443 0.4945 -0.1010 -0.0173 -0.0319 210 HIS A O   
144  C CB  . HIS A 22  ? 0.8156 1.0091 0.4831 -0.0895 -0.0447 0.0033  210 HIS A CB  
145  C CG  . HIS A 22  ? 0.9002 1.0893 0.5772 -0.0832 -0.0607 0.0230  210 HIS A CG  
146  N ND1 . HIS A 22  ? 0.9649 1.1532 0.6547 -0.0770 -0.0702 0.0214  210 HIS A ND1 
147  C CD2 . HIS A 22  ? 0.9213 1.1045 0.6014 -0.0811 -0.0680 0.0445  210 HIS A CD2 
148  C CE1 . HIS A 22  ? 0.9742 1.1576 0.6755 -0.0708 -0.0822 0.0407  210 HIS A CE1 
149  N NE2 . HIS A 22  ? 0.9490 1.1283 0.6448 -0.0728 -0.0813 0.0547  210 HIS A NE2 
150  N N   . ASN A 23  ? 0.7764 0.9750 0.4444 -0.0937 -0.0183 -0.0570 211 ASN A N   
151  C CA  . ASN A 23  ? 0.8284 1.0297 0.4932 -0.0977 -0.0024 -0.0760 211 ASN A CA  
152  C C   . ASN A 23  ? 0.8248 1.0258 0.4990 -0.0931 0.0095  -0.0782 211 ASN A C   
153  O O   . ASN A 23  ? 0.8437 1.0507 0.5107 -0.0993 0.0209  -0.0831 211 ASN A O   
154  C CB  . ASN A 23  ? 0.8904 1.0998 0.5330 -0.1110 -0.0008 -0.0748 211 ASN A CB  
155  C CG  . ASN A 23  ? 0.9802 1.1917 0.6126 -0.1166 -0.0143 -0.0694 211 ASN A CG  
156  O OD1 . ASN A 23  ? 1.0531 1.2688 0.6729 -0.1226 -0.0243 -0.0517 211 ASN A OD1 
157  N ND2 . ASN A 23  ? 0.9773 1.1857 0.6160 -0.1147 -0.0148 -0.0844 211 ASN A ND2 
158  N N   . PHE A 24  ? 0.8126 1.0081 0.5034 -0.0825 0.0067  -0.0745 212 PHE A N   
159  C CA  . PHE A 24  ? 0.7360 0.9273 0.4440 -0.0756 0.0163  -0.0745 212 PHE A CA  
160  C C   . PHE A 24  ? 0.7874 0.9849 0.4811 -0.0838 0.0183  -0.0601 212 PHE A C   
161  O O   . PHE A 24  ? 0.8011 1.0059 0.4926 -0.0880 0.0314  -0.0673 212 PHE A O   
162  C CB  . PHE A 24  ? 0.6984 0.8924 0.4159 -0.0734 0.0315  -0.0975 212 PHE A CB  
163  C CG  . PHE A 24  ? 0.6905 0.8766 0.4222 -0.0660 0.0297  -0.1114 212 PHE A CG  
164  C CD1 . PHE A 24  ? 0.6612 0.8347 0.4204 -0.0524 0.0265  -0.1098 212 PHE A CD1 
165  C CD2 . PHE A 24  ? 0.7317 0.9205 0.4517 -0.0726 0.0304  -0.1241 212 PHE A CD2 
166  C CE1 . PHE A 24  ? 0.6914 0.8571 0.4633 -0.0464 0.0246  -0.1211 212 PHE A CE1 
167  C CE2 . PHE A 24  ? 0.7559 0.9368 0.4884 -0.0669 0.0286  -0.1368 212 PHE A CE2 
168  C CZ  . PHE A 24  ? 0.7342 0.9039 0.4923 -0.0539 0.0258  -0.1351 212 PHE A CZ  
169  N N   . SER A 25  ? 0.7957 0.9904 0.4811 -0.0861 0.0053  -0.0393 213 SER A N   
170  C CA  . SER A 25  ? 0.8282 1.0257 0.5010 -0.0937 0.0047  -0.0219 213 SER A CA  
171  C C   . SER A 25  ? 0.8314 1.0224 0.5235 -0.0874 0.0127  -0.0198 213 SER A C   
172  O O   . SER A 25  ? 0.8150 0.9954 0.5324 -0.0748 0.0124  -0.0236 213 SER A O   
173  C CB  . SER A 25  ? 0.8588 1.0508 0.5267 -0.0937 -0.0124 0.0006  213 SER A CB  
174  O OG  . SER A 25  ? 0.9320 1.1221 0.5934 -0.0987 -0.0136 0.0189  213 SER A OG  
175  N N   . GLU A 26  ? 0.8014 0.9996 0.4808 -0.0973 0.0197  -0.0134 214 GLU A N   
176  C CA  . GLU A 26  ? 0.8478 1.0418 0.5439 -0.0938 0.0272  -0.0108 214 GLU A CA  
177  C C   . GLU A 26  ? 0.9014 1.0796 0.6098 -0.0872 0.0159  0.0088  214 GLU A C   
178  O O   . GLU A 26  ? 0.9227 1.0930 0.6514 -0.0802 0.0193  0.0089  214 GLU A O   
179  C CB  . GLU A 26  ? 0.9108 1.1187 0.5889 -0.1079 0.0387  -0.0099 214 GLU A CB  
180  C CG  . GLU A 26  ? 0.9647 1.1879 0.6389 -0.1121 0.0544  -0.0330 214 GLU A CG  
181  C CD  . GLU A 26  ? 1.0180 1.2430 0.7177 -0.1054 0.0670  -0.0440 214 GLU A CD  
182  O OE1 . GLU A 26  ? 1.0479 1.2742 0.7509 -0.1095 0.0708  -0.0339 214 GLU A OE1 
183  O OE2 . GLU A 26  ? 1.0311 1.2561 0.7483 -0.0962 0.0726  -0.0621 214 GLU A OE2 
184  N N   . GLU A 27  ? 0.9130 1.0866 0.6098 -0.0894 0.0025  0.0250  215 GLU A N   
185  C CA  . GLU A 27  ? 0.9718 1.1295 0.6815 -0.0823 -0.0084 0.0429  215 GLU A CA  
186  C C   . GLU A 27  ? 0.8749 1.0215 0.6088 -0.0670 -0.0135 0.0365  215 GLU A C   
187  O O   . GLU A 27  ? 0.8607 0.9934 0.6117 -0.0587 -0.0179 0.0446  215 GLU A O   
188  C CB  . GLU A 27  ? 1.1261 1.2835 0.8176 -0.0892 -0.0215 0.0631  215 GLU A CB  
189  C CG  . GLU A 27  ? 1.2406 1.3807 0.9469 -0.0809 -0.0333 0.0817  215 GLU A CG  
190  C CD  . GLU A 27  ? 1.3200 1.4495 1.0352 -0.0815 -0.0284 0.0899  215 GLU A CD  
191  O OE1 . GLU A 27  ? 1.3217 1.4436 1.0577 -0.0728 -0.0225 0.0802  215 GLU A OE1 
192  O OE2 . GLU A 27  ? 1.3564 1.4849 1.0575 -0.0914 -0.0309 0.1065  215 GLU A OE2 
193  N N   . LEU A 28  ? 0.8666 1.0191 0.6014 -0.0640 -0.0123 0.0213  216 LEU A N   
194  C CA  . LEU A 28  ? 0.7727 0.9163 0.5291 -0.0508 -0.0161 0.0142  216 LEU A CA  
195  C C   . LEU A 28  ? 0.7194 0.8611 0.4935 -0.0444 -0.0051 -0.0011 216 LEU A C   
196  O O   . LEU A 28  ? 0.6645 0.7994 0.4561 -0.0343 -0.0066 -0.0085 216 LEU A O   
197  C CB  . LEU A 28  ? 0.7103 0.8599 0.4599 -0.0513 -0.0218 0.0070  216 LEU A CB  
198  C CG  . LEU A 28  ? 0.7134 0.8595 0.4625 -0.0489 -0.0368 0.0222  216 LEU A CG  
199  C CD1 . LEU A 28  ? 0.7813 0.9297 0.5131 -0.0579 -0.0431 0.0414  216 LEU A CD1 
200  C CD2 . LEU A 28  ? 0.7021 0.8560 0.4453 -0.0506 -0.0421 0.0137  216 LEU A CD2 
201  N N   . LYS A 29  ? 0.7011 0.8497 0.4714 -0.0507 0.0056  -0.0051 217 LYS A N   
202  C CA  . LYS A 29  ? 0.6926 0.8429 0.4799 -0.0456 0.0162  -0.0198 217 LYS A CA  
203  C C   . LYS A 29  ? 0.6955 0.8351 0.5005 -0.0396 0.0153  -0.0121 217 LYS A C   
204  O O   . LYS A 29  ? 0.7724 0.9117 0.5727 -0.0458 0.0168  -0.0018 217 LYS A O   
205  C CB  . LYS A 29  ? 0.7621 0.9278 0.5380 -0.0555 0.0292  -0.0294 217 LYS A CB  
206  C CG  . LYS A 29  ? 0.8077 0.9784 0.6025 -0.0505 0.0409  -0.0453 217 LYS A CG  
207  C CD  . LYS A 29  ? 0.8864 1.0739 0.6686 -0.0597 0.0537  -0.0587 217 LYS A CD  
208  C CE  . LYS A 29  ? 0.9346 1.1300 0.7363 -0.0565 0.0666  -0.0709 217 LYS A CE  
209  N NZ  . LYS A 29  ? 0.9691 1.1674 0.7741 -0.0615 0.0697  -0.0599 217 LYS A NZ  
210  N N   . ILE A 30  ? 0.6298 0.7602 0.4541 -0.0283 0.0124  -0.0169 218 ILE A N   
211  C CA  . ILE A 30  ? 0.6260 0.7456 0.4664 -0.0226 0.0107  -0.0111 218 ILE A CA  
212  C C   . ILE A 30  ? 0.6341 0.7583 0.4907 -0.0198 0.0195  -0.0220 218 ILE A C   
213  O O   . ILE A 30  ? 0.6432 0.7603 0.5126 -0.0165 0.0186  -0.0182 218 ILE A O   
214  C CB  . ILE A 30  ? 0.5981 0.7048 0.4491 -0.0125 0.0013  -0.0077 218 ILE A CB  
215  C CG1 . ILE A 30  ? 0.5714 0.6798 0.4322 -0.0056 0.0026  -0.0215 218 ILE A CG1 
216  C CG2 . ILE A 30  ? 0.6218 0.7250 0.4605 -0.0145 -0.0081 0.0045  218 ILE A CG2 
217  C CD1 . ILE A 30  ? 0.5282 0.6261 0.3975 0.0030  -0.0060 -0.0185 218 ILE A CD1 
218  N N   . GLY A 31  ? 0.5687 0.7049 0.4257 -0.0213 0.0279  -0.0357 219 GLY A N   
219  C CA  . GLY A 31  ? 0.5677 0.7100 0.4428 -0.0181 0.0360  -0.0456 219 GLY A CA  
220  C C   . GLY A 31  ? 0.6664 0.8231 0.5413 -0.0206 0.0469  -0.0607 219 GLY A C   
221  O O   . GLY A 31  ? 0.7133 0.8741 0.5736 -0.0242 0.0479  -0.0659 219 GLY A O   
222  N N   . GLU A 32  ? 0.6873 0.8527 0.5790 -0.0191 0.0552  -0.0681 220 GLU A N   
223  C CA  . GLU A 32  ? 0.8222 1.0007 0.7200 -0.0189 0.0663  -0.0845 220 GLU A CA  
224  C C   . GLU A 32  ? 0.8330 1.0168 0.7585 -0.0120 0.0712  -0.0911 220 GLU A C   
225  O O   . GLU A 32  ? 0.8671 1.0478 0.8029 -0.0109 0.0673  -0.0824 220 GLU A O   
226  C CB  . GLU A 32  ? 0.9475 1.1407 0.8266 -0.0312 0.0762  -0.0866 220 GLU A CB  
227  C CG  . GLU A 32  ? 1.0500 1.2504 0.9286 -0.0392 0.0801  -0.0769 220 GLU A CG  
228  C CD  . GLU A 32  ? 1.1624 1.3783 1.0210 -0.0524 0.0906  -0.0790 220 GLU A CD  
229  O OE1 . GLU A 32  ? 1.1953 1.4146 1.0362 -0.0560 0.0926  -0.0859 220 GLU A OE1 
230  O OE2 . GLU A 32  ? 1.2033 1.4287 1.0632 -0.0599 0.0969  -0.0738 220 GLU A OE2 
231  N N   . GLY A 33  ? 0.8626 1.0544 0.8006 -0.0076 0.0793  -0.1065 221 GLY A N   
232  C CA  . GLY A 33  ? 0.8614 1.0593 0.8283 0.0000  0.0832  -0.1128 221 GLY A CA  
233  C C   . GLY A 33  ? 0.8605 1.0679 0.8397 0.0040  0.0939  -0.1308 221 GLY A C   
234  O O   . GLY A 33  ? 0.8724 1.0852 0.8355 -0.0017 0.1012  -0.1396 221 GLY A O   
235  N N   . GLY A 34  ? 0.8360 1.0457 0.8442 0.0137  0.0947  -0.1363 222 GLY A N   
236  C CA  . GLY A 34  ? 0.8363 1.0537 0.8617 0.0195  0.1048  -0.1534 222 GLY A CA  
237  C C   . GLY A 34  ? 0.8037 1.0088 0.8191 0.0224  0.1031  -0.1623 222 GLY A C   
238  O O   . GLY A 34  ? 0.8236 1.0352 0.8365 0.0207  0.1137  -0.1775 222 GLY A O   
239  N N   . PHE A 35  ? 0.7631 0.9509 0.7729 0.0261  0.0900  -0.1534 223 PHE A N   
240  C CA  . PHE A 35  ? 0.7563 0.9315 0.7577 0.0283  0.0866  -0.1602 223 PHE A CA  
241  C C   . PHE A 35  ? 0.7063 0.8844 0.6776 0.0175  0.0903  -0.1642 223 PHE A C   
242  O O   . PHE A 35  ? 0.7081 0.8843 0.6745 0.0169  0.0949  -0.1777 223 PHE A O   
243  C CB  . PHE A 35  ? 0.7849 0.9430 0.7860 0.0332  0.0720  -0.1478 223 PHE A CB  
244  C CG  . PHE A 35  ? 0.8287 0.9846 0.8141 0.0278  0.0643  -0.1314 223 PHE A CG  
245  C CD1 . PHE A 35  ? 0.8636 1.0156 0.8231 0.0204  0.0602  -0.1260 223 PHE A CD1 
246  C CD2 . PHE A 35  ? 0.8227 0.9801 0.8199 0.0298  0.0607  -0.1216 223 PHE A CD2 
247  C CE1 . PHE A 35  ? 0.8471 0.9958 0.7946 0.0163  0.0532  -0.1109 223 PHE A CE1 
248  C CE2 . PHE A 35  ? 0.8264 0.9799 0.8101 0.0249  0.0542  -0.1077 223 PHE A CE2 
249  C CZ  . PHE A 35  ? 0.8259 0.9745 0.7855 0.0187  0.0507  -0.1023 223 PHE A CZ  
250  N N   . GLY A 36  ? 0.7602 0.9424 0.7113 0.0086  0.0877  -0.1521 224 GLY A N   
251  C CA  . GLY A 36  ? 0.7363 0.9190 0.6570 -0.0016 0.0865  -0.1506 224 GLY A CA  
252  C C   . GLY A 36  ? 0.7009 0.8801 0.6060 -0.0070 0.0772  -0.1314 224 GLY A C   
253  O O   . GLY A 36  ? 0.6955 0.8764 0.6100 -0.0060 0.0761  -0.1219 224 GLY A O   
254  N N   . CYS A 37  ? 0.6747 0.8491 0.5569 -0.0128 0.0701  -0.1257 225 CYS A N   
255  C CA  . CYS A 37  ? 0.6012 0.7720 0.4686 -0.0179 0.0614  -0.1074 225 CYS A CA  
256  C C   . CYS A 37  ? 0.5665 0.7225 0.4342 -0.0123 0.0477  -0.0982 225 CYS A C   
257  O O   . CYS A 37  ? 0.5465 0.6969 0.4174 -0.0081 0.0449  -0.1059 225 CYS A O   
258  C CB  . CYS A 37  ? 0.6220 0.8027 0.4611 -0.0311 0.0644  -0.1053 225 CYS A CB  
259  S SG  . CYS A 37  ? 1.0328 1.2334 0.8689 -0.0394 0.0825  -0.1178 225 CYS A SG  
260  N N   . VAL A 38  ? 0.5703 0.7200 0.4356 -0.0123 0.0399  -0.0821 226 VAL A N   
261  C CA  . VAL A 38  ? 0.5623 0.6991 0.4296 -0.0068 0.0279  -0.0729 226 VAL A CA  
262  C C   . VAL A 38  ? 0.5811 0.7167 0.4293 -0.0133 0.0204  -0.0586 226 VAL A C   
263  O O   . VAL A 38  ? 0.5828 0.7209 0.4237 -0.0190 0.0215  -0.0490 226 VAL A O   
264  C CB  . VAL A 38  ? 0.5154 0.6430 0.4021 0.0016  0.0246  -0.0671 226 VAL A CB  
265  C CG1 . VAL A 38  ? 0.4866 0.6020 0.3753 0.0072  0.0138  -0.0591 226 VAL A CG1 
266  C CG2 . VAL A 38  ? 0.5078 0.6373 0.4147 0.0082  0.0306  -0.0791 226 VAL A CG2 
267  N N   . TYR A 39  ? 0.5175 0.6492 0.3593 -0.0124 0.0122  -0.0567 227 TYR A N   
268  C CA  . TYR A 39  ? 0.4980 0.6297 0.3234 -0.0179 0.0035  -0.0432 227 TYR A CA  
269  C C   . TYR A 39  ? 0.5056 0.6265 0.3402 -0.0103 -0.0075 -0.0336 227 TYR A C   
270  O O   . TYR A 39  ? 0.5240 0.6389 0.3733 -0.0024 -0.0087 -0.0396 227 TYR A O   
271  C CB  . TYR A 39  ? 0.5246 0.6659 0.3310 -0.0261 0.0032  -0.0496 227 TYR A CB  
272  C CG  . TYR A 39  ? 0.6282 0.7815 0.4238 -0.0343 0.0151  -0.0615 227 TYR A CG  
273  C CD1 . TYR A 39  ? 0.6576 0.8130 0.4632 -0.0311 0.0242  -0.0799 227 TYR A CD1 
274  C CD2 . TYR A 39  ? 0.7083 0.8706 0.4838 -0.0453 0.0177  -0.0544 227 TYR A CD2 
275  C CE1 . TYR A 39  ? 0.7360 0.9029 0.5332 -0.0380 0.0363  -0.0922 227 TYR A CE1 
276  C CE2 . TYR A 39  ? 0.7487 0.9234 0.5137 -0.0533 0.0299  -0.0661 227 TYR A CE2 
277  C CZ  . TYR A 39  ? 0.7719 0.9492 0.5485 -0.0493 0.0396  -0.0857 227 TYR A CZ  
278  O OH  . TYR A 39  ? 0.8566 1.0468 0.6245 -0.0567 0.0530  -0.0987 227 TYR A OH  
279  N N   . ARG A 40  ? 0.5034 0.6223 0.3298 -0.0129 -0.0152 -0.0183 228 ARG A N   
280  C CA  . ARG A 40  ? 0.5181 0.6293 0.3522 -0.0065 -0.0255 -0.0092 228 ARG A CA  
281  C C   . ARG A 40  ? 0.6030 0.7218 0.4253 -0.0110 -0.0328 -0.0079 228 ARG A C   
282  O O   . ARG A 40  ? 0.6465 0.7725 0.4512 -0.0197 -0.0359 -0.0004 228 ARG A O   
283  C CB  . ARG A 40  ? 0.5406 0.6437 0.3766 -0.0052 -0.0301 0.0068  228 ARG A CB  
284  C CG  . ARG A 40  ? 0.5407 0.6364 0.3869 0.0022  -0.0398 0.0161  228 ARG A CG  
285  C CD  . ARG A 40  ? 0.5725 0.6601 0.4187 0.0022  -0.0444 0.0322  228 ARG A CD  
286  N NE  . ARG A 40  ? 0.5648 0.6443 0.4248 0.0109  -0.0519 0.0398  228 ARG A NE  
287  C CZ  . ARG A 40  ? 0.5956 0.6796 0.4546 0.0115  -0.0612 0.0480  228 ARG A CZ  
288  N NH1 . ARG A 40  ? 0.5813 0.6774 0.4241 0.0032  -0.0648 0.0497  228 ARG A NH1 
289  N NH2 . ARG A 40  ? 0.5974 0.6746 0.4720 0.0202  -0.0667 0.0540  228 ARG A NH2 
290  N N   . ALA A 41  ? 0.5559 0.6736 0.3875 -0.0061 -0.0360 -0.0147 229 ALA A N   
291  C CA  . ALA A 41  ? 0.5668 0.6926 0.3891 -0.0109 -0.0430 -0.0155 229 ALA A CA  
292  C C   . ALA A 41  ? 0.5202 0.6429 0.3545 -0.0045 -0.0533 -0.0061 229 ALA A C   
293  O O   . ALA A 41  ? 0.4796 0.5932 0.3310 0.0045  -0.0531 -0.0038 229 ALA A O   
294  C CB  . ALA A 41  ? 0.5316 0.6606 0.3536 -0.0128 -0.0372 -0.0335 229 ALA A CB  
295  N N   . VAL A 42  ? 0.5256 0.6573 0.3509 -0.0098 -0.0623 -0.0008 230 VAL A N   
296  C CA  . VAL A 42  ? 0.4882 0.6206 0.3267 -0.0045 -0.0719 0.0059  230 VAL A CA  
297  C C   . VAL A 42  ? 0.5093 0.6510 0.3429 -0.0101 -0.0753 -0.0036 230 VAL A C   
298  O O   . VAL A 42  ? 0.5604 0.7124 0.3756 -0.0202 -0.0791 -0.0036 230 VAL A O   
299  C CB  . VAL A 42  ? 0.5069 0.6422 0.3437 -0.0045 -0.0823 0.0249  230 VAL A CB  
300  C CG1 . VAL A 42  ? 0.5283 0.6667 0.3816 0.0015  -0.0916 0.0307  230 VAL A CG1 
301  C CG2 . VAL A 42  ? 0.4558 0.5797 0.2980 0.0006  -0.0789 0.0341  230 VAL A CG2 
302  N N   . MET A 43  ? 0.4582 0.5960 0.3072 -0.0047 -0.0739 -0.0119 231 MET A N   
303  C CA  . MET A 43  ? 0.4562 0.6012 0.3030 -0.0103 -0.0772 -0.0212 231 MET A CA  
304  C C   . MET A 43  ? 0.4568 0.6014 0.3239 -0.0036 -0.0829 -0.0174 231 MET A C   
305  O O   . MET A 43  ? 0.3871 0.5226 0.2703 0.0056  -0.0788 -0.0164 231 MET A O   
306  C CB  . MET A 43  ? 0.4717 0.6119 0.3151 -0.0128 -0.0670 -0.0396 231 MET A CB  
307  C CG  . MET A 43  ? 0.5202 0.6617 0.3461 -0.0187 -0.0591 -0.0450 231 MET A CG  
308  S SD  . MET A 43  ? 0.6148 0.7504 0.4418 -0.0195 -0.0462 -0.0669 231 MET A SD  
309  C CE  . MET A 43  ? 0.4839 0.6057 0.3365 -0.0060 -0.0418 -0.0656 231 MET A CE  
310  N N   . ARG A 44  ? 0.4875 0.6435 0.3535 -0.0090 -0.0922 -0.0154 232 ARG A N   
311  C CA  . ARG A 44  ? 0.5005 0.6598 0.3864 -0.0038 -0.0981 -0.0110 232 ARG A CA  
312  C C   . ARG A 44  ? 0.4656 0.6201 0.3674 0.0071  -0.0989 0.0019  232 ARG A C   
313  O O   . ARG A 44  ? 0.4428 0.5909 0.3619 0.0149  -0.0951 0.0003  232 ARG A O   
314  C CB  . ARG A 44  ? 0.5108 0.6635 0.4069 -0.0026 -0.0919 -0.0245 232 ARG A CB  
315  C CG  . ARG A 44  ? 0.5847 0.7413 0.4684 -0.0133 -0.0919 -0.0380 232 ARG A CG  
316  C CD  . ARG A 44  ? 0.6390 0.7828 0.5278 -0.0115 -0.0819 -0.0523 232 ARG A CD  
317  N NE  . ARG A 44  ? 0.6425 0.7873 0.5394 -0.0156 -0.0842 -0.0602 232 ARG A NE  
318  C CZ  . ARG A 44  ? 0.6124 0.7572 0.4992 -0.0248 -0.0832 -0.0736 232 ARG A CZ  
319  N NH1 . ARG A 44  ? 0.6071 0.7523 0.4749 -0.0307 -0.0793 -0.0813 232 ARG A NH1 
320  N NH2 . ARG A 44  ? 0.6285 0.7727 0.5244 -0.0287 -0.0856 -0.0799 232 ARG A NH2 
321  N N   . ASN A 45  ? 0.4605 0.6171 0.3550 0.0070  -0.1035 0.0143  233 ASN A N   
322  C CA  . ASN A 45  ? 0.4277 0.5789 0.3363 0.0168  -0.1051 0.0272  233 ASN A CA  
323  C C   . ASN A 45  ? 0.4120 0.5478 0.3289 0.0248  -0.0943 0.0222  233 ASN A C   
324  O O   . ASN A 45  ? 0.4026 0.5328 0.3355 0.0338  -0.0938 0.0284  233 ASN A O   
325  C CB  . ASN A 45  ? 0.3863 0.5465 0.3151 0.0218  -0.1132 0.0344  233 ASN A CB  
326  C CG  . ASN A 45  ? 0.4760 0.6529 0.3986 0.0144  -0.1261 0.0427  233 ASN A CG  
327  O OD1 . ASN A 45  ? 0.5065 0.6862 0.4205 0.0125  -0.1326 0.0551  233 ASN A OD1 
328  N ND2 . ASN A 45  ? 0.4643 0.6525 0.3912 0.0095  -0.1303 0.0367  233 ASN A ND2 
329  N N   . THR A 46  ? 0.3751 0.5045 0.2813 0.0214  -0.0857 0.0108  234 THR A N   
330  C CA  . THR A 46  ? 0.3906 0.5071 0.3041 0.0278  -0.0763 0.0055  234 THR A CA  
331  C C   . THR A 46  ? 0.4563 0.5674 0.3557 0.0243  -0.0699 0.0030  234 THR A C   
332  O O   . THR A 46  ? 0.5214 0.6380 0.4057 0.0162  -0.0686 -0.0029 234 THR A O   
333  C CB  . THR A 46  ? 0.3511 0.4650 0.2723 0.0288  -0.0713 -0.0070 234 THR A CB  
334  O OG1 . THR A 46  ? 0.3552 0.4758 0.2891 0.0306  -0.0769 -0.0047 234 THR A OG1 
335  C CG2 . THR A 46  ? 0.3370 0.4387 0.2662 0.0354  -0.0633 -0.0106 234 THR A CG2 
336  N N   . VAL A 47  ? 0.4090 0.5100 0.3136 0.0297  -0.0657 0.0068  235 VAL A N   
337  C CA  . VAL A 47  ? 0.4155 0.5124 0.3095 0.0263  -0.0593 0.0050  235 VAL A CA  
338  C C   . VAL A 47  ? 0.4302 0.5224 0.3273 0.0274  -0.0505 -0.0082 235 VAL A C   
339  O O   . VAL A 47  ? 0.4210 0.5064 0.3311 0.0339  -0.0481 -0.0111 235 VAL A O   
340  C CB  . VAL A 47  ? 0.4067 0.4945 0.3047 0.0304  -0.0593 0.0156  235 VAL A CB  
341  C CG1 . VAL A 47  ? 0.4190 0.5042 0.3064 0.0255  -0.0529 0.0140  235 VAL A CG1 
342  C CG2 . VAL A 47  ? 0.4386 0.5298 0.3360 0.0302  -0.0686 0.0300  235 VAL A CG2 
343  N N   . TYR A 48  ? 0.3683 0.4651 0.2538 0.0210  -0.0457 -0.0161 236 TYR A N   
344  C CA  . TYR A 48  ? 0.3774 0.4712 0.2671 0.0220  -0.0377 -0.0286 236 TYR A CA  
345  C C   . TYR A 48  ? 0.4433 0.5382 0.3256 0.0184  -0.0307 -0.0306 236 TYR A C   
346  O O   . TYR A 48  ? 0.4733 0.5728 0.3430 0.0126  -0.0317 -0.0240 236 TYR A O   
347  C CB  . TYR A 48  ? 0.3940 0.4929 0.2805 0.0182  -0.0370 -0.0401 236 TYR A CB  
348  C CG  . TYR A 48  ? 0.3774 0.4764 0.2721 0.0203  -0.0431 -0.0399 236 TYR A CG  
349  C CD1 . TYR A 48  ? 0.3549 0.4466 0.2644 0.0266  -0.0415 -0.0433 236 TYR A CD1 
350  C CD2 . TYR A 48  ? 0.3439 0.4515 0.2313 0.0152  -0.0505 -0.0362 236 TYR A CD2 
351  C CE1 . TYR A 48  ? 0.3117 0.4045 0.2290 0.0276  -0.0463 -0.0431 236 TYR A CE1 
352  C CE2 . TYR A 48  ? 0.3746 0.4841 0.2711 0.0165  -0.0559 -0.0362 236 TYR A CE2 
353  C CZ  . TYR A 48  ? 0.3821 0.4841 0.2936 0.0226  -0.0533 -0.0398 236 TYR A CZ  
354  O OH  . TYR A 48  ? 0.3746 0.4793 0.2954 0.0230  -0.0580 -0.0395 236 TYR A OH  
355  N N   . ALA A 49  ? 0.3713 0.4627 0.2622 0.0215  -0.0238 -0.0392 237 ALA A N   
356  C CA  . ALA A 49  ? 0.4203 0.5161 0.3066 0.0175  -0.0158 -0.0449 237 ALA A CA  
357  C C   . ALA A 49  ? 0.4601 0.5611 0.3444 0.0149  -0.0109 -0.0592 237 ALA A C   
358  O O   . ALA A 49  ? 0.5063 0.6029 0.4009 0.0192  -0.0114 -0.0660 237 ALA A O   
359  C CB  . ALA A 49  ? 0.3357 0.4258 0.2348 0.0226  -0.0118 -0.0450 237 ALA A CB  
360  N N   . VAL A 50  ? 0.4380 0.5479 0.3089 0.0073  -0.0057 -0.0639 238 VAL A N   
361  C CA  . VAL A 50  ? 0.4654 0.5800 0.3340 0.0044  0.0004  -0.0793 238 VAL A CA  
362  C C   . VAL A 50  ? 0.5136 0.6335 0.3855 0.0034  0.0115  -0.0878 238 VAL A C   
363  O O   . VAL A 50  ? 0.5335 0.6606 0.3949 -0.0025 0.0152  -0.0836 238 VAL A O   
364  C CB  . VAL A 50  ? 0.4584 0.5810 0.3066 -0.0051 -0.0024 -0.0810 238 VAL A CB  
365  C CG1 . VAL A 50  ? 0.4099 0.5369 0.2544 -0.0090 0.0056  -0.0991 238 VAL A CG1 
366  C CG2 . VAL A 50  ? 0.4701 0.5895 0.3184 -0.0039 -0.0135 -0.0738 238 VAL A CG2 
367  N N   . LYS A 51  ? 0.5218 0.6384 0.4097 0.0092  0.0166  -0.0992 239 LYS A N   
368  C CA  . LYS A 51  ? 0.5174 0.6403 0.4133 0.0096  0.0274  -0.1088 239 LYS A CA  
369  C C   . LYS A 51  ? 0.5480 0.6768 0.4368 0.0048  0.0350  -0.1251 239 LYS A C   
370  O O   . LYS A 51  ? 0.5631 0.6856 0.4577 0.0075  0.0340  -0.1342 239 LYS A O   
371  C CB  . LYS A 51  ? 0.5277 0.6437 0.4479 0.0196  0.0280  -0.1105 239 LYS A CB  
372  C CG  . LYS A 51  ? 0.5850 0.7092 0.5177 0.0211  0.0380  -0.1177 239 LYS A CG  
373  C CD  . LYS A 51  ? 0.6179 0.7367 0.5731 0.0300  0.0356  -0.1139 239 LYS A CD  
374  C CE  . LYS A 51  ? 0.6477 0.7594 0.6204 0.0375  0.0357  -0.1230 239 LYS A CE  
375  N NZ  . LYS A 51  ? 0.6321 0.7410 0.6264 0.0453  0.0334  -0.1188 239 LYS A NZ  
376  N N   . ARG A 52  ? 0.5319 0.6726 0.4075 -0.0030 0.0431  -0.1290 240 ARG A N   
377  C CA  . ARG A 52  ? 0.5727 0.7206 0.4402 -0.0085 0.0525  -0.1463 240 ARG A CA  
378  C C   . ARG A 52  ? 0.5573 0.7111 0.4428 -0.0042 0.0651  -0.1577 240 ARG A C   
379  O O   . ARG A 52  ? 0.5513 0.7131 0.4397 -0.0052 0.0696  -0.1519 240 ARG A O   
380  C CB  . ARG A 52  ? 0.6227 0.7818 0.4612 -0.0215 0.0537  -0.1438 240 ARG A CB  
381  C CG  . ARG A 52  ? 0.6984 0.8654 0.5245 -0.0289 0.0637  -0.1627 240 ARG A CG  
382  C CD  . ARG A 52  ? 0.7776 0.9583 0.5746 -0.0426 0.0667  -0.1592 240 ARG A CD  
383  N NE  . ARG A 52  ? 0.8742 1.0605 0.6620 -0.0497 0.0767  -0.1758 240 ARG A NE  
384  C CZ  . ARG A 52  ? 0.9503 1.1463 0.7197 -0.0607 0.0819  -0.1737 240 ARG A CZ  
385  N NH1 . ARG A 52  ? 0.9598 1.1633 0.7150 -0.0668 0.0791  -0.1577 240 ARG A NH1 
386  N NH2 . ARG A 52  ? 1.0059 1.2037 0.7711 -0.0656 0.0900  -0.1876 240 ARG A NH2 
387  N N   . LEU A 53  ? 0.5486 0.6985 0.4476 0.0007  0.0706  -0.1738 241 LEU A N   
388  C CA  . LEU A 53  ? 0.5957 0.7512 0.5161 0.0064  0.0824  -0.1858 241 LEU A CA  
389  C C   . LEU A 53  ? 0.7295 0.8995 0.6365 -0.0024 0.0964  -0.2004 241 LEU A C   
390  O O   . LEU A 53  ? 0.7694 0.9404 0.6544 -0.0109 0.0973  -0.2080 241 LEU A O   
391  C CB  . LEU A 53  ? 0.5554 0.6983 0.4991 0.0166  0.0817  -0.1955 241 LEU A CB  
392  C CG  . LEU A 53  ? 0.5512 0.6802 0.5071 0.0244  0.0686  -0.1818 241 LEU A CG  
393  C CD1 . LEU A 53  ? 0.5693 0.6863 0.5485 0.0337  0.0686  -0.1909 241 LEU A CD1 
394  C CD2 . LEU A 53  ? 0.5748 0.7078 0.5404 0.0281  0.0656  -0.1674 241 LEU A CD2 
395  N N   . LYS A 54  ? 0.7581 0.9402 0.6781 -0.0008 0.1072  -0.2043 242 LYS A N   
396  C CA  . LYS A 54  ? 0.8090 1.0037 0.7207 -0.0089 0.1202  -0.2140 242 LYS A CA  
397  C C   . LYS A 54  ? 0.8638 1.0505 0.7731 -0.0106 0.1239  -0.2283 242 LYS A C   
398  O O   . LYS A 54  ? 0.9353 1.1298 0.8402 -0.0163 0.1342  -0.2369 242 LYS A O   
399  C CB  . LYS A 54  ? 0.8219 1.0276 0.7594 -0.0033 0.1304  -0.2172 242 LYS A CB  
400  C CG  . LYS A 54  ? 0.8620 1.0757 0.8051 -0.0021 0.1273  -0.2031 242 LYS A CG  
401  C CD  . LYS A 54  ? 0.9129 1.1372 0.8279 -0.0157 0.1282  -0.1923 242 LYS A CD  
402  C CE  . LYS A 54  ? 0.9134 1.1419 0.8394 -0.0149 0.1248  -0.1762 242 LYS A CE  
403  N NZ  . LYS A 54  ? 0.9153 1.1516 0.8150 -0.0283 0.1249  -0.1638 242 LYS A NZ  
404  N N   . GLU A 60  ? 0.9295 1.1297 1.0310 0.0475  0.1686  -0.2739 248 GLU A N   
405  C CA  . GLU A 60  ? 0.9961 1.1814 1.0897 0.0464  0.1704  -0.2863 248 GLU A CA  
406  C C   . GLU A 60  ? 1.0258 1.1943 1.1000 0.0439  0.1583  -0.2813 248 GLU A C   
407  O O   . GLU A 60  ? 0.9996 1.1612 1.0824 0.0501  0.1477  -0.2705 248 GLU A O   
408  C CB  . GLU A 60  ? 1.0149 1.1918 1.1430 0.0591  0.1735  -0.2946 248 GLU A CB  
409  C CG  . GLU A 60  ? 1.0676 1.2298 1.1898 0.0577  0.1773  -0.3092 248 GLU A CG  
410  C CD  . GLU A 60  ? 1.1168 1.2885 1.2104 0.0444  0.1876  -0.3198 248 GLU A CD  
411  O OE1 . GLU A 60  ? 1.1149 1.3046 1.2110 0.0414  0.1985  -0.3235 248 GLU A OE1 
412  O OE2 . GLU A 60  ? 1.1482 1.3098 1.2167 0.0364  0.1845  -0.3242 248 GLU A OE2 
413  N N   . TRP A 61  ? 0.9935 1.1563 1.0419 0.0345  0.1600  -0.2893 249 TRP A N   
414  C CA  . TRP A 61  ? 1.0279 1.1782 1.0535 0.0293  0.1492  -0.2848 249 TRP A CA  
415  C C   . TRP A 61  ? 1.0392 1.1698 1.0835 0.0395  0.1395  -0.2827 249 TRP A C   
416  O O   . TRP A 61  ? 1.0566 1.1804 1.0924 0.0393  0.1284  -0.2729 249 TRP A O   
417  C CB  . TRP A 61  ? 1.0846 1.2330 1.0837 0.0178  0.1534  -0.2958 249 TRP A CB  
418  C CG  . TRP A 61  ? 1.1410 1.2858 1.1088 0.0080  0.1435  -0.2886 249 TRP A CG  
419  C CD1 . TRP A 61  ? 1.1343 1.2758 1.0969 0.0093  0.1317  -0.2748 249 TRP A CD1 
420  C CD2 . TRP A 61  ? 1.1946 1.3398 1.1327 -0.0048 0.1440  -0.2946 249 TRP A CD2 
421  N NE1 . TRP A 61  ? 1.1517 1.2918 1.0842 -0.0014 0.1247  -0.2714 249 TRP A NE1 
422  C CE2 . TRP A 61  ? 1.1863 1.3287 1.1033 -0.0104 0.1316  -0.2829 249 TRP A CE2 
423  C CE3 . TRP A 61  ? 1.2295 1.3778 1.1570 -0.0121 0.1536  -0.3087 249 TRP A CE3 
424  C CZ2 . TRP A 61  ? 1.1992 1.3422 1.0860 -0.0229 0.1276  -0.2838 249 TRP A CZ2 
425  C CZ3 . TRP A 61  ? 1.2439 1.3925 1.1402 -0.0250 0.1499  -0.3102 249 TRP A CZ3 
426  C CH2 . TRP A 61  ? 1.2312 1.3774 1.1078 -0.0303 0.1366  -0.2973 249 TRP A CH2 
427  N N   . THR A 62  ? 1.0481 1.1697 1.1183 0.0482  0.1436  -0.2916 250 THR A N   
428  C CA  . THR A 62  ? 1.0352 1.1370 1.1238 0.0573  0.1348  -0.2894 250 THR A CA  
429  C C   . THR A 62  ? 0.9341 1.0367 1.0436 0.0672  0.1263  -0.2748 250 THR A C   
430  O O   . THR A 62  ? 0.9153 1.0031 1.0322 0.0724  0.1159  -0.2681 250 THR A O   
431  C CB  . THR A 62  ? 1.1013 1.1928 1.2126 0.0640  0.1415  -0.3020 250 THR A CB  
432  O OG1 . THR A 62  ? 1.1306 1.2057 1.2671 0.0750  0.1329  -0.2959 250 THR A OG1 
433  C CG2 . THR A 62  ? 1.0957 1.2032 1.2238 0.0675  0.1535  -0.3076 250 THR A CG2 
434  N N   . ALA A 63  ? 0.9572 1.0773 1.0756 0.0691  0.1306  -0.2697 251 ALA A N   
435  C CA  . ALA A 63  ? 0.8648 0.9887 0.9995 0.0766  0.1223  -0.2555 251 ALA A CA  
436  C C   . ALA A 63  ? 0.8182 0.9412 0.9291 0.0709  0.1128  -0.2454 251 ALA A C   
437  O O   . ALA A 63  ? 0.8315 0.9454 0.9510 0.0770  0.1021  -0.2358 251 ALA A O   
438  C CB  . ALA A 63  ? 0.8175 0.9620 0.9660 0.0781  0.1296  -0.2534 251 ALA A CB  
439  N N   . VAL A 64  ? 0.8444 0.9770 0.9251 0.0592  0.1165  -0.2469 252 VAL A N   
440  C CA  . VAL A 64  ? 0.8205 0.9528 0.8770 0.0534  0.1077  -0.2374 252 VAL A CA  
441  C C   . VAL A 64  ? 0.7452 0.8588 0.7939 0.0531  0.0994  -0.2393 252 VAL A C   
442  O O   . VAL A 64  ? 0.7400 0.8477 0.7796 0.0528  0.0885  -0.2283 252 VAL A O   
443  C CB  . VAL A 64  ? 0.8558 1.0025 0.8808 0.0401  0.1127  -0.2369 252 VAL A CB  
444  C CG1 . VAL A 64  ? 0.8414 1.0050 0.8748 0.0385  0.1247  -0.2406 252 VAL A CG1 
445  C CG2 . VAL A 64  ? 0.8644 1.0045 0.8640 0.0303  0.1131  -0.2446 252 VAL A CG2 
446  N N   . LYS A 65  ? 0.7245 0.8278 0.7772 0.0527  0.1038  -0.2510 253 LYS A N   
447  C CA  . LYS A 65  ? 0.7115 0.7962 0.7613 0.0527  0.0964  -0.2535 253 LYS A CA  
448  C C   . LYS A 65  ? 0.6943 0.7670 0.7694 0.0643  0.0876  -0.2451 253 LYS A C   
449  O O   . LYS A 65  ? 0.6930 0.7559 0.7621 0.0643  0.0776  -0.2390 253 LYS A O   
450  C CB  . LYS A 65  ? 0.7554 0.8316 0.8075 0.0504  0.1038  -0.2684 253 LYS A CB  
451  C CG  . LYS A 65  ? 0.8088 0.8676 0.8519 0.0465  0.0973  -0.2727 253 LYS A CG  
452  C CD  . LYS A 65  ? 0.8717 0.9204 0.9229 0.0463  0.1050  -0.2878 253 LYS A CD  
453  C CE  . LYS A 65  ? 0.9306 0.9934 0.9678 0.0389  0.1169  -0.2982 253 LYS A CE  
454  N NZ  . LYS A 65  ? 0.9507 1.0225 0.9522 0.0249  0.1150  -0.2978 253 LYS A NZ  
455  N N   . GLN A 66  ? 0.6726 0.7469 0.7762 0.0740  0.0909  -0.2441 254 GLN A N   
456  C CA  . GLN A 66  ? 0.6592 0.7232 0.7882 0.0849  0.0821  -0.2344 254 GLN A CA  
457  C C   . GLN A 66  ? 0.5676 0.6368 0.6900 0.0854  0.0720  -0.2180 254 GLN A C   
458  O O   . GLN A 66  ? 0.5040 0.5600 0.6278 0.0874  0.0606  -0.2060 254 GLN A O   
459  C CB  . GLN A 66  ? 0.7439 0.8118 0.9039 0.0942  0.0870  -0.2350 254 GLN A CB  
460  C CG  . GLN A 66  ? 0.8605 0.9094 1.0448 0.1026  0.0832  -0.2354 254 GLN A CG  
461  C CD  . GLN A 66  ? 0.9337 0.9710 1.1271 0.1083  0.0696  -0.2211 254 GLN A CD  
462  O OE1 . GLN A 66  ? 0.9745 1.0157 1.1888 0.1162  0.0643  -0.2102 254 GLN A OE1 
463  N NE2 . GLN A 66  ? 0.9388 0.9626 1.1165 0.1036  0.0634  -0.2209 254 GLN A NE2 
464  N N   . SER A 67  ? 0.5532 0.6399 0.6654 0.0813  0.0751  -0.2130 255 SER A N   
465  C CA  . SER A 67  ? 0.5486 0.6380 0.6506 0.0791  0.0648  -0.1935 255 SER A CA  
466  C C   . SER A 67  ? 0.4908 0.5713 0.5661 0.0714  0.0567  -0.1869 255 SER A C   
467  O O   . SER A 67  ? 0.4839 0.5577 0.5565 0.0723  0.0460  -0.1723 255 SER A O   
468  C CB  . SER A 67  ? 0.5804 0.6892 0.6761 0.0749  0.0703  -0.1904 255 SER A CB  
469  O OG  . SER A 67  ? 0.6238 0.7404 0.6938 0.0647  0.0774  -0.1977 255 SER A OG  
470  N N   . PHE A 68  ? 0.4528 0.5341 0.5091 0.0636  0.0620  -0.1983 256 PHE A N   
471  C CA  . PHE A 68  ? 0.5106 0.5849 0.5437 0.0561  0.0544  -0.1935 256 PHE A CA  
472  C C   . PHE A 68  ? 0.5273 0.5839 0.5710 0.0605  0.0457  -0.1896 256 PHE A C   
473  O O   . PHE A 68  ? 0.5323 0.5842 0.5699 0.0597  0.0358  -0.1755 256 PHE A O   
474  C CB  . PHE A 68  ? 0.5339 0.6126 0.5471 0.0469  0.0617  -0.2085 256 PHE A CB  
475  C CG  . PHE A 68  ? 0.6116 0.6840 0.6037 0.0390  0.0534  -0.2050 256 PHE A CG  
476  C CD1 . PHE A 68  ? 0.6168 0.6970 0.5874 0.0322  0.0473  -0.1925 256 PHE A CD1 
477  C CD2 . PHE A 68  ? 0.6512 0.7103 0.6466 0.0383  0.0517  -0.2142 256 PHE A CD2 
478  C CE1 . PHE A 68  ? 0.6125 0.6891 0.5665 0.0255  0.0393  -0.1888 256 PHE A CE1 
479  C CE2 . PHE A 68  ? 0.6662 0.7216 0.6438 0.0305  0.0438  -0.2109 256 PHE A CE2 
480  C CZ  . PHE A 68  ? 0.6521 0.7173 0.6096 0.0243  0.0375  -0.1981 256 PHE A CZ  
481  N N   . LEU A 69  ? 0.5471 0.5938 0.6077 0.0649  0.0501  -0.2023 257 LEU A N   
482  C CA  . LEU A 69  ? 0.5204 0.5490 0.5918 0.0682  0.0425  -0.1991 257 LEU A CA  
483  C C   . LEU A 69  ? 0.4870 0.5116 0.5726 0.0754  0.0335  -0.1815 257 LEU A C   
484  O O   . LEU A 69  ? 0.4725 0.4875 0.5546 0.0742  0.0243  -0.1709 257 LEU A O   
485  C CB  . LEU A 69  ? 0.5890 0.6066 0.6795 0.0728  0.0496  -0.2159 257 LEU A CB  
486  C CG  . LEU A 69  ? 0.6691 0.6865 0.7452 0.0649  0.0580  -0.2356 257 LEU A CG  
487  C CD1 . LEU A 69  ? 0.7232 0.7273 0.8204 0.0698  0.0643  -0.2486 257 LEU A CD1 
488  C CD2 . LEU A 69  ? 0.6682 0.6802 0.7212 0.0548  0.0504  -0.2325 257 LEU A CD2 
489  N N   . THR A 70  ? 0.5068 0.5403 0.6081 0.0819  0.0363  -0.1786 258 THR A N   
490  C CA  . THR A 70  ? 0.4757 0.5075 0.5894 0.0879  0.0278  -0.1625 258 THR A CA  
491  C C   . THR A 70  ? 0.4690 0.5043 0.5623 0.0823  0.0201  -0.1478 258 THR A C   
492  O O   . THR A 70  ? 0.4875 0.5142 0.5817 0.0834  0.0112  -0.1361 258 THR A O   
493  C CB  . THR A 70  ? 0.4692 0.5134 0.6023 0.0945  0.0322  -0.1624 258 THR A CB  
494  O OG1 . THR A 70  ? 0.5063 0.5468 0.6634 0.1015  0.0391  -0.1755 258 THR A OG1 
495  C CG2 . THR A 70  ? 0.3678 0.4116 0.5108 0.0989  0.0222  -0.1453 258 THR A CG2 
496  N N   . GLU A 71  ? 0.4455 0.4932 0.5205 0.0763  0.0237  -0.1485 259 GLU A N   
497  C CA  . GLU A 71  ? 0.3853 0.4359 0.4426 0.0717  0.0171  -0.1354 259 GLU A CA  
498  C C   . GLU A 71  ? 0.4111 0.4520 0.4559 0.0673  0.0111  -0.1326 259 GLU A C   
499  O O   . GLU A 71  ? 0.3635 0.4003 0.4051 0.0674  0.0036  -0.1206 259 GLU A O   
500  C CB  . GLU A 71  ? 0.4196 0.4842 0.4606 0.0657  0.0222  -0.1365 259 GLU A CB  
501  C CG  . GLU A 71  ? 0.4673 0.5336 0.4923 0.0619  0.0156  -0.1229 259 GLU A CG  
502  C CD  . GLU A 71  ? 0.5456 0.6243 0.5623 0.0583  0.0194  -0.1198 259 GLU A CD  
503  O OE1 . GLU A 71  ? 0.6385 0.7265 0.6569 0.0568  0.0280  -0.1290 259 GLU A OE1 
504  O OE2 . GLU A 71  ? 0.5396 0.6186 0.5483 0.0568  0.0142  -0.1084 259 GLU A OE2 
505  N N   . VAL A 72  ? 0.4906 0.5285 0.5289 0.0631  0.0147  -0.1442 260 VAL A N   
506  C CA  . VAL A 72  ? 0.4463 0.4760 0.4752 0.0584  0.0088  -0.1423 260 VAL A CA  
507  C C   . VAL A 72  ? 0.4011 0.4175 0.4445 0.0630  0.0025  -0.1350 260 VAL A C   
508  O O   . VAL A 72  ? 0.4233 0.4372 0.4608 0.0611  -0.0044 -0.1241 260 VAL A O   
509  C CB  . VAL A 72  ? 0.5015 0.5290 0.5236 0.0527  0.0136  -0.1578 260 VAL A CB  
510  C CG1 . VAL A 72  ? 0.4735 0.4923 0.4897 0.0478  0.0069  -0.1558 260 VAL A CG1 
511  C CG2 . VAL A 72  ? 0.4925 0.5339 0.4952 0.0460  0.0186  -0.1631 260 VAL A CG2 
512  N N   . GLU A 73  ? 0.4151 0.4235 0.4783 0.0691  0.0049  -0.1404 261 GLU A N   
513  C CA  . GLU A 73  ? 0.4882 0.4832 0.5655 0.0730  -0.0015 -0.1325 261 GLU A CA  
514  C C   . GLU A 73  ? 0.4455 0.4435 0.5228 0.0755  -0.0082 -0.1160 261 GLU A C   
515  O O   . GLU A 73  ? 0.5140 0.5062 0.5868 0.0731  -0.0145 -0.1063 261 GLU A O   
516  C CB  . GLU A 73  ? 0.5970 0.5835 0.6980 0.0803  0.0020  -0.1400 261 GLU A CB  
517  C CG  . GLU A 73  ? 0.7223 0.6941 0.8383 0.0842  -0.0054 -0.1301 261 GLU A CG  
518  C CD  . GLU A 73  ? 0.8241 0.7886 0.9669 0.0931  -0.0033 -0.1345 261 GLU A CD  
519  O OE1 . GLU A 73  ? 0.8477 0.8162 0.9982 0.0959  0.0053  -0.1489 261 GLU A OE1 
520  O OE2 . GLU A 73  ? 0.8560 0.8111 1.0123 0.0974  -0.0103 -0.1232 261 GLU A OE2 
521  N N   . GLN A 74  ? 0.4022 0.4099 0.4843 0.0794  -0.0064 -0.1133 262 GLN A N   
522  C CA  . GLN A 74  ? 0.4122 0.4221 0.4957 0.0817  -0.0126 -0.0992 262 GLN A CA  
523  C C   . GLN A 74  ? 0.3794 0.3940 0.4429 0.0762  -0.0156 -0.0914 262 GLN A C   
524  O O   . GLN A 74  ? 0.3945 0.4059 0.4558 0.0759  -0.0215 -0.0806 262 GLN A O   
525  C CB  . GLN A 74  ? 0.4384 0.4584 0.5334 0.0865  -0.0101 -0.0991 262 GLN A CB  
526  C CG  . GLN A 74  ? 0.4599 0.4765 0.5793 0.0936  -0.0072 -0.1061 262 GLN A CG  
527  C CD  . GLN A 74  ? 0.5222 0.5253 0.6559 0.0977  -0.0147 -0.0979 262 GLN A CD  
528  O OE1 . GLN A 74  ? 0.5406 0.5391 0.6659 0.0950  -0.0220 -0.0861 262 GLN A OE1 
529  N NE2 . GLN A 74  ? 0.5575 0.5543 0.7134 0.1041  -0.0126 -0.1042 262 GLN A NE2 
530  N N   . LEU A 75  ? 0.3934 0.4157 0.4426 0.0717  -0.0117 -0.0966 263 LEU A N   
531  C CA  . LEU A 75  ? 0.3980 0.4240 0.4308 0.0672  -0.0148 -0.0892 263 LEU A CA  
532  C C   . LEU A 75  ? 0.4660 0.4848 0.4943 0.0638  -0.0186 -0.0875 263 LEU A C   
533  O O   . LEU A 75  ? 0.4359 0.4556 0.4562 0.0618  -0.0223 -0.0794 263 LEU A O   
534  C CB  . LEU A 75  ? 0.3666 0.4027 0.3859 0.0632  -0.0106 -0.0935 263 LEU A CB  
535  C CG  . LEU A 75  ? 0.3764 0.4213 0.3965 0.0647  -0.0075 -0.0917 263 LEU A CG  
536  C CD1 . LEU A 75  ? 0.3833 0.4370 0.3877 0.0593  -0.0043 -0.0934 263 LEU A CD1 
537  C CD2 . LEU A 75  ? 0.3268 0.3705 0.3490 0.0669  -0.0124 -0.0805 263 LEU A CD2 
538  N N   . SER A 76  ? 0.4762 0.4878 0.5105 0.0629  -0.0173 -0.0957 264 SER A N   
539  C CA  . SER A 76  ? 0.5298 0.5339 0.5629 0.0593  -0.0214 -0.0933 264 SER A CA  
540  C C   . SER A 76  ? 0.5787 0.5755 0.6199 0.0620  -0.0262 -0.0824 264 SER A C   
541  O O   . SER A 76  ? 0.5929 0.5890 0.6287 0.0588  -0.0297 -0.0751 264 SER A O   
542  C CB  . SER A 76  ? 0.5031 0.4993 0.5416 0.0570  -0.0190 -0.1050 264 SER A CB  
543  O OG  . SER A 76  ? 0.5082 0.5120 0.5346 0.0520  -0.0156 -0.1144 264 SER A OG  
544  N N   . ARG A 77  ? 0.5158 0.5083 0.5703 0.0675  -0.0263 -0.0810 265 ARG A N   
545  C CA  . ARG A 77  ? 0.4823 0.4683 0.5432 0.0693  -0.0318 -0.0696 265 ARG A CA  
546  C C   . ARG A 77  ? 0.5110 0.5044 0.5630 0.0693  -0.0343 -0.0594 265 ARG A C   
547  O O   . ARG A 77  ? 0.5710 0.5621 0.6179 0.0666  -0.0378 -0.0509 265 ARG A O   
548  C CB  . ARG A 77  ? 0.5248 0.5043 0.6044 0.0755  -0.0325 -0.0701 265 ARG A CB  
549  C CG  . ARG A 77  ? 0.5763 0.5522 0.6605 0.0773  -0.0391 -0.0565 265 ARG A CG  
550  C CD  . ARG A 77  ? 0.6671 0.6338 0.7719 0.0829  -0.0418 -0.0548 265 ARG A CD  
551  N NE  . ARG A 77  ? 0.6936 0.6580 0.8002 0.0832  -0.0493 -0.0402 265 ARG A NE  
552  C CZ  . ARG A 77  ? 0.6814 0.6370 0.7839 0.0789  -0.0538 -0.0311 265 ARG A CZ  
553  N NH1 . ARG A 77  ? 0.6340 0.5888 0.7359 0.0784  -0.0605 -0.0178 265 ARG A NH1 
554  N NH2 . ARG A 77  ? 0.7015 0.6498 0.7998 0.0742  -0.0517 -0.0353 265 ARG A NH2 
555  N N   . PHE A 78  ? 0.4611 0.4634 0.5114 0.0716  -0.0321 -0.0608 266 PHE A N   
556  C CA  . PHE A 78  ? 0.4347 0.4424 0.4784 0.0716  -0.0346 -0.0523 266 PHE A CA  
557  C C   . PHE A 78  ? 0.4103 0.4247 0.4389 0.0682  -0.0326 -0.0521 266 PHE A C   
558  O O   . PHE A 78  ? 0.4172 0.4378 0.4416 0.0678  -0.0289 -0.0578 266 PHE A O   
559  C CB  . PHE A 78  ? 0.4444 0.4574 0.4972 0.0757  -0.0343 -0.0524 266 PHE A CB  
560  C CG  . PHE A 78  ? 0.5193 0.5266 0.5884 0.0798  -0.0385 -0.0485 266 PHE A CG  
561  C CD1 . PHE A 78  ? 0.5421 0.5471 0.6104 0.0791  -0.0449 -0.0375 266 PHE A CD1 
562  C CD2 . PHE A 78  ? 0.5442 0.5484 0.6294 0.0841  -0.0361 -0.0556 266 PHE A CD2 
563  C CE1 . PHE A 78  ? 0.5844 0.5843 0.6677 0.0827  -0.0500 -0.0319 266 PHE A CE1 
564  C CE2 . PHE A 78  ? 0.5780 0.5762 0.6806 0.0887  -0.0407 -0.0510 266 PHE A CE2 
565  C CZ  . PHE A 78  ? 0.5745 0.5708 0.6763 0.0879  -0.0482 -0.0382 266 PHE A CZ  
566  N N   . ARG A 79  ? 0.4213 0.4346 0.4423 0.0658  -0.0350 -0.0453 267 ARG A N   
567  C CA  . ARG A 79  ? 0.3971 0.4157 0.4065 0.0636  -0.0336 -0.0441 267 ARG A CA  
568  C C   . ARG A 79  ? 0.4572 0.4764 0.4615 0.0635  -0.0352 -0.0372 267 ARG A C   
569  O O   . ARG A 79  ? 0.4225 0.4379 0.4273 0.0625  -0.0377 -0.0319 267 ARG A O   
570  C CB  . ARG A 79  ? 0.3814 0.3994 0.3876 0.0604  -0.0337 -0.0445 267 ARG A CB  
571  C CG  . ARG A 79  ? 0.4331 0.4495 0.4434 0.0591  -0.0327 -0.0522 267 ARG A CG  
572  C CD  . ARG A 79  ? 0.4197 0.4366 0.4274 0.0549  -0.0337 -0.0522 267 ARG A CD  
573  N NE  . ARG A 79  ? 0.4131 0.4383 0.4129 0.0539  -0.0335 -0.0499 267 ARG A NE  
574  C CZ  . ARG A 79  ? 0.4411 0.4707 0.4395 0.0506  -0.0347 -0.0495 267 ARG A CZ  
575  N NH1 . ARG A 79  ? 0.3847 0.4110 0.3877 0.0469  -0.0360 -0.0520 267 ARG A NH1 
576  N NH2 . ARG A 79  ? 0.3639 0.4011 0.3574 0.0509  -0.0349 -0.0465 267 ARG A NH2 
577  N N   . HIS A 80  ? 0.4034 0.4271 0.4025 0.0639  -0.0336 -0.0376 268 HIS A N   
578  C CA  . HIS A 80  ? 0.3328 0.3566 0.3271 0.0634  -0.0348 -0.0330 268 HIS A CA  
579  C C   . HIS A 80  ? 0.2688 0.2955 0.2554 0.0628  -0.0323 -0.0339 268 HIS A C   
580  O O   . HIS A 80  ? 0.3747 0.4044 0.3610 0.0631  -0.0303 -0.0371 268 HIS A O   
581  C CB  . HIS A 80  ? 0.2831 0.3079 0.2845 0.0648  -0.0372 -0.0322 268 HIS A CB  
582  C CG  . HIS A 80  ? 0.3207 0.3454 0.3172 0.0630  -0.0399 -0.0272 268 HIS A CG  
583  N ND1 . HIS A 80  ? 0.2958 0.3231 0.2869 0.0617  -0.0389 -0.0278 268 HIS A ND1 
584  C CD2 . HIS A 80  ? 0.3016 0.3237 0.2969 0.0614  -0.0439 -0.0216 268 HIS A CD2 
585  C CE1 . HIS A 80  ? 0.3146 0.3410 0.3010 0.0592  -0.0420 -0.0240 268 HIS A CE1 
586  N NE2 . HIS A 80  ? 0.3290 0.3529 0.3172 0.0590  -0.0452 -0.0198 268 HIS A NE2 
587  N N   . PRO A 81  ? 0.3020 0.3272 0.2820 0.0617  -0.0321 -0.0310 269 PRO A N   
588  C CA  . PRO A 81  ? 0.2947 0.3203 0.2690 0.0617  -0.0298 -0.0315 269 PRO A CA  
589  C C   . PRO A 81  ? 0.3096 0.3371 0.2847 0.0613  -0.0294 -0.0329 269 PRO A C   
590  O O   . PRO A 81  ? 0.3259 0.3537 0.2977 0.0609  -0.0276 -0.0331 269 PRO A O   
591  C CB  . PRO A 81  ? 0.3038 0.3263 0.2722 0.0604  -0.0294 -0.0296 269 PRO A CB  
592  C CG  . PRO A 81  ? 0.3273 0.3492 0.2966 0.0594  -0.0308 -0.0274 269 PRO A CG  
593  C CD  . PRO A 81  ? 0.3091 0.3316 0.2860 0.0601  -0.0337 -0.0273 269 PRO A CD  
594  N N   . ASN A 82  ? 0.3122 0.3413 0.2925 0.0610  -0.0313 -0.0331 270 ASN A N   
595  C CA  . ASN A 82  ? 0.2691 0.3023 0.2528 0.0602  -0.0306 -0.0346 270 ASN A CA  
596  C C   . ASN A 82  ? 0.3790 0.4173 0.3706 0.0617  -0.0289 -0.0384 270 ASN A C   
597  O O   . ASN A 82  ? 0.3371 0.3808 0.3343 0.0612  -0.0278 -0.0400 270 ASN A O   
598  C CB  . ASN A 82  ? 0.2384 0.2723 0.2242 0.0587  -0.0339 -0.0324 270 ASN A CB  
599  C CG  . ASN A 82  ? 0.2874 0.3164 0.2632 0.0559  -0.0343 -0.0308 270 ASN A CG  
600  O OD1 . ASN A 82  ? 0.3324 0.3591 0.3046 0.0547  -0.0367 -0.0288 270 ASN A OD1 
601  N ND2 . ASN A 82  ? 0.2865 0.3132 0.2574 0.0546  -0.0315 -0.0319 270 ASN A ND2 
602  N N   . ILE A 83  ? 0.3367 0.3738 0.3296 0.0632  -0.0284 -0.0404 271 ILE A N   
603  C CA  . ILE A 83  ? 0.2863 0.3273 0.2847 0.0640  -0.0257 -0.0459 271 ILE A CA  
604  C C   . ILE A 83  ? 0.3690 0.4114 0.3590 0.0622  -0.0234 -0.0478 271 ILE A C   
605  O O   . ILE A 83  ? 0.3590 0.3983 0.3435 0.0618  -0.0250 -0.0451 271 ILE A O   
606  C CB  . ILE A 83  ? 0.3050 0.3429 0.3130 0.0665  -0.0274 -0.0476 271 ILE A CB  
607  C CG1 . ILE A 83  ? 0.3019 0.3399 0.3195 0.0684  -0.0307 -0.0445 271 ILE A CG1 
608  C CG2 . ILE A 83  ? 0.3005 0.3408 0.3134 0.0672  -0.0237 -0.0553 271 ILE A CG2 
609  C CD1 . ILE A 83  ? 0.3229 0.3568 0.3523 0.0713  -0.0330 -0.0448 271 ILE A CD1 
610  N N   . VAL A 84  ? 0.3430 0.3910 0.3320 0.0607  -0.0198 -0.0522 272 VAL A N   
611  C CA  . VAL A 84  ? 0.3652 0.4157 0.3446 0.0579  -0.0186 -0.0532 272 VAL A CA  
612  C C   . VAL A 84  ? 0.3375 0.3855 0.3165 0.0580  -0.0205 -0.0553 272 VAL A C   
613  O O   . VAL A 84  ? 0.3330 0.3781 0.3199 0.0597  -0.0206 -0.0592 272 VAL A O   
614  C CB  . VAL A 84  ? 0.3143 0.3723 0.2917 0.0553  -0.0137 -0.0587 272 VAL A CB  
615  C CG1 . VAL A 84  ? 0.3442 0.4058 0.3213 0.0537  -0.0116 -0.0558 272 VAL A CG1 
616  C CG2 . VAL A 84  ? 0.2839 0.3433 0.2713 0.0572  -0.0109 -0.0672 272 VAL A CG2 
617  N N   . ASP A 85  ? 0.3241 0.3730 0.2954 0.0562  -0.0224 -0.0522 273 ASP A N   
618  C CA  A ASP A 85  ? 0.3948 0.4431 0.3662 0.0552  -0.0247 -0.0539 273 ASP A CA  
619  C CA  B ASP A 85  ? 0.3932 0.4414 0.3646 0.0553  -0.0247 -0.0539 273 ASP A CA  
620  C C   . ASP A 85  ? 0.3972 0.4498 0.3647 0.0517  -0.0229 -0.0613 273 ASP A C   
621  O O   . ASP A 85  ? 0.4525 0.5109 0.4111 0.0486  -0.0219 -0.0613 273 ASP A O   
622  C CB  A ASP A 85  ? 0.4037 0.4531 0.3709 0.0550  -0.0279 -0.0473 273 ASP A CB  
623  C CB  B ASP A 85  ? 0.4069 0.4562 0.3742 0.0550  -0.0279 -0.0474 273 ASP A CB  
624  C CG  A ASP A 85  ? 0.4733 0.5180 0.4437 0.0581  -0.0286 -0.0419 273 ASP A CG  
625  C CG  B ASP A 85  ? 0.4510 0.5006 0.4213 0.0539  -0.0305 -0.0482 273 ASP A CG  
626  O OD1 A ASP A 85  ? 0.4819 0.5261 0.4490 0.0589  -0.0282 -0.0377 273 ASP A OD1 
627  O OD1 B ASP A 85  ? 0.5518 0.6061 0.5192 0.0524  -0.0333 -0.0452 273 ASP A OD1 
628  O OD2 A ASP A 85  ? 0.5650 0.6063 0.5408 0.0592  -0.0292 -0.0419 273 ASP A OD2 
629  O OD2 B ASP A 85  ? 0.4299 0.4751 0.4066 0.0543  -0.0302 -0.0514 273 ASP A OD2 
630  N N   . PHE A 86  ? 0.4206 0.4699 0.3942 0.0517  -0.0225 -0.0676 274 PHE A N   
631  C CA  . PHE A 86  ? 0.4195 0.4716 0.3897 0.0480  -0.0200 -0.0770 274 PHE A CA  
632  C C   . PHE A 86  ? 0.4232 0.4779 0.3868 0.0435  -0.0240 -0.0770 274 PHE A C   
633  O O   . PHE A 86  ? 0.4324 0.4830 0.4017 0.0436  -0.0271 -0.0756 274 PHE A O   
634  C CB  . PHE A 86  ? 0.4172 0.4629 0.3992 0.0505  -0.0173 -0.0847 274 PHE A CB  
635  C CG  . PHE A 86  ? 0.4213 0.4684 0.4009 0.0471  -0.0134 -0.0967 274 PHE A CG  
636  C CD1 . PHE A 86  ? 0.4285 0.4836 0.4003 0.0445  -0.0083 -0.1021 274 PHE A CD1 
637  C CD2 . PHE A 86  ? 0.4333 0.4734 0.4183 0.0458  -0.0142 -0.1031 274 PHE A CD2 
638  C CE1 . PHE A 86  ? 0.4539 0.5108 0.4222 0.0407  -0.0037 -0.1147 274 PHE A CE1 
639  C CE2 . PHE A 86  ? 0.4478 0.4881 0.4303 0.0422  -0.0100 -0.1159 274 PHE A CE2 
640  C CZ  . PHE A 86  ? 0.4713 0.5203 0.4450 0.0397  -0.0045 -0.1222 274 PHE A CZ  
641  N N   . ALA A 87  ? 0.3791 0.4416 0.3307 0.0388  -0.0242 -0.0778 275 ALA A N   
642  C CA  . ALA A 87  ? 0.3922 0.4602 0.3364 0.0336  -0.0290 -0.0769 275 ALA A CA  
643  C C   . ALA A 87  ? 0.4640 0.5330 0.4037 0.0278  -0.0274 -0.0889 275 ALA A C   
644  O O   . ALA A 87  ? 0.4979 0.5729 0.4296 0.0219  -0.0317 -0.0896 275 ALA A O   
645  C CB  . ALA A 87  ? 0.3811 0.4571 0.3140 0.0314  -0.0315 -0.0691 275 ALA A CB  
646  N N   . GLY A 88  ? 0.4516 0.5150 0.3971 0.0295  -0.0214 -0.0987 276 GLY A N   
647  C CA  . GLY A 88  ? 0.4147 0.4772 0.3568 0.0244  -0.0183 -0.1122 276 GLY A CA  
648  C C   . GLY A 88  ? 0.4708 0.5389 0.4040 0.0215  -0.0111 -0.1218 276 GLY A C   
649  O O   . GLY A 88  ? 0.4791 0.5519 0.4100 0.0236  -0.0078 -0.1176 276 GLY A O   
650  N N   . TYR A 89  ? 0.4658 0.5332 0.3945 0.0161  -0.0079 -0.1355 277 TYR A N   
651  C CA  . TYR A 89  ? 0.5102 0.5817 0.4334 0.0138  0.0013  -0.1481 277 TYR A CA  
652  C C   . TYR A 89  ? 0.5410 0.6195 0.4450 0.0031  0.0020  -0.1581 277 TYR A C   
653  O O   . TYR A 89  ? 0.5830 0.6610 0.4815 -0.0024 -0.0048 -0.1580 277 TYR A O   
654  C CB  . TYR A 89  ? 0.5110 0.5717 0.4526 0.0199  0.0078  -0.1593 277 TYR A CB  
655  C CG  . TYR A 89  ? 0.5637 0.6147 0.5090 0.0166  0.0064  -0.1697 277 TYR A CG  
656  C CD1 . TYR A 89  ? 0.5755 0.6176 0.5300 0.0182  -0.0011 -0.1623 277 TYR A CD1 
657  C CD2 . TYR A 89  ? 0.6116 0.6622 0.5507 0.0110  0.0131  -0.1875 277 TYR A CD2 
658  C CE1 . TYR A 89  ? 0.5811 0.6137 0.5393 0.0142  -0.0026 -0.1713 277 TYR A CE1 
659  C CE2 . TYR A 89  ? 0.6312 0.6714 0.5737 0.0073  0.0117  -0.1977 277 TYR A CE2 
660  C CZ  . TYR A 89  ? 0.6511 0.6821 0.6036 0.0087  0.0036  -0.1891 277 TYR A CZ  
661  O OH  . TYR A 89  ? 0.6470 0.6670 0.6034 0.0040  0.0020  -0.1987 277 TYR A OH  
662  N N   . CYS A 90  ? 0.5055 0.5918 0.3990 -0.0006 0.0103  -0.1668 278 CYS A N   
663  C CA  . CYS A 90  ? 0.5380 0.6299 0.4138 -0.0111 0.0135  -0.1807 278 CYS A CA  
664  C C   . CYS A 90  ? 0.6253 0.7173 0.5042 -0.0105 0.0270  -0.1984 278 CYS A C   
665  O O   . CYS A 90  ? 0.6046 0.7045 0.4826 -0.0087 0.0339  -0.1968 278 CYS A O   
666  C CB  . CYS A 90  ? 0.5464 0.6525 0.3979 -0.0202 0.0088  -0.1717 278 CYS A CB  
667  S SG  . CYS A 90  ? 0.8329 0.9489 0.6576 -0.0349 0.0132  -0.1883 278 CYS A SG  
668  N N   . ALA A 91  ? 0.6396 0.7231 0.5238 -0.0120 0.0313  -0.2155 279 ALA A N   
669  C CA  . ALA A 91  ? 0.6790 0.7647 0.5619 -0.0138 0.0449  -0.2352 279 ALA A CA  
670  C C   . ALA A 91  ? 0.7424 0.8296 0.6054 -0.0263 0.0454  -0.2449 279 ALA A C   
671  O O   . ALA A 91  ? 0.7551 0.8307 0.6229 -0.0284 0.0429  -0.2532 279 ALA A O   
672  C CB  . ALA A 91  ? 0.6138 0.6851 0.5252 -0.0031 0.0510  -0.2450 279 ALA A CB  
673  N N   . GLN A 92  ? 0.7183 0.8187 0.5602 -0.0348 0.0486  -0.2427 280 GLN A N   
674  C CA  . GLN A 92  ? 0.7747 0.8779 0.5962 -0.0472 0.0486  -0.2495 280 GLN A CA  
675  C C   . GLN A 92  ? 0.7163 0.8311 0.5239 -0.0527 0.0585  -0.2522 280 GLN A C   
676  O O   . GLN A 92  ? 0.6979 0.8233 0.5010 -0.0517 0.0599  -0.2418 280 GLN A O   
677  C CB  . GLN A 92  ? 0.8813 0.9911 0.6835 -0.0560 0.0344  -0.2377 280 GLN A CB  
678  C CG  . GLN A 92  ? 0.9477 1.0474 0.7586 -0.0555 0.0246  -0.2388 280 GLN A CG  
679  C CD  . GLN A 92  ? 1.0085 1.1179 0.8012 -0.0651 0.0107  -0.2272 280 GLN A CD  
680  O OE1 . GLN A 92  ? 1.0629 1.1826 0.8344 -0.0749 0.0093  -0.2243 280 GLN A OE1 
681  N NE2 . GLN A 92  ? 0.9893 1.0966 0.7915 -0.0621 0.0001  -0.2198 280 GLN A NE2 
682  N N   . ASN A 93  ? 0.7558 0.8690 0.5559 -0.0595 0.0652  -0.2660 281 ASN A N   
683  C CA  . ASN A 93  ? 0.8259 0.9516 0.6084 -0.0676 0.0736  -0.2692 281 ASN A CA  
684  C C   . ASN A 93  ? 0.8495 0.9830 0.6422 -0.0612 0.0838  -0.2666 281 ASN A C   
685  O O   . ASN A 93  ? 0.8969 1.0441 0.6732 -0.0676 0.0858  -0.2588 281 ASN A O   
686  C CB  . ASN A 93  ? 0.8452 0.9829 0.5987 -0.0799 0.0634  -0.2563 281 ASN A CB  
687  C CG  . ASN A 93  ? 0.8874 1.0366 0.6195 -0.0910 0.0708  -0.2612 281 ASN A CG  
688  O OD1 . ASN A 93  ? 0.8971 1.0438 0.6326 -0.0920 0.0822  -0.2779 281 ASN A OD1 
689  N ND2 . ASN A 93  ? 0.8922 1.0541 0.6025 -0.0993 0.0643  -0.2463 281 ASN A ND2 
690  N N   . GLY A 94  ? 0.8846 1.0096 0.7054 -0.0487 0.0896  -0.2721 282 GLY A N   
691  C CA  . GLY A 94  ? 0.8536 0.9861 0.6881 -0.0419 0.0990  -0.2701 282 GLY A CA  
692  C C   . GLY A 94  ? 0.8440 0.9824 0.6800 -0.0376 0.0924  -0.2530 282 GLY A C   
693  O O   . GLY A 94  ? 0.8503 0.9956 0.6985 -0.0322 0.0992  -0.2502 282 GLY A O   
694  N N   . PHE A 95  ? 0.8083 0.9448 0.6326 -0.0404 0.0792  -0.2415 283 PHE A N   
695  C CA  . PHE A 95  ? 0.7621 0.9029 0.5880 -0.0360 0.0721  -0.2255 283 PHE A CA  
696  C C   . PHE A 95  ? 0.7308 0.8598 0.5821 -0.0233 0.0680  -0.2256 283 PHE A C   
697  O O   . PHE A 95  ? 0.7346 0.8520 0.5922 -0.0216 0.0629  -0.2311 283 PHE A O   
698  C CB  . PHE A 95  ? 0.7689 0.9150 0.5701 -0.0449 0.0593  -0.2114 283 PHE A CB  
699  C CG  . PHE A 95  ? 0.8177 0.9769 0.5942 -0.0565 0.0613  -0.2052 283 PHE A CG  
700  C CD1 . PHE A 95  ? 0.8592 1.0208 0.6186 -0.0670 0.0630  -0.2128 283 PHE A CD1 
701  C CD2 . PHE A 95  ? 0.8474 1.0160 0.6175 -0.0575 0.0610  -0.1912 283 PHE A CD2 
702  C CE1 . PHE A 95  ? 0.9070 1.0807 0.6434 -0.0780 0.0644  -0.2064 283 PHE A CE1 
703  C CE2 . PHE A 95  ? 0.8853 1.0649 0.6328 -0.0686 0.0625  -0.1841 283 PHE A CE2 
704  C CZ  . PHE A 95  ? 0.9146 1.0971 0.6453 -0.0788 0.0640  -0.1916 283 PHE A CZ  
705  N N   . TYR A 96  ? 0.6655 0.7979 0.5316 -0.0148 0.0702  -0.2193 284 TYR A N   
706  C CA  . TYR A 96  ? 0.6370 0.7567 0.5281 -0.0028 0.0634  -0.2117 284 TYR A CA  
707  C C   . TYR A 96  ? 0.5951 0.7163 0.4838 -0.0011 0.0532  -0.1892 284 TYR A C   
708  O O   . TYR A 96  ? 0.5669 0.6970 0.4538 -0.0015 0.0566  -0.1817 284 TYR A O   
709  C CB  . TYR A 96  ? 0.6832 0.8005 0.6020 0.0076  0.0730  -0.2205 284 TYR A CB  
710  C CG  . TYR A 96  ? 0.7685 0.8776 0.6974 0.0087  0.0807  -0.2393 284 TYR A CG  
711  C CD1 . TYR A 96  ? 0.8087 0.9015 0.7513 0.0139  0.0753  -0.2436 284 TYR A CD1 
712  C CD2 . TYR A 96  ? 0.8414 0.9571 0.7673 0.0042  0.0921  -0.2491 284 TYR A CD2 
713  C CE1 . TYR A 96  ? 0.8845 0.9666 0.8375 0.0146  0.0810  -0.2569 284 TYR A CE1 
714  C CE2 . TYR A 96  ? 0.9064 1.0125 0.8428 0.0055  0.0981  -0.2633 284 TYR A CE2 
715  C CZ  . TYR A 96  ? 0.9371 1.0259 0.8870 0.0107  0.0924  -0.2670 284 TYR A CZ  
716  O OH  . TYR A 96  ? 1.0058 1.0838 0.9662 0.0118  0.0982  -0.2809 284 TYR A OH  
717  N N   . CYS A 97  ? 0.5940 0.7062 0.4831 0.0005  0.0413  -0.1792 285 CYS A N   
718  C CA  . CYS A 97  ? 0.5316 0.6446 0.4170 0.0015  0.0316  -0.1592 285 CYS A CA  
719  C C   . CYS A 97  ? 0.5107 0.6114 0.4145 0.0105  0.0235  -0.1505 285 CYS A C   
720  O O   . CYS A 97  ? 0.5006 0.5923 0.4116 0.0122  0.0205  -0.1560 285 CYS A O   
721  C CB  . CYS A 97  ? 0.5488 0.6681 0.4098 -0.0084 0.0241  -0.1526 285 CYS A CB  
722  S SG  . CYS A 97  ? 0.7708 0.9062 0.6051 -0.0209 0.0318  -0.1575 285 CYS A SG  
723  N N   . LEU A 98  ? 0.5145 0.6150 0.4249 0.0155  0.0204  -0.1369 286 LEU A N   
724  C CA  . LEU A 98  ? 0.5038 0.5945 0.4280 0.0228  0.0129  -0.1270 286 LEU A CA  
725  C C   . LEU A 98  ? 0.4630 0.5558 0.3769 0.0208  0.0048  -0.1114 286 LEU A C   
726  O O   . LEU A 98  ? 0.4453 0.5448 0.3499 0.0178  0.0060  -0.1049 286 LEU A O   
727  C CB  . LEU A 98  ? 0.5210 0.6087 0.4647 0.0310  0.0166  -0.1261 286 LEU A CB  
728  C CG  . LEU A 98  ? 0.5699 0.6548 0.5280 0.0345  0.0241  -0.1410 286 LEU A CG  
729  C CD1 . LEU A 98  ? 0.5213 0.6091 0.4972 0.0411  0.0292  -0.1409 286 LEU A CD1 
730  C CD2 . LEU A 98  ? 0.5976 0.6697 0.5657 0.0380  0.0191  -0.1433 286 LEU A CD2 
731  N N   . VAL A 99  ? 0.4540 0.5410 0.3704 0.0223  -0.0033 -0.1054 287 VAL A N   
732  C CA  . VAL A 99  ? 0.4194 0.5083 0.3288 0.0214  -0.0109 -0.0914 287 VAL A CA  
733  C C   . VAL A 99  ? 0.4157 0.4968 0.3392 0.0292  -0.0140 -0.0829 287 VAL A C   
734  O O   . VAL A 99  ? 0.3989 0.4729 0.3347 0.0335  -0.0142 -0.0863 287 VAL A O   
735  C CB  . VAL A 99  ? 0.3986 0.4902 0.2995 0.0163  -0.0179 -0.0907 287 VAL A CB  
736  C CG1 . VAL A 99  ? 0.3561 0.4513 0.2515 0.0159  -0.0256 -0.0760 287 VAL A CG1 
737  C CG2 . VAL A 99  ? 0.4183 0.5173 0.3042 0.0075  -0.0147 -0.1015 287 VAL A CG2 
738  N N   . TYR A 100 ? 0.3544 0.4363 0.2756 0.0306  -0.0160 -0.0720 288 TYR A N   
739  C CA  . TYR A 100 ? 0.3781 0.4529 0.3102 0.0369  -0.0184 -0.0645 288 TYR A CA  
740  C C   . TYR A 100 ? 0.3807 0.4555 0.3084 0.0372  -0.0242 -0.0527 288 TYR A C   
741  O O   . TYR A 100 ? 0.3700 0.4502 0.2866 0.0328  -0.0259 -0.0481 288 TYR A O   
742  C CB  . TYR A 100 ? 0.3724 0.4460 0.3106 0.0396  -0.0136 -0.0645 288 TYR A CB  
743  C CG  . TYR A 100 ? 0.3811 0.4572 0.3253 0.0398  -0.0069 -0.0752 288 TYR A CG  
744  C CD1 . TYR A 100 ? 0.3859 0.4564 0.3449 0.0452  -0.0061 -0.0792 288 TYR A CD1 
745  C CD2 . TYR A 100 ? 0.4040 0.4883 0.3397 0.0347  -0.0012 -0.0808 288 TYR A CD2 
746  C CE1 . TYR A 100 ? 0.3797 0.4525 0.3476 0.0466  -0.0001 -0.0887 288 TYR A CE1 
747  C CE2 . TYR A 100 ? 0.4140 0.5016 0.3577 0.0356  0.0061  -0.0917 288 TYR A CE2 
748  C CZ  . TYR A 100 ? 0.4171 0.4987 0.3782 0.0421  0.0065  -0.0956 288 TYR A CZ  
749  O OH  . TYR A 100 ? 0.4468 0.5317 0.4190 0.0442  0.0136  -0.1061 288 TYR A OH  
750  N N   . GLY A 101 ? 0.3912 0.4600 0.3278 0.0423  -0.0270 -0.0477 289 GLY A N   
751  C CA  . GLY A 101 ? 0.3792 0.4467 0.3150 0.0441  -0.0309 -0.0375 289 GLY A CA  
752  C C   . GLY A 101 ? 0.4159 0.4825 0.3466 0.0428  -0.0286 -0.0330 289 GLY A C   
753  O O   . GLY A 101 ? 0.3936 0.4584 0.3273 0.0433  -0.0241 -0.0365 289 GLY A O   
754  N N   . PHE A 102 ? 0.4278 0.4962 0.3518 0.0409  -0.0321 -0.0246 290 PHE A N   
755  C CA  . PHE A 102 ? 0.3876 0.4547 0.3058 0.0384  -0.0303 -0.0190 290 PHE A CA  
756  C C   . PHE A 102 ? 0.4250 0.4827 0.3512 0.0427  -0.0291 -0.0159 290 PHE A C   
757  O O   . PHE A 102 ? 0.4534 0.5058 0.3870 0.0477  -0.0315 -0.0136 290 PHE A O   
758  C CB  . PHE A 102 ? 0.3739 0.4442 0.2832 0.0351  -0.0356 -0.0092 290 PHE A CB  
759  C CG  . PHE A 102 ? 0.3861 0.4554 0.2872 0.0306  -0.0340 -0.0027 290 PHE A CG  
760  C CD1 . PHE A 102 ? 0.4069 0.4826 0.2991 0.0242  -0.0284 -0.0078 290 PHE A CD1 
761  C CD2 . PHE A 102 ? 0.4122 0.4739 0.3155 0.0325  -0.0374 0.0083  290 PHE A CD2 
762  C CE1 . PHE A 102 ? 0.4357 0.5114 0.3203 0.0189  -0.0264 -0.0012 290 PHE A CE1 
763  C CE2 . PHE A 102 ? 0.4526 0.5121 0.3485 0.0275  -0.0361 0.0152  290 PHE A CE2 
764  C CZ  . PHE A 102 ? 0.4295 0.4965 0.3155 0.0202  -0.0306 0.0108  290 PHE A CZ  
765  N N   . LEU A 103 ? 0.4327 0.4893 0.3576 0.0402  -0.0249 -0.0166 291 LEU A N   
766  C CA  . LEU A 103 ? 0.3959 0.4440 0.3272 0.0427  -0.0237 -0.0148 291 LEU A CA  
767  C C   . LEU A 103 ? 0.4585 0.5035 0.3843 0.0385  -0.0232 -0.0074 291 LEU A C   
768  O O   . LEU A 103 ? 0.4910 0.5398 0.4143 0.0338  -0.0191 -0.0092 291 LEU A O   
769  C CB  . LEU A 103 ? 0.4011 0.4508 0.3391 0.0435  -0.0197 -0.0227 291 LEU A CB  
770  C CG  . LEU A 103 ? 0.3806 0.4304 0.3253 0.0478  -0.0207 -0.0285 291 LEU A CG  
771  C CD1 . LEU A 103 ? 0.2926 0.3455 0.2444 0.0483  -0.0175 -0.0355 291 LEU A CD1 
772  C CD2 . LEU A 103 ? 0.3261 0.3680 0.2753 0.0522  -0.0235 -0.0254 291 LEU A CD2 
773  N N   . PRO A 104 ? 0.4072 0.4450 0.3324 0.0401  -0.0273 0.0012  292 PRO A N   
774  C CA  . PRO A 104 ? 0.4999 0.5336 0.4191 0.0360  -0.0286 0.0110  292 PRO A CA  
775  C C   . PRO A 104 ? 0.4714 0.5005 0.3905 0.0316  -0.0246 0.0114  292 PRO A C   
776  O O   . PRO A 104 ? 0.4693 0.4986 0.3811 0.0255  -0.0244 0.0184  292 PRO A O   
777  C CB  . PRO A 104 ? 0.4778 0.5018 0.4033 0.0419  -0.0334 0.0178  292 PRO A CB  
778  C CG  . PRO A 104 ? 0.5041 0.5329 0.4352 0.0473  -0.0352 0.0127  292 PRO A CG  
779  C CD  . PRO A 104 ? 0.4345 0.4675 0.3671 0.0468  -0.0307 0.0021  292 PRO A CD  
780  N N   . ASN A 105 ? 0.4377 0.4632 0.3644 0.0337  -0.0220 0.0049  293 ASN A N   
781  C CA  . ASN A 105 ? 0.4707 0.4923 0.3985 0.0288  -0.0190 0.0054  293 ASN A CA  
782  C C   . ASN A 105 ? 0.4148 0.4490 0.3424 0.0238  -0.0140 -0.0004 293 ASN A C   
783  O O   . ASN A 105 ? 0.4098 0.4438 0.3401 0.0193  -0.0113 -0.0007 293 ASN A O   
784  C CB  . ASN A 105 ? 0.4785 0.4899 0.4142 0.0325  -0.0194 0.0018  293 ASN A CB  
785  C CG  . ASN A 105 ? 0.5421 0.5385 0.4787 0.0345  -0.0220 0.0082  293 ASN A CG  
786  O OD1 . ASN A 105 ? 0.5905 0.5814 0.5234 0.0305  -0.0227 0.0162  293 ASN A OD1 
787  N ND2 . ASN A 105 ? 0.5109 0.5004 0.4530 0.0408  -0.0230 0.0048  293 ASN A ND2 
788  N N   . GLY A 106 ? 0.4054 0.4505 0.3308 0.0245  -0.0125 -0.0055 294 GLY A N   
789  C CA  . GLY A 106 ? 0.3925 0.4503 0.3182 0.0201  -0.0068 -0.0114 294 GLY A CA  
790  C C   . GLY A 106 ? 0.3707 0.4319 0.3089 0.0223  -0.0044 -0.0188 294 GLY A C   
791  O O   . GLY A 106 ? 0.4165 0.4711 0.3613 0.0275  -0.0076 -0.0206 294 GLY A O   
792  N N   . SER A 107 ? 0.3530 0.4255 0.2946 0.0179  0.0012  -0.0229 295 SER A N   
793  C CA  . SER A 107 ? 0.3941 0.4728 0.3498 0.0200  0.0031  -0.0294 295 SER A CA  
794  C C   . SER A 107 ? 0.4199 0.4937 0.3811 0.0171  0.0013  -0.0258 295 SER A C   
795  O O   . SER A 107 ? 0.4149 0.4833 0.3698 0.0114  0.0013  -0.0193 295 SER A O   
796  C CB  . SER A 107 ? 0.4008 0.4954 0.3610 0.0169  0.0104  -0.0359 295 SER A CB  
797  O OG  . SER A 107 ? 0.4459 0.5458 0.4010 0.0084  0.0147  -0.0316 295 SER A OG  
798  N N   . LEU A 108 ? 0.3975 0.4731 0.3706 0.0205  -0.0006 -0.0300 296 LEU A N   
799  C CA  . LEU A 108 ? 0.3659 0.4404 0.3455 0.0167  -0.0023 -0.0284 296 LEU A CA  
800  C C   . LEU A 108 ? 0.3996 0.4855 0.3830 0.0089  0.0031  -0.0277 296 LEU A C   
801  O O   . LEU A 108 ? 0.3648 0.4467 0.3475 0.0024  0.0025  -0.0236 296 LEU A O   
802  C CB  . LEU A 108 ? 0.3406 0.4187 0.3324 0.0215  -0.0058 -0.0328 296 LEU A CB  
803  C CG  . LEU A 108 ? 0.2960 0.3764 0.2959 0.0170  -0.0084 -0.0320 296 LEU A CG  
804  C CD1 . LEU A 108 ? 0.2855 0.3503 0.2755 0.0134  -0.0118 -0.0280 296 LEU A CD1 
805  C CD2 . LEU A 108 ? 0.2613 0.3474 0.2731 0.0218  -0.0128 -0.0352 296 LEU A CD2 
806  N N   . GLU A 109 ? 0.3606 0.4606 0.3479 0.0090  0.0090  -0.0323 297 GLU A N   
807  C CA  . GLU A 109 ? 0.4103 0.5239 0.4013 0.0013  0.0159  -0.0325 297 GLU A CA  
808  C C   . GLU A 109 ? 0.4420 0.5486 0.4181 -0.0071 0.0172  -0.0242 297 GLU A C   
809  O O   . GLU A 109 ? 0.4104 0.5196 0.3890 -0.0151 0.0190  -0.0205 297 GLU A O   
810  C CB  . GLU A 109 ? 0.3703 0.4991 0.3658 0.0033  0.0232  -0.0402 297 GLU A CB  
811  C CG  . GLU A 109 ? 0.4593 0.6054 0.4610 -0.0044 0.0319  -0.0419 297 GLU A CG  
812  C CD  . GLU A 109 ? 0.5640 0.7246 0.5687 -0.0025 0.0405  -0.0512 297 GLU A CD  
813  O OE1 . GLU A 109 ? 0.6251 0.8016 0.6483 -0.0014 0.0460  -0.0578 297 GLU A OE1 
814  O OE2 . GLU A 109 ? 0.6049 0.7612 0.5941 -0.0023 0.0419  -0.0521 297 GLU A OE2 
815  N N   . ASP A 110 ? 0.4275 0.5251 0.3889 -0.0055 0.0156  -0.0206 298 ASP A N   
816  C CA  . ASP A 110 ? 0.4549 0.5448 0.4022 -0.0127 0.0155  -0.0110 298 ASP A CA  
817  C C   . ASP A 110 ? 0.4640 0.5371 0.4115 -0.0143 0.0099  -0.0043 298 ASP A C   
818  O O   . ASP A 110 ? 0.4562 0.5260 0.4006 -0.0227 0.0112  0.0022  298 ASP A O   
819  C CB  . ASP A 110 ? 0.4733 0.5586 0.4064 -0.0100 0.0136  -0.0081 298 ASP A CB  
820  C CG  . ASP A 110 ? 0.5550 0.6562 0.4832 -0.0121 0.0202  -0.0139 298 ASP A CG  
821  O OD1 . ASP A 110 ? 0.5694 0.6847 0.5023 -0.0178 0.0276  -0.0176 298 ASP A OD1 
822  O OD2 . ASP A 110 ? 0.6188 0.7190 0.5386 -0.0086 0.0183  -0.0154 298 ASP A OD2 
823  N N   . ARG A 111 ? 0.4009 0.4629 0.3518 -0.0067 0.0042  -0.0065 299 ARG A N   
824  C CA  . ARG A 111 ? 0.4456 0.4910 0.3964 -0.0079 -0.0003 -0.0023 299 ARG A CA  
825  C C   . ARG A 111 ? 0.4099 0.4589 0.3693 -0.0153 0.0010  -0.0035 299 ARG A C   
826  O O   . ARG A 111 ? 0.4582 0.4956 0.4150 -0.0214 -0.0001 0.0018  299 ARG A O   
827  C CB  . ARG A 111 ? 0.4754 0.5112 0.4283 0.0010  -0.0052 -0.0062 299 ARG A CB  
828  C CG  . ARG A 111 ? 0.5312 0.5600 0.4763 0.0073  -0.0075 -0.0033 299 ARG A CG  
829  C CD  . ARG A 111 ? 0.6049 0.6222 0.5416 0.0036  -0.0087 0.0065  299 ARG A CD  
830  N NE  . ARG A 111 ? 0.6948 0.6945 0.6320 0.0083  -0.0127 0.0087  299 ARG A NE  
831  C CZ  . ARG A 111 ? 0.7903 0.7770 0.7301 0.0052  -0.0135 0.0095  299 ARG A CZ  
832  N NH1 . ARG A 111 ? 0.8117 0.8015 0.7539 -0.0033 -0.0113 0.0092  299 ARG A NH1 
833  N NH2 . ARG A 111 ? 0.8318 0.8028 0.7726 0.0102  -0.0161 0.0098  299 ARG A NH2 
834  N N   . LEU A 112 ? 0.4240 0.4890 0.3951 -0.0147 0.0029  -0.0102 300 LEU A N   
835  C CA  . LEU A 112 ? 0.4543 0.5263 0.4357 -0.0221 0.0036  -0.0113 300 LEU A CA  
836  C C   . LEU A 112 ? 0.5295 0.6108 0.5103 -0.0325 0.0098  -0.0069 300 LEU A C   
837  O O   . LEU A 112 ? 0.5594 0.6346 0.5404 -0.0413 0.0093  -0.0025 300 LEU A O   
838  C CB  . LEU A 112 ? 0.3841 0.4721 0.3808 -0.0177 0.0030  -0.0188 300 LEU A CB  
839  C CG  . LEU A 112 ? 0.3881 0.4687 0.3874 -0.0106 -0.0039 -0.0222 300 LEU A CG  
840  C CD1 . LEU A 112 ? 0.3472 0.4448 0.3620 -0.0060 -0.0044 -0.0277 300 LEU A CD1 
841  C CD2 . LEU A 112 ? 0.3641 0.4325 0.3615 -0.0162 -0.0087 -0.0208 300 LEU A CD2 
842  N N   . HIS A 113 ? 0.5592 0.6559 0.5397 -0.0322 0.0161  -0.0089 301 HIS A N   
843  C CA  . HIS A 113 ? 0.5492 0.6603 0.5313 -0.0423 0.0236  -0.0067 301 HIS A CA  
844  C C   . HIS A 113 ? 0.6886 0.7939 0.6536 -0.0495 0.0267  0.0023  301 HIS A C   
845  O O   . HIS A 113 ? 0.7156 0.8310 0.6802 -0.0600 0.0328  0.0058  301 HIS A O   
846  C CB  . HIS A 113 ? 0.4520 0.5861 0.4456 -0.0389 0.0301  -0.0155 301 HIS A CB  
847  C CG  . HIS A 113 ? 0.4426 0.5834 0.4545 -0.0316 0.0263  -0.0227 301 HIS A CG  
848  N ND1 . HIS A 113 ? 0.4371 0.5803 0.4616 -0.0357 0.0226  -0.0222 301 HIS A ND1 
849  C CD2 . HIS A 113 ? 0.4122 0.5572 0.4316 -0.0211 0.0249  -0.0297 301 HIS A CD2 
850  C CE1 . HIS A 113 ? 0.4796 0.6292 0.5182 -0.0279 0.0186  -0.0280 301 HIS A CE1 
851  N NE2 . HIS A 113 ? 0.4219 0.5721 0.4581 -0.0187 0.0200  -0.0322 301 HIS A NE2 
852  N N   . CYS A 114 ? 0.7161 0.8061 0.6674 -0.0447 0.0223  0.0069  302 CYS A N   
853  C CA  . CYS A 114 ? 0.8383 0.9251 0.7731 -0.0509 0.0244  0.0162  302 CYS A CA  
854  C C   . CYS A 114 ? 0.9214 0.9892 0.8507 -0.0578 0.0203  0.0277  302 CYS A C   
855  O O   . CYS A 114 ? 0.8827 0.9310 0.8110 -0.0522 0.0134  0.0304  302 CYS A O   
856  C CB  . CYS A 114 ? 0.8763 0.9590 0.8000 -0.0429 0.0213  0.0162  302 CYS A CB  
857  S SG  . CYS A 114 ? 1.0303 1.1101 0.9323 -0.0504 0.0216  0.0288  302 CYS A SG  
858  N N   . GLN A 115 ? 0.9530 1.0268 0.8795 -0.0701 0.0253  0.0340  303 GLN A N   
859  C CA  . GLN A 115 ? 1.1123 1.1680 1.0341 -0.0784 0.0223  0.0457  303 GLN A CA  
860  C C   . GLN A 115 ? 1.2156 1.2619 1.1198 -0.0803 0.0200  0.0581  303 GLN A C   
861  O O   . GLN A 115 ? 1.2163 1.2714 1.1117 -0.0756 0.0207  0.0565  303 GLN A O   
862  C CB  . GLN A 115 ? 1.1783 1.2452 1.1063 -0.0922 0.0285  0.0475  303 GLN A CB  
863  C CG  . GLN A 115 ? 1.2059 1.2922 1.1520 -0.0910 0.0324  0.0351  303 GLN A CG  
864  C CD  . GLN A 115 ? 1.2516 1.3614 1.2025 -0.1027 0.0421  0.0348  303 GLN A CD  
865  O OE1 . GLN A 115 ? 1.2745 1.3832 1.2150 -0.1143 0.0458  0.0450  303 GLN A OE1 
866  N NE2 . GLN A 115 ? 1.2539 1.3857 1.2213 -0.0997 0.0466  0.0236  303 GLN A NE2 
867  N N   . THR A 116 ? 1.2286 1.2564 1.1283 -0.0871 0.0166  0.0705  304 THR A N   
868  C CA  . THR A 116 ? 1.2762 1.2962 1.1597 -0.0919 0.0142  0.0856  304 THR A CA  
869  C C   . THR A 116 ? 1.2833 1.2940 1.1602 -0.0801 0.0069  0.0881  304 THR A C   
870  O O   . THR A 116 ? 1.3004 1.3033 1.1654 -0.0826 0.0027  0.1016  304 THR A O   
871  C CB  . THR A 116 ? 1.6064 1.6491 1.4779 -0.1028 0.0223  0.0884  304 THR A CB  
872  O OG1 . THR A 116 ? 1.6083 1.6694 1.4771 -0.0955 0.0254  0.0773  304 THR A OG1 
873  C CG2 . THR A 116 ? 1.5896 1.6453 1.4696 -0.1147 0.0305  0.0855  304 THR A CG2 
874  N N   . GLN A 117 ? 1.3169 1.3295 1.2022 -0.0677 0.0050  0.0759  305 GLN A N   
875  C CA  . GLN A 117 ? 1.2779 1.2859 1.1584 -0.0570 -0.0010 0.0769  305 GLN A CA  
876  C C   . GLN A 117 ? 1.1848 1.1737 1.0759 -0.0458 -0.0073 0.0741  305 GLN A C   
877  O O   . GLN A 117 ? 1.1341 1.1248 1.0356 -0.0398 -0.0061 0.0619  305 GLN A O   
878  C CB  . GLN A 117 ? 1.3100 1.3391 1.1885 -0.0524 0.0028  0.0653  305 GLN A CB  
879  C CG  . GLN A 117 ? 1.3466 1.3948 1.2115 -0.0621 0.0090  0.0674  305 GLN A CG  
880  C CD  . GLN A 117 ? 1.3612 1.4256 1.2225 -0.0564 0.0113  0.0565  305 GLN A CD  
881  O OE1 . GLN A 117 ? 1.3691 1.4292 1.2365 -0.0453 0.0069  0.0502  305 GLN A OE1 
882  N NE2 . GLN A 117 ? 1.3810 1.4642 1.2323 -0.0645 0.0189  0.0538  305 GLN A NE2 
883  N N   . ALA A 118 ? 1.2139 1.1851 1.1024 -0.0431 -0.0138 0.0858  306 ALA A N   
884  C CA  . ALA A 118 ? 1.1449 1.1012 1.0417 -0.0307 -0.0195 0.0837  306 ALA A CA  
885  C C   . ALA A 118 ? 1.1070 1.0527 1.0165 -0.0265 -0.0183 0.0727  306 ALA A C   
886  O O   . ALA A 118 ? 1.1217 1.0537 1.0354 -0.0322 -0.0176 0.0747  306 ALA A O   
887  C CB  . ALA A 118 ? 1.1078 1.0773 1.0020 -0.0220 -0.0213 0.0782  306 ALA A CB  
888  N N   . CYS A 119 ? 1.0545 1.0067 0.9690 -0.0172 -0.0183 0.0612  307 CYS A N   
889  C CA  . CYS A 119 ? 0.9965 0.9385 0.9209 -0.0112 -0.0185 0.0512  307 CYS A CA  
890  C C   . CYS A 119 ? 0.9173 0.8567 0.8464 -0.0189 -0.0153 0.0454  307 CYS A C   
891  O O   . CYS A 119 ? 0.9214 0.8746 0.8488 -0.0274 -0.0116 0.0449  307 CYS A O   
892  C CB  . CYS A 119 ? 0.9884 0.9433 0.9152 -0.0025 -0.0182 0.0405  307 CYS A CB  
893  S SG  . CYS A 119 ? 1.5546 1.5361 1.4768 -0.0064 -0.0139 0.0353  307 CYS A SG  
894  N N   . PRO A 120 ? 0.9041 0.8264 0.8395 -0.0163 -0.0166 0.0405  308 PRO A N   
895  C CA  . PRO A 120 ? 0.8339 0.7527 0.7738 -0.0232 -0.0148 0.0332  308 PRO A CA  
896  C C   . PRO A 120 ? 0.7151 0.6544 0.6578 -0.0229 -0.0130 0.0226  308 PRO A C   
897  O O   . PRO A 120 ? 0.6666 0.6181 0.6085 -0.0154 -0.0131 0.0194  308 PRO A O   
898  C CB  . PRO A 120 ? 0.8672 0.7641 0.8114 -0.0175 -0.0167 0.0284  308 PRO A CB  
899  C CG  . PRO A 120 ? 0.9299 0.8149 0.8737 -0.0104 -0.0192 0.0377  308 PRO A CG  
900  C CD  . PRO A 120 ? 0.9066 0.8111 0.8453 -0.0069 -0.0198 0.0419  308 PRO A CD  
901  N N   . PRO A 121 ? 0.6738 0.6170 0.6207 -0.0313 -0.0117 0.0179  309 PRO A N   
902  C CA  . PRO A 121 ? 0.5911 0.5530 0.5432 -0.0306 -0.0112 0.0086  309 PRO A CA  
903  C C   . PRO A 121 ? 0.4911 0.4498 0.4438 -0.0210 -0.0138 0.0005  309 PRO A C   
904  O O   . PRO A 121 ? 0.5036 0.4439 0.4542 -0.0175 -0.0153 -0.0008 309 PRO A O   
905  C CB  . PRO A 121 ? 0.6071 0.5688 0.5643 -0.0419 -0.0110 0.0063  309 PRO A CB  
906  C CG  . PRO A 121 ? 0.6454 0.5946 0.5996 -0.0502 -0.0096 0.0159  309 PRO A CG  
907  C CD  . PRO A 121 ? 0.6574 0.5884 0.6058 -0.0424 -0.0113 0.0216  309 PRO A CD  
908  N N   . LEU A 122 ? 0.4353 0.4114 0.3913 -0.0170 -0.0139 -0.0049 310 LEU A N   
909  C CA  . LEU A 122 ? 0.4429 0.4180 0.3993 -0.0100 -0.0164 -0.0123 310 LEU A CA  
910  C C   . LEU A 122 ? 0.4451 0.4124 0.4025 -0.0160 -0.0186 -0.0178 310 LEU A C   
911  O O   . LEU A 122 ? 0.4647 0.4399 0.4269 -0.0246 -0.0189 -0.0184 310 LEU A O   
912  C CB  . LEU A 122 ? 0.4103 0.4054 0.3714 -0.0058 -0.0165 -0.0157 310 LEU A CB  
913  C CG  . LEU A 122 ? 0.4357 0.4386 0.3949 0.0003  -0.0145 -0.0127 310 LEU A CG  
914  C CD1 . LEU A 122 ? 0.3626 0.3845 0.3287 0.0029  -0.0139 -0.0169 310 LEU A CD1 
915  C CD2 . LEU A 122 ? 0.4049 0.3963 0.3588 0.0086  -0.0161 -0.0124 310 LEU A CD2 
916  N N   . SER A 123 ? 0.4314 0.3844 0.3845 -0.0121 -0.0198 -0.0225 311 SER A N   
917  C CA  . SER A 123 ? 0.4431 0.3885 0.3948 -0.0185 -0.0217 -0.0292 311 SER A CA  
918  C C   . SER A 123 ? 0.3941 0.3562 0.3480 -0.0189 -0.0251 -0.0342 311 SER A C   
919  O O   . SER A 123 ? 0.4136 0.3906 0.3710 -0.0131 -0.0254 -0.0326 311 SER A O   
920  C CB  . SER A 123 ? 0.4502 0.3750 0.3963 -0.0144 -0.0207 -0.0338 311 SER A CB  
921  O OG  . SER A 123 ? 0.5313 0.4604 0.4750 -0.0048 -0.0206 -0.0363 311 SER A OG  
922  N N   . TRP A 124 ? 0.3685 0.3278 0.3203 -0.0259 -0.0280 -0.0401 312 TRP A N   
923  C CA  . TRP A 124 ? 0.3910 0.3658 0.3444 -0.0267 -0.0327 -0.0436 312 TRP A CA  
924  C C   . TRP A 124 ? 0.4240 0.3985 0.3714 -0.0178 -0.0332 -0.0462 312 TRP A C   
925  O O   . TRP A 124 ? 0.4805 0.4704 0.4322 -0.0137 -0.0358 -0.0446 312 TRP A O   
926  C CB  . TRP A 124 ? 0.3582 0.3304 0.3092 -0.0379 -0.0367 -0.0490 312 TRP A CB  
927  C CG  . TRP A 124 ? 0.3994 0.3802 0.3599 -0.0477 -0.0375 -0.0459 312 TRP A CG  
928  C CD1 . TRP A 124 ? 0.3893 0.3575 0.3489 -0.0575 -0.0364 -0.0468 312 TRP A CD1 
929  C CD2 . TRP A 124 ? 0.3934 0.3976 0.3669 -0.0486 -0.0390 -0.0416 312 TRP A CD2 
930  N NE1 . TRP A 124 ? 0.4126 0.3960 0.3833 -0.0653 -0.0372 -0.0428 312 TRP A NE1 
931  C CE2 . TRP A 124 ? 0.4065 0.4128 0.3863 -0.0597 -0.0385 -0.0399 312 TRP A CE2 
932  C CE3 . TRP A 124 ? 0.3849 0.4080 0.3664 -0.0412 -0.0403 -0.0393 312 TRP A CE3 
933  C CZ2 . TRP A 124 ? 0.3884 0.4172 0.3829 -0.0634 -0.0386 -0.0363 312 TRP A CZ2 
934  C CZ3 . TRP A 124 ? 0.4119 0.4557 0.4083 -0.0441 -0.0405 -0.0363 312 TRP A CZ3 
935  C CH2 . TRP A 124 ? 0.3357 0.3833 0.3388 -0.0550 -0.0394 -0.0349 312 TRP A CH2 
936  N N   . PRO A 125 ? 0.4358 0.3930 0.3745 -0.0147 -0.0305 -0.0503 313 PRO A N   
937  C CA  . PRO A 125 ? 0.4093 0.3678 0.3432 -0.0064 -0.0299 -0.0521 313 PRO A CA  
938  C C   . PRO A 125 ? 0.3859 0.3540 0.3258 0.0024  -0.0286 -0.0460 313 PRO A C   
939  O O   . PRO A 125 ? 0.4872 0.4649 0.4272 0.0068  -0.0304 -0.0457 313 PRO A O   
940  C CB  . PRO A 125 ? 0.4123 0.3508 0.3394 -0.0042 -0.0254 -0.0570 313 PRO A CB  
941  C CG  . PRO A 125 ? 0.4602 0.3871 0.3851 -0.0141 -0.0257 -0.0612 313 PRO A CG  
942  C CD  . PRO A 125 ? 0.4621 0.3984 0.3957 -0.0190 -0.0277 -0.0545 313 PRO A CD  
943  N N   . GLN A 126 ? 0.4001 0.3651 0.3441 0.0042  -0.0258 -0.0410 314 GLN A N   
944  C CA  . GLN A 126 ? 0.3693 0.3431 0.3175 0.0113  -0.0245 -0.0360 314 GLN A CA  
945  C C   . GLN A 126 ? 0.4395 0.4322 0.3948 0.0105  -0.0268 -0.0346 314 GLN A C   
946  O O   . GLN A 126 ? 0.4319 0.4329 0.3894 0.0165  -0.0272 -0.0340 314 GLN A O   
947  C CB  . GLN A 126 ? 0.3900 0.3567 0.3392 0.0114  -0.0216 -0.0303 314 GLN A CB  
948  C CG  . GLN A 126 ? 0.3943 0.3430 0.3400 0.0155  -0.0196 -0.0305 314 GLN A CG  
949  C CD  . GLN A 126 ? 0.4842 0.4244 0.4312 0.0150  -0.0182 -0.0232 314 GLN A CD  
950  O OE1 . GLN A 126 ? 0.4872 0.4323 0.4357 0.0090  -0.0182 -0.0185 314 GLN A OE1 
951  N NE2 . GLN A 126 ? 0.5062 0.4341 0.4533 0.0212  -0.0171 -0.0215 314 GLN A NE2 
952  N N   . ARG A 127 ? 0.3925 0.3918 0.3528 0.0029  -0.0281 -0.0344 315 ARG A N   
953  C CA  . ARG A 127 ? 0.3788 0.3968 0.3490 0.0023  -0.0302 -0.0337 315 ARG A CA  
954  C C   . ARG A 127 ? 0.3614 0.3856 0.3323 0.0053  -0.0349 -0.0359 315 ARG A C   
955  O O   . ARG A 127 ? 0.3751 0.4108 0.3533 0.0105  -0.0359 -0.0347 315 ARG A O   
956  C CB  . ARG A 127 ? 0.3709 0.3952 0.3476 -0.0073 -0.0310 -0.0333 315 ARG A CB  
957  C CG  . ARG A 127 ? 0.3475 0.3706 0.3255 -0.0107 -0.0261 -0.0293 315 ARG A CG  
958  C CD  . ARG A 127 ? 0.3535 0.3794 0.3364 -0.0218 -0.0265 -0.0289 315 ARG A CD  
959  N NE  . ARG A 127 ? 0.4081 0.4266 0.3883 -0.0261 -0.0219 -0.0241 315 ARG A NE  
960  C CZ  . ARG A 127 ? 0.3824 0.4132 0.3695 -0.0317 -0.0184 -0.0208 315 ARG A CZ  
961  N NH1 . ARG A 127 ? 0.3852 0.4371 0.3848 -0.0330 -0.0187 -0.0226 315 ARG A NH1 
962  N NH2 . ARG A 127 ? 0.3811 0.4035 0.3632 -0.0361 -0.0146 -0.0152 315 ARG A NH2 
963  N N   . LEU A 128 ? 0.3465 0.3623 0.3091 0.0017  -0.0378 -0.0392 316 LEU A N   
964  C CA  . LEU A 128 ? 0.3728 0.3932 0.3327 0.0032  -0.0426 -0.0403 316 LEU A CA  
965  C C   . LEU A 128 ? 0.4071 0.4254 0.3642 0.0121  -0.0407 -0.0393 316 LEU A C   
966  O O   . LEU A 128 ? 0.4043 0.4319 0.3662 0.0155  -0.0439 -0.0372 316 LEU A O   
967  C CB  . LEU A 128 ? 0.3954 0.4062 0.3436 -0.0035 -0.0449 -0.0451 316 LEU A CB  
968  C CG  . LEU A 128 ? 0.4401 0.4562 0.3824 -0.0042 -0.0505 -0.0456 316 LEU A CG  
969  C CD1 . LEU A 128 ? 0.3999 0.4342 0.3548 -0.0046 -0.0572 -0.0408 316 LEU A CD1 
970  C CD2 . LEU A 128 ? 0.4462 0.4536 0.3752 -0.0128 -0.0523 -0.0516 316 LEU A CD2 
971  N N   . ASP A 129 ? 0.3728 0.3789 0.3234 0.0155  -0.0358 -0.0404 317 ASP A N   
972  C CA  . ASP A 129 ? 0.3823 0.3871 0.3312 0.0233  -0.0337 -0.0394 317 ASP A CA  
973  C C   . ASP A 129 ? 0.3505 0.3661 0.3090 0.0281  -0.0336 -0.0360 317 ASP A C   
974  O O   . ASP A 129 ? 0.3566 0.3767 0.3169 0.0324  -0.0350 -0.0351 317 ASP A O   
975  C CB  . ASP A 129 ? 0.4347 0.4266 0.3786 0.0263  -0.0288 -0.0403 317 ASP A CB  
976  C CG  . ASP A 129 ? 0.6862 0.6676 0.6208 0.0251  -0.0275 -0.0453 317 ASP A CG  
977  O OD1 . ASP A 129 ? 0.7597 0.7451 0.6894 0.0231  -0.0301 -0.0472 317 ASP A OD1 
978  O OD2 . ASP A 129 ? 0.7699 0.7391 0.7022 0.0263  -0.0236 -0.0472 317 ASP A OD2 
979  N N   . ILE A 130 ? 0.3396 0.3590 0.3037 0.0266  -0.0315 -0.0345 318 ILE A N   
980  C CA  . ILE A 130 ? 0.3470 0.3768 0.3194 0.0303  -0.0301 -0.0331 318 ILE A CA  
981  C C   . ILE A 130 ? 0.3312 0.3732 0.3137 0.0311  -0.0339 -0.0332 318 ILE A C   
982  O O   . ILE A 130 ? 0.3524 0.3988 0.3399 0.0364  -0.0341 -0.0331 318 ILE A O   
983  C CB  . ILE A 130 ? 0.3316 0.3643 0.3066 0.0269  -0.0264 -0.0316 318 ILE A CB  
984  C CG1 . ILE A 130 ? 0.3162 0.3373 0.2828 0.0278  -0.0235 -0.0295 318 ILE A CG1 
985  C CG2 . ILE A 130 ? 0.2687 0.3147 0.2528 0.0293  -0.0243 -0.0320 318 ILE A CG2 
986  C CD1 . ILE A 130 ? 0.3525 0.3740 0.3188 0.0229  -0.0205 -0.0264 318 ILE A CD1 
987  N N   . LEU A 131 ? 0.3193 0.3663 0.3057 0.0256  -0.0374 -0.0333 319 LEU A N   
988  C CA  . LEU A 131 ? 0.3141 0.3732 0.3121 0.0266  -0.0424 -0.0322 319 LEU A CA  
989  C C   . LEU A 131 ? 0.3343 0.3898 0.3278 0.0303  -0.0466 -0.0308 319 LEU A C   
990  O O   . LEU A 131 ? 0.3361 0.3981 0.3392 0.0350  -0.0489 -0.0290 319 LEU A O   
991  C CB  . LEU A 131 ? 0.2688 0.3347 0.2714 0.0192  -0.0467 -0.0319 319 LEU A CB  
992  C CG  . LEU A 131 ? 0.3109 0.3838 0.3212 0.0144  -0.0430 -0.0325 319 LEU A CG  
993  C CD1 . LEU A 131 ? 0.2584 0.3379 0.2732 0.0060  -0.0482 -0.0323 319 LEU A CD1 
994  C CD2 . LEU A 131 ? 0.2687 0.3550 0.2942 0.0192  -0.0392 -0.0327 319 LEU A CD2 
995  N N   . LEU A 132 ? 0.2990 0.3439 0.2784 0.0279  -0.0471 -0.0317 320 LEU A N   
996  C CA  . LEU A 132 ? 0.3117 0.3532 0.2843 0.0298  -0.0502 -0.0302 320 LEU A CA  
997  C C   . LEU A 132 ? 0.3325 0.3724 0.3078 0.0369  -0.0472 -0.0292 320 LEU A C   
998  O O   . LEU A 132 ? 0.3833 0.4263 0.3629 0.0397  -0.0507 -0.0263 320 LEU A O   
999  C CB  . LEU A 132 ? 0.2788 0.3093 0.2353 0.0257  -0.0488 -0.0331 320 LEU A CB  
1000 C CG  . LEU A 132 ? 0.3691 0.3960 0.3156 0.0261  -0.0503 -0.0322 320 LEU A CG  
1001 C CD1 . LEU A 132 ? 0.3423 0.3772 0.2894 0.0223  -0.0585 -0.0282 320 LEU A CD1 
1002 C CD2 . LEU A 132 ? 0.3725 0.3884 0.3047 0.0230  -0.0459 -0.0373 320 LEU A CD2 
1003 N N   . GLY A 133 ? 0.2958 0.3307 0.2688 0.0394  -0.0414 -0.0312 321 GLY A N   
1004 C CA  . GLY A 133 ? 0.3244 0.3585 0.2996 0.0451  -0.0389 -0.0309 321 GLY A CA  
1005 C C   . GLY A 133 ? 0.2984 0.3412 0.2870 0.0484  -0.0396 -0.0306 321 GLY A C   
1006 O O   . GLY A 133 ? 0.3438 0.3867 0.3364 0.0522  -0.0408 -0.0297 321 GLY A O   
1007 N N   . THR A 134 ? 0.2914 0.3415 0.2879 0.0468  -0.0385 -0.0318 322 THR A N   
1008 C CA  . THR A 134 ? 0.2853 0.3448 0.2965 0.0502  -0.0379 -0.0330 322 THR A CA  
1009 C C   . THR A 134 ? 0.2872 0.3504 0.3081 0.0524  -0.0441 -0.0300 322 THR A C   
1010 O O   . THR A 134 ? 0.2961 0.3604 0.3264 0.0574  -0.0445 -0.0303 322 THR A O   
1011 C CB  . THR A 134 ? 0.3074 0.3760 0.3260 0.0472  -0.0350 -0.0348 322 THR A CB  
1012 O OG1 . THR A 134 ? 0.3109 0.3751 0.3195 0.0445  -0.0299 -0.0359 322 THR A OG1 
1013 C CG2 . THR A 134 ? 0.2626 0.3415 0.2973 0.0513  -0.0326 -0.0376 322 THR A CG2 
1014 N N   . ALA A 135 ? 0.2956 0.3603 0.3141 0.0482  -0.0496 -0.0270 323 ALA A N   
1015 C CA  . ALA A 135 ? 0.3020 0.3702 0.3274 0.0490  -0.0573 -0.0221 323 ALA A CA  
1016 C C   . ALA A 135 ? 0.3544 0.4140 0.3731 0.0517  -0.0587 -0.0195 323 ALA A C   
1017 O O   . ALA A 135 ? 0.2967 0.3580 0.3258 0.0553  -0.0628 -0.0158 323 ALA A O   
1018 C CB  . ALA A 135 ? 0.3002 0.3709 0.3193 0.0421  -0.0631 -0.0196 323 ALA A CB  
1019 N N   . ARG A 136 ? 0.3375 0.3880 0.3402 0.0499  -0.0551 -0.0210 324 ARG A N   
1020 C CA  . ARG A 136 ? 0.2897 0.3333 0.2864 0.0517  -0.0554 -0.0187 324 ARG A CA  
1021 C C   . ARG A 136 ? 0.3121 0.3553 0.3200 0.0575  -0.0531 -0.0200 324 ARG A C   
1022 O O   . ARG A 136 ? 0.3079 0.3487 0.3206 0.0595  -0.0565 -0.0162 324 ARG A O   
1023 C CB  . ARG A 136 ? 0.3186 0.3546 0.2996 0.0496  -0.0506 -0.0213 324 ARG A CB  
1024 C CG  . ARG A 136 ? 0.3374 0.3682 0.3114 0.0497  -0.0509 -0.0185 324 ARG A CG  
1025 C CD  . ARG A 136 ? 0.3391 0.3644 0.3009 0.0485  -0.0455 -0.0215 324 ARG A CD  
1026 N NE  . ARG A 136 ? 0.3693 0.3927 0.3203 0.0437  -0.0451 -0.0234 324 ARG A NE  
1027 C CZ  . ARG A 136 ? 0.4077 0.4282 0.3559 0.0432  -0.0413 -0.0278 324 ARG A CZ  
1028 N NH1 . ARG A 136 ? 0.3638 0.3841 0.3182 0.0468  -0.0379 -0.0294 324 ARG A NH1 
1029 N NH2 . ARG A 136 ? 0.4241 0.4413 0.3628 0.0384  -0.0410 -0.0304 324 ARG A NH2 
1030 N N   . ALA A 137 ? 0.3308 0.3760 0.3422 0.0594  -0.0474 -0.0253 325 ALA A N   
1031 C CA  . ALA A 137 ? 0.3085 0.3537 0.3296 0.0639  -0.0447 -0.0285 325 ALA A CA  
1032 C C   . ALA A 137 ? 0.3134 0.3632 0.3525 0.0676  -0.0485 -0.0270 325 ALA A C   
1033 O O   . ALA A 137 ? 0.3318 0.3771 0.3779 0.0709  -0.0501 -0.0258 325 ALA A O   
1034 C CB  . ALA A 137 ? 0.2208 0.2694 0.2413 0.0640  -0.0382 -0.0344 325 ALA A CB  
1035 N N   . ILE A 138 ? 0.3154 0.3742 0.3634 0.0671  -0.0501 -0.0267 326 ILE A N   
1036 C CA  . ILE A 138 ? 0.3282 0.3934 0.3969 0.0715  -0.0534 -0.0254 326 ILE A CA  
1037 C C   . ILE A 138 ? 0.3563 0.4174 0.4283 0.0724  -0.0622 -0.0169 326 ILE A C   
1038 O O   . ILE A 138 ? 0.3200 0.3787 0.4066 0.0776  -0.0642 -0.0156 326 ILE A O   
1039 C CB  . ILE A 138 ? 0.3238 0.4019 0.4026 0.0700  -0.0537 -0.0263 326 ILE A CB  
1040 C CG1 . ILE A 138 ? 0.3024 0.3847 0.3785 0.0687  -0.0446 -0.0339 326 ILE A CG1 
1041 C CG2 . ILE A 138 ? 0.3058 0.3923 0.4095 0.0754  -0.0577 -0.0244 326 ILE A CG2 
1042 C CD1 . ILE A 138 ? 0.3264 0.4198 0.4067 0.0644  -0.0440 -0.0342 326 ILE A CD1 
1043 N N   . GLN A 139 ? 0.3426 0.4023 0.4009 0.0670  -0.0674 -0.0111 327 GLN A N   
1044 C CA  . GLN A 139 ? 0.3644 0.4208 0.4222 0.0662  -0.0760 -0.0019 327 GLN A CA  
1045 C C   . GLN A 139 ? 0.4281 0.4732 0.4809 0.0677  -0.0743 -0.0007 327 GLN A C   
1046 O O   . GLN A 139 ? 0.4190 0.4602 0.4792 0.0695  -0.0803 0.0064  327 GLN A O   
1047 C CB  . GLN A 139 ? 0.3130 0.3707 0.3536 0.0586  -0.0808 0.0026  327 GLN A CB  
1048 C CG  . GLN A 139 ? 0.3349 0.3852 0.3533 0.0540  -0.0749 -0.0013 327 GLN A CG  
1049 C CD  . GLN A 139 ? 0.3552 0.3971 0.3623 0.0524  -0.0760 0.0033  327 GLN A CD  
1050 O OE1 . GLN A 139 ? 0.3609 0.4029 0.3654 0.0497  -0.0833 0.0114  327 GLN A OE1 
1051 N NE2 . GLN A 139 ? 0.3519 0.3874 0.3525 0.0536  -0.0689 -0.0012 327 GLN A NE2 
1052 N N   . PHE A 140 ? 0.3511 0.3910 0.3921 0.0667  -0.0669 -0.0068 328 PHE A N   
1053 C CA  . PHE A 140 ? 0.3673 0.3981 0.4060 0.0679  -0.0648 -0.0067 328 PHE A CA  
1054 C C   . PHE A 140 ? 0.3826 0.4112 0.4408 0.0740  -0.0645 -0.0090 328 PHE A C   
1055 O O   . PHE A 140 ? 0.3818 0.4030 0.4457 0.0753  -0.0683 -0.0038 328 PHE A O   
1056 C CB  . PHE A 140 ? 0.3573 0.3854 0.3831 0.0662  -0.0574 -0.0130 328 PHE A CB  
1057 C CG  . PHE A 140 ? 0.4146 0.4351 0.4388 0.0664  -0.0555 -0.0133 328 PHE A CG  
1058 C CD1 . PHE A 140 ? 0.3885 0.4042 0.4031 0.0627  -0.0578 -0.0071 328 PHE A CD1 
1059 C CD2 . PHE A 140 ? 0.3954 0.4141 0.4271 0.0695  -0.0512 -0.0200 328 PHE A CD2 
1060 C CE1 . PHE A 140 ? 0.3868 0.3964 0.4009 0.0620  -0.0560 -0.0070 328 PHE A CE1 
1061 C CE2 . PHE A 140 ? 0.4237 0.4357 0.4542 0.0687  -0.0499 -0.0206 328 PHE A CE2 
1062 C CZ  . PHE A 140 ? 0.4130 0.4206 0.4356 0.0650  -0.0525 -0.0138 328 PHE A CZ  
1063 N N   . LEU A 141 ? 0.3860 0.4203 0.4544 0.0775  -0.0596 -0.0168 329 LEU A N   
1064 C CA  . LEU A 141 ? 0.3844 0.4171 0.4725 0.0836  -0.0581 -0.0210 329 LEU A CA  
1065 C C   . LEU A 141 ? 0.4419 0.4748 0.5482 0.0875  -0.0662 -0.0131 329 LEU A C   
1066 O O   . LEU A 141 ? 0.3910 0.4158 0.5102 0.0917  -0.0677 -0.0122 329 LEU A O   
1067 C CB  . LEU A 141 ? 0.3830 0.4247 0.4785 0.0859  -0.0508 -0.0310 329 LEU A CB  
1068 C CG  . LEU A 141 ? 0.3667 0.4083 0.4461 0.0824  -0.0434 -0.0382 329 LEU A CG  
1069 C CD1 . LEU A 141 ? 0.3749 0.4258 0.4612 0.0837  -0.0363 -0.0471 329 LEU A CD1 
1070 C CD2 . LEU A 141 ? 0.3013 0.3326 0.3752 0.0821  -0.0415 -0.0408 329 LEU A CD2 
1071 N N   . HIS A 142 ? 0.4102 0.4521 0.5180 0.0860  -0.0720 -0.0070 330 HIS A N   
1072 C CA  . HIS A 142 ? 0.3899 0.4345 0.5160 0.0896  -0.0811 0.0019  330 HIS A CA  
1073 C C   . HIS A 142 ? 0.4431 0.4777 0.5619 0.0869  -0.0893 0.0137  330 HIS A C   
1074 O O   . HIS A 142 ? 0.4160 0.4484 0.5511 0.0907  -0.0971 0.0221  330 HIS A O   
1075 C CB  . HIS A 142 ? 0.3675 0.4264 0.4966 0.0874  -0.0858 0.0051  330 HIS A CB  
1076 C CG  . HIS A 142 ? 0.4013 0.4718 0.5440 0.0905  -0.0789 -0.0044 330 HIS A CG  
1077 N ND1 . HIS A 142 ? 0.4234 0.5084 0.5729 0.0885  -0.0819 -0.0029 330 HIS A ND1 
1078 C CD2 . HIS A 142 ? 0.3671 0.4379 0.5174 0.0944  -0.0689 -0.0156 330 HIS A CD2 
1079 C CE1 . HIS A 142 ? 0.3968 0.4907 0.5581 0.0912  -0.0736 -0.0124 330 HIS A CE1 
1080 N NE2 . HIS A 142 ? 0.3777 0.4631 0.5388 0.0948  -0.0655 -0.0203 330 HIS A NE2 
1081 N N   . GLN A 143 ? 0.4502 0.4789 0.5451 0.0803  -0.0875 0.0148  331 GLN A N   
1082 C CA  . GLN A 143 ? 0.4763 0.4973 0.5610 0.0759  -0.0942 0.0261  331 GLN A CA  
1083 C C   . GLN A 143 ? 0.5158 0.5236 0.6084 0.0787  -0.0932 0.0271  331 GLN A C   
1084 O O   . GLN A 143 ? 0.5501 0.5505 0.6389 0.0757  -0.0992 0.0378  331 GLN A O   
1085 C CB  . GLN A 143 ? 0.5043 0.5254 0.5618 0.0677  -0.0913 0.0257  331 GLN A CB  
1086 C CG  . GLN A 143 ? 0.6401 0.6575 0.6838 0.0613  -0.0981 0.0376  331 GLN A CG  
1087 C CD  . GLN A 143 ? 0.7742 0.7999 0.8014 0.0545  -0.1017 0.0404  331 GLN A CD  
1088 O OE1 . GLN A 143 ? 0.7732 0.8032 0.7900 0.0524  -0.0958 0.0320  331 GLN A OE1 
1089 N NE2 . GLN A 143 ? 0.8509 0.8783 0.8752 0.0506  -0.1118 0.0525  331 GLN A NE2 
1090 N N   . ASP A 144 ? 0.5170 0.5218 0.6197 0.0835  -0.0855 0.0160  332 ASP A N   
1091 C CA  . ASP A 144 ? 0.5369 0.5284 0.6469 0.0854  -0.0838 0.0147  332 ASP A CA  
1092 C C   . ASP A 144 ? 0.5822 0.5676 0.7160 0.0915  -0.0910 0.0220  332 ASP A C   
1093 O O   . ASP A 144 ? 0.6146 0.6084 0.7633 0.0960  -0.0955 0.0248  332 ASP A O   
1094 C CB  . ASP A 144 ? 0.5560 0.5468 0.6686 0.0880  -0.0737 -0.0003 332 ASP A CB  
1095 C CG  . ASP A 144 ? 0.6483 0.6266 0.7567 0.0854  -0.0707 -0.0029 332 ASP A CG  
1096 O OD1 . ASP A 144 ? 0.6817 0.6558 0.7758 0.0793  -0.0730 0.0045  332 ASP A OD1 
1097 O OD2 . ASP A 144 ? 0.6926 0.6660 0.8119 0.0890  -0.0656 -0.0130 332 ASP A OD2 
1098 N N   . SER A 145 ? 0.6262 0.5969 0.7645 0.0913  -0.0924 0.0256  333 SER A N   
1099 C CA  . SER A 145 ? 0.6917 0.6532 0.8546 0.0976  -0.0991 0.0326  333 SER A CA  
1100 C C   . SER A 145 ? 0.6851 0.6351 0.8647 0.1031  -0.0922 0.0206  333 SER A C   
1101 O O   . SER A 145 ? 0.7133 0.6515 0.8851 0.0988  -0.0892 0.0183  333 SER A O   
1102 C CB  . SER A 145 ? 0.7725 0.7242 0.9282 0.0920  -0.1083 0.0496  333 SER A CB  
1103 O OG  . SER A 145 ? 0.8975 0.8395 1.0781 0.0984  -0.1160 0.0583  333 SER A OG  
1104 N N   . PRO A 146 ? 0.6637 0.6180 0.8668 0.1121  -0.0894 0.0121  334 PRO A N   
1105 C CA  . PRO A 146 ? 0.6351 0.6055 0.8498 0.1168  -0.0926 0.0143  334 PRO A CA  
1106 C C   . PRO A 146 ? 0.6243 0.6105 0.8223 0.1132  -0.0853 0.0047  334 PRO A C   
1107 O O   . PRO A 146 ? 0.6167 0.6009 0.7956 0.1081  -0.0779 -0.0035 334 PRO A O   
1108 C CB  . PRO A 146 ? 0.6272 0.5947 0.8747 0.1277  -0.0898 0.0064  334 PRO A CB  
1109 C CG  . PRO A 146 ? 0.6333 0.5892 0.8771 0.1270  -0.0794 -0.0085 334 PRO A CG  
1110 C CD  . PRO A 146 ? 0.6313 0.5752 0.8519 0.1178  -0.0821 -0.0013 334 PRO A CD  
1111 N N   . SER A 147 ? 0.6365 0.6383 0.8429 0.1157  -0.0877 0.0062  335 SER A N   
1112 C CA  . SER A 147 ? 0.5495 0.5656 0.7419 0.1120  -0.0814 -0.0016 335 SER A CA  
1113 C C   . SER A 147 ? 0.4802 0.4979 0.6765 0.1148  -0.0690 -0.0187 335 SER A C   
1114 O O   . SER A 147 ? 0.5050 0.5203 0.7241 0.1221  -0.0654 -0.0257 335 SER A O   
1115 C CB  . SER A 147 ? 0.5127 0.5453 0.7165 0.1137  -0.0871 0.0037  335 SER A CB  
1116 O OG  . SER A 147 ? 0.5123 0.5455 0.7069 0.1090  -0.0986 0.0189  335 SER A OG  
1117 N N   . LEU A 148 ? 0.4388 0.4606 0.6129 0.1087  -0.0623 -0.0254 336 LEU A N   
1118 C CA  . LEU A 148 ? 0.4434 0.4709 0.6187 0.1099  -0.0512 -0.0402 336 LEU A CA  
1119 C C   . LEU A 148 ? 0.4542 0.4992 0.6339 0.1100  -0.0493 -0.0419 336 LEU A C   
1120 O O   . LEU A 148 ? 0.4655 0.5166 0.6307 0.1047  -0.0530 -0.0355 336 LEU A O   
1121 C CB  . LEU A 148 ? 0.4613 0.4840 0.6117 0.1033  -0.0455 -0.0459 336 LEU A CB  
1122 C CG  . LEU A 148 ? 0.4436 0.4717 0.5932 0.1036  -0.0347 -0.0607 336 LEU A CG  
1123 C CD1 . LEU A 148 ? 0.4274 0.4471 0.5947 0.1090  -0.0305 -0.0701 336 LEU A CD1 
1124 C CD2 . LEU A 148 ? 0.4434 0.4704 0.5675 0.0965  -0.0308 -0.0639 336 LEU A CD2 
1125 N N   . ILE A 149 ? 0.3986 0.4518 0.5990 0.1158  -0.0431 -0.0510 337 ILE A N   
1126 C CA  . ILE A 149 ? 0.3917 0.4629 0.5977 0.1152  -0.0396 -0.0539 337 ILE A CA  
1127 C C   . ILE A 149 ? 0.3908 0.4666 0.5821 0.1109  -0.0279 -0.0661 337 ILE A C   
1128 O O   . ILE A 149 ? 0.4406 0.5139 0.6381 0.1137  -0.0196 -0.0777 337 ILE A O   
1129 C CB  . ILE A 149 ? 0.4501 0.5311 0.6902 0.1239  -0.0395 -0.0558 337 ILE A CB  
1130 C CG1 . ILE A 149 ? 0.4798 0.5553 0.7350 0.1283  -0.0526 -0.0420 337 ILE A CG1 
1131 C CG2 . ILE A 149 ? 0.4246 0.5261 0.6710 0.1221  -0.0360 -0.0580 337 ILE A CG2 
1132 C CD1 . ILE A 149 ? 0.5728 0.6532 0.8652 0.1389  -0.0531 -0.0436 337 ILE A CD1 
1133 N N   . HIS A 150 ? 0.3520 0.4335 0.5230 0.1037  -0.0275 -0.0634 338 HIS A N   
1134 C CA  . HIS A 150 ? 0.3601 0.4451 0.5145 0.0986  -0.0181 -0.0722 338 HIS A CA  
1135 C C   . HIS A 150 ? 0.3893 0.4883 0.5590 0.1008  -0.0084 -0.0827 338 HIS A C   
1136 O O   . HIS A 150 ? 0.4089 0.5068 0.5765 0.1011  0.0004  -0.0938 338 HIS A O   
1137 C CB  . HIS A 150 ? 0.3030 0.3904 0.4358 0.0911  -0.0206 -0.0657 338 HIS A CB  
1138 C CG  . HIS A 150 ? 0.3030 0.3913 0.4166 0.0855  -0.0130 -0.0718 338 HIS A CG  
1139 N ND1 . HIS A 150 ? 0.3049 0.4056 0.4202 0.0831  -0.0049 -0.0781 338 HIS A ND1 
1140 C CD2 . HIS A 150 ? 0.3091 0.3884 0.4018 0.0816  -0.0126 -0.0716 338 HIS A CD2 
1141 C CE1 . HIS A 150 ? 0.3137 0.4121 0.4086 0.0777  -0.0005 -0.0807 338 HIS A CE1 
1142 N NE2 . HIS A 150 ? 0.3331 0.4188 0.4150 0.0771  -0.0054 -0.0769 338 HIS A NE2 
1143 N N   . GLY A 151 ? 0.3471 0.4603 0.5317 0.1016  -0.0099 -0.0792 339 GLY A N   
1144 C CA  . GLY A 151 ? 0.3303 0.4596 0.5356 0.1046  -0.0013 -0.0879 339 GLY A CA  
1145 C C   . GLY A 151 ? 0.4424 0.5826 0.6337 0.0973  0.0087  -0.0943 339 GLY A C   
1146 O O   . GLY A 151 ? 0.4617 0.6186 0.6688 0.0978  0.0155  -0.0994 339 GLY A O   
1147 N N   . ASP A 152 ? 0.3854 0.5168 0.5484 0.0906  0.0097  -0.0938 340 ASP A N   
1148 C CA  . ASP A 152 ? 0.4421 0.5811 0.5874 0.0825  0.0173  -0.0969 340 ASP A CA  
1149 C C   . ASP A 152 ? 0.4568 0.5964 0.5861 0.0751  0.0121  -0.0867 340 ASP A C   
1150 O O   . ASP A 152 ? 0.5068 0.6488 0.6188 0.0681  0.0172  -0.0876 340 ASP A O   
1151 C CB  . ASP A 152 ? 0.5529 0.6831 0.6780 0.0796  0.0226  -0.1038 340 ASP A CB  
1152 C CG  . ASP A 152 ? 0.5795 0.7221 0.6992 0.0746  0.0348  -0.1134 340 ASP A CG  
1153 O OD1 . ASP A 152 ? 0.5533 0.7109 0.6822 0.0723  0.0390  -0.1131 340 ASP A OD1 
1154 O OD2 . ASP A 152 ? 0.6325 0.7706 0.7382 0.0722  0.0400  -0.1210 340 ASP A OD2 
1155 N N   . ILE A 153 ? 0.4327 0.5681 0.5650 0.0760  0.0019  -0.0772 341 ILE A N   
1156 C CA  . ILE A 153 ? 0.3700 0.5023 0.4849 0.0689  -0.0028 -0.0690 341 ILE A CA  
1157 C C   . ILE A 153 ? 0.3420 0.4874 0.4562 0.0619  0.0028  -0.0695 341 ILE A C   
1158 O O   . ILE A 153 ? 0.3232 0.4832 0.4570 0.0625  0.0042  -0.0707 341 ILE A O   
1159 C CB  . ILE A 153 ? 0.3260 0.4549 0.4465 0.0702  -0.0140 -0.0601 341 ILE A CB  
1160 C CG1 . ILE A 153 ? 0.3023 0.4169 0.4191 0.0750  -0.0198 -0.0575 341 ILE A CG1 
1161 C CG2 . ILE A 153 ? 0.2841 0.4101 0.3882 0.0626  -0.0179 -0.0537 341 ILE A CG2 
1162 C CD1 . ILE A 153 ? 0.2751 0.3892 0.4032 0.0778  -0.0302 -0.0496 341 ILE A CD1 
1163 N N   . LYS A 154 ? 0.3028 0.4428 0.3951 0.0552  0.0054  -0.0679 342 LYS A N   
1164 C CA  . LYS A 154 ? 0.3224 0.4718 0.4100 0.0472  0.0109  -0.0672 342 LYS A CA  
1165 C C   . LYS A 154 ? 0.3952 0.5319 0.4594 0.0411  0.0078  -0.0606 342 LYS A C   
1166 O O   . LYS A 154 ? 0.4175 0.5406 0.4690 0.0434  0.0039  -0.0587 342 LYS A O   
1167 C CB  . LYS A 154 ? 0.2817 0.4415 0.3695 0.0456  0.0224  -0.0756 342 LYS A CB  
1168 C CG  . LYS A 154 ? 0.3696 0.5413 0.4810 0.0523  0.0280  -0.0846 342 LYS A CG  
1169 C CD  . LYS A 154 ? 0.4120 0.5947 0.5204 0.0490  0.0408  -0.0940 342 LYS A CD  
1170 C CE  . LYS A 154 ? 0.4101 0.5814 0.4923 0.0457  0.0427  -0.0956 342 LYS A CE  
1171 N NZ  . LYS A 154 ? 0.4312 0.5872 0.5109 0.0525  0.0364  -0.0964 342 LYS A NZ  
1172 N N   . SER A 155 ? 0.3927 0.5336 0.4521 0.0332  0.0097  -0.0570 343 SER A N   
1173 C CA  . SER A 155 ? 0.3246 0.4521 0.3639 0.0279  0.0069  -0.0506 343 SER A CA  
1174 C C   . SER A 155 ? 0.3658 0.4877 0.3881 0.0269  0.0112  -0.0513 343 SER A C   
1175 O O   . SER A 155 ? 0.3964 0.5052 0.4037 0.0258  0.0076  -0.0462 343 SER A O   
1176 C CB  . SER A 155 ? 0.3125 0.4444 0.3518 0.0191  0.0079  -0.0463 343 SER A CB  
1177 O OG  . SER A 155 ? 0.3586 0.5033 0.3991 0.0138  0.0169  -0.0486 343 SER A OG  
1178 N N   . SER A 156 ? 0.3347 0.4671 0.3598 0.0273  0.0187  -0.0579 344 SER A N   
1179 C CA  . SER A 156 ? 0.3877 0.5170 0.3957 0.0251  0.0224  -0.0590 344 SER A CA  
1180 C C   . SER A 156 ? 0.3846 0.5029 0.3871 0.0315  0.0178  -0.0607 344 SER A C   
1181 O O   . SER A 156 ? 0.4316 0.5432 0.4180 0.0295  0.0166  -0.0580 344 SER A O   
1182 C CB  . SER A 156 ? 0.3639 0.5087 0.3751 0.0223  0.0327  -0.0671 344 SER A CB  
1183 O OG  . SER A 156 ? 0.3735 0.5249 0.4029 0.0296  0.0353  -0.0763 344 SER A OG  
1184 N N   . ASN A 157 ? 0.3177 0.4349 0.3342 0.0387  0.0149  -0.0645 345 ASN A N   
1185 C CA  . ASN A 157 ? 0.3697 0.4762 0.3822 0.0439  0.0103  -0.0655 345 ASN A CA  
1186 C C   . ASN A 157 ? 0.3491 0.4437 0.3592 0.0461  0.0019  -0.0582 345 ASN A C   
1187 O O   . ASN A 157 ? 0.3957 0.4827 0.4058 0.0505  -0.0020 -0.0585 345 ASN A O   
1188 C CB  . ASN A 157 ? 0.4375 0.5475 0.4650 0.0501  0.0126  -0.0740 345 ASN A CB  
1189 C CG  . ASN A 157 ? 0.4727 0.5881 0.5210 0.0543  0.0106  -0.0740 345 ASN A CG  
1190 O OD1 . ASN A 157 ? 0.5652 0.6924 0.6230 0.0519  0.0145  -0.0748 345 ASN A OD1 
1191 N ND2 . ASN A 157 ? 0.4670 0.5749 0.5235 0.0602  0.0044  -0.0726 345 ASN A ND2 
1192 N N   . VAL A 158 ? 0.3499 0.4434 0.3590 0.0427  -0.0005 -0.0525 346 VAL A N   
1193 C CA  . VAL A 158 ? 0.2945 0.3758 0.2960 0.0431  -0.0069 -0.0465 346 VAL A CA  
1194 C C   . VAL A 158 ? 0.3789 0.4533 0.3647 0.0394  -0.0063 -0.0420 346 VAL A C   
1195 O O   . VAL A 158 ? 0.4310 0.5071 0.4125 0.0339  -0.0040 -0.0390 346 VAL A O   
1196 C CB  . VAL A 158 ? 0.3005 0.3821 0.3082 0.0409  -0.0104 -0.0433 346 VAL A CB  
1197 C CG1 . VAL A 158 ? 0.2860 0.3544 0.2837 0.0407  -0.0154 -0.0388 346 VAL A CG1 
1198 C CG2 . VAL A 158 ? 0.2518 0.3407 0.2761 0.0449  -0.0128 -0.0459 346 VAL A CG2 
1199 N N   . LEU A 159 ? 0.3487 0.4151 0.3270 0.0424  -0.0090 -0.0408 347 LEU A N   
1200 C CA  . LEU A 159 ? 0.3186 0.3802 0.2843 0.0400  -0.0091 -0.0363 347 LEU A CA  
1201 C C   . LEU A 159 ? 0.3334 0.3832 0.2954 0.0419  -0.0136 -0.0314 347 LEU A C   
1202 O O   . LEU A 159 ? 0.3504 0.3964 0.3171 0.0451  -0.0162 -0.0326 347 LEU A O   
1203 C CB  . LEU A 159 ? 0.3758 0.4407 0.3367 0.0411  -0.0081 -0.0394 347 LEU A CB  
1204 C CG  . LEU A 159 ? 0.4667 0.5432 0.4306 0.0387  -0.0021 -0.0459 347 LEU A CG  
1205 C CD1 . LEU A 159 ? 0.4677 0.5464 0.4374 0.0427  -0.0012 -0.0537 347 LEU A CD1 
1206 C CD2 . LEU A 159 ? 0.4650 0.5463 0.4163 0.0323  0.0011  -0.0435 347 LEU A CD2 
1207 N N   . LEU A 160 ? 0.3081 0.3523 0.2621 0.0398  -0.0143 -0.0257 348 LEU A N   
1208 C CA  . LEU A 160 ? 0.3531 0.3857 0.3055 0.0415  -0.0171 -0.0218 348 LEU A CA  
1209 C C   . LEU A 160 ? 0.3792 0.4071 0.3266 0.0440  -0.0193 -0.0173 348 LEU A C   
1210 O O   . LEU A 160 ? 0.4044 0.4347 0.3460 0.0414  -0.0193 -0.0130 348 LEU A O   
1211 C CB  . LEU A 160 ? 0.4233 0.4510 0.3747 0.0364  -0.0162 -0.0185 348 LEU A CB  
1212 C CG  . LEU A 160 ? 0.4634 0.4977 0.4214 0.0329  -0.0146 -0.0221 348 LEU A CG  
1213 C CD1 . LEU A 160 ? 0.4527 0.4849 0.4092 0.0259  -0.0130 -0.0184 348 LEU A CD1 
1214 C CD2 . LEU A 160 ? 0.4379 0.4688 0.4006 0.0356  -0.0174 -0.0255 348 LEU A CD2 
1215 N N   . ASP A 161 ? 0.3489 0.3712 0.2988 0.0488  -0.0214 -0.0179 349 ASP A N   
1216 C CA  . ASP A 161 ? 0.4398 0.4590 0.3884 0.0520  -0.0236 -0.0135 349 ASP A CA  
1217 C C   . ASP A 161 ? 0.4649 0.4730 0.4133 0.0522  -0.0242 -0.0082 349 ASP A C   
1218 O O   . ASP A 161 ? 0.4780 0.4810 0.4255 0.0486  -0.0227 -0.0079 349 ASP A O   
1219 C CB  . ASP A 161 ? 0.4035 0.4235 0.3564 0.0567  -0.0247 -0.0167 349 ASP A CB  
1220 C CG  . ASP A 161 ? 0.4976 0.5098 0.4534 0.0589  -0.0237 -0.0189 349 ASP A CG  
1221 O OD1 . ASP A 161 ? 0.5402 0.5463 0.4949 0.0566  -0.0226 -0.0192 349 ASP A OD1 
1222 O OD2 . ASP A 161 ? 0.5472 0.5599 0.5059 0.0622  -0.0239 -0.0206 349 ASP A OD2 
1223 N N   . GLU A 162 ? 0.4927 0.4973 0.4435 0.0565  -0.0264 -0.0042 350 GLU A N   
1224 C CA  . GLU A 162 ? 0.5144 0.5073 0.4674 0.0580  -0.0270 0.0011  350 GLU A CA  
1225 C C   . GLU A 162 ? 0.4757 0.4578 0.4308 0.0579  -0.0242 -0.0036 350 GLU A C   
1226 O O   . GLU A 162 ? 0.5740 0.5455 0.5290 0.0559  -0.0238 -0.0006 350 GLU A O   
1227 C CB  . GLU A 162 ? 0.5524 0.5451 0.5116 0.0643  -0.0296 0.0047  350 GLU A CB  
1228 C CG  . GLU A 162 ? 0.6206 0.6231 0.5773 0.0636  -0.0339 0.0110  350 GLU A CG  
1229 C CD  . GLU A 162 ? 0.6874 0.7024 0.6423 0.0628  -0.0341 0.0056  350 GLU A CD  
1230 O OE1 . GLU A 162 ? 0.6058 0.6222 0.5603 0.0620  -0.0310 -0.0019 350 GLU A OE1 
1231 O OE2 . GLU A 162 ? 0.7649 0.7881 0.7190 0.0628  -0.0380 0.0093  350 GLU A OE2 
1232 N N   . ARG A 163 ? 0.3587 0.3433 0.3150 0.0593  -0.0225 -0.0107 351 ARG A N   
1233 C CA  . ARG A 163 ? 0.4561 0.4320 0.4123 0.0584  -0.0202 -0.0161 351 ARG A CA  
1234 C C   . ARG A 163 ? 0.4797 0.4585 0.4324 0.0521  -0.0199 -0.0192 351 ARG A C   
1235 O O   . ARG A 163 ? 0.5275 0.5018 0.4788 0.0500  -0.0190 -0.0241 351 ARG A O   
1236 C CB  . ARG A 163 ? 0.5315 0.5091 0.4899 0.0625  -0.0186 -0.0213 351 ARG A CB  
1237 C CG  . ARG A 163 ? 0.6780 0.6526 0.6428 0.0688  -0.0179 -0.0194 351 ARG A CG  
1238 C CD  . ARG A 163 ? 0.7943 0.7715 0.7610 0.0717  -0.0150 -0.0251 351 ARG A CD  
1239 N NE  . ARG A 163 ? 0.8905 0.8604 0.8522 0.0688  -0.0118 -0.0317 351 ARG A NE  
1240 C CZ  . ARG A 163 ? 0.9317 0.9062 0.8873 0.0648  -0.0121 -0.0354 351 ARG A CZ  
1241 N NH1 . ARG A 163 ? 0.8975 0.8823 0.8527 0.0640  -0.0148 -0.0334 351 ARG A NH1 
1242 N NH2 . ARG A 163 ? 0.9845 0.9527 0.9342 0.0613  -0.0100 -0.0411 351 ARG A NH2 
1243 N N   . LEU A 164 ? 0.4521 0.4398 0.4036 0.0491  -0.0207 -0.0168 352 LEU A N   
1244 C CA  . LEU A 164 ? 0.4335 0.4277 0.3850 0.0440  -0.0204 -0.0195 352 LEU A CA  
1245 C C   . LEU A 164 ? 0.4411 0.4418 0.3947 0.0455  -0.0212 -0.0246 352 LEU A C   
1246 O O   . LEU A 164 ? 0.4541 0.4573 0.4091 0.0421  -0.0219 -0.0272 352 LEU A O   
1247 C CB  . LEU A 164 ? 0.4066 0.3924 0.3572 0.0385  -0.0198 -0.0197 352 LEU A CB  
1248 C CG  . LEU A 164 ? 0.4814 0.4599 0.4303 0.0354  -0.0193 -0.0134 352 LEU A CG  
1249 C CD1 . LEU A 164 ? 0.5075 0.4763 0.4562 0.0292  -0.0187 -0.0145 352 LEU A CD1 
1250 C CD2 . LEU A 164 ? 0.4718 0.4617 0.4193 0.0324  -0.0186 -0.0095 352 LEU A CD2 
1251 N N   . THR A 165 ? 0.4389 0.4428 0.3934 0.0502  -0.0217 -0.0252 353 THR A N   
1252 C CA  . THR A 165 ? 0.3942 0.4044 0.3511 0.0515  -0.0228 -0.0284 353 THR A CA  
1253 C C   . THR A 165 ? 0.3908 0.4109 0.3516 0.0504  -0.0229 -0.0290 353 THR A C   
1254 O O   . THR A 165 ? 0.4214 0.4454 0.3816 0.0509  -0.0219 -0.0278 353 THR A O   
1255 C CB  . THR A 165 ? 0.3908 0.4010 0.3480 0.0560  -0.0230 -0.0285 353 THR A CB  
1256 O OG1 . THR A 165 ? 0.4398 0.4419 0.3950 0.0574  -0.0216 -0.0290 353 THR A OG1 
1257 C CG2 . THR A 165 ? 0.3056 0.3210 0.2654 0.0566  -0.0244 -0.0306 353 THR A CG2 
1258 N N   . PRO A 166 ? 0.3269 0.3519 0.2922 0.0486  -0.0240 -0.0310 354 PRO A N   
1259 C CA  . PRO A 166 ? 0.3013 0.3362 0.2732 0.0484  -0.0231 -0.0327 354 PRO A CA  
1260 C C   . PRO A 166 ? 0.3010 0.3391 0.2764 0.0525  -0.0235 -0.0347 354 PRO A C   
1261 O O   . PRO A 166 ? 0.3327 0.3675 0.3083 0.0547  -0.0259 -0.0344 354 PRO A O   
1262 C CB  . PRO A 166 ? 0.2316 0.2706 0.2096 0.0459  -0.0250 -0.0336 354 PRO A CB  
1263 C CG  . PRO A 166 ? 0.3322 0.3642 0.3058 0.0461  -0.0282 -0.0330 354 PRO A CG  
1264 C CD  . PRO A 166 ? 0.2871 0.3095 0.2521 0.0468  -0.0263 -0.0320 354 PRO A CD  
1265 N N   . LYS A 167 ? 0.2785 0.3228 0.2561 0.0527  -0.0210 -0.0370 355 LYS A N   
1266 C CA  . LYS A 167 ? 0.3239 0.3709 0.3059 0.0557  -0.0209 -0.0404 355 LYS A CA  
1267 C C   . LYS A 167 ? 0.3243 0.3800 0.3149 0.0555  -0.0179 -0.0449 355 LYS A C   
1268 O O   . LYS A 167 ? 0.3402 0.4013 0.3281 0.0526  -0.0140 -0.0463 355 LYS A O   
1269 C CB  . LYS A 167 ? 0.3610 0.4068 0.3359 0.0559  -0.0202 -0.0403 355 LYS A CB  
1270 C CG  . LYS A 167 ? 0.4075 0.4466 0.3758 0.0563  -0.0221 -0.0356 355 LYS A CG  
1271 C CD  . LYS A 167 ? 0.4960 0.5326 0.4654 0.0589  -0.0240 -0.0358 355 LYS A CD  
1272 C CE  . LYS A 167 ? 0.5908 0.6228 0.5561 0.0600  -0.0249 -0.0319 355 LYS A CE  
1273 N NZ  . LYS A 167 ? 0.6138 0.6459 0.5812 0.0618  -0.0261 -0.0321 355 LYS A NZ  
1274 N N   . LEU A 168 ? 0.3138 0.3711 0.3153 0.0587  -0.0194 -0.0471 356 LEU A N   
1275 C CA  . LEU A 168 ? 0.2804 0.3460 0.2942 0.0600  -0.0163 -0.0522 356 LEU A CA  
1276 C C   . LEU A 168 ? 0.3514 0.4184 0.3647 0.0610  -0.0122 -0.0587 356 LEU A C   
1277 O O   . LEU A 168 ? 0.3433 0.4041 0.3547 0.0628  -0.0141 -0.0595 356 LEU A O   
1278 C CB  . LEU A 168 ? 0.2655 0.3311 0.2929 0.0637  -0.0205 -0.0510 356 LEU A CB  
1279 C CG  . LEU A 168 ? 0.3056 0.3806 0.3506 0.0665  -0.0180 -0.0555 356 LEU A CG  
1280 C CD1 . LEU A 168 ? 0.3044 0.3895 0.3519 0.0628  -0.0149 -0.0557 356 LEU A CD1 
1281 C CD2 . LEU A 168 ? 0.2820 0.3555 0.3406 0.0707  -0.0241 -0.0521 356 LEU A CD2 
1282 N N   . GLY A 169 ? 0.3709 0.4464 0.3847 0.0588  -0.0062 -0.0636 357 GLY A N   
1283 C CA  . GLY A 169 ? 0.3493 0.4277 0.3619 0.0586  -0.0012 -0.0717 357 GLY A CA  
1284 C C   . GLY A 169 ? 0.3882 0.4738 0.4170 0.0616  0.0040  -0.0802 357 GLY A C   
1285 O O   . GLY A 169 ? 0.3554 0.4434 0.4000 0.0654  0.0023  -0.0790 357 GLY A O   
1286 N N   . ASP A 170 ? 0.3451 0.4347 0.3701 0.0598  0.0104  -0.0891 358 ASP A N   
1287 C CA  . ASP A 170 ? 0.4075 0.5050 0.4470 0.0623  0.0178  -0.0996 358 ASP A CA  
1288 C C   . ASP A 170 ? 0.4082 0.5004 0.4687 0.0702  0.0152  -0.1020 358 ASP A C   
1289 O O   . ASP A 170 ? 0.4197 0.5182 0.4986 0.0742  0.0158  -0.1019 358 ASP A O   
1290 C CB  . ASP A 170 ? 0.4401 0.5512 0.4855 0.0599  0.0231  -0.0995 358 ASP A CB  
1291 C CG  . ASP A 170 ? 0.5053 0.6226 0.5311 0.0515  0.0279  -0.0989 358 ASP A CG  
1292 O OD1 . ASP A 170 ? 0.5501 0.6624 0.5585 0.0480  0.0270  -0.0993 358 ASP A OD1 
1293 O OD2 . ASP A 170 ? 0.5187 0.6464 0.5469 0.0480  0.0321  -0.0973 358 ASP A OD2 
1294 N N   . PHE A 171 ? 0.4396 0.5205 0.4979 0.0719  0.0120  -0.1038 359 PHE A N   
1295 C CA  . PHE A 171 ? 0.4108 0.4836 0.4875 0.0787  0.0083  -0.1043 359 PHE A CA  
1296 C C   . PHE A 171 ? 0.3798 0.4534 0.4709 0.0824  0.0157  -0.1177 359 PHE A C   
1297 O O   . PHE A 171 ? 0.4215 0.4862 0.5283 0.0880  0.0133  -0.1193 359 PHE A O   
1298 C CB  . PHE A 171 ? 0.3783 0.4378 0.4462 0.0780  0.0011  -0.0986 359 PHE A CB  
1299 C CG  . PHE A 171 ? 0.3661 0.4227 0.4296 0.0777  -0.0067 -0.0857 359 PHE A CG  
1300 C CD1 . PHE A 171 ? 0.3551 0.4161 0.4035 0.0731  -0.0074 -0.0801 359 PHE A CD1 
1301 C CD2 . PHE A 171 ? 0.3473 0.3965 0.4216 0.0816  -0.0133 -0.0793 359 PHE A CD2 
1302 C CE1 . PHE A 171 ? 0.3473 0.4052 0.3916 0.0726  -0.0137 -0.0701 359 PHE A CE1 
1303 C CE2 . PHE A 171 ? 0.3276 0.3749 0.3958 0.0803  -0.0198 -0.0685 359 PHE A CE2 
1304 C CZ  . PHE A 171 ? 0.3338 0.3854 0.3871 0.0759  -0.0196 -0.0648 359 PHE A CZ  
1305 N N   . GLY A 172 ? 0.4206 0.5042 0.5058 0.0787  0.0251  -0.1275 360 GLY A N   
1306 C CA  . GLY A 172 ? 0.4250 0.5102 0.5218 0.0813  0.0341  -0.1427 360 GLY A CA  
1307 C C   . GLY A 172 ? 0.4297 0.5182 0.5571 0.0903  0.0367  -0.1466 360 GLY A C   
1308 O O   . GLY A 172 ? 0.4237 0.5086 0.5647 0.0945  0.0427  -0.1589 360 GLY A O   
1309 N N   . LEU A 173 ? 0.4065 0.5027 0.5457 0.0932  0.0324  -0.1367 361 LEU A N   
1310 C CA  . LEU A 173 ? 0.4318 0.5327 0.6025 0.1022  0.0328  -0.1381 361 LEU A CA  
1311 C C   . LEU A 173 ? 0.4382 0.5269 0.6220 0.1082  0.0209  -0.1268 361 LEU A C   
1312 O O   . LEU A 173 ? 0.4691 0.5612 0.6798 0.1159  0.0188  -0.1251 361 LEU A O   
1313 C CB  . LEU A 173 ? 0.4558 0.5758 0.6351 0.1012  0.0358  -0.1350 361 LEU A CB  
1314 C CG  . LEU A 173 ? 0.4685 0.6031 0.6394 0.0954  0.0489  -0.1462 361 LEU A CG  
1315 C CD1 . LEU A 173 ? 0.4665 0.6206 0.6523 0.0952  0.0521  -0.1435 361 LEU A CD1 
1316 C CD2 . LEU A 173 ? 0.4290 0.5621 0.6087 0.0987  0.0597  -0.1636 361 LEU A CD2 
1317 N N   . ALA A 174 ? 0.4156 0.4914 0.5809 0.1045  0.0130  -0.1185 362 ALA A N   
1318 C CA  . ALA A 174 ? 0.4495 0.5147 0.6227 0.1082  0.0015  -0.1061 362 ALA A CA  
1319 C C   . ALA A 174 ? 0.4817 0.5360 0.6786 0.1163  0.0006  -0.1099 362 ALA A C   
1320 O O   . ALA A 174 ? 0.5252 0.5717 0.7228 0.1168  0.0070  -0.1219 362 ALA A O   
1321 C CB  . ALA A 174 ? 0.3715 0.4260 0.5199 0.1020  -0.0046 -0.0983 362 ALA A CB  
1322 N N   . ARG A 175 ? 0.3829 0.4361 0.5990 0.1221  -0.0080 -0.0994 363 ARG A N   
1323 C CA  . ARG A 175 ? 0.4857 0.5273 0.7268 0.1304  -0.0110 -0.0996 363 ARG A CA  
1324 C C   . ARG A 175 ? 0.5533 0.5859 0.7962 0.1311  -0.0248 -0.0820 363 ARG A C   
1325 O O   . ARG A 175 ? 0.5625 0.6036 0.7977 0.1280  -0.0316 -0.0707 363 ARG A O   
1326 C CB  . ARG A 175 ? 0.5274 0.5808 0.8006 0.1392  -0.0059 -0.1063 363 ARG A CB  
1327 C CG  . ARG A 175 ? 0.6316 0.6845 0.9136 0.1421  0.0077  -0.1260 363 ARG A CG  
1328 C CD  . ARG A 175 ? 0.7279 0.7989 0.9972 0.1365  0.0189  -0.1362 363 ARG A CD  
1329 N NE  . ARG A 175 ? 0.8175 0.8883 1.0907 0.1376  0.0326  -0.1559 363 ARG A NE  
1330 C CZ  . ARG A 175 ? 0.8783 0.9426 1.1263 0.1300  0.0385  -0.1655 363 ARG A CZ  
1331 N NH1 . ARG A 175 ? 0.8803 0.9382 1.0995 0.1217  0.0318  -0.1567 363 ARG A NH1 
1332 N NH2 . ARG A 175 ? 0.9257 0.9898 1.1743 0.1290  0.0505  -0.1819 363 ARG A NH2 
1333 N N   . PHE A 176 ? 0.6056 0.6207 0.8578 0.1345  -0.0287 -0.0800 364 PHE A N   
1334 C CA  . PHE A 176 ? 0.6366 0.6425 0.8922 0.1352  -0.0417 -0.0628 364 PHE A CA  
1335 C C   . PHE A 176 ? 0.6823 0.6953 0.9682 0.1439  -0.0483 -0.0549 364 PHE A C   
1336 O O   . PHE A 176 ? 0.6538 0.6744 0.9644 0.1515  -0.0420 -0.0645 364 PHE A O   
1337 C CB  . PHE A 176 ? 0.6152 0.5991 0.8703 0.1347  -0.0436 -0.0625 364 PHE A CB  
1338 C CG  . PHE A 176 ? 0.6155 0.5929 0.8399 0.1248  -0.0433 -0.0614 364 PHE A CG  
1339 C CD1 . PHE A 176 ? 0.6644 0.6418 0.8714 0.1189  -0.0518 -0.0467 364 PHE A CD1 
1340 C CD2 . PHE A 176 ? 0.5952 0.5675 0.8085 0.1211  -0.0346 -0.0756 364 PHE A CD2 
1341 C CE1 . PHE A 176 ? 0.6978 0.6708 0.8793 0.1105  -0.0509 -0.0461 364 PHE A CE1 
1342 C CE2 . PHE A 176 ? 0.6432 0.6114 0.8308 0.1123  -0.0350 -0.0740 364 PHE A CE2 
1343 C CZ  . PHE A 176 ? 0.6648 0.6335 0.8377 0.1074  -0.0428 -0.0592 364 PHE A CZ  
1344 N N   . SER A 177 ? 0.7210 0.7329 1.0051 0.1424  -0.0610 -0.0373 365 SER A N   
1345 C CA  . SER A 177 ? 0.8066 0.8251 1.1188 0.1499  -0.0701 -0.0266 365 SER A CA  
1346 C C   . SER A 177 ? 0.9002 0.9038 1.2389 0.1583  -0.0708 -0.0271 365 SER A C   
1347 O O   . SER A 177 ? 0.9244 0.9081 1.2575 0.1568  -0.0733 -0.0241 365 SER A O   
1348 C CB  . SER A 177 ? 0.8032 0.8228 1.1018 0.1442  -0.0841 -0.0072 365 SER A CB  
1349 O OG  . SER A 177 ? 0.7933 0.8293 1.0733 0.1373  -0.0838 -0.0064 365 SER A OG  
1350 N N   . ARG A 178 ? 0.9673 0.9806 1.3289 0.1642  -0.0670 -0.0300 366 ARG A N   
1351 C CA  . ARG A 178 ? 1.0170 1.0178 1.3997 0.1704  -0.0657 -0.0303 366 ARG A CA  
1352 C C   . ARG A 178 ? 1.0247 1.0077 1.4033 0.1702  -0.0552 -0.0458 366 ARG A C   
1353 O O   . ARG A 178 ? 1.0248 1.0137 1.4062 0.1715  -0.0421 -0.0634 366 ARG A O   
1354 C CB  . ARG A 178 ? 1.0604 1.0500 1.4465 0.1702  -0.0806 -0.0097 366 ARG A CB  
1355 C CG  . ARG A 178 ? 1.1154 1.1225 1.5052 0.1696  -0.0920 0.0058  366 ARG A CG  
1356 C CD  . ARG A 178 ? 1.1764 1.1724 1.5625 0.1669  -0.1069 0.0267  366 ARG A CD  
1357 N NE  . ARG A 178 ? 1.1939 1.1979 1.5572 0.1588  -0.1166 0.0386  366 ARG A NE  
1358 C CZ  . ARG A 178 ? 1.2144 1.2134 1.5685 0.1540  -0.1299 0.0575  366 ARG A CZ  
1359 N NH1 . ARG A 178 ? 1.2500 1.2360 1.6170 0.1569  -0.1356 0.0675  366 ARG A NH1 
1360 N NH2 . ARG A 178 ? 1.1893 1.1965 1.5205 0.1459  -0.1373 0.0662  366 ARG A NH2 
1361 N N   . THR A 195 ? 0.9857 1.1827 1.3863 0.1521  0.1054  -0.2027 383 THR A N   
1362 C CA  . THR A 195 ? 0.9731 1.1507 1.3623 0.1528  0.0913  -0.1924 383 THR A CA  
1363 C C   . THR A 195 ? 0.9832 1.1709 1.3602 0.1473  0.0829  -0.1807 383 THR A C   
1364 O O   . THR A 195 ? 0.9871 1.1614 1.3521 0.1468  0.0715  -0.1720 383 THR A O   
1365 C CB  . THR A 195 ? 0.9321 1.0970 1.3478 0.1639  0.0799  -0.1825 383 THR A CB  
1366 O OG1 . THR A 195 ? 0.8726 1.0165 1.2742 0.1633  0.0680  -0.1743 383 THR A OG1 
1367 C CG2 . THR A 195 ? 0.9194 1.1024 1.3604 0.1686  0.0718  -0.1692 383 THR A CG2 
1368 N N   . VAL A 196 ? 0.9491 1.1605 1.3292 0.1428  0.0888  -0.1809 384 VAL A N   
1369 C CA  . VAL A 196 ? 0.8891 1.1120 1.2595 0.1369  0.0817  -0.1709 384 VAL A CA  
1370 C C   . VAL A 196 ? 0.8425 1.0636 1.1773 0.1264  0.0876  -0.1771 384 VAL A C   
1371 O O   . VAL A 196 ? 0.8409 1.0712 1.1633 0.1196  0.1011  -0.1878 384 VAL A O   
1372 C CB  . VAL A 196 ? 0.8648 1.1148 1.2557 0.1358  0.0847  -0.1675 384 VAL A CB  
1373 C CG1 . VAL A 196 ? 0.8844 1.1474 1.2793 0.1334  0.1022  -0.1812 384 VAL A CG1 
1374 C CG2 . VAL A 196 ? 0.8380 1.1009 1.2147 0.1271  0.0803  -0.1604 384 VAL A CG2 
1375 N N   . ARG A 197 ? 0.8645 1.0740 1.1824 0.1248  0.0770  -0.1698 385 ARG A N   
1376 C CA  . ARG A 197 ? 0.8349 1.0380 1.1151 0.1145  0.0798  -0.1722 385 ARG A CA  
1377 C C   . ARG A 197 ? 0.7751 0.9768 1.0341 0.1065  0.0684  -0.1551 385 ARG A C   
1378 O O   . ARG A 197 ? 0.7676 0.9580 1.0278 0.1094  0.0546  -0.1426 385 ARG A O   
1379 C CB  . ARG A 197 ? 0.8620 1.0415 1.1279 0.1163  0.0773  -0.1769 385 ARG A CB  
1380 C CG  . ARG A 197 ? 0.8977 1.0666 1.1837 0.1242  0.0811  -0.1849 385 ARG A CG  
1381 C CD  . ARG A 197 ? 0.9151 1.0598 1.1868 0.1246  0.0769  -0.1878 385 ARG A CD  
1382 N NE  . ARG A 197 ? 0.9523 1.0835 1.2448 0.1323  0.0769  -0.1910 385 ARG A NE  
1383 C CZ  . ARG A 197 ? 0.9635 1.0826 1.2743 0.1402  0.0653  -0.1804 385 ARG A CZ  
1384 N NH1 . ARG A 197 ? 0.9877 1.0946 1.3169 0.1468  0.0662  -0.1837 385 ARG A NH1 
1385 N NH2 . ARG A 197 ? 0.9336 1.0527 1.2437 0.1412  0.0527  -0.1662 385 ARG A NH2 
1386 N N   . GLY A 198 ? 0.7301 0.9431 0.9697 0.0960  0.0745  -0.1548 386 GLY A N   
1387 C CA  . GLY A 198 ? 0.6833 0.8933 0.9013 0.0878  0.0653  -0.1404 386 GLY A CA  
1388 C C   . GLY A 198 ? 0.6478 0.8775 0.8638 0.0792  0.0723  -0.1393 386 GLY A C   
1389 O O   . GLY A 198 ? 0.6520 0.8985 0.8799 0.0786  0.0854  -0.1501 386 GLY A O   
1390 N N   . THR A 199 ? 0.6559 0.8835 0.8573 0.0721  0.0640  -0.1264 387 THR A N   
1391 C CA  . THR A 199 ? 0.5721 0.8168 0.7729 0.0631  0.0689  -0.1233 387 THR A CA  
1392 C C   . THR A 199 ? 0.5049 0.7622 0.7347 0.0667  0.0622  -0.1170 387 THR A C   
1393 O O   . THR A 199 ? 0.4758 0.7233 0.7049 0.0682  0.0488  -0.1065 387 THR A O   
1394 C CB  . THR A 199 ? 0.5912 0.8254 0.7592 0.0523  0.0643  -0.1134 387 THR A CB  
1395 O OG1 . THR A 199 ? 0.6195 0.8422 0.7616 0.0496  0.0684  -0.1179 387 THR A OG1 
1396 C CG2 . THR A 199 ? 0.5845 0.8353 0.7513 0.0420  0.0705  -0.1106 387 THR A CG2 
1397 N N   . LEU A 200 ? 0.4743 0.7545 0.7295 0.0676  0.0717  -0.1237 388 LEU A N   
1398 C CA  . LEU A 200 ? 0.4356 0.7314 0.7242 0.0722  0.0658  -0.1191 388 LEU A CA  
1399 C C   . LEU A 200 ? 0.3800 0.6754 0.6606 0.0642  0.0541  -0.1053 388 LEU A C   
1400 O O   . LEU A 200 ? 0.4142 0.7154 0.7159 0.0681  0.0436  -0.0985 388 LEU A O   
1401 C CB  . LEU A 200 ? 0.4411 0.7644 0.7565 0.0724  0.0800  -0.1289 388 LEU A CB  
1402 C CG  . LEU A 200 ? 0.4764 0.8041 0.8071 0.0812  0.0932  -0.1450 388 LEU A CG  
1403 C CD1 . LEU A 200 ? 0.4756 0.8334 0.8351 0.0808  0.1073  -0.1541 388 LEU A CD1 
1404 C CD2 . LEU A 200 ? 0.4636 0.7788 0.8149 0.0956  0.0846  -0.1454 388 LEU A CD2 
1405 N N   . ALA A 201 ? 0.3654 0.6535 0.6157 0.0527  0.0556  -0.1012 389 ALA A N   
1406 C CA  . ALA A 201 ? 0.4026 0.6879 0.6432 0.0442  0.0456  -0.0895 389 ALA A CA  
1407 C C   . ALA A 201 ? 0.3457 0.6136 0.5820 0.0491  0.0300  -0.0812 389 ALA A C   
1408 O O   . ALA A 201 ? 0.3623 0.6332 0.6047 0.0459  0.0199  -0.0733 389 ALA A O   
1409 C CB  . ALA A 201 ? 0.4185 0.6945 0.6266 0.0325  0.0499  -0.0867 389 ALA A CB  
1410 N N   . TYR A 202 ? 0.3657 0.6157 0.5902 0.0559  0.0282  -0.0834 390 TYR A N   
1411 C CA  . TYR A 202 ? 0.3445 0.5766 0.5605 0.0595  0.0148  -0.0757 390 TYR A CA  
1412 C C   . TYR A 202 ? 0.3711 0.6059 0.6138 0.0708  0.0082  -0.0753 390 TYR A C   
1413 O O   . TYR A 202 ? 0.3910 0.6117 0.6278 0.0741  -0.0027 -0.0687 390 TYR A O   
1414 C CB  . TYR A 202 ? 0.3193 0.5299 0.5059 0.0590  0.0156  -0.0766 390 TYR A CB  
1415 C CG  . TYR A 202 ? 0.3397 0.5444 0.4996 0.0483  0.0180  -0.0732 390 TYR A CG  
1416 C CD1 . TYR A 202 ? 0.3510 0.5619 0.5014 0.0428  0.0297  -0.0786 390 TYR A CD1 
1417 C CD2 . TYR A 202 ? 0.3148 0.5077 0.4594 0.0434  0.0087  -0.0644 390 TYR A CD2 
1418 C CE1 . TYR A 202 ? 0.2957 0.5004 0.4228 0.0330  0.0309  -0.0737 390 TYR A CE1 
1419 C CE2 . TYR A 202 ? 0.2935 0.4795 0.4162 0.0343  0.0107  -0.0611 390 TYR A CE2 
1420 C CZ  . TYR A 202 ? 0.3113 0.5029 0.4259 0.0293  0.0213  -0.0649 390 TYR A CZ  
1421 O OH  . TYR A 202 ? 0.4080 0.5917 0.5016 0.0205  0.0224  -0.0599 390 TYR A OH  
1422 N N   . LEU A 203 ? 0.3493 0.6024 0.6222 0.0766  0.0148  -0.0819 391 LEU A N   
1423 C CA  . LEU A 203 ? 0.3342 0.5881 0.6345 0.0888  0.0097  -0.0822 391 LEU A CA  
1424 C C   . LEU A 203 ? 0.3555 0.6308 0.6897 0.0916  0.0034  -0.0772 391 LEU A C   
1425 O O   . LEU A 203 ? 0.3396 0.6356 0.6862 0.0865  0.0096  -0.0797 391 LEU A O   
1426 C CB  . LEU A 203 ? 0.3427 0.5974 0.6540 0.0964  0.0226  -0.0956 391 LEU A CB  
1427 C CG  . LEU A 203 ? 0.3909 0.6243 0.6736 0.0957  0.0268  -0.1008 391 LEU A CG  
1428 C CD1 . LEU A 203 ? 0.4283 0.6662 0.7211 0.1006  0.0414  -0.1162 391 LEU A CD1 
1429 C CD2 . LEU A 203 ? 0.3667 0.5794 0.6436 0.1010  0.0144  -0.0933 391 LEU A CD2 
1430 N N   . PRO A 204 ? 0.3381 0.6090 0.6879 0.0993  -0.0095 -0.0694 392 PRO A N   
1431 C CA  . PRO A 204 ? 0.3518 0.6424 0.7347 0.1026  -0.0185 -0.0626 392 PRO A CA  
1432 C C   . PRO A 204 ? 0.4158 0.7251 0.8386 0.1129  -0.0093 -0.0714 392 PRO A C   
1433 O O   . PRO A 204 ? 0.4048 0.7062 0.8306 0.1201  0.0009  -0.0818 392 PRO A O   
1434 C CB  . PRO A 204 ? 0.3786 0.6540 0.7597 0.1074  -0.0348 -0.0512 392 PRO A CB  
1435 C CG  . PRO A 204 ? 0.4151 0.6668 0.7785 0.1123  -0.0301 -0.0563 392 PRO A CG  
1436 C CD  . PRO A 204 ? 0.3725 0.6190 0.7072 0.1040  -0.0172 -0.0651 392 PRO A CD  
1437 N N   . GLU A 205 ? 0.4189 0.7534 0.8727 0.1134  -0.0129 -0.0678 393 GLU A N   
1438 C CA  . GLU A 205 ? 0.5102 0.8666 1.0055 0.1228  -0.0031 -0.0767 393 GLU A CA  
1439 C C   . GLU A 205 ? 0.5160 0.8557 1.0229 0.1358  -0.0059 -0.0746 393 GLU A C   
1440 O O   . GLU A 205 ? 0.5294 0.8667 1.0445 0.1419  0.0074  -0.0848 393 GLU A O   
1441 C CB  . GLU A 205 ? 0.6350 1.0191 1.1563 0.1190  -0.0087 -0.0697 393 GLU A CB  
1442 C CG  . GLU A 205 ? 0.7535 1.1560 1.3001 0.1230  0.0054  -0.0769 393 GLU A CG  
1443 C CD  . GLU A 205 ? 0.8352 1.2440 1.3697 0.1168  0.0258  -0.0918 393 GLU A CD  
1444 O OE1 . GLU A 205 ? 0.8916 1.3062 1.4388 0.1218  0.0398  -0.1009 393 GLU A OE1 
1445 O OE2 . GLU A 205 ? 0.8427 1.2507 1.3534 0.1062  0.0277  -0.0942 393 GLU A OE2 
1446 N N   . GLU A 206 ? 0.5024 0.8294 1.0076 0.1389  -0.0231 -0.0613 394 GLU A N   
1447 C CA  . GLU A 206 ? 0.4518 0.7617 0.9665 0.1499  -0.0272 -0.0573 394 GLU A CA  
1448 C C   . GLU A 206 ? 0.4771 0.7636 0.9750 0.1537  -0.0163 -0.0687 394 GLU A C   
1449 O O   . GLU A 206 ? 0.4931 0.7686 1.0026 0.1624  -0.0123 -0.0719 394 GLU A O   
1450 C CB  . GLU A 206 ? 0.4501 0.7502 0.9602 0.1500  -0.0478 -0.0398 394 GLU A CB  
1451 C CG  . GLU A 206 ? 0.4818 0.7551 0.9639 0.1490  -0.0534 -0.0373 394 GLU A CG  
1452 C CD  . GLU A 206 ? 0.5721 0.8466 1.0296 0.1383  -0.0595 -0.0349 394 GLU A CD  
1453 O OE1 . GLU A 206 ? 0.5902 0.8831 1.0487 0.1300  -0.0625 -0.0315 394 GLU A OE1 
1454 O OE2 . GLU A 206 ? 0.6268 0.8778 1.0511 0.1346  -0.0593 -0.0349 394 GLU A OE2 
1455 N N   . TYR A 207 ? 0.5189 0.7981 0.9899 0.1468  -0.0117 -0.0752 395 TYR A N   
1456 C CA  . TYR A 207 ? 0.5445 0.8040 0.9978 0.1488  -0.0008 -0.0870 395 TYR A CA  
1457 C C   . TYR A 207 ? 0.5843 0.8543 1.0423 0.1483  0.0186  -0.1030 395 TYR A C   
1458 O O   . TYR A 207 ? 0.6780 0.9352 1.1360 0.1533  0.0276  -0.1123 395 TYR A O   
1459 C CB  . TYR A 207 ? 0.4984 0.7442 0.9150 0.1404  -0.0031 -0.0866 395 TYR A CB  
1460 C CG  . TYR A 207 ? 0.5448 0.7744 0.9420 0.1406  0.0092  -0.0998 395 TYR A CG  
1461 C CD1 . TYR A 207 ? 0.5700 0.7793 0.9709 0.1485  0.0073  -0.1017 395 TYR A CD1 
1462 C CD2 . TYR A 207 ? 0.5627 0.7969 0.9373 0.1318  0.0224  -0.1096 395 TYR A CD2 
1463 C CE1 . TYR A 207 ? 0.5692 0.7643 0.9526 0.1477  0.0180  -0.1142 395 TYR A CE1 
1464 C CE2 . TYR A 207 ? 0.5679 0.7887 0.9242 0.1312  0.0327  -0.1214 395 TYR A CE2 
1465 C CZ  . TYR A 207 ? 0.5869 0.7888 0.9483 0.1392  0.0304  -0.1244 395 TYR A CZ  
1466 O OH  . TYR A 207 ? 0.6117 0.8007 0.9548 0.1376  0.0400  -0.1367 395 TYR A OH  
1467 N N   . ILE A 208 ? 0.4921 0.7852 0.9525 0.1411  0.0251  -0.1062 396 ILE A N   
1468 C CA  . ILE A 208 ? 0.4972 0.8025 0.9594 0.1386  0.0439  -0.1204 396 ILE A CA  
1469 C C   . ILE A 208 ? 0.5187 0.8274 1.0090 0.1482  0.0491  -0.1236 396 ILE A C   
1470 O O   . ILE A 208 ? 0.5571 0.8617 1.0454 0.1501  0.0632  -0.1368 396 ILE A O   
1471 C CB  . ILE A 208 ? 0.4932 0.8249 0.9564 0.1284  0.0487  -0.1206 396 ILE A CB  
1472 C CG1 . ILE A 208 ? 0.4767 0.7999 0.9040 0.1172  0.0446  -0.1167 396 ILE A CG1 
1473 C CG2 . ILE A 208 ? 0.4966 0.8418 0.9622 0.1254  0.0683  -0.1340 396 ILE A CG2 
1474 C CD1 . ILE A 208 ? 0.4716 0.8130 0.8903 0.1042  0.0485  -0.1139 396 ILE A CD1 
1475 N N   . LYS A 209 ? 0.5021 0.8181 1.0179 0.1540  0.0369  -0.1115 397 LYS A N   
1476 C CA  . LYS A 209 ? 0.6103 0.9305 1.1557 0.1643  0.0397  -0.1129 397 LYS A CA  
1477 C C   . LYS A 209 ? 0.7045 0.9973 1.2483 0.1732  0.0372  -0.1144 397 LYS A C   
1478 O O   . LYS A 209 ? 0.7564 1.0426 1.3040 0.1775  0.0498  -0.1273 397 LYS A O   
1479 C CB  . LYS A 209 ? 0.6109 0.9491 1.1830 0.1670  0.0262  -0.0984 397 LYS A CB  
1480 C CG  . LYS A 209 ? 0.6522 1.0185 1.2286 0.1573  0.0275  -0.0962 397 LYS A CG  
1481 C CD  . LYS A 209 ? 0.7161 1.1073 1.3277 0.1620  0.0272  -0.0926 397 LYS A CD  
1482 C CE  . LYS A 209 ? 0.7198 1.1368 1.3371 0.1518  0.0210  -0.0846 397 LYS A CE  
1483 N NZ  . LYS A 209 ? 0.7228 1.1342 1.3334 0.1491  -0.0003 -0.0685 397 LYS A NZ  
1484 N N   . THR A 210 ? 0.7126 0.9895 1.2505 0.1751  0.0209  -0.1013 398 THR A N   
1485 C CA  . THR A 210 ? 0.7200 0.9709 1.2580 0.1827  0.0165  -0.1000 398 THR A CA  
1486 C C   . THR A 210 ? 0.7350 0.9647 1.2453 0.1794  0.0253  -0.1118 398 THR A C   
1487 O O   . THR A 210 ? 0.7653 0.9851 1.2786 0.1834  0.0362  -0.1241 398 THR A O   
1488 C CB  . THR A 210 ? 0.6963 0.9372 1.2335 0.1841  -0.0037 -0.0811 398 THR A CB  
1489 O OG1 . THR A 210 ? 0.7059 0.9670 1.2679 0.1866  -0.0131 -0.0697 398 THR A OG1 
1490 C CG2 . THR A 210 ? 0.6921 0.9062 1.2305 0.1913  -0.0079 -0.0792 398 THR A CG2 
1491 N N   . GLY A 211 ? 0.7064 0.9293 1.1899 0.1718  0.0202  -0.1082 399 GLY A N   
1492 C CA  . GLY A 211 ? 0.6995 0.9038 1.1558 0.1680  0.0271  -0.1183 399 GLY A CA  
1493 C C   . GLY A 211 ? 0.7159 0.8944 1.1616 0.1703  0.0155  -0.1102 399 GLY A C   
1494 O O   . GLY A 211 ? 0.7165 0.8775 1.1431 0.1682  0.0205  -0.1184 399 GLY A O   
1495 N N   . ARG A 212 ? 0.6935 0.8703 1.1509 0.1737  0.0000  -0.0936 400 ARG A N   
1496 C CA  . ARG A 212 ? 0.7690 0.9230 1.2145 0.1742  -0.0121 -0.0835 400 ARG A CA  
1497 C C   . ARG A 212 ? 0.7705 0.9273 1.1954 0.1669  -0.0224 -0.0736 400 ARG A C   
1498 O O   . ARG A 212 ? 0.7535 0.9278 1.1849 0.1644  -0.0298 -0.0648 400 ARG A O   
1499 C CB  . ARG A 212 ? 0.8660 1.0138 1.3342 0.1819  -0.0231 -0.0707 400 ARG A CB  
1500 C CG  . ARG A 212 ? 0.9416 1.0629 1.4091 0.1862  -0.0231 -0.0725 400 ARG A CG  
1501 C CD  . ARG A 212 ? 0.9540 1.0567 1.3940 0.1804  -0.0295 -0.0678 400 ARG A CD  
1502 N NE  . ARG A 212 ? 1.0029 1.0824 1.4373 0.1819  -0.0238 -0.0764 400 ARG A NE  
1503 C CZ  . ARG A 212 ? 1.0498 1.1100 1.4911 0.1855  -0.0316 -0.0680 400 ARG A CZ  
1504 N NH1 . ARG A 212 ? 1.0675 1.1073 1.5036 0.1858  -0.0257 -0.0774 400 ARG A NH1 
1505 N NH2 . ARG A 212 ? 1.0609 1.1221 1.5135 0.1880  -0.0457 -0.0501 400 ARG A NH2 
1506 N N   . LEU A 213 ? 0.7529 0.8928 1.1532 0.1631  -0.0232 -0.0756 401 LEU A N   
1507 C CA  . LEU A 213 ? 0.7374 0.8792 1.1157 0.1561  -0.0313 -0.0688 401 LEU A CA  
1508 C C   . LEU A 213 ? 0.6398 0.7693 1.0127 0.1556  -0.0481 -0.0509 401 LEU A C   
1509 O O   . LEU A 213 ? 0.6520 0.7638 1.0298 0.1600  -0.0520 -0.0467 401 LEU A O   
1510 C CB  . LEU A 213 ? 0.8376 0.9669 1.1809 0.1483  -0.0221 -0.0781 401 LEU A CB  
1511 C CG  . LEU A 213 ? 0.9244 1.0654 1.2622 0.1450  -0.0060 -0.0943 401 LEU A CG  
1512 C CD1 . LEU A 213 ? 0.9600 1.0937 1.3120 0.1520  0.0054  -0.1101 401 LEU A CD1 
1513 C CD2 . LEU A 213 ? 0.9355 1.0724 1.2337 0.1333  -0.0032 -0.0945 401 LEU A CD2 
1514 N N   . ALA A 214 ? 0.6109 0.7486 0.9681 0.1477  -0.0569 -0.0399 402 ALA A N   
1515 C CA  . ALA A 214 ? 0.5087 0.6352 0.8499 0.1435  -0.0713 -0.0240 402 ALA A CA  
1516 C C   . ALA A 214 ? 0.4384 0.5623 0.7407 0.1313  -0.0703 -0.0232 402 ALA A C   
1517 O O   . ALA A 214 ? 0.4319 0.5618 0.7223 0.1270  -0.0594 -0.0337 402 ALA A O   
1518 C CB  . ALA A 214 ? 0.4088 0.5486 0.7725 0.1462  -0.0852 -0.0100 402 ALA A CB  
1519 N N   . VAL A 215 ? 0.4245 0.5398 0.7077 0.1257  -0.0812 -0.0107 403 VAL A N   
1520 C CA  . VAL A 215 ? 0.4620 0.5751 0.7109 0.1148  -0.0806 -0.0098 403 VAL A CA  
1521 C C   . VAL A 215 ? 0.4639 0.5960 0.7138 0.1095  -0.0816 -0.0094 403 VAL A C   
1522 O O   . VAL A 215 ? 0.4868 0.6199 0.7138 0.1014  -0.0768 -0.0133 403 VAL A O   
1523 C CB  . VAL A 215 ? 0.4659 0.5661 0.6949 0.1100  -0.0913 0.0027  403 VAL A CB  
1524 C CG1 . VAL A 215 ? 0.4480 0.5289 0.6726 0.1132  -0.0888 0.0015  403 VAL A CG1 
1525 C CG2 . VAL A 215 ? 0.4186 0.5263 0.6638 0.1115  -0.1058 0.0168  403 VAL A CG2 
1526 N N   . ASP A 216 ? 0.3738 0.5210 0.6524 0.1141  -0.0880 -0.0045 404 ASP A N   
1527 C CA  . ASP A 216 ? 0.4110 0.5787 0.6970 0.1094  -0.0896 -0.0041 404 ASP A CA  
1528 C C   . ASP A 216 ? 0.3452 0.5214 0.6300 0.1074  -0.0748 -0.0176 404 ASP A C   
1529 O O   . ASP A 216 ? 0.3965 0.5828 0.6715 0.0991  -0.0736 -0.0185 404 ASP A O   
1530 C CB  . ASP A 216 ? 0.5504 0.7343 0.8736 0.1166  -0.0984 0.0028  404 ASP A CB  
1531 C CG  . ASP A 216 ? 0.6898 0.8662 1.0149 0.1182  -0.1142 0.0181  404 ASP A CG  
1532 O OD1 . ASP A 216 ? 0.7865 0.9529 1.0817 0.1096  -0.1207 0.0250  404 ASP A OD1 
1533 O OD2 . ASP A 216 ? 0.7289 0.9095 1.0856 0.1279  -0.1201 0.0234  404 ASP A OD2 
1534 N N   . THR A 217 ? 0.3272 0.4991 0.6216 0.1142  -0.0636 -0.0282 405 THR A N   
1535 C CA  . THR A 217 ? 0.3559 0.5356 0.6475 0.1119  -0.0490 -0.0411 405 THR A CA  
1536 C C   . THR A 217 ? 0.3202 0.4903 0.5747 0.1016  -0.0456 -0.0423 405 THR A C   
1537 O O   . THR A 217 ? 0.3583 0.5385 0.6050 0.0944  -0.0410 -0.0448 405 THR A O   
1538 C CB  . THR A 217 ? 0.4134 0.5875 0.7174 0.1203  -0.0379 -0.0529 405 THR A CB  
1539 O OG1 . THR A 217 ? 0.4475 0.6258 0.7865 0.1312  -0.0424 -0.0507 405 THR A OG1 
1540 C CG2 . THR A 217 ? 0.4315 0.6187 0.7369 0.1178  -0.0229 -0.0659 405 THR A CG2 
1541 N N   . ASP A 218 ? 0.3037 0.4543 0.5370 0.1010  -0.0480 -0.0400 406 ASP A N   
1542 C CA  . ASP A 218 ? 0.3378 0.4781 0.5381 0.0926  -0.0461 -0.0399 406 ASP A CA  
1543 C C   . ASP A 218 ? 0.3287 0.4743 0.5180 0.0844  -0.0535 -0.0323 406 ASP A C   
1544 O O   . ASP A 218 ? 0.2719 0.4183 0.4444 0.0772  -0.0489 -0.0350 406 ASP A O   
1545 C CB  . ASP A 218 ? 0.3872 0.5078 0.5710 0.0937  -0.0492 -0.0371 406 ASP A CB  
1546 C CG  . ASP A 218 ? 0.4473 0.5598 0.6303 0.0976  -0.0397 -0.0470 406 ASP A CG  
1547 O OD1 . ASP A 218 ? 0.4809 0.6022 0.6705 0.0983  -0.0298 -0.0567 406 ASP A OD1 
1548 O OD2 . ASP A 218 ? 0.4411 0.5387 0.6158 0.0992  -0.0421 -0.0452 406 ASP A OD2 
1549 N N   . THR A 219 ? 0.2810 0.4297 0.4795 0.0851  -0.0654 -0.0228 407 THR A N   
1550 C CA  . THR A 219 ? 0.3280 0.4824 0.5160 0.0765  -0.0730 -0.0165 407 THR A CA  
1551 C C   . THR A 219 ? 0.3338 0.5053 0.5314 0.0719  -0.0678 -0.0211 407 THR A C   
1552 O O   . THR A 219 ? 0.3060 0.4765 0.4856 0.0630  -0.0667 -0.0217 407 THR A O   
1553 C CB  . THR A 219 ? 0.3307 0.4893 0.5298 0.0776  -0.0873 -0.0053 407 THR A CB  
1554 O OG1 . THR A 219 ? 0.3828 0.5250 0.5709 0.0803  -0.0917 -0.0001 407 THR A OG1 
1555 C CG2 . THR A 219 ? 0.2736 0.4380 0.4595 0.0672  -0.0951 -0.0001 407 THR A CG2 
1556 N N   . PHE A 220 ? 0.2868 0.4737 0.5136 0.0780  -0.0641 -0.0247 408 PHE A N   
1557 C CA  . PHE A 220 ? 0.2935 0.4987 0.5324 0.0738  -0.0578 -0.0294 408 PHE A CA  
1558 C C   . PHE A 220 ? 0.2706 0.4702 0.4886 0.0681  -0.0455 -0.0372 408 PHE A C   
1559 O O   . PHE A 220 ? 0.2481 0.4533 0.4575 0.0590  -0.0437 -0.0373 408 PHE A O   
1560 C CB  . PHE A 220 ? 0.3028 0.5251 0.5780 0.0829  -0.0539 -0.0334 408 PHE A CB  
1561 C CG  . PHE A 220 ? 0.3067 0.5518 0.5991 0.0785  -0.0484 -0.0369 408 PHE A CG  
1562 C CD1 . PHE A 220 ? 0.3222 0.5717 0.6098 0.0755  -0.0338 -0.0467 408 PHE A CD1 
1563 C CD2 . PHE A 220 ? 0.3299 0.5932 0.6436 0.0766  -0.0582 -0.0301 408 PHE A CD2 
1564 C CE1 . PHE A 220 ? 0.3492 0.6205 0.6526 0.0705  -0.0280 -0.0496 408 PHE A CE1 
1565 C CE2 . PHE A 220 ? 0.3974 0.6833 0.7288 0.0719  -0.0530 -0.0333 408 PHE A CE2 
1566 C CZ  . PHE A 220 ? 0.3736 0.6633 0.6998 0.0687  -0.0374 -0.0431 408 PHE A CZ  
1567 N N   . SER A 221 ? 0.2534 0.4416 0.4636 0.0729  -0.0375 -0.0434 409 SER A N   
1568 C CA  . SER A 221 ? 0.3297 0.5119 0.5187 0.0677  -0.0270 -0.0495 409 SER A CA  
1569 C C   . SER A 221 ? 0.3473 0.5172 0.5085 0.0590  -0.0314 -0.0444 409 SER A C   
1570 O O   . SER A 221 ? 0.3516 0.5231 0.5012 0.0514  -0.0263 -0.0458 409 SER A O   
1571 C CB  . SER A 221 ? 0.3528 0.5234 0.5355 0.0736  -0.0204 -0.0560 409 SER A CB  
1572 O OG  . SER A 221 ? 0.3353 0.5151 0.5444 0.0821  -0.0161 -0.0619 409 SER A OG  
1573 N N   . PHE A 222 ? 0.3405 0.4980 0.4915 0.0601  -0.0405 -0.0385 410 PHE A N   
1574 C CA  . PHE A 222 ? 0.3049 0.4505 0.4312 0.0527  -0.0443 -0.0347 410 PHE A CA  
1575 C C   . PHE A 222 ? 0.2831 0.4386 0.4118 0.0445  -0.0480 -0.0321 410 PHE A C   
1576 O O   . PHE A 222 ? 0.2842 0.4332 0.3959 0.0370  -0.0459 -0.0325 410 PHE A O   
1577 C CB  . PHE A 222 ? 0.2928 0.4260 0.4093 0.0548  -0.0529 -0.0292 410 PHE A CB  
1578 C CG  . PHE A 222 ? 0.3337 0.4543 0.4249 0.0480  -0.0549 -0.0272 410 PHE A CG  
1579 C CD1 . PHE A 222 ? 0.2600 0.3683 0.3334 0.0474  -0.0483 -0.0304 410 PHE A CD1 
1580 C CD2 . PHE A 222 ? 0.3505 0.4721 0.4364 0.0420  -0.0633 -0.0225 410 PHE A CD2 
1581 C CE1 . PHE A 222 ? 0.3256 0.4224 0.3786 0.0422  -0.0495 -0.0292 410 PHE A CE1 
1582 C CE2 . PHE A 222 ? 0.3437 0.4531 0.4068 0.0359  -0.0639 -0.0224 410 PHE A CE2 
1583 C CZ  . PHE A 222 ? 0.3069 0.4037 0.3547 0.0366  -0.0566 -0.0259 410 PHE A CZ  
1584 N N   . GLY A 223 ? 0.2944 0.4656 0.4456 0.0457  -0.0539 -0.0293 411 GLY A N   
1585 C CA  . GLY A 223 ? 0.2766 0.4599 0.4331 0.0371  -0.0578 -0.0271 411 GLY A CA  
1586 C C   . GLY A 223 ? 0.3034 0.4933 0.4598 0.0315  -0.0474 -0.0322 411 GLY A C   
1587 O O   . GLY A 223 ? 0.3307 0.5185 0.4756 0.0217  -0.0477 -0.0314 411 GLY A O   
1588 N N   . VAL A 224 ? 0.3007 0.4979 0.4692 0.0370  -0.0377 -0.0376 412 VAL A N   
1589 C CA  . VAL A 224 ? 0.2807 0.4844 0.4469 0.0311  -0.0269 -0.0419 412 VAL A CA  
1590 C C   . VAL A 224 ? 0.3347 0.5192 0.4709 0.0255  -0.0236 -0.0417 412 VAL A C   
1591 O O   . VAL A 224 ? 0.3069 0.4918 0.4354 0.0164  -0.0207 -0.0408 412 VAL A O   
1592 C CB  . VAL A 224 ? 0.2910 0.5054 0.4726 0.0378  -0.0161 -0.0490 412 VAL A CB  
1593 C CG1 . VAL A 224 ? 0.2876 0.5085 0.4627 0.0302  -0.0046 -0.0528 412 VAL A CG1 
1594 C CG2 . VAL A 224 ? 0.2714 0.5060 0.4868 0.0441  -0.0186 -0.0497 412 VAL A CG2 
1595 N N   . VAL A 225 ? 0.3193 0.4870 0.4401 0.0308  -0.0243 -0.0418 413 VAL A N   
1596 C CA  . VAL A 225 ? 0.2801 0.4302 0.3751 0.0267  -0.0220 -0.0410 413 VAL A CA  
1597 C C   . VAL A 225 ? 0.3076 0.4492 0.3909 0.0189  -0.0286 -0.0368 413 VAL A C   
1598 O O   . VAL A 225 ? 0.3179 0.4510 0.3873 0.0124  -0.0254 -0.0360 413 VAL A O   
1599 C CB  . VAL A 225 ? 0.3187 0.4541 0.4018 0.0340  -0.0226 -0.0417 413 VAL A CB  
1600 C CG1 . VAL A 225 ? 0.2844 0.4021 0.3436 0.0304  -0.0227 -0.0396 413 VAL A CG1 
1601 C CG2 . VAL A 225 ? 0.2510 0.3917 0.3403 0.0394  -0.0145 -0.0474 413 VAL A CG2 
1602 N N   . VAL A 226 ? 0.2643 0.4079 0.3532 0.0192  -0.0379 -0.0341 414 VAL A N   
1603 C CA  . VAL A 226 ? 0.3101 0.4473 0.3886 0.0110  -0.0442 -0.0317 414 VAL A CA  
1604 C C   . VAL A 226 ? 0.3145 0.4617 0.3999 0.0014  -0.0420 -0.0319 414 VAL A C   
1605 O O   . VAL A 226 ? 0.2974 0.4334 0.3687 -0.0063 -0.0409 -0.0317 414 VAL A O   
1606 C CB  . VAL A 226 ? 0.3139 0.4551 0.3979 0.0119  -0.0552 -0.0284 414 VAL A CB  
1607 C CG1 . VAL A 226 ? 0.3627 0.5011 0.4377 0.0014  -0.0613 -0.0274 414 VAL A CG1 
1608 C CG2 . VAL A 226 ? 0.3378 0.4659 0.4103 0.0188  -0.0577 -0.0272 414 VAL A CG2 
1609 N N   . LEU A 227 ? 0.2543 0.4225 0.3627 0.0019  -0.0408 -0.0323 415 LEU A N   
1610 C CA  . LEU A 227 ? 0.2828 0.4632 0.4000 -0.0077 -0.0377 -0.0324 415 LEU A CA  
1611 C C   . LEU A 227 ? 0.3242 0.4961 0.4282 -0.0123 -0.0277 -0.0335 415 LEU A C   
1612 O O   . LEU A 227 ? 0.2925 0.4599 0.3895 -0.0224 -0.0271 -0.0321 415 LEU A O   
1613 C CB  . LEU A 227 ? 0.2418 0.4481 0.3884 -0.0049 -0.0361 -0.0334 415 LEU A CB  
1614 C CG  . LEU A 227 ? 0.3959 0.6182 0.5610 -0.0081 -0.0466 -0.0304 415 LEU A CG  
1615 C CD1 . LEU A 227 ? 0.3962 0.6457 0.5922 -0.0066 -0.0422 -0.0319 415 LEU A CD1 
1616 C CD2 . LEU A 227 ? 0.4807 0.6968 0.6334 -0.0213 -0.0519 -0.0286 415 LEU A CD2 
1617 N N   . GLU A 228 ? 0.2896 0.4592 0.3902 -0.0052 -0.0203 -0.0357 416 GLU A N   
1618 C CA  . GLU A 228 ? 0.3140 0.4764 0.4008 -0.0090 -0.0115 -0.0357 416 GLU A CA  
1619 C C   . GLU A 228 ? 0.3198 0.4589 0.3840 -0.0132 -0.0143 -0.0326 416 GLU A C   
1620 O O   . GLU A 228 ? 0.2923 0.4254 0.3477 -0.0210 -0.0104 -0.0301 416 GLU A O   
1621 C CB  . GLU A 228 ? 0.3557 0.5190 0.4410 -0.0002 -0.0050 -0.0392 416 GLU A CB  
1622 C CG  . GLU A 228 ? 0.4295 0.5877 0.4999 -0.0043 0.0036  -0.0386 416 GLU A CG  
1623 C CD  . GLU A 228 ? 0.4258 0.5877 0.4955 0.0030  0.0100  -0.0434 416 GLU A CD  
1624 O OE1 . GLU A 228 ? 0.4062 0.5734 0.4883 0.0116  0.0082  -0.0475 416 GLU A OE1 
1625 O OE2 . GLU A 228 ? 0.3934 0.5525 0.4496 -0.0004 0.0164  -0.0428 416 GLU A OE2 
1626 N N   . THR A 229 ? 0.3126 0.4387 0.3683 -0.0080 -0.0209 -0.0325 417 THR A N   
1627 C CA  . THR A 229 ? 0.3334 0.4378 0.3697 -0.0105 -0.0230 -0.0308 417 THR A CA  
1628 C C   . THR A 229 ? 0.4003 0.5009 0.4355 -0.0208 -0.0272 -0.0301 417 THR A C   
1629 O O   . THR A 229 ? 0.4169 0.5017 0.4399 -0.0262 -0.0259 -0.0287 417 THR A O   
1630 C CB  . THR A 229 ? 0.2974 0.3908 0.3254 -0.0024 -0.0276 -0.0318 417 THR A CB  
1631 O OG1 . THR A 229 ? 0.2873 0.3847 0.3179 0.0062  -0.0241 -0.0329 417 THR A OG1 
1632 C CG2 . THR A 229 ? 0.3180 0.3900 0.3280 -0.0037 -0.0279 -0.0310 417 THR A CG2 
1633 N N   . LEU A 230 ? 0.3690 0.4841 0.4180 -0.0238 -0.0326 -0.0309 418 LEU A N   
1634 C CA  . LEU A 230 ? 0.4041 0.5185 0.4535 -0.0350 -0.0373 -0.0308 418 LEU A CA  
1635 C C   . LEU A 230 ? 0.3861 0.5058 0.4407 -0.0449 -0.0316 -0.0292 418 LEU A C   
1636 O O   . LEU A 230 ? 0.3664 0.4725 0.4117 -0.0539 -0.0320 -0.0286 418 LEU A O   
1637 C CB  . LEU A 230 ? 0.4326 0.5643 0.4970 -0.0357 -0.0456 -0.0312 418 LEU A CB  
1638 C CG  . LEU A 230 ? 0.4733 0.5966 0.5279 -0.0341 -0.0547 -0.0319 418 LEU A CG  
1639 C CD1 . LEU A 230 ? 0.5249 0.6689 0.5972 -0.0338 -0.0633 -0.0301 418 LEU A CD1 
1640 C CD2 . LEU A 230 ? 0.4587 0.5648 0.4969 -0.0440 -0.0570 -0.0343 418 LEU A CD2 
1641 N N   . ALA A 231 ? 0.3810 0.5205 0.4510 -0.0436 -0.0261 -0.0286 419 ALA A N   
1642 C CA  . ALA A 231 ? 0.3785 0.5286 0.4566 -0.0539 -0.0204 -0.0268 419 ALA A CA  
1643 C C   . ALA A 231 ? 0.4122 0.5518 0.4773 -0.0559 -0.0115 -0.0239 419 ALA A C   
1644 O O   . ALA A 231 ? 0.4282 0.5711 0.4950 -0.0664 -0.0070 -0.0210 419 ALA A O   
1645 C CB  . ALA A 231 ? 0.3101 0.4895 0.4131 -0.0522 -0.0180 -0.0283 419 ALA A CB  
1646 N N   . GLY A 232 ? 0.4101 0.5376 0.4624 -0.0467 -0.0095 -0.0239 420 GLY A N   
1647 C CA  . GLY A 232 ? 0.4485 0.5688 0.4889 -0.0479 -0.0021 -0.0203 420 GLY A CA  
1648 C C   . GLY A 232 ? 0.4940 0.6364 0.5454 -0.0516 0.0066  -0.0204 420 GLY A C   
1649 O O   . GLY A 232 ? 0.5336 0.6744 0.5776 -0.0594 0.0126  -0.0159 420 GLY A O   
1650 N N   . GLN A 233 ? 0.4500 0.6133 0.5196 -0.0462 0.0074  -0.0254 421 GLN A N   
1651 C CA  . GLN A 233 ? 0.4626 0.6498 0.5463 -0.0485 0.0166  -0.0276 421 GLN A CA  
1652 C C   . GLN A 233 ? 0.4295 0.6246 0.5171 -0.0368 0.0208  -0.0333 421 GLN A C   
1653 O O   . GLN A 233 ? 0.3867 0.5771 0.4775 -0.0269 0.0147  -0.0359 421 GLN A O   
1654 C CB  . GLN A 233 ? 0.5107 0.7193 0.6187 -0.0535 0.0147  -0.0293 421 GLN A CB  
1655 C CG  . GLN A 233 ? 0.6116 0.8177 0.7187 -0.0680 0.0131  -0.0246 421 GLN A CG  
1656 C CD  . GLN A 233 ? 0.7320 0.9538 0.8441 -0.0781 0.0239  -0.0228 421 GLN A CD  
1657 O OE1 . GLN A 233 ? 0.7922 1.0395 0.9268 -0.0816 0.0274  -0.0252 421 GLN A OE1 
1658 N NE2 . GLN A 233 ? 0.7614 0.9693 0.8532 -0.0829 0.0293  -0.0179 421 GLN A NE2 
1659 N N   . ARG A 234 ? 0.4474 0.6540 0.5341 -0.0387 0.0314  -0.0352 422 ARG A N   
1660 C CA  . ARG A 234 ? 0.4528 0.6671 0.5433 -0.0287 0.0367  -0.0422 422 ARG A CA  
1661 C C   . ARG A 234 ? 0.4283 0.6615 0.5472 -0.0213 0.0357  -0.0484 422 ARG A C   
1662 O O   . ARG A 234 ? 0.4177 0.6665 0.5553 -0.0263 0.0350  -0.0477 422 ARG A O   
1663 C CB  . ARG A 234 ? 0.4569 0.6810 0.5392 -0.0343 0.0491  -0.0438 422 ARG A CB  
1664 C CG  . ARG A 234 ? 0.5039 0.7090 0.5580 -0.0403 0.0489  -0.0364 422 ARG A CG  
1665 C CD  . ARG A 234 ? 0.5166 0.7319 0.5598 -0.0459 0.0603  -0.0377 422 ARG A CD  
1666 N NE  . ARG A 234 ? 0.5308 0.7284 0.5476 -0.0517 0.0586  -0.0288 422 ARG A NE  
1667 C CZ  . ARG A 234 ? 0.5588 0.7425 0.5591 -0.0456 0.0552  -0.0282 422 ARG A CZ  
1668 N NH1 . ARG A 234 ? 0.5360 0.7202 0.5421 -0.0343 0.0536  -0.0364 422 ARG A NH1 
1669 N NH2 . ARG A 234 ? 0.6090 0.7782 0.5878 -0.0511 0.0529  -0.0187 422 ARG A NH2 
1670 N N   . ALA A 235 ? 0.3824 0.6139 0.5054 -0.0096 0.0351  -0.0539 423 ALA A N   
1671 C CA  . ALA A 235 ? 0.3843 0.6306 0.5348 -0.0008 0.0330  -0.0588 423 ALA A CA  
1672 C C   . ALA A 235 ? 0.4016 0.6751 0.5750 -0.0031 0.0439  -0.0645 423 ALA A C   
1673 O O   . ALA A 235 ? 0.3843 0.6748 0.5851 -0.0001 0.0413  -0.0658 423 ALA A O   
1674 C CB  . ALA A 235 ? 0.3409 0.5777 0.4897 0.0113  0.0315  -0.0634 423 ALA A CB  
1675 N N   . VAL A 236 ? 0.4423 0.7207 0.6043 -0.0086 0.0559  -0.0677 424 VAL A N   
1676 C CA  . VAL A 236 ? 0.4728 0.7774 0.6525 -0.0134 0.0685  -0.0732 424 VAL A CA  
1677 C C   . VAL A 236 ? 0.4540 0.7598 0.6167 -0.0286 0.0743  -0.0674 424 VAL A C   
1678 O O   . VAL A 236 ? 0.4622 0.7491 0.5962 -0.0333 0.0731  -0.0622 424 VAL A O   
1679 C CB  . VAL A 236 ? 0.5890 0.9022 0.7720 -0.0066 0.0806  -0.0847 424 VAL A CB  
1680 C CG1 . VAL A 236 ? 0.6623 0.9802 0.8714 0.0078  0.0774  -0.0913 424 VAL A CG1 
1681 C CG2 . VAL A 236 ? 0.5778 0.8709 0.7278 -0.0075 0.0821  -0.0845 424 VAL A CG2 
1682 N N   . LYS A 237 ? 0.4629 0.7915 0.6444 -0.0364 0.0805  -0.0676 425 LYS A N   
1683 C CA  . LYS A 237 ? 0.5909 0.9235 0.7577 -0.0516 0.0885  -0.0627 425 LYS A CA  
1684 C C   . LYS A 237 ? 0.6919 1.0570 0.8847 -0.0570 0.1004  -0.0679 425 LYS A C   
1685 O O   . LYS A 237 ? 0.7094 1.0929 0.9316 -0.0477 0.1024  -0.0757 425 LYS A O   
1686 C CB  . LYS A 237 ? 0.6355 0.9507 0.7893 -0.0612 0.0780  -0.0511 425 LYS A CB  
1687 C CG  . LYS A 237 ? 0.6832 1.0087 0.8613 -0.0635 0.0698  -0.0489 425 LYS A CG  
1688 C CD  . LYS A 237 ? 0.7464 1.0519 0.9081 -0.0741 0.0607  -0.0390 425 LYS A CD  
1689 C CE  . LYS A 237 ? 0.7975 1.1147 0.9817 -0.0793 0.0529  -0.0371 425 LYS A CE  
1690 N NZ  . LYS A 237 ? 0.8197 1.1163 0.9877 -0.0906 0.0449  -0.0291 425 LYS A NZ  
1691 N N   . THR A 238 ? 0.7471 1.1197 0.9301 -0.0720 0.1087  -0.0632 426 THR A N   
1692 C CA  . THR A 238 ? 0.7937 1.1988 1.0008 -0.0788 0.1213  -0.0679 426 THR A CA  
1693 C C   . THR A 238 ? 0.8456 1.2563 1.0591 -0.0933 0.1176  -0.0584 426 THR A C   
1694 O O   . THR A 238 ? 0.8842 1.2781 1.0726 -0.1053 0.1157  -0.0487 426 THR A O   
1695 C CB  . THR A 238 ? 0.8063 1.2225 0.9982 -0.0853 0.1388  -0.0730 426 THR A CB  
1696 O OG1 . THR A 238 ? 0.8363 1.2344 0.9941 -0.0986 0.1380  -0.0619 426 THR A OG1 
1697 C CG2 . THR A 238 ? 0.7860 1.1974 0.9720 -0.0719 0.1432  -0.0841 426 THR A CG2 
1698 N N   . HIS A 239 ? 0.8469 1.2805 1.0952 -0.0922 0.1157  -0.0609 427 HIS A N   
1699 C CA  . HIS A 239 ? 0.8545 1.3001 1.1139 -0.1074 0.1145  -0.0539 427 HIS A CA  
1700 C C   . HIS A 239 ? 0.8375 1.3192 1.1191 -0.1140 0.1317  -0.0598 427 HIS A C   
1701 O O   . HIS A 239 ? 0.8278 1.3352 1.1431 -0.1047 0.1359  -0.0686 427 HIS A O   
1702 C CB  . HIS A 239 ? 0.8879 1.3354 1.1705 -0.1035 0.0989  -0.0515 427 HIS A CB  
1703 C CG  . HIS A 239 ? 0.9327 1.3853 1.2208 -0.1202 0.0945  -0.0436 427 HIS A CG  
1704 N ND1 . HIS A 239 ? 0.9375 1.4091 1.2567 -0.1215 0.0861  -0.0432 427 HIS A ND1 
1705 C CD2 . HIS A 239 ? 0.9588 1.3994 1.2257 -0.1370 0.0967  -0.0353 427 HIS A CD2 
1706 C CE1 . HIS A 239 ? 0.9483 1.4196 1.2648 -0.1388 0.0837  -0.0361 427 HIS A CE1 
1707 N NE2 . HIS A 239 ? 0.9607 1.4125 1.2459 -0.1483 0.0903  -0.0311 427 HIS A NE2 
1708 N N   . GLY A 240 ? 0.8817 1.3655 1.1450 -0.1302 0.1420  -0.0547 428 GLY A N   
1709 C CA  . GLY A 240 ? 0.8749 1.3921 1.1535 -0.1378 0.1609  -0.0606 428 GLY A CA  
1710 C C   . GLY A 240 ? 0.8534 1.3806 1.1340 -0.1249 0.1732  -0.0741 428 GLY A C   
1711 O O   . GLY A 240 ? 0.8533 1.3586 1.1032 -0.1207 0.1736  -0.0750 428 GLY A O   
1712 N N   . ALA A 241 ? 0.7915 1.3517 1.1094 -0.1186 0.1830  -0.0851 429 ALA A N   
1713 C CA  . ALA A 241 ? 0.7904 1.3617 1.1160 -0.1054 0.1955  -0.1002 429 ALA A CA  
1714 C C   . ALA A 241 ? 0.7689 1.3296 1.1121 -0.0844 0.1834  -0.1058 429 ALA A C   
1715 O O   . ALA A 241 ? 0.7703 1.3385 1.1252 -0.0715 0.1920  -0.1189 429 ALA A O   
1716 C CB  . ALA A 241 ? 0.8090 1.4077 1.1596 -0.1062 0.2098  -0.1068 429 ALA A CB  
1717 N N   . ARG A 242 ? 0.7503 1.2931 1.0949 -0.0816 0.1638  -0.0961 430 ARG A N   
1718 C CA  . ARG A 242 ? 0.7138 1.2491 1.0779 -0.0633 0.1510  -0.0992 430 ARG A CA  
1719 C C   . ARG A 242 ? 0.7141 1.2114 1.0454 -0.0560 0.1387  -0.0954 430 ARG A C   
1720 O O   . ARG A 242 ? 0.7212 1.1952 1.0188 -0.0656 0.1332  -0.0862 430 ARG A O   
1721 C CB  . ARG A 242 ? 0.7281 1.2749 1.1215 -0.0645 0.1371  -0.0920 430 ARG A CB  
1722 C CG  . ARG A 242 ? 0.8116 1.3992 1.2520 -0.0630 0.1459  -0.0984 430 ARG A CG  
1723 C CD  . ARG A 242 ? 0.8550 1.4507 1.3285 -0.0423 0.1420  -0.1063 430 ARG A CD  
1724 N NE  . ARG A 242 ? 0.8948 1.5139 1.4095 -0.0399 0.1335  -0.1023 430 ARG A NE  
1725 C CZ  . ARG A 242 ? 0.9179 1.5333 1.4393 -0.0422 0.1144  -0.0927 430 ARG A CZ  
1726 N NH1 . ARG A 242 ? 0.9366 1.5171 1.4205 -0.0457 0.1015  -0.0846 430 ARG A NH1 
1727 N NH2 . ARG A 242 ? 0.9238 1.5627 1.4831 -0.0405 0.1067  -0.0889 430 ARG A NH2 
1728 N N   . THR A 243 ? 0.6744 1.1658 1.0174 -0.0389 0.1348  -0.1025 431 THR A N   
1729 C CA  . THR A 243 ? 0.6432 1.1012 0.9605 -0.0308 0.1226  -0.0992 431 THR A CA  
1730 C C   . THR A 243 ? 0.5993 1.0465 0.9258 -0.0268 0.1029  -0.0901 431 THR A C   
1731 O O   . THR A 243 ? 0.6156 1.0776 0.9758 -0.0175 0.0974  -0.0920 431 THR A O   
1732 C CB  . THR A 243 ? 0.6630 1.1177 0.9859 -0.0152 0.1283  -0.1113 431 THR A CB  
1733 O OG1 . THR A 243 ? 0.6946 1.1606 1.0080 -0.0198 0.1473  -0.1213 431 THR A OG1 
1734 C CG2 . THR A 243 ? 0.6425 1.0632 0.9375 -0.0085 0.1164  -0.1076 431 THR A CG2 
1735 N N   . LYS A 244 ? 0.5897 1.0117 0.8866 -0.0342 0.0924  -0.0802 432 LYS A N   
1736 C CA  . LYS A 244 ? 0.5568 0.9664 0.8563 -0.0325 0.0742  -0.0721 432 LYS A CA  
1737 C C   . LYS A 244 ? 0.4831 0.8640 0.7628 -0.0215 0.0646  -0.0713 432 LYS A C   
1738 O O   . LYS A 244 ? 0.4648 0.8244 0.7130 -0.0233 0.0670  -0.0705 432 LYS A O   
1739 C CB  . LYS A 244 ? 0.6381 1.0394 0.9207 -0.0487 0.0691  -0.0624 432 LYS A CB  
1740 C CG  . LYS A 244 ? 0.7066 1.1095 1.0037 -0.0509 0.0535  -0.0562 432 LYS A CG  
1741 C CD  . LYS A 244 ? 0.7905 1.2265 1.1203 -0.0588 0.0569  -0.0564 432 LYS A CD  
1742 C CE  . LYS A 244 ? 0.8441 1.2890 1.1976 -0.0560 0.0410  -0.0526 432 LYS A CE  
1743 N NZ  . LYS A 244 ? 0.8579 1.3111 1.2351 -0.0382 0.0374  -0.0570 432 LYS A NZ  
1744 N N   . TYR A 245 ? 0.4268 0.8085 0.7260 -0.0105 0.0536  -0.0709 433 TYR A N   
1745 C CA  . TYR A 245 ? 0.3937 0.7506 0.6780 -0.0003 0.0437  -0.0695 433 TYR A CA  
1746 C C   . TYR A 245 ? 0.3682 0.7105 0.6425 -0.0043 0.0273  -0.0601 433 TYR A C   
1747 O O   . TYR A 245 ? 0.3853 0.7420 0.6806 -0.0067 0.0192  -0.0564 433 TYR A O   
1748 C CB  . TYR A 245 ? 0.4373 0.8030 0.7488 0.0153  0.0432  -0.0755 433 TYR A CB  
1749 C CG  . TYR A 245 ? 0.4754 0.8501 0.7934 0.0210  0.0593  -0.0870 433 TYR A CG  
1750 C CD1 . TYR A 245 ? 0.4992 0.8538 0.7937 0.0260  0.0633  -0.0917 433 TYR A CD1 
1751 C CD2 . TYR A 245 ? 0.5119 0.9159 0.8598 0.0211  0.0710  -0.0940 433 TYR A CD2 
1752 C CE1 . TYR A 245 ? 0.5261 0.8883 0.8246 0.0302  0.0781  -0.1035 433 TYR A CE1 
1753 C CE2 . TYR A 245 ? 0.5579 0.9701 0.9107 0.0260  0.0869  -0.1062 433 TYR A CE2 
1754 C CZ  . TYR A 245 ? 0.5761 0.9667 0.9030 0.0302  0.0902  -0.1112 433 TYR A CZ  
1755 O OH  . TYR A 245 ? 0.6207 1.0189 0.9506 0.0340  0.1060  -0.1245 433 TYR A OH  
1756 N N   . LEU A 246 ? 0.3382 0.6527 0.5810 -0.0050 0.0226  -0.0568 434 LEU A N   
1757 C CA  . LEU A 246 ? 0.3453 0.6435 0.5747 -0.0089 0.0087  -0.0495 434 LEU A CA  
1758 C C   . LEU A 246 ? 0.3662 0.6675 0.6129 0.0001  -0.0039 -0.0474 434 LEU A C   
1759 O O   . LEU A 246 ? 0.3946 0.6972 0.6441 -0.0053 -0.0151 -0.0421 434 LEU A O   
1760 C CB  . LEU A 246 ? 0.3301 0.5990 0.5248 -0.0093 0.0078  -0.0477 434 LEU A CB  
1761 C CG  . LEU A 246 ? 0.3269 0.5772 0.5048 -0.0144 -0.0041 -0.0417 434 LEU A CG  
1762 C CD1 . LEU A 246 ? 0.2988 0.5550 0.4777 -0.0285 -0.0050 -0.0384 434 LEU A CD1 
1763 C CD2 . LEU A 246 ? 0.3015 0.5251 0.4493 -0.0127 -0.0036 -0.0407 434 LEU A CD2 
1764 N N   . LYS A 247 ? 0.3330 0.6352 0.5907 0.0131  -0.0022 -0.0513 435 LYS A N   
1765 C CA  . LYS A 247 ? 0.3481 0.6528 0.6235 0.0225  -0.0139 -0.0482 435 LYS A CA  
1766 C C   . LYS A 247 ? 0.4190 0.7505 0.7274 0.0206  -0.0197 -0.0454 435 LYS A C   
1767 O O   . LYS A 247 ? 0.4821 0.8159 0.8014 0.0239  -0.0331 -0.0394 435 LYS A O   
1768 C CB  . LYS A 247 ? 0.3568 0.6590 0.6423 0.0364  -0.0088 -0.0539 435 LYS A CB  
1769 C CG  . LYS A 247 ? 0.3886 0.7140 0.7023 0.0408  0.0039  -0.0621 435 LYS A CG  
1770 C CD  . LYS A 247 ? 0.3881 0.7081 0.7109 0.0543  0.0092  -0.0691 435 LYS A CD  
1771 C CE  . LYS A 247 ? 0.3642 0.7076 0.7154 0.0586  0.0233  -0.0792 435 LYS A CE  
1772 N NZ  . LYS A 247 ? 0.3473 0.6846 0.7088 0.0716  0.0291  -0.0877 435 LYS A NZ  
1773 N N   . ASP A 248 ? 0.3801 0.7327 0.7041 0.0145  -0.0098 -0.0490 436 ASP A N   
1774 C CA  . ASP A 248 ? 0.3475 0.7288 0.7055 0.0120  -0.0143 -0.0467 436 ASP A CA  
1775 C C   . ASP A 248 ? 0.3450 0.7262 0.6938 -0.0020 -0.0252 -0.0396 436 ASP A C   
1776 O O   . ASP A 248 ? 0.2969 0.7013 0.6721 -0.0056 -0.0319 -0.0364 436 ASP A O   
1777 C CB  . ASP A 248 ? 0.3735 0.7796 0.7532 0.0101  0.0017  -0.0538 436 ASP A CB  
1778 C CG  . ASP A 248 ? 0.4952 0.9061 0.8908 0.0242  0.0125  -0.0626 436 ASP A CG  
1779 O OD1 . ASP A 248 ? 0.5160 0.9203 0.9220 0.0368  0.0050  -0.0616 436 ASP A OD1 
1780 O OD2 . ASP A 248 ? 0.5668 0.9876 0.9639 0.0219  0.0288  -0.0705 436 ASP A OD2 
1781 N N   . LEU A 249 ? 0.3593 0.7151 0.6721 -0.0099 -0.0269 -0.0377 437 LEU A N   
1782 C CA  . LEU A 249 ? 0.3628 0.7154 0.6642 -0.0244 -0.0352 -0.0329 437 LEU A CA  
1783 C C   . LEU A 249 ? 0.3050 0.6644 0.6178 -0.0244 -0.0526 -0.0270 437 LEU A C   
1784 O O   . LEU A 249 ? 0.2977 0.6750 0.6256 -0.0341 -0.0588 -0.0243 437 LEU A O   
1785 C CB  . LEU A 249 ? 0.4078 0.7288 0.6695 -0.0302 -0.0342 -0.0325 437 LEU A CB  
1786 C CG  . LEU A 249 ? 0.4602 0.7734 0.7075 -0.0456 -0.0409 -0.0293 437 LEU A CG  
1787 C CD1 . LEU A 249 ? 0.4571 0.7906 0.7202 -0.0576 -0.0342 -0.0297 437 LEU A CD1 
1788 C CD2 . LEU A 249 ? 0.4725 0.7534 0.6835 -0.0487 -0.0390 -0.0294 437 LEU A CD2 
1789 N N   . VAL A 250 ? 0.2769 0.6231 0.5828 -0.0141 -0.0607 -0.0246 438 VAL A N   
1790 C CA  . VAL A 250 ? 0.3591 0.7086 0.6697 -0.0147 -0.0780 -0.0179 438 VAL A CA  
1791 C C   . VAL A 250 ? 0.4099 0.7928 0.7605 -0.0143 -0.0842 -0.0147 438 VAL A C   
1792 O O   . VAL A 250 ? 0.4455 0.8403 0.8011 -0.0257 -0.0939 -0.0110 438 VAL A O   
1793 C CB  . VAL A 250 ? 0.3863 0.7195 0.6881 -0.0021 -0.0839 -0.0152 438 VAL A CB  
1794 C CG1 . VAL A 250 ? 0.3942 0.7345 0.7038 -0.0025 -0.1021 -0.0068 438 VAL A CG1 
1795 C CG2 . VAL A 250 ? 0.3781 0.6798 0.6409 -0.0036 -0.0796 -0.0176 438 VAL A CG2 
1796 N N   . GLU A 251 ? 0.4120 0.8105 0.7922 -0.0015 -0.0779 -0.0169 439 GLU A N   
1797 C CA  . GLU A 251 ? 0.4442 0.8767 0.8676 0.0009  -0.0812 -0.0149 439 GLU A CA  
1798 C C   . GLU A 251 ? 0.3912 0.8424 0.8223 -0.0144 -0.0775 -0.0163 439 GLU A C   
1799 O O   . GLU A 251 ? 0.3865 0.8583 0.8369 -0.0212 -0.0893 -0.0110 439 GLU A O   
1800 C CB  . GLU A 251 ? 0.5288 0.9730 0.9804 0.0160  -0.0688 -0.0208 439 GLU A CB  
1801 C CG  . GLU A 251 ? 0.6321 1.0640 1.0881 0.0319  -0.0745 -0.0183 439 GLU A CG  
1802 C CD  . GLU A 251 ? 0.7307 1.1826 1.2212 0.0384  -0.0905 -0.0094 439 GLU A CD  
1803 O OE1 . GLU A 251 ? 0.7260 1.2046 1.2405 0.0314  -0.0961 -0.0061 439 GLU A OE1 
1804 O OE2 . GLU A 251 ? 0.8016 1.2426 1.2957 0.0502  -0.0979 -0.0049 439 GLU A OE2 
1805 N N   . GLU A 252 ? 0.3491 0.7921 0.7635 -0.0207 -0.0620 -0.0227 440 GLU A N   
1806 C CA  . GLU A 252 ? 0.4467 0.9071 0.8691 -0.0355 -0.0562 -0.0241 440 GLU A CA  
1807 C C   . GLU A 252 ? 0.4079 0.8625 0.8148 -0.0509 -0.0701 -0.0188 440 GLU A C   
1808 O O   . GLU A 252 ? 0.3846 0.8619 0.8105 -0.0622 -0.0733 -0.0172 440 GLU A O   
1809 C CB  . GLU A 252 ? 0.5773 1.0256 0.9790 -0.0401 -0.0380 -0.0303 440 GLU A CB  
1810 C CG  . GLU A 252 ? 0.7409 1.2052 1.1644 -0.0294 -0.0220 -0.0373 440 GLU A CG  
1811 C CD  . GLU A 252 ? 0.8878 1.3400 1.2873 -0.0349 -0.0049 -0.0426 440 GLU A CD  
1812 O OE1 . GLU A 252 ? 0.9480 1.3789 1.3159 -0.0463 -0.0059 -0.0399 440 GLU A OE1 
1813 O OE2 . GLU A 252 ? 0.9257 1.3896 1.3381 -0.0278 0.0095  -0.0494 440 GLU A OE2 
1814 N N   . GLU A 253 ? 0.4617 0.8869 0.8348 -0.0517 -0.0783 -0.0168 441 GLU A N   
1815 C CA  . GLU A 253 ? 0.4291 0.8474 0.7859 -0.0661 -0.0913 -0.0134 441 GLU A CA  
1816 C C   . GLU A 253 ? 0.3649 0.8026 0.7435 -0.0641 -0.1092 -0.0068 441 GLU A C   
1817 O O   . GLU A 253 ? 0.3208 0.7730 0.7072 -0.0771 -0.1193 -0.0041 441 GLU A O   
1818 C CB  . GLU A 253 ? 0.4313 0.8120 0.7447 -0.0680 -0.0925 -0.0146 441 GLU A CB  
1819 C CG  . GLU A 253 ? 0.4879 0.8495 0.7784 -0.0751 -0.0784 -0.0192 441 GLU A CG  
1820 C CD  . GLU A 253 ? 0.5582 0.9281 0.8516 -0.0933 -0.0778 -0.0195 441 GLU A CD  
1821 O OE1 . GLU A 253 ? 0.6182 0.9985 0.9185 -0.1028 -0.0908 -0.0171 441 GLU A OE1 
1822 O OE2 . GLU A 253 ? 0.5442 0.9100 0.8323 -0.0989 -0.0648 -0.0218 441 GLU A OE2 
1823 N N   . ALA A 254 ? 0.3598 0.7981 0.7488 -0.0482 -0.1135 -0.0038 442 ALA A N   
1824 C CA  . ALA A 254 ? 0.4255 0.8809 0.8350 -0.0447 -0.1314 0.0044  442 ALA A CA  
1825 C C   . ALA A 254 ? 0.4853 0.9791 0.9365 -0.0495 -0.1351 0.0067  442 ALA A C   
1826 O O   . ALA A 254 ? 0.5204 1.0281 0.9774 -0.0602 -0.1504 0.0121  442 ALA A O   
1827 C CB  . ALA A 254 ? 0.4067 0.8574 0.8263 -0.0257 -0.1326 0.0073  442 ALA A CB  
1828 N N   . GLU A 255 ? 0.4222 0.9340 0.9019 -0.0425 -0.1206 0.0020  443 GLU A N   
1829 C CA  . GLU A 255 ? 0.5109 1.0617 1.0340 -0.0458 -0.1217 0.0034  443 GLU A CA  
1830 C C   . GLU A 255 ? 0.5270 1.0852 1.0424 -0.0672 -0.1226 0.0023  443 GLU A C   
1831 O O   . GLU A 255 ? 0.5629 1.1525 1.1093 -0.0743 -0.1302 0.0058  443 GLU A O   
1832 C CB  . GLU A 255 ? 0.5815 1.1488 1.1342 -0.0340 -0.1032 -0.0032 443 GLU A CB  
1833 C CG  . GLU A 255 ? 0.7010 1.2734 1.2494 -0.0454 -0.0853 -0.0107 443 GLU A CG  
1834 C CD  . GLU A 255 ? 0.7980 1.3983 1.3851 -0.0361 -0.0693 -0.0167 443 GLU A CD  
1835 O OE1 . GLU A 255 ? 0.8382 1.4300 1.4124 -0.0362 -0.0505 -0.0246 443 GLU A OE1 
1836 O OE2 . GLU A 255 ? 0.8112 1.4425 1.4421 -0.0289 -0.0757 -0.0136 443 GLU A OE2 
1837 N N   . GLU A 256 ? 0.4824 1.0117 0.9579 -0.0775 -0.1153 -0.0021 444 GLU A N   
1838 C CA  . GLU A 256 ? 0.5236 1.0556 0.9900 -0.0984 -0.1170 -0.0030 444 GLU A CA  
1839 C C   . GLU A 256 ? 0.5194 1.0464 0.9715 -0.1085 -0.1378 0.0021  444 GLU A C   
1840 O O   . GLU A 256 ? 0.4823 1.0257 0.9436 -0.1244 -0.1458 0.0035  444 GLU A O   
1841 C CB  . GLU A 256 ? 0.5981 1.1004 1.0289 -0.1060 -0.1024 -0.0089 444 GLU A CB  
1842 C CG  . GLU A 256 ? 0.7023 1.2054 1.1252 -0.1279 -0.1031 -0.0098 444 GLU A CG  
1843 C CD  . GLU A 256 ? 0.7888 1.2640 1.1810 -0.1348 -0.0883 -0.0142 444 GLU A CD  
1844 O OE1 . GLU A 256 ? 0.8262 1.2798 1.1920 -0.1490 -0.0926 -0.0150 444 GLU A OE1 
1845 O OE2 . GLU A 256 ? 0.8180 1.2927 1.2126 -0.1264 -0.0725 -0.0169 444 GLU A OE2 
1846 N N   . ALA A 257 ? 0.5542 1.0594 0.9837 -0.0999 -0.1464 0.0047  445 ALA A N   
1847 C CA  . ALA A 257 ? 0.5553 1.0535 0.9659 -0.1094 -0.1654 0.0089  445 ALA A CA  
1848 C C   . ALA A 257 ? 0.5775 1.1063 1.0208 -0.1047 -0.1831 0.0181  445 ALA A C   
1849 O O   . ALA A 257 ? 0.5917 1.1161 1.0207 -0.1125 -0.1982 0.0209  445 ALA A O   
1850 C CB  . ALA A 257 ? 0.5187 0.9796 0.8878 -0.1040 -0.1659 0.0076  445 ALA A CB  
1851 N N   . GLY A 258 ? 0.5776 1.1280 1.0587 -0.0892 -0.1779 0.0202  446 GLY A N   
1852 C CA  . GLY A 258 ? 0.5615 1.1276 1.0670 -0.0790 -0.1890 0.0253  446 GLY A CA  
1853 C C   . GLY A 258 ? 0.5452 1.0932 1.0323 -0.0684 -0.2009 0.0318  446 GLY A C   
1854 O O   . GLY A 258 ? 0.5184 1.0716 1.0066 -0.0681 -0.2153 0.0375  446 GLY A O   
1855 N N   . VAL A 259 ? 0.5326 1.0596 1.0022 -0.0602 -0.1948 0.0315  447 VAL A N   
1856 C CA  . VAL A 259 ? 0.5912 1.0997 1.0435 -0.0497 -0.2041 0.0378  447 VAL A CA  
1857 C C   . VAL A 259 ? 0.6393 1.1514 1.1178 -0.0283 -0.1969 0.0393  447 VAL A C   
1858 O O   . VAL A 259 ? 0.6421 1.1609 1.1398 -0.0219 -0.1816 0.0334  447 VAL A O   
1859 C CB  . VAL A 259 ? 0.5562 1.0347 0.9652 -0.0564 -0.2041 0.0365  447 VAL A CB  
1860 C CG1 . VAL A 259 ? 0.6005 1.0729 0.9821 -0.0777 -0.2085 0.0324  447 VAL A CG1 
1861 C CG2 . VAL A 259 ? 0.4908 0.9494 0.8901 -0.0470 -0.1830 0.0276  447 VAL A CG2 
1862 N N   . ALA A 260 ? 0.6953 1.2025 1.1740 -0.0179 -0.2073 0.0471  448 ALA A N   
1863 C CA  . ALA A 260 ? 0.6983 1.2046 1.1985 0.0022  -0.2013 0.0489  448 ALA A CA  
1864 C C   . ALA A 260 ? 0.6838 1.1618 1.1604 0.0090  -0.1960 0.0481  448 ALA A C   
1865 O O   . ALA A 260 ? 0.6992 1.1729 1.1911 0.0236  -0.1852 0.0452  448 ALA A O   
1866 C CB  . ALA A 260 ? 0.7067 1.2199 1.2187 0.0098  -0.2148 0.0588  448 ALA A CB  
1867 N N   . ALA A 273 ? 0.8921 1.1527 0.9520 -0.0657 -0.2475 0.0672  461 ALA A N   
1868 C CA  . ALA A 273 ? 0.9153 1.1951 0.9980 -0.0653 -0.2585 0.0758  461 ALA A CA  
1869 C C   . ALA A 273 ? 0.9219 1.2159 1.0490 -0.0503 -0.2574 0.0806  461 ALA A C   
1870 O O   . ALA A 273 ? 0.9065 1.2193 1.0596 -0.0510 -0.2602 0.0798  461 ALA A O   
1871 C CB  . ALA A 273 ? 0.9373 1.2135 1.0043 -0.0666 -0.2677 0.0871  461 ALA A CB  
1872 N N   . ALA A 274 ? 0.9295 1.2142 1.0653 -0.0369 -0.2526 0.0850  462 ALA A N   
1873 C CA  . ALA A 274 ? 0.9292 1.2242 1.1059 -0.0216 -0.2491 0.0875  462 ALA A CA  
1874 C C   . ALA A 274 ? 0.9243 1.2233 1.1142 -0.0207 -0.2382 0.0763  462 ALA A C   
1875 O O   . ALA A 274 ? 0.9266 1.2395 1.1520 -0.0114 -0.2341 0.0753  462 ALA A O   
1876 C CB  . ALA A 274 ? 0.9185 1.1998 1.0988 -0.0083 -0.2468 0.0947  462 ALA A CB  
1877 N N   . ASP A 275 ? 0.9211 1.2052 1.0803 -0.0299 -0.2306 0.0665  463 ASP A N   
1878 C CA  . ASP A 275 ? 0.8270 1.1052 0.9886 -0.0289 -0.2135 0.0527  463 ASP A CA  
1879 C C   . ASP A 275 ? 0.7367 1.0264 0.8968 -0.0432 -0.2154 0.0464  463 ASP A C   
1880 O O   . ASP A 275 ? 0.7250 1.0101 0.8855 -0.0448 -0.2024 0.0359  463 ASP A O   
1881 C CB  . ASP A 275 ? 0.8425 1.0925 0.9719 -0.0278 -0.1996 0.0440  463 ASP A CB  
1882 C CG  . ASP A 275 ? 0.8541 1.0923 0.9860 -0.0144 -0.1963 0.0491  463 ASP A CG  
1883 O OD1 . ASP A 275 ? 0.8390 1.0886 1.0022 -0.0033 -0.1998 0.0560  463 ASP A OD1 
1884 O OD2 . ASP A 275 ? 0.8456 1.0631 0.9494 -0.0149 -0.1899 0.0458  463 ASP A OD2 
1885 N N   . ALA A 276 ? 0.7313 1.0359 0.8892 -0.0542 -0.2322 0.0534  464 ALA A N   
1886 C CA  . ALA A 276 ? 0.6856 1.0010 0.8402 -0.0699 -0.2361 0.0477  464 ALA A CA  
1887 C C   . ALA A 276 ? 0.6196 0.9535 0.8097 -0.0672 -0.2298 0.0441  464 ALA A C   
1888 O O   . ALA A 276 ? 0.6649 0.9979 0.8494 -0.0776 -0.2233 0.0347  464 ALA A O   
1889 C CB  . ALA A 276 ? 0.6842 1.0074 0.8312 -0.0775 -0.2498 0.0540  464 ALA A CB  
1890 N N   . TRP A 277 ? 0.5443 0.8945 0.7712 -0.0533 -0.2310 0.0513  465 TRP A N   
1891 C CA  . TRP A 277 ? 0.4965 0.8672 0.7606 -0.0492 -0.2242 0.0482  465 TRP A CA  
1892 C C   . TRP A 277 ? 0.5273 0.8832 0.7816 -0.0500 -0.2041 0.0350  465 TRP A C   
1893 O O   . TRP A 277 ? 0.5541 0.9247 0.8273 -0.0545 -0.1983 0.0303  465 TRP A O   
1894 C CB  . TRP A 277 ? 0.4867 0.8703 0.7882 -0.0311 -0.2247 0.0557  465 TRP A CB  
1895 C CG  . TRP A 277 ? 0.5484 0.9087 0.8405 -0.0175 -0.2108 0.0517  465 TRP A CG  
1896 C CD1 . TRP A 277 ? 0.6032 0.9449 0.8769 -0.0113 -0.2143 0.0572  465 TRP A CD1 
1897 C CD2 . TRP A 277 ? 0.5810 0.9345 0.8805 -0.0098 -0.1914 0.0413  465 TRP A CD2 
1898 N NE1 . TRP A 277 ? 0.6500 0.9740 0.9206 -0.0001 -0.1986 0.0506  465 TRP A NE1 
1899 C CE2 . TRP A 277 ? 0.6360 0.9669 0.9214 0.0010  -0.1846 0.0408  465 TRP A CE2 
1900 C CE3 . TRP A 277 ? 0.5735 0.9384 0.8893 -0.0120 -0.1792 0.0329  465 TRP A CE3 
1901 C CZ2 . TRP A 277 ? 0.6130 0.9327 0.8996 0.0096  -0.1669 0.0317  465 TRP A CZ2 
1902 C CZ3 . TRP A 277 ? 0.5695 0.9232 0.8855 -0.0035 -0.1612 0.0244  465 TRP A CZ3 
1903 C CH2 . TRP A 277 ? 0.5837 0.9151 0.8850 0.0072  -0.1556 0.0237  465 TRP A CH2 
1904 N N   . ALA A 278 ? 0.5156 0.8432 0.7409 -0.0458 -0.1938 0.0299  466 ALA A N   
1905 C CA  . ALA A 278 ? 0.5108 0.8228 0.7263 -0.0447 -0.1754 0.0191  466 ALA A CA  
1906 C C   . ALA A 278 ? 0.5681 0.8677 0.7567 -0.0606 -0.1726 0.0113  466 ALA A C   
1907 O O   . ALA A 278 ? 0.5876 0.8775 0.7713 -0.0623 -0.1589 0.0035  466 ALA A O   
1908 C CB  . ALA A 278 ? 0.4918 0.7802 0.6905 -0.0330 -0.1663 0.0175  466 ALA A CB  
1909 N N   . ALA A 279 ? 0.5733 0.8725 0.7439 -0.0727 -0.1855 0.0132  467 ALA A N   
1910 C CA  . ALA A 279 ? 0.5728 0.8565 0.7152 -0.0879 -0.1829 0.0045  467 ALA A CA  
1911 C C   . ALA A 279 ? 0.5548 0.8472 0.7113 -0.0969 -0.1763 -0.0011 467 ALA A C   
1912 O O   . ALA A 279 ? 0.5457 0.8186 0.6866 -0.1000 -0.1639 -0.0091 467 ALA A O   
1913 C CB  . ALA A 279 ? 0.5660 0.8523 0.6897 -0.1006 -0.1990 0.0072  467 ALA A CB  
1914 N N   . PRO A 280 ? 0.4782 0.8002 0.6651 -0.1014 -0.1847 0.0035  468 PRO A N   
1915 C CA  . PRO A 280 ? 0.4942 0.8240 0.6928 -0.1118 -0.1779 -0.0019 468 PRO A CA  
1916 C C   . PRO A 280 ? 0.5016 0.8253 0.7096 -0.1026 -0.1595 -0.0058 468 PRO A C   
1917 O O   . PRO A 280 ? 0.5639 0.8741 0.7601 -0.1107 -0.1495 -0.0122 468 PRO A O   
1918 C CB  . PRO A 280 ? 0.4708 0.8371 0.7049 -0.1156 -0.1903 0.0051  468 PRO A CB  
1919 C CG  . PRO A 280 ? 0.4591 0.8364 0.7087 -0.1007 -0.1984 0.0144  468 PRO A CG  
1920 C CD  . PRO A 280 ? 0.4630 0.8126 0.6765 -0.0975 -0.1999 0.0141  468 PRO A CD  
1921 N N   . ILE A 281 ? 0.4685 0.8007 0.6960 -0.0863 -0.1553 -0.0018 469 ILE A N   
1922 C CA  . ILE A 281 ? 0.4187 0.7455 0.6530 -0.0770 -0.1382 -0.0057 469 ILE A CA  
1923 C C   . ILE A 281 ? 0.4282 0.7219 0.6279 -0.0783 -0.1276 -0.0120 469 ILE A C   
1924 O O   . ILE A 281 ? 0.4254 0.7125 0.6216 -0.0834 -0.1163 -0.0164 469 ILE A O   
1925 C CB  . ILE A 281 ? 0.4071 0.7420 0.6611 -0.0587 -0.1364 -0.0017 469 ILE A CB  
1926 C CG1 . ILE A 281 ? 0.4427 0.8109 0.7349 -0.0560 -0.1472 0.0050  469 ILE A CG1 
1927 C CG2 . ILE A 281 ? 0.3658 0.6956 0.6245 -0.0503 -0.1186 -0.0069 469 ILE A CG2 
1928 C CD1 . ILE A 281 ? 0.4431 0.8180 0.7562 -0.0381 -0.1480 0.0097  469 ILE A CD1 
1929 N N   . ALA A 282 ? 0.4042 0.6777 0.5790 -0.0742 -0.1315 -0.0117 470 ALA A N   
1930 C CA  . ALA A 282 ? 0.4420 0.6847 0.5852 -0.0749 -0.1228 -0.0173 470 ALA A CA  
1931 C C   . ALA A 282 ? 0.4516 0.6847 0.5820 -0.0905 -0.1205 -0.0227 470 ALA A C   
1932 O O   . ALA A 282 ? 0.4066 0.6234 0.5270 -0.0913 -0.1089 -0.0267 470 ALA A O   
1933 C CB  . ALA A 282 ? 0.4519 0.6784 0.5713 -0.0715 -0.1294 -0.0163 470 ALA A CB  
1934 N N   . MET A 283 ? 0.4223 0.6659 0.5542 -0.1033 -0.1321 -0.0224 471 MET A N   
1935 C CA  . MET A 283 ? 0.3957 0.6292 0.5156 -0.1196 -0.1312 -0.0281 471 MET A CA  
1936 C C   . MET A 283 ? 0.4285 0.6684 0.5650 -0.1222 -0.1200 -0.0287 471 MET A C   
1937 O O   . MET A 283 ? 0.5378 0.7566 0.6593 -0.1270 -0.1107 -0.0329 471 MET A O   
1938 C CB  . MET A 283 ? 0.3757 0.6250 0.4992 -0.1335 -0.1463 -0.0273 471 MET A CB  
1939 C CG  . MET A 283 ? 0.4489 0.6891 0.5626 -0.1519 -0.1461 -0.0339 471 MET A CG  
1940 S SD  . MET A 283 ? 0.6942 0.8917 0.7683 -0.1560 -0.1381 -0.0438 471 MET A SD  
1941 C CE  . MET A 283 ? 0.5530 0.7452 0.6036 -0.1551 -0.1500 -0.0448 471 MET A CE  
1942 N N   . GLN A 284 ? 0.3723 0.6412 0.5402 -0.1181 -0.1203 -0.0240 472 GLN A N   
1943 C CA  . GLN A 284 ? 0.3983 0.6775 0.5835 -0.1207 -0.1089 -0.0242 472 GLN A CA  
1944 C C   . GLN A 284 ? 0.4148 0.6717 0.5845 -0.1122 -0.0945 -0.0263 472 GLN A C   
1945 O O   . GLN A 284 ? 0.4619 0.7063 0.6231 -0.1202 -0.0860 -0.0283 472 GLN A O   
1946 C CB  . GLN A 284 ? 0.3424 0.6566 0.5647 -0.1142 -0.1099 -0.0198 472 GLN A CB  
1947 C CG  . GLN A 284 ? 0.4261 0.7663 0.6686 -0.1253 -0.1233 -0.0171 472 GLN A CG  
1948 C CD  . GLN A 284 ? 0.5467 0.8837 0.7836 -0.1447 -0.1227 -0.0203 472 GLN A CD  
1949 O OE1 . GLN A 284 ? 0.6328 0.9795 0.8839 -0.1500 -0.1127 -0.0208 472 GLN A OE1 
1950 N NE2 . GLN A 284 ? 0.5967 0.9194 0.8121 -0.1562 -0.1329 -0.0229 472 GLN A NE2 
1951 N N   . ILE A 285 ? 0.3651 0.6159 0.5303 -0.0969 -0.0927 -0.0253 473 ILE A N   
1952 C CA  . ILE A 285 ? 0.4036 0.6354 0.5548 -0.0884 -0.0803 -0.0269 473 ILE A CA  
1953 C C   . ILE A 285 ? 0.4306 0.6327 0.5537 -0.0968 -0.0780 -0.0302 473 ILE A C   
1954 O O   . ILE A 285 ? 0.4426 0.6345 0.5602 -0.1008 -0.0684 -0.0307 473 ILE A O   
1955 C CB  . ILE A 285 ? 0.4055 0.6324 0.5530 -0.0723 -0.0809 -0.0258 473 ILE A CB  
1956 C CG1 . ILE A 285 ? 0.4098 0.6645 0.5880 -0.0632 -0.0821 -0.0229 473 ILE A CG1 
1957 C CG2 . ILE A 285 ? 0.4171 0.6229 0.5473 -0.0650 -0.0694 -0.0277 473 ILE A CG2 
1958 C CD1 . ILE A 285 ? 0.3828 0.6332 0.5604 -0.0480 -0.0837 -0.0214 473 ILE A CD1 
1959 N N   . TYR A 286 ? 0.4475 0.6374 0.5542 -0.1006 -0.0872 -0.0324 474 TYR A N   
1960 C CA  . TYR A 286 ? 0.4717 0.6318 0.5520 -0.1066 -0.0849 -0.0369 474 TYR A CA  
1961 C C   . TYR A 286 ? 0.4955 0.6519 0.5777 -0.1215 -0.0818 -0.0384 474 TYR A C   
1962 O O   . TYR A 286 ? 0.5218 0.6548 0.5895 -0.1241 -0.0745 -0.0402 474 TYR A O   
1963 C CB  . TYR A 286 ? 0.4823 0.6337 0.5461 -0.1095 -0.0952 -0.0402 474 TYR A CB  
1964 C CG  . TYR A 286 ? 0.5007 0.6224 0.5392 -0.1164 -0.0926 -0.0467 474 TYR A CG  
1965 C CD1 . TYR A 286 ? 0.4935 0.5920 0.5149 -0.1070 -0.0852 -0.0487 474 TYR A CD1 
1966 C CD2 . TYR A 286 ? 0.5347 0.6517 0.5679 -0.1324 -0.0974 -0.0515 474 TYR A CD2 
1967 C CE1 . TYR A 286 ? 0.5636 0.6350 0.5648 -0.1122 -0.0823 -0.0552 474 TYR A CE1 
1968 C CE2 . TYR A 286 ? 0.6009 0.6891 0.6124 -0.1383 -0.0943 -0.0587 474 TYR A CE2 
1969 C CZ  . TYR A 286 ? 0.6304 0.6959 0.6266 -0.1276 -0.0865 -0.0606 474 TYR A CZ  
1970 O OH  . TYR A 286 ? 0.7002 0.7374 0.6776 -0.1323 -0.0829 -0.0682 474 TYR A OH  
1971 N N   . LYS A 287 ? 0.4230 0.6030 0.5246 -0.1314 -0.0874 -0.0370 475 LYS A N   
1972 C CA  . LYS A 287 ? 0.4881 0.6651 0.5919 -0.1476 -0.0854 -0.0383 475 LYS A CA  
1973 C C   . LYS A 287 ? 0.4591 0.6408 0.5737 -0.1472 -0.0732 -0.0345 475 LYS A C   
1974 O O   . LYS A 287 ? 0.4752 0.6449 0.5853 -0.1586 -0.0685 -0.0346 475 LYS A O   
1975 C CB  . LYS A 287 ? 0.5203 0.7222 0.6414 -0.1599 -0.0963 -0.0382 475 LYS A CB  
1976 C CG  . LYS A 287 ? 0.6332 0.8257 0.7376 -0.1670 -0.1084 -0.0430 475 LYS A CG  
1977 C CD  . LYS A 287 ? 0.7418 0.8985 0.8190 -0.1744 -0.1044 -0.0499 475 LYS A CD  
1978 C CE  . LYS A 287 ? 0.8521 1.0000 0.9115 -0.1835 -0.1153 -0.0567 475 LYS A CE  
1979 N NZ  . LYS A 287 ? 0.9143 1.0275 0.9501 -0.1913 -0.1106 -0.0650 475 LYS A NZ  
1980 N N   . LYS A 288 ? 0.4770 0.6754 0.6052 -0.1345 -0.0680 -0.0312 476 LYS A N   
1981 C CA  . LYS A 288 ? 0.4514 0.6637 0.5944 -0.1365 -0.0572 -0.0279 476 LYS A CA  
1982 C C   . LYS A 288 ? 0.4497 0.6501 0.5823 -0.1246 -0.0464 -0.0264 476 LYS A C   
1983 O O   . LYS A 288 ? 0.5352 0.7233 0.6590 -0.1297 -0.0379 -0.0242 476 LYS A O   
1984 C CB  . LYS A 288 ? 0.4363 0.6864 0.6110 -0.1357 -0.0594 -0.0261 476 LYS A CB  
1985 C CG  . LYS A 288 ? 0.4753 0.7407 0.6634 -0.1516 -0.0684 -0.0264 476 LYS A CG  
1986 C CD  . LYS A 288 ? 0.5390 0.8438 0.7624 -0.1520 -0.0684 -0.0240 476 LYS A CD  
1987 C CE  . LYS A 288 ? 0.5967 0.9188 0.8350 -0.1374 -0.0761 -0.0231 476 LYS A CE  
1988 N NZ  . LYS A 288 ? 0.6358 0.9973 0.9123 -0.1372 -0.0769 -0.0209 476 LYS A NZ  
1989 N N   . HIS A 289 ? 0.4183 0.6239 0.5530 -0.1095 -0.0472 -0.0269 477 HIS A N   
1990 C CA  . HIS A 289 ? 0.4213 0.6247 0.5527 -0.0981 -0.0372 -0.0260 477 HIS A CA  
1991 C C   . HIS A 289 ? 0.4180 0.5914 0.5232 -0.0909 -0.0349 -0.0263 477 HIS A C   
1992 O O   . HIS A 289 ? 0.4470 0.6194 0.5491 -0.0812 -0.0280 -0.0257 477 HIS A O   
1993 C CB  . HIS A 289 ? 0.4389 0.6653 0.5902 -0.0857 -0.0385 -0.0268 477 HIS A CB  
1994 C CG  . HIS A 289 ? 0.4618 0.7198 0.6426 -0.0909 -0.0409 -0.0263 477 HIS A CG  
1995 N ND1 . HIS A 289 ? 0.4540 0.7301 0.6501 -0.0981 -0.0317 -0.0256 477 HIS A ND1 
1996 C CD2 . HIS A 289 ? 0.4872 0.7630 0.6859 -0.0903 -0.0518 -0.0258 477 HIS A CD2 
1997 C CE1 . HIS A 289 ? 0.4781 0.7826 0.7021 -0.1012 -0.0363 -0.0254 477 HIS A CE1 
1998 N NE2 . HIS A 289 ? 0.4877 0.7926 0.7141 -0.0964 -0.0492 -0.0251 477 HIS A NE2 
1999 N N   . LEU A 290 ? 0.3814 0.5314 0.4687 -0.0952 -0.0403 -0.0278 478 LEU A N   
2000 C CA  . LEU A 290 ? 0.3580 0.4814 0.4235 -0.0874 -0.0380 -0.0283 478 LEU A CA  
2001 C C   . LEU A 290 ? 0.3870 0.4961 0.4426 -0.0895 -0.0289 -0.0246 478 LEU A C   
2002 O O   . LEU A 290 ? 0.4241 0.5357 0.4840 -0.1007 -0.0252 -0.0217 478 LEU A O   
2003 C CB  . LEU A 290 ? 0.4012 0.5036 0.4510 -0.0912 -0.0452 -0.0322 478 LEU A CB  
2004 C CG  . LEU A 290 ? 0.4519 0.5629 0.5038 -0.0883 -0.0551 -0.0352 478 LEU A CG  
2005 C CD1 . LEU A 290 ? 0.4529 0.5393 0.4835 -0.0889 -0.0588 -0.0398 478 LEU A CD1 
2006 C CD2 . LEU A 290 ? 0.3840 0.5102 0.4452 -0.0747 -0.0553 -0.0334 478 LEU A CD2 
2007 N N   . ASP A 291 ? 0.3584 0.4533 0.4011 -0.0790 -0.0258 -0.0239 479 ASP A N   
2008 C CA  . ASP A 291 ? 0.4101 0.4896 0.4412 -0.0794 -0.0189 -0.0192 479 ASP A CA  
2009 C C   . ASP A 291 ? 0.3986 0.4524 0.4181 -0.0880 -0.0206 -0.0183 479 ASP A C   
2010 O O   . ASP A 291 ? 0.4177 0.4553 0.4284 -0.0855 -0.0255 -0.0227 479 ASP A O   
2011 C CB  . ASP A 291 ? 0.4222 0.4941 0.4435 -0.0657 -0.0171 -0.0191 479 ASP A CB  
2012 C CG  . ASP A 291 ? 0.4520 0.5139 0.4633 -0.0653 -0.0106 -0.0132 479 ASP A CG  
2013 O OD1 . ASP A 291 ? 0.4483 0.5032 0.4571 -0.0754 -0.0079 -0.0084 479 ASP A OD1 
2014 O OD2 . ASP A 291 ? 0.4296 0.4906 0.4351 -0.0553 -0.0086 -0.0128 479 ASP A OD2 
2015 N N   . PRO A 292 ? 0.3957 0.4454 0.4154 -0.0985 -0.0163 -0.0130 480 PRO A N   
2016 C CA  . PRO A 292 ? 0.4524 0.4755 0.4625 -0.1069 -0.0172 -0.0112 480 PRO A CA  
2017 C C   . PRO A 292 ? 0.4598 0.4574 0.4552 -0.0983 -0.0156 -0.0082 480 PRO A C   
2018 O O   . PRO A 292 ? 0.4144 0.3872 0.4025 -0.1007 -0.0177 -0.0097 480 PRO A O   
2019 C CB  . PRO A 292 ? 0.4428 0.4735 0.4594 -0.1200 -0.0122 -0.0045 480 PRO A CB  
2020 C CG  . PRO A 292 ? 0.4107 0.4643 0.4325 -0.1145 -0.0061 -0.0011 480 PRO A CG  
2021 C CD  . PRO A 292 ? 0.4481 0.5190 0.4778 -0.1037 -0.0096 -0.0083 480 PRO A CD  
2022 N N   . ARG A 293 ? 0.4271 0.4313 0.4194 -0.0886 -0.0120 -0.0043 481 ARG A N   
2023 C CA  . ARG A 293 ? 0.4831 0.4666 0.4636 -0.0809 -0.0109 0.0002  481 ARG A CA  
2024 C C   . ARG A 293 ? 0.4665 0.4309 0.4403 -0.0724 -0.0150 -0.0059 481 ARG A C   
2025 O O   . ARG A 293 ? 0.4827 0.4231 0.4501 -0.0718 -0.0151 -0.0035 481 ARG A O   
2026 C CB  . ARG A 293 ? 0.4226 0.4203 0.4011 -0.0728 -0.0070 0.0043  481 ARG A CB  
2027 C CG  . ARG A 293 ? 0.5210 0.5260 0.4986 -0.0814 -0.0015 0.0132  481 ARG A CG  
2028 C CD  . ARG A 293 ? 0.5711 0.5957 0.5475 -0.0756 0.0031  0.0145  481 ARG A CD  
2029 N NE  . ARG A 293 ? 0.6734 0.7238 0.6627 -0.0744 0.0048  0.0071  481 ARG A NE  
2030 C CZ  . ARG A 293 ? 0.7600 0.8311 0.7524 -0.0717 0.0103  0.0060  481 ARG A CZ  
2031 N NH1 . ARG A 293 ? 0.7992 0.8691 0.7803 -0.0712 0.0144  0.0118  481 ARG A NH1 
2032 N NH2 . ARG A 293 ? 0.7622 0.8553 0.7693 -0.0697 0.0115  -0.0009 481 ARG A NH2 
2033 N N   . PRO A 294 ? 0.4316 0.4063 0.4075 -0.0659 -0.0181 -0.0136 482 PRO A N   
2034 C CA  . PRO A 294 ? 0.4065 0.3643 0.3752 -0.0596 -0.0210 -0.0200 482 PRO A CA  
2035 C C   . PRO A 294 ? 0.4758 0.4171 0.4424 -0.0690 -0.0235 -0.0256 482 PRO A C   
2036 O O   . PRO A 294 ? 0.5018 0.4266 0.4615 -0.0650 -0.0246 -0.0316 482 PRO A O   
2037 C CB  . PRO A 294 ? 0.4071 0.3830 0.3787 -0.0526 -0.0238 -0.0252 482 PRO A CB  
2038 C CG  . PRO A 294 ? 0.4016 0.4011 0.3847 -0.0590 -0.0242 -0.0241 482 PRO A CG  
2039 C CD  . PRO A 294 ? 0.4013 0.4029 0.3866 -0.0641 -0.0190 -0.0165 482 PRO A CD  
2040 N N   . GLY A 295 ? 0.5041 0.4516 0.4769 -0.0817 -0.0242 -0.0247 483 GLY A N   
2041 C CA  . GLY A 295 ? 0.4281 0.3608 0.3990 -0.0924 -0.0269 -0.0307 483 GLY A CA  
2042 C C   . GLY A 295 ? 0.4218 0.3708 0.3953 -0.0962 -0.0325 -0.0386 483 GLY A C   
2043 O O   . GLY A 295 ? 0.4025 0.3734 0.3810 -0.0899 -0.0342 -0.0381 483 GLY A O   
2044 N N   . PRO A 296 ? 0.4641 0.4022 0.4344 -0.1068 -0.0359 -0.0457 484 PRO A N   
2045 C CA  . PRO A 296 ? 0.5227 0.4761 0.4940 -0.1121 -0.0427 -0.0527 484 PRO A CA  
2046 C C   . PRO A 296 ? 0.5517 0.5109 0.5163 -0.1002 -0.0449 -0.0564 484 PRO A C   
2047 O O   . PRO A 296 ? 0.5554 0.4974 0.5103 -0.0914 -0.0416 -0.0589 484 PRO A O   
2048 C CB  . PRO A 296 ? 0.5226 0.4547 0.4863 -0.1243 -0.0447 -0.0611 484 PRO A CB  
2049 C CG  . PRO A 296 ? 0.5228 0.4253 0.4812 -0.1213 -0.0384 -0.0594 484 PRO A CG  
2050 C CD  . PRO A 296 ? 0.4653 0.3759 0.4313 -0.1153 -0.0340 -0.0473 484 PRO A CD  
2051 N N   . CYS A 297 ? 0.5411 0.5252 0.5125 -0.1002 -0.0504 -0.0561 485 CYS A N   
2052 C CA  . CYS A 297 ? 0.5129 0.5052 0.4797 -0.0899 -0.0533 -0.0576 485 CYS A CA  
2053 C C   . CYS A 297 ? 0.5730 0.5639 0.5297 -0.0968 -0.0601 -0.0656 485 CYS A C   
2054 O O   . CYS A 297 ? 0.6198 0.6217 0.5814 -0.1085 -0.0663 -0.0672 485 CYS A O   
2055 C CB  . CYS A 297 ? 0.5078 0.5280 0.4897 -0.0844 -0.0552 -0.0511 485 CYS A CB  
2056 S SG  . CYS A 297 ? 0.5461 0.5766 0.5252 -0.0713 -0.0586 -0.0507 485 CYS A SG  
2057 N N   . PRO A 298 ? 0.6571 0.6352 0.5992 -0.0904 -0.0590 -0.0709 486 PRO A N   
2058 C CA  . PRO A 298 ? 0.6640 0.6424 0.5937 -0.0971 -0.0652 -0.0785 486 PRO A CA  
2059 C C   . PRO A 298 ? 0.6068 0.6130 0.5450 -0.0994 -0.0747 -0.0737 486 PRO A C   
2060 O O   . PRO A 298 ? 0.5748 0.5957 0.5227 -0.0892 -0.0750 -0.0666 486 PRO A O   
2061 C CB  . PRO A 298 ? 0.6651 0.6311 0.5812 -0.0865 -0.0608 -0.0821 486 PRO A CB  
2062 C CG  . PRO A 298 ? 0.6883 0.6392 0.6083 -0.0775 -0.0519 -0.0791 486 PRO A CG  
2063 C CD  . PRO A 298 ? 0.6822 0.6468 0.6188 -0.0774 -0.0520 -0.0698 486 PRO A CD  
2064 N N   . PRO A 299 ? 0.6358 0.6489 0.5715 -0.1128 -0.0827 -0.0777 487 PRO A N   
2065 C CA  . PRO A 299 ? 0.6022 0.6433 0.5497 -0.1168 -0.0933 -0.0723 487 PRO A CA  
2066 C C   . PRO A 299 ? 0.5644 0.6179 0.5108 -0.1060 -0.0972 -0.0671 487 PRO A C   
2067 O O   . PRO A 299 ? 0.5488 0.6237 0.5131 -0.1007 -0.1013 -0.0589 487 PRO A O   
2068 C CB  . PRO A 299 ? 0.6430 0.6823 0.5790 -0.1331 -0.1010 -0.0800 487 PRO A CB  
2069 C CG  . PRO A 299 ? 0.6705 0.6832 0.5976 -0.1396 -0.0932 -0.0884 487 PRO A CG  
2070 C CD  . PRO A 299 ? 0.6689 0.6628 0.5907 -0.1255 -0.0824 -0.0882 487 PRO A CD  
2071 N N   . GLU A 300 ? 0.4989 0.5386 0.4254 -0.1029 -0.0955 -0.0720 488 GLU A N   
2072 C CA  . GLU A 300 ? 0.5543 0.6032 0.4769 -0.0944 -0.0993 -0.0671 488 GLU A CA  
2073 C C   . GLU A 300 ? 0.5581 0.6126 0.4958 -0.0795 -0.0941 -0.0592 488 GLU A C   
2074 O O   . GLU A 300 ? 0.5869 0.6592 0.5365 -0.0739 -0.0998 -0.0515 488 GLU A O   
2075 C CB  . GLU A 300 ? 0.6690 0.7002 0.5667 -0.0944 -0.0956 -0.0748 488 GLU A CB  
2076 C CG  . GLU A 300 ? 0.8545 0.8750 0.7341 -0.1092 -0.0977 -0.0858 488 GLU A CG  
2077 C CD  . GLU A 300 ? 0.9999 0.9983 0.8783 -0.1127 -0.0887 -0.0943 488 GLU A CD  
2078 O OE1 . GLU A 300 ? 1.0231 1.0127 0.9112 -0.1028 -0.0803 -0.0913 488 GLU A OE1 
2079 O OE2 . GLU A 300 ? 1.0866 1.0761 0.9542 -0.1259 -0.0905 -0.1036 488 GLU A OE2 
2080 N N   . LEU A 301 ? 0.5620 0.6010 0.4995 -0.0734 -0.0836 -0.0613 489 LEU A N   
2081 C CA  . LEU A 301 ? 0.5251 0.5676 0.4743 -0.0604 -0.0780 -0.0552 489 LEU A CA  
2082 C C   . LEU A 301 ? 0.5034 0.5661 0.4755 -0.0601 -0.0802 -0.0489 489 LEU A C   
2083 O O   . LEU A 301 ? 0.5396 0.6162 0.5238 -0.0516 -0.0819 -0.0432 489 LEU A O   
2084 C CB  . LEU A 301 ? 0.4972 0.5192 0.4408 -0.0558 -0.0675 -0.0582 489 LEU A CB  
2085 C CG  . LEU A 301 ? 0.5366 0.5608 0.4894 -0.0437 -0.0615 -0.0527 489 LEU A CG  
2086 C CD1 . LEU A 301 ? 0.5516 0.5818 0.5025 -0.0344 -0.0633 -0.0499 489 LEU A CD1 
2087 C CD2 . LEU A 301 ? 0.5356 0.5396 0.4822 -0.0405 -0.0529 -0.0549 489 LEU A CD2 
2088 N N   . GLY A 302 ? 0.4689 0.5328 0.4475 -0.0695 -0.0797 -0.0503 490 GLY A N   
2089 C CA  . GLY A 302 ? 0.4728 0.5564 0.4734 -0.0704 -0.0800 -0.0453 490 GLY A CA  
2090 C C   . GLY A 302 ? 0.4566 0.5648 0.4719 -0.0706 -0.0900 -0.0409 490 GLY A C   
2091 O O   . GLY A 302 ? 0.4524 0.5771 0.4864 -0.0628 -0.0892 -0.0359 490 GLY A O   
2092 N N   . LEU A 303 ? 0.4576 0.5683 0.4647 -0.0794 -0.0995 -0.0428 491 LEU A N   
2093 C CA  . LEU A 303 ? 0.4622 0.5964 0.4829 -0.0806 -0.1110 -0.0373 491 LEU A CA  
2094 C C   . LEU A 303 ? 0.4282 0.5655 0.4489 -0.0681 -0.1134 -0.0321 491 LEU A C   
2095 O O   . LEU A 303 ? 0.4315 0.5881 0.4730 -0.0620 -0.1182 -0.0255 491 LEU A O   
2096 C CB  . LEU A 303 ? 0.4731 0.6086 0.4819 -0.0949 -0.1214 -0.0405 491 LEU A CB  
2097 C CG  . LEU A 303 ? 0.4693 0.6065 0.4825 -0.1093 -0.1219 -0.0448 491 LEU A CG  
2098 C CD1 . LEU A 303 ? 0.4797 0.6136 0.4753 -0.1237 -0.1314 -0.0501 491 LEU A CD1 
2099 C CD2 . LEU A 303 ? 0.4377 0.6021 0.4815 -0.1102 -0.1250 -0.0387 491 LEU A CD2 
2100 N N   . GLY A 304 ? 0.4259 0.5441 0.4248 -0.0644 -0.1098 -0.0351 492 GLY A N   
2101 C CA  . GLY A 304 ? 0.4523 0.5712 0.4502 -0.0532 -0.1109 -0.0301 492 GLY A CA  
2102 C C   . GLY A 304 ? 0.4427 0.5679 0.4602 -0.0409 -0.1045 -0.0264 492 GLY A C   
2103 O O   . GLY A 304 ? 0.4115 0.5497 0.4438 -0.0335 -0.1093 -0.0201 492 GLY A O   
2104 N N   . LEU A 305 ? 0.4269 0.5426 0.4443 -0.0389 -0.0938 -0.0303 493 LEU A N   
2105 C CA  . LEU A 305 ? 0.4079 0.5286 0.4405 -0.0286 -0.0864 -0.0282 493 LEU A CA  
2106 C C   . LEU A 305 ? 0.3858 0.5300 0.4452 -0.0287 -0.0891 -0.0249 493 LEU A C   
2107 O O   . LEU A 305 ? 0.4162 0.5707 0.4919 -0.0192 -0.0881 -0.0220 493 LEU A O   
2108 C CB  . LEU A 305 ? 0.3848 0.4905 0.4090 -0.0284 -0.0753 -0.0322 493 LEU A CB  
2109 C CG  . LEU A 305 ? 0.4279 0.5124 0.4317 -0.0240 -0.0706 -0.0349 493 LEU A CG  
2110 C CD1 . LEU A 305 ? 0.4306 0.5024 0.4299 -0.0231 -0.0609 -0.0370 493 LEU A CD1 
2111 C CD2 . LEU A 305 ? 0.4035 0.4897 0.4087 -0.0134 -0.0714 -0.0319 493 LEU A CD2 
2112 N N   . GLY A 306 ? 0.3471 0.5000 0.4124 -0.0396 -0.0922 -0.0259 494 GLY A N   
2113 C CA  . GLY A 306 ? 0.3772 0.5549 0.4700 -0.0405 -0.0948 -0.0229 494 GLY A CA  
2114 C C   . GLY A 306 ? 0.4224 0.6164 0.5304 -0.0350 -0.1055 -0.0170 494 GLY A C   
2115 O O   . GLY A 306 ? 0.3545 0.5646 0.4870 -0.0267 -0.1044 -0.0142 494 GLY A O   
2116 N N   . GLN A 307 ? 0.3971 0.5865 0.4906 -0.0398 -0.1159 -0.0150 495 GLN A N   
2117 C CA  . GLN A 307 ? 0.4426 0.6457 0.5474 -0.0358 -0.1279 -0.0074 495 GLN A CA  
2118 C C   . GLN A 307 ? 0.4040 0.6022 0.5136 -0.0213 -0.1246 -0.0042 495 GLN A C   
2119 O O   . GLN A 307 ? 0.4047 0.6182 0.5385 -0.0134 -0.1293 0.0015  495 GLN A O   
2120 C CB  . GLN A 307 ? 0.4991 0.6960 0.5812 -0.0454 -0.1388 -0.0062 495 GLN A CB  
2121 C CG  . GLN A 307 ? 0.6666 0.8797 0.7599 -0.0439 -0.1536 0.0035  495 GLN A CG  
2122 C CD  . GLN A 307 ? 0.8187 1.0321 0.8921 -0.0575 -0.1656 0.0044  495 GLN A CD  
2123 O OE1 . GLN A 307 ? 0.8770 1.0741 0.9242 -0.0665 -0.1615 -0.0034 495 GLN A OE1 
2124 N NE2 . GLN A 307 ? 0.8622 1.0942 0.9479 -0.0592 -0.1805 0.0138  495 GLN A NE2 
2125 N N   . LEU A 308 ? 0.3442 0.5210 0.4321 -0.0178 -0.1166 -0.0080 496 LEU A N   
2126 C CA  . LEU A 308 ? 0.4080 0.5783 0.4989 -0.0051 -0.1123 -0.0061 496 LEU A CA  
2127 C C   . LEU A 308 ? 0.3775 0.5593 0.4944 0.0034  -0.1049 -0.0074 496 LEU A C   
2128 O O   . LEU A 308 ? 0.3920 0.5799 0.5259 0.0132  -0.1066 -0.0038 496 LEU A O   
2129 C CB  . LEU A 308 ? 0.4379 0.5852 0.5031 -0.0039 -0.1037 -0.0110 496 LEU A CB  
2130 C CG  . LEU A 308 ? 0.4793 0.6192 0.5462 0.0078  -0.0990 -0.0097 496 LEU A CG  
2131 C CD1 . LEU A 308 ? 0.5199 0.6608 0.5859 0.0105  -0.1090 -0.0022 496 LEU A CD1 
2132 C CD2 . LEU A 308 ? 0.5300 0.6507 0.5762 0.0088  -0.0893 -0.0151 496 LEU A CD2 
2133 N N   . ALA A 309 ? 0.3758 0.5603 0.4957 -0.0008 -0.0964 -0.0127 497 ALA A N   
2134 C CA  . ALA A 309 ? 0.3679 0.5649 0.5104 0.0052  -0.0879 -0.0152 497 ALA A CA  
2135 C C   . ALA A 309 ? 0.3521 0.5735 0.5261 0.0080  -0.0950 -0.0109 497 ALA A C   
2136 O O   . ALA A 309 ? 0.3381 0.5681 0.5332 0.0182  -0.0913 -0.0112 497 ALA A O   
2137 C CB  . ALA A 309 ? 0.3730 0.5691 0.5107 -0.0025 -0.0785 -0.0202 497 ALA A CB  
2138 N N   . CYS A 310 ? 0.3193 0.5520 0.4973 -0.0011 -0.1053 -0.0073 498 CYS A N   
2139 C CA  . CYS A 310 ? 0.3320 0.5896 0.5417 0.0014  -0.1140 -0.0019 498 CYS A CA  
2140 C C   . CYS A 310 ? 0.3936 0.6506 0.6127 0.0127  -0.1215 0.0046  498 CYS A C   
2141 O O   . CYS A 310 ? 0.4353 0.7064 0.6841 0.0224  -0.1208 0.0062  498 CYS A O   
2142 C CB  . CYS A 310 ? 0.2870 0.5559 0.4961 -0.0116 -0.1258 0.0015  498 CYS A CB  
2143 S SG  . CYS A 310 ? 0.3954 0.6691 0.6020 -0.0255 -0.1180 -0.0052 498 CYS A SG  
2144 N N   . CYS A 311 ? 0.3699 0.6100 0.5642 0.0112  -0.1280 0.0083  499 CYS A N   
2145 C CA  . CYS A 311 ? 0.3810 0.6184 0.5816 0.0205  -0.1358 0.0160  499 CYS A CA  
2146 C C   . CYS A 311 ? 0.3788 0.6091 0.5904 0.0338  -0.1253 0.0124  499 CYS A C   
2147 O O   . CYS A 311 ? 0.3071 0.5450 0.5433 0.0436  -0.1293 0.0172  499 CYS A O   
2148 C CB  . CYS A 311 ? 0.4250 0.6448 0.5933 0.0149  -0.1426 0.0197  499 CYS A CB  
2149 S SG  . CYS A 311 ? 0.5705 0.7996 0.7262 -0.0004 -0.1579 0.0248  499 CYS A SG  
2150 N N   . CYS A 312 ? 0.3387 0.5543 0.5328 0.0338  -0.1121 0.0040  500 CYS A N   
2151 C CA  . CYS A 312 ? 0.3477 0.5565 0.5495 0.0447  -0.1017 -0.0007 500 CYS A CA  
2152 C C   . CYS A 312 ? 0.3902 0.6179 0.6245 0.0508  -0.0950 -0.0050 500 CYS A C   
2153 O O   . CYS A 312 ? 0.3620 0.5893 0.6127 0.0615  -0.0904 -0.0072 500 CYS A O   
2154 C CB  . CYS A 312 ? 0.3436 0.5343 0.5186 0.0421  -0.0902 -0.0081 500 CYS A CB  
2155 S SG  . CYS A 312 ? 0.4121 0.5797 0.5521 0.0382  -0.0947 -0.0050 500 CYS A SG  
2156 N N   . LEU A 313 ? 0.4086 0.6527 0.6524 0.0436  -0.0937 -0.0069 501 LEU A N   
2157 C CA  . LEU A 313 ? 0.3897 0.6534 0.6628 0.0476  -0.0851 -0.0123 501 LEU A CA  
2158 C C   . LEU A 313 ? 0.4219 0.7082 0.7314 0.0528  -0.0946 -0.0063 501 LEU A C   
2159 O O   . LEU A 313 ? 0.4621 0.7688 0.8001 0.0557  -0.0883 -0.0104 501 LEU A O   
2160 C CB  . LEU A 313 ? 0.3277 0.5983 0.5936 0.0365  -0.0773 -0.0173 501 LEU A CB  
2161 C CG  . LEU A 313 ? 0.3264 0.5781 0.5638 0.0334  -0.0654 -0.0237 501 LEU A CG  
2162 C CD1 . LEU A 313 ? 0.3593 0.6174 0.5910 0.0216  -0.0593 -0.0266 501 LEU A CD1 
2163 C CD2 . LEU A 313 ? 0.3035 0.5522 0.5477 0.0436  -0.0539 -0.0303 501 LEU A CD2 
2164 N N   . HIS A 314 ? 0.3999 0.6836 0.7085 0.0536  -0.1097 0.0037  502 HIS A N   
2165 C CA  . HIS A 314 ? 0.4154 0.7203 0.7579 0.0581  -0.1218 0.0119  502 HIS A CA  
2166 C C   . HIS A 314 ? 0.4268 0.7425 0.8060 0.0724  -0.1145 0.0080  502 HIS A C   
2167 O O   . HIS A 314 ? 0.4577 0.7579 0.8335 0.0814  -0.1067 0.0036  502 HIS A O   
2168 C CB  . HIS A 314 ? 0.4775 0.7728 0.8094 0.0584  -0.1383 0.0240  502 HIS A CB  
2169 C CG  . HIS A 314 ? 0.5750 0.8925 0.9344 0.0586  -0.1545 0.0350  502 HIS A CG  
2170 N ND1 . HIS A 314 ? 0.5867 0.9202 0.9877 0.0710  -0.1571 0.0385  502 HIS A ND1 
2171 C CD2 . HIS A 314 ? 0.6012 0.9279 0.9530 0.0476  -0.1695 0.0433  502 HIS A CD2 
2172 C CE1 . HIS A 314 ? 0.6007 0.9525 1.0184 0.0681  -0.1731 0.0494  502 HIS A CE1 
2173 N NE2 . HIS A 314 ? 0.6158 0.9648 1.0045 0.0535  -0.1817 0.0528  502 HIS A NE2 
2174 N N   . ARG A 315 ? 0.5024 0.8454 0.9174 0.0741  -0.1164 0.0090  503 ARG A N   
2175 C CA  . ARG A 315 ? 0.5228 0.8798 0.9768 0.0874  -0.1079 0.0036  503 ARG A CA  
2176 C C   . ARG A 315 ? 0.4950 0.8425 0.9655 0.1013  -0.1156 0.0101  503 ARG A C   
2177 O O   . ARG A 315 ? 0.4756 0.8180 0.9609 0.1127  -0.1046 0.0027  503 ARG A O   
2178 C CB  . ARG A 315 ? 0.5598 0.9504 1.0506 0.0855  -0.1102 0.0047  503 ARG A CB  
2179 C CG  . ARG A 315 ? 0.6459 1.0491 1.1736 0.0992  -0.1092 0.0066  503 ARG A CG  
2180 C CD  . ARG A 315 ? 0.7069 1.1375 1.2622 0.0984  -0.0973 -0.0010 503 ARG A CD  
2181 N NE  . ARG A 315 ? 0.7593 1.2070 1.3427 0.1050  -0.1031 0.0061  503 ARG A NE  
2182 C CZ  . ARG A 315 ? 0.8264 1.2965 1.4211 0.0972  -0.1138 0.0133  503 ARG A CZ  
2183 N NH1 . ARG A 315 ? 0.8550 1.3316 1.4345 0.0819  -0.1194 0.0144  503 ARG A NH1 
2184 N NH2 . ARG A 315 ? 0.8392 1.3248 1.4605 0.1045  -0.1190 0.0190  503 ARG A NH2 
2185 N N   . ARG A 316 ? 0.4567 0.7991 0.9192 0.0990  -0.1334 0.0239  504 ARG A N   
2186 C CA  . ARG A 316 ? 0.4839 0.8102 0.9470 0.1087  -0.1388 0.0321  504 ARG A CA  
2187 C C   . ARG A 316 ? 0.5102 0.8090 0.9440 0.1085  -0.1391 0.0319  504 ARG A C   
2188 O O   . ARG A 316 ? 0.4929 0.7828 0.8961 0.0981  -0.1474 0.0373  504 ARG A O   
2189 C CB  . ARG A 316 ? 0.5581 0.8924 1.0234 0.1055  -0.1562 0.0471  504 ARG A CB  
2190 C CG  . ARG A 316 ? 0.6731 1.0080 1.1634 0.1178  -0.1582 0.0527  504 ARG A CG  
2191 C CD  . ARG A 316 ? 0.7376 1.0939 1.2440 0.1149  -0.1710 0.0626  504 ARG A CD  
2192 N NE  . ARG A 316 ? 0.8169 1.1713 1.2968 0.1025  -0.1871 0.0733  504 ARG A NE  
2193 C CZ  . ARG A 316 ? 0.8811 1.2544 1.3582 0.0908  -0.1941 0.0746  504 ARG A CZ  
2194 N NH1 . ARG A 316 ? 0.8934 1.2902 1.3944 0.0899  -0.1869 0.0669  504 ARG A NH1 
2195 N NH2 . ARG A 316 ? 0.8945 1.2633 1.3443 0.0792  -0.2080 0.0832  504 ARG A NH2 
2196 N N   . ALA A 317 ? 0.5357 0.8194 0.9738 0.1187  -0.1282 0.0248  505 ALA A N   
2197 C CA  . ALA A 317 ? 0.5157 0.7734 0.9255 0.1185  -0.1247 0.0219  505 ALA A CA  
2198 C C   . ALA A 317 ? 0.5585 0.8014 0.9494 0.1156  -0.1404 0.0366  505 ALA A C   
2199 O O   . ALA A 317 ? 0.6041 0.8276 0.9590 0.1091  -0.1386 0.0361  505 ALA A O   
2200 C CB  . ALA A 317 ? 0.4627 0.7094 0.8867 0.1304  -0.1118 0.0119  505 ALA A CB  
2201 N N   . LYS A 318 ? 0.5524 0.8008 0.9556 0.1176  -0.1510 0.0487  506 LYS A N   
2202 C CA  . LYS A 318 ? 0.5863 0.8210 0.9703 0.1142  -0.1646 0.0631  506 LYS A CA  
2203 C C   . LYS A 318 ? 0.5002 0.7387 0.8560 0.1000  -0.1754 0.0693  506 LYS A C   
2204 O O   . LYS A 318 ? 0.5344 0.7589 0.8651 0.0948  -0.1838 0.0784  506 LYS A O   
2205 C CB  . LYS A 318 ? 0.7070 0.9476 1.1126 0.1201  -0.1728 0.0738  506 LYS A CB  
2206 C CG  . LYS A 318 ? 0.8300 1.0514 1.2459 0.1310  -0.1694 0.0756  506 LYS A CG  
2207 C CD  . LYS A 318 ? 0.8813 1.0973 1.3110 0.1397  -0.1519 0.0594  506 LYS A CD  
2208 C CE  . LYS A 318 ? 0.9102 1.1046 1.3473 0.1490  -0.1487 0.0603  506 LYS A CE  
2209 N NZ  . LYS A 318 ? 0.8925 1.0803 1.3393 0.1561  -0.1314 0.0432  506 LYS A NZ  
2210 N N   . ARG A 319 ? 0.4627 0.7200 0.8221 0.0930  -0.1747 0.0641  507 ARG A N   
2211 C CA  . ARG A 319 ? 0.4811 0.7411 0.8120 0.0781  -0.1836 0.0678  507 ARG A CA  
2212 C C   . ARG A 319 ? 0.4459 0.6901 0.7403 0.0701  -0.1696 0.0554  507 ARG A C   
2213 O O   . ARG A 319 ? 0.4296 0.6720 0.6961 0.0576  -0.1731 0.0556  507 ARG A O   
2214 C CB  . ARG A 319 ? 0.5661 0.8519 0.9132 0.0719  -0.1897 0.0694  507 ARG A CB  
2215 C CG  . ARG A 319 ? 0.6295 0.9232 0.9877 0.0738  -0.2014 0.0816  507 ARG A CG  
2216 C CD  . ARG A 319 ? 0.7096 1.0277 1.0774 0.0651  -0.2085 0.0829  507 ARG A CD  
2217 N NE  . ARG A 319 ? 0.7626 1.0805 1.1002 0.0491  -0.2134 0.0813  507 ARG A NE  
2218 C CZ  . ARG A 319 ? 0.8223 1.1577 1.1598 0.0380  -0.2205 0.0819  507 ARG A CZ  
2219 N NH1 . ARG A 319 ? 0.8160 1.1721 1.1831 0.0415  -0.2243 0.0849  507 ARG A NH1 
2220 N NH2 . ARG A 319 ? 0.8550 1.1866 1.1625 0.0230  -0.2237 0.0791  507 ARG A NH2 
2221 N N   . ARG A 320 ? 0.4141 0.6469 0.7089 0.0772  -0.1542 0.0446  508 ARG A N   
2222 C CA  . ARG A 320 ? 0.3958 0.6125 0.6570 0.0708  -0.1421 0.0346  508 ARG A CA  
2223 C C   . ARG A 320 ? 0.3936 0.5895 0.6244 0.0676  -0.1468 0.0404  508 ARG A C   
2224 O O   . ARG A 320 ? 0.4594 0.6472 0.6977 0.0747  -0.1516 0.0475  508 ARG A O   
2225 C CB  . ARG A 320 ? 0.4097 0.6215 0.6794 0.0786  -0.1254 0.0222  508 ARG A CB  
2226 C CG  . ARG A 320 ? 0.4346 0.6675 0.7319 0.0807  -0.1184 0.0152  508 ARG A CG  
2227 C CD  . ARG A 320 ? 0.4264 0.6556 0.7342 0.0892  -0.1026 0.0034  508 ARG A CD  
2228 N NE  . ARG A 320 ? 0.4596 0.7118 0.8010 0.0932  -0.0971 -0.0017 508 ARG A NE  
2229 C CZ  . ARG A 320 ? 0.4531 0.7085 0.8141 0.1021  -0.0847 -0.0115 508 ARG A CZ  
2230 N NH1 . ARG A 320 ? 0.3984 0.6348 0.7482 0.1075  -0.0771 -0.0174 508 ARG A NH1 
2231 N NH2 . ARG A 320 ? 0.4256 0.7043 0.8178 0.1050  -0.0796 -0.0161 508 ARG A NH2 
2232 N N   . PRO A 321 ? 0.3692 0.5566 0.5668 0.0567  -0.1449 0.0374  509 PRO A N   
2233 C CA  . PRO A 321 ? 0.3807 0.5503 0.5487 0.0526  -0.1480 0.0419  509 PRO A CA  
2234 C C   . PRO A 321 ? 0.4336 0.5857 0.5963 0.0601  -0.1378 0.0373  509 PRO A C   
2235 O O   . PRO A 321 ? 0.4305 0.5820 0.6030 0.0655  -0.1262 0.0276  509 PRO A O   
2236 C CB  . PRO A 321 ? 0.3750 0.5411 0.5136 0.0405  -0.1448 0.0359  509 PRO A CB  
2237 C CG  . PRO A 321 ? 0.4101 0.5836 0.5595 0.0409  -0.1342 0.0255  509 PRO A CG  
2238 C CD  . PRO A 321 ? 0.3943 0.5869 0.5809 0.0480  -0.1382 0.0287  509 PRO A CD  
2239 N N   . PRO A 322 ? 0.4543 0.5929 0.6014 0.0595  -0.1423 0.0443  510 PRO A N   
2240 C CA  . PRO A 322 ? 0.4474 0.5686 0.5847 0.0639  -0.1329 0.0397  510 PRO A CA  
2241 C C   . PRO A 322 ? 0.4229 0.5364 0.5351 0.0582  -0.1217 0.0291  510 PRO A C   
2242 O O   . PRO A 322 ? 0.4331 0.5484 0.5265 0.0491  -0.1239 0.0287  510 PRO A O   
2243 C CB  . PRO A 322 ? 0.4221 0.5338 0.5466 0.0614  -0.1421 0.0516  510 PRO A CB  
2244 C CG  . PRO A 322 ? 0.4656 0.5905 0.6019 0.0592  -0.1572 0.0636  510 PRO A CG  
2245 C CD  . PRO A 322 ? 0.4576 0.5979 0.5968 0.0541  -0.1569 0.0578  510 PRO A CD  
2246 N N   . MET A 323 ? 0.3851 0.4900 0.4974 0.0633  -0.1104 0.0207  511 MET A N   
2247 C CA  . MET A 323 ? 0.4010 0.4994 0.4928 0.0589  -0.1003 0.0116  511 MET A CA  
2248 C C   . MET A 323 ? 0.3815 0.4689 0.4451 0.0521  -0.1014 0.0139  511 MET A C   
2249 O O   . MET A 323 ? 0.4003 0.4840 0.4467 0.0470  -0.0956 0.0079  511 MET A O   
2250 C CB  . MET A 323 ? 0.3747 0.4670 0.4722 0.0655  -0.0894 0.0033  511 MET A CB  
2251 C CG  . MET A 323 ? 0.3947 0.4987 0.5126 0.0694  -0.0837 -0.0034 511 MET A CG  
2252 S SD  . MET A 323 ? 0.3557 0.4693 0.4654 0.0611  -0.0806 -0.0079 511 MET A SD  
2253 C CE  . MET A 323 ? 0.2957 0.3936 0.3753 0.0565  -0.0729 -0.0127 511 MET A CE  
2254 N N   . THR A 324 ? 0.3574 0.4399 0.4170 0.0518  -0.1085 0.0228  512 THR A N   
2255 C CA  . THR A 324 ? 0.4215 0.4963 0.4547 0.0443  -0.1098 0.0255  512 THR A CA  
2256 C C   . THR A 324 ? 0.4874 0.5694 0.5080 0.0352  -0.1148 0.0257  512 THR A C   
2257 O O   . THR A 324 ? 0.5275 0.6042 0.5267 0.0289  -0.1100 0.0203  512 THR A O   
2258 C CB  . THR A 324 ? 0.4592 0.5288 0.4909 0.0445  -0.1173 0.0366  512 THR A CB  
2259 O OG1 . THR A 324 ? 0.4928 0.5718 0.5436 0.0467  -0.1287 0.0460  512 THR A OG1 
2260 C CG2 . THR A 324 ? 0.3528 0.4118 0.3909 0.0512  -0.1110 0.0349  512 THR A CG2 
2261 N N   . GLN A 325 ? 0.4092 0.5037 0.4446 0.0345  -0.1245 0.0316  513 GLN A N   
2262 C CA  . GLN A 325 ? 0.4582 0.5612 0.4842 0.0251  -0.1304 0.0315  513 GLN A CA  
2263 C C   . GLN A 325 ? 0.3905 0.4945 0.4148 0.0229  -0.1215 0.0202  513 GLN A C   
2264 O O   . GLN A 325 ? 0.3745 0.4764 0.3802 0.0142  -0.1208 0.0158  513 GLN A O   
2265 C CB  . GLN A 325 ? 0.5112 0.6296 0.5576 0.0254  -0.1434 0.0408  513 GLN A CB  
2266 C CG  . GLN A 325 ? 0.6225 0.7406 0.6659 0.0242  -0.1552 0.0543  513 GLN A CG  
2267 C CD  . GLN A 325 ? 0.7020 0.8369 0.7615 0.0220  -0.1700 0.0642  513 GLN A CD  
2268 O OE1 . GLN A 325 ? 0.6720 0.8195 0.7433 0.0200  -0.1713 0.0601  513 GLN A OE1 
2269 N NE2 . GLN A 325 ? 0.7368 0.8724 0.7974 0.0217  -0.1819 0.0782  513 GLN A NE2 
2270 N N   . VAL A 326 ? 0.3284 0.4351 0.3716 0.0303  -0.1147 0.0154  514 VAL A N   
2271 C CA  . VAL A 326 ? 0.3898 0.4968 0.4314 0.0282  -0.1059 0.0060  514 VAL A CA  
2272 C C   . VAL A 326 ? 0.4136 0.5055 0.4307 0.0251  -0.0976 -0.0003 514 VAL A C   
2273 O O   . VAL A 326 ? 0.3776 0.4667 0.3822 0.0181  -0.0951 -0.0054 514 VAL A O   
2274 C CB  . VAL A 326 ? 0.3581 0.4701 0.4218 0.0366  -0.0988 0.0020  514 VAL A CB  
2275 C CG1 . VAL A 326 ? 0.3210 0.4301 0.3783 0.0340  -0.0886 -0.0067 514 VAL A CG1 
2276 C CG2 . VAL A 326 ? 0.2991 0.4283 0.3898 0.0393  -0.1056 0.0063  514 VAL A CG2 
2277 N N   . TYR A 327 ? 0.3993 0.4815 0.4112 0.0302  -0.0936 0.0003  515 TYR A N   
2278 C CA  . TYR A 327 ? 0.3702 0.4396 0.3619 0.0284  -0.0861 -0.0047 515 TYR A CA  
2279 C C   . TYR A 327 ? 0.3946 0.4608 0.3654 0.0194  -0.0896 -0.0046 515 TYR A C   
2280 O O   . TYR A 327 ? 0.4368 0.4961 0.3942 0.0153  -0.0839 -0.0113 515 TYR A O   
2281 C CB  . TYR A 327 ? 0.3572 0.4190 0.3482 0.0345  -0.0829 -0.0028 515 TYR A CB  
2282 C CG  . TYR A 327 ? 0.3657 0.4167 0.3381 0.0326  -0.0757 -0.0073 515 TYR A CG  
2283 C CD1 . TYR A 327 ? 0.3308 0.3769 0.3026 0.0355  -0.0671 -0.0139 515 TYR A CD1 
2284 C CD2 . TYR A 327 ? 0.3760 0.4227 0.3315 0.0278  -0.0777 -0.0048 515 TYR A CD2 
2285 C CE1 . TYR A 327 ? 0.3777 0.4151 0.3357 0.0346  -0.0610 -0.0176 515 TYR A CE1 
2286 C CE2 . TYR A 327 ? 0.3880 0.4264 0.3290 0.0266  -0.0702 -0.0097 515 TYR A CE2 
2287 C CZ  . TYR A 327 ? 0.3884 0.4222 0.3320 0.0306  -0.0622 -0.0160 515 TYR A CZ  
2288 O OH  . TYR A 327 ? 0.4627 0.4893 0.3950 0.0303  -0.0553 -0.0203 515 TYR A OH  
2289 N N   . GLU A 328 ? 0.3543 0.4249 0.3221 0.0162  -0.0989 0.0031  516 GLU A N   
2290 C CA  . GLU A 328 ? 0.4830 0.5517 0.4287 0.0065  -0.1025 0.0031  516 GLU A CA  
2291 C C   . GLU A 328 ? 0.4970 0.5691 0.4382 -0.0012 -0.1036 -0.0028 516 GLU A C   
2292 O O   . GLU A 328 ? 0.4972 0.5620 0.4192 -0.0079 -0.0996 -0.0096 516 GLU A O   
2293 C CB  . GLU A 328 ? 0.5703 0.6454 0.5146 0.0036  -0.1141 0.0143  516 GLU A CB  
2294 C CG  . GLU A 328 ? 0.6978 0.7663 0.6394 0.0079  -0.1128 0.0202  516 GLU A CG  
2295 C CD  . GLU A 328 ? 0.8325 0.9070 0.7766 0.0058  -0.1253 0.0335  516 GLU A CD  
2296 O OE1 . GLU A 328 ? 0.8784 0.9639 0.8353 0.0048  -0.1353 0.0390  516 GLU A OE1 
2297 O OE2 . GLU A 328 ? 0.8979 0.9667 0.8320 0.0049  -0.1254 0.0393  516 GLU A OE2 
2298 N N   . ARG A 329 ? 0.4682 0.5516 0.4285 -0.0003 -0.1084 -0.0009 517 ARG A N   
2299 C CA  . ARG A 329 ? 0.4752 0.5632 0.4345 -0.0083 -0.1101 -0.0059 517 ARG A CA  
2300 C C   . ARG A 329 ? 0.4395 0.5165 0.3936 -0.0080 -0.0986 -0.0157 517 ARG A C   
2301 O O   . ARG A 329 ? 0.4611 0.5325 0.4016 -0.0162 -0.0971 -0.0220 517 ARG A O   
2302 C CB  . ARG A 329 ? 0.5321 0.6367 0.5164 -0.0068 -0.1173 -0.0010 517 ARG A CB  
2303 C CG  . ARG A 329 ? 0.6162 0.7334 0.6025 -0.0122 -0.1317 0.0080  517 ARG A CG  
2304 C CD  . ARG A 329 ? 0.6683 0.7974 0.6812 -0.0033 -0.1384 0.0177  517 ARG A CD  
2305 N NE  . ARG A 329 ? 0.7613 0.9067 0.7994 -0.0027 -0.1416 0.0180  517 ARG A NE  
2306 C CZ  . ARG A 329 ? 0.8030 0.9628 0.8672 0.0032  -0.1497 0.0263  517 ARG A CZ  
2307 N NH1 . ARG A 329 ? 0.8226 0.9806 0.8904 0.0088  -0.1561 0.0356  517 ARG A NH1 
2308 N NH2 . ARG A 329 ? 0.8112 0.9873 0.8992 0.0034  -0.1514 0.0255  517 ARG A NH2 
2309 N N   . LEU A 330 ? 0.4510 0.5244 0.4155 0.0009  -0.0907 -0.0169 518 LEU A N   
2310 C CA  . LEU A 330 ? 0.4243 0.4869 0.3836 0.0014  -0.0807 -0.0244 518 LEU A CA  
2311 C C   . LEU A 330 ? 0.4562 0.5045 0.3939 -0.0011 -0.0758 -0.0293 518 LEU A C   
2312 O O   . LEU A 330 ? 0.4825 0.5219 0.4110 -0.0059 -0.0714 -0.0360 518 LEU A O   
2313 C CB  . LEU A 330 ? 0.3313 0.3937 0.3037 0.0109  -0.0741 -0.0239 518 LEU A CB  
2314 C CG  . LEU A 330 ? 0.3639 0.4394 0.3574 0.0127  -0.0752 -0.0224 518 LEU A CG  
2315 C CD1 . LEU A 330 ? 0.3356 0.4122 0.3409 0.0219  -0.0695 -0.0221 518 LEU A CD1 
2316 C CD2 . LEU A 330 ? 0.3355 0.4105 0.3284 0.0060  -0.0721 -0.0267 518 LEU A CD2 
2317 N N   . GLU A 331 ? 0.3831 0.4293 0.3138 0.0019  -0.0763 -0.0262 519 GLU A N   
2318 C CA  . GLU A 331 ? 0.4777 0.5128 0.3896 0.0000  -0.0708 -0.0309 519 GLU A CA  
2319 C C   . GLU A 331 ? 0.5389 0.5719 0.4340 -0.0107 -0.0736 -0.0356 519 GLU A C   
2320 O O   . GLU A 331 ? 0.5687 0.5908 0.4517 -0.0133 -0.0667 -0.0439 519 GLU A O   
2321 C CB  . GLU A 331 ? 0.5087 0.5446 0.4172 0.0037  -0.0717 -0.0253 519 GLU A CB  
2322 C CG  . GLU A 331 ? 0.6587 0.6849 0.5510 0.0031  -0.0640 -0.0304 519 GLU A CG  
2323 C CD  . GLU A 331 ? 0.7819 0.8094 0.6727 0.0064  -0.0641 -0.0244 519 GLU A CD  
2324 O OE1 . GLU A 331 ? 0.8177 0.8523 0.7123 0.0054  -0.0724 -0.0159 519 GLU A OE1 
2325 O OE2 . GLU A 331 ? 0.8377 0.8591 0.7247 0.0099  -0.0561 -0.0277 519 GLU A OE2 
2326 N N   . LYS A 332 ? 0.5250 0.5686 0.4200 -0.0170 -0.0839 -0.0308 520 LYS A N   
2327 C CA  . LYS A 332 ? 0.5967 0.6398 0.4755 -0.0288 -0.0877 -0.0357 520 LYS A CA  
2328 C C   . LYS A 332 ? 0.6471 0.6849 0.5293 -0.0326 -0.0843 -0.0436 520 LYS A C   
2329 O O   . LYS A 332 ? 0.7065 0.7345 0.5733 -0.0398 -0.0806 -0.0526 520 LYS A O   
2330 C CB  . LYS A 332 ? 0.6197 0.6774 0.4999 -0.0349 -0.1013 -0.0273 520 LYS A CB  
2331 C CG  . LYS A 332 ? 0.7052 0.7661 0.5758 -0.0347 -0.1058 -0.0194 520 LYS A CG  
2332 C CD  . LYS A 332 ? 0.8032 0.8787 0.6758 -0.0411 -0.1207 -0.0096 520 LYS A CD  
2333 C CE  . LYS A 332 ? 0.8367 0.9239 0.7386 -0.0341 -0.1270 -0.0021 520 LYS A CE  
2334 N NZ  . LYS A 332 ? 0.8597 0.9627 0.7673 -0.0400 -0.1423 0.0077  520 LYS A NZ  
2335 N N   . LEU A 333 ? 0.6192 0.6628 0.5215 -0.0281 -0.0847 -0.0404 521 LEU A N   
2336 C CA  . LEU A 333 ? 0.6107 0.6501 0.5183 -0.0321 -0.0815 -0.0460 521 LEU A CA  
2337 C C   . LEU A 333 ? 0.6304 0.6517 0.5301 -0.0292 -0.0704 -0.0536 521 LEU A C   
2338 O O   . LEU A 333 ? 0.6284 0.6409 0.5255 -0.0347 -0.0674 -0.0598 521 LEU A O   
2339 C CB  . LEU A 333 ? 0.5870 0.6375 0.5178 -0.0273 -0.0827 -0.0407 521 LEU A CB  
2340 C CG  . LEU A 333 ? 0.6160 0.6827 0.5590 -0.0342 -0.0920 -0.0372 521 LEU A CG  
2341 C CD1 . LEU A 333 ? 0.5772 0.6536 0.5431 -0.0289 -0.0894 -0.0341 521 LEU A CD1 
2342 C CD2 . LEU A 333 ? 0.5975 0.6594 0.5292 -0.0470 -0.0941 -0.0440 521 LEU A CD2 
2343 N N   . GLN A 334 ? 0.6537 0.6694 0.5508 -0.0207 -0.0646 -0.0528 522 GLN A N   
2344 C CA  . GLN A 334 ? 0.6966 0.6967 0.5889 -0.0166 -0.0546 -0.0589 522 GLN A CA  
2345 C C   . GLN A 334 ? 0.7581 0.7458 0.6332 -0.0242 -0.0513 -0.0690 522 GLN A C   
2346 O O   . GLN A 334 ? 0.7417 0.7151 0.6148 -0.0217 -0.0434 -0.0750 522 GLN A O   
2347 C CB  . GLN A 334 ? 0.6650 0.6642 0.5583 -0.0069 -0.0500 -0.0559 522 GLN A CB  
2348 C CG  . GLN A 334 ? 0.6554 0.6440 0.5538 0.0003  -0.0416 -0.0580 522 GLN A CG  
2349 C CD  . GLN A 334 ? 0.6731 0.6639 0.5752 0.0093  -0.0384 -0.0542 522 GLN A CD  
2350 O OE1 . GLN A 334 ? 0.6925 0.6881 0.5888 0.0094  -0.0402 -0.0523 522 GLN A OE1 
2351 N NE2 . GLN A 334 ? 0.6717 0.6592 0.5829 0.0160  -0.0342 -0.0525 522 GLN A NE2 
2352 N N   . ALA A 335 ? 0.8125 0.8056 0.6754 -0.0335 -0.0575 -0.0708 523 ALA A N   
2353 C CA  . ALA A 335 ? 0.8402 0.8225 0.6849 -0.0423 -0.0546 -0.0818 523 ALA A CA  
2354 C C   . ALA A 335 ? 0.9155 0.8882 0.7623 -0.0493 -0.0538 -0.0885 523 ALA A C   
2355 O O   . ALA A 335 ? 0.9275 0.8858 0.7625 -0.0543 -0.0483 -0.0995 523 ALA A O   
2356 C CB  . ALA A 335 ? 0.8145 0.8070 0.6440 -0.0517 -0.0626 -0.0809 523 ALA A CB  
2357 N N   . VAL A 336 ? 0.8481 0.8286 0.7105 -0.0500 -0.0588 -0.0824 524 VAL A N   
2358 C CA  . VAL A 336 ? 0.9148 0.8879 0.7804 -0.0581 -0.0590 -0.0872 524 VAL A CA  
2359 C C   . VAL A 336 ? 0.9854 0.9382 0.8534 -0.0531 -0.0488 -0.0923 524 VAL A C   
2360 O O   . VAL A 336 ? 0.9928 0.9327 0.8587 -0.0602 -0.0468 -0.0991 524 VAL A O   
2361 C CB  . VAL A 336 ? 0.8903 0.8788 0.7741 -0.0595 -0.0656 -0.0787 524 VAL A CB  
2362 C CG1 . VAL A 336 ? 0.8552 0.8447 0.7546 -0.0480 -0.0605 -0.0717 524 VAL A CG1 
2363 C CG2 . VAL A 336 ? 0.9008 0.8845 0.7860 -0.0713 -0.0675 -0.0836 524 VAL A CG2 
2364 N N   . VAL A 337 ? 0.9814 0.9314 0.8545 -0.0410 -0.0428 -0.0887 525 VAL A N   
2365 C CA  . VAL A 337 ? 1.0161 0.9487 0.8936 -0.0348 -0.0343 -0.0913 525 VAL A CA  
2366 C C   . VAL A 337 ? 1.0428 0.9643 0.9100 -0.0301 -0.0269 -0.0990 525 VAL A C   
2367 O O   . VAL A 337 ? 1.0915 0.9959 0.9529 -0.0330 -0.0214 -0.1088 525 VAL A O   
2368 C CB  . VAL A 337 ? 1.0047 0.9429 0.8972 -0.0249 -0.0330 -0.0811 525 VAL A CB  
2369 C CG1 . VAL A 337 ? 1.0244 0.9452 0.9211 -0.0185 -0.0255 -0.0824 525 VAL A CG1 
2370 C CG2 . VAL A 337 ? 0.9814 0.9312 0.8849 -0.0297 -0.0385 -0.0746 525 VAL A CG2 
2371 N N   . ALA A 338 ? 1.0682 0.9993 0.9344 -0.0229 -0.0262 -0.0950 526 ALA A N   
2372 C CA  . ALA A 338 ? 1.0542 0.9788 0.9121 -0.0183 -0.0187 -0.1015 526 ALA A CA  
2373 C C   . ALA A 338 ? 1.0616 0.9806 0.9013 -0.0282 -0.0173 -0.1133 526 ALA A C   
2374 O O   . ALA A 338 ? 1.0598 0.9836 0.8918 -0.0390 -0.0242 -0.1148 526 ALA A O   
2375 C CB  . ALA A 338 ? 1.0227 0.9612 0.8819 -0.0116 -0.0198 -0.0941 526 ALA A CB  
2376 N N   . ARG B 6   ? 0.8613 0.7573 1.0082 0.0736  -0.0086 -0.1556 194 ARG B N   
2377 C CA  . ARG B 6   ? 0.8591 0.7642 0.9823 0.0634  -0.0115 -0.1519 194 ARG B CA  
2378 C C   . ARG B 6   ? 0.8117 0.7262 0.9276 0.0639  -0.0183 -0.1324 194 ARG B C   
2379 O O   . ARG B 6   ? 0.7785 0.6847 0.9055 0.0674  -0.0238 -0.1195 194 ARG B O   
2380 C CB  . ARG B 6   ? 0.8857 0.7761 1.0077 0.0549  -0.0142 -0.1557 194 ARG B CB  
2381 C CG  . ARG B 6   ? 0.8972 0.7987 0.9972 0.0441  -0.0167 -0.1547 194 ARG B CG  
2382 C CD  . ARG B 6   ? 0.9198 0.8110 1.0212 0.0372  -0.0233 -0.1453 194 ARG B CD  
2383 N NE  . ARG B 6   ? 0.9235 0.8269 1.0072 0.0271  -0.0258 -0.1446 194 ARG B NE  
2384 C CZ  . ARG B 6   ? 0.9406 0.8410 1.0186 0.0177  -0.0255 -0.1562 194 ARG B CZ  
2385 N NH1 . ARG B 6   ? 0.9372 0.8512 1.0009 0.0091  -0.0289 -0.1537 194 ARG B NH1 
2386 N NH2 . ARG B 6   ? 0.9625 0.8462 1.0501 0.0169  -0.0219 -0.1706 194 ARG B NH2 
2387 N N   . PRO B 7   ? 0.8104 0.7421 0.9073 0.0600  -0.0179 -0.1303 195 PRO B N   
2388 C CA  . PRO B 7   ? 0.7850 0.7261 0.8737 0.0602  -0.0231 -0.1140 195 PRO B CA  
2389 C C   . PRO B 7   ? 0.7123 0.6475 0.7975 0.0542  -0.0291 -0.1034 195 PRO B C   
2390 O O   . PRO B 7   ? 0.7169 0.6496 0.7963 0.0467  -0.0295 -0.1085 195 PRO B O   
2391 C CB  . PRO B 7   ? 0.7867 0.7453 0.8572 0.0569  -0.0202 -0.1176 195 PRO B CB  
2392 C CG  . PRO B 7   ? 0.7977 0.7578 0.8688 0.0572  -0.0129 -0.1343 195 PRO B CG  
2393 C CD  . PRO B 7   ? 0.8111 0.7544 0.8939 0.0559  -0.0121 -0.1434 195 PRO B CD  
2394 N N   . PHE B 8   ? 0.6322 0.5664 0.7206 0.0569  -0.0338 -0.0887 196 PHE B N   
2395 C CA  . PHE B 8   ? 0.5800 0.5117 0.6636 0.0511  -0.0386 -0.0771 196 PHE B CA  
2396 C C   . PHE B 8   ? 0.5391 0.4840 0.6119 0.0521  -0.0403 -0.0661 196 PHE B C   
2397 O O   . PHE B 8   ? 0.5860 0.5364 0.6601 0.0580  -0.0397 -0.0641 196 PHE B O   
2398 C CB  . PHE B 8   ? 0.5833 0.4979 0.6812 0.0519  -0.0427 -0.0695 196 PHE B CB  
2399 C CG  . PHE B 8   ? 0.6311 0.5300 0.7389 0.0488  -0.0416 -0.0792 196 PHE B CG  
2400 C CD1 . PHE B 8   ? 0.6293 0.5194 0.7505 0.0547  -0.0380 -0.0909 196 PHE B CD1 
2401 C CD2 . PHE B 8   ? 0.6303 0.5230 0.7351 0.0396  -0.0437 -0.0771 196 PHE B CD2 
2402 C CE1 . PHE B 8   ? 0.6317 0.5056 0.7622 0.0516  -0.0365 -0.1013 196 PHE B CE1 
2403 C CE2 . PHE B 8   ? 0.6352 0.5121 0.7491 0.0358  -0.0429 -0.0866 196 PHE B CE2 
2404 C CZ  . PHE B 8   ? 0.6356 0.5022 0.7619 0.0418  -0.0392 -0.0991 196 PHE B CZ  
2405 N N   . PRO B 9   ? 0.5234 0.4737 0.5866 0.0460  -0.0420 -0.0596 197 PRO B N   
2406 C CA  . PRO B 9   ? 0.4614 0.4234 0.5147 0.0468  -0.0427 -0.0506 197 PRO B CA  
2407 C C   . PRO B 9   ? 0.4439 0.4014 0.5010 0.0501  -0.0460 -0.0393 197 PRO B C   
2408 O O   . PRO B 9   ? 0.4366 0.3818 0.5037 0.0501  -0.0490 -0.0348 197 PRO B O   
2409 C CB  . PRO B 9   ? 0.4138 0.3809 0.4601 0.0396  -0.0432 -0.0471 197 PRO B CB  
2410 C CG  . PRO B 9   ? 0.5032 0.4586 0.5575 0.0344  -0.0445 -0.0500 197 PRO B CG  
2411 C CD  . PRO B 9   ? 0.5370 0.4842 0.5988 0.0379  -0.0428 -0.0615 197 PRO B CD  
2412 N N   . PHE B 10  ? 0.3580 0.3252 0.4071 0.0524  -0.0458 -0.0345 198 PHE B N   
2413 C CA  . PHE B 10  ? 0.3867 0.3523 0.4371 0.0549  -0.0494 -0.0244 198 PHE B CA  
2414 C C   . PHE B 10  ? 0.4254 0.3865 0.4722 0.0493  -0.0525 -0.0132 198 PHE B C   
2415 O O   . PHE B 10  ? 0.3846 0.3521 0.4219 0.0443  -0.0504 -0.0114 198 PHE B O   
2416 C CB  . PHE B 10  ? 0.3415 0.3189 0.3825 0.0572  -0.0480 -0.0239 198 PHE B CB  
2417 C CG  . PHE B 10  ? 0.3695 0.3470 0.4120 0.0599  -0.0519 -0.0160 198 PHE B CG  
2418 C CD1 . PHE B 10  ? 0.4232 0.4008 0.4576 0.0560  -0.0549 -0.0056 198 PHE B CD1 
2419 C CD2 . PHE B 10  ? 0.4473 0.4263 0.4989 0.0656  -0.0526 -0.0190 198 PHE B CD2 
2420 C CE1 . PHE B 10  ? 0.4511 0.4299 0.4852 0.0573  -0.0595 0.0019  198 PHE B CE1 
2421 C CE2 . PHE B 10  ? 0.4872 0.4682 0.5412 0.0675  -0.0574 -0.0112 198 PHE B CE2 
2422 C CZ  . PHE B 10  ? 0.4681 0.4487 0.5126 0.0631  -0.0613 -0.0006 198 PHE B CZ  
2423 N N   . CYS B 11  ? 0.4086 0.3596 0.4638 0.0500  -0.0572 -0.0053 199 CYS B N   
2424 C CA  . CYS B 11  ? 0.4447 0.3908 0.4957 0.0437  -0.0604 0.0067  199 CYS B CA  
2425 C C   . CYS B 11  ? 0.4901 0.4403 0.5335 0.0436  -0.0643 0.0178  199 CYS B C   
2426 O O   . CYS B 11  ? 0.5014 0.4474 0.5531 0.0480  -0.0693 0.0225  199 CYS B O   
2427 C CB  . CYS B 11  ? 0.4554 0.3851 0.5202 0.0426  -0.0639 0.0098  199 CYS B CB  
2428 S SG  . CYS B 11  ? 0.5256 0.4477 0.5859 0.0338  -0.0683 0.0267  199 CYS B SG  
2429 N N   . TRP B 12  ? 0.4898 0.4488 0.5180 0.0384  -0.0619 0.0216  200 TRP B N   
2430 C CA  . TRP B 12  ? 0.4779 0.4416 0.4954 0.0364  -0.0650 0.0310  200 TRP B CA  
2431 C C   . TRP B 12  ? 0.5109 0.4667 0.5268 0.0303  -0.0701 0.0449  200 TRP B C   
2432 O O   . TRP B 12  ? 0.5357 0.4888 0.5492 0.0238  -0.0678 0.0477  200 TRP B O   
2433 C CB  . TRP B 12  ? 0.3932 0.3691 0.3949 0.0332  -0.0593 0.0281  200 TRP B CB  
2434 C CG  . TRP B 12  ? 0.3838 0.3676 0.3840 0.0387  -0.0557 0.0179  200 TRP B CG  
2435 C CD1 . TRP B 12  ? 0.3363 0.3242 0.3387 0.0407  -0.0506 0.0082  200 TRP B CD1 
2436 C CD2 . TRP B 12  ? 0.3982 0.3870 0.3940 0.0419  -0.0573 0.0172  200 TRP B CD2 
2437 N NE1 . TRP B 12  ? 0.3186 0.3127 0.3180 0.0450  -0.0488 0.0023  200 TRP B NE1 
2438 C CE2 . TRP B 12  ? 0.3783 0.3729 0.3740 0.0457  -0.0525 0.0072  200 TRP B CE2 
2439 C CE3 . TRP B 12  ? 0.3850 0.3742 0.3769 0.0412  -0.0628 0.0246  200 TRP B CE3 
2440 C CZ2 . TRP B 12  ? 0.3897 0.3895 0.3821 0.0487  -0.0525 0.0042  200 TRP B CZ2 
2441 C CZ3 . TRP B 12  ? 0.3900 0.3854 0.3788 0.0440  -0.0631 0.0208  200 TRP B CZ3 
2442 C CH2 . TRP B 12  ? 0.4168 0.4169 0.4061 0.0476  -0.0577 0.0106  200 TRP B CH2 
2443 N N   . PRO B 13  ? 0.4787 0.4317 0.4961 0.0316  -0.0775 0.0544  201 PRO B N   
2444 C CA  . PRO B 13  ? 0.4990 0.4460 0.5110 0.0245  -0.0831 0.0697  201 PRO B CA  
2445 C C   . PRO B 13  ? 0.5648 0.5217 0.5550 0.0157  -0.0788 0.0733  201 PRO B C   
2446 O O   . PRO B 13  ? 0.5592 0.5271 0.5381 0.0165  -0.0754 0.0677  201 PRO B O   
2447 C CB  . PRO B 13  ? 0.5145 0.4597 0.5327 0.0289  -0.0925 0.0781  201 PRO B CB  
2448 C CG  . PRO B 13  ? 0.5303 0.4854 0.5498 0.0358  -0.0901 0.0672  201 PRO B CG  
2449 C CD  . PRO B 13  ? 0.4945 0.4504 0.5191 0.0392  -0.0815 0.0524  201 PRO B CD  
2450 N N   . LEU B 14  ? 0.5432 0.4961 0.5280 0.0071  -0.0783 0.0822  202 LEU B N   
2451 C CA  . LEU B 14  ? 0.5659 0.5289 0.5315 -0.0019 -0.0723 0.0844  202 LEU B CA  
2452 C C   . LEU B 14  ? 0.6402 0.6108 0.5883 -0.0049 -0.0753 0.0901  202 LEU B C   
2453 O O   . LEU B 14  ? 0.6251 0.6068 0.5574 -0.0091 -0.0684 0.0856  202 LEU B O   
2454 C CB  . LEU B 14  ? 0.5347 0.4915 0.4988 -0.0116 -0.0721 0.0949  202 LEU B CB  
2455 C CG  . LEU B 14  ? 0.5780 0.5461 0.5234 -0.0221 -0.0647 0.0976  202 LEU B CG  
2456 C CD1 . LEU B 14  ? 0.5194 0.5001 0.4635 -0.0193 -0.0542 0.0824  202 LEU B CD1 
2457 C CD2 . LEU B 14  ? 0.6315 0.5930 0.5781 -0.0320 -0.0646 0.1084  202 LEU B CD2 
2458 N N   . CYS B 15  ? 0.5996 0.5647 0.5515 -0.0027 -0.0856 0.0996  203 CYS B N   
2459 C CA  . CYS B 15  ? 0.6061 0.5786 0.5414 -0.0067 -0.0903 0.1060  203 CYS B CA  
2460 C C   . CYS B 15  ? 0.5713 0.5544 0.5006 -0.0021 -0.0855 0.0925  203 CYS B C   
2461 O O   . CYS B 15  ? 0.5764 0.5683 0.4862 -0.0080 -0.0830 0.0917  203 CYS B O   
2462 C CB  . CYS B 15  ? 0.6322 0.5975 0.5768 -0.0044 -0.1038 0.1195  203 CYS B CB  
2463 S SG  . CYS B 15  ? 0.6780 0.6402 0.6490 0.0102  -0.1088 0.1117  203 CYS B SG  
2464 N N   . GLU B 16  ? 0.5561 0.5379 0.5016 0.0077  -0.0838 0.0816  204 GLU B N   
2465 C CA  . GLU B 16  ? 0.4989 0.4893 0.4404 0.0120  -0.0795 0.0696  204 GLU B CA  
2466 C C   . GLU B 16  ? 0.4798 0.4769 0.4097 0.0090  -0.0682 0.0599  204 GLU B C   
2467 O O   . GLU B 16  ? 0.4609 0.4653 0.3791 0.0081  -0.0646 0.0537  204 GLU B O   
2468 C CB  . GLU B 16  ? 0.5046 0.4924 0.4660 0.0224  -0.0801 0.0611  204 GLU B CB  
2469 C CG  . GLU B 16  ? 0.5655 0.5512 0.5393 0.0271  -0.0902 0.0673  204 GLU B CG  
2470 C CD  . GLU B 16  ? 0.5938 0.5807 0.5840 0.0366  -0.0884 0.0565  204 GLU B CD  
2471 O OE1 . GLU B 16  ? 0.6201 0.5997 0.6290 0.0423  -0.0903 0.0562  204 GLU B OE1 
2472 O OE2 . GLU B 16  ? 0.5455 0.5402 0.5298 0.0379  -0.0848 0.0483  204 GLU B OE2 
2473 N N   . ILE B 17  ? 0.4425 0.4374 0.3775 0.0077  -0.0628 0.0585  205 ILE B N   
2474 C CA  . ILE B 17  ? 0.4664 0.4690 0.3942 0.0054  -0.0523 0.0502  205 ILE B CA  
2475 C C   . ILE B 17  ? 0.5242 0.5330 0.4320 -0.0042 -0.0488 0.0551  205 ILE B C   
2476 O O   . ILE B 17  ? 0.5137 0.5304 0.4113 -0.0053 -0.0412 0.0471  205 ILE B O   
2477 C CB  . ILE B 17  ? 0.4917 0.4919 0.4316 0.0056  -0.0483 0.0480  205 ILE B CB  
2478 C CG1 . ILE B 17  ? 0.5410 0.5362 0.4981 0.0144  -0.0505 0.0409  205 ILE B CG1 
2479 C CG2 . ILE B 17  ? 0.4619 0.4722 0.3964 0.0032  -0.0380 0.0409  205 ILE B CG2 
2480 C CD1 . ILE B 17  ? 0.6241 0.6176 0.5920 0.0141  -0.0471 0.0371  205 ILE B CD1 
2481 N N   . SER B 18  ? 0.5300 0.5346 0.4323 -0.0114 -0.0543 0.0683  206 SER B N   
2482 C CA  . SER B 18  ? 0.6094 0.6200 0.4904 -0.0221 -0.0517 0.0745  206 SER B CA  
2483 C C   . SER B 18  ? 0.5626 0.5786 0.4284 -0.0229 -0.0534 0.0710  206 SER B C   
2484 O O   . SER B 18  ? 0.5630 0.5871 0.4134 -0.0273 -0.0451 0.0642  206 SER B O   
2485 C CB  . SER B 18  ? 0.6713 0.6750 0.5496 -0.0297 -0.0597 0.0915  206 SER B CB  
2486 O OG  . SER B 18  ? 0.7784 0.7889 0.6339 -0.0414 -0.0567 0.0980  206 SER B OG  
2487 N N   . ARG B 19  ? 0.5068 0.5184 0.3783 -0.0185 -0.0639 0.0750  207 ARG B N   
2488 C CA  . ARG B 19  ? 0.5422 0.5588 0.4017 -0.0193 -0.0671 0.0718  207 ARG B CA  
2489 C C   . ARG B 19  ? 0.4965 0.5178 0.3555 -0.0143 -0.0579 0.0554  207 ARG B C   
2490 O O   . ARG B 19  ? 0.5191 0.5457 0.3612 -0.0189 -0.0544 0.0498  207 ARG B O   
2491 C CB  . ARG B 19  ? 0.6613 0.6736 0.5334 -0.0139 -0.0798 0.0785  207 ARG B CB  
2492 C CG  . ARG B 19  ? 0.8013 0.8197 0.6622 -0.0161 -0.0853 0.0771  207 ARG B CG  
2493 C CD  . ARG B 19  ? 0.9523 0.9687 0.8333 -0.0073 -0.0943 0.0779  207 ARG B CD  
2494 N NE  . ARG B 19  ? 1.0861 1.0950 0.9855 -0.0032 -0.1018 0.0890  207 ARG B NE  
2495 C CZ  . ARG B 19  ? 1.1671 1.1728 1.0898 0.0064  -0.1067 0.0881  207 ARG B CZ  
2496 N NH1 . ARG B 19  ? 1.1742 1.1847 1.1038 0.0123  -0.1049 0.0776  207 ARG B NH1 
2497 N NH2 . ARG B 19  ? 1.2069 1.2042 1.1464 0.0100  -0.1127 0.0975  207 ARG B NH2 
2498 N N   . GLY B 20  ? 0.4848 0.5033 0.3619 -0.0053 -0.0543 0.0478  208 GLY B N   
2499 C CA  . GLY B 20  ? 0.4586 0.4801 0.3378 0.0003  -0.0471 0.0340  208 GLY B CA  
2500 C C   . GLY B 20  ? 0.4987 0.5256 0.3691 -0.0026 -0.0351 0.0263  208 GLY B C   
2501 O O   . GLY B 20  ? 0.4980 0.5273 0.3660 0.0003  -0.0291 0.0157  208 GLY B O   
2502 N N   . THR B 21  ? 0.4891 0.5181 0.3570 -0.0081 -0.0314 0.0316  209 THR B N   
2503 C CA  . THR B 21  ? 0.5206 0.5569 0.3814 -0.0116 -0.0194 0.0251  209 THR B CA  
2504 C C   . THR B 21  ? 0.5877 0.6292 0.4253 -0.0227 -0.0163 0.0282  209 THR B C   
2505 O O   . THR B 21  ? 0.5885 0.6372 0.4195 -0.0267 -0.0054 0.0231  209 THR B O   
2506 C CB  . THR B 21  ? 0.5009 0.5390 0.3746 -0.0115 -0.0152 0.0274  209 THR B CB  
2507 O OG1 . THR B 21  ? 0.5334 0.5671 0.4061 -0.0176 -0.0220 0.0407  209 THR B OG1 
2508 C CG2 . THR B 21  ? 0.4984 0.5335 0.3925 -0.0014 -0.0164 0.0218  209 THR B CG2 
2509 N N   . HIS B 22  ? 0.5630 0.6017 0.3886 -0.0278 -0.0259 0.0366  210 HIS B N   
2510 C CA  . HIS B 22  ? 0.6114 0.6548 0.4125 -0.0401 -0.0251 0.0421  210 HIS B CA  
2511 C C   . HIS B 22  ? 0.6413 0.6878 0.4405 -0.0473 -0.0204 0.0503  210 HIS B C   
2512 O O   . HIS B 22  ? 0.6188 0.6736 0.4040 -0.0548 -0.0099 0.0465  210 HIS B O   
2513 C CB  . HIS B 22  ? 0.6423 0.6918 0.4271 -0.0431 -0.0151 0.0285  210 HIS B CB  
2514 C CG  . HIS B 22  ? 0.7680 0.8143 0.5496 -0.0399 -0.0207 0.0223  210 HIS B CG  
2515 N ND1 . HIS B 22  ? 0.8508 0.8950 0.6430 -0.0310 -0.0156 0.0091  210 HIS B ND1 
2516 C CD2 . HIS B 22  ? 0.8515 0.8968 0.6212 -0.0450 -0.0316 0.0283  210 HIS B CD2 
2517 C CE1 . HIS B 22  ? 0.8519 0.8934 0.6386 -0.0312 -0.0224 0.0067  210 HIS B CE1 
2518 N NE2 . HIS B 22  ? 0.8598 0.9027 0.6332 -0.0395 -0.0323 0.0179  210 HIS B NE2 
2519 N N   . ASN B 23  ? 0.6519 0.6917 0.4663 -0.0450 -0.0279 0.0610  211 ASN B N   
2520 C CA  . ASN B 23  ? 0.6862 0.7267 0.5028 -0.0516 -0.0251 0.0700  211 ASN B CA  
2521 C C   . ASN B 23  ? 0.6609 0.7101 0.4836 -0.0509 -0.0107 0.0596  211 ASN B C   
2522 O O   . ASN B 23  ? 0.6943 0.7513 0.5063 -0.0604 -0.0027 0.0622  211 ASN B O   
2523 C CB  . ASN B 23  ? 0.8128 0.8559 0.6060 -0.0654 -0.0279 0.0829  211 ASN B CB  
2524 C CG  . ASN B 23  ? 0.9696 1.0050 0.7587 -0.0663 -0.0438 0.0956  211 ASN B CG  
2525 O OD1 . ASN B 23  ? 1.0243 1.0502 0.8277 -0.0638 -0.0534 0.1071  211 ASN B OD1 
2526 N ND2 . ASN B 23  ? 1.0200 1.0596 0.7909 -0.0698 -0.0467 0.0932  211 ASN B ND2 
2527 N N   . PHE B 24  ? 0.6290 0.6778 0.4698 -0.0398 -0.0078 0.0484  212 PHE B N   
2528 C CA  . PHE B 24  ? 0.6112 0.6688 0.4624 -0.0369 0.0042  0.0384  212 PHE B CA  
2529 C C   . PHE B 24  ? 0.6460 0.7151 0.4812 -0.0430 0.0166  0.0310  212 PHE B C   
2530 O O   . PHE B 24  ? 0.6601 0.7390 0.4972 -0.0477 0.0265  0.0299  212 PHE B O   
2531 C CB  . PHE B 24  ? 0.5838 0.6420 0.4482 -0.0402 0.0047  0.0456  212 PHE B CB  
2532 C CG  . PHE B 24  ? 0.6213 0.6679 0.5031 -0.0340 -0.0058 0.0501  212 PHE B CG  
2533 C CD1 . PHE B 24  ? 0.6223 0.6686 0.5222 -0.0239 -0.0053 0.0409  212 PHE B CD1 
2534 C CD2 . PHE B 24  ? 0.6817 0.7177 0.5617 -0.0382 -0.0161 0.0633  212 PHE B CD2 
2535 C CE1 . PHE B 24  ? 0.6245 0.6605 0.5388 -0.0188 -0.0139 0.0435  212 PHE B CE1 
2536 C CE2 . PHE B 24  ? 0.6956 0.7205 0.5927 -0.0320 -0.0246 0.0658  212 PHE B CE2 
2537 C CZ  . PHE B 24  ? 0.6546 0.6798 0.5681 -0.0225 -0.0230 0.0551  212 PHE B CZ  
2538 N N   . SER B 25  ? 0.6273 0.6953 0.4470 -0.0431 0.0164  0.0254  213 SER B N   
2539 C CA  . SER B 25  ? 0.6428 0.7200 0.4469 -0.0479 0.0288  0.0152  213 SER B CA  
2540 C C   . SER B 25  ? 0.6315 0.7161 0.4526 -0.0399 0.0410  0.0022  213 SER B C   
2541 O O   . SER B 25  ? 0.5466 0.6268 0.3855 -0.0287 0.0383  -0.0033 213 SER B O   
2542 C CB  . SER B 25  ? 0.6942 0.7669 0.4819 -0.0482 0.0251  0.0095  213 SER B CB  
2543 O OG  . SER B 25  ? 0.7665 0.8464 0.5423 -0.0508 0.0384  -0.0039 213 SER B OG  
2544 N N   . GLU B 26  ? 0.6328 0.7296 0.4488 -0.0460 0.0543  -0.0024 214 GLU B N   
2545 C CA  . GLU B 26  ? 0.6705 0.7765 0.5036 -0.0386 0.0668  -0.0148 214 GLU B CA  
2546 C C   . GLU B 26  ? 0.6387 0.7398 0.4727 -0.0296 0.0695  -0.0285 214 GLU B C   
2547 O O   . GLU B 26  ? 0.6355 0.7394 0.4891 -0.0196 0.0750  -0.0372 214 GLU B O   
2548 C CB  . GLU B 26  ? 0.7084 0.8296 0.5337 -0.0478 0.0817  -0.0179 214 GLU B CB  
2549 C CG  . GLU B 26  ? 0.7686 0.8950 0.5912 -0.0588 0.0801  -0.0036 214 GLU B CG  
2550 C CD  . GLU B 26  ? 0.8168 0.9490 0.6673 -0.0540 0.0806  -0.0009 214 GLU B CD  
2551 O OE1 . GLU B 26  ? 0.8258 0.9653 0.6957 -0.0446 0.0879  -0.0116 214 GLU B OE1 
2552 O OE2 . GLU B 26  ? 0.8553 0.9844 0.7088 -0.0598 0.0733  0.0121  214 GLU B OE2 
2553 N N   . GLU B 27  ? 0.5878 0.6812 0.4010 -0.0336 0.0648  -0.0297 215 GLU B N   
2554 C CA  . GLU B 27  ? 0.6255 0.7125 0.4373 -0.0270 0.0668  -0.0425 215 GLU B CA  
2555 C C   . GLU B 27  ? 0.6112 0.6879 0.4407 -0.0156 0.0564  -0.0413 215 GLU B C   
2556 O O   . GLU B 27  ? 0.6337 0.7055 0.4697 -0.0079 0.0590  -0.0515 215 GLU B O   
2557 C CB  . GLU B 27  ? 0.7067 0.7897 0.4897 -0.0367 0.0643  -0.0439 215 GLU B CB  
2558 C CG  . GLU B 27  ? 0.8216 0.9150 0.5835 -0.0487 0.0761  -0.0473 215 GLU B CG  
2559 C CD  . GLU B 27  ? 0.9363 1.0282 0.6691 -0.0622 0.0679  -0.0383 215 GLU B CD  
2560 O OE1 . GLU B 27  ? 0.9631 1.0473 0.6839 -0.0632 0.0608  -0.0414 215 GLU B OE1 
2561 O OE2 . GLU B 27  ? 1.0019 1.1007 0.7244 -0.0723 0.0680  -0.0273 215 GLU B OE2 
2562 N N   . LEU B 28  ? 0.5974 0.6705 0.4347 -0.0148 0.0450  -0.0291 216 LEU B N   
2563 C CA  . LEU B 28  ? 0.5611 0.6260 0.4149 -0.0048 0.0360  -0.0281 216 LEU B CA  
2564 C C   . LEU B 28  ? 0.5096 0.5793 0.3873 0.0029  0.0389  -0.0287 216 LEU B C   
2565 O O   . LEU B 28  ? 0.4945 0.5591 0.3861 0.0107  0.0322  -0.0277 216 LEU B O   
2566 C CB  . LEU B 28  ? 0.5796 0.6374 0.4300 -0.0075 0.0221  -0.0161 216 LEU B CB  
2567 C CG  . LEU B 28  ? 0.6421 0.6950 0.4723 -0.0137 0.0156  -0.0140 216 LEU B CG  
2568 C CD1 . LEU B 28  ? 0.6785 0.7239 0.5154 -0.0107 0.0017  -0.0052 216 LEU B CD1 
2569 C CD2 . LEU B 28  ? 0.6678 0.7186 0.4904 -0.0119 0.0211  -0.0269 216 LEU B CD2 
2570 N N   . LYS B 29  ? 0.4843 0.5653 0.3666 0.0003  0.0490  -0.0307 217 LYS B N   
2571 C CA  . LYS B 29  ? 0.4969 0.5851 0.4023 0.0063  0.0512  -0.0305 217 LYS B CA  
2572 C C   . LYS B 29  ? 0.4854 0.5741 0.4051 0.0172  0.0560  -0.0408 217 LYS B C   
2573 O O   . LYS B 29  ? 0.4624 0.5543 0.3788 0.0182  0.0661  -0.0503 217 LYS B O   
2574 C CB  . LYS B 29  ? 0.5023 0.6044 0.4095 -0.0007 0.0607  -0.0289 217 LYS B CB  
2575 C CG  . LYS B 29  ? 0.6176 0.7284 0.5483 0.0028  0.0609  -0.0262 217 LYS B CG  
2576 C CD  . LYS B 29  ? 0.7169 0.8445 0.6530 -0.0023 0.0736  -0.0285 217 LYS B CD  
2577 C CE  . LYS B 29  ? 0.8120 0.9418 0.7285 -0.0160 0.0759  -0.0212 217 LYS B CE  
2578 N NZ  . LYS B 29  ? 0.8518 0.9744 0.7680 -0.0215 0.0645  -0.0081 217 LYS B NZ  
2579 N N   . ILE B 30  ? 0.4956 0.5800 0.4303 0.0251  0.0483  -0.0388 218 ILE B N   
2580 C CA  . ILE B 30  ? 0.4297 0.5141 0.3793 0.0354  0.0511  -0.0460 218 ILE B CA  
2581 C C   . ILE B 30  ? 0.4930 0.5897 0.4656 0.0402  0.0537  -0.0452 218 ILE B C   
2582 O O   . ILE B 30  ? 0.5154 0.6140 0.5028 0.0489  0.0560  -0.0499 218 ILE B O   
2583 C CB  . ILE B 30  ? 0.4092 0.4813 0.3590 0.0408  0.0411  -0.0447 218 ILE B CB  
2584 C CG1 . ILE B 30  ? 0.4010 0.4723 0.3576 0.0404  0.0311  -0.0361 218 ILE B CG1 
2585 C CG2 . ILE B 30  ? 0.3501 0.4119 0.2798 0.0363  0.0387  -0.0463 218 ILE B CG2 
2586 C CD1 . ILE B 30  ? 0.3583 0.4189 0.3138 0.0445  0.0220  -0.0348 218 ILE B CD1 
2587 N N   . GLY B 31  ? 0.4988 0.6038 0.4753 0.0342  0.0527  -0.0388 219 GLY B N   
2588 C CA  . GLY B 31  ? 0.4629 0.5816 0.4615 0.0374  0.0549  -0.0380 219 GLY B CA  
2589 C C   . GLY B 31  ? 0.4948 0.6236 0.4952 0.0281  0.0567  -0.0320 219 GLY B C   
2590 O O   . GLY B 31  ? 0.4614 0.5835 0.4471 0.0200  0.0526  -0.0260 219 GLY B O   
2591 N N   . GLU B 32  ? 0.4913 0.6365 0.5107 0.0291  0.0625  -0.0332 220 GLU B N   
2592 C CA  . GLU B 32  ? 0.6183 0.7741 0.6416 0.0196  0.0642  -0.0272 220 GLU B CA  
2593 C C   . GLU B 32  ? 0.6760 0.8486 0.7260 0.0230  0.0648  -0.0272 220 GLU B C   
2594 O O   . GLU B 32  ? 0.6940 0.8743 0.7597 0.0324  0.0684  -0.0328 220 GLU B O   
2595 C CB  . GLU B 32  ? 0.6967 0.8596 0.7075 0.0113  0.0763  -0.0290 220 GLU B CB  
2596 C CG  . GLU B 32  ? 0.7539 0.9249 0.7641 -0.0009 0.0775  -0.0209 220 GLU B CG  
2597 C CD  . GLU B 32  ? 0.8178 0.9915 0.8078 -0.0113 0.0871  -0.0204 220 GLU B CD  
2598 O OE1 . GLU B 32  ? 0.8626 1.0328 0.8390 -0.0090 0.0932  -0.0276 220 GLU B OE1 
2599 O OE2 . GLU B 32  ? 0.8168 0.9958 0.8037 -0.0225 0.0883  -0.0126 220 GLU B OE2 
2600 N N   . GLY B 33  ? 0.7081 0.8862 0.7641 0.0151  0.0609  -0.0206 221 GLY B N   
2601 C CA  . GLY B 33  ? 0.7050 0.9001 0.7858 0.0162  0.0599  -0.0197 221 GLY B CA  
2602 C C   . GLY B 33  ? 0.7058 0.9063 0.7886 0.0039  0.0583  -0.0127 221 GLY B C   
2603 O O   . GLY B 33  ? 0.6400 0.8335 0.7060 -0.0054 0.0607  -0.0086 221 GLY B O   
2604 N N   . GLY B 34  ? 0.7256 0.9385 0.8290 0.0031  0.0539  -0.0110 222 GLY B N   
2605 C CA  . GLY B 34  ? 0.7455 0.9626 0.8528 -0.0090 0.0513  -0.0048 222 GLY B CA  
2606 C C   . GLY B 34  ? 0.7539 0.9492 0.8463 -0.0138 0.0403  0.0001  222 GLY B C   
2607 O O   . GLY B 34  ? 0.7549 0.9457 0.8420 -0.0249 0.0395  0.0060  222 GLY B O   
2608 N N   . PHE B 35  ? 0.6841 0.8656 0.7706 -0.0053 0.0321  -0.0024 223 PHE B N   
2609 C CA  . PHE B 35  ? 0.6819 0.8429 0.7563 -0.0079 0.0221  0.0005  223 PHE B CA  
2610 C C   . PHE B 35  ? 0.5941 0.7396 0.6476 -0.0121 0.0238  0.0045  223 PHE B C   
2611 O O   . PHE B 35  ? 0.5874 0.7197 0.6342 -0.0187 0.0182  0.0098  223 PHE B O   
2612 C CB  . PHE B 35  ? 0.7555 0.9084 0.8292 0.0023  0.0143  -0.0037 223 PHE B CB  
2613 C CG  . PHE B 35  ? 0.7783 0.9273 0.8435 0.0117  0.0184  -0.0075 223 PHE B CG  
2614 C CD1 . PHE B 35  ? 0.7774 0.9403 0.8544 0.0191  0.0240  -0.0116 223 PHE B CD1 
2615 C CD2 . PHE B 35  ? 0.7634 0.8948 0.8102 0.0132  0.0163  -0.0071 223 PHE B CD2 
2616 C CE1 . PHE B 35  ? 0.7703 0.9275 0.8398 0.0272  0.0279  -0.0158 223 PHE B CE1 
2617 C CE2 . PHE B 35  ? 0.7632 0.8908 0.8023 0.0206  0.0197  -0.0111 223 PHE B CE2 
2618 C CZ  . PHE B 35  ? 0.7599 0.8994 0.8097 0.0274  0.0257  -0.0157 223 PHE B CZ  
2619 N N   . GLY B 36  ? 0.6744 0.8213 0.7181 -0.0082 0.0311  0.0020  224 GLY B N   
2620 C CA  . GLY B 36  ? 0.6463 0.7794 0.6687 -0.0115 0.0315  0.0054  224 GLY B CA  
2621 C C   . GLY B 36  ? 0.6013 0.7330 0.6141 -0.0036 0.0361  -0.0006 224 GLY B C   
2622 O O   . GLY B 36  ? 0.5862 0.7298 0.6090 0.0026  0.0426  -0.0071 224 GLY B O   
2623 N N   . CYS B 37  ? 0.5382 0.6551 0.5328 -0.0040 0.0325  0.0015  225 CYS B N   
2624 C CA  . CYS B 37  ? 0.5279 0.6419 0.5113 0.0017  0.0363  -0.0044 225 CYS B CA  
2625 C C   . CYS B 37  ? 0.4825 0.5819 0.4614 0.0088  0.0271  -0.0056 225 CYS B C   
2626 O O   . CYS B 37  ? 0.4622 0.5517 0.4410 0.0075  0.0182  -0.0007 225 CYS B O   
2627 C CB  . CYS B 37  ? 0.5678 0.6807 0.5312 -0.0068 0.0417  -0.0014 225 CYS B CB  
2628 S SG  . CYS B 37  ? 0.7877 0.9164 0.7528 -0.0187 0.0518  0.0029  225 CYS B SG  
2629 N N   . VAL B 38  ? 0.4820 0.5800 0.4579 0.0161  0.0297  -0.0125 226 VAL B N   
2630 C CA  . VAL B 38  ? 0.4442 0.5297 0.4151 0.0220  0.0222  -0.0139 226 VAL B CA  
2631 C C   . VAL B 38  ? 0.4993 0.5787 0.4526 0.0210  0.0247  -0.0164 226 VAL B C   
2632 O O   . VAL B 38  ? 0.5840 0.6690 0.5344 0.0221  0.0336  -0.0228 226 VAL B O   
2633 C CB  . VAL B 38  ? 0.3961 0.4839 0.3807 0.0316  0.0211  -0.0192 226 VAL B CB  
2634 C CG1 . VAL B 38  ? 0.3497 0.4249 0.3289 0.0363  0.0133  -0.0197 226 VAL B CG1 
2635 C CG2 . VAL B 38  ? 0.4664 0.5628 0.4679 0.0316  0.0186  -0.0172 226 VAL B CG2 
2636 N N   . TYR B 39  ? 0.4481 0.5164 0.3908 0.0191  0.0168  -0.0120 227 TYR B N   
2637 C CA  . TYR B 39  ? 0.4176 0.4801 0.3427 0.0167  0.0167  -0.0131 227 TYR B CA  
2638 C C   . TYR B 39  ? 0.4632 0.5169 0.3886 0.0233  0.0106  -0.0163 227 TYR B C   
2639 O O   . TYR B 39  ? 0.5004 0.5507 0.4366 0.0281  0.0046  -0.0150 227 TYR B O   
2640 C CB  . TYR B 39  ? 0.3973 0.4557 0.3096 0.0079  0.0116  -0.0037 227 TYR B CB  
2641 C CG  . TYR B 39  ? 0.4554 0.5211 0.3663 -0.0005 0.0163  0.0019  227 TYR B CG  
2642 C CD1 . TYR B 39  ? 0.4354 0.5019 0.3596 -0.0017 0.0134  0.0073  227 TYR B CD1 
2643 C CD2 . TYR B 39  ? 0.4950 0.5669 0.3903 -0.0083 0.0239  0.0017  227 TYR B CD2 
2644 C CE1 . TYR B 39  ? 0.5387 0.6118 0.4621 -0.0104 0.0177  0.0130  227 TYR B CE1 
2645 C CE2 . TYR B 39  ? 0.5436 0.6231 0.4370 -0.0171 0.0288  0.0074  227 TYR B CE2 
2646 C CZ  . TYR B 39  ? 0.5766 0.6565 0.4847 -0.0181 0.0255  0.0135  227 TYR B CZ  
2647 O OH  . TYR B 39  ? 0.5722 0.6595 0.4790 -0.0278 0.0304  0.0197  227 TYR B OH  
2648 N N   . ARG B 40  ? 0.4339 0.4844 0.3471 0.0228  0.0125  -0.0208 228 ARG B N   
2649 C CA  . ARG B 40  ? 0.4289 0.4710 0.3398 0.0264  0.0059  -0.0221 228 ARG B CA  
2650 C C   . ARG B 40  ? 0.4413 0.4790 0.3408 0.0204  -0.0020 -0.0147 228 ARG B C   
2651 O O   . ARG B 40  ? 0.5068 0.5465 0.3918 0.0129  -0.0003 -0.0124 228 ARG B O   
2652 C CB  . ARG B 40  ? 0.4445 0.4846 0.3495 0.0286  0.0114  -0.0313 228 ARG B CB  
2653 C CG  . ARG B 40  ? 0.4532 0.4852 0.3568 0.0316  0.0052  -0.0329 228 ARG B CG  
2654 C CD  . ARG B 40  ? 0.5075 0.5359 0.4039 0.0321  0.0111  -0.0421 228 ARG B CD  
2655 N NE  . ARG B 40  ? 0.5377 0.5587 0.4331 0.0338  0.0055  -0.0437 228 ARG B NE  
2656 C CZ  . ARG B 40  ? 0.5428 0.5612 0.4269 0.0283  -0.0006 -0.0415 228 ARG B CZ  
2657 N NH1 . ARG B 40  ? 0.5520 0.5738 0.4239 0.0209  -0.0027 -0.0369 228 ARG B NH1 
2658 N NH2 . ARG B 40  ? 0.5491 0.5620 0.4344 0.0297  -0.0050 -0.0433 228 ARG B NH2 
2659 N N   . ALA B 41  ? 0.3765 0.4090 0.2832 0.0236  -0.0106 -0.0108 229 ALA B N   
2660 C CA  . ALA B 41  ? 0.4261 0.4549 0.3269 0.0195  -0.0191 -0.0027 229 ALA B CA  
2661 C C   . ALA B 41  ? 0.4667 0.4913 0.3698 0.0232  -0.0255 -0.0042 229 ALA B C   
2662 O O   . ALA B 41  ? 0.4575 0.4809 0.3696 0.0294  -0.0243 -0.0098 229 ALA B O   
2663 C CB  . ALA B 41  ? 0.4057 0.4327 0.3163 0.0190  -0.0235 0.0051  229 ALA B CB  
2664 N N   . VAL B 42  ? 0.4859 0.5091 0.3810 0.0189  -0.0324 0.0014  230 VAL B N   
2665 C CA  . VAL B 42  ? 0.4763 0.4974 0.3763 0.0219  -0.0394 0.0015  230 VAL B CA  
2666 C C   . VAL B 42  ? 0.4273 0.4466 0.3353 0.0220  -0.0485 0.0113  230 VAL B C   
2667 O O   . VAL B 42  ? 0.4480 0.4676 0.3478 0.0160  -0.0529 0.0196  230 VAL B O   
2668 C CB  . VAL B 42  ? 0.5125 0.5348 0.3981 0.0170  -0.0405 -0.0015 230 VAL B CB  
2669 C CG1 . VAL B 42  ? 0.4883 0.5103 0.3812 0.0193  -0.0484 -0.0003 230 VAL B CG1 
2670 C CG2 . VAL B 42  ? 0.4971 0.5190 0.3769 0.0177  -0.0311 -0.0122 230 VAL B CG2 
2671 N N   . MET B 43  ? 0.3901 0.4073 0.3145 0.0287  -0.0511 0.0105  231 MET B N   
2672 C CA  . MET B 43  ? 0.4089 0.4232 0.3446 0.0304  -0.0590 0.0184  231 MET B CA  
2673 C C   . MET B 43  ? 0.4344 0.4496 0.3833 0.0364  -0.0624 0.0150  231 MET B C   
2674 O O   . MET B 43  ? 0.3878 0.4038 0.3415 0.0406  -0.0574 0.0070  231 MET B O   
2675 C CB  . MET B 43  ? 0.3828 0.3929 0.3276 0.0318  -0.0572 0.0205  231 MET B CB  
2676 C CG  . MET B 43  ? 0.4223 0.4330 0.3563 0.0253  -0.0531 0.0241  231 MET B CG  
2677 S SD  . MET B 43  ? 0.5505 0.5563 0.4965 0.0257  -0.0517 0.0266  231 MET B SD  
2678 C CE  . MET B 43  ? 0.4134 0.4217 0.3688 0.0325  -0.0453 0.0144  231 MET B CE  
2679 N N   . ARG B 44  ? 0.4975 0.5134 0.4526 0.0366  -0.0708 0.0219  232 ARG B N   
2680 C CA  . ARG B 44  ? 0.4704 0.4894 0.4399 0.0419  -0.0741 0.0193  232 ARG B CA  
2681 C C   . ARG B 44  ? 0.4268 0.4500 0.3906 0.0418  -0.0695 0.0106  232 ARG B C   
2682 O O   . ARG B 44  ? 0.3916 0.4159 0.3651 0.0466  -0.0661 0.0043  232 ARG B O   
2683 C CB  . ARG B 44  ? 0.4598 0.4750 0.4472 0.0487  -0.0724 0.0166  232 ARG B CB  
2684 C CG  . ARG B 44  ? 0.4719 0.4807 0.4669 0.0489  -0.0773 0.0252  232 ARG B CG  
2685 C CD  . ARG B 44  ? 0.4193 0.4232 0.4329 0.0554  -0.0759 0.0214  232 ARG B CD  
2686 N NE  . ARG B 44  ? 0.4604 0.4558 0.4807 0.0548  -0.0806 0.0300  232 ARG B NE  
2687 C CZ  . ARG B 44  ? 0.4445 0.4328 0.4820 0.0597  -0.0810 0.0285  232 ARG B CZ  
2688 N NH1 . ARG B 44  ? 0.4310 0.4209 0.4798 0.0655  -0.0764 0.0180  232 ARG B NH1 
2689 N NH2 . ARG B 44  ? 0.4115 0.3904 0.4543 0.0583  -0.0857 0.0374  232 ARG B NH2 
2690 N N   . ASN B 45  ? 0.3702 0.3950 0.3173 0.0356  -0.0691 0.0103  233 ASN B N   
2691 C CA  . ASN B 45  ? 0.3944 0.4210 0.3346 0.0341  -0.0652 0.0025  233 ASN B CA  
2692 C C   . ASN B 45  ? 0.4221 0.4457 0.3637 0.0381  -0.0563 -0.0056 233 ASN B C   
2693 O O   . ASN B 45  ? 0.4106 0.4347 0.3529 0.0390  -0.0536 -0.0113 233 ASN B O   
2694 C CB  . ASN B 45  ? 0.3514 0.3835 0.3016 0.0351  -0.0707 0.0027  233 ASN B CB  
2695 C CG  . ASN B 45  ? 0.4225 0.4592 0.3696 0.0302  -0.0805 0.0108  233 ASN B CG  
2696 O OD1 . ASN B 45  ? 0.4809 0.5182 0.4110 0.0229  -0.0818 0.0112  233 ASN B OD1 
2697 N ND2 . ASN B 45  ? 0.4377 0.4780 0.4017 0.0340  -0.0876 0.0173  233 ASN B ND2 
2698 N N   . THR B 46  ? 0.4290 0.4498 0.3711 0.0397  -0.0523 -0.0053 234 THR B N   
2699 C CA  . THR B 46  ? 0.3574 0.3767 0.3022 0.0435  -0.0452 -0.0114 234 THR B CA  
2700 C C   . THR B 46  ? 0.4032 0.4214 0.3394 0.0413  -0.0397 -0.0122 234 THR B C   
2701 O O   . THR B 46  ? 0.3766 0.3947 0.3095 0.0382  -0.0410 -0.0071 234 THR B O   
2702 C CB  . THR B 46  ? 0.3421 0.3610 0.3010 0.0486  -0.0457 -0.0114 234 THR B CB  
2703 O OG1 . THR B 46  ? 0.3952 0.4165 0.3640 0.0507  -0.0501 -0.0108 234 THR B OG1 
2704 C CG2 . THR B 46  ? 0.3038 0.3227 0.2647 0.0517  -0.0398 -0.0172 234 THR B CG2 
2705 N N   . VAL B 47  ? 0.3736 0.3913 0.3072 0.0429  -0.0335 -0.0182 235 VAL B N   
2706 C CA  . VAL B 47  ? 0.3781 0.3966 0.3066 0.0418  -0.0272 -0.0201 235 VAL B CA  
2707 C C   . VAL B 47  ? 0.4198 0.4400 0.3585 0.0453  -0.0252 -0.0196 235 VAL B C   
2708 O O   . VAL B 47  ? 0.3931 0.4134 0.3398 0.0497  -0.0250 -0.0220 235 VAL B O   
2709 C CB  . VAL B 47  ? 0.3959 0.4125 0.3193 0.0426  -0.0215 -0.0270 235 VAL B CB  
2710 C CG1 . VAL B 47  ? 0.3756 0.3944 0.2960 0.0420  -0.0141 -0.0296 235 VAL B CG1 
2711 C CG2 . VAL B 47  ? 0.3719 0.3862 0.2847 0.0380  -0.0237 -0.0287 235 VAL B CG2 
2712 N N   . TYR B 48  ? 0.3617 0.3840 0.2995 0.0424  -0.0240 -0.0162 236 TYR B N   
2713 C CA  . TYR B 48  ? 0.2935 0.3181 0.2406 0.0441  -0.0226 -0.0155 236 TYR B CA  
2714 C C   . TYR B 48  ? 0.3596 0.3893 0.3048 0.0420  -0.0161 -0.0164 236 TYR B C   
2715 O O   . TYR B 48  ? 0.3652 0.3961 0.3002 0.0378  -0.0128 -0.0164 236 TYR B O   
2716 C CB  . TYR B 48  ? 0.3384 0.3605 0.2904 0.0421  -0.0279 -0.0097 236 TYR B CB  
2717 C CG  . TYR B 48  ? 0.3525 0.3707 0.3106 0.0450  -0.0338 -0.0091 236 TYR B CG  
2718 C CD1 . TYR B 48  ? 0.3052 0.3234 0.2724 0.0493  -0.0340 -0.0131 236 TYR B CD1 
2719 C CD2 . TYR B 48  ? 0.3480 0.3637 0.3030 0.0432  -0.0391 -0.0044 236 TYR B CD2 
2720 C CE1 . TYR B 48  ? 0.3299 0.3458 0.3036 0.0520  -0.0379 -0.0136 236 TYR B CE1 
2721 C CE2 . TYR B 48  ? 0.3455 0.3593 0.3092 0.0464  -0.0439 -0.0041 236 TYR B CE2 
2722 C CZ  . TYR B 48  ? 0.3644 0.3783 0.3376 0.0510  -0.0426 -0.0093 236 TYR B CZ  
2723 O OH  . TYR B 48  ? 0.3744 0.3876 0.3569 0.0542  -0.0459 -0.0101 236 TYR B OH  
2724 N N   . ALA B 49  ? 0.3102 0.3441 0.2653 0.0442  -0.0141 -0.0175 237 ALA B N   
2725 C CA  . ALA B 49  ? 0.3376 0.3784 0.2948 0.0414  -0.0087 -0.0170 237 ALA B CA  
2726 C C   . ALA B 49  ? 0.3693 0.4095 0.3302 0.0370  -0.0122 -0.0112 237 ALA B C   
2727 O O   . ALA B 49  ? 0.3728 0.4091 0.3404 0.0386  -0.0174 -0.0104 237 ALA B O   
2728 C CB  . ALA B 49  ? 0.2921 0.3395 0.2598 0.0462  -0.0050 -0.0210 237 ALA B CB  
2729 N N   . VAL B 50  ? 0.3358 0.3792 0.2920 0.0309  -0.0090 -0.0075 238 VAL B N   
2730 C CA  . VAL B 50  ? 0.3730 0.4146 0.3326 0.0255  -0.0120 -0.0011 238 VAL B CA  
2731 C C   . VAL B 50  ? 0.4389 0.4902 0.4043 0.0217  -0.0060 -0.0009 238 VAL B C   
2732 O O   . VAL B 50  ? 0.4821 0.5399 0.4408 0.0179  0.0007  -0.0009 238 VAL B O   
2733 C CB  . VAL B 50  ? 0.3899 0.4256 0.3379 0.0196  -0.0153 0.0063  238 VAL B CB  
2734 C CG1 . VAL B 50  ? 0.3900 0.4227 0.3424 0.0136  -0.0181 0.0139  238 VAL B CG1 
2735 C CG2 . VAL B 50  ? 0.3166 0.3443 0.2621 0.0233  -0.0223 0.0069  238 VAL B CG2 
2736 N N   . LYS B 51  ? 0.4363 0.4897 0.4143 0.0220  -0.0080 -0.0013 239 LYS B N   
2737 C CA  . LYS B 51  ? 0.3926 0.4564 0.3788 0.0176  -0.0035 -0.0005 239 LYS B CA  
2738 C C   . LYS B 51  ? 0.4543 0.5135 0.4394 0.0089  -0.0056 0.0072  239 LYS B C   
2739 O O   . LYS B 51  ? 0.4774 0.5266 0.4661 0.0081  -0.0123 0.0096  239 LYS B O   
2740 C CB  . LYS B 51  ? 0.3750 0.4449 0.3755 0.0215  -0.0052 -0.0048 239 LYS B CB  
2741 C CG  . LYS B 51  ? 0.4132 0.4961 0.4249 0.0167  -0.0013 -0.0039 239 LYS B CG  
2742 C CD  . LYS B 51  ? 0.4110 0.5037 0.4365 0.0214  -0.0028 -0.0083 239 LYS B CD  
2743 C CE  . LYS B 51  ? 0.4342 0.5205 0.4639 0.0201  -0.0108 -0.0089 239 LYS B CE  
2744 N NZ  . LYS B 51  ? 0.4178 0.5154 0.4594 0.0228  -0.0132 -0.0121 239 LYS B NZ  
2745 N N   . ARG B 52  ? 0.4765 0.5428 0.4568 0.0021  0.0006  0.0108  240 ARG B N   
2746 C CA  . ARG B 52  ? 0.4835 0.5468 0.4622 -0.0076 -0.0004 0.0193  240 ARG B CA  
2747 C C   . ARG B 52  ? 0.4777 0.5542 0.4684 -0.0127 0.0050  0.0189  240 ARG B C   
2748 O O   . ARG B 52  ? 0.4905 0.5812 0.4824 -0.0130 0.0136  0.0156  240 ARG B O   
2749 C CB  . ARG B 52  ? 0.4924 0.5542 0.4538 -0.0135 0.0022  0.0253  240 ARG B CB  
2750 C CG  . ARG B 52  ? 0.6099 0.6687 0.5678 -0.0246 0.0014  0.0360  240 ARG B CG  
2751 C CD  . ARG B 52  ? 0.6778 0.7390 0.6162 -0.0314 0.0053  0.0415  240 ARG B CD  
2752 N NE  . ARG B 52  ? 0.7538 0.8135 0.6879 -0.0433 0.0053  0.0529  240 ARG B NE  
2753 C CZ  . ARG B 52  ? 0.7905 0.8543 0.7070 -0.0523 0.0095  0.0594  240 ARG B CZ  
2754 N NH1 . ARG B 52  ? 0.7448 0.8143 0.6465 -0.0507 0.0142  0.0541  240 ARG B NH1 
2755 N NH2 . ARG B 52  ? 0.8175 0.8793 0.7305 -0.0638 0.0090  0.0711  240 ARG B NH2 
2756 N N   . LEU B 53  ? 0.4536 0.5256 0.4545 -0.0167 0.0001  0.0215  241 LEU B N   
2757 C CA  . LEU B 53  ? 0.4945 0.5794 0.5088 -0.0225 0.0037  0.0213  241 LEU B CA  
2758 C C   . LEU B 53  ? 0.5742 0.6637 0.5836 -0.0340 0.0094  0.0293  241 LEU B C   
2759 O O   . LEU B 53  ? 0.5716 0.6489 0.5695 -0.0394 0.0065  0.0375  241 LEU B O   
2760 C CB  . LEU B 53  ? 0.4593 0.5368 0.4853 -0.0239 -0.0039 0.0203  241 LEU B CB  
2761 C CG  . LEU B 53  ? 0.5157 0.5893 0.5458 -0.0143 -0.0094 0.0124  241 LEU B CG  
2762 C CD1 . LEU B 53  ? 0.5194 0.5857 0.5590 -0.0178 -0.0160 0.0107  241 LEU B CD1 
2763 C CD2 . LEU B 53  ? 0.5364 0.6267 0.5730 -0.0078 -0.0053 0.0061  241 LEU B CD2 
2764 N N   . LYS B 54  ? 0.6079 0.7159 0.6268 -0.0380 0.0172  0.0277  242 LYS B N   
2765 C CA  . LYS B 54  ? 0.6785 0.7940 0.6935 -0.0499 0.0242  0.0349  242 LYS B CA  
2766 C C   . LYS B 54  ? 0.7052 0.8250 0.7356 -0.0590 0.0226  0.0383  242 LYS B C   
2767 O O   . LYS B 54  ? 0.7026 0.8274 0.7487 -0.0554 0.0190  0.0326  242 LYS B O   
2768 C CB  . LYS B 54  ? 0.7006 0.8358 0.7145 -0.0489 0.0366  0.0301  242 LYS B CB  
2769 C CG  . LYS B 54  ? 0.7234 0.8768 0.7579 -0.0421 0.0405  0.0214  242 LYS B CG  
2770 C CD  . LYS B 54  ? 0.7442 0.9164 0.7796 -0.0408 0.0539  0.0162  242 LYS B CD  
2771 C CE  . LYS B 54  ? 0.7428 0.9070 0.7594 -0.0347 0.0569  0.0123  242 LYS B CE  
2772 N NZ  . LYS B 54  ? 0.7102 0.8915 0.7305 -0.0310 0.0701  0.0041  242 LYS B NZ  
2773 N N   . GLU B 55  ? 0.7342 0.8517 0.7594 -0.0715 0.0247  0.0479  243 GLU B N   
2774 C CA  . GLU B 55  ? 0.8077 0.9281 0.8469 -0.0822 0.0234  0.0521  243 GLU B CA  
2775 C C   . GLU B 55  ? 0.7879 0.9350 0.8447 -0.0841 0.0316  0.0466  243 GLU B C   
2776 O O   . GLU B 55  ? 0.7987 0.9631 0.8536 -0.0834 0.0422  0.0444  243 GLU B O   
2777 C CB  . GLU B 55  ? 0.9228 1.0345 0.9512 -0.0960 0.0244  0.0652  243 GLU B CB  
2778 C CG  . GLU B 55  ? 1.0278 1.1117 1.0464 -0.0960 0.0136  0.0727  243 GLU B CG  
2779 C CD  . GLU B 55  ? 1.1032 1.1784 1.1052 -0.0862 0.0112  0.0718  243 GLU B CD  
2780 O OE1 . GLU B 55  ? 1.1278 1.2146 1.1172 -0.0861 0.0190  0.0713  243 GLU B OE1 
2781 O OE2 . GLU B 55  ? 1.1141 1.1712 1.1160 -0.0791 0.0018  0.0710  243 GLU B OE2 
2782 N N   . TRP B 61  ? 0.8576 0.9561 0.9534 -0.1024 -0.0041 0.0448  249 TRP B N   
2783 C CA  . TRP B 61  ? 0.8870 0.9626 0.9821 -0.1124 -0.0094 0.0515  249 TRP B CA  
2784 C C   . TRP B 61  ? 0.8202 0.8738 0.9152 -0.1055 -0.0189 0.0443  249 TRP B C   
2785 O O   . TRP B 61  ? 0.8149 0.8553 0.8992 -0.0951 -0.0214 0.0435  249 TRP B O   
2786 C CB  . TRP B 61  ? 0.9779 1.0636 1.0875 -0.1277 -0.0078 0.0543  249 TRP B CB  
2787 C CG  . TRP B 61  ? 1.0064 1.1184 1.1325 -0.1274 -0.0067 0.0454  249 TRP B CG  
2788 C CD1 . TRP B 61  ? 1.0064 1.1188 1.1454 -0.1317 -0.0135 0.0382  249 TRP B CD1 
2789 C CD2 . TRP B 61  ? 1.0012 1.1431 1.1336 -0.1230 0.0013  0.0430  249 TRP B CD2 
2790 N NE1 . TRP B 61  ? 0.9991 1.1406 1.1519 -0.1303 -0.0113 0.0328  249 TRP B NE1 
2791 C CE2 . TRP B 61  ? 0.9822 1.1418 1.1326 -0.1243 -0.0021 0.0357  249 TRP B CE2 
2792 C CE3 . TRP B 61  ? 0.9777 1.1329 1.1026 -0.1180 0.0110  0.0458  249 TRP B CE3 
2793 C CZ2 . TRP B 61  ? 0.9355 1.1255 1.0989 -0.1198 0.0033  0.0323  249 TRP B CZ2 
2794 C CZ3 . TRP B 61  ? 0.9450 1.1291 1.0824 -0.1135 0.0176  0.0409  249 TRP B CZ3 
2795 C CH2 . TRP B 61  ? 0.9275 1.1288 1.0851 -0.1140 0.0135  0.0347  249 TRP B CH2 
2796 N N   . THR B 62  ? 0.8313 0.8816 0.9383 -0.1118 -0.0238 0.0386  250 THR B N   
2797 C CA  . THR B 62  ? 0.7466 0.7804 0.8540 -0.1052 -0.0313 0.0288  250 THR B CA  
2798 C C   . THR B 62  ? 0.6299 0.6804 0.7364 -0.0933 -0.0313 0.0189  250 THR B C   
2799 O O   . THR B 62  ? 0.5899 0.6296 0.6908 -0.0836 -0.0353 0.0119  250 THR B O   
2800 C CB  . THR B 62  ? 0.7544 0.7796 0.8735 -0.1165 -0.0364 0.0240  250 THR B CB  
2801 O OG1 . THR B 62  ? 0.7972 0.8044 0.9175 -0.1276 -0.0366 0.0343  250 THR B OG1 
2802 C CG2 . THR B 62  ? 0.7326 0.7410 0.8505 -0.1097 -0.0430 0.0122  250 THR B CG2 
2803 N N   . ALA B 63  ? 0.6423 0.7196 0.7549 -0.0939 -0.0264 0.0190  251 ALA B N   
2804 C CA  . ALA B 63  ? 0.5472 0.6418 0.6610 -0.0830 -0.0264 0.0117  251 ALA B CA  
2805 C C   . ALA B 63  ? 0.4864 0.5744 0.5864 -0.0696 -0.0245 0.0115  251 ALA B C   
2806 O O   . ALA B 63  ? 0.4728 0.5608 0.5699 -0.0600 -0.0278 0.0044  251 ALA B O   
2807 C CB  . ALA B 63  ? 0.4938 0.6177 0.6195 -0.0860 -0.0208 0.0134  251 ALA B CB  
2808 N N   . VAL B 64  ? 0.4271 0.5107 0.5182 -0.0698 -0.0193 0.0197  252 VAL B N   
2809 C CA  . VAL B 64  ? 0.4322 0.5101 0.5100 -0.0586 -0.0176 0.0199  252 VAL B CA  
2810 C C   . VAL B 64  ? 0.4340 0.4890 0.5053 -0.0528 -0.0246 0.0166  252 VAL B C   
2811 O O   . VAL B 64  ? 0.4458 0.5001 0.5123 -0.0423 -0.0262 0.0107  252 VAL B O   
2812 C CB  . VAL B 64  ? 0.4721 0.5495 0.5398 -0.0622 -0.0114 0.0295  252 VAL B CB  
2813 C CG1 . VAL B 64  ? 0.4421 0.5121 0.4956 -0.0518 -0.0111 0.0294  252 VAL B CG1 
2814 C CG2 . VAL B 64  ? 0.5273 0.6293 0.6013 -0.0664 -0.0026 0.0309  252 VAL B CG2 
2815 N N   . LYS B 65  ? 0.4334 0.4699 0.5061 -0.0598 -0.0284 0.0203  253 LYS B N   
2816 C CA  . LYS B 65  ? 0.4413 0.4559 0.5115 -0.0546 -0.0345 0.0166  253 LYS B CA  
2817 C C   . LYS B 65  ? 0.4237 0.4408 0.4982 -0.0498 -0.0380 0.0040  253 LYS B C   
2818 O O   . LYS B 65  ? 0.4232 0.4328 0.4926 -0.0405 -0.0401 -0.0014 253 LYS B O   
2819 C CB  . LYS B 65  ? 0.4453 0.4395 0.5200 -0.0638 -0.0378 0.0223  253 LYS B CB  
2820 C CG  . LYS B 65  ? 0.4978 0.4682 0.5714 -0.0574 -0.0431 0.0200  253 LYS B CG  
2821 C CD  . LYS B 65  ? 0.5499 0.4989 0.6304 -0.0661 -0.0466 0.0256  253 LYS B CD  
2822 C CE  . LYS B 65  ? 0.5498 0.4981 0.6409 -0.0746 -0.0481 0.0170  253 LYS B CE  
2823 N NZ  . LYS B 65  ? 0.6163 0.5398 0.7153 -0.0823 -0.0518 0.0209  253 LYS B NZ  
2824 N N   . GLN B 66  ? 0.3807 0.4098 0.4644 -0.0569 -0.0388 -0.0003 254 GLN B N   
2825 C CA  . GLN B 66  ? 0.3969 0.4315 0.4832 -0.0542 -0.0427 -0.0116 254 GLN B CA  
2826 C C   . GLN B 66  ? 0.4521 0.5005 0.5326 -0.0428 -0.0412 -0.0146 254 GLN B C   
2827 O O   . GLN B 66  ? 0.5070 0.5514 0.5831 -0.0367 -0.0442 -0.0222 254 GLN B O   
2828 C CB  . GLN B 66  ? 0.4000 0.4486 0.4976 -0.0649 -0.0444 -0.0141 254 GLN B CB  
2829 C CG  . GLN B 66  ? 0.4764 0.5081 0.5800 -0.0767 -0.0474 -0.0147 254 GLN B CG  
2830 C CD  . GLN B 66  ? 0.5599 0.6057 0.6746 -0.0881 -0.0502 -0.0189 254 GLN B CD  
2831 O OE1 . GLN B 66  ? 0.6059 0.6763 0.7255 -0.0874 -0.0498 -0.0194 254 GLN B OE1 
2832 N NE2 . GLN B 66  ? 0.5527 0.5827 0.6725 -0.0986 -0.0534 -0.0219 254 GLN B NE2 
2833 N N   . SER B 67  ? 0.3838 0.4479 0.4642 -0.0403 -0.0362 -0.0088 255 SER B N   
2834 C CA  . SER B 67  ? 0.4340 0.5094 0.5099 -0.0296 -0.0345 -0.0111 255 SER B CA  
2835 C C   . SER B 67  ? 0.3704 0.4305 0.4345 -0.0208 -0.0346 -0.0115 255 SER B C   
2836 O O   . SER B 67  ? 0.3351 0.3965 0.3948 -0.0128 -0.0361 -0.0166 255 SER B O   
2837 C CB  . SER B 67  ? 0.4396 0.5335 0.5195 -0.0290 -0.0280 -0.0058 255 SER B CB  
2838 O OG  . SER B 67  ? 0.6220 0.7342 0.7156 -0.0355 -0.0282 -0.0062 255 SER B OG  
2839 N N   . PHE B 68  ? 0.3191 0.3656 0.3786 -0.0228 -0.0333 -0.0053 256 PHE B N   
2840 C CA  . PHE B 68  ? 0.3770 0.4092 0.4272 -0.0155 -0.0342 -0.0045 256 PHE B CA  
2841 C C   . PHE B 68  ? 0.3944 0.4146 0.4452 -0.0118 -0.0389 -0.0127 256 PHE B C   
2842 O O   . PHE B 68  ? 0.3853 0.4059 0.4310 -0.0036 -0.0393 -0.0173 256 PHE B O   
2843 C CB  . PHE B 68  ? 0.3116 0.3316 0.3587 -0.0203 -0.0337 0.0050  256 PHE B CB  
2844 C CG  . PHE B 68  ? 0.3904 0.3957 0.4305 -0.0138 -0.0361 0.0072  256 PHE B CG  
2845 C CD1 . PHE B 68  ? 0.3595 0.3699 0.3902 -0.0073 -0.0338 0.0090  256 PHE B CD1 
2846 C CD2 . PHE B 68  ? 0.3691 0.3557 0.4135 -0.0143 -0.0408 0.0072  256 PHE B CD2 
2847 C CE1 . PHE B 68  ? 0.3847 0.3835 0.4103 -0.0020 -0.0368 0.0114  256 PHE B CE1 
2848 C CE2 . PHE B 68  ? 0.4230 0.3980 0.4639 -0.0078 -0.0435 0.0096  256 PHE B CE2 
2849 C CZ  . PHE B 68  ? 0.4029 0.3848 0.4343 -0.0019 -0.0418 0.0121  256 PHE B CZ  
2850 N N   . LEU B 69  ? 0.3887 0.3984 0.4460 -0.0186 -0.0419 -0.0152 257 LEU B N   
2851 C CA  . LEU B 69  ? 0.4373 0.4347 0.4959 -0.0163 -0.0453 -0.0245 257 LEU B CA  
2852 C C   . LEU B 69  ? 0.4047 0.4149 0.4610 -0.0134 -0.0462 -0.0337 257 LEU B C   
2853 O O   . LEU B 69  ? 0.3381 0.3440 0.3897 -0.0069 -0.0467 -0.0401 257 LEU B O   
2854 C CB  . LEU B 69  ? 0.4205 0.4043 0.4872 -0.0254 -0.0478 -0.0263 257 LEU B CB  
2855 C CG  . LEU B 69  ? 0.4646 0.4314 0.5340 -0.0281 -0.0483 -0.0166 257 LEU B CG  
2856 C CD1 . LEU B 69  ? 0.4684 0.4202 0.5470 -0.0375 -0.0508 -0.0189 257 LEU B CD1 
2857 C CD2 . LEU B 69  ? 0.4390 0.3932 0.5052 -0.0183 -0.0491 -0.0154 257 LEU B CD2 
2858 N N   . THR B 70  ? 0.3858 0.4127 0.4457 -0.0184 -0.0464 -0.0336 258 THR B N   
2859 C CA  . THR B 70  ? 0.3503 0.3913 0.4083 -0.0163 -0.0485 -0.0399 258 THR B CA  
2860 C C   . THR B 70  ? 0.3586 0.4042 0.4088 -0.0058 -0.0466 -0.0390 258 THR B C   
2861 O O   . THR B 70  ? 0.3972 0.4431 0.4419 -0.0021 -0.0483 -0.0454 258 THR B O   
2862 C CB  . THR B 70  ? 0.3621 0.4232 0.4280 -0.0220 -0.0493 -0.0372 258 THR B CB  
2863 O OG1 . THR B 70  ? 0.3986 0.4563 0.4723 -0.0332 -0.0512 -0.0380 258 THR B OG1 
2864 C CG2 . THR B 70  ? 0.3428 0.4183 0.4069 -0.0199 -0.0530 -0.0423 258 THR B CG2 
2865 N N   . GLU B 71  ? 0.3315 0.3807 0.3806 -0.0018 -0.0428 -0.0315 259 GLU B N   
2866 C CA  . GLU B 71  ? 0.3290 0.3820 0.3711 0.0073  -0.0409 -0.0307 259 GLU B CA  
2867 C C   . GLU B 71  ? 0.3786 0.4170 0.4141 0.0125  -0.0414 -0.0341 259 GLU B C   
2868 O O   . GLU B 71  ? 0.3623 0.4030 0.3925 0.0180  -0.0418 -0.0378 259 GLU B O   
2869 C CB  . GLU B 71  ? 0.3479 0.4071 0.3896 0.0096  -0.0362 -0.0234 259 GLU B CB  
2870 C CG  . GLU B 71  ? 0.3695 0.4323 0.4048 0.0184  -0.0343 -0.0235 259 GLU B CG  
2871 C CD  . GLU B 71  ? 0.4579 0.5320 0.4951 0.0204  -0.0293 -0.0191 259 GLU B CD  
2872 O OE1 . GLU B 71  ? 0.4827 0.5613 0.5245 0.0149  -0.0264 -0.0153 259 GLU B OE1 
2873 O OE2 . GLU B 71  ? 0.4403 0.5183 0.4745 0.0271  -0.0277 -0.0198 259 GLU B OE2 
2874 N N   . VAL B 72  ? 0.3707 0.3945 0.4076 0.0107  -0.0415 -0.0322 260 VAL B N   
2875 C CA  . VAL B 72  ? 0.3774 0.3884 0.4115 0.0160  -0.0422 -0.0356 260 VAL B CA  
2876 C C   . VAL B 72  ? 0.3829 0.3923 0.4166 0.0161  -0.0437 -0.0463 260 VAL B C   
2877 O O   . VAL B 72  ? 0.4102 0.4202 0.4391 0.0218  -0.0429 -0.0504 260 VAL B O   
2878 C CB  . VAL B 72  ? 0.3536 0.3486 0.3923 0.0140  -0.0432 -0.0313 260 VAL B CB  
2879 C CG1 . VAL B 72  ? 0.2888 0.2725 0.3283 0.0204  -0.0439 -0.0353 260 VAL B CG1 
2880 C CG2 . VAL B 72  ? 0.3008 0.2976 0.3366 0.0132  -0.0417 -0.0204 260 VAL B CG2 
2881 N N   . GLU B 73  ? 0.3237 0.3321 0.3618 0.0089  -0.0456 -0.0511 261 GLU B N   
2882 C CA  . GLU B 73  ? 0.3924 0.3993 0.4284 0.0073  -0.0468 -0.0624 261 GLU B CA  
2883 C C   . GLU B 73  ? 0.3974 0.4195 0.4254 0.0096  -0.0473 -0.0649 261 GLU B C   
2884 O O   . GLU B 73  ? 0.3824 0.4033 0.4043 0.0132  -0.0462 -0.0711 261 GLU B O   
2885 C CB  . GLU B 73  ? 0.4679 0.4720 0.5094 -0.0025 -0.0493 -0.0671 261 GLU B CB  
2886 C CG  . GLU B 73  ? 0.5852 0.5908 0.6219 -0.0061 -0.0507 -0.0797 261 GLU B CG  
2887 C CD  . GLU B 73  ? 0.7090 0.7130 0.7504 -0.0171 -0.0537 -0.0849 261 GLU B CD  
2888 O OE1 . GLU B 73  ? 0.7865 0.7858 0.8363 -0.0218 -0.0543 -0.0786 261 GLU B OE1 
2889 O OE2 . GLU B 73  ? 0.7325 0.7404 0.7685 -0.0220 -0.0556 -0.0951 261 GLU B OE2 
2890 N N   . GLN B 74  ? 0.3381 0.3749 0.3669 0.0075  -0.0488 -0.0595 262 GLN B N   
2891 C CA  . GLN B 74  ? 0.3283 0.3790 0.3510 0.0092  -0.0506 -0.0605 262 GLN B CA  
2892 C C   . GLN B 74  ? 0.3496 0.4011 0.3663 0.0180  -0.0480 -0.0571 262 GLN B C   
2893 O O   . GLN B 74  ? 0.2942 0.3503 0.3034 0.0199  -0.0488 -0.0601 262 GLN B O   
2894 C CB  . GLN B 74  ? 0.3587 0.4256 0.3873 0.0056  -0.0534 -0.0551 262 GLN B CB  
2895 C CG  . GLN B 74  ? 0.3617 0.4304 0.3968 -0.0045 -0.0566 -0.0584 262 GLN B CG  
2896 C CD  . GLN B 74  ? 0.4713 0.5374 0.5002 -0.0103 -0.0600 -0.0691 262 GLN B CD  
2897 O OE1 . GLN B 74  ? 0.4729 0.5391 0.4919 -0.0071 -0.0600 -0.0736 262 GLN B OE1 
2898 N NE2 . GLN B 74  ? 0.4919 0.5559 0.5261 -0.0198 -0.0625 -0.0735 262 GLN B NE2 
2899 N N   . LEU B 75  ? 0.3309 0.3779 0.3498 0.0224  -0.0451 -0.0507 263 LEU B N   
2900 C CA  . LEU B 75  ? 0.3123 0.3585 0.3256 0.0297  -0.0428 -0.0483 263 LEU B CA  
2901 C C   . LEU B 75  ? 0.3564 0.3923 0.3662 0.0322  -0.0415 -0.0543 263 LEU B C   
2902 O O   . LEU B 75  ? 0.3307 0.3679 0.3352 0.0369  -0.0401 -0.0544 263 LEU B O   
2903 C CB  . LEU B 75  ? 0.2788 0.3235 0.2941 0.0327  -0.0401 -0.0408 263 LEU B CB  
2904 C CG  . LEU B 75  ? 0.3440 0.4009 0.3627 0.0325  -0.0393 -0.0356 263 LEU B CG  
2905 C CD1 . LEU B 75  ? 0.3197 0.3745 0.3376 0.0351  -0.0355 -0.0300 263 LEU B CD1 
2906 C CD2 . LEU B 75  ? 0.3383 0.4051 0.3546 0.0359  -0.0407 -0.0359 263 LEU B CD2 
2907 N N   . SER B 76  ? 0.3170 0.3428 0.3312 0.0291  -0.0417 -0.0593 264 SER B N   
2908 C CA  . SER B 76  ? 0.3938 0.4113 0.4074 0.0316  -0.0400 -0.0668 264 SER B CA  
2909 C C   . SER B 76  ? 0.4186 0.4427 0.4248 0.0290  -0.0400 -0.0754 264 SER B C   
2910 O O   . SER B 76  ? 0.4086 0.4325 0.4106 0.0321  -0.0374 -0.0801 264 SER B O   
2911 C CB  . SER B 76  ? 0.4268 0.4300 0.4491 0.0298  -0.0400 -0.0699 264 SER B CB  
2912 O OG  . SER B 76  ? 0.4489 0.4457 0.4764 0.0322  -0.0404 -0.0609 264 SER B OG  
2913 N N   . ARG B 77  ? 0.3661 0.3971 0.3706 0.0225  -0.0431 -0.0772 265 ARG B N   
2914 C CA  . ARG B 77  ? 0.3739 0.4124 0.3693 0.0184  -0.0442 -0.0847 265 ARG B CA  
2915 C C   . ARG B 77  ? 0.3926 0.4437 0.3797 0.0210  -0.0454 -0.0790 265 ARG B C   
2916 O O   . ARG B 77  ? 0.4343 0.4885 0.4121 0.0209  -0.0440 -0.0835 265 ARG B O   
2917 C CB  . ARG B 77  ? 0.4092 0.4518 0.4056 0.0095  -0.0484 -0.0884 265 ARG B CB  
2918 C CG  . ARG B 77  ? 0.4742 0.5279 0.4589 0.0042  -0.0511 -0.0939 265 ARG B CG  
2919 C CD  . ARG B 77  ? 0.5295 0.5845 0.5141 -0.0060 -0.0549 -0.1016 265 ARG B CD  
2920 N NE  . ARG B 77  ? 0.5436 0.6110 0.5150 -0.0118 -0.0585 -0.1058 265 ARG B NE  
2921 C CZ  . ARG B 77  ? 0.5365 0.6017 0.4960 -0.0142 -0.0554 -0.1165 265 ARG B CZ  
2922 N NH1 . ARG B 77  ? 0.5489 0.6003 0.5108 -0.0102 -0.0484 -0.1246 265 ARG B NH1 
2923 N NH2 . ARG B 77  ? 0.5223 0.6002 0.4680 -0.0207 -0.0594 -0.1188 265 ARG B NH2 
2924 N N   . PHE B 78  ? 0.3869 0.4449 0.3777 0.0231  -0.0475 -0.0692 266 PHE B N   
2925 C CA  . PHE B 78  ? 0.3537 0.4228 0.3388 0.0254  -0.0495 -0.0632 266 PHE B CA  
2926 C C   . PHE B 78  ? 0.3669 0.4328 0.3521 0.0330  -0.0462 -0.0571 266 PHE B C   
2927 O O   . PHE B 78  ? 0.3284 0.3926 0.3202 0.0362  -0.0450 -0.0514 266 PHE B O   
2928 C CB  . PHE B 78  ? 0.3092 0.3901 0.3001 0.0227  -0.0543 -0.0573 266 PHE B CB  
2929 C CG  . PHE B 78  ? 0.3762 0.4636 0.3650 0.0141  -0.0591 -0.0628 266 PHE B CG  
2930 C CD1 . PHE B 78  ? 0.3973 0.4936 0.3755 0.0107  -0.0630 -0.0642 266 PHE B CD1 
2931 C CD2 . PHE B 78  ? 0.3966 0.4811 0.3929 0.0084  -0.0601 -0.0663 266 PHE B CD2 
2932 C CE1 . PHE B 78  ? 0.3920 0.4950 0.3664 0.0016  -0.0680 -0.0698 266 PHE B CE1 
2933 C CE2 . PHE B 78  ? 0.3824 0.4728 0.3764 -0.0007 -0.0648 -0.0722 266 PHE B CE2 
2934 C CZ  . PHE B 78  ? 0.3938 0.4938 0.3764 -0.0041 -0.0689 -0.0743 266 PHE B CZ  
2935 N N   . ARG B 79  ? 0.3225 0.3881 0.2994 0.0348  -0.0444 -0.0589 267 ARG B N   
2936 C CA  . ARG B 79  ? 0.3781 0.4408 0.3540 0.0407  -0.0416 -0.0540 267 ARG B CA  
2937 C C   . ARG B 79  ? 0.4078 0.4781 0.3765 0.0413  -0.0435 -0.0491 267 ARG B C   
2938 O O   . ARG B 79  ? 0.4006 0.4740 0.3601 0.0382  -0.0436 -0.0524 267 ARG B O   
2939 C CB  . ARG B 79  ? 0.3840 0.4388 0.3590 0.0425  -0.0373 -0.0597 267 ARG B CB  
2940 C CG  . ARG B 79  ? 0.4715 0.5172 0.4550 0.0429  -0.0359 -0.0631 267 ARG B CG  
2941 C CD  . ARG B 79  ? 0.5347 0.5745 0.5207 0.0476  -0.0327 -0.0630 267 ARG B CD  
2942 N NE  . ARG B 79  ? 0.6053 0.6372 0.5983 0.0481  -0.0309 -0.0694 267 ARG B NE  
2943 C CZ  . ARG B 79  ? 0.5872 0.6154 0.5847 0.0521  -0.0284 -0.0703 267 ARG B CZ  
2944 N NH1 . ARG B 79  ? 0.5346 0.5665 0.5289 0.0549  -0.0276 -0.0656 267 ARG B NH1 
2945 N NH2 . ARG B 79  ? 0.5436 0.5646 0.5502 0.0535  -0.0271 -0.0759 267 ARG B NH2 
2946 N N   . HIS B 80  ? 0.4113 0.4838 0.3841 0.0451  -0.0446 -0.0411 268 HIS B N   
2947 C CA  . HIS B 80  ? 0.3922 0.4714 0.3611 0.0458  -0.0478 -0.0347 268 HIS B CA  
2948 C C   . HIS B 80  ? 0.3876 0.4624 0.3601 0.0519  -0.0456 -0.0287 268 HIS B C   
2949 O O   . HIS B 80  ? 0.4249 0.4957 0.4044 0.0549  -0.0430 -0.0284 268 HIS B O   
2950 C CB  . HIS B 80  ? 0.3706 0.4605 0.3442 0.0432  -0.0537 -0.0316 268 HIS B CB  
2951 C CG  . HIS B 80  ? 0.3358 0.4338 0.3050 0.0427  -0.0589 -0.0246 268 HIS B CG  
2952 N ND1 . HIS B 80  ? 0.3109 0.4106 0.2871 0.0483  -0.0605 -0.0158 268 HIS B ND1 
2953 C CD2 . HIS B 80  ? 0.3474 0.4520 0.3057 0.0370  -0.0632 -0.0248 268 HIS B CD2 
2954 C CE1 . HIS B 80  ? 0.3794 0.4859 0.3504 0.0465  -0.0662 -0.0096 268 HIS B CE1 
2955 N NE2 . HIS B 80  ? 0.4172 0.5274 0.3762 0.0392  -0.0681 -0.0146 268 HIS B NE2 
2956 N N   . PRO B 81  ? 0.4089 0.4838 0.3758 0.0530  -0.0464 -0.0240 269 PRO B N   
2957 C CA  . PRO B 81  ? 0.3861 0.4555 0.3564 0.0583  -0.0445 -0.0187 269 PRO B CA  
2958 C C   . PRO B 81  ? 0.3905 0.4623 0.3723 0.0626  -0.0452 -0.0150 269 PRO B C   
2959 O O   . PRO B 81  ? 0.3538 0.4196 0.3398 0.0667  -0.0416 -0.0142 269 PRO B O   
2960 C CB  . PRO B 81  ? 0.4273 0.4983 0.3905 0.0573  -0.0473 -0.0128 269 PRO B CB  
2961 C CG  . PRO B 81  ? 0.4506 0.5260 0.4032 0.0510  -0.0479 -0.0174 269 PRO B CG  
2962 C CD  . PRO B 81  ? 0.4062 0.4859 0.3622 0.0484  -0.0489 -0.0237 269 PRO B CD  
2963 N N   . ASN B 82  ? 0.2922 0.3739 0.2792 0.0610  -0.0496 -0.0131 270 ASN B N   
2964 C CA  . ASN B 82  ? 0.3321 0.4197 0.3326 0.0646  -0.0502 -0.0099 270 ASN B CA  
2965 C C   . ASN B 82  ? 0.3450 0.4356 0.3519 0.0623  -0.0481 -0.0144 270 ASN B C   
2966 O O   . ASN B 82  ? 0.3336 0.4328 0.3522 0.0636  -0.0489 -0.0121 270 ASN B O   
2967 C CB  . ASN B 82  ? 0.3649 0.4635 0.3703 0.0647  -0.0573 -0.0030 270 ASN B CB  
2968 C CG  . ASN B 82  ? 0.3997 0.4939 0.4013 0.0679  -0.0592 0.0039  270 ASN B CG  
2969 O OD1 . ASN B 82  ? 0.4383 0.5355 0.4305 0.0639  -0.0641 0.0072  270 ASN B OD1 
2970 N ND2 . ASN B 82  ? 0.3759 0.4622 0.3840 0.0742  -0.0550 0.0057  270 ASN B ND2 
2971 N N   . ILE B 83  ? 0.2983 0.3827 0.2985 0.0587  -0.0458 -0.0203 271 ILE B N   
2972 C CA  . ILE B 83  ? 0.2533 0.3375 0.2586 0.0561  -0.0437 -0.0236 271 ILE B CA  
2973 C C   . ILE B 83  ? 0.3323 0.4057 0.3344 0.0579  -0.0383 -0.0256 271 ILE B C   
2974 O O   . ILE B 83  ? 0.3053 0.3715 0.3000 0.0588  -0.0373 -0.0271 271 ILE B O   
2975 C CB  . ILE B 83  ? 0.2908 0.3766 0.2928 0.0495  -0.0468 -0.0285 271 ILE B CB  
2976 C CG1 . ILE B 83  ? 0.3063 0.4049 0.3118 0.0464  -0.0529 -0.0263 271 ILE B CG1 
2977 C CG2 . ILE B 83  ? 0.3262 0.4080 0.3327 0.0464  -0.0445 -0.0316 271 ILE B CG2 
2978 C CD1 . ILE B 83  ? 0.2932 0.3937 0.2948 0.0387  -0.0562 -0.0323 271 ILE B CD1 
2979 N N   . VAL B 84  ? 0.2840 0.3576 0.2917 0.0577  -0.0352 -0.0252 272 VAL B N   
2980 C CA  . VAL B 84  ? 0.2956 0.3602 0.2992 0.0586  -0.0310 -0.0260 272 VAL B CA  
2981 C C   . VAL B 84  ? 0.3132 0.3696 0.3110 0.0563  -0.0321 -0.0291 272 VAL B C   
2982 O O   . VAL B 84  ? 0.3033 0.3603 0.3018 0.0529  -0.0347 -0.0319 272 VAL B O   
2983 C CB  . VAL B 84  ? 0.2957 0.3629 0.3045 0.0567  -0.0277 -0.0247 272 VAL B CB  
2984 C CG1 . VAL B 84  ? 0.2728 0.3484 0.2894 0.0601  -0.0249 -0.0227 272 VAL B CG1 
2985 C CG2 . VAL B 84  ? 0.2451 0.3153 0.2585 0.0510  -0.0301 -0.0254 272 VAL B CG2 
2986 N N   . ASP B 85  ? 0.2627 0.3117 0.2555 0.0581  -0.0301 -0.0291 273 ASP B N   
2987 C CA  . ASP B 85  ? 0.3337 0.3761 0.3237 0.0571  -0.0311 -0.0317 273 ASP B CA  
2988 C C   . ASP B 85  ? 0.3334 0.3710 0.3258 0.0547  -0.0311 -0.0307 273 ASP B C   
2989 O O   . ASP B 85  ? 0.4398 0.4747 0.4299 0.0548  -0.0296 -0.0278 273 ASP B O   
2990 C CB  . ASP B 85  ? 0.3339 0.3722 0.3188 0.0598  -0.0300 -0.0316 273 ASP B CB  
2991 C CG  . ASP B 85  ? 0.4926 0.5341 0.4748 0.0616  -0.0300 -0.0313 273 ASP B CG  
2992 O OD1 . ASP B 85  ? 0.5811 0.6250 0.5617 0.0605  -0.0315 -0.0335 273 ASP B OD1 
2993 O OD2 . ASP B 85  ? 0.5584 0.5996 0.5397 0.0638  -0.0285 -0.0289 273 ASP B OD2 
2994 N N   . PHE B 86  ? 0.3701 0.4058 0.3664 0.0519  -0.0330 -0.0332 274 PHE B N   
2995 C CA  . PHE B 86  ? 0.3715 0.4015 0.3715 0.0490  -0.0337 -0.0312 274 PHE B CA  
2996 C C   . PHE B 86  ? 0.3801 0.4017 0.3805 0.0508  -0.0348 -0.0310 274 PHE B C   
2997 O O   . PHE B 86  ? 0.3873 0.4066 0.3898 0.0525  -0.0354 -0.0357 274 PHE B O   
2998 C CB  . PHE B 86  ? 0.3293 0.3598 0.3347 0.0448  -0.0354 -0.0343 274 PHE B CB  
2999 C CG  . PHE B 86  ? 0.3517 0.3747 0.3618 0.0410  -0.0364 -0.0318 274 PHE B CG  
3000 C CD1 . PHE B 86  ? 0.3670 0.3921 0.3775 0.0379  -0.0352 -0.0257 274 PHE B CD1 
3001 C CD2 . PHE B 86  ? 0.3508 0.3645 0.3655 0.0403  -0.0381 -0.0355 274 PHE B CD2 
3002 C CE1 . PHE B 86  ? 0.3808 0.3985 0.3950 0.0334  -0.0363 -0.0220 274 PHE B CE1 
3003 C CE2 . PHE B 86  ? 0.4139 0.4189 0.4341 0.0367  -0.0396 -0.0322 274 PHE B CE2 
3004 C CZ  . PHE B 86  ? 0.3772 0.3840 0.3966 0.0329  -0.0390 -0.0247 274 PHE B CZ  
3005 N N   . ALA B 87  ? 0.3651 0.3836 0.3635 0.0502  -0.0350 -0.0255 275 ALA B N   
3006 C CA  . ALA B 87  ? 0.3772 0.3893 0.3768 0.0517  -0.0373 -0.0229 275 ALA B CA  
3007 C C   . ALA B 87  ? 0.3587 0.3626 0.3645 0.0492  -0.0402 -0.0191 275 ALA B C   
3008 O O   . ALA B 87  ? 0.3500 0.3488 0.3580 0.0503  -0.0432 -0.0150 275 ALA B O   
3009 C CB  . ALA B 87  ? 0.3993 0.4133 0.3910 0.0519  -0.0367 -0.0187 275 ALA B CB  
3010 N N   . GLY B 88  ? 0.3964 0.3991 0.4058 0.0454  -0.0399 -0.0197 276 GLY B N   
3011 C CA  . GLY B 88  ? 0.3937 0.3872 0.4092 0.0421  -0.0426 -0.0153 276 GLY B CA  
3012 C C   . GLY B 88  ? 0.3987 0.3926 0.4113 0.0358  -0.0422 -0.0080 276 GLY B C   
3013 O O   . GLY B 88  ? 0.3617 0.3649 0.3685 0.0338  -0.0388 -0.0074 276 GLY B O   
3014 N N   . TYR B 89  ? 0.3162 0.3000 0.3342 0.0326  -0.0453 -0.0025 277 TYR B N   
3015 C CA  . TYR B 89  ? 0.3475 0.3307 0.3645 0.0250  -0.0447 0.0041  277 TYR B CA  
3016 C C   . TYR B 89  ? 0.4066 0.3801 0.4232 0.0221  -0.0488 0.0152  277 TYR B C   
3017 O O   . TYR B 89  ? 0.4173 0.3820 0.4394 0.0264  -0.0532 0.0170  277 TYR B O   
3018 C CB  . TYR B 89  ? 0.3316 0.3114 0.3574 0.0212  -0.0446 -0.0008 277 TYR B CB  
3019 C CG  . TYR B 89  ? 0.3658 0.3300 0.4019 0.0224  -0.0486 -0.0019 277 TYR B CG  
3020 C CD1 . TYR B 89  ? 0.3835 0.3444 0.4248 0.0288  -0.0490 -0.0110 277 TYR B CD1 
3021 C CD2 . TYR B 89  ? 0.3885 0.3409 0.4296 0.0171  -0.0515 0.0063  277 TYR B CD2 
3022 C CE1 . TYR B 89  ? 0.3880 0.3344 0.4406 0.0307  -0.0516 -0.0133 277 TYR B CE1 
3023 C CE2 . TYR B 89  ? 0.4364 0.3729 0.4891 0.0190  -0.0551 0.0052  277 TYR B CE2 
3024 C CZ  . TYR B 89  ? 0.4385 0.3721 0.4976 0.0263  -0.0549 -0.0052 277 TYR B CZ  
3025 O OH  . TYR B 89  ? 0.4408 0.3585 0.5132 0.0289  -0.0574 -0.0076 277 TYR B OH  
3026 N N   . CYS B 90  ? 0.4438 0.4198 0.4545 0.0146  -0.0473 0.0231  278 CYS B N   
3027 C CA  . CYS B 90  ? 0.4186 0.3845 0.4289 0.0095  -0.0516 0.0352  278 CYS B CA  
3028 C C   . CYS B 90  ? 0.4434 0.4093 0.4546 -0.0002 -0.0492 0.0399  278 CYS B C   
3029 O O   . CYS B 90  ? 0.4490 0.4277 0.4532 -0.0046 -0.0435 0.0396  278 CYS B O   
3030 C CB  . CYS B 90  ? 0.4158 0.3861 0.4130 0.0088  -0.0528 0.0431  278 CYS B CB  
3031 S SG  . CYS B 90  ? 0.5681 0.5281 0.5614 0.0011  -0.0590 0.0605  278 CYS B SG  
3032 N N   . ALA B 91  ? 0.4513 0.4032 0.4728 -0.0034 -0.0531 0.0435  279 ALA B N   
3033 C CA  . ALA B 91  ? 0.4839 0.4340 0.5074 -0.0140 -0.0515 0.0492  279 ALA B CA  
3034 C C   . ALA B 91  ? 0.5850 0.5259 0.6038 -0.0212 -0.0553 0.0653  279 ALA B C   
3035 O O   . ALA B 91  ? 0.6402 0.5773 0.6614 -0.0307 -0.0546 0.0716  279 ALA B O   
3036 C CB  . ALA B 91  ? 0.4714 0.4117 0.5091 -0.0149 -0.0528 0.0418  279 ALA B CB  
3037 N N   . GLN B 92  ? 0.5708 0.5080 0.5836 -0.0172 -0.0600 0.0725  280 GLN B N   
3038 C CA  . GLN B 92  ? 0.6434 0.5704 0.6522 -0.0235 -0.0658 0.0893  280 GLN B CA  
3039 C C   . GLN B 92  ? 0.6415 0.5783 0.6350 -0.0354 -0.0613 0.0989  280 GLN B C   
3040 O O   . GLN B 92  ? 0.5716 0.5253 0.5534 -0.0365 -0.0543 0.0938  280 GLN B O   
3041 C CB  . GLN B 92  ? 0.7058 0.6300 0.7113 -0.0167 -0.0727 0.0949  280 GLN B CB  
3042 C CG  . GLN B 92  ? 0.8513 0.7626 0.8748 -0.0063 -0.0784 0.0900  280 GLN B CG  
3043 C CD  . GLN B 92  ? 0.9777 0.8898 0.9998 0.0006  -0.0850 0.0951  280 GLN B CD  
3044 O OE1 . GLN B 92  ? 1.0457 0.9622 1.0541 -0.0043 -0.0885 0.1071  280 GLN B OE1 
3045 N NE2 . GLN B 92  ? 1.0151 0.9241 1.0511 0.0113  -0.0868 0.0860  280 GLN B NE2 
3046 N N   . ASN B 93  ? 0.7504 0.6759 0.7449 -0.0445 -0.0651 0.1128  281 ASN B N   
3047 C CA  . ASN B 93  ? 0.7788 0.7113 0.7567 -0.0566 -0.0625 0.1258  281 ASN B CA  
3048 C C   . ASN B 93  ? 0.7555 0.7067 0.7267 -0.0638 -0.0511 0.1192  281 ASN B C   
3049 O O   . ASN B 93  ? 0.7823 0.7467 0.7363 -0.0700 -0.0459 0.1234  281 ASN B O   
3050 C CB  . ASN B 93  ? 0.8394 0.7772 0.8005 -0.0549 -0.0662 0.1327  281 ASN B CB  
3051 C CG  . ASN B 93  ? 0.9637 0.8978 0.9110 -0.0667 -0.0702 0.1522  281 ASN B CG  
3052 O OD1 . ASN B 93  ? 1.0016 0.9257 0.9539 -0.0754 -0.0716 0.1622  281 ASN B OD1 
3053 N ND2 . ASN B 93  ? 1.0176 0.9594 0.9465 -0.0680 -0.0726 0.1580  281 ASN B ND2 
3054 N N   . GLY B 94  ? 0.7013 0.6543 0.6866 -0.0630 -0.0471 0.1087  282 GLY B N   
3055 C CA  . GLY B 94  ? 0.7203 0.6919 0.7039 -0.0691 -0.0370 0.1027  282 GLY B CA  
3056 C C   . GLY B 94  ? 0.6963 0.6850 0.6775 -0.0602 -0.0308 0.0883  282 GLY B C   
3057 O O   . GLY B 94  ? 0.7163 0.7206 0.7013 -0.0624 -0.0230 0.0812  282 GLY B O   
3058 N N   . PHE B 95  ? 0.6450 0.6309 0.6212 -0.0502 -0.0346 0.0847  283 PHE B N   
3059 C CA  . PHE B 95  ? 0.6011 0.6003 0.5750 -0.0414 -0.0296 0.0719  283 PHE B CA  
3060 C C   . PHE B 95  ? 0.6111 0.6078 0.6005 -0.0331 -0.0314 0.0600  283 PHE B C   
3061 O O   . PHE B 95  ? 0.6386 0.6203 0.6367 -0.0296 -0.0383 0.0601  283 PHE B O   
3062 C CB  . PHE B 95  ? 0.6118 0.6097 0.5730 -0.0356 -0.0327 0.0731  283 PHE B CB  
3063 C CG  . PHE B 95  ? 0.7266 0.7311 0.6689 -0.0438 -0.0296 0.0819  283 PHE B CG  
3064 C CD1 . PHE B 95  ? 0.7902 0.7855 0.7257 -0.0527 -0.0348 0.0972  283 PHE B CD1 
3065 C CD2 . PHE B 95  ? 0.8207 0.8399 0.7512 -0.0430 -0.0216 0.0750  283 PHE B CD2 
3066 C CE1 . PHE B 95  ? 0.8417 0.8439 0.7571 -0.0615 -0.0322 0.1056  283 PHE B CE1 
3067 C CE2 . PHE B 95  ? 0.8758 0.9013 0.7869 -0.0514 -0.0181 0.0816  283 PHE B CE2 
3068 C CZ  . PHE B 95  ? 0.8647 0.8825 0.7672 -0.0611 -0.0234 0.0971  283 PHE B CZ  
3069 N N   . TYR B 96  ? 0.5405 0.5521 0.5333 -0.0302 -0.0252 0.0500  284 TYR B N   
3070 C CA  . TYR B 96  ? 0.4914 0.5030 0.4947 -0.0219 -0.0270 0.0387  284 TYR B CA  
3071 C C   . TYR B 96  ? 0.4472 0.4672 0.4439 -0.0130 -0.0245 0.0318  284 TYR B C   
3072 O O   . TYR B 96  ? 0.4446 0.4790 0.4386 -0.0129 -0.0177 0.0284  284 TYR B O   
3073 C CB  . TYR B 96  ? 0.5261 0.5478 0.5410 -0.0260 -0.0238 0.0335  284 TYR B CB  
3074 C CG  . TYR B 96  ? 0.5911 0.6031 0.6144 -0.0351 -0.0268 0.0386  284 TYR B CG  
3075 C CD1 . TYR B 96  ? 0.6552 0.6731 0.6782 -0.0462 -0.0227 0.0465  284 TYR B CD1 
3076 C CD2 . TYR B 96  ? 0.5755 0.5721 0.6075 -0.0332 -0.0332 0.0350  284 TYR B CD2 
3077 C CE1 . TYR B 96  ? 0.6878 0.6956 0.7189 -0.0555 -0.0257 0.0516  284 TYR B CE1 
3078 C CE2 . TYR B 96  ? 0.5714 0.5570 0.6117 -0.0418 -0.0359 0.0388  284 TYR B CE2 
3079 C CZ  . TYR B 96  ? 0.6558 0.6465 0.6957 -0.0532 -0.0325 0.0476  284 TYR B CZ  
3080 O OH  . TYR B 96  ? 0.6836 0.6623 0.7321 -0.0627 -0.0354 0.0519  284 TYR B OH  
3081 N N   . CYS B 97  ? 0.4129 0.4236 0.4083 -0.0055 -0.0296 0.0295  285 CYS B N   
3082 C CA  . CYS B 97  ? 0.3365 0.3530 0.3253 0.0022  -0.0278 0.0238  285 CYS B CA  
3083 C C   . CYS B 97  ? 0.3756 0.3903 0.3722 0.0102  -0.0303 0.0147  285 CYS B C   
3084 O O   . CYS B 97  ? 0.4259 0.4300 0.4294 0.0118  -0.0353 0.0137  285 CYS B O   
3085 C CB  . CYS B 97  ? 0.4033 0.4137 0.3809 0.0027  -0.0311 0.0300  285 CYS B CB  
3086 S SG  . CYS B 97  ? 0.6232 0.6390 0.5857 -0.0072 -0.0270 0.0398  285 CYS B SG  
3087 N N   . LEU B 98  ? 0.3348 0.3597 0.3301 0.0149  -0.0265 0.0081  286 LEU B N   
3088 C CA  . LEU B 98  ? 0.3205 0.3455 0.3203 0.0218  -0.0283 0.0003  286 LEU B CA  
3089 C C   . LEU B 98  ? 0.3571 0.3841 0.3487 0.0275  -0.0270 -0.0018 286 LEU B C   
3090 O O   . LEU B 98  ? 0.3453 0.3796 0.3311 0.0272  -0.0222 -0.0016 286 LEU B O   
3091 C CB  . LEU B 98  ? 0.3942 0.4299 0.4018 0.0214  -0.0261 -0.0047 286 LEU B CB  
3092 C CG  . LEU B 98  ? 0.4629 0.4977 0.4789 0.0143  -0.0275 -0.0031 286 LEU B CG  
3093 C CD1 . LEU B 98  ? 0.4389 0.4881 0.4626 0.0126  -0.0251 -0.0063 286 LEU B CD1 
3094 C CD2 . LEU B 98  ? 0.4642 0.4866 0.4846 0.0149  -0.0328 -0.0064 286 LEU B CD2 
3095 N N   . VAL B 99  ? 0.3222 0.3429 0.3141 0.0324  -0.0307 -0.0043 287 VAL B N   
3096 C CA  . VAL B 99  ? 0.3414 0.3629 0.3261 0.0368  -0.0301 -0.0059 287 VAL B CA  
3097 C C   . VAL B 99  ? 0.3577 0.3833 0.3453 0.0421  -0.0292 -0.0128 287 VAL B C   
3098 O O   . VAL B 99  ? 0.3247 0.3490 0.3187 0.0431  -0.0312 -0.0162 287 VAL B O   
3099 C CB  . VAL B 99  ? 0.3536 0.3666 0.3367 0.0379  -0.0351 -0.0025 287 VAL B CB  
3100 C CG1 . VAL B 99  ? 0.3104 0.3254 0.2853 0.0405  -0.0347 -0.0035 287 VAL B CG1 
3101 C CG2 . VAL B 99  ? 0.3423 0.3503 0.3236 0.0322  -0.0376 0.0062  287 VAL B CG2 
3102 N N   . TYR B 100 ? 0.2833 0.3133 0.2656 0.0448  -0.0260 -0.0147 288 TYR B N   
3103 C CA  . TYR B 100 ? 0.3177 0.3509 0.3019 0.0494  -0.0255 -0.0195 288 TYR B CA  
3104 C C   . TYR B 100 ? 0.3353 0.3663 0.3127 0.0523  -0.0246 -0.0207 288 TYR B C   
3105 O O   . TYR B 100 ? 0.3686 0.3982 0.3391 0.0505  -0.0231 -0.0189 288 TYR B O   
3106 C CB  . TYR B 100 ? 0.3021 0.3441 0.2907 0.0500  -0.0221 -0.0207 288 TYR B CB  
3107 C CG  . TYR B 100 ? 0.3335 0.3804 0.3292 0.0459  -0.0222 -0.0193 288 TYR B CG  
3108 C CD1 . TYR B 100 ? 0.3368 0.3860 0.3319 0.0414  -0.0191 -0.0159 288 TYR B CD1 
3109 C CD2 . TYR B 100 ? 0.3120 0.3622 0.3144 0.0456  -0.0251 -0.0216 288 TYR B CD2 
3110 C CE1 . TYR B 100 ? 0.3732 0.4274 0.3756 0.0367  -0.0189 -0.0143 288 TYR B CE1 
3111 C CE2 . TYR B 100 ? 0.2937 0.3488 0.3031 0.0409  -0.0255 -0.0207 288 TYR B CE2 
3112 C CZ  . TYR B 100 ? 0.3406 0.3977 0.3508 0.0365  -0.0224 -0.0169 288 TYR B CZ  
3113 O OH  . TYR B 100 ? 0.3744 0.4367 0.3924 0.0308  -0.0227 -0.0156 288 TYR B OH  
3114 N N   . GLY B 101 ? 0.3240 0.3550 0.3025 0.0558  -0.0255 -0.0237 289 GLY B N   
3115 C CA  . GLY B 101 ? 0.3294 0.3586 0.3026 0.0579  -0.0243 -0.0250 289 GLY B CA  
3116 C C   . GLY B 101 ? 0.3603 0.3921 0.3316 0.0586  -0.0196 -0.0257 289 GLY B C   
3117 O O   . GLY B 101 ? 0.3628 0.4001 0.3400 0.0598  -0.0178 -0.0259 289 GLY B O   
3118 N N   . PHE B 102 ? 0.4014 0.4300 0.3652 0.0576  -0.0176 -0.0264 290 PHE B N   
3119 C CA  . PHE B 102 ? 0.4005 0.4306 0.3622 0.0581  -0.0119 -0.0287 290 PHE B CA  
3120 C C   . PHE B 102 ? 0.4020 0.4319 0.3689 0.0632  -0.0101 -0.0311 290 PHE B C   
3121 O O   . PHE B 102 ? 0.4328 0.4581 0.3983 0.0646  -0.0123 -0.0316 290 PHE B O   
3122 C CB  . PHE B 102 ? 0.4177 0.4436 0.3680 0.0547  -0.0105 -0.0300 290 PHE B CB  
3123 C CG  . PHE B 102 ? 0.3792 0.4065 0.3258 0.0542  -0.0033 -0.0340 290 PHE B CG  
3124 C CD1 . PHE B 102 ? 0.3819 0.4153 0.3289 0.0517  0.0009  -0.0332 290 PHE B CD1 
3125 C CD2 . PHE B 102 ? 0.4109 0.4329 0.3537 0.0557  -0.0002 -0.0390 290 PHE B CD2 
3126 C CE1 . PHE B 102 ? 0.3858 0.4217 0.3298 0.0512  0.0089  -0.0380 290 PHE B CE1 
3127 C CE2 . PHE B 102 ? 0.4420 0.4646 0.3819 0.0556  0.0074  -0.0443 290 PHE B CE2 
3128 C CZ  . PHE B 102 ? 0.3803 0.4105 0.3209 0.0535  0.0124  -0.0441 290 PHE B CZ  
3129 N N   . LEU B 103 ? 0.4576 0.4929 0.4318 0.0657  -0.0062 -0.0318 291 LEU B N   
3130 C CA  . LEU B 103 ? 0.4250 0.4598 0.4061 0.0711  -0.0050 -0.0328 291 LEU B CA  
3131 C C   . LEU B 103 ? 0.4428 0.4756 0.4240 0.0730  0.0021  -0.0372 291 LEU B C   
3132 O O   . LEU B 103 ? 0.4189 0.4589 0.4065 0.0739  0.0070  -0.0384 291 LEU B O   
3133 C CB  . LEU B 103 ? 0.3647 0.4083 0.3574 0.0735  -0.0073 -0.0297 291 LEU B CB  
3134 C CG  . LEU B 103 ? 0.3548 0.3999 0.3464 0.0710  -0.0136 -0.0272 291 LEU B CG  
3135 C CD1 . LEU B 103 ? 0.3063 0.3615 0.3076 0.0708  -0.0157 -0.0251 291 LEU B CD1 
3136 C CD2 . LEU B 103 ? 0.3145 0.3544 0.3027 0.0724  -0.0171 -0.0264 291 LEU B CD2 
3137 N N   . PRO B 104 ? 0.4379 0.4612 0.4129 0.0735  0.0033  -0.0403 292 PRO B N   
3138 C CA  . PRO B 104 ? 0.4475 0.4662 0.4181 0.0733  0.0103  -0.0467 292 PRO B CA  
3139 C C   . PRO B 104 ? 0.4608 0.4821 0.4439 0.0794  0.0168  -0.0498 292 PRO B C   
3140 O O   . PRO B 104 ? 0.4840 0.5050 0.4644 0.0786  0.0244  -0.0561 292 PRO B O   
3141 C CB  . PRO B 104 ? 0.4271 0.4341 0.3904 0.0723  0.0082  -0.0485 292 PRO B CB  
3142 C CG  . PRO B 104 ? 0.4667 0.4746 0.4272 0.0698  0.0006  -0.0432 292 PRO B CG  
3143 C CD  . PRO B 104 ? 0.4399 0.4564 0.4105 0.0728  -0.0021 -0.0385 292 PRO B CD  
3144 N N   . ASN B 105 ? 0.4482 0.4727 0.4451 0.0852  0.0139  -0.0456 293 ASN B N   
3145 C CA  . ASN B 105 ? 0.4386 0.4663 0.4509 0.0921  0.0193  -0.0478 293 ASN B CA  
3146 C C   . ASN B 105 ? 0.4057 0.4489 0.4291 0.0928  0.0221  -0.0467 293 ASN B C   
3147 O O   . ASN B 105 ? 0.4346 0.4837 0.4740 0.0990  0.0265  -0.0481 293 ASN B O   
3148 C CB  . ASN B 105 ? 0.4740 0.4976 0.4971 0.0983  0.0142  -0.0426 293 ASN B CB  
3149 C CG  . ASN B 105 ? 0.5634 0.5713 0.5841 0.1005  0.0165  -0.0463 293 ASN B CG  
3150 O OD1 . ASN B 105 ? 0.6275 0.6303 0.6490 0.1020  0.0245  -0.0542 293 ASN B OD1 
3151 N ND2 . ASN B 105 ? 0.5456 0.5456 0.5629 0.1001  0.0100  -0.0411 293 ASN B ND2 
3152 N N   . GLY B 106 ? 0.3842 0.4340 0.4005 0.0866  0.0196  -0.0441 294 GLY B N   
3153 C CA  . GLY B 106 ? 0.3559 0.4199 0.3806 0.0850  0.0229  -0.0434 294 GLY B CA  
3154 C C   . GLY B 106 ? 0.3787 0.4542 0.4212 0.0890  0.0184  -0.0381 294 GLY B C   
3155 O O   . GLY B 106 ? 0.4078 0.4810 0.4519 0.0907  0.0103  -0.0332 294 GLY B O   
3156 N N   . SER B 107 ? 0.3410 0.4301 0.3968 0.0899  0.0237  -0.0390 295 SER B N   
3157 C CA  . SER B 107 ? 0.3964 0.4995 0.4699 0.0922  0.0190  -0.0338 295 SER B CA  
3158 C C   . SER B 107 ? 0.4329 0.5399 0.5260 0.1020  0.0199  -0.0333 295 SER B C   
3159 O O   . SER B 107 ? 0.4826 0.5854 0.5801 0.1069  0.0281  -0.0390 295 SER B O   
3160 C CB  . SER B 107 ? 0.3942 0.5123 0.4740 0.0869  0.0234  -0.0340 295 SER B CB  
3161 O OG  . SER B 107 ? 0.4279 0.5525 0.5160 0.0895  0.0347  -0.0397 295 SER B OG  
3162 N N   . LEU B 108 ? 0.4056 0.5198 0.5101 0.1046  0.0110  -0.0264 296 LEU B N   
3163 C CA  . LEU B 108 ? 0.4094 0.5297 0.5357 0.1139  0.0099  -0.0234 296 LEU B CA  
3164 C C   . LEU B 108 ? 0.4580 0.5918 0.6038 0.1181  0.0199  -0.0281 296 LEU B C   
3165 O O   . LEU B 108 ? 0.5096 0.6427 0.6715 0.1272  0.0243  -0.0300 296 LEU B O   
3166 C CB  . LEU B 108 ? 0.3804 0.5110 0.5152 0.1136  -0.0021 -0.0144 296 LEU B CB  
3167 C CG  . LEU B 108 ? 0.3674 0.5071 0.5269 0.1231  -0.0056 -0.0089 296 LEU B CG  
3168 C CD1 . LEU B 108 ? 0.3512 0.4738 0.5099 0.1305  -0.0051 -0.0083 296 LEU B CD1 
3169 C CD2 . LEU B 108 ? 0.3453 0.4973 0.5101 0.1205  -0.0183 0.0002  296 LEU B CD2 
3170 N N   . GLU B 109 ? 0.4055 0.5513 0.5504 0.1111  0.0241  -0.0300 297 GLU B N   
3171 C CA  . GLU B 109 ? 0.4758 0.6369 0.6380 0.1132  0.0348  -0.0348 297 GLU B CA  
3172 C C   . GLU B 109 ? 0.4718 0.6232 0.6297 0.1168  0.0476  -0.0446 297 GLU B C   
3173 O O   . GLU B 109 ? 0.4444 0.6035 0.6228 0.1247  0.0556  -0.0489 297 GLU B O   
3174 C CB  . GLU B 109 ? 0.5524 0.7253 0.7094 0.1027  0.0370  -0.0346 297 GLU B CB  
3175 C CG  . GLU B 109 ? 0.6401 0.8312 0.8144 0.1030  0.0490  -0.0392 297 GLU B CG  
3176 C CD  . GLU B 109 ? 0.7002 0.8980 0.8631 0.0909  0.0530  -0.0395 297 GLU B CD  
3177 O OE1 . GLU B 109 ? 0.7079 0.8913 0.8456 0.0842  0.0543  -0.0413 297 GLU B OE1 
3178 O OE2 . GLU B 109 ? 0.7137 0.9313 0.8935 0.0877  0.0544  -0.0372 297 GLU B OE2 
3179 N N   . ASP B 110 ? 0.5373 0.6723 0.6692 0.1110  0.0493  -0.0484 298 ASP B N   
3180 C CA  . ASP B 110 ? 0.5394 0.6640 0.6629 0.1125  0.0606  -0.0585 298 ASP B CA  
3181 C C   . ASP B 110 ? 0.5224 0.6337 0.6545 0.1227  0.0602  -0.0606 298 ASP B C   
3182 O O   . ASP B 110 ? 0.5518 0.6607 0.6923 0.1282  0.0708  -0.0694 298 ASP B O   
3183 C CB  . ASP B 110 ? 0.5797 0.6912 0.6729 0.1028  0.0606  -0.0608 298 ASP B CB  
3184 C CG  . ASP B 110 ? 0.6580 0.7803 0.7420 0.0926  0.0634  -0.0596 298 ASP B CG  
3185 O OD1 . ASP B 110 ? 0.6734 0.8131 0.7728 0.0925  0.0697  -0.0604 298 ASP B OD1 
3186 O OD2 . ASP B 110 ? 0.7354 0.8489 0.7976 0.0846  0.0592  -0.0575 298 ASP B OD2 
3187 N N   . ARG B 111 ? 0.4737 0.5761 0.6038 0.1247  0.0482  -0.0527 299 ARG B N   
3188 C CA  . ARG B 111 ? 0.5398 0.6279 0.6772 0.1333  0.0463  -0.0525 299 ARG B CA  
3189 C C   . ARG B 111 ? 0.5637 0.6625 0.7330 0.1446  0.0482  -0.0508 299 ARG B C   
3190 O O   . ARG B 111 ? 0.6465 0.7350 0.8268 0.1529  0.0532  -0.0553 299 ARG B O   
3191 C CB  . ARG B 111 ? 0.5823 0.6603 0.7089 0.1314  0.0331  -0.0432 299 ARG B CB  
3192 C CG  . ARG B 111 ? 0.6783 0.7390 0.7781 0.1242  0.0324  -0.0464 299 ARG B CG  
3193 C CD  . ARG B 111 ? 0.7862 0.8318 0.8823 0.1269  0.0415  -0.0562 299 ARG B CD  
3194 N NE  . ARG B 111 ? 0.8676 0.8945 0.9485 0.1244  0.0365  -0.0551 299 ARG B NE  
3195 C CZ  . ARG B 111 ? 0.9047 0.9186 0.9937 0.1306  0.0341  -0.0530 299 ARG B CZ  
3196 N NH1 . ARG B 111 ? 0.9084 0.9255 1.0216 0.1406  0.0359  -0.0514 299 ARG B NH1 
3197 N NH2 . ARG B 111 ? 0.9359 0.9341 1.0104 0.1267  0.0299  -0.0519 299 ARG B NH2 
3198 N N   . LEU B 112 ? 0.5211 0.6406 0.7066 0.1449  0.0438  -0.0442 300 LEU B N   
3199 C CA  . LEU B 112 ? 0.5645 0.6980 0.7833 0.1555  0.0447  -0.0416 300 LEU B CA  
3200 C C   . LEU B 112 ? 0.6578 0.7998 0.8914 0.1597  0.0609  -0.0532 300 LEU B C   
3201 O O   . LEU B 112 ? 0.6986 0.8369 0.9526 0.1705  0.0667  -0.0573 300 LEU B O   
3202 C CB  . LEU B 112 ? 0.5109 0.6662 0.7424 0.1530  0.0349  -0.0316 300 LEU B CB  
3203 C CG  . LEU B 112 ? 0.4729 0.6251 0.6998 0.1519  0.0184  -0.0192 300 LEU B CG  
3204 C CD1 . LEU B 112 ? 0.4397 0.6152 0.6787 0.1480  0.0103  -0.0118 300 LEU B CD1 
3205 C CD2 . LEU B 112 ? 0.4545 0.5971 0.6968 0.1630  0.0136  -0.0137 300 LEU B CD2 
3206 N N   . HIS B 113 ? 0.6617 0.8147 0.8851 0.1508  0.0686  -0.0586 301 HIS B N   
3207 C CA  . HIS B 113 ? 0.7174 0.8852 0.9568 0.1533  0.0839  -0.0683 301 HIS B CA  
3208 C C   . HIS B 113 ? 0.8500 1.0044 1.0704 0.1502  0.0981  -0.0823 301 HIS B C   
3209 O O   . HIS B 113 ? 0.9215 1.0719 1.1560 0.1588  0.1088  -0.0918 301 HIS B O   
3210 C CB  . HIS B 113 ? 0.6537 0.8448 0.8959 0.1446  0.0845  -0.0650 301 HIS B CB  
3211 C CG  . HIS B 113 ? 0.6254 0.8304 0.8835 0.1454  0.0702  -0.0522 301 HIS B CG  
3212 N ND1 . HIS B 113 ? 0.6188 0.8344 0.9089 0.1568  0.0653  -0.0468 301 HIS B ND1 
3213 C CD2 . HIS B 113 ? 0.6123 0.8223 0.8588 0.1359  0.0593  -0.0440 301 HIS B CD2 
3214 C CE1 . HIS B 113 ? 0.6241 0.8516 0.9199 0.1534  0.0517  -0.0357 301 HIS B CE1 
3215 N NE2 . HIS B 113 ? 0.6100 0.8338 0.8794 0.1407  0.0483  -0.0346 301 HIS B NE2 
3216 N N   . CYS B 114 ? 0.7862 0.9337 0.9751 0.1379  0.0979  -0.0835 302 CYS B N   
3217 C CA  . CYS B 114 ? 0.8924 1.0302 1.0598 0.1322  0.1104  -0.0960 302 CYS B CA  
3218 C C   . CYS B 114 ? 0.9907 1.1065 1.1551 0.1390  0.1140  -0.1043 302 CYS B C   
3219 O O   . CYS B 114 ? 1.0357 1.1500 1.2046 0.1421  0.1282  -0.1174 302 CYS B O   
3220 C CB  . CYS B 114 ? 0.8702 1.0018 1.0043 0.1184  0.1052  -0.0926 302 CYS B CB  
3221 S SG  . CYS B 114 ? 1.1867 1.3087 1.2910 0.1091  0.1185  -0.1060 302 CYS B SG  
3222 N N   . GLN B 115 ? 0.9268 1.0255 1.0838 0.1406  0.1015  -0.0972 303 GLN B N   
3223 C CA  . GLN B 115 ? 0.9733 1.0489 1.1246 0.1449  0.1033  -0.1039 303 GLN B CA  
3224 C C   . GLN B 115 ? 1.0112 1.0844 1.1947 0.1596  0.1050  -0.1044 303 GLN B C   
3225 O O   . GLN B 115 ? 1.0429 1.1140 1.2385 0.1656  0.1183  -0.1168 303 GLN B O   
3226 C CB  . GLN B 115 ? 0.9715 1.0306 1.1015 0.1396  0.0898  -0.0957 303 GLN B CB  
3227 C CG  . GLN B 115 ? 0.9893 1.0521 1.0923 0.1265  0.0856  -0.0926 303 GLN B CG  
3228 C CD  . GLN B 115 ? 1.0092 1.0568 1.0935 0.1219  0.0735  -0.0857 303 GLN B CD  
3229 O OE1 . GLN B 115 ? 1.0512 1.0821 1.1354 0.1257  0.0711  -0.0867 303 GLN B OE1 
3230 N NE2 . GLN B 115 ? 0.9682 1.0216 1.0380 0.1135  0.0662  -0.0788 303 GLN B NE2 
3231 N N   . CYS B 119 ? 1.3018 1.2571 1.3986 0.1432  0.1031  -0.1328 307 CYS B N   
3232 C CA  . CYS B 119 ? 1.2673 1.2277 1.3668 0.1436  0.0880  -0.1149 307 CYS B CA  
3233 C C   . CYS B 119 ? 1.2020 1.1699 1.3337 0.1565  0.0846  -0.1057 307 CYS B C   
3234 O O   . CYS B 119 ? 1.2169 1.2046 1.3645 0.1608  0.0888  -0.1054 307 CYS B O   
3235 C CB  . CYS B 119 ? 1.2697 1.2480 1.3525 0.1343  0.0834  -0.1090 307 CYS B CB  
3236 S SG  . CYS B 119 ? 1.0655 1.0504 1.1492 0.1334  0.0662  -0.0897 307 CYS B SG  
3237 N N   . PRO B 120 ? 1.1644 1.1174 1.3060 0.1620  0.0763  -0.0972 308 PRO B N   
3238 C CA  . PRO B 120 ? 1.0460 1.0038 1.2186 0.1745  0.0713  -0.0869 308 PRO B CA  
3239 C C   . PRO B 120 ? 0.8841 0.8658 1.0627 0.1741  0.0621  -0.0736 308 PRO B C   
3240 O O   . PRO B 120 ? 0.8492 0.8370 1.0064 0.1642  0.0556  -0.0687 308 PRO B O   
3241 C CB  . PRO B 120 ? 1.0601 0.9953 1.2314 0.1757  0.0622  -0.0787 308 PRO B CB  
3242 C CG  . PRO B 120 ? 1.0809 1.0078 1.2199 0.1624  0.0586  -0.0798 308 PRO B CG  
3243 C CD  . PRO B 120 ? 1.1292 1.0608 1.2525 0.1557  0.0701  -0.0955 308 PRO B CD  
3244 N N   . PRO B 121 ? 0.8319 0.8272 1.0407 0.1848  0.0614  -0.0682 309 PRO B N   
3245 C CA  . PRO B 121 ? 0.7650 0.7842 0.9811 0.1839  0.0525  -0.0564 309 PRO B CA  
3246 C C   . PRO B 121 ? 0.7593 0.7748 0.9654 0.1801  0.0365  -0.0407 309 PRO B C   
3247 O O   . PRO B 121 ? 0.7782 0.7733 0.9738 0.1787  0.0323  -0.0380 309 PRO B O   
3248 C CB  . PRO B 121 ? 0.7537 0.7854 1.0075 0.1974  0.0553  -0.0546 309 PRO B CB  
3249 C CG  . PRO B 121 ? 0.7923 0.8013 1.0593 0.2067  0.0596  -0.0589 309 PRO B CG  
3250 C CD  . PRO B 121 ? 0.8243 0.8136 1.0635 0.1983  0.0685  -0.0729 309 PRO B CD  
3251 N N   . LEU B 122 ? 0.7031 0.7386 0.9124 0.1777  0.0279  -0.0309 310 LEU B N   
3252 C CA  . LEU B 122 ? 0.6494 0.6840 0.8488 0.1735  0.0133  -0.0168 310 LEU B CA  
3253 C C   . LEU B 122 ? 0.6399 0.6718 0.8627 0.1835  0.0050  -0.0048 310 LEU B C   
3254 O O   . LEU B 122 ? 0.6625 0.7099 0.9125 0.1919  0.0041  -0.0011 310 LEU B O   
3255 C CB  . LEU B 122 ? 0.6408 0.6970 0.8338 0.1663  0.0073  -0.0119 310 LEU B CB  
3256 C CG  . LEU B 122 ? 0.6326 0.6906 0.8010 0.1554  0.0126  -0.0205 310 LEU B CG  
3257 C CD1 . LEU B 122 ? 0.6377 0.7166 0.8054 0.1497  0.0071  -0.0157 310 LEU B CD1 
3258 C CD2 . LEU B 122 ? 0.5921 0.6318 0.7337 0.1480  0.0096  -0.0208 310 LEU B CD2 
3259 N N   . SER B 123 ? 0.6126 0.6252 0.8258 0.1825  -0.0014 0.0021  311 SER B N   
3260 C CA  . SER B 123 ? 0.5955 0.6038 0.8280 0.1906  -0.0111 0.0161  311 SER B CA  
3261 C C   . SER B 123 ? 0.6117 0.6412 0.8470 0.1881  -0.0244 0.0301  311 SER B C   
3262 O O   . SER B 123 ? 0.6388 0.6800 0.8551 0.1784  -0.0267 0.0291  311 SER B O   
3263 C CB  . SER B 123 ? 0.6099 0.5925 0.8279 0.1877  -0.0150 0.0209  311 SER B CB  
3264 O OG  . SER B 123 ? 0.6637 0.6478 0.8543 0.1758  -0.0225 0.0266  311 SER B OG  
3265 N N   . TRP B 124 ? 0.6152 0.6494 0.8744 0.1968  -0.0333 0.0432  312 TRP B N   
3266 C CA  . TRP B 124 ? 0.6278 0.6835 0.8910 0.1943  -0.0468 0.0569  312 TRP B CA  
3267 C C   . TRP B 124 ? 0.6511 0.7040 0.8832 0.1818  -0.0566 0.0648  312 TRP B C   
3268 O O   . TRP B 124 ? 0.6646 0.7358 0.8873 0.1744  -0.0625 0.0672  312 TRP B O   
3269 C CB  . TRP B 124 ? 0.6471 0.7066 0.9422 0.2063  -0.0557 0.0709  312 TRP B CB  
3270 C CG  . TRP B 124 ? 0.6884 0.7549 1.0082 0.2158  -0.0457 0.0610  312 TRP B CG  
3271 C CD1 . TRP B 124 ? 0.7001 0.7490 1.0311 0.2242  -0.0369 0.0541  312 TRP B CD1 
3272 C CD2 . TRP B 124 ? 0.6993 0.7927 1.0345 0.2170  -0.0427 0.0563  312 TRP B CD2 
3273 N NE1 . TRP B 124 ? 0.6921 0.7560 1.0441 0.2309  -0.0285 0.0454  312 TRP B NE1 
3274 C CE2 . TRP B 124 ? 0.7060 0.7977 1.0615 0.2265  -0.0318 0.0468  312 TRP B CE2 
3275 C CE3 . TRP B 124 ? 0.6710 0.7899 1.0052 0.2103  -0.0482 0.0591  312 TRP B CE3 
3276 C CZ2 . TRP B 124 ? 0.7074 0.8231 1.0822 0.2296  -0.0260 0.0406  312 TRP B CZ2 
3277 C CZ3 . TRP B 124 ? 0.6781 0.8198 1.0319 0.2131  -0.0428 0.0529  312 TRP B CZ3 
3278 C CH2 . TRP B 124 ? 0.7027 0.8431 1.0767 0.2227  -0.0316 0.0440  312 TRP B CH2 
3279 N N   . PRO B 125 ? 0.6365 0.6668 0.8529 0.1789  -0.0578 0.0681  313 PRO B N   
3280 C CA  . PRO B 125 ? 0.6038 0.6333 0.7899 0.1662  -0.0645 0.0728  313 PRO B CA  
3281 C C   . PRO B 125 ? 0.6226 0.6583 0.7873 0.1569  -0.0573 0.0595  313 PRO B C   
3282 O O   . PRO B 125 ? 0.6494 0.6960 0.7972 0.1479  -0.0634 0.0625  313 PRO B O   
3283 C CB  . PRO B 125 ? 0.6228 0.6263 0.7987 0.1652  -0.0638 0.0760  313 PRO B CB  
3284 C CG  . PRO B 125 ? 0.6296 0.6237 0.8345 0.1780  -0.0645 0.0820  313 PRO B CG  
3285 C CD  . PRO B 125 ? 0.6335 0.6401 0.8610 0.1866  -0.0557 0.0707  313 PRO B CD  
3286 N N   . GLN B 126 ? 0.6095 0.6380 0.7747 0.1587  -0.0447 0.0451  314 GLN B N   
3287 C CA  . GLN B 126 ? 0.5710 0.6048 0.7178 0.1504  -0.0382 0.0334  314 GLN B CA  
3288 C C   . GLN B 126 ? 0.5566 0.6145 0.7100 0.1487  -0.0409 0.0336  314 GLN B C   
3289 O O   . GLN B 126 ? 0.5543 0.6197 0.6904 0.1396  -0.0436 0.0323  314 GLN B O   
3290 C CB  . GLN B 126 ? 0.5715 0.5944 0.7188 0.1528  -0.0247 0.0189  314 GLN B CB  
3291 C CG  . GLN B 126 ? 0.5864 0.5859 0.7186 0.1498  -0.0212 0.0152  314 GLN B CG  
3292 C CD  . GLN B 126 ? 0.6205 0.6095 0.7550 0.1525  -0.0085 0.0008  314 GLN B CD  
3293 O OE1 . GLN B 126 ? 0.6623 0.6593 0.8143 0.1592  -0.0018 -0.0051 314 GLN B OE1 
3294 N NE2 . GLN B 126 ? 0.6248 0.5970 0.7414 0.1467  -0.0048 -0.0052 314 GLN B NE2 
3295 N N   . ARG B 127 ? 0.5013 0.5711 0.6814 0.1573  -0.0401 0.0350  315 ARG B N   
3296 C CA  . ARG B 127 ? 0.4959 0.5899 0.6862 0.1558  -0.0431 0.0359  315 ARG B CA  
3297 C C   . ARG B 127 ? 0.5005 0.6049 0.6814 0.1491  -0.0569 0.0473  315 ARG B C   
3298 O O   . ARG B 127 ? 0.4969 0.6143 0.6683 0.1410  -0.0592 0.0450  315 ARG B O   
3299 C CB  . ARG B 127 ? 0.5067 0.6125 0.7309 0.1672  -0.0409 0.0374  315 ARG B CB  
3300 C CG  . ARG B 127 ? 0.5563 0.6554 0.7895 0.1728  -0.0255 0.0238  315 ARG B CG  
3301 C CD  . ARG B 127 ? 0.5570 0.6624 0.8257 0.1863  -0.0228 0.0255  315 ARG B CD  
3302 N NE  . ARG B 127 ? 0.5954 0.6927 0.8701 0.1910  -0.0066 0.0107  315 ARG B NE  
3303 C CZ  . ARG B 127 ? 0.5884 0.7023 0.8799 0.1939  0.0033  0.0022  315 ARG B CZ  
3304 N NH1 . ARG B 127 ? 0.5489 0.6885 0.8551 0.1929  -0.0018 0.0076  315 ARG B NH1 
3305 N NH2 . ARG B 127 ? 0.5975 0.7029 0.8911 0.1972  0.0185  -0.0120 315 ARG B NH2 
3306 N N   . LEU B 128 ? 0.5060 0.6034 0.6885 0.1517  -0.0660 0.0594  316 LEU B N   
3307 C CA  . LEU B 128 ? 0.5643 0.6708 0.7354 0.1446  -0.0793 0.0707  316 LEU B CA  
3308 C C   . LEU B 128 ? 0.5435 0.6450 0.6831 0.1325  -0.0781 0.0649  316 LEU B C   
3309 O O   . LEU B 128 ? 0.5170 0.6324 0.6473 0.1246  -0.0837 0.0654  316 LEU B O   
3310 C CB  . LEU B 128 ? 0.6194 0.7164 0.7953 0.1490  -0.0883 0.0853  316 LEU B CB  
3311 C CG  . LEU B 128 ? 0.6428 0.7507 0.8078 0.1418  -0.1031 0.0990  316 LEU B CG  
3312 C CD1 . LEU B 128 ? 0.6135 0.7479 0.7911 0.1403  -0.1098 0.1008  316 LEU B CD1 
3313 C CD2 . LEU B 128 ? 0.6669 0.7660 0.8413 0.1475  -0.1121 0.1152  316 LEU B CD2 
3314 N N   . ASP B 129 ? 0.5200 0.6020 0.6448 0.1310  -0.0707 0.0588  317 ASP B N   
3315 C CA  . ASP B 129 ? 0.5477 0.6245 0.6454 0.1206  -0.0688 0.0530  317 ASP B CA  
3316 C C   . ASP B 129 ? 0.4850 0.5724 0.5784 0.1158  -0.0640 0.0424  317 ASP B C   
3317 O O   . ASP B 129 ? 0.4691 0.5633 0.5478 0.1074  -0.0677 0.0413  317 ASP B O   
3318 C CB  . ASP B 129 ? 0.6892 0.7447 0.7760 0.1206  -0.0613 0.0478  317 ASP B CB  
3319 C CG  . ASP B 129 ? 0.8565 0.8992 0.9422 0.1222  -0.0665 0.0588  317 ASP B CG  
3320 O OD1 . ASP B 129 ? 0.9118 0.9624 0.9982 0.1209  -0.0768 0.0710  317 ASP B OD1 
3321 O OD2 . ASP B 129 ? 0.9188 0.9436 1.0023 0.1240  -0.0606 0.0555  317 ASP B OD2 
3322 N N   . ILE B 130 ? 0.4877 0.5759 0.5938 0.1207  -0.0553 0.0345  318 ILE B N   
3323 C CA  . ILE B 130 ? 0.3964 0.4939 0.5001 0.1163  -0.0503 0.0256  318 ILE B CA  
3324 C C   . ILE B 130 ? 0.4195 0.5370 0.5294 0.1124  -0.0583 0.0299  318 ILE B C   
3325 O O   . ILE B 130 ? 0.3797 0.5019 0.4772 0.1042  -0.0591 0.0256  318 ILE B O   
3326 C CB  . ILE B 130 ? 0.3260 0.4232 0.4442 0.1224  -0.0398 0.0180  318 ILE B CB  
3327 C CG1 . ILE B 130 ? 0.3182 0.3960 0.4243 0.1228  -0.0314 0.0108  318 ILE B CG1 
3328 C CG2 . ILE B 130 ? 0.3394 0.4503 0.4597 0.1179  -0.0362 0.0120  318 ILE B CG2 
3329 C CD1 . ILE B 130 ? 0.3945 0.4697 0.5135 0.1291  -0.0207 0.0031  318 ILE B CD1 
3330 N N   . LEU B 131 ? 0.3863 0.5151 0.5162 0.1182  -0.0646 0.0384  319 LEU B N   
3331 C CA  . LEU B 131 ? 0.4106 0.5598 0.5477 0.1142  -0.0737 0.0434  319 LEU B CA  
3332 C C   . LEU B 131 ? 0.4160 0.5654 0.5313 0.1047  -0.0828 0.0474  319 LEU B C   
3333 O O   . LEU B 131 ? 0.4207 0.5814 0.5299 0.0967  -0.0866 0.0448  319 LEU B O   
3334 C CB  . LEU B 131 ? 0.3965 0.5579 0.5608 0.1229  -0.0800 0.0534  319 LEU B CB  
3335 C CG  . LEU B 131 ? 0.3781 0.5461 0.5684 0.1317  -0.0709 0.0484  319 LEU B CG  
3336 C CD1 . LEU B 131 ? 0.4028 0.5838 0.6229 0.1413  -0.0779 0.0589  319 LEU B CD1 
3337 C CD2 . LEU B 131 ? 0.3281 0.5094 0.5196 0.1255  -0.0657 0.0399  319 LEU B CD2 
3338 N N   . LEU B 132 ? 0.3944 0.5309 0.4975 0.1050  -0.0856 0.0530  320 LEU B N   
3339 C CA  . LEU B 132 ? 0.4166 0.5532 0.4978 0.0959  -0.0929 0.0566  320 LEU B CA  
3340 C C   . LEU B 132 ? 0.4223 0.5539 0.4835 0.0875  -0.0870 0.0450  320 LEU B C   
3341 O O   . LEU B 132 ? 0.4700 0.6100 0.5197 0.0790  -0.0918 0.0433  320 LEU B O   
3342 C CB  . LEU B 132 ? 0.4348 0.5577 0.5077 0.0978  -0.0955 0.0651  320 LEU B CB  
3343 C CG  . LEU B 132 ? 0.4791 0.6026 0.5283 0.0879  -0.1022 0.0696  320 LEU B CG  
3344 C CD1 . LEU B 132 ? 0.4729 0.6145 0.5251 0.0843  -0.1153 0.0797  320 LEU B CD1 
3345 C CD2 . LEU B 132 ? 0.4926 0.5996 0.5318 0.0887  -0.1013 0.0757  320 LEU B CD2 
3346 N N   . GLY B 133 ? 0.3802 0.4981 0.4378 0.0898  -0.0767 0.0369  321 GLY B N   
3347 C CA  . GLY B 133 ? 0.3809 0.4932 0.4225 0.0832  -0.0712 0.0268  321 GLY B CA  
3348 C C   . GLY B 133 ? 0.3977 0.5209 0.4443 0.0793  -0.0703 0.0205  321 GLY B C   
3349 O O   . GLY B 133 ? 0.4394 0.5640 0.4737 0.0717  -0.0713 0.0153  321 GLY B O   
3350 N N   . THR B 134 ? 0.3535 0.4843 0.4192 0.0844  -0.0680 0.0207  322 THR B N   
3351 C CA  . THR B 134 ? 0.3451 0.4878 0.4180 0.0802  -0.0676 0.0163  322 THR B CA  
3352 C C   . THR B 134 ? 0.3365 0.4929 0.4072 0.0732  -0.0778 0.0197  322 THR B C   
3353 O O   . THR B 134 ? 0.3275 0.4869 0.3908 0.0652  -0.0785 0.0138  322 THR B O   
3354 C CB  . THR B 134 ? 0.3565 0.5081 0.4523 0.0868  -0.0635 0.0172  322 THR B CB  
3355 O OG1 . THR B 134 ? 0.3033 0.4419 0.3989 0.0924  -0.0535 0.0128  322 THR B OG1 
3356 C CG2 . THR B 134 ? 0.3626 0.5267 0.4655 0.0811  -0.0623 0.0129  322 THR B CG2 
3357 N N   . ALA B 135 ? 0.3243 0.4884 0.4012 0.0759  -0.0862 0.0294  323 ALA B N   
3358 C CA  . ALA B 135 ? 0.3206 0.4986 0.3936 0.0687  -0.0973 0.0337  323 ALA B CA  
3359 C C   . ALA B 135 ? 0.3524 0.5228 0.3996 0.0595  -0.0981 0.0282  323 ALA B C   
3360 O O   . ALA B 135 ? 0.3164 0.4951 0.3571 0.0507  -0.1024 0.0241  323 ALA B O   
3361 C CB  . ALA B 135 ? 0.2951 0.4805 0.3771 0.0735  -0.1067 0.0468  323 ALA B CB  
3362 N N   . ARG B 136 ? 0.3216 0.4766 0.3551 0.0613  -0.0935 0.0275  324 ARG B N   
3363 C CA  . ARG B 136 ? 0.3573 0.5057 0.3679 0.0534  -0.0927 0.0218  324 ARG B CA  
3364 C C   . ARG B 136 ? 0.3750 0.5206 0.3817 0.0483  -0.0871 0.0097  324 ARG B C   
3365 O O   . ARG B 136 ? 0.4080 0.5564 0.4024 0.0399  -0.0895 0.0041  324 ARG B O   
3366 C CB  . ARG B 136 ? 0.3340 0.4672 0.3343 0.0566  -0.0874 0.0228  324 ARG B CB  
3367 C CG  . ARG B 136 ? 0.3721 0.5005 0.3505 0.0487  -0.0858 0.0170  324 ARG B CG  
3368 C CD  . ARG B 136 ? 0.3601 0.4752 0.3299 0.0513  -0.0805 0.0185  324 ARG B CD  
3369 N NE  . ARG B 136 ? 0.4164 0.5311 0.3891 0.0549  -0.0857 0.0311  324 ARG B NE  
3370 C CZ  . ARG B 136 ? 0.4302 0.5355 0.4137 0.0630  -0.0826 0.0355  324 ARG B CZ  
3371 N NH1 . ARG B 136 ? 0.3287 0.4255 0.3192 0.0675  -0.0744 0.0281  324 ARG B NH1 
3372 N NH2 . ARG B 136 ? 0.4419 0.5457 0.4289 0.0661  -0.0880 0.0474  324 ARG B NH2 
3373 N N   . ALA B 137 ? 0.3714 0.5107 0.3881 0.0531  -0.0796 0.0058  325 ALA B N   
3374 C CA  . ALA B 137 ? 0.3516 0.4876 0.3670 0.0487  -0.0749 -0.0037 325 ALA B CA  
3375 C C   . ALA B 137 ? 0.3580 0.5075 0.3788 0.0417  -0.0809 -0.0053 325 ALA B C   
3376 O O   . ALA B 137 ? 0.3444 0.4923 0.3553 0.0339  -0.0817 -0.0127 325 ALA B O   
3377 C CB  . ALA B 137 ? 0.2979 0.4275 0.3236 0.0544  -0.0670 -0.0054 325 ALA B CB  
3378 N N   . ILE B 138 ? 0.3157 0.4788 0.3534 0.0443  -0.0851 0.0012  326 ILE B N   
3379 C CA  . ILE B 138 ? 0.3430 0.5205 0.3886 0.0373  -0.0909 0.0000  326 ILE B CA  
3380 C C   . ILE B 138 ? 0.3809 0.5652 0.4126 0.0283  -0.0999 -0.0007 326 ILE B C   
3381 O O   . ILE B 138 ? 0.3923 0.5787 0.4191 0.0192  -0.1016 -0.0081 326 ILE B O   
3382 C CB  . ILE B 138 ? 0.3241 0.5176 0.3930 0.0423  -0.0940 0.0079  326 ILE B CB  
3383 C CG1 . ILE B 138 ? 0.3083 0.4957 0.3892 0.0501  -0.0837 0.0068  326 ILE B CG1 
3384 C CG2 . ILE B 138 ? 0.2943 0.5043 0.3726 0.0340  -0.1002 0.0066  326 ILE B CG2 
3385 C CD1 . ILE B 138 ? 0.3520 0.5525 0.4561 0.0582  -0.0845 0.0142  326 ILE B CD1 
3386 N N   . GLN B 139 ? 0.3713 0.5581 0.3957 0.0301  -0.1055 0.0068  327 GLN B N   
3387 C CA  . GLN B 139 ? 0.3648 0.5590 0.3734 0.0208  -0.1141 0.0068  327 GLN B CA  
3388 C C   . GLN B 139 ? 0.4034 0.5848 0.3911 0.0144  -0.1083 -0.0050 327 GLN B C   
3389 O O   . GLN B 139 ? 0.4260 0.6123 0.4013 0.0043  -0.1126 -0.0111 327 GLN B O   
3390 C CB  . GLN B 139 ? 0.3799 0.5790 0.3844 0.0239  -0.1213 0.0191  327 GLN B CB  
3391 C CG  . GLN B 139 ? 0.4036 0.5866 0.3975 0.0298  -0.1147 0.0210  327 GLN B CG  
3392 C CD  . GLN B 139 ? 0.3926 0.5693 0.3608 0.0217  -0.1132 0.0149  327 GLN B CD  
3393 O OE1 . GLN B 139 ? 0.4323 0.6190 0.3876 0.0127  -0.1208 0.0156  327 GLN B OE1 
3394 N NE2 . GLN B 139 ? 0.3568 0.5181 0.3177 0.0245  -0.1032 0.0086  327 GLN B NE2 
3395 N N   . PHE B 140 ? 0.3095 0.4749 0.2940 0.0201  -0.0986 -0.0089 328 PHE B N   
3396 C CA  . PHE B 140 ? 0.3498 0.5035 0.3191 0.0155  -0.0923 -0.0204 328 PHE B CA  
3397 C C   . PHE B 140 ? 0.3675 0.5204 0.3412 0.0094  -0.0911 -0.0303 328 PHE B C   
3398 O O   . PHE B 140 ? 0.3434 0.4947 0.3051 0.0012  -0.0914 -0.0397 328 PHE B O   
3399 C CB  . PHE B 140 ? 0.3975 0.5359 0.3660 0.0230  -0.0830 -0.0217 328 PHE B CB  
3400 C CG  . PHE B 140 ? 0.4717 0.5992 0.4277 0.0195  -0.0766 -0.0329 328 PHE B CG  
3401 C CD1 . PHE B 140 ? 0.4742 0.6018 0.4134 0.0153  -0.0764 -0.0353 328 PHE B CD1 
3402 C CD2 . PHE B 140 ? 0.5340 0.6519 0.4963 0.0204  -0.0706 -0.0406 328 PHE B CD2 
3403 C CE1 . PHE B 140 ? 0.5010 0.6199 0.4313 0.0128  -0.0696 -0.0464 328 PHE B CE1 
3404 C CE2 . PHE B 140 ? 0.5102 0.6182 0.4643 0.0183  -0.0650 -0.0506 328 PHE B CE2 
3405 C CZ  . PHE B 140 ? 0.5104 0.6193 0.4493 0.0148  -0.0640 -0.0541 328 PHE B CZ  
3406 N N   . LEU B 141 ? 0.3806 0.5345 0.3716 0.0129  -0.0893 -0.0284 329 LEU B N   
3407 C CA  . LEU B 141 ? 0.3170 0.4700 0.3137 0.0065  -0.0885 -0.0361 329 LEU B CA  
3408 C C   . LEU B 141 ? 0.4191 0.5858 0.4128 -0.0039 -0.0976 -0.0382 329 LEU B C   
3409 O O   . LEU B 141 ? 0.4396 0.6019 0.4269 -0.0124 -0.0974 -0.0485 329 LEU B O   
3410 C CB  . LEU B 141 ? 0.2691 0.4238 0.2847 0.0110  -0.0853 -0.0320 329 LEU B CB  
3411 C CG  . LEU B 141 ? 0.3256 0.4666 0.3434 0.0193  -0.0762 -0.0313 329 LEU B CG  
3412 C CD1 . LEU B 141 ? 0.3284 0.4732 0.3629 0.0216  -0.0729 -0.0280 329 LEU B CD1 
3413 C CD2 . LEU B 141 ? 0.3250 0.4493 0.3319 0.0174  -0.0708 -0.0403 329 LEU B CD2 
3414 N N   . HIS B 142 ? 0.4198 0.6029 0.4185 -0.0035 -0.1060 -0.0285 330 HIS B N   
3415 C CA  . HIS B 142 ? 0.4474 0.6463 0.4444 -0.0138 -0.1163 -0.0289 330 HIS B CA  
3416 C C   . HIS B 142 ? 0.4963 0.6944 0.4692 -0.0225 -0.1198 -0.0353 330 HIS B C   
3417 O O   . HIS B 142 ? 0.4891 0.6955 0.4560 -0.0337 -0.1261 -0.0410 330 HIS B O   
3418 C CB  . HIS B 142 ? 0.4159 0.6340 0.4277 -0.0100 -0.1253 -0.0152 330 HIS B CB  
3419 C CG  . HIS B 142 ? 0.3990 0.6229 0.4359 -0.0040 -0.1225 -0.0108 330 HIS B CG  
3420 N ND1 . HIS B 142 ? 0.3849 0.6260 0.4410 0.0014  -0.1285 0.0007  330 HIS B ND1 
3421 C CD2 . HIS B 142 ? 0.3739 0.5894 0.4203 -0.0029 -0.1139 -0.0162 330 HIS B CD2 
3422 C CE1 . HIS B 142 ? 0.3705 0.6142 0.4466 0.0055  -0.1227 0.0010  330 HIS B CE1 
3423 N NE2 . HIS B 142 ? 0.3862 0.6144 0.4555 0.0024  -0.1140 -0.0087 330 HIS B NE2 
3424 N N   . GLN B 143 ? 0.4850 0.6737 0.4437 -0.0182 -0.1152 -0.0348 331 GLN B N   
3425 C CA  . GLN B 143 ? 0.4815 0.6706 0.4163 -0.0266 -0.1170 -0.0407 331 GLN B CA  
3426 C C   . GLN B 143 ? 0.5238 0.7010 0.4485 -0.0336 -0.1101 -0.0580 331 GLN B C   
3427 O O   . GLN B 143 ? 0.6060 0.7853 0.5117 -0.0429 -0.1115 -0.0662 331 GLN B O   
3428 C CB  . GLN B 143 ? 0.5219 0.7053 0.4457 -0.0204 -0.1134 -0.0345 331 GLN B CB  
3429 C CG  . GLN B 143 ? 0.6076 0.8039 0.5327 -0.0179 -0.1230 -0.0182 331 GLN B CG  
3430 C CD  . GLN B 143 ? 0.6779 0.8734 0.5809 -0.0209 -0.1233 -0.0150 331 GLN B CD  
3431 O OE1 . GLN B 143 ? 0.7766 0.9728 0.6592 -0.0309 -0.1223 -0.0246 331 GLN B OE1 
3432 N NE2 . GLN B 143 ? 0.6187 0.8124 0.5255 -0.0129 -0.1241 -0.0019 331 GLN B NE2 
3433 N N   . ASP B 144 ? 0.4873 0.6517 0.4246 -0.0292 -0.1026 -0.0637 332 ASP B N   
3434 C CA  . ASP B 144 ? 0.5217 0.6733 0.4539 -0.0348 -0.0965 -0.0794 332 ASP B CA  
3435 C C   . ASP B 144 ? 0.5645 0.7246 0.4950 -0.0476 -0.1038 -0.0863 332 ASP B C   
3436 O O   . ASP B 144 ? 0.5518 0.7263 0.4930 -0.0500 -0.1122 -0.0781 332 ASP B O   
3437 C CB  . ASP B 144 ? 0.5459 0.6826 0.4938 -0.0274 -0.0887 -0.0809 332 ASP B CB  
3438 C CG  . ASP B 144 ? 0.6253 0.7444 0.5668 -0.0264 -0.0794 -0.0932 332 ASP B CG  
3439 O OD1 . ASP B 144 ? 0.6605 0.7783 0.5880 -0.0257 -0.0760 -0.0966 332 ASP B OD1 
3440 O OD2 . ASP B 144 ? 0.6360 0.7430 0.5875 -0.0263 -0.0754 -0.0990 332 ASP B OD2 
3441 N N   . SER B 145 ? 0.5985 0.7506 0.5161 -0.0559 -0.1006 -0.1018 333 SER B N   
3442 C CA  . SER B 145 ? 0.6612 0.8186 0.5767 -0.0691 -0.1066 -0.1109 333 SER B CA  
3443 C C   . SER B 145 ? 0.7109 0.8494 0.6340 -0.0713 -0.0994 -0.1244 333 SER B C   
3444 O O   . SER B 145 ? 0.7724 0.8966 0.6862 -0.0713 -0.0913 -0.1372 333 SER B O   
3445 C CB  . SER B 145 ? 0.6611 0.8273 0.5520 -0.0802 -0.1108 -0.1184 333 SER B CB  
3446 O OG  . SER B 145 ? 0.6917 0.8645 0.5799 -0.0940 -0.1179 -0.1268 333 SER B OG  
3447 N N   . PRO B 146 ? 0.7285 0.8670 0.6696 -0.0733 -0.1022 -0.1215 334 PRO B N   
3448 C CA  . PRO B 146 ? 0.6711 0.8280 0.6263 -0.0736 -0.1109 -0.1078 334 PRO B CA  
3449 C C   . PRO B 146 ? 0.6049 0.7641 0.5725 -0.0596 -0.1082 -0.0928 334 PRO B C   
3450 O O   . PRO B 146 ? 0.6027 0.7466 0.5715 -0.0505 -0.0993 -0.0933 334 PRO B O   
3451 C CB  . PRO B 146 ? 0.6571 0.8082 0.6268 -0.0808 -0.1112 -0.1130 334 PRO B CB  
3452 C CG  . PRO B 146 ? 0.6740 0.7998 0.6442 -0.0764 -0.1005 -0.1223 334 PRO B CG  
3453 C CD  . PRO B 146 ? 0.7207 0.8398 0.6710 -0.0752 -0.0960 -0.1318 334 PRO B CD  
3454 N N   . SER B 147 ? 0.5459 0.7244 0.5232 -0.0582 -0.1159 -0.0800 335 SER B N   
3455 C CA  . SER B 147 ? 0.4682 0.6501 0.4582 -0.0454 -0.1135 -0.0665 335 SER B CA  
3456 C C   . SER B 147 ? 0.4732 0.6443 0.4794 -0.0401 -0.1058 -0.0657 335 SER B C   
3457 O O   . SER B 147 ? 0.5343 0.7051 0.5502 -0.0473 -0.1064 -0.0695 335 SER B O   
3458 C CB  . SER B 147 ? 0.4506 0.6562 0.4513 -0.0454 -0.1237 -0.0541 335 SER B CB  
3459 O OG  . SER B 147 ? 0.4794 0.6950 0.4642 -0.0490 -0.1315 -0.0516 335 SER B OG  
3460 N N   . LEU B 148 ? 0.4294 0.5918 0.4380 -0.0286 -0.0988 -0.0603 336 LEU B N   
3461 C CA  . LEU B 148 ? 0.4207 0.5760 0.4439 -0.0235 -0.0922 -0.0571 336 LEU B CA  
3462 C C   . LEU B 148 ? 0.4309 0.6035 0.4709 -0.0187 -0.0948 -0.0454 336 LEU B C   
3463 O O   . LEU B 148 ? 0.3987 0.5780 0.4387 -0.0108 -0.0960 -0.0379 336 LEU B O   
3464 C CB  . LEU B 148 ? 0.4256 0.5633 0.4430 -0.0142 -0.0834 -0.0578 336 LEU B CB  
3465 C CG  . LEU B 148 ? 0.4379 0.5679 0.4676 -0.0106 -0.0771 -0.0545 336 LEU B CG  
3466 C CD1 . LEU B 148 ? 0.4178 0.5372 0.4504 -0.0191 -0.0760 -0.0618 336 LEU B CD1 
3467 C CD2 . LEU B 148 ? 0.4080 0.5253 0.4335 -0.0006 -0.0701 -0.0521 336 LEU B CD2 
3468 N N   . ILE B 149 ? 0.4336 0.6134 0.4889 -0.0236 -0.0952 -0.0442 337 ILE B N   
3469 C CA  . ILE B 149 ? 0.3976 0.5943 0.4720 -0.0189 -0.0956 -0.0345 337 ILE B CA  
3470 C C   . ILE B 149 ? 0.4084 0.5948 0.4888 -0.0113 -0.0853 -0.0318 337 ILE B C   
3471 O O   . ILE B 149 ? 0.4090 0.5852 0.4910 -0.0158 -0.0805 -0.0353 337 ILE B O   
3472 C CB  . ILE B 149 ? 0.4213 0.6347 0.5107 -0.0291 -0.1012 -0.0342 337 ILE B CB  
3473 C CG1 . ILE B 149 ? 0.4260 0.6484 0.5066 -0.0388 -0.1120 -0.0383 337 ILE B CG1 
3474 C CG2 . ILE B 149 ? 0.4023 0.6362 0.5138 -0.0235 -0.1013 -0.0244 337 ILE B CG2 
3475 C CD1 . ILE B 149 ? 0.4237 0.6572 0.5148 -0.0519 -0.1174 -0.0415 337 ILE B CD1 
3476 N N   . HIS B 150 ? 0.4170 0.6054 0.4999 -0.0004 -0.0821 -0.0256 338 HIS B N   
3477 C CA  . HIS B 150 ? 0.4316 0.6100 0.5168 0.0066  -0.0724 -0.0238 338 HIS B CA  
3478 C C   . HIS B 150 ? 0.3760 0.5640 0.4782 0.0036  -0.0682 -0.0212 338 HIS B C   
3479 O O   . HIS B 150 ? 0.3122 0.4892 0.4124 0.0000  -0.0625 -0.0233 338 HIS B O   
3480 C CB  . HIS B 150 ? 0.3436 0.5230 0.4287 0.0181  -0.0704 -0.0185 338 HIS B CB  
3481 C CG  . HIS B 150 ? 0.3261 0.4938 0.4096 0.0246  -0.0608 -0.0180 338 HIS B CG  
3482 N ND1 . HIS B 150 ? 0.3227 0.4978 0.4197 0.0267  -0.0546 -0.0152 338 HIS B ND1 
3483 C CD2 . HIS B 150 ? 0.3093 0.4598 0.3791 0.0288  -0.0564 -0.0203 338 HIS B CD2 
3484 C CE1 . HIS B 150 ? 0.3090 0.4712 0.3987 0.0315  -0.0470 -0.0159 338 HIS B CE1 
3485 N NE2 . HIS B 150 ? 0.2979 0.4451 0.3718 0.0329  -0.0485 -0.0186 338 HIS B NE2 
3486 N N   . GLY B 151 ? 0.3454 0.5547 0.4651 0.0049  -0.0709 -0.0160 339 GLY B N   
3487 C CA  . GLY B 151 ? 0.3307 0.5535 0.4686 0.0005  -0.0674 -0.0138 339 GLY B CA  
3488 C C   . GLY B 151 ? 0.3636 0.5873 0.5093 0.0078  -0.0566 -0.0109 339 GLY B C   
3489 O O   . GLY B 151 ? 0.4509 0.6913 0.6148 0.0063  -0.0531 -0.0082 339 GLY B O   
3490 N N   . ASP B 152 ? 0.3314 0.5377 0.4630 0.0147  -0.0511 -0.0120 340 ASP B N   
3491 C CA  . ASP B 152 ? 0.3823 0.5876 0.5175 0.0213  -0.0407 -0.0104 340 ASP B CA  
3492 C C   . ASP B 152 ? 0.4191 0.6270 0.5579 0.0335  -0.0390 -0.0083 340 ASP B C   
3493 O O   . ASP B 152 ? 0.4322 0.6343 0.5688 0.0390  -0.0303 -0.0090 340 ASP B O   
3494 C CB  . ASP B 152 ? 0.4590 0.6431 0.5770 0.0194  -0.0350 -0.0129 340 ASP B CB  
3495 C CG  . ASP B 152 ? 0.4741 0.6614 0.5970 0.0175  -0.0250 -0.0114 340 ASP B CG  
3496 O OD1 . ASP B 152 ? 0.4477 0.6524 0.5866 0.0207  -0.0205 -0.0097 340 ASP B OD1 
3497 O OD2 . ASP B 152 ? 0.5187 0.6918 0.6298 0.0129  -0.0216 -0.0117 340 ASP B OD2 
3498 N N   . ILE B 153 ? 0.3752 0.5893 0.5170 0.0372  -0.0475 -0.0059 341 ILE B N   
3499 C CA  . ILE B 153 ? 0.3474 0.5597 0.4908 0.0486  -0.0466 -0.0033 341 ILE B CA  
3500 C C   . ILE B 153 ? 0.3716 0.5954 0.5343 0.0561  -0.0385 -0.0018 341 ILE B C   
3501 O O   . ILE B 153 ? 0.3793 0.6237 0.5636 0.0558  -0.0397 0.0008  341 ILE B O   
3502 C CB  . ILE B 153 ? 0.3241 0.5442 0.4701 0.0502  -0.0581 0.0011  341 ILE B CB  
3503 C CG1 . ILE B 153 ? 0.3629 0.5698 0.4869 0.0438  -0.0642 -0.0018 341 ILE B CG1 
3504 C CG2 . ILE B 153 ? 0.2419 0.4605 0.3931 0.0619  -0.0575 0.0054  341 ILE B CG2 
3505 C CD1 . ILE B 153 ? 0.3890 0.6054 0.5122 0.0420  -0.0760 0.0021  341 ILE B CD1 
3506 N N   . LYS B 154 ? 0.3570 0.5680 0.5124 0.0627  -0.0301 -0.0042 342 LYS B N   
3507 C CA  . LYS B 154 ? 0.3147 0.5335 0.4857 0.0702  -0.0205 -0.0051 342 LYS B CA  
3508 C C   . LYS B 154 ? 0.3746 0.5772 0.5364 0.0792  -0.0168 -0.0066 342 LYS B C   
3509 O O   . LYS B 154 ? 0.4593 0.6457 0.6025 0.0786  -0.0212 -0.0066 342 LYS B O   
3510 C CB  . LYS B 154 ? 0.2767 0.4979 0.4470 0.0641  -0.0099 -0.0089 342 LYS B CB  
3511 C CG  . LYS B 154 ? 0.3543 0.5884 0.5316 0.0533  -0.0126 -0.0075 342 LYS B CG  
3512 C CD  . LYS B 154 ? 0.3916 0.6270 0.5669 0.0469  -0.0017 -0.0100 342 LYS B CD  
3513 C CE  . LYS B 154 ? 0.4207 0.6332 0.5703 0.0446  0.0020  -0.0124 342 LYS B CE  
3514 N NZ  . LYS B 154 ? 0.4343 0.6318 0.5679 0.0396  -0.0075 -0.0117 342 LYS B NZ  
3515 N N   . SER B 155 ? 0.3219 0.5284 0.4966 0.0870  -0.0079 -0.0087 343 SER B N   
3516 C CA  . SER B 155 ? 0.3568 0.5470 0.5235 0.0949  -0.0042 -0.0110 343 SER B CA  
3517 C C   . SER B 155 ? 0.3911 0.5652 0.5360 0.0906  0.0039  -0.0170 343 SER B C   
3518 O O   . SER B 155 ? 0.3622 0.5196 0.4936 0.0938  0.0048  -0.0190 343 SER B O   
3519 C CB  . SER B 155 ? 0.3808 0.5798 0.5710 0.1057  0.0021  -0.0118 343 SER B CB  
3520 O OG  . SER B 155 ? 0.4232 0.6317 0.6219 0.1046  0.0145  -0.0177 343 SER B OG  
3521 N N   . SER B 156 ? 0.3601 0.5398 0.5016 0.0826  0.0091  -0.0192 344 SER B N   
3522 C CA  . SER B 156 ? 0.3624 0.5287 0.4834 0.0777  0.0157  -0.0234 344 SER B CA  
3523 C C   . SER B 156 ? 0.3880 0.5387 0.4883 0.0724  0.0079  -0.0217 344 SER B C   
3524 O O   . SER B 156 ? 0.3855 0.5219 0.4685 0.0710  0.0107  -0.0242 344 SER B O   
3525 C CB  . SER B 156 ? 0.3267 0.5043 0.4508 0.0702  0.0236  -0.0248 344 SER B CB  
3526 O OG  . SER B 156 ? 0.3566 0.5418 0.4840 0.0623  0.0171  -0.0206 344 SER B OG  
3527 N N   . ASN B 157 ? 0.3528 0.5071 0.4553 0.0691  -0.0016 -0.0179 345 ASN B N   
3528 C CA  . ASN B 157 ? 0.3218 0.4621 0.4071 0.0651  -0.0085 -0.0173 345 ASN B CA  
3529 C C   . ASN B 157 ? 0.3299 0.4639 0.4119 0.0706  -0.0153 -0.0157 345 ASN B C   
3530 O O   . ASN B 157 ? 0.3718 0.4985 0.4430 0.0673  -0.0215 -0.0153 345 ASN B O   
3531 C CB  . ASN B 157 ? 0.3450 0.4899 0.4307 0.0564  -0.0137 -0.0159 345 ASN B CB  
3532 C CG  . ASN B 157 ? 0.3349 0.4962 0.4368 0.0559  -0.0198 -0.0132 345 ASN B CG  
3533 O OD1 . ASN B 157 ? 0.4163 0.5930 0.5353 0.0574  -0.0164 -0.0121 345 ASN B OD1 
3534 N ND2 . ASN B 157 ? 0.3130 0.4720 0.4097 0.0531  -0.0288 -0.0124 345 ASN B ND2 
3535 N N   . VAL B 158 ? 0.3360 0.4736 0.4286 0.0786  -0.0141 -0.0145 346 VAL B N   
3536 C CA  . VAL B 158 ? 0.2955 0.4231 0.3819 0.0836  -0.0187 -0.0126 346 VAL B CA  
3537 C C   . VAL B 158 ? 0.3496 0.4622 0.4253 0.0866  -0.0119 -0.0166 346 VAL B C   
3538 O O   . VAL B 158 ? 0.3589 0.4721 0.4424 0.0916  -0.0048 -0.0192 346 VAL B O   
3539 C CB  . VAL B 158 ? 0.3602 0.4975 0.4640 0.0907  -0.0228 -0.0076 346 VAL B CB  
3540 C CG1 . VAL B 158 ? 0.3568 0.4817 0.4528 0.0951  -0.0269 -0.0047 346 VAL B CG1 
3541 C CG2 . VAL B 158 ? 0.3686 0.5216 0.4815 0.0866  -0.0312 -0.0033 346 VAL B CG2 
3542 N N   . LEU B 159 ? 0.3330 0.4325 0.3914 0.0835  -0.0142 -0.0177 347 LEU B N   
3543 C CA  . LEU B 159 ? 0.3323 0.4187 0.3790 0.0840  -0.0086 -0.0217 347 LEU B CA  
3544 C C   . LEU B 159 ? 0.3801 0.4555 0.4213 0.0878  -0.0115 -0.0205 347 LEU B C   
3545 O O   . LEU B 159 ? 0.3844 0.4611 0.4260 0.0881  -0.0183 -0.0162 347 LEU B O   
3546 C CB  . LEU B 159 ? 0.3519 0.4327 0.3848 0.0770  -0.0085 -0.0235 347 LEU B CB  
3547 C CG  . LEU B 159 ? 0.4407 0.5315 0.4795 0.0728  -0.0049 -0.0239 347 LEU B CG  
3548 C CD1 . LEU B 159 ? 0.5062 0.5978 0.5411 0.0661  -0.0099 -0.0222 347 LEU B CD1 
3549 C CD2 . LEU B 159 ? 0.4601 0.5478 0.4927 0.0714  0.0035  -0.0274 347 LEU B CD2 
3550 N N   . LEU B 160 ? 0.3926 0.4576 0.4282 0.0898  -0.0061 -0.0242 348 LEU B N   
3551 C CA  . LEU B 160 ? 0.3888 0.4430 0.4218 0.0935  -0.0079 -0.0229 348 LEU B CA  
3552 C C   . LEU B 160 ? 0.4068 0.4484 0.4239 0.0897  -0.0066 -0.0263 348 LEU B C   
3553 O O   . LEU B 160 ? 0.4333 0.4717 0.4442 0.0874  -0.0012 -0.0314 348 LEU B O   
3554 C CB  . LEU B 160 ? 0.3871 0.4402 0.4334 0.1008  -0.0029 -0.0243 348 LEU B CB  
3555 C CG  . LEU B 160 ? 0.4040 0.4718 0.4700 0.1054  -0.0038 -0.0209 348 LEU B CG  
3556 C CD1 . LEU B 160 ? 0.3511 0.4180 0.4324 0.1133  0.0033  -0.0241 348 LEU B CD1 
3557 C CD2 . LEU B 160 ? 0.4183 0.4907 0.4885 0.1063  -0.0138 -0.0124 348 LEU B CD2 
3558 N N   . ASP B 161 ? 0.3961 0.4316 0.4064 0.0884  -0.0116 -0.0234 349 ASP B N   
3559 C CA  . ASP B 161 ? 0.4564 0.4814 0.4543 0.0850  -0.0107 -0.0263 349 ASP B CA  
3560 C C   . ASP B 161 ? 0.4392 0.4531 0.4380 0.0881  -0.0075 -0.0281 349 ASP B C   
3561 O O   . ASP B 161 ? 0.4243 0.4383 0.4342 0.0937  -0.0050 -0.0279 349 ASP B O   
3562 C CB  . ASP B 161 ? 0.4999 0.5244 0.4905 0.0813  -0.0163 -0.0234 349 ASP B CB  
3563 C CG  . ASP B 161 ? 0.5635 0.5867 0.5567 0.0833  -0.0203 -0.0180 349 ASP B CG  
3564 O OD1 . ASP B 161 ? 0.5467 0.5675 0.5480 0.0881  -0.0197 -0.0155 349 ASP B OD1 
3565 O OD2 . ASP B 161 ? 0.5471 0.5717 0.5342 0.0799  -0.0240 -0.0160 349 ASP B OD2 
3566 N N   . GLU B 162 ? 0.4139 0.4184 0.4025 0.0846  -0.0077 -0.0300 350 GLU B N   
3567 C CA  . GLU B 162 ? 0.5206 0.5128 0.5086 0.0859  -0.0045 -0.0330 350 GLU B CA  
3568 C C   . GLU B 162 ? 0.5575 0.5448 0.5549 0.0909  -0.0067 -0.0275 350 GLU B C   
3569 O O   . GLU B 162 ? 0.5539 0.5314 0.5568 0.0945  -0.0032 -0.0298 350 GLU B O   
3570 C CB  . GLU B 162 ? 0.6116 0.5965 0.5875 0.0799  -0.0057 -0.0351 350 GLU B CB  
3571 C CG  . GLU B 162 ? 0.7603 0.7492 0.7271 0.0748  -0.0047 -0.0392 350 GLU B CG  
3572 C CD  . GLU B 162 ? 0.8901 0.8885 0.8556 0.0726  -0.0093 -0.0355 350 GLU B CD  
3573 O OE1 . GLU B 162 ? 0.9577 0.9578 0.9164 0.0683  -0.0103 -0.0370 350 GLU B OE1 
3574 O OE2 . GLU B 162 ? 0.9044 0.9082 0.8757 0.0749  -0.0121 -0.0311 350 GLU B OE2 
3575 N N   . ARG B 163 ? 0.5373 0.5310 0.5363 0.0908  -0.0127 -0.0201 351 ARG B N   
3576 C CA  . ARG B 163 ? 0.5670 0.5578 0.5739 0.0947  -0.0165 -0.0125 351 ARG B CA  
3577 C C   . ARG B 163 ? 0.5653 0.5664 0.5868 0.1008  -0.0179 -0.0089 351 ARG B C   
3578 O O   . ARG B 163 ? 0.5532 0.5547 0.5824 0.1042  -0.0227 -0.0009 351 ARG B O   
3579 C CB  . ARG B 163 ? 0.6197 0.6127 0.6184 0.0900  -0.0225 -0.0061 351 ARG B CB  
3580 C CG  . ARG B 163 ? 0.7321 0.7170 0.7194 0.0840  -0.0215 -0.0084 351 ARG B CG  
3581 C CD  . ARG B 163 ? 0.8397 0.8235 0.8221 0.0806  -0.0260 -0.0007 351 ARG B CD  
3582 N NE  . ARG B 163 ? 0.9093 0.9059 0.8910 0.0799  -0.0306 0.0042  351 ARG B NE  
3583 C CZ  . ARG B 163 ? 0.9366 0.9358 0.9226 0.0820  -0.0355 0.0129  351 ARG B CZ  
3584 N NH1 . ARG B 163 ? 0.9555 0.9671 0.9388 0.0800  -0.0399 0.0161  351 ARG B NH1 
3585 N NH2 . ARG B 163 ? 0.9256 0.9147 0.9190 0.0860  -0.0363 0.0184  351 ARG B NH2 
3586 N N   . LEU B 164 ? 0.5732 0.5833 0.5982 0.1015  -0.0142 -0.0140 352 LEU B N   
3587 C CA  . LEU B 164 ? 0.5170 0.5402 0.5567 0.1060  -0.0153 -0.0113 352 LEU B CA  
3588 C C   . LEU B 164 ? 0.5044 0.5389 0.5434 0.1034  -0.0236 -0.0040 352 LEU B C   
3589 O O   . LEU B 164 ? 0.4684 0.5121 0.5202 0.1073  -0.0277 0.0018  352 LEU B O   
3590 C CB  . LEU B 164 ? 0.4922 0.5115 0.5490 0.1146  -0.0136 -0.0092 352 LEU B CB  
3591 C CG  . LEU B 164 ? 0.5076 0.5171 0.5680 0.1180  -0.0040 -0.0183 352 LEU B CG  
3592 C CD1 . LEU B 164 ? 0.4982 0.5009 0.5768 0.1270  -0.0032 -0.0154 352 LEU B CD1 
3593 C CD2 . LEU B 164 ? 0.4850 0.5058 0.5482 0.1173  0.0027  -0.0254 352 LEU B CD2 
3594 N N   . THR B 165 ? 0.5212 0.5555 0.5457 0.0967  -0.0259 -0.0048 353 THR B N   
3595 C CA  . THR B 165 ? 0.4962 0.5412 0.5175 0.0927  -0.0323 -0.0010 353 THR B CA  
3596 C C   . THR B 165 ? 0.4199 0.4766 0.4468 0.0915  -0.0312 -0.0044 353 THR B C   
3597 O O   . THR B 165 ? 0.4326 0.4873 0.4552 0.0893  -0.0263 -0.0104 353 THR B O   
3598 C CB  . THR B 165 ? 0.5094 0.5502 0.5149 0.0863  -0.0337 -0.0024 353 THR B CB  
3599 O OG1 . THR B 165 ? 0.5579 0.5905 0.5589 0.0863  -0.0355 0.0024  353 THR B OG1 
3600 C CG2 . THR B 165 ? 0.4750 0.5266 0.4764 0.0816  -0.0385 -0.0016 353 THR B CG2 
3601 N N   . PRO B 166 ? 0.3915 0.4607 0.4282 0.0924  -0.0361 0.0002  354 PRO B N   
3602 C CA  . PRO B 166 ? 0.3688 0.4498 0.4125 0.0905  -0.0351 -0.0026 354 PRO B CA  
3603 C C   . PRO B 166 ? 0.3943 0.4770 0.4266 0.0829  -0.0371 -0.0059 354 PRO B C   
3604 O O   . PRO B 166 ? 0.4009 0.4831 0.4240 0.0793  -0.0420 -0.0044 354 PRO B O   
3605 C CB  . PRO B 166 ? 0.3148 0.4090 0.3736 0.0936  -0.0411 0.0040  354 PRO B CB  
3606 C CG  . PRO B 166 ? 0.3318 0.4223 0.3840 0.0934  -0.0480 0.0108  354 PRO B CG  
3607 C CD  . PRO B 166 ? 0.3400 0.4138 0.3818 0.0945  -0.0436 0.0088  354 PRO B CD  
3608 N N   . LYS B 167 ? 0.3614 0.4462 0.3948 0.0804  -0.0330 -0.0105 355 LYS B N   
3609 C CA  . LYS B 167 ? 0.3549 0.4400 0.3805 0.0737  -0.0344 -0.0138 355 LYS B CA  
3610 C C   . LYS B 167 ? 0.3221 0.4173 0.3574 0.0711  -0.0334 -0.0147 355 LYS B C   
3611 O O   . LYS B 167 ? 0.2903 0.3867 0.3313 0.0727  -0.0276 -0.0159 355 LYS B O   
3612 C CB  . LYS B 167 ? 0.3860 0.4590 0.4002 0.0721  -0.0305 -0.0178 355 LYS B CB  
3613 C CG  . LYS B 167 ? 0.4091 0.4737 0.4140 0.0730  -0.0317 -0.0173 355 LYS B CG  
3614 C CD  . LYS B 167 ? 0.5307 0.5858 0.5266 0.0710  -0.0288 -0.0210 355 LYS B CD  
3615 C CE  . LYS B 167 ? 0.5909 0.6389 0.5796 0.0718  -0.0291 -0.0205 355 LYS B CE  
3616 N NZ  . LYS B 167 ? 0.6296 0.6802 0.6133 0.0689  -0.0329 -0.0200 355 LYS B NZ  
3617 N N   . LEU B 168 ? 0.3203 0.4229 0.3567 0.0662  -0.0388 -0.0144 356 LEU B N   
3618 C CA  . LEU B 168 ? 0.2670 0.3807 0.3139 0.0624  -0.0391 -0.0146 356 LEU B CA  
3619 C C   . LEU B 168 ? 0.2904 0.3976 0.3318 0.0569  -0.0358 -0.0184 356 LEU B C   
3620 O O   . LEU B 168 ? 0.3653 0.4640 0.3968 0.0535  -0.0377 -0.0213 356 LEU B O   
3621 C CB  . LEU B 168 ? 0.3602 0.4847 0.4104 0.0585  -0.0472 -0.0127 356 LEU B CB  
3622 C CG  . LEU B 168 ? 0.3836 0.5213 0.4457 0.0533  -0.0490 -0.0127 356 LEU B CG  
3623 C CD1 . LEU B 168 ? 0.3067 0.4565 0.3867 0.0583  -0.0457 -0.0092 356 LEU B CD1 
3624 C CD2 . LEU B 168 ? 0.3693 0.5158 0.4304 0.0478  -0.0580 -0.0121 356 LEU B CD2 
3625 N N   . GLY B 169 ? 0.3068 0.4180 0.3553 0.0561  -0.0306 -0.0182 357 GLY B N   
3626 C CA  . GLY B 169 ? 0.3106 0.4161 0.3549 0.0503  -0.0280 -0.0199 357 GLY B CA  
3627 C C   . GLY B 169 ? 0.3619 0.4777 0.4163 0.0438  -0.0292 -0.0192 357 GLY B C   
3628 O O   . GLY B 169 ? 0.3562 0.4836 0.4194 0.0427  -0.0339 -0.0182 357 GLY B O   
3629 N N   . ASP B 170 ? 0.3275 0.4391 0.3801 0.0386  -0.0256 -0.0190 358 ASP B N   
3630 C CA  . ASP B 170 ? 0.3231 0.4435 0.3853 0.0312  -0.0254 -0.0177 358 ASP B CA  
3631 C C   . ASP B 170 ? 0.3553 0.4784 0.4208 0.0256  -0.0328 -0.0196 358 ASP B C   
3632 O O   . ASP B 170 ? 0.4001 0.5382 0.4775 0.0233  -0.0356 -0.0187 358 ASP B O   
3633 C CB  . ASP B 170 ? 0.3561 0.4940 0.4327 0.0333  -0.0208 -0.0157 358 ASP B CB  
3634 C CG  . ASP B 170 ? 0.4201 0.5562 0.4933 0.0354  -0.0117 -0.0152 358 ASP B CG  
3635 O OD1 . ASP B 170 ? 0.4101 0.5319 0.4692 0.0351  -0.0101 -0.0155 358 ASP B OD1 
3636 O OD2 . ASP B 170 ? 0.4374 0.5874 0.5226 0.0373  -0.0060 -0.0148 358 ASP B OD2 
3637 N N   . PHE B 171 ? 0.3401 0.4489 0.3957 0.0230  -0.0358 -0.0226 359 PHE B N   
3638 C CA  . PHE B 171 ? 0.3305 0.4389 0.3865 0.0172  -0.0421 -0.0265 359 PHE B CA  
3639 C C   . PHE B 171 ? 0.3253 0.4312 0.3867 0.0077  -0.0423 -0.0268 359 PHE B C   
3640 O O   . PHE B 171 ? 0.3888 0.4901 0.4494 0.0019  -0.0468 -0.0313 359 PHE B O   
3641 C CB  . PHE B 171 ? 0.2941 0.3887 0.3380 0.0195  -0.0443 -0.0312 359 PHE B CB  
3642 C CG  . PHE B 171 ? 0.2879 0.3880 0.3273 0.0248  -0.0471 -0.0319 359 PHE B CG  
3643 C CD1 . PHE B 171 ? 0.3165 0.4187 0.3549 0.0325  -0.0442 -0.0282 359 PHE B CD1 
3644 C CD2 . PHE B 171 ? 0.3342 0.4367 0.3695 0.0213  -0.0526 -0.0363 359 PHE B CD2 
3645 C CE1 . PHE B 171 ? 0.3403 0.4463 0.3749 0.0368  -0.0471 -0.0275 359 PHE B CE1 
3646 C CE2 . PHE B 171 ? 0.3795 0.4873 0.4093 0.0251  -0.0555 -0.0355 359 PHE B CE2 
3647 C CZ  . PHE B 171 ? 0.3786 0.4877 0.4085 0.0330  -0.0529 -0.0305 359 PHE B CZ  
3648 N N   . GLY B 172 ? 0.3346 0.4422 0.4004 0.0057  -0.0371 -0.0221 360 GLY B N   
3649 C CA  . GLY B 172 ? 0.3132 0.4170 0.3836 -0.0038 -0.0367 -0.0206 360 GLY B CA  
3650 C C   . GLY B 172 ? 0.4091 0.5252 0.4912 -0.0123 -0.0407 -0.0221 360 GLY B C   
3651 O O   . GLY B 172 ? 0.4645 0.5731 0.5488 -0.0211 -0.0421 -0.0227 360 GLY B O   
3652 N N   . LEU B 173 ? 0.3491 0.4838 0.4394 -0.0100 -0.0429 -0.0220 361 LEU B N   
3653 C CA  . LEU B 173 ? 0.3370 0.4866 0.4395 -0.0183 -0.0478 -0.0230 361 LEU B CA  
3654 C C   . LEU B 173 ? 0.3968 0.5463 0.4946 -0.0202 -0.0563 -0.0289 361 LEU B C   
3655 O O   . LEU B 173 ? 0.4393 0.6011 0.5456 -0.0279 -0.0618 -0.0303 361 LEU B O   
3656 C CB  . LEU B 173 ? 0.3641 0.5376 0.4822 -0.0155 -0.0456 -0.0184 361 LEU B CB  
3657 C CG  . LEU B 173 ? 0.4059 0.5837 0.5294 -0.0145 -0.0359 -0.0137 361 LEU B CG  
3658 C CD1 . LEU B 173 ? 0.4184 0.6219 0.5610 -0.0120 -0.0336 -0.0107 361 LEU B CD1 
3659 C CD2 . LEU B 173 ? 0.3824 0.5517 0.5054 -0.0255 -0.0333 -0.0121 361 LEU B CD2 
3660 N N   . ALA B 174 ? 0.3896 0.5264 0.4736 -0.0140 -0.0573 -0.0324 362 ALA B N   
3661 C CA  . ALA B 174 ? 0.3937 0.5318 0.4706 -0.0155 -0.0643 -0.0380 362 ALA B CA  
3662 C C   . ALA B 174 ? 0.4576 0.5901 0.5337 -0.0271 -0.0687 -0.0451 362 ALA B C   
3663 O O   . ALA B 174 ? 0.5048 0.6218 0.5804 -0.0315 -0.0658 -0.0474 362 ALA B O   
3664 C CB  . ALA B 174 ? 0.3511 0.4752 0.4131 -0.0077 -0.0627 -0.0409 362 ALA B CB  
3665 N N   . ARG B 175 ? 0.4233 0.5683 0.4994 -0.0324 -0.0762 -0.0483 363 ARG B N   
3666 C CA  . ARG B 175 ? 0.4485 0.5888 0.5217 -0.0441 -0.0810 -0.0570 363 ARG B CA  
3667 C C   . ARG B 175 ? 0.4681 0.6143 0.5293 -0.0455 -0.0877 -0.0625 363 ARG B C   
3668 O O   . ARG B 175 ? 0.4529 0.6148 0.5144 -0.0406 -0.0914 -0.0568 363 ARG B O   
3669 C CB  . ARG B 175 ? 0.4460 0.6006 0.5348 -0.0545 -0.0844 -0.0547 363 ARG B CB  
3670 C CG  . ARG B 175 ? 0.4990 0.6505 0.5995 -0.0556 -0.0778 -0.0486 363 ARG B CG  
3671 C CD  . ARG B 175 ? 0.5813 0.7075 0.6767 -0.0605 -0.0743 -0.0534 363 ARG B CD  
3672 N NE  . ARG B 175 ? 0.6223 0.7470 0.7282 -0.0640 -0.0691 -0.0463 363 ARG B NE  
3673 C CZ  . ARG B 175 ? 0.6593 0.7770 0.7636 -0.0567 -0.0621 -0.0398 363 ARG B CZ  
3674 N NH1 . ARG B 175 ? 0.6136 0.7247 0.7073 -0.0451 -0.0598 -0.0396 363 ARG B NH1 
3675 N NH2 . ARG B 175 ? 0.6931 0.8107 0.8053 -0.0618 -0.0576 -0.0332 363 ARG B NH2 
3676 N N   . PHE B 176 ? 0.5012 0.6345 0.5517 -0.0525 -0.0890 -0.0736 364 PHE B N   
3677 C CA  . PHE B 176 ? 0.5186 0.6585 0.5556 -0.0567 -0.0952 -0.0801 364 PHE B CA  
3678 C C   . PHE B 176 ? 0.5599 0.7199 0.6036 -0.0679 -0.1046 -0.0797 364 PHE B C   
3679 O O   . PHE B 176 ? 0.5320 0.6931 0.5878 -0.0761 -0.1055 -0.0805 364 PHE B O   
3680 C CB  . PHE B 176 ? 0.5161 0.6357 0.5395 -0.0604 -0.0921 -0.0939 364 PHE B CB  
3681 C CG  . PHE B 176 ? 0.5051 0.6103 0.5196 -0.0494 -0.0849 -0.0948 364 PHE B CG  
3682 C CD1 . PHE B 176 ? 0.4889 0.6018 0.4920 -0.0434 -0.0857 -0.0924 364 PHE B CD1 
3683 C CD2 . PHE B 176 ? 0.5382 0.6229 0.5566 -0.0454 -0.0779 -0.0972 364 PHE B CD2 
3684 C CE1 . PHE B 176 ? 0.4845 0.5855 0.4805 -0.0341 -0.0791 -0.0932 364 PHE B CE1 
3685 C CE2 . PHE B 176 ? 0.5215 0.5950 0.5335 -0.0355 -0.0719 -0.0978 364 PHE B CE2 
3686 C CZ  . PHE B 176 ? 0.5101 0.5922 0.5111 -0.0301 -0.0723 -0.0962 364 PHE B CZ  
3687 N N   . SER B 177 ? 0.5618 0.7379 0.5977 -0.0690 -0.1121 -0.0780 365 SER B N   
3688 C CA  . SER B 177 ? 0.6482 0.8466 0.6909 -0.0791 -0.1227 -0.0760 365 SER B CA  
3689 C C   . SER B 177 ? 0.6998 0.8925 0.7332 -0.0944 -0.1268 -0.0897 365 SER B C   
3690 O O   . SER B 177 ? 0.6389 0.8089 0.6640 -0.0964 -0.1203 -0.1008 365 SER B O   
3691 C CB  . SER B 177 ? 0.6654 0.8828 0.7024 -0.0752 -0.1306 -0.0680 365 SER B CB  
3692 O OG  . SER B 177 ? 0.7291 0.9388 0.7422 -0.0777 -0.1316 -0.0759 365 SER B OG  
3693 N N   . ARG B 178 ? 0.6748 0.8883 0.7108 -0.1051 -0.1377 -0.0890 366 ARG B N   
3694 C CA  . ARG B 178 ? 0.7521 0.9636 0.7797 -0.1216 -0.1431 -0.1022 366 ARG B CA  
3695 C C   . ARG B 178 ? 0.7921 0.9890 0.8324 -0.1284 -0.1382 -0.1081 366 ARG B C   
3696 O O   . ARG B 178 ? 0.8291 1.0376 0.8804 -0.1407 -0.1446 -0.1090 366 ARG B O   
3697 C CB  . ARG B 178 ? 0.8207 1.0172 0.8219 -0.1240 -0.1408 -0.1156 366 ARG B CB  
3698 C CG  . ARG B 178 ? 0.9361 1.1295 0.9266 -0.1415 -0.1457 -0.1314 366 ARG B CG  
3699 C CD  . ARG B 178 ? 1.0367 1.2124 1.0025 -0.1431 -0.1401 -0.1470 366 ARG B CD  
3700 N NE  . ARG B 178 ? 1.1057 1.2529 1.0743 -0.1354 -0.1273 -0.1542 366 ARG B NE  
3701 C CZ  . ARG B 178 ? 1.1490 1.2854 1.1118 -0.1219 -0.1188 -0.1522 366 ARG B CZ  
3702 N NH1 . ARG B 178 ? 1.1585 1.2702 1.1259 -0.1155 -0.1085 -0.1583 366 ARG B NH1 
3703 N NH2 . ARG B 178 ? 1.1751 1.3254 1.1280 -0.1151 -0.1212 -0.1435 366 ARG B NH2 
3704 N N   . THR B 195 ? 0.9727 1.2654 1.2261 -0.1262 -0.0507 -0.0034 383 THR B N   
3705 C CA  . THR B 195 ? 0.9685 1.2344 1.1984 -0.1153 -0.0525 -0.0074 383 THR B CA  
3706 C C   . THR B 195 ? 0.9365 1.2157 1.1670 -0.1006 -0.0563 -0.0089 383 THR B C   
3707 O O   . THR B 195 ? 0.9467 1.2174 1.1664 -0.0974 -0.0649 -0.0143 383 THR B O   
3708 C CB  . THR B 195 ? 1.0004 1.2415 1.2172 -0.1239 -0.0610 -0.0145 383 THR B CB  
3709 O OG1 . THR B 195 ? 1.0299 1.2625 1.2517 -0.1395 -0.0591 -0.0126 383 THR B OG1 
3710 C CG2 . THR B 195 ? 0.9973 1.2083 1.1911 -0.1139 -0.0598 -0.0176 383 THR B CG2 
3711 N N   . VAL B 196 ? 0.8881 1.1883 1.1319 -0.0921 -0.0493 -0.0042 384 VAL B N   
3712 C CA  . VAL B 196 ? 0.7886 1.0976 1.0330 -0.0764 -0.0507 -0.0041 384 VAL B CA  
3713 C C   . VAL B 196 ? 0.6993 0.9960 0.9326 -0.0653 -0.0394 -0.0023 384 VAL B C   
3714 O O   . VAL B 196 ? 0.7140 1.0188 0.9548 -0.0668 -0.0288 0.0012  384 VAL B O   
3715 C CB  . VAL B 196 ? 0.7471 1.0919 1.0194 -0.0740 -0.0527 -0.0008 384 VAL B CB  
3716 C CG1 . VAL B 196 ? 0.6907 1.0419 0.9651 -0.0565 -0.0513 0.0007  384 VAL B CG1 
3717 C CG2 . VAL B 196 ? 0.7737 1.1316 1.0549 -0.0839 -0.0665 -0.0026 384 VAL B CG2 
3718 N N   . ARG B 197 ? 0.6368 0.9146 0.8514 -0.0551 -0.0414 -0.0048 385 ARG B N   
3719 C CA  . ARG B 197 ? 0.6266 0.8893 0.8275 -0.0463 -0.0320 -0.0038 385 ARG B CA  
3720 C C   . ARG B 197 ? 0.5378 0.8054 0.7387 -0.0308 -0.0314 -0.0041 385 ARG B C   
3721 O O   . ARG B 197 ? 0.5271 0.8032 0.7331 -0.0265 -0.0400 -0.0049 385 ARG B O   
3722 C CB  . ARG B 197 ? 0.7269 0.9584 0.9046 -0.0489 -0.0336 -0.0062 385 ARG B CB  
3723 C CG  . ARG B 197 ? 0.8153 1.0354 0.9829 -0.0481 -0.0443 -0.0116 385 ARG B CG  
3724 C CD  . ARG B 197 ? 0.8798 1.0887 1.0450 -0.0616 -0.0497 -0.0148 385 ARG B CD  
3725 N NE  . ARG B 197 ? 0.9199 1.1246 1.0783 -0.0623 -0.0597 -0.0213 385 ARG B NE  
3726 C CZ  . ARG B 197 ? 0.9255 1.1178 1.0792 -0.0728 -0.0652 -0.0269 385 ARG B CZ  
3727 N NH1 . ARG B 197 ? 0.9083 1.0985 1.0542 -0.0733 -0.0733 -0.0337 385 ARG B NH1 
3728 N NH2 . ARG B 197 ? 0.9243 1.1059 1.0805 -0.0831 -0.0623 -0.0260 385 ARG B NH2 
3729 N N   . GLY B 198 ? 0.5382 0.7999 0.7328 -0.0233 -0.0214 -0.0033 386 GLY B N   
3730 C CA  . GLY B 198 ? 0.4971 0.7610 0.6918 -0.0090 -0.0195 -0.0039 386 GLY B CA  
3731 C C   . GLY B 198 ? 0.4665 0.7527 0.6816 -0.0034 -0.0105 -0.0025 386 GLY B C   
3732 O O   . GLY B 198 ? 0.4482 0.7498 0.6769 -0.0110 -0.0044 -0.0010 386 GLY B O   
3733 N N   . THR B 199 ? 0.4562 0.7440 0.6742 0.0097  -0.0090 -0.0033 387 THR B N   
3734 C CA  . THR B 199 ? 0.4393 0.7455 0.6767 0.0174  0.0008  -0.0035 387 THR B CA  
3735 C C   . THR B 199 ? 0.4227 0.7546 0.6885 0.0212  -0.0057 -0.0008 387 THR B C   
3736 O O   . THR B 199 ? 0.4545 0.7850 0.7209 0.0273  -0.0163 0.0011  387 THR B O   
3737 C CB  . THR B 199 ? 0.4775 0.7696 0.7039 0.0299  0.0066  -0.0063 387 THR B CB  
3738 O OG1 . THR B 199 ? 0.5361 0.8058 0.7365 0.0258  0.0115  -0.0083 387 THR B OG1 
3739 C CG2 . THR B 199 ? 0.4166 0.7262 0.6635 0.0380  0.0182  -0.0084 387 THR B CG2 
3740 N N   . LEU B 200 ? 0.4047 0.7612 0.6942 0.0174  0.0005  0.0001  388 LEU B N   
3741 C CA  . LEU B 200 ? 0.4443 0.8290 0.7642 0.0186  -0.0065 0.0036  388 LEU B CA  
3742 C C   . LEU B 200 ? 0.3825 0.7749 0.7181 0.0345  -0.0096 0.0052  388 LEU B C   
3743 O O   . LEU B 200 ? 0.3430 0.7529 0.6977 0.0364  -0.0207 0.0099  388 LEU B O   
3744 C CB  . LEU B 200 ? 0.5411 0.9516 0.8849 0.0122  0.0036  0.0037  388 LEU B CB  
3745 C CG  . LEU B 200 ? 0.6186 1.0268 0.9536 -0.0055 0.0047  0.0043  388 LEU B CG  
3746 C CD1 . LEU B 200 ? 0.6349 1.0697 0.9937 -0.0113 0.0168  0.0046  388 LEU B CD1 
3747 C CD2 . LEU B 200 ? 0.6168 1.0260 0.9515 -0.0148 -0.0115 0.0067  388 LEU B CD2 
3748 N N   . ALA B 201 ? 0.3720 0.7512 0.6999 0.0453  -0.0001 0.0018  389 ALA B N   
3749 C CA  . ALA B 201 ? 0.4001 0.7836 0.7436 0.0609  -0.0018 0.0033  389 ALA B CA  
3750 C C   . ALA B 201 ? 0.4478 0.8195 0.7801 0.0641  -0.0177 0.0080  389 ALA B C   
3751 O O   . ALA B 201 ? 0.5068 0.8889 0.8575 0.0736  -0.0249 0.0129  389 ALA B O   
3752 C CB  . ALA B 201 ? 0.3805 0.7491 0.7150 0.0700  0.0120  -0.0027 389 ALA B CB  
3753 N N   . TYR B 202 ? 0.4562 0.8060 0.7582 0.0561  -0.0228 0.0068  390 TYR B N   
3754 C CA  . TYR B 202 ? 0.3845 0.7214 0.6714 0.0579  -0.0361 0.0101  390 TYR B CA  
3755 C C   . TYR B 202 ? 0.3702 0.7173 0.6573 0.0468  -0.0499 0.0133  390 TYR B C   
3756 O O   . TYR B 202 ? 0.4417 0.7799 0.7146 0.0461  -0.0610 0.0155  390 TYR B O   
3757 C CB  . TYR B 202 ? 0.3402 0.6467 0.5944 0.0573  -0.0328 0.0058  390 TYR B CB  
3758 C CG  . TYR B 202 ? 0.3398 0.6347 0.5915 0.0686  -0.0222 0.0029  390 TYR B CG  
3759 C CD1 . TYR B 202 ? 0.3493 0.6421 0.5996 0.0678  -0.0079 -0.0024 390 TYR B CD1 
3760 C CD2 . TYR B 202 ? 0.3394 0.6253 0.5897 0.0792  -0.0266 0.0055  390 TYR B CD2 
3761 C CE1 . TYR B 202 ? 0.3409 0.6230 0.5877 0.0771  0.0018  -0.0063 390 TYR B CE1 
3762 C CE2 . TYR B 202 ? 0.3522 0.6263 0.6005 0.0888  -0.0170 0.0020  390 TYR B CE2 
3763 C CZ  . TYR B 202 ? 0.3775 0.6498 0.6239 0.0877  -0.0027 -0.0046 390 TYR B CZ  
3764 O OH  . TYR B 202 ? 0.4200 0.6802 0.6631 0.0963  0.0069  -0.0093 390 TYR B OH  
3765 N N   . LEU B 203 ? 0.3448 0.7109 0.6476 0.0375  -0.0490 0.0132  391 LEU B N   
3766 C CA  . LEU B 203 ? 0.4128 0.7869 0.7140 0.0250  -0.0614 0.0146  391 LEU B CA  
3767 C C   . LEU B 203 ? 0.4683 0.8748 0.8014 0.0252  -0.0697 0.0205  391 LEU B C   
3768 O O   . LEU B 203 ? 0.4693 0.8954 0.8296 0.0310  -0.0621 0.0220  391 LEU B O   
3769 C CB  . LEU B 203 ? 0.4330 0.8008 0.7245 0.0109  -0.0559 0.0100  391 LEU B CB  
3770 C CG  . LEU B 203 ? 0.4602 0.7967 0.7211 0.0089  -0.0495 0.0050  391 LEU B CG  
3771 C CD1 . LEU B 203 ? 0.4375 0.7702 0.6941 -0.0047 -0.0444 0.0025  391 LEU B CD1 
3772 C CD2 . LEU B 203 ? 0.4581 0.7756 0.6955 0.0088  -0.0596 0.0037  391 LEU B CD2 
3773 N N   . PRO B 204 ? 0.4892 0.9025 0.8194 0.0186  -0.0853 0.0237  392 PRO B N   
3774 C CA  . PRO B 204 ? 0.4990 0.9449 0.8600 0.0178  -0.0953 0.0304  392 PRO B CA  
3775 C C   . PRO B 204 ? 0.5273 0.9917 0.9038 0.0043  -0.0929 0.0281  392 PRO B C   
3776 O O   . PRO B 204 ? 0.5498 0.9984 0.9096 -0.0050 -0.0850 0.0220  392 PRO B O   
3777 C CB  . PRO B 204 ? 0.4951 0.9388 0.8410 0.0134  -0.1128 0.0339  392 PRO B CB  
3778 C CG  . PRO B 204 ? 0.4802 0.8949 0.7901 0.0042  -0.1109 0.0260  392 PRO B CG  
3779 C CD  . PRO B 204 ? 0.4581 0.8511 0.7576 0.0116  -0.0945 0.0213  392 PRO B CD  
3780 N N   . GLU B 205 ? 0.5072 1.0041 0.9152 0.0026  -0.1002 0.0336  393 GLU B N   
3781 C CA  . GLU B 205 ? 0.5226 1.0393 0.9488 -0.0102 -0.0965 0.0318  393 GLU B CA  
3782 C C   . GLU B 205 ? 0.5042 1.0206 0.9174 -0.0283 -0.1092 0.0298  393 GLU B C   
3783 O O   . GLU B 205 ? 0.5532 1.0761 0.9720 -0.0420 -0.1058 0.0267  393 GLU B O   
3784 C CB  . GLU B 205 ? 0.6236 1.1782 1.0937 -0.0039 -0.0968 0.0379  393 GLU B CB  
3785 C CG  . GLU B 205 ? 0.7220 1.2909 1.2127 -0.0070 -0.0802 0.0347  393 GLU B CG  
3786 C CD  . GLU B 205 ? 0.8191 1.3937 1.3289 0.0106  -0.0659 0.0347  393 GLU B CD  
3787 O OE1 . GLU B 205 ? 0.8650 1.4687 1.4112 0.0196  -0.0687 0.0400  393 GLU B OE1 
3788 O OE2 . GLU B 205 ? 0.8294 1.3796 1.3186 0.0153  -0.0522 0.0292  393 GLU B OE2 
3789 N N   . GLU B 206 ? 0.5096 1.0171 0.9041 -0.0293 -0.1234 0.0310  394 GLU B N   
3790 C CA  . GLU B 206 ? 0.5274 1.0331 0.9072 -0.0468 -0.1352 0.0273  394 GLU B CA  
3791 C C   . GLU B 206 ? 0.5759 1.0473 0.9234 -0.0547 -0.1272 0.0179  394 GLU B C   
3792 O O   . GLU B 206 ? 0.6090 1.0767 0.9489 -0.0707 -0.1309 0.0126  394 GLU B O   
3793 C CB  . GLU B 206 ? 0.5541 1.0638 0.9235 -0.0463 -0.1529 0.0315  394 GLU B CB  
3794 C CG  . GLU B 206 ? 0.6503 1.1269 0.9803 -0.0456 -0.1541 0.0263  394 GLU B CG  
3795 C CD  . GLU B 206 ? 0.6700 1.1337 0.9941 -0.0274 -0.1491 0.0308  394 GLU B CD  
3796 O OE1 . GLU B 206 ? 0.6750 1.1569 1.0257 -0.0152 -0.1484 0.0388  394 GLU B OE1 
3797 O OE2 . GLU B 206 ? 0.7146 1.1500 1.0085 -0.0254 -0.1459 0.0260  394 GLU B OE2 
3798 N N   . TYR B 207 ? 0.5871 1.0334 0.9170 -0.0436 -0.1166 0.0159  395 TYR B N   
3799 C CA  . TYR B 207 ? 0.5687 0.9836 0.8718 -0.0493 -0.1082 0.0082  395 TYR B CA  
3800 C C   . TYR B 207 ? 0.5533 0.9700 0.8680 -0.0540 -0.0947 0.0072  395 TYR B C   
3801 O O   . TYR B 207 ? 0.5413 0.9428 0.8440 -0.0660 -0.0918 0.0024  395 TYR B O   
3802 C CB  . TYR B 207 ? 0.5693 0.9577 0.8489 -0.0367 -0.1029 0.0068  395 TYR B CB  
3803 C CG  . TYR B 207 ? 0.5515 0.9105 0.8091 -0.0402 -0.0926 0.0005  395 TYR B CG  
3804 C CD1 . TYR B 207 ? 0.5477 0.8889 0.7861 -0.0522 -0.0969 -0.0061 395 TYR B CD1 
3805 C CD2 . TYR B 207 ? 0.5476 0.8968 0.8044 -0.0316 -0.0789 0.0010  395 TYR B CD2 
3806 C CE1 . TYR B 207 ? 0.5349 0.8493 0.7558 -0.0547 -0.0884 -0.0108 395 TYR B CE1 
3807 C CE2 . TYR B 207 ? 0.5303 0.8537 0.7677 -0.0351 -0.0709 -0.0033 395 TYR B CE2 
3808 C CZ  . TYR B 207 ? 0.5617 0.8679 0.7824 -0.0461 -0.0760 -0.0086 395 TYR B CZ  
3809 O OH  . TYR B 207 ? 0.5761 0.8568 0.7800 -0.0487 -0.0688 -0.0118 395 TYR B OH  
3810 N N   . ILE B 208 ? 0.5282 0.9635 0.8665 -0.0447 -0.0862 0.0117  396 ILE B N   
3811 C CA  . ILE B 208 ? 0.5646 1.0058 0.9152 -0.0489 -0.0723 0.0114  396 ILE B CA  
3812 C C   . ILE B 208 ? 0.6512 1.1091 1.0162 -0.0668 -0.0763 0.0112  396 ILE B C   
3813 O O   . ILE B 208 ? 0.7082 1.1573 1.0687 -0.0770 -0.0679 0.0093  396 ILE B O   
3814 C CB  . ILE B 208 ? 0.5330 0.9961 0.9100 -0.0356 -0.0628 0.0153  396 ILE B CB  
3815 C CG1 . ILE B 208 ? 0.5528 0.9945 0.9133 -0.0200 -0.0550 0.0140  396 ILE B CG1 
3816 C CG2 . ILE B 208 ? 0.4993 0.9770 0.8935 -0.0427 -0.0495 0.0151  396 ILE B CG2 
3817 C CD1 . ILE B 208 ? 0.5601 1.0204 0.9457 -0.0054 -0.0463 0.0164  396 ILE B CD1 
3818 N N   . LYS B 209 ? 0.5767 1.0582 0.9584 -0.0712 -0.0899 0.0137  397 LYS B N   
3819 C CA  . LYS B 209 ? 0.6485 1.1497 1.0473 -0.0885 -0.0949 0.0137  397 LYS B CA  
3820 C C   . LYS B 209 ? 0.6876 1.1705 1.0642 -0.1040 -0.1057 0.0079  397 LYS B C   
3821 O O   . LYS B 209 ? 0.7568 1.2520 1.1444 -0.1202 -0.1106 0.0068  397 LYS B O   
3822 C CB  . LYS B 209 ? 0.6929 1.2341 1.1262 -0.0861 -0.1042 0.0199  397 LYS B CB  
3823 C CG  . LYS B 209 ? 0.7465 1.3131 1.2118 -0.0762 -0.0917 0.0243  397 LYS B CG  
3824 C CD  . LYS B 209 ? 0.8001 1.3711 1.2738 -0.0886 -0.0785 0.0226  397 LYS B CD  
3825 C CE  . LYS B 209 ? 0.8010 1.4068 1.3129 -0.0824 -0.0679 0.0265  397 LYS B CE  
3826 N NZ  . LYS B 209 ? 0.7900 1.4036 1.3107 -0.0969 -0.0557 0.0256  397 LYS B NZ  
3827 N N   . THR B 210 ? 0.6798 1.1334 1.0258 -0.0995 -0.1088 0.0036  398 THR B N   
3828 C CA  . THR B 210 ? 0.6874 1.1225 1.0116 -0.1129 -0.1182 -0.0037 398 THR B CA  
3829 C C   . THR B 210 ? 0.6668 1.0627 0.9620 -0.1127 -0.1099 -0.0098 398 THR B C   
3830 O O   . THR B 210 ? 0.6638 1.0452 0.9534 -0.1256 -0.1072 -0.0140 398 THR B O   
3831 C CB  . THR B 210 ? 0.7108 1.1510 1.0254 -0.1104 -0.1333 -0.0042 398 THR B CB  
3832 O OG1 . THR B 210 ? 0.6844 1.1619 1.0270 -0.1119 -0.1432 0.0024  398 THR B OG1 
3833 C CG2 . THR B 210 ? 0.7585 1.1791 1.0493 -0.1249 -0.1413 -0.0137 398 THR B CG2 
3834 N N   . GLY B 211 ? 0.6708 1.0497 0.9488 -0.0981 -0.1065 -0.0099 399 GLY B N   
3835 C CA  . GLY B 211 ? 0.6717 1.0152 0.9233 -0.0965 -0.1000 -0.0152 399 GLY B CA  
3836 C C   . GLY B 211 ? 0.7092 1.0364 0.9377 -0.0976 -0.1093 -0.0220 399 GLY B C   
3837 O O   . GLY B 211 ? 0.7255 1.0239 0.9324 -0.0965 -0.1055 -0.0277 399 GLY B O   
3838 N N   . ARG B 212 ? 0.6801 1.0272 0.9135 -0.1002 -0.1217 -0.0214 400 ARG B N   
3839 C CA  . ARG B 212 ? 0.7516 1.0879 0.9625 -0.1015 -0.1308 -0.0273 400 ARG B CA  
3840 C C   . ARG B 212 ? 0.7480 1.0685 0.9426 -0.0855 -0.1259 -0.0258 400 ARG B C   
3841 O O   . ARG B 212 ? 0.7504 1.0810 0.9561 -0.0726 -0.1219 -0.0179 400 ARG B O   
3842 C CB  . ARG B 212 ? 0.8161 1.1811 1.0371 -0.1070 -0.1456 -0.0243 400 ARG B CB  
3843 C CG  . ARG B 212 ? 0.8721 1.2407 1.0812 -0.0968 -0.1528 -0.0206 400 ARG B CG  
3844 C CD  . ARG B 212 ? 0.9138 1.3166 1.1411 -0.0994 -0.1668 -0.0128 400 ARG B CD  
3845 N NE  . ARG B 212 ? 0.9409 1.3468 1.1562 -0.0909 -0.1749 -0.0077 400 ARG B NE  
3846 C CZ  . ARG B 212 ? 0.9460 1.3570 1.1704 -0.0745 -0.1721 0.0019  400 ARG B CZ  
3847 N NH1 . ARG B 212 ? 0.9472 1.3596 1.1594 -0.0685 -0.1804 0.0071  400 ARG B NH1 
3848 N NH2 . ARG B 212 ? 0.9523 1.3661 1.1971 -0.0646 -0.1609 0.0061  400 ARG B NH2 
3849 N N   . LEU B 213 ? 0.7880 1.0835 0.9572 -0.0864 -0.1257 -0.0339 401 LEU B N   
3850 C CA  . LEU B 213 ? 0.7335 1.0138 0.8867 -0.0727 -0.1211 -0.0330 401 LEU B CA  
3851 C C   . LEU B 213 ? 0.6674 0.9559 0.8089 -0.0713 -0.1316 -0.0325 401 LEU B C   
3852 O O   . LEU B 213 ? 0.6737 0.9615 0.8030 -0.0825 -0.1395 -0.0397 401 LEU B O   
3853 C CB  . LEU B 213 ? 0.7882 1.0366 0.9226 -0.0729 -0.1130 -0.0412 401 LEU B CB  
3854 C CG  . LEU B 213 ? 0.8430 1.0756 0.9652 -0.0865 -0.1158 -0.0529 401 LEU B CG  
3855 C CD1 . LEU B 213 ? 0.8694 1.0950 0.9698 -0.0876 -0.1215 -0.0606 401 LEU B CD1 
3856 C CD2 . LEU B 213 ? 0.8571 1.0635 0.9755 -0.0864 -0.1058 -0.0564 401 LEU B CD2 
3857 N N   . ALA B 214 ? 0.6131 0.9094 0.7581 -0.0582 -0.1316 -0.0240 402 ALA B N   
3858 C CA  . ALA B 214 ? 0.5317 0.8357 0.6658 -0.0558 -0.1414 -0.0207 402 ALA B CA  
3859 C C   . ALA B 214 ? 0.4745 0.7709 0.6050 -0.0399 -0.1359 -0.0142 402 ALA B C   
3860 O O   . ALA B 214 ? 0.4866 0.7812 0.6303 -0.0305 -0.1269 -0.0102 402 ALA B O   
3861 C CB  . ALA B 214 ? 0.4694 0.8046 0.6222 -0.0605 -0.1540 -0.0131 402 ALA B CB  
3862 N N   . VAL B 215 ? 0.4341 0.7259 0.5460 -0.0378 -0.1411 -0.0135 403 VAL B N   
3863 C CA  . VAL B 215 ? 0.4563 0.7401 0.5636 -0.0240 -0.1370 -0.0071 403 VAL B CA  
3864 C C   . VAL B 215 ? 0.4647 0.7682 0.5966 -0.0140 -0.1402 0.0055  403 VAL B C   
3865 O O   . VAL B 215 ? 0.4629 0.7595 0.5991 -0.0013 -0.1336 0.0104  403 VAL B O   
3866 C CB  . VAL B 215 ? 0.4942 0.7713 0.5762 -0.0260 -0.1427 -0.0084 403 VAL B CB  
3867 C CG1 . VAL B 215 ? 0.5021 0.7576 0.5616 -0.0330 -0.1367 -0.0219 403 VAL B CG1 
3868 C CG2 . VAL B 215 ? 0.4824 0.7813 0.5642 -0.0347 -0.1578 -0.0037 403 VAL B CG2 
3869 N N   . ASP B 216 ? 0.4108 0.7390 0.5601 -0.0198 -0.1502 0.0102  404 ASP B N   
3870 C CA  . ASP B 216 ? 0.4500 0.8000 0.6271 -0.0107 -0.1542 0.0220  404 ASP B CA  
3871 C C   . ASP B 216 ? 0.4137 0.7615 0.6106 -0.0013 -0.1407 0.0221  404 ASP B C   
3872 O O   . ASP B 216 ? 0.4316 0.7877 0.6473 0.0110  -0.1389 0.0299  404 ASP B O   
3873 C CB  . ASP B 216 ? 0.5543 0.9326 0.7484 -0.0206 -0.1671 0.0259  404 ASP B CB  
3874 C CG  . ASP B 216 ? 0.6875 1.0677 0.8587 -0.0337 -0.1798 0.0229  404 ASP B CG  
3875 O OD1 . ASP B 216 ? 0.7433 1.1132 0.8930 -0.0311 -0.1831 0.0250  404 ASP B OD1 
3876 O OD2 . ASP B 216 ? 0.7644 1.1563 0.9384 -0.0474 -0.1861 0.0181  404 ASP B OD2 
3877 N N   . THR B 217 ? 0.3862 0.7224 0.5787 -0.0074 -0.1312 0.0131  405 THR B N   
3878 C CA  . THR B 217 ? 0.4080 0.7402 0.6138 -0.0005 -0.1175 0.0123  405 THR B CA  
3879 C C   . THR B 217 ? 0.3744 0.6872 0.5695 0.0125  -0.1091 0.0130  405 THR B C   
3880 O O   . THR B 217 ? 0.4107 0.7286 0.6224 0.0234  -0.1026 0.0172  405 THR B O   
3881 C CB  . THR B 217 ? 0.4347 0.7555 0.6339 -0.0109 -0.1101 0.0037  405 THR B CB  
3882 O OG1 . THR B 217 ? 0.4272 0.7625 0.6326 -0.0248 -0.1189 0.0018  405 THR B OG1 
3883 C CG2 . THR B 217 ? 0.3997 0.7226 0.6150 -0.0060 -0.0972 0.0044  405 THR B CG2 
3884 N N   . ASP B 218 ? 0.3679 0.6590 0.5360 0.0109  -0.1089 0.0083  406 ASP B N   
3885 C CA  . ASP B 218 ? 0.3533 0.6261 0.5094 0.0216  -0.1023 0.0089  406 ASP B CA  
3886 C C   . ASP B 218 ? 0.3573 0.6401 0.5247 0.0321  -0.1076 0.0186  406 ASP B C   
3887 O O   . ASP B 218 ? 0.3344 0.6111 0.5084 0.0432  -0.1002 0.0209  406 ASP B O   
3888 C CB  . ASP B 218 ? 0.3392 0.5916 0.4665 0.0172  -0.1033 0.0029  406 ASP B CB  
3889 C CG  . ASP B 218 ? 0.3705 0.6060 0.4871 0.0115  -0.0950 -0.0061 406 ASP B CG  
3890 O OD1 . ASP B 218 ? 0.3873 0.6235 0.5156 0.0122  -0.0873 -0.0067 406 ASP B OD1 
3891 O OD2 . ASP B 218 ? 0.3866 0.6080 0.4833 0.0064  -0.0961 -0.0124 406 ASP B OD2 
3892 N N   . THR B 219 ? 0.3654 0.6631 0.5347 0.0281  -0.1208 0.0243  407 THR B N   
3893 C CA  . THR B 219 ? 0.4035 0.7117 0.5851 0.0374  -0.1281 0.0355  407 THR B CA  
3894 C C   . THR B 219 ? 0.3455 0.6688 0.5600 0.0475  -0.1233 0.0403  407 THR B C   
3895 O O   . THR B 219 ? 0.3027 0.6217 0.5264 0.0599  -0.1200 0.0455  407 THR B O   
3896 C CB  . THR B 219 ? 0.4768 0.8023 0.6564 0.0295  -0.1446 0.0418  407 THR B CB  
3897 O OG1 . THR B 219 ? 0.4783 0.7902 0.6264 0.0198  -0.1476 0.0358  407 THR B OG1 
3898 C CG2 . THR B 219 ? 0.4805 0.8152 0.6722 0.0394  -0.1532 0.0553  407 THR B CG2 
3899 N N   . PHE B 220 ? 0.3792 0.7197 0.6118 0.0418  -0.1222 0.0380  408 PHE B N   
3900 C CA  . PHE B 220 ? 0.3647 0.7215 0.6295 0.0503  -0.1157 0.0408  408 PHE B CA  
3901 C C   . PHE B 220 ? 0.3505 0.6895 0.6131 0.0593  -0.0994 0.0355  408 PHE B C   
3902 O O   . PHE B 220 ? 0.3305 0.6721 0.6106 0.0720  -0.0948 0.0391  408 PHE B O   
3903 C CB  . PHE B 220 ? 0.3707 0.7479 0.6523 0.0401  -0.1159 0.0380  408 PHE B CB  
3904 C CG  . PHE B 220 ? 0.4344 0.8335 0.7520 0.0480  -0.1099 0.0413  408 PHE B CG  
3905 C CD1 . PHE B 220 ? 0.4526 0.8463 0.7759 0.0512  -0.0934 0.0350  408 PHE B CD1 
3906 C CD2 . PHE B 220 ? 0.4443 0.8702 0.7903 0.0521  -0.1206 0.0506  408 PHE B CD2 
3907 C CE1 . PHE B 220 ? 0.4705 0.8852 0.8268 0.0582  -0.0864 0.0367  408 PHE B CE1 
3908 C CE2 . PHE B 220 ? 0.4590 0.9063 0.8409 0.0601  -0.1142 0.0529  408 PHE B CE2 
3909 C CZ  . PHE B 220 ? 0.4781 0.9199 0.8650 0.0631  -0.0963 0.0453  408 PHE B CZ  
3910 N N   . SER B 221 ? 0.3358 0.6568 0.5772 0.0527  -0.0910 0.0267  409 SER B N   
3911 C CA  . SER B 221 ? 0.3120 0.6156 0.5470 0.0592  -0.0765 0.0214  409 SER B CA  
3912 C C   . SER B 221 ? 0.3009 0.5893 0.5285 0.0707  -0.0757 0.0243  409 SER B C   
3913 O O   . SER B 221 ? 0.3265 0.6109 0.5638 0.0804  -0.0660 0.0232  409 SER B O   
3914 C CB  . SER B 221 ? 0.3610 0.6458 0.5713 0.0497  -0.0712 0.0135  409 SER B CB  
3915 O OG  . SER B 221 ? 0.4030 0.6994 0.6210 0.0390  -0.0705 0.0110  409 SER B OG  
3916 N N   . PHE B 222 ? 0.2744 0.5545 0.4847 0.0687  -0.0856 0.0277  410 PHE B N   
3917 C CA  . PHE B 222 ? 0.3324 0.5981 0.5350 0.0780  -0.0861 0.0316  410 PHE B CA  
3918 C C   . PHE B 222 ? 0.3848 0.6643 0.6151 0.0894  -0.0893 0.0402  410 PHE B C   
3919 O O   . PHE B 222 ? 0.3920 0.6602 0.6261 0.0998  -0.0836 0.0412  410 PHE B O   
3920 C CB  . PHE B 222 ? 0.3029 0.5596 0.4813 0.0721  -0.0961 0.0340  410 PHE B CB  
3921 C CG  . PHE B 222 ? 0.3169 0.5588 0.4867 0.0802  -0.0969 0.0390  410 PHE B CG  
3922 C CD1 . PHE B 222 ? 0.3363 0.5564 0.4907 0.0833  -0.0870 0.0333  410 PHE B CD1 
3923 C CD2 . PHE B 222 ? 0.3236 0.5738 0.5010 0.0842  -0.1080 0.0502  410 PHE B CD2 
3924 C CE1 . PHE B 222 ? 0.3760 0.5822 0.5230 0.0896  -0.0877 0.0378  410 PHE B CE1 
3925 C CE2 . PHE B 222 ? 0.3564 0.5919 0.5261 0.0908  -0.1088 0.0557  410 PHE B CE2 
3926 C CZ  . PHE B 222 ? 0.3573 0.5706 0.5119 0.0934  -0.0982 0.0491  410 PHE B CZ  
3927 N N   . GLY B 223 ? 0.3997 0.7035 0.6503 0.0872  -0.0988 0.0463  411 GLY B N   
3928 C CA  . GLY B 223 ? 0.3882 0.7082 0.6704 0.0984  -0.1021 0.0549  411 GLY B CA  
3929 C C   . GLY B 223 ? 0.3864 0.7074 0.6893 0.1079  -0.0869 0.0492  411 GLY B C   
3930 O O   . GLY B 223 ? 0.3477 0.6653 0.6666 0.1207  -0.0838 0.0526  411 GLY B O   
3931 N N   . VAL B 224 ? 0.3906 0.7156 0.6928 0.1011  -0.0772 0.0405  412 VAL B N   
3932 C CA  . VAL B 224 ? 0.3763 0.7022 0.6934 0.1078  -0.0612 0.0337  412 VAL B CA  
3933 C C   . VAL B 224 ? 0.4134 0.7122 0.7129 0.1148  -0.0518 0.0288  412 VAL B C   
3934 O O   . VAL B 224 ? 0.3752 0.6727 0.6912 0.1259  -0.0430 0.0269  412 VAL B O   
3935 C CB  . VAL B 224 ? 0.3731 0.7055 0.6866 0.0969  -0.0526 0.0260  412 VAL B CB  
3936 C CG1 . VAL B 224 ? 0.3527 0.6876 0.6800 0.1031  -0.0356 0.0192  412 VAL B CG1 
3937 C CG2 . VAL B 224 ? 0.3524 0.7112 0.6830 0.0884  -0.0619 0.0303  412 VAL B CG2 
3938 N N   . VAL B 225 ? 0.4111 0.6889 0.6783 0.1081  -0.0537 0.0263  413 VAL B N   
3939 C CA  . VAL B 225 ? 0.4120 0.6644 0.6610 0.1132  -0.0465 0.0222  413 VAL B CA  
3940 C C   . VAL B 225 ? 0.4531 0.6998 0.7130 0.1251  -0.0507 0.0290  413 VAL B C   
3941 O O   . VAL B 225 ? 0.4925 0.7266 0.7556 0.1335  -0.0414 0.0249  413 VAL B O   
3942 C CB  . VAL B 225 ? 0.3735 0.6074 0.5887 0.1039  -0.0500 0.0198  413 VAL B CB  
3943 C CG1 . VAL B 225 ? 0.3188 0.5286 0.5173 0.1092  -0.0452 0.0175  413 VAL B CG1 
3944 C CG2 . VAL B 225 ? 0.3219 0.5560 0.5261 0.0936  -0.0440 0.0126  413 VAL B CG2 
3945 N N   . VAL B 226 ? 0.4122 0.6678 0.6777 0.1251  -0.0651 0.0394  414 VAL B N   
3946 C CA  . VAL B 226 ? 0.4369 0.6881 0.7146 0.1359  -0.0711 0.0485  414 VAL B CA  
3947 C C   . VAL B 226 ? 0.4580 0.7206 0.7712 0.1485  -0.0644 0.0485  414 VAL B C   
3948 O O   . VAL B 226 ? 0.4591 0.7075 0.7792 0.1590  -0.0589 0.0480  414 VAL B O   
3949 C CB  . VAL B 226 ? 0.4135 0.6761 0.6914 0.1323  -0.0890 0.0611  414 VAL B CB  
3950 C CG1 . VAL B 226 ? 0.3364 0.5965 0.6317 0.1441  -0.0959 0.0727  414 VAL B CG1 
3951 C CG2 . VAL B 226 ? 0.3829 0.6323 0.6249 0.1207  -0.0945 0.0602  414 VAL B CG2 
3952 N N   . LEU B 227 ? 0.4270 0.7152 0.7636 0.1473  -0.0642 0.0484  415 LEU B N   
3953 C CA  . LEU B 227 ? 0.4284 0.7308 0.8018 0.1593  -0.0565 0.0473  415 LEU B CA  
3954 C C   . LEU B 227 ? 0.4428 0.7298 0.8122 0.1640  -0.0377 0.0343  415 LEU B C   
3955 O O   . LEU B 227 ? 0.4281 0.7112 0.8180 0.1766  -0.0309 0.0327  415 LEU B O   
3956 C CB  . LEU B 227 ? 0.4150 0.7489 0.8124 0.1549  -0.0578 0.0478  415 LEU B CB  
3957 C CG  . LEU B 227 ? 0.4287 0.7862 0.8531 0.1582  -0.0735 0.0607  415 LEU B CG  
3958 C CD1 . LEU B 227 ? 0.4351 0.8203 0.8869 0.1565  -0.0689 0.0568  415 LEU B CD1 
3959 C CD2 . LEU B 227 ? 0.4257 0.7688 0.8572 0.1705  -0.0771 0.0653  415 LEU B CD2 
3960 N N   . GLU B 228 ? 0.4584 0.7364 0.8013 0.1535  -0.0298 0.0251  416 GLU B N   
3961 C CA  . GLU B 228 ? 0.4643 0.7281 0.7979 0.1552  -0.0129 0.0128  416 GLU B CA  
3962 C C   . GLU B 228 ? 0.4560 0.6929 0.7776 0.1625  -0.0112 0.0118  416 GLU B C   
3963 O O   . GLU B 228 ? 0.4775 0.7065 0.8082 0.1707  0.0008  0.0042  416 GLU B O   
3964 C CB  . GLU B 228 ? 0.4833 0.7418 0.7884 0.1415  -0.0081 0.0061  416 GLU B CB  
3965 C CG  . GLU B 228 ? 0.5277 0.7757 0.8224 0.1410  0.0087  -0.0059 416 GLU B CG  
3966 C CD  . GLU B 228 ? 0.5408 0.7860 0.8105 0.1273  0.0118  -0.0101 416 GLU B CD  
3967 O OE1 . GLU B 228 ? 0.5508 0.7870 0.8076 0.1249  0.0242  -0.0187 416 GLU B OE1 
3968 O OE2 . GLU B 228 ? 0.4822 0.7336 0.7452 0.1187  0.0017  -0.0048 416 GLU B OE2 
3969 N N   . THR B 229 ? 0.4481 0.6714 0.7494 0.1590  -0.0231 0.0191  417 THR B N   
3970 C CA  . THR B 229 ? 0.4421 0.6401 0.7309 0.1642  -0.0230 0.0196  417 THR B CA  
3971 C C   . THR B 229 ? 0.4798 0.6783 0.7982 0.1783  -0.0255 0.0261  417 THR B C   
3972 O O   . THR B 229 ? 0.4795 0.6587 0.7982 0.1856  -0.0191 0.0223  417 THR B O   
3973 C CB  . THR B 229 ? 0.4632 0.6495 0.7243 0.1560  -0.0351 0.0267  417 THR B CB  
3974 O OG1 . THR B 229 ? 0.4869 0.6735 0.7243 0.1437  -0.0333 0.0208  417 THR B OG1 
3975 C CG2 . THR B 229 ? 0.4261 0.5860 0.6722 0.1594  -0.0336 0.0263  417 THR B CG2 
3976 N N   . LEU B 230 ? 0.4953 0.7162 0.8399 0.1821  -0.0349 0.0358  418 LEU B N   
3977 C CA  . LEU B 230 ? 0.5573 0.7812 0.9344 0.1963  -0.0387 0.0436  418 LEU B CA  
3978 C C   . LEU B 230 ? 0.5857 0.8127 0.9836 0.2049  -0.0229 0.0317  418 LEU B C   
3979 O O   . LEU B 230 ? 0.6226 0.8301 1.0215 0.2128  -0.0159 0.0269  418 LEU B O   
3980 C CB  . LEU B 230 ? 0.5901 0.8354 0.9796 0.1944  -0.0548 0.0561  418 LEU B CB  
3981 C CG  . LEU B 230 ? 0.6477 0.8841 1.0211 0.1909  -0.0720 0.0703  418 LEU B CG  
3982 C CD1 . LEU B 230 ? 0.6882 0.9473 1.0727 0.1876  -0.0867 0.0805  418 LEU B CD1 
3983 C CD2 . LEU B 230 ? 0.6799 0.8911 1.0521 0.1998  -0.0716 0.0735  418 LEU B CD2 
3984 N N   . ALA B 231 ? 0.5585 0.8104 0.9719 0.2024  -0.0173 0.0269  419 ALA B N   
3985 C CA  . ALA B 231 ? 0.5802 0.8397 1.0128 0.2092  -0.0020 0.0158  419 ALA B CA  
3986 C C   . ALA B 231 ? 0.6066 0.8491 1.0251 0.2089  0.0161  0.0007  419 ALA B C   
3987 O O   . ALA B 231 ? 0.5957 0.8329 1.0228 0.2160  0.0287  -0.0088 419 ALA B O   
3988 C CB  . ALA B 231 ? 0.6034 0.8952 1.0545 0.2046  -0.0008 0.0153  419 ALA B CB  
3989 N N   . GLY B 232 ? 0.6603 0.8930 1.0513 0.1986  0.0169  -0.0022 420 GLY B N   
3990 C CA  . GLY B 232 ? 0.6569 0.8723 1.0250 0.1947  0.0321  -0.0166 420 GLY B CA  
3991 C C   . GLY B 232 ? 0.6651 0.8986 1.0406 0.1911  0.0473  -0.0277 420 GLY B C   
3992 O O   . GLY B 232 ? 0.6899 0.9129 1.0539 0.1902  0.0621  -0.0407 420 GLY B O   
3993 N N   . GLN B 233 ? 0.5379 0.7992 0.9320 0.1881  0.0437  -0.0226 421 GLN B N   
3994 C CA  . GLN B 233 ? 0.5829 0.8632 0.9823 0.1823  0.0575  -0.0316 421 GLN B CA  
3995 C C   . GLN B 233 ? 0.6080 0.8981 0.9882 0.1668  0.0504  -0.0268 421 GLN B C   
3996 O O   . GLN B 233 ? 0.6354 0.9250 1.0084 0.1627  0.0343  -0.0162 421 GLN B O   
3997 C CB  . GLN B 233 ? 0.6489 0.9551 1.0898 0.1920  0.0628  -0.0317 421 GLN B CB  
3998 C CG  . GLN B 233 ? 0.6918 1.0159 1.1530 0.1942  0.0453  -0.0172 421 GLN B CG  
3999 C CD  . GLN B 233 ? 0.7544 1.0986 1.2447 0.2021  0.0491  -0.0177 421 GLN B CD  
4000 O OE1 . GLN B 233 ? 0.7532 1.1171 1.2546 0.1989  0.0616  -0.0247 421 GLN B OE1 
4001 N NE2 . GLN B 233 ? 0.8065 1.1460 1.3098 0.2124  0.0386  -0.0101 421 GLN B NE2 
4002 N N   . ARG B 234 ? 0.6040 0.9024 0.9755 0.1579  0.0628  -0.0348 422 ARG B N   
4003 C CA  . ARG B 234 ? 0.5916 0.8930 0.9404 0.1424  0.0582  -0.0319 422 ARG B CA  
4004 C C   . ARG B 234 ? 0.5312 0.8576 0.9001 0.1382  0.0470  -0.0224 422 ARG B C   
4005 O O   . ARG B 234 ? 0.5538 0.9018 0.9579 0.1463  0.0462  -0.0194 422 ARG B O   
4006 C CB  . ARG B 234 ? 0.6203 0.9246 0.9563 0.1340  0.0748  -0.0419 422 ARG B CB  
4007 C CG  . ARG B 234 ? 0.6844 0.9671 1.0023 0.1377  0.0867  -0.0525 422 ARG B CG  
4008 C CD  . ARG B 234 ? 0.7650 1.0461 1.0587 0.1256  0.0989  -0.0599 422 ARG B CD  
4009 N NE  . ARG B 234 ? 0.8640 1.1174 1.1240 0.1227  0.0995  -0.0642 422 ARG B NE  
4010 C CZ  . ARG B 234 ? 0.9398 1.1771 1.1735 0.1154  0.0878  -0.0581 422 ARG B CZ  
4011 N NH1 . ARG B 234 ? 0.9520 1.1967 1.1879 0.1100  0.0752  -0.0483 422 ARG B NH1 
4012 N NH2 . ARG B 234 ? 0.9676 1.1819 1.1737 0.1132  0.0888  -0.0623 422 ARG B NH2 
4013 N N   . ALA B 235 ? 0.5131 0.8363 0.8601 0.1253  0.0382  -0.0180 423 ALA B N   
4014 C CA  . ALA B 235 ? 0.4777 0.8215 0.8384 0.1188  0.0264  -0.0098 423 ALA B CA  
4015 C C   . ALA B 235 ? 0.4426 0.8146 0.8268 0.1141  0.0360  -0.0123 423 ALA B C   
4016 O O   . ALA B 235 ? 0.4005 0.7961 0.8084 0.1121  0.0280  -0.0061 423 ALA B O   
4017 C CB  . ALA B 235 ? 0.4529 0.7828 0.7826 0.1060  0.0162  -0.0066 423 ALA B CB  
4018 N N   . VAL B 236 ? 0.5010 0.8709 0.8775 0.1112  0.0529  -0.0213 424 VAL B N   
4019 C CA  . VAL B 236 ? 0.5211 0.9179 0.9199 0.1071  0.0651  -0.0248 424 VAL B CA  
4020 C C   . VAL B 236 ? 0.5696 0.9688 0.9808 0.1171  0.0835  -0.0351 424 VAL B C   
4021 O O   . VAL B 236 ? 0.5717 0.9479 0.9593 0.1193  0.0909  -0.0420 424 VAL B O   
4022 C CB  . VAL B 236 ? 0.5466 0.9422 0.9225 0.0898  0.0698  -0.0259 424 VAL B CB  
4023 C CG1 . VAL B 236 ? 0.5013 0.9294 0.9046 0.0830  0.0750  -0.0246 424 VAL B CG1 
4024 C CG2 . VAL B 236 ? 0.5769 0.9546 0.9260 0.0805  0.0544  -0.0196 424 VAL B CG2 
4025 N N   . LYS B 237 ? 0.5385 0.9665 0.9876 0.1229  0.0909  -0.0366 425 LYS B N   
4026 C CA  . LYS B 237 ? 0.5973 1.0313 1.0633 0.1328  0.1097  -0.0477 425 LYS B CA  
4027 C C   . LYS B 237 ? 0.6243 1.0897 1.1118 0.1262  0.1239  -0.0517 425 LYS B C   
4028 O O   . LYS B 237 ? 0.5980 1.0857 1.1014 0.1186  0.1165  -0.0441 425 LYS B O   
4029 C CB  . LYS B 237 ? 0.6510 1.0880 1.1493 0.1516  0.1055  -0.0461 425 LYS B CB  
4030 C CG  . LYS B 237 ? 0.6876 1.0920 1.1669 0.1614  0.1063  -0.0507 425 LYS B CG  
4031 C CD  . LYS B 237 ? 0.6686 1.0681 1.1653 0.1762  0.0948  -0.0431 425 LYS B CD  
4032 C CE  . LYS B 237 ? 0.6269 1.0476 1.1521 0.1842  0.1020  -0.0447 425 LYS B CE  
4033 N NZ  . LYS B 237 ? 0.5913 1.0059 1.1329 0.1985  0.0905  -0.0385 425 LYS B NZ  
4034 N N   . THR B 238 ? 0.6592 1.1258 1.1454 0.1281  0.1443  -0.0637 426 THR B N   
4035 C CA  . THR B 238 ? 0.6986 1.1908 1.2020 0.1237  0.1578  -0.0654 426 THR B CA  
4036 C C   . THR B 238 ? 0.7073 1.2047 1.2348 0.1402  0.1619  -0.0666 426 THR B C   
4037 O O   . THR B 238 ? 0.7367 1.2156 1.2529 0.1487  0.1717  -0.0755 426 THR B O   
4038 C CB  . THR B 238 ? 0.7305 1.2190 1.2072 0.1118  0.1770  -0.0756 426 THR B CB  
4039 O OG1 . THR B 238 ? 0.7610 1.2201 1.2105 0.1173  0.1829  -0.0846 426 THR B OG1 
4040 C CG2 . THR B 238 ? 0.7154 1.2055 1.1695 0.0929  0.1717  -0.0707 426 THR B CG2 
4041 N N   . HIS B 239 ? 0.6415 1.1644 1.2015 0.1443  0.1534  -0.0581 427 HIS B N   
4042 C CA  . HIS B 239 ? 0.5904 1.1233 1.1761 0.1594  0.1566  -0.0596 427 HIS B CA  
4043 C C   . HIS B 239 ? 0.5344 1.0984 1.1399 0.1543  0.1705  -0.0618 427 HIS B C   
4044 O O   . HIS B 239 ? 0.4892 1.0799 1.1135 0.1465  0.1637  -0.0536 427 HIS B O   
4045 C CB  . HIS B 239 ? 0.5851 1.1238 1.1927 0.1693  0.1352  -0.0488 427 HIS B CB  
4046 C CG  . HIS B 239 ? 0.5901 1.1402 1.2263 0.1848  0.1369  -0.0501 427 HIS B CG  
4047 N ND1 . HIS B 239 ? 0.5877 1.1664 1.2558 0.1879  0.1260  -0.0421 427 HIS B ND1 
4048 C CD2 . HIS B 239 ? 0.6144 1.1512 1.2528 0.1976  0.1482  -0.0590 427 HIS B CD2 
4049 C CE1 . HIS B 239 ? 0.6077 1.1903 1.2974 0.2028  0.1305  -0.0456 427 HIS B CE1 
4050 N NE2 . HIS B 239 ? 0.6210 1.1781 1.2935 0.2089  0.1442  -0.0559 427 HIS B NE2 
4051 N N   . GLY B 240 ? 0.5672 1.1278 1.1678 0.1578  0.1899  -0.0732 428 GLY B N   
4052 C CA  . GLY B 240 ? 0.5685 1.1564 1.1829 0.1513  0.2059  -0.0764 428 GLY B CA  
4053 C C   . GLY B 240 ? 0.5531 1.1483 1.1508 0.1305  0.2095  -0.0735 428 GLY B C   
4054 O O   . GLY B 240 ? 0.6001 1.1735 1.1640 0.1214  0.2140  -0.0783 428 GLY B O   
4055 N N   . ALA B 241 ? 0.5250 1.1510 1.1465 0.1225  0.2069  -0.0655 429 ALA B N   
4056 C CA  . ALA B 241 ? 0.5089 1.1427 1.1182 0.1017  0.2089  -0.0615 429 ALA B CA  
4057 C C   . ALA B 241 ? 0.5113 1.1434 1.1213 0.0949  0.1874  -0.0511 429 ALA B C   
4058 O O   . ALA B 241 ? 0.5348 1.1730 1.1368 0.0773  0.1857  -0.0473 429 ALA B O   
4059 C CB  . ALA B 241 ? 0.5001 1.1675 1.1336 0.0944  0.2198  -0.0593 429 ALA B CB  
4060 N N   . ARG B 242 ? 0.5009 1.1238 1.1188 0.1081  0.1707  -0.0468 430 ARG B N   
4061 C CA  . ARG B 242 ? 0.4755 1.1008 1.0979 0.1027  0.1490  -0.0364 430 ARG B CA  
4062 C C   . ARG B 242 ? 0.4981 1.0916 1.0922 0.1035  0.1387  -0.0375 430 ARG B C   
4063 O O   . ARG B 242 ? 0.5068 1.0761 1.0845 0.1140  0.1435  -0.0442 430 ARG B O   
4064 C CB  . ARG B 242 ? 0.4652 1.1106 1.1191 0.1147  0.1338  -0.0290 430 ARG B CB  
4065 C CG  . ARG B 242 ? 0.4842 1.1659 1.1694 0.1138  0.1408  -0.0275 430 ARG B CG  
4066 C CD  . ARG B 242 ? 0.5248 1.2244 1.2385 0.1264  0.1244  -0.0237 430 ARG B CD  
4067 N NE  . ARG B 242 ? 0.5563 1.2704 1.2781 0.1161  0.1035  -0.0165 430 ARG B NE  
4068 C CZ  . ARG B 242 ? 0.5805 1.3272 1.3262 0.1072  0.0998  -0.0142 430 ARG B CZ  
4069 N NH1 . ARG B 242 ? 0.5427 1.3140 1.3080 0.1085  0.1161  -0.0158 430 ARG B NH1 
4070 N NH2 . ARG B 242 ? 0.6146 1.3665 1.3656 0.0964  0.0800  -0.0113 430 ARG B NH2 
4071 N N   . THR B 243 ? 0.5221 1.1166 1.1102 0.0916  0.1241  -0.0316 431 THR B N   
4072 C CA  . THR B 243 ? 0.5239 1.0891 1.0823 0.0918  0.1101  -0.0300 431 THR B CA  
4073 C C   . THR B 243 ? 0.5390 1.1048 1.1171 0.1045  0.0912  -0.0220 431 THR B C   
4074 O O   . THR B 243 ? 0.5860 1.1749 1.1881 0.1023  0.0790  -0.0137 431 THR B O   
4075 C CB  . THR B 243 ? 0.4916 1.0466 1.0195 0.0720  0.1010  -0.0241 431 THR B CB  
4076 O OG1 . THR B 243 ? 0.5004 1.0626 1.0181 0.0588  0.1176  -0.0288 431 THR B OG1 
4077 C CG2 . THR B 243 ? 0.4586 0.9744 0.9444 0.0714  0.0908  -0.0227 431 THR B CG2 
4078 N N   . LYS B 244 ? 0.5255 1.0646 1.0895 0.1168  0.0880  -0.0236 432 LYS B N   
4079 C CA  . LYS B 244 ? 0.5055 1.0399 1.0799 0.1281  0.0694  -0.0149 432 LYS B CA  
4080 C C   . LYS B 244 ? 0.4861 0.9890 1.0247 0.1246  0.0553  -0.0102 432 LYS B C   
4081 O O   . LYS B 244 ? 0.4460 0.9204 0.9531 0.1250  0.0620  -0.0164 432 LYS B O   
4082 C CB  . LYS B 244 ? 0.5271 1.0536 1.1097 0.1459  0.0753  -0.0191 432 LYS B CB  
4083 C CG  . LYS B 244 ? 0.5611 1.0930 1.1621 0.1562  0.0572  -0.0107 432 LYS B CG  
4084 C CD  . LYS B 244 ? 0.5814 1.1071 1.1945 0.1732  0.0647  -0.0151 432 LYS B CD  
4085 C CE  . LYS B 244 ? 0.6074 1.1459 1.2454 0.1822  0.0485  -0.0065 432 LYS B CE  
4086 N NZ  . LYS B 244 ? 0.6375 1.2130 1.3033 0.1766  0.0476  -0.0047 432 LYS B NZ  
4087 N N   . TYR B 245 ? 0.4834 0.9911 1.0234 0.1203  0.0354  0.0003  433 TYR B N   
4088 C CA  . TYR B 245 ? 0.4466 0.9253 0.9503 0.1161  0.0215  0.0046  433 TYR B CA  
4089 C C   . TYR B 245 ? 0.4402 0.9101 0.9522 0.1302  0.0093  0.0114  433 TYR B C   
4090 O O   . TYR B 245 ? 0.5040 0.9945 1.0481 0.1378  0.0011  0.0177  433 TYR B O   
4091 C CB  . TYR B 245 ? 0.4239 0.9096 0.9167 0.0999  0.0078  0.0107  433 TYR B CB  
4092 C CG  . TYR B 245 ? 0.4759 0.9640 0.9550 0.0844  0.0182  0.0054  433 TYR B CG  
4093 C CD1 . TYR B 245 ? 0.4801 0.9395 0.9202 0.0771  0.0239  0.0005  433 TYR B CD1 
4094 C CD2 . TYR B 245 ? 0.5105 1.0299 1.0166 0.0768  0.0220  0.0063  433 TYR B CD2 
4095 C CE1 . TYR B 245 ? 0.5240 0.9847 0.9517 0.0628  0.0326  -0.0027 433 TYR B CE1 
4096 C CE2 . TYR B 245 ? 0.5473 1.0681 1.0406 0.0617  0.0314  0.0026  433 TYR B CE2 
4097 C CZ  . TYR B 245 ? 0.5832 1.0738 1.0369 0.0549  0.0364  -0.0014 433 TYR B CZ  
4098 O OH  . TYR B 245 ? 0.6396 1.1305 1.0806 0.0398  0.0449  -0.0034 433 TYR B OH  
4099 N N   . LEU B 246 ? 0.4541 0.8918 0.9345 0.1327  0.0076  0.0099  434 LEU B N   
4100 C CA  . LEU B 246 ? 0.4377 0.8627 0.9203 0.1443  -0.0040 0.0169  434 LEU B CA  
4101 C C   . LEU B 246 ? 0.4734 0.9086 0.9576 0.1390  -0.0254 0.0290  434 LEU B C   
4102 O O   . LEU B 246 ? 0.5270 0.9665 1.0277 0.1479  -0.0367 0.0371  434 LEU B O   
4103 C CB  . LEU B 246 ? 0.3886 0.7772 0.8338 0.1450  -0.0008 0.0122  434 LEU B CB  
4104 C CG  . LEU B 246 ? 0.3738 0.7451 0.8197 0.1575  -0.0087 0.0179  434 LEU B CG  
4105 C CD1 . LEU B 246 ? 0.3381 0.7171 0.8188 0.1737  0.0002  0.0155  434 LEU B CD1 
4106 C CD2 . LEU B 246 ? 0.3672 0.7047 0.7742 0.1548  -0.0054 0.0129  434 LEU B CD2 
4107 N N   . LYS B 247 ? 0.4667 0.9025 0.9295 0.1230  -0.0310 0.0290  435 LYS B N   
4108 C CA  . LYS B 247 ? 0.4746 0.9187 0.9335 0.1152  -0.0506 0.0385  435 LYS B CA  
4109 C C   . LYS B 247 ? 0.5125 0.9916 1.0126 0.1188  -0.0599 0.0469  435 LYS B C   
4110 O O   . LYS B 247 ? 0.5272 1.0078 1.0239 0.1165  -0.0773 0.0545  435 LYS B O   
4111 C CB  . LYS B 247 ? 0.4461 0.8852 0.8780 0.0971  -0.0523 0.0345  435 LYS B CB  
4112 C CG  . LYS B 247 ? 0.4301 0.8884 0.8766 0.0887  -0.0413 0.0292  435 LYS B CG  
4113 C CD  . LYS B 247 ? 0.3976 0.8505 0.8201 0.0706  -0.0456 0.0270  435 LYS B CD  
4114 C CE  . LYS B 247 ? 0.3696 0.8406 0.8063 0.0613  -0.0344 0.0227  435 LYS B CE  
4115 N NZ  . LYS B 247 ? 0.3756 0.8432 0.7942 0.0433  -0.0403 0.0218  435 LYS B NZ  
4116 N N   . ASP B 248 ? 0.4672 0.9642 0.9939 0.1217  -0.0477 0.0411  436 ASP B N   
4117 C CA  . ASP B 248 ? 0.5003 1.0214 1.0558 0.1232  -0.0544 0.0436  436 ASP B CA  
4118 C C   . ASP B 248 ? 0.5589 1.0738 1.1264 0.1392  -0.0592 0.0471  436 ASP B C   
4119 O O   . ASP B 248 ? 0.6060 1.1382 1.1930 0.1414  -0.0697 0.0524  436 ASP B O   
4120 C CB  . ASP B 248 ? 0.4955 1.0394 1.0751 0.1207  -0.0385 0.0358  436 ASP B CB  
4121 C CG  . ASP B 248 ? 0.5576 1.1134 1.1301 0.1026  -0.0370 0.0351  436 ASP B CG  
4122 O OD1 . ASP B 248 ? 0.5946 1.1506 1.1530 0.0915  -0.0526 0.0411  436 ASP B OD1 
4123 O OD2 . ASP B 248 ? 0.5795 1.1443 1.1589 0.0989  -0.0199 0.0283  436 ASP B OD2 
4124 N N   . LEU B 249 ? 0.6028 1.0928 1.1583 0.1500  -0.0517 0.0444  437 LEU B N   
4125 C CA  . LEU B 249 ? 0.6006 1.0821 1.1675 0.1658  -0.0533 0.0469  437 LEU B CA  
4126 C C   . LEU B 249 ? 0.6488 1.1350 1.2187 0.1663  -0.0743 0.0593  437 LEU B C   
4127 O O   . LEU B 249 ? 0.6858 1.1844 1.2799 0.1754  -0.0777 0.0628  437 LEU B O   
4128 C CB  . LEU B 249 ? 0.5384 0.9875 1.0843 0.1737  -0.0462 0.0439  437 LEU B CB  
4129 C CG  . LEU B 249 ? 0.5716 1.0082 1.1277 0.1895  -0.0469 0.0465  437 LEU B CG  
4130 C CD1 . LEU B 249 ? 0.5615 1.0141 1.1469 0.1989  -0.0328 0.0388  437 LEU B CD1 
4131 C CD2 . LEU B 249 ? 0.5527 0.9559 1.0852 0.1946  -0.0417 0.0440  437 LEU B CD2 
4132 N N   . VAL B 250 ? 0.6156 1.0924 1.1602 0.1562  -0.0881 0.0660  438 VAL B N   
4133 C CA  . VAL B 250 ? 0.6592 1.1395 1.2007 0.1541  -0.1083 0.0778  438 VAL B CA  
4134 C C   . VAL B 250 ? 0.6911 1.2026 1.2611 0.1520  -0.1149 0.0805  438 VAL B C   
4135 O O   . VAL B 250 ? 0.7031 1.2211 1.2904 0.1611  -0.1226 0.0874  438 VAL B O   
4136 C CB  . VAL B 250 ? 0.5854 1.0563 1.0941 0.1398  -0.1201 0.0819  438 VAL B CB  
4137 C CG1 . VAL B 250 ? 0.6196 1.0990 1.1250 0.1348  -0.1404 0.0929  438 VAL B CG1 
4138 C CG2 . VAL B 250 ? 0.5498 0.9904 1.0313 0.1433  -0.1162 0.0814  438 VAL B CG2 
4139 N N   . GLU B 251 ? 0.6150 1.1458 1.1909 0.1400  -0.1115 0.0752  439 GLU B N   
4140 C CA  . GLU B 251 ? 0.7107 1.2723 1.3141 0.1364  -0.1172 0.0769  439 GLU B CA  
4141 C C   . GLU B 251 ? 0.7106 1.2848 1.3475 0.1515  -0.1064 0.0737  439 GLU B C   
4142 O O   . GLU B 251 ? 0.7414 1.3345 1.4020 0.1561  -0.1151 0.0794  439 GLU B O   
4143 C CB  . GLU B 251 ? 0.8075 1.3853 1.4113 0.1203  -0.1128 0.0707  439 GLU B CB  
4144 C CG  . GLU B 251 ? 0.9281 1.4944 1.4990 0.1045  -0.1225 0.0727  439 GLU B CG  
4145 C CD  . GLU B 251 ? 1.0538 1.6238 1.6151 0.0982  -0.1440 0.0820  439 GLU B CD  
4146 O OE1 . GLU B 251 ? 1.0839 1.6747 1.6539 0.0865  -0.1521 0.0826  439 GLU B OE1 
4147 O OE2 . GLU B 251 ? 1.1077 1.6595 1.6516 0.1041  -0.1525 0.0886  439 GLU B OE2 
4148 N N   . GLU B 252 ? 0.7218 1.2852 1.3598 0.1593  -0.0874 0.0645  440 GLU B N   
4149 C CA  . GLU B 252 ? 0.7335 1.3072 1.4004 0.1734  -0.0745 0.0593  440 GLU B CA  
4150 C C   . GLU B 252 ? 0.6836 1.2464 1.3581 0.1884  -0.0832 0.0677  440 GLU B C   
4151 O O   . GLU B 252 ? 0.6599 1.2375 1.3639 0.1995  -0.0802 0.0679  440 GLU B O   
4152 C CB  . GLU B 252 ? 0.8100 1.3711 1.4701 0.1770  -0.0520 0.0471  440 GLU B CB  
4153 C CG  . GLU B 252 ? 0.9139 1.4914 1.6028 0.1875  -0.0351 0.0389  440 GLU B CG  
4154 C CD  . GLU B 252 ? 0.9884 1.5956 1.6930 0.1768  -0.0255 0.0324  440 GLU B CD  
4155 O OE1 . GLU B 252 ? 1.0085 1.6318 1.7146 0.1635  -0.0373 0.0370  440 GLU B OE1 
4156 O OE2 . GLU B 252 ? 1.0131 1.6272 1.7276 0.1809  -0.0057 0.0225  440 GLU B OE2 
4157 N N   . GLU B 253 ? 0.7219 1.2588 1.3700 0.1884  -0.0938 0.0749  441 GLU B N   
4158 C CA  . GLU B 253 ? 0.7263 1.2514 1.3793 0.2006  -0.1037 0.0847  441 GLU B CA  
4159 C C   . GLU B 253 ? 0.7230 1.2630 1.3799 0.1950  -0.1255 0.0979  441 GLU B C   
4160 O O   . GLU B 253 ? 0.7144 1.2521 1.3821 0.2045  -0.1353 0.1077  441 GLU B O   
4161 C CB  . GLU B 253 ? 0.7372 1.2265 1.3605 0.2037  -0.1031 0.0863  441 GLU B CB  
4162 C CG  . GLU B 253 ? 0.7776 1.2497 1.3963 0.2102  -0.0821 0.0736  441 GLU B CG  
4163 C CD  . GLU B 253 ? 0.8451 1.3227 1.4934 0.2254  -0.0700 0.0684  441 GLU B CD  
4164 O OE1 . GLU B 253 ? 0.8675 1.3271 1.5190 0.2372  -0.0723 0.0731  441 GLU B OE1 
4165 O OE2 . GLU B 253 ? 0.8777 1.3773 1.5460 0.2253  -0.0578 0.0596  441 GLU B OE2 
4166 N N   . ALA B 254 ? 0.6837 1.2386 1.3316 0.1791  -0.1331 0.0980  442 ALA B N   
4167 C CA  . ALA B 254 ? 0.6852 1.2567 1.3362 0.1720  -0.1531 0.1089  442 ALA B CA  
4168 C C   . ALA B 254 ? 0.7338 1.3375 1.4247 0.1769  -0.1534 0.1092  442 ALA B C   
4169 O O   . ALA B 254 ? 0.7722 1.3849 1.4788 0.1834  -0.1660 0.1195  442 ALA B O   
4170 C CB  . ALA B 254 ? 0.6311 1.2055 1.2573 0.1525  -0.1607 0.1078  442 ALA B CB  
4171 N N   . GLU B 255 ? 0.7264 1.3479 1.4340 0.1739  -0.1390 0.0980  443 GLU B N   
4172 C CA  . GLU B 255 ? 0.7494 1.4040 1.4957 0.1775  -0.1370 0.0966  443 GLU B CA  
4173 C C   . GLU B 255 ? 0.7410 1.3952 1.5136 0.1976  -0.1320 0.0988  443 GLU B C   
4174 O O   . GLU B 255 ? 0.7594 1.4376 1.5630 0.2035  -0.1383 0.1038  443 GLU B O   
4175 C CB  . GLU B 255 ? 0.7695 1.4404 1.5256 0.1699  -0.1198 0.0835  443 GLU B CB  
4176 C CG  . GLU B 255 ? 0.8059 1.4600 1.5567 0.1777  -0.0975 0.0724  443 GLU B CG  
4177 C CD  . GLU B 255 ? 0.8300 1.5001 1.5864 0.1677  -0.0811 0.0607  443 GLU B CD  
4178 O OE1 . GLU B 255 ? 0.8691 1.5592 1.6531 0.1743  -0.0675 0.0541  443 GLU B OE1 
4179 O OE2 . GLU B 255 ? 0.8111 1.4735 1.5439 0.1529  -0.0816 0.0585  443 GLU B OE2 
4180 N N   . GLU B 256 ? 0.7270 1.3534 1.4873 0.2079  -0.1209 0.0951  444 GLU B N   
4181 C CA  . GLU B 256 ? 0.7387 1.3590 1.5207 0.2269  -0.1154 0.0966  444 GLU B CA  
4182 C C   . GLU B 256 ? 0.7189 1.3305 1.5000 0.2324  -0.1354 0.1126  444 GLU B C   
4183 O O   . GLU B 256 ? 0.7401 1.3594 1.5494 0.2459  -0.1380 0.1181  444 GLU B O   
4184 C CB  . GLU B 256 ? 0.7842 1.3751 1.5503 0.2344  -0.0975 0.0870  444 GLU B CB  
4185 C CG  . GLU B 256 ? 0.8571 1.4457 1.6496 0.2527  -0.0847 0.0825  444 GLU B CG  
4186 C CD  . GLU B 256 ? 0.8980 1.4713 1.6807 0.2557  -0.0613 0.0673  444 GLU B CD  
4187 O OE1 . GLU B 256 ? 0.9248 1.4694 1.6982 0.2657  -0.0554 0.0656  444 GLU B OE1 
4188 O OE2 . GLU B 256 ? 0.8946 1.4846 1.6787 0.2474  -0.0488 0.0571  444 GLU B OE2 
4189 N N   . ALA B 257 ? 0.7353 1.3311 1.4838 0.2217  -0.1492 0.1204  445 ALA B N   
4190 C CA  . ALA B 257 ? 0.7203 1.3076 1.4632 0.2245  -0.1686 0.1364  445 ALA B CA  
4191 C C   . ALA B 257 ? 0.7297 1.3435 1.4784 0.2135  -0.1874 0.1456  445 ALA B C   
4192 O O   . ALA B 257 ? 0.7323 1.3442 1.4779 0.2143  -0.2047 0.1598  445 ALA B O   
4193 C CB  . ALA B 257 ? 0.6856 1.2391 1.3883 0.2199  -0.1723 0.1401  445 ALA B CB  
4194 N N   . GLY B 258 ? 0.6972 1.3355 1.4540 0.2026  -0.1839 0.1375  446 GLY B N   
4195 C CA  . GLY B 258 ? 0.7131 1.3771 1.4751 0.1904  -0.2006 0.1442  446 GLY B CA  
4196 C C   . GLY B 258 ? 0.7259 1.3760 1.4506 0.1769  -0.2177 0.1530  446 GLY B C   
4197 O O   . GLY B 258 ? 0.7223 1.3807 1.4486 0.1751  -0.2357 0.1658  446 GLY B O   
4198 N N   . VAL B 259 ? 0.7402 1.3699 1.4310 0.1671  -0.2118 0.1462  447 VAL B N   
4199 C CA  . VAL B 259 ? 0.7742 1.3875 1.4263 0.1549  -0.2254 0.1531  447 VAL B CA  
4200 C C   . VAL B 259 ? 0.7743 1.3967 1.4079 0.1351  -0.2280 0.1462  447 VAL B C   
4201 O O   . VAL B 259 ? 0.7673 1.3926 1.4036 0.1308  -0.2141 0.1342  447 VAL B O   
4202 C CB  . VAL B 259 ? 0.8123 1.3901 1.4361 0.1600  -0.2181 0.1523  447 VAL B CB  
4203 C CG1 . VAL B 259 ? 0.7979 1.3600 1.3816 0.1473  -0.2315 0.1592  447 VAL B CG1 
4204 C CG2 . VAL B 259 ? 0.8461 1.4123 1.4879 0.1790  -0.2151 0.1586  447 VAL B CG2 
4205 N N   . ALA B 260 ? 0.8037 1.4304 1.4183 0.1227  -0.2456 0.1540  448 ALA B N   
4206 C CA  . ALA B 260 ? 0.8068 1.4373 1.3979 0.1028  -0.2500 0.1481  448 ALA B CA  
4207 C C   . ALA B 260 ? 0.8254 1.4824 1.4417 0.0959  -0.2440 0.1390  448 ALA B C   
4208 O O   . ALA B 260 ? 0.8460 1.5060 1.4463 0.0794  -0.2451 0.1324  448 ALA B O   
4209 C CB  . ALA B 260 ? 0.7359 1.3383 1.2918 0.0977  -0.2409 0.1409  448 ALA B CB  
4210 N N   . ALA B 276 ? 0.9321 1.3753 1.2839 0.0990  -0.2783 0.1974  464 ALA B N   
4211 C CA  . ALA B 276 ? 0.9346 1.3616 1.3040 0.1154  -0.2660 0.1965  464 ALA B CA  
4212 C C   . ALA B 276 ? 0.9419 1.3856 1.3534 0.1271  -0.2592 0.1917  464 ALA B C   
4213 O O   . ALA B 276 ? 0.9405 1.3787 1.3760 0.1424  -0.2549 0.1960  464 ALA B O   
4214 C CB  . ALA B 276 ? 0.9623 1.3739 1.3282 0.1231  -0.2723 0.2115  464 ALA B CB  
4215 N N   . TRP B 277 ? 0.9045 1.3684 1.3245 0.1193  -0.2578 0.1823  465 TRP B N   
4216 C CA  . TRP B 277 ? 0.9139 1.3950 1.3716 0.1280  -0.2490 0.1753  465 TRP B CA  
4217 C C   . TRP B 277 ? 0.8871 1.3511 1.3530 0.1400  -0.2306 0.1664  465 TRP B C   
4218 O O   . TRP B 277 ? 0.8885 1.3606 1.3867 0.1520  -0.2216 0.1627  465 TRP B O   
4219 C CB  . TRP B 277 ? 0.9317 1.4336 1.3906 0.1146  -0.2490 0.1656  465 TRP B CB  
4220 C CG  . TRP B 277 ? 0.9753 1.4636 1.4086 0.1056  -0.2390 0.1537  465 TRP B CG  
4221 C CD1 . TRP B 277 ? 0.9969 1.4676 1.3917 0.0954  -0.2422 0.1534  465 TRP B CD1 
4222 C CD2 . TRP B 277 ? 0.9899 1.4815 1.4347 0.1059  -0.2239 0.1406  465 TRP B CD2 
4223 N NE1 . TRP B 277 ? 0.9895 1.4523 1.3721 0.0900  -0.2306 0.1412  465 TRP B NE1 
4224 C CE2 . TRP B 277 ? 0.9747 1.4498 1.3872 0.0960  -0.2195 0.1337  465 TRP B CE2 
4225 C CE3 . TRP B 277 ? 0.9986 1.5061 1.4778 0.1133  -0.2133 0.1342  465 TRP B CE3 
4226 C CZ2 . TRP B 277 ? 0.9448 1.4186 1.3587 0.0934  -0.2058 0.1218  465 TRP B CZ2 
4227 C CZ3 . TRP B 277 ? 0.9740 1.4802 1.4532 0.1099  -0.1989 0.1220  465 TRP B CZ3 
4228 C CH2 . TRP B 277 ? 0.9429 1.4322 1.3899 0.1001  -0.1957 0.1165  465 TRP B CH2 
4229 N N   . ALA B 278 ? 0.8843 1.3249 1.3202 0.1361  -0.2249 0.1625  466 ALA B N   
4230 C CA  . ALA B 278 ? 0.8679 1.2908 1.3058 0.1448  -0.2078 0.1532  466 ALA B CA  
4231 C C   . ALA B 278 ? 0.8816 1.2898 1.3360 0.1616  -0.2031 0.1585  466 ALA B C   
4232 O O   . ALA B 278 ? 0.9009 1.3072 1.3766 0.1725  -0.1892 0.1504  466 ALA B O   
4233 C CB  . ALA B 278 ? 0.8577 1.2604 1.2584 0.1355  -0.2049 0.1490  466 ALA B CB  
4234 N N   . ALA B 279 ? 0.9321 1.3294 1.3760 0.1631  -0.2146 0.1719  467 ALA B N   
4235 C CA  . ALA B 279 ? 0.8857 1.2634 1.3393 0.1774  -0.2111 0.1781  467 ALA B CA  
4236 C C   . ALA B 279 ? 0.8434 1.2284 1.3367 0.1933  -0.2017 0.1740  467 ALA B C   
4237 O O   . ALA B 279 ? 0.8166 1.1823 1.3155 0.2040  -0.1893 0.1690  467 ALA B O   
4238 C CB  . ALA B 279 ? 0.8904 1.2638 1.3337 0.1754  -0.2277 0.1955  467 ALA B CB  
4239 N N   . PRO B 280 ? 0.8212 1.2339 1.3421 0.1949  -0.2070 0.1758  468 PRO B N   
4240 C CA  . PRO B 280 ? 0.8069 1.2271 1.3652 0.2101  -0.1962 0.1704  468 PRO B CA  
4241 C C   . PRO B 280 ? 0.7539 1.1704 1.3156 0.2124  -0.1760 0.1529  468 PRO B C   
4242 O O   . PRO B 280 ? 0.7782 1.1812 1.3529 0.2249  -0.1630 0.1470  468 PRO B O   
4243 C CB  . PRO B 280 ? 0.8288 1.2826 1.4126 0.2080  -0.2058 0.1743  468 PRO B CB  
4244 C CG  . PRO B 280 ? 0.8514 1.3091 1.4129 0.1957  -0.2251 0.1871  468 PRO B CG  
4245 C CD  . PRO B 280 ? 0.8362 1.2738 1.3572 0.1841  -0.2229 0.1830  468 PRO B CD  
4246 N N   . ILE B 281 ? 0.7637 1.1915 1.3126 0.1998  -0.1735 0.1447  469 ILE B N   
4247 C CA  . ILE B 281 ? 0.7512 1.1766 1.3008 0.1999  -0.1551 0.1290  469 ILE B CA  
4248 C C   . ILE B 281 ? 0.7449 1.1379 1.2727 0.2037  -0.1457 0.1251  469 ILE B C   
4249 O O   . ILE B 281 ? 0.7334 1.1179 1.2695 0.2115  -0.1290 0.1142  469 ILE B O   
4250 C CB  . ILE B 281 ? 0.7443 1.1849 1.2806 0.1839  -0.1562 0.1230  469 ILE B CB  
4251 C CG1 . ILE B 281 ? 0.7684 1.2404 1.3243 0.1783  -0.1674 0.1275  469 ILE B CG1 
4252 C CG2 . ILE B 281 ? 0.7503 1.1907 1.2903 0.1841  -0.1370 0.1079  469 ILE B CG2 
4253 C CD1 . ILE B 281 ? 0.7698 1.2570 1.3149 0.1618  -0.1688 0.1215  469 ILE B CD1 
4254 N N   . ALA B 282 ? 0.7429 1.1184 1.2422 0.1978  -0.1562 0.1340  470 ALA B N   
4255 C CA  . ALA B 282 ? 0.7378 1.0825 1.2155 0.2005  -0.1495 0.1322  470 ALA B CA  
4256 C C   . ALA B 282 ? 0.7114 1.0408 1.2082 0.2164  -0.1421 0.1325  470 ALA B C   
4257 O O   . ALA B 282 ? 0.6599 0.9699 1.1524 0.2218  -0.1281 0.1233  470 ALA B O   
4258 C CB  . ALA B 282 ? 0.7835 1.1157 1.2300 0.1912  -0.1635 0.1435  470 ALA B CB  
4259 N N   . MET B 283 ? 0.7635 1.1017 1.2817 0.2237  -0.1515 0.1430  471 MET B N   
4260 C CA  . MET B 283 ? 0.7334 1.0581 1.2729 0.2392  -0.1452 0.1438  471 MET B CA  
4261 C C   . MET B 283 ? 0.6840 1.0173 1.2479 0.2477  -0.1269 0.1282  471 MET B C   
4262 O O   . MET B 283 ? 0.6807 0.9939 1.2470 0.2564  -0.1135 0.1200  471 MET B O   
4263 C CB  . MET B 283 ? 0.7585 1.0937 1.3180 0.2449  -0.1601 0.1591  471 MET B CB  
4264 C CG  . MET B 283 ? 0.7647 1.0771 1.3359 0.2584  -0.1587 0.1651  471 MET B CG  
4265 S SD  . MET B 283 ? 1.0384 1.3194 1.5750 0.2524  -0.1689 0.1783  471 MET B SD  
4266 C CE  . MET B 283 ? 0.6784 0.9808 1.2061 0.2412  -0.1922 0.1962  471 MET B CE  
4267 N N   . GLN B 284 ? 0.6167 0.9799 1.1975 0.2443  -0.1261 0.1237  472 GLN B N   
4268 C CA  . GLN B 284 ? 0.6771 1.0526 1.2807 0.2507  -0.1085 0.1092  472 GLN B CA  
4269 C C   . GLN B 284 ? 0.6609 1.0190 1.2452 0.2480  -0.0914 0.0947  472 GLN B C   
4270 O O   . GLN B 284 ? 0.6719 1.0224 1.2675 0.2570  -0.0751 0.0836  472 GLN B O   
4271 C CB  . GLN B 284 ? 0.7487 1.1599 1.3692 0.2440  -0.1113 0.1074  472 GLN B CB  
4272 C CG  . GLN B 284 ? 0.8792 1.3127 1.5326 0.2516  -0.1208 0.1163  472 GLN B CG  
4273 C CD  . GLN B 284 ? 0.9687 1.4348 1.6496 0.2512  -0.1128 0.1077  472 GLN B CD  
4274 O OE1 . GLN B 284 ? 1.0119 1.4798 1.7072 0.2583  -0.0947 0.0951  472 GLN B OE1 
4275 N NE2 . GLN B 284 ? 0.9766 1.4690 1.6640 0.2420  -0.1259 0.1141  472 GLN B NE2 
4276 N N   . ILE B 285 ? 0.7019 1.0540 1.2568 0.2353  -0.0950 0.0946  473 ILE B N   
4277 C CA  . ILE B 285 ? 0.6708 1.0057 1.2054 0.2319  -0.0806 0.0825  473 ILE B CA  
4278 C C   . ILE B 285 ? 0.7074 1.0092 1.2309 0.2398  -0.0759 0.0821  473 ILE B C   
4279 O O   . ILE B 285 ? 0.7157 1.0044 1.2389 0.2447  -0.0594 0.0696  473 ILE B O   
4280 C CB  . ILE B 285 ? 0.6301 0.9657 1.1364 0.2167  -0.0874 0.0841  473 ILE B CB  
4281 C CG1 . ILE B 285 ? 0.6174 0.9846 1.1347 0.2076  -0.0913 0.0833  473 ILE B CG1 
4282 C CG2 . ILE B 285 ? 0.5856 0.9025 1.0715 0.2139  -0.0732 0.0726  473 ILE B CG2 
4283 C CD1 . ILE B 285 ? 0.6193 0.9889 1.1109 0.1925  -0.1022 0.0876  473 ILE B CD1 
4284 N N   . TYR B 286 ? 0.6830 0.9715 1.1970 0.2402  -0.0903 0.0958  474 TYR B N   
4285 C CA  . TYR B 286 ? 0.7503 1.0071 1.2539 0.2464  -0.0882 0.0978  474 TYR B CA  
4286 C C   . TYR B 286 ? 0.7940 1.0428 1.3218 0.2606  -0.0754 0.0900  474 TYR B C   
4287 O O   . TYR B 286 ? 0.8156 1.0396 1.3347 0.2645  -0.0642 0.0818  474 TYR B O   
4288 C CB  . TYR B 286 ? 0.7865 1.0359 1.2819 0.2448  -0.1067 0.1159  474 TYR B CB  
4289 C CG  . TYR B 286 ? 0.8118 1.0285 1.2964 0.2500  -0.1058 0.1198  474 TYR B CG  
4290 C CD1 . TYR B 286 ? 0.7978 0.9937 1.2516 0.2421  -0.1055 0.1195  474 TYR B CD1 
4291 C CD2 . TYR B 286 ? 0.8218 1.0284 1.3282 0.2625  -0.1052 0.1238  474 TYR B CD2 
4292 C CE1 . TYR B 286 ? 0.8197 0.9860 1.2642 0.2459  -0.1046 0.1231  474 TYR B CE1 
4293 C CE2 . TYR B 286 ? 0.8292 1.0051 1.3264 0.2664  -0.1044 0.1274  474 TYR B CE2 
4294 C CZ  . TYR B 286 ? 0.8183 0.9743 1.2843 0.2577  -0.1041 0.1271  474 TYR B CZ  
4295 O OH  . TYR B 286 ? 0.8158 0.9414 1.2730 0.2606  -0.1033 0.1307  474 TYR B OH  
4296 N N   . LYS B 287 ? 0.7511 1.0213 1.3094 0.2680  -0.0770 0.0921  475 LYS B N   
4297 C CA  . LYS B 287 ? 0.7866 1.0518 1.3703 0.2818  -0.0649 0.0845  475 LYS B CA  
4298 C C   . LYS B 287 ? 0.8332 1.1074 1.4222 0.2821  -0.0448 0.0657  475 LYS B C   
4299 O O   . LYS B 287 ? 0.8891 1.1426 1.4709 0.2858  -0.0302 0.0538  475 LYS B O   
4300 C CB  . LYS B 287 ? 0.7531 1.0382 1.3691 0.2903  -0.0746 0.0947  475 LYS B CB  
4301 C CG  . LYS B 287 ? 0.7592 1.0352 1.3710 0.2904  -0.0942 0.1141  475 LYS B CG  
4302 C CD  . LYS B 287 ? 0.7926 1.0846 1.4392 0.3012  -0.1022 0.1235  475 LYS B CD  
4303 C CE  . LYS B 287 ? 0.8105 1.0927 1.4515 0.3007  -0.1217 0.1436  475 LYS B CE  
4304 N NZ  . LYS B 287 ? 0.8459 1.1429 1.5220 0.3118  -0.1300 0.1537  475 LYS B NZ  
4305 N N   . LYS B 288 ? 0.7779 1.0831 1.3787 0.2773  -0.0440 0.0632  476 LYS B N   
4306 C CA  . LYS B 288 ? 0.7840 1.1025 1.3933 0.2774  -0.0252 0.0469  476 LYS B CA  
4307 C C   . LYS B 288 ? 0.7482 1.0546 1.3283 0.2676  -0.0140 0.0357  476 LYS B C   
4308 O O   . LYS B 288 ? 0.7593 1.0541 1.3359 0.2707  0.0034  0.0218  476 LYS B O   
4309 C CB  . LYS B 288 ? 0.8087 1.1651 1.4394 0.2737  -0.0286 0.0488  476 LYS B CB  
4310 C CG  . LYS B 288 ? 0.8559 1.2290 1.5187 0.2833  -0.0391 0.0590  476 LYS B CG  
4311 C CD  . LYS B 288 ? 0.8763 1.2876 1.5589 0.2779  -0.0425 0.0602  476 LYS B CD  
4312 C CE  . LYS B 288 ? 0.9364 1.3661 1.6535 0.2881  -0.0521 0.0696  476 LYS B CE  
4313 N NZ  . LYS B 288 ? 0.9635 1.4315 1.7008 0.2823  -0.0552 0.0701  476 LYS B NZ  
4314 N N   . HIS B 289 ? 0.7802 1.0897 1.3395 0.2555  -0.0241 0.0418  477 HIS B N   
4315 C CA  . HIS B 289 ? 0.7084 1.0164 1.2460 0.2450  -0.0143 0.0320  477 HIS B CA  
4316 C C   . HIS B 289 ? 0.6899 0.9670 1.1960 0.2410  -0.0127 0.0298  477 HIS B C   
4317 O O   . HIS B 289 ? 0.6766 0.9523 1.1648 0.2324  -0.0054 0.0223  477 HIS B O   
4318 C CB  . HIS B 289 ? 0.6769 1.0101 1.2130 0.2332  -0.0244 0.0380  477 HIS B CB  
4319 C CG  . HIS B 289 ? 0.6850 1.0507 1.2512 0.2350  -0.0250 0.0388  477 HIS B CG  
4320 N ND1 . HIS B 289 ? 0.6996 1.0761 1.2880 0.2428  -0.0095 0.0287  477 HIS B ND1 
4321 C CD2 . HIS B 289 ? 0.6891 1.0793 1.2668 0.2295  -0.0393 0.0483  477 HIS B CD2 
4322 C CE1 . HIS B 289 ? 0.7092 1.1163 1.3229 0.2425  -0.0140 0.0323  477 HIS B CE1 
4323 N NE2 . HIS B 289 ? 0.7051 1.1208 1.3129 0.2343  -0.0323 0.0441  477 HIS B NE2 
4324 N N   . LEU B 290 ? 0.7075 0.9605 1.2074 0.2468  -0.0195 0.0364  478 LEU B N   
4325 C CA  . LEU B 290 ? 0.6917 0.9159 1.1628 0.2428  -0.0186 0.0349  478 LEU B CA  
4326 C C   . LEU B 290 ? 0.6949 0.9044 1.1563 0.2434  0.0010  0.0177  478 LEU B C   
4327 O O   . LEU B 290 ? 0.6994 0.9123 1.1767 0.2503  0.0140  0.0076  478 LEU B O   
4328 C CB  . LEU B 290 ? 0.7361 0.9375 1.2050 0.2489  -0.0288 0.0456  478 LEU B CB  
4329 C CG  . LEU B 290 ? 0.7396 0.9432 1.1985 0.2432  -0.0491 0.0632  478 LEU B CG  
4330 C CD1 . LEU B 290 ? 0.7634 0.9398 1.2154 0.2479  -0.0558 0.0721  478 LEU B CD1 
4331 C CD2 . LEU B 290 ? 0.7065 0.9129 1.1400 0.2303  -0.0525 0.0633  478 LEU B CD2 
4332 N N   . ASP B 291 ? 0.7021 0.8955 1.1366 0.2356  0.0030  0.0142  479 ASP B N   
4333 C CA  . ASP B 291 ? 0.7228 0.8997 1.1434 0.2346  0.0202  -0.0018 479 ASP B CA  
4334 C C   . ASP B 291 ? 0.7562 0.9041 1.1745 0.2423  0.0234  -0.0046 479 ASP B C   
4335 O O   . ASP B 291 ? 0.7939 0.9227 1.2002 0.2416  0.0133  0.0042  479 ASP B O   
4336 C CB  . ASP B 291 ? 0.7183 0.8885 1.1120 0.2235  0.0201  -0.0040 479 ASP B CB  
4337 C CG  . ASP B 291 ? 0.7495 0.9046 1.1270 0.2209  0.0373  -0.0209 479 ASP B CG  
4338 O OD1 . ASP B 291 ? 0.7806 0.9407 1.1677 0.2245  0.0514  -0.0324 479 ASP B OD1 
4339 O OD2 . ASP B 291 ? 0.7664 0.9051 1.1208 0.2145  0.0367  -0.0229 479 ASP B OD2 
4340 N N   . PRO B 292 ? 0.7404 0.8852 1.1704 0.2492  0.0376  -0.0168 480 PRO B N   
4341 C CA  . PRO B 292 ? 0.7822 0.9000 1.2135 0.2569  0.0415  -0.0207 480 PRO B CA  
4342 C C   . PRO B 292 ? 0.8058 0.8948 1.2088 0.2511  0.0470  -0.0287 480 PRO B C   
4343 O O   . PRO B 292 ? 0.8016 0.8658 1.2012 0.2547  0.0430  -0.0255 480 PRO B O   
4344 C CB  . PRO B 292 ? 0.7849 0.9120 1.2351 0.2639  0.0570  -0.0338 480 PRO B CB  
4345 C CG  . PRO B 292 ? 0.7787 0.9295 1.2247 0.2562  0.0660  -0.0416 480 PRO B CG  
4346 C CD  . PRO B 292 ? 0.7506 0.9181 1.1938 0.2495  0.0511  -0.0277 480 PRO B CD  
4347 N N   . ARG B 293 ? 0.7955 0.8880 1.1793 0.2419  0.0556  -0.0387 481 ARG B N   
4348 C CA  . ARG B 293 ? 0.8145 0.8822 1.1718 0.2358  0.0630  -0.0493 481 ARG B CA  
4349 C C   . ARG B 293 ? 0.7786 0.8224 1.1218 0.2338  0.0512  -0.0396 481 ARG B C   
4350 O O   . ARG B 293 ? 0.7682 0.7863 1.1017 0.2345  0.0558  -0.0463 481 ARG B O   
4351 C CB  . ARG B 293 ? 0.8621 0.9411 1.2011 0.2252  0.0706  -0.0580 481 ARG B CB  
4352 C CG  . ARG B 293 ? 0.9342 1.0336 1.2821 0.2250  0.0850  -0.0694 481 ARG B CG  
4353 C CD  . ARG B 293 ? 0.9687 1.0729 1.2937 0.2134  0.0945  -0.0799 481 ARG B CD  
4354 N NE  . ARG B 293 ? 1.0112 1.1266 1.3297 0.2064  0.0839  -0.0704 481 ARG B NE  
4355 C CZ  . ARG B 293 ? 1.0329 1.1753 1.3637 0.2037  0.0815  -0.0653 481 ARG B CZ  
4356 N NH1 . ARG B 293 ? 1.0276 1.1898 1.3782 0.2074  0.0892  -0.0682 481 ARG B NH1 
4357 N NH2 . ARG B 293 ? 1.0435 1.1905 1.3548 0.1935  0.0692  -0.0553 481 ARG B NH2 
4358 N N   . PRO B 294 ? 0.8064 0.8585 1.1474 0.2305  0.0362  -0.0242 482 PRO B N   
4359 C CA  . PRO B 294 ? 0.8167 0.8462 1.1440 0.2282  0.0260  -0.0149 482 PRO B CA  
4360 C C   . PRO B 294 ? 0.8523 0.8665 1.1935 0.2368  0.0198  -0.0064 482 PRO B C   
4361 O O   . PRO B 294 ? 0.8837 0.8747 1.2140 0.2352  0.0145  -0.0011 482 PRO B O   
4362 C CB  . PRO B 294 ? 0.7750 0.8206 1.0973 0.2224  0.0118  -0.0005 482 PRO B CB  
4363 C CG  . PRO B 294 ? 0.7621 0.8371 1.1043 0.2253  0.0103  0.0023  482 PRO B CG  
4364 C CD  . PRO B 294 ? 0.7685 0.8491 1.1173 0.2275  0.0279  -0.0149 482 PRO B CD  
4365 N N   . GLY B 295 ? 0.8342 0.8614 1.2000 0.2455  0.0205  -0.0048 483 GLY B N   
4366 C CA  . GLY B 295 ? 0.8489 0.8641 1.2311 0.2544  0.0138  0.0044  483 GLY B CA  
4367 C C   . GLY B 295 ? 0.8428 0.8755 1.2372 0.2560  -0.0031 0.0238  483 GLY B C   
4368 O O   . GLY B 295 ? 0.8234 0.8792 1.2152 0.2506  -0.0087 0.0283  483 GLY B O   
4369 N N   . PRO B 296 ? 0.8495 0.8713 1.2568 0.2629  -0.0117 0.0353  484 PRO B N   
4370 C CA  . PRO B 296 ? 0.8316 0.8694 1.2491 0.2638  -0.0286 0.0543  484 PRO B CA  
4371 C C   . PRO B 296 ? 0.8165 0.8536 1.2100 0.2530  -0.0416 0.0669  484 PRO B C   
4372 O O   . PRO B 296 ? 0.8018 0.8172 1.1748 0.2476  -0.0401 0.0655  484 PRO B O   
4373 C CB  . PRO B 296 ? 0.8233 0.8434 1.2571 0.2733  -0.0328 0.0621  484 PRO B CB  
4374 C CG  . PRO B 296 ? 0.8326 0.8208 1.2536 0.2728  -0.0227 0.0517  484 PRO B CG  
4375 C CD  . PRO B 296 ? 0.8394 0.8324 1.2512 0.2692  -0.0066 0.0314  484 PRO B CD  
4376 N N   . CYS B 297 ? 0.7723 0.8335 1.1684 0.2495  -0.0540 0.0787  485 CYS B N   
4377 C CA  . CYS B 297 ? 0.8000 0.8626 1.1732 0.2388  -0.0669 0.0910  485 CYS B CA  
4378 C C   . CYS B 297 ? 0.8039 0.8699 1.1819 0.2394  -0.0837 0.1106  485 CYS B C   
4379 O O   . CYS B 297 ? 0.8038 0.8831 1.2053 0.2468  -0.0874 0.1150  485 CYS B O   
4380 C CB  . CYS B 297 ? 0.7849 0.8725 1.1504 0.2308  -0.0674 0.0871  485 CYS B CB  
4381 S SG  . CYS B 297 ? 1.5072 1.6308 1.8960 0.2328  -0.0747 0.0920  485 CYS B SG  
4382 N N   . PRO B 298 ? 0.8606 0.9150 1.2160 0.2313  -0.0938 0.1227  486 PRO B N   
4383 C CA  . PRO B 298 ? 0.8753 0.9336 1.2296 0.2291  -0.1105 0.1422  486 PRO B CA  
4384 C C   . PRO B 298 ? 0.8654 0.9555 1.2298 0.2275  -0.1196 0.1474  486 PRO B C   
4385 O O   . PRO B 298 ? 0.8472 0.9549 1.2038 0.2209  -0.1180 0.1406  486 PRO B O   
4386 C CB  . PRO B 298 ? 0.8836 0.9307 1.2061 0.2171  -0.1167 0.1497  486 PRO B CB  
4387 C CG  . PRO B 298 ? 0.8876 0.9131 1.2012 0.2173  -0.1029 0.1362  486 PRO B CG  
4388 C CD  . PRO B 298 ? 0.8647 0.9015 1.1942 0.2232  -0.0896 0.1184  486 PRO B CD  
4389 N N   . PRO B 299 ? 0.8524 0.9494 1.2348 0.2332  -0.1294 0.1594  487 PRO B N   
4390 C CA  . PRO B 299 ? 0.8670 0.9942 1.2642 0.2330  -0.1381 0.1642  487 PRO B CA  
4391 C C   . PRO B 299 ? 0.8593 1.0046 1.2335 0.2190  -0.1478 0.1686  487 PRO B C   
4392 O O   . PRO B 299 ? 0.8701 1.0393 1.2519 0.2166  -0.1471 0.1623  487 PRO B O   
4393 C CB  . PRO B 299 ? 0.8795 1.0034 1.2917 0.2392  -0.1497 0.1806  487 PRO B CB  
4394 C CG  . PRO B 299 ? 0.8962 0.9890 1.2929 0.2383  -0.1500 0.1872  487 PRO B CG  
4395 C CD  . PRO B 299 ? 0.8794 0.9548 1.2692 0.2396  -0.1335 0.1702  487 PRO B CD  
4396 N N   . GLU B 300 ? 0.8579 0.9922 1.2044 0.2093  -0.1562 0.1787  488 GLU B N   
4397 C CA  . GLU B 300 ? 0.8457 0.9965 1.1687 0.1953  -0.1656 0.1826  488 GLU B CA  
4398 C C   . GLU B 300 ? 0.7676 0.9226 1.0771 0.1891  -0.1560 0.1679  488 GLU B C   
4399 O O   . GLU B 300 ? 0.7380 0.9122 1.0368 0.1796  -0.1611 0.1665  488 GLU B O   
4400 C CB  . GLU B 300 ? 0.9286 1.0665 1.2245 0.1862  -0.1761 0.1971  488 GLU B CB  
4401 C CG  . GLU B 300 ? 1.0022 1.1118 1.2819 0.1855  -0.1683 0.1951  488 GLU B CG  
4402 C CD  . GLU B 300 ? 1.0902 1.1776 1.3879 0.1969  -0.1648 0.1992  488 GLU B CD  
4403 O OE1 . GLU B 300 ? 1.1112 1.1929 1.4304 0.2077  -0.1531 0.1873  488 GLU B OE1 
4404 O OE2 . GLU B 300 ? 1.1272 1.2026 1.4170 0.1946  -0.1735 0.2140  488 GLU B OE2 
4405 N N   . LEU B 301 ? 0.7634 0.9001 1.0734 0.1942  -0.1422 0.1569  489 LEU B N   
4406 C CA  . LEU B 301 ? 0.7374 0.8772 1.0372 0.1895  -0.1322 0.1430  489 LEU B CA  
4407 C C   . LEU B 301 ? 0.7408 0.9038 1.0620 0.1928  -0.1266 0.1329  489 LEU B C   
4408 O O   . LEU B 301 ? 0.7144 0.8953 1.0276 0.1843  -0.1286 0.1293  489 LEU B O   
4409 C CB  . LEU B 301 ? 0.7506 0.8645 1.0467 0.1942  -0.1188 0.1338  489 LEU B CB  
4410 C CG  . LEU B 301 ? 0.7546 0.8652 1.0353 0.1888  -0.1089 0.1215  489 LEU B CG  
4411 C CD1 . LEU B 301 ? 0.7896 0.8712 1.0605 0.1908  -0.1009 0.1180  489 LEU B CD1 
4412 C CD2 . LEU B 301 ? 0.7543 0.8791 1.0521 0.1930  -0.0972 0.1068  489 LEU B CD2 
4413 N N   . GLY B 302 ? 0.7369 0.8995 1.0853 0.2047  -0.1193 0.1282  490 GLY B N   
4414 C CA  . GLY B 302 ? 0.7049 0.8894 1.0758 0.2085  -0.1124 0.1186  490 GLY B CA  
4415 C C   . GLY B 302 ? 0.7380 0.9499 1.1160 0.2033  -0.1256 0.1268  490 GLY B C   
4416 O O   . GLY B 302 ? 0.7674 0.9994 1.1473 0.1974  -0.1240 0.1205  490 GLY B O   
4417 N N   . LEU B 303 ? 0.7466 0.9586 1.1283 0.2049  -0.1386 0.1411  491 LEU B N   
4418 C CA  . LEU B 303 ? 0.7175 0.9535 1.1025 0.1988  -0.1531 0.1506  491 LEU B CA  
4419 C C   . LEU B 303 ? 0.6956 0.9408 1.0535 0.1835  -0.1588 0.1497  491 LEU B C   
4420 O O   . LEU B 303 ? 0.6658 0.9331 1.0296 0.1780  -0.1597 0.1446  491 LEU B O   
4421 C CB  . LEU B 303 ? 0.7283 0.9583 1.1142 0.2011  -0.1666 0.1675  491 LEU B CB  
4422 C CG  . LEU B 303 ? 0.7663 1.0052 1.1865 0.2135  -0.1691 0.1727  491 LEU B CG  
4423 C CD1 . LEU B 303 ? 0.7695 1.0066 1.2151 0.2255  -0.1522 0.1585  491 LEU B CD1 
4424 C CD2 . LEU B 303 ? 0.7701 0.9908 1.1891 0.2180  -0.1777 0.1878  491 LEU B CD2 
4425 N N   . GLY B 304 ? 0.6995 0.9276 1.0280 0.1763  -0.1624 0.1545  492 GLY B N   
4426 C CA  . GLY B 304 ? 0.7127 0.9471 1.0129 0.1617  -0.1672 0.1531  492 GLY B CA  
4427 C C   . GLY B 304 ? 0.6517 0.8964 0.9529 0.1580  -0.1573 0.1388  492 GLY B C   
4428 O O   . GLY B 304 ? 0.6077 0.8711 0.9028 0.1481  -0.1628 0.1370  492 GLY B O   
4429 N N   . LEU B 305 ? 0.6605 0.8928 0.9691 0.1655  -0.1426 0.1287  493 LEU B N   
4430 C CA  . LEU B 305 ? 0.5907 0.8319 0.9011 0.1626  -0.1320 0.1158  493 LEU B CA  
4431 C C   . LEU B 305 ? 0.5446 0.8118 0.8802 0.1633  -0.1317 0.1121  493 LEU B C   
4432 O O   . LEU B 305 ? 0.4942 0.7769 0.8262 0.1547  -0.1310 0.1066  493 LEU B O   
4433 C CB  . LEU B 305 ? 0.5729 0.7954 0.8876 0.1710  -0.1157 0.1057  493 LEU B CB  
4434 C CG  . LEU B 305 ? 0.6129 0.8116 0.9018 0.1683  -0.1132 0.1061  493 LEU B CG  
4435 C CD1 . LEU B 305 ? 0.6127 0.7927 0.9022 0.1741  -0.0955 0.0917  493 LEU B CD1 
4436 C CD2 . LEU B 305 ? 0.6048 0.8050 0.8592 0.1526  -0.1160 0.1018  493 LEU B CD2 
4437 N N   . GLY B 306 ? 0.4935 0.7656 0.8549 0.1735  -0.1323 0.1153  494 GLY B N   
4438 C CA  . GLY B 306 ? 0.4944 0.7925 0.8821 0.1748  -0.1324 0.1128  494 GLY B CA  
4439 C C   . GLY B 306 ? 0.5647 0.8831 0.9456 0.1630  -0.1475 0.1197  494 GLY B C   
4440 O O   . GLY B 306 ? 0.5728 0.9116 0.9614 0.1565  -0.1465 0.1141  494 GLY B O   
4441 N N   . GLN B 307 ? 0.5647 0.8773 0.9303 0.1595  -0.1613 0.1318  495 GLN B N   
4442 C CA  . GLN B 307 ? 0.6440 0.9736 0.9989 0.1473  -0.1763 0.1384  495 GLN B CA  
4443 C C   . GLN B 307 ? 0.6162 0.9489 0.9468 0.1332  -0.1755 0.1309  495 GLN B C   
4444 O O   . GLN B 307 ? 0.6328 0.9857 0.9662 0.1240  -0.1802 0.1280  495 GLN B O   
4445 C CB  . GLN B 307 ? 0.7284 1.0477 1.0668 0.1456  -0.1895 0.1524  495 GLN B CB  
4446 C CG  . GLN B 307 ? 0.8377 1.1524 1.1994 0.1592  -0.1916 0.1615  495 GLN B CG  
4447 C CD  . GLN B 307 ? 0.9479 1.2556 1.2941 0.1559  -0.2059 0.1771  495 GLN B CD  
4448 O OE1 . GLN B 307 ? 0.9923 1.3162 1.3333 0.1473  -0.2190 0.1842  495 GLN B OE1 
4449 N NE2 . GLN B 307 ? 0.9868 1.2702 1.3251 0.1618  -0.2033 0.1825  495 GLN B NE2 
4450 N N   . LEU B 308 ? 0.5774 0.8901 0.8846 0.1313  -0.1694 0.1275  496 LEU B N   
4451 C CA  . LEU B 308 ? 0.5516 0.8656 0.8357 0.1191  -0.1674 0.1200  496 LEU B CA  
4452 C C   . LEU B 308 ? 0.5059 0.8351 0.8076 0.1183  -0.1579 0.1093  496 LEU B C   
4453 O O   . LEU B 308 ? 0.5036 0.8468 0.7978 0.1064  -0.1615 0.1052  496 LEU B O   
4454 C CB  . LEU B 308 ? 0.5521 0.8427 0.8129 0.1198  -0.1606 0.1180  496 LEU B CB  
4455 C CG  . LEU B 308 ? 0.5821 0.8711 0.8147 0.1070  -0.1580 0.1092  496 LEU B CG  
4456 C CD1 . LEU B 308 ? 0.6192 0.9217 0.8346 0.0934  -0.1724 0.1136  496 LEU B CD1 
4457 C CD2 . LEU B 308 ? 0.5822 0.8426 0.7877 0.1071  -0.1497 0.1046  496 LEU B CD2 
4458 N N   . ALA B 309 ? 0.4826 0.8087 0.8074 0.1303  -0.1452 0.1045  497 ALA B N   
4459 C CA  . ALA B 309 ? 0.5076 0.8486 0.8514 0.1304  -0.1343 0.0949  497 ALA B CA  
4460 C C   . ALA B 309 ? 0.5147 0.8823 0.8763 0.1243  -0.1421 0.0963  497 ALA B C   
4461 O O   . ALA B 309 ? 0.4622 0.8437 0.8227 0.1144  -0.1405 0.0907  497 ALA B O   
4462 C CB  . ALA B 309 ? 0.5359 0.8693 0.9019 0.1447  -0.1196 0.0896  497 ALA B CB  
4463 N N   . CYS B 310 ? 0.5553 0.9302 0.9332 0.1301  -0.1508 0.1042  498 CYS B N   
4464 C CA  . CYS B 310 ? 0.5688 0.9699 0.9652 0.1250  -0.1591 0.1064  498 CYS B CA  
4465 C C   . CYS B 310 ? 0.5658 0.9748 0.9391 0.1080  -0.1714 0.1078  498 CYS B C   
4466 O O   . CYS B 310 ? 0.5338 0.9616 0.9151 0.0989  -0.1724 0.1032  498 CYS B O   
4467 C CB  . CYS B 310 ? 0.5850 0.9911 1.0005 0.1348  -0.1673 0.1162  498 CYS B CB  
4468 S SG  . CYS B 310 ? 0.6775 1.0809 1.1271 0.1542  -0.1527 0.1124  498 CYS B SG  
4469 N N   . CYS B 311 ? 0.5705 0.9646 0.9145 0.1032  -0.1802 0.1134  499 CYS B N   
4470 C CA  . CYS B 311 ? 0.5628 0.9617 0.8808 0.0867  -0.1908 0.1131  499 CYS B CA  
4471 C C   . CYS B 311 ? 0.5374 0.9371 0.8437 0.0767  -0.1830 0.1017  499 CYS B C   
4472 O O   . CYS B 311 ? 0.5153 0.9281 0.8162 0.0636  -0.1885 0.0977  499 CYS B O   
4473 C CB  . CYS B 311 ? 0.6179 0.9990 0.9050 0.0838  -0.1987 0.1200  499 CYS B CB  
4474 S SG  . CYS B 311 ? 0.7646 1.1450 1.0616 0.0928  -0.2099 0.1354  499 CYS B SG  
4475 N N   . CYS B 312 ? 0.5068 0.8920 0.8089 0.0828  -0.1701 0.0965  500 CYS B N   
4476 C CA  . CYS B 312 ? 0.4754 0.8575 0.7646 0.0745  -0.1606 0.0849  500 CYS B CA  
4477 C C   . CYS B 312 ? 0.4908 0.8928 0.8057 0.0720  -0.1547 0.0794  500 CYS B C   
4478 O O   . CYS B 312 ? 0.4800 0.8821 0.7828 0.0597  -0.1518 0.0703  500 CYS B O   
4479 C CB  . CYS B 312 ? 0.4522 0.8053 0.7260 0.0817  -0.1451 0.0773  500 CYS B CB  
4480 S SG  . CYS B 312 ? 0.4324 0.7587 0.6667 0.0787  -0.1484 0.0786  500 CYS B SG  
4481 N N   . LEU B 313 ? 0.4777 0.8936 0.8269 0.0833  -0.1520 0.0838  501 LEU B N   
4482 C CA  . LEU B 313 ? 0.4813 0.9167 0.8577 0.0827  -0.1436 0.0786  501 LEU B CA  
4483 C C   . LEU B 313 ? 0.4966 0.9553 0.8888 0.0745  -0.1545 0.0811  501 LEU B C   
4484 O O   . LEU B 313 ? 0.5006 0.9778 0.9185 0.0741  -0.1483 0.0777  501 LEU B O   
4485 C CB  . LEU B 313 ? 0.4776 0.9112 0.8799 0.0990  -0.1305 0.0775  501 LEU B CB  
4486 C CG  . LEU B 313 ? 0.4801 0.8879 0.8659 0.1053  -0.1152 0.0701  501 LEU B CG  
4487 C CD1 . LEU B 313 ? 0.4523 0.8623 0.8670 0.1210  -0.1027 0.0688  501 LEU B CD1 
4488 C CD2 . LEU B 313 ? 0.4490 0.8466 0.8122 0.0931  -0.1048 0.0579  501 LEU B CD2 
4489 N N   . HIS B 314 ? 0.5423 1.0006 0.9187 0.0678  -0.1701 0.0869  502 HIS B N   
4490 C CA  . HIS B 314 ? 0.5664 1.0463 0.9557 0.0599  -0.1818 0.0898  502 HIS B CA  
4491 C C   . HIS B 314 ? 0.5444 1.0401 0.9406 0.0466  -0.1785 0.0819  502 HIS B C   
4492 O O   . HIS B 314 ? 0.4770 0.9642 0.8522 0.0365  -0.1747 0.0751  502 HIS B O   
4493 C CB  . HIS B 314 ? 0.6120 1.0865 0.9748 0.0515  -0.1980 0.0954  502 HIS B CB  
4494 C CG  . HIS B 314 ? 0.7218 1.2176 1.0983 0.0461  -0.2110 0.1004  502 HIS B CG  
4495 N ND1 . HIS B 314 ? 0.7600 1.2693 1.1324 0.0300  -0.2170 0.0953  502 HIS B ND1 
4496 C CD2 . HIS B 314 ? 0.7426 1.2485 1.1372 0.0544  -0.2194 0.1100  502 HIS B CD2 
4497 C CE1 . HIS B 314 ? 0.7671 1.2946 1.1542 0.0286  -0.2286 0.1016  502 HIS B CE1 
4498 N NE2 . HIS B 314 ? 0.7576 1.2840 1.1586 0.0435  -0.2305 0.1109  502 HIS B NE2 
4499 N N   . ARG B 315 ? 0.5683 1.0873 0.9944 0.0464  -0.1798 0.0828  503 ARG B N   
4500 C CA  . ARG B 315 ? 0.5681 1.1039 1.0059 0.0341  -0.1756 0.0760  503 ARG B CA  
4501 C C   . ARG B 315 ? 0.5759 1.1087 0.9867 0.0150  -0.1852 0.0720  503 ARG B C   
4502 O O   . ARG B 315 ? 0.5577 1.0905 0.9631 0.0040  -0.1788 0.0644  503 ARG B O   
4503 C CB  . ARG B 315 ? 0.5678 1.1303 1.0420 0.0369  -0.1778 0.0787  503 ARG B CB  
4504 C CG  . ARG B 315 ? 0.6396 1.2110 1.1159 0.0373  -0.1951 0.0872  503 ARG B CG  
4505 C CD  . ARG B 315 ? 0.7149 1.3138 1.2303 0.0425  -0.1962 0.0899  503 ARG B CD  
4506 N NE  . ARG B 315 ? 0.8040 1.4083 1.3259 0.0505  -0.2097 0.1001  503 ARG B NE  
4507 C CZ  . ARG B 315 ? 0.8713 1.4912 1.3946 0.0417  -0.2254 0.1050  503 ARG B CZ  
4508 N NH1 . ARG B 315 ? 0.8959 1.5269 1.4147 0.0245  -0.2295 0.0995  503 ARG B NH1 
4509 N NH2 . ARG B 315 ? 0.8832 1.5071 1.4123 0.0499  -0.2371 0.1154  503 ARG B NH2 
4510 N N   . ARG B 316 ? 0.5698 1.0995 0.9631 0.0108  -0.2001 0.0766  504 ARG B N   
4511 C CA  . ARG B 316 ? 0.6141 1.1392 0.9794 -0.0072 -0.2092 0.0713  504 ARG B CA  
4512 C C   . ARG B 316 ? 0.6451 1.1446 0.9742 -0.0086 -0.2071 0.0679  504 ARG B C   
4513 O O   . ARG B 316 ? 0.6805 1.1680 0.9965 -0.0002 -0.2108 0.0741  504 ARG B O   
4514 C CB  . ARG B 316 ? 0.6790 1.2156 1.0427 -0.0124 -0.2257 0.0772  504 ARG B CB  
4515 C CG  . ARG B 316 ? 0.7208 1.2841 1.1223 -0.0086 -0.2288 0.0820  504 ARG B CG  
4516 C CD  . ARG B 316 ? 0.7890 1.3648 1.1873 -0.0155 -0.2461 0.0877  504 ARG B CD  
4517 N NE  . ARG B 316 ? 0.8461 1.4361 1.2714 -0.0014 -0.2510 0.0985  504 ARG B NE  
4518 C CZ  . ARG B 316 ? 0.8796 1.4630 1.2944 0.0059  -0.2602 0.1083  504 ARG B CZ  
4519 N NH1 . ARG B 316 ? 0.8916 1.4881 1.3336 0.0188  -0.2644 0.1180  504 ARG B NH1 
4520 N NH2 . ARG B 316 ? 0.8915 1.4553 1.2687 -0.0002 -0.2651 0.1084  504 ARG B NH2 
4521 N N   . ALA B 317 ? 0.6860 1.1774 0.9997 -0.0196 -0.2011 0.0580  505 ALA B N   
4522 C CA  . ALA B 317 ? 0.6571 1.1255 0.9393 -0.0207 -0.1969 0.0528  505 ALA B CA  
4523 C C   . ALA B 317 ? 0.6270 1.0836 0.8778 -0.0258 -0.2080 0.0539  505 ALA B C   
4524 O O   . ALA B 317 ? 0.5636 1.0023 0.7921 -0.0212 -0.2053 0.0538  505 ALA B O   
4525 C CB  . ALA B 317 ? 0.6460 1.1041 0.9164 -0.0329 -0.1883 0.0400  505 ALA B CB  
4526 N N   . LYS B 318 ? 0.6239 1.0912 0.8728 -0.0356 -0.2199 0.0549  506 LYS B N   
4527 C CA  . LYS B 318 ? 0.6597 1.1178 0.8773 -0.0431 -0.2299 0.0547  506 LYS B CA  
4528 C C   . LYS B 318 ? 0.6406 1.0956 0.8567 -0.0304 -0.2349 0.0674  506 LYS B C   
4529 O O   . LYS B 318 ? 0.6484 1.0921 0.8360 -0.0341 -0.2404 0.0686  506 LYS B O   
4530 C CB  . LYS B 318 ? 0.7474 1.2191 0.9640 -0.0579 -0.2409 0.0518  506 LYS B CB  
4531 C CG  . LYS B 318 ? 0.7872 1.2772 1.0338 -0.0628 -0.2389 0.0487  506 LYS B CG  
4532 C CD  . LYS B 318 ? 0.8274 1.3080 1.0661 -0.0736 -0.2298 0.0355  506 LYS B CD  
4533 C CE  . LYS B 318 ? 0.8358 1.3344 1.1068 -0.0773 -0.2258 0.0343  506 LYS B CE  
4534 N NZ  . LYS B 318 ? 0.8197 1.3306 1.1230 -0.0607 -0.2188 0.0436  506 LYS B NZ  
4535 N N   . ARG B 319 ? 0.6042 1.0686 0.8511 -0.0159 -0.2324 0.0765  507 ARG B N   
4536 C CA  . ARG B 319 ? 0.6259 1.0862 0.8754 -0.0029 -0.2366 0.0887  507 ARG B CA  
4537 C C   . ARG B 319 ? 0.5714 1.0115 0.8126 0.0087  -0.2262 0.0896  507 ARG B C   
4538 O O   . ARG B 319 ? 0.5843 1.0156 0.8217 0.0181  -0.2288 0.0988  507 ARG B O   
4539 C CB  . ARG B 319 ? 0.6891 1.1688 0.9769 0.0076  -0.2393 0.0973  507 ARG B CB  
4540 C CG  . ARG B 319 ? 0.7819 1.2762 1.0711 0.0027  -0.2548 0.1053  507 ARG B CG  
4541 C CD  . ARG B 319 ? 0.8670 1.3674 1.1808 0.0187  -0.2582 0.1183  507 ARG B CD  
4542 N NE  . ARG B 319 ? 0.9738 1.4780 1.2753 0.0152  -0.2732 0.1285  507 ARG B NE  
4543 C CZ  . ARG B 319 ? 1.0442 1.5512 1.3606 0.0273  -0.2789 0.1415  507 ARG B CZ  
4544 N NH1 . ARG B 319 ? 1.0521 1.5576 1.3964 0.0439  -0.2702 0.1444  507 ARG B NH1 
4545 N NH2 . ARG B 319 ? 1.0905 1.6014 1.3936 0.0224  -0.2929 0.1513  507 ARG B NH2 
4546 N N   . ARG B 320 ? 0.5787 1.0114 0.8173 0.0076  -0.2146 0.0802  508 ARG B N   
4547 C CA  . ARG B 320 ? 0.5455 0.9596 0.7751 0.0175  -0.2045 0.0799  508 ARG B CA  
4548 C C   . ARG B 320 ? 0.5495 0.9458 0.7408 0.0110  -0.2078 0.0782  508 ARG B C   
4549 O O   . ARG B 320 ? 0.5797 0.9749 0.7486 -0.0034 -0.2112 0.0700  508 ARG B O   
4550 C CB  . ARG B 320 ? 0.5151 0.9289 0.7530 0.0176  -0.1914 0.0707  508 ARG B CB  
4551 C CG  . ARG B 320 ? 0.5097 0.9407 0.7852 0.0244  -0.1853 0.0719  508 ARG B CG  
4552 C CD  . ARG B 320 ? 0.4956 0.9175 0.7701 0.0202  -0.1703 0.0592  508 ARG B CD  
4553 N NE  . ARG B 320 ? 0.5234 0.9689 0.8329 0.0215  -0.1670 0.0604  508 ARG B NE  
4554 C CZ  . ARG B 320 ? 0.5416 0.9882 0.8549 0.0132  -0.1580 0.0514  508 ARG B CZ  
4555 N NH1 . ARG B 320 ? 0.5263 0.9503 0.8113 0.0039  -0.1521 0.0410  508 ARG B NH1 
4556 N NH2 . ARG B 320 ? 0.5324 1.0028 0.8788 0.0143  -0.1550 0.0534  508 ARG B NH2 
4557 N N   . PRO B 321 ? 0.5323 0.9144 0.7163 0.0214  -0.2060 0.0854  509 PRO B N   
4558 C CA  . PRO B 321 ? 0.5612 0.9267 0.7100 0.0163  -0.2080 0.0851  509 PRO B CA  
4559 C C   . PRO B 321 ? 0.5766 0.9281 0.7039 0.0108  -0.1977 0.0719  509 PRO B C   
4560 O O   . PRO B 321 ? 0.5974 0.9402 0.7360 0.0161  -0.1847 0.0638  509 PRO B O   
4561 C CB  . PRO B 321 ? 0.5361 0.8903 0.6911 0.0308  -0.2064 0.0964  509 PRO B CB  
4562 C CG  . PRO B 321 ? 0.5014 0.8597 0.6892 0.0438  -0.1972 0.0965  509 PRO B CG  
4563 C CD  . PRO B 321 ? 0.5344 0.9142 0.7440 0.0386  -0.2005 0.0934  509 PRO B CD  
4564 N N   . PRO B 322 ? 0.5506 0.8920 0.6446 0.0008  -0.1999 0.0670  510 PRO B N   
4565 C CA  . PRO B 322 ? 0.4981 0.8155 0.5694 -0.0020 -0.1862 0.0522  510 PRO B CA  
4566 C C   . PRO B 322 ? 0.4767 0.7740 0.5480 0.0113  -0.1750 0.0545  510 PRO B C   
4567 O O   . PRO B 322 ? 0.4856 0.7837 0.5610 0.0190  -0.1799 0.0672  510 PRO B O   
4568 C CB  . PRO B 322 ? 0.5248 0.8408 0.5634 -0.0151 -0.1929 0.0487  510 PRO B CB  
4569 C CG  . PRO B 322 ? 0.5715 0.8995 0.6114 -0.0144 -0.2063 0.0644  510 PRO B CG  
4570 C CD  . PRO B 322 ? 0.5216 0.8656 0.5960 -0.0078 -0.2112 0.0721  510 PRO B CD  
4571 N N   . MET B 323 ? 0.4289 0.7084 0.4959 0.0135  -0.1609 0.0427  511 MET B N   
4572 C CA  . MET B 323 ? 0.4093 0.6705 0.4776 0.0254  -0.1501 0.0437  511 MET B CA  
4573 C C   . MET B 323 ? 0.4310 0.6802 0.4768 0.0257  -0.1512 0.0480  511 MET B C   
4574 O O   . MET B 323 ? 0.4348 0.6730 0.4847 0.0357  -0.1464 0.0535  511 MET B O   
4575 C CB  . MET B 323 ? 0.3673 0.6129 0.4330 0.0257  -0.1362 0.0304  511 MET B CB  
4576 C CG  . MET B 323 ? 0.3737 0.6276 0.4652 0.0295  -0.1315 0.0290  511 MET B CG  
4577 S SD  . MET B 323 ? 0.3945 0.6550 0.5142 0.0451  -0.1303 0.0406  511 MET B SD  
4578 C CE  . MET B 323 ? 0.3669 0.6012 0.4711 0.0535  -0.1203 0.0394  511 MET B CE  
4579 N N   . THR B 324 ? 0.4320 0.6837 0.4542 0.0142  -0.1571 0.0452  512 THR B N   
4580 C CA  . THR B 324 ? 0.4987 0.7425 0.4988 0.0127  -0.1590 0.0505  512 THR B CA  
4581 C C   . THR B 324 ? 0.5220 0.7750 0.5334 0.0190  -0.1697 0.0690  512 THR B C   
4582 O O   . THR B 324 ? 0.5658 0.8070 0.5737 0.0256  -0.1670 0.0763  512 THR B O   
4583 C CB  . THR B 324 ? 0.5374 0.7852 0.5096 -0.0021 -0.1634 0.0435  512 THR B CB  
4584 O OG1 . THR B 324 ? 0.6206 0.8887 0.5983 -0.0105 -0.1752 0.0451  512 THR B OG1 
4585 C CG2 . THR B 324 ? 0.5087 0.7417 0.4678 -0.0064 -0.1510 0.0255  512 THR B CG2 
4586 N N   . GLN B 325 ? 0.5028 0.7768 0.5289 0.0167  -0.1821 0.0769  513 GLN B N   
4587 C CA  . GLN B 325 ? 0.5419 0.8264 0.5845 0.0239  -0.1934 0.0955  513 GLN B CA  
4588 C C   . GLN B 325 ? 0.5055 0.7798 0.5734 0.0402  -0.1852 0.0996  513 GLN B C   
4589 O O   . GLN B 325 ? 0.4891 0.7566 0.5608 0.0478  -0.1879 0.1118  513 GLN B O   
4590 C CB  . GLN B 325 ? 0.5868 0.8906 0.6451 0.0198  -0.2041 0.0992  513 GLN B CB  
4591 C CG  . GLN B 325 ? 0.7088 1.0174 0.7426 0.0059  -0.2134 0.0994  513 GLN B CG  
4592 C CD  . GLN B 325 ? 0.7988 1.1244 0.8506 0.0048  -0.2246 0.1068  513 GLN B CD  
4593 O OE1 . GLN B 325 ? 0.7716 1.1031 0.8532 0.0164  -0.2264 0.1153  513 GLN B OE1 
4594 N NE2 . GLN B 325 ? 0.8768 1.2105 0.9108 -0.0090 -0.2318 0.1028  513 GLN B NE2 
4595 N N   . VAL B 326 ? 0.4728 0.7456 0.5574 0.0447  -0.1750 0.0892  514 VAL B N   
4596 C CA  . VAL B 326 ? 0.4826 0.7467 0.5906 0.0591  -0.1657 0.0902  514 VAL B CA  
4597 C C   . VAL B 326 ? 0.4861 0.7256 0.5788 0.0640  -0.1566 0.0890  514 VAL B C   
4598 O O   . VAL B 326 ? 0.5323 0.7644 0.6378 0.0746  -0.1559 0.0978  514 VAL B O   
4599 C CB  . VAL B 326 ? 0.4749 0.7407 0.5968 0.0602  -0.1549 0.0775  514 VAL B CB  
4600 C CG1 . VAL B 326 ? 0.4759 0.7304 0.6158 0.0736  -0.1432 0.0762  514 VAL B CG1 
4601 C CG2 . VAL B 326 ? 0.4030 0.6944 0.5451 0.0562  -0.1637 0.0799  514 VAL B CG2 
4602 N N   . TYR B 327 ? 0.4992 0.7264 0.5659 0.0561  -0.1497 0.0780  515 TYR B N   
4603 C CA  . TYR B 327 ? 0.4888 0.6948 0.5398 0.0588  -0.1415 0.0762  515 TYR B CA  
4604 C C   . TYR B 327 ? 0.5426 0.7467 0.5852 0.0590  -0.1504 0.0909  515 TYR B C   
4605 O O   . TYR B 327 ? 0.6417 0.8319 0.6886 0.0669  -0.1467 0.0965  515 TYR B O   
4606 C CB  . TYR B 327 ? 0.4190 0.6157 0.4447 0.0494  -0.1342 0.0626  515 TYR B CB  
4607 C CG  . TYR B 327 ? 0.4278 0.6056 0.4371 0.0508  -0.1269 0.0615  515 TYR B CG  
4608 C CD1 . TYR B 327 ? 0.3804 0.5429 0.3955 0.0580  -0.1153 0.0551  515 TYR B CD1 
4609 C CD2 . TYR B 327 ? 0.4282 0.6046 0.4161 0.0440  -0.1317 0.0671  515 TYR B CD2 
4610 C CE1 . TYR B 327 ? 0.4008 0.5474 0.4024 0.0587  -0.1093 0.0543  515 TYR B CE1 
4611 C CE2 . TYR B 327 ? 0.4561 0.6168 0.4306 0.0446  -0.1248 0.0664  515 TYR B CE2 
4612 C CZ  . TYR B 327 ? 0.4252 0.5711 0.4075 0.0520  -0.1138 0.0599  515 TYR B CZ  
4613 O OH  . TYR B 327 ? 0.4526 0.5840 0.4227 0.0519  -0.1074 0.0592  515 TYR B OH  
4614 N N   . GLU B 328 ? 0.4888 0.7065 0.5184 0.0493  -0.1623 0.0971  516 GLU B N   
4615 C CA  . GLU B 328 ? 0.5624 0.7798 0.5816 0.0476  -0.1720 0.1127  516 GLU B CA  
4616 C C   . GLU B 328 ? 0.5103 0.7291 0.5570 0.0601  -0.1784 0.1284  516 GLU B C   
4617 O O   . GLU B 328 ? 0.5928 0.7984 0.6370 0.0646  -0.1788 0.1384  516 GLU B O   
4618 C CB  . GLU B 328 ? 0.6184 0.8533 0.6194 0.0341  -0.1846 0.1166  516 GLU B CB  
4619 C CG  . GLU B 328 ? 0.7240 0.9542 0.6939 0.0215  -0.1781 0.1022  516 GLU B CG  
4620 C CD  . GLU B 328 ? 0.8331 1.0809 0.7855 0.0073  -0.1891 0.1022  516 GLU B CD  
4621 O OE1 . GLU B 328 ? 0.8784 1.1375 0.8459 0.0076  -0.1980 0.1080  516 GLU B OE1 
4622 O OE2 . GLU B 328 ? 0.8764 1.1213 0.8005 -0.0038 -0.1854 0.0931  516 GLU B OE2 
4623 N N   . ARG B 329 ? 0.4734 0.7075 0.5475 0.0658  -0.1827 0.1303  517 ARG B N   
4624 C CA  . ARG B 329 ? 0.5107 0.7442 0.6142 0.0788  -0.1860 0.1413  517 ARG B CA  
4625 C C   . ARG B 329 ? 0.5431 0.7578 0.6589 0.0910  -0.1741 0.1390  517 ARG B C   
4626 O O   . ARG B 329 ? 0.6197 0.8228 0.7445 0.0991  -0.1759 0.1496  517 ARG B O   
4627 C CB  . ARG B 329 ? 0.5057 0.7580 0.6365 0.0821  -0.1888 0.1389  517 ARG B CB  
4628 C CG  . ARG B 329 ? 0.6209 0.8901 0.7439 0.0711  -0.2009 0.1416  517 ARG B CG  
4629 C CD  . ARG B 329 ? 0.7023 0.9897 0.8571 0.0763  -0.2037 0.1413  517 ARG B CD  
4630 N NE  . ARG B 329 ? 0.7661 1.0718 0.9134 0.0637  -0.2126 0.1387  517 ARG B NE  
4631 C CZ  . ARG B 329 ? 0.7889 1.1131 0.9598 0.0643  -0.2153 0.1364  517 ARG B CZ  
4632 N NH1 . ARG B 329 ? 0.7966 1.1245 1.0002 0.0772  -0.2091 0.1361  517 ARG B NH1 
4633 N NH2 . ARG B 329 ? 0.7985 1.1378 0.9604 0.0517  -0.2237 0.1337  517 ARG B NH2 
4634 N N   . LEU B 330 ? 0.5209 0.7278 0.6343 0.0913  -0.1600 0.1221  518 LEU B N   
4635 C CA  . LEU B 330 ? 0.5527 0.7391 0.6729 0.1008  -0.1467 0.1158  518 LEU B CA  
4636 C C   . LEU B 330 ? 0.6241 0.7901 0.7231 0.0987  -0.1449 0.1200  518 LEU B C   
4637 O O   . LEU B 330 ? 0.6553 0.8060 0.7647 0.1077  -0.1411 0.1242  518 LEU B O   
4638 C CB  . LEU B 330 ? 0.5086 0.6914 0.6248 0.0988  -0.1332 0.0977  518 LEU B CB  
4639 C CG  . LEU B 330 ? 0.5169 0.7153 0.6586 0.1032  -0.1305 0.0925  518 LEU B CG  
4640 C CD1 . LEU B 330 ? 0.4912 0.6863 0.6226 0.0977  -0.1193 0.0764  518 LEU B CD1 
4641 C CD2 . LEU B 330 ? 0.5346 0.7292 0.7051 0.1175  -0.1257 0.0957  518 LEU B CD2 
4642 N N   . GLU B 331 ? 0.6040 0.7702 0.6739 0.0865  -0.1473 0.1183  519 GLU B N   
4643 C CA  . GLU B 331 ? 0.6667 0.8164 0.7146 0.0824  -0.1455 0.1221  519 GLU B CA  
4644 C C   . GLU B 331 ? 0.6378 0.7855 0.6920 0.0859  -0.1566 0.1419  519 GLU B C   
4645 O O   . GLU B 331 ? 0.6152 0.7445 0.6692 0.0902  -0.1530 0.1469  519 GLU B O   
4646 C CB  . GLU B 331 ? 0.7342 0.8886 0.7514 0.0681  -0.1459 0.1158  519 GLU B CB  
4647 C CG  . GLU B 331 ? 0.7802 0.9188 0.7744 0.0629  -0.1404 0.1158  519 GLU B CG  
4648 C CD  . GLU B 331 ? 0.8386 0.9832 0.8046 0.0495  -0.1392 0.1076  519 GLU B CD  
4649 O OE1 . GLU B 331 ? 0.8524 1.0129 0.8150 0.0435  -0.1445 0.1037  519 GLU B OE1 
4650 O OE2 . GLU B 331 ? 0.8806 1.0144 0.8286 0.0447  -0.1325 0.1043  519 GLU B OE2 
4651 N N   . LYS B 332 ? 0.6469 0.8134 0.7072 0.0836  -0.1707 0.1536  520 LYS B N   
4652 C CA  . LYS B 332 ? 0.7242 0.8883 0.7922 0.0871  -0.1814 0.1718  520 LYS B CA  
4653 C C   . LYS B 332 ? 0.7314 0.8827 0.8304 0.1029  -0.1770 0.1749  520 LYS B C   
4654 O O   . LYS B 332 ? 0.7661 0.9003 0.8659 0.1067  -0.1776 0.1844  520 LYS B O   
4655 C CB  . LYS B 332 ? 0.7531 0.9358 0.8228 0.0819  -0.1927 0.1765  520 LYS B CB  
4656 C CG  . LYS B 332 ? 0.7952 0.9882 0.8326 0.0653  -0.1976 0.1742  520 LYS B CG  
4657 C CD  . LYS B 332 ? 0.8460 1.0547 0.8854 0.0605  -0.2098 0.1814  520 LYS B CD  
4658 C CE  . LYS B 332 ? 0.8610 1.0803 0.8690 0.0437  -0.2135 0.1762  520 LYS B CE  
4659 N NZ  . LYS B 332 ? 0.8513 1.0810 0.8572 0.0392  -0.2084 0.1596  520 LYS B NZ  
4660 N N   . LEU B 333 ? 0.7422 0.9016 0.8662 0.1115  -0.1718 0.1660  521 LEU B N   
4661 C CA  . LEU B 333 ? 0.6923 0.8405 0.8459 0.1264  -0.1651 0.1652  521 LEU B CA  
4662 C C   . LEU B 333 ? 0.7127 0.8364 0.8604 0.1301  -0.1550 0.1620  521 LEU B C   
4663 O O   . LEU B 333 ? 0.7161 0.8232 0.8777 0.1389  -0.1534 0.1676  521 LEU B O   
4664 C CB  . LEU B 333 ? 0.6105 0.7730 0.7881 0.1329  -0.1587 0.1537  521 LEU B CB  
4665 C CG  . LEU B 333 ? 0.6411 0.8240 0.8378 0.1346  -0.1665 0.1568  521 LEU B CG  
4666 C CD1 . LEU B 333 ? 0.6872 0.8857 0.9024 0.1376  -0.1591 0.1444  521 LEU B CD1 
4667 C CD2 . LEU B 333 ? 0.6019 0.7770 0.8206 0.1457  -0.1691 0.1659  521 LEU B CD2 
4668 N N   . GLN B 334 ? 0.7124 0.8297 0.8348 0.1213  -0.1453 0.1478  522 GLN B N   
4669 C CA  . GLN B 334 ? 0.7727 0.8659 0.8841 0.1217  -0.1340 0.1406  522 GLN B CA  
4670 C C   . GLN B 334 ? 0.9040 0.9836 1.0030 0.1183  -0.1406 0.1555  522 GLN B C   
4671 O O   . GLN B 334 ? 0.9403 0.9992 1.0452 0.1238  -0.1357 0.1572  522 GLN B O   
4672 C CB  . GLN B 334 ? 0.7183 0.8104 0.8055 0.1123  -0.1243 0.1242  522 GLN B CB  
4673 C CG  . GLN B 334 ? 0.7212 0.7913 0.8014 0.1136  -0.1119 0.1146  522 GLN B CG  
4674 C CD  . GLN B 334 ? 0.7525 0.8211 0.8059 0.1027  -0.1056 0.1036  522 GLN B CD  
4675 O OE1 . GLN B 334 ? 0.7777 0.8548 0.8120 0.0930  -0.1113 0.1072  522 GLN B OE1 
4676 N NE2 . GLN B 334 ? 0.7467 0.8049 0.7987 0.1042  -0.0940 0.0900  522 GLN B NE2 
4677 N N   . ALA B 335 ? 0.8826 0.9739 0.9635 0.1083  -0.1517 0.1663  523 ALA B N   
4678 C CA  . ALA B 335 ? 0.9657 1.0466 1.0335 0.1035  -0.1592 0.1828  523 ALA B CA  
4679 C C   . ALA B 335 ? 1.0403 1.1123 1.1342 0.1148  -0.1656 0.1970  523 ALA B C   
4680 O O   . ALA B 335 ? 1.0713 1.1226 1.1641 0.1163  -0.1643 0.2044  523 ALA B O   
4681 C CB  . ALA B 335 ? 0.9729 1.0712 1.0167 0.0902  -0.1702 0.1913  523 ALA B CB  
4682 N N   . VAL B 336 ? 0.9928 1.0785 1.1082 0.1216  -0.1697 0.1967  524 VAL B N   
4683 C CA  . VAL B 336 ? 0.9876 1.0655 1.1273 0.1323  -0.1729 0.2051  524 VAL B CA  
4684 C C   . VAL B 336 ? 0.9901 1.0462 1.1500 0.1445  -0.1619 0.1986  524 VAL B C   
4685 O O   . VAL B 336 ? 1.0285 1.0651 1.1938 0.1485  -0.1624 0.2069  524 VAL B O   
4686 C CB  . VAL B 336 ? 0.9507 1.0504 1.1116 0.1374  -0.1784 0.2042  524 VAL B CB  
4687 C CG1 . VAL B 336 ? 0.9470 1.0386 1.1365 0.1502  -0.1800 0.2111  524 VAL B CG1 
4688 C CG2 . VAL B 336 ? 0.9387 1.0579 1.0805 0.1251  -0.1905 0.2117  524 VAL B CG2 
4689 N N   . VAL B 337 ? 1.0300 1.0892 1.2006 0.1497  -0.1516 0.1832  525 VAL B N   
4690 C CA  . VAL B 337 ? 1.0076 1.0474 1.1960 0.1604  -0.1395 0.1737  525 VAL B CA  
4691 C C   . VAL B 337 ? 1.0316 1.0452 1.2052 0.1568  -0.1361 0.1771  525 VAL B C   
4692 O O   . VAL B 337 ? 1.0734 1.0656 1.2603 0.1645  -0.1308 0.1763  525 VAL B O   
4693 C CB  . VAL B 337 ? 0.9622 1.0110 1.1576 0.1632  -0.1285 0.1562  525 VAL B CB  
4694 C CG1 . VAL B 337 ? 0.9844 1.0114 1.1908 0.1714  -0.1141 0.1432  525 VAL B CG1 
4695 C CG2 . VAL B 337 ? 0.9263 0.9997 1.1402 0.1673  -0.1308 0.1528  525 VAL B CG2 
4696 N N   . ALA B 338 ? 1.0563 1.0713 1.1993 0.1435  -0.1376 0.1782  526 ALA B N   
4697 C CA  . ALA B 338 ? 1.0710 1.0634 1.1945 0.1367  -0.1334 0.1795  526 ALA B CA  
4698 C C   . ALA B 338 ? 1.0767 1.0541 1.2088 0.1396  -0.1430 0.2001  526 ALA B C   
4699 O O   . ALA B 338 ? 1.0721 1.0498 1.1830 0.1290  -0.1506 0.2129  526 ALA B O   
4700 C CB  . ALA B 338 ? 1.0735 1.0745 1.1623 0.1210  -0.1332 0.1767  526 ALA B CB  
4701 C CAM . DL1 C .   ? 0.6321 0.6865 0.5227 0.0049  -0.0128 0.0175  601 DL1 A CAM 
4702 C CAK . DL1 C .   ? 0.7163 0.7667 0.5958 -0.0020 -0.0155 0.0313  601 DL1 A CAK 
4703 O OAS . DL1 C .   ? 0.7172 0.7748 0.5910 -0.0116 -0.0090 0.0319  601 DL1 A OAS 
4704 C CAL . DL1 C .   ? 0.7106 0.7850 0.5765 -0.0155 -0.0036 0.0238  601 DL1 A CAL 
4705 C CAN . DL1 C .   ? 0.6509 0.7307 0.5294 -0.0086 0.0001  0.0089  601 DL1 A CAN 
4706 N NBB . DL1 C .   ? 0.5917 0.6615 0.4789 0.0013  -0.0063 0.0076  601 DL1 A NBB 
4707 C CAV . DL1 C .   ? 0.5273 0.6016 0.4209 0.0071  -0.0054 -0.0030 601 DL1 A CAV 
4708 C CAJ . DL1 C .   ? 0.4753 0.5606 0.3734 0.0058  0.0018  -0.0139 601 DL1 A CAJ 
4709 C CBA . DL1 C .   ? 0.4932 0.5811 0.3990 0.0119  0.0023  -0.0242 601 DL1 A CBA 
4710 O OAT . DL1 C .   ? 0.4916 0.5891 0.4047 0.0122  0.0090  -0.0352 601 DL1 A OAT 
4711 C CAA . DL1 C .   ? 0.4995 0.6058 0.4126 0.0057  0.0159  -0.0354 601 DL1 A CAA 
4712 C CAH . DL1 C .   ? 0.4563 0.5243 0.3535 0.0143  -0.0114 -0.0029 601 DL1 A CAH 
4713 C CAI . DL1 C .   ? 0.4091 0.4807 0.3129 0.0193  -0.0106 -0.0131 601 DL1 A CAI 
4714 C CAY . DL1 C .   ? 0.4249 0.5056 0.3328 0.0181  -0.0040 -0.0235 601 DL1 A CAY 
4715 N NAQ . DL1 C .   ? 0.4150 0.4980 0.3306 0.0227  -0.0027 -0.0333 601 DL1 A NAQ 
4716 C CAU . DL1 C .   ? 0.3978 0.4763 0.3160 0.0278  -0.0075 -0.0347 601 DL1 A CAU 
4717 O OAB . DL1 C .   ? 0.4272 0.5004 0.3420 0.0294  -0.0133 -0.0280 601 DL1 A OAB 
4718 C CAW . DL1 C .   ? 0.4195 0.5001 0.3471 0.0315  -0.0049 -0.0447 601 DL1 A CAW 
4719 N NAP . DL1 C .   ? 0.3883 0.4762 0.3209 0.0300  0.0018  -0.0522 601 DL1 A NAP 
4720 C CAE . DL1 C .   ? 0.3709 0.4459 0.3041 0.0366  -0.0091 -0.0464 601 DL1 A CAE 
4721 C CAC . DL1 C .   ? 0.3671 0.4427 0.3103 0.0399  -0.0068 -0.0553 601 DL1 A CAC 
4722 C CAF . DL1 C .   ? 0.3715 0.4535 0.3206 0.0392  -0.0005 -0.0627 601 DL1 A CAF 
4723 C CAX . DL1 C .   ? 0.4104 0.4995 0.3543 0.0342  0.0042  -0.0615 601 DL1 A CAX 
4724 C CAZ . DL1 C .   ? 0.4770 0.5743 0.4285 0.0335  0.0112  -0.0690 601 DL1 A CAZ 
4725 N NAR . DL1 C .   ? 0.4722 0.5708 0.4374 0.0382  0.0140  -0.0779 601 DL1 A NAR 
4726 N NAO . DL1 C .   ? 0.5001 0.6083 0.4716 0.0366  0.0211  -0.0833 601 DL1 A NAO 
4727 C CAD . DL1 C .   ? 0.4844 0.5981 0.4453 0.0300  0.0233  -0.0777 601 DL1 A CAD 
4728 C CAG . DL1 C .   ? 0.4985 0.6043 0.4466 0.0282  0.0167  -0.0682 601 DL1 A CAG 
4729 C CAM . DL1 D .   ? 0.5690 0.6361 0.5519 0.0653  0.0537  -0.0639 601 DL1 B CAM 
4730 C CAK . DL1 D .   ? 0.6519 0.7166 0.6419 0.0715  0.0636  -0.0740 601 DL1 B CAK 
4731 O OAS . DL1 D .   ? 0.6805 0.7295 0.6579 0.0713  0.0619  -0.0786 601 DL1 B OAS 
4732 C CAL . DL1 D .   ? 0.6654 0.7068 0.6495 0.0762  0.0519  -0.0726 601 DL1 B CAL 
4733 C CAN . DL1 D .   ? 0.5813 0.6248 0.5583 0.0710  0.0417  -0.0632 601 DL1 B CAN 
4734 N NBB . DL1 D .   ? 0.4944 0.5516 0.4768 0.0680  0.0428  -0.0589 601 DL1 B NBB 
4735 C CAV . DL1 D .   ? 0.4539 0.5145 0.4397 0.0666  0.0344  -0.0509 601 DL1 B CAV 
4736 C CAJ . DL1 D .   ? 0.4031 0.4766 0.4002 0.0657  0.0351  -0.0472 601 DL1 B CAJ 
4737 C CBA . DL1 D .   ? 0.3955 0.4709 0.3954 0.0636  0.0266  -0.0402 601 DL1 B CBA 
4738 O OAT . DL1 D .   ? 0.4065 0.4938 0.4174 0.0615  0.0264  -0.0367 601 DL1 B OAT 
4739 C CAA . DL1 D .   ? 0.3785 0.4779 0.4005 0.0630  0.0358  -0.0402 601 DL1 B CAA 
4740 C CAH . DL1 D .   ? 0.3790 0.4304 0.3572 0.0656  0.0253  -0.0469 601 DL1 B CAH 
4741 C CAI . DL1 D .   ? 0.3841 0.4383 0.3657 0.0642  0.0176  -0.0403 601 DL1 B CAI 
4742 C CAY . DL1 D .   ? 0.4029 0.4683 0.3948 0.0630  0.0181  -0.0372 601 DL1 B CAY 
4743 N NAQ . DL1 D .   ? 0.4124 0.4802 0.4082 0.0610  0.0113  -0.0321 601 DL1 B NAQ 
4744 C CAU . DL1 D .   ? 0.4499 0.5101 0.4403 0.0603  0.0037  -0.0296 601 DL1 B CAU 
4745 O OAB . DL1 D .   ? 0.4293 0.4805 0.4114 0.0612  0.0014  -0.0307 601 DL1 B OAB 
4746 C CAW . DL1 D .   ? 0.3969 0.4613 0.3937 0.0583  -0.0012 -0.0261 601 DL1 B CAW 
4747 N NAP . DL1 D .   ? 0.3511 0.4259 0.3572 0.0563  0.0013  -0.0249 601 DL1 B NAP 
4748 C CAE . DL1 D .   ? 0.3784 0.4369 0.3726 0.0580  -0.0081 -0.0247 601 DL1 B CAE 
4749 C CAC . DL1 D .   ? 0.3975 0.4597 0.3978 0.0555  -0.0122 -0.0228 601 DL1 B CAC 
4750 C CAF . DL1 D .   ? 0.4004 0.4723 0.4096 0.0528  -0.0102 -0.0216 601 DL1 B CAF 
4751 C CAX . DL1 D .   ? 0.4026 0.4816 0.4152 0.0533  -0.0033 -0.0223 601 DL1 B CAX 
4752 C CAZ . DL1 D .   ? 0.4589 0.5493 0.4816 0.0505  -0.0006 -0.0212 601 DL1 B CAZ 
4753 N NAR . DL1 D .   ? 0.4426 0.5376 0.4721 0.0462  -0.0048 -0.0190 601 DL1 B NAR 
4754 N NAO . DL1 D .   ? 0.4490 0.5560 0.4883 0.0440  -0.0006 -0.0183 601 DL1 B NAO 
4755 C CAD . DL1 D .   ? 0.4607 0.5715 0.5002 0.0472  0.0072  -0.0205 601 DL1 B CAD 
4756 C CAG . DL1 D .   ? 0.4756 0.5750 0.5039 0.0512  0.0070  -0.0226 601 DL1 B CAG 
4757 O O   . HOH E .   ? 0.5797 0.6577 0.4943 0.0010  0.0057  -0.0079 701 HOH A O   
4758 O O   . HOH E .   ? 0.4933 0.5490 0.4599 0.0563  -0.0352 -0.0338 702 HOH A O   
4759 O O   . HOH E .   ? 0.6836 1.1609 1.0117 -0.0035 0.1683  -0.1467 703 HOH A O   
4760 O O   . HOH E .   ? 0.5076 0.5423 0.4821 0.0619  -0.0274 -0.0367 704 HOH A O   
4761 O O   . HOH E .   ? 0.5824 0.6298 0.5399 0.0560  -0.0266 -0.0345 705 HOH A O   
4762 O O   . HOH E .   ? 0.4666 0.8130 0.9664 0.1209  -0.0721 -0.0228 706 HOH A O   
4763 O O   . HOH E .   ? 0.5431 0.7389 0.5790 -0.0162 0.0526  -0.0523 707 HOH A O   
4764 O O   . HOH E .   ? 0.6628 0.7810 0.5611 -0.0164 0.0261  -0.0200 708 HOH A O   
4765 O O   . HOH E .   ? 0.4757 0.8397 0.8347 0.0217  -0.0561 -0.0280 709 HOH A O   
4766 O O   . HOH E .   ? 0.7333 0.7905 0.6274 0.0298  -0.0547 0.0435  710 HOH A O   
4767 O O   . HOH E .   ? 0.4751 0.6118 0.6818 0.0877  -0.1115 0.0188  711 HOH A O   
4768 O O   . HOH E .   ? 0.5978 0.6435 0.5799 0.0546  -0.0337 -0.0433 712 HOH A O   
4769 O O   . HOH E .   ? 0.5343 0.7924 0.7878 0.0400  -0.1631 0.0407  713 HOH A O   
4770 O O   . HOH E .   ? 0.5291 0.5734 0.5137 -0.0458 -0.0030 -0.0046 714 HOH A O   
4771 O O   . HOH E .   ? 0.4487 0.4778 0.4565 -0.0973 -0.0381 -0.0339 715 HOH A O   
4772 O O   . HOH E .   ? 0.7290 0.8543 0.7578 0.0519  0.0485  -0.1348 716 HOH A O   
4773 O O   . HOH E .   ? 0.6223 0.7536 0.5509 -0.0093 -0.0796 -0.0667 717 HOH A O   
4774 O O   . HOH E .   ? 0.5222 0.5358 0.4875 -0.0253 -0.0082 -0.0038 718 HOH A O   
4775 O O   . HOH E .   ? 0.5156 0.6430 0.4663 0.0009  0.0301  -0.0427 719 HOH A O   
4776 O O   . HOH E .   ? 0.6645 0.7004 0.6173 -0.0102 -0.0345 -0.1525 720 HOH A O   
4777 O O   . HOH E .   ? 0.6889 0.7109 0.5920 0.0217  -0.0528 -0.0192 721 HOH A O   
4778 O O   . HOH E .   ? 0.3722 0.6627 0.6070 0.0204  0.0231  -0.0654 722 HOH A O   
4779 O O   . HOH E .   ? 0.4545 0.8946 0.8362 -0.0064 0.0461  -0.0704 723 HOH A O   
4780 O O   . HOH E .   ? 0.5327 0.6026 0.4662 0.0476  -0.0473 -0.0042 724 HOH A O   
4781 O O   . HOH E .   ? 0.3782 0.5744 0.4552 -0.0030 0.0355  -0.0535 725 HOH A O   
4782 O O   . HOH E .   ? 0.8158 0.8157 0.6639 -0.0269 -0.0560 -0.0649 726 HOH A O   
4783 O O   . HOH E .   ? 0.7836 0.9726 0.8165 -0.0331 -0.1896 0.0405  727 HOH A O   
4784 O O   . HOH E .   ? 0.3933 0.4770 0.3297 0.0188  -0.0454 -0.0761 728 HOH A O   
4785 O O   . HOH E .   ? 0.3657 0.4625 0.4934 0.0896  0.0149  -0.1087 729 HOH A O   
4786 O O   . HOH E .   ? 0.5903 0.7666 0.3680 -0.0486 -0.0818 -0.0397 730 HOH A O   
4787 O O   . HOH E .   ? 0.4021 0.4578 0.3556 0.0511  -0.0218 -0.0436 731 HOH A O   
4788 O O   . HOH E .   ? 0.7121 0.8902 0.4907 -0.0426 -0.0936 -0.0026 732 HOH A O   
4789 O O   . HOH E .   ? 0.5141 0.7347 0.5967 -0.0680 0.0443  -0.0251 733 HOH A O   
4790 O O   . HOH E .   ? 0.4620 0.5481 0.4498 0.0498  0.0093  -0.0869 734 HOH A O   
4791 O O   . HOH E .   ? 0.3354 0.3682 0.3280 0.0627  -0.0281 -0.0471 735 HOH A O   
4792 O O   . HOH E .   ? 0.4900 0.6563 0.5801 -0.0923 -0.0064 -0.0183 736 HOH A O   
4793 O O   . HOH E .   ? 0.5349 0.7259 0.6706 0.0642  0.0633  -0.1296 737 HOH A O   
4794 O O   . HOH E .   ? 0.3892 0.5386 0.5787 0.0900  -0.0107 -0.0705 738 HOH A O   
4795 O O   . HOH E .   ? 0.5400 0.6819 0.5446 0.0312  0.0384  -0.0864 739 HOH A O   
4796 O O   . HOH E .   ? 0.5127 0.6857 0.3631 -0.0132 -0.1129 0.0215  740 HOH A O   
4797 O O   . HOH E .   ? 0.4388 0.5399 0.5972 0.0831  -0.1051 0.0179  741 HOH A O   
4798 O O   . HOH E .   ? 0.6488 0.5770 0.5955 0.0355  -0.0151 -0.0308 742 HOH A O   
4799 O O   . HOH E .   ? 0.5157 0.5493 0.5036 0.0587  -0.0307 -0.0455 743 HOH A O   
4800 O O   . HOH E .   ? 0.5846 0.6944 0.5149 0.0409  -0.0898 0.0440  744 HOH A O   
4801 O O   . HOH E .   ? 0.5339 0.5388 0.4695 0.0388  -0.0320 -0.0380 745 HOH A O   
4802 O O   . HOH E .   ? 0.5328 0.7055 0.3570 -0.0334 -0.0949 -0.0316 746 HOH A O   
4803 O O   . HOH E .   ? 0.6903 0.6232 0.6372 0.0033  -0.0168 0.0015  747 HOH A O   
4804 O O   . HOH E .   ? 0.6121 0.9160 0.8340 0.0367  0.0838  -0.1143 748 HOH A O   
4805 O O   . HOH E .   ? 0.5721 0.6085 0.4637 0.0182  -0.0327 0.0374  749 HOH A O   
4806 O O   . HOH E .   ? 0.3998 0.4330 0.4021 0.0622  -0.0243 -0.0622 750 HOH A O   
4807 O O   . HOH E .   ? 0.5837 0.6618 0.6846 0.0678  -0.1147 0.0327  751 HOH A O   
4808 O O   . HOH E .   ? 0.5807 0.4741 0.5296 -0.0775 -0.0285 -0.0504 752 HOH A O   
4809 O O   . HOH E .   ? 0.8267 0.8235 0.8110 0.0078  -0.0103 -0.1828 753 HOH A O   
4810 O O   . HOH E .   ? 0.5503 0.7383 0.7224 0.0743  0.0386  -0.1073 754 HOH A O   
4811 O O   . HOH E .   ? 0.6261 0.7045 0.5418 -0.0242 -0.0490 -0.1383 755 HOH A O   
4812 O O   . HOH E .   ? 0.6318 0.7974 0.6817 -0.0189 -0.1438 0.0091  756 HOH A O   
4813 O O   . HOH E .   ? 0.9521 0.9738 0.8674 -0.0302 0.0003  0.0349  757 HOH A O   
4814 O O   . HOH E .   ? 0.6121 0.6383 0.5757 0.0647  -0.0262 -0.0235 758 HOH A O   
4815 O O   . HOH E .   ? 0.4679 0.5960 0.5438 -0.1234 -0.0504 -0.0316 759 HOH A O   
4816 O O   . HOH E .   ? 0.4226 0.5936 0.4786 0.0193  0.0338  -0.0654 760 HOH A O   
4817 O O   . HOH E .   ? 0.4095 0.4597 0.3763 0.0329  -0.0304 -0.0894 761 HOH A O   
4818 O O   . HOH E .   ? 0.3730 0.3862 0.3269 0.0495  -0.0296 -0.0333 762 HOH A O   
4819 O O   . HOH E .   ? 0.3820 0.5603 0.5689 0.0791  0.0113  -0.0841 763 HOH A O   
4820 O O   . HOH E .   ? 0.6777 0.8241 0.4187 -0.0882 -0.0207 -0.1869 764 HOH A O   
4821 O O   . HOH E .   ? 0.5693 0.5004 0.6603 0.0625  -0.0605 -0.0136 765 HOH A O   
4822 O O   . HOH E .   ? 0.6634 0.7148 0.5433 -0.0148 -0.0945 -0.0099 766 HOH A O   
4823 O O   . HOH E .   ? 1.0499 0.9860 0.9133 -0.1170 -0.0671 -0.1166 767 HOH A O   
4824 O O   . HOH E .   ? 0.5347 0.6679 0.5878 -0.0882 0.0061  -0.0097 768 HOH A O   
4825 O O   . HOH E .   ? 0.6232 0.7585 0.6372 -0.0637 0.0271  -0.0067 769 HOH A O   
4826 O O   . HOH E .   ? 0.6787 0.7635 0.5327 -0.0338 0.0095  -0.2151 770 HOH A O   
4827 O O   . HOH E .   ? 0.4281 0.3483 0.3756 -0.0418 -0.0252 -0.0421 771 HOH A O   
4828 O O   . HOH E .   ? 0.7136 1.0151 0.9023 -0.1976 -0.1417 -0.0329 772 HOH A O   
4829 O O   . HOH E .   ? 0.5490 0.5819 0.5553 -0.1175 -0.0550 -0.0472 773 HOH A O   
4830 O O   . HOH E .   ? 0.5602 0.6734 0.6247 0.0664  0.0395  -0.1310 774 HOH A O   
4831 O O   . HOH E .   ? 0.4270 0.4302 0.4471 0.0456  -0.0373 -0.0552 775 HOH A O   
4832 O O   . HOH E .   ? 0.4600 0.5481 0.4011 0.0487  -0.0671 0.0173  776 HOH A O   
4833 O O   . HOH E .   ? 0.7263 0.8089 0.7219 0.0216  -0.1458 0.0610  777 HOH A O   
4834 O O   . HOH E .   ? 0.5684 0.7110 0.5846 -0.0312 -0.1303 -0.0070 778 HOH A O   
4835 O O   . HOH E .   ? 0.4570 0.5398 0.7718 0.1406  -0.0971 0.0063  779 HOH A O   
4836 O O   . HOH E .   ? 0.7983 0.6925 0.7299 -0.0433 -0.0156 0.0645  780 HOH A O   
4837 O O   . HOH E .   ? 0.6202 0.6578 0.5365 -0.0143 -0.0007 0.0207  781 HOH A O   
4838 O O   . HOH E .   ? 0.5744 0.6169 0.5859 -0.1408 -0.0664 -0.0539 782 HOH A O   
4839 O O   . HOH E .   ? 0.5981 0.4750 0.5432 -0.0341 -0.0188 -0.0361 783 HOH A O   
4840 O O   . HOH F .   ? 0.5259 1.0355 1.0471 0.1126  -0.1006 0.0645  701 HOH B O   
4841 O O   . HOH F .   ? 0.5065 0.5077 0.5605 0.0712  -0.0675 0.0009  702 HOH B O   
4842 O O   . HOH F .   ? 0.5566 0.6841 0.6714 -0.0541 -0.0320 -0.0064 703 HOH B O   
4843 O O   . HOH F .   ? 0.5624 0.5703 0.5177 0.0297  -0.0836 0.0458  704 HOH B O   
4844 O O   . HOH F .   ? 0.6421 0.7578 0.5435 -0.0561 -0.0786 -0.1349 705 HOH B O   
4845 O O   . HOH F .   ? 0.5719 0.5849 0.5825 0.0461  -0.0311 -0.0784 706 HOH B O   
4846 O O   . HOH F .   ? 0.3856 0.3976 0.3830 0.0591  -0.0427 -0.0191 707 HOH B O   
4847 O O   . HOH F .   ? 0.5775 0.6214 0.6437 0.1139  -0.0400 0.0196  708 HOH B O   
4848 O O   . HOH F .   ? 0.7003 0.8100 0.6007 -0.0353 -0.0671 -0.1213 709 HOH B O   
4849 O O   . HOH F .   ? 0.5085 0.6146 0.6091 -0.0459 -0.0462 -0.0231 710 HOH B O   
4850 O O   . HOH F .   ? 0.6476 0.7458 0.5143 -0.0452 0.0439  0.0213  711 HOH B O   
4851 O O   . HOH F .   ? 0.5841 0.6655 0.6205 0.0860  0.0503  -0.0591 712 HOH B O   
4852 O O   . HOH F .   ? 0.7885 0.8400 0.7357 -0.0643 0.0018  0.0733  713 HOH B O   
4853 O O   . HOH F .   ? 0.6143 0.6861 0.4990 0.0149  0.0605  -0.0571 714 HOH B O   
4854 O O   . HOH F .   ? 0.5431 0.6865 0.6283 0.0766  0.0480  -0.0425 715 HOH B O   
4855 O O   . HOH F .   ? 0.6003 0.6452 0.5814 -0.0455 -0.0064 0.0543  716 HOH B O   
4856 O O   . HOH F .   ? 0.7128 0.6431 0.7491 0.0203  -0.0697 0.0479  717 HOH B O   
4857 O O   . HOH F .   ? 0.6918 0.8561 0.6576 0.0033  0.1057  -0.0482 718 HOH B O   
4858 O O   . HOH F .   ? 0.3337 0.4905 0.4233 0.0480  0.0099  -0.0185 719 HOH B O   
4859 O O   . HOH F .   ? 0.4042 0.6662 0.5978 0.0194  -0.0262 -0.0043 720 HOH B O   
4860 O O   . HOH F .   ? 0.4143 0.9776 1.0143 0.1194  0.0197  0.0097  721 HOH B O   
4861 O O   . HOH F .   ? 0.3296 0.4193 0.2695 0.0280  -0.0501 -0.0527 722 HOH B O   
4862 O O   . HOH F .   ? 0.4268 0.4811 0.4061 0.0618  -0.0349 -0.0275 723 HOH B O   
4863 O O   . HOH F .   ? 0.7891 0.8040 0.7505 0.0283  -0.1031 0.0610  724 HOH B O   
4864 O O   . HOH F .   ? 0.3433 0.4312 0.3737 0.0416  -0.0181 -0.0189 725 HOH B O   
4865 O O   . HOH F .   ? 0.3585 0.5085 0.4472 0.0071  -0.0464 -0.0217 726 HOH B O   
4866 O O   . HOH F .   ? 0.5059 0.6308 0.5460 0.0652  0.0644  -0.0541 727 HOH B O   
4867 O O   . HOH F .   ? 0.4800 0.4977 0.4310 0.0554  -0.0239 -0.0283 728 HOH B O   
4868 O O   . HOH F .   ? 0.4418 0.5186 0.4920 -0.0021 -0.0245 -0.0078 729 HOH B O   
4869 O O   . HOH F .   ? 0.4609 0.6922 0.6229 0.0139  -0.0026 -0.0074 730 HOH B O   
4870 O O   . HOH F .   ? 0.6503 0.9505 0.8344 -0.0416 -0.1065 -0.0133 731 HOH B O   
4871 O O   . HOH F .   ? 0.7087 0.6329 0.7816 0.0291  -0.0338 -0.1129 732 HOH B O   
4872 O O   . HOH F .   ? 0.6458 0.7803 0.5726 0.0342  -0.1126 0.0656  733 HOH B O   
4873 O O   . HOH F .   ? 0.7940 0.9971 0.6477 -0.0554 -0.1241 -0.0515 734 HOH B O   
4874 O O   . HOH F .   ? 0.5497 0.5598 0.4647 0.0119  -0.0756 0.0521  735 HOH B O   
4875 O O   . HOH F .   ? 0.5411 0.4567 0.6272 0.0431  -0.0532 -0.0321 736 HOH B O   
4876 O O   . HOH F .   ? 0.3154 0.3601 0.3035 0.0622  -0.0234 -0.0263 737 HOH B O   
4877 O O   . HOH F .   ? 0.3398 0.3927 0.3358 0.0456  -0.0389 -0.0430 738 HOH B O   
4878 O O   . HOH F .   ? 0.6986 0.7078 0.7790 0.1256  -0.0393 0.0291  739 HOH B O   
4879 O O   . HOH F .   ? 0.3703 0.4369 0.3305 0.0264  -0.0420 -0.0764 740 HOH B O   
4880 O O   . HOH F .   ? 0.6305 0.6622 0.4873 0.0083  -0.0040 -0.0228 741 HOH B O   
4881 O O   . HOH F .   ? 0.4720 0.6034 0.5506 0.0097  -0.0229 -0.0135 742 HOH B O   
4882 O O   . HOH F .   ? 0.6597 0.6786 0.6306 0.0710  -0.0148 -0.0305 743 HOH B O   
4883 O O   . HOH F .   ? 0.5575 0.5571 0.5736 0.0592  -0.0460 -0.0187 744 HOH B O   
4884 O O   . HOH F .   ? 0.4495 0.5814 0.5117 0.0611  0.0278  -0.0299 745 HOH B O   
4885 O O   . HOH F .   ? 0.7556 0.8034 0.6613 0.0060  -0.0973 0.0191  746 HOH B O   
4886 O O   . HOH F .   ? 0.6882 0.7241 0.4819 -0.0420 -0.0594 0.0616  747 HOH B O   
4887 O O   . HOH F .   ? 0.5629 0.5513 0.5973 0.0551  -0.0390 -0.0483 748 HOH B O   
4888 O O   . HOH F .   ? 0.3342 0.3936 0.3201 0.0518  -0.0386 -0.0379 749 HOH B O   
4889 O O   . HOH F .   ? 0.5183 0.4373 0.5638 0.0071  -0.0654 0.0456  750 HOH B O   
4890 O O   . HOH F .   ? 0.3857 0.4590 0.3931 0.0808  -0.0589 0.0207  751 HOH B O   
4891 O O   . HOH F .   ? 0.3721 0.6385 0.5679 0.0324  -0.0455 -0.0002 752 HOH B O   
4892 O O   . HOH F .   ? 0.5325 0.6075 0.5897 -0.0373 -0.0665 -0.0669 753 HOH B O   
4893 O O   . HOH F .   ? 0.7162 0.6307 0.7739 0.0334  -0.0861 0.0626  754 HOH B O   
4894 O O   . HOH F .   ? 0.6554 0.6767 0.6714 0.0952  -0.0414 0.0186  755 HOH B O   
4895 O O   . HOH F .   ? 0.6420 0.8838 0.8206 -0.0418 -0.0064 0.0017  756 HOH B O   
4896 O O   . HOH F .   ? 0.5080 0.5087 0.5264 0.0532  -0.0392 -0.0362 757 HOH B O   
4897 O O   . HOH F .   ? 0.3847 0.6345 0.5483 0.0257  -0.0686 -0.0010 758 HOH B O   
4898 O O   . HOH F .   ? 0.4826 0.5077 0.4004 0.0206  -0.0771 0.0262  759 HOH B O   
4899 O O   . HOH F .   ? 0.4671 0.8407 0.7806 0.0390  0.0344  -0.0084 760 HOH B O   
4900 O O   . HOH F .   ? 0.5292 0.6839 0.5845 0.0529  0.0694  -0.0465 761 HOH B O   
4901 O O   . HOH F .   ? 0.4556 0.4871 0.4414 0.0316  -0.0308 -0.0977 762 HOH B O   
4902 O O   . HOH F .   ? 0.5758 0.7476 0.6793 0.0178  -0.0004 -0.0101 763 HOH B O   
4903 O O   . HOH F .   ? 0.6503 0.5806 0.6416 0.0009  -0.1021 0.1206  764 HOH B O   
4904 O O   . HOH F .   ? 0.5633 0.5978 0.5744 -0.0138 -0.0559 -0.0999 765 HOH B O   
4905 O O   . HOH F .   ? 0.7461 0.7700 0.5812 0.0015  -0.0148 -0.0292 766 HOH B O   
4906 O O   . HOH F .   ? 0.6957 0.7088 0.5599 0.0160  -0.0220 -0.0365 767 HOH B O   
4907 O O   . HOH F .   ? 0.5205 0.6065 0.5775 -0.0581 -0.0777 -0.0819 768 HOH B O   
4908 O O   . HOH F .   ? 0.3593 0.3750 0.3011 0.0482  -0.0327 -0.0265 769 HOH B O   
4909 O O   . HOH F .   ? 0.5734 0.5850 0.5203 0.0588  -0.0138 -0.0357 770 HOH B O   
4910 O O   . HOH F .   ? 0.5934 0.6090 0.5107 0.0339  -0.0399 -0.0258 771 HOH B O   
4911 O O   . HOH F .   ? 0.7007 0.6834 0.9927 0.2171  -0.0309 0.0497  772 HOH B O   
4912 O O   . HOH F .   ? 0.5826 0.6126 0.5325 0.0276  -0.0961 0.0397  773 HOH B O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   189 ?   ?   ?   A . n 
A 1 2   ALA 2   190 ?   ?   ?   A . n 
A 1 3   MET 3   191 ?   ?   ?   A . n 
A 1 4   GLY 4   192 ?   ?   ?   A . n 
A 1 5   SER 5   193 193 SER SER A . n 
A 1 6   ARG 6   194 194 ARG ARG A . n 
A 1 7   PRO 7   195 195 PRO PRO A . n 
A 1 8   PHE 8   196 196 PHE PHE A . n 
A 1 9   PRO 9   197 197 PRO PRO A . n 
A 1 10  PHE 10  198 198 PHE PHE A . n 
A 1 11  CYS 11  199 199 CYS CYS A . n 
A 1 12  TRP 12  200 200 TRP TRP A . n 
A 1 13  PRO 13  201 201 PRO PRO A . n 
A 1 14  LEU 14  202 202 LEU LEU A . n 
A 1 15  CYS 15  203 203 CYS CYS A . n 
A 1 16  GLU 16  204 204 GLU GLU A . n 
A 1 17  ILE 17  205 205 ILE ILE A . n 
A 1 18  SER 18  206 206 SER SER A . n 
A 1 19  ARG 19  207 207 ARG ARG A . n 
A 1 20  GLY 20  208 208 GLY GLY A . n 
A 1 21  THR 21  209 209 THR THR A . n 
A 1 22  HIS 22  210 210 HIS HIS A . n 
A 1 23  ASN 23  211 211 ASN ASN A . n 
A 1 24  PHE 24  212 212 PHE PHE A . n 
A 1 25  SER 25  213 213 SER SER A . n 
A 1 26  GLU 26  214 214 GLU GLU A . n 
A 1 27  GLU 27  215 215 GLU GLU A . n 
A 1 28  LEU 28  216 216 LEU LEU A . n 
A 1 29  LYS 29  217 217 LYS LYS A . n 
A 1 30  ILE 30  218 218 ILE ILE A . n 
A 1 31  GLY 31  219 219 GLY GLY A . n 
A 1 32  GLU 32  220 220 GLU GLU A . n 
A 1 33  GLY 33  221 221 GLY GLY A . n 
A 1 34  GLY 34  222 222 GLY GLY A . n 
A 1 35  PHE 35  223 223 PHE PHE A . n 
A 1 36  GLY 36  224 224 GLY GLY A . n 
A 1 37  CYS 37  225 225 CYS CYS A . n 
A 1 38  VAL 38  226 226 VAL VAL A . n 
A 1 39  TYR 39  227 227 TYR TYR A . n 
A 1 40  ARG 40  228 228 ARG ARG A . n 
A 1 41  ALA 41  229 229 ALA ALA A . n 
A 1 42  VAL 42  230 230 VAL VAL A . n 
A 1 43  MET 43  231 231 MET MET A . n 
A 1 44  ARG 44  232 232 ARG ARG A . n 
A 1 45  ASN 45  233 233 ASN ASN A . n 
A 1 46  THR 46  234 234 THR THR A . n 
A 1 47  VAL 47  235 235 VAL VAL A . n 
A 1 48  TYR 48  236 236 TYR TYR A . n 
A 1 49  ALA 49  237 237 ALA ALA A . n 
A 1 50  VAL 50  238 238 VAL VAL A . n 
A 1 51  LYS 51  239 239 LYS LYS A . n 
A 1 52  ARG 52  240 240 ARG ARG A . n 
A 1 53  LEU 53  241 241 LEU LEU A . n 
A 1 54  LYS 54  242 242 LYS LYS A . n 
A 1 55  GLU 55  243 ?   ?   ?   A . n 
A 1 56  ASN 56  244 ?   ?   ?   A . n 
A 1 57  ALA 57  245 ?   ?   ?   A . n 
A 1 58  ASP 58  246 ?   ?   ?   A . n 
A 1 59  LEU 59  247 ?   ?   ?   A . n 
A 1 60  GLU 60  248 248 GLU GLU A . n 
A 1 61  TRP 61  249 249 TRP TRP A . n 
A 1 62  THR 62  250 250 THR THR A . n 
A 1 63  ALA 63  251 251 ALA ALA A . n 
A 1 64  VAL 64  252 252 VAL VAL A . n 
A 1 65  LYS 65  253 253 LYS LYS A . n 
A 1 66  GLN 66  254 254 GLN GLN A . n 
A 1 67  SER 67  255 255 SER SER A . n 
A 1 68  PHE 68  256 256 PHE PHE A . n 
A 1 69  LEU 69  257 257 LEU LEU A . n 
A 1 70  THR 70  258 258 THR THR A . n 
A 1 71  GLU 71  259 259 GLU GLU A . n 
A 1 72  VAL 72  260 260 VAL VAL A . n 
A 1 73  GLU 73  261 261 GLU GLU A . n 
A 1 74  GLN 74  262 262 GLN GLN A . n 
A 1 75  LEU 75  263 263 LEU LEU A . n 
A 1 76  SER 76  264 264 SER SER A . n 
A 1 77  ARG 77  265 265 ARG ARG A . n 
A 1 78  PHE 78  266 266 PHE PHE A . n 
A 1 79  ARG 79  267 267 ARG ARG A . n 
A 1 80  HIS 80  268 268 HIS HIS A . n 
A 1 81  PRO 81  269 269 PRO PRO A . n 
A 1 82  ASN 82  270 270 ASN ASN A . n 
A 1 83  ILE 83  271 271 ILE ILE A . n 
A 1 84  VAL 84  272 272 VAL VAL A . n 
A 1 85  ASP 85  273 273 ASP ASP A . n 
A 1 86  PHE 86  274 274 PHE PHE A . n 
A 1 87  ALA 87  275 275 ALA ALA A . n 
A 1 88  GLY 88  276 276 GLY GLY A . n 
A 1 89  TYR 89  277 277 TYR TYR A . n 
A 1 90  CYS 90  278 278 CYS CYS A . n 
A 1 91  ALA 91  279 279 ALA ALA A . n 
A 1 92  GLN 92  280 280 GLN GLN A . n 
A 1 93  ASN 93  281 281 ASN ASN A . n 
A 1 94  GLY 94  282 282 GLY GLY A . n 
A 1 95  PHE 95  283 283 PHE PHE A . n 
A 1 96  TYR 96  284 284 TYR TYR A . n 
A 1 97  CYS 97  285 285 CYS CYS A . n 
A 1 98  LEU 98  286 286 LEU LEU A . n 
A 1 99  VAL 99  287 287 VAL VAL A . n 
A 1 100 TYR 100 288 288 TYR TYR A . n 
A 1 101 GLY 101 289 289 GLY GLY A . n 
A 1 102 PHE 102 290 290 PHE PHE A . n 
A 1 103 LEU 103 291 291 LEU LEU A . n 
A 1 104 PRO 104 292 292 PRO PRO A . n 
A 1 105 ASN 105 293 293 ASN ASN A . n 
A 1 106 GLY 106 294 294 GLY GLY A . n 
A 1 107 SER 107 295 295 SER SER A . n 
A 1 108 LEU 108 296 296 LEU LEU A . n 
A 1 109 GLU 109 297 297 GLU GLU A . n 
A 1 110 ASP 110 298 298 ASP ASP A . n 
A 1 111 ARG 111 299 299 ARG ARG A . n 
A 1 112 LEU 112 300 300 LEU LEU A . n 
A 1 113 HIS 113 301 301 HIS HIS A . n 
A 1 114 CYS 114 302 302 CYS CYS A . n 
A 1 115 GLN 115 303 303 GLN GLN A . n 
A 1 116 THR 116 304 304 THR THR A . n 
A 1 117 GLN 117 305 305 GLN GLN A . n 
A 1 118 ALA 118 306 306 ALA ALA A . n 
A 1 119 CYS 119 307 307 CYS CYS A . n 
A 1 120 PRO 120 308 308 PRO PRO A . n 
A 1 121 PRO 121 309 309 PRO PRO A . n 
A 1 122 LEU 122 310 310 LEU LEU A . n 
A 1 123 SER 123 311 311 SER SER A . n 
A 1 124 TRP 124 312 312 TRP TRP A . n 
A 1 125 PRO 125 313 313 PRO PRO A . n 
A 1 126 GLN 126 314 314 GLN GLN A . n 
A 1 127 ARG 127 315 315 ARG ARG A . n 
A 1 128 LEU 128 316 316 LEU LEU A . n 
A 1 129 ASP 129 317 317 ASP ASP A . n 
A 1 130 ILE 130 318 318 ILE ILE A . n 
A 1 131 LEU 131 319 319 LEU LEU A . n 
A 1 132 LEU 132 320 320 LEU LEU A . n 
A 1 133 GLY 133 321 321 GLY GLY A . n 
A 1 134 THR 134 322 322 THR THR A . n 
A 1 135 ALA 135 323 323 ALA ALA A . n 
A 1 136 ARG 136 324 324 ARG ARG A . n 
A 1 137 ALA 137 325 325 ALA ALA A . n 
A 1 138 ILE 138 326 326 ILE ILE A . n 
A 1 139 GLN 139 327 327 GLN GLN A . n 
A 1 140 PHE 140 328 328 PHE PHE A . n 
A 1 141 LEU 141 329 329 LEU LEU A . n 
A 1 142 HIS 142 330 330 HIS HIS A . n 
A 1 143 GLN 143 331 331 GLN GLN A . n 
A 1 144 ASP 144 332 332 ASP ASP A . n 
A 1 145 SER 145 333 333 SER SER A . n 
A 1 146 PRO 146 334 334 PRO PRO A . n 
A 1 147 SER 147 335 335 SER SER A . n 
A 1 148 LEU 148 336 336 LEU LEU A . n 
A 1 149 ILE 149 337 337 ILE ILE A . n 
A 1 150 HIS 150 338 338 HIS HIS A . n 
A 1 151 GLY 151 339 339 GLY GLY A . n 
A 1 152 ASP 152 340 340 ASP ASP A . n 
A 1 153 ILE 153 341 341 ILE ILE A . n 
A 1 154 LYS 154 342 342 LYS LYS A . n 
A 1 155 SER 155 343 343 SER SER A . n 
A 1 156 SER 156 344 344 SER SER A . n 
A 1 157 ASN 157 345 345 ASN ASN A . n 
A 1 158 VAL 158 346 346 VAL VAL A . n 
A 1 159 LEU 159 347 347 LEU LEU A . n 
A 1 160 LEU 160 348 348 LEU LEU A . n 
A 1 161 ASP 161 349 349 ASP ASP A . n 
A 1 162 GLU 162 350 350 GLU GLU A . n 
A 1 163 ARG 163 351 351 ARG ARG A . n 
A 1 164 LEU 164 352 352 LEU LEU A . n 
A 1 165 THR 165 353 353 THR THR A . n 
A 1 166 PRO 166 354 354 PRO PRO A . n 
A 1 167 LYS 167 355 355 LYS LYS A . n 
A 1 168 LEU 168 356 356 LEU LEU A . n 
A 1 169 GLY 169 357 357 GLY GLY A . n 
A 1 170 ASP 170 358 358 ASP ASP A . n 
A 1 171 PHE 171 359 359 PHE PHE A . n 
A 1 172 GLY 172 360 360 GLY GLY A . n 
A 1 173 LEU 173 361 361 LEU LEU A . n 
A 1 174 ALA 174 362 362 ALA ALA A . n 
A 1 175 ARG 175 363 363 ARG ARG A . n 
A 1 176 PHE 176 364 364 PHE PHE A . n 
A 1 177 SER 177 365 365 SER SER A . n 
A 1 178 ARG 178 366 366 ARG ARG A . n 
A 1 179 PHE 179 367 ?   ?   ?   A . n 
A 1 180 ALA 180 368 ?   ?   ?   A . n 
A 1 181 GLY 181 369 ?   ?   ?   A . n 
A 1 182 SER 182 370 ?   ?   ?   A . n 
A 1 183 SER 183 371 ?   ?   ?   A . n 
A 1 184 PRO 184 372 ?   ?   ?   A . n 
A 1 185 SER 185 373 ?   ?   ?   A . n 
A 1 186 GLN 186 374 ?   ?   ?   A . n 
A 1 187 SER 187 375 ?   ?   ?   A . n 
A 1 188 SER 188 376 ?   ?   ?   A . n 
A 1 189 MET 189 377 ?   ?   ?   A . n 
A 1 190 VAL 190 378 ?   ?   ?   A . n 
A 1 191 ALA 191 379 ?   ?   ?   A . n 
A 1 192 ARG 192 380 ?   ?   ?   A . n 
A 1 193 THR 193 381 ?   ?   ?   A . n 
A 1 194 GLN 194 382 ?   ?   ?   A . n 
A 1 195 THR 195 383 383 THR THR A . n 
A 1 196 VAL 196 384 384 VAL VAL A . n 
A 1 197 ARG 197 385 385 ARG ARG A . n 
A 1 198 GLY 198 386 386 GLY GLY A . n 
A 1 199 THR 199 387 387 THR THR A . n 
A 1 200 LEU 200 388 388 LEU LEU A . n 
A 1 201 ALA 201 389 389 ALA ALA A . n 
A 1 202 TYR 202 390 390 TYR TYR A . n 
A 1 203 LEU 203 391 391 LEU LEU A . n 
A 1 204 PRO 204 392 392 PRO PRO A . n 
A 1 205 GLU 205 393 393 GLU GLU A . n 
A 1 206 GLU 206 394 394 GLU GLU A . n 
A 1 207 TYR 207 395 395 TYR TYR A . n 
A 1 208 ILE 208 396 396 ILE ILE A . n 
A 1 209 LYS 209 397 397 LYS LYS A . n 
A 1 210 THR 210 398 398 THR THR A . n 
A 1 211 GLY 211 399 399 GLY GLY A . n 
A 1 212 ARG 212 400 400 ARG ARG A . n 
A 1 213 LEU 213 401 401 LEU LEU A . n 
A 1 214 ALA 214 402 402 ALA ALA A . n 
A 1 215 VAL 215 403 403 VAL VAL A . n 
A 1 216 ASP 216 404 404 ASP ASP A . n 
A 1 217 THR 217 405 405 THR THR A . n 
A 1 218 ASP 218 406 406 ASP ASP A . n 
A 1 219 THR 219 407 407 THR THR A . n 
A 1 220 PHE 220 408 408 PHE PHE A . n 
A 1 221 SER 221 409 409 SER SER A . n 
A 1 222 PHE 222 410 410 PHE PHE A . n 
A 1 223 GLY 223 411 411 GLY GLY A . n 
A 1 224 VAL 224 412 412 VAL VAL A . n 
A 1 225 VAL 225 413 413 VAL VAL A . n 
A 1 226 VAL 226 414 414 VAL VAL A . n 
A 1 227 LEU 227 415 415 LEU LEU A . n 
A 1 228 GLU 228 416 416 GLU GLU A . n 
A 1 229 THR 229 417 417 THR THR A . n 
A 1 230 LEU 230 418 418 LEU LEU A . n 
A 1 231 ALA 231 419 419 ALA ALA A . n 
A 1 232 GLY 232 420 420 GLY GLY A . n 
A 1 233 GLN 233 421 421 GLN GLN A . n 
A 1 234 ARG 234 422 422 ARG ARG A . n 
A 1 235 ALA 235 423 423 ALA ALA A . n 
A 1 236 VAL 236 424 424 VAL VAL A . n 
A 1 237 LYS 237 425 425 LYS LYS A . n 
A 1 238 THR 238 426 426 THR THR A . n 
A 1 239 HIS 239 427 427 HIS HIS A . n 
A 1 240 GLY 240 428 428 GLY GLY A . n 
A 1 241 ALA 241 429 429 ALA ALA A . n 
A 1 242 ARG 242 430 430 ARG ARG A . n 
A 1 243 THR 243 431 431 THR THR A . n 
A 1 244 LYS 244 432 432 LYS LYS A . n 
A 1 245 TYR 245 433 433 TYR TYR A . n 
A 1 246 LEU 246 434 434 LEU LEU A . n 
A 1 247 LYS 247 435 435 LYS LYS A . n 
A 1 248 ASP 248 436 436 ASP ASP A . n 
A 1 249 LEU 249 437 437 LEU LEU A . n 
A 1 250 VAL 250 438 438 VAL VAL A . n 
A 1 251 GLU 251 439 439 GLU GLU A . n 
A 1 252 GLU 252 440 440 GLU GLU A . n 
A 1 253 GLU 253 441 441 GLU GLU A . n 
A 1 254 ALA 254 442 442 ALA ALA A . n 
A 1 255 GLU 255 443 443 GLU GLU A . n 
A 1 256 GLU 256 444 444 GLU GLU A . n 
A 1 257 ALA 257 445 445 ALA ALA A . n 
A 1 258 GLY 258 446 446 GLY GLY A . n 
A 1 259 VAL 259 447 447 VAL VAL A . n 
A 1 260 ALA 260 448 448 ALA ALA A . n 
A 1 261 LEU 261 449 ?   ?   ?   A . n 
A 1 262 ARG 262 450 ?   ?   ?   A . n 
A 1 263 SER 263 451 ?   ?   ?   A . n 
A 1 264 THR 264 452 ?   ?   ?   A . n 
A 1 265 GLN 265 453 ?   ?   ?   A . n 
A 1 266 SER 266 454 ?   ?   ?   A . n 
A 1 267 THR 267 455 ?   ?   ?   A . n 
A 1 268 LEU 268 456 ?   ?   ?   A . n 
A 1 269 GLN 269 457 ?   ?   ?   A . n 
A 1 270 ALA 270 458 ?   ?   ?   A . n 
A 1 271 GLY 271 459 ?   ?   ?   A . n 
A 1 272 LEU 272 460 ?   ?   ?   A . n 
A 1 273 ALA 273 461 461 ALA ALA A . n 
A 1 274 ALA 274 462 462 ALA ALA A . n 
A 1 275 ASP 275 463 463 ASP ASP A . n 
A 1 276 ALA 276 464 464 ALA ALA A . n 
A 1 277 TRP 277 465 465 TRP TRP A . n 
A 1 278 ALA 278 466 466 ALA ALA A . n 
A 1 279 ALA 279 467 467 ALA ALA A . n 
A 1 280 PRO 280 468 468 PRO PRO A . n 
A 1 281 ILE 281 469 469 ILE ILE A . n 
A 1 282 ALA 282 470 470 ALA ALA A . n 
A 1 283 MET 283 471 471 MET MET A . n 
A 1 284 GLN 284 472 472 GLN GLN A . n 
A 1 285 ILE 285 473 473 ILE ILE A . n 
A 1 286 TYR 286 474 474 TYR TYR A . n 
A 1 287 LYS 287 475 475 LYS LYS A . n 
A 1 288 LYS 288 476 476 LYS LYS A . n 
A 1 289 HIS 289 477 477 HIS HIS A . n 
A 1 290 LEU 290 478 478 LEU LEU A . n 
A 1 291 ASP 291 479 479 ASP ASP A . n 
A 1 292 PRO 292 480 480 PRO PRO A . n 
A 1 293 ARG 293 481 481 ARG ARG A . n 
A 1 294 PRO 294 482 482 PRO PRO A . n 
A 1 295 GLY 295 483 483 GLY GLY A . n 
A 1 296 PRO 296 484 484 PRO PRO A . n 
A 1 297 CYS 297 485 485 CYS CYS A . n 
A 1 298 PRO 298 486 486 PRO PRO A . n 
A 1 299 PRO 299 487 487 PRO PRO A . n 
A 1 300 GLU 300 488 488 GLU GLU A . n 
A 1 301 LEU 301 489 489 LEU LEU A . n 
A 1 302 GLY 302 490 490 GLY GLY A . n 
A 1 303 LEU 303 491 491 LEU LEU A . n 
A 1 304 GLY 304 492 492 GLY GLY A . n 
A 1 305 LEU 305 493 493 LEU LEU A . n 
A 1 306 GLY 306 494 494 GLY GLY A . n 
A 1 307 GLN 307 495 495 GLN GLN A . n 
A 1 308 LEU 308 496 496 LEU LEU A . n 
A 1 309 ALA 309 497 497 ALA ALA A . n 
A 1 310 CYS 310 498 498 CYS CYS A . n 
A 1 311 CYS 311 499 499 CYS CYS A . n 
A 1 312 CYS 312 500 500 CYS CYS A . n 
A 1 313 LEU 313 501 501 LEU LEU A . n 
A 1 314 HIS 314 502 502 HIS HIS A . n 
A 1 315 ARG 315 503 503 ARG ARG A . n 
A 1 316 ARG 316 504 504 ARG ARG A . n 
A 1 317 ALA 317 505 505 ALA ALA A . n 
A 1 318 LYS 318 506 506 LYS LYS A . n 
A 1 319 ARG 319 507 507 ARG ARG A . n 
A 1 320 ARG 320 508 508 ARG ARG A . n 
A 1 321 PRO 321 509 509 PRO PRO A . n 
A 1 322 PRO 322 510 510 PRO PRO A . n 
A 1 323 MET 323 511 511 MET MET A . n 
A 1 324 THR 324 512 512 THR THR A . n 
A 1 325 GLN 325 513 513 GLN GLN A . n 
A 1 326 VAL 326 514 514 VAL VAL A . n 
A 1 327 TYR 327 515 515 TYR TYR A . n 
A 1 328 GLU 328 516 516 GLU GLU A . n 
A 1 329 ARG 329 517 517 ARG ARG A . n 
A 1 330 LEU 330 518 518 LEU LEU A . n 
A 1 331 GLU 331 519 519 GLU GLU A . n 
A 1 332 LYS 332 520 520 LYS LYS A . n 
A 1 333 LEU 333 521 521 LEU LEU A . n 
A 1 334 GLN 334 522 522 GLN GLN A . n 
A 1 335 ALA 335 523 523 ALA ALA A . n 
A 1 336 VAL 336 524 524 VAL VAL A . n 
A 1 337 VAL 337 525 525 VAL VAL A . n 
A 1 338 ALA 338 526 526 ALA ALA A . n 
A 1 339 GLY 339 527 ?   ?   ?   A . n 
A 1 340 VAL 340 528 ?   ?   ?   A . n 
A 1 341 PRO 341 529 ?   ?   ?   A . n 
A 1 342 GLY 342 530 ?   ?   ?   A . n 
B 1 1   GLY 1   189 ?   ?   ?   B . n 
B 1 2   ALA 2   190 ?   ?   ?   B . n 
B 1 3   MET 3   191 ?   ?   ?   B . n 
B 1 4   GLY 4   192 ?   ?   ?   B . n 
B 1 5   SER 5   193 ?   ?   ?   B . n 
B 1 6   ARG 6   194 194 ARG ARG B . n 
B 1 7   PRO 7   195 195 PRO PRO B . n 
B 1 8   PHE 8   196 196 PHE PHE B . n 
B 1 9   PRO 9   197 197 PRO PRO B . n 
B 1 10  PHE 10  198 198 PHE PHE B . n 
B 1 11  CYS 11  199 199 CYS CYS B . n 
B 1 12  TRP 12  200 200 TRP TRP B . n 
B 1 13  PRO 13  201 201 PRO PRO B . n 
B 1 14  LEU 14  202 202 LEU LEU B . n 
B 1 15  CYS 15  203 203 CYS CYS B . n 
B 1 16  GLU 16  204 204 GLU GLU B . n 
B 1 17  ILE 17  205 205 ILE ILE B . n 
B 1 18  SER 18  206 206 SER SER B . n 
B 1 19  ARG 19  207 207 ARG ARG B . n 
B 1 20  GLY 20  208 208 GLY GLY B . n 
B 1 21  THR 21  209 209 THR THR B . n 
B 1 22  HIS 22  210 210 HIS HIS B . n 
B 1 23  ASN 23  211 211 ASN ASN B . n 
B 1 24  PHE 24  212 212 PHE PHE B . n 
B 1 25  SER 25  213 213 SER SER B . n 
B 1 26  GLU 26  214 214 GLU GLU B . n 
B 1 27  GLU 27  215 215 GLU GLU B . n 
B 1 28  LEU 28  216 216 LEU LEU B . n 
B 1 29  LYS 29  217 217 LYS LYS B . n 
B 1 30  ILE 30  218 218 ILE ILE B . n 
B 1 31  GLY 31  219 219 GLY GLY B . n 
B 1 32  GLU 32  220 220 GLU GLU B . n 
B 1 33  GLY 33  221 221 GLY GLY B . n 
B 1 34  GLY 34  222 222 GLY GLY B . n 
B 1 35  PHE 35  223 223 PHE PHE B . n 
B 1 36  GLY 36  224 224 GLY GLY B . n 
B 1 37  CYS 37  225 225 CYS CYS B . n 
B 1 38  VAL 38  226 226 VAL VAL B . n 
B 1 39  TYR 39  227 227 TYR TYR B . n 
B 1 40  ARG 40  228 228 ARG ARG B . n 
B 1 41  ALA 41  229 229 ALA ALA B . n 
B 1 42  VAL 42  230 230 VAL VAL B . n 
B 1 43  MET 43  231 231 MET MET B . n 
B 1 44  ARG 44  232 232 ARG ARG B . n 
B 1 45  ASN 45  233 233 ASN ASN B . n 
B 1 46  THR 46  234 234 THR THR B . n 
B 1 47  VAL 47  235 235 VAL VAL B . n 
B 1 48  TYR 48  236 236 TYR TYR B . n 
B 1 49  ALA 49  237 237 ALA ALA B . n 
B 1 50  VAL 50  238 238 VAL VAL B . n 
B 1 51  LYS 51  239 239 LYS LYS B . n 
B 1 52  ARG 52  240 240 ARG ARG B . n 
B 1 53  LEU 53  241 241 LEU LEU B . n 
B 1 54  LYS 54  242 242 LYS LYS B . n 
B 1 55  GLU 55  243 243 GLU GLU B . n 
B 1 56  ASN 56  244 ?   ?   ?   B . n 
B 1 57  ALA 57  245 ?   ?   ?   B . n 
B 1 58  ASP 58  246 ?   ?   ?   B . n 
B 1 59  LEU 59  247 ?   ?   ?   B . n 
B 1 60  GLU 60  248 ?   ?   ?   B . n 
B 1 61  TRP 61  249 249 TRP TRP B . n 
B 1 62  THR 62  250 250 THR THR B . n 
B 1 63  ALA 63  251 251 ALA ALA B . n 
B 1 64  VAL 64  252 252 VAL VAL B . n 
B 1 65  LYS 65  253 253 LYS LYS B . n 
B 1 66  GLN 66  254 254 GLN GLN B . n 
B 1 67  SER 67  255 255 SER SER B . n 
B 1 68  PHE 68  256 256 PHE PHE B . n 
B 1 69  LEU 69  257 257 LEU LEU B . n 
B 1 70  THR 70  258 258 THR THR B . n 
B 1 71  GLU 71  259 259 GLU GLU B . n 
B 1 72  VAL 72  260 260 VAL VAL B . n 
B 1 73  GLU 73  261 261 GLU GLU B . n 
B 1 74  GLN 74  262 262 GLN GLN B . n 
B 1 75  LEU 75  263 263 LEU LEU B . n 
B 1 76  SER 76  264 264 SER SER B . n 
B 1 77  ARG 77  265 265 ARG ARG B . n 
B 1 78  PHE 78  266 266 PHE PHE B . n 
B 1 79  ARG 79  267 267 ARG ARG B . n 
B 1 80  HIS 80  268 268 HIS HIS B . n 
B 1 81  PRO 81  269 269 PRO PRO B . n 
B 1 82  ASN 82  270 270 ASN ASN B . n 
B 1 83  ILE 83  271 271 ILE ILE B . n 
B 1 84  VAL 84  272 272 VAL VAL B . n 
B 1 85  ASP 85  273 273 ASP ASP B . n 
B 1 86  PHE 86  274 274 PHE PHE B . n 
B 1 87  ALA 87  275 275 ALA ALA B . n 
B 1 88  GLY 88  276 276 GLY GLY B . n 
B 1 89  TYR 89  277 277 TYR TYR B . n 
B 1 90  CYS 90  278 278 CYS CYS B . n 
B 1 91  ALA 91  279 279 ALA ALA B . n 
B 1 92  GLN 92  280 280 GLN GLN B . n 
B 1 93  ASN 93  281 281 ASN ASN B . n 
B 1 94  GLY 94  282 282 GLY GLY B . n 
B 1 95  PHE 95  283 283 PHE PHE B . n 
B 1 96  TYR 96  284 284 TYR TYR B . n 
B 1 97  CYS 97  285 285 CYS CYS B . n 
B 1 98  LEU 98  286 286 LEU LEU B . n 
B 1 99  VAL 99  287 287 VAL VAL B . n 
B 1 100 TYR 100 288 288 TYR TYR B . n 
B 1 101 GLY 101 289 289 GLY GLY B . n 
B 1 102 PHE 102 290 290 PHE PHE B . n 
B 1 103 LEU 103 291 291 LEU LEU B . n 
B 1 104 PRO 104 292 292 PRO PRO B . n 
B 1 105 ASN 105 293 293 ASN ASN B . n 
B 1 106 GLY 106 294 294 GLY GLY B . n 
B 1 107 SER 107 295 295 SER SER B . n 
B 1 108 LEU 108 296 296 LEU LEU B . n 
B 1 109 GLU 109 297 297 GLU GLU B . n 
B 1 110 ASP 110 298 298 ASP ASP B . n 
B 1 111 ARG 111 299 299 ARG ARG B . n 
B 1 112 LEU 112 300 300 LEU LEU B . n 
B 1 113 HIS 113 301 301 HIS HIS B . n 
B 1 114 CYS 114 302 302 CYS CYS B . n 
B 1 115 GLN 115 303 303 GLN GLN B . n 
B 1 116 THR 116 304 ?   ?   ?   B . n 
B 1 117 GLN 117 305 ?   ?   ?   B . n 
B 1 118 ALA 118 306 ?   ?   ?   B . n 
B 1 119 CYS 119 307 307 CYS CYS B . n 
B 1 120 PRO 120 308 308 PRO PRO B . n 
B 1 121 PRO 121 309 309 PRO PRO B . n 
B 1 122 LEU 122 310 310 LEU LEU B . n 
B 1 123 SER 123 311 311 SER SER B . n 
B 1 124 TRP 124 312 312 TRP TRP B . n 
B 1 125 PRO 125 313 313 PRO PRO B . n 
B 1 126 GLN 126 314 314 GLN GLN B . n 
B 1 127 ARG 127 315 315 ARG ARG B . n 
B 1 128 LEU 128 316 316 LEU LEU B . n 
B 1 129 ASP 129 317 317 ASP ASP B . n 
B 1 130 ILE 130 318 318 ILE ILE B . n 
B 1 131 LEU 131 319 319 LEU LEU B . n 
B 1 132 LEU 132 320 320 LEU LEU B . n 
B 1 133 GLY 133 321 321 GLY GLY B . n 
B 1 134 THR 134 322 322 THR THR B . n 
B 1 135 ALA 135 323 323 ALA ALA B . n 
B 1 136 ARG 136 324 324 ARG ARG B . n 
B 1 137 ALA 137 325 325 ALA ALA B . n 
B 1 138 ILE 138 326 326 ILE ILE B . n 
B 1 139 GLN 139 327 327 GLN GLN B . n 
B 1 140 PHE 140 328 328 PHE PHE B . n 
B 1 141 LEU 141 329 329 LEU LEU B . n 
B 1 142 HIS 142 330 330 HIS HIS B . n 
B 1 143 GLN 143 331 331 GLN GLN B . n 
B 1 144 ASP 144 332 332 ASP ASP B . n 
B 1 145 SER 145 333 333 SER SER B . n 
B 1 146 PRO 146 334 334 PRO PRO B . n 
B 1 147 SER 147 335 335 SER SER B . n 
B 1 148 LEU 148 336 336 LEU LEU B . n 
B 1 149 ILE 149 337 337 ILE ILE B . n 
B 1 150 HIS 150 338 338 HIS HIS B . n 
B 1 151 GLY 151 339 339 GLY GLY B . n 
B 1 152 ASP 152 340 340 ASP ASP B . n 
B 1 153 ILE 153 341 341 ILE ILE B . n 
B 1 154 LYS 154 342 342 LYS LYS B . n 
B 1 155 SER 155 343 343 SER SER B . n 
B 1 156 SER 156 344 344 SER SER B . n 
B 1 157 ASN 157 345 345 ASN ASN B . n 
B 1 158 VAL 158 346 346 VAL VAL B . n 
B 1 159 LEU 159 347 347 LEU LEU B . n 
B 1 160 LEU 160 348 348 LEU LEU B . n 
B 1 161 ASP 161 349 349 ASP ASP B . n 
B 1 162 GLU 162 350 350 GLU GLU B . n 
B 1 163 ARG 163 351 351 ARG ARG B . n 
B 1 164 LEU 164 352 352 LEU LEU B . n 
B 1 165 THR 165 353 353 THR THR B . n 
B 1 166 PRO 166 354 354 PRO PRO B . n 
B 1 167 LYS 167 355 355 LYS LYS B . n 
B 1 168 LEU 168 356 356 LEU LEU B . n 
B 1 169 GLY 169 357 357 GLY GLY B . n 
B 1 170 ASP 170 358 358 ASP ASP B . n 
B 1 171 PHE 171 359 359 PHE PHE B . n 
B 1 172 GLY 172 360 360 GLY GLY B . n 
B 1 173 LEU 173 361 361 LEU LEU B . n 
B 1 174 ALA 174 362 362 ALA ALA B . n 
B 1 175 ARG 175 363 363 ARG ARG B . n 
B 1 176 PHE 176 364 364 PHE PHE B . n 
B 1 177 SER 177 365 365 SER SER B . n 
B 1 178 ARG 178 366 366 ARG ARG B . n 
B 1 179 PHE 179 367 ?   ?   ?   B . n 
B 1 180 ALA 180 368 ?   ?   ?   B . n 
B 1 181 GLY 181 369 ?   ?   ?   B . n 
B 1 182 SER 182 370 ?   ?   ?   B . n 
B 1 183 SER 183 371 ?   ?   ?   B . n 
B 1 184 PRO 184 372 ?   ?   ?   B . n 
B 1 185 SER 185 373 ?   ?   ?   B . n 
B 1 186 GLN 186 374 ?   ?   ?   B . n 
B 1 187 SER 187 375 ?   ?   ?   B . n 
B 1 188 SER 188 376 ?   ?   ?   B . n 
B 1 189 MET 189 377 ?   ?   ?   B . n 
B 1 190 VAL 190 378 ?   ?   ?   B . n 
B 1 191 ALA 191 379 ?   ?   ?   B . n 
B 1 192 ARG 192 380 ?   ?   ?   B . n 
B 1 193 THR 193 381 ?   ?   ?   B . n 
B 1 194 GLN 194 382 ?   ?   ?   B . n 
B 1 195 THR 195 383 383 THR THR B . n 
B 1 196 VAL 196 384 384 VAL VAL B . n 
B 1 197 ARG 197 385 385 ARG ARG B . n 
B 1 198 GLY 198 386 386 GLY GLY B . n 
B 1 199 THR 199 387 387 THR THR B . n 
B 1 200 LEU 200 388 388 LEU LEU B . n 
B 1 201 ALA 201 389 389 ALA ALA B . n 
B 1 202 TYR 202 390 390 TYR TYR B . n 
B 1 203 LEU 203 391 391 LEU LEU B . n 
B 1 204 PRO 204 392 392 PRO PRO B . n 
B 1 205 GLU 205 393 393 GLU GLU B . n 
B 1 206 GLU 206 394 394 GLU GLU B . n 
B 1 207 TYR 207 395 395 TYR TYR B . n 
B 1 208 ILE 208 396 396 ILE ILE B . n 
B 1 209 LYS 209 397 397 LYS LYS B . n 
B 1 210 THR 210 398 398 THR THR B . n 
B 1 211 GLY 211 399 399 GLY GLY B . n 
B 1 212 ARG 212 400 400 ARG ARG B . n 
B 1 213 LEU 213 401 401 LEU LEU B . n 
B 1 214 ALA 214 402 402 ALA ALA B . n 
B 1 215 VAL 215 403 403 VAL VAL B . n 
B 1 216 ASP 216 404 404 ASP ASP B . n 
B 1 217 THR 217 405 405 THR THR B . n 
B 1 218 ASP 218 406 406 ASP ASP B . n 
B 1 219 THR 219 407 407 THR THR B . n 
B 1 220 PHE 220 408 408 PHE PHE B . n 
B 1 221 SER 221 409 409 SER SER B . n 
B 1 222 PHE 222 410 410 PHE PHE B . n 
B 1 223 GLY 223 411 411 GLY GLY B . n 
B 1 224 VAL 224 412 412 VAL VAL B . n 
B 1 225 VAL 225 413 413 VAL VAL B . n 
B 1 226 VAL 226 414 414 VAL VAL B . n 
B 1 227 LEU 227 415 415 LEU LEU B . n 
B 1 228 GLU 228 416 416 GLU GLU B . n 
B 1 229 THR 229 417 417 THR THR B . n 
B 1 230 LEU 230 418 418 LEU LEU B . n 
B 1 231 ALA 231 419 419 ALA ALA B . n 
B 1 232 GLY 232 420 420 GLY GLY B . n 
B 1 233 GLN 233 421 421 GLN GLN B . n 
B 1 234 ARG 234 422 422 ARG ARG B . n 
B 1 235 ALA 235 423 423 ALA ALA B . n 
B 1 236 VAL 236 424 424 VAL VAL B . n 
B 1 237 LYS 237 425 425 LYS LYS B . n 
B 1 238 THR 238 426 426 THR THR B . n 
B 1 239 HIS 239 427 427 HIS HIS B . n 
B 1 240 GLY 240 428 428 GLY GLY B . n 
B 1 241 ALA 241 429 429 ALA ALA B . n 
B 1 242 ARG 242 430 430 ARG ARG B . n 
B 1 243 THR 243 431 431 THR THR B . n 
B 1 244 LYS 244 432 432 LYS LYS B . n 
B 1 245 TYR 245 433 433 TYR TYR B . n 
B 1 246 LEU 246 434 434 LEU LEU B . n 
B 1 247 LYS 247 435 435 LYS LYS B . n 
B 1 248 ASP 248 436 436 ASP ASP B . n 
B 1 249 LEU 249 437 437 LEU LEU B . n 
B 1 250 VAL 250 438 438 VAL VAL B . n 
B 1 251 GLU 251 439 439 GLU GLU B . n 
B 1 252 GLU 252 440 440 GLU GLU B . n 
B 1 253 GLU 253 441 441 GLU GLU B . n 
B 1 254 ALA 254 442 442 ALA ALA B . n 
B 1 255 GLU 255 443 443 GLU GLU B . n 
B 1 256 GLU 256 444 444 GLU GLU B . n 
B 1 257 ALA 257 445 445 ALA ALA B . n 
B 1 258 GLY 258 446 446 GLY GLY B . n 
B 1 259 VAL 259 447 447 VAL VAL B . n 
B 1 260 ALA 260 448 448 ALA ALA B . n 
B 1 261 LEU 261 449 ?   ?   ?   B . n 
B 1 262 ARG 262 450 ?   ?   ?   B . n 
B 1 263 SER 263 451 ?   ?   ?   B . n 
B 1 264 THR 264 452 ?   ?   ?   B . n 
B 1 265 GLN 265 453 ?   ?   ?   B . n 
B 1 266 SER 266 454 ?   ?   ?   B . n 
B 1 267 THR 267 455 ?   ?   ?   B . n 
B 1 268 LEU 268 456 ?   ?   ?   B . n 
B 1 269 GLN 269 457 ?   ?   ?   B . n 
B 1 270 ALA 270 458 ?   ?   ?   B . n 
B 1 271 GLY 271 459 ?   ?   ?   B . n 
B 1 272 LEU 272 460 ?   ?   ?   B . n 
B 1 273 ALA 273 461 ?   ?   ?   B . n 
B 1 274 ALA 274 462 ?   ?   ?   B . n 
B 1 275 ASP 275 463 ?   ?   ?   B . n 
B 1 276 ALA 276 464 464 ALA ALA B . n 
B 1 277 TRP 277 465 465 TRP TRP B . n 
B 1 278 ALA 278 466 466 ALA ALA B . n 
B 1 279 ALA 279 467 467 ALA ALA B . n 
B 1 280 PRO 280 468 468 PRO PRO B . n 
B 1 281 ILE 281 469 469 ILE ILE B . n 
B 1 282 ALA 282 470 470 ALA ALA B . n 
B 1 283 MET 283 471 471 MET MET B . n 
B 1 284 GLN 284 472 472 GLN GLN B . n 
B 1 285 ILE 285 473 473 ILE ILE B . n 
B 1 286 TYR 286 474 474 TYR TYR B . n 
B 1 287 LYS 287 475 475 LYS LYS B . n 
B 1 288 LYS 288 476 476 LYS LYS B . n 
B 1 289 HIS 289 477 477 HIS HIS B . n 
B 1 290 LEU 290 478 478 LEU LEU B . n 
B 1 291 ASP 291 479 479 ASP ASP B . n 
B 1 292 PRO 292 480 480 PRO PRO B . n 
B 1 293 ARG 293 481 481 ARG ARG B . n 
B 1 294 PRO 294 482 482 PRO PRO B . n 
B 1 295 GLY 295 483 483 GLY GLY B . n 
B 1 296 PRO 296 484 484 PRO PRO B . n 
B 1 297 CYS 297 485 485 CYS CYS B . n 
B 1 298 PRO 298 486 486 PRO PRO B . n 
B 1 299 PRO 299 487 487 PRO PRO B . n 
B 1 300 GLU 300 488 488 GLU GLU B . n 
B 1 301 LEU 301 489 489 LEU LEU B . n 
B 1 302 GLY 302 490 490 GLY GLY B . n 
B 1 303 LEU 303 491 491 LEU LEU B . n 
B 1 304 GLY 304 492 492 GLY GLY B . n 
B 1 305 LEU 305 493 493 LEU LEU B . n 
B 1 306 GLY 306 494 494 GLY GLY B . n 
B 1 307 GLN 307 495 495 GLN GLN B . n 
B 1 308 LEU 308 496 496 LEU LEU B . n 
B 1 309 ALA 309 497 497 ALA ALA B . n 
B 1 310 CYS 310 498 498 CYS CYS B . n 
B 1 311 CYS 311 499 499 CYS CYS B . n 
B 1 312 CYS 312 500 500 CYS CYS B . n 
B 1 313 LEU 313 501 501 LEU LEU B . n 
B 1 314 HIS 314 502 502 HIS HIS B . n 
B 1 315 ARG 315 503 503 ARG ARG B . n 
B 1 316 ARG 316 504 504 ARG ARG B . n 
B 1 317 ALA 317 505 505 ALA ALA B . n 
B 1 318 LYS 318 506 506 LYS LYS B . n 
B 1 319 ARG 319 507 507 ARG ARG B . n 
B 1 320 ARG 320 508 508 ARG ARG B . n 
B 1 321 PRO 321 509 509 PRO PRO B . n 
B 1 322 PRO 322 510 510 PRO PRO B . n 
B 1 323 MET 323 511 511 MET MET B . n 
B 1 324 THR 324 512 512 THR THR B . n 
B 1 325 GLN 325 513 513 GLN GLN B . n 
B 1 326 VAL 326 514 514 VAL VAL B . n 
B 1 327 TYR 327 515 515 TYR TYR B . n 
B 1 328 GLU 328 516 516 GLU GLU B . n 
B 1 329 ARG 329 517 517 ARG ARG B . n 
B 1 330 LEU 330 518 518 LEU LEU B . n 
B 1 331 GLU 331 519 519 GLU GLU B . n 
B 1 332 LYS 332 520 520 LYS LYS B . n 
B 1 333 LEU 333 521 521 LEU LEU B . n 
B 1 334 GLN 334 522 522 GLN GLN B . n 
B 1 335 ALA 335 523 523 ALA ALA B . n 
B 1 336 VAL 336 524 524 VAL VAL B . n 
B 1 337 VAL 337 525 525 VAL VAL B . n 
B 1 338 ALA 338 526 526 ALA ALA B . n 
B 1 339 GLY 339 527 ?   ?   ?   B . n 
B 1 340 VAL 340 528 ?   ?   ?   B . n 
B 1 341 PRO 341 529 ?   ?   ?   B . n 
B 1 342 GLY 342 530 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 DL1 1  601 1   DL1 DRG A . 
D 2 DL1 1  601 2   DL1 DRG B . 
E 3 HOH 1  701 166 HOH HOH A . 
E 3 HOH 2  702 122 HOH HOH A . 
E 3 HOH 3  703 126 HOH HOH A . 
E 3 HOH 4  704 25  HOH HOH A . 
E 3 HOH 5  705 141 HOH HOH A . 
E 3 HOH 6  706 127 HOH HOH A . 
E 3 HOH 7  707 142 HOH HOH A . 
E 3 HOH 8  708 121 HOH HOH A . 
E 3 HOH 9  709 148 HOH HOH A . 
E 3 HOH 10 710 63  HOH HOH A . 
E 3 HOH 11 711 41  HOH HOH A . 
E 3 HOH 12 712 135 HOH HOH A . 
E 3 HOH 13 713 100 HOH HOH A . 
E 3 HOH 14 714 55  HOH HOH A . 
E 3 HOH 15 715 28  HOH HOH A . 
E 3 HOH 16 716 164 HOH HOH A . 
E 3 HOH 17 717 139 HOH HOH A . 
E 3 HOH 18 718 52  HOH HOH A . 
E 3 HOH 19 719 138 HOH HOH A . 
E 3 HOH 20 720 111 HOH HOH A . 
E 3 HOH 21 721 128 HOH HOH A . 
E 3 HOH 22 722 68  HOH HOH A . 
E 3 HOH 23 723 147 HOH HOH A . 
E 3 HOH 24 724 60  HOH HOH A . 
E 3 HOH 25 725 38  HOH HOH A . 
E 3 HOH 26 726 152 HOH HOH A . 
E 3 HOH 27 727 149 HOH HOH A . 
E 3 HOH 28 728 19  HOH HOH A . 
E 3 HOH 29 729 10  HOH HOH A . 
E 3 HOH 30 730 32  HOH HOH A . 
E 3 HOH 31 731 33  HOH HOH A . 
E 3 HOH 32 732 88  HOH HOH A . 
E 3 HOH 33 733 44  HOH HOH A . 
E 3 HOH 34 734 4   HOH HOH A . 
E 3 HOH 35 735 2   HOH HOH A . 
E 3 HOH 36 736 96  HOH HOH A . 
E 3 HOH 37 737 35  HOH HOH A . 
E 3 HOH 38 738 66  HOH HOH A . 
E 3 HOH 39 739 93  HOH HOH A . 
E 3 HOH 40 740 53  HOH HOH A . 
E 3 HOH 41 741 42  HOH HOH A . 
E 3 HOH 42 742 145 HOH HOH A . 
E 3 HOH 43 743 65  HOH HOH A . 
E 3 HOH 44 744 64  HOH HOH A . 
E 3 HOH 45 745 140 HOH HOH A . 
E 3 HOH 46 746 29  HOH HOH A . 
E 3 HOH 47 747 144 HOH HOH A . 
E 3 HOH 48 748 95  HOH HOH A . 
E 3 HOH 49 749 56  HOH HOH A . 
E 3 HOH 50 750 1   HOH HOH A . 
E 3 HOH 51 751 146 HOH HOH A . 
E 3 HOH 52 752 54  HOH HOH A . 
E 3 HOH 53 753 119 HOH HOH A . 
E 3 HOH 54 754 67  HOH HOH A . 
E 3 HOH 55 755 157 HOH HOH A . 
E 3 HOH 56 756 59  HOH HOH A . 
E 3 HOH 57 757 143 HOH HOH A . 
E 3 HOH 58 758 94  HOH HOH A . 
E 3 HOH 59 759 16  HOH HOH A . 
E 3 HOH 60 760 36  HOH HOH A . 
E 3 HOH 61 761 34  HOH HOH A . 
E 3 HOH 62 762 15  HOH HOH A . 
E 3 HOH 63 763 43  HOH HOH A . 
E 3 HOH 64 764 120 HOH HOH A . 
E 3 HOH 65 765 129 HOH HOH A . 
E 3 HOH 66 766 151 HOH HOH A . 
E 3 HOH 67 767 150 HOH HOH A . 
E 3 HOH 68 768 69  HOH HOH A . 
E 3 HOH 69 769 97  HOH HOH A . 
E 3 HOH 70 770 87  HOH HOH A . 
E 3 HOH 71 771 9   HOH HOH A . 
E 3 HOH 72 772 98  HOH HOH A . 
E 3 HOH 73 773 70  HOH HOH A . 
E 3 HOH 74 774 136 HOH HOH A . 
E 3 HOH 75 775 17  HOH HOH A . 
E 3 HOH 76 776 89  HOH HOH A . 
E 3 HOH 77 777 72  HOH HOH A . 
E 3 HOH 78 778 99  HOH HOH A . 
E 3 HOH 79 779 40  HOH HOH A . 
E 3 HOH 80 780 90  HOH HOH A . 
E 3 HOH 81 781 162 HOH HOH A . 
E 3 HOH 82 782 71  HOH HOH A . 
E 3 HOH 83 783 50  HOH HOH A . 
F 3 HOH 1  701 159 HOH HOH B . 
F 3 HOH 2  702 20  HOH HOH B . 
F 3 HOH 3  703 109 HOH HOH B . 
F 3 HOH 4  704 46  HOH HOH B . 
F 3 HOH 5  705 82  HOH HOH B . 
F 3 HOH 6  706 62  HOH HOH B . 
F 3 HOH 7  707 3   HOH HOH B . 
F 3 HOH 8  708 113 HOH HOH B . 
F 3 HOH 9  709 158 HOH HOH B . 
F 3 HOH 10 710 110 HOH HOH B . 
F 3 HOH 11 711 74  HOH HOH B . 
F 3 HOH 12 712 30  HOH HOH B . 
F 3 HOH 13 713 77  HOH HOH B . 
F 3 HOH 14 714 22  HOH HOH B . 
F 3 HOH 15 715 154 HOH HOH B . 
F 3 HOH 16 716 58  HOH HOH B . 
F 3 HOH 17 717 123 HOH HOH B . 
F 3 HOH 18 718 105 HOH HOH B . 
F 3 HOH 19 719 26  HOH HOH B . 
F 3 HOH 20 720 27  HOH HOH B . 
F 3 HOH 21 721 160 HOH HOH B . 
F 3 HOH 22 722 11  HOH HOH B . 
F 3 HOH 23 723 31  HOH HOH B . 
F 3 HOH 24 724 92  HOH HOH B . 
F 3 HOH 25 725 5   HOH HOH B . 
F 3 HOH 26 726 6   HOH HOH B . 
F 3 HOH 27 727 80  HOH HOH B . 
F 3 HOH 28 728 23  HOH HOH B . 
F 3 HOH 29 729 78  HOH HOH B . 
F 3 HOH 30 730 14  HOH HOH B . 
F 3 HOH 31 731 163 HOH HOH B . 
F 3 HOH 32 732 153 HOH HOH B . 
F 3 HOH 33 733 86  HOH HOH B . 
F 3 HOH 34 734 114 HOH HOH B . 
F 3 HOH 35 735 103 HOH HOH B . 
F 3 HOH 36 736 101 HOH HOH B . 
F 3 HOH 37 737 8   HOH HOH B . 
F 3 HOH 38 738 13  HOH HOH B . 
F 3 HOH 39 739 81  HOH HOH B . 
F 3 HOH 40 740 24  HOH HOH B . 
F 3 HOH 41 741 75  HOH HOH B . 
F 3 HOH 42 742 48  HOH HOH B . 
F 3 HOH 43 743 51  HOH HOH B . 
F 3 HOH 44 744 79  HOH HOH B . 
F 3 HOH 45 745 84  HOH HOH B . 
F 3 HOH 46 746 107 HOH HOH B . 
F 3 HOH 47 747 131 HOH HOH B . 
F 3 HOH 48 748 130 HOH HOH B . 
F 3 HOH 49 749 12  HOH HOH B . 
F 3 HOH 50 750 112 HOH HOH B . 
F 3 HOH 51 751 18  HOH HOH B . 
F 3 HOH 52 752 83  HOH HOH B . 
F 3 HOH 53 753 133 HOH HOH B . 
F 3 HOH 54 754 124 HOH HOH B . 
F 3 HOH 55 755 115 HOH HOH B . 
F 3 HOH 56 756 117 HOH HOH B . 
F 3 HOH 57 757 102 HOH HOH B . 
F 3 HOH 58 758 47  HOH HOH B . 
F 3 HOH 59 759 76  HOH HOH B . 
F 3 HOH 60 760 118 HOH HOH B . 
F 3 HOH 61 761 104 HOH HOH B . 
F 3 HOH 62 762 61  HOH HOH B . 
F 3 HOH 63 763 155 HOH HOH B . 
F 3 HOH 64 764 165 HOH HOH B . 
F 3 HOH 65 765 57  HOH HOH B . 
F 3 HOH 66 766 156 HOH HOH B . 
F 3 HOH 67 767 106 HOH HOH B . 
F 3 HOH 68 768 116 HOH HOH B . 
F 3 HOH 69 769 7   HOH HOH B . 
F 3 HOH 70 770 125 HOH HOH B . 
F 3 HOH 71 771 108 HOH HOH B . 
F 3 HOH 72 772 134 HOH HOH B . 
F 3 HOH 73 773 91  HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E 
2 1 B,D,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-12-06 
2 'Structure model' 1 1 2017-12-20 
3 'Structure model' 1 2 2018-01-03 
4 'Structure model' 1 3 2019-12-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' 'Database references'        
3 4 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation           
2 3 'Structure model' citation           
3 4 'Structure model' pdbx_audit_support 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_abbrev'                 
2 2 'Structure model' '_citation.pdbx_database_id_PubMed'        
3 2 'Structure model' '_citation.title'                          
4 3 'Structure model' '_citation.journal_volume'                 
5 3 'Structure model' '_citation.page_first'                     
6 3 'Structure model' '_citation.page_last'                      
7 4 'Structure model' '_pdbx_audit_support.funding_organization' 
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         -30.1412 
_pdbx_refine_tls.origin_y         8.9839 
_pdbx_refine_tls.origin_z         17.1108 
_pdbx_refine_tls.T[1][1]          0.2213 
_pdbx_refine_tls.T[2][2]          0.2607 
_pdbx_refine_tls.T[3][3]          0.1936 
_pdbx_refine_tls.T[1][2]          0.0626 
_pdbx_refine_tls.T[1][3]          -0.0292 
_pdbx_refine_tls.T[2][3]          -0.0320 
_pdbx_refine_tls.L[1][1]          1.7116 
_pdbx_refine_tls.L[2][2]          1.2915 
_pdbx_refine_tls.L[3][3]          1.1195 
_pdbx_refine_tls.L[1][2]          0.6386 
_pdbx_refine_tls.L[1][3]          0.0171 
_pdbx_refine_tls.L[2][3]          -0.0576 
_pdbx_refine_tls.S[1][1]          -0.0119 
_pdbx_refine_tls.S[1][2]          0.1399 
_pdbx_refine_tls.S[1][3]          -0.0343 
_pdbx_refine_tls.S[2][1]          -0.0500 
_pdbx_refine_tls.S[2][2]          0.0481 
_pdbx_refine_tls.S[2][3]          0.0439 
_pdbx_refine_tls.S[3][1]          -0.0250 
_pdbx_refine_tls.S[3][2]          -0.0568 
_pdbx_refine_tls.S[3][3]          -0.0214 
# 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    ? 
_pdbx_refine_tls_group.beg_auth_seq_id     ? 
_pdbx_refine_tls_group.beg_label_asym_id   ? 
_pdbx_refine_tls_group.beg_label_seq_id    ? 
_pdbx_refine_tls_group.end_auth_asym_id    ? 
_pdbx_refine_tls_group.end_auth_seq_id     ? 
_pdbx_refine_tls_group.end_label_asym_id   ? 
_pdbx_refine_tls_group.end_label_seq_id    ? 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.selection_details   all 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX  ? ? ? 1.9_1692 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS     ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHENIX  ? ? ? .        4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 THR A 304 ? ? 64.98   -6.28   
2 1 ALA A 306 ? ? 53.54   -116.80 
3 1 LYS A 476 ? ? -121.69 -59.51  
4 1 VAL A 525 ? ? -108.56 -63.13  
5 1 HIS B 301 ? ? -97.79  -63.06  
6 1 THR B 398 ? ? -126.00 -63.74  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 189 ? A GLY 1   
2  1 Y 1 A ALA 190 ? A ALA 2   
3  1 Y 1 A MET 191 ? A MET 3   
4  1 Y 1 A GLY 192 ? A GLY 4   
5  1 Y 1 A GLU 243 ? A GLU 55  
6  1 Y 1 A ASN 244 ? A ASN 56  
7  1 Y 1 A ALA 245 ? A ALA 57  
8  1 Y 1 A ASP 246 ? A ASP 58  
9  1 Y 1 A LEU 247 ? A LEU 59  
10 1 Y 1 A PHE 367 ? A PHE 179 
11 1 Y 1 A ALA 368 ? A ALA 180 
12 1 Y 1 A GLY 369 ? A GLY 181 
13 1 Y 1 A SER 370 ? A SER 182 
14 1 Y 1 A SER 371 ? A SER 183 
15 1 Y 1 A PRO 372 ? A PRO 184 
16 1 Y 1 A SER 373 ? A SER 185 
17 1 Y 1 A GLN 374 ? A GLN 186 
18 1 Y 1 A SER 375 ? A SER 187 
19 1 Y 1 A SER 376 ? A SER 188 
20 1 Y 1 A MET 377 ? A MET 189 
21 1 Y 1 A VAL 378 ? A VAL 190 
22 1 Y 1 A ALA 379 ? A ALA 191 
23 1 Y 1 A ARG 380 ? A ARG 192 
24 1 Y 1 A THR 381 ? A THR 193 
25 1 Y 1 A GLN 382 ? A GLN 194 
26 1 Y 1 A LEU 449 ? A LEU 261 
27 1 Y 1 A ARG 450 ? A ARG 262 
28 1 Y 1 A SER 451 ? A SER 263 
29 1 Y 1 A THR 452 ? A THR 264 
30 1 Y 1 A GLN 453 ? A GLN 265 
31 1 Y 1 A SER 454 ? A SER 266 
32 1 Y 1 A THR 455 ? A THR 267 
33 1 Y 1 A LEU 456 ? A LEU 268 
34 1 Y 1 A GLN 457 ? A GLN 269 
35 1 Y 1 A ALA 458 ? A ALA 270 
36 1 Y 1 A GLY 459 ? A GLY 271 
37 1 Y 1 A LEU 460 ? A LEU 272 
38 1 Y 1 A GLY 527 ? A GLY 339 
39 1 Y 1 A VAL 528 ? A VAL 340 
40 1 Y 1 A PRO 529 ? A PRO 341 
41 1 Y 1 A GLY 530 ? A GLY 342 
42 1 Y 1 B GLY 189 ? B GLY 1   
43 1 Y 1 B ALA 190 ? B ALA 2   
44 1 Y 1 B MET 191 ? B MET 3   
45 1 Y 1 B GLY 192 ? B GLY 4   
46 1 Y 1 B SER 193 ? B SER 5   
47 1 Y 1 B ASN 244 ? B ASN 56  
48 1 Y 1 B ALA 245 ? B ALA 57  
49 1 Y 1 B ASP 246 ? B ASP 58  
50 1 Y 1 B LEU 247 ? B LEU 59  
51 1 Y 1 B GLU 248 ? B GLU 60  
52 1 Y 1 B THR 304 ? B THR 116 
53 1 Y 1 B GLN 305 ? B GLN 117 
54 1 Y 1 B ALA 306 ? B ALA 118 
55 1 Y 1 B PHE 367 ? B PHE 179 
56 1 Y 1 B ALA 368 ? B ALA 180 
57 1 Y 1 B GLY 369 ? B GLY 181 
58 1 Y 1 B SER 370 ? B SER 182 
59 1 Y 1 B SER 371 ? B SER 183 
60 1 Y 1 B PRO 372 ? B PRO 184 
61 1 Y 1 B SER 373 ? B SER 185 
62 1 Y 1 B GLN 374 ? B GLN 186 
63 1 Y 1 B SER 375 ? B SER 187 
64 1 Y 1 B SER 376 ? B SER 188 
65 1 Y 1 B MET 377 ? B MET 189 
66 1 Y 1 B VAL 378 ? B VAL 190 
67 1 Y 1 B ALA 379 ? B ALA 191 
68 1 Y 1 B ARG 380 ? B ARG 192 
69 1 Y 1 B THR 381 ? B THR 193 
70 1 Y 1 B GLN 382 ? B GLN 194 
71 1 Y 1 B LEU 449 ? B LEU 261 
72 1 Y 1 B ARG 450 ? B ARG 262 
73 1 Y 1 B SER 451 ? B SER 263 
74 1 Y 1 B THR 452 ? B THR 264 
75 1 Y 1 B GLN 453 ? B GLN 265 
76 1 Y 1 B SER 454 ? B SER 266 
77 1 Y 1 B THR 455 ? B THR 267 
78 1 Y 1 B LEU 456 ? B LEU 268 
79 1 Y 1 B GLN 457 ? B GLN 269 
80 1 Y 1 B ALA 458 ? B ALA 270 
81 1 Y 1 B GLY 459 ? B GLY 271 
82 1 Y 1 B LEU 460 ? B LEU 272 
83 1 Y 1 B ALA 461 ? B ALA 273 
84 1 Y 1 B ALA 462 ? B ALA 274 
85 1 Y 1 B ASP 463 ? B ASP 275 
86 1 Y 1 B GLY 527 ? B GLY 339 
87 1 Y 1 B VAL 528 ? B VAL 340 
88 1 Y 1 B PRO 529 ? B PRO 341 
89 1 Y 1 B GLY 530 ? B GLY 342 
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           AI050872 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'N-[2-methoxy-4-(morpholin-4-yl)phenyl]-6-(1H-pyrazol-5-yl)pyridine-2-carboxamide' DL1 
3 water                                                                              HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#