data_6BGH
# 
_entry.id   6BGH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.291 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6BGH         
WWPDB D_1000230643 
BMRB  30368        
# 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.details        'Solution NMR structure of Brd3 ET domain bound to Brg1 peptide' 
_pdbx_database_related.db_id          30368 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.entry_id                        6BGH 
_pdbx_database_status.recvd_initial_deposition_date   2017-10-28 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Szyszka, T.N.' 1 ? 
'Wai, D.C.'     2 ? 
'Mackay, J.P.'  3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'To Be Published' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            0353 
_citation.journal_id_ISSN           ? 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'Solution NMR structure of Brd3 ET domain bound to Brg1 peptide' 
_citation.year                      ? 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Szyszka, T.N.' 1 
primary 'Wai, D.C.'     2 
primary 'Mackay, J.P.'  3 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Bromodomain-containing protein 3' 10179.387 1 ? ? ? ? 
2 polymer man Brd3_ET                            1417.829  1 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RING3-like protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;ASASYDSEEEEEGLPMSYDEKRQLSLDINRLPGEKLGRVVHIIQSREPSLRDSNPDEIEIDFETLKPTTLRELERYVKSC
LQKKQRK
;
;ASASYDSEEEEEGLPMSYDEKRQLSLDINRLPGEKLGRVVHIIQSREPSLRDSNPDEIEIDFETLKPTTLRELERYVKSC
LQKKQRK
;
A ? 
2 'polypeptide(L)' no no RSVKVKIKLGRK                                                                               RSVKVKIKLGRK B 
? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ALA n 
1 2  SER n 
1 3  ALA n 
1 4  SER n 
1 5  TYR n 
1 6  ASP n 
1 7  SER n 
1 8  GLU n 
1 9  GLU n 
1 10 GLU n 
1 11 GLU n 
1 12 GLU n 
1 13 GLY n 
1 14 LEU n 
1 15 PRO n 
1 16 MET n 
1 17 SER n 
1 18 TYR n 
1 19 ASP n 
1 20 GLU n 
1 21 LYS n 
1 22 ARG n 
1 23 GLN n 
1 24 LEU n 
1 25 SER n 
1 26 LEU n 
1 27 ASP n 
1 28 ILE n 
1 29 ASN n 
1 30 ARG n 
1 31 LEU n 
1 32 PRO n 
1 33 GLY n 
1 34 GLU n 
1 35 LYS n 
1 36 LEU n 
1 37 GLY n 
1 38 ARG n 
1 39 VAL n 
1 40 VAL n 
1 41 HIS n 
1 42 ILE n 
1 43 ILE n 
1 44 GLN n 
1 45 SER n 
1 46 ARG n 
1 47 GLU n 
1 48 PRO n 
1 49 SER n 
1 50 LEU n 
1 51 ARG n 
1 52 ASP n 
1 53 SER n 
1 54 ASN n 
1 55 PRO n 
1 56 ASP n 
1 57 GLU n 
1 58 ILE n 
1 59 GLU n 
1 60 ILE n 
1 61 ASP n 
1 62 PHE n 
1 63 GLU n 
1 64 THR n 
1 65 LEU n 
1 66 LYS n 
1 67 PRO n 
1 68 THR n 
1 69 THR n 
1 70 LEU n 
1 71 ARG n 
1 72 GLU n 
1 73 LEU n 
1 74 GLU n 
1 75 ARG n 
1 76 TYR n 
1 77 VAL n 
1 78 LYS n 
1 79 SER n 
1 80 CYS n 
1 81 LEU n 
1 82 GLN n 
1 83 LYS n 
1 84 LYS n 
1 85 GLN n 
1 86 ARG n 
1 87 LYS n 
2 1  ARG n 
2 2  SER n 
2 3  VAL n 
2 4  LYS n 
2 5  VAL n 
2 6  LYS n 
2 7  ILE n 
2 8  LYS n 
2 9  LEU n 
2 10 GLY n 
2 11 ARG n 
2 12 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 87 Human ? 'BRD3, KIAA0043, RING3L' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 12 ?     ? ?                        ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP BRD3_HUMAN Q15059 ? 1 
;ASASYDSEEEEEGLPMSYDEKRQLSLDINRLPGEKLGRVVHIIQSREPSLRDSNPDEIEIDFETLKPTTLRELERYVKSC
LQKKQRK
;
557 
2 PDB 6BGH       6BGH   ? 2 ?                                                                                          1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6BGH A 1 ? 87 ? Q15059 557  ? 643  ? 557  643  
2 2 6BGH B 1 ? 12 ? 6BGH   1591 ? 1602 ? 1591 1602 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.spectrometer_id 
_pdbx_nmr_exptl.sample_state 
1  3 3 '2D 1H-13C HSQC'                           2 isotropic 
2  3 3 '3D 1H-13C NOESY'                          2 isotropic 
3  2 2 '3D 1H-15N NOESY'                          2 isotropic 
4  3 3 '3D 13C/15N (F2/F1) Filtered, 1H-1H NOESY' 2 isotropic 
5  3 3 '2D 13C/15N (F2/F1) Filtered, 1H-1H NOESY' 1 isotropic 
6  3 3 '2D 13C/15N (F2/F1) Filtered, 1H-1H TOCSY' 1 isotropic 
7  3 3 '3D HCCH-TOCSY'                            2 isotropic 
8  3 3 '3D HCCH-COSY'                             2 isotropic 
9  1 1 '2D 1H-1H TOCSY'                           2 isotropic 
10 1 1 '2D 1H-1H NOESY'                           1 isotropic 
11 3 3 '3D HNCO'                                  1 isotropic 
12 2 2 '2D 1H-15N HSQC'                           1 isotropic 
13 3 3 '3D HN(CA)CO'                              1 isotropic 
14 3 3 '3D H(CC)(CO)HN'                           1 isotropic 
15 3 3 '3D HNCA'                                  1 isotropic 
16 3 3 '3D CBCA(CO)NH'                            1 isotropic 
17 3 3 '3D HNCACB'                                1 isotropic 
# 
loop_
_pdbx_nmr_exptl_sample_conditions.conditions_id 
_pdbx_nmr_exptl_sample_conditions.temperature 
_pdbx_nmr_exptl_sample_conditions.pressure_units 
_pdbx_nmr_exptl_sample_conditions.pressure 
_pdbx_nmr_exptl_sample_conditions.pH 
_pdbx_nmr_exptl_sample_conditions.ionic_strength 
_pdbx_nmr_exptl_sample_conditions.details 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_err 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units 
_pdbx_nmr_exptl_sample_conditions.label 
_pdbx_nmr_exptl_sample_conditions.pH_err 
_pdbx_nmr_exptl_sample_conditions.pH_units 
_pdbx_nmr_exptl_sample_conditions.pressure_err 
_pdbx_nmr_exptl_sample_conditions.temperature_err 
_pdbx_nmr_exptl_sample_conditions.temperature_units 
1 298 atm 1 7 '50 NaCl' ? ? mM Unlabelled     ? pH ? ? K 
2 298 atm 1 7 '50 NaCl' ? ? mM 15N_Sample     ? pH ? ? K 
3 298 atm 1 7 '50 NaCl' ? ? mM 13C_15N_Sample ? pH ? ? K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
_pdbx_nmr_sample_details.label 
_pdbx_nmr_sample_details.type 
_pdbx_nmr_sample_details.details 
1 '300 uM Brd3_ET, 600 uM Brg1, 0.02 % Roche Complete Protease Inhibitor, 166 uM DSS, 90% H2O/10% D2O'                
'90% H2O/10% D2O' Unlabelled     solution ? 
2 '300 uM [U-15N] Brd3_ET, 600 uM Brg1, 0.02 % Roche Complete Protease Inhibitor, 166 uM DSS, 90% H2O/10% D2O'        
'90% H2O/10% D2O' 15N_Sample     solution ? 
3 '300 uM [U-13C; U-15N] Brd3_ET, 600 uM Brg1, 0.02 % Roche Complete Protease Inhibitor, 166 uM DSS, 90% H2O/10% D2O' 
'90% H2O/10% D2O' 15N_13C_Sample solution ? 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.details 
1 AvanceIII ? Bruker 600 ? 
2 AvanceIII ? Bruker 800 ? 
# 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.entry_id           6BGH 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                             6BGH 
_pdbx_nmr_ensemble.conformers_calculated_total_number   1000 
_pdbx_nmr_ensemble.conformers_submitted_total_number    20 
_pdbx_nmr_ensemble.conformer_selection_criteria         'structures with the lowest energy' 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             6BGH 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
_pdbx_nmr_software.name             CNS 
_pdbx_nmr_software.version          ? 
_pdbx_nmr_software.classification   refinement 
_pdbx_nmr_software.authors          'Brunger A. T. et.al.' 
_pdbx_nmr_software.ordinal          1 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6BGH 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                     6BGH 
_struct.title                        'Solution NMR structure of Brd3 ET domain bound to Brg1 peptide' 
_struct.pdbx_descriptor              'Bromodomain-containing protein 3, Brd3_ET' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6BGH 
_struct_keywords.text            'Transcription Bromodomain BET protein, TRANSCRIPTION' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 ALA A 1  ? ASP A 6  ? ALA A 557 ASP A 562 1 ? 6  
HELX_P HELX_P2 AA2 SER A 17 ? LEU A 31 ? SER A 573 LEU A 587 1 ? 15 
HELX_P HELX_P3 AA3 PRO A 32 ? GLN A 44 ? PRO A 588 GLN A 600 1 ? 13 
HELX_P HELX_P4 AA4 LYS A 66 ? LYS A 83 ? LYS A 622 LYS A 639 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_atom_sites.entry_id                    6BGH 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . ALA A 1 1  ? 29.584  -2.862  0.443   1.00 0.00 ?  557  ALA A N    1  
ATOM 2     C CA   . ALA A 1 1  ? 28.886  -3.316  -0.756  1.00 0.00 ?  557  ALA A CA   1  
ATOM 3     C C    . ALA A 1 1  ? 27.586  -2.567  -0.919  1.00 0.00 ?  557  ALA A C    1  
ATOM 4     O O    . ALA A 1 1  ? 26.941  -2.641  -1.956  1.00 0.00 ?  557  ALA A O    1  
ATOM 5     C CB   . ALA A 1 1  ? 28.624  -4.809  -0.693  1.00 0.00 ?  557  ALA A CB   1  
ATOM 6     H H1   . ALA A 1 1  ? 30.242  -2.139  0.327   1.00 0.00 ?  557  ALA A H1   1  
ATOM 7     H HA   . ALA A 1 1  ? 29.515  -3.112  -1.610  1.00 0.00 ?  557  ALA A HA   1  
ATOM 8     H HB1  . ALA A 1 1  ? 29.564  -5.332  -0.605  1.00 0.00 ?  557  ALA A HB1  1  
ATOM 9     H HB2  . ALA A 1 1  ? 28.116  -5.128  -1.591  1.00 0.00 ?  557  ALA A HB2  1  
ATOM 10    H HB3  . ALA A 1 1  ? 28.011  -5.027  0.168   1.00 0.00 ?  557  ALA A HB3  1  
ATOM 11    N N    . SER A 1 2  ? 27.230  -1.820  0.108   1.00 0.00 ?  558  SER A N    1  
ATOM 12    C CA   . SER A 1 2  ? 25.995  -1.052  0.147   1.00 0.00 ?  558  SER A CA   1  
ATOM 13    C C    . SER A 1 2  ? 25.899  -0.067  -1.023  1.00 0.00 ?  558  SER A C    1  
ATOM 14    O O    . SER A 1 2  ? 24.865  0.025   -1.683  1.00 0.00 ?  558  SER A O    1  
ATOM 15    C CB   . SER A 1 2  ? 25.897  -0.335  1.492   1.00 0.00 ?  558  SER A CB   1  
ATOM 16    O OG   . SER A 1 2  ? 27.142  0.292   1.808   1.00 0.00 ?  558  SER A OG   1  
ATOM 17    H H    . SER A 1 2  ? 27.835  -1.779  0.881   1.00 0.00 ?  558  SER A H    1  
ATOM 18    H HA   . SER A 1 2  ? 25.176  -1.752  0.074   1.00 0.00 ?  558  SER A HA   1  
ATOM 19    H HB2  . SER A 1 2  ? 25.126  0.419   1.439   1.00 0.00 ?  558  SER A HB2  1  
ATOM 20    H HB3  . SER A 1 2  ? 25.658  -1.045  2.269   1.00 0.00 ?  558  SER A HB3  1  
ATOM 21    H HG   . SER A 1 2  ? 26.994  1.248   1.855   1.00 0.00 ?  558  SER A HG   1  
ATOM 22    N N    . ALA A 1 3  ? 27.009  0.607   -1.309  1.00 0.00 ?  559  ALA A N    1  
ATOM 23    C CA   . ALA A 1 3  ? 27.078  1.598   -2.384  1.00 0.00 ?  559  ALA A CA   1  
ATOM 24    C C    . ALA A 1 3  ? 26.886  0.957   -3.756  1.00 0.00 ?  559  ALA A C    1  
ATOM 25    O O    . ALA A 1 3  ? 26.396  1.599   -4.687  1.00 0.00 ?  559  ALA A O    1  
ATOM 26    C CB   . ALA A 1 3  ? 28.404  2.342   -2.329  1.00 0.00 ?  559  ALA A CB   1  
ATOM 27    H H    . ALA A 1 3  ? 27.803  0.438   -0.760  1.00 0.00 ?  559  ALA A H    1  
ATOM 28    H HA   . ALA A 1 3  ? 26.283  2.313   -2.230  1.00 0.00 ?  559  ALA A HA   1  
ATOM 29    H HB1  . ALA A 1 3  ? 29.210  1.647   -2.511  1.00 0.00 ?  559  ALA A HB1  1  
ATOM 30    H HB2  . ALA A 1 3  ? 28.527  2.790   -1.354  1.00 0.00 ?  559  ALA A HB2  1  
ATOM 31    H HB3  . ALA A 1 3  ? 28.413  3.112   -3.086  1.00 0.00 ?  559  ALA A HB3  1  
ATOM 32    N N    . SER A 1 4  ? 27.249  -0.301  -3.861  1.00 0.00 ?  560  SER A N    1  
ATOM 33    C CA   . SER A 1 4  ? 27.154  -1.041  -5.101  1.00 0.00 ?  560  SER A CA   1  
ATOM 34    C C    . SER A 1 4  ? 25.846  -1.832  -5.155  1.00 0.00 ?  560  SER A C    1  
ATOM 35    O O    . SER A 1 4  ? 25.534  -2.486  -6.153  1.00 0.00 ?  560  SER A O    1  
ATOM 36    C CB   . SER A 1 4  ? 28.327  -1.998  -5.175  1.00 0.00 ?  560  SER A CB   1  
ATOM 37    O OG   . SER A 1 4  ? 29.554  -1.309  -4.962  1.00 0.00 ?  560  SER A OG   1  
ATOM 38    H H    . SER A 1 4  ? 27.603  -0.773  -3.079  1.00 0.00 ?  560  SER A H    1  
ATOM 39    H HA   . SER A 1 4  ? 27.211  -0.353  -5.931  1.00 0.00 ?  560  SER A HA   1  
ATOM 40    H HB2  . SER A 1 4  ? 28.214  -2.748  -4.407  1.00 0.00 ?  560  SER A HB2  1  
ATOM 41    H HB3  . SER A 1 4  ? 28.351  -2.474  -6.144  1.00 0.00 ?  560  SER A HB3  1  
ATOM 42    H HG   . SER A 1 4  ? 29.823  -0.944  -5.813  1.00 0.00 ?  560  SER A HG   1  
ATOM 43    N N    . TYR A 1 5  ? 25.104  -1.794  -4.073  1.00 0.00 ?  561  TYR A N    1  
ATOM 44    C CA   . TYR A 1 5  ? 23.866  -2.519  -3.990  1.00 0.00 ?  561  TYR A CA   1  
ATOM 45    C C    . TYR A 1 5  ? 22.747  -1.621  -4.458  1.00 0.00 ?  561  TYR A C    1  
ATOM 46    O O    . TYR A 1 5  ? 21.897  -2.028  -5.267  1.00 0.00 ?  561  TYR A O    1  
ATOM 47    C CB   . TYR A 1 5  ? 23.625  -3.000  -2.554  1.00 0.00 ?  561  TYR A CB   1  
ATOM 48    C CG   . TYR A 1 5  ? 22.481  -3.970  -2.410  1.00 0.00 ?  561  TYR A CG   1  
ATOM 49    C CD1  . TYR A 1 5  ? 21.283  -3.599  -1.816  1.00 0.00 ?  561  TYR A CD1  1  
ATOM 50    C CD2  . TYR A 1 5  ? 22.606  -5.267  -2.872  1.00 0.00 ?  561  TYR A CD2  1  
ATOM 51    C CE1  . TYR A 1 5  ? 20.243  -4.504  -1.689  1.00 0.00 ?  561  TYR A CE1  1  
ATOM 52    C CE2  . TYR A 1 5  ? 21.578  -6.169  -2.751  1.00 0.00 ?  561  TYR A CE2  1  
ATOM 53    C CZ   . TYR A 1 5  ? 20.401  -5.788  -2.161  1.00 0.00 ?  561  TYR A CZ   1  
ATOM 54    O OH   . TYR A 1 5  ? 19.379  -6.700  -2.039  1.00 0.00 ?  561  TYR A OH   1  
ATOM 55    H H    . TYR A 1 5  ? 25.404  -1.256  -3.310  1.00 0.00 ?  561  TYR A H    1  
ATOM 56    H HA   . TYR A 1 5  ? 23.929  -3.373  -4.647  1.00 0.00 ?  561  TYR A HA   1  
ATOM 57    H HB2  . TYR A 1 5  ? 24.518  -3.488  -2.190  1.00 0.00 ?  561  TYR A HB2  1  
ATOM 58    H HB3  . TYR A 1 5  ? 23.418  -2.140  -1.933  1.00 0.00 ?  561  TYR A HB3  1  
ATOM 59    H HD1  . TYR A 1 5  ? 21.169  -2.590  -1.449  1.00 0.00 ?  561  TYR A HD1  1  
ATOM 60    H HD2  . TYR A 1 5  ? 23.533  -5.570  -3.337  1.00 0.00 ?  561  TYR A HD2  1  
ATOM 61    H HE1  . TYR A 1 5  ? 19.315  -4.207  -1.224  1.00 0.00 ?  561  TYR A HE1  1  
ATOM 62    H HE2  . TYR A 1 5  ? 21.697  -7.175  -3.122  1.00 0.00 ?  561  TYR A HE2  1  
ATOM 63    H HH   . TYR A 1 5  ? 19.757  -7.520  -1.701  1.00 0.00 ?  561  TYR A HH   1  
ATOM 64    N N    . ASP A 1 6  ? 22.756  -0.399  -3.947  1.00 0.00 ?  562  ASP A N    1  
ATOM 65    C CA   . ASP A 1 6  ? 21.809  0.629   -4.332  1.00 0.00 ?  562  ASP A CA   1  
ATOM 66    C C    . ASP A 1 6  ? 22.210  1.896   -3.590  1.00 0.00 ?  562  ASP A C    1  
ATOM 67    O O    . ASP A 1 6  ? 23.317  1.983   -3.038  1.00 0.00 ?  562  ASP A O    1  
ATOM 68    C CB   . ASP A 1 6  ? 20.356  0.244   -3.945  1.00 0.00 ?  562  ASP A CB   1  
ATOM 69    C CG   . ASP A 1 6  ? 19.305  0.900   -4.841  1.00 0.00 ?  562  ASP A CG   1  
ATOM 70    O OD1  . ASP A 1 6  ? 18.588  0.157   -5.563  1.00 0.00 ?  562  ASP A OD1  1  
ATOM 71    O OD2  . ASP A 1 6  ? 19.187  2.150   -4.857  1.00 0.00 -1 562  ASP A OD2  1  
ATOM 72    H H    . ASP A 1 6  ? 23.431  -0.146  -3.277  1.00 0.00 ?  562  ASP A H    1  
ATOM 73    H HA   . ASP A 1 6  ? 21.885  0.781   -5.397  1.00 0.00 ?  562  ASP A HA   1  
ATOM 74    H HB2  . ASP A 1 6  ? 20.244  -0.828  -4.012  1.00 0.00 ?  562  ASP A HB2  1  
ATOM 75    H HB3  . ASP A 1 6  ? 20.174  0.550   -2.925  1.00 0.00 ?  562  ASP A HB3  1  
ATOM 76    N N    . SER A 1 7  ? 21.365  2.859   -3.586  1.00 0.00 ?  563  SER A N    1  
ATOM 77    C CA   . SER A 1 7  ? 21.578  4.081   -2.873  1.00 0.00 ?  563  SER A CA   1  
ATOM 78    C C    . SER A 1 7  ? 20.247  4.599   -2.336  1.00 0.00 ?  563  SER A C    1  
ATOM 79    O O    . SER A 1 7  ? 20.175  5.044   -1.198  1.00 0.00 ?  563  SER A O    1  
ATOM 80    C CB   . SER A 1 7  ? 22.295  5.106   -3.765  1.00 0.00 ?  563  SER A CB   1  
ATOM 81    O OG   . SER A 1 7  ? 23.567  4.584   -4.176  1.00 0.00 ?  563  SER A OG   1  
ATOM 82    H H    . SER A 1 7  ? 20.527  2.723   -4.090  1.00 0.00 ?  563  SER A H    1  
ATOM 83    H HA   . SER A 1 7  ? 22.210  3.841   -2.031  1.00 0.00 ?  563  SER A HA   1  
ATOM 84    H HB2  . SER A 1 7  ? 21.692  5.299   -4.641  1.00 0.00 ?  563  SER A HB2  1  
ATOM 85    H HB3  . SER A 1 7  ? 22.451  6.024   -3.218  1.00 0.00 ?  563  SER A HB3  1  
ATOM 86    H HG   . SER A 1 7  ? 23.601  3.705   -3.767  1.00 0.00 ?  563  SER A HG   1  
ATOM 87    N N    . GLU A 1 8  ? 19.191  4.443   -3.151  1.00 0.00 ?  564  GLU A N    1  
ATOM 88    C CA   . GLU A 1 8  ? 17.820  4.853   -2.827  1.00 0.00 ?  564  GLU A CA   1  
ATOM 89    C C    . GLU A 1 8  ? 17.699  6.261   -2.251  1.00 0.00 ?  564  GLU A C    1  
ATOM 90    O O    . GLU A 1 8  ? 17.817  6.470   -1.042  1.00 0.00 ?  564  GLU A O    1  
ATOM 91    C CB   . GLU A 1 8  ? 17.111  3.818   -1.946  1.00 0.00 ?  564  GLU A CB   1  
ATOM 92    C CG   . GLU A 1 8  ? 16.859  2.506   -2.667  1.00 0.00 ?  564  GLU A CG   1  
ATOM 93    C CD   . GLU A 1 8  ? 16.199  1.464   -1.811  1.00 0.00 ?  564  GLU A CD   1  
ATOM 94    O OE1  . GLU A 1 8  ? 16.877  0.486   -1.407  1.00 0.00 ?  564  GLU A OE1  1  
ATOM 95    O OE2  . GLU A 1 8  ? 14.990  1.566   -1.554  1.00 0.00 -1 564  GLU A OE2  1  
ATOM 96    H H    . GLU A 1 8  ? 19.317  3.996   -4.015  1.00 0.00 ?  564  GLU A H    1  
ATOM 97    H HA   . GLU A 1 8  ? 17.301  4.874   -3.774  1.00 0.00 ?  564  GLU A HA   1  
ATOM 98    H HB2  . GLU A 1 8  ? 17.727  3.622   -1.081  1.00 0.00 ?  564  GLU A HB2  1  
ATOM 99    H HB3  . GLU A 1 8  ? 16.163  4.221   -1.623  1.00 0.00 ?  564  GLU A HB3  1  
ATOM 100   H HG2  . GLU A 1 8  ? 16.216  2.697   -3.513  1.00 0.00 ?  564  GLU A HG2  1  
ATOM 101   H HG3  . GLU A 1 8  ? 17.804  2.121   -3.020  1.00 0.00 ?  564  GLU A HG3  1  
ATOM 102   N N    . GLU A 1 9  ? 17.494  7.223   -3.116  1.00 0.00 ?  565  GLU A N    1  
ATOM 103   C CA   . GLU A 1 9  ? 17.275  8.591   -2.696  1.00 0.00 ?  565  GLU A CA   1  
ATOM 104   C C    . GLU A 1 9  ? 15.825  8.711   -2.248  1.00 0.00 ?  565  GLU A C    1  
ATOM 105   O O    . GLU A 1 9  ? 14.939  9.097   -3.019  1.00 0.00 ?  565  GLU A O    1  
ATOM 106   C CB   . GLU A 1 9  ? 17.584  9.573   -3.830  1.00 0.00 ?  565  GLU A CB   1  
ATOM 107   C CG   . GLU A 1 9  ? 18.999  9.453   -4.376  1.00 0.00 ?  565  GLU A CG   1  
ATOM 108   C CD   . GLU A 1 9  ? 19.270  10.409  -5.508  1.00 0.00 ?  565  GLU A CD   1  
ATOM 109   O OE1  . GLU A 1 9  ? 19.772  11.519  -5.257  1.00 0.00 ?  565  GLU A OE1  1  
ATOM 110   O OE2  . GLU A 1 9  ? 19.005  10.061  -6.677  1.00 0.00 -1 565  GLU A OE2  1  
ATOM 111   H H    . GLU A 1 9  ? 17.466  7.007   -4.071  1.00 0.00 ?  565  GLU A H    1  
ATOM 112   H HA   . GLU A 1 9  ? 17.922  8.780   -1.852  1.00 0.00 ?  565  GLU A HA   1  
ATOM 113   H HB2  . GLU A 1 9  ? 16.891  9.398   -4.640  1.00 0.00 ?  565  GLU A HB2  1  
ATOM 114   H HB3  . GLU A 1 9  ? 17.445  10.579  -3.463  1.00 0.00 ?  565  GLU A HB3  1  
ATOM 115   H HG2  . GLU A 1 9  ? 19.696  9.662   -3.578  1.00 0.00 ?  565  GLU A HG2  1  
ATOM 116   H HG3  . GLU A 1 9  ? 19.152  8.443   -4.728  1.00 0.00 ?  565  GLU A HG3  1  
ATOM 117   N N    . GLU A 1 10 ? 15.591  8.302   -1.039  1.00 0.00 ?  566  GLU A N    1  
ATOM 118   C CA   . GLU A 1 10 ? 14.270  8.188   -0.498  1.00 0.00 ?  566  GLU A CA   1  
ATOM 119   C C    . GLU A 1 10 ? 13.998  9.276   0.530   1.00 0.00 ?  566  GLU A C    1  
ATOM 120   O O    . GLU A 1 10 ? 14.766  9.464   1.484   1.00 0.00 ?  566  GLU A O    1  
ATOM 121   C CB   . GLU A 1 10 ? 14.140  6.808   0.115   1.00 0.00 ?  566  GLU A CB   1  
ATOM 122   C CG   . GLU A 1 10 ? 12.808  6.481   0.736   1.00 0.00 ?  566  GLU A CG   1  
ATOM 123   C CD   . GLU A 1 10 ? 12.827  5.114   1.354   1.00 0.00 ?  566  GLU A CD   1  
ATOM 124   O OE1  . GLU A 1 10 ? 13.100  4.998   2.566   1.00 0.00 ?  566  GLU A OE1  1  
ATOM 125   O OE2  . GLU A 1 10 ? 12.569  4.118   0.640   1.00 0.00 -1 566  GLU A OE2  1  
ATOM 126   H H    . GLU A 1 10 ? 16.354  8.053   -0.473  1.00 0.00 ?  566  GLU A H    1  
ATOM 127   H HA   . GLU A 1 10 ? 13.563  8.266   -1.309  1.00 0.00 ?  566  GLU A HA   1  
ATOM 128   H HB2  . GLU A 1 10 ? 14.320  6.083   -0.664  1.00 0.00 ?  566  GLU A HB2  1  
ATOM 129   H HB3  . GLU A 1 10 ? 14.904  6.714   0.869   1.00 0.00 ?  566  GLU A HB3  1  
ATOM 130   H HG2  . GLU A 1 10 ? 12.589  7.210   1.502   1.00 0.00 ?  566  GLU A HG2  1  
ATOM 131   H HG3  . GLU A 1 10 ? 12.044  6.509   -0.025  1.00 0.00 ?  566  GLU A HG3  1  
ATOM 132   N N    . GLU A 1 11 ? 12.909  9.960   0.343   1.00 0.00 ?  567  GLU A N    1  
ATOM 133   C CA   . GLU A 1 11 ? 12.511  11.049  1.209   1.00 0.00 ?  567  GLU A CA   1  
ATOM 134   C C    . GLU A 1 11 ? 11.451  10.580  2.183   1.00 0.00 ?  567  GLU A C    1  
ATOM 135   O O    . GLU A 1 11 ? 10.457  9.984   1.788   1.00 0.00 ?  567  GLU A O    1  
ATOM 136   C CB   . GLU A 1 11 ? 11.971  12.207  0.386   1.00 0.00 ?  567  GLU A CB   1  
ATOM 137   C CG   . GLU A 1 11 ? 12.983  12.816  -0.558  1.00 0.00 ?  567  GLU A CG   1  
ATOM 138   C CD   . GLU A 1 11 ? 12.395  13.934  -1.358  1.00 0.00 ?  567  GLU A CD   1  
ATOM 139   O OE1  . GLU A 1 11 ? 12.205  13.777  -2.585  1.00 0.00 ?  567  GLU A OE1  1  
ATOM 140   O OE2  . GLU A 1 11 ? 12.096  14.993  -0.782  1.00 0.00 -1 567  GLU A OE2  1  
ATOM 141   H H    . GLU A 1 11 ? 12.331  9.692   -0.404  1.00 0.00 ?  567  GLU A H    1  
ATOM 142   H HA   . GLU A 1 11 ? 13.379  11.384  1.758   1.00 0.00 ?  567  GLU A HA   1  
ATOM 143   H HB2  . GLU A 1 11 ? 11.137  11.853  -0.201  1.00 0.00 ?  567  GLU A HB2  1  
ATOM 144   H HB3  . GLU A 1 11 ? 11.624  12.980  1.054   1.00 0.00 ?  567  GLU A HB3  1  
ATOM 145   H HG2  . GLU A 1 11 ? 13.813  13.198  0.017   1.00 0.00 ?  567  GLU A HG2  1  
ATOM 146   H HG3  . GLU A 1 11 ? 13.334  12.050  -1.233  1.00 0.00 ?  567  GLU A HG3  1  
ATOM 147   N N    . GLU A 1 12 ? 11.657  10.857  3.440   1.00 0.00 ?  568  GLU A N    1  
ATOM 148   C CA   . GLU A 1 12 ? 10.732  10.436  4.473   1.00 0.00 ?  568  GLU A CA   1  
ATOM 149   C C    . GLU A 1 12 ? 9.814   11.576  4.883   1.00 0.00 ?  568  GLU A C    1  
ATOM 150   O O    . GLU A 1 12 ? 8.867   11.389  5.631   1.00 0.00 ?  568  GLU A O    1  
ATOM 151   C CB   . GLU A 1 12 ? 11.477  9.896   5.712   1.00 0.00 ?  568  GLU A CB   1  
ATOM 152   C CG   . GLU A 1 12 ? 12.352  10.924  6.458   1.00 0.00 ?  568  GLU A CG   1  
ATOM 153   C CD   . GLU A 1 12 ? 13.628  11.319  5.733   1.00 0.00 ?  568  GLU A CD   1  
ATOM 154   O OE1  . GLU A 1 12 ? 13.583  12.157  4.799   1.00 0.00 ?  568  GLU A OE1  1  
ATOM 155   O OE2  . GLU A 1 12 ? 14.707  10.830  6.115   1.00 0.00 -1 568  GLU A OE2  1  
ATOM 156   H H    . GLU A 1 12 ? 12.464  11.352  3.720   1.00 0.00 ?  568  GLU A H    1  
ATOM 157   H HA   . GLU A 1 12 ? 10.127  9.646   4.061   1.00 0.00 ?  568  GLU A HA   1  
ATOM 158   H HB2  . GLU A 1 12 ? 10.751  9.508   6.410   1.00 0.00 ?  568  GLU A HB2  1  
ATOM 159   H HB3  . GLU A 1 12 ? 12.115  9.086   5.392   1.00 0.00 ?  568  GLU A HB3  1  
ATOM 160   H HG2  . GLU A 1 12 ? 11.768  11.821  6.606   1.00 0.00 ?  568  GLU A HG2  1  
ATOM 161   H HG3  . GLU A 1 12 ? 12.609  10.511  7.422   1.00 0.00 ?  568  GLU A HG3  1  
ATOM 162   N N    . GLY A 1 13 ? 10.104  12.743  4.391   1.00 0.00 ?  569  GLY A N    1  
ATOM 163   C CA   . GLY A 1 13 ? 9.348   13.908  4.773   1.00 0.00 ?  569  GLY A CA   1  
ATOM 164   C C    . GLY A 1 13 ? 8.565   14.493  3.636   1.00 0.00 ?  569  GLY A C    1  
ATOM 165   O O    . GLY A 1 13 ? 8.250   15.687  3.638   1.00 0.00 ?  569  GLY A O    1  
ATOM 166   H H    . GLY A 1 13 ? 10.852  12.800  3.762   1.00 0.00 ?  569  GLY A H    1  
ATOM 167   H HA2  . GLY A 1 13 ? 8.659   13.626  5.556   1.00 0.00 ?  569  GLY A HA2  1  
ATOM 168   H HA3  . GLY A 1 13 ? 10.027  14.657  5.153   1.00 0.00 ?  569  GLY A HA3  1  
ATOM 169   N N    . LEU A 1 14 ? 8.250   13.676  2.671   1.00 0.00 ?  570  LEU A N    1  
ATOM 170   C CA   . LEU A 1 14 ? 7.495   14.127  1.526   1.00 0.00 ?  570  LEU A CA   1  
ATOM 171   C C    . LEU A 1 14 ? 6.035   14.465  1.893   1.00 0.00 ?  570  LEU A C    1  
ATOM 172   O O    . LEU A 1 14 ? 5.430   13.796  2.747   1.00 0.00 ?  570  LEU A O    1  
ATOM 173   C CB   . LEU A 1 14 ? 7.637   13.156  0.319   1.00 0.00 ?  570  LEU A CB   1  
ATOM 174   C CG   . LEU A 1 14 ? 7.650   11.638  0.607   1.00 0.00 ?  570  LEU A CG   1  
ATOM 175   C CD1  . LEU A 1 14 ? 6.352   11.150  1.212   1.00 0.00 ?  570  LEU A CD1  1  
ATOM 176   C CD2  . LEU A 1 14 ? 7.976   10.858  -0.657  1.00 0.00 ?  570  LEU A CD2  1  
ATOM 177   H H    . LEU A 1 14 ? 8.502   12.733  2.751   1.00 0.00 ?  570  LEU A H    1  
ATOM 178   H HA   . LEU A 1 14 ? 7.957   15.066  1.259   1.00 0.00 ?  570  LEU A HA   1  
ATOM 179   H HB2  . LEU A 1 14 ? 6.817   13.351  -0.356  1.00 0.00 ?  570  LEU A HB2  1  
ATOM 180   H HB3  . LEU A 1 14 ? 8.552   13.405  -0.198  1.00 0.00 ?  570  LEU A HB3  1  
ATOM 181   H HG   . LEU A 1 14 ? 8.437   11.445  1.321   1.00 0.00 ?  570  LEU A HG   1  
ATOM 182   H HD11 . LEU A 1 14 ? 5.535   11.392  0.549   1.00 0.00 ?  570  LEU A HD11 1  
ATOM 183   H HD12 . LEU A 1 14 ? 6.200   11.634  2.167   1.00 0.00 ?  570  LEU A HD12 1  
ATOM 184   H HD13 . LEU A 1 14 ? 6.400   10.080  1.353   1.00 0.00 ?  570  LEU A HD13 1  
ATOM 185   H HD21 . LEU A 1 14 ? 7.228   11.059  -1.410  1.00 0.00 ?  570  LEU A HD21 1  
ATOM 186   H HD22 . LEU A 1 14 ? 7.986   9.802   -0.432  1.00 0.00 ?  570  LEU A HD22 1  
ATOM 187   H HD23 . LEU A 1 14 ? 8.947   11.156  -1.025  1.00 0.00 ?  570  LEU A HD23 1  
ATOM 188   N N    . PRO A 1 15 ? 5.493   15.559  1.333   1.00 0.00 ?  571  PRO A N    1  
ATOM 189   C CA   . PRO A 1 15 ? 4.116   15.978  1.599   1.00 0.00 ?  571  PRO A CA   1  
ATOM 190   C C    . PRO A 1 15 ? 3.109   15.116  0.857   1.00 0.00 ?  571  PRO A C    1  
ATOM 191   O O    . PRO A 1 15 ? 3.454   14.490  -0.166  1.00 0.00 ?  571  PRO A O    1  
ATOM 192   C CB   . PRO A 1 15 ? 4.076   17.409  1.067   1.00 0.00 ?  571  PRO A CB   1  
ATOM 193   C CG   . PRO A 1 15 ? 5.094   17.433  -0.020  1.00 0.00 ?  571  PRO A CG   1  
ATOM 194   C CD   . PRO A 1 15 ? 6.182   16.486  0.405   1.00 0.00 ?  571  PRO A CD   1  
ATOM 195   H HA   . PRO A 1 15 ? 3.892   15.972  2.655   1.00 0.00 ?  571  PRO A HA   1  
ATOM 196   H HB2  . PRO A 1 15 ? 3.086   17.626  0.693   1.00 0.00 ?  571  PRO A HB2  1  
ATOM 197   H HB3  . PRO A 1 15 ? 4.326   18.100  1.859   1.00 0.00 ?  571  PRO A HB3  1  
ATOM 198   H HG2  . PRO A 1 15 ? 4.642   17.083  -0.937  1.00 0.00 ?  571  PRO A HG2  1  
ATOM 199   H HG3  . PRO A 1 15 ? 5.487   18.432  -0.142  1.00 0.00 ?  571  PRO A HG3  1  
ATOM 200   H HD2  . PRO A 1 15 ? 6.574   15.954  -0.449  1.00 0.00 ?  571  PRO A HD2  1  
ATOM 201   H HD3  . PRO A 1 15 ? 6.971   17.021  0.912   1.00 0.00 ?  571  PRO A HD3  1  
ATOM 202   N N    . MET A 1 16 ? 1.871   15.098  1.359   1.00 0.00 ?  572  MET A N    1  
ATOM 203   C CA   . MET A 1 16 ? 0.807   14.290  0.768   1.00 0.00 ?  572  MET A CA   1  
ATOM 204   C C    . MET A 1 16 ? 0.606   14.631  -0.701  1.00 0.00 ?  572  MET A C    1  
ATOM 205   O O    . MET A 1 16 ? 0.224   15.748  -1.066  1.00 0.00 ?  572  MET A O    1  
ATOM 206   C CB   . MET A 1 16 ? -0.525  14.379  1.549   1.00 0.00 ?  572  MET A CB   1  
ATOM 207   C CG   . MET A 1 16 ? -1.186  15.747  1.562   1.00 0.00 ?  572  MET A CG   1  
ATOM 208   S SD   . MET A 1 16 ? -2.794  15.720  2.372   1.00 0.00 ?  572  MET A SD   1  
ATOM 209   C CE   . MET A 1 16 ? -3.342  17.387  2.046   1.00 0.00 ?  572  MET A CE   1  
ATOM 210   H H    . MET A 1 16 ? 1.679   15.627  2.161   1.00 0.00 ?  572  MET A H    1  
ATOM 211   H HA   . MET A 1 16 ? 1.160   13.270  0.805   1.00 0.00 ?  572  MET A HA   1  
ATOM 212   H HB2  . MET A 1 16 ? -1.226  13.687  1.108   1.00 0.00 ?  572  MET A HB2  1  
ATOM 213   H HB3  . MET A 1 16 ? -0.348  14.079  2.570   1.00 0.00 ?  572  MET A HB3  1  
ATOM 214   H HG2  . MET A 1 16 ? -0.543  16.437  2.088   1.00 0.00 ?  572  MET A HG2  1  
ATOM 215   H HG3  . MET A 1 16 ? -1.314  16.079  0.542   1.00 0.00 ?  572  MET A HG3  1  
ATOM 216   H HE1  . MET A 1 16 ? -2.676  18.083  2.532   1.00 0.00 ?  572  MET A HE1  1  
ATOM 217   H HE2  . MET A 1 16 ? -4.347  17.516  2.419   1.00 0.00 ?  572  MET A HE2  1  
ATOM 218   H HE3  . MET A 1 16 ? -3.331  17.565  0.981   1.00 0.00 ?  572  MET A HE3  1  
ATOM 219   N N    . SER A 1 17 ? 0.904   13.683  -1.521  1.00 0.00 ?  573  SER A N    1  
ATOM 220   C CA   . SER A 1 17 ? 0.841   13.824  -2.937  1.00 0.00 ?  573  SER A CA   1  
ATOM 221   C C    . SER A 1 17 ? 0.190   12.574  -3.497  1.00 0.00 ?  573  SER A C    1  
ATOM 222   O O    . SER A 1 17 ? 0.235   11.520  -2.873  1.00 0.00 ?  573  SER A O    1  
ATOM 223   C CB   . SER A 1 17 ? 2.267   13.978  -3.485  1.00 0.00 ?  573  SER A CB   1  
ATOM 224   O OG   . SER A 1 17 ? 2.971   15.010  -2.790  1.00 0.00 ?  573  SER A OG   1  
ATOM 225   H H    . SER A 1 17 ? 1.159   12.812  -1.123  1.00 0.00 ?  573  SER A H    1  
ATOM 226   H HA   . SER A 1 17 ? 0.262   14.699  -3.189  1.00 0.00 ?  573  SER A HA   1  
ATOM 227   H HB2  . SER A 1 17 ? 2.801   13.047  -3.363  1.00 0.00 ?  573  SER A HB2  1  
ATOM 228   H HB3  . SER A 1 17 ? 2.227   14.230  -4.534  1.00 0.00 ?  573  SER A HB3  1  
ATOM 229   H HG   . SER A 1 17 ? 3.082   14.697  -1.875  1.00 0.00 ?  573  SER A HG   1  
ATOM 230   N N    . TYR A 1 18 ? -0.409  12.668  -4.653  1.00 0.00 ?  574  TYR A N    1  
ATOM 231   C CA   . TYR A 1 18 ? -1.060  11.511  -5.223  1.00 0.00 ?  574  TYR A CA   1  
ATOM 232   C C    . TYR A 1 18 ? -0.038  10.495  -5.674  1.00 0.00 ?  574  TYR A C    1  
ATOM 233   O O    . TYR A 1 18 ? -0.254  9.311   -5.544  1.00 0.00 ?  574  TYR A O    1  
ATOM 234   C CB   . TYR A 1 18 ? -2.032  11.895  -6.338  1.00 0.00 ?  574  TYR A CB   1  
ATOM 235   C CG   . TYR A 1 18 ? -3.122  12.808  -5.839  1.00 0.00 ?  574  TYR A CG   1  
ATOM 236   C CD1  . TYR A 1 18 ? -3.119  14.159  -6.147  1.00 0.00 ?  574  TYR A CD1  1  
ATOM 237   C CD2  . TYR A 1 18 ? -4.133  12.323  -5.015  1.00 0.00 ?  574  TYR A CD2  1  
ATOM 238   C CE1  . TYR A 1 18 ? -4.090  15.001  -5.655  1.00 0.00 ?  574  TYR A CE1  1  
ATOM 239   C CE2  . TYR A 1 18 ? -5.112  13.158  -4.525  1.00 0.00 ?  574  TYR A CE2  1  
ATOM 240   C CZ   . TYR A 1 18 ? -5.086  14.497  -4.845  1.00 0.00 ?  574  TYR A CZ   1  
ATOM 241   O OH   . TYR A 1 18 ? -6.055  15.345  -4.340  1.00 0.00 ?  574  TYR A OH   1  
ATOM 242   H H    . TYR A 1 18 ? -0.401  13.514  -5.151  1.00 0.00 ?  574  TYR A H    1  
ATOM 243   H HA   . TYR A 1 18 ? -1.618  11.056  -4.417  1.00 0.00 ?  574  TYR A HA   1  
ATOM 244   H HB2  . TYR A 1 18 ? -1.494  12.399  -7.128  1.00 0.00 ?  574  TYR A HB2  1  
ATOM 245   H HB3  . TYR A 1 18 ? -2.496  11.002  -6.729  1.00 0.00 ?  574  TYR A HB3  1  
ATOM 246   H HD1  . TYR A 1 18 ? -2.341  14.550  -6.786  1.00 0.00 ?  574  TYR A HD1  1  
ATOM 247   H HD2  . TYR A 1 18 ? -4.148  11.271  -4.766  1.00 0.00 ?  574  TYR A HD2  1  
ATOM 248   H HE1  . TYR A 1 18 ? -4.069  16.050  -5.908  1.00 0.00 ?  574  TYR A HE1  1  
ATOM 249   H HE2  . TYR A 1 18 ? -5.892  12.765  -3.890  1.00 0.00 ?  574  TYR A HE2  1  
ATOM 250   H HH   . TYR A 1 18 ? -6.083  15.226  -3.380  1.00 0.00 ?  574  TYR A HH   1  
ATOM 251   N N    . ASP A 1 19 ? 1.115   10.984  -6.121  1.00 0.00 ?  575  ASP A N    1  
ATOM 252   C CA   . ASP A 1 19 ? 2.213   10.110  -6.574  1.00 0.00 ?  575  ASP A CA   1  
ATOM 253   C C    . ASP A 1 19 ? 2.784   9.323   -5.401  1.00 0.00 ?  575  ASP A C    1  
ATOM 254   O O    . ASP A 1 19 ? 3.135   8.149   -5.543  1.00 0.00 ?  575  ASP A O    1  
ATOM 255   C CB   . ASP A 1 19 ? 3.346   10.898  -7.266  1.00 0.00 ?  575  ASP A CB   1  
ATOM 256   C CG   . ASP A 1 19 ? 2.894   11.711  -8.461  1.00 0.00 ?  575  ASP A CG   1  
ATOM 257   O OD1  . ASP A 1 19 ? 2.960   12.958  -8.395  1.00 0.00 ?  575  ASP A OD1  1  
ATOM 258   O OD2  . ASP A 1 19 ? 2.418   11.134  -9.477  1.00 0.00 -1 575  ASP A OD2  1  
ATOM 259   H H    . ASP A 1 19 ? 1.214   11.959  -6.153  1.00 0.00 ?  575  ASP A H    1  
ATOM 260   H HA   . ASP A 1 19 ? 1.794   9.402   -7.272  1.00 0.00 ?  575  ASP A HA   1  
ATOM 261   H HB2  . ASP A 1 19 ? 3.786   11.579  -6.552  1.00 0.00 ?  575  ASP A HB2  1  
ATOM 262   H HB3  . ASP A 1 19 ? 4.103   10.201  -7.592  1.00 0.00 ?  575  ASP A HB3  1  
ATOM 263   N N    . GLU A 1 20 ? 2.861   9.982   -4.244  1.00 0.00 ?  576  GLU A N    1  
ATOM 264   C CA   . GLU A 1 20 ? 3.297   9.438   -3.029  1.00 0.00 ?  576  GLU A CA   1  
ATOM 265   C C    . GLU A 1 20 ? 2.418   8.256   -2.627  1.00 0.00 ?  576  GLU A C    1  
ATOM 266   O O    . GLU A 1 20 ? 2.892   7.138   -2.431  1.00 0.00 ?  576  GLU A O    1  
ATOM 267   C CB   . GLU A 1 20 ? 3.098   10.550  -2.049  1.00 0.00 ?  576  GLU A CB   1  
ATOM 268   C CG   . GLU A 1 20 ? 3.208   10.144  -0.653  1.00 0.00 ?  576  GLU A CG   1  
ATOM 269   C CD   . GLU A 1 20 ? 2.479   11.078  0.283   1.00 0.00 ?  576  GLU A CD   1  
ATOM 270   O OE1  . GLU A 1 20 ? 1.339   11.469  -0.045  1.00 0.00 ?  576  GLU A OE1  1  
ATOM 271   O OE2  . GLU A 1 20 ? 2.995   11.385  1.362   1.00 0.00 -1 576  GLU A OE2  1  
ATOM 272   H H    . GLU A 1 20 ? 2.629   10.915  -4.089  1.00 0.00 ?  576  GLU A H    1  
ATOM 273   H HA   . GLU A 1 20 ? 4.346   9.204   -3.045  1.00 0.00 ?  576  GLU A HA   1  
ATOM 274   H HB2  . GLU A 1 20 ? 3.817   11.332  -2.244  1.00 0.00 ?  576  GLU A HB2  1  
ATOM 275   H HB3  . GLU A 1 20 ? 2.108   10.929  -2.227  1.00 0.00 ?  576  GLU A HB3  1  
ATOM 276   H HG2  . GLU A 1 20 ? 2.800   9.146   -0.628  1.00 0.00 ?  576  GLU A HG2  1  
ATOM 277   H HG3  . GLU A 1 20 ? 4.271   10.163  -0.506  1.00 0.00 ?  576  GLU A HG3  1  
ATOM 278   N N    . LYS A 1 21 ? 1.129   8.514   -2.588  1.00 0.00 ?  577  LYS A N    1  
ATOM 279   C CA   . LYS A 1 21 ? 0.144   7.544   -2.178  1.00 0.00 ?  577  LYS A CA   1  
ATOM 280   C C    . LYS A 1 21 ? 0.055   6.426   -3.166  1.00 0.00 ?  577  LYS A C    1  
ATOM 281   O O    . LYS A 1 21 ? -0.116  5.252   -2.817  1.00 0.00 ?  577  LYS A O    1  
ATOM 282   C CB   . LYS A 1 21 ? -1.199  8.236   -2.032  1.00 0.00 ?  577  LYS A CB   1  
ATOM 283   C CG   . LYS A 1 21 ? -1.158  9.333   -0.968  1.00 0.00 ?  577  LYS A CG   1  
ATOM 284   C CD   . LYS A 1 21 ? -2.475  10.030  -0.820  1.00 0.00 ?  577  LYS A CD   1  
ATOM 285   C CE   . LYS A 1 21 ? -2.478  11.007  0.334   1.00 0.00 ?  577  LYS A CE   1  
ATOM 286   N NZ   . LYS A 1 21 ? -3.862  11.379  0.712   1.00 0.00 1  577  LYS A NZ   1  
ATOM 287   H H    . LYS A 1 21 ? 0.833   9.422   -2.815  1.00 0.00 ?  577  LYS A H    1  
ATOM 288   H HA   . LYS A 1 21 ? 0.435   7.162   -1.213  1.00 0.00 ?  577  LYS A HA   1  
ATOM 289   H HB2  . LYS A 1 21 ? -1.471  8.642   -2.997  1.00 0.00 ?  577  LYS A HB2  1  
ATOM 290   H HB3  . LYS A 1 21 ? -1.956  7.506   -1.781  1.00 0.00 ?  577  LYS A HB3  1  
ATOM 291   H HG2  . LYS A 1 21 ? -0.897  8.890   -0.019  1.00 0.00 ?  577  LYS A HG2  1  
ATOM 292   H HG3  . LYS A 1 21 ? -0.403  10.054  -1.243  1.00 0.00 ?  577  LYS A HG3  1  
ATOM 293   H HD2  . LYS A 1 21 ? -2.689  10.567  -1.732  1.00 0.00 ?  577  LYS A HD2  1  
ATOM 294   H HD3  . LYS A 1 21 ? -3.243  9.288   -0.653  1.00 0.00 ?  577  LYS A HD3  1  
ATOM 295   H HE2  . LYS A 1 21 ? -1.989  10.552  1.183   1.00 0.00 ?  577  LYS A HE2  1  
ATOM 296   H HE3  . LYS A 1 21 ? -1.942  11.897  0.039   1.00 0.00 ?  577  LYS A HE3  1  
ATOM 297   H HZ1  . LYS A 1 21 ? -4.440  11.663  -0.107  1.00 0.00 ?  577  LYS A HZ1  1  
ATOM 298   H HZ2  . LYS A 1 21 ? -3.863  12.178  1.376   1.00 0.00 ?  577  LYS A HZ2  1  
ATOM 299   H HZ3  . LYS A 1 21 ? -4.339  10.591  1.199   1.00 0.00 ?  577  LYS A HZ3  1  
ATOM 300   N N    . ARG A 1 22 ? 0.207   6.785   -4.389  1.00 0.00 ?  578  ARG A N    1  
ATOM 301   C CA   . ARG A 1 22 ? 0.104   5.886   -5.453  1.00 0.00 ?  578  ARG A CA   1  
ATOM 302   C C    . ARG A 1 22 ? 1.300   4.972   -5.599  1.00 0.00 ?  578  ARG A C    1  
ATOM 303   O O    . ARG A 1 22 ? 1.178   3.919   -6.154  1.00 0.00 ?  578  ARG A O    1  
ATOM 304   C CB   . ARG A 1 22 ? -0.399  6.521   -6.711  1.00 0.00 ?  578  ARG A CB   1  
ATOM 305   C CG   . ARG A 1 22 ? -0.916  5.528   -7.697  1.00 0.00 ?  578  ARG A CG   1  
ATOM 306   C CD   . ARG A 1 22 ? -1.958  6.151   -8.553  1.00 0.00 ?  578  ARG A CD   1  
ATOM 307   N NE   . ARG A 1 22 ? -1.579  6.127   -9.971  1.00 0.00 ?  578  ARG A NE   1  
ATOM 308   C CZ   . ARG A 1 22 ? -2.281  5.549   -10.962 1.00 0.00 ?  578  ARG A CZ   1  
ATOM 309   N NH1  . ARG A 1 22 ? -3.430  4.947   -10.717 1.00 0.00 1  578  ARG A NH1  1  
ATOM 310   N NH2  . ARG A 1 22 ? -1.834  5.604   -12.198 1.00 0.00 ?  578  ARG A NH2  1  
ATOM 311   H H    . ARG A 1 22 ? 0.380   7.732   -4.587  1.00 0.00 ?  578  ARG A H    1  
ATOM 312   H HA   . ARG A 1 22 ? -0.672  5.222   -5.098  1.00 0.00 ?  578  ARG A HA   1  
ATOM 313   H HB2  . ARG A 1 22 ? -1.185  7.209   -6.436  1.00 0.00 ?  578  ARG A HB2  1  
ATOM 314   H HB3  . ARG A 1 22 ? 0.378   7.103   -7.165  1.00 0.00 ?  578  ARG A HB3  1  
ATOM 315   H HG2  . ARG A 1 22 ? -0.115  5.109   -8.294  1.00 0.00 ?  578  ARG A HG2  1  
ATOM 316   H HG3  . ARG A 1 22 ? -1.381  4.737   -7.129  1.00 0.00 ?  578  ARG A HG3  1  
ATOM 317   H HD2  . ARG A 1 22 ? -2.879  5.631   -8.328  1.00 0.00 ?  578  ARG A HD2  1  
ATOM 318   H HD3  . ARG A 1 22 ? -2.095  7.161   -8.196  1.00 0.00 ?  578  ARG A HD3  1  
ATOM 319   H HE   . ARG A 1 22 ? -0.735  6.592   -10.176 1.00 0.00 ?  578  ARG A HE   1  
ATOM 320   H HH11 . ARG A 1 22 ? -3.832  4.895   -9.795  1.00 0.00 ?  578  ARG A HH11 1  
ATOM 321   H HH12 . ARG A 1 22 ? -3.963  4.520   -11.453 1.00 0.00 ?  578  ARG A HH12 1  
ATOM 322   H HH21 . ARG A 1 22 ? -0.978  6.079   -12.423 1.00 0.00 ?  578  ARG A HH21 1  
ATOM 323   H HH22 . ARG A 1 22 ? -2.318  5.174   -12.964 1.00 0.00 ?  578  ARG A HH22 1  
ATOM 324   N N    . GLN A 1 23 ? 2.459   5.382   -5.115  1.00 0.00 ?  579  GLN A N    1  
ATOM 325   C CA   . GLN A 1 23 ? 3.640   4.500   -5.127  1.00 0.00 ?  579  GLN A CA   1  
ATOM 326   C C    . GLN A 1 23 ? 3.280   3.176   -4.428  1.00 0.00 ?  579  GLN A C    1  
ATOM 327   O O    . GLN A 1 23 ? 3.637   2.084   -4.887  1.00 0.00 ?  579  GLN A O    1  
ATOM 328   C CB   . GLN A 1 23 ? 4.777   5.149   -4.338  1.00 0.00 ?  579  GLN A CB   1  
ATOM 329   C CG   . GLN A 1 23 ? 5.951   4.216   -4.100  1.00 0.00 ?  579  GLN A CG   1  
ATOM 330   C CD   . GLN A 1 23 ? 6.946   4.748   -3.103  1.00 0.00 ?  579  GLN A CD   1  
ATOM 331   O OE1  . GLN A 1 23 ? 6.606   5.499   -2.192  1.00 0.00 ?  579  GLN A OE1  1  
ATOM 332   N NE2  . GLN A 1 23 ? 8.158   4.320   -3.227  1.00 0.00 ?  579  GLN A NE2  1  
ATOM 333   H H    . GLN A 1 23 ? 2.540   6.292   -4.752  1.00 0.00 ?  579  GLN A H    1  
ATOM 334   H HA   . GLN A 1 23 ? 3.952   4.324   -6.146  1.00 0.00 ?  579  GLN A HA   1  
ATOM 335   H HB2  . GLN A 1 23 ? 5.131   6.014   -4.878  1.00 0.00 ?  579  GLN A HB2  1  
ATOM 336   H HB3  . GLN A 1 23 ? 4.399   5.467   -3.377  1.00 0.00 ?  579  GLN A HB3  1  
ATOM 337   H HG2  . GLN A 1 23 ? 5.576   3.272   -3.735  1.00 0.00 ?  579  GLN A HG2  1  
ATOM 338   H HG3  . GLN A 1 23 ? 6.457   4.057   -5.042  1.00 0.00 ?  579  GLN A HG3  1  
ATOM 339   H HE21 . GLN A 1 23 ? 8.360   3.678   -3.943  1.00 0.00 ?  579  GLN A HE21 1  
ATOM 340   H HE22 . GLN A 1 23 ? 8.835   4.655   -2.601  1.00 0.00 ?  579  GLN A HE22 1  
ATOM 341   N N    . LEU A 1 24 ? 2.507   3.295   -3.375  1.00 0.00 ?  580  LEU A N    1  
ATOM 342   C CA   . LEU A 1 24 ? 2.046   2.159   -2.613  1.00 0.00 ?  580  LEU A CA   1  
ATOM 343   C C    . LEU A 1 24 ? 0.973   1.362   -3.386  1.00 0.00 ?  580  LEU A C    1  
ATOM 344   O O    . LEU A 1 24 ? 0.796   0.162   -3.156  1.00 0.00 ?  580  LEU A O    1  
ATOM 345   C CB   . LEU A 1 24 ? 1.554   2.587   -1.217  1.00 0.00 ?  580  LEU A CB   1  
ATOM 346   C CG   . LEU A 1 24 ? 2.629   2.982   -0.160  1.00 0.00 ?  580  LEU A CG   1  
ATOM 347   C CD1  . LEU A 1 24 ? 3.551   1.820   0.131   1.00 0.00 ?  580  LEU A CD1  1  
ATOM 348   C CD2  . LEU A 1 24 ? 3.445   4.209   -0.567  1.00 0.00 ?  580  LEU A CD2  1  
ATOM 349   H H    . LEU A 1 24 ? 2.243   4.199   -3.095  1.00 0.00 ?  580  LEU A H    1  
ATOM 350   H HA   . LEU A 1 24 ? 2.898   1.506   -2.493  1.00 0.00 ?  580  LEU A HA   1  
ATOM 351   H HB2  . LEU A 1 24 ? 0.887   3.427   -1.340  1.00 0.00 ?  580  LEU A HB2  1  
ATOM 352   H HB3  . LEU A 1 24 ? 0.990   1.760   -0.817  1.00 0.00 ?  580  LEU A HB3  1  
ATOM 353   H HG   . LEU A 1 24 ? 2.115   3.205   0.765   1.00 0.00 ?  580  LEU A HG   1  
ATOM 354   H HD11 . LEU A 1 24 ? 4.052   1.505   -0.771  1.00 0.00 ?  580  LEU A HD11 1  
ATOM 355   H HD12 . LEU A 1 24 ? 2.980   0.998   0.537   1.00 0.00 ?  580  LEU A HD12 1  
ATOM 356   H HD13 . LEU A 1 24 ? 4.286   2.129   0.858   1.00 0.00 ?  580  LEU A HD13 1  
ATOM 357   H HD21 . LEU A 1 24 ? 2.791   5.051   -0.733  1.00 0.00 ?  580  LEU A HD21 1  
ATOM 358   H HD22 . LEU A 1 24 ? 3.985   3.991   -1.477  1.00 0.00 ?  580  LEU A HD22 1  
ATOM 359   H HD23 . LEU A 1 24 ? 4.146   4.449   0.219   1.00 0.00 ?  580  LEU A HD23 1  
ATOM 360   N N    . SER A 1 25 ? 0.286   2.032   -4.329  1.00 0.00 ?  581  SER A N    1  
ATOM 361   C CA   . SER A 1 25 ? -0.718  1.392   -5.185  1.00 0.00 ?  581  SER A CA   1  
ATOM 362   C C    . SER A 1 25 ? -0.020  0.308   -5.996  1.00 0.00 ?  581  SER A C    1  
ATOM 363   O O    . SER A 1 25 ? -0.530  -0.794  -6.179  1.00 0.00 ?  581  SER A O    1  
ATOM 364   C CB   . SER A 1 25 ? -1.290  2.391   -6.195  1.00 0.00 ?  581  SER A CB   1  
ATOM 365   O OG   . SER A 1 25 ? -2.506  1.930   -6.779  1.00 0.00 ?  581  SER A OG   1  
ATOM 366   H H    . SER A 1 25 ? 0.489   2.984   -4.451  1.00 0.00 ?  581  SER A H    1  
ATOM 367   H HA   . SER A 1 25 ? -1.517  1.045   -4.544  1.00 0.00 ?  581  SER A HA   1  
ATOM 368   H HB2  . SER A 1 25 ? -1.391  3.368   -5.757  1.00 0.00 ?  581  SER A HB2  1  
ATOM 369   H HB3  . SER A 1 25 ? -0.562  2.480   -6.988  1.00 0.00 ?  581  SER A HB3  1  
ATOM 370   H HG   . SER A 1 25 ? -3.070  1.578   -6.082  1.00 0.00 ?  581  SER A HG   1  
ATOM 371   N N    . LEU A 1 26 ? 1.174   0.641   -6.472  1.00 0.00 ?  582  LEU A N    1  
ATOM 372   C CA   . LEU A 1 26 ? 1.949   -0.266  -7.258  1.00 0.00 ?  582  LEU A CA   1  
ATOM 373   C C    . LEU A 1 26 ? 2.474   -1.433  -6.427  1.00 0.00 ?  582  LEU A C    1  
ATOM 374   O O    . LEU A 1 26 ? 2.623   -2.533  -6.951  1.00 0.00 ?  582  LEU A O    1  
ATOM 375   C CB   . LEU A 1 26 ? 3.075   0.446   -8.039  1.00 0.00 ?  582  LEU A CB   1  
ATOM 376   C CG   . LEU A 1 26 ? 2.656   1.391   -9.208  1.00 0.00 ?  582  LEU A CG   1  
ATOM 377   C CD1  . LEU A 1 26 ? 1.711   0.713   -10.185 1.00 0.00 ?  582  LEU A CD1  1  
ATOM 378   C CD2  . LEU A 1 26 ? 2.089   2.724   -8.737  1.00 0.00 ?  582  LEU A CD2  1  
ATOM 379   H H    . LEU A 1 26 ? 1.549   1.531   -6.298  1.00 0.00 ?  582  LEU A H    1  
ATOM 380   H HA   . LEU A 1 26 ? 1.263   -0.690  -7.974  1.00 0.00 ?  582  LEU A HA   1  
ATOM 381   H HB2  . LEU A 1 26 ? 3.637   1.035   -7.331  1.00 0.00 ?  582  LEU A HB2  1  
ATOM 382   H HB3  . LEU A 1 26 ? 3.730   -0.313  -8.440  1.00 0.00 ?  582  LEU A HB3  1  
ATOM 383   H HG   . LEU A 1 26 ? 3.563   1.592   -9.756  1.00 0.00 ?  582  LEU A HG   1  
ATOM 384   H HD11 . LEU A 1 26 ? 2.173   -0.179  -10.579 1.00 0.00 ?  582  LEU A HD11 1  
ATOM 385   H HD12 . LEU A 1 26 ? 1.495   1.392   -10.996 1.00 0.00 ?  582  LEU A HD12 1  
ATOM 386   H HD13 . LEU A 1 26 ? 0.790   0.455   -9.683  1.00 0.00 ?  582  LEU A HD13 1  
ATOM 387   H HD21 . LEU A 1 26 ? 1.214   2.569   -8.122  1.00 0.00 ?  582  LEU A HD21 1  
ATOM 388   H HD22 . LEU A 1 26 ? 1.804   3.331   -9.583  1.00 0.00 ?  582  LEU A HD22 1  
ATOM 389   H HD23 . LEU A 1 26 ? 2.834   3.250   -8.160  1.00 0.00 ?  582  LEU A HD23 1  
ATOM 390   N N    . ASP A 1 27 ? 2.735   -1.209  -5.140  1.00 0.00 ?  583  ASP A N    1  
ATOM 391   C CA   . ASP A 1 27 ? 3.190   -2.307  -4.272  1.00 0.00 ?  583  ASP A CA   1  
ATOM 392   C C    . ASP A 1 27 ? 2.087   -3.306  -4.064  1.00 0.00 ?  583  ASP A C    1  
ATOM 393   O O    . ASP A 1 27 ? 2.286   -4.500  -4.274  1.00 0.00 ?  583  ASP A O    1  
ATOM 394   C CB   . ASP A 1 27 ? 3.714   -1.848  -2.906  1.00 0.00 ?  583  ASP A CB   1  
ATOM 395   C CG   . ASP A 1 27 ? 4.979   -1.005  -2.984  1.00 0.00 ?  583  ASP A CG   1  
ATOM 396   O OD1  . ASP A 1 27 ? 5.923   -1.372  -3.725  1.00 0.00 ?  583  ASP A OD1  1  
ATOM 397   O OD2  . ASP A 1 27 ? 5.067   0.015   -2.295  1.00 0.00 -1 583  ASP A OD2  1  
ATOM 398   H H    . ASP A 1 27 ? 2.624   -0.308  -4.771  1.00 0.00 ?  583  ASP A H    1  
ATOM 399   H HA   . ASP A 1 27 ? 3.987   -2.807  -4.804  1.00 0.00 ?  583  ASP A HA   1  
ATOM 400   H HB2  . ASP A 1 27 ? 2.936   -1.284  -2.411  1.00 0.00 ?  583  ASP A HB2  1  
ATOM 401   H HB3  . ASP A 1 27 ? 3.903   -2.732  -2.306  1.00 0.00 ?  583  ASP A HB3  1  
ATOM 402   N N    . ILE A 1 28 ? 0.897   -2.818  -3.685  1.00 0.00 ?  584  ILE A N    1  
ATOM 403   C CA   . ILE A 1 28 ? -0.254  -3.704  -3.484  1.00 0.00 ?  584  ILE A CA   1  
ATOM 404   C C    . ILE A 1 28 ? -0.600  -4.440  -4.793  1.00 0.00 ?  584  ILE A C    1  
ATOM 405   O O    . ILE A 1 28 ? -0.933  -5.617  -4.789  1.00 0.00 ?  584  ILE A O    1  
ATOM 406   C CB   . ILE A 1 28 ? -1.517  -2.968  -2.861  1.00 0.00 ?  584  ILE A CB   1  
ATOM 407   C CG1  . ILE A 1 28 ? -2.717  -3.883  -2.762  1.00 0.00 ?  584  ILE A CG1  1  
ATOM 408   C CG2  . ILE A 1 28 ? -1.903  -1.715  -3.617  1.00 0.00 ?  584  ILE A CG2  1  
ATOM 409   C CD1  . ILE A 1 28 ? -2.524  -5.099  -1.898  1.00 0.00 ?  584  ILE A CD1  1  
ATOM 410   H H    . ILE A 1 28 ? 0.813   -1.851  -3.530  1.00 0.00 ?  584  ILE A H    1  
ATOM 411   H HA   . ILE A 1 28 ? 0.088   -4.462  -2.793  1.00 0.00 ?  584  ILE A HA   1  
ATOM 412   H HB   . ILE A 1 28 ? -1.245  -2.668  -1.862  1.00 0.00 ?  584  ILE A HB   1  
ATOM 413   H HG12 . ILE A 1 28 ? -3.564  -3.331  -2.382  1.00 0.00 ?  584  ILE A HG12 1  
ATOM 414   H HG13 . ILE A 1 28 ? -2.921  -4.208  -3.770  1.00 0.00 ?  584  ILE A HG13 1  
ATOM 415   H HG21 . ILE A 1 28 ? -2.866  -1.337  -3.299  1.00 0.00 ?  584  ILE A HG21 1  
ATOM 416   H HG22 . ILE A 1 28 ? -1.964  -1.953  -4.669  1.00 0.00 ?  584  ILE A HG22 1  
ATOM 417   H HG23 . ILE A 1 28 ? -1.149  -0.956  -3.466  1.00 0.00 ?  584  ILE A HG23 1  
ATOM 418   H HD11 . ILE A 1 28 ? -3.439  -5.672  -1.915  1.00 0.00 ?  584  ILE A HD11 1  
ATOM 419   H HD12 . ILE A 1 28 ? -2.298  -4.794  -0.887  1.00 0.00 ?  584  ILE A HD12 1  
ATOM 420   H HD13 . ILE A 1 28 ? -1.718  -5.698  -2.295  1.00 0.00 ?  584  ILE A HD13 1  
ATOM 421   N N    . ASN A 1 29 ? -0.442  -3.745  -5.903  1.00 0.00 ?  585  ASN A N    1  
ATOM 422   C CA   . ASN A 1 29 ? -0.677  -4.304  -7.239  1.00 0.00 ?  585  ASN A CA   1  
ATOM 423   C C    . ASN A 1 29 ? 0.280   -5.480  -7.544  1.00 0.00 ?  585  ASN A C    1  
ATOM 424   O O    . ASN A 1 29 ? -0.073  -6.413  -8.281  1.00 0.00 ?  585  ASN A O    1  
ATOM 425   C CB   . ASN A 1 29 ? -0.525  -3.194  -8.300  1.00 0.00 ?  585  ASN A CB   1  
ATOM 426   C CG   . ASN A 1 29 ? -0.812  -3.653  -9.720  1.00 0.00 ?  585  ASN A CG   1  
ATOM 427   O OD1  . ASN A 1 29 ? -1.964  -3.644  -10.160 1.00 0.00 ?  585  ASN A OD1  1  
ATOM 428   N ND2  . ASN A 1 29 ? 0.213   -3.979  -10.463 1.00 0.00 ?  585  ASN A ND2  1  
ATOM 429   H H    . ASN A 1 29 ? -0.189  -2.801  -5.813  1.00 0.00 ?  585  ASN A H    1  
ATOM 430   H HA   . ASN A 1 29 ? -1.692  -4.671  -7.267  1.00 0.00 ?  585  ASN A HA   1  
ATOM 431   H HB2  . ASN A 1 29 ? -1.199  -2.383  -8.066  1.00 0.00 ?  585  ASN A HB2  1  
ATOM 432   H HB3  . ASN A 1 29 ? 0.487   -2.820  -8.257  1.00 0.00 ?  585  ASN A HB3  1  
ATOM 433   H HD21 . ASN A 1 29 ? 1.119   -3.908  -10.087 1.00 0.00 ?  585  ASN A HD21 1  
ATOM 434   H HD22 . ASN A 1 29 ? 0.057   -4.292  -11.380 1.00 0.00 ?  585  ASN A HD22 1  
ATOM 435   N N    . ARG A 1 30 ? 1.475   -5.443  -6.963  1.00 0.00 ?  586  ARG A N    1  
ATOM 436   C CA   . ARG A 1 30 ? 2.475   -6.491  -7.175  1.00 0.00 ?  586  ARG A CA   1  
ATOM 437   C C    . ARG A 1 30 ? 2.226   -7.694  -6.295  1.00 0.00 ?  586  ARG A C    1  
ATOM 438   O O    . ARG A 1 30 ? 2.658   -8.808  -6.620  1.00 0.00 ?  586  ARG A O    1  
ATOM 439   C CB   . ARG A 1 30 ? 3.904   -5.990  -6.916  1.00 0.00 ?  586  ARG A CB   1  
ATOM 440   C CG   . ARG A 1 30 ? 4.439   -4.982  -7.919  1.00 0.00 ?  586  ARG A CG   1  
ATOM 441   C CD   . ARG A 1 30 ? 4.406   -5.530  -9.342  1.00 0.00 ?  586  ARG A CD   1  
ATOM 442   N NE   . ARG A 1 30 ? 5.074   -6.835  -9.460  1.00 0.00 ?  586  ARG A NE   1  
ATOM 443   C CZ   . ARG A 1 30 ? 5.252   -7.511  -10.599 1.00 0.00 ?  586  ARG A CZ   1  
ATOM 444   N NH1  . ARG A 1 30 ? 4.915   -6.971  -11.764 1.00 0.00 1  586  ARG A NH1  1  
ATOM 445   N NH2  . ARG A 1 30 ? 5.794   -8.719  -10.566 1.00 0.00 ?  586  ARG A NH2  1  
ATOM 446   H H    . ARG A 1 30 ? 1.689   -4.697  -6.360  1.00 0.00 ?  586  ARG A H    1  
ATOM 447   H HA   . ARG A 1 30 ? 2.409   -6.806  -8.206  1.00 0.00 ?  586  ARG A HA   1  
ATOM 448   H HB2  . ARG A 1 30 ? 3.934   -5.530  -5.939  1.00 0.00 ?  586  ARG A HB2  1  
ATOM 449   H HB3  . ARG A 1 30 ? 4.563   -6.845  -6.910  1.00 0.00 ?  586  ARG A HB3  1  
ATOM 450   H HG2  . ARG A 1 30 ? 3.830   -4.091  -7.870  1.00 0.00 ?  586  ARG A HG2  1  
ATOM 451   H HG3  . ARG A 1 30 ? 5.458   -4.734  -7.658  1.00 0.00 ?  586  ARG A HG3  1  
ATOM 452   H HD2  . ARG A 1 30 ? 3.383   -5.621  -9.670  1.00 0.00 ?  586  ARG A HD2  1  
ATOM 453   H HD3  . ARG A 1 30 ? 4.922   -4.824  -9.974  1.00 0.00 ?  586  ARG A HD3  1  
ATOM 454   H HE   . ARG A 1 30 ? 5.385   -7.226  -8.610  1.00 0.00 ?  586  ARG A HE   1  
ATOM 455   H HH11 . ARG A 1 30 ? 4.524   -6.049  -11.836 1.00 0.00 ?  586  ARG A HH11 1  
ATOM 456   H HH12 . ARG A 1 30 ? 5.036   -7.468  -12.628 1.00 0.00 ?  586  ARG A HH12 1  
ATOM 457   H HH21 . ARG A 1 30 ? 6.077   -9.151  -9.707  1.00 0.00 ?  586  ARG A HH21 1  
ATOM 458   H HH22 . ARG A 1 30 ? 5.934   -9.257  -11.405 1.00 0.00 ?  586  ARG A HH22 1  
ATOM 459   N N    . LEU A 1 31 ? 1.534   -7.486  -5.208  1.00 0.00 ?  587  LEU A N    1  
ATOM 460   C CA   . LEU A 1 31 ? 1.304   -8.524  -4.241  1.00 0.00 ?  587  LEU A CA   1  
ATOM 461   C C    . LEU A 1 31 ? 0.222   -9.528  -4.695  1.00 0.00 ?  587  LEU A C    1  
ATOM 462   O O    . LEU A 1 31 ? -0.736  -9.154  -5.384  1.00 0.00 ?  587  LEU A O    1  
ATOM 463   C CB   . LEU A 1 31 ? 1.004   -7.902  -2.888  1.00 0.00 ?  587  LEU A CB   1  
ATOM 464   C CG   . LEU A 1 31 ? 2.220   -7.227  -2.258  1.00 0.00 ?  587  LEU A CG   1  
ATOM 465   C CD1  . LEU A 1 31 ? 1.837   -6.346  -1.105  1.00 0.00 ?  587  LEU A CD1  1  
ATOM 466   C CD2  . LEU A 1 31 ? 3.233   -8.242  -1.772  1.00 0.00 ?  587  LEU A CD2  1  
ATOM 467   H H    . LEU A 1 31 ? 1.134   -6.604  -5.049  1.00 0.00 ?  587  LEU A H    1  
ATOM 468   H HA   . LEU A 1 31 ? 2.276   -8.989  -4.167  1.00 0.00 ?  587  LEU A HA   1  
ATOM 469   H HB2  . LEU A 1 31 ? 0.220   -7.169  -3.014  1.00 0.00 ?  587  LEU A HB2  1  
ATOM 470   H HB3  . LEU A 1 31 ? 0.661   -8.673  -2.215  1.00 0.00 ?  587  LEU A HB3  1  
ATOM 471   H HG   . LEU A 1 31 ? 2.673   -6.693  -3.080  1.00 0.00 ?  587  LEU A HG   1  
ATOM 472   H HD11 . LEU A 1 31 ? 1.387   -5.431  -1.458  1.00 0.00 ?  587  LEU A HD11 1  
ATOM 473   H HD12 . LEU A 1 31 ? 2.716   -6.163  -0.499  1.00 0.00 ?  587  LEU A HD12 1  
ATOM 474   H HD13 . LEU A 1 31 ? 1.116   -6.892  -0.516  1.00 0.00 ?  587  LEU A HD13 1  
ATOM 475   H HD21 . LEU A 1 31 ? 2.756   -8.943  -1.105  1.00 0.00 ?  587  LEU A HD21 1  
ATOM 476   H HD22 . LEU A 1 31 ? 3.991   -7.720  -1.199  1.00 0.00 ?  587  LEU A HD22 1  
ATOM 477   H HD23 . LEU A 1 31 ? 3.690   -8.764  -2.598  1.00 0.00 ?  587  LEU A HD23 1  
ATOM 478   N N    . PRO A 1 32 ? 0.417   -10.833 -4.408  1.00 0.00 ?  588  PRO A N    1  
ATOM 479   C CA   . PRO A 1 32 ? -0.532  -11.898 -4.785  1.00 0.00 ?  588  PRO A CA   1  
ATOM 480   C C    . PRO A 1 32 ? -1.821  -11.912 -3.950  1.00 0.00 ?  588  PRO A C    1  
ATOM 481   O O    . PRO A 1 32 ? -1.942  -11.200 -2.936  1.00 0.00 ?  588  PRO A O    1  
ATOM 482   C CB   . PRO A 1 32 ? 0.255   -13.181 -4.543  1.00 0.00 ?  588  PRO A CB   1  
ATOM 483   C CG   . PRO A 1 32 ? 1.214   -12.821 -3.476  1.00 0.00 ?  588  PRO A CG   1  
ATOM 484   C CD   . PRO A 1 32 ? 1.609   -11.393 -3.742  1.00 0.00 ?  588  PRO A CD   1  
ATOM 485   H HA   . PRO A 1 32 ? -0.796  -11.832 -5.830  1.00 0.00 ?  588  PRO A HA   1  
ATOM 486   H HB2  . PRO A 1 32 ? -0.418  -13.965 -4.228  1.00 0.00 ?  588  PRO A HB2  1  
ATOM 487   H HB3  . PRO A 1 32 ? 0.763   -13.476 -5.448  1.00 0.00 ?  588  PRO A HB3  1  
ATOM 488   H HG2  . PRO A 1 32 ? 0.726   -12.906 -2.517  1.00 0.00 ?  588  PRO A HG2  1  
ATOM 489   H HG3  . PRO A 1 32 ? 2.076   -13.469 -3.523  1.00 0.00 ?  588  PRO A HG3  1  
ATOM 490   H HD2  . PRO A 1 32 ? 1.812   -10.875 -2.815  1.00 0.00 ?  588  PRO A HD2  1  
ATOM 491   H HD3  . PRO A 1 32 ? 2.469   -11.354 -4.396  1.00 0.00 ?  588  PRO A HD3  1  
ATOM 492   N N    . GLY A 1 33 ? -2.758  -12.766 -4.379  1.00 0.00 ?  589  GLY A N    1  
ATOM 493   C CA   . GLY A 1 33 ? -4.076  -12.917 -3.764  1.00 0.00 ?  589  GLY A CA   1  
ATOM 494   C C    . GLY A 1 33 ? -4.066  -13.096 -2.262  1.00 0.00 ?  589  GLY A C    1  
ATOM 495   O O    . GLY A 1 33 ? -4.895  -12.499 -1.552  1.00 0.00 ?  589  GLY A O    1  
ATOM 496   H H    . GLY A 1 33 ? -2.560  -13.310 -5.174  1.00 0.00 ?  589  GLY A H    1  
ATOM 497   H HA2  . GLY A 1 33 ? -4.667  -12.044 -3.994  1.00 0.00 ?  589  GLY A HA2  1  
ATOM 498   H HA3  . GLY A 1 33 ? -4.557  -13.774 -4.210  1.00 0.00 ?  589  GLY A HA3  1  
ATOM 499   N N    . GLU A 1 34 ? -3.140  -13.899 -1.770  1.00 0.00 ?  590  GLU A N    1  
ATOM 500   C CA   . GLU A 1 34 ? -3.025  -14.137 -0.342  1.00 0.00 ?  590  GLU A CA   1  
ATOM 501   C C    . GLU A 1 34 ? -2.605  -12.866 0.390   1.00 0.00 ?  590  GLU A C    1  
ATOM 502   O O    . GLU A 1 34 ? -3.122  -12.551 1.449   1.00 0.00 ?  590  GLU A O    1  
ATOM 503   C CB   . GLU A 1 34 ? -2.022  -15.259 -0.042  1.00 0.00 ?  590  GLU A CB   1  
ATOM 504   C CG   . GLU A 1 34 ? -0.622  -14.994 -0.577  1.00 0.00 ?  590  GLU A CG   1  
ATOM 505   C CD   . GLU A 1 34 ? 0.385   -15.983 -0.094  1.00 0.00 ?  590  GLU A CD   1  
ATOM 506   O OE1  . GLU A 1 34 ? 0.437   -17.106 -0.634  1.00 0.00 ?  590  GLU A OE1  1  
ATOM 507   O OE2  . GLU A 1 34 ? 1.165   -15.644 0.818   1.00 0.00 -1 590  GLU A OE2  1  
ATOM 508   H H    . GLU A 1 34 ? -2.532  -14.355 -2.388  1.00 0.00 ?  590  GLU A H    1  
ATOM 509   H HA   . GLU A 1 34 ? -3.998  -14.435 0.018   1.00 0.00 ?  590  GLU A HA   1  
ATOM 510   H HB2  . GLU A 1 34 ? -1.952  -15.387 1.028   1.00 0.00 ?  590  GLU A HB2  1  
ATOM 511   H HB3  . GLU A 1 34 ? -2.384  -16.177 -0.482  1.00 0.00 ?  590  GLU A HB3  1  
ATOM 512   H HG2  . GLU A 1 34 ? -0.643  -15.020 -1.656  1.00 0.00 ?  590  GLU A HG2  1  
ATOM 513   H HG3  . GLU A 1 34 ? -0.321  -14.008 -0.255  1.00 0.00 ?  590  GLU A HG3  1  
ATOM 514   N N    . LYS A 1 35 ? -1.707  -12.117 -0.217  1.00 0.00 ?  591  LYS A N    1  
ATOM 515   C CA   . LYS A 1 35 ? -1.153  -10.957 0.410   1.00 0.00 ?  591  LYS A CA   1  
ATOM 516   C C    . LYS A 1 35 ? -2.140  -9.811  0.422   1.00 0.00 ?  591  LYS A C    1  
ATOM 517   O O    . LYS A 1 35 ? -2.296  -9.161  1.457   1.00 0.00 ?  591  LYS A O    1  
ATOM 518   C CB   . LYS A 1 35 ? 0.177   -10.535 -0.237  1.00 0.00 ?  591  LYS A CB   1  
ATOM 519   C CG   . LYS A 1 35 ? 1.354   -11.516 -0.059  1.00 0.00 ?  591  LYS A CG   1  
ATOM 520   C CD   . LYS A 1 35 ? 1.662   -11.797 1.410   1.00 0.00 ?  591  LYS A CD   1  
ATOM 521   C CE   . LYS A 1 35 ? 2.996   -12.528 1.597   1.00 0.00 ?  591  LYS A CE   1  
ATOM 522   N NZ   . LYS A 1 35 ? 3.061   -13.806 0.856   1.00 0.00 1  591  LYS A NZ   1  
ATOM 523   H H    . LYS A 1 35 ? -1.442  -12.338 -1.135  1.00 0.00 ?  591  LYS A H    1  
ATOM 524   H HA   . LYS A 1 35 ? -0.955  -11.224 1.437   1.00 0.00 ?  591  LYS A HA   1  
ATOM 525   H HB2  . LYS A 1 35 ? 0.004   -10.421 -1.297  1.00 0.00 ?  591  LYS A HB2  1  
ATOM 526   H HB3  . LYS A 1 35 ? 0.468   -9.579  0.170   1.00 0.00 ?  591  LYS A HB3  1  
ATOM 527   H HG2  . LYS A 1 35 ? 1.106   -12.450 -0.539  1.00 0.00 ?  591  LYS A HG2  1  
ATOM 528   H HG3  . LYS A 1 35 ? 2.231   -11.095 -0.529  1.00 0.00 ?  591  LYS A HG3  1  
ATOM 529   H HD2  . LYS A 1 35 ? 1.705   -10.857 1.940   1.00 0.00 ?  591  LYS A HD2  1  
ATOM 530   H HD3  . LYS A 1 35 ? 0.868   -12.404 1.819   1.00 0.00 ?  591  LYS A HD3  1  
ATOM 531   H HE2  . LYS A 1 35 ? 3.792   -11.888 1.244   1.00 0.00 ?  591  LYS A HE2  1  
ATOM 532   H HE3  . LYS A 1 35 ? 3.140   -12.717 2.649   1.00 0.00 ?  591  LYS A HE3  1  
ATOM 533   H HZ1  . LYS A 1 35 ? 3.038   -13.626 -0.166  1.00 0.00 ?  591  LYS A HZ1  1  
ATOM 534   H HZ2  . LYS A 1 35 ? 2.263   -14.449 1.063   1.00 0.00 ?  591  LYS A HZ2  1  
ATOM 535   H HZ3  . LYS A 1 35 ? 3.944   -14.316 1.055   1.00 0.00 ?  591  LYS A HZ3  1  
ATOM 536   N N    . LEU A 1 36 ? -2.855  -9.609  -0.710  1.00 0.00 ?  592  LEU A N    1  
ATOM 537   C CA   . LEU A 1 36 ? -3.802  -8.489  -0.859  1.00 0.00 ?  592  LEU A CA   1  
ATOM 538   C C    . LEU A 1 36 ? -4.877  -8.543  0.222   1.00 0.00 ?  592  LEU A C    1  
ATOM 539   O O    . LEU A 1 36 ? -5.197  -7.529  0.835   1.00 0.00 ?  592  LEU A O    1  
ATOM 540   C CB   . LEU A 1 36 ? -4.430  -8.448  -2.306  1.00 0.00 ?  592  LEU A CB   1  
ATOM 541   C CG   . LEU A 1 36 ? -5.569  -9.476  -2.666  1.00 0.00 ?  592  LEU A CG   1  
ATOM 542   C CD1  . LEU A 1 36 ? -6.938  -8.901  -2.381  1.00 0.00 ?  592  LEU A CD1  1  
ATOM 543   C CD2  . LEU A 1 36 ? -5.544  -9.834  -4.117  1.00 0.00 ?  592  LEU A CD2  1  
ATOM 544   H H    . LEU A 1 36 ? -2.727  -10.215 -1.473  1.00 0.00 ?  592  LEU A H    1  
ATOM 545   H HA   . LEU A 1 36 ? -3.232  -7.584  -0.698  1.00 0.00 ?  592  LEU A HA   1  
ATOM 546   H HB2  . LEU A 1 36 ? -4.810  -7.447  -2.470  1.00 0.00 ?  592  LEU A HB2  1  
ATOM 547   H HB3  . LEU A 1 36 ? -3.619  -8.584  -3.007  1.00 0.00 ?  592  LEU A HB3  1  
ATOM 548   H HG   . LEU A 1 36 ? -5.444  -10.379 -2.087  1.00 0.00 ?  592  LEU A HG   1  
ATOM 549   H HD11 . LEU A 1 36 ? -7.685  -9.677  -2.458  1.00 0.00 ?  592  LEU A HD11 1  
ATOM 550   H HD12 . LEU A 1 36 ? -7.117  -8.197  -3.189  1.00 0.00 ?  592  LEU A HD12 1  
ATOM 551   H HD13 . LEU A 1 36 ? -6.968  -8.411  -1.419  1.00 0.00 ?  592  LEU A HD13 1  
ATOM 552   H HD21 . LEU A 1 36 ? -5.909  -8.951  -4.630  1.00 0.00 ?  592  LEU A HD21 1  
ATOM 553   H HD22 . LEU A 1 36 ? -6.198  -10.670 -4.312  1.00 0.00 ?  592  LEU A HD22 1  
ATOM 554   H HD23 . LEU A 1 36 ? -4.536  -10.043 -4.441  1.00 0.00 ?  592  LEU A HD23 1  
ATOM 555   N N    . GLY A 1 37 ? -5.377  -9.745  0.487   1.00 0.00 ?  593  GLY A N    1  
ATOM 556   C CA   . GLY A 1 37 ? -6.415  -9.922  1.475   1.00 0.00 ?  593  GLY A CA   1  
ATOM 557   C C    . GLY A 1 37 ? -5.918  -9.650  2.873   1.00 0.00 ?  593  GLY A C    1  
ATOM 558   O O    . GLY A 1 37 ? -6.616  -9.080  3.691   1.00 0.00 ?  593  GLY A O    1  
ATOM 559   H H    . GLY A 1 37 ? -5.027  -10.516 -0.009  1.00 0.00 ?  593  GLY A H    1  
ATOM 560   H HA2  . GLY A 1 37 ? -7.232  -9.251  1.254   1.00 0.00 ?  593  GLY A HA2  1  
ATOM 561   H HA3  . GLY A 1 37 ? -6.769  -10.940 1.424   1.00 0.00 ?  593  GLY A HA3  1  
ATOM 562   N N    . ARG A 1 38 ? -4.700  -10.040 3.134   1.00 0.00 ?  594  ARG A N    1  
ATOM 563   C CA   . ARG A 1 38 ? -4.113  -9.857  4.442   1.00 0.00 ?  594  ARG A CA   1  
ATOM 564   C C    . ARG A 1 38 ? -3.831  -8.400  4.708   1.00 0.00 ?  594  ARG A C    1  
ATOM 565   O O    . ARG A 1 38 ? -4.297  -7.841  5.698   1.00 0.00 ?  594  ARG A O    1  
ATOM 566   C CB   . ARG A 1 38 ? -2.843  -10.689 4.595   1.00 0.00 ?  594  ARG A CB   1  
ATOM 567   C CG   . ARG A 1 38 ? -3.108  -12.169 4.503   1.00 0.00 ?  594  ARG A CG   1  
ATOM 568   C CD   . ARG A 1 38 ? -1.855  -12.994 4.635   1.00 0.00 ?  594  ARG A CD   1  
ATOM 569   N NE   . ARG A 1 38 ? -2.181  -14.429 4.529   1.00 0.00 ?  594  ARG A NE   1  
ATOM 570   C CZ   . ARG A 1 38 ? -1.449  -15.442 5.018   1.00 0.00 ?  594  ARG A CZ   1  
ATOM 571   N NH1  . ARG A 1 38 ? -0.279  -15.208 5.601   1.00 0.00 1  594  ARG A NH1  1  
ATOM 572   N NH2  . ARG A 1 38 ? -1.896  -16.690 4.923   1.00 0.00 ?  594  ARG A NH2  1  
ATOM 573   H H    . ARG A 1 38 ? -4.185  -10.439 2.403   1.00 0.00 ?  594  ARG A H    1  
ATOM 574   H HA   . ARG A 1 38 ? -4.832  -10.192 5.173   1.00 0.00 ?  594  ARG A HA   1  
ATOM 575   H HB2  . ARG A 1 38 ? -2.150  -10.414 3.813   1.00 0.00 ?  594  ARG A HB2  1  
ATOM 576   H HB3  . ARG A 1 38 ? -2.394  -10.480 5.555   1.00 0.00 ?  594  ARG A HB3  1  
ATOM 577   H HG2  . ARG A 1 38 ? -3.781  -12.453 5.297   1.00 0.00 ?  594  ARG A HG2  1  
ATOM 578   H HG3  . ARG A 1 38 ? -3.571  -12.381 3.550   1.00 0.00 ?  594  ARG A HG3  1  
ATOM 579   H HD2  . ARG A 1 38 ? -1.162  -12.692 3.862   1.00 0.00 ?  594  ARG A HD2  1  
ATOM 580   H HD3  . ARG A 1 38 ? -1.410  -12.792 5.598   1.00 0.00 ?  594  ARG A HD3  1  
ATOM 581   H HE   . ARG A 1 38 ? -3.037  -14.613 4.076   1.00 0.00 ?  594  ARG A HE   1  
ATOM 582   H HH11 . ARG A 1 38 ? 0.093   -14.283 5.697   1.00 0.00 ?  594  ARG A HH11 1  
ATOM 583   H HH12 . ARG A 1 38 ? 0.285   -15.947 5.982   1.00 0.00 ?  594  ARG A HH12 1  
ATOM 584   H HH21 . ARG A 1 38 ? -2.773  -16.939 4.498   1.00 0.00 ?  594  ARG A HH21 1  
ATOM 585   H HH22 . ARG A 1 38 ? -1.369  -17.454 5.303   1.00 0.00 ?  594  ARG A HH22 1  
ATOM 586   N N    . VAL A 1 39 ? -3.130  -7.775  3.788   1.00 0.00 ?  595  VAL A N    1  
ATOM 587   C CA   . VAL A 1 39 ? -2.701  -6.399  3.944   1.00 0.00 ?  595  VAL A CA   1  
ATOM 588   C C    . VAL A 1 39 ? -3.846  -5.452  4.018   1.00 0.00 ?  595  VAL A C    1  
ATOM 589   O O    . VAL A 1 39 ? -3.842  -4.567  4.870   1.00 0.00 ?  595  VAL A O    1  
ATOM 590   C CB   . VAL A 1 39 ? -1.697  -5.969  2.852   1.00 0.00 ?  595  VAL A CB   1  
ATOM 591   C CG1  . VAL A 1 39 ? -2.263  -6.079  1.456   1.00 0.00 ?  595  VAL A CG1  1  
ATOM 592   C CG2  . VAL A 1 39 ? -1.192  -4.585  3.092   1.00 0.00 ?  595  VAL A CG2  1  
ATOM 593   H H    . VAL A 1 39 ? -2.907  -8.251  2.955   1.00 0.00 ?  595  VAL A H    1  
ATOM 594   H HA   . VAL A 1 39 ? -2.221  -6.274  4.905   1.00 0.00 ?  595  VAL A HA   1  
ATOM 595   H HB   . VAL A 1 39 ? -0.863  -6.646  2.929   1.00 0.00 ?  595  VAL A HB   1  
ATOM 596   H HG11 . VAL A 1 39 ? -3.116  -5.424  1.362   1.00 0.00 ?  595  VAL A HG11 1  
ATOM 597   H HG12 . VAL A 1 39 ? -2.571  -7.099  1.279   1.00 0.00 ?  595  VAL A HG12 1  
ATOM 598   H HG13 . VAL A 1 39 ? -1.504  -5.797  0.741   1.00 0.00 ?  595  VAL A HG13 1  
ATOM 599   H HG21 . VAL A 1 39 ? -2.023  -3.896  3.057   1.00 0.00 ?  595  VAL A HG21 1  
ATOM 600   H HG22 . VAL A 1 39 ? -0.484  -4.345  2.314   1.00 0.00 ?  595  VAL A HG22 1  
ATOM 601   H HG23 . VAL A 1 39 ? -0.710  -4.533  4.057   1.00 0.00 ?  595  VAL A HG23 1  
ATOM 602   N N    . VAL A 1 40 ? -4.858  -5.674  3.197   1.00 0.00 ?  596  VAL A N    1  
ATOM 603   C CA   . VAL A 1 40 ? -5.989  -4.800  3.168   1.00 0.00 ?  596  VAL A CA   1  
ATOM 604   C C    . VAL A 1 40 ? -6.643  -4.772  4.549   1.00 0.00 ?  596  VAL A C    1  
ATOM 605   O O    . VAL A 1 40 ? -7.037  -3.754  5.017   1.00 0.00 ?  596  VAL A O    1  
ATOM 606   C CB   . VAL A 1 40 ? -6.999  -5.191  2.039   1.00 0.00 ?  596  VAL A CB   1  
ATOM 607   C CG1  . VAL A 1 40 ? -7.844  -6.415  2.367   1.00 0.00 ?  596  VAL A CG1  1  
ATOM 608   C CG2  . VAL A 1 40 ? -7.839  -4.010  1.593   1.00 0.00 ?  596  VAL A CG2  1  
ATOM 609   H H    . VAL A 1 40 ? -4.836  -6.442  2.582   1.00 0.00 ?  596  VAL A H    1  
ATOM 610   H HA   . VAL A 1 40 ? -5.607  -3.808  2.970   1.00 0.00 ?  596  VAL A HA   1  
ATOM 611   H HB   . VAL A 1 40 ? -6.381  -5.496  1.208   1.00 0.00 ?  596  VAL A HB   1  
ATOM 612   H HG11 . VAL A 1 40 ? -8.508  -6.626  1.542   1.00 0.00 ?  596  VAL A HG11 1  
ATOM 613   H HG12 . VAL A 1 40 ? -8.424  -6.217  3.255   1.00 0.00 ?  596  VAL A HG12 1  
ATOM 614   H HG13 . VAL A 1 40 ? -7.198  -7.263  2.539   1.00 0.00 ?  596  VAL A HG13 1  
ATOM 615   H HG21 . VAL A 1 40 ? -8.522  -4.326  0.819   1.00 0.00 ?  596  VAL A HG21 1  
ATOM 616   H HG22 . VAL A 1 40 ? -7.195  -3.233  1.208   1.00 0.00 ?  596  VAL A HG22 1  
ATOM 617   H HG23 . VAL A 1 40 ? -8.401  -3.626  2.433   1.00 0.00 ?  596  VAL A HG23 1  
ATOM 618   N N    . HIS A 1 41 ? -6.595  -5.881  5.237   1.00 0.00 ?  597  HIS A N    1  
ATOM 619   C CA   . HIS A 1 41 ? -7.187  -5.964  6.571   1.00 0.00 ?  597  HIS A CA   1  
ATOM 620   C C    . HIS A 1 41 ? -6.327  -5.237  7.612   1.00 0.00 ?  597  HIS A C    1  
ATOM 621   O O    . HIS A 1 41 ? -6.854  -4.642  8.543   1.00 0.00 ?  597  HIS A O    1  
ATOM 622   C CB   . HIS A 1 41 ? -7.461  -7.408  7.011   1.00 0.00 ?  597  HIS A CB   1  
ATOM 623   C CG   . HIS A 1 41 ? -8.743  -8.011  6.496   1.00 0.00 ?  597  HIS A CG   1  
ATOM 624   N ND1  . HIS A 1 41 ? -9.805  -8.336  7.312   1.00 0.00 ?  597  HIS A ND1  1  
ATOM 625   C CD2  . HIS A 1 41 ? -9.106  -8.394  5.249   1.00 0.00 ?  597  HIS A CD2  1  
ATOM 626   C CE1  . HIS A 1 41 ? -10.753 -8.898  6.563   1.00 0.00 ?  597  HIS A CE1  1  
ATOM 627   N NE2  . HIS A 1 41 ? -10.383 -8.959  5.291   1.00 0.00 ?  597  HIS A NE2  1  
ATOM 628   H H    . HIS A 1 41 ? -6.096  -6.623  4.831   1.00 0.00 ?  597  HIS A H    1  
ATOM 629   H HA   . HIS A 1 41 ? -8.129  -5.433  6.492   1.00 0.00 ?  597  HIS A HA   1  
ATOM 630   H HB2  . HIS A 1 41 ? -6.653  -8.028  6.653   1.00 0.00 ?  597  HIS A HB2  1  
ATOM 631   H HB3  . HIS A 1 41 ? -7.478  -7.447  8.090   1.00 0.00 ?  597  HIS A HB3  1  
ATOM 632   H HD1  . HIS A 1 41 ? -9.862  -8.165  8.277   1.00 0.00 ?  597  HIS A HD1  1  
ATOM 633   H HD2  . HIS A 1 41 ? -8.508  -8.287  4.355   1.00 0.00 ?  597  HIS A HD2  1  
ATOM 634   H HE1  . HIS A 1 41 ? -11.700 -9.254  6.939   1.00 0.00 ?  597  HIS A HE1  1  
ATOM 635   N N    . ILE A 1 42 ? -5.007  -5.284  7.450   1.00 0.00 ?  598  ILE A N    1  
ATOM 636   C CA   . ILE A 1 42 ? -4.090  -4.593  8.366   1.00 0.00 ?  598  ILE A CA   1  
ATOM 637   C C    . ILE A 1 42 ? -4.210  -3.082  8.183   1.00 0.00 ?  598  ILE A C    1  
ATOM 638   O O    . ILE A 1 42 ? -4.307  -2.323  9.162   1.00 0.00 ?  598  ILE A O    1  
ATOM 639   C CB   . ILE A 1 42 ? -2.579  -5.054  8.191   1.00 0.00 ?  598  ILE A CB   1  
ATOM 640   C CG1  . ILE A 1 42 ? -2.271  -6.381  8.927   1.00 0.00 ?  598  ILE A CG1  1  
ATOM 641   C CG2  . ILE A 1 42 ? -1.583  -3.983  8.642   1.00 0.00 ?  598  ILE A CG2  1  
ATOM 642   C CD1  . ILE A 1 42 ? -3.020  -7.592  8.449   1.00 0.00 ?  598  ILE A CD1  1  
ATOM 643   H H    . ILE A 1 42 ? -4.641  -5.778  6.685   1.00 0.00 ?  598  ILE A H    1  
ATOM 644   H HA   . ILE A 1 42 ? -4.414  -4.831  9.369   1.00 0.00 ?  598  ILE A HA   1  
ATOM 645   H HB   . ILE A 1 42 ? -2.437  -5.204  7.131   1.00 0.00 ?  598  ILE A HB   1  
ATOM 646   H HG12 . ILE A 1 42 ? -1.219  -6.602  8.827   1.00 0.00 ?  598  ILE A HG12 1  
ATOM 647   H HG13 . ILE A 1 42 ? -2.489  -6.246  9.977   1.00 0.00 ?  598  ILE A HG13 1  
ATOM 648   H HG21 . ILE A 1 42 ? -1.737  -3.770  9.689   1.00 0.00 ?  598  ILE A HG21 1  
ATOM 649   H HG22 . ILE A 1 42 ? -1.739  -3.080  8.071   1.00 0.00 ?  598  ILE A HG22 1  
ATOM 650   H HG23 . ILE A 1 42 ? -0.574  -4.338  8.492   1.00 0.00 ?  598  ILE A HG23 1  
ATOM 651   H HD11 . ILE A 1 42 ? -4.080  -7.424  8.573   1.00 0.00 ?  598  ILE A HD11 1  
ATOM 652   H HD12 . ILE A 1 42 ? -2.720  -8.458  9.020   1.00 0.00 ?  598  ILE A HD12 1  
ATOM 653   H HD13 . ILE A 1 42 ? -2.805  -7.753  7.402   1.00 0.00 ?  598  ILE A HD13 1  
ATOM 654   N N    . ILE A 1 43 ? -4.230  -2.655  6.938   1.00 0.00 ?  599  ILE A N    1  
ATOM 655   C CA   . ILE A 1 43 ? -4.324  -1.216  6.626   1.00 0.00 ?  599  ILE A CA   1  
ATOM 656   C C    . ILE A 1 43 ? -5.662  -0.648  7.107   1.00 0.00 ?  599  ILE A C    1  
ATOM 657   O O    . ILE A 1 43 ? -5.717  0.370   7.810   1.00 0.00 ?  599  ILE A O    1  
ATOM 658   C CB   . ILE A 1 43 ? -4.167  -0.911  5.101   1.00 0.00 ?  599  ILE A CB   1  
ATOM 659   C CG1  . ILE A 1 43 ? -3.014  -1.715  4.455   1.00 0.00 ?  599  ILE A CG1  1  
ATOM 660   C CG2  . ILE A 1 43 ? -3.958  0.579   4.875   1.00 0.00 ?  599  ILE A CG2  1  
ATOM 661   C CD1  . ILE A 1 43 ? -1.713  -1.697  5.205   1.00 0.00 ?  599  ILE A CD1  1  
ATOM 662   H H    . ILE A 1 43 ? -4.130  -3.339  6.230   1.00 0.00 ?  599  ILE A H    1  
ATOM 663   H HA   . ILE A 1 43 ? -3.569  -0.673  7.176   1.00 0.00 ?  599  ILE A HA   1  
ATOM 664   H HB   . ILE A 1 43 ? -5.096  -1.180  4.621   1.00 0.00 ?  599  ILE A HB   1  
ATOM 665   H HG12 . ILE A 1 43 ? -3.292  -2.756  4.379   1.00 0.00 ?  599  ILE A HG12 1  
ATOM 666   H HG13 . ILE A 1 43 ? -2.830  -1.329  3.462   1.00 0.00 ?  599  ILE A HG13 1  
ATOM 667   H HG21 . ILE A 1 43 ? -4.804  1.123   5.269   1.00 0.00 ?  599  ILE A HG21 1  
ATOM 668   H HG22 . ILE A 1 43 ? -3.863  0.774   3.817   1.00 0.00 ?  599  ILE A HG22 1  
ATOM 669   H HG23 . ILE A 1 43 ? -3.059  0.897   5.384   1.00 0.00 ?  599  ILE A HG23 1  
ATOM 670   H HD11 . ILE A 1 43 ? -0.975  -2.251  4.643   1.00 0.00 ?  599  ILE A HD11 1  
ATOM 671   H HD12 . ILE A 1 43 ? -1.891  -2.215  6.138   1.00 0.00 ?  599  ILE A HD12 1  
ATOM 672   H HD13 . ILE A 1 43 ? -1.386  -0.684  5.382   1.00 0.00 ?  599  ILE A HD13 1  
ATOM 673   N N    . GLN A 1 44 ? -6.725  -1.347  6.786   1.00 0.00 ?  600  GLN A N    1  
ATOM 674   C CA   . GLN A 1 44 ? -8.070  -0.935  7.105   1.00 0.00 ?  600  GLN A CA   1  
ATOM 675   C C    . GLN A 1 44 ? -8.414  -1.152  8.540   1.00 0.00 ?  600  GLN A C    1  
ATOM 676   O O    . GLN A 1 44 ? -9.464  -0.739  9.005   1.00 0.00 ?  600  GLN A O    1  
ATOM 677   C CB   . GLN A 1 44 ? -9.019  -1.637  6.203   1.00 0.00 ?  600  GLN A CB   1  
ATOM 678   C CG   . GLN A 1 44 ? -8.632  -1.429  4.772   1.00 0.00 ?  600  GLN A CG   1  
ATOM 679   C CD   . GLN A 1 44 ? -9.672  -1.830  3.778   1.00 0.00 ?  600  GLN A CD   1  
ATOM 680   O OE1  . GLN A 1 44 ? -9.698  -1.342  2.698   1.00 0.00 ?  600  GLN A OE1  1  
ATOM 681   N NE2  . GLN A 1 44 ? -10.563 -2.665  4.159   1.00 0.00 ?  600  GLN A NE2  1  
ATOM 682   H H    . GLN A 1 44 ? -6.649  -2.187  6.280   1.00 0.00 ?  600  GLN A H    1  
ATOM 683   H HA   . GLN A 1 44 ? -8.193  0.127   6.939   1.00 0.00 ?  600  GLN A HA   1  
ATOM 684   H HB2  . GLN A 1 44 ? -9.000  -2.695  6.427   1.00 0.00 ?  600  GLN A HB2  1  
ATOM 685   H HB3  . GLN A 1 44 ? -10.014 -1.251  6.350   1.00 0.00 ?  600  GLN A HB3  1  
ATOM 686   H HG2  . GLN A 1 44 ? -8.383  -0.386  4.666   1.00 0.00 ?  600  GLN A HG2  1  
ATOM 687   H HG3  . GLN A 1 44 ? -7.743  -2.027  4.645   1.00 0.00 ?  600  GLN A HG3  1  
ATOM 688   H HE21 . GLN A 1 44 ? -10.472 -2.976  5.081   1.00 0.00 ?  600  GLN A HE21 1  
ATOM 689   H HE22 . GLN A 1 44 ? -11.298 -2.958  3.586   1.00 0.00 ?  600  GLN A HE22 1  
ATOM 690   N N    . SER A 1 45 ? -7.522  -1.756  9.268   1.00 0.00 ?  601  SER A N    1  
ATOM 691   C CA   . SER A 1 45 ? -7.754  -1.945  10.654  1.00 0.00 ?  601  SER A CA   1  
ATOM 692   C C    . SER A 1 45 ? -7.583  -0.591  11.385  1.00 0.00 ?  601  SER A C    1  
ATOM 693   O O    . SER A 1 45 ? -7.923  -0.453  12.559  1.00 0.00 ?  601  SER A O    1  
ATOM 694   C CB   . SER A 1 45 ? -6.818  -3.023  11.232  1.00 0.00 ?  601  SER A CB   1  
ATOM 695   O OG   . SER A 1 45 ? -7.142  -3.351  12.582  1.00 0.00 ?  601  SER A OG   1  
ATOM 696   H H    . SER A 1 45 ? -6.699  -2.098  8.859   1.00 0.00 ?  601  SER A H    1  
ATOM 697   H HA   . SER A 1 45 ? -8.773  -2.295  10.662  1.00 0.00 ?  601  SER A HA   1  
ATOM 698   H HB2  . SER A 1 45 ? -6.895  -3.916  10.632  1.00 0.00 ?  601  SER A HB2  1  
ATOM 699   H HB3  . SER A 1 45 ? -5.802  -2.660  11.198  1.00 0.00 ?  601  SER A HB3  1  
ATOM 700   H HG   . SER A 1 45 ? -6.915  -2.600  13.142  1.00 0.00 ?  601  SER A HG   1  
ATOM 701   N N    . ARG A 1 46 ? -7.060  0.392   10.661  1.00 0.00 ?  602  ARG A N    1  
ATOM 702   C CA   . ARG A 1 46 ? -6.810  1.706   11.194  1.00 0.00 ?  602  ARG A CA   1  
ATOM 703   C C    . ARG A 1 46 ? -7.943  2.673   10.838  1.00 0.00 ?  602  ARG A C    1  
ATOM 704   O O    . ARG A 1 46 ? -8.621  3.204   11.723  1.00 0.00 ?  602  ARG A O    1  
ATOM 705   C CB   . ARG A 1 46 ? -5.489  2.218   10.649  1.00 0.00 ?  602  ARG A CB   1  
ATOM 706   C CG   . ARG A 1 46 ? -4.334  1.285   10.936  1.00 0.00 ?  602  ARG A CG   1  
ATOM 707   C CD   . ARG A 1 46 ? -3.048  1.780   10.339  1.00 0.00 ?  602  ARG A CD   1  
ATOM 708   N NE   . ARG A 1 46 ? -2.631  3.064   10.895  1.00 0.00 ?  602  ARG A NE   1  
ATOM 709   C CZ   . ARG A 1 46 ? -1.362  3.459   10.997  1.00 0.00 ?  602  ARG A CZ   1  
ATOM 710   N NH1  . ARG A 1 46 ? -0.382  2.584   10.842  1.00 0.00 1  602  ARG A NH1  1  
ATOM 711   N NH2  . ARG A 1 46 ? -1.080  4.704   11.353  1.00 0.00 ?  602  ARG A NH2  1  
ATOM 712   H H    . ARG A 1 46 ? -6.838  0.202   9.724   1.00 0.00 ?  602  ARG A H    1  
ATOM 713   H HA   . ARG A 1 46 ? -6.733  1.630   12.267  1.00 0.00 ?  602  ARG A HA   1  
ATOM 714   H HB2  . ARG A 1 46 ? -5.577  2.339   9.579   1.00 0.00 ?  602  ARG A HB2  1  
ATOM 715   H HB3  . ARG A 1 46 ? -5.270  3.177   11.093  1.00 0.00 ?  602  ARG A HB3  1  
ATOM 716   H HG2  . ARG A 1 46 ? -4.204  1.211   12.004  1.00 0.00 ?  602  ARG A HG2  1  
ATOM 717   H HG3  . ARG A 1 46 ? -4.565  0.312   10.528  1.00 0.00 ?  602  ARG A HG3  1  
ATOM 718   H HD2  . ARG A 1 46 ? -2.275  1.050   10.531  1.00 0.00 ?  602  ARG A HD2  1  
ATOM 719   H HD3  . ARG A 1 46 ? -3.178  1.886   9.273   1.00 0.00 ?  602  ARG A HD3  1  
ATOM 720   H HE   . ARG A 1 46 ? -3.363  3.665   11.164  1.00 0.00 ?  602  ARG A HE   1  
ATOM 721   H HH11 . ARG A 1 46 ? -0.537  1.601   10.662  1.00 0.00 ?  602  ARG A HH11 1  
ATOM 722   H HH12 . ARG A 1 46 ? 0.579   2.865   10.885  1.00 0.00 ?  602  ARG A HH12 1  
ATOM 723   H HH21 . ARG A 1 46 ? -1.800  5.374   11.552  1.00 0.00 ?  602  ARG A HH21 1  
ATOM 724   H HH22 . ARG A 1 46 ? -0.133  5.030   11.445  1.00 0.00 ?  602  ARG A HH22 1  
ATOM 725   N N    . GLU A 1 47 ? -8.161  2.887   9.555   1.00 0.00 ?  603  GLU A N    1  
ATOM 726   C CA   . GLU A 1 47 ? -9.193  3.837   9.105   1.00 0.00 ?  603  GLU A CA   1  
ATOM 727   C C    . GLU A 1 47 ? -10.571 3.186   9.016   1.00 0.00 ?  603  GLU A C    1  
ATOM 728   O O    . GLU A 1 47 ? -10.673 2.048   8.626   1.00 0.00 ?  603  GLU A O    1  
ATOM 729   C CB   . GLU A 1 47 ? -8.822  4.424   7.743   1.00 0.00 ?  603  GLU A CB   1  
ATOM 730   C CG   . GLU A 1 47 ? -7.685  5.423   7.782   1.00 0.00 ?  603  GLU A CG   1  
ATOM 731   C CD   . GLU A 1 47 ? -8.064  6.698   8.492   1.00 0.00 ?  603  GLU A CD   1  
ATOM 732   O OE1  . GLU A 1 47 ? -7.736  6.858   9.680   1.00 0.00 ?  603  GLU A OE1  1  
ATOM 733   O OE2  . GLU A 1 47 ? -8.706  7.561   7.876   1.00 0.00 -1 603  GLU A OE2  1  
ATOM 734   H H    . GLU A 1 47 ? -7.635  2.387   8.893   1.00 0.00 ?  603  GLU A H    1  
ATOM 735   H HA   . GLU A 1 47 ? -9.230  4.642   9.825   1.00 0.00 ?  603  GLU A HA   1  
ATOM 736   H HB2  . GLU A 1 47 ? -8.541  3.617   7.083   1.00 0.00 ?  603  GLU A HB2  1  
ATOM 737   H HB3  . GLU A 1 47 ? -9.693  4.916   7.335   1.00 0.00 ?  603  GLU A HB3  1  
ATOM 738   H HG2  . GLU A 1 47 ? -6.853  4.975   8.304   1.00 0.00 ?  603  GLU A HG2  1  
ATOM 739   H HG3  . GLU A 1 47 ? -7.386  5.663   6.773   1.00 0.00 ?  603  GLU A HG3  1  
ATOM 740   N N    . PRO A 1 48 ? -11.645 3.894   9.423   1.00 0.00 ?  604  PRO A N    1  
ATOM 741   C CA   . PRO A 1 48 ? -13.027 3.404   9.251   1.00 0.00 ?  604  PRO A CA   1  
ATOM 742   C C    . PRO A 1 48 ? -13.529 3.684   7.815   1.00 0.00 ?  604  PRO A C    1  
ATOM 743   O O    . PRO A 1 48 ? -14.400 3.002   7.285   1.00 0.00 ?  604  PRO A O    1  
ATOM 744   C CB   . PRO A 1 48 ? -13.813 4.222   10.273  1.00 0.00 ?  604  PRO A CB   1  
ATOM 745   C CG   . PRO A 1 48 ? -13.047 5.499   10.431  1.00 0.00 ?  604  PRO A CG   1  
ATOM 746   C CD   . PRO A 1 48 ? -11.599 5.190   10.145  1.00 0.00 ?  604  PRO A CD   1  
ATOM 747   H HA   . PRO A 1 48 ? -13.102 2.346   9.461   1.00 0.00 ?  604  PRO A HA   1  
ATOM 748   H HB2  . PRO A 1 48 ? -14.811 4.398   9.899   1.00 0.00 ?  604  PRO A HB2  1  
ATOM 749   H HB3  . PRO A 1 48 ? -13.867 3.682   11.207  1.00 0.00 ?  604  PRO A HB3  1  
ATOM 750   H HG2  . PRO A 1 48 ? -13.412 6.232   9.728   1.00 0.00 ?  604  PRO A HG2  1  
ATOM 751   H HG3  . PRO A 1 48 ? -13.160 5.862   11.441  1.00 0.00 ?  604  PRO A HG3  1  
ATOM 752   H HD2  . PRO A 1 48 ? -11.168 5.958   9.519   1.00 0.00 ?  604  PRO A HD2  1  
ATOM 753   H HD3  . PRO A 1 48 ? -11.042 5.097   11.067  1.00 0.00 ?  604  PRO A HD3  1  
ATOM 754   N N    . SER A 1 49 ? -12.883 4.648   7.202   1.00 0.00 ?  605  SER A N    1  
ATOM 755   C CA   . SER A 1 49 ? -13.094 5.133   5.833   1.00 0.00 ?  605  SER A CA   1  
ATOM 756   C C    . SER A 1 49 ? -12.376 4.201   4.837   1.00 0.00 ?  605  SER A C    1  
ATOM 757   O O    . SER A 1 49 ? -12.364 4.435   3.631   1.00 0.00 ?  605  SER A O    1  
ATOM 758   C CB   . SER A 1 49 ? -12.504 6.531   5.752   1.00 0.00 ?  605  SER A CB   1  
ATOM 759   O OG   . SER A 1 49 ? -12.917 7.299   6.873   1.00 0.00 ?  605  SER A OG   1  
ATOM 760   H H    . SER A 1 49 ? -12.189 5.111   7.717   1.00 0.00 ?  605  SER A H    1  
ATOM 761   H HA   . SER A 1 49 ? -14.151 5.173   5.619   1.00 0.00 ?  605  SER A HA   1  
ATOM 762   H HB2  . SER A 1 49 ? -11.426 6.466   5.743   1.00 0.00 ?  605  SER A HB2  1  
ATOM 763   H HB3  . SER A 1 49 ? -12.852 7.014   4.851   1.00 0.00 ?  605  SER A HB3  1  
ATOM 764   H HG   . SER A 1 49 ? -13.815 7.024   7.091   1.00 0.00 ?  605  SER A HG   1  
ATOM 765   N N    . LEU A 1 50 ? -11.852 3.134   5.398   1.00 0.00 ?  606  LEU A N    1  
ATOM 766   C CA   . LEU A 1 50 ? -10.809 2.280   4.871   1.00 0.00 ?  606  LEU A CA   1  
ATOM 767   C C    . LEU A 1 50 ? -10.777 1.984   3.353   1.00 0.00 ?  606  LEU A C    1  
ATOM 768   O O    . LEU A 1 50 ? -9.945  2.587   2.669   1.00 0.00 ?  606  LEU A O    1  
ATOM 769   C CB   . LEU A 1 50 ? -10.826 1.001   5.717   1.00 0.00 ?  606  LEU A CB   1  
ATOM 770   C CG   . LEU A 1 50 ? -12.221 0.436   6.214   1.00 0.00 ?  606  LEU A CG   1  
ATOM 771   C CD1  . LEU A 1 50 ? -13.010 -0.246  5.128   1.00 0.00 ?  606  LEU A CD1  1  
ATOM 772   C CD2  . LEU A 1 50 ? -12.049 -0.513  7.376   1.00 0.00 ?  606  LEU A CD2  1  
ATOM 773   H H    . LEU A 1 50 ? -12.216 2.909   6.277   1.00 0.00 ?  606  LEU A H    1  
ATOM 774   H HA   . LEU A 1 50 ? -9.874  2.759   5.114   1.00 0.00 ?  606  LEU A HA   1  
ATOM 775   H HB2  . LEU A 1 50 ? -10.374 0.236   5.105   1.00 0.00 ?  606  LEU A HB2  1  
ATOM 776   H HB3  . LEU A 1 50 ? -10.201 1.162   6.583   1.00 0.00 ?  606  LEU A HB3  1  
ATOM 777   H HG   . LEU A 1 50 ? -12.820 1.266   6.558   1.00 0.00 ?  606  LEU A HG   1  
ATOM 778   H HD11 . LEU A 1 50 ? -12.350 -0.961  4.657   1.00 0.00 ?  606  LEU A HD11 1  
ATOM 779   H HD12 . LEU A 1 50 ? -13.386 0.481   4.425   1.00 0.00 ?  606  LEU A HD12 1  
ATOM 780   H HD13 . LEU A 1 50 ? -13.836 -0.775  5.576   1.00 0.00 ?  606  LEU A HD13 1  
ATOM 781   H HD21 . LEU A 1 50 ? -11.280 -0.117  8.026   1.00 0.00 ?  606  LEU A HD21 1  
ATOM 782   H HD22 . LEU A 1 50 ? -11.781 -1.498  7.026   1.00 0.00 ?  606  LEU A HD22 1  
ATOM 783   H HD23 . LEU A 1 50 ? -12.975 -0.572  7.927   1.00 0.00 ?  606  LEU A HD23 1  
ATOM 784   N N    . ARG A 1 51 ? -11.591 1.103   2.790   1.00 0.00 ?  607  ARG A N    1  
ATOM 785   C CA   . ARG A 1 51 ? -11.521 1.034   1.365   1.00 0.00 ?  607  ARG A CA   1  
ATOM 786   C C    . ARG A 1 51 ? -12.524 1.975   0.761   1.00 0.00 ?  607  ARG A C    1  
ATOM 787   O O    . ARG A 1 51 ? -12.206 2.799   -0.055  1.00 0.00 ?  607  ARG A O    1  
ATOM 788   C CB   . ARG A 1 51 ? -11.605 -0.376  0.782   1.00 0.00 ?  607  ARG A CB   1  
ATOM 789   C CG   . ARG A 1 51 ? -12.829 -1.164  1.078   1.00 0.00 ?  607  ARG A CG   1  
ATOM 790   C CD   . ARG A 1 51 ? -12.628 -2.577  0.615   1.00 0.00 ?  607  ARG A CD   1  
ATOM 791   N NE   . ARG A 1 51 ? -11.628 -3.285  1.425   1.00 0.00 ?  607  ARG A NE   1  
ATOM 792   C CZ   . ARG A 1 51 ? -11.669 -4.608  1.662   1.00 0.00 ?  607  ARG A CZ   1  
ATOM 793   N NH1  . ARG A 1 51 ? -12.386 -5.392  0.887   1.00 0.00 1  607  ARG A NH1  1  
ATOM 794   N NH2  . ARG A 1 51 ? -10.933 -5.148  2.622   1.00 0.00 ?  607  ARG A NH2  1  
ATOM 795   H H    . ARG A 1 51 ? -12.170 0.535   3.327   1.00 0.00 ?  607  ARG A H    1  
ATOM 796   H HA   . ARG A 1 51 ? -10.501 1.376   1.287   1.00 0.00 ?  607  ARG A HA   1  
ATOM 797   H HB2  . ARG A 1 51 ? -11.526 -0.298  -0.292  1.00 0.00 ?  607  ARG A HB2  1  
ATOM 798   H HB3  . ARG A 1 51 ? -10.750 -0.932  1.138   1.00 0.00 ?  607  ARG A HB3  1  
ATOM 799   H HG2  . ARG A 1 51 ? -13.008 -1.154  2.143   1.00 0.00 ?  607  ARG A HG2  1  
ATOM 800   H HG3  . ARG A 1 51 ? -13.669 -0.733  0.554   1.00 0.00 ?  607  ARG A HG3  1  
ATOM 801   H HD2  . ARG A 1 51 ? -13.569 -3.102  0.684   1.00 0.00 ?  607  ARG A HD2  1  
ATOM 802   H HD3  . ARG A 1 51 ? -12.300 -2.563  -0.413  1.00 0.00 ?  607  ARG A HD3  1  
ATOM 803   H HE   . ARG A 1 51 ? -10.967 -2.685  1.847   1.00 0.00 ?  607  ARG A HE   1  
ATOM 804   H HH11 . ARG A 1 51 ? -12.902 -5.034  0.097   1.00 0.00 ?  607  ARG A HH11 1  
ATOM 805   H HH12 . ARG A 1 51 ? -12.452 -6.382  1.055   1.00 0.00 ?  607  ARG A HH12 1  
ATOM 806   H HH21 . ARG A 1 51 ? -10.308 -4.642  3.224   1.00 0.00 ?  607  ARG A HH21 1  
ATOM 807   H HH22 . ARG A 1 51 ? -10.988 -6.138  2.792   1.00 0.00 ?  607  ARG A HH22 1  
ATOM 808   N N    . ASP A 1 52 ? -13.747 1.821   1.196   1.00 0.00 ?  608  ASP A N    1  
ATOM 809   C CA   . ASP A 1 52 ? -14.827 2.747   0.929   1.00 0.00 ?  608  ASP A CA   1  
ATOM 810   C C    . ASP A 1 52 ? -15.746 2.631   2.113   1.00 0.00 ?  608  ASP A C    1  
ATOM 811   O O    . ASP A 1 52 ? -16.138 3.610   2.729   1.00 0.00 ?  608  ASP A O    1  
ATOM 812   C CB   . ASP A 1 52 ? -15.581 2.356   -0.345  1.00 0.00 ?  608  ASP A CB   1  
ATOM 813   C CG   . ASP A 1 52 ? -16.599 3.394   -0.764  1.00 0.00 ?  608  ASP A CG   1  
ATOM 814   O OD1  . ASP A 1 52 ? -16.337 4.136   -1.736  1.00 0.00 ?  608  ASP A OD1  1  
ATOM 815   O OD2  . ASP A 1 52 ? -17.654 3.509   -0.134  1.00 0.00 -1 608  ASP A OD2  1  
ATOM 816   H H    . ASP A 1 52 ? -13.923 1.046   1.761   1.00 0.00 ?  608  ASP A H    1  
ATOM 817   H HA   . ASP A 1 52 ? -14.432 3.749   0.854   1.00 0.00 ?  608  ASP A HA   1  
ATOM 818   H HB2  . ASP A 1 52 ? -14.872 2.230   -1.148  1.00 0.00 ?  608  ASP A HB2  1  
ATOM 819   H HB3  . ASP A 1 52 ? -16.093 1.420   -0.177  1.00 0.00 ?  608  ASP A HB3  1  
ATOM 820   N N    . SER A 1 53 ? -16.000 1.344   2.427   1.00 0.00 ?  609  SER A N    1  
ATOM 821   C CA   . SER A 1 53 ? -16.769 0.781   3.551   1.00 0.00 ?  609  SER A CA   1  
ATOM 822   C C    . SER A 1 53 ? -17.050 -0.687  3.211   1.00 0.00 ?  609  SER A C    1  
ATOM 823   O O    . SER A 1 53 ? -16.858 -1.578  4.037   1.00 0.00 ?  609  SER A O    1  
ATOM 824   C CB   . SER A 1 53 ? -18.108 1.516   3.851   1.00 0.00 ?  609  SER A CB   1  
ATOM 825   O OG   . SER A 1 53 ? -17.889 2.785   4.448   1.00 0.00 ?  609  SER A OG   1  
ATOM 826   H H    . SER A 1 53 ? -15.668 0.681   1.788   1.00 0.00 ?  609  SER A H    1  
ATOM 827   H HA   . SER A 1 53 ? -16.118 0.800   4.415   1.00 0.00 ?  609  SER A HA   1  
ATOM 828   H HB2  . SER A 1 53 ? -18.648 1.668   2.929   1.00 0.00 ?  609  SER A HB2  1  
ATOM 829   H HB3  . SER A 1 53 ? -18.704 0.914   4.521   1.00 0.00 ?  609  SER A HB3  1  
ATOM 830   H HG   . SER A 1 53 ? -17.340 3.287   3.827   1.00 0.00 ?  609  SER A HG   1  
ATOM 831   N N    . ASN A 1 54 ? -17.460 -0.908  1.953   1.00 0.00 ?  610  ASN A N    1  
ATOM 832   C CA   . ASN A 1 54 ? -17.766 -2.246  1.392   1.00 0.00 ?  610  ASN A CA   1  
ATOM 833   C C    . ASN A 1 54 ? -16.556 -3.180  1.442   1.00 0.00 ?  610  ASN A C    1  
ATOM 834   O O    . ASN A 1 54 ? -15.543 -2.888  0.855   1.00 0.00 ?  610  ASN A O    1  
ATOM 835   C CB   . ASN A 1 54 ? -18.237 -2.105  -0.067  1.00 0.00 ?  610  ASN A CB   1  
ATOM 836   C CG   . ASN A 1 54 ? -18.479 -3.445  -0.754  1.00 0.00 ?  610  ASN A CG   1  
ATOM 837   O OD1  . ASN A 1 54 ? -17.578 -4.026  -1.378  1.00 0.00 ?  610  ASN A OD1  1  
ATOM 838   N ND2  . ASN A 1 54 ? -19.673 -3.936  -0.660  1.00 0.00 ?  610  ASN A ND2  1  
ATOM 839   H H    . ASN A 1 54 ? -17.607 -0.134  1.365   1.00 0.00 ?  610  ASN A H    1  
ATOM 840   H HA   . ASN A 1 54 ? -18.571 -2.673  1.969   1.00 0.00 ?  610  ASN A HA   1  
ATOM 841   H HB2  . ASN A 1 54 ? -19.167 -1.556  -0.079  1.00 0.00 ?  610  ASN A HB2  1  
ATOM 842   H HB3  . ASN A 1 54 ? -17.495 -1.557  -0.627  1.00 0.00 ?  610  ASN A HB3  1  
ATOM 843   H HD21 . ASN A 1 54 ? -20.342 -3.418  -0.158  1.00 0.00 ?  610  ASN A HD21 1  
ATOM 844   H HD22 . ASN A 1 54 ? -19.895 -4.794  -1.078  1.00 0.00 ?  610  ASN A HD22 1  
ATOM 845   N N    . PRO A 1 55 ? -16.665 -4.315  2.141   1.00 0.00 ?  611  PRO A N    1  
ATOM 846   C CA   . PRO A 1 55 ? -15.570 -5.278  2.293   1.00 0.00 ?  611  PRO A CA   1  
ATOM 847   C C    . PRO A 1 55 ? -15.507 -6.362  1.190   1.00 0.00 ?  611  PRO A C    1  
ATOM 848   O O    . PRO A 1 55 ? -14.640 -7.243  1.230   1.00 0.00 ?  611  PRO A O    1  
ATOM 849   C CB   . PRO A 1 55 ? -15.880 -5.912  3.635   1.00 0.00 ?  611  PRO A CB   1  
ATOM 850   C CG   . PRO A 1 55 ? -17.374 -5.944  3.689   1.00 0.00 ?  611  PRO A CG   1  
ATOM 851   C CD   . PRO A 1 55 ? -17.861 -4.746  2.906   1.00 0.00 ?  611  PRO A CD   1  
ATOM 852   H HA   . PRO A 1 55 ? -14.614 -4.779  2.354   1.00 0.00 ?  611  PRO A HA   1  
ATOM 853   H HB2  . PRO A 1 55 ? -15.455 -6.906  3.662   1.00 0.00 ?  611  PRO A HB2  1  
ATOM 854   H HB3  . PRO A 1 55 ? -15.459 -5.306  4.425   1.00 0.00 ?  611  PRO A HB3  1  
ATOM 855   H HG2  . PRO A 1 55 ? -17.733 -6.850  3.224   1.00 0.00 ?  611  PRO A HG2  1  
ATOM 856   H HG3  . PRO A 1 55 ? -17.713 -5.891  4.713   1.00 0.00 ?  611  PRO A HG3  1  
ATOM 857   H HD2  . PRO A 1 55 ? -18.662 -5.030  2.239   1.00 0.00 ?  611  PRO A HD2  1  
ATOM 858   H HD3  . PRO A 1 55 ? -18.186 -3.970  3.582   1.00 0.00 ?  611  PRO A HD3  1  
ATOM 859   N N    . ASP A 1 56 ? -16.437 -6.338  0.252   1.00 0.00 ?  612  ASP A N    1  
ATOM 860   C CA   . ASP A 1 56 ? -16.499 -7.398  -0.764  1.00 0.00 ?  612  ASP A CA   1  
ATOM 861   C C    . ASP A 1 56 ? -15.410 -7.239  -1.830  1.00 0.00 ?  612  ASP A C    1  
ATOM 862   O O    . ASP A 1 56 ? -14.695 -8.197  -2.152  1.00 0.00 ?  612  ASP A O    1  
ATOM 863   C CB   . ASP A 1 56 ? -17.887 -7.492  -1.394  1.00 0.00 ?  612  ASP A CB   1  
ATOM 864   C CG   . ASP A 1 56 ? -18.013 -8.662  -2.347  1.00 0.00 ?  612  ASP A CG   1  
ATOM 865   O OD1  . ASP A 1 56 ? -18.076 -9.818  -1.883  1.00 0.00 ?  612  ASP A OD1  1  
ATOM 866   O OD2  . ASP A 1 56 ? -18.091 -8.453  -3.565  1.00 0.00 -1 612  ASP A OD2  1  
ATOM 867   H H    . ASP A 1 56 ? -17.063 -5.584  0.227   1.00 0.00 ?  612  ASP A H    1  
ATOM 868   H HA   . ASP A 1 56 ? -16.295 -8.320  -0.242  1.00 0.00 ?  612  ASP A HA   1  
ATOM 869   H HB2  . ASP A 1 56 ? -18.621 -7.613  -0.611  1.00 0.00 ?  612  ASP A HB2  1  
ATOM 870   H HB3  . ASP A 1 56 ? -18.088 -6.581  -1.938  1.00 0.00 ?  612  ASP A HB3  1  
ATOM 871   N N    . GLU A 1 57 ? -15.270 -6.048  -2.360  1.00 0.00 ?  613  GLU A N    1  
ATOM 872   C CA   . GLU A 1 57 ? -14.204 -5.768  -3.315  1.00 0.00 ?  613  GLU A CA   1  
ATOM 873   C C    . GLU A 1 57 ? -13.090 -5.043  -2.612  1.00 0.00 ?  613  GLU A C    1  
ATOM 874   O O    . GLU A 1 57 ? -13.280 -4.577  -1.503  1.00 0.00 ?  613  GLU A O    1  
ATOM 875   C CB   . GLU A 1 57 ? -14.710 -4.956  -4.512  1.00 0.00 ?  613  GLU A CB   1  
ATOM 876   C CG   . GLU A 1 57 ? -15.636 -5.729  -5.428  1.00 0.00 ?  613  GLU A CG   1  
ATOM 877   C CD   . GLU A 1 57 ? -14.932 -6.838  -6.191  1.00 0.00 ?  613  GLU A CD   1  
ATOM 878   O OE1  . GLU A 1 57 ? -14.444 -7.798  -5.566  1.00 0.00 ?  613  GLU A OE1  1  
ATOM 879   O OE2  . GLU A 1 57 ? -14.913 -6.792  -7.445  1.00 0.00 -1 613  GLU A OE2  1  
ATOM 880   H H    . GLU A 1 57 ? -15.875 -5.322  -2.096  1.00 0.00 ?  613  GLU A H    1  
ATOM 881   H HA   . GLU A 1 57 ? -13.827 -6.720  -3.660  1.00 0.00 ?  613  GLU A HA   1  
ATOM 882   H HB2  . GLU A 1 57 ? -15.247 -4.094  -4.147  1.00 0.00 ?  613  GLU A HB2  1  
ATOM 883   H HB3  . GLU A 1 57 ? -13.861 -4.623  -5.090  1.00 0.00 ?  613  GLU A HB3  1  
ATOM 884   H HG2  . GLU A 1 57 ? -16.409 -6.176  -4.822  1.00 0.00 ?  613  GLU A HG2  1  
ATOM 885   H HG3  . GLU A 1 57 ? -16.082 -5.047  -6.136  1.00 0.00 ?  613  GLU A HG3  1  
ATOM 886   N N    . ILE A 1 58 ? -11.939 -4.975  -3.230  1.00 0.00 ?  614  ILE A N    1  
ATOM 887   C CA   . ILE A 1 58 ? -10.794 -4.303  -2.654  1.00 0.00 ?  614  ILE A CA   1  
ATOM 888   C C    . ILE A 1 58 ? -10.445 -3.057  -3.456  1.00 0.00 ?  614  ILE A C    1  
ATOM 889   O O    . ILE A 1 58 ? -9.861  -3.150  -4.491  1.00 0.00 ?  614  ILE A O    1  
ATOM 890   C CB   . ILE A 1 58 ? -9.551  -5.294  -2.594  1.00 0.00 ?  614  ILE A CB   1  
ATOM 891   C CG1  . ILE A 1 58 ? -8.201  -4.545  -2.411  1.00 0.00 ?  614  ILE A CG1  1  
ATOM 892   C CG2  . ILE A 1 58 ? -9.507  -6.198  -3.829  1.00 0.00 ?  614  ILE A CG2  1  
ATOM 893   C CD1  . ILE A 1 58 ? -7.014  -5.427  -2.086  1.00 0.00 ?  614  ILE A CD1  1  
ATOM 894   H H    . ILE A 1 58 ? -11.856 -5.371  -4.123  1.00 0.00 ?  614  ILE A H    1  
ATOM 895   H HA   . ILE A 1 58 ? -11.015 -4.008  -1.638  1.00 0.00 ?  614  ILE A HA   1  
ATOM 896   H HB   . ILE A 1 58 ? -9.711  -5.939  -1.742  1.00 0.00 ?  614  ILE A HB   1  
ATOM 897   H HG12 . ILE A 1 58 ? -7.983  -4.128  -3.383  1.00 0.00 ?  614  ILE A HG12 1  
ATOM 898   H HG13 . ILE A 1 58 ? -8.233  -3.712  -1.725  1.00 0.00 ?  614  ILE A HG13 1  
ATOM 899   H HG21 . ILE A 1 58 ? -10.415 -6.781  -3.883  1.00 0.00 ?  614  ILE A HG21 1  
ATOM 900   H HG22 . ILE A 1 58 ? -8.659  -6.862  -3.767  1.00 0.00 ?  614  ILE A HG22 1  
ATOM 901   H HG23 . ILE A 1 58 ? -9.424  -5.580  -4.713  1.00 0.00 ?  614  ILE A HG23 1  
ATOM 902   H HD11 . ILE A 1 58 ? -6.171  -4.800  -1.841  1.00 0.00 ?  614  ILE A HD11 1  
ATOM 903   H HD12 . ILE A 1 58 ? -6.732  -6.075  -2.912  1.00 0.00 ?  614  ILE A HD12 1  
ATOM 904   H HD13 . ILE A 1 58 ? -7.287  -6.010  -1.220  1.00 0.00 ?  614  ILE A HD13 1  
ATOM 905   N N    . GLU A 1 59 ? -10.823 -1.899  -2.990  1.00 0.00 ?  615  GLU A N    1  
ATOM 906   C CA   . GLU A 1 59 ? -10.395 -0.678  -3.603  1.00 0.00 ?  615  GLU A CA   1  
ATOM 907   C C    . GLU A 1 59 ? -9.857  0.334   -2.629  1.00 0.00 ?  615  GLU A C    1  
ATOM 908   O O    . GLU A 1 59 ? -10.574 1.025   -1.933  1.00 0.00 ?  615  GLU A O    1  
ATOM 909   C CB   . GLU A 1 59 ? -11.361 -0.094  -4.642  1.00 0.00 ?  615  GLU A CB   1  
ATOM 910   C CG   . GLU A 1 59 ? -12.841 -0.341  -4.465  1.00 0.00 ?  615  GLU A CG   1  
ATOM 911   C CD   . GLU A 1 59 ? -13.388 -0.100  -3.078  1.00 0.00 ?  615  GLU A CD   1  
ATOM 912   O OE1  . GLU A 1 59 ? -13.846 1.028   -2.810  1.00 0.00 ?  615  GLU A OE1  1  
ATOM 913   O OE2  . GLU A 1 59 ? -13.367 -1.029  -2.251  1.00 0.00 -1 615  GLU A OE2  1  
ATOM 914   H H    . GLU A 1 59 ? -11.482 -1.821  -2.267  1.00 0.00 ?  615  GLU A H    1  
ATOM 915   H HA   . GLU A 1 59 ? -9.511  -1.000  -4.137  1.00 0.00 ?  615  GLU A HA   1  
ATOM 916   H HB2  . GLU A 1 59 ? -11.213 0.951   -4.824  1.00 0.00 ?  615  GLU A HB2  1  
ATOM 917   H HB3  . GLU A 1 59 ? -11.100 -0.603  -5.556  1.00 0.00 ?  615  GLU A HB3  1  
ATOM 918   H HG2  . GLU A 1 59 ? -13.327 0.338   -5.153  1.00 0.00 ?  615  GLU A HG2  1  
ATOM 919   H HG3  . GLU A 1 59 ? -12.979 -1.339  -4.842  1.00 0.00 ?  615  GLU A HG3  1  
ATOM 920   N N    . ILE A 1 60 ? -8.572  0.429   -2.676  1.00 0.00 ?  616  ILE A N    1  
ATOM 921   C CA   . ILE A 1 60 ? -7.762  1.217   -1.797  1.00 0.00 ?  616  ILE A CA   1  
ATOM 922   C C    . ILE A 1 60 ? -7.972  2.747   -1.929  1.00 0.00 ?  616  ILE A C    1  
ATOM 923   O O    . ILE A 1 60 ? -7.541  3.371   -2.860  1.00 0.00 ?  616  ILE A O    1  
ATOM 924   C CB   . ILE A 1 60 ? -6.306  0.777   -1.978  1.00 0.00 ?  616  ILE A CB   1  
ATOM 925   C CG1  . ILE A 1 60 ? -6.195  -0.573  -1.298  1.00 0.00 ?  616  ILE A CG1  1  
ATOM 926   C CG2  . ILE A 1 60 ? -5.331  1.754   -1.363  1.00 0.00 ?  616  ILE A CG2  1  
ATOM 927   C CD1  . ILE A 1 60 ? -4.921  -1.260  -1.543  1.00 0.00 ?  616  ILE A CD1  1  
ATOM 928   H H    . ILE A 1 60 ? -8.145  -0.088  -3.383  1.00 0.00 ?  616  ILE A H    1  
ATOM 929   H HA   . ILE A 1 60 ? -8.030  0.866   -0.809  1.00 0.00 ?  616  ILE A HA   1  
ATOM 930   H HB   . ILE A 1 60 ? -6.094  0.626   -3.030  1.00 0.00 ?  616  ILE A HB   1  
ATOM 931   H HG12 . ILE A 1 60 ? -6.279  -0.435  -0.230  1.00 0.00 ?  616  ILE A HG12 1  
ATOM 932   H HG13 . ILE A 1 60 ? -6.999  -1.211  -1.632  1.00 0.00 ?  616  ILE A HG13 1  
ATOM 933   H HG21 . ILE A 1 60 ? -5.467  2.714   -1.837  1.00 0.00 ?  616  ILE A HG21 1  
ATOM 934   H HG22 . ILE A 1 60 ? -4.320  1.408   -1.523  1.00 0.00 ?  616  ILE A HG22 1  
ATOM 935   H HG23 . ILE A 1 60 ? -5.522  1.846   -0.304  1.00 0.00 ?  616  ILE A HG23 1  
ATOM 936   H HD11 . ILE A 1 60 ? -4.855  -1.460  -2.608  1.00 0.00 ?  616  ILE A HD11 1  
ATOM 937   H HD12 . ILE A 1 60 ? -4.948  -2.177  -0.977  1.00 0.00 ?  616  ILE A HD12 1  
ATOM 938   H HD13 . ILE A 1 60 ? -4.145  -0.586  -1.224  1.00 0.00 ?  616  ILE A HD13 1  
ATOM 939   N N    . ASP A 1 61 ? -8.654  3.303   -0.970  1.00 0.00 ?  617  ASP A N    1  
ATOM 940   C CA   . ASP A 1 61 ? -9.017  4.746   -0.863  1.00 0.00 ?  617  ASP A CA   1  
ATOM 941   C C    . ASP A 1 61 ? -7.874  5.762   -0.814  1.00 0.00 ?  617  ASP A C    1  
ATOM 942   O O    . ASP A 1 61 ? -8.099  6.953   -0.822  1.00 0.00 ?  617  ASP A O    1  
ATOM 943   C CB   . ASP A 1 61 ? -10.213 5.027   0.051   1.00 0.00 ?  617  ASP A CB   1  
ATOM 944   C CG   . ASP A 1 61 ? -10.650 6.490   0.127   1.00 0.00 ?  617  ASP A CG   1  
ATOM 945   O OD1  . ASP A 1 61 ? -11.123 7.047   -0.907  1.00 0.00 ?  617  ASP A OD1  1  
ATOM 946   O OD2  . ASP A 1 61 ? -10.574 7.097   1.214   1.00 0.00 -1 617  ASP A OD2  1  
ATOM 947   H H    . ASP A 1 61 ? -8.969  2.724   -0.243  1.00 0.00 ?  617  ASP A H    1  
ATOM 948   H HA   . ASP A 1 61 ? -9.353  4.917   -1.874  1.00 0.00 ?  617  ASP A HA   1  
ATOM 949   H HB2  . ASP A 1 61 ? -11.010 4.524   -0.483  1.00 0.00 ?  617  ASP A HB2  1  
ATOM 950   H HB3  . ASP A 1 61 ? -10.069 4.608   1.035   1.00 0.00 ?  617  ASP A HB3  1  
ATOM 951   N N    . PHE A 1 62 ? -6.651  5.274   -0.844  1.00 0.00 ?  618  PHE A N    1  
ATOM 952   C CA   . PHE A 1 62 ? -5.421  6.012   -0.502  1.00 0.00 ?  618  PHE A CA   1  
ATOM 953   C C    . PHE A 1 62 ? -5.278  7.384   -1.116  1.00 0.00 ?  618  PHE A C    1  
ATOM 954   O O    . PHE A 1 62 ? -4.612  8.179   -0.525  1.00 0.00 ?  618  PHE A O    1  
ATOM 955   C CB   . PHE A 1 62 ? -4.249  5.193   -0.993  1.00 0.00 ?  618  PHE A CB   1  
ATOM 956   C CG   . PHE A 1 62 ? -3.583  4.328   0.043   1.00 0.00 ?  618  PHE A CG   1  
ATOM 957   C CD1  . PHE A 1 62 ? -4.254  3.948   1.198   1.00 0.00 ?  618  PHE A CD1  1  
ATOM 958   C CD2  . PHE A 1 62 ? -2.294  3.879   -0.141  1.00 0.00 ?  618  PHE A CD2  1  
ATOM 959   C CE1  . PHE A 1 62 ? -3.648  3.148   2.141   1.00 0.00 ?  618  PHE A CE1  1  
ATOM 960   C CE2  . PHE A 1 62 ? -1.685  3.077   0.802   1.00 0.00 ?  618  PHE A CE2  1  
ATOM 961   C CZ   . PHE A 1 62 ? -2.362  2.714   1.944   1.00 0.00 ?  618  PHE A CZ   1  
ATOM 962   H H    . PHE A 1 62 ? -6.574  4.339   -1.125  1.00 0.00 ?  618  PHE A H    1  
ATOM 963   H HA   . PHE A 1 62 ? -5.311  6.081   0.565   1.00 0.00 ?  618  PHE A HA   1  
ATOM 964   H HB2  . PHE A 1 62 ? -4.723  4.516   -1.690  1.00 0.00 ?  618  PHE A HB2  1  
ATOM 965   H HB3  . PHE A 1 62 ? -3.550  5.758   -1.599  1.00 0.00 ?  618  PHE A HB3  1  
ATOM 966   H HD1  . PHE A 1 62 ? -5.268  4.283   1.360   1.00 0.00 ?  618  PHE A HD1  1  
ATOM 967   H HD2  . PHE A 1 62 ? -1.755  4.158   -1.035  1.00 0.00 ?  618  PHE A HD2  1  
ATOM 968   H HE1  . PHE A 1 62 ? -4.183  2.861   3.034   1.00 0.00 ?  618  PHE A HE1  1  
ATOM 969   H HE2  . PHE A 1 62 ? -0.672  2.739   0.649   1.00 0.00 ?  618  PHE A HE2  1  
ATOM 970   H HZ   . PHE A 1 62 ? -1.883  2.089   2.683   1.00 0.00 ?  618  PHE A HZ   1  
ATOM 971   N N    . GLU A 1 63 ? -5.931  7.677   -2.233  1.00 0.00 ?  619  GLU A N    1  
ATOM 972   C CA   . GLU A 1 63 ? -5.948  9.050   -2.762  1.00 0.00 ?  619  GLU A CA   1  
ATOM 973   C C    . GLU A 1 63 ? -6.450  10.010  -1.659  1.00 0.00 ?  619  GLU A C    1  
ATOM 974   O O    . GLU A 1 63 ? -5.811  11.017  -1.327  1.00 0.00 ?  619  GLU A O    1  
ATOM 975   C CB   . GLU A 1 63 ? -6.972  9.180   -3.859  1.00 0.00 ?  619  GLU A CB   1  
ATOM 976   C CG   . GLU A 1 63 ? -6.799  8.412   -5.131  1.00 0.00 ?  619  GLU A CG   1  
ATOM 977   C CD   . GLU A 1 63 ? -8.016  8.620   -5.949  1.00 0.00 ?  619  GLU A CD   1  
ATOM 978   O OE1  . GLU A 1 63 ? -8.116  9.665   -6.640  1.00 0.00 ?  619  GLU A OE1  1  
ATOM 979   O OE2  . GLU A 1 63 ? -8.923  7.789   -5.878  1.00 0.00 -1 619  GLU A OE2  1  
ATOM 980   H H    . GLU A 1 63 ? -6.437  6.970   -2.680  1.00 0.00 ?  619  GLU A H    1  
ATOM 981   H HA   . GLU A 1 63 ? -4.974  9.336   -3.129  1.00 0.00 ?  619  GLU A HA   1  
ATOM 982   H HB2  . GLU A 1 63 ? -7.900  8.820   -3.443  1.00 0.00 ?  619  GLU A HB2  1  
ATOM 983   H HB3  . GLU A 1 63 ? -7.076  10.228  -4.097  1.00 0.00 ?  619  GLU A HB3  1  
ATOM 984   H HG2  . GLU A 1 63 ? -5.959  8.742   -5.726  1.00 0.00 ?  619  GLU A HG2  1  
ATOM 985   H HG3  . GLU A 1 63 ? -6.687  7.354   -4.965  1.00 0.00 ?  619  GLU A HG3  1  
ATOM 986   N N    . THR A 1 64 ? -7.588  9.641   -1.095  1.00 0.00 ?  620  THR A N    1  
ATOM 987   C CA   . THR A 1 64 ? -8.304  10.424  -0.119  1.00 0.00 ?  620  THR A CA   1  
ATOM 988   C C    . THR A 1 64 ? -7.941  9.981   1.304   1.00 0.00 ?  620  THR A C    1  
ATOM 989   O O    . THR A 1 64 ? -8.285  10.643  2.287   1.00 0.00 ?  620  THR A O    1  
ATOM 990   C CB   . THR A 1 64 ? -9.813  10.171  -0.297  1.00 0.00 ?  620  THR A CB   1  
ATOM 991   O OG1  . THR A 1 64 ? -10.058 9.461   -1.547  1.00 0.00 ?  620  THR A OG1  1  
ATOM 992   C CG2  . THR A 1 64 ? -10.592 11.478  -0.290  1.00 0.00 ?  620  THR A CG2  1  
ATOM 993   H H    . THR A 1 64 ? -8.001  8.783   -1.337  1.00 0.00 ?  620  THR A H    1  
ATOM 994   H HA   . THR A 1 64 ? -8.118  11.477  -0.266  1.00 0.00 ?  620  THR A HA   1  
ATOM 995   H HB   . THR A 1 64 ? -10.133 9.554   0.529   1.00 0.00 ?  620  THR A HB   1  
ATOM 996   H HG1  . THR A 1 64 ? -10.365 8.580   -1.265  1.00 0.00 ?  620  THR A HG1  1  
ATOM 997   H HG21 . THR A 1 64 ? -10.431 11.987  0.649   1.00 0.00 ?  620  THR A HG21 1  
ATOM 998   H HG22 . THR A 1 64 ? -11.645 11.269  -0.408  1.00 0.00 ?  620  THR A HG22 1  
ATOM 999   H HG23 . THR A 1 64 ? -10.256 12.105  -1.103  1.00 0.00 ?  620  THR A HG23 1  
ATOM 1000  N N    . LEU A 1 65 ? -7.308  8.837   1.412   1.00 0.00 ?  621  LEU A N    1  
ATOM 1001  C CA   . LEU A 1 65 ? -6.965  8.289   2.705   1.00 0.00 ?  621  LEU A CA   1  
ATOM 1002  C C    . LEU A 1 65 ? -5.700  8.963   3.242   1.00 0.00 ?  621  LEU A C    1  
ATOM 1003  O O    . LEU A 1 65 ? -4.883  9.494   2.469   1.00 0.00 ?  621  LEU A O    1  
ATOM 1004  C CB   . LEU A 1 65 ? -6.792  6.767   2.629   1.00 0.00 ?  621  LEU A CB   1  
ATOM 1005  C CG   . LEU A 1 65 ? -7.089  5.984   3.917   1.00 0.00 ?  621  LEU A CG   1  
ATOM 1006  C CD1  . LEU A 1 65 ? -8.561  6.104   4.285   1.00 0.00 ?  621  LEU A CD1  1  
ATOM 1007  C CD2  . LEU A 1 65 ? -6.706  4.525   3.762   1.00 0.00 ?  621  LEU A CD2  1  
ATOM 1008  H H    . LEU A 1 65 ? -7.091  8.355   0.588   1.00 0.00 ?  621  LEU A H    1  
ATOM 1009  H HA   . LEU A 1 65 ? -7.777  8.521   3.378   1.00 0.00 ?  621  LEU A HA   1  
ATOM 1010  H HB2  . LEU A 1 65 ? -7.416  6.378   1.838   1.00 0.00 ?  621  LEU A HB2  1  
ATOM 1011  H HB3  . LEU A 1 65 ? -5.758  6.584   2.376   1.00 0.00 ?  621  LEU A HB3  1  
ATOM 1012  H HG   . LEU A 1 65 ? -6.507  6.408   4.721   1.00 0.00 ?  621  LEU A HG   1  
ATOM 1013  H HD11 . LEU A 1 65 ? -8.807  7.136   4.487   1.00 0.00 ?  621  LEU A HD11 1  
ATOM 1014  H HD12 . LEU A 1 65 ? -8.767  5.508   5.162   1.00 0.00 ?  621  LEU A HD12 1  
ATOM 1015  H HD13 . LEU A 1 65 ? -9.166  5.748   3.465   1.00 0.00 ?  621  LEU A HD13 1  
ATOM 1016  H HD21 . LEU A 1 65 ? -5.648  4.454   3.557   1.00 0.00 ?  621  LEU A HD21 1  
ATOM 1017  H HD22 . LEU A 1 65 ? -7.265  4.093   2.945   1.00 0.00 ?  621  LEU A HD22 1  
ATOM 1018  H HD23 . LEU A 1 65 ? -6.933  3.995   4.676   1.00 0.00 ?  621  LEU A HD23 1  
ATOM 1019  N N    . LYS A 1 66 ? -5.549  8.923   4.549   1.00 0.00 ?  622  LYS A N    1  
ATOM 1020  C CA   . LYS A 1 66 ? -4.479  9.612   5.268   1.00 0.00 ?  622  LYS A CA   1  
ATOM 1021  C C    . LYS A 1 66 ? -3.086  9.040   4.979   1.00 0.00 ?  622  LYS A C    1  
ATOM 1022  O O    . LYS A 1 66 ? -2.919  7.817   4.850   1.00 0.00 ?  622  LYS A O    1  
ATOM 1023  C CB   . LYS A 1 66 ? -4.746  9.541   6.768   1.00 0.00 ?  622  LYS A CB   1  
ATOM 1024  C CG   . LYS A 1 66 ? -6.031  10.212  7.191   1.00 0.00 ?  622  LYS A CG   1  
ATOM 1025  C CD   . LYS A 1 66 ? -6.271  10.044  8.672   1.00 0.00 ?  622  LYS A CD   1  
ATOM 1026  C CE   . LYS A 1 66 ? -7.558  10.723  9.113   1.00 0.00 ?  622  LYS A CE   1  
ATOM 1027  N NZ   . LYS A 1 66 ? -8.740  10.201  8.398   1.00 0.00 1  622  LYS A NZ   1  
ATOM 1028  H H    . LYS A 1 66 ? -6.190  8.397   5.070   1.00 0.00 ?  622  LYS A H    1  
ATOM 1029  H HA   . LYS A 1 66 ? -4.518  10.650  4.979   1.00 0.00 ?  622  LYS A HA   1  
ATOM 1030  H HB2  . LYS A 1 66 ? -4.795  8.503   7.063   1.00 0.00 ?  622  LYS A HB2  1  
ATOM 1031  H HB3  . LYS A 1 66 ? -3.927  10.012  7.290   1.00 0.00 ?  622  LYS A HB3  1  
ATOM 1032  H HG2  . LYS A 1 66 ? -5.974  11.266  6.959   1.00 0.00 ?  622  LYS A HG2  1  
ATOM 1033  H HG3  . LYS A 1 66 ? -6.850  9.765   6.648   1.00 0.00 ?  622  LYS A HG3  1  
ATOM 1034  H HD2  . LYS A 1 66 ? -6.341  8.989   8.894   1.00 0.00 ?  622  LYS A HD2  1  
ATOM 1035  H HD3  . LYS A 1 66 ? -5.439  10.470  9.213   1.00 0.00 ?  622  LYS A HD3  1  
ATOM 1036  H HE2  . LYS A 1 66 ? -7.695  10.569  10.174  1.00 0.00 ?  622  LYS A HE2  1  
ATOM 1037  H HE3  . LYS A 1 66 ? -7.468  11.781  8.915   1.00 0.00 ?  622  LYS A HE3  1  
ATOM 1038  H HZ1  . LYS A 1 66 ? -8.699  10.462  7.392   1.00 0.00 ?  622  LYS A HZ1  1  
ATOM 1039  H HZ2  . LYS A 1 66 ? -9.629  10.579  8.784   1.00 0.00 ?  622  LYS A HZ2  1  
ATOM 1040  H HZ3  . LYS A 1 66 ? -8.769  9.156   8.436   1.00 0.00 ?  622  LYS A HZ3  1  
ATOM 1041  N N    . PRO A 1 67 ? -2.047  9.919   4.918   1.00 0.00 ?  623  PRO A N    1  
ATOM 1042  C CA   . PRO A 1 67 ? -0.658  9.499   4.710   1.00 0.00 ?  623  PRO A CA   1  
ATOM 1043  C C    . PRO A 1 67 ? -0.141  8.664   5.889   1.00 0.00 ?  623  PRO A C    1  
ATOM 1044  O O    . PRO A 1 67 ? 0.772   7.866   5.744   1.00 0.00 ?  623  PRO A O    1  
ATOM 1045  C CB   . PRO A 1 67 ? 0.128   10.814  4.609   1.00 0.00 ?  623  PRO A CB   1  
ATOM 1046  C CG   . PRO A 1 67 ? -0.896  11.859  4.346   1.00 0.00 ?  623  PRO A CG   1  
ATOM 1047  C CD   . PRO A 1 67 ? -2.149  11.389  5.016   1.00 0.00 ?  623  PRO A CD   1  
ATOM 1048  H HA   . PRO A 1 67 ? -0.558  8.933   3.796   1.00 0.00 ?  623  PRO A HA   1  
ATOM 1049  H HB2  . PRO A 1 67 ? 0.649   10.995  5.537   1.00 0.00 ?  623  PRO A HB2  1  
ATOM 1050  H HB3  . PRO A 1 67 ? 0.842   10.749  3.801   1.00 0.00 ?  623  PRO A HB3  1  
ATOM 1051  H HG2  . PRO A 1 67 ? -0.574  12.801  4.766   1.00 0.00 ?  623  PRO A HG2  1  
ATOM 1052  H HG3  . PRO A 1 67 ? -1.053  11.959  3.282   1.00 0.00 ?  623  PRO A HG3  1  
ATOM 1053  H HD2  . PRO A 1 67 ? -2.177  11.716  6.045   1.00 0.00 ?  623  PRO A HD2  1  
ATOM 1054  H HD3  . PRO A 1 67 ? -3.004  11.756  4.470   1.00 0.00 ?  623  PRO A HD3  1  
ATOM 1055  N N    . THR A 1 68 ? -0.748  8.841   7.042   1.00 0.00 ?  624  THR A N    1  
ATOM 1056  C CA   . THR A 1 68 ? -0.404  8.080   8.216   1.00 0.00 ?  624  THR A CA   1  
ATOM 1057  C C    . THR A 1 68 ? -0.769  6.596   7.994   1.00 0.00 ?  624  THR A C    1  
ATOM 1058  O O    . THR A 1 68 ? 0.004   5.696   8.320   1.00 0.00 ?  624  THR A O    1  
ATOM 1059  C CB   . THR A 1 68 ? -1.176  8.637   9.418   1.00 0.00 ?  624  THR A CB   1  
ATOM 1060  O OG1  . THR A 1 68 ? -1.108  10.076  9.366   1.00 0.00 ?  624  THR A OG1  1  
ATOM 1061  C CG2  . THR A 1 68 ? -0.557  8.157   10.721  1.00 0.00 ?  624  THR A CG2  1  
ATOM 1062  H H    . THR A 1 68 ? -1.437  9.533   7.128   1.00 0.00 ?  624  THR A H    1  
ATOM 1063  H HA   . THR A 1 68 ? 0.656   8.176   8.398   1.00 0.00 ?  624  THR A HA   1  
ATOM 1064  H HB   . THR A 1 68 ? -2.206  8.315   9.362   1.00 0.00 ?  624  THR A HB   1  
ATOM 1065  H HG1  . THR A 1 68 ? -0.264  10.342  9.754   1.00 0.00 ?  624  THR A HG1  1  
ATOM 1066  H HG21 . THR A 1 68 ? -1.108  8.564   11.556  1.00 0.00 ?  624  THR A HG21 1  
ATOM 1067  H HG22 . THR A 1 68 ? 0.470   8.485   10.773  1.00 0.00 ?  624  THR A HG22 1  
ATOM 1068  H HG23 . THR A 1 68 ? -0.593  7.078   10.760  1.00 0.00 ?  624  THR A HG23 1  
ATOM 1069  N N    . THR A 1 69 ? -1.917  6.367   7.384   1.00 0.00 ?  625  THR A N    1  
ATOM 1070  C CA   . THR A 1 69 ? -2.381  5.037   7.090   1.00 0.00 ?  625  THR A CA   1  
ATOM 1071  C C    . THR A 1 69 ? -1.617  4.489   5.863   1.00 0.00 ?  625  THR A C    1  
ATOM 1072  O O    . THR A 1 69 ? -1.396  3.287   5.731   1.00 0.00 ?  625  THR A O    1  
ATOM 1073  C CB   . THR A 1 69 ? -3.885  5.094   6.810   1.00 0.00 ?  625  THR A CB   1  
ATOM 1074  O OG1  . THR A 1 69 ? -4.488  5.972   7.793   1.00 0.00 ?  625  THR A OG1  1  
ATOM 1075  C CG2  . THR A 1 69 ? -4.507  3.711   6.932   1.00 0.00 ?  625  THR A CG2  1  
ATOM 1076  H H    . THR A 1 69 ? -2.507  7.106   7.124   1.00 0.00 ?  625  THR A H    1  
ATOM 1077  H HA   . THR A 1 69 ? -2.199  4.406   7.947   1.00 0.00 ?  625  THR A HA   1  
ATOM 1078  H HB   . THR A 1 69 ? -4.051  5.488   5.818   1.00 0.00 ?  625  THR A HB   1  
ATOM 1079  H HG1  . THR A 1 69 ? -4.616  5.507   8.628   1.00 0.00 ?  625  THR A HG1  1  
ATOM 1080  H HG21 . THR A 1 69 ? -5.563  3.765   6.715   1.00 0.00 ?  625  THR A HG21 1  
ATOM 1081  H HG22 . THR A 1 69 ? -4.368  3.343   7.937   1.00 0.00 ?  625  THR A HG22 1  
ATOM 1082  H HG23 . THR A 1 69 ? -4.029  3.040   6.235   1.00 0.00 ?  625  THR A HG23 1  
ATOM 1083  N N    . LEU A 1 70 ? -1.197  5.408   4.999   1.00 0.00 ?  626  LEU A N    1  
ATOM 1084  C CA   . LEU A 1 70 ? -0.376  5.116   3.816   1.00 0.00 ?  626  LEU A CA   1  
ATOM 1085  C C    . LEU A 1 70 ? 0.905   4.389   4.218   1.00 0.00 ?  626  LEU A C    1  
ATOM 1086  O O    . LEU A 1 70 ? 1.287   3.375   3.618   1.00 0.00 ?  626  LEU A O    1  
ATOM 1087  C CB   . LEU A 1 70 ? -0.002  6.442   3.149   1.00 0.00 ?  626  LEU A CB   1  
ATOM 1088  C CG   . LEU A 1 70 ? 0.993   6.398   2.000   1.00 0.00 ?  626  LEU A CG   1  
ATOM 1089  C CD1  . LEU A 1 70 ? 0.388   5.747   0.799   1.00 0.00 ?  626  LEU A CD1  1  
ATOM 1090  C CD2  . LEU A 1 70 ? 1.492   7.788   1.674   1.00 0.00 ?  626  LEU A CD2  1  
ATOM 1091  H H    . LEU A 1 70 ? -1.473  6.336   5.155   1.00 0.00 ?  626  LEU A H    1  
ATOM 1092  H HA   . LEU A 1 70 ? -0.946  4.521   3.119   1.00 0.00 ?  626  LEU A HA   1  
ATOM 1093  H HB2  . LEU A 1 70 ? -0.907  6.899   2.779   1.00 0.00 ?  626  LEU A HB2  1  
ATOM 1094  H HB3  . LEU A 1 70 ? 0.411   7.080   3.916   1.00 0.00 ?  626  LEU A HB3  1  
ATOM 1095  H HG   . LEU A 1 70 ? 1.842   5.802   2.302   1.00 0.00 ?  626  LEU A HG   1  
ATOM 1096  H HD11 . LEU A 1 70 ? 1.106   5.732   -0.005  1.00 0.00 ?  626  LEU A HD11 1  
ATOM 1097  H HD12 . LEU A 1 70 ? -0.493  6.294   0.497   1.00 0.00 ?  626  LEU A HD12 1  
ATOM 1098  H HD13 . LEU A 1 70 ? 0.111   4.733   1.048   1.00 0.00 ?  626  LEU A HD13 1  
ATOM 1099  H HD21 . LEU A 1 70 ? 2.190   7.734   0.852   1.00 0.00 ?  626  LEU A HD21 1  
ATOM 1100  H HD22 . LEU A 1 70 ? 1.987   8.203   2.538   1.00 0.00 ?  626  LEU A HD22 1  
ATOM 1101  H HD23 . LEU A 1 70 ? 0.659   8.417   1.400   1.00 0.00 ?  626  LEU A HD23 1  
ATOM 1102  N N    . ARG A 1 71 ? 1.536   4.893   5.263   1.00 0.00 ?  627  ARG A N    1  
ATOM 1103  C CA   . ARG A 1 71 ? 2.802   4.366   5.738   1.00 0.00 ?  627  ARG A CA   1  
ATOM 1104  C C    . ARG A 1 71 ? 2.667   2.933   6.259   1.00 0.00 ?  627  ARG A C    1  
ATOM 1105  O O    . ARG A 1 71 ? 3.626   2.174   6.232   1.00 0.00 ?  627  ARG A O    1  
ATOM 1106  C CB   . ARG A 1 71 ? 3.439   5.296   6.775   1.00 0.00 ?  627  ARG A CB   1  
ATOM 1107  C CG   . ARG A 1 71 ? 3.605   6.724   6.262   1.00 0.00 ?  627  ARG A CG   1  
ATOM 1108  C CD   . ARG A 1 71 ? 4.347   7.613   7.241   1.00 0.00 ?  627  ARG A CD   1  
ATOM 1109  N NE   . ARG A 1 71 ? 5.769   7.268   7.339   1.00 0.00 ?  627  ARG A NE   1  
ATOM 1110  C CZ   . ARG A 1 71 ? 6.578   7.599   8.360   1.00 0.00 ?  627  ARG A CZ   1  
ATOM 1111  N NH1  . ARG A 1 71 ? 6.093   8.206   9.449   1.00 0.00 1  627  ARG A NH1  1  
ATOM 1112  N NH2  . ARG A 1 71 ? 7.863   7.312   8.290   1.00 0.00 ?  627  ARG A NH2  1  
ATOM 1113  H H    . ARG A 1 71 ? 1.134   5.664   5.722   1.00 0.00 ?  627  ARG A H    1  
ATOM 1114  H HA   . ARG A 1 71 ? 3.449   4.324   4.874   1.00 0.00 ?  627  ARG A HA   1  
ATOM 1115  H HB2  . ARG A 1 71 ? 2.813   5.315   7.656   1.00 0.00 ?  627  ARG A HB2  1  
ATOM 1116  H HB3  . ARG A 1 71 ? 4.413   4.915   7.044   1.00 0.00 ?  627  ARG A HB3  1  
ATOM 1117  H HG2  . ARG A 1 71 ? 4.148   6.702   5.330   1.00 0.00 ?  627  ARG A HG2  1  
ATOM 1118  H HG3  . ARG A 1 71 ? 2.624   7.140   6.084   1.00 0.00 ?  627  ARG A HG3  1  
ATOM 1119  H HD2  . ARG A 1 71 ? 4.262   8.639   6.912   1.00 0.00 ?  627  ARG A HD2  1  
ATOM 1120  H HD3  . ARG A 1 71 ? 3.891   7.509   8.213   1.00 0.00 ?  627  ARG A HD3  1  
ATOM 1121  H HE   . ARG A 1 71 ? 6.123   6.797   6.547   1.00 0.00 ?  627  ARG A HE   1  
ATOM 1122  H HH11 . ARG A 1 71 ? 5.122   8.436   9.547   1.00 0.00 ?  627  ARG A HH11 1  
ATOM 1123  H HH12 . ARG A 1 71 ? 6.678   8.456   10.228  1.00 0.00 ?  627  ARG A HH12 1  
ATOM 1124  H HH21 . ARG A 1 71 ? 8.263   6.846   7.497   1.00 0.00 ?  627  ARG A HH21 1  
ATOM 1125  H HH22 . ARG A 1 71 ? 8.496   7.562   9.027   1.00 0.00 ?  627  ARG A HH22 1  
ATOM 1126  N N    . GLU A 1 72 ? 1.459   2.556   6.684   1.00 0.00 ?  628  GLU A N    1  
ATOM 1127  C CA   . GLU A 1 72 ? 1.199   1.199   7.166   1.00 0.00 ?  628  GLU A CA   1  
ATOM 1128  C C    . GLU A 1 72 ? 1.461   0.189   6.030   1.00 0.00 ?  628  GLU A C    1  
ATOM 1129  O O    . GLU A 1 72 ? 2.054   -0.879  6.243   1.00 0.00 ?  628  GLU A O    1  
ATOM 1130  C CB   . GLU A 1 72 ? -0.253  1.070   7.640   1.00 0.00 ?  628  GLU A CB   1  
ATOM 1131  C CG   . GLU A 1 72 ? -0.589  -0.263  8.292   1.00 0.00 ?  628  GLU A CG   1  
ATOM 1132  C CD   . GLU A 1 72 ? 0.085   -0.451  9.624   1.00 0.00 ?  628  GLU A CD   1  
ATOM 1133  O OE1  . GLU A 1 72 ? -0.528  -0.109  10.645  1.00 0.00 ?  628  GLU A OE1  1  
ATOM 1134  O OE2  . GLU A 1 72 ? 1.221   -0.944  9.682   1.00 0.00 -1 628  GLU A OE2  1  
ATOM 1135  H H    . GLU A 1 72 ? 0.726   3.207   6.659   1.00 0.00 ?  628  GLU A H    1  
ATOM 1136  H HA   . GLU A 1 72 ? 1.868   0.990   7.988   1.00 0.00 ?  628  GLU A HA   1  
ATOM 1137  H HB2  . GLU A 1 72 ? -0.456  1.852   8.356   1.00 0.00 ?  628  GLU A HB2  1  
ATOM 1138  H HB3  . GLU A 1 72 ? -0.904  1.205   6.789   1.00 0.00 ?  628  GLU A HB3  1  
ATOM 1139  H HG2  . GLU A 1 72 ? -1.657  -0.323  8.441   1.00 0.00 ?  628  GLU A HG2  1  
ATOM 1140  H HG3  . GLU A 1 72 ? -0.275  -1.056  7.629   1.00 0.00 ?  628  GLU A HG3  1  
ATOM 1141  N N    . LEU A 1 73 ? 1.051   0.554   4.819   1.00 0.00 ?  629  LEU A N    1  
ATOM 1142  C CA   . LEU A 1 73 ? 1.254   -0.306  3.664   1.00 0.00 ?  629  LEU A CA   1  
ATOM 1143  C C    . LEU A 1 73 ? 2.734   -0.386  3.336   1.00 0.00 ?  629  LEU A C    1  
ATOM 1144  O O    . LEU A 1 73 ? 3.241   -1.450  3.018   1.00 0.00 ?  629  LEU A O    1  
ATOM 1145  C CB   . LEU A 1 73 ? 0.393   0.151   2.457   1.00 0.00 ?  629  LEU A CB   1  
ATOM 1146  C CG   . LEU A 1 73 ? 0.535   -0.647  1.130   1.00 0.00 ?  629  LEU A CG   1  
ATOM 1147  C CD1  . LEU A 1 73 ? 0.394   -2.132  1.367   1.00 0.00 ?  629  LEU A CD1  1  
ATOM 1148  C CD2  . LEU A 1 73 ? -0.530  -0.216  0.140   1.00 0.00 ?  629  LEU A CD2  1  
ATOM 1149  H H    . LEU A 1 73 ? 0.610   1.425   4.709   1.00 0.00 ?  629  LEU A H    1  
ATOM 1150  H HA   . LEU A 1 73 ? 0.943   -1.295  3.968   1.00 0.00 ?  629  LEU A HA   1  
ATOM 1151  H HB2  . LEU A 1 73 ? -0.643  0.104   2.757   1.00 0.00 ?  629  LEU A HB2  1  
ATOM 1152  H HB3  . LEU A 1 73 ? 0.636   1.184   2.253   1.00 0.00 ?  629  LEU A HB3  1  
ATOM 1153  H HG   . LEU A 1 73 ? 1.501   -0.466  0.683   1.00 0.00 ?  629  LEU A HG   1  
ATOM 1154  H HD11 . LEU A 1 73 ? 0.491   -2.658  0.429   1.00 0.00 ?  629  LEU A HD11 1  
ATOM 1155  H HD12 . LEU A 1 73 ? -0.579  -2.325  1.794   1.00 0.00 ?  629  LEU A HD12 1  
ATOM 1156  H HD13 . LEU A 1 73 ? 1.161   -2.464  2.050   1.00 0.00 ?  629  LEU A HD13 1  
ATOM 1157  H HD21 . LEU A 1 73 ? -0.377  -0.721  -0.802  1.00 0.00 ?  629  LEU A HD21 1  
ATOM 1158  H HD22 . LEU A 1 73 ? -0.511  0.853   -0.005  1.00 0.00 ?  629  LEU A HD22 1  
ATOM 1159  H HD23 . LEU A 1 73 ? -1.498  -0.495  0.528   1.00 0.00 ?  629  LEU A HD23 1  
ATOM 1160  N N    . GLU A 1 74 ? 3.428   0.728   3.500   1.00 0.00 ?  630  GLU A N    1  
ATOM 1161  C CA   . GLU A 1 74 ? 4.874   0.797   3.284   1.00 0.00 ?  630  GLU A CA   1  
ATOM 1162  C C    . GLU A 1 74 ? 5.590   -0.223  4.179   1.00 0.00 ?  630  GLU A C    1  
ATOM 1163  O O    . GLU A 1 74 ? 6.442   -0.996  3.705   1.00 0.00 ?  630  GLU A O    1  
ATOM 1164  C CB   . GLU A 1 74 ? 5.373   2.205   3.592   1.00 0.00 ?  630  GLU A CB   1  
ATOM 1165  C CG   . GLU A 1 74 ? 6.867   2.391   3.442   1.00 0.00 ?  630  GLU A CG   1  
ATOM 1166  C CD   . GLU A 1 74 ? 7.301   3.755   3.875   1.00 0.00 ?  630  GLU A CD   1  
ATOM 1167  O OE1  . GLU A 1 74 ? 7.562   3.957   5.081   1.00 0.00 ?  630  GLU A OE1  1  
ATOM 1168  O OE2  . GLU A 1 74 ? 7.376   4.657   3.038   1.00 0.00 -1 630  GLU A OE2  1  
ATOM 1169  H H    . GLU A 1 74 ? 2.948   1.537   3.775   1.00 0.00 ?  630  GLU A H    1  
ATOM 1170  H HA   . GLU A 1 74 ? 5.073   0.565   2.248   1.00 0.00 ?  630  GLU A HA   1  
ATOM 1171  H HB2  . GLU A 1 74 ? 4.880   2.903   2.932   1.00 0.00 ?  630  GLU A HB2  1  
ATOM 1172  H HB3  . GLU A 1 74 ? 5.107   2.445   4.611   1.00 0.00 ?  630  GLU A HB3  1  
ATOM 1173  H HG2  . GLU A 1 74 ? 7.376   1.657   4.050   1.00 0.00 ?  630  GLU A HG2  1  
ATOM 1174  H HG3  . GLU A 1 74 ? 7.137   2.251   2.405   1.00 0.00 ?  630  GLU A HG3  1  
ATOM 1175  N N    . ARG A 1 75 ? 5.200   -0.239  5.453   1.00 0.00 ?  631  ARG A N    1  
ATOM 1176  C CA   . ARG A 1 75 ? 5.755   -1.158  6.457   1.00 0.00 ?  631  ARG A CA   1  
ATOM 1177  C C    . ARG A 1 75 ? 5.539   -2.589  6.019   1.00 0.00 ?  631  ARG A C    1  
ATOM 1178  O O    . ARG A 1 75 ? 6.459   -3.413  6.050   1.00 0.00 ?  631  ARG A O    1  
ATOM 1179  C CB   . ARG A 1 75 ? 5.050   -0.967  7.791   1.00 0.00 ?  631  ARG A CB   1  
ATOM 1180  C CG   . ARG A 1 75 ? 5.067   0.443   8.299   1.00 0.00 ?  631  ARG A CG   1  
ATOM 1181  C CD   . ARG A 1 75 ? 4.248   0.578   9.567   1.00 0.00 ?  631  ARG A CD   1  
ATOM 1182  N NE   . ARG A 1 75 ? 4.862   -0.102  10.714  1.00 0.00 ?  631  ARG A NE   1  
ATOM 1183  C CZ   . ARG A 1 75 ? 4.208   -0.432  11.834  1.00 0.00 ?  631  ARG A CZ   1  
ATOM 1184  N NH1  . ARG A 1 75 ? 2.877   -0.537  11.830  1.00 0.00 1  631  ARG A NH1  1  
ATOM 1185  N NH2  . ARG A 1 75 ? 4.900   -0.749  12.925  1.00 0.00 ?  631  ARG A NH2  1  
ATOM 1186  H H    . ARG A 1 75 ? 4.516   0.415   5.721   1.00 0.00 ?  631  ARG A H    1  
ATOM 1187  H HA   . ARG A 1 75 ? 6.809   -0.958  6.580   1.00 0.00 ?  631  ARG A HA   1  
ATOM 1188  H HB2  . ARG A 1 75 ? 4.019   -1.262  7.671   1.00 0.00 ?  631  ARG A HB2  1  
ATOM 1189  H HB3  . ARG A 1 75 ? 5.511   -1.605  8.528   1.00 0.00 ?  631  ARG A HB3  1  
ATOM 1190  H HG2  . ARG A 1 75 ? 6.089   0.733   8.489   1.00 0.00 ?  631  ARG A HG2  1  
ATOM 1191  H HG3  . ARG A 1 75 ? 4.641   1.065   7.526   1.00 0.00 ?  631  ARG A HG3  1  
ATOM 1192  H HD2  . ARG A 1 75 ? 4.133   1.625   9.803   1.00 0.00 ?  631  ARG A HD2  1  
ATOM 1193  H HD3  . ARG A 1 75 ? 3.274   0.146   9.392   1.00 0.00 ?  631  ARG A HD3  1  
ATOM 1194  H HE   . ARG A 1 75 ? 5.841   -0.206  10.656  1.00 0.00 ?  631  ARG A HE   1  
ATOM 1195  H HH11 . ARG A 1 75 ? 2.327   -0.400  10.994  1.00 0.00 ?  631  ARG A HH11 1  
ATOM 1196  H HH12 . ARG A 1 75 ? 2.336   -0.736  12.652  1.00 0.00 ?  631  ARG A HH12 1  
ATOM 1197  H HH21 . ARG A 1 75 ? 5.904   -0.747  12.908  1.00 0.00 ?  631  ARG A HH21 1  
ATOM 1198  H HH22 . ARG A 1 75 ? 4.466   -0.976  13.801  1.00 0.00 ?  631  ARG A HH22 1  
ATOM 1199  N N    . TYR A 1 76 ? 4.320   -2.865  5.585   1.00 0.00 ?  632  TYR A N    1  
ATOM 1200  C CA   . TYR A 1 76 ? 3.916   -4.177  5.146   1.00 0.00 ?  632  TYR A CA   1  
ATOM 1201  C C    . TYR A 1 76 ? 4.760   -4.635  3.979   1.00 0.00 ?  632  TYR A C    1  
ATOM 1202  O O    . TYR A 1 76 ? 5.282   -5.731  3.989   1.00 0.00 ?  632  TYR A O    1  
ATOM 1203  C CB   . TYR A 1 76 ? 2.450   -4.159  4.716   1.00 0.00 ?  632  TYR A CB   1  
ATOM 1204  C CG   . TYR A 1 76 ? 1.963   -5.479  4.165   1.00 0.00 ?  632  TYR A CG   1  
ATOM 1205  C CD1  . TYR A 1 76 ? 2.100   -5.747  2.819   1.00 0.00 ?  632  TYR A CD1  1  
ATOM 1206  C CD2  . TYR A 1 76 ? 1.387   -6.447  4.978   1.00 0.00 ?  632  TYR A CD2  1  
ATOM 1207  C CE1  . TYR A 1 76 ? 1.694   -6.920  2.277   1.00 0.00 ?  632  TYR A CE1  1  
ATOM 1208  C CE2  . TYR A 1 76 ? 0.961   -7.657  4.443   1.00 0.00 ?  632  TYR A CE2  1  
ATOM 1209  C CZ   . TYR A 1 76 ? 1.120   -7.887  3.093   1.00 0.00 ?  632  TYR A CZ   1  
ATOM 1210  O OH   . TYR A 1 76 ? 0.689   -9.067  2.560   1.00 0.00 ?  632  TYR A OH   1  
ATOM 1211  H H    . TYR A 1 76 ? 3.659   -2.140  5.555   1.00 0.00 ?  632  TYR A H    1  
ATOM 1212  H HA   . TYR A 1 76 ? 4.022   -4.867  5.968   1.00 0.00 ?  632  TYR A HA   1  
ATOM 1213  H HB2  . TYR A 1 76 ? 1.804   -3.858  5.526   1.00 0.00 ?  632  TYR A HB2  1  
ATOM 1214  H HB3  . TYR A 1 76 ? 2.394   -3.443  3.906   1.00 0.00 ?  632  TYR A HB3  1  
ATOM 1215  H HD1  . TYR A 1 76 ? 2.547   -4.985  2.198   1.00 0.00 ?  632  TYR A HD1  1  
ATOM 1216  H HD2  . TYR A 1 76 ? 1.270   -6.232  6.030   1.00 0.00 ?  632  TYR A HD2  1  
ATOM 1217  H HE1  . TYR A 1 76 ? 1.848   -7.028  1.212   1.00 0.00 ?  632  TYR A HE1  1  
ATOM 1218  H HE2  . TYR A 1 76 ? 0.511   -8.425  5.059   1.00 0.00 ?  632  TYR A HE2  1  
ATOM 1219  H HH   . TYR A 1 76 ? -0.213  -9.213  2.856   1.00 0.00 ?  632  TYR A HH   1  
ATOM 1220  N N    . VAL A 1 77 ? 4.884   -3.786  2.985   1.00 0.00 ?  633  VAL A N    1  
ATOM 1221  C CA   . VAL A 1 77 ? 5.589   -4.143  1.763   1.00 0.00 ?  633  VAL A CA   1  
ATOM 1222  C C    . VAL A 1 77 ? 7.059   -4.396  2.056   1.00 0.00 ?  633  VAL A C    1  
ATOM 1223  O O    . VAL A 1 77 ? 7.644   -5.362  1.563   1.00 0.00 ?  633  VAL A O    1  
ATOM 1224  C CB   . VAL A 1 77 ? 5.437   -3.051  0.684   1.00 0.00 ?  633  VAL A CB   1  
ATOM 1225  C CG1  . VAL A 1 77 ? 6.163   -3.455  -0.578  1.00 0.00 ?  633  VAL A CG1  1  
ATOM 1226  C CG2  . VAL A 1 77 ? 3.972   -2.824  0.382   1.00 0.00 ?  633  VAL A CG2  1  
ATOM 1227  H H    . VAL A 1 77 ? 4.494   -2.886  3.087   1.00 0.00 ?  633  VAL A H    1  
ATOM 1228  H HA   . VAL A 1 77 ? 5.158   -5.064  1.387   1.00 0.00 ?  633  VAL A HA   1  
ATOM 1229  H HB   . VAL A 1 77 ? 5.857   -2.127  1.052   1.00 0.00 ?  633  VAL A HB   1  
ATOM 1230  H HG11 . VAL A 1 77 ? 6.054   -2.677  -1.319  1.00 0.00 ?  633  VAL A HG11 1  
ATOM 1231  H HG12 . VAL A 1 77 ? 5.717   -4.370  -0.936  1.00 0.00 ?  633  VAL A HG12 1  
ATOM 1232  H HG13 . VAL A 1 77 ? 7.206   -3.617  -0.352  1.00 0.00 ?  633  VAL A HG13 1  
ATOM 1233  H HG21 . VAL A 1 77 ? 3.459   -2.550  1.293   1.00 0.00 ?  633  VAL A HG21 1  
ATOM 1234  H HG22 . VAL A 1 77 ? 3.538   -3.726  -0.026  1.00 0.00 ?  633  VAL A HG22 1  
ATOM 1235  H HG23 . VAL A 1 77 ? 3.873   -2.021  -0.332  1.00 0.00 ?  633  VAL A HG23 1  
ATOM 1236  N N    . LYS A 1 78 ? 7.630   -3.563  2.910   1.00 0.00 ?  634  LYS A N    1  
ATOM 1237  C CA   . LYS A 1 78 ? 9.018   -3.701  3.305   1.00 0.00 ?  634  LYS A CA   1  
ATOM 1238  C C    . LYS A 1 78 ? 9.200   -5.029  4.041   1.00 0.00 ?  634  LYS A C    1  
ATOM 1239  O O    . LYS A 1 78 ? 10.236  -5.693  3.916   1.00 0.00 ?  634  LYS A O    1  
ATOM 1240  C CB   . LYS A 1 78 ? 9.423   -2.526  4.194   1.00 0.00 ?  634  LYS A CB   1  
ATOM 1241  C CG   . LYS A 1 78 ? 10.921  -2.368  4.407   1.00 0.00 ?  634  LYS A CG   1  
ATOM 1242  C CD   . LYS A 1 78 ? 11.652  -2.235  3.072   1.00 0.00 ?  634  LYS A CD   1  
ATOM 1243  C CE   . LYS A 1 78 ? 13.008  -1.569  3.231   1.00 0.00 ?  634  LYS A CE   1  
ATOM 1244  N NZ   . LYS A 1 78 ? 12.869  -0.143  3.612   1.00 0.00 1  634  LYS A NZ   1  
ATOM 1245  H H    . LYS A 1 78 ? 7.102   -2.816  3.271   1.00 0.00 ?  634  LYS A H    1  
ATOM 1246  H HA   . LYS A 1 78 ? 9.622   -3.704  2.411   1.00 0.00 ?  634  LYS A HA   1  
ATOM 1247  H HB2  . LYS A 1 78 ? 9.050   -1.612  3.756   1.00 0.00 ?  634  LYS A HB2  1  
ATOM 1248  H HB3  . LYS A 1 78 ? 8.955   -2.656  5.158   1.00 0.00 ?  634  LYS A HB3  1  
ATOM 1249  H HG2  . LYS A 1 78 ? 11.111  -1.492  5.008   1.00 0.00 ?  634  LYS A HG2  1  
ATOM 1250  H HG3  . LYS A 1 78 ? 11.291  -3.243  4.921   1.00 0.00 ?  634  LYS A HG3  1  
ATOM 1251  H HD2  . LYS A 1 78 ? 11.799  -3.223  2.661   1.00 0.00 ?  634  LYS A HD2  1  
ATOM 1252  H HD3  . LYS A 1 78 ? 11.042  -1.654  2.397   1.00 0.00 ?  634  LYS A HD3  1  
ATOM 1253  H HE2  . LYS A 1 78 ? 13.566  -2.087  3.998   1.00 0.00 ?  634  LYS A HE2  1  
ATOM 1254  H HE3  . LYS A 1 78 ? 13.538  -1.635  2.292   1.00 0.00 ?  634  LYS A HE3  1  
ATOM 1255  H HZ1  . LYS A 1 78 ? 12.366  -0.035  4.517   1.00 0.00 ?  634  LYS A HZ1  1  
ATOM 1256  H HZ2  . LYS A 1 78 ? 12.324  0.373   2.893   1.00 0.00 ?  634  LYS A HZ2  1  
ATOM 1257  H HZ3  . LYS A 1 78 ? 13.794  0.322   3.700   1.00 0.00 ?  634  LYS A HZ3  1  
ATOM 1258  N N    . SER A 1 79 ? 8.183   -5.406  4.791   1.00 0.00 ?  635  SER A N    1  
ATOM 1259  C CA   . SER A 1 79 ? 8.160   -6.670  5.464   1.00 0.00 ?  635  SER A CA   1  
ATOM 1260  C C    . SER A 1 79 ? 8.018   -7.812  4.438   1.00 0.00 ?  635  SER A C    1  
ATOM 1261  O O    . SER A 1 79 ? 8.769   -8.765  4.486   1.00 0.00 ?  635  SER A O    1  
ATOM 1262  C CB   . SER A 1 79 ? 7.030   -6.707  6.504   1.00 0.00 ?  635  SER A CB   1  
ATOM 1263  O OG   . SER A 1 79 ? 7.156   -5.622  7.427   1.00 0.00 ?  635  SER A OG   1  
ATOM 1264  H H    . SER A 1 79 ? 7.420   -4.798  4.892   1.00 0.00 ?  635  SER A H    1  
ATOM 1265  H HA   . SER A 1 79 ? 9.107   -6.782  5.969   1.00 0.00 ?  635  SER A HA   1  
ATOM 1266  H HB2  . SER A 1 79 ? 6.077   -6.630  6.002   1.00 0.00 ?  635  SER A HB2  1  
ATOM 1267  H HB3  . SER A 1 79 ? 7.078   -7.634  7.055   1.00 0.00 ?  635  SER A HB3  1  
ATOM 1268  H HG   . SER A 1 79 ? 7.010   -4.796  6.945   1.00 0.00 ?  635  SER A HG   1  
ATOM 1269  N N    . CYS A 1 80 ? 7.090   -7.671  3.474   1.00 0.00 ?  636  CYS A N    1  
ATOM 1270  C CA   . CYS A 1 80 ? 6.848   -8.689  2.467   1.00 0.00 ?  636  CYS A CA   1  
ATOM 1271  C C    . CYS A 1 80 ? 8.098   -8.990  1.642   1.00 0.00 ?  636  CYS A C    1  
ATOM 1272  O O    . CYS A 1 80 ? 8.356   -10.137 1.288   1.00 0.00 ?  636  CYS A O    1  
ATOM 1273  C CB   . CYS A 1 80 ? 5.707   -8.294  1.538   1.00 0.00 ?  636  CYS A CB   1  
ATOM 1274  S SG   . CYS A 1 80 ? 5.289   -9.609  0.373   1.00 0.00 ?  636  CYS A SG   1  
ATOM 1275  H H    . CYS A 1 80 ? 6.522   -6.868  3.438   1.00 0.00 ?  636  CYS A H    1  
ATOM 1276  H HA   . CYS A 1 80 ? 6.543   -9.582  2.986   1.00 0.00 ?  636  CYS A HA   1  
ATOM 1277  H HB2  . CYS A 1 80 ? 4.827   -8.072  2.125   1.00 0.00 ?  636  CYS A HB2  1  
ATOM 1278  H HB3  . CYS A 1 80 ? 5.993   -7.424  0.966   1.00 0.00 ?  636  CYS A HB3  1  
ATOM 1279  H HG   . CYS A 1 80 ? 6.386   -10.349 0.262   1.00 0.00 ?  636  CYS A HG   1  
ATOM 1280  N N    . LEU A 1 81 ? 8.883   -7.961  1.356   1.00 0.00 ?  637  LEU A N    1  
ATOM 1281  C CA   . LEU A 1 81 ? 10.104  -8.117  0.564   1.00 0.00 ?  637  LEU A CA   1  
ATOM 1282  C C    . LEU A 1 81 ? 11.151  -8.961  1.297   1.00 0.00 ?  637  LEU A C    1  
ATOM 1283  O O    . LEU A 1 81 ? 11.874  -9.757  0.679   1.00 0.00 ?  637  LEU A O    1  
ATOM 1284  C CB   . LEU A 1 81 ? 10.697  -6.749  0.198   1.00 0.00 ?  637  LEU A CB   1  
ATOM 1285  C CG   . LEU A 1 81 ? 9.818   -5.828  -0.659  1.00 0.00 ?  637  LEU A CG   1  
ATOM 1286  C CD1  . LEU A 1 81 ? 10.516  -4.499  -0.897  1.00 0.00 ?  637  LEU A CD1  1  
ATOM 1287  C CD2  . LEU A 1 81 ? 9.467   -6.490  -1.986  1.00 0.00 ?  637  LEU A CD2  1  
ATOM 1288  H H    . LEU A 1 81 ? 8.617   -7.065  1.665   1.00 0.00 ?  637  LEU A H    1  
ATOM 1289  H HA   . LEU A 1 81 ? 9.839   -8.632  -0.347  1.00 0.00 ?  637  LEU A HA   1  
ATOM 1290  H HB2  . LEU A 1 81 ? 10.928  -6.230  1.117   1.00 0.00 ?  637  LEU A HB2  1  
ATOM 1291  H HB3  . LEU A 1 81 ? 11.623  -6.919  -0.330  1.00 0.00 ?  637  LEU A HB3  1  
ATOM 1292  H HG   . LEU A 1 81 ? 8.901   -5.624  -0.126  1.00 0.00 ?  637  LEU A HG   1  
ATOM 1293  H HD11 . LEU A 1 81 ? 10.713  -4.019  0.050   1.00 0.00 ?  637  LEU A HD11 1  
ATOM 1294  H HD12 . LEU A 1 81 ? 9.884   -3.861  -1.498  1.00 0.00 ?  637  LEU A HD12 1  
ATOM 1295  H HD13 . LEU A 1 81 ? 11.448  -4.672  -1.415  1.00 0.00 ?  637  LEU A HD13 1  
ATOM 1296  H HD21 . LEU A 1 81 ? 8.917   -7.401  -1.803  1.00 0.00 ?  637  LEU A HD21 1  
ATOM 1297  H HD22 . LEU A 1 81 ? 10.375  -6.720  -2.523  1.00 0.00 ?  637  LEU A HD22 1  
ATOM 1298  H HD23 . LEU A 1 81 ? 8.861   -5.817  -2.574  1.00 0.00 ?  637  LEU A HD23 1  
ATOM 1299  N N    . GLN A 1 82 ? 11.209  -8.818  2.603   1.00 0.00 ?  638  GLN A N    1  
ATOM 1300  C CA   . GLN A 1 82 ? 12.209  -9.520  3.392   1.00 0.00 ?  638  GLN A CA   1  
ATOM 1301  C C    . GLN A 1 82 ? 11.635  -10.811 3.987   1.00 0.00 ?  638  GLN A C    1  
ATOM 1302  O O    . GLN A 1 82 ? 12.367  -11.652 4.508   1.00 0.00 ?  638  GLN A O    1  
ATOM 1303  C CB   . GLN A 1 82 ? 12.760  -8.603  4.498   1.00 0.00 ?  638  GLN A CB   1  
ATOM 1304  C CG   . GLN A 1 82 ? 11.751  -8.238  5.575   1.00 0.00 ?  638  GLN A CG   1  
ATOM 1305  C CD   . GLN A 1 82 ? 12.264  -7.183  6.523   1.00 0.00 ?  638  GLN A CD   1  
ATOM 1306  O OE1  . GLN A 1 82 ? 12.902  -7.486  7.536   1.00 0.00 ?  638  GLN A OE1  1  
ATOM 1307  N NE2  . GLN A 1 82 ? 11.969  -5.950  6.232   1.00 0.00 ?  638  GLN A NE2  1  
ATOM 1308  H H    . GLN A 1 82 ? 10.564  -8.227  3.047   1.00 0.00 ?  638  GLN A H    1  
ATOM 1309  H HA   . GLN A 1 82 ? 13.018  -9.785  2.728   1.00 0.00 ?  638  GLN A HA   1  
ATOM 1310  H HB2  . GLN A 1 82 ? 13.595  -9.096  4.974   1.00 0.00 ?  638  GLN A HB2  1  
ATOM 1311  H HB3  . GLN A 1 82 ? 13.113  -7.689  4.044   1.00 0.00 ?  638  GLN A HB3  1  
ATOM 1312  H HG2  . GLN A 1 82 ? 10.855  -7.866  5.098   1.00 0.00 ?  638  GLN A HG2  1  
ATOM 1313  H HG3  . GLN A 1 82 ? 11.511  -9.127  6.139   1.00 0.00 ?  638  GLN A HG3  1  
ATOM 1314  H HE21 . GLN A 1 82 ? 11.435  -5.792  5.420   1.00 0.00 ?  638  GLN A HE21 1  
ATOM 1315  H HE22 . GLN A 1 82 ? 12.284  -5.235  6.825   1.00 0.00 ?  638  GLN A HE22 1  
ATOM 1316  N N    . LYS A 1 83 ? 10.343  -10.983 3.889   1.00 0.00 ?  639  LYS A N    1  
ATOM 1317  C CA   . LYS A 1 83 ? 9.697   -12.143 4.458   1.00 0.00 ?  639  LYS A CA   1  
ATOM 1318  C C    . LYS A 1 83 ? 8.967   -12.920 3.359   1.00 0.00 ?  639  LYS A C    1  
ATOM 1319  O O    . LYS A 1 83 ? 8.025   -13.672 3.603   1.00 0.00 ?  639  LYS A O    1  
ATOM 1320  C CB   . LYS A 1 83 ? 8.747   -11.699 5.573   1.00 0.00 ?  639  LYS A CB   1  
ATOM 1321  C CG   . LYS A 1 83 ? 8.306   -12.811 6.514   1.00 0.00 ?  639  LYS A CG   1  
ATOM 1322  C CD   . LYS A 1 83 ? 7.386   -12.298 7.603   1.00 0.00 ?  639  LYS A CD   1  
ATOM 1323  C CE   . LYS A 1 83 ? 8.084   -11.283 8.489   1.00 0.00 ?  639  LYS A CE   1  
ATOM 1324  N NZ   . LYS A 1 83 ? 9.277   -11.847 9.152   1.00 0.00 1  639  LYS A NZ   1  
ATOM 1325  H H    . LYS A 1 83 ? 9.791   -10.297 3.453   1.00 0.00 ?  639  LYS A H    1  
ATOM 1326  H HA   . LYS A 1 83 ? 10.466  -12.775 4.877   1.00 0.00 ?  639  LYS A HA   1  
ATOM 1327  H HB2  . LYS A 1 83 ? 9.254   -10.942 6.153   1.00 0.00 ?  639  LYS A HB2  1  
ATOM 1328  H HB3  . LYS A 1 83 ? 7.870   -11.258 5.123   1.00 0.00 ?  639  LYS A HB3  1  
ATOM 1329  H HG2  . LYS A 1 83 ? 7.802   -13.586 5.957   1.00 0.00 ?  639  LYS A HG2  1  
ATOM 1330  H HG3  . LYS A 1 83 ? 9.193   -13.210 6.983   1.00 0.00 ?  639  LYS A HG3  1  
ATOM 1331  H HD2  . LYS A 1 83 ? 6.529   -11.831 7.143   1.00 0.00 ?  639  LYS A HD2  1  
ATOM 1332  H HD3  . LYS A 1 83 ? 7.062   -13.132 8.208   1.00 0.00 ?  639  LYS A HD3  1  
ATOM 1333  H HE2  . LYS A 1 83 ? 8.400   -10.454 7.872   1.00 0.00 ?  639  LYS A HE2  1  
ATOM 1334  H HE3  . LYS A 1 83 ? 7.391   -10.934 9.239   1.00 0.00 ?  639  LYS A HE3  1  
ATOM 1335  H HZ1  . LYS A 1 83 ? 9.047   -12.665 9.752   1.00 0.00 ?  639  LYS A HZ1  1  
ATOM 1336  H HZ2  . LYS A 1 83 ? 9.692   -11.125 9.776   1.00 0.00 ?  639  LYS A HZ2  1  
ATOM 1337  H HZ3  . LYS A 1 83 ? 10.015  -12.119 8.473   1.00 0.00 ?  639  LYS A HZ3  1  
ATOM 1338  N N    . LYS A 1 84 ? 9.446   -12.759 2.140   1.00 0.00 ?  640  LYS A N    1  
ATOM 1339  C CA   . LYS A 1 84 ? 8.912   -13.493 0.991   1.00 0.00 ?  640  LYS A CA   1  
ATOM 1340  C C    . LYS A 1 84 ? 9.303   -14.968 1.109   1.00 0.00 ?  640  LYS A C    1  
ATOM 1341  O O    . LYS A 1 84 ? 8.702   -15.848 0.489   1.00 0.00 ?  640  LYS A O    1  
ATOM 1342  C CB   . LYS A 1 84 ? 9.444   -12.898 -0.322  1.00 0.00 ?  640  LYS A CB   1  
ATOM 1343  C CG   . LYS A 1 84 ? 10.956  -12.915 -0.424  1.00 0.00 ?  640  LYS A CG   1  
ATOM 1344  C CD   . LYS A 1 84 ? 11.452  -12.293 -1.706  1.00 0.00 ?  640  LYS A CD   1  
ATOM 1345  C CE   . LYS A 1 84 ? 12.971  -12.341 -1.768  1.00 0.00 ?  640  LYS A CE   1  
ATOM 1346  N NZ   . LYS A 1 84 ? 13.587  -11.621 -0.630  1.00 0.00 1  640  LYS A NZ   1  
ATOM 1347  H H    . LYS A 1 84 ? 10.165  -12.106 2.012   1.00 0.00 ?  640  LYS A H    1  
ATOM 1348  H HA   . LYS A 1 84 ? 7.835   -13.411 1.017   1.00 0.00 ?  640  LYS A HA   1  
ATOM 1349  H HB2  . LYS A 1 84 ? 9.043   -13.464 -1.150  1.00 0.00 ?  640  LYS A HB2  1  
ATOM 1350  H HB3  . LYS A 1 84 ? 9.109   -11.875 -0.400  1.00 0.00 ?  640  LYS A HB3  1  
ATOM 1351  H HG2  . LYS A 1 84 ? 11.357  -12.350 0.404   1.00 0.00 ?  640  LYS A HG2  1  
ATOM 1352  H HG3  . LYS A 1 84 ? 11.300  -13.937 -0.363  1.00 0.00 ?  640  LYS A HG3  1  
ATOM 1353  H HD2  . LYS A 1 84 ? 11.040  -12.833 -2.545  1.00 0.00 ?  640  LYS A HD2  1  
ATOM 1354  H HD3  . LYS A 1 84 ? 11.130  -11.264 -1.745  1.00 0.00 ?  640  LYS A HD3  1  
ATOM 1355  H HE2  . LYS A 1 84 ? 13.282  -13.374 -1.739  1.00 0.00 ?  640  LYS A HE2  1  
ATOM 1356  H HE3  . LYS A 1 84 ? 13.305  -11.896 -2.693  1.00 0.00 ?  640  LYS A HE3  1  
ATOM 1357  H HZ1  . LYS A 1 84 ? 14.623  -11.620 -0.723  1.00 0.00 ?  640  LYS A HZ1  1  
ATOM 1358  H HZ2  . LYS A 1 84 ? 13.365  -12.085 0.274   1.00 0.00 ?  640  LYS A HZ2  1  
ATOM 1359  H HZ3  . LYS A 1 84 ? 13.260  -10.634 -0.595  1.00 0.00 ?  640  LYS A HZ3  1  
ATOM 1360  N N    . GLN A 1 85 ? 10.332  -15.212 1.899   1.00 0.00 ?  641  GLN A N    1  
ATOM 1361  C CA   . GLN A 1 85 ? 10.789  -16.534 2.200   1.00 0.00 ?  641  GLN A CA   1  
ATOM 1362  C C    . GLN A 1 85 ? 9.810   -17.185 3.168   1.00 0.00 ?  641  GLN A C    1  
ATOM 1363  O O    . GLN A 1 85 ? 9.768   -16.845 4.356   1.00 0.00 ?  641  GLN A O    1  
ATOM 1364  C CB   . GLN A 1 85 ? 12.194  -16.465 2.813   1.00 0.00 ?  641  GLN A CB   1  
ATOM 1365  C CG   . GLN A 1 85 ? 12.816  -17.807 3.179   1.00 0.00 ?  641  GLN A CG   1  
ATOM 1366  C CD   . GLN A 1 85 ? 12.943  -18.741 1.999   1.00 0.00 ?  641  GLN A CD   1  
ATOM 1367  O OE1  . GLN A 1 85 ? 13.930  -18.693 1.272   1.00 0.00 ?  641  GLN A OE1  1  
ATOM 1368  N NE2  . GLN A 1 85 ? 12.001  -19.634 1.838   1.00 0.00 ?  641  GLN A NE2  1  
ATOM 1369  H H    . GLN A 1 85 ? 10.794  -14.444 2.298   1.00 0.00 ?  641  GLN A H    1  
ATOM 1370  H HA   . GLN A 1 85 ? 10.828  -17.106 1.285   1.00 0.00 ?  641  GLN A HA   1  
ATOM 1371  H HB2  . GLN A 1 85 ? 12.850  -15.979 2.107   1.00 0.00 ?  641  GLN A HB2  1  
ATOM 1372  H HB3  . GLN A 1 85 ? 12.143  -15.861 3.707   1.00 0.00 ?  641  GLN A HB3  1  
ATOM 1373  H HG2  . GLN A 1 85 ? 13.802  -17.638 3.588   1.00 0.00 ?  641  GLN A HG2  1  
ATOM 1374  H HG3  . GLN A 1 85 ? 12.197  -18.279 3.927   1.00 0.00 ?  641  GLN A HG3  1  
ATOM 1375  H HE21 . GLN A 1 85 ? 11.250  -19.690 2.472   1.00 0.00 ?  641  GLN A HE21 1  
ATOM 1376  H HE22 . GLN A 1 85 ? 12.094  -20.248 1.077   1.00 0.00 ?  641  GLN A HE22 1  
ATOM 1377  N N    . ARG A 1 86 ? 8.991   -18.052 2.644   1.00 0.00 ?  642  ARG A N    1  
ATOM 1378  C CA   . ARG A 1 86 ? 8.025   -18.777 3.441   1.00 0.00 ?  642  ARG A CA   1  
ATOM 1379  C C    . ARG A 1 86 ? 8.632   -20.072 3.932   1.00 0.00 ?  642  ARG A C    1  
ATOM 1380  O O    . ARG A 1 86 ? 9.765   -20.415 3.549   1.00 0.00 ?  642  ARG A O    1  
ATOM 1381  C CB   . ARG A 1 86 ? 6.756   -19.068 2.632   1.00 0.00 ?  642  ARG A CB   1  
ATOM 1382  C CG   . ARG A 1 86 ? 7.007   -19.835 1.339   1.00 0.00 ?  642  ARG A CG   1  
ATOM 1383  C CD   . ARG A 1 86 ? 5.707   -20.213 0.659   1.00 0.00 ?  642  ARG A CD   1  
ATOM 1384  N NE   . ARG A 1 86 ? 4.878   -19.040 0.359   1.00 0.00 ?  642  ARG A NE   1  
ATOM 1385  C CZ   . ARG A 1 86 ? 3.630   -19.089 -0.105  1.00 0.00 ?  642  ARG A CZ   1  
ATOM 1386  N NH1  . ARG A 1 86 ? 3.106   -20.250 -0.484  1.00 0.00 1  642  ARG A NH1  1  
ATOM 1387  N NH2  . ARG A 1 86 ? 2.946   -17.965 -0.235  1.00 0.00 ?  642  ARG A NH2  1  
ATOM 1388  H H    . ARG A 1 86 ? 9.034   -18.214 1.679   1.00 0.00 ?  642  ARG A H    1  
ATOM 1389  H HA   . ARG A 1 86 ? 7.767   -18.170 4.294   1.00 0.00 ?  642  ARG A HA   1  
ATOM 1390  H HB2  . ARG A 1 86 ? 6.085   -19.655 3.242   1.00 0.00 ?  642  ARG A HB2  1  
ATOM 1391  H HB3  . ARG A 1 86 ? 6.273   -18.135 2.382   1.00 0.00 ?  642  ARG A HB3  1  
ATOM 1392  H HG2  . ARG A 1 86 ? 7.584   -19.211 0.673   1.00 0.00 ?  642  ARG A HG2  1  
ATOM 1393  H HG3  . ARG A 1 86 ? 7.566   -20.730 1.567   1.00 0.00 ?  642  ARG A HG3  1  
ATOM 1394  H HD2  . ARG A 1 86 ? 5.932   -20.720 -0.266  1.00 0.00 ?  642  ARG A HD2  1  
ATOM 1395  H HD3  . ARG A 1 86 ? 5.152   -20.877 1.304   1.00 0.00 ?  642  ARG A HD3  1  
ATOM 1396  H HE   . ARG A 1 86 ? 5.291   -18.169 0.548   1.00 0.00 ?  642  ARG A HE   1  
ATOM 1397  H HH11 . ARG A 1 86 ? 3.636   -21.102 -0.434  1.00 0.00 ?  642  ARG A HH11 1  
ATOM 1398  H HH12 . ARG A 1 86 ? 2.174   -20.342 -0.843  1.00 0.00 ?  642  ARG A HH12 1  
ATOM 1399  H HH21 . ARG A 1 86 ? 3.360   -17.083 0.002   1.00 0.00 ?  642  ARG A HH21 1  
ATOM 1400  H HH22 . ARG A 1 86 ? 1.985   -17.894 -0.543  1.00 0.00 ?  642  ARG A HH22 1  
ATOM 1401  N N    . LYS A 1 87 ? 7.904   -20.767 4.770   1.00 0.00 ?  643  LYS A N    1  
ATOM 1402  C CA   . LYS A 1 87 ? 8.330   -22.033 5.290   1.00 0.00 ?  643  LYS A CA   1  
ATOM 1403  C C    . LYS A 1 87 ? 7.163   -23.027 5.241   1.00 0.00 ?  643  LYS A C    1  
ATOM 1404  O O    . LYS A 1 87 ? 6.467   -23.243 6.249   1.00 0.00 ?  643  LYS A O    1  
ATOM 1405  C CB   . LYS A 1 87 ? 8.928   -21.863 6.705   1.00 0.00 ?  643  LYS A CB   1  
ATOM 1406  C CG   . LYS A 1 87 ? 8.018   -21.166 7.722   1.00 0.00 ?  643  LYS A CG   1  
ATOM 1407  C CD   . LYS A 1 87 ? 8.713   -20.951 9.054   1.00 0.00 ?  643  LYS A CD   1  
ATOM 1408  C CE   . LYS A 1 87 ? 9.847   -19.944 8.935   1.00 0.00 ?  643  LYS A CE   1  
ATOM 1409  N NZ   . LYS A 1 87 ? 10.538  -19.731 10.216  1.00 0.00 1  643  LYS A NZ   1  
ATOM 1410  O OXT  . LYS A 1 87 ? 6.881   -23.543 4.147   1.00 0.00 ?  643  LYS A OXT  1  
ATOM 1411  H H    . LYS A 1 87 ? 7.029   -20.431 5.064   1.00 0.00 ?  643  LYS A H    1  
ATOM 1412  H HA   . LYS A 1 87 ? 9.097   -22.401 4.624   1.00 0.00 ?  643  LYS A HA   1  
ATOM 1413  H HB2  . LYS A 1 87 ? 9.174   -22.840 7.091   1.00 0.00 ?  643  LYS A HB2  1  
ATOM 1414  H HB3  . LYS A 1 87 ? 9.838   -21.292 6.609   1.00 0.00 ?  643  LYS A HB3  1  
ATOM 1415  H HG2  . LYS A 1 87 ? 7.728   -20.205 7.325   1.00 0.00 ?  643  LYS A HG2  1  
ATOM 1416  H HG3  . LYS A 1 87 ? 7.138   -21.774 7.873   1.00 0.00 ?  643  LYS A HG3  1  
ATOM 1417  H HD2  . LYS A 1 87 ? 7.988   -20.589 9.767   1.00 0.00 ?  643  LYS A HD2  1  
ATOM 1418  H HD3  . LYS A 1 87 ? 9.114   -21.893 9.399   1.00 0.00 ?  643  LYS A HD3  1  
ATOM 1419  H HE2  . LYS A 1 87 ? 10.561  -20.299 8.208   1.00 0.00 ?  643  LYS A HE2  1  
ATOM 1420  H HE3  . LYS A 1 87 ? 9.435   -19.004 8.598   1.00 0.00 ?  643  LYS A HE3  1  
ATOM 1421  H HZ1  . LYS A 1 87 ? 9.884   -19.384 10.947  1.00 0.00 ?  643  LYS A HZ1  1  
ATOM 1422  H HZ2  . LYS A 1 87 ? 11.298  -19.029 10.111  1.00 0.00 ?  643  LYS A HZ2  1  
ATOM 1423  H HZ3  . LYS A 1 87 ? 10.966  -20.613 10.558  1.00 0.00 ?  643  LYS A HZ3  1  
ATOM 1424  N N    . ARG B 2 1  ? -10.477 10.774  -6.386  1.00 0.00 ?  1591 ARG B N    1  
ATOM 1425  C CA   . ARG B 2 1  ? -10.142 12.184  -6.199  1.00 0.00 ?  1591 ARG B CA   1  
ATOM 1426  C C    . ARG B 2 1  ? -9.401  12.745  -7.422  1.00 0.00 ?  1591 ARG B C    1  
ATOM 1427  O O    . ARG B 2 1  ? -9.832  13.735  -8.011  1.00 0.00 ?  1591 ARG B O    1  
ATOM 1428  C CB   . ARG B 2 1  ? -9.298  12.379  -4.922  1.00 0.00 ?  1591 ARG B CB   1  
ATOM 1429  C CG   . ARG B 2 1  ? -8.810  13.805  -4.710  1.00 0.00 ?  1591 ARG B CG   1  
ATOM 1430  C CD   . ARG B 2 1  ? -9.947  14.794  -4.531  1.00 0.00 ?  1591 ARG B CD   1  
ATOM 1431  N NE   . ARG B 2 1  ? -9.457  16.170  -4.582  1.00 0.00 ?  1591 ARG B NE   1  
ATOM 1432  C CZ   . ARG B 2 1  ? -10.101 17.242  -4.116  1.00 0.00 ?  1591 ARG B CZ   1  
ATOM 1433  N NH1  . ARG B 2 1  ? -11.266 17.105  -3.493  1.00 0.00 1  1591 ARG B NH1  1  
ATOM 1434  N NH2  . ARG B 2 1  ? -9.577  18.454  -4.279  1.00 0.00 ?  1591 ARG B NH2  1  
ATOM 1435  H H1   . ARG B 2 1  ? -10.984 10.385  -5.568  1.00 0.00 ?  1591 ARG B H1   1  
ATOM 1436  H HA   . ARG B 2 1  ? -11.072 12.722  -6.090  1.00 0.00 ?  1591 ARG B HA   1  
ATOM 1437  H HB2  . ARG B 2 1  ? -9.886  12.100  -4.061  1.00 0.00 ?  1591 ARG B HB2  1  
ATOM 1438  H HB3  . ARG B 2 1  ? -8.434  11.733  -4.978  1.00 0.00 ?  1591 ARG B HB3  1  
ATOM 1439  H HG2  . ARG B 2 1  ? -8.190  13.833  -3.828  1.00 0.00 ?  1591 ARG B HG2  1  
ATOM 1440  H HG3  . ARG B 2 1  ? -8.220  14.098  -5.567  1.00 0.00 ?  1591 ARG B HG3  1  
ATOM 1441  H HD2  . ARG B 2 1  ? -10.674 14.649  -5.316  1.00 0.00 ?  1591 ARG B HD2  1  
ATOM 1442  H HD3  . ARG B 2 1  ? -10.410 14.624  -3.570  1.00 0.00 ?  1591 ARG B HD3  1  
ATOM 1443  H HE   . ARG B 2 1  ? -8.590  16.267  -5.039  1.00 0.00 ?  1591 ARG B HE   1  
ATOM 1444  H HH11 . ARG B 2 1  ? -11.701 16.214  -3.344  1.00 0.00 ?  1591 ARG B HH11 1  
ATOM 1445  H HH12 . ARG B 2 1  ? -11.768 17.897  -3.141  1.00 0.00 ?  1591 ARG B HH12 1  
ATOM 1446  H HH21 . ARG B 2 1  ? -8.703  18.608  -4.750  1.00 0.00 ?  1591 ARG B HH21 1  
ATOM 1447  H HH22 . ARG B 2 1  ? -10.030 19.283  -3.937  1.00 0.00 ?  1591 ARG B HH22 1  
ATOM 1448  N N    . SER B 2 2  ? -8.304  12.122  -7.807  1.00 0.00 ?  1592 SER B N    1  
ATOM 1449  C CA   . SER B 2 2  ? -7.516  12.624  -8.909  1.00 0.00 ?  1592 SER B CA   1  
ATOM 1450  C C    . SER B 2 2  ? -6.852  11.452  -9.628  1.00 0.00 ?  1592 SER B C    1  
ATOM 1451  O O    . SER B 2 2  ? -7.399  10.929  -10.603 1.00 0.00 ?  1592 SER B O    1  
ATOM 1452  C CB   . SER B 2 2  ? -6.479  13.663  -8.394  1.00 0.00 ?  1592 SER B CB   1  
ATOM 1453  O OG   . SER B 2 2  ? -5.749  14.285  -9.440  1.00 0.00 ?  1592 SER B OG   1  
ATOM 1454  H H    . SER B 2 2  ? -8.022  11.279  -7.373  1.00 0.00 ?  1592 SER B H    1  
ATOM 1455  H HA   . SER B 2 2  ? -8.193  13.109  -9.596  1.00 0.00 ?  1592 SER B HA   1  
ATOM 1456  H HB2  . SER B 2 2  ? -6.993  14.431  -7.838  1.00 0.00 ?  1592 SER B HB2  1  
ATOM 1457  H HB3  . SER B 2 2  ? -5.782  13.170  -7.732  1.00 0.00 ?  1592 SER B HB3  1  
ATOM 1458  H HG   . SER B 2 2  ? -6.343  14.461  -10.180 1.00 0.00 ?  1592 SER B HG   1  
ATOM 1459  N N    . VAL B 2 3  ? -5.724  11.009  -9.117  1.00 0.00 ?  1593 VAL B N    1  
ATOM 1460  C CA   . VAL B 2 3  ? -5.022  9.879   -9.667  1.00 0.00 ?  1593 VAL B CA   1  
ATOM 1461  C C    . VAL B 2 3  ? -5.282  8.725   -8.719  1.00 0.00 ?  1593 VAL B C    1  
ATOM 1462  O O    . VAL B 2 3  ? -4.784  8.710   -7.595  1.00 0.00 ?  1593 VAL B O    1  
ATOM 1463  C CB   . VAL B 2 3  ? -3.506  10.159  -9.793  1.00 0.00 ?  1593 VAL B CB   1  
ATOM 1464  C CG1  . VAL B 2 3  ? -2.827  9.070   -10.586 1.00 0.00 ?  1593 VAL B CG1  1  
ATOM 1465  C CG2  . VAL B 2 3  ? -3.260  11.510  -10.442 1.00 0.00 ?  1593 VAL B CG2  1  
ATOM 1466  H H    . VAL B 2 3  ? -5.331  11.440  -8.330  1.00 0.00 ?  1593 VAL B H    1  
ATOM 1467  H HA   . VAL B 2 3  ? -5.449  9.652   -10.634 1.00 0.00 ?  1593 VAL B HA   1  
ATOM 1468  H HB   . VAL B 2 3  ? -3.079  10.177  -8.801  1.00 0.00 ?  1593 VAL B HB   1  
ATOM 1469  H HG11 . VAL B 2 3  ? -3.240  9.038   -11.583 1.00 0.00 ?  1593 VAL B HG11 1  
ATOM 1470  H HG12 . VAL B 2 3  ? -2.988  8.119   -10.101 1.00 0.00 ?  1593 VAL B HG12 1  
ATOM 1471  H HG13 . VAL B 2 3  ? -1.767  9.268   -10.643 1.00 0.00 ?  1593 VAL B HG13 1  
ATOM 1472  H HG21 . VAL B 2 3  ? -2.198  11.679  -10.531 1.00 0.00 ?  1593 VAL B HG21 1  
ATOM 1473  H HG22 . VAL B 2 3  ? -3.701  12.290  -9.839  1.00 0.00 ?  1593 VAL B HG22 1  
ATOM 1474  H HG23 . VAL B 2 3  ? -3.706  11.518  -11.425 1.00 0.00 ?  1593 VAL B HG23 1  
ATOM 1475  N N    . LYS B 2 4  ? -6.071  7.792   -9.173  1.00 0.00 ?  1594 LYS B N    1  
ATOM 1476  C CA   . LYS B 2 4  ? -6.678  6.774   -8.316  1.00 0.00 ?  1594 LYS B CA   1  
ATOM 1477  C C    . LYS B 2 4  ? -5.697  5.734   -7.802  1.00 0.00 ?  1594 LYS B C    1  
ATOM 1478  O O    . LYS B 2 4  ? -5.029  5.034   -8.564  1.00 0.00 ?  1594 LYS B O    1  
ATOM 1479  C CB   . LYS B 2 4  ? -7.818  6.040   -9.049  1.00 0.00 ?  1594 LYS B CB   1  
ATOM 1480  C CG   . LYS B 2 4  ? -8.785  6.909   -9.859  1.00 0.00 ?  1594 LYS B CG   1  
ATOM 1481  C CD   . LYS B 2 4  ? -9.453  7.970   -9.022  1.00 0.00 ?  1594 LYS B CD   1  
ATOM 1482  C CE   . LYS B 2 4  ? -10.526 8.707   -9.797  1.00 0.00 ?  1594 LYS B CE   1  
ATOM 1483  N NZ   . LYS B 2 4  ? -11.670 7.835   -10.121 1.00 0.00 1  1594 LYS B NZ   1  
ATOM 1484  H H    . LYS B 2 4  ? -6.246  7.768   -10.140 1.00 0.00 ?  1594 LYS B H    1  
ATOM 1485  H HA   . LYS B 2 4  ? -7.094  7.260   -7.441  1.00 0.00 ?  1594 LYS B HA   1  
ATOM 1486  H HB2  . LYS B 2 4  ? -7.372  5.331   -9.731  1.00 0.00 ?  1594 LYS B HB2  1  
ATOM 1487  H HB3  . LYS B 2 4  ? -8.391  5.489   -8.318  1.00 0.00 ?  1594 LYS B HB3  1  
ATOM 1488  H HG2  . LYS B 2 4  ? -8.237  7.397   -10.650 1.00 0.00 ?  1594 LYS B HG2  1  
ATOM 1489  H HG3  . LYS B 2 4  ? -9.540  6.272   -10.295 1.00 0.00 ?  1594 LYS B HG3  1  
ATOM 1490  H HD2  . LYS B 2 4  ? -9.899  7.496   -8.162  1.00 0.00 ?  1594 LYS B HD2  1  
ATOM 1491  H HD3  . LYS B 2 4  ? -8.704  8.676   -8.692  1.00 0.00 ?  1594 LYS B HD3  1  
ATOM 1492  H HE2  . LYS B 2 4  ? -10.871 9.537   -9.202  1.00 0.00 ?  1594 LYS B HE2  1  
ATOM 1493  H HE3  . LYS B 2 4  ? -10.096 9.080   -10.714 1.00 0.00 ?  1594 LYS B HE3  1  
ATOM 1494  H HZ1  . LYS B 2 4  ? -12.124 7.488   -9.251  1.00 0.00 ?  1594 LYS B HZ1  1  
ATOM 1495  H HZ2  . LYS B 2 4  ? -11.352 7.000   -10.651 1.00 0.00 ?  1594 LYS B HZ2  1  
ATOM 1496  H HZ3  . LYS B 2 4  ? -12.383 8.329   -10.694 1.00 0.00 ?  1594 LYS B HZ3  1  
ATOM 1497  N N    . VAL B 2 5  ? -5.670  5.609   -6.505  1.00 0.00 ?  1595 VAL B N    1  
ATOM 1498  C CA   . VAL B 2 5  ? -4.915  4.586   -5.830  1.00 0.00 ?  1595 VAL B CA   1  
ATOM 1499  C C    . VAL B 2 5  ? -5.911  3.485   -5.419  1.00 0.00 ?  1595 VAL B C    1  
ATOM 1500  O O    . VAL B 2 5  ? -5.553  2.511   -4.757  1.00 0.00 ?  1595 VAL B O    1  
ATOM 1501  C CB   . VAL B 2 5  ? -4.133  5.155   -4.578  1.00 0.00 ?  1595 VAL B CB   1  
ATOM 1502  C CG1  . VAL B 2 5  ? -3.206  4.120   -3.942  1.00 0.00 ?  1595 VAL B CG1  1  
ATOM 1503  C CG2  . VAL B 2 5  ? -3.383  6.447   -4.927  1.00 0.00 ?  1595 VAL B CG2  1  
ATOM 1504  H H    . VAL B 2 5  ? -6.185  6.250   -5.978  1.00 0.00 ?  1595 VAL B H    1  
ATOM 1505  H HA   . VAL B 2 5  ? -4.219  4.172   -6.545  1.00 0.00 ?  1595 VAL B HA   1  
ATOM 1506  H HB   . VAL B 2 5  ? -4.819  5.384   -3.770  1.00 0.00 ?  1595 VAL B HB   1  
ATOM 1507  H HG11 . VAL B 2 5  ? -3.815  3.535   -3.267  1.00 0.00 ?  1595 VAL B HG11 1  
ATOM 1508  H HG12 . VAL B 2 5  ? -2.415  4.599   -3.389  1.00 0.00 ?  1595 VAL B HG12 1  
ATOM 1509  H HG13 . VAL B 2 5  ? -2.793  3.427   -4.662  1.00 0.00 ?  1595 VAL B HG13 1  
ATOM 1510  H HG21 . VAL B 2 5  ? -4.143  7.185   -5.152  1.00 0.00 ?  1595 VAL B HG21 1  
ATOM 1511  H HG22 . VAL B 2 5  ? -2.754  6.315   -5.813  1.00 0.00 ?  1595 VAL B HG22 1  
ATOM 1512  H HG23 . VAL B 2 5  ? -2.828  6.755   -4.042  1.00 0.00 ?  1595 VAL B HG23 1  
ATOM 1513  N N    . LYS B 2 6  ? -7.189  3.669   -5.849  1.00 0.00 ?  1596 LYS B N    1  
ATOM 1514  C CA   . LYS B 2 6  ? -8.285  2.714   -5.604  1.00 0.00 ?  1596 LYS B CA   1  
ATOM 1515  C C    . LYS B 2 6  ? -7.973  1.413   -6.333  1.00 0.00 ?  1596 LYS B C    1  
ATOM 1516  O O    . LYS B 2 6  ? -8.393  1.198   -7.461  1.00 0.00 ?  1596 LYS B O    1  
ATOM 1517  C CB   . LYS B 2 6  ? -9.638  3.322   -6.044  1.00 0.00 ?  1596 LYS B CB   1  
ATOM 1518  C CG   . LYS B 2 6  ? -10.068 4.567   -5.233  1.00 0.00 ?  1596 LYS B CG   1  
ATOM 1519  C CD   . LYS B 2 6  ? -10.623 4.218   -3.839  1.00 0.00 ?  1596 LYS B CD   1  
ATOM 1520  C CE   . LYS B 2 6  ? -11.977 3.570   -3.936  1.00 0.00 ?  1596 LYS B CE   1  
ATOM 1521  N NZ   . LYS B 2 6  ? -12.539 3.276   -2.623  1.00 0.00 1  1596 LYS B NZ   1  
ATOM 1522  H H    . LYS B 2 6  ? -7.377  4.478   -6.367  1.00 0.00 ?  1596 LYS B H    1  
ATOM 1523  H HA   . LYS B 2 6  ? -8.301  2.509   -4.543  1.00 0.00 ?  1596 LYS B HA   1  
ATOM 1524  H HB2  . LYS B 2 6  ? -9.555  3.609   -7.082  1.00 0.00 ?  1596 LYS B HB2  1  
ATOM 1525  H HB3  . LYS B 2 6  ? -10.406 2.569   -5.954  1.00 0.00 ?  1596 LYS B HB3  1  
ATOM 1526  H HG2  . LYS B 2 6  ? -9.208  5.208   -5.107  1.00 0.00 ?  1596 LYS B HG2  1  
ATOM 1527  H HG3  . LYS B 2 6  ? -10.824 5.099   -5.792  1.00 0.00 ?  1596 LYS B HG3  1  
ATOM 1528  H HD2  . LYS B 2 6  ? -9.967  3.514   -3.351  1.00 0.00 ?  1596 LYS B HD2  1  
ATOM 1529  H HD3  . LYS B 2 6  ? -10.712 5.075   -3.186  1.00 0.00 ?  1596 LYS B HD3  1  
ATOM 1530  H HE2  . LYS B 2 6  ? -12.641 4.255   -4.443  1.00 0.00 ?  1596 LYS B HE2  1  
ATOM 1531  H HE3  . LYS B 2 6  ? -11.911 2.659   -4.508  1.00 0.00 ?  1596 LYS B HE3  1  
ATOM 1532  H HZ1  . LYS B 2 6  ? -12.907 4.124   -2.152  1.00 0.00 ?  1596 LYS B HZ1  1  
ATOM 1533  H HZ2  . LYS B 2 6  ? -11.833 2.847   -1.988  1.00 0.00 ?  1596 LYS B HZ2  1  
ATOM 1534  H HZ3  . LYS B 2 6  ? -13.301 2.565   -2.689  1.00 0.00 ?  1596 LYS B HZ3  1  
ATOM 1535  N N    . ILE B 2 7  ? -7.183  0.596   -5.654  1.00 0.00 ?  1597 ILE B N    1  
ATOM 1536  C CA   . ILE B 2 7  ? -6.520  -0.568  -6.195  1.00 0.00 ?  1597 ILE B CA   1  
ATOM 1537  C C    . ILE B 2 7  ? -7.367  -1.503  -7.115  1.00 0.00 ?  1597 ILE B C    1  
ATOM 1538  O O    . ILE B 2 7  ? -7.080  -1.603  -8.305  1.00 0.00 ?  1597 ILE B O    1  
ATOM 1539  C CB   . ILE B 2 7  ? -5.748  -1.383  -5.090  1.00 0.00 ?  1597 ILE B CB   1  
ATOM 1540  C CG1  . ILE B 2 7  ? -4.801  -2.369  -5.714  1.00 0.00 ?  1597 ILE B CG1  1  
ATOM 1541  C CG2  . ILE B 2 7  ? -6.695  -2.152  -4.190  1.00 0.00 ?  1597 ILE B CG2  1  
ATOM 1542  C CD1  . ILE B 2 7  ? -3.799  -1.768  -6.687  1.00 0.00 ?  1597 ILE B CD1  1  
ATOM 1543  H H    . ILE B 2 7  ? -6.968  0.870   -4.738  1.00 0.00 ?  1597 ILE B H    1  
ATOM 1544  H HA   . ILE B 2 7  ? -5.751  -0.094  -6.781  1.00 0.00 ?  1597 ILE B HA   1  
ATOM 1545  H HB   . ILE B 2 7  ? -5.162  -0.711  -4.472  1.00 0.00 ?  1597 ILE B HB   1  
ATOM 1546  H HG12 . ILE B 2 7  ? -4.258  -2.755  -4.860  1.00 0.00 ?  1597 ILE B HG12 1  
ATOM 1547  H HG13 . ILE B 2 7  ? -5.363  -3.154  -6.197  1.00 0.00 ?  1597 ILE B HG13 1  
ATOM 1548  H HG21 . ILE B 2 7  ? -6.166  -2.764  -3.474  1.00 0.00 ?  1597 ILE B HG21 1  
ATOM 1549  H HG22 . ILE B 2 7  ? -7.322  -2.794  -4.787  1.00 0.00 ?  1597 ILE B HG22 1  
ATOM 1550  H HG23 . ILE B 2 7  ? -7.327  -1.467  -3.648  1.00 0.00 ?  1597 ILE B HG23 1  
ATOM 1551  H HD11 . ILE B 2 7  ? -4.321  -1.343  -7.532  1.00 0.00 ?  1597 ILE B HD11 1  
ATOM 1552  H HD12 . ILE B 2 7  ? -3.126  -2.539  -7.030  1.00 0.00 ?  1597 ILE B HD12 1  
ATOM 1553  H HD13 . ILE B 2 7  ? -3.237  -0.994  -6.187  1.00 0.00 ?  1597 ILE B HD13 1  
ATOM 1554  N N    . LYS B 2 8  ? -8.416  -2.124  -6.562  1.00 0.00 ?  1598 LYS B N    1  
ATOM 1555  C CA   . LYS B 2 8  ? -9.146  -3.192  -7.204  1.00 0.00 ?  1598 LYS B CA   1  
ATOM 1556  C C    . LYS B 2 8  ? -8.248  -4.241  -7.756  1.00 0.00 ?  1598 LYS B C    1  
ATOM 1557  O O    . LYS B 2 8  ? -7.983  -4.304  -8.958  1.00 0.00 ?  1598 LYS B O    1  
ATOM 1558  C CB   . LYS B 2 8  ? -10.335 -2.742  -8.050  1.00 0.00 ?  1598 LYS B CB   1  
ATOM 1559  C CG   . LYS B 2 8  ? -11.568 -2.546  -7.153  1.00 0.00 ?  1598 LYS B CG   1  
ATOM 1560  C CD   . LYS B 2 8  ? -12.617 -1.596  -7.680  1.00 0.00 ?  1598 LYS B CD   1  
ATOM 1561  C CE   . LYS B 2 8  ? -12.099 -0.203  -7.907  1.00 0.00 ?  1598 LYS B CE   1  
ATOM 1562  N NZ   . LYS B 2 8  ? -13.084 0.664   -8.576  1.00 0.00 1  1598 LYS B NZ   1  
ATOM 1563  H H    . LYS B 2 8  ? -8.718  -1.877  -5.666  1.00 0.00 ?  1598 LYS B H    1  
ATOM 1564  H HA   . LYS B 2 8  ? -9.534  -3.709  -6.333  1.00 0.00 ?  1598 LYS B HA   1  
ATOM 1565  H HB2  . LYS B 2 8  ? -10.081 -1.821  -8.552  1.00 0.00 ?  1598 LYS B HB2  1  
ATOM 1566  H HB3  . LYS B 2 8  ? -10.564 -3.502  -8.782  1.00 0.00 ?  1598 LYS B HB3  1  
ATOM 1567  H HG2  . LYS B 2 8  ? -12.049 -3.512  -7.088  1.00 0.00 ?  1598 LYS B HG2  1  
ATOM 1568  H HG3  . LYS B 2 8  ? -11.303 -2.277  -6.142  1.00 0.00 ?  1598 LYS B HG3  1  
ATOM 1569  H HD2  . LYS B 2 8  ? -13.207 -1.948  -8.508  1.00 0.00 ?  1598 LYS B HD2  1  
ATOM 1570  H HD3  . LYS B 2 8  ? -13.206 -1.488  -6.777  1.00 0.00 ?  1598 LYS B HD3  1  
ATOM 1571  H HE2  . LYS B 2 8  ? -12.042 0.149   -6.884  1.00 0.00 ?  1598 LYS B HE2  1  
ATOM 1572  H HE3  . LYS B 2 8  ? -11.138 -0.183  -8.395  1.00 0.00 ?  1598 LYS B HE3  1  
ATOM 1573  H HZ1  . LYS B 2 8  ? -13.376 0.289   -9.499  1.00 0.00 ?  1598 LYS B HZ1  1  
ATOM 1574  H HZ2  . LYS B 2 8  ? -12.694 1.615   -8.724  1.00 0.00 ?  1598 LYS B HZ2  1  
ATOM 1575  H HZ3  . LYS B 2 8  ? -13.934 0.788   -7.989  1.00 0.00 ?  1598 LYS B HZ3  1  
ATOM 1576  N N    . LEU B 2 9  ? -7.690  -4.999  -6.788  1.00 0.00 ?  1599 LEU B N    1  
ATOM 1577  C CA   . LEU B 2 9  ? -6.715  -6.035  -7.023  1.00 0.00 ?  1599 LEU B CA   1  
ATOM 1578  C C    . LEU B 2 9  ? -7.242  -6.979  -8.064  1.00 0.00 ?  1599 LEU B C    1  
ATOM 1579  O O    . LEU B 2 9  ? -8.179  -7.762  -7.810  1.00 0.00 ?  1599 LEU B O    1  
ATOM 1580  C CB   . LEU B 2 9  ? -6.379  -6.799  -5.709  1.00 0.00 ?  1599 LEU B CB   1  
ATOM 1581  C CG   . LEU B 2 9  ? -4.908  -6.939  -5.356  1.00 0.00 ?  1599 LEU B CG   1  
ATOM 1582  C CD1  . LEU B 2 9  ? -4.119  -7.701  -6.407  1.00 0.00 ?  1599 LEU B CD1  1  
ATOM 1583  C CD2  . LEU B 2 9  ? -4.283  -5.619  -5.120  1.00 0.00 ?  1599 LEU B CD2  1  
ATOM 1584  H H    . LEU B 2 9  ? -7.993  -4.839  -5.871  1.00 0.00 ?  1599 LEU B H    1  
ATOM 1585  H HA   . LEU B 2 9  ? -5.814  -5.560  -7.383  1.00 0.00 ?  1599 LEU B HA   1  
ATOM 1586  H HB2  . LEU B 2 9  ? -6.847  -6.391  -4.831  1.00 0.00 ?  1599 LEU B HB2  1  
ATOM 1587  H HB3  . LEU B 2 9  ? -6.780  -7.799  -5.757  1.00 0.00 ?  1599 LEU B HB3  1  
ATOM 1588  H HG   . LEU B 2 9  ? -4.925  -7.441  -4.395  1.00 0.00 ?  1599 LEU B HG   1  
ATOM 1589  H HD11 . LEU B 2 9  ? -3.086  -7.773  -6.099  1.00 0.00 ?  1599 LEU B HD11 1  
ATOM 1590  H HD12 . LEU B 2 9  ? -4.181  -7.176  -7.349  1.00 0.00 ?  1599 LEU B HD12 1  
ATOM 1591  H HD13 . LEU B 2 9  ? -4.532  -8.692  -6.517  1.00 0.00 ?  1599 LEU B HD13 1  
ATOM 1592  H HD21 . LEU B 2 9  ? -3.233  -5.779  -4.918  1.00 0.00 ?  1599 LEU B HD21 1  
ATOM 1593  H HD22 . LEU B 2 9  ? -4.727  -5.206  -4.225  1.00 0.00 ?  1599 LEU B HD22 1  
ATOM 1594  H HD23 . LEU B 2 9  ? -4.405  -4.958  -5.963  1.00 0.00 ?  1599 LEU B HD23 1  
ATOM 1595  N N    . GLY B 2 10 ? -6.669  -6.886  -9.233  1.00 0.00 ?  1600 GLY B N    1  
ATOM 1596  C CA   . GLY B 2 10 ? -7.111  -7.632  -10.368 1.00 0.00 ?  1600 GLY B CA   1  
ATOM 1597  C C    . GLY B 2 10 ? -6.673  -9.065  -10.354 1.00 0.00 ?  1600 GLY B C    1  
ATOM 1598  O O    . GLY B 2 10 ? -5.953  -9.513  -11.252 1.00 0.00 ?  1600 GLY B O    1  
ATOM 1599  H H    . GLY B 2 10 ? -5.916  -6.264  -9.340  1.00 0.00 ?  1600 GLY B H    1  
ATOM 1600  H HA2  . GLY B 2 10 ? -8.190  -7.599  -10.413 1.00 0.00 ?  1600 GLY B HA2  1  
ATOM 1601  H HA3  . GLY B 2 10 ? -6.711  -7.156  -11.250 1.00 0.00 ?  1600 GLY B HA3  1  
ATOM 1602  N N    . ARG B 2 11 ? -7.077  -9.774  -9.333  1.00 0.00 ?  1601 ARG B N    1  
ATOM 1603  C CA   . ARG B 2 11 ? -6.819  -11.183 -9.245  1.00 0.00 ?  1601 ARG B CA   1  
ATOM 1604  C C    . ARG B 2 11 ? -7.829  -11.880 -10.137 1.00 0.00 ?  1601 ARG B C    1  
ATOM 1605  O O    . ARG B 2 11 ? -7.515  -12.857 -10.821 1.00 0.00 ?  1601 ARG B O    1  
ATOM 1606  C CB   . ARG B 2 11 ? -6.955  -11.669 -7.795  1.00 0.00 ?  1601 ARG B CB   1  
ATOM 1607  C CG   . ARG B 2 11 ? -6.613  -13.140 -7.605  1.00 0.00 ?  1601 ARG B CG   1  
ATOM 1608  C CD   . ARG B 2 11 ? -6.781  -13.577 -6.161  1.00 0.00 ?  1601 ARG B CD   1  
ATOM 1609  N NE   . ARG B 2 11 ? -6.394  -14.981 -5.965  1.00 0.00 ?  1601 ARG B NE   1  
ATOM 1610  C CZ   . ARG B 2 11 ? -6.538  -15.676 -4.831  1.00 0.00 ?  1601 ARG B CZ   1  
ATOM 1611  N NH1  . ARG B 2 11 ? -7.102  -15.119 -3.768  1.00 0.00 1  1601 ARG B NH1  1  
ATOM 1612  N NH2  . ARG B 2 11 ? -6.132  -16.937 -4.775  1.00 0.00 ?  1601 ARG B NH2  1  
ATOM 1613  H H    . ARG B 2 11 ? -7.560  -9.296  -8.622  1.00 0.00 ?  1601 ARG B H    1  
ATOM 1614  H HA   . ARG B 2 11 ? -5.821  -11.374 -9.608  1.00 0.00 ?  1601 ARG B HA   1  
ATOM 1615  H HB2  . ARG B 2 11 ? -6.301  -11.081 -7.168  1.00 0.00 ?  1601 ARG B HB2  1  
ATOM 1616  H HB3  . ARG B 2 11 ? -7.975  -11.515 -7.474  1.00 0.00 ?  1601 ARG B HB3  1  
ATOM 1617  H HG2  . ARG B 2 11 ? -7.273  -13.728 -8.225  1.00 0.00 ?  1601 ARG B HG2  1  
ATOM 1618  H HG3  . ARG B 2 11 ? -5.590  -13.305 -7.911  1.00 0.00 ?  1601 ARG B HG3  1  
ATOM 1619  H HD2  . ARG B 2 11 ? -6.164  -12.950 -5.534  1.00 0.00 ?  1601 ARG B HD2  1  
ATOM 1620  H HD3  . ARG B 2 11 ? -7.817  -13.458 -5.879  1.00 0.00 ?  1601 ARG B HD3  1  
ATOM 1621  H HE   . ARG B 2 11 ? -5.995  -15.412 -6.758  1.00 0.00 ?  1601 ARG B HE   1  
ATOM 1622  H HH11 . ARG B 2 11 ? -7.440  -14.173 -3.768  1.00 0.00 ?  1601 ARG B HH11 1  
ATOM 1623  H HH12 . ARG B 2 11 ? -7.231  -15.623 -2.907  1.00 0.00 ?  1601 ARG B HH12 1  
ATOM 1624  H HH21 . ARG B 2 11 ? -5.714  -17.396 -5.565  1.00 0.00 ?  1601 ARG B HH21 1  
ATOM 1625  H HH22 . ARG B 2 11 ? -6.218  -17.497 -3.944  1.00 0.00 ?  1601 ARG B HH22 1  
ATOM 1626  N N    . LYS B 2 12 ? -9.034  -11.330 -10.149 1.00 0.00 ?  1602 LYS B N    1  
ATOM 1627  C CA   . LYS B 2 12 ? -10.135 -11.822 -10.949 1.00 0.00 ?  1602 LYS B CA   1  
ATOM 1628  C C    . LYS B 2 12 ? -11.248 -10.785 -10.934 1.00 0.00 ?  1602 LYS B C    1  
ATOM 1629  O O    . LYS B 2 12 ? -11.064 -9.696  -10.360 1.00 0.00 ?  1602 LYS B O    1  
ATOM 1630  C CB   . LYS B 2 12 ? -10.647 -13.172 -10.418 1.00 0.00 ?  1602 LYS B CB   1  
ATOM 1631  C CG   . LYS B 2 12 ? -11.729 -13.791 -11.288 1.00 0.00 ?  1602 LYS B CG   1  
ATOM 1632  C CD   . LYS B 2 12 ? -12.118 -15.181 -10.826 1.00 0.00 ?  1602 LYS B CD   1  
ATOM 1633  C CE   . LYS B 2 12 ? -12.769 -15.184 -9.456  1.00 0.00 ?  1602 LYS B CE   1  
ATOM 1634  N NZ   . LYS B 2 12 ? -13.152 -16.549 -9.053  1.00 0.00 1  1602 LYS B NZ   1  
ATOM 1635  H H    . LYS B 2 12 ? -9.215  -10.529 -9.612  1.00 0.00 ?  1602 LYS B H    1  
ATOM 1636  H HA   . LYS B 2 12 ? -9.786  -11.940 -11.963 1.00 0.00 ?  1602 LYS B HA   1  
ATOM 1637  H HB2  . LYS B 2 12 ? -9.817  -13.861 -10.363 1.00 0.00 ?  1602 LYS B HB2  1  
ATOM 1638  H HB3  . LYS B 2 12 ? -11.048 -13.022 -9.427  1.00 0.00 ?  1602 LYS B HB3  1  
ATOM 1639  H HG2  . LYS B 2 12 ? -12.607 -13.161 -11.250 1.00 0.00 ?  1602 LYS B HG2  1  
ATOM 1640  H HG3  . LYS B 2 12 ? -11.367 -13.845 -12.304 1.00 0.00 ?  1602 LYS B HG3  1  
ATOM 1641  H HD2  . LYS B 2 12 ? -12.824 -15.583 -11.536 1.00 0.00 ?  1602 LYS B HD2  1  
ATOM 1642  H HD3  . LYS B 2 12 ? -11.238 -15.807 -10.807 1.00 0.00 ?  1602 LYS B HD3  1  
ATOM 1643  H HE2  . LYS B 2 12 ? -12.068 -14.793 -8.734  1.00 0.00 ?  1602 LYS B HE2  1  
ATOM 1644  H HE3  . LYS B 2 12 ? -13.651 -14.563 -9.485  1.00 0.00 ?  1602 LYS B HE3  1  
ATOM 1645  H HZ1  . LYS B 2 12 ? -13.763 -16.979 -9.779  1.00 0.00 ?  1602 LYS B HZ1  1  
ATOM 1646  H HZ2  . LYS B 2 12 ? -13.682 -16.537 -8.158  1.00 0.00 ?  1602 LYS B HZ2  1  
ATOM 1647  H HZ3  . LYS B 2 12 ? -12.311 -17.149 -8.938  1.00 0.00 ?  1602 LYS B HZ3  1  
ATOM 1648  N N    . ALA A 1 1  ? -10.248 26.988  10.135  1.00 0.00 ?  557  ALA A N    2  
ATOM 1649  C CA   . ALA A 1 1  ? -8.946  26.423  10.437  1.00 0.00 ?  557  ALA A CA   2  
ATOM 1650  C C    . ALA A 1 1  ? -8.279  27.215  11.538  1.00 0.00 ?  557  ALA A C    2  
ATOM 1651  O O    . ALA A 1 1  ? -7.226  26.840  12.054  1.00 0.00 ?  557  ALA A O    2  
ATOM 1652  C CB   . ALA A 1 1  ? -8.078  26.424  9.194   1.00 0.00 ?  557  ALA A CB   2  
ATOM 1653  H H1   . ALA A 1 1  ? -10.356 27.442  9.270   1.00 0.00 ?  557  ALA A H1   2  
ATOM 1654  H HA   . ALA A 1 1  ? -9.084  25.404  10.763  1.00 0.00 ?  557  ALA A HA   2  
ATOM 1655  H HB1  . ALA A 1 1  ? -8.551  25.839  8.420   1.00 0.00 ?  557  ALA A HB1  2  
ATOM 1656  H HB2  . ALA A 1 1  ? -7.112  26.002  9.431   1.00 0.00 ?  557  ALA A HB2  2  
ATOM 1657  H HB3  . ALA A 1 1  ? -7.951  27.439  8.849   1.00 0.00 ?  557  ALA A HB3  2  
ATOM 1658  N N    . SER A 1 2  ? -8.902  28.305  11.897  1.00 0.00 ?  558  SER A N    2  
ATOM 1659  C CA   . SER A 1 2  ? -8.364  29.200  12.889  1.00 0.00 ?  558  SER A CA   2  
ATOM 1660  C C    . SER A 1 2  ? -8.754  28.797  14.327  1.00 0.00 ?  558  SER A C    2  
ATOM 1661  O O    . SER A 1 2  ? -8.144  29.273  15.282  1.00 0.00 ?  558  SER A O    2  
ATOM 1662  C CB   . SER A 1 2  ? -8.795  30.625  12.573  1.00 0.00 ?  558  SER A CB   2  
ATOM 1663  O OG   . SER A 1 2  ? -8.517  30.928  11.202  1.00 0.00 ?  558  SER A OG   2  
ATOM 1664  H H    . SER A 1 2  ? -9.756  28.512  11.456  1.00 0.00 ?  558  SER A H    2  
ATOM 1665  H HA   . SER A 1 2  ? -7.289  29.150  12.808  1.00 0.00 ?  558  SER A HA   2  
ATOM 1666  H HB2  . SER A 1 2  ? -9.854  30.727  12.753  1.00 0.00 ?  558  SER A HB2  2  
ATOM 1667  H HB3  . SER A 1 2  ? -8.250  31.314  13.200  1.00 0.00 ?  558  SER A HB3  2  
ATOM 1668  H HG   . SER A 1 2  ? -9.349  30.819  10.722  1.00 0.00 ?  558  SER A HG   2  
ATOM 1669  N N    . ALA A 1 3  ? -9.740  27.893  14.478  1.00 0.00 ?  559  ALA A N    2  
ATOM 1670  C CA   . ALA A 1 3  ? -10.209 27.479  15.818  1.00 0.00 ?  559  ALA A CA   2  
ATOM 1671  C C    . ALA A 1 3  ? -9.106  26.766  16.590  1.00 0.00 ?  559  ALA A C    2  
ATOM 1672  O O    . ALA A 1 3  ? -8.733  27.177  17.697  1.00 0.00 ?  559  ALA A O    2  
ATOM 1673  C CB   . ALA A 1 3  ? -11.444 26.600  15.720  1.00 0.00 ?  559  ALA A CB   2  
ATOM 1674  H H    . ALA A 1 3  ? -10.156 27.497  13.682  1.00 0.00 ?  559  ALA A H    2  
ATOM 1675  H HA   . ALA A 1 3  ? -10.466 28.381  16.357  1.00 0.00 ?  559  ALA A HA   2  
ATOM 1676  H HB1  . ALA A 1 3  ? -11.811 26.386  16.713  1.00 0.00 ?  559  ALA A HB1  2  
ATOM 1677  H HB2  . ALA A 1 3  ? -11.189 25.673  15.229  1.00 0.00 ?  559  ALA A HB2  2  
ATOM 1678  H HB3  . ALA A 1 3  ? -12.210 27.112  15.157  1.00 0.00 ?  559  ALA A HB3  2  
ATOM 1679  N N    . SER A 1 4  ? -8.564  25.723  16.000  1.00 0.00 ?  560  SER A N    2  
ATOM 1680  C CA   . SER A 1 4  ? -7.458  25.014  16.601  1.00 0.00 ?  560  SER A CA   2  
ATOM 1681  C C    . SER A 1 4  ? -6.161  25.660  16.129  1.00 0.00 ?  560  SER A C    2  
ATOM 1682  O O    . SER A 1 4  ? -5.090  25.429  16.691  1.00 0.00 ?  560  SER A O    2  
ATOM 1683  C CB   . SER A 1 4  ? -7.486  23.552  16.147  1.00 0.00 ?  560  SER A CB   2  
ATOM 1684  O OG   . SER A 1 4  ? -8.770  22.977  16.350  1.00 0.00 ?  560  SER A OG   2  
ATOM 1685  H H    . SER A 1 4  ? -8.917  25.386  15.148  1.00 0.00 ?  560  SER A H    2  
ATOM 1686  H HA   . SER A 1 4  ? -7.534  25.063  17.677  1.00 0.00 ?  560  SER A HA   2  
ATOM 1687  H HB2  . SER A 1 4  ? -7.245  23.500  15.095  1.00 0.00 ?  560  SER A HB2  2  
ATOM 1688  H HB3  . SER A 1 4  ? -6.757  22.988  16.712  1.00 0.00 ?  560  SER A HB3  2  
ATOM 1689  H HG   . SER A 1 4  ? -9.168  23.422  17.112  1.00 0.00 ?  560  SER A HG   2  
ATOM 1690  N N    . TYR A 1 5  ? -6.313  26.535  15.135  1.00 0.00 ?  561  TYR A N    2  
ATOM 1691  C CA   . TYR A 1 5  ? -5.248  27.147  14.401  1.00 0.00 ?  561  TYR A CA   2  
ATOM 1692  C C    . TYR A 1 5  ? -4.311  26.097  13.844  1.00 0.00 ?  561  TYR A C    2  
ATOM 1693  O O    . TYR A 1 5  ? -3.325  25.694  14.473  1.00 0.00 ?  561  TYR A O    2  
ATOM 1694  C CB   . TYR A 1 5  ? -4.548  28.227  15.193  1.00 0.00 ?  561  TYR A CB   2  
ATOM 1695  C CG   . TYR A 1 5  ? -3.499  28.967  14.391  1.00 0.00 ?  561  TYR A CG   2  
ATOM 1696  C CD1  . TYR A 1 5  ? -3.864  29.739  13.300  1.00 0.00 ?  561  TYR A CD1  2  
ATOM 1697  C CD2  . TYR A 1 5  ? -2.153  28.887  14.720  1.00 0.00 ?  561  TYR A CD2  2  
ATOM 1698  C CE1  . TYR A 1 5  ? -2.918  30.414  12.555  1.00 0.00 ?  561  TYR A CE1  2  
ATOM 1699  C CE2  . TYR A 1 5  ? -1.200  29.559  13.983  1.00 0.00 ?  561  TYR A CE2  2  
ATOM 1700  C CZ   . TYR A 1 5  ? -1.589  30.321  12.901  1.00 0.00 ?  561  TYR A CZ   2  
ATOM 1701  O OH   . TYR A 1 5  ? -0.635  30.982  12.151  1.00 0.00 ?  561  TYR A OH   2  
ATOM 1702  H H    . TYR A 1 5  ? -7.218  26.820  14.910  1.00 0.00 ?  561  TYR A H    2  
ATOM 1703  H HA   . TYR A 1 5  ? -5.725  27.599  13.543  1.00 0.00 ?  561  TYR A HA   2  
ATOM 1704  H HB2  . TYR A 1 5  ? -5.329  28.904  15.504  1.00 0.00 ?  561  TYR A HB2  2  
ATOM 1705  H HB3  . TYR A 1 5  ? -4.093  27.782  16.065  1.00 0.00 ?  561  TYR A HB3  2  
ATOM 1706  H HD1  . TYR A 1 5  ? -4.910  29.795  13.037  1.00 0.00 ?  561  TYR A HD1  2  
ATOM 1707  H HD2  . TYR A 1 5  ? -1.855  28.288  15.568  1.00 0.00 ?  561  TYR A HD2  2  
ATOM 1708  H HE1  . TYR A 1 5  ? -3.222  31.012  11.708  1.00 0.00 ?  561  TYR A HE1  2  
ATOM 1709  H HE2  . TYR A 1 5  ? -0.158  29.487  14.253  1.00 0.00 ?  561  TYR A HE2  2  
ATOM 1710  H HH   . TYR A 1 5  ? -0.943  31.887  11.994  1.00 0.00 ?  561  TYR A HH   2  
ATOM 1711  N N    . ASP A 1 6  ? -4.656  25.629  12.685  1.00 0.00 ?  562  ASP A N    2  
ATOM 1712  C CA   . ASP A 1 6  ? -3.932  24.546  12.068  1.00 0.00 ?  562  ASP A CA   2  
ATOM 1713  C C    . ASP A 1 6  ? -3.064  25.077  10.951  1.00 0.00 ?  562  ASP A C    2  
ATOM 1714  O O    . ASP A 1 6  ? -3.535  25.839  10.098  1.00 0.00 ?  562  ASP A O    2  
ATOM 1715  C CB   . ASP A 1 6  ? -4.893  23.486  11.542  1.00 0.00 ?  562  ASP A CB   2  
ATOM 1716  C CG   . ASP A 1 6  ? -4.176  22.212  11.206  1.00 0.00 ?  562  ASP A CG   2  
ATOM 1717  O OD1  . ASP A 1 6  ? -4.050  21.347  12.098  1.00 0.00 ?  562  ASP A OD1  2  
ATOM 1718  O OD2  . ASP A 1 6  ? -3.690  22.054  10.087  1.00 0.00 -1 562  ASP A OD2  2  
ATOM 1719  H H    . ASP A 1 6  ? -5.419  26.047  12.227  1.00 0.00 ?  562  ASP A H    2  
ATOM 1720  H HA   . ASP A 1 6  ? -3.303  24.105  12.824  1.00 0.00 ?  562  ASP A HA   2  
ATOM 1721  H HB2  . ASP A 1 6  ? -5.639  23.277  12.295  1.00 0.00 ?  562  ASP A HB2  2  
ATOM 1722  H HB3  . ASP A 1 6  ? -5.377  23.856  10.651  1.00 0.00 ?  562  ASP A HB3  2  
ATOM 1723  N N    . SER A 1 7  ? -1.816  24.682  10.947  1.00 0.00 ?  563  SER A N    2  
ATOM 1724  C CA   . SER A 1 7  ? -0.860  25.187  9.997   1.00 0.00 ?  563  SER A CA   2  
ATOM 1725  C C    . SER A 1 7  ? -0.704  24.271  8.778   1.00 0.00 ?  563  SER A C    2  
ATOM 1726  O O    . SER A 1 7  ? -0.012  24.633  7.820   1.00 0.00 ?  563  SER A O    2  
ATOM 1727  C CB   . SER A 1 7  ? 0.479   25.396  10.690  1.00 0.00 ?  563  SER A CB   2  
ATOM 1728  O OG   . SER A 1 7  ? 0.339   26.290  11.801  1.00 0.00 ?  563  SER A OG   2  
ATOM 1729  H H    . SER A 1 7  ? -1.517  24.017  11.605  1.00 0.00 ?  563  SER A H    2  
ATOM 1730  H HA   . SER A 1 7  ? -1.212  26.151  9.660   1.00 0.00 ?  563  SER A HA   2  
ATOM 1731  H HB2  . SER A 1 7  ? 0.852   24.446  11.048  1.00 0.00 ?  563  SER A HB2  2  
ATOM 1732  H HB3  . SER A 1 7  ? 1.178   25.823  9.988   1.00 0.00 ?  563  SER A HB3  2  
ATOM 1733  H HG   . SER A 1 7  ? -0.064  25.800  12.528  1.00 0.00 ?  563  SER A HG   2  
ATOM 1734  N N    . GLU A 1 8  ? -1.380  23.118  8.804   1.00 0.00 ?  564  GLU A N    2  
ATOM 1735  C CA   . GLU A 1 8  ? -1.329  22.127  7.726   1.00 0.00 ?  564  GLU A CA   2  
ATOM 1736  C C    . GLU A 1 8  ? 0.076   21.638  7.435   1.00 0.00 ?  564  GLU A C    2  
ATOM 1737  O O    . GLU A 1 8  ? 0.664   21.945  6.389   1.00 0.00 ?  564  GLU A O    2  
ATOM 1738  C CB   . GLU A 1 8  ? -1.992  22.641  6.464   1.00 0.00 ?  564  GLU A CB   2  
ATOM 1739  C CG   . GLU A 1 8  ? -3.462  22.864  6.611   1.00 0.00 ?  564  GLU A CG   2  
ATOM 1740  C CD   . GLU A 1 8  ? -4.038  23.570  5.437   1.00 0.00 ?  564  GLU A CD   2  
ATOM 1741  O OE1  . GLU A 1 8  ? -3.960  23.041  4.304   1.00 0.00 ?  564  GLU A OE1  2  
ATOM 1742  O OE2  . GLU A 1 8  ? -4.604  24.667  5.630   1.00 0.00 -1 564  GLU A OE2  2  
ATOM 1743  H H    . GLU A 1 8  ? -1.968  22.912  9.566   1.00 0.00 ?  564  GLU A H    2  
ATOM 1744  H HA   . GLU A 1 8  ? -1.895  21.278  8.079   1.00 0.00 ?  564  GLU A HA   2  
ATOM 1745  H HB2  . GLU A 1 8  ? -1.534  23.579  6.189   1.00 0.00 ?  564  GLU A HB2  2  
ATOM 1746  H HB3  . GLU A 1 8  ? -1.832  21.924  5.672   1.00 0.00 ?  564  GLU A HB3  2  
ATOM 1747  H HG2  . GLU A 1 8  ? -3.955  21.910  6.722   1.00 0.00 ?  564  GLU A HG2  2  
ATOM 1748  H HG3  . GLU A 1 8  ? -3.632  23.460  7.494   1.00 0.00 ?  564  GLU A HG3  2  
ATOM 1749  N N    . GLU A 1 9  ? 0.631   20.937  8.367   1.00 0.00 ?  565  GLU A N    2  
ATOM 1750  C CA   . GLU A 1 9  ? 1.948   20.389  8.196   1.00 0.00 ?  565  GLU A CA   2  
ATOM 1751  C C    . GLU A 1 9  ? 1.826   19.025  7.556   1.00 0.00 ?  565  GLU A C    2  
ATOM 1752  O O    . GLU A 1 9  ? 0.790   18.355  7.695   1.00 0.00 ?  565  GLU A O    2  
ATOM 1753  C CB   . GLU A 1 9  ? 2.680   20.214  9.537   1.00 0.00 ?  565  GLU A CB   2  
ATOM 1754  C CG   . GLU A 1 9  ? 2.363   21.245  10.610  1.00 0.00 ?  565  GLU A CG   2  
ATOM 1755  C CD   . GLU A 1 9  ? 1.137   20.863  11.404  1.00 0.00 ?  565  GLU A CD   2  
ATOM 1756  O OE1  . GLU A 1 9  ? 0.018   21.250  11.027  1.00 0.00 ?  565  GLU A OE1  2  
ATOM 1757  O OE2  . GLU A 1 9  ? 1.278   20.137  12.408  1.00 0.00 -1 565  GLU A OE2  2  
ATOM 1758  H H    . GLU A 1 9  ? 0.161   20.814  9.223   1.00 0.00 ?  565  GLU A H    2  
ATOM 1759  H HA   . GLU A 1 9  ? 2.519   21.048  7.561   1.00 0.00 ?  565  GLU A HA   2  
ATOM 1760  H HB2  . GLU A 1 9  ? 2.423   19.243  9.936   1.00 0.00 ?  565  GLU A HB2  2  
ATOM 1761  H HB3  . GLU A 1 9  ? 3.743   20.228  9.349   1.00 0.00 ?  565  GLU A HB3  2  
ATOM 1762  H HG2  . GLU A 1 9  ? 3.202   21.327  11.283  1.00 0.00 ?  565  GLU A HG2  2  
ATOM 1763  H HG3  . GLU A 1 9  ? 2.182   22.199  10.137  1.00 0.00 ?  565  GLU A HG3  2  
ATOM 1764  N N    . GLU A 1 10 ? 2.827   18.626  6.842   1.00 0.00 ?  566  GLU A N    2  
ATOM 1765  C CA   . GLU A 1 10 ? 2.880   17.300  6.309   1.00 0.00 ?  566  GLU A CA   2  
ATOM 1766  C C    . GLU A 1 10 ? 3.932   16.571  7.099   1.00 0.00 ?  566  GLU A C    2  
ATOM 1767  O O    . GLU A 1 10 ? 5.122   16.893  7.013   1.00 0.00 ?  566  GLU A O    2  
ATOM 1768  C CB   . GLU A 1 10 ? 3.192   17.306  4.817   1.00 0.00 ?  566  GLU A CB   2  
ATOM 1769  C CG   . GLU A 1 10 ? 2.158   18.054  3.981   1.00 0.00 ?  566  GLU A CG   2  
ATOM 1770  C CD   . GLU A 1 10 ? 2.455   18.005  2.506   1.00 0.00 ?  566  GLU A CD   2  
ATOM 1771  O OE1  . GLU A 1 10 ? 1.674   17.415  1.750   1.00 0.00 ?  566  GLU A OE1  2  
ATOM 1772  O OE2  . GLU A 1 10 ? 3.500   18.552  2.081   1.00 0.00 -1 566  GLU A OE2  2  
ATOM 1773  H H    . GLU A 1 10 ? 3.594   19.217  6.676   1.00 0.00 ?  566  GLU A H    2  
ATOM 1774  H HA   . GLU A 1 10 ? 1.922   16.835  6.495   1.00 0.00 ?  566  GLU A HA   2  
ATOM 1775  H HB2  . GLU A 1 10 ? 4.157   17.768  4.675   1.00 0.00 ?  566  GLU A HB2  2  
ATOM 1776  H HB3  . GLU A 1 10 ? 3.237   16.286  4.467   1.00 0.00 ?  566  GLU A HB3  2  
ATOM 1777  H HG2  . GLU A 1 10 ? 1.189   17.609  4.151   1.00 0.00 ?  566  GLU A HG2  2  
ATOM 1778  H HG3  . GLU A 1 10 ? 2.139   19.086  4.300   1.00 0.00 ?  566  GLU A HG3  2  
ATOM 1779  N N    . GLU A 1 11 ? 3.490   15.633  7.879   1.00 0.00 ?  567  GLU A N    2  
ATOM 1780  C CA   . GLU A 1 11 ? 4.308   14.948  8.866   1.00 0.00 ?  567  GLU A CA   2  
ATOM 1781  C C    . GLU A 1 11 ? 5.519   14.191  8.324   1.00 0.00 ?  567  GLU A C    2  
ATOM 1782  O O    . GLU A 1 11 ? 5.627   13.912  7.122   1.00 0.00 ?  567  GLU A O    2  
ATOM 1783  C CB   . GLU A 1 11 ? 3.474   14.093  9.859   1.00 0.00 ?  567  GLU A CB   2  
ATOM 1784  C CG   . GLU A 1 11 ? 2.326   13.272  9.262   1.00 0.00 ?  567  GLU A CG   2  
ATOM 1785  C CD   . GLU A 1 11 ? 1.121   14.127  8.912   1.00 0.00 ?  567  GLU A CD   2  
ATOM 1786  O OE1  . GLU A 1 11 ? 0.998   14.555  7.763   1.00 0.00 ?  567  GLU A OE1  2  
ATOM 1787  O OE2  . GLU A 1 11 ? 0.298   14.418  9.810   1.00 0.00 -1 567  GLU A OE2  2  
ATOM 1788  H H    . GLU A 1 11 ? 2.550   15.355  7.762   1.00 0.00 ?  567  GLU A H    2  
ATOM 1789  H HA   . GLU A 1 11 ? 4.733   15.758  9.442   1.00 0.00 ?  567  GLU A HA   2  
ATOM 1790  H HB2  . GLU A 1 11 ? 4.139   13.402  10.354  1.00 0.00 ?  567  GLU A HB2  2  
ATOM 1791  H HB3  . GLU A 1 11 ? 3.060   14.757  10.604  1.00 0.00 ?  567  GLU A HB3  2  
ATOM 1792  H HG2  . GLU A 1 11 ? 2.677   12.783  8.365   1.00 0.00 ?  567  GLU A HG2  2  
ATOM 1793  H HG3  . GLU A 1 11 ? 2.024   12.528  9.984   1.00 0.00 ?  567  GLU A HG3  2  
ATOM 1794  N N    . GLU A 1 12 ? 6.422   13.884  9.269   1.00 0.00 ?  568  GLU A N    2  
ATOM 1795  C CA   . GLU A 1 12 ? 7.715   13.215  9.077   1.00 0.00 ?  568  GLU A CA   2  
ATOM 1796  C C    . GLU A 1 12 ? 8.653   13.883  8.051   1.00 0.00 ?  568  GLU A C    2  
ATOM 1797  O O    . GLU A 1 12 ? 8.327   14.910  7.449   1.00 0.00 ?  568  GLU A O    2  
ATOM 1798  C CB   . GLU A 1 12 ? 7.614   11.678  8.928   1.00 0.00 ?  568  GLU A CB   2  
ATOM 1799  C CG   . GLU A 1 12 ? 6.882   11.147  7.709   1.00 0.00 ?  568  GLU A CG   2  
ATOM 1800  C CD   . GLU A 1 12 ? 6.824   9.644   7.705   1.00 0.00 ?  568  GLU A CD   2  
ATOM 1801  O OE1  . GLU A 1 12 ? 7.539   9.006   6.912   1.00 0.00 ?  568  GLU A OE1  2  
ATOM 1802  O OE2  . GLU A 1 12 ? 6.075   9.072   8.511   1.00 0.00 -1 568  GLU A OE2  2  
ATOM 1803  H H    . GLU A 1 12 ? 6.194   14.129  10.191  1.00 0.00 ?  568  GLU A H    2  
ATOM 1804  H HA   . GLU A 1 12 ? 8.209   13.414  10.018  1.00 0.00 ?  568  GLU A HA   2  
ATOM 1805  H HB2  . GLU A 1 12 ? 8.606   11.254  8.931   1.00 0.00 ?  568  GLU A HB2  2  
ATOM 1806  H HB3  . GLU A 1 12 ? 7.089   11.339  9.809   1.00 0.00 ?  568  GLU A HB3  2  
ATOM 1807  H HG2  . GLU A 1 12 ? 5.874   11.535  7.707   1.00 0.00 ?  568  GLU A HG2  2  
ATOM 1808  H HG3  . GLU A 1 12 ? 7.398   11.478  6.819   1.00 0.00 ?  568  GLU A HG3  2  
ATOM 1809  N N    . GLY A 1 13 ? 9.836   13.317  7.903   1.00 0.00 ?  569  GLY A N    2  
ATOM 1810  C CA   . GLY A 1 13 ? 10.845  13.909  7.060   1.00 0.00 ?  569  GLY A CA   2  
ATOM 1811  C C    . GLY A 1 13 ? 10.706  13.505  5.630   1.00 0.00 ?  569  GLY A C    2  
ATOM 1812  O O    . GLY A 1 13 ? 11.295  14.124  4.740   1.00 0.00 ?  569  GLY A O    2  
ATOM 1813  H H    . GLY A 1 13 ? 10.033  12.487  8.382   1.00 0.00 ?  569  GLY A H    2  
ATOM 1814  H HA2  . GLY A 1 13 ? 10.766  14.984  7.126   1.00 0.00 ?  569  GLY A HA2  2  
ATOM 1815  H HA3  . GLY A 1 13 ? 11.818  13.606  7.418   1.00 0.00 ?  569  GLY A HA3  2  
ATOM 1816  N N    . LEU A 1 14 ? 9.937   12.484  5.394   1.00 0.00 ?  570  LEU A N    2  
ATOM 1817  C CA   . LEU A 1 14 ? 9.719   12.010  4.059   1.00 0.00 ?  570  LEU A CA   2  
ATOM 1818  C C    . LEU A 1 14 ? 8.560   12.783  3.454   1.00 0.00 ?  570  LEU A C    2  
ATOM 1819  O O    . LEU A 1 14 ? 7.509   12.910  4.088   1.00 0.00 ?  570  LEU A O    2  
ATOM 1820  C CB   . LEU A 1 14 ? 9.429   10.501  4.057   1.00 0.00 ?  570  LEU A CB   2  
ATOM 1821  C CG   . LEU A 1 14 ? 10.544  9.594   4.605   1.00 0.00 ?  570  LEU A CG   2  
ATOM 1822  C CD1  . LEU A 1 14 ? 10.114  8.138   4.563   1.00 0.00 ?  570  LEU A CD1  2  
ATOM 1823  C CD2  . LEU A 1 14 ? 11.838  9.785   3.822   1.00 0.00 ?  570  LEU A CD2  2  
ATOM 1824  H H    . LEU A 1 14 ? 9.464   12.054  6.136   1.00 0.00 ?  570  LEU A H    2  
ATOM 1825  H HA   . LEU A 1 14 ? 10.620  12.205  3.498   1.00 0.00 ?  570  LEU A HA   2  
ATOM 1826  H HB2  . LEU A 1 14 ? 8.539   10.329  4.645   1.00 0.00 ?  570  LEU A HB2  2  
ATOM 1827  H HB3  . LEU A 1 14 ? 9.225   10.199  3.041   1.00 0.00 ?  570  LEU A HB3  2  
ATOM 1828  H HG   . LEU A 1 14 ? 10.728  9.854   5.637   1.00 0.00 ?  570  LEU A HG   2  
ATOM 1829  H HD11 . LEU A 1 14 ? 9.224   8.009   5.161   1.00 0.00 ?  570  LEU A HD11 2  
ATOM 1830  H HD12 . LEU A 1 14 ? 10.906  7.519   4.958   1.00 0.00 ?  570  LEU A HD12 2  
ATOM 1831  H HD13 . LEU A 1 14 ? 9.907   7.854   3.541   1.00 0.00 ?  570  LEU A HD13 2  
ATOM 1832  H HD21 . LEU A 1 14 ? 12.176  10.806  3.915   1.00 0.00 ?  570  LEU A HD21 2  
ATOM 1833  H HD22 . LEU A 1 14 ? 11.664  9.561   2.780   1.00 0.00 ?  570  LEU A HD22 2  
ATOM 1834  H HD23 . LEU A 1 14 ? 12.593  9.117   4.213   1.00 0.00 ?  570  LEU A HD23 2  
ATOM 1835  N N    . PRO A 1 15 ? 8.737   13.367  2.259   1.00 0.00 ?  571  PRO A N    2  
ATOM 1836  C CA   . PRO A 1 15 ? 7.676   14.117  1.619   1.00 0.00 ?  571  PRO A CA   2  
ATOM 1837  C C    . PRO A 1 15 ? 6.557   13.200  1.152   1.00 0.00 ?  571  PRO A C    2  
ATOM 1838  O O    . PRO A 1 15 ? 6.780   12.023  0.825   1.00 0.00 ?  571  PRO A O    2  
ATOM 1839  C CB   . PRO A 1 15 ? 8.350   14.772  0.426   1.00 0.00 ?  571  PRO A CB   2  
ATOM 1840  C CG   . PRO A 1 15 ? 9.491   13.871  0.114   1.00 0.00 ?  571  PRO A CG   2  
ATOM 1841  C CD   . PRO A 1 15 ? 9.969   13.349  1.442   1.00 0.00 ?  571  PRO A CD   2  
ATOM 1842  H HA   . PRO A 1 15 ? 7.276   14.870  2.281   1.00 0.00 ?  571  PRO A HA   2  
ATOM 1843  H HB2  . PRO A 1 15 ? 7.617   14.825  -0.366  1.00 0.00 ?  571  PRO A HB2  2  
ATOM 1844  H HB3  . PRO A 1 15 ? 8.676   15.766  0.695   1.00 0.00 ?  571  PRO A HB3  2  
ATOM 1845  H HG2  . PRO A 1 15 ? 9.135   13.058  -0.502  1.00 0.00 ?  571  PRO A HG2  2  
ATOM 1846  H HG3  . PRO A 1 15 ? 10.277  14.416  -0.387  1.00 0.00 ?  571  PRO A HG3  2  
ATOM 1847  H HD2  . PRO A 1 15 ? 10.359  12.347  1.335   1.00 0.00 ?  571  PRO A HD2  2  
ATOM 1848  H HD3  . PRO A 1 15 ? 10.717  14.004  1.860   1.00 0.00 ?  571  PRO A HD3  2  
ATOM 1849  N N    . MET A 1 16 ? 5.390   13.728  1.114   1.00 0.00 ?  572  MET A N    2  
ATOM 1850  C CA   . MET A 1 16 ? 4.230   12.974  0.760   1.00 0.00 ?  572  MET A CA   2  
ATOM 1851  C C    . MET A 1 16 ? 3.525   13.617  -0.417  1.00 0.00 ?  572  MET A C    2  
ATOM 1852  O O    . MET A 1 16 ? 2.921   14.662  -0.301  1.00 0.00 ?  572  MET A O    2  
ATOM 1853  C CB   . MET A 1 16 ? 3.312   12.827  1.976   1.00 0.00 ?  572  MET A CB   2  
ATOM 1854  C CG   . MET A 1 16 ? 2.967   14.151  2.645   1.00 0.00 ?  572  MET A CG   2  
ATOM 1855  S SD   . MET A 1 16 ? 1.943   13.957  4.114   1.00 0.00 ?  572  MET A SD   2  
ATOM 1856  C CE   . MET A 1 16 ? 3.060   13.062  5.200   1.00 0.00 ?  572  MET A CE   2  
ATOM 1857  H H    . MET A 1 16 ? 5.300   14.685  1.315   1.00 0.00 ?  572  MET A H    2  
ATOM 1858  H HA   . MET A 1 16 ? 4.564   11.990  0.459   1.00 0.00 ?  572  MET A HA   2  
ATOM 1859  H HB2  . MET A 1 16 ? 2.395   12.352  1.662   1.00 0.00 ?  572  MET A HB2  2  
ATOM 1860  H HB3  . MET A 1 16 ? 3.805   12.197  2.702   1.00 0.00 ?  572  MET A HB3  2  
ATOM 1861  H HG2  . MET A 1 16 ? 3.898   14.632  2.911   1.00 0.00 ?  572  MET A HG2  2  
ATOM 1862  H HG3  . MET A 1 16 ? 2.452   14.769  1.925   1.00 0.00 ?  572  MET A HG3  2  
ATOM 1863  H HE1  . MET A 1 16 ? 2.570   12.892  6.147   1.00 0.00 ?  572  MET A HE1  2  
ATOM 1864  H HE2  . MET A 1 16 ? 3.956   13.645  5.356   1.00 0.00 ?  572  MET A HE2  2  
ATOM 1865  H HE3  . MET A 1 16 ? 3.317   12.113  4.754   1.00 0.00 ?  572  MET A HE3  2  
ATOM 1866  N N    . SER A 1 17 ? 3.642   13.011  -1.540  1.00 0.00 ?  573  SER A N    2  
ATOM 1867  C CA   . SER A 1 17 ? 3.057   13.523  -2.736  1.00 0.00 ?  573  SER A CA   2  
ATOM 1868  C C    . SER A 1 17 ? 1.927   12.600  -3.190  1.00 0.00 ?  573  SER A C    2  
ATOM 1869  O O    . SER A 1 17 ? 1.665   11.560  -2.545  1.00 0.00 ?  573  SER A O    2  
ATOM 1870  C CB   . SER A 1 17 ? 4.160   13.581  -3.786  1.00 0.00 ?  573  SER A CB   2  
ATOM 1871  O OG   . SER A 1 17 ? 4.801   12.307  -3.885  1.00 0.00 ?  573  SER A OG   2  
ATOM 1872  H H    . SER A 1 17 ? 4.150   12.177  -1.611  1.00 0.00 ?  573  SER A H    2  
ATOM 1873  H HA   . SER A 1 17 ? 2.695   14.523  -2.556  1.00 0.00 ?  573  SER A HA   2  
ATOM 1874  H HB2  . SER A 1 17 ? 3.736   13.837  -4.745  1.00 0.00 ?  573  SER A HB2  2  
ATOM 1875  H HB3  . SER A 1 17 ? 4.896   14.317  -3.501  1.00 0.00 ?  573  SER A HB3  2  
ATOM 1876  H HG   . SER A 1 17 ? 5.755   12.456  -3.955  1.00 0.00 ?  573  SER A HG   2  
ATOM 1877  N N    . TYR A 1 18 ? 1.247   12.957  -4.277  1.00 0.00 ?  574  TYR A N    2  
ATOM 1878  C CA   . TYR A 1 18 ? 0.272   12.060  -4.875  1.00 0.00 ?  574  TYR A CA   2  
ATOM 1879  C C    . TYR A 1 18 ? 1.000   10.894  -5.516  1.00 0.00 ?  574  TYR A C    2  
ATOM 1880  O O    . TYR A 1 18 ? 0.462   9.791   -5.631  1.00 0.00 ?  574  TYR A O    2  
ATOM 1881  C CB   . TYR A 1 18 ? -0.668  12.768  -5.871  1.00 0.00 ?  574  TYR A CB   2  
ATOM 1882  C CG   . TYR A 1 18 ? -1.647  13.716  -5.208  1.00 0.00 ?  574  TYR A CG   2  
ATOM 1883  C CD1  . TYR A 1 18 ? -1.423  15.084  -5.183  1.00 0.00 ?  574  TYR A CD1  2  
ATOM 1884  C CD2  . TYR A 1 18 ? -2.792  13.230  -4.589  1.00 0.00 ?  574  TYR A CD2  2  
ATOM 1885  C CE1  . TYR A 1 18 ? -2.308  15.943  -4.555  1.00 0.00 ?  574  TYR A CE1  2  
ATOM 1886  C CE2  . TYR A 1 18 ? -3.684  14.079  -3.965  1.00 0.00 ?  574  TYR A CE2  2  
ATOM 1887  C CZ   . TYR A 1 18 ? -3.438  15.434  -3.948  1.00 0.00 ?  574  TYR A CZ   2  
ATOM 1888  O OH   . TYR A 1 18 ? -4.323  16.281  -3.312  1.00 0.00 ?  574  TYR A OH   2  
ATOM 1889  H H    . TYR A 1 18 ? 1.391   13.844  -4.680  1.00 0.00 ?  574  TYR A H    2  
ATOM 1890  H HA   . TYR A 1 18 ? -0.304  11.658  -4.056  1.00 0.00 ?  574  TYR A HA   2  
ATOM 1891  H HB2  . TYR A 1 18 ? -0.081  13.335  -6.577  1.00 0.00 ?  574  TYR A HB2  2  
ATOM 1892  H HB3  . TYR A 1 18 ? -1.237  12.024  -6.407  1.00 0.00 ?  574  TYR A HB3  2  
ATOM 1893  H HD1  . TYR A 1 18 ? -0.537  15.477  -5.660  1.00 0.00 ?  574  TYR A HD1  2  
ATOM 1894  H HD2  . TYR A 1 18 ? -2.983  12.167  -4.605  1.00 0.00 ?  574  TYR A HD2  2  
ATOM 1895  H HE1  . TYR A 1 18 ? -2.116  17.005  -4.547  1.00 0.00 ?  574  TYR A HE1  2  
ATOM 1896  H HE2  . TYR A 1 18 ? -4.568  13.678  -3.491  1.00 0.00 ?  574  TYR A HE2  2  
ATOM 1897  H HH   . TYR A 1 18 ? -4.428  17.077  -3.846  1.00 0.00 ?  574  TYR A HH   2  
ATOM 1898  N N    . ASP A 1 19 ? 2.250   11.151  -5.894  1.00 0.00 ?  575  ASP A N    2  
ATOM 1899  C CA   . ASP A 1 19 ? 3.151   10.127  -6.406  1.00 0.00 ?  575  ASP A CA   2  
ATOM 1900  C C    . ASP A 1 19 ? 3.421   9.103   -5.335  1.00 0.00 ?  575  ASP A C    2  
ATOM 1901  O O    . ASP A 1 19 ? 3.336   7.927   -5.586  1.00 0.00 ?  575  ASP A O    2  
ATOM 1902  C CB   . ASP A 1 19 ? 4.477   10.722  -6.896  1.00 0.00 ?  575  ASP A CB   2  
ATOM 1903  C CG   . ASP A 1 19 ? 4.356   11.454  -8.202  1.00 0.00 ?  575  ASP A CG   2  
ATOM 1904  O OD1  . ASP A 1 19 ? 3.790   12.567  -8.229  1.00 0.00 ?  575  ASP A OD1  2  
ATOM 1905  O OD2  . ASP A 1 19 ? 4.832   10.930  -9.233  1.00 0.00 -1 575  ASP A OD2  2  
ATOM 1906  H H    . ASP A 1 19 ? 2.570   12.076  -5.836  1.00 0.00 ?  575  ASP A H    2  
ATOM 1907  H HA   . ASP A 1 19 ? 2.656   9.638   -7.232  1.00 0.00 ?  575  ASP A HA   2  
ATOM 1908  H HB2  . ASP A 1 19 ? 4.844   11.416  -6.156  1.00 0.00 ?  575  ASP A HB2  2  
ATOM 1909  H HB3  . ASP A 1 19 ? 5.194   9.923   -7.014  1.00 0.00 ?  575  ASP A HB3  2  
ATOM 1910  N N    . GLU A 1 20 ? 3.724   9.570   -4.124  1.00 0.00 ?  576  GLU A N    2  
ATOM 1911  C CA   . GLU A 1 20 ? 3.942   8.684   -2.971  1.00 0.00 ?  576  GLU A CA   2  
ATOM 1912  C C    . GLU A 1 20 ? 2.751   7.777   -2.705  1.00 0.00 ?  576  GLU A C    2  
ATOM 1913  O O    . GLU A 1 20 ? 2.920   6.602   -2.396  1.00 0.00 ?  576  GLU A O    2  
ATOM 1914  C CB   . GLU A 1 20 ? 4.283   9.479   -1.714  1.00 0.00 ?  576  GLU A CB   2  
ATOM 1915  C CG   . GLU A 1 20 ? 5.723   9.931   -1.642  1.00 0.00 ?  576  GLU A CG   2  
ATOM 1916  C CD   . GLU A 1 20 ? 6.674   8.755   -1.601  1.00 0.00 ?  576  GLU A CD   2  
ATOM 1917  O OE1  . GLU A 1 20 ? 7.555   8.641   -2.485  1.00 0.00 ?  576  GLU A OE1  2  
ATOM 1918  O OE2  . GLU A 1 20 ? 6.550   7.910   -0.697  1.00 0.00 -1 576  GLU A OE2  2  
ATOM 1919  H H    . GLU A 1 20 ? 3.842   10.540  -4.017  1.00 0.00 ?  576  GLU A H    2  
ATOM 1920  H HA   . GLU A 1 20 ? 4.787   8.056   -3.213  1.00 0.00 ?  576  GLU A HA   2  
ATOM 1921  H HB2  . GLU A 1 20 ? 3.651   10.355  -1.685  1.00 0.00 ?  576  GLU A HB2  2  
ATOM 1922  H HB3  . GLU A 1 20 ? 4.069   8.873   -0.847  1.00 0.00 ?  576  GLU A HB3  2  
ATOM 1923  H HG2  . GLU A 1 20 ? 5.948   10.530  -2.512  1.00 0.00 ?  576  GLU A HG2  2  
ATOM 1924  H HG3  . GLU A 1 20 ? 5.863   10.520  -0.747  1.00 0.00 ?  576  GLU A HG3  2  
ATOM 1925  N N    . LYS A 1 21 ? 1.559   8.322   -2.847  1.00 0.00 ?  577  LYS A N    2  
ATOM 1926  C CA   . LYS A 1 21 ? 0.329   7.557   -2.656  1.00 0.00 ?  577  LYS A CA   2  
ATOM 1927  C C    . LYS A 1 21 ? 0.225   6.474   -3.704  1.00 0.00 ?  577  LYS A C    2  
ATOM 1928  O O    . LYS A 1 21 ? -0.035  5.313   -3.417  1.00 0.00 ?  577  LYS A O    2  
ATOM 1929  C CB   . LYS A 1 21 ? -0.898  8.470   -2.789  1.00 0.00 ?  577  LYS A CB   2  
ATOM 1930  C CG   . LYS A 1 21 ? -0.952  9.613   -1.772  1.00 0.00 ?  577  LYS A CG   2  
ATOM 1931  C CD   . LYS A 1 21 ? -2.101  10.562  -2.077  1.00 0.00 ?  577  LYS A CD   2  
ATOM 1932  C CE   . LYS A 1 21 ? -2.386  11.533  -0.935  1.00 0.00 ?  577  LYS A CE   2  
ATOM 1933  N NZ   . LYS A 1 21 ? -1.250  12.418  -0.633  1.00 0.00 1  577  LYS A NZ   2  
ATOM 1934  H H    . LYS A 1 21 ? 1.515   9.271   -3.086  1.00 0.00 ?  577  LYS A H    2  
ATOM 1935  H HA   . LYS A 1 21 ? 0.333   7.117   -1.670  1.00 0.00 ?  577  LYS A HA   2  
ATOM 1936  H HB2  . LYS A 1 21 ? -0.975  8.833   -3.804  1.00 0.00 ?  577  LYS A HB2  2  
ATOM 1937  H HB3  . LYS A 1 21 ? -1.770  7.849   -2.645  1.00 0.00 ?  577  LYS A HB3  2  
ATOM 1938  H HG2  . LYS A 1 21 ? -1.088  9.202   -0.782  1.00 0.00 ?  577  LYS A HG2  2  
ATOM 1939  H HG3  . LYS A 1 21 ? -0.021  10.159  -1.812  1.00 0.00 ?  577  LYS A HG3  2  
ATOM 1940  H HD2  . LYS A 1 21 ? -1.868  11.134  -2.962  1.00 0.00 ?  577  LYS A HD2  2  
ATOM 1941  H HD3  . LYS A 1 21 ? -2.988  9.975   -2.264  1.00 0.00 ?  577  LYS A HD3  2  
ATOM 1942  H HE2  . LYS A 1 21 ? -3.232  12.145  -1.208  1.00 0.00 ?  577  LYS A HE2  2  
ATOM 1943  H HE3  . LYS A 1 21 ? -2.636  10.960  -0.053  1.00 0.00 ?  577  LYS A HE3  2  
ATOM 1944  H HZ1  . LYS A 1 21 ? -0.945  12.943  -1.476  1.00 0.00 ?  577  LYS A HZ1  2  
ATOM 1945  H HZ2  . LYS A 1 21 ? -0.443  11.928  -0.206  1.00 0.00 ?  577  LYS A HZ2  2  
ATOM 1946  H HZ3  . LYS A 1 21 ? -1.556  13.133  0.061   1.00 0.00 ?  577  LYS A HZ3  2  
ATOM 1947  N N    . ARG A 1 22 ? 0.475   6.863   -4.907  1.00 0.00 ?  578  ARG A N    2  
ATOM 1948  C CA   . ARG A 1 22 ? 0.259   6.015   -6.018  1.00 0.00 ?  578  ARG A CA   2  
ATOM 1949  C C    . ARG A 1 22 ? 1.378   5.034   -6.255  1.00 0.00 ?  578  ARG A C    2  
ATOM 1950  O O    . ARG A 1 22 ? 1.163   3.998   -6.809  1.00 0.00 ?  578  ARG A O    2  
ATOM 1951  C CB   . ARG A 1 22 ? -0.107  6.800   -7.212  1.00 0.00 ?  578  ARG A CB   2  
ATOM 1952  C CG   . ARG A 1 22 ? -0.819  5.991   -8.242  1.00 0.00 ?  578  ARG A CG   2  
ATOM 1953  C CD   . ARG A 1 22 ? -1.548  6.920   -9.144  1.00 0.00 ?  578  ARG A CD   2  
ATOM 1954  N NE   . ARG A 1 22 ? -0.704  7.401   -10.255 1.00 0.00 ?  578  ARG A NE   2  
ATOM 1955  C CZ   . ARG A 1 22 ? -0.098  8.613   -10.328 1.00 0.00 ?  578  ARG A CZ   2  
ATOM 1956  N NH1  . ARG A 1 22 ? -0.256  9.524   -9.352  1.00 0.00 1  578  ARG A NH1  2  
ATOM 1957  N NH2  . ARG A 1 22 ? 0.630   8.912   -11.390 1.00 0.00 ?  578  ARG A NH2  2  
ATOM 1958  H H    . ARG A 1 22 ? 0.823   7.771   -5.049  1.00 0.00 ?  578  ARG A H    2  
ATOM 1959  H HA   . ARG A 1 22 ? -0.606  5.437   -5.733  1.00 0.00 ?  578  ARG A HA   2  
ATOM 1960  H HB2  . ARG A 1 22 ? -0.760  7.593   -6.878  1.00 0.00 ?  578  ARG A HB2  2  
ATOM 1961  H HB3  . ARG A 1 22 ? 0.759   7.252   -7.655  1.00 0.00 ?  578  ARG A HB3  2  
ATOM 1962  H HG2  . ARG A 1 22 ? -0.107  5.387   -8.793  1.00 0.00 ?  578  ARG A HG2  2  
ATOM 1963  H HG3  . ARG A 1 22 ? -1.524  5.336   -7.751  1.00 0.00 ?  578  ARG A HG3  2  
ATOM 1964  H HD2  . ARG A 1 22 ? -2.495  6.467   -9.381  1.00 0.00 ?  578  ARG A HD2  2  
ATOM 1965  H HD3  . ARG A 1 22 ? -1.814  7.770   -8.534  1.00 0.00 ?  578  ARG A HD3  2  
ATOM 1966  H HE   . ARG A 1 22 ? -0.596  6.766   -11.000 1.00 0.00 ?  578  ARG A HE   2  
ATOM 1967  H HH11 . ARG A 1 22 ? -0.830  9.360   -8.544  1.00 0.00 ?  578  ARG A HH11 2  
ATOM 1968  H HH12 . ARG A 1 22 ? 0.203   10.418  -9.378  1.00 0.00 ?  578  ARG A HH12 2  
ATOM 1969  H HH21 . ARG A 1 22 ? 0.734   8.264   -12.150 1.00 0.00 ?  578  ARG A HH21 2  
ATOM 1970  H HH22 . ARG A 1 22 ? 1.113   9.784   -11.491 1.00 0.00 ?  578  ARG A HH22 2  
ATOM 1971  N N    . GLN A 1 23 ? 2.555   5.373   -5.853  1.00 0.00 ?  579  GLN A N    2  
ATOM 1972  C CA   . GLN A 1 23 ? 3.698   4.467   -5.932  1.00 0.00 ?  579  GLN A CA   2  
ATOM 1973  C C    . GLN A 1 23 ? 3.342   3.166   -5.178  1.00 0.00 ?  579  GLN A C    2  
ATOM 1974  O O    . GLN A 1 23 ? 3.654   2.062   -5.620  1.00 0.00 ?  579  GLN A O    2  
ATOM 1975  C CB   . GLN A 1 23 ? 4.887   5.159   -5.274  1.00 0.00 ?  579  GLN A CB   2  
ATOM 1976  C CG   . GLN A 1 23 ? 6.186   4.381   -5.234  1.00 0.00 ?  579  GLN A CG   2  
ATOM 1977  C CD   . GLN A 1 23 ? 7.261   5.137   -4.469  1.00 0.00 ?  579  GLN A CD   2  
ATOM 1978  O OE1  . GLN A 1 23 ? 8.132   4.542   -3.845  1.00 0.00 ?  579  GLN A OE1  2  
ATOM 1979  N NE2  . GLN A 1 23 ? 7.213   6.449   -4.503  1.00 0.00 ?  579  GLN A NE2  2  
ATOM 1980  H H    . GLN A 1 23 ? 2.688   6.284   -5.507  1.00 0.00 ?  579  GLN A H    2  
ATOM 1981  H HA   . GLN A 1 23 ? 3.913   4.256   -6.970  1.00 0.00 ?  579  GLN A HA   2  
ATOM 1982  H HB2  . GLN A 1 23 ? 5.075   6.079   -5.806  1.00 0.00 ?  579  GLN A HB2  2  
ATOM 1983  H HB3  . GLN A 1 23 ? 4.611   5.409   -4.260  1.00 0.00 ?  579  GLN A HB3  2  
ATOM 1984  H HG2  . GLN A 1 23 ? 6.010   3.431   -4.750  1.00 0.00 ?  579  GLN A HG2  2  
ATOM 1985  H HG3  . GLN A 1 23 ? 6.531   4.215   -6.243  1.00 0.00 ?  579  GLN A HG3  2  
ATOM 1986  H HE21 . GLN A 1 23 ? 6.504   6.889   -5.017  1.00 0.00 ?  579  GLN A HE21 2  
ATOM 1987  H HE22 . GLN A 1 23 ? 7.873   6.979   -4.004  1.00 0.00 ?  579  GLN A HE22 2  
ATOM 1988  N N    . LEU A 1 24 ? 2.608   3.333   -4.096  1.00 0.00 ?  580  LEU A N    2  
ATOM 1989  C CA   . LEU A 1 24 ? 2.116   2.231   -3.302  1.00 0.00 ?  580  LEU A CA   2  
ATOM 1990  C C    . LEU A 1 24 ? 0.939   1.513   -3.974  1.00 0.00 ?  580  LEU A C    2  
ATOM 1991  O O    . LEU A 1 24 ? 0.699   0.336   -3.708  1.00 0.00 ?  580  LEU A O    2  
ATOM 1992  C CB   . LEU A 1 24 ? 1.799   2.674   -1.870  1.00 0.00 ?  580  LEU A CB   2  
ATOM 1993  C CG   . LEU A 1 24 ? 3.003   2.759   -0.894  1.00 0.00 ?  580  LEU A CG   2  
ATOM 1994  C CD1  . LEU A 1 24 ? 4.111   3.661   -1.408  1.00 0.00 ?  580  LEU A CD1  2  
ATOM 1995  C CD2  . LEU A 1 24 ? 2.546   3.239   0.458   1.00 0.00 ?  580  LEU A CD2  2  
ATOM 1996  H H    . LEU A 1 24 ? 2.393   4.246   -3.812  1.00 0.00 ?  580  LEU A H    2  
ATOM 1997  H HA   . LEU A 1 24 ? 2.924   1.517   -3.261  1.00 0.00 ?  580  LEU A HA   2  
ATOM 1998  H HB2  . LEU A 1 24 ? 1.341   3.649   -1.925  1.00 0.00 ?  580  LEU A HB2  2  
ATOM 1999  H HB3  . LEU A 1 24 ? 1.079   1.982   -1.460  1.00 0.00 ?  580  LEU A HB3  2  
ATOM 2000  H HG   . LEU A 1 24 ? 3.418   1.770   -0.767  1.00 0.00 ?  580  LEU A HG   2  
ATOM 2001  H HD11 . LEU A 1 24 ? 4.915   3.687   -0.688  1.00 0.00 ?  580  LEU A HD11 2  
ATOM 2002  H HD12 . LEU A 1 24 ? 3.725   4.658   -1.558  1.00 0.00 ?  580  LEU A HD12 2  
ATOM 2003  H HD13 . LEU A 1 24 ? 4.482   3.274   -2.346  1.00 0.00 ?  580  LEU A HD13 2  
ATOM 2004  H HD21 . LEU A 1 24 ? 1.809   2.558   0.853   1.00 0.00 ?  580  LEU A HD21 2  
ATOM 2005  H HD22 . LEU A 1 24 ? 2.117   4.226   0.363   1.00 0.00 ?  580  LEU A HD22 2  
ATOM 2006  H HD23 . LEU A 1 24 ? 3.395   3.278   1.125   1.00 0.00 ?  580  LEU A HD23 2  
ATOM 2007  N N    . SER A 1 25 ? 0.227   2.226   -4.873  1.00 0.00 ?  581  SER A N    2  
ATOM 2008  C CA   . SER A 1 25 ? -0.866  1.645   -5.660  1.00 0.00 ?  581  SER A CA   2  
ATOM 2009  C C    . SER A 1 25 ? -0.263  0.517   -6.512  1.00 0.00 ?  581  SER A C    2  
ATOM 2010  O O    . SER A 1 25 ? -0.844  -0.552  -6.699  1.00 0.00 ?  581  SER A O    2  
ATOM 2011  C CB   . SER A 1 25 ? -1.419  2.690   -6.637  1.00 0.00 ?  581  SER A CB   2  
ATOM 2012  O OG   . SER A 1 25 ? -2.739  2.376   -7.053  1.00 0.00 ?  581  SER A OG   2  
ATOM 2013  H H    . SER A 1 25 ? 0.460   3.166   -5.012  1.00 0.00 ?  581  SER A H    2  
ATOM 2014  H HA   . SER A 1 25 ? -1.657  1.360   -4.975  1.00 0.00 ?  581  SER A HA   2  
ATOM 2015  H HB2  . SER A 1 25 ? -1.376  3.672   -6.195  1.00 0.00 ?  581  SER A HB2  2  
ATOM 2016  H HB3  . SER A 1 25 ? -0.783  2.697   -7.510  1.00 0.00 ?  581  SER A HB3  2  
ATOM 2017  H HG   . SER A 1 25 ? -2.706  1.590   -7.613  1.00 0.00 ?  581  SER A HG   2  
ATOM 2018  N N    . LEU A 1 26 ? 0.935   0.790   -7.019  1.00 0.00 ?  582  LEU A N    2  
ATOM 2019  C CA   . LEU A 1 26 ? 1.670   -0.142  -7.828  1.00 0.00 ?  582  LEU A CA   2  
ATOM 2020  C C    . LEU A 1 26 ? 2.197   -1.300  -6.986  1.00 0.00 ?  582  LEU A C    2  
ATOM 2021  O O    . LEU A 1 26 ? 2.167   -2.447  -7.430  1.00 0.00 ?  582  LEU A O    2  
ATOM 2022  C CB   . LEU A 1 26 ? 2.815   0.559   -8.595  1.00 0.00 ?  582  LEU A CB   2  
ATOM 2023  C CG   . LEU A 1 26 ? 2.444   1.445   -9.822  1.00 0.00 ?  582  LEU A CG   2  
ATOM 2024  C CD1  . LEU A 1 26 ? 1.721   0.635   -10.882 1.00 0.00 ?  582  LEU A CD1  2  
ATOM 2025  C CD2  . LEU A 1 26 ? 1.636   2.694   -9.447  1.00 0.00 ?  582  LEU A CD2  2  
ATOM 2026  H H    . LEU A 1 26 ? 1.341   1.666   -6.844  1.00 0.00 ?  582  LEU A H    2  
ATOM 2027  H HA   . LEU A 1 26 ? 0.976   -0.551  -8.546  1.00 0.00 ?  582  LEU A HA   2  
ATOM 2028  H HB2  . LEU A 1 26 ? 3.349   1.182   -7.892  1.00 0.00 ?  582  LEU A HB2  2  
ATOM 2029  H HB3  . LEU A 1 26 ? 3.495   -0.210  -8.934  1.00 0.00 ?  582  LEU A HB3  2  
ATOM 2030  H HG   . LEU A 1 26 ? 3.376   1.763   -10.262 1.00 0.00 ?  582  LEU A HG   2  
ATOM 2031  H HD11 . LEU A 1 26 ? 2.352   -0.177  -11.208 1.00 0.00 ?  582  LEU A HD11 2  
ATOM 2032  H HD12 . LEU A 1 26 ? 1.495   1.274   -11.724 1.00 0.00 ?  582  LEU A HD12 2  
ATOM 2033  H HD13 . LEU A 1 26 ? 0.803   0.240   -10.477 1.00 0.00 ?  582  LEU A HD13 2  
ATOM 2034  H HD21 . LEU A 1 26 ? 0.700   2.410   -8.992  1.00 0.00 ?  582  LEU A HD21 2  
ATOM 2035  H HD22 . LEU A 1 26 ? 1.429   3.301   -10.315 1.00 0.00 ?  582  LEU A HD22 2  
ATOM 2036  H HD23 . LEU A 1 26 ? 2.191   3.292   -8.736  1.00 0.00 ?  582  LEU A HD23 2  
ATOM 2037  N N    . ASP A 1 27 ? 2.652   -1.000  -5.756  1.00 0.00 ?  583  ASP A N    2  
ATOM 2038  C CA   . ASP A 1 27 ? 3.159   -2.046  -4.843  1.00 0.00 ?  583  ASP A CA   2  
ATOM 2039  C C    . ASP A 1 27 ? 2.135   -3.095  -4.572  1.00 0.00 ?  583  ASP A C    2  
ATOM 2040  O O    . ASP A 1 27 ? 2.403   -4.273  -4.764  1.00 0.00 ?  583  ASP A O    2  
ATOM 2041  C CB   . ASP A 1 27 ? 3.722   -1.514  -3.513  1.00 0.00 ?  583  ASP A CB   2  
ATOM 2042  C CG   . ASP A 1 27 ? 5.111   -0.942  -3.662  1.00 0.00 ?  583  ASP A CG   2  
ATOM 2043  O OD1  . ASP A 1 27 ? 5.338   0.228   -3.316  1.00 0.00 ?  583  ASP A OD1  2  
ATOM 2044  O OD2  . ASP A 1 27 ? 6.008   -1.663  -4.168  1.00 0.00 -1 583  ASP A OD2  2  
ATOM 2045  H H    . ASP A 1 27 ? 2.660   -0.061  -5.471  1.00 0.00 ?  583  ASP A H    2  
ATOM 2046  H HA   . ASP A 1 27 ? 3.961   -2.531  -5.380  1.00 0.00 ?  583  ASP A HA   2  
ATOM 2047  H HB2  . ASP A 1 27 ? 3.063   -0.749  -3.131  1.00 0.00 ?  583  ASP A HB2  2  
ATOM 2048  H HB3  . ASP A 1 27 ? 3.745   -2.319  -2.789  1.00 0.00 ?  583  ASP A HB3  2  
ATOM 2049  N N    . ILE A 1 28 ? 0.954   -2.678  -4.166  1.00 0.00 ?  584  ILE A N    2  
ATOM 2050  C CA   . ILE A 1 28 ? -0.127  -3.607  -3.893  1.00 0.00 ?  584  ILE A CA   2  
ATOM 2051  C C    . ILE A 1 28 ? -0.480  -4.445  -5.144  1.00 0.00 ?  584  ILE A C    2  
ATOM 2052  O O    . ILE A 1 28 ? -0.686  -5.653  -5.048  1.00 0.00 ?  584  ILE A O    2  
ATOM 2053  C CB   . ILE A 1 28 ? -1.388  -2.903  -3.239  1.00 0.00 ?  584  ILE A CB   2  
ATOM 2054  C CG1  . ILE A 1 28 ? -2.584  -3.828  -3.129  1.00 0.00 ?  584  ILE A CG1  2  
ATOM 2055  C CG2  . ILE A 1 28 ? -1.784  -1.631  -3.960  1.00 0.00 ?  584  ILE A CG2  2  
ATOM 2056  C CD1  . ILE A 1 28 ? -2.325  -5.123  -2.415  1.00 0.00 ?  584  ILE A CD1  2  
ATOM 2057  H H    . ILE A 1 28 ? 0.818   -1.713  -4.046  1.00 0.00 ?  584  ILE A H    2  
ATOM 2058  H HA   . ILE A 1 28 ? 0.282   -4.307  -3.177  1.00 0.00 ?  584  ILE A HA   2  
ATOM 2059  H HB   . ILE A 1 28 ? -1.096  -2.613  -2.244  1.00 0.00 ?  584  ILE A HB   2  
ATOM 2060  H HG12 . ILE A 1 28 ? -3.385  -3.319  -2.614  1.00 0.00 ?  584  ILE A HG12 2  
ATOM 2061  H HG13 . ILE A 1 28 ? -2.894  -4.054  -4.137  1.00 0.00 ?  584  ILE A HG13 2  
ATOM 2062  H HG21 . ILE A 1 28 ? -1.885  -1.860  -5.010  1.00 0.00 ?  584  ILE A HG21 2  
ATOM 2063  H HG22 . ILE A 1 28 ? -1.032  -0.868  -3.827  1.00 0.00 ?  584  ILE A HG22 2  
ATOM 2064  H HG23 . ILE A 1 28 ? -2.739  -1.261  -3.607  1.00 0.00 ?  584  ILE A HG23 2  
ATOM 2065  H HD11 . ILE A 1 28 ? -3.277  -5.611  -2.272  1.00 0.00 ?  584  ILE A HD11 2  
ATOM 2066  H HD12 . ILE A 1 28 ? -1.805  -4.954  -1.486  1.00 0.00 ?  584  ILE A HD12 2  
ATOM 2067  H HD13 . ILE A 1 28 ? -1.721  -5.738  -3.065  1.00 0.00 ?  584  ILE A HD13 2  
ATOM 2068  N N    . ASN A 1 29 ? -0.449  -3.828  -6.312  1.00 0.00 ?  585  ASN A N    2  
ATOM 2069  C CA   . ASN A 1 29 ? -0.750  -4.538  -7.562  1.00 0.00 ?  585  ASN A CA   2  
ATOM 2070  C C    . ASN A 1 29 ? 0.342   -5.594  -7.885  1.00 0.00 ?  585  ASN A C    2  
ATOM 2071  O O    . ASN A 1 29 ? 0.122   -6.530  -8.667  1.00 0.00 ?  585  ASN A O    2  
ATOM 2072  C CB   . ASN A 1 29 ? -0.923  -3.537  -8.724  1.00 0.00 ?  585  ASN A CB   2  
ATOM 2073  C CG   . ASN A 1 29 ? -1.346  -4.174  -10.054 1.00 0.00 ?  585  ASN A CG   2  
ATOM 2074  O OD1  . ASN A 1 29 ? -0.997  -3.673  -11.125 1.00 0.00 ?  585  ASN A OD1  2  
ATOM 2075  N ND2  . ASN A 1 29 ? -2.122  -5.242  -10.008 1.00 0.00 ?  585  ASN A ND2  2  
ATOM 2076  H H    . ASN A 1 29 ? -0.224  -2.873  -6.339  1.00 0.00 ?  585  ASN A H    2  
ATOM 2077  H HA   . ASN A 1 29 ? -1.681  -5.064  -7.411  1.00 0.00 ?  585  ASN A HA   2  
ATOM 2078  H HB2  . ASN A 1 29 ? -1.674  -2.811  -8.452  1.00 0.00 ?  585  ASN A HB2  2  
ATOM 2079  H HB3  . ASN A 1 29 ? 0.017   -3.027  -8.876  1.00 0.00 ?  585  ASN A HB3  2  
ATOM 2080  H HD21 . ASN A 1 29 ? -2.405  -5.591  -9.139  1.00 0.00 ?  585  ASN A HD21 2  
ATOM 2081  H HD22 . ASN A 1 29 ? -2.375  -5.685  -10.848 1.00 0.00 ?  585  ASN A HD22 2  
ATOM 2082  N N    . ARG A 1 30 ? 1.493   -5.459  -7.256  1.00 0.00 ?  586  ARG A N    2  
ATOM 2083  C CA   . ARG A 1 30 ? 2.590   -6.385  -7.454  1.00 0.00 ?  586  ARG A CA   2  
ATOM 2084  C C    . ARG A 1 30 ? 2.545   -7.564  -6.476  1.00 0.00 ?  586  ARG A C    2  
ATOM 2085  O O    . ARG A 1 30 ? 3.219   -8.571  -6.691  1.00 0.00 ?  586  ARG A O    2  
ATOM 2086  C CB   . ARG A 1 30 ? 3.943   -5.665  -7.417  1.00 0.00 ?  586  ARG A CB   2  
ATOM 2087  C CG   . ARG A 1 30 ? 4.152   -4.745  -8.610  1.00 0.00 ?  586  ARG A CG   2  
ATOM 2088  C CD   . ARG A 1 30 ? 5.489   -4.019  -8.574  1.00 0.00 ?  586  ARG A CD   2  
ATOM 2089  N NE   . ARG A 1 30 ? 5.584   -3.009  -7.498  1.00 0.00 ?  586  ARG A NE   2  
ATOM 2090  C CZ   . ARG A 1 30 ? 5.798   -1.696  -7.715  1.00 0.00 ?  586  ARG A CZ   2  
ATOM 2091  N NH1  . ARG A 1 30 ? 5.697   -1.193  -8.946  1.00 0.00 1  586  ARG A NH1  2  
ATOM 2092  N NH2  . ARG A 1 30 ? 6.039   -0.880  -6.700  1.00 0.00 ?  586  ARG A NH2  2  
ATOM 2093  H H    . ARG A 1 30 ? 1.609   -4.706  -6.632  1.00 0.00 ?  586  ARG A H    2  
ATOM 2094  H HA   . ARG A 1 30 ? 2.455   -6.795  -8.444  1.00 0.00 ?  586  ARG A HA   2  
ATOM 2095  H HB2  . ARG A 1 30 ? 4.002   -5.074  -6.514  1.00 0.00 ?  586  ARG A HB2  2  
ATOM 2096  H HB3  . ARG A 1 30 ? 4.734   -6.402  -7.411  1.00 0.00 ?  586  ARG A HB3  2  
ATOM 2097  H HG2  . ARG A 1 30 ? 4.106   -5.335  -9.514  1.00 0.00 ?  586  ARG A HG2  2  
ATOM 2098  H HG3  . ARG A 1 30 ? 3.355   -4.017  -8.623  1.00 0.00 ?  586  ARG A HG3  2  
ATOM 2099  H HD2  . ARG A 1 30 ? 6.266   -4.752  -8.414  1.00 0.00 ?  586  ARG A HD2  2  
ATOM 2100  H HD3  . ARG A 1 30 ? 5.654   -3.537  -9.525  1.00 0.00 ?  586  ARG A HD3  2  
ATOM 2101  H HE   . ARG A 1 30 ? 5.549   -3.352  -6.578  1.00 0.00 ?  586  ARG A HE   2  
ATOM 2102  H HH11 . ARG A 1 30 ? 5.454   -1.756  -9.743  1.00 0.00 ?  586  ARG A HH11 2  
ATOM 2103  H HH12 . ARG A 1 30 ? 5.869   -0.220  -9.119  1.00 0.00 ?  586  ARG A HH12 2  
ATOM 2104  H HH21 . ARG A 1 30 ? 6.076   -1.193  -5.735  1.00 0.00 ?  586  ARG A HH21 2  
ATOM 2105  H HH22 . ARG A 1 30 ? 6.204   0.101   -6.831  1.00 0.00 ?  586  ARG A HH22 2  
ATOM 2106  N N    . LEU A 1 31 ? 1.767   -7.446  -5.416  1.00 0.00 ?  587  LEU A N    2  
ATOM 2107  C CA   . LEU A 1 31 ? 1.594   -8.538  -4.476  1.00 0.00 ?  587  LEU A CA   2  
ATOM 2108  C C    . LEU A 1 31 ? 0.564   -9.569  -4.964  1.00 0.00 ?  587  LEU A C    2  
ATOM 2109  O O    . LEU A 1 31 ? -0.338  -9.239  -5.738  1.00 0.00 ?  587  LEU A O    2  
ATOM 2110  C CB   . LEU A 1 31 ? 1.255   -8.052  -3.057  1.00 0.00 ?  587  LEU A CB   2  
ATOM 2111  C CG   . LEU A 1 31 ? 2.449   -7.675  -2.179  1.00 0.00 ?  587  LEU A CG   2  
ATOM 2112  C CD1  . LEU A 1 31 ? 3.021   -6.311  -2.495  1.00 0.00 ?  587  LEU A CD1  2  
ATOM 2113  C CD2  . LEU A 1 31 ? 2.119   -7.828  -0.717  1.00 0.00 ?  587  LEU A CD2  2  
ATOM 2114  H H    . LEU A 1 31 ? 1.286   -6.611  -5.236  1.00 0.00 ?  587  LEU A H    2  
ATOM 2115  H HA   . LEU A 1 31 ? 2.547   -9.046  -4.442  1.00 0.00 ?  587  LEU A HA   2  
ATOM 2116  H HB2  . LEU A 1 31 ? 0.635   -7.171  -3.156  1.00 0.00 ?  587  LEU A HB2  2  
ATOM 2117  H HB3  . LEU A 1 31 ? 0.689   -8.823  -2.554  1.00 0.00 ?  587  LEU A HB3  2  
ATOM 2118  H HG   . LEU A 1 31 ? 3.230   -8.379  -2.414  1.00 0.00 ?  587  LEU A HG   2  
ATOM 2119  H HD11 . LEU A 1 31 ? 3.351   -6.287  -3.524  1.00 0.00 ?  587  LEU A HD11 2  
ATOM 2120  H HD12 . LEU A 1 31 ? 3.863   -6.129  -1.842  1.00 0.00 ?  587  LEU A HD12 2  
ATOM 2121  H HD13 . LEU A 1 31 ? 2.270   -5.551  -2.335  1.00 0.00 ?  587  LEU A HD13 2  
ATOM 2122  H HD21 . LEU A 1 31 ? 1.920   -8.867  -0.497  1.00 0.00 ?  587  LEU A HD21 2  
ATOM 2123  H HD22 . LEU A 1 31 ? 1.231   -7.254  -0.500  1.00 0.00 ?  587  LEU A HD22 2  
ATOM 2124  H HD23 . LEU A 1 31 ? 2.943   -7.477  -0.112  1.00 0.00 ?  587  LEU A HD23 2  
ATOM 2125  N N    . PRO A 1 32 ? 0.725   -10.858 -4.552  1.00 0.00 ?  588  PRO A N    2  
ATOM 2126  C CA   . PRO A 1 32 ? -0.183  -11.954 -4.943  1.00 0.00 ?  588  PRO A CA   2  
ATOM 2127  C C    . PRO A 1 32 ? -1.606  -11.801 -4.373  1.00 0.00 ?  588  PRO A C    2  
ATOM 2128  O O    . PRO A 1 32 ? -1.832  -11.079 -3.377  1.00 0.00 ?  588  PRO A O    2  
ATOM 2129  C CB   . PRO A 1 32 ? 0.490   -13.208 -4.368  1.00 0.00 ?  588  PRO A CB   2  
ATOM 2130  C CG   . PRO A 1 32 ? 1.339   -12.703 -3.254  1.00 0.00 ?  588  PRO A CG   2  
ATOM 2131  C CD   . PRO A 1 32 ? 1.820   -11.349 -3.686  1.00 0.00 ?  588  PRO A CD   2  
ATOM 2132  H HA   . PRO A 1 32 ? -0.246  -12.038 -6.018  1.00 0.00 ?  588  PRO A HA   2  
ATOM 2133  H HB2  . PRO A 1 32 ? -0.266  -13.893 -4.013  1.00 0.00 ?  588  PRO A HB2  2  
ATOM 2134  H HB3  . PRO A 1 32 ? 1.086   -13.685 -5.132  1.00 0.00 ?  588  PRO A HB3  2  
ATOM 2135  H HG2  . PRO A 1 32 ? 0.754   -12.624 -2.350  1.00 0.00 ?  588  PRO A HG2  2  
ATOM 2136  H HG3  . PRO A 1 32 ? 2.176   -13.368 -3.100  1.00 0.00 ?  588  PRO A HG3  2  
ATOM 2137  H HD2  . PRO A 1 32 ? 1.951   -10.699 -2.833  1.00 0.00 ?  588  PRO A HD2  2  
ATOM 2138  H HD3  . PRO A 1 32 ? 2.741   -11.421 -4.246  1.00 0.00 ?  588  PRO A HD3  2  
ATOM 2139  N N    . GLY A 1 33 ? -2.530  -12.537 -4.972  1.00 0.00 ?  589  GLY A N    2  
ATOM 2140  C CA   . GLY A 1 33 ? -3.945  -12.476 -4.653  1.00 0.00 ?  589  GLY A CA   2  
ATOM 2141  C C    . GLY A 1 33 ? -4.270  -12.751 -3.206  1.00 0.00 ?  589  GLY A C    2  
ATOM 2142  O O    . GLY A 1 33 ? -5.142  -12.100 -2.624  1.00 0.00 ?  589  GLY A O    2  
ATOM 2143  H H    . GLY A 1 33 ? -2.243  -13.164 -5.671  1.00 0.00 ?  589  GLY A H    2  
ATOM 2144  H HA2  . GLY A 1 33 ? -4.309  -11.492 -4.899  1.00 0.00 ?  589  GLY A HA2  2  
ATOM 2145  H HA3  . GLY A 1 33 ? -4.464  -13.194 -5.270  1.00 0.00 ?  589  GLY A HA3  2  
ATOM 2146  N N    . GLU A 1 34 ? -3.565  -13.687 -2.620  1.00 0.00 ?  590  GLU A N    2  
ATOM 2147  C CA   . GLU A 1 34 ? -3.776  -14.052 -1.229  1.00 0.00 ?  590  GLU A CA   2  
ATOM 2148  C C    . GLU A 1 34 ? -3.432  -12.896 -0.281  1.00 0.00 ?  590  GLU A C    2  
ATOM 2149  O O    . GLU A 1 34 ? -3.946  -12.824 0.840   1.00 0.00 ?  590  GLU A O    2  
ATOM 2150  C CB   . GLU A 1 34 ? -2.932  -15.267 -0.846  1.00 0.00 ?  590  GLU A CB   2  
ATOM 2151  C CG   . GLU A 1 34 ? -1.440  -15.056 -1.044  1.00 0.00 ?  590  GLU A CG   2  
ATOM 2152  C CD   . GLU A 1 34 ? -0.612  -15.924 -0.145  1.00 0.00 ?  590  GLU A CD   2  
ATOM 2153  O OE1  . GLU A 1 34 ? -0.298  -15.480 0.980   1.00 0.00 ?  590  GLU A OE1  2  
ATOM 2154  O OE2  . GLU A 1 34 ? -0.250  -17.040 -0.541  1.00 0.00 -1 590  GLU A OE2  2  
ATOM 2155  H H    . GLU A 1 34 ? -2.909  -14.174 -3.165  1.00 0.00 ?  590  GLU A H    2  
ATOM 2156  H HA   . GLU A 1 34 ? -4.819  -14.306 -1.103  1.00 0.00 ?  590  GLU A HA   2  
ATOM 2157  H HB2  . GLU A 1 34 ? -3.111  -15.498 0.192   1.00 0.00 ?  590  GLU A HB2  2  
ATOM 2158  H HB3  . GLU A 1 34 ? -3.239  -16.109 -1.449  1.00 0.00 ?  590  GLU A HB3  2  
ATOM 2159  H HG2  . GLU A 1 34 ? -1.189  -15.284 -2.069  1.00 0.00 ?  590  GLU A HG2  2  
ATOM 2160  H HG3  . GLU A 1 34 ? -1.210  -14.020 -0.845  1.00 0.00 ?  590  GLU A HG3  2  
ATOM 2161  N N    . LYS A 1 35 ? -2.573  -12.005 -0.719  1.00 0.00 ?  591  LYS A N    2  
ATOM 2162  C CA   . LYS A 1 35 ? -2.121  -10.938 0.123   1.00 0.00 ?  591  LYS A CA   2  
ATOM 2163  C C    . LYS A 1 35 ? -2.824  -9.624  -0.147  1.00 0.00 ?  591  LYS A C    2  
ATOM 2164  O O    . LYS A 1 35 ? -2.921  -8.788  0.748   1.00 0.00 ?  591  LYS A O    2  
ATOM 2165  C CB   . LYS A 1 35 ? -0.600  -10.813 0.105   1.00 0.00 ?  591  LYS A CB   2  
ATOM 2166  C CG   . LYS A 1 35 ? 0.096   -11.911 0.916   1.00 0.00 ?  591  LYS A CG   2  
ATOM 2167  C CD   . LYS A 1 35 ? 1.609   -11.764 0.923   1.00 0.00 ?  591  LYS A CD   2  
ATOM 2168  C CE   . LYS A 1 35 ? 2.270   -12.779 1.867   1.00 0.00 ?  591  LYS A CE   2  
ATOM 2169  N NZ   . LYS A 1 35 ? 2.058   -14.193 1.456   1.00 0.00 1  591  LYS A NZ   2  
ATOM 2170  H H    . LYS A 1 35 ? -2.262  -12.050 -1.650  1.00 0.00 ?  591  LYS A H    2  
ATOM 2171  H HA   . LYS A 1 35 ? -2.409  -11.232 1.122   1.00 0.00 ?  591  LYS A HA   2  
ATOM 2172  H HB2  . LYS A 1 35 ? -0.270  -10.875 -0.923  1.00 0.00 ?  591  LYS A HB2  2  
ATOM 2173  H HB3  . LYS A 1 35 ? -0.339  -9.848  0.507   1.00 0.00 ?  591  LYS A HB3  2  
ATOM 2174  H HG2  . LYS A 1 35 ? -0.255  -11.864 1.936   1.00 0.00 ?  591  LYS A HG2  2  
ATOM 2175  H HG3  . LYS A 1 35 ? -0.162  -12.874 0.502   1.00 0.00 ?  591  LYS A HG3  2  
ATOM 2176  H HD2  . LYS A 1 35 ? 1.982   -11.927 -0.078  1.00 0.00 ?  591  LYS A HD2  2  
ATOM 2177  H HD3  . LYS A 1 35 ? 1.867   -10.766 1.244   1.00 0.00 ?  591  LYS A HD3  2  
ATOM 2178  H HE2  . LYS A 1 35 ? 3.331   -12.582 1.895   1.00 0.00 ?  591  LYS A HE2  2  
ATOM 2179  H HE3  . LYS A 1 35 ? 1.863   -12.638 2.859   1.00 0.00 ?  591  LYS A HE3  2  
ATOM 2180  H HZ1  . LYS A 1 35 ? 2.501   -14.388 0.540   1.00 0.00 ?  591  LYS A HZ1  2  
ATOM 2181  H HZ2  . LYS A 1 35 ? 1.053   -14.475 1.398   1.00 0.00 ?  591  LYS A HZ2  2  
ATOM 2182  H HZ3  . LYS A 1 35 ? 2.496   -14.828 2.155   1.00 0.00 ?  591  LYS A HZ3  2  
ATOM 2183  N N    . LEU A 1 36 ? -3.341  -9.454  -1.358  1.00 0.00 ?  592  LEU A N    2  
ATOM 2184  C CA   . LEU A 1 36 ? -4.100  -8.257  -1.700  1.00 0.00 ?  592  LEU A CA   2  
ATOM 2185  C C    . LEU A 1 36 ? -5.330  -8.124  -0.780  1.00 0.00 ?  592  LEU A C    2  
ATOM 2186  O O    . LEU A 1 36 ? -5.702  -7.040  -0.386  1.00 0.00 ?  592  LEU A O    2  
ATOM 2187  C CB   . LEU A 1 36 ? -4.474  -8.252  -3.228  1.00 0.00 ?  592  LEU A CB   2  
ATOM 2188  C CG   . LEU A 1 36 ? -5.556  -9.267  -3.759  1.00 0.00 ?  592  LEU A CG   2  
ATOM 2189  C CD1  . LEU A 1 36 ? -6.959  -8.781  -3.500  1.00 0.00 ?  592  LEU A CD1  2  
ATOM 2190  C CD2  . LEU A 1 36 ? -5.437  -9.454  -5.236  1.00 0.00 ?  592  LEU A CD2  2  
ATOM 2191  H H    . LEU A 1 36 ? -3.172  -10.105 -2.071  1.00 0.00 ?  592  LEU A H    2  
ATOM 2192  H HA   . LEU A 1 36 ? -3.462  -7.410  -1.482  1.00 0.00 ?  592  LEU A HA   2  
ATOM 2193  H HB2  . LEU A 1 36 ? -4.779  -7.249  -3.490  1.00 0.00 ?  592  LEU A HB2  2  
ATOM 2194  H HB3  . LEU A 1 36 ? -3.556  -8.439  -3.766  1.00 0.00 ?  592  LEU A HB3  2  
ATOM 2195  H HG   . LEU A 1 36 ? -5.427  -10.229 -3.286  1.00 0.00 ?  592  LEU A HG   2  
ATOM 2196  H HD11 . LEU A 1 36 ? -7.084  -8.455  -2.479  1.00 0.00 ?  592  LEU A HD11 2  
ATOM 2197  H HD12 . LEU A 1 36 ? -7.651  -9.582  -3.721  1.00 0.00 ?  592  LEU A HD12 2  
ATOM 2198  H HD13 . LEU A 1 36 ? -7.114  -7.962  -4.192  1.00 0.00 ?  592  LEU A HD13 2  
ATOM 2199  H HD21 . LEU A 1 36 ? -4.409  -9.622  -5.521  1.00 0.00 ?  592  LEU A HD21 2  
ATOM 2200  H HD22 . LEU A 1 36 ? -5.823  -8.541  -5.674  1.00 0.00 ?  592  LEU A HD22 2  
ATOM 2201  H HD23 . LEU A 1 36 ? -6.061  -10.280 -5.547  1.00 0.00 ?  592  LEU A HD23 2  
ATOM 2202  N N    . GLY A 1 37 ? -5.927  -9.244  -0.428  1.00 0.00 ?  593  GLY A N    2  
ATOM 2203  C CA   . GLY A 1 37 ? -7.039  -9.205  0.490   1.00 0.00 ?  593  GLY A CA   2  
ATOM 2204  C C    . GLY A 1 37 ? -6.580  -8.916  1.904   1.00 0.00 ?  593  GLY A C    2  
ATOM 2205  O O    . GLY A 1 37 ? -7.214  -8.161  2.622   1.00 0.00 ?  593  GLY A O    2  
ATOM 2206  H H    . GLY A 1 37 ? -5.624  -10.084 -0.830  1.00 0.00 ?  593  GLY A H    2  
ATOM 2207  H HA2  . GLY A 1 37 ? -7.724  -8.427  0.184   1.00 0.00 ?  593  GLY A HA2  2  
ATOM 2208  H HA3  . GLY A 1 37 ? -7.551  -10.156 0.478   1.00 0.00 ?  593  GLY A HA3  2  
ATOM 2209  N N    . ARG A 1 38 ? -5.422  -9.472  2.262   1.00 0.00 ?  594  ARG A N    2  
ATOM 2210  C CA   . ARG A 1 38 ? -4.852  -9.350  3.614   1.00 0.00 ?  594  ARG A CA   2  
ATOM 2211  C C    . ARG A 1 38 ? -4.602  -7.906  3.977   1.00 0.00 ?  594  ARG A C    2  
ATOM 2212  O O    . ARG A 1 38 ? -5.029  -7.445  5.031   1.00 0.00 ?  594  ARG A O    2  
ATOM 2213  C CB   . ARG A 1 38 ? -3.536  -10.132 3.726   1.00 0.00 ?  594  ARG A CB   2  
ATOM 2214  C CG   . ARG A 1 38 ? -2.847  -9.978  5.085   1.00 0.00 ?  594  ARG A CG   2  
ATOM 2215  C CD   . ARG A 1 38 ? -1.538  -10.737 5.147   1.00 0.00 ?  594  ARG A CD   2  
ATOM 2216  N NE   . ARG A 1 38 ? -1.730  -12.180 4.981   1.00 0.00 ?  594  ARG A NE   2  
ATOM 2217  C CZ   . ARG A 1 38 ? -0.743  -13.090 4.974   1.00 0.00 ?  594  ARG A CZ   2  
ATOM 2218  N NH1  . ARG A 1 38 ? 0.530   -12.710 5.091   1.00 0.00 1  594  ARG A NH1  2  
ATOM 2219  N NH2  . ARG A 1 38 ? -1.032  -14.367 4.839   1.00 0.00 ?  594  ARG A NH2  2  
ATOM 2220  H H    . ARG A 1 38 ? -4.931  -9.956  1.568   1.00 0.00 ?  594  ARG A H    2  
ATOM 2221  H HA   . ARG A 1 38 ? -5.553  -9.757  4.327   1.00 0.00 ?  594  ARG A HA   2  
ATOM 2222  H HB2  . ARG A 1 38 ? -3.731  -11.179 3.552   1.00 0.00 ?  594  ARG A HB2  2  
ATOM 2223  H HB3  . ARG A 1 38 ? -2.861  -9.774  2.964   1.00 0.00 ?  594  ARG A HB3  2  
ATOM 2224  H HG2  . ARG A 1 38 ? -2.646  -8.930  5.253   1.00 0.00 ?  594  ARG A HG2  2  
ATOM 2225  H HG3  . ARG A 1 38 ? -3.510  -10.342 5.856   1.00 0.00 ?  594  ARG A HG3  2  
ATOM 2226  H HD2  . ARG A 1 38 ? -0.887  -10.376 4.364   1.00 0.00 ?  594  ARG A HD2  2  
ATOM 2227  H HD3  . ARG A 1 38 ? -1.078  -10.554 6.107   1.00 0.00 ?  594  ARG A HD3  2  
ATOM 2228  H HE   . ARG A 1 38 ? -2.664  -12.476 4.886   1.00 0.00 ?  594  ARG A HE   2  
ATOM 2229  H HH11 . ARG A 1 38 ? 0.802   -11.748 5.185   1.00 0.00 ?  594  ARG A HH11 2  
ATOM 2230  H HH12 . ARG A 1 38 ? 1.279   -13.379 5.122   1.00 0.00 ?  594  ARG A HH12 2  
ATOM 2231  H HH21 . ARG A 1 38 ? -1.979  -14.691 4.737   1.00 0.00 ?  594  ARG A HH21 2  
ATOM 2232  H HH22 . ARG A 1 38 ? -0.330  -15.086 4.812   1.00 0.00 ?  594  ARG A HH22 2  
ATOM 2233  N N    . VAL A 1 39 ? -3.944  -7.197  3.093   1.00 0.00 ?  595  VAL A N    2  
ATOM 2234  C CA   . VAL A 1 39 ? -3.597  -5.800  3.309   1.00 0.00 ?  595  VAL A CA   2  
ATOM 2235  C C    . VAL A 1 39 ? -4.846  -4.959  3.555   1.00 0.00 ?  595  VAL A C    2  
ATOM 2236  O O    . VAL A 1 39 ? -4.853  -4.099  4.432   1.00 0.00 ?  595  VAL A O    2  
ATOM 2237  C CB   . VAL A 1 39 ? -2.767  -5.258  2.116   1.00 0.00 ?  595  VAL A CB   2  
ATOM 2238  C CG1  . VAL A 1 39 ? -3.540  -5.278  0.830   1.00 0.00 ?  595  VAL A CG1  2  
ATOM 2239  C CG2  . VAL A 1 39 ? -2.230  -3.893  2.367   1.00 0.00 ?  595  VAL A CG2  2  
ATOM 2240  H H    . VAL A 1 39 ? -3.673  -7.629  2.251   1.00 0.00 ?  595  VAL A H    2  
ATOM 2241  H HA   . VAL A 1 39 ? -3.017  -5.700  4.216   1.00 0.00 ?  595  VAL A HA   2  
ATOM 2242  H HB   . VAL A 1 39 ? -1.931  -5.930  2.000   1.00 0.00 ?  595  VAL A HB   2  
ATOM 2243  H HG11 . VAL A 1 39 ? -2.941  -4.836  0.048   1.00 0.00 ?  595  VAL A HG11 2  
ATOM 2244  H HG12 . VAL A 1 39 ? -4.448  -4.707  0.954   1.00 0.00 ?  595  VAL A HG12 2  
ATOM 2245  H HG13 . VAL A 1 39 ? -3.784  -6.297  0.568   1.00 0.00 ?  595  VAL A HG13 2  
ATOM 2246  H HG21 . VAL A 1 39 ? -3.051  -3.214  2.538   1.00 0.00 ?  595  VAL A HG21 2  
ATOM 2247  H HG22 . VAL A 1 39 ? -1.702  -3.600  1.472   1.00 0.00 ?  595  VAL A HG22 2  
ATOM 2248  H HG23 . VAL A 1 39 ? -1.562  -3.904  3.214   1.00 0.00 ?  595  VAL A HG23 2  
ATOM 2249  N N    . VAL A 1 40 ? -5.911  -5.291  2.864   1.00 0.00 ?  596  VAL A N    2  
ATOM 2250  C CA   . VAL A 1 40 ? -7.163  -4.602  2.989   1.00 0.00 ?  596  VAL A CA   2  
ATOM 2251  C C    . VAL A 1 40 ? -7.735  -4.748  4.401   1.00 0.00 ?  596  VAL A C    2  
ATOM 2252  O O    . VAL A 1 40 ? -8.436  -3.881  4.873   1.00 0.00 ?  596  VAL A O    2  
ATOM 2253  C CB   . VAL A 1 40 ? -8.156  -5.011  1.861   1.00 0.00 ?  596  VAL A CB   2  
ATOM 2254  C CG1  . VAL A 1 40 ? -9.524  -4.374  2.039   1.00 0.00 ?  596  VAL A CG1  2  
ATOM 2255  C CG2  . VAL A 1 40 ? -7.571  -4.548  0.561   1.00 0.00 ?  596  VAL A CG2  2  
ATOM 2256  H H    . VAL A 1 40 ? -5.858  -6.045  2.236   1.00 0.00 ?  596  VAL A H    2  
ATOM 2257  H HA   . VAL A 1 40 ? -6.924  -3.555  2.868   1.00 0.00 ?  596  VAL A HA   2  
ATOM 2258  H HB   . VAL A 1 40 ? -8.280  -6.082  1.787   1.00 0.00 ?  596  VAL A HB   2  
ATOM 2259  H HG11 . VAL A 1 40 ? -10.186 -4.728  1.264   1.00 0.00 ?  596  VAL A HG11 2  
ATOM 2260  H HG12 . VAL A 1 40 ? -9.429  -3.300  1.970   1.00 0.00 ?  596  VAL A HG12 2  
ATOM 2261  H HG13 . VAL A 1 40 ? -9.918  -4.640  3.008   1.00 0.00 ?  596  VAL A HG13 2  
ATOM 2262  H HG21 . VAL A 1 40 ? -8.181  -4.904  -0.254  1.00 0.00 ?  596  VAL A HG21 2  
ATOM 2263  H HG22 . VAL A 1 40 ? -6.569  -4.939  0.459   1.00 0.00 ?  596  VAL A HG22 2  
ATOM 2264  H HG23 . VAL A 1 40 ? -7.542  -3.469  0.542   1.00 0.00 ?  596  VAL A HG23 2  
ATOM 2265  N N    . HIS A 1 41 ? -7.380  -5.819  5.085   1.00 0.00 ?  597  HIS A N    2  
ATOM 2266  C CA   . HIS A 1 41 ? -7.832  -6.008  6.465   1.00 0.00 ?  597  HIS A CA   2  
ATOM 2267  C C    . HIS A 1 41 ? -7.051  -5.078  7.395   1.00 0.00 ?  597  HIS A C    2  
ATOM 2268  O O    . HIS A 1 41 ? -7.640  -4.352  8.219   1.00 0.00 ?  597  HIS A O    2  
ATOM 2269  C CB   . HIS A 1 41 ? -7.654  -7.460  6.971   1.00 0.00 ?  597  HIS A CB   2  
ATOM 2270  C CG   . HIS A 1 41 ? -8.498  -8.515  6.318   1.00 0.00 ?  597  HIS A CG   2  
ATOM 2271  N ND1  . HIS A 1 41 ? -9.598  -9.089  6.911   1.00 0.00 ?  597  HIS A ND1  2  
ATOM 2272  C CD2  . HIS A 1 41 ? -8.342  -9.153  5.143   1.00 0.00 ?  597  HIS A CD2  2  
ATOM 2273  C CE1  . HIS A 1 41 ? -10.062 -10.040 6.102   1.00 0.00 ?  597  HIS A CE1  2  
ATOM 2274  N NE2  . HIS A 1 41 ? -9.332  -10.122 5.003   1.00 0.00 ?  597  HIS A NE2  2  
ATOM 2275  H H    . HIS A 1 41 ? -6.750  -6.447  4.667   1.00 0.00 ?  597  HIS A H    2  
ATOM 2276  H HA   . HIS A 1 41 ? -8.880  -5.736  6.484   1.00 0.00 ?  597  HIS A HA   2  
ATOM 2277  H HB2  . HIS A 1 41 ? -6.625  -7.749  6.819   1.00 0.00 ?  597  HIS A HB2  2  
ATOM 2278  H HB3  . HIS A 1 41 ? -7.858  -7.478  8.032   1.00 0.00 ?  597  HIS A HB3  2  
ATOM 2279  H HD1  . HIS A 1 41 ? -9.987  -8.844  7.779   1.00 0.00 ?  597  HIS A HD1  2  
ATOM 2280  H HD2  . HIS A 1 41 ? -7.575  -8.947  4.412   1.00 0.00 ?  597  HIS A HD2  2  
ATOM 2281  H HE1  . HIS A 1 41 ? -10.921 -10.658 6.315   1.00 0.00 ?  597  HIS A HE1  2  
ATOM 2282  N N    . ILE A 1 42 ? -5.722  -5.086  7.232   1.00 0.00 ?  598  ILE A N    2  
ATOM 2283  C CA   . ILE A 1 42 ? -4.817  -4.325  8.093   1.00 0.00 ?  598  ILE A CA   2  
ATOM 2284  C C    . ILE A 1 42 ? -5.052  -2.836  7.943   1.00 0.00 ?  598  ILE A C    2  
ATOM 2285  O O    . ILE A 1 42 ? -5.315  -2.140  8.925   1.00 0.00 ?  598  ILE A O    2  
ATOM 2286  C CB   . ILE A 1 42 ? -3.283  -4.667  7.847   1.00 0.00 ?  598  ILE A CB   2  
ATOM 2287  C CG1  . ILE A 1 42 ? -2.885  -6.050  8.415   1.00 0.00 ?  598  ILE A CG1  2  
ATOM 2288  C CG2  . ILE A 1 42 ? -2.357  -3.595  8.424   1.00 0.00 ?  598  ILE A CG2  2  
ATOM 2289  C CD1  . ILE A 1 42 ? -3.541  -7.237  7.764   1.00 0.00 ?  598  ILE A CD1  2  
ATOM 2290  H H    . ILE A 1 42 ? -5.337  -5.608  6.494   1.00 0.00 ?  598  ILE A H    2  
ATOM 2291  H HA   . ILE A 1 42 ? -5.064  -4.587  9.112   1.00 0.00 ?  598  ILE A HA   2  
ATOM 2292  H HB   . ILE A 1 42 ? -3.129  -4.677  6.778   1.00 0.00 ?  598  ILE A HB   2  
ATOM 2293  H HG12 . ILE A 1 42 ? -1.819  -6.177  8.300   1.00 0.00 ?  598  ILE A HG12 2  
ATOM 2294  H HG13 . ILE A 1 42 ? -3.120  -6.071  9.470   1.00 0.00 ?  598  ILE A HG13 2  
ATOM 2295  H HG21 . ILE A 1 42 ? -1.327  -3.869  8.247   1.00 0.00 ?  598  ILE A HG21 2  
ATOM 2296  H HG22 . ILE A 1 42 ? -2.533  -3.509  9.486   1.00 0.00 ?  598  ILE A HG22 2  
ATOM 2297  H HG23 . ILE A 1 42 ? -2.564  -2.646  7.955   1.00 0.00 ?  598  ILE A HG23 2  
ATOM 2298  H HD11 . ILE A 1 42 ? -3.192  -8.141  8.236   1.00 0.00 ?  598  ILE A HD11 2  
ATOM 2299  H HD12 . ILE A 1 42 ? -3.290  -7.255  6.714   1.00 0.00 ?  598  ILE A HD12 2  
ATOM 2300  H HD13 . ILE A 1 42 ? -4.613  -7.164  7.878   1.00 0.00 ?  598  ILE A HD13 2  
ATOM 2301  N N    . ILE A 1 43 ? -5.023  -2.362  6.712   1.00 0.00 ?  599  ILE A N    2  
ATOM 2302  C CA   . ILE A 1 43 ? -5.160  -0.922  6.453   1.00 0.00 ?  599  ILE A CA   2  
ATOM 2303  C C    . ILE A 1 43 ? -6.545  -0.415  6.911   1.00 0.00 ?  599  ILE A C    2  
ATOM 2304  O O    . ILE A 1 43 ? -6.695  0.717   7.400   1.00 0.00 ?  599  ILE A O    2  
ATOM 2305  C CB   . ILE A 1 43 ? -4.949  -0.559  4.942   1.00 0.00 ?  599  ILE A CB   2  
ATOM 2306  C CG1  . ILE A 1 43 ? -3.775  -1.333  4.316   1.00 0.00 ?  599  ILE A CG1  2  
ATOM 2307  C CG2  . ILE A 1 43 ? -4.712  0.933   4.776   1.00 0.00 ?  599  ILE A CG2  2  
ATOM 2308  C CD1  . ILE A 1 43 ? -2.497  -1.351  5.117   1.00 0.00 ?  599  ILE A CD1  2  
ATOM 2309  H H    . ILE A 1 43 ? -4.868  -2.991  5.965   1.00 0.00 ?  599  ILE A H    2  
ATOM 2310  H HA   . ILE A 1 43 ? -4.407  -0.420  7.043   1.00 0.00 ?  599  ILE A HA   2  
ATOM 2311  H HB   . ILE A 1 43 ? -5.855  -0.811  4.413   1.00 0.00 ?  599  ILE A HB   2  
ATOM 2312  H HG12 . ILE A 1 43 ? -4.070  -2.363  4.184   1.00 0.00 ?  599  ILE A HG12 2  
ATOM 2313  H HG13 . ILE A 1 43 ? -3.558  -0.908  3.348   1.00 0.00 ?  599  ILE A HG13 2  
ATOM 2314  H HG21 . ILE A 1 43 ? -4.562  1.163   3.732   1.00 0.00 ?  599  ILE A HG21 2  
ATOM 2315  H HG22 . ILE A 1 43 ? -3.835  1.216   5.341   1.00 0.00 ?  599  ILE A HG22 2  
ATOM 2316  H HG23 . ILE A 1 43 ? -5.568  1.475   5.150   1.00 0.00 ?  599  ILE A HG23 2  
ATOM 2317  H HD11 . ILE A 1 43 ? -1.725  -1.842  4.544   1.00 0.00 ?  599  ILE A HD11 2  
ATOM 2318  H HD12 . ILE A 1 43 ? -2.710  -1.954  5.989   1.00 0.00 ?  599  ILE A HD12 2  
ATOM 2319  H HD13 . ILE A 1 43 ? -2.205  -0.352  5.403   1.00 0.00 ?  599  ILE A HD13 2  
ATOM 2320  N N    . GLN A 1 44 ? -7.528  -1.290  6.837   1.00 0.00 ?  600  GLN A N    2  
ATOM 2321  C CA   . GLN A 1 44 ? -8.900  -0.946  7.168   1.00 0.00 ?  600  GLN A CA   2  
ATOM 2322  C C    . GLN A 1 44 ? -9.128  -0.928  8.680   1.00 0.00 ?  600  GLN A C    2  
ATOM 2323  O O    . GLN A 1 44 ? -10.165 -0.468  9.166   1.00 0.00 ?  600  GLN A O    2  
ATOM 2324  C CB   . GLN A 1 44 ? -9.829  -1.917  6.489   1.00 0.00 ?  600  GLN A CB   2  
ATOM 2325  C CG   . GLN A 1 44 ? -11.273 -1.541  6.511   1.00 0.00 ?  600  GLN A CG   2  
ATOM 2326  C CD   . GLN A 1 44 ? -12.138 -2.484  5.718   1.00 0.00 ?  600  GLN A CD   2  
ATOM 2327  O OE1  . GLN A 1 44 ? -13.307 -2.643  6.015   1.00 0.00 ?  600  GLN A OE1  2  
ATOM 2328  N NE2  . GLN A 1 44 ? -11.558 -3.182  4.773   1.00 0.00 ?  600  GLN A NE2  2  
ATOM 2329  H H    . GLN A 1 44 ? -7.328  -2.202  6.540   1.00 0.00 ?  600  GLN A H    2  
ATOM 2330  H HA   . GLN A 1 44 ? -9.087  0.044   6.785   1.00 0.00 ?  600  GLN A HA   2  
ATOM 2331  H HB2  . GLN A 1 44 ? -9.519  -1.995  5.457   1.00 0.00 ?  600  GLN A HB2  2  
ATOM 2332  H HB3  . GLN A 1 44 ? -9.717  -2.884  6.956   1.00 0.00 ?  600  GLN A HB3  2  
ATOM 2333  H HG2  . GLN A 1 44 ? -11.596 -1.575  7.541   1.00 0.00 ?  600  GLN A HG2  2  
ATOM 2334  H HG3  . GLN A 1 44 ? -11.384 -0.540  6.121   1.00 0.00 ?  600  GLN A HG3  2  
ATOM 2335  H HE21 . GLN A 1 44 ? -10.588 -3.098  4.633   1.00 0.00 ?  600  GLN A HE21 2  
ATOM 2336  H HE22 . GLN A 1 44 ? -12.141 -3.726  4.209   1.00 0.00 ?  600  GLN A HE22 2  
ATOM 2337  N N    . SER A 1 45 ? -8.158  -1.390  9.422   1.00 0.00 ?  601  SER A N    2  
ATOM 2338  C CA   . SER A 1 45 ? -8.261  -1.386  10.856  1.00 0.00 ?  601  SER A CA   2  
ATOM 2339  C C    . SER A 1 45 ? -7.951  0.026   11.400  1.00 0.00 ?  601  SER A C    2  
ATOM 2340  O O    . SER A 1 45 ? -8.200  0.329   12.569  1.00 0.00 ?  601  SER A O    2  
ATOM 2341  C CB   . SER A 1 45 ? -7.316  -2.441  11.448  1.00 0.00 ?  601  SER A CB   2  
ATOM 2342  O OG   . SER A 1 45 ? -7.591  -3.738  10.894  1.00 0.00 ?  601  SER A OG   2  
ATOM 2343  H H    . SER A 1 45 ? -7.338  -1.733  9.002   1.00 0.00 ?  601  SER A H    2  
ATOM 2344  H HA   . SER A 1 45 ? -9.280  -1.640  11.111  1.00 0.00 ?  601  SER A HA   2  
ATOM 2345  H HB2  . SER A 1 45 ? -6.294  -2.176  11.220  1.00 0.00 ?  601  SER A HB2  2  
ATOM 2346  H HB3  . SER A 1 45 ? -7.447  -2.485  12.519  1.00 0.00 ?  601  SER A HB3  2  
ATOM 2347  H HG   . SER A 1 45 ? -7.599  -3.671  9.929   1.00 0.00 ?  601  SER A HG   2  
ATOM 2348  N N    . ARG A 1 46 ? -7.438  0.896   10.531  1.00 0.00 ?  602  ARG A N    2  
ATOM 2349  C CA   . ARG A 1 46 ? -7.090  2.246   10.937  1.00 0.00 ?  602  ARG A CA   2  
ATOM 2350  C C    . ARG A 1 46 ? -8.136  3.271   10.502  1.00 0.00 ?  602  ARG A C    2  
ATOM 2351  O O    . ARG A 1 46 ? -8.583  4.083   11.311  1.00 0.00 ?  602  ARG A O    2  
ATOM 2352  C CB   . ARG A 1 46 ? -5.702  2.632   10.431  1.00 0.00 ?  602  ARG A CB   2  
ATOM 2353  C CG   . ARG A 1 46 ? -4.592  1.751   10.982  1.00 0.00 ?  602  ARG A CG   2  
ATOM 2354  C CD   . ARG A 1 46 ? -3.227  2.196   10.502  1.00 0.00 ?  602  ARG A CD   2  
ATOM 2355  N NE   . ARG A 1 46 ? -2.877  3.547   10.965  1.00 0.00 ?  602  ARG A NE   2  
ATOM 2356  C CZ   . ARG A 1 46 ? -1.665  4.118   10.843  1.00 0.00 ?  602  ARG A CZ   2  
ATOM 2357  N NH1  . ARG A 1 46 ? -0.621  3.412   10.422  1.00 0.00 1  602  ARG A NH1  2  
ATOM 2358  N NH2  . ARG A 1 46 ? -1.494  5.376   11.219  1.00 0.00 ?  602  ARG A NH2  2  
ATOM 2359  H H    . ARG A 1 46 ? -7.297  0.608   9.604   1.00 0.00 ?  602  ARG A H    2  
ATOM 2360  H HA   . ARG A 1 46 ? -7.067  2.245   12.017  1.00 0.00 ?  602  ARG A HA   2  
ATOM 2361  H HB2  . ARG A 1 46 ? -5.695  2.560   9.353   1.00 0.00 ?  602  ARG A HB2  2  
ATOM 2362  H HB3  . ARG A 1 46 ? -5.498  3.655   10.716  1.00 0.00 ?  602  ARG A HB3  2  
ATOM 2363  H HG2  . ARG A 1 46 ? -4.613  1.798   12.060  1.00 0.00 ?  602  ARG A HG2  2  
ATOM 2364  H HG3  . ARG A 1 46 ? -4.766  0.733   10.663  1.00 0.00 ?  602  ARG A HG3  2  
ATOM 2365  H HD2  . ARG A 1 46 ? -2.486  1.498   10.857  1.00 0.00 ?  602  ARG A HD2  2  
ATOM 2366  H HD3  . ARG A 1 46 ? -3.226  2.189   9.422   1.00 0.00 ?  602  ARG A HD3  2  
ATOM 2367  H HE   . ARG A 1 46 ? -3.612  4.062   11.372  1.00 0.00 ?  602  ARG A HE   2  
ATOM 2368  H HH11 . ARG A 1 46 ? -0.683  2.427   10.199  1.00 0.00 ?  602  ARG A HH11 2  
ATOM 2369  H HH12 . ARG A 1 46 ? 0.285   3.822   10.289  1.00 0.00 ?  602  ARG A HH12 2  
ATOM 2370  H HH21 . ARG A 1 46 ? -2.251  5.915   11.601  1.00 0.00 ?  602  ARG A HH21 2  
ATOM 2371  H HH22 . ARG A 1 46 ? -0.603  5.831   11.141  1.00 0.00 ?  602  ARG A HH22 2  
ATOM 2372  N N    . GLU A 1 47 ? -8.535  3.234   9.248   1.00 0.00 ?  603  GLU A N    2  
ATOM 2373  C CA   . GLU A 1 47 ? -9.504  4.206   8.741   1.00 0.00 ?  603  GLU A CA   2  
ATOM 2374  C C    . GLU A 1 47 ? -10.914 3.649   8.724   1.00 0.00 ?  603  GLU A C    2  
ATOM 2375  O O    . GLU A 1 47 ? -11.149 2.579   8.192   1.00 0.00 ?  603  GLU A O    2  
ATOM 2376  C CB   . GLU A 1 47 ? -9.127  4.680   7.344   1.00 0.00 ?  603  GLU A CB   2  
ATOM 2377  C CG   . GLU A 1 47 ? -7.928  5.591   7.303   1.00 0.00 ?  603  GLU A CG   2  
ATOM 2378  C CD   . GLU A 1 47 ? -8.179  6.916   7.976   1.00 0.00 ?  603  GLU A CD   2  
ATOM 2379  O OE1  . GLU A 1 47 ? -8.846  7.769   7.379   1.00 0.00 ?  603  GLU A OE1  2  
ATOM 2380  O OE2  . GLU A 1 47 ? -7.702  7.120   9.093   1.00 0.00 -1 603  GLU A OE2  2  
ATOM 2381  H H    . GLU A 1 47 ? -8.200  2.539   8.645   1.00 0.00 ?  603  GLU A H    2  
ATOM 2382  H HA   . GLU A 1 47 ? -9.475  5.057   9.406   1.00 0.00 ?  603  GLU A HA   2  
ATOM 2383  H HB2  . GLU A 1 47 ? -8.915  3.815   6.732   1.00 0.00 ?  603  GLU A HB2  2  
ATOM 2384  H HB3  . GLU A 1 47 ? -9.969  5.208   6.922   1.00 0.00 ?  603  GLU A HB3  2  
ATOM 2385  H HG2  . GLU A 1 47 ? -7.110  5.102   7.813   1.00 0.00 ?  603  GLU A HG2  2  
ATOM 2386  H HG3  . GLU A 1 47 ? -7.650  5.771   6.276   1.00 0.00 ?  603  GLU A HG3  2  
ATOM 2387  N N    . PRO A 1 48 ? -11.875 4.367   9.309   1.00 0.00 ?  604  PRO A N    2  
ATOM 2388  C CA   . PRO A 1 48 ? -13.272 3.955   9.293   1.00 0.00 ?  604  PRO A CA   2  
ATOM 2389  C C    . PRO A 1 48 ? -13.979 4.335   7.974   1.00 0.00 ?  604  PRO A C    2  
ATOM 2390  O O    . PRO A 1 48 ? -15.048 3.814   7.651   1.00 0.00 ?  604  PRO A O    2  
ATOM 2391  C CB   . PRO A 1 48 ? -13.874 4.726   10.470  1.00 0.00 ?  604  PRO A CB   2  
ATOM 2392  C CG   . PRO A 1 48 ? -13.055 5.973   10.569  1.00 0.00 ?  604  PRO A CG   2  
ATOM 2393  C CD   . PRO A 1 48 ? -11.668 5.614   10.088  1.00 0.00 ?  604  PRO A CD   2  
ATOM 2394  H HA   . PRO A 1 48 ? -13.369 2.894   9.461   1.00 0.00 ?  604  PRO A HA   2  
ATOM 2395  H HB2  . PRO A 1 48 ? -14.911 4.946   10.262  1.00 0.00 ?  604  PRO A HB2  2  
ATOM 2396  H HB3  . PRO A 1 48 ? -13.798 4.135   11.371  1.00 0.00 ?  604  PRO A HB3  2  
ATOM 2397  H HG2  . PRO A 1 48 ? -13.484 6.737   9.937   1.00 0.00 ?  604  PRO A HG2  2  
ATOM 2398  H HG3  . PRO A 1 48 ? -13.021 6.312   11.595  1.00 0.00 ?  604  PRO A HG3  2  
ATOM 2399  H HD2  . PRO A 1 48 ? -11.268 6.394   9.458   1.00 0.00 ?  604  PRO A HD2  2  
ATOM 2400  H HD3  . PRO A 1 48 ? -11.015 5.432   10.929  1.00 0.00 ?  604  PRO A HD3  2  
ATOM 2401  N N    . SER A 1 49 ? -13.351 5.198   7.211   1.00 0.00 ?  605  SER A N    2  
ATOM 2402  C CA   . SER A 1 49 ? -13.918 5.749   5.997   1.00 0.00 ?  605  SER A CA   2  
ATOM 2403  C C    . SER A 1 49 ? -14.150 4.687   4.881   1.00 0.00 ?  605  SER A C    2  
ATOM 2404  O O    . SER A 1 49 ? -15.207 4.661   4.257   1.00 0.00 ?  605  SER A O    2  
ATOM 2405  C CB   . SER A 1 49 ? -12.996 6.859   5.526   1.00 0.00 ?  605  SER A CB   2  
ATOM 2406  O OG   . SER A 1 49 ? -12.697 7.736   6.617   1.00 0.00 ?  605  SER A OG   2  
ATOM 2407  H H    . SER A 1 49 ? -12.466 5.525   7.479   1.00 0.00 ?  605  SER A H    2  
ATOM 2408  H HA   . SER A 1 49 ? -14.866 6.197   6.254   1.00 0.00 ?  605  SER A HA   2  
ATOM 2409  H HB2  . SER A 1 49 ? -12.074 6.428   5.163   1.00 0.00 ?  605  SER A HB2  2  
ATOM 2410  H HB3  . SER A 1 49 ? -13.475 7.426   4.742   1.00 0.00 ?  605  SER A HB3  2  
ATOM 2411  H HG   . SER A 1 49 ? -12.823 8.635   6.289   1.00 0.00 ?  605  SER A HG   2  
ATOM 2412  N N    . LEU A 1 50 ? -13.211 3.770   4.689   1.00 0.00 ?  606  LEU A N    2  
ATOM 2413  C CA   . LEU A 1 50 ? -13.345 2.783   3.600   1.00 0.00 ?  606  LEU A CA   2  
ATOM 2414  C C    . LEU A 1 50 ? -14.080 1.548   4.086   1.00 0.00 ?  606  LEU A C    2  
ATOM 2415  O O    . LEU A 1 50 ? -14.323 0.625   3.322   1.00 0.00 ?  606  LEU A O    2  
ATOM 2416  C CB   . LEU A 1 50 ? -11.974 2.334   3.027   1.00 0.00 ?  606  LEU A CB   2  
ATOM 2417  C CG   . LEU A 1 50 ? -11.148 1.332   3.873   1.00 0.00 ?  606  LEU A CG   2  
ATOM 2418  C CD1  . LEU A 1 50 ? -9.970  0.787   3.085   1.00 0.00 ?  606  LEU A CD1  2  
ATOM 2419  C CD2  . LEU A 1 50 ? -10.663 1.951   5.166   1.00 0.00 ?  606  LEU A CD2  2  
ATOM 2420  H H    . LEU A 1 50 ? -12.407 3.764   5.248   1.00 0.00 ?  606  LEU A H    2  
ATOM 2421  H HA   . LEU A 1 50 ? -13.920 3.243   2.809   1.00 0.00 ?  606  LEU A HA   2  
ATOM 2422  H HB2  . LEU A 1 50 ? -12.147 1.882   2.062   1.00 0.00 ?  606  LEU A HB2  2  
ATOM 2423  H HB3  . LEU A 1 50 ? -11.369 3.216   2.877   1.00 0.00 ?  606  LEU A HB3  2  
ATOM 2424  H HG   . LEU A 1 50 ? -11.786 0.494   4.117   1.00 0.00 ?  606  LEU A HG   2  
ATOM 2425  H HD11 . LEU A 1 50 ? -9.310  1.590   2.794   1.00 0.00 ?  606  LEU A HD11 2  
ATOM 2426  H HD12 . LEU A 1 50 ? -10.340 0.276   2.208   1.00 0.00 ?  606  LEU A HD12 2  
ATOM 2427  H HD13 . LEU A 1 50 ? -9.434  0.079   3.701   1.00 0.00 ?  606  LEU A HD13 2  
ATOM 2428  H HD21 . LEU A 1 50 ? -10.140 2.874   4.965   1.00 0.00 ?  606  LEU A HD21 2  
ATOM 2429  H HD22 . LEU A 1 50 ? -9.984  1.255   5.630   1.00 0.00 ?  606  LEU A HD22 2  
ATOM 2430  H HD23 . LEU A 1 50 ? -11.499 2.124   5.830   1.00 0.00 ?  606  LEU A HD23 2  
ATOM 2431  N N    . ARG A 1 51 ? -14.481 1.564   5.347   1.00 0.00 ?  607  ARG A N    2  
ATOM 2432  C CA   . ARG A 1 51 ? -15.050 0.389   5.993   1.00 0.00 ?  607  ARG A CA   2  
ATOM 2433  C C    . ARG A 1 51 ? -16.414 -0.014  5.485   1.00 0.00 ?  607  ARG A C    2  
ATOM 2434  O O    . ARG A 1 51 ? -16.976 -1.015  5.943   1.00 0.00 ?  607  ARG A O    2  
ATOM 2435  C CB   . ARG A 1 51 ? -15.025 0.488   7.504   1.00 0.00 ?  607  ARG A CB   2  
ATOM 2436  C CG   . ARG A 1 51 ? -13.622 0.518   8.058   1.00 0.00 ?  607  ARG A CG   2  
ATOM 2437  C CD   . ARG A 1 51 ? -13.608 0.345   9.560   1.00 0.00 ?  607  ARG A CD   2  
ATOM 2438  N NE   . ARG A 1 51 ? -14.200 -0.944  9.954   1.00 0.00 ?  607  ARG A NE   2  
ATOM 2439  C CZ   . ARG A 1 51 ? -13.506 -1.999  10.415  1.00 0.00 ?  607  ARG A CZ   2  
ATOM 2440  N NH1  . ARG A 1 51 ? -12.172 -1.965  10.455  1.00 0.00 1  607  ARG A NH1  2  
ATOM 2441  N NH2  . ARG A 1 51 ? -14.149 -3.100  10.795  1.00 0.00 ?  607  ARG A NH2  2  
ATOM 2442  H H    . ARG A 1 51 ? -14.407 2.402   5.847   1.00 0.00 ?  607  ARG A H    2  
ATOM 2443  H HA   . ARG A 1 51 ? -14.388 -0.419  5.716   1.00 0.00 ?  607  ARG A HA   2  
ATOM 2444  H HB2  . ARG A 1 51 ? -15.529 1.395   7.801   1.00 0.00 ?  607  ARG A HB2  2  
ATOM 2445  H HB3  . ARG A 1 51 ? -15.539 -0.363  7.923   1.00 0.00 ?  607  ARG A HB3  2  
ATOM 2446  H HG2  . ARG A 1 51 ? -13.081 -0.300  7.607   1.00 0.00 ?  607  ARG A HG2  2  
ATOM 2447  H HG3  . ARG A 1 51 ? -13.137 1.445   7.783   1.00 0.00 ?  607  ARG A HG3  2  
ATOM 2448  H HD2  . ARG A 1 51 ? -12.589 0.394   9.916   1.00 0.00 ?  607  ARG A HD2  2  
ATOM 2449  H HD3  . ARG A 1 51 ? -14.185 1.137   10.013  1.00 0.00 ?  607  ARG A HD3  2  
ATOM 2450  H HE   . ARG A 1 51 ? -15.181 -0.979  9.877   1.00 0.00 ?  607  ARG A HE   2  
ATOM 2451  H HH11 . ARG A 1 51 ? -11.636 -1.171  10.146  1.00 0.00 ?  607  ARG A HH11 2  
ATOM 2452  H HH12 . ARG A 1 51 ? -11.632 -2.740  10.792  1.00 0.00 ?  607  ARG A HH12 2  
ATOM 2453  H HH21 . ARG A 1 51 ? -15.147 -3.188  10.749  1.00 0.00 ?  607  ARG A HH21 2  
ATOM 2454  H HH22 . ARG A 1 51 ? -13.679 -3.910  11.156  1.00 0.00 ?  607  ARG A HH22 2  
ATOM 2455  N N    . ASP A 1 52 ? -16.967 0.753   4.571   1.00 0.00 ?  608  ASP A N    2  
ATOM 2456  C CA   . ASP A 1 52 ? -18.214 0.361   3.958   1.00 0.00 ?  608  ASP A CA   2  
ATOM 2457  C C    . ASP A 1 52 ? -17.961 -0.814  3.017   1.00 0.00 ?  608  ASP A C    2  
ATOM 2458  O O    . ASP A 1 52 ? -18.824 -1.676  2.815   1.00 0.00 ?  608  ASP A O    2  
ATOM 2459  C CB   . ASP A 1 52 ? -18.882 1.515   3.217   1.00 0.00 ?  608  ASP A CB   2  
ATOM 2460  C CG   . ASP A 1 52 ? -20.245 1.123   2.694   1.00 0.00 ?  608  ASP A CG   2  
ATOM 2461  O OD1  . ASP A 1 52 ? -21.204 1.085   3.489   1.00 0.00 ?  608  ASP A OD1  2  
ATOM 2462  O OD2  . ASP A 1 52 ? -20.390 0.854   1.484   1.00 0.00 -1 608  ASP A OD2  2  
ATOM 2463  H H    . ASP A 1 52 ? -16.517 1.584   4.310   1.00 0.00 ?  608  ASP A H    2  
ATOM 2464  H HA   . ASP A 1 52 ? -18.857 0.014   4.752   1.00 0.00 ?  608  ASP A HA   2  
ATOM 2465  H HB2  . ASP A 1 52 ? -18.998 2.353   3.888   1.00 0.00 ?  608  ASP A HB2  2  
ATOM 2466  H HB3  . ASP A 1 52 ? -18.265 1.808   2.381   1.00 0.00 ?  608  ASP A HB3  2  
ATOM 2467  N N    . SER A 1 53 ? -16.763 -0.867  2.481   1.00 0.00 ?  609  SER A N    2  
ATOM 2468  C CA   . SER A 1 53 ? -16.367 -1.942  1.631   1.00 0.00 ?  609  SER A CA   2  
ATOM 2469  C C    . SER A 1 53 ? -15.692 -2.990  2.517   1.00 0.00 ?  609  SER A C    2  
ATOM 2470  O O    . SER A 1 53 ? -14.643 -2.736  3.114   1.00 0.00 ?  609  SER A O    2  
ATOM 2471  C CB   . SER A 1 53 ? -15.417 -1.425  0.524   1.00 0.00 ?  609  SER A CB   2  
ATOM 2472  O OG   . SER A 1 53 ? -15.166 -2.410  -0.484  1.00 0.00 ?  609  SER A OG   2  
ATOM 2473  H H    . SER A 1 53 ? -16.093 -0.177  2.686   1.00 0.00 ?  609  SER A H    2  
ATOM 2474  H HA   . SER A 1 53 ? -17.255 -2.366  1.187   1.00 0.00 ?  609  SER A HA   2  
ATOM 2475  H HB2  . SER A 1 53 ? -15.861 -0.560  0.052   1.00 0.00 ?  609  SER A HB2  2  
ATOM 2476  H HB3  . SER A 1 53 ? -14.478 -1.139  0.975   1.00 0.00 ?  609  SER A HB3  2  
ATOM 2477  H HG   . SER A 1 53 ? -15.781 -3.155  -0.390  1.00 0.00 ?  609  SER A HG   2  
ATOM 2478  N N    . ASN A 1 54 ? -16.348 -4.123  2.656   1.00 0.00 ?  610  ASN A N    2  
ATOM 2479  C CA   . ASN A 1 54 ? -15.873 -5.226  3.480   1.00 0.00 ?  610  ASN A CA   2  
ATOM 2480  C C    . ASN A 1 54 ? -14.546 -5.761  2.927   1.00 0.00 ?  610  ASN A C    2  
ATOM 2481  O O    . ASN A 1 54 ? -14.389 -5.841  1.712   1.00 0.00 ?  610  ASN A O    2  
ATOM 2482  C CB   . ASN A 1 54 ? -16.969 -6.331  3.538   1.00 0.00 ?  610  ASN A CB   2  
ATOM 2483  C CG   . ASN A 1 54 ? -16.562 -7.595  4.288   1.00 0.00 ?  610  ASN A CG   2  
ATOM 2484  O OD1  . ASN A 1 54 ? -16.677 -7.678  5.505   1.00 0.00 ?  610  ASN A OD1  2  
ATOM 2485  N ND2  . ASN A 1 54 ? -16.163 -8.601  3.567   1.00 0.00 ?  610  ASN A ND2  2  
ATOM 2486  H H    . ASN A 1 54 ? -17.187 -4.232  2.160   1.00 0.00 ?  610  ASN A H    2  
ATOM 2487  H HA   . ASN A 1 54 ? -15.706 -4.844  4.474   1.00 0.00 ?  610  ASN A HA   2  
ATOM 2488  H HB2  . ASN A 1 54 ? -17.841 -5.928  4.031   1.00 0.00 ?  610  ASN A HB2  2  
ATOM 2489  H HB3  . ASN A 1 54 ? -17.239 -6.604  2.528   1.00 0.00 ?  610  ASN A HB3  2  
ATOM 2490  H HD21 . ASN A 1 54 ? -16.158 -8.494  2.594   1.00 0.00 ?  610  ASN A HD21 2  
ATOM 2491  H HD22 . ASN A 1 54 ? -15.894 -9.445  3.996   1.00 0.00 ?  610  ASN A HD22 2  
ATOM 2492  N N    . PRO A 1 55 ? -13.571 -6.137  3.822   1.00 0.00 ?  611  PRO A N    2  
ATOM 2493  C CA   . PRO A 1 55 ? -12.207 -6.639  3.446   1.00 0.00 ?  611  PRO A CA   2  
ATOM 2494  C C    . PRO A 1 55 ? -12.180 -7.831  2.465   1.00 0.00 ?  611  PRO A C    2  
ATOM 2495  O O    . PRO A 1 55 ? -11.107 -8.320  2.085   1.00 0.00 ?  611  PRO A O    2  
ATOM 2496  C CB   . PRO A 1 55 ? -11.585 -7.049  4.781   1.00 0.00 ?  611  PRO A CB   2  
ATOM 2497  C CG   . PRO A 1 55 ? -12.718 -7.093  5.750   1.00 0.00 ?  611  PRO A CG   2  
ATOM 2498  C CD   . PRO A 1 55 ? -13.698 -6.066  5.286   1.00 0.00 ?  611  PRO A CD   2  
ATOM 2499  H HA   . PRO A 1 55 ? -11.621 -5.839  3.018   1.00 0.00 ?  611  PRO A HA   2  
ATOM 2500  H HB2  . PRO A 1 55 ? -11.139 -8.025  4.655   1.00 0.00 ?  611  PRO A HB2  2  
ATOM 2501  H HB3  . PRO A 1 55 ? -10.831 -6.332  5.076   1.00 0.00 ?  611  PRO A HB3  2  
ATOM 2502  H HG2  . PRO A 1 55 ? -13.171 -8.073  5.733   1.00 0.00 ?  611  PRO A HG2  2  
ATOM 2503  H HG3  . PRO A 1 55 ? -12.367 -6.859  6.744   1.00 0.00 ?  611  PRO A HG3  2  
ATOM 2504  H HD2  . PRO A 1 55 ? -14.695 -6.331  5.604   1.00 0.00 ?  611  PRO A HD2  2  
ATOM 2505  H HD3  . PRO A 1 55 ? -13.430 -5.084  5.648   1.00 0.00 ?  611  PRO A HD3  2  
ATOM 2506  N N    . ASP A 1 56 ? -13.344 -8.322  2.107   1.00 0.00 ?  612  ASP A N    2  
ATOM 2507  C CA   . ASP A 1 56 ? -13.468 -9.355  1.092   1.00 0.00 ?  612  ASP A CA   2  
ATOM 2508  C C    . ASP A 1 56 ? -13.123 -8.753  -0.266  1.00 0.00 ?  612  ASP A C    2  
ATOM 2509  O O    . ASP A 1 56 ? -12.645 -9.439  -1.166  1.00 0.00 ?  612  ASP A O    2  
ATOM 2510  C CB   . ASP A 1 56 ? -14.887 -9.922  1.059   1.00 0.00 ?  612  ASP A CB   2  
ATOM 2511  C CG   . ASP A 1 56 ? -15.018 -11.109 0.145   1.00 0.00 ?  612  ASP A CG   2  
ATOM 2512  O OD1  . ASP A 1 56 ? -15.641 -10.995 -0.937  1.00 0.00 ?  612  ASP A OD1  2  
ATOM 2513  O OD2  . ASP A 1 56 ? -14.484 -12.189 0.495   1.00 0.00 -1 612  ASP A OD2  2  
ATOM 2514  H H    . ASP A 1 56 ? -14.129 -7.955  2.562   1.00 0.00 ?  612  ASP A H    2  
ATOM 2515  H HA   . ASP A 1 56 ? -12.765 -10.138 1.336   1.00 0.00 ?  612  ASP A HA   2  
ATOM 2516  H HB2  . ASP A 1 56 ? -15.175 -10.227 2.053   1.00 0.00 ?  612  ASP A HB2  2  
ATOM 2517  H HB3  . ASP A 1 56 ? -15.562 -9.150  0.718   1.00 0.00 ?  612  ASP A HB3  2  
ATOM 2518  N N    . GLU A 1 57 ? -13.339 -7.458  -0.376  1.00 0.00 ?  613  GLU A N    2  
ATOM 2519  C CA   . GLU A 1 57 ? -13.027 -6.696  -1.565  1.00 0.00 ?  613  GLU A CA   2  
ATOM 2520  C C    . GLU A 1 57 ? -11.654 -6.052  -1.368  1.00 0.00 ?  613  GLU A C    2  
ATOM 2521  O O    . GLU A 1 57 ? -11.016 -6.259  -0.341  1.00 0.00 ?  613  GLU A O    2  
ATOM 2522  C CB   . GLU A 1 57 ? -14.076 -5.598  -1.763  1.00 0.00 ?  613  GLU A CB   2  
ATOM 2523  C CG   . GLU A 1 57 ? -15.502 -6.109  -1.854  1.00 0.00 ?  613  GLU A CG   2  
ATOM 2524  C CD   . GLU A 1 57 ? -16.505 -4.999  -1.976  1.00 0.00 ?  613  GLU A CD   2  
ATOM 2525  O OE1  . GLU A 1 57 ? -16.912 -4.657  -3.110  1.00 0.00 ?  613  GLU A OE1  2  
ATOM 2526  O OE2  . GLU A 1 57 ? -16.908 -4.427  -0.950  1.00 0.00 -1 613  GLU A OE2  2  
ATOM 2527  H H    . GLU A 1 57 ? -13.702 -6.963  0.392   1.00 0.00 ?  613  GLU A H    2  
ATOM 2528  H HA   . GLU A 1 57 ? -13.018 -7.353  -2.421  1.00 0.00 ?  613  GLU A HA   2  
ATOM 2529  H HB2  . GLU A 1 57 ? -14.021 -4.909  -0.933  1.00 0.00 ?  613  GLU A HB2  2  
ATOM 2530  H HB3  . GLU A 1 57 ? -13.847 -5.066  -2.674  1.00 0.00 ?  613  GLU A HB3  2  
ATOM 2531  H HG2  . GLU A 1 57 ? -15.588 -6.738  -2.727  1.00 0.00 ?  613  GLU A HG2  2  
ATOM 2532  H HG3  . GLU A 1 57 ? -15.724 -6.687  -0.969  1.00 0.00 ?  613  GLU A HG3  2  
ATOM 2533  N N    . ILE A 1 58 ? -11.208 -5.278  -2.330  1.00 0.00 ?  614  ILE A N    2  
ATOM 2534  C CA   . ILE A 1 58 ? -9.938  -4.587  -2.215  1.00 0.00 ?  614  ILE A CA   2  
ATOM 2535  C C    . ILE A 1 58 ? -9.981  -3.227  -2.857  1.00 0.00 ?  614  ILE A C    2  
ATOM 2536  O O    . ILE A 1 58 ? -9.994  -3.098  -4.094  1.00 0.00 ?  614  ILE A O    2  
ATOM 2537  C CB   . ILE A 1 58 ? -8.725  -5.402  -2.766  1.00 0.00 ?  614  ILE A CB   2  
ATOM 2538  C CG1  . ILE A 1 58 ? -7.461  -4.504  -2.831  1.00 0.00 ?  614  ILE A CG1  2  
ATOM 2539  C CG2  . ILE A 1 58 ? -9.064  -5.948  -4.140  1.00 0.00 ?  614  ILE A CG2  2  
ATOM 2540  C CD1  . ILE A 1 58 ? -6.147  -5.225  -2.929  1.00 0.00 ?  614  ILE A CD1  2  
ATOM 2541  H H    . ILE A 1 58 ? -11.739 -5.150  -3.143  1.00 0.00 ?  614  ILE A H    2  
ATOM 2542  H HA   . ILE A 1 58 ? -9.787  -4.430  -1.160  1.00 0.00 ?  614  ILE A HA   2  
ATOM 2543  H HB   . ILE A 1 58 ? -8.536  -6.236  -2.107  1.00 0.00 ?  614  ILE A HB   2  
ATOM 2544  H HG12 . ILE A 1 58 ? -7.543  -3.905  -3.724  1.00 0.00 ?  614  ILE A HG12 2  
ATOM 2545  H HG13 . ILE A 1 58 ? -7.422  -3.833  -1.985  1.00 0.00 ?  614  ILE A HG13 2  
ATOM 2546  H HG21 . ILE A 1 58 ? -9.913  -6.605  -4.033  1.00 0.00 ?  614  ILE A HG21 2  
ATOM 2547  H HG22 . ILE A 1 58 ? -8.216  -6.483  -4.531  1.00 0.00 ?  614  ILE A HG22 2  
ATOM 2548  H HG23 . ILE A 1 58 ? -9.315  -5.119  -4.793  1.00 0.00 ?  614  ILE A HG23 2  
ATOM 2549  H HD11 . ILE A 1 58 ? -6.011  -5.803  -2.027  1.00 0.00 ?  614  ILE A HD11 2  
ATOM 2550  H HD12 . ILE A 1 58 ? -5.346  -4.507  -3.010  1.00 0.00 ?  614  ILE A HD12 2  
ATOM 2551  H HD13 . ILE A 1 58 ? -6.102  -5.895  -3.774  1.00 0.00 ?  614  ILE A HD13 2  
ATOM 2552  N N    . GLU A 1 59 ? -10.046 -2.218  -2.049  1.00 0.00 ?  615  GLU A N    2  
ATOM 2553  C CA   . GLU A 1 59 ? -10.010 -0.906  -2.562  1.00 0.00 ?  615  GLU A CA   2  
ATOM 2554  C C    . GLU A 1 59 ? -9.242  0.025   -1.689  1.00 0.00 ?  615  GLU A C    2  
ATOM 2555  O O    . GLU A 1 59 ? -9.394  0.048   -0.470  1.00 0.00 ?  615  GLU A O    2  
ATOM 2556  C CB   . GLU A 1 59 ? -11.379 -0.495  -3.104  1.00 0.00 ?  615  GLU A CB   2  
ATOM 2557  C CG   . GLU A 1 59 ? -11.705 0.808   -3.684  1.00 0.00 ?  615  GLU A CG   2  
ATOM 2558  C CD   . GLU A 1 59 ? -11.818 1.943   -2.709  1.00 0.00 ?  615  GLU A CD   2  
ATOM 2559  O OE1  . GLU A 1 59 ? -12.936 2.212   -2.238  1.00 0.00 ?  615  GLU A OE1  2  
ATOM 2560  O OE2  . GLU A 1 59 ? -10.838 2.620   -2.446  1.00 0.00 -1 615  GLU A OE2  2  
ATOM 2561  H H    . GLU A 1 59 ? -10.112 -2.340  -1.078  1.00 0.00 ?  615  GLU A H    2  
ATOM 2562  H HA   . GLU A 1 59 ? -9.340  -1.021  -3.403  1.00 0.00 ?  615  GLU A HA   2  
ATOM 2563  H HB2  . GLU A 1 59 ? -11.007 -0.760  -4.077  1.00 0.00 ?  615  GLU A HB2  2  
ATOM 2564  H HB3  . GLU A 1 59 ? -12.251 -1.097  -2.912  1.00 0.00 ?  615  GLU A HB3  2  
ATOM 2565  H HG2  . GLU A 1 59 ? -11.106 0.948   -4.577  1.00 0.00 ?  615  GLU A HG2  2  
ATOM 2566  H HG3  . GLU A 1 59 ? -12.669 0.559   -4.093  1.00 0.00 ?  615  GLU A HG3  2  
ATOM 2567  N N    . ILE A 1 60 ? -8.357  0.710   -2.333  1.00 0.00 ?  616  ILE A N    2  
ATOM 2568  C CA   . ILE A 1 60 ? -7.360  1.542   -1.665  1.00 0.00 ?  616  ILE A CA   2  
ATOM 2569  C C    . ILE A 1 60 ? -7.514  3.020   -1.962  1.00 0.00 ?  616  ILE A C    2  
ATOM 2570  O O    . ILE A 1 60 ? -6.944  3.542   -2.871  1.00 0.00 ?  616  ILE A O    2  
ATOM 2571  C CB   . ILE A 1 60 ? -5.922  1.040   -1.930  1.00 0.00 ?  616  ILE A CB   2  
ATOM 2572  C CG1  . ILE A 1 60 ? -5.791  -0.291  -1.217  1.00 0.00 ?  616  ILE A CG1  2  
ATOM 2573  C CG2  . ILE A 1 60 ? -4.867  2.013   -1.378  1.00 0.00 ?  616  ILE A CG2  2  
ATOM 2574  C CD1  . ILE A 1 60 ? -4.545  -0.990  -1.525  1.00 0.00 ?  616  ILE A CD1  2  
ATOM 2575  H H    . ILE A 1 60 ? -8.491  0.650   -3.311  1.00 0.00 ?  616  ILE A H    2  
ATOM 2576  H HA   . ILE A 1 60 ? -7.533  1.351   -0.614  1.00 0.00 ?  616  ILE A HA   2  
ATOM 2577  H HB   . ILE A 1 60 ? -5.764  0.877   -2.988  1.00 0.00 ?  616  ILE A HB   2  
ATOM 2578  H HG12 . ILE A 1 60 ? -5.817  -0.123  -0.151  1.00 0.00 ?  616  ILE A HG12 2  
ATOM 2579  H HG13 . ILE A 1 60 ? -6.618  -0.929  -1.491  1.00 0.00 ?  616  ILE A HG13 2  
ATOM 2580  H HG21 . ILE A 1 60 ? -3.878  1.633   -1.590  1.00 0.00 ?  616  ILE A HG21 2  
ATOM 2581  H HG22 . ILE A 1 60 ? -4.991  2.112   -0.310  1.00 0.00 ?  616  ILE A HG22 2  
ATOM 2582  H HG23 . ILE A 1 60 ? -4.991  2.979   -1.845  1.00 0.00 ?  616  ILE A HG23 2  
ATOM 2583  H HD11 . ILE A 1 60 ? -4.554  -1.206  -2.587  1.00 0.00 ?  616  ILE A HD11 2  
ATOM 2584  H HD12 . ILE A 1 60 ? -4.515  -1.884  -0.925  1.00 0.00 ?  616  ILE A HD12 2  
ATOM 2585  H HD13 . ILE A 1 60 ? -3.771  -0.283  -1.284  1.00 0.00 ?  616  ILE A HD13 2  
ATOM 2586  N N    . ASP A 1 61 ? -8.279  3.636   -1.140  1.00 0.00 ?  617  ASP A N    2  
ATOM 2587  C CA   . ASP A 1 61 ? -8.701  5.058   -1.128  1.00 0.00 ?  617  ASP A CA   2  
ATOM 2588  C C    . ASP A 1 61 ? -7.637  6.185   -1.249  1.00 0.00 ?  617  ASP A C    2  
ATOM 2589  O O    . ASP A 1 61 ? -7.970  7.362   -1.285  1.00 0.00 ?  617  ASP A O    2  
ATOM 2590  C CB   . ASP A 1 61 ? -9.890  5.275   -0.196  1.00 0.00 ?  617  ASP A CB   2  
ATOM 2591  C CG   . ASP A 1 61 ? -10.484 6.670   -0.136  1.00 0.00 ?  617  ASP A CG   2  
ATOM 2592  O OD1  . ASP A 1 61 ? -11.207 7.051   -1.090  1.00 0.00 ?  617  ASP A OD1  2  
ATOM 2593  O OD2  . ASP A 1 61 ? -10.351 7.349   0.900   1.00 0.00 -1 617  ASP A OD2  2  
ATOM 2594  H H    . ASP A 1 61 ? -8.676  3.068   -0.446  1.00 0.00 ?  617  ASP A H    2  
ATOM 2595  H HA   . ASP A 1 61 ? -9.094  5.146   -2.125  1.00 0.00 ?  617  ASP A HA   2  
ATOM 2596  H HB2  . ASP A 1 61 ? -10.619 4.712   -0.766  1.00 0.00 ?  617  ASP A HB2  2  
ATOM 2597  H HB3  . ASP A 1 61 ? -9.731  4.850   0.783   1.00 0.00 ?  617  ASP A HB3  2  
ATOM 2598  N N    . PHE A 1 62 ? -6.375  5.803   -1.357  1.00 0.00 ?  618  PHE A N    2  
ATOM 2599  C CA   . PHE A 1 62 ? -5.171  6.652   -1.171  1.00 0.00 ?  618  PHE A CA   2  
ATOM 2600  C C    . PHE A 1 62 ? -5.143  8.000   -1.878  1.00 0.00 ?  618  PHE A C    2  
ATOM 2601  O O    . PHE A 1 62 ? -4.371  8.830   -1.463  1.00 0.00 ?  618  PHE A O    2  
ATOM 2602  C CB   . PHE A 1 62 ? -3.970  5.870   -1.690  1.00 0.00 ?  618  PHE A CB   2  
ATOM 2603  C CG   . PHE A 1 62 ? -3.207  5.084   -0.669  1.00 0.00 ?  618  PHE A CG   2  
ATOM 2604  C CD1  . PHE A 1 62 ? -3.695  4.916   0.621   1.00 0.00 ?  618  PHE A CD1  2  
ATOM 2605  C CD2  . PHE A 1 62 ? -1.989  4.504   -0.993  1.00 0.00 ?  618  PHE A CD2  2  
ATOM 2606  C CE1  . PHE A 1 62 ? -2.993  4.204   1.549   1.00 0.00 ?  618  PHE A CE1  2  
ATOM 2607  C CE2  . PHE A 1 62 ? -1.293  3.790   -0.060  1.00 0.00 ?  618  PHE A CE2  2  
ATOM 2608  C CZ   . PHE A 1 62 ? -1.798  3.643   1.211   1.00 0.00 ?  618  PHE A CZ   2  
ATOM 2609  H H    . PHE A 1 62 ? -6.251  4.867   -1.626  1.00 0.00 ?  618  PHE A H    2  
ATOM 2610  H HA   . PHE A 1 62 ? -4.974  6.826   -0.129  1.00 0.00 ?  618  PHE A HA   2  
ATOM 2611  H HB2  . PHE A 1 62 ? -4.416  5.138   -2.350  1.00 0.00 ?  618  PHE A HB2  2  
ATOM 2612  H HB3  . PHE A 1 62 ? -3.318  6.456   -2.328  1.00 0.00 ?  618  PHE A HB3  2  
ATOM 2613  H HD1  . PHE A 1 62 ? -4.642  5.341   0.912   1.00 0.00 ?  618  PHE A HD1  2  
ATOM 2614  H HD2  . PHE A 1 62 ? -1.573  4.601   -1.986  1.00 0.00 ?  618  PHE A HD2  2  
ATOM 2615  H HE1  . PHE A 1 62 ? -3.383  4.080   2.549   1.00 0.00 ?  618  PHE A HE1  2  
ATOM 2616  H HE2  . PHE A 1 62 ? -0.346  3.343   -0.320  1.00 0.00 ?  618  PHE A HE2  2  
ATOM 2617  H HZ   . PHE A 1 62 ? -1.244  3.085   1.948   1.00 0.00 ?  618  PHE A HZ   2  
ATOM 2618  N N    . GLU A 1 63 ? -5.934  8.247   -2.891  1.00 0.00 ?  619  GLU A N    2  
ATOM 2619  C CA   . GLU A 1 63 ? -6.003  9.619   -3.408  1.00 0.00 ?  619  GLU A CA   2  
ATOM 2620  C C    . GLU A 1 63 ? -6.570  10.547  -2.324  1.00 0.00 ?  619  GLU A C    2  
ATOM 2621  O O    . GLU A 1 63 ? -6.029  11.620  -2.049  1.00 0.00 ?  619  GLU A O    2  
ATOM 2622  C CB   . GLU A 1 63 ? -6.902  9.732   -4.616  1.00 0.00 ?  619  GLU A CB   2  
ATOM 2623  C CG   . GLU A 1 63 ? -6.391  9.137   -5.897  1.00 0.00 ?  619  GLU A CG   2  
ATOM 2624  C CD   . GLU A 1 63 ? -7.377  9.361   -6.985  1.00 0.00 ?  619  GLU A CD   2  
ATOM 2625  O OE1  . GLU A 1 63 ? -8.268  8.540   -7.142  1.00 0.00 ?  619  GLU A OE1  2  
ATOM 2626  O OE2  . GLU A 1 63 ? -7.264  10.374  -7.707  1.00 0.00 -1 619  GLU A OE2  2  
ATOM 2627  H H    . GLU A 1 63 ? -6.473  7.521   -3.275  1.00 0.00 ?  619  GLU A H    2  
ATOM 2628  H HA   . GLU A 1 63 ? -5.004  9.938   -3.662  1.00 0.00 ?  619  GLU A HA   2  
ATOM 2629  H HB2  . GLU A 1 63 ? -7.817  9.214   -4.373  1.00 0.00 ?  619  GLU A HB2  2  
ATOM 2630  H HB3  . GLU A 1 63 ? -7.127  10.775  -4.779  1.00 0.00 ?  619  GLU A HB3  2  
ATOM 2631  H HG2  . GLU A 1 63 ? -5.440  9.540   -6.214  1.00 0.00 ?  619  GLU A HG2  2  
ATOM 2632  H HG3  . GLU A 1 63 ? -6.255  8.073   -5.800  1.00 0.00 ?  619  GLU A HG3  2  
ATOM 2633  N N    . THR A 1 64 ? -7.627  10.092  -1.697  1.00 0.00 ?  620  THR A N    2  
ATOM 2634  C CA   . THR A 1 64 ? -8.335  10.862  -0.716  1.00 0.00 ?  620  THR A CA   2  
ATOM 2635  C C    . THR A 1 64 ? -7.900  10.461  0.703   1.00 0.00 ?  620  THR A C    2  
ATOM 2636  O O    . THR A 1 64 ? -7.918  11.292  1.630   1.00 0.00 ?  620  THR A O    2  
ATOM 2637  C CB   . THR A 1 64 ? -9.843  10.603  -0.872  1.00 0.00 ?  620  THR A CB   2  
ATOM 2638  O OG1  . THR A 1 64 ? -10.187 10.639  -2.271  1.00 0.00 ?  620  THR A OG1  2  
ATOM 2639  C CG2  . THR A 1 64 ? -10.650 11.667  -0.149  1.00 0.00 ?  620  THR A CG2  2  
ATOM 2640  H H    . THR A 1 64 ? -7.953  9.187   -1.899  1.00 0.00 ?  620  THR A H    2  
ATOM 2641  H HA   . THR A 1 64 ? -8.149  11.913  -0.883  1.00 0.00 ?  620  THR A HA   2  
ATOM 2642  H HB   . THR A 1 64 ? -10.080 9.632   -0.462  1.00 0.00 ?  620  THR A HB   2  
ATOM 2643  H HG1  . THR A 1 64 ? -11.022 10.161  -2.343  1.00 0.00 ?  620  THR A HG1  2  
ATOM 2644  H HG21 . THR A 1 64 ? -10.429 12.630  -0.586  1.00 0.00 ?  620  THR A HG21 2  
ATOM 2645  H HG22 . THR A 1 64 ? -10.378 11.677  0.897   1.00 0.00 ?  620  THR A HG22 2  
ATOM 2646  H HG23 . THR A 1 64 ? -11.704 11.457  -0.251  1.00 0.00 ?  620  THR A HG23 2  
ATOM 2647  N N    . LEU A 1 65 ? -7.489  9.207   0.851   1.00 0.00 ?  621  LEU A N    2  
ATOM 2648  C CA   . LEU A 1 65 ? -7.127  8.632   2.139   1.00 0.00 ?  621  LEU A CA   2  
ATOM 2649  C C    . LEU A 1 65 ? -5.921  9.364   2.742   1.00 0.00 ?  621  LEU A C    2  
ATOM 2650  O O    . LEU A 1 65 ? -5.058  9.888   2.018   1.00 0.00 ?  621  LEU A O    2  
ATOM 2651  C CB   . LEU A 1 65 ? -6.832  7.134   1.983   1.00 0.00 ?  621  LEU A CB   2  
ATOM 2652  C CG   . LEU A 1 65 ? -7.009  6.248   3.225   1.00 0.00 ?  621  LEU A CG   2  
ATOM 2653  C CD1  . LEU A 1 65 ? -8.467  6.228   3.659   1.00 0.00 ?  621  LEU A CD1  2  
ATOM 2654  C CD2  . LEU A 1 65 ? -6.536  4.834   2.939   1.00 0.00 ?  621  LEU A CD2  2  
ATOM 2655  H H    . LEU A 1 65 ? -7.443  8.640   0.051   1.00 0.00 ?  621  LEU A H    2  
ATOM 2656  H HA   . LEU A 1 65 ? -7.967  8.757   2.805   1.00 0.00 ?  621  LEU A HA   2  
ATOM 2657  H HB2  . LEU A 1 65 ? -7.466  6.743   1.201   1.00 0.00 ?  621  LEU A HB2  2  
ATOM 2658  H HB3  . LEU A 1 65 ? -5.805  7.048   1.662   1.00 0.00 ?  621  LEU A HB3  2  
ATOM 2659  H HG   . LEU A 1 65 ? -6.421  6.649   4.038   1.00 0.00 ?  621  LEU A HG   2  
ATOM 2660  H HD11 . LEU A 1 65 ? -8.776  7.220   3.947   1.00 0.00 ?  621  LEU A HD11 2  
ATOM 2661  H HD12 . LEU A 1 65 ? -8.596  5.546   4.485   1.00 0.00 ?  621  LEU A HD12 2  
ATOM 2662  H HD13 . LEU A 1 65 ? -9.076  5.895   2.831   1.00 0.00 ?  621  LEU A HD13 2  
ATOM 2663  H HD21 . LEU A 1 65 ? -6.720  4.212   3.802   1.00 0.00 ?  621  LEU A HD21 2  
ATOM 2664  H HD22 . LEU A 1 65 ? -5.476  4.848   2.735   1.00 0.00 ?  621  LEU A HD22 2  
ATOM 2665  H HD23 . LEU A 1 65 ? -7.065  4.436   2.086   1.00 0.00 ?  621  LEU A HD23 2  
ATOM 2666  N N    . LYS A 1 66 ? -5.887  9.412   4.046   1.00 0.00 ?  622  LYS A N    2  
ATOM 2667  C CA   . LYS A 1 66 ? -4.877  10.135  4.804   1.00 0.00 ?  622  LYS A CA   2  
ATOM 2668  C C    . LYS A 1 66 ? -3.462  9.551   4.649   1.00 0.00 ?  622  LYS A C    2  
ATOM 2669  O O    . LYS A 1 66 ? -3.283  8.332   4.493   1.00 0.00 ?  622  LYS A O    2  
ATOM 2670  C CB   . LYS A 1 66 ? -5.263  10.144  6.280   1.00 0.00 ?  622  LYS A CB   2  
ATOM 2671  C CG   . LYS A 1 66 ? -6.560  10.861  6.564   1.00 0.00 ?  622  LYS A CG   2  
ATOM 2672  C CD   . LYS A 1 66 ? -6.942  10.747  8.021   1.00 0.00 ?  622  LYS A CD   2  
ATOM 2673  C CE   . LYS A 1 66 ? -8.237  11.482  8.315   1.00 0.00 ?  622  LYS A CE   2  
ATOM 2674  N NZ   . LYS A 1 66 ? -8.119  12.944  8.097   1.00 0.00 1  622  LYS A NZ   2  
ATOM 2675  H H    . LYS A 1 66 ? -6.584  8.931   4.541   1.00 0.00 ?  622  LYS A H    2  
ATOM 2676  H HA   . LYS A 1 66 ? -4.879  11.157  4.458   1.00 0.00 ?  622  LYS A HA   2  
ATOM 2677  H HB2  . LYS A 1 66 ? -5.360  9.122   6.616   1.00 0.00 ?  622  LYS A HB2  2  
ATOM 2678  H HB3  . LYS A 1 66 ? -4.477  10.623  6.844   1.00 0.00 ?  622  LYS A HB3  2  
ATOM 2679  H HG2  . LYS A 1 66 ? -6.433  11.904  6.318   1.00 0.00 ?  622  LYS A HG2  2  
ATOM 2680  H HG3  . LYS A 1 66 ? -7.342  10.432  5.955   1.00 0.00 ?  622  LYS A HG3  2  
ATOM 2681  H HD2  . LYS A 1 66 ? -7.071  9.703   8.266   1.00 0.00 ?  622  LYS A HD2  2  
ATOM 2682  H HD3  . LYS A 1 66 ? -6.151  11.165  8.626   1.00 0.00 ?  622  LYS A HD3  2  
ATOM 2683  H HE2  . LYS A 1 66 ? -9.015  11.098  7.673   1.00 0.00 ?  622  LYS A HE2  2  
ATOM 2684  H HE3  . LYS A 1 66 ? -8.507  11.304  9.345   1.00 0.00 ?  622  LYS A HE3  2  
ATOM 2685  H HZ1  . LYS A 1 66 ? -7.882  13.187  7.114   1.00 0.00 ?  622  LYS A HZ1  2  
ATOM 2686  H HZ2  . LYS A 1 66 ? -7.377  13.353  8.704   1.00 0.00 ?  622  LYS A HZ2  2  
ATOM 2687  H HZ3  . LYS A 1 66 ? -9.007  13.425  8.344   1.00 0.00 ?  622  LYS A HZ3  2  
ATOM 2688  N N    . PRO A 1 67 ? -2.422  10.426  4.723   1.00 0.00 ?  623  PRO A N    2  
ATOM 2689  C CA   . PRO A 1 67 ? -1.010  10.005  4.688   1.00 0.00 ?  623  PRO A CA   2  
ATOM 2690  C C    . PRO A 1 67 ? -0.668  9.126   5.892   1.00 0.00 ?  623  PRO A C    2  
ATOM 2691  O O    . PRO A 1 67 ? 0.307   8.371   5.882   1.00 0.00 ?  623  PRO A O    2  
ATOM 2692  C CB   . PRO A 1 67 ? -0.232  11.317  4.767   1.00 0.00 ?  623  PRO A CB   2  
ATOM 2693  C CG   . PRO A 1 67 ? -1.195  12.314  5.306   1.00 0.00 ?  623  PRO A CG   2  
ATOM 2694  C CD   . PRO A 1 67 ? -2.542  11.896  4.813   1.00 0.00 ?  623  PRO A CD   2  
ATOM 2695  H HA   . PRO A 1 67 ? -0.781  9.485   3.771   1.00 0.00 ?  623  PRO A HA   2  
ATOM 2696  H HB2  . PRO A 1 67 ? 0.614   11.189  5.427   1.00 0.00 ?  623  PRO A HB2  2  
ATOM 2697  H HB3  . PRO A 1 67 ? 0.119   11.593  3.783   1.00 0.00 ?  623  PRO A HB3  2  
ATOM 2698  H HG2  . PRO A 1 67 ? -1.169  12.304  6.385   1.00 0.00 ?  623  PRO A HG2  2  
ATOM 2699  H HG3  . PRO A 1 67 ? -0.946  13.298  4.933   1.00 0.00 ?  623  PRO A HG3  2  
ATOM 2700  H HD2  . PRO A 1 67 ? -3.305  12.182  5.524   1.00 0.00 ?  623  PRO A HD2  2  
ATOM 2701  H HD3  . PRO A 1 67 ? -2.741  12.325  3.841   1.00 0.00 ?  623  PRO A HD3  2  
ATOM 2702  N N    . THR A 1 68 ? -1.489  9.246   6.903   1.00 0.00 ?  624  THR A N    2  
ATOM 2703  C CA   . THR A 1 68 ? -1.428  8.474   8.104   1.00 0.00 ?  624  THR A CA   2  
ATOM 2704  C C    . THR A 1 68 ? -1.551  6.982   7.746   1.00 0.00 ?  624  THR A C    2  
ATOM 2705  O O    . THR A 1 68 ? -0.740  6.149   8.150   1.00 0.00 ?  624  THR A O    2  
ATOM 2706  C CB   . THR A 1 68 ? -2.645  8.885   8.929   1.00 0.00 ?  624  THR A CB   2  
ATOM 2707  O OG1  . THR A 1 68 ? -2.817  10.304  8.784   1.00 0.00 ?  624  THR A OG1  2  
ATOM 2708  C CG2  . THR A 1 68 ? -2.464  8.545   10.392  1.00 0.00 ?  624  THR A CG2  2  
ATOM 2709  H H    . THR A 1 68 ? -2.198  9.924   6.878   1.00 0.00 ?  624  THR A H    2  
ATOM 2710  H HA   . THR A 1 68 ? -0.533  8.693   8.665   1.00 0.00 ?  624  THR A HA   2  
ATOM 2711  H HB   . THR A 1 68 ? -3.517  8.381   8.537   1.00 0.00 ?  624  THR A HB   2  
ATOM 2712  H HG1  . THR A 1 68 ? -2.370  10.760  9.506   1.00 0.00 ?  624  THR A HG1  2  
ATOM 2713  H HG21 . THR A 1 68 ? -1.605  9.073   10.777  1.00 0.00 ?  624  THR A HG21 2  
ATOM 2714  H HG22 . THR A 1 68 ? -2.311  7.481   10.495  1.00 0.00 ?  624  THR A HG22 2  
ATOM 2715  H HG23 . THR A 1 68 ? -3.344  8.837   10.945  1.00 0.00 ?  624  THR A HG23 2  
ATOM 2716  N N    . THR A 1 69 ? -2.538  6.688   6.936   1.00 0.00 ?  625  THR A N    2  
ATOM 2717  C CA   . THR A 1 69 ? -2.845  5.361   6.509   1.00 0.00 ?  625  THR A CA   2  
ATOM 2718  C C    . THR A 1 69 ? -1.866  4.927   5.410   1.00 0.00 ?  625  THR A C    2  
ATOM 2719  O O    . THR A 1 69 ? -1.570  3.740   5.245   1.00 0.00 ?  625  THR A O    2  
ATOM 2720  C CB   . THR A 1 69 ? -4.254  5.381   5.964   1.00 0.00 ?  625  THR A CB   2  
ATOM 2721  O OG1  . THR A 1 69 ? -4.966  6.437   6.648   1.00 0.00 ?  625  THR A OG1  2  
ATOM 2722  C CG2  . THR A 1 69 ? -4.933  4.066   6.253   1.00 0.00 ?  625  THR A CG2  2  
ATOM 2723  H H    . THR A 1 69 ? -3.150  7.380   6.601   1.00 0.00 ?  625  THR A H    2  
ATOM 2724  H HA   . THR A 1 69 ? -2.805  4.685   7.350   1.00 0.00 ?  625  THR A HA   2  
ATOM 2725  H HB   . THR A 1 69 ? -4.237  5.564   4.900   1.00 0.00 ?  625  THR A HB   2  
ATOM 2726  H HG1  . THR A 1 69 ? -5.881  6.176   6.795   1.00 0.00 ?  625  THR A HG1  2  
ATOM 2727  H HG21 . THR A 1 69 ? -5.939  4.082   5.863   1.00 0.00 ?  625  THR A HG21 2  
ATOM 2728  H HG22 . THR A 1 69 ? -4.959  3.903   7.321   1.00 0.00 ?  625  THR A HG22 2  
ATOM 2729  H HG23 . THR A 1 69 ? -4.373  3.275   5.777   1.00 0.00 ?  625  THR A HG23 2  
ATOM 2730  N N    . LEU A 1 70 ? -1.367  5.919   4.681   1.00 0.00 ?  626  LEU A N    2  
ATOM 2731  C CA   . LEU A 1 70 ? -0.353  5.735   3.638   1.00 0.00 ?  626  LEU A CA   2  
ATOM 2732  C C    . LEU A 1 70 ? 0.879   5.050   4.226   1.00 0.00 ?  626  LEU A C    2  
ATOM 2733  O O    . LEU A 1 70 ? 1.483   4.177   3.605   1.00 0.00 ?  626  LEU A O    2  
ATOM 2734  C CB   . LEU A 1 70 ? 0.033   7.108   3.065   1.00 0.00 ?  626  LEU A CB   2  
ATOM 2735  C CG   . LEU A 1 70 ? 1.144   7.164   2.011   1.00 0.00 ?  626  LEU A CG   2  
ATOM 2736  C CD1  . LEU A 1 70 ? 0.717   6.480   0.738   1.00 0.00 ?  626  LEU A CD1  2  
ATOM 2737  C CD2  . LEU A 1 70 ? 1.542   8.607   1.736   1.00 0.00 ?  626  LEU A CD2  2  
ATOM 2738  H H    . LEU A 1 70 ? -1.730  6.814   4.851   1.00 0.00 ?  626  LEU A H    2  
ATOM 2739  H HA   . LEU A 1 70 ? -0.770  5.126   2.851   1.00 0.00 ?  626  LEU A HA   2  
ATOM 2740  H HB2  . LEU A 1 70 ? -0.851  7.549   2.630   1.00 0.00 ?  626  LEU A HB2  2  
ATOM 2741  H HB3  . LEU A 1 70 ? 0.337   7.722   3.900   1.00 0.00 ?  626  LEU A HB3  2  
ATOM 2742  H HG   . LEU A 1 70 ? 2.012   6.645   2.389   1.00 0.00 ?  626  LEU A HG   2  
ATOM 2743  H HD11 . LEU A 1 70 ? 1.520   6.531   0.017   1.00 0.00 ?  626  LEU A HD11 2  
ATOM 2744  H HD12 . LEU A 1 70 ? -0.161  6.974   0.350   1.00 0.00 ?  626  LEU A HD12 2  
ATOM 2745  H HD13 . LEU A 1 70 ? 0.479   5.447   0.944   1.00 0.00 ?  626  LEU A HD13 2  
ATOM 2746  H HD21 . LEU A 1 70 ? 1.904   9.060   2.648   1.00 0.00 ?  626  LEU A HD21 2  
ATOM 2747  H HD22 . LEU A 1 70 ? 0.682   9.156   1.381   1.00 0.00 ?  626  LEU A HD22 2  
ATOM 2748  H HD23 . LEU A 1 70 ? 2.319   8.632   0.987   1.00 0.00 ?  626  LEU A HD23 2  
ATOM 2749  N N    . ARG A 1 71 ? 1.226   5.442   5.443   1.00 0.00 ?  627  ARG A N    2  
ATOM 2750  C CA   . ARG A 1 71 ? 2.367   4.876   6.138   1.00 0.00 ?  627  ARG A CA   2  
ATOM 2751  C C    . ARG A 1 71 ? 2.171   3.388   6.414   1.00 0.00 ?  627  ARG A C    2  
ATOM 2752  O O    . ARG A 1 71 ? 3.091   2.613   6.231   1.00 0.00 ?  627  ARG A O    2  
ATOM 2753  C CB   . ARG A 1 71 ? 2.645   5.626   7.442   1.00 0.00 ?  627  ARG A CB   2  
ATOM 2754  C CG   . ARG A 1 71 ? 3.021   7.106   7.300   1.00 0.00 ?  627  ARG A CG   2  
ATOM 2755  C CD   . ARG A 1 71 ? 4.361   7.331   6.589   1.00 0.00 ?  627  ARG A CD   2  
ATOM 2756  N NE   . ARG A 1 71 ? 4.335   7.021   5.148   1.00 0.00 ?  627  ARG A NE   2  
ATOM 2757  C CZ   . ARG A 1 71 ? 5.321   7.329   4.284   1.00 0.00 ?  627  ARG A CZ   2  
ATOM 2758  N NH1  . ARG A 1 71 ? 6.426   7.961   4.696   1.00 0.00 1  627  ARG A NH1  2  
ATOM 2759  N NH2  . ARG A 1 71 ? 5.196   7.015   3.002   1.00 0.00 ?  627  ARG A NH2  2  
ATOM 2760  H H    . ARG A 1 71 ? 0.684   6.135   5.879   1.00 0.00 ?  627  ARG A H    2  
ATOM 2761  H HA   . ARG A 1 71 ? 3.228   4.978   5.493   1.00 0.00 ?  627  ARG A HA   2  
ATOM 2762  H HB2  . ARG A 1 71 ? 1.760   5.574   8.058   1.00 0.00 ?  627  ARG A HB2  2  
ATOM 2763  H HB3  . ARG A 1 71 ? 3.450   5.123   7.954   1.00 0.00 ?  627  ARG A HB3  2  
ATOM 2764  H HG2  . ARG A 1 71 ? 2.251   7.606   6.733   1.00 0.00 ?  627  ARG A HG2  2  
ATOM 2765  H HG3  . ARG A 1 71 ? 3.071   7.541   8.288   1.00 0.00 ?  627  ARG A HG3  2  
ATOM 2766  H HD2  . ARG A 1 71 ? 4.640   8.368   6.706   1.00 0.00 ?  627  ARG A HD2  2  
ATOM 2767  H HD3  . ARG A 1 71 ? 5.107   6.713   7.066   1.00 0.00 ?  627  ARG A HD3  2  
ATOM 2768  H HE   . ARG A 1 71 ? 3.525   6.566   4.834   1.00 0.00 ?  627  ARG A HE   2  
ATOM 2769  H HH11 . ARG A 1 71 ? 6.610   8.246   5.652   1.00 0.00 ?  627  ARG A HH11 2  
ATOM 2770  H HH12 . ARG A 1 71 ? 7.160   8.203   4.059   1.00 0.00 ?  627  ARG A HH12 2  
ATOM 2771  H HH21 . ARG A 1 71 ? 4.410   6.550   2.587   1.00 0.00 ?  627  ARG A HH21 2  
ATOM 2772  H HH22 . ARG A 1 71 ? 5.920   7.243   2.348   1.00 0.00 ?  627  ARG A HH22 2  
ATOM 2773  N N    . GLU A 1 72 ? 0.950   2.999   6.780   1.00 0.00 ?  628  GLU A N    2  
ATOM 2774  C CA   . GLU A 1 72 ? 0.634   1.607   7.135   1.00 0.00 ?  628  GLU A CA   2  
ATOM 2775  C C    . GLU A 1 72 ? 0.929   0.678   5.957   1.00 0.00 ?  628  GLU A C    2  
ATOM 2776  O O    . GLU A 1 72 ? 1.571   -0.362  6.106   1.00 0.00 ?  628  GLU A O    2  
ATOM 2777  C CB   . GLU A 1 72 ? -0.848  1.491   7.530   1.00 0.00 ?  628  GLU A CB   2  
ATOM 2778  C CG   . GLU A 1 72 ? -1.228  0.165   8.179   1.00 0.00 ?  628  GLU A CG   2  
ATOM 2779  C CD   . GLU A 1 72 ? -0.421  -0.105  9.427   1.00 0.00 ?  628  GLU A CD   2  
ATOM 2780  O OE1  . GLU A 1 72 ? 0.257   -1.135  9.498   1.00 0.00 ?  628  GLU A OE1  2  
ATOM 2781  O OE2  . GLU A 1 72 ? -0.424  0.739   10.348  1.00 0.00 -1 628  GLU A OE2  2  
ATOM 2782  H H    . GLU A 1 72 ? 0.237   3.670   6.809   1.00 0.00 ?  628  GLU A H    2  
ATOM 2783  H HA   . GLU A 1 72 ? 1.248   1.322   7.977   1.00 0.00 ?  628  GLU A HA   2  
ATOM 2784  H HB2  . GLU A 1 72 ? -1.114  2.291   8.204   1.00 0.00 ?  628  GLU A HB2  2  
ATOM 2785  H HB3  . GLU A 1 72 ? -1.439  1.600   6.633   1.00 0.00 ?  628  GLU A HB3  2  
ATOM 2786  H HG2  . GLU A 1 72 ? -2.277  0.182   8.435   1.00 0.00 ?  628  GLU A HG2  2  
ATOM 2787  H HG3  . GLU A 1 72 ? -1.052  -0.633  7.473   1.00 0.00 ?  628  GLU A HG3  2  
ATOM 2788  N N    . LEU A 1 73 ? 0.496   1.102   4.790   1.00 0.00 ?  629  LEU A N    2  
ATOM 2789  C CA   . LEU A 1 73 ? 0.670   0.348   3.556   1.00 0.00 ?  629  LEU A CA   2  
ATOM 2790  C C    . LEU A 1 73 ? 2.175   0.241   3.246   1.00 0.00 ?  629  LEU A C    2  
ATOM 2791  O O    . LEU A 1 73 ? 2.663   -0.811  2.847   1.00 0.00 ?  629  LEU A O    2  
ATOM 2792  C CB   . LEU A 1 73 ? -0.087  1.106   2.445   1.00 0.00 ?  629  LEU A CB   2  
ATOM 2793  C CG   . LEU A 1 73 ? -0.470  0.398   1.106   1.00 0.00 ?  629  LEU A CG   2  
ATOM 2794  C CD1  . LEU A 1 73 ? 0.701   -0.176  0.350   1.00 0.00 ?  629  LEU A CD1  2  
ATOM 2795  C CD2  . LEU A 1 73 ? -1.540  -0.641  1.324   1.00 0.00 ?  629  LEU A CD2  2  
ATOM 2796  H H    . LEU A 1 73 ? 0.031   1.966   4.764   1.00 0.00 ?  629  LEU A H    2  
ATOM 2797  H HA   . LEU A 1 73 ? 0.243   -0.636  3.678   1.00 0.00 ?  629  LEU A HA   2  
ATOM 2798  H HB2  . LEU A 1 73 ? -1.016  1.412   2.899   1.00 0.00 ?  629  LEU A HB2  2  
ATOM 2799  H HB3  . LEU A 1 73 ? 0.483   1.994   2.219   1.00 0.00 ?  629  LEU A HB3  2  
ATOM 2800  H HG   . LEU A 1 73 ? -0.892  1.154   0.461   1.00 0.00 ?  629  LEU A HG   2  
ATOM 2801  H HD11 . LEU A 1 73 ? 0.357   -0.623  -0.571  1.00 0.00 ?  629  LEU A HD11 2  
ATOM 2802  H HD12 . LEU A 1 73 ? 1.167   -0.936  0.959   1.00 0.00 ?  629  LEU A HD12 2  
ATOM 2803  H HD13 . LEU A 1 73 ? 1.420   0.600   0.133   1.00 0.00 ?  629  LEU A HD13 2  
ATOM 2804  H HD21 . LEU A 1 73 ? -2.429  -0.165  1.711   1.00 0.00 ?  629  LEU A HD21 2  
ATOM 2805  H HD22 . LEU A 1 73 ? -1.189  -1.374  2.034   1.00 0.00 ?  629  LEU A HD22 2  
ATOM 2806  H HD23 . LEU A 1 73 ? -1.770  -1.127  0.388   1.00 0.00 ?  629  LEU A HD23 2  
ATOM 2807  N N    . GLU A 1 74 ? 2.895   1.329   3.487   1.00 0.00 ?  630  GLU A N    2  
ATOM 2808  C CA   . GLU A 1 74 ? 4.339   1.400   3.243   1.00 0.00 ?  630  GLU A CA   2  
ATOM 2809  C C    . GLU A 1 74 ? 5.065   0.374   4.131   1.00 0.00 ?  630  GLU A C    2  
ATOM 2810  O O    . GLU A 1 74 ? 5.945   -0.352  3.663   1.00 0.00 ?  630  GLU A O    2  
ATOM 2811  C CB   . GLU A 1 74 ? 4.821   2.855   3.514   1.00 0.00 ?  630  GLU A CB   2  
ATOM 2812  C CG   . GLU A 1 74 ? 6.245   3.231   3.058   1.00 0.00 ?  630  GLU A CG   2  
ATOM 2813  C CD   . GLU A 1 74 ? 7.368   2.654   3.900   1.00 0.00 ?  630  GLU A CD   2  
ATOM 2814  O OE1  . GLU A 1 74 ? 7.298   2.746   5.132   1.00 0.00 ?  630  GLU A OE1  2  
ATOM 2815  O OE2  . GLU A 1 74 ? 8.398   2.207   3.329   1.00 0.00 -1 630  GLU A OE2  2  
ATOM 2816  H H    . GLU A 1 74 ? 2.437   2.122   3.839   1.00 0.00 ?  630  GLU A H    2  
ATOM 2817  H HA   . GLU A 1 74 ? 4.516   1.152   2.207   1.00 0.00 ?  630  GLU A HA   2  
ATOM 2818  H HB2  . GLU A 1 74 ? 4.138   3.541   3.037   1.00 0.00 ?  630  GLU A HB2  2  
ATOM 2819  H HB3  . GLU A 1 74 ? 4.760   3.022   4.580   1.00 0.00 ?  630  GLU A HB3  2  
ATOM 2820  H HG2  . GLU A 1 74 ? 6.380   2.884   2.045   1.00 0.00 ?  630  GLU A HG2  2  
ATOM 2821  H HG3  . GLU A 1 74 ? 6.328   4.309   3.066   1.00 0.00 ?  630  GLU A HG3  2  
ATOM 2822  N N    . ARG A 1 75 ? 4.639   0.271   5.389   1.00 0.00 ?  631  ARG A N    2  
ATOM 2823  C CA   . ARG A 1 75 ? 5.266   -0.657  6.342   1.00 0.00 ?  631  ARG A CA   2  
ATOM 2824  C C    . ARG A 1 75 ? 4.965   -2.079  5.931   1.00 0.00 ?  631  ARG A C    2  
ATOM 2825  O O    . ARG A 1 75 ? 5.832   -2.961  6.016   1.00 0.00 ?  631  ARG A O    2  
ATOM 2826  C CB   . ARG A 1 75 ? 4.758   -0.447  7.771   1.00 0.00 ?  631  ARG A CB   2  
ATOM 2827  C CG   . ARG A 1 75 ? 4.659   0.994   8.205   1.00 0.00 ?  631  ARG A CG   2  
ATOM 2828  C CD   . ARG A 1 75 ? 5.944   1.770   7.985   1.00 0.00 ?  631  ARG A CD   2  
ATOM 2829  N NE   . ARG A 1 75 ? 7.083   1.246   8.738   1.00 0.00 ?  631  ARG A NE   2  
ATOM 2830  C CZ   . ARG A 1 75 ? 8.350   1.528   8.446   1.00 0.00 ?  631  ARG A CZ   2  
ATOM 2831  N NH1  . ARG A 1 75 ? 8.657   2.105   7.295   1.00 0.00 1  631  ARG A NH1  2  
ATOM 2832  N NH2  . ARG A 1 75 ? 9.309   1.179   9.274   1.00 0.00 ?  631  ARG A NH2  2  
ATOM 2833  H H    . ARG A 1 75 ? 3.889   0.841   5.670   1.00 0.00 ?  631  ARG A H    2  
ATOM 2834  H HA   . ARG A 1 75 ? 6.334   -0.499  6.313   1.00 0.00 ?  631  ARG A HA   2  
ATOM 2835  H HB2  . ARG A 1 75 ? 3.774   -0.885  7.850   1.00 0.00 ?  631  ARG A HB2  2  
ATOM 2836  H HB3  . ARG A 1 75 ? 5.418   -0.964  8.452   1.00 0.00 ?  631  ARG A HB3  2  
ATOM 2837  H HG2  . ARG A 1 75 ? 3.894   1.431   7.579   1.00 0.00 ?  631  ARG A HG2  2  
ATOM 2838  H HG3  . ARG A 1 75 ? 4.363   1.042   9.242   1.00 0.00 ?  631  ARG A HG3  2  
ATOM 2839  H HD2  . ARG A 1 75 ? 6.181   1.739   6.932   1.00 0.00 ?  631  ARG A HD2  2  
ATOM 2840  H HD3  . ARG A 1 75 ? 5.774   2.796   8.273   1.00 0.00 ?  631  ARG A HD3  2  
ATOM 2841  H HE   . ARG A 1 75 ? 6.863   0.721   9.540   1.00 0.00 ?  631  ARG A HE   2  
ATOM 2842  H HH11 . ARG A 1 75 ? 7.968   2.347   6.591   1.00 0.00 ?  631  ARG A HH11 2  
ATOM 2843  H HH12 . ARG A 1 75 ? 9.598   2.352   7.055   1.00 0.00 ?  631  ARG A HH12 2  
ATOM 2844  H HH21 . ARG A 1 75 ? 9.105   0.696   10.132  1.00 0.00 ?  631  ARG A HH21 2  
ATOM 2845  H HH22 . ARG A 1 75 ? 10.273  1.397   9.102   1.00 0.00 ?  631  ARG A HH22 2  
ATOM 2846  N N    . TYR A 1 76 ? 3.733   -2.290  5.492   1.00 0.00 ?  632  TYR A N    2  
ATOM 2847  C CA   . TYR A 1 76 ? 3.268   -3.565  4.995   1.00 0.00 ?  632  TYR A CA   2  
ATOM 2848  C C    . TYR A 1 76 ? 4.134   -4.021  3.839   1.00 0.00 ?  632  TYR A C    2  
ATOM 2849  O O    . TYR A 1 76 ? 4.630   -5.155  3.810   1.00 0.00 ?  632  TYR A O    2  
ATOM 2850  C CB   . TYR A 1 76 ? 1.828   -3.419  4.510   1.00 0.00 ?  632  TYR A CB   2  
ATOM 2851  C CG   . TYR A 1 76 ? 1.280   -4.648  3.842   1.00 0.00 ?  632  TYR A CG   2  
ATOM 2852  C CD1  . TYR A 1 76 ? 0.824   -5.731  4.576   1.00 0.00 ?  632  TYR A CD1  2  
ATOM 2853  C CD2  . TYR A 1 76 ? 1.239   -4.720  2.462   1.00 0.00 ?  632  TYR A CD2  2  
ATOM 2854  C CE1  . TYR A 1 76 ? 0.339   -6.858  3.943   1.00 0.00 ?  632  TYR A CE1  2  
ATOM 2855  C CE2  . TYR A 1 76 ? 0.761   -5.821  1.820   1.00 0.00 ?  632  TYR A CE2  2  
ATOM 2856  C CZ   . TYR A 1 76 ? 0.310   -6.903  2.565   1.00 0.00 ?  632  TYR A CZ   2  
ATOM 2857  O OH   . TYR A 1 76 ? -0.171  -8.022  1.927   1.00 0.00 ?  632  TYR A OH   2  
ATOM 2858  H H    . TYR A 1 76 ? 3.083   -1.552  5.523   1.00 0.00 ?  632  TYR A H    2  
ATOM 2859  H HA   . TYR A 1 76 ? 3.294   -4.294  5.789   1.00 0.00 ?  632  TYR A HA   2  
ATOM 2860  H HB2  . TYR A 1 76 ? 1.170   -3.131  5.316   1.00 0.00 ?  632  TYR A HB2  2  
ATOM 2861  H HB3  . TYR A 1 76 ? 1.862   -2.644  3.756   1.00 0.00 ?  632  TYR A HB3  2  
ATOM 2862  H HD1  . TYR A 1 76 ? 0.852   -5.677  5.653   1.00 0.00 ?  632  TYR A HD1  2  
ATOM 2863  H HD2  . TYR A 1 76 ? 1.591   -3.874  1.891   1.00 0.00 ?  632  TYR A HD2  2  
ATOM 2864  H HE1  . TYR A 1 76 ? -0.015  -7.697  4.525   1.00 0.00 ?  632  TYR A HE1  2  
ATOM 2865  H HE2  . TYR A 1 76 ? 0.760   -5.809  0.738   1.00 0.00 ?  632  TYR A HE2  2  
ATOM 2866  H HH   . TYR A 1 76 ? 0.381   -8.169  1.155   1.00 0.00 ?  632  TYR A HH   2  
ATOM 2867  N N    . VAL A 1 77 ? 4.327   -3.128  2.888   1.00 0.00 ?  633  VAL A N    2  
ATOM 2868  C CA   . VAL A 1 77 ? 5.092   -3.451  1.714   1.00 0.00 ?  633  VAL A CA   2  
ATOM 2869  C C    . VAL A 1 77 ? 6.544   -3.676  2.079   1.00 0.00 ?  633  VAL A C    2  
ATOM 2870  O O    . VAL A 1 77 ? 7.189   -4.580  1.541   1.00 0.00 ?  633  VAL A O    2  
ATOM 2871  C CB   . VAL A 1 77 ? 4.949   -2.395  0.595   1.00 0.00 ?  633  VAL A CB   2  
ATOM 2872  C CG1  . VAL A 1 77 ? 5.777   -2.788  -0.602  1.00 0.00 ?  633  VAL A CG1  2  
ATOM 2873  C CG2  . VAL A 1 77 ? 3.503   -2.280  0.179   1.00 0.00 ?  633  VAL A CG2  2  
ATOM 2874  H H    . VAL A 1 77 ? 3.938   -2.229  2.998   1.00 0.00 ?  633  VAL A H    2  
ATOM 2875  H HA   . VAL A 1 77 ? 4.705   -4.393  1.352   1.00 0.00 ?  633  VAL A HA   2  
ATOM 2876  H HB   . VAL A 1 77 ? 5.278   -1.435  0.963   1.00 0.00 ?  633  VAL A HB   2  
ATOM 2877  H HG11 . VAL A 1 77 ? 5.424   -3.748  -0.947  1.00 0.00 ?  633  VAL A HG11 2  
ATOM 2878  H HG12 . VAL A 1 77 ? 6.812   -2.859  -0.305  1.00 0.00 ?  633  VAL A HG12 2  
ATOM 2879  H HG13 . VAL A 1 77 ? 5.651   -2.052  -1.379  1.00 0.00 ?  633  VAL A HG13 2  
ATOM 2880  H HG21 . VAL A 1 77 ? 3.401   -1.519  -0.581  1.00 0.00 ?  633  VAL A HG21 2  
ATOM 2881  H HG22 . VAL A 1 77 ? 2.911   -2.014  1.042   1.00 0.00 ?  633  VAL A HG22 2  
ATOM 2882  H HG23 . VAL A 1 77 ? 3.160   -3.226  -0.211  1.00 0.00 ?  633  VAL A HG23 2  
ATOM 2883  N N    . LYS A 1 78 ? 7.041   -2.894  3.032   1.00 0.00 ?  634  LYS A N    2  
ATOM 2884  C CA   . LYS A 1 78 ? 8.389   -3.074  3.522   1.00 0.00 ?  634  LYS A CA   2  
ATOM 2885  C C    . LYS A 1 78 ? 8.546   -4.484  4.093   1.00 0.00 ?  634  LYS A C    2  
ATOM 2886  O O    . LYS A 1 78 ? 9.508   -5.163  3.795   1.00 0.00 ?  634  LYS A O    2  
ATOM 2887  C CB   . LYS A 1 78 ? 8.763   -2.031  4.577   1.00 0.00 ?  634  LYS A CB   2  
ATOM 2888  C CG   . LYS A 1 78 ? 10.205  -2.170  5.048   1.00 0.00 ?  634  LYS A CG   2  
ATOM 2889  C CD   . LYS A 1 78 ? 10.570  -1.165  6.116   1.00 0.00 ?  634  LYS A CD   2  
ATOM 2890  C CE   . LYS A 1 78 ? 12.005  -1.377  6.566   1.00 0.00 ?  634  LYS A CE   2  
ATOM 2891  N NZ   . LYS A 1 78 ? 12.377  -0.518  7.696   1.00 0.00 1  634  LYS A NZ   2  
ATOM 2892  H H    . LYS A 1 78 ? 6.491   -2.162  3.391   1.00 0.00 ?  634  LYS A H    2  
ATOM 2893  H HA   . LYS A 1 78 ? 9.050   -2.975  2.675   1.00 0.00 ?  634  LYS A HA   2  
ATOM 2894  H HB2  . LYS A 1 78 ? 8.623   -1.044  4.160   1.00 0.00 ?  634  LYS A HB2  2  
ATOM 2895  H HB3  . LYS A 1 78 ? 8.110   -2.150  5.428   1.00 0.00 ?  634  LYS A HB3  2  
ATOM 2896  H HG2  . LYS A 1 78 ? 10.341  -3.164  5.446   1.00 0.00 ?  634  LYS A HG2  2  
ATOM 2897  H HG3  . LYS A 1 78 ? 10.859  -2.039  4.198   1.00 0.00 ?  634  LYS A HG3  2  
ATOM 2898  H HD2  . LYS A 1 78 ? 10.470  -0.171  5.707   1.00 0.00 ?  634  LYS A HD2  2  
ATOM 2899  H HD3  . LYS A 1 78 ? 9.910   -1.279  6.961   1.00 0.00 ?  634  LYS A HD3  2  
ATOM 2900  H HE2  . LYS A 1 78 ? 12.134  -2.408  6.858   1.00 0.00 ?  634  LYS A HE2  2  
ATOM 2901  H HE3  . LYS A 1 78 ? 12.658  -1.157  5.734   1.00 0.00 ?  634  LYS A HE3  2  
ATOM 2902  H HZ1  . LYS A 1 78 ? 12.308  0.491   7.465   1.00 0.00 ?  634  LYS A HZ1  2  
ATOM 2903  H HZ2  . LYS A 1 78 ? 13.355  -0.711  7.990   1.00 0.00 ?  634  LYS A HZ2  2  
ATOM 2904  H HZ3  . LYS A 1 78 ? 11.775  -0.710  8.523   1.00 0.00 ?  634  LYS A HZ3  2  
ATOM 2905  N N    . SER A 1 79 ? 7.551   -4.930  4.850   1.00 0.00 ?  635  SER A N    2  
ATOM 2906  C CA   . SER A 1 79 ? 7.549   -6.262  5.435   1.00 0.00 ?  635  SER A CA   2  
ATOM 2907  C C    . SER A 1 79 ? 7.644   -7.335  4.328   1.00 0.00 ?  635  SER A C    2  
ATOM 2908  O O    . SER A 1 79 ? 8.358   -8.343  4.475   1.00 0.00 ?  635  SER A O    2  
ATOM 2909  C CB   . SER A 1 79 ? 6.277   -6.464  6.295   1.00 0.00 ?  635  SER A CB   2  
ATOM 2910  O OG   . SER A 1 79 ? 6.248   -7.747  6.912   1.00 0.00 ?  635  SER A OG   2  
ATOM 2911  H H    . SER A 1 79 ? 6.788   -4.334  5.024   1.00 0.00 ?  635  SER A H    2  
ATOM 2912  H HA   . SER A 1 79 ? 8.419   -6.343  6.070   1.00 0.00 ?  635  SER A HA   2  
ATOM 2913  H HB2  . SER A 1 79 ? 6.243   -5.710  7.067   1.00 0.00 ?  635  SER A HB2  2  
ATOM 2914  H HB3  . SER A 1 79 ? 5.408   -6.363  5.663   1.00 0.00 ?  635  SER A HB3  2  
ATOM 2915  H HG   . SER A 1 79 ? 6.581   -7.661  7.816   1.00 0.00 ?  635  SER A HG   2  
ATOM 2916  N N    . CYS A 1 80 ? 6.964   -7.092  3.216   1.00 0.00 ?  636  CYS A N    2  
ATOM 2917  C CA   . CYS A 1 80 ? 6.981   -8.000  2.088   1.00 0.00 ?  636  CYS A CA   2  
ATOM 2918  C C    . CYS A 1 80 ? 8.358   -8.001  1.413   1.00 0.00 ?  636  CYS A C    2  
ATOM 2919  O O    . CYS A 1 80 ? 8.950   -9.068  1.168   1.00 0.00 ?  636  CYS A O    2  
ATOM 2920  C CB   . CYS A 1 80 ? 5.879   -7.625  1.084   1.00 0.00 ?  636  CYS A CB   2  
ATOM 2921  S SG   . CYS A 1 80 ? 5.731   -8.748  -0.330  1.00 0.00 ?  636  CYS A SG   2  
ATOM 2922  H H    . CYS A 1 80 ? 6.421   -6.276  3.167   1.00 0.00 ?  636  CYS A H    2  
ATOM 2923  H HA   . CYS A 1 80 ? 6.782   -8.991  2.461   1.00 0.00 ?  636  CYS A HA   2  
ATOM 2924  H HB2  . CYS A 1 80 ? 4.927   -7.618  1.593   1.00 0.00 ?  636  CYS A HB2  2  
ATOM 2925  H HB3  . CYS A 1 80 ? 6.081   -6.635  0.702   1.00 0.00 ?  636  CYS A HB3  2  
ATOM 2926  H HG   . CYS A 1 80 ? 6.153   -9.937  0.084   1.00 0.00 ?  636  CYS A HG   2  
ATOM 2927  N N    . LEU A 1 81 ? 8.896   -6.814  1.165   1.00 0.00 ?  637  LEU A N    2  
ATOM 2928  C CA   . LEU A 1 81 ? 10.170  -6.696  0.493   1.00 0.00 ?  637  LEU A CA   2  
ATOM 2929  C C    . LEU A 1 81 ? 11.364  -7.028  1.384   1.00 0.00 ?  637  LEU A C    2  
ATOM 2930  O O    . LEU A 1 81 ? 12.479  -7.117  0.901   1.00 0.00 ?  637  LEU A O    2  
ATOM 2931  C CB   . LEU A 1 81 ? 10.307  -5.370  -0.296  1.00 0.00 ?  637  LEU A CB   2  
ATOM 2932  C CG   . LEU A 1 81 ? 10.127  -4.058  0.455   1.00 0.00 ?  637  LEU A CG   2  
ATOM 2933  C CD1  . LEU A 1 81 ? 11.289  -3.795  1.376   1.00 0.00 ?  637  LEU A CD1  2  
ATOM 2934  C CD2  . LEU A 1 81 ? 9.944   -2.923  -0.523  1.00 0.00 ?  637  LEU A CD2  2  
ATOM 2935  H H    . LEU A 1 81 ? 8.415   -5.999  1.435   1.00 0.00 ?  637  LEU A H    2  
ATOM 2936  H HA   . LEU A 1 81 ? 10.168  -7.497  -0.227  1.00 0.00 ?  637  LEU A HA   2  
ATOM 2937  H HB2  . LEU A 1 81 ? 11.292  -5.352  -0.740  1.00 0.00 ?  637  LEU A HB2  2  
ATOM 2938  H HB3  . LEU A 1 81 ? 9.586   -5.399  -1.100  1.00 0.00 ?  637  LEU A HB3  2  
ATOM 2939  H HG   . LEU A 1 81 ? 9.229   -4.133  1.050   1.00 0.00 ?  637  LEU A HG   2  
ATOM 2940  H HD11 . LEU A 1 81 ? 11.125  -2.907  1.967   1.00 0.00 ?  637  LEU A HD11 2  
ATOM 2941  H HD12 . LEU A 1 81 ? 12.182  -3.686  0.778   1.00 0.00 ?  637  LEU A HD12 2  
ATOM 2942  H HD13 . LEU A 1 81 ? 11.388  -4.664  2.010   1.00 0.00 ?  637  LEU A HD13 2  
ATOM 2943  H HD21 . LEU A 1 81 ? 9.807   -1.999  0.018   1.00 0.00 ?  637  LEU A HD21 2  
ATOM 2944  H HD22 . LEU A 1 81 ? 9.077   -3.127  -1.134  1.00 0.00 ?  637  LEU A HD22 2  
ATOM 2945  H HD23 . LEU A 1 81 ? 10.820  -2.855  -1.150  1.00 0.00 ?  637  LEU A HD23 2  
ATOM 2946  N N    . GLN A 1 82 ? 11.124  -7.174  2.688   1.00 0.00 ?  638  GLN A N    2  
ATOM 2947  C CA   . GLN A 1 82 ? 12.144  -7.673  3.611   1.00 0.00 ?  638  GLN A CA   2  
ATOM 2948  C C    . GLN A 1 82 ? 12.435  -9.113  3.281   1.00 0.00 ?  638  GLN A C    2  
ATOM 2949  O O    . GLN A 1 82 ? 13.589  -9.538  3.192   1.00 0.00 ?  638  GLN A O    2  
ATOM 2950  C CB   . GLN A 1 82 ? 11.659  -7.652  5.053   1.00 0.00 ?  638  GLN A CB   2  
ATOM 2951  C CG   . GLN A 1 82 ? 11.549  -6.304  5.722   1.00 0.00 ?  638  GLN A CG   2  
ATOM 2952  C CD   . GLN A 1 82 ? 11.021  -6.431  7.144   1.00 0.00 ?  638  GLN A CD   2  
ATOM 2953  O OE1  . GLN A 1 82 ? 10.374  -5.520  7.668   1.00 0.00 ?  638  GLN A OE1  2  
ATOM 2954  N NE2  . GLN A 1 82 ? 11.273  -7.560  7.781   1.00 0.00 ?  638  GLN A NE2  2  
ATOM 2955  H H    . GLN A 1 82 ? 10.248  -6.898  3.035   1.00 0.00 ?  638  GLN A H    2  
ATOM 2956  H HA   . GLN A 1 82 ? 13.039  -7.076  3.521   1.00 0.00 ?  638  GLN A HA   2  
ATOM 2957  H HB2  . GLN A 1 82 ? 10.680  -8.109  5.086   1.00 0.00 ?  638  GLN A HB2  2  
ATOM 2958  H HB3  . GLN A 1 82 ? 12.336  -8.262  5.630   1.00 0.00 ?  638  GLN A HB3  2  
ATOM 2959  H HG2  . GLN A 1 82 ? 12.521  -5.835  5.744   1.00 0.00 ?  638  GLN A HG2  2  
ATOM 2960  H HG3  . GLN A 1 82 ? 10.864  -5.690  5.155   1.00 0.00 ?  638  GLN A HG3  2  
ATOM 2961  H HE21 . GLN A 1 82 ? 11.782  -8.273  7.334   1.00 0.00 ?  638  GLN A HE21 2  
ATOM 2962  H HE22 . GLN A 1 82 ? 10.938  -7.663  8.696   1.00 0.00 ?  638  GLN A HE22 2  
ATOM 2963  N N    . LYS A 1 83 ? 11.366  -9.863  3.111   1.00 0.00 ?  639  LYS A N    2  
ATOM 2964  C CA   . LYS A 1 83 ? 11.458  -11.260 2.831   1.00 0.00 ?  639  LYS A CA   2  
ATOM 2965  C C    . LYS A 1 83 ? 11.907  -11.466 1.405   1.00 0.00 ?  639  LYS A C    2  
ATOM 2966  O O    . LYS A 1 83 ? 12.730  -12.331 1.123   1.00 0.00 ?  639  LYS A O    2  
ATOM 2967  C CB   . LYS A 1 83 ? 10.122  -11.948 3.109   1.00 0.00 ?  639  LYS A CB   2  
ATOM 2968  C CG   . LYS A 1 83 ? 10.160  -13.444 2.881   1.00 0.00 ?  639  LYS A CG   2  
ATOM 2969  C CD   . LYS A 1 83 ? 8.852   -14.127 3.267   1.00 0.00 ?  639  LYS A CD   2  
ATOM 2970  C CE   . LYS A 1 83 ? 8.598   -14.053 4.772   1.00 0.00 ?  639  LYS A CE   2  
ATOM 2971  N NZ   . LYS A 1 83 ? 7.361   -14.761 5.162   1.00 0.00 1  639  LYS A NZ   2  
ATOM 2972  H H    . LYS A 1 83 ? 10.485  -9.437  3.164   1.00 0.00 ?  639  LYS A H    2  
ATOM 2973  H HA   . LYS A 1 83 ? 12.209  -11.694 3.474   1.00 0.00 ?  639  LYS A HA   2  
ATOM 2974  H HB2  . LYS A 1 83 ? 9.848   -11.761 4.136   1.00 0.00 ?  639  LYS A HB2  2  
ATOM 2975  H HB3  . LYS A 1 83 ? 9.369   -11.522 2.461   1.00 0.00 ?  639  LYS A HB3  2  
ATOM 2976  H HG2  . LYS A 1 83 ? 10.383  -13.623 1.842   1.00 0.00 ?  639  LYS A HG2  2  
ATOM 2977  H HG3  . LYS A 1 83 ? 10.961  -13.847 3.481   1.00 0.00 ?  639  LYS A HG3  2  
ATOM 2978  H HD2  . LYS A 1 83 ? 8.038   -13.639 2.751   1.00 0.00 ?  639  LYS A HD2  2  
ATOM 2979  H HD3  . LYS A 1 83 ? 8.903   -15.163 2.969   1.00 0.00 ?  639  LYS A HD3  2  
ATOM 2980  H HE2  . LYS A 1 83 ? 9.435   -14.499 5.286   1.00 0.00 ?  639  LYS A HE2  2  
ATOM 2981  H HE3  . LYS A 1 83 ? 8.522   -13.017 5.070   1.00 0.00 ?  639  LYS A HE3  2  
ATOM 2982  H HZ1  . LYS A 1 83 ? 7.222   -14.736 6.192   1.00 0.00 ?  639  LYS A HZ1  2  
ATOM 2983  H HZ2  . LYS A 1 83 ? 7.407   -15.760 4.876   1.00 0.00 ?  639  LYS A HZ2  2  
ATOM 2984  H HZ3  . LYS A 1 83 ? 6.523   -14.348 4.709   1.00 0.00 ?  639  LYS A HZ3  2  
ATOM 2985  N N    . LYS A 1 84 ? 11.393  -10.658 0.512   1.00 0.00 ?  640  LYS A N    2  
ATOM 2986  C CA   . LYS A 1 84 ? 11.789  -10.743 -0.860  1.00 0.00 ?  640  LYS A CA   2  
ATOM 2987  C C    . LYS A 1 84 ? 12.815  -9.688  -1.218  1.00 0.00 ?  640  LYS A C    2  
ATOM 2988  O O    . LYS A 1 84 ? 12.472  -8.601  -1.706  1.00 0.00 ?  640  LYS A O    2  
ATOM 2989  C CB   . LYS A 1 84 ? 10.600  -10.693 -1.815  1.00 0.00 ?  640  LYS A CB   2  
ATOM 2990  C CG   . LYS A 1 84 ? 9.690   -11.897 -1.726  1.00 0.00 ?  640  LYS A CG   2  
ATOM 2991  C CD   . LYS A 1 84 ? 8.557   -11.783 -2.719  1.00 0.00 ?  640  LYS A CD   2  
ATOM 2992  C CE   . LYS A 1 84 ? 7.689   -13.022 -2.709  1.00 0.00 ?  640  LYS A CE   2  
ATOM 2993  N NZ   . LYS A 1 84 ? 6.577   -12.909 -3.669  1.00 0.00 1  640  LYS A NZ   2  
ATOM 2994  H H    . LYS A 1 84 ? 10.735  -9.983  0.790   1.00 0.00 ?  640  LYS A H    2  
ATOM 2995  H HA   . LYS A 1 84 ? 12.268  -11.704 -0.974  1.00 0.00 ?  640  LYS A HA   2  
ATOM 2996  H HB2  . LYS A 1 84 ? 10.017  -9.811  -1.592  1.00 0.00 ?  640  LYS A HB2  2  
ATOM 2997  H HB3  . LYS A 1 84 ? 10.968  -10.619 -2.827  1.00 0.00 ?  640  LYS A HB3  2  
ATOM 2998  H HG2  . LYS A 1 84 ? 10.262  -12.787 -1.942  1.00 0.00 ?  640  LYS A HG2  2  
ATOM 2999  H HG3  . LYS A 1 84 ? 9.280   -11.959 -0.728  1.00 0.00 ?  640  LYS A HG3  2  
ATOM 3000  H HD2  . LYS A 1 84 ? 7.945   -10.931 -2.461  1.00 0.00 ?  640  LYS A HD2  2  
ATOM 3001  H HD3  . LYS A 1 84 ? 8.968   -11.648 -3.708  1.00 0.00 ?  640  LYS A HD3  2  
ATOM 3002  H HE2  . LYS A 1 84 ? 8.297   -13.873 -2.974  1.00 0.00 ?  640  LYS A HE2  2  
ATOM 3003  H HE3  . LYS A 1 84 ? 7.290   -13.161 -1.717  1.00 0.00 ?  640  LYS A HE3  2  
ATOM 3004  H HZ1  . LYS A 1 84 ? 6.918   -12.756 -4.637  1.00 0.00 ?  640  LYS A HZ1  2  
ATOM 3005  H HZ2  . LYS A 1 84 ? 5.976   -12.095 -3.431  1.00 0.00 ?  640  LYS A HZ2  2  
ATOM 3006  H HZ3  . LYS A 1 84 ? 5.977   -13.756 -3.659  1.00 0.00 ?  640  LYS A HZ3  2  
ATOM 3007  N N    . GLN A 1 85 ? 14.060  -9.980  -0.922  1.00 0.00 ?  641  GLN A N    2  
ATOM 3008  C CA   . GLN A 1 85 ? 15.149  -9.122  -1.316  1.00 0.00 ?  641  GLN A CA   2  
ATOM 3009  C C    . GLN A 1 85 ? 15.344  -9.311  -2.803  1.00 0.00 ?  641  GLN A C    2  
ATOM 3010  O O    . GLN A 1 85 ? 15.317  -10.448 -3.296  1.00 0.00 ?  641  GLN A O    2  
ATOM 3011  C CB   . GLN A 1 85 ? 16.448  -9.476  -0.573  1.00 0.00 ?  641  GLN A CB   2  
ATOM 3012  C CG   . GLN A 1 85 ? 16.422  -9.243  0.932   1.00 0.00 ?  641  GLN A CG   2  
ATOM 3013  C CD   . GLN A 1 85 ? 16.274  -7.779  1.320   1.00 0.00 ?  641  GLN A CD   2  
ATOM 3014  O OE1  . GLN A 1 85 ? 15.186  -7.274  1.492   1.00 0.00 ?  641  GLN A OE1  2  
ATOM 3015  N NE2  . GLN A 1 85 ? 17.369  -7.097  1.478   1.00 0.00 ?  641  GLN A NE2  2  
ATOM 3016  H H    . GLN A 1 85 ? 14.249  -10.811 -0.437  1.00 0.00 ?  641  GLN A H    2  
ATOM 3017  H HA   . GLN A 1 85 ? 14.869  -8.100  -1.109  1.00 0.00 ?  641  GLN A HA   2  
ATOM 3018  H HB2  . GLN A 1 85 ? 16.665  -10.521 -0.742  1.00 0.00 ?  641  GLN A HB2  2  
ATOM 3019  H HB3  . GLN A 1 85 ? 17.252  -8.888  -0.993  1.00 0.00 ?  641  GLN A HB3  2  
ATOM 3020  H HG2  . GLN A 1 85 ? 15.587  -9.788  1.348   1.00 0.00 ?  641  GLN A HG2  2  
ATOM 3021  H HG3  . GLN A 1 85 ? 17.342  -9.621  1.355   1.00 0.00 ?  641  GLN A HG3  2  
ATOM 3022  H HE21 . GLN A 1 85 ? 18.233  -7.546  1.347   1.00 0.00 ?  641  GLN A HE21 2  
ATOM 3023  H HE22 . GLN A 1 85 ? 17.307  -6.148  1.720   1.00 0.00 ?  641  GLN A HE22 2  
ATOM 3024  N N    . ARG A 1 86 ? 15.515  -8.251  -3.512  1.00 0.00 ?  642  ARG A N    2  
ATOM 3025  C CA   . ARG A 1 86 ? 15.646  -8.320  -4.942  1.00 0.00 ?  642  ARG A CA   2  
ATOM 3026  C C    . ARG A 1 86 ? 16.952  -7.733  -5.402  1.00 0.00 ?  642  ARG A C    2  
ATOM 3027  O O    . ARG A 1 86 ? 17.664  -7.075  -4.630  1.00 0.00 ?  642  ARG A O    2  
ATOM 3028  C CB   . ARG A 1 86 ? 14.463  -7.645  -5.636  1.00 0.00 ?  642  ARG A CB   2  
ATOM 3029  C CG   . ARG A 1 86 ? 13.146  -8.373  -5.429  1.00 0.00 ?  642  ARG A CG   2  
ATOM 3030  C CD   . ARG A 1 86 ? 11.994  -7.645  -6.084  1.00 0.00 ?  642  ARG A CD   2  
ATOM 3031  N NE   . ARG A 1 86 ? 11.739  -6.335  -5.480  1.00 0.00 ?  642  ARG A NE   2  
ATOM 3032  C CZ   . ARG A 1 86 ? 10.837  -5.456  -5.922  1.00 0.00 ?  642  ARG A CZ   2  
ATOM 3033  N NH1  . ARG A 1 86 ? 10.189  -5.681  -7.072  1.00 0.00 1  642  ARG A NH1  2  
ATOM 3034  N NH2  . ARG A 1 86 ? 10.619  -4.337  -5.239  1.00 0.00 ?  642  ARG A NH2  2  
ATOM 3035  H H    . ARG A 1 86 ? 15.585  -7.377  -3.071  1.00 0.00 ?  642  ARG A H    2  
ATOM 3036  H HA   . ARG A 1 86 ? 15.639  -9.366  -5.208  1.00 0.00 ?  642  ARG A HA   2  
ATOM 3037  H HB2  . ARG A 1 86 ? 14.362  -6.641  -5.252  1.00 0.00 ?  642  ARG A HB2  2  
ATOM 3038  H HB3  . ARG A 1 86 ? 14.666  -7.600  -6.695  1.00 0.00 ?  642  ARG A HB3  2  
ATOM 3039  H HG2  . ARG A 1 86 ? 13.221  -9.360  -5.862  1.00 0.00 ?  642  ARG A HG2  2  
ATOM 3040  H HG3  . ARG A 1 86 ? 12.956  -8.458  -4.369  1.00 0.00 ?  642  ARG A HG3  2  
ATOM 3041  H HD2  . ARG A 1 86 ? 12.227  -7.502  -7.128  1.00 0.00 ?  642  ARG A HD2  2  
ATOM 3042  H HD3  . ARG A 1 86 ? 11.106  -8.252  -5.991  1.00 0.00 ?  642  ARG A HD3  2  
ATOM 3043  H HE   . ARG A 1 86 ? 12.265  -6.147  -4.668  1.00 0.00 ?  642  ARG A HE   2  
ATOM 3044  H HH11 . ARG A 1 86 ? 10.365  -6.507  -7.619  1.00 0.00 ?  642  ARG A HH11 2  
ATOM 3045  H HH12 . ARG A 1 86 ? 9.524   -5.049  -7.480  1.00 0.00 ?  642  ARG A HH12 2  
ATOM 3046  H HH21 . ARG A 1 86 ? 11.125  -4.123  -4.397  1.00 0.00 ?  642  ARG A HH21 2  
ATOM 3047  H HH22 . ARG A 1 86 ? 9.921   -3.660  -5.489  1.00 0.00 ?  642  ARG A HH22 2  
ATOM 3048  N N    . LYS A 1 87 ? 17.269  -7.990  -6.635  1.00 0.00 ?  643  LYS A N    2  
ATOM 3049  C CA   . LYS A 1 87 ? 18.480  -7.541  -7.254  1.00 0.00 ?  643  LYS A CA   2  
ATOM 3050  C C    . LYS A 1 87 ? 18.216  -7.310  -8.745  1.00 0.00 ?  643  LYS A C    2  
ATOM 3051  O O    . LYS A 1 87 ? 18.700  -8.099  -9.592  1.00 0.00 ?  643  LYS A O    2  
ATOM 3052  C CB   . LYS A 1 87 ? 19.590  -8.589  -7.053  1.00 0.00 ?  643  LYS A CB   2  
ATOM 3053  C CG   . LYS A 1 87 ? 19.136  -10.025 -7.357  1.00 0.00 ?  643  LYS A CG   2  
ATOM 3054  C CD   . LYS A 1 87 ? 20.299  -10.967 -7.590  1.00 0.00 ?  643  LYS A CD   2  
ATOM 3055  C CE   . LYS A 1 87 ? 21.090  -10.554 -8.826  1.00 0.00 ?  643  LYS A CE   2  
ATOM 3056  N NZ   . LYS A 1 87 ? 20.217  -10.391 -10.018 1.00 0.00 1  643  LYS A NZ   2  
ATOM 3057  O OXT  . LYS A 1 87 ? 17.453  -6.390  -9.068  1.00 0.00 ?  643  LYS A OXT  2  
ATOM 3058  H H    . LYS A 1 87 ? 16.654  -8.507  -7.201  1.00 0.00 ?  643  LYS A H    2  
ATOM 3059  H HA   . LYS A 1 87 ? 18.778  -6.611  -6.795  1.00 0.00 ?  643  LYS A HA   2  
ATOM 3060  H HB2  . LYS A 1 87 ? 20.414  -8.336  -7.703  1.00 0.00 ?  643  LYS A HB2  2  
ATOM 3061  H HB3  . LYS A 1 87 ? 19.925  -8.545  -6.029  1.00 0.00 ?  643  LYS A HB3  2  
ATOM 3062  H HG2  . LYS A 1 87 ? 18.551  -10.390 -6.528  1.00 0.00 ?  643  LYS A HG2  2  
ATOM 3063  H HG3  . LYS A 1 87 ? 18.518  -10.003 -8.241  1.00 0.00 ?  643  LYS A HG3  2  
ATOM 3064  H HD2  . LYS A 1 87 ? 20.952  -10.940 -6.730  1.00 0.00 ?  643  LYS A HD2  2  
ATOM 3065  H HD3  . LYS A 1 87 ? 19.922  -11.969 -7.730  1.00 0.00 ?  643  LYS A HD3  2  
ATOM 3066  H HE2  . LYS A 1 87 ? 21.619  -9.633  -8.638  1.00 0.00 ?  643  LYS A HE2  2  
ATOM 3067  H HE3  . LYS A 1 87 ? 21.807  -11.334 -9.033  1.00 0.00 ?  643  LYS A HE3  2  
ATOM 3068  H HZ1  . LYS A 1 87 ? 19.708  -11.275 -10.222 1.00 0.00 ?  643  LYS A HZ1  2  
ATOM 3069  H HZ2  . LYS A 1 87 ? 20.796  -10.158 -10.849 1.00 0.00 ?  643  LYS A HZ2  2  
ATOM 3070  H HZ3  . LYS A 1 87 ? 19.521  -9.623  -9.876  1.00 0.00 ?  643  LYS A HZ3  2  
ATOM 3071  N N    . ARG B 2 1  ? -5.253  5.808   -17.787 1.00 0.00 ?  1591 ARG B N    2  
ATOM 3072  C CA   . ARG B 2 1  ? -5.053  5.780   -16.348 1.00 0.00 ?  1591 ARG B CA   2  
ATOM 3073  C C    . ARG B 2 1  ? -3.665  6.286   -16.002 1.00 0.00 ?  1591 ARG B C    2  
ATOM 3074  O O    . ARG B 2 1  ? -2.672  5.554   -16.051 1.00 0.00 ?  1591 ARG B O    2  
ATOM 3075  C CB   . ARG B 2 1  ? -5.340  4.377   -15.744 1.00 0.00 ?  1591 ARG B CB   2  
ATOM 3076  C CG   . ARG B 2 1  ? -4.599  3.227   -16.419 1.00 0.00 ?  1591 ARG B CG   2  
ATOM 3077  C CD   . ARG B 2 1  ? -4.833  1.900   -15.721 1.00 0.00 ?  1591 ARG B CD   2  
ATOM 3078  N NE   . ARG B 2 1  ? -4.129  0.810   -16.404 1.00 0.00 ?  1591 ARG B NE   2  
ATOM 3079  C CZ   . ARG B 2 1  ? -3.701  -0.330  -15.833 1.00 0.00 ?  1591 ARG B CZ   2  
ATOM 3080  N NH1  . ARG B 2 1  ? -3.872  -0.545  -14.524 1.00 0.00 1  1591 ARG B NH1  2  
ATOM 3081  N NH2  . ARG B 2 1  ? -3.085  -1.242  -16.572 1.00 0.00 ?  1591 ARG B NH2  2  
ATOM 3082  H H1   . ARG B 2 1  ? -4.513  5.250   -18.256 1.00 0.00 ?  1591 ARG B H1   2  
ATOM 3083  H HA   . ARG B 2 1  ? -5.753  6.492   -15.935 1.00 0.00 ?  1591 ARG B HA   2  
ATOM 3084  H HB2  . ARG B 2 1  ? -5.059  4.386   -14.702 1.00 0.00 ?  1591 ARG B HB2  2  
ATOM 3085  H HB3  . ARG B 2 1  ? -6.401  4.185   -15.811 1.00 0.00 ?  1591 ARG B HB3  2  
ATOM 3086  H HG2  . ARG B 2 1  ? -4.949  3.142   -17.436 1.00 0.00 ?  1591 ARG B HG2  2  
ATOM 3087  H HG3  . ARG B 2 1  ? -3.540  3.447   -16.421 1.00 0.00 ?  1591 ARG B HG3  2  
ATOM 3088  H HD2  . ARG B 2 1  ? -4.469  1.974   -14.708 1.00 0.00 ?  1591 ARG B HD2  2  
ATOM 3089  H HD3  . ARG B 2 1  ? -5.891  1.684   -15.711 1.00 0.00 ?  1591 ARG B HD3  2  
ATOM 3090  H HE   . ARG B 2 1  ? -3.971  0.965   -17.364 1.00 0.00 ?  1591 ARG B HE   2  
ATOM 3091  H HH11 . ARG B 2 1  ? -4.315  0.128   -13.927 1.00 0.00 ?  1591 ARG B HH11 2  
ATOM 3092  H HH12 . ARG B 2 1  ? -3.563  -1.389  -14.074 1.00 0.00 ?  1591 ARG B HH12 2  
ATOM 3093  H HH21 . ARG B 2 1  ? -2.928  -1.124  -17.557 1.00 0.00 ?  1591 ARG B HH21 2  
ATOM 3094  H HH22 . ARG B 2 1  ? -2.724  -2.088  -16.173 1.00 0.00 ?  1591 ARG B HH22 2  
ATOM 3095  N N    . SER B 2 2  ? -3.591  7.549   -15.727 1.00 0.00 ?  1592 SER B N    2  
ATOM 3096  C CA   . SER B 2 2  ? -2.355  8.178   -15.389 1.00 0.00 ?  1592 SER B CA   2  
ATOM 3097  C C    . SER B 2 2  ? -2.220  8.227   -13.874 1.00 0.00 ?  1592 SER B C    2  
ATOM 3098  O O    . SER B 2 2  ? -1.213  7.800   -13.310 1.00 0.00 ?  1592 SER B O    2  
ATOM 3099  C CB   . SER B 2 2  ? -2.343  9.591   -15.969 1.00 0.00 ?  1592 SER B CB   2  
ATOM 3100  O OG   . SER B 2 2  ? -2.718  9.571   -17.346 1.00 0.00 ?  1592 SER B OG   2  
ATOM 3101  H H    . SER B 2 2  ? -4.395  8.109   -15.747 1.00 0.00 ?  1592 SER B H    2  
ATOM 3102  H HA   . SER B 2 2  ? -1.547  7.612   -15.822 1.00 0.00 ?  1592 SER B HA   2  
ATOM 3103  H HB2  . SER B 2 2  ? -3.043  10.207  -15.424 1.00 0.00 ?  1592 SER B HB2  2  
ATOM 3104  H HB3  . SER B 2 2  ? -1.351  10.008  -15.884 1.00 0.00 ?  1592 SER B HB3  2  
ATOM 3105  H HG   . SER B 2 2  ? -3.114  10.433  -17.530 1.00 0.00 ?  1592 SER B HG   2  
ATOM 3106  N N    . VAL B 2 3  ? -3.270  8.693   -13.231 1.00 0.00 ?  1593 VAL B N    2  
ATOM 3107  C CA   . VAL B 2 3  ? -3.295  8.876   -11.802 1.00 0.00 ?  1593 VAL B CA   2  
ATOM 3108  C C    . VAL B 2 3  ? -4.370  7.986   -11.177 1.00 0.00 ?  1593 VAL B C    2  
ATOM 3109  O O    . VAL B 2 3  ? -4.819  7.027   -11.817 1.00 0.00 ?  1593 VAL B O    2  
ATOM 3110  C CB   . VAL B 2 3  ? -3.532  10.379  -11.431 1.00 0.00 ?  1593 VAL B CB   2  
ATOM 3111  C CG1  . VAL B 2 3  ? -2.365  11.236  -11.893 1.00 0.00 ?  1593 VAL B CG1  2  
ATOM 3112  C CG2  . VAL B 2 3  ? -4.837  10.910  -12.028 1.00 0.00 ?  1593 VAL B CG2  2  
ATOM 3113  H H    . VAL B 2 3  ? -4.093  8.893   -13.726 1.00 0.00 ?  1593 VAL B H    2  
ATOM 3114  H HA   . VAL B 2 3  ? -2.332  8.573   -11.417 1.00 0.00 ?  1593 VAL B HA   2  
ATOM 3115  H HB   . VAL B 2 3  ? -3.584  10.458  -10.356 1.00 0.00 ?  1593 VAL B HB   2  
ATOM 3116  H HG11 . VAL B 2 3  ? -2.549  12.268  -11.631 1.00 0.00 ?  1593 VAL B HG11 2  
ATOM 3117  H HG12 . VAL B 2 3  ? -2.262  11.151  -12.964 1.00 0.00 ?  1593 VAL B HG12 2  
ATOM 3118  H HG13 . VAL B 2 3  ? -1.457  10.900  -11.415 1.00 0.00 ?  1593 VAL B HG13 2  
ATOM 3119  H HG21 . VAL B 2 3  ? -4.797  10.830  -13.104 1.00 0.00 ?  1593 VAL B HG21 2  
ATOM 3120  H HG22 . VAL B 2 3  ? -4.964  11.945  -11.750 1.00 0.00 ?  1593 VAL B HG22 2  
ATOM 3121  H HG23 . VAL B 2 3  ? -5.667  10.332  -11.652 1.00 0.00 ?  1593 VAL B HG23 2  
ATOM 3122  N N    . LYS B 2 4  ? -4.757  8.318   -9.931  1.00 0.00 ?  1594 LYS B N    2  
ATOM 3123  C CA   . LYS B 2 4  ? -5.779  7.612   -9.126  1.00 0.00 ?  1594 LYS B CA   2  
ATOM 3124  C C    . LYS B 2 4  ? -5.230  6.398   -8.421  1.00 0.00 ?  1594 LYS B C    2  
ATOM 3125  O O    . LYS B 2 4  ? -4.501  5.574   -8.989  1.00 0.00 ?  1594 LYS B O    2  
ATOM 3126  C CB   . LYS B 2 4  ? -7.072  7.255   -9.894  1.00 0.00 ?  1594 LYS B CB   2  
ATOM 3127  C CG   . LYS B 2 4  ? -7.777  8.433   -10.558 1.00 0.00 ?  1594 LYS B CG   2  
ATOM 3128  C CD   . LYS B 2 4  ? -9.117  8.024   -11.156 1.00 0.00 ?  1594 LYS B CD   2  
ATOM 3129  C CE   . LYS B 2 4  ? -8.980  6.884   -12.151 1.00 0.00 ?  1594 LYS B CE   2  
ATOM 3130  N NZ   . LYS B 2 4  ? -10.279 6.520   -12.750 1.00 0.00 1  1594 LYS B NZ   2  
ATOM 3131  H H    . LYS B 2 4  ? -4.334  9.096   -9.509  1.00 0.00 ?  1594 LYS B H    2  
ATOM 3132  H HA   . LYS B 2 4  ? -6.040  8.267   -8.297  1.00 0.00 ?  1594 LYS B HA   2  
ATOM 3133  H HB2  . LYS B 2 4  ? -6.815  6.543   -10.663 1.00 0.00 ?  1594 LYS B HB2  2  
ATOM 3134  H HB3  . LYS B 2 4  ? -7.763  6.787   -9.207  1.00 0.00 ?  1594 LYS B HB3  2  
ATOM 3135  H HG2  . LYS B 2 4  ? -7.942  9.205   -9.820  1.00 0.00 ?  1594 LYS B HG2  2  
ATOM 3136  H HG3  . LYS B 2 4  ? -7.144  8.816   -11.345 1.00 0.00 ?  1594 LYS B HG3  2  
ATOM 3137  H HD2  . LYS B 2 4  ? -9.772  7.709   -10.358 1.00 0.00 ?  1594 LYS B HD2  2  
ATOM 3138  H HD3  . LYS B 2 4  ? -9.553  8.876   -11.657 1.00 0.00 ?  1594 LYS B HD3  2  
ATOM 3139  H HE2  . LYS B 2 4  ? -8.294  7.181   -12.929 1.00 0.00 ?  1594 LYS B HE2  2  
ATOM 3140  H HE3  . LYS B 2 4  ? -8.581  6.022   -11.637 1.00 0.00 ?  1594 LYS B HE3  2  
ATOM 3141  H HZ1  . LYS B 2 4  ? -10.660 7.297   -13.327 1.00 0.00 ?  1594 LYS B HZ1  2  
ATOM 3142  H HZ2  . LYS B 2 4  ? -10.975 6.350   -11.994 1.00 0.00 ?  1594 LYS B HZ2  2  
ATOM 3143  H HZ3  . LYS B 2 4  ? -10.208 5.663   -13.334 1.00 0.00 ?  1594 LYS B HZ3  2  
ATOM 3144  N N    . VAL B 2 5  ? -5.608  6.296   -7.184  1.00 0.00 ?  1595 VAL B N    2  
ATOM 3145  C CA   . VAL B 2 5  ? -5.196  5.256   -6.307  1.00 0.00 ?  1595 VAL B CA   2  
ATOM 3146  C C    . VAL B 2 5  ? -6.428  4.854   -5.549  1.00 0.00 ?  1595 VAL B C    2  
ATOM 3147  O O    . VAL B 2 5  ? -6.834  5.558   -4.625  1.00 0.00 ?  1595 VAL B O    2  
ATOM 3148  C CB   . VAL B 2 5  ? -4.124  5.692   -5.244  1.00 0.00 ?  1595 VAL B CB   2  
ATOM 3149  C CG1  . VAL B 2 5  ? -3.386  4.487   -4.649  1.00 0.00 ?  1595 VAL B CG1  2  
ATOM 3150  C CG2  . VAL B 2 5  ? -3.180  6.817   -5.721  1.00 0.00 ?  1595 VAL B CG2  2  
ATOM 3151  H H    . VAL B 2 5  ? -6.271  6.935   -6.852  1.00 0.00 ?  1595 VAL B H    2  
ATOM 3152  H HA   . VAL B 2 5  ? -4.824  4.423   -6.887  1.00 0.00 ?  1595 VAL B HA   2  
ATOM 3153  H HB   . VAL B 2 5  ? -4.673  6.058   -4.383  1.00 0.00 ?  1595 VAL B HB   2  
ATOM 3154  H HG11 . VAL B 2 5  ? -4.073  3.957   -4.006  1.00 0.00 ?  1595 VAL B HG11 2  
ATOM 3155  H HG12 . VAL B 2 5  ? -2.533  4.817   -4.075  1.00 0.00 ?  1595 VAL B HG12 2  
ATOM 3156  H HG13 . VAL B 2 5  ? -3.033  3.782   -5.391  1.00 0.00 ?  1595 VAL B HG13 2  
ATOM 3157  H HG21 . VAL B 2 5  ? -3.799  7.683   -5.921  1.00 0.00 ?  1595 VAL B HG21 2  
ATOM 3158  H HG22 . VAL B 2 5  ? -2.642  6.574   -6.639  1.00 0.00 ?  1595 VAL B HG22 2  
ATOM 3159  H HG23 . VAL B 2 5  ? -2.514  7.062   -4.896  1.00 0.00 ?  1595 VAL B HG23 2  
ATOM 3160  N N    . LYS B 2 6  ? -7.087  3.828   -6.047  1.00 0.00 ?  1596 LYS B N    2  
ATOM 3161  C CA   . LYS B 2 6  ? -8.241  3.195   -5.391  1.00 0.00 ?  1596 LYS B CA   2  
ATOM 3162  C C    . LYS B 2 6  ? -8.071  1.687   -5.531  1.00 0.00 ?  1596 LYS B C    2  
ATOM 3163  O O    . LYS B 2 6  ? -8.950  0.897   -5.228  1.00 0.00 ?  1596 LYS B O    2  
ATOM 3164  C CB   . LYS B 2 6  ? -9.580  3.701   -5.994  1.00 0.00 ?  1596 LYS B CB   2  
ATOM 3165  C CG   . LYS B 2 6  ? -9.911  5.161   -5.629  1.00 0.00 ?  1596 LYS B CG   2  
ATOM 3166  C CD   . LYS B 2 6  ? -10.383 5.302   -4.166  1.00 0.00 ?  1596 LYS B CD   2  
ATOM 3167  C CE   . LYS B 2 6  ? -11.869 5.108   -4.029  1.00 0.00 ?  1596 LYS B CE   2  
ATOM 3168  N NZ   . LYS B 2 6  ? -12.243 5.002   -2.611  1.00 0.00 1  1596 LYS B NZ   2  
ATOM 3169  H H    . LYS B 2 6  ? -6.812  3.479   -6.921  1.00 0.00 ?  1596 LYS B H    2  
ATOM 3170  H HA   . LYS B 2 6  ? -8.179  3.440   -4.340  1.00 0.00 ?  1596 LYS B HA   2  
ATOM 3171  H HB2  . LYS B 2 6  ? -9.524  3.625   -7.071  1.00 0.00 ?  1596 LYS B HB2  2  
ATOM 3172  H HB3  . LYS B 2 6  ? -10.382 3.072   -5.640  1.00 0.00 ?  1596 LYS B HB3  2  
ATOM 3173  H HG2  . LYS B 2 6  ? -9.023  5.761   -5.764  1.00 0.00 ?  1596 LYS B HG2  2  
ATOM 3174  H HG3  . LYS B 2 6  ? -10.688 5.520   -6.287  1.00 0.00 ?  1596 LYS B HG3  2  
ATOM 3175  H HD2  . LYS B 2 6  ? -9.973  4.522   -3.538  1.00 0.00 ?  1596 LYS B HD2  2  
ATOM 3176  H HD3  . LYS B 2 6  ? -10.131 6.263   -3.745  1.00 0.00 ?  1596 LYS B HD3  2  
ATOM 3177  H HE2  . LYS B 2 6  ? -12.379 5.949   -4.474  1.00 0.00 ?  1596 LYS B HE2  2  
ATOM 3178  H HE3  . LYS B 2 6  ? -12.152 4.197   -4.536  1.00 0.00 ?  1596 LYS B HE3  2  
ATOM 3179  H HZ1  . LYS B 2 6  ? -13.271 4.925   -2.488  1.00 0.00 ?  1596 LYS B HZ1  2  
ATOM 3180  H HZ2  . LYS B 2 6  ? -11.872 5.796   -2.043  1.00 0.00 ?  1596 LYS B HZ2  2  
ATOM 3181  H HZ3  . LYS B 2 6  ? -11.819 4.109   -2.264  1.00 0.00 ?  1596 LYS B HZ3  2  
ATOM 3182  N N    . ILE B 2 7  ? -6.841  1.336   -5.882  1.00 0.00 ?  1597 ILE B N    2  
ATOM 3183  C CA   . ILE B 2 7  ? -6.366  0.005   -6.240  1.00 0.00 ?  1597 ILE B CA   2  
ATOM 3184  C C    . ILE B 2 7  ? -7.323  -0.832  -7.135  1.00 0.00 ?  1597 ILE B C    2  
ATOM 3185  O O    . ILE B 2 7  ? -7.183  -0.793  -8.355  1.00 0.00 ?  1597 ILE B O    2  
ATOM 3186  C CB   . ILE B 2 7  ? -5.698  -0.855  -5.083  1.00 0.00 ?  1597 ILE B CB   2  
ATOM 3187  C CG1  . ILE B 2 7  ? -4.954  -2.034  -5.677  1.00 0.00 ?  1597 ILE B CG1  2  
ATOM 3188  C CG2  . ILE B 2 7  ? -6.712  -1.409  -4.119  1.00 0.00 ?  1597 ILE B CG2  2  
ATOM 3189  C CD1  . ILE B 2 7  ? -3.943  -1.669  -6.755  1.00 0.00 ?  1597 ILE B CD1  2  
ATOM 3190  H H    . ILE B 2 7  ? -6.177  2.055   -5.879  1.00 0.00 ?  1597 ILE B H    2  
ATOM 3191  H HA   . ILE B 2 7  ? -5.561  0.304   -6.894  1.00 0.00 ?  1597 ILE B HA   2  
ATOM 3192  H HB   . ILE B 2 7  ? -4.973  -0.265  -4.536  1.00 0.00 ?  1597 ILE B HB   2  
ATOM 3193  H HG12 . ILE B 2 7  ? -4.415  -2.467  -4.845  1.00 0.00 ?  1597 ILE B HG12 2  
ATOM 3194  H HG13 . ILE B 2 7  ? -5.659  -2.750  -6.073  1.00 0.00 ?  1597 ILE B HG13 2  
ATOM 3195  H HG21 . ILE B 2 7  ? -7.243  -0.599  -3.643  1.00 0.00 ?  1597 ILE B HG21 2  
ATOM 3196  H HG22 . ILE B 2 7  ? -6.229  -2.022  -3.371  1.00 0.00 ?  1597 ILE B HG22 2  
ATOM 3197  H HG23 . ILE B 2 7  ? -7.415  -2.026  -4.656  1.00 0.00 ?  1597 ILE B HG23 2  
ATOM 3198  H HD11 . ILE B 2 7  ? -3.246  -0.941  -6.367  1.00 0.00 ?  1597 ILE B HD11 2  
ATOM 3199  H HD12 . ILE B 2 7  ? -4.451  -1.271  -7.620  1.00 0.00 ?  1597 ILE B HD12 2  
ATOM 3200  H HD13 . ILE B 2 7  ? -3.398  -2.556  -7.044  1.00 0.00 ?  1597 ILE B HD13 2  
ATOM 3201  N N    . LYS B 2 8  ? -8.342  -1.482  -6.512  1.00 0.00 ?  1598 LYS B N    2  
ATOM 3202  C CA   . LYS B 2 8  ? -9.182  -2.486  -7.127  1.00 0.00 ?  1598 LYS B CA   2  
ATOM 3203  C C    . LYS B 2 8  ? -8.285  -3.469  -7.898  1.00 0.00 ?  1598 LYS B C    2  
ATOM 3204  O O    . LYS B 2 8  ? -8.129  -3.386  -9.124  1.00 0.00 ?  1598 LYS B O    2  
ATOM 3205  C CB   . LYS B 2 8  ? -10.298 -1.844  -7.977  1.00 0.00 ?  1598 LYS B CB   2  
ATOM 3206  C CG   . LYS B 2 8  ? -11.305 -0.948  -7.187  1.00 0.00 ?  1598 LYS B CG   2  
ATOM 3207  C CD   . LYS B 2 8  ? -12.113 -1.716  -6.204  1.00 0.00 ?  1598 LYS B CD   2  
ATOM 3208  C CE   . LYS B 2 8  ? -13.399 -1.034  -5.883  1.00 0.00 ?  1598 LYS B CE   2  
ATOM 3209  N NZ   . LYS B 2 8  ? -14.389 -1.133  -6.959  1.00 0.00 1  1598 LYS B NZ   2  
ATOM 3210  H H    . LYS B 2 8  ? -8.553  -1.217  -5.593  1.00 0.00 ?  1598 LYS B H    2  
ATOM 3211  H HA   . LYS B 2 8  ? -9.610  -3.068  -6.318  1.00 0.00 ?  1598 LYS B HA   2  
ATOM 3212  H HB2  . LYS B 2 8  ? -9.838  -1.234  -8.739  1.00 0.00 ?  1598 LYS B HB2  2  
ATOM 3213  H HB3  . LYS B 2 8  ? -10.857 -2.633  -8.457  1.00 0.00 ?  1598 LYS B HB3  2  
ATOM 3214  H HG2  . LYS B 2 8  ? -10.779 -0.292  -6.493  1.00 0.00 ?  1598 LYS B HG2  2  
ATOM 3215  H HG3  . LYS B 2 8  ? -11.969 -0.404  -7.842  1.00 0.00 ?  1598 LYS B HG3  2  
ATOM 3216  H HD2  . LYS B 2 8  ? -12.251 -2.761  -6.419  1.00 0.00 ?  1598 LYS B HD2  2  
ATOM 3217  H HD3  . LYS B 2 8  ? -11.535 -1.577  -5.307  1.00 0.00 ?  1598 LYS B HD3  2  
ATOM 3218  H HE2  . LYS B 2 8  ? -13.754 -1.404  -4.935  1.00 0.00 ?  1598 LYS B HE2  2  
ATOM 3219  H HE3  . LYS B 2 8  ? -13.106 -0.002  -5.756  1.00 0.00 ?  1598 LYS B HE3  2  
ATOM 3220  H HZ1  . LYS B 2 8  ? -14.590 -2.119  -7.215  1.00 0.00 ?  1598 LYS B HZ1  2  
ATOM 3221  H HZ2  . LYS B 2 8  ? -14.103 -0.600  -7.806  1.00 0.00 ?  1598 LYS B HZ2  2  
ATOM 3222  H HZ3  . LYS B 2 8  ? -15.278 -0.706  -6.635  1.00 0.00 ?  1598 LYS B HZ3  2  
ATOM 3223  N N    . LEU B 2 9  ? -7.638  -4.351  -7.115  1.00 0.00 ?  1599 LEU B N    2  
ATOM 3224  C CA   . LEU B 2 9  ? -6.575  -5.263  -7.589  1.00 0.00 ?  1599 LEU B CA   2  
ATOM 3225  C C    . LEU B 2 9  ? -7.044  -6.108  -8.755  1.00 0.00 ?  1599 LEU B C    2  
ATOM 3226  O O    . LEU B 2 9  ? -6.306  -6.330  -9.728  1.00 0.00 ?  1599 LEU B O    2  
ATOM 3227  C CB   . LEU B 2 9  ? -6.152  -6.239  -6.452  1.00 0.00 ?  1599 LEU B CB   2  
ATOM 3228  C CG   . LEU B 2 9  ? -4.649  -6.535  -6.277  1.00 0.00 ?  1599 LEU B CG   2  
ATOM 3229  C CD1  . LEU B 2 9  ? -4.008  -7.155  -7.509  1.00 0.00 ?  1599 LEU B CD1  2  
ATOM 3230  C CD2  . LEU B 2 9  ? -3.921  -5.302  -5.878  1.00 0.00 ?  1599 LEU B CD2  2  
ATOM 3231  H H    . LEU B 2 9  ? -7.913  -4.393  -6.176  1.00 0.00 ?  1599 LEU B H    2  
ATOM 3232  H HA   . LEU B 2 9  ? -5.708  -4.677  -7.856  1.00 0.00 ?  1599 LEU B HA   2  
ATOM 3233  H HB2  . LEU B 2 9  ? -6.537  -5.950  -5.494  1.00 0.00 ?  1599 LEU B HB2  2  
ATOM 3234  H HB3  . LEU B 2 9  ? -6.639  -7.187  -6.624  1.00 0.00 ?  1599 LEU B HB3  2  
ATOM 3235  H HG   . LEU B 2 9  ? -4.571  -7.222  -5.438  1.00 0.00 ?  1599 LEU B HG   2  
ATOM 3236  H HD11 . LEU B 2 9  ? -4.115  -6.480  -8.345  1.00 0.00 ?  1599 LEU B HD11 2  
ATOM 3237  H HD12 . LEU B 2 9  ? -4.498  -8.091  -7.738  1.00 0.00 ?  1599 LEU B HD12 2  
ATOM 3238  H HD13 . LEU B 2 9  ? -2.959  -7.334  -7.321  1.00 0.00 ?  1599 LEU B HD13 2  
ATOM 3239  H HD21 . LEU B 2 9  ? -2.874  -5.523  -5.727  1.00 0.00 ?  1599 LEU B HD21 2  
ATOM 3240  H HD22 . LEU B 2 9  ? -4.343  -4.995  -4.932  1.00 0.00 ?  1599 LEU B HD22 2  
ATOM 3241  H HD23 . LEU B 2 9  ? -4.041  -4.522  -6.614  1.00 0.00 ?  1599 LEU B HD23 2  
ATOM 3242  N N    . GLY B 2 10 ? -8.258  -6.536  -8.665  1.00 0.00 ?  1600 GLY B N    2  
ATOM 3243  C CA   . GLY B 2 10 ? -8.769  -7.500  -9.564  1.00 0.00 ?  1600 GLY B CA   2  
ATOM 3244  C C    . GLY B 2 10 ? -8.752  -8.814  -8.849  1.00 0.00 ?  1600 GLY B C    2  
ATOM 3245  O O    . GLY B 2 10 ? -8.402  -8.839  -7.650  1.00 0.00 ?  1600 GLY B O    2  
ATOM 3246  H H    . GLY B 2 10 ? -8.843  -6.192  -7.956  1.00 0.00 ?  1600 GLY B H    2  
ATOM 3247  H HA2  . GLY B 2 10 ? -9.777  -7.233  -9.848  1.00 0.00 ?  1600 GLY B HA2  2  
ATOM 3248  H HA3  . GLY B 2 10 ? -8.134  -7.566  -10.435 1.00 0.00 ?  1600 GLY B HA3  2  
ATOM 3249  N N    . ARG B 2 11 ? -9.105  -9.898  -9.540  1.00 0.00 ?  1601 ARG B N    2  
ATOM 3250  C CA   . ARG B 2 11 ? -9.165  -11.270 -8.975  1.00 0.00 ?  1601 ARG B CA   2  
ATOM 3251  C C    . ARG B 2 11 ? -10.334 -11.392 -8.009  1.00 0.00 ?  1601 ARG B C    2  
ATOM 3252  O O    . ARG B 2 11 ? -11.322 -12.073 -8.283  1.00 0.00 ?  1601 ARG B O    2  
ATOM 3253  C CB   . ARG B 2 11 ? -7.870  -11.675 -8.223  1.00 0.00 ?  1601 ARG B CB   2  
ATOM 3254  C CG   . ARG B 2 11 ? -6.583  -11.609 -9.016  1.00 0.00 ?  1601 ARG B CG   2  
ATOM 3255  C CD   . ARG B 2 11 ? -6.554  -12.594 -10.156 1.00 0.00 ?  1601 ARG B CD   2  
ATOM 3256  N NE   . ARG B 2 11 ? -5.259  -12.546 -10.832 1.00 0.00 ?  1601 ARG B NE   2  
ATOM 3257  C CZ   . ARG B 2 11 ? -4.941  -13.197 -11.945 1.00 0.00 ?  1601 ARG B CZ   2  
ATOM 3258  N NH1  . ARG B 2 11 ? -5.789  -14.075 -12.480 1.00 0.00 1  1601 ARG B NH1  2  
ATOM 3259  N NH2  . ARG B 2 11 ? -3.748  -12.995 -12.507 1.00 0.00 ?  1601 ARG B NH2  2  
ATOM 3260  H H    . ARG B 2 11 ? -9.376  -9.788  -10.477 1.00 0.00 ?  1601 ARG B H    2  
ATOM 3261  H HA   . ARG B 2 11 ? -9.330  -11.954 -9.793  1.00 0.00 ?  1601 ARG B HA   2  
ATOM 3262  H HB2  . ARG B 2 11 ? -7.757  -11.025 -7.370  1.00 0.00 ?  1601 ARG B HB2  2  
ATOM 3263  H HB3  . ARG B 2 11 ? -7.998  -12.686 -7.862  1.00 0.00 ?  1601 ARG B HB3  2  
ATOM 3264  H HG2  . ARG B 2 11 ? -6.473  -10.615 -9.420  1.00 0.00 ?  1601 ARG B HG2  2  
ATOM 3265  H HG3  . ARG B 2 11 ? -5.758  -11.815 -8.350  1.00 0.00 ?  1601 ARG B HG3  2  
ATOM 3266  H HD2  . ARG B 2 11 ? -6.723  -13.588 -9.771  1.00 0.00 ?  1601 ARG B HD2  2  
ATOM 3267  H HD3  . ARG B 2 11 ? -7.328  -12.340 -10.865 1.00 0.00 ?  1601 ARG B HD3  2  
ATOM 3268  H HE   . ARG B 2 11 ? -4.610  -11.956 -10.387 1.00 0.00 ?  1601 ARG B HE   2  
ATOM 3269  H HH11 . ARG B 2 11 ? -6.679  -14.276 -12.062 1.00 0.00 ?  1601 ARG B HH11 2  
ATOM 3270  H HH12 . ARG B 2 11 ? -5.593  -14.577 -13.327 1.00 0.00 ?  1601 ARG B HH12 2  
ATOM 3271  H HH21 . ARG B 2 11 ? -3.074  -12.363 -12.117 1.00 0.00 ?  1601 ARG B HH21 2  
ATOM 3272  H HH22 . ARG B 2 11 ? -3.497  -13.451 -13.364 1.00 0.00 ?  1601 ARG B HH22 2  
ATOM 3273  N N    . LYS B 2 12 ? -10.223 -10.687 -6.919  1.00 0.00 ?  1602 LYS B N    2  
ATOM 3274  C CA   . LYS B 2 12 ? -11.158 -10.735 -5.842  1.00 0.00 ?  1602 LYS B CA   2  
ATOM 3275  C C    . LYS B 2 12 ? -11.932 -9.419  -5.776  1.00 0.00 ?  1602 LYS B C    2  
ATOM 3276  O O    . LYS B 2 12 ? -11.372 -8.342  -6.064  1.00 0.00 ?  1602 LYS B O    2  
ATOM 3277  C CB   . LYS B 2 12 ? -10.384 -10.954 -4.541  1.00 0.00 ?  1602 LYS B CB   2  
ATOM 3278  C CG   . LYS B 2 12 ? -11.247 -11.190 -3.331  1.00 0.00 ?  1602 LYS B CG   2  
ATOM 3279  C CD   . LYS B 2 12 ? -11.968 -12.521 -3.409  1.00 0.00 ?  1602 LYS B CD   2  
ATOM 3280  C CE   . LYS B 2 12 ? -12.933 -12.683 -2.258  1.00 0.00 ?  1602 LYS B CE   2  
ATOM 3281  N NZ   . LYS B 2 12 ? -12.266 -12.600 -0.941  1.00 0.00 1  1602 LYS B NZ   2  
ATOM 3282  H H    . LYS B 2 12 ? -9.471  -10.054 -6.864  1.00 0.00 ?  1602 LYS B H    2  
ATOM 3283  H HA   . LYS B 2 12 ? -11.827 -11.566 -5.996  1.00 0.00 ?  1602 LYS B HA   2  
ATOM 3284  H HB2  . LYS B 2 12 ? -9.742  -11.814 -4.663  1.00 0.00 ?  1602 LYS B HB2  2  
ATOM 3285  H HB3  . LYS B 2 12 ? -9.770  -10.085 -4.358  1.00 0.00 ?  1602 LYS B HB3  2  
ATOM 3286  H HG2  . LYS B 2 12 ? -10.624 -11.186 -2.449  1.00 0.00 ?  1602 LYS B HG2  2  
ATOM 3287  H HG3  . LYS B 2 12 ? -11.978 -10.397 -3.260  1.00 0.00 ?  1602 LYS B HG3  2  
ATOM 3288  H HD2  . LYS B 2 12 ? -12.519 -12.581 -4.335  1.00 0.00 ?  1602 LYS B HD2  2  
ATOM 3289  H HD3  . LYS B 2 12 ? -11.242 -13.318 -3.373  1.00 0.00 ?  1602 LYS B HD3  2  
ATOM 3290  H HE2  . LYS B 2 12 ? -13.675 -11.899 -2.315  1.00 0.00 ?  1602 LYS B HE2  2  
ATOM 3291  H HE3  . LYS B 2 12 ? -13.419 -13.642 -2.347  1.00 0.00 ?  1602 LYS B HE3  2  
ATOM 3292  H HZ1  . LYS B 2 12 ? -11.725 -11.719 -0.830  1.00 0.00 ?  1602 LYS B HZ1  2  
ATOM 3293  H HZ2  . LYS B 2 12 ? -11.646 -13.417 -0.761  1.00 0.00 ?  1602 LYS B HZ2  2  
ATOM 3294  H HZ3  . LYS B 2 12 ? -13.024 -12.591 -0.221  1.00 0.00 ?  1602 LYS B HZ3  2  
ATOM 3295  N N    . ALA A 1 1  ? 3.329   18.141  -20.145 1.00 0.00 ?  557  ALA A N    3  
ATOM 3296  C CA   . ALA A 1 1  ? 4.241   19.044  -20.837 1.00 0.00 ?  557  ALA A CA   3  
ATOM 3297  C C    . ALA A 1 1  ? 4.387   20.327  -20.045 1.00 0.00 ?  557  ALA A C    3  
ATOM 3298  O O    . ALA A 1 1  ? 5.359   21.078  -20.201 1.00 0.00 ?  557  ALA A O    3  
ATOM 3299  C CB   . ALA A 1 1  ? 3.743   19.330  -22.242 1.00 0.00 ?  557  ALA A CB   3  
ATOM 3300  H H1   . ALA A 1 1  ? 3.684   17.269  -19.859 1.00 0.00 ?  557  ALA A H1   3  
ATOM 3301  H HA   . ALA A 1 1  ? 5.203   18.557  -20.900 1.00 0.00 ?  557  ALA A HA   3  
ATOM 3302  H HB1  . ALA A 1 1  ? 2.783   19.819  -22.192 1.00 0.00 ?  557  ALA A HB1  3  
ATOM 3303  H HB2  . ALA A 1 1  ? 3.644   18.402  -22.784 1.00 0.00 ?  557  ALA A HB2  3  
ATOM 3304  H HB3  . ALA A 1 1  ? 4.447   19.972  -22.752 1.00 0.00 ?  557  ALA A HB3  3  
ATOM 3305  N N    . SER A 1 2  ? 3.434   20.539  -19.156 1.00 0.00 ?  558  SER A N    3  
ATOM 3306  C CA   . SER A 1 2  ? 3.405   21.690  -18.276 1.00 0.00 ?  558  SER A CA   3  
ATOM 3307  C C    . SER A 1 2  ? 4.543   21.597  -17.265 1.00 0.00 ?  558  SER A C    3  
ATOM 3308  O O    . SER A 1 2  ? 5.034   22.604  -16.767 1.00 0.00 ?  558  SER A O    3  
ATOM 3309  C CB   . SER A 1 2  ? 2.053   21.728  -17.562 1.00 0.00 ?  558  SER A CB   3  
ATOM 3310  O OG   . SER A 1 2  ? 1.768   20.461  -16.977 1.00 0.00 ?  558  SER A OG   3  
ATOM 3311  H H    . SER A 1 2  ? 2.701   19.889  -19.083 1.00 0.00 ?  558  SER A H    3  
ATOM 3312  H HA   . SER A 1 2  ? 3.518   22.585  -18.867 1.00 0.00 ?  558  SER A HA   3  
ATOM 3313  H HB2  . SER A 1 2  ? 2.081   22.472  -16.779 1.00 0.00 ?  558  SER A HB2  3  
ATOM 3314  H HB3  . SER A 1 2  ? 1.273   21.969  -18.268 1.00 0.00 ?  558  SER A HB3  3  
ATOM 3315  H HG   . SER A 1 2  ? 1.829   20.557  -16.018 1.00 0.00 ?  558  SER A HG   3  
ATOM 3316  N N    . ALA A 1 3  ? 4.976   20.360  -17.027 1.00 0.00 ?  559  ALA A N    3  
ATOM 3317  C CA   . ALA A 1 3  ? 6.036   20.007  -16.089 1.00 0.00 ?  559  ALA A CA   3  
ATOM 3318  C C    . ALA A 1 3  ? 7.360   20.713  -16.400 1.00 0.00 ?  559  ALA A C    3  
ATOM 3319  O O    . ALA A 1 3  ? 8.204   20.862  -15.522 1.00 0.00 ?  559  ALA A O    3  
ATOM 3320  C CB   . ALA A 1 3  ? 6.219   18.501  -16.049 1.00 0.00 ?  559  ALA A CB   3  
ATOM 3321  H H    . ALA A 1 3  ? 4.528   19.641  -17.517 1.00 0.00 ?  559  ALA A H    3  
ATOM 3322  H HA   . ALA A 1 3  ? 5.712   20.327  -15.110 1.00 0.00 ?  559  ALA A HA   3  
ATOM 3323  H HB1  . ALA A 1 3  ? 6.588   18.155  -17.002 1.00 0.00 ?  559  ALA A HB1  3  
ATOM 3324  H HB2  . ALA A 1 3  ? 5.270   18.032  -15.840 1.00 0.00 ?  559  ALA A HB2  3  
ATOM 3325  H HB3  . ALA A 1 3  ? 6.925   18.246  -15.273 1.00 0.00 ?  559  ALA A HB3  3  
ATOM 3326  N N    . SER A 1 4  ? 7.557   21.083  -17.653 1.00 0.00 ?  560  SER A N    3  
ATOM 3327  C CA   . SER A 1 4  ? 8.739   21.811  -18.059 1.00 0.00 ?  560  SER A CA   3  
ATOM 3328  C C    . SER A 1 4  ? 8.821   23.180  -17.316 1.00 0.00 ?  560  SER A C    3  
ATOM 3329  O O    . SER A 1 4  ? 9.890   23.593  -16.843 1.00 0.00 ?  560  SER A O    3  
ATOM 3330  C CB   . SER A 1 4  ? 8.705   21.990  -19.571 1.00 0.00 ?  560  SER A CB   3  
ATOM 3331  O OG   . SER A 1 4  ? 8.526   20.716  -20.214 1.00 0.00 ?  560  SER A OG   3  
ATOM 3332  H H    . SER A 1 4  ? 6.900   20.858  -18.345 1.00 0.00 ?  560  SER A H    3  
ATOM 3333  H HA   . SER A 1 4  ? 9.599   21.216  -17.790 1.00 0.00 ?  560  SER A HA   3  
ATOM 3334  H HB2  . SER A 1 4  ? 7.884   22.639  -19.838 1.00 0.00 ?  560  SER A HB2  3  
ATOM 3335  H HB3  . SER A 1 4  ? 9.639   22.419  -19.905 1.00 0.00 ?  560  SER A HB3  3  
ATOM 3336  H HG   . SER A 1 4  ? 9.409   20.375  -20.405 1.00 0.00 ?  560  SER A HG   3  
ATOM 3337  N N    . TYR A 1 5  ? 7.688   23.842  -17.178 1.00 0.00 ?  561  TYR A N    3  
ATOM 3338  C CA   . TYR A 1 5  ? 7.618   25.095  -16.448 1.00 0.00 ?  561  TYR A CA   3  
ATOM 3339  C C    . TYR A 1 5  ? 7.222   24.828  -15.011 1.00 0.00 ?  561  TYR A C    3  
ATOM 3340  O O    . TYR A 1 5  ? 7.970   25.114  -14.071 1.00 0.00 ?  561  TYR A O    3  
ATOM 3341  C CB   . TYR A 1 5  ? 6.621   26.075  -17.106 1.00 0.00 ?  561  TYR A CB   3  
ATOM 3342  C CG   . TYR A 1 5  ? 6.301   27.304  -16.262 1.00 0.00 ?  561  TYR A CG   3  
ATOM 3343  C CD1  . TYR A 1 5  ? 7.198   28.361  -16.144 1.00 0.00 ?  561  TYR A CD1  3  
ATOM 3344  C CD2  . TYR A 1 5  ? 5.097   27.388  -15.565 1.00 0.00 ?  561  TYR A CD2  3  
ATOM 3345  C CE1  . TYR A 1 5  ? 6.904   29.458  -15.348 1.00 0.00 ?  561  TYR A CE1  3  
ATOM 3346  C CE2  . TYR A 1 5  ? 4.797   28.476  -14.780 1.00 0.00 ?  561  TYR A CE2  3  
ATOM 3347  C CZ   . TYR A 1 5  ? 5.699   29.506  -14.671 1.00 0.00 ?  561  TYR A CZ   3  
ATOM 3348  O OH   . TYR A 1 5  ? 5.398   30.584  -13.863 1.00 0.00 ?  561  TYR A OH   3  
ATOM 3349  H H    . TYR A 1 5  ? 6.865   23.472  -17.562 1.00 0.00 ?  561  TYR A H    3  
ATOM 3350  H HA   . TYR A 1 5  ? 8.603   25.537  -16.457 1.00 0.00 ?  561  TYR A HA   3  
ATOM 3351  H HB2  . TYR A 1 5  ? 7.032   26.421  -18.042 1.00 0.00 ?  561  TYR A HB2  3  
ATOM 3352  H HB3  . TYR A 1 5  ? 5.697   25.550  -17.299 1.00 0.00 ?  561  TYR A HB3  3  
ATOM 3353  H HD1  . TYR A 1 5  ? 8.137   28.315  -16.677 1.00 0.00 ?  561  TYR A HD1  3  
ATOM 3354  H HD2  . TYR A 1 5  ? 4.388   26.577  -15.650 1.00 0.00 ?  561  TYR A HD2  3  
ATOM 3355  H HE1  . TYR A 1 5  ? 7.611   30.271  -15.267 1.00 0.00 ?  561  TYR A HE1  3  
ATOM 3356  H HE2  . TYR A 1 5  ? 3.857   28.516  -14.249 1.00 0.00 ?  561  TYR A HE2  3  
ATOM 3357  H HH   . TYR A 1 5  ? 5.071   30.213  -13.031 1.00 0.00 ?  561  TYR A HH   3  
ATOM 3358  N N    . ASP A 1 6  ? 6.072   24.236  -14.848 1.00 0.00 ?  562  ASP A N    3  
ATOM 3359  C CA   . ASP A 1 6  ? 5.531   23.985  -13.545 1.00 0.00 ?  562  ASP A CA   3  
ATOM 3360  C C    . ASP A 1 6  ? 6.051   22.683  -12.993 1.00 0.00 ?  562  ASP A C    3  
ATOM 3361  O O    . ASP A 1 6  ? 5.497   21.599  -13.232 1.00 0.00 ?  562  ASP A O    3  
ATOM 3362  C CB   . ASP A 1 6  ? 4.001   24.044  -13.543 1.00 0.00 ?  562  ASP A CB   3  
ATOM 3363  C CG   . ASP A 1 6  ? 3.400   23.664  -12.209 1.00 0.00 ?  562  ASP A CG   3  
ATOM 3364  O OD1  . ASP A 1 6  ? 3.558   24.412  -11.227 1.00 0.00 ?  562  ASP A OD1  3  
ATOM 3365  O OD2  . ASP A 1 6  ? 2.729   22.614  -12.130 1.00 0.00 -1 562  ASP A OD2  3  
ATOM 3366  H H    . ASP A 1 6  ? 5.576   23.914  -15.635 1.00 0.00 ?  562  ASP A H    3  
ATOM 3367  H HA   . ASP A 1 6  ? 5.905   24.772  -12.908 1.00 0.00 ?  562  ASP A HA   3  
ATOM 3368  H HB2  . ASP A 1 6  ? 3.689   25.050  -13.780 1.00 0.00 ?  562  ASP A HB2  3  
ATOM 3369  H HB3  . ASP A 1 6  ? 3.621   23.373  -14.299 1.00 0.00 ?  562  ASP A HB3  3  
ATOM 3370  N N    . SER A 1 7  ? 7.171   22.790  -12.361 1.00 0.00 ?  563  SER A N    3  
ATOM 3371  C CA   . SER A 1 7  ? 7.800   21.684  -11.717 1.00 0.00 ?  563  SER A CA   3  
ATOM 3372  C C    . SER A 1 7  ? 8.183   22.138  -10.318 1.00 0.00 ?  563  SER A C    3  
ATOM 3373  O O    . SER A 1 7  ? 8.093   21.365  -9.353  1.00 0.00 ?  563  SER A O    3  
ATOM 3374  C CB   . SER A 1 7  ? 9.038   21.251  -12.519 1.00 0.00 ?  563  SER A CB   3  
ATOM 3375  O OG   . SER A 1 7  ? 9.546   19.992  -12.086 1.00 0.00 ?  563  SER A OG   3  
ATOM 3376  H H    . SER A 1 7  ? 7.594   23.675  -12.355 1.00 0.00 ?  563  SER A H    3  
ATOM 3377  H HA   . SER A 1 7  ? 7.095   20.868  -11.658 1.00 0.00 ?  563  SER A HA   3  
ATOM 3378  H HB2  . SER A 1 7  ? 8.780   21.178  -13.564 1.00 0.00 ?  563  SER A HB2  3  
ATOM 3379  H HB3  . SER A 1 7  ? 9.810   21.995  -12.396 1.00 0.00 ?  563  SER A HB3  3  
ATOM 3380  H HG   . SER A 1 7  ? 8.769   19.437  -11.926 1.00 0.00 ?  563  SER A HG   3  
ATOM 3381  N N    . GLU A 1 8  ? 8.597   23.421  -10.224 1.00 0.00 ?  564  GLU A N    3  
ATOM 3382  C CA   . GLU A 1 8  ? 8.968   24.071  -8.983  1.00 0.00 ?  564  GLU A CA   3  
ATOM 3383  C C    . GLU A 1 8  ? 10.205  23.441  -8.384  1.00 0.00 ?  564  GLU A C    3  
ATOM 3384  O O    . GLU A 1 8  ? 10.922  22.661  -9.042  1.00 0.00 ?  564  GLU A O    3  
ATOM 3385  C CB   . GLU A 1 8  ? 7.796   24.073  -7.980  1.00 0.00 ?  564  GLU A CB   3  
ATOM 3386  C CG   . GLU A 1 8  ? 6.585   24.865  -8.446  1.00 0.00 ?  564  GLU A CG   3  
ATOM 3387  C CD   . GLU A 1 8  ? 6.893   26.325  -8.651  1.00 0.00 ?  564  GLU A CD   3  
ATOM 3388  O OE1  . GLU A 1 8  ? 6.984   26.779  -9.810  1.00 0.00 ?  564  GLU A OE1  3  
ATOM 3389  O OE2  . GLU A 1 8  ? 7.044   27.053  -7.649  1.00 0.00 -1 564  GLU A OE2  3  
ATOM 3390  H H    . GLU A 1 8  ? 8.713   23.967  -11.027 1.00 0.00 ?  564  GLU A H    3  
ATOM 3391  H HA   . GLU A 1 8  ? 9.222   25.095  -9.210  1.00 0.00 ?  564  GLU A HA   3  
ATOM 3392  H HB2  . GLU A 1 8  ? 7.486   23.053  -7.813  1.00 0.00 ?  564  GLU A HB2  3  
ATOM 3393  H HB3  . GLU A 1 8  ? 8.135   24.490  -7.044  1.00 0.00 ?  564  GLU A HB3  3  
ATOM 3394  H HG2  . GLU A 1 8  ? 6.233   24.453  -9.379  1.00 0.00 ?  564  GLU A HG2  3  
ATOM 3395  H HG3  . GLU A 1 8  ? 5.808   24.776  -7.702  1.00 0.00 ?  564  GLU A HG3  3  
ATOM 3396  N N    . GLU A 1 9  ? 10.495  23.832  -7.197  1.00 0.00 ?  565  GLU A N    3  
ATOM 3397  C CA   . GLU A 1 9  ? 11.574  23.273  -6.456  1.00 0.00 ?  565  GLU A CA   3  
ATOM 3398  C C    . GLU A 1 9  ? 11.002  22.470  -5.302  1.00 0.00 ?  565  GLU A C    3  
ATOM 3399  O O    . GLU A 1 9  ? 10.308  23.014  -4.429  1.00 0.00 ?  565  GLU A O    3  
ATOM 3400  C CB   . GLU A 1 9  ? 12.540  24.371  -5.979  1.00 0.00 ?  565  GLU A CB   3  
ATOM 3401  C CG   . GLU A 1 9  ? 11.895  25.477  -5.153  1.00 0.00 ?  565  GLU A CG   3  
ATOM 3402  C CD   . GLU A 1 9  ? 12.880  26.518  -4.728  1.00 0.00 ?  565  GLU A CD   3  
ATOM 3403  O OE1  . GLU A 1 9  ? 13.533  26.347  -3.666  1.00 0.00 ?  565  GLU A OE1  3  
ATOM 3404  O OE2  . GLU A 1 9  ? 13.024  27.530  -5.449  1.00 0.00 -1 565  GLU A OE2  3  
ATOM 3405  H H    . GLU A 1 9  ? 9.945   24.533  -6.793  1.00 0.00 ?  565  GLU A H    3  
ATOM 3406  H HA   . GLU A 1 9  ? 12.098  22.598  -7.116  1.00 0.00 ?  565  GLU A HA   3  
ATOM 3407  H HB2  . GLU A 1 9  ? 13.312  23.914  -5.379  1.00 0.00 ?  565  GLU A HB2  3  
ATOM 3408  H HB3  . GLU A 1 9  ? 13.000  24.824  -6.845  1.00 0.00 ?  565  GLU A HB3  3  
ATOM 3409  H HG2  . GLU A 1 9  ? 11.125  25.952  -5.740  1.00 0.00 ?  565  GLU A HG2  3  
ATOM 3410  H HG3  . GLU A 1 9  ? 11.453  25.038  -4.270  1.00 0.00 ?  565  GLU A HG3  3  
ATOM 3411  N N    . GLU A 1 10 ? 11.207  21.186  -5.332  1.00 0.00 ?  566  GLU A N    3  
ATOM 3412  C CA   . GLU A 1 10 ? 10.721  20.359  -4.275  1.00 0.00 ?  566  GLU A CA   3  
ATOM 3413  C C    . GLU A 1 10 ? 11.682  20.387  -3.128  1.00 0.00 ?  566  GLU A C    3  
ATOM 3414  O O    . GLU A 1 10 ? 12.781  19.812  -3.176  1.00 0.00 ?  566  GLU A O    3  
ATOM 3415  C CB   . GLU A 1 10 ? 10.427  18.949  -4.724  1.00 0.00 ?  566  GLU A CB   3  
ATOM 3416  C CG   . GLU A 1 10 ? 9.332   18.873  -5.769  1.00 0.00 ?  566  GLU A CG   3  
ATOM 3417  C CD   . GLU A 1 10 ? 8.906   17.466  -6.047  1.00 0.00 ?  566  GLU A CD   3  
ATOM 3418  O OE1  . GLU A 1 10 ? 8.003   16.963  -5.350  1.00 0.00 ?  566  GLU A OE1  3  
ATOM 3419  O OE2  . GLU A 1 10 ? 9.453   16.831  -6.976  1.00 0.00 -1 566  GLU A OE2  3  
ATOM 3420  H H    . GLU A 1 10 ? 11.702  20.778  -6.075  1.00 0.00 ?  566  GLU A H    3  
ATOM 3421  H HA   . GLU A 1 10 ? 9.805   20.820  -3.937  1.00 0.00 ?  566  GLU A HA   3  
ATOM 3422  H HB2  . GLU A 1 10 ? 11.338  18.539  -5.127  1.00 0.00 ?  566  GLU A HB2  3  
ATOM 3423  H HB3  . GLU A 1 10 ? 10.126  18.362  -3.869  1.00 0.00 ?  566  GLU A HB3  3  
ATOM 3424  H HG2  . GLU A 1 10 ? 8.475   19.430  -5.421  1.00 0.00 ?  566  GLU A HG2  3  
ATOM 3425  H HG3  . GLU A 1 10 ? 9.691   19.316  -6.685  1.00 0.00 ?  566  GLU A HG3  3  
ATOM 3426  N N    . GLU A 1 11 ? 11.290  21.104  -2.143  1.00 0.00 ?  567  GLU A N    3  
ATOM 3427  C CA   . GLU A 1 11 ? 12.062  21.298  -0.963  1.00 0.00 ?  567  GLU A CA   3  
ATOM 3428  C C    . GLU A 1 11 ? 11.926  20.089  -0.081  1.00 0.00 ?  567  GLU A C    3  
ATOM 3429  O O    . GLU A 1 11 ? 10.888  19.406  -0.097  1.00 0.00 ?  567  GLU A O    3  
ATOM 3430  C CB   . GLU A 1 11 ? 11.564  22.535  -0.241  1.00 0.00 ?  567  GLU A CB   3  
ATOM 3431  C CG   . GLU A 1 11 ? 11.654  23.798  -1.076  1.00 0.00 ?  567  GLU A CG   3  
ATOM 3432  C CD   . GLU A 1 11 ? 10.973  24.955  -0.424  1.00 0.00 ?  567  GLU A CD   3  
ATOM 3433  O OE1  . GLU A 1 11 ? 11.620  25.687  0.353   1.00 0.00 ?  567  GLU A OE1  3  
ATOM 3434  O OE2  . GLU A 1 11 ? 9.767   25.154  -0.654  1.00 0.00 -1 567  GLU A OE2  3  
ATOM 3435  H H    . GLU A 1 11 ? 10.407  21.518  -2.229  1.00 0.00 ?  567  GLU A H    3  
ATOM 3436  H HA   . GLU A 1 11 ? 13.093  21.445  -1.239  1.00 0.00 ?  567  GLU A HA   3  
ATOM 3437  H HB2  . GLU A 1 11 ? 10.530  22.381  0.034   1.00 0.00 ?  567  GLU A HB2  3  
ATOM 3438  H HB3  . GLU A 1 11 ? 12.148  22.678  0.657   1.00 0.00 ?  567  GLU A HB3  3  
ATOM 3439  H HG2  . GLU A 1 11 ? 12.695  24.046  -1.218  1.00 0.00 ?  567  GLU A HG2  3  
ATOM 3440  H HG3  . GLU A 1 11 ? 11.192  23.615  -2.036  1.00 0.00 ?  567  GLU A HG3  3  
ATOM 3441  N N    . GLU A 1 12 ? 12.952  19.809  0.671   1.00 0.00 ?  568  GLU A N    3  
ATOM 3442  C CA   . GLU A 1 12 ? 12.951  18.687  1.556   1.00 0.00 ?  568  GLU A CA   3  
ATOM 3443  C C    . GLU A 1 12 ? 12.154  19.010  2.806   1.00 0.00 ?  568  GLU A C    3  
ATOM 3444  O O    . GLU A 1 12 ? 12.680  19.452  3.827   1.00 0.00 ?  568  GLU A O    3  
ATOM 3445  C CB   . GLU A 1 12 ? 14.363  18.222  1.859   1.00 0.00 ?  568  GLU A CB   3  
ATOM 3446  C CG   . GLU A 1 12 ? 15.099  17.716  0.628   1.00 0.00 ?  568  GLU A CG   3  
ATOM 3447  C CD   . GLU A 1 12 ? 16.492  17.275  0.937   1.00 0.00 ?  568  GLU A CD   3  
ATOM 3448  O OE1  . GLU A 1 12 ? 16.662  16.260  1.635   1.00 0.00 ?  568  GLU A OE1  3  
ATOM 3449  O OE2  . GLU A 1 12 ? 17.454  17.932  0.485   1.00 0.00 -1 568  GLU A OE2  3  
ATOM 3450  H H    . GLU A 1 12 ? 13.737  20.397  0.643   1.00 0.00 ?  568  GLU A H    3  
ATOM 3451  H HA   . GLU A 1 12 ? 12.426  17.897  1.039   1.00 0.00 ?  568  GLU A HA   3  
ATOM 3452  H HB2  . GLU A 1 12 ? 14.922  19.046  2.280   1.00 0.00 ?  568  GLU A HB2  3  
ATOM 3453  H HB3  . GLU A 1 12 ? 14.319  17.418  2.579   1.00 0.00 ?  568  GLU A HB3  3  
ATOM 3454  H HG2  . GLU A 1 12 ? 14.555  16.879  0.215   1.00 0.00 ?  568  GLU A HG2  3  
ATOM 3455  H HG3  . GLU A 1 12 ? 15.138  18.512  -0.103  1.00 0.00 ?  568  GLU A HG3  3  
ATOM 3456  N N    . GLY A 1 13 ? 10.874  18.892  2.636   1.00 0.00 ?  569  GLY A N    3  
ATOM 3457  C CA   . GLY A 1 13 ? 9.906   19.154  3.642   1.00 0.00 ?  569  GLY A CA   3  
ATOM 3458  C C    . GLY A 1 13 ? 8.566   19.206  2.978   1.00 0.00 ?  569  GLY A C    3  
ATOM 3459  O O    . GLY A 1 13 ? 7.877   20.236  2.984   1.00 0.00 ?  569  GLY A O    3  
ATOM 3460  H H    . GLY A 1 13 ? 10.566  18.650  1.734   1.00 0.00 ?  569  GLY A H    3  
ATOM 3461  H HA2  . GLY A 1 13 ? 9.940   18.362  4.374   1.00 0.00 ?  569  GLY A HA2  3  
ATOM 3462  H HA3  . GLY A 1 13 ? 10.107  20.105  4.111   1.00 0.00 ?  569  GLY A HA3  3  
ATOM 3463  N N    . LEU A 1 14 ? 8.215   18.118  2.356   1.00 0.00 ?  570  LEU A N    3  
ATOM 3464  C CA   . LEU A 1 14 ? 7.013   18.040  1.580   1.00 0.00 ?  570  LEU A CA   3  
ATOM 3465  C C    . LEU A 1 14 ? 6.057   16.973  2.099   1.00 0.00 ?  570  LEU A C    3  
ATOM 3466  O O    . LEU A 1 14 ? 6.493   15.980  2.711   1.00 0.00 ?  570  LEU A O    3  
ATOM 3467  C CB   . LEU A 1 14 ? 7.353   17.859  0.069   1.00 0.00 ?  570  LEU A CB   3  
ATOM 3468  C CG   . LEU A 1 14 ? 8.383   16.768  -0.320  1.00 0.00 ?  570  LEU A CG   3  
ATOM 3469  C CD1  . LEU A 1 14 ? 7.847   15.351  -0.146  1.00 0.00 ?  570  LEU A CD1  3  
ATOM 3470  C CD2  . LEU A 1 14 ? 8.882   16.980  -1.739  1.00 0.00 ?  570  LEU A CD2  3  
ATOM 3471  H H    . LEU A 1 14 ? 8.765   17.310  2.450   1.00 0.00 ?  570  LEU A H    3  
ATOM 3472  H HA   . LEU A 1 14 ? 6.533   18.999  1.692   1.00 0.00 ?  570  LEU A HA   3  
ATOM 3473  H HB2  . LEU A 1 14 ? 6.435   17.641  -0.454  1.00 0.00 ?  570  LEU A HB2  3  
ATOM 3474  H HB3  . LEU A 1 14 ? 7.723   18.806  -0.293  1.00 0.00 ?  570  LEU A HB3  3  
ATOM 3475  H HG   . LEU A 1 14 ? 9.224   16.886  0.346   1.00 0.00 ?  570  LEU A HG   3  
ATOM 3476  H HD11 . LEU A 1 14 ? 6.975   15.216  -0.767  1.00 0.00 ?  570  LEU A HD11 3  
ATOM 3477  H HD12 . LEU A 1 14 ? 7.577   15.195  0.889   1.00 0.00 ?  570  LEU A HD12 3  
ATOM 3478  H HD13 . LEU A 1 14 ? 8.608   14.640  -0.431  1.00 0.00 ?  570  LEU A HD13 3  
ATOM 3479  H HD21 . LEU A 1 14 ? 9.602   16.213  -1.986  1.00 0.00 ?  570  LEU A HD21 3  
ATOM 3480  H HD22 . LEU A 1 14 ? 9.349   17.950  -1.813  1.00 0.00 ?  570  LEU A HD22 3  
ATOM 3481  H HD23 . LEU A 1 14 ? 8.050   16.928  -2.426  1.00 0.00 ?  570  LEU A HD23 3  
ATOM 3482  N N    . PRO A 1 15 ? 4.744   17.189  1.925   1.00 0.00 ?  571  PRO A N    3  
ATOM 3483  C CA   . PRO A 1 15 ? 3.725   16.192  2.243   1.00 0.00 ?  571  PRO A CA   3  
ATOM 3484  C C    . PRO A 1 15 ? 3.795   15.048  1.240   1.00 0.00 ?  571  PRO A C    3  
ATOM 3485  O O    . PRO A 1 15 ? 4.462   15.167  0.204   1.00 0.00 ?  571  PRO A O    3  
ATOM 3486  C CB   . PRO A 1 15 ? 2.402   16.950  2.083   1.00 0.00 ?  571  PRO A CB   3  
ATOM 3487  C CG   . PRO A 1 15 ? 2.716   18.057  1.142   1.00 0.00 ?  571  PRO A CG   3  
ATOM 3488  C CD   . PRO A 1 15 ? 4.140   18.437  1.417   1.00 0.00 ?  571  PRO A CD   3  
ATOM 3489  H HA   . PRO A 1 15 ? 3.831   15.810  3.248   1.00 0.00 ?  571  PRO A HA   3  
ATOM 3490  H HB2  . PRO A 1 15 ? 1.662   16.275  1.676   1.00 0.00 ?  571  PRO A HB2  3  
ATOM 3491  H HB3  . PRO A 1 15 ? 2.072   17.320  3.042   1.00 0.00 ?  571  PRO A HB3  3  
ATOM 3492  H HG2  . PRO A 1 15 ? 2.610   17.711  0.125   1.00 0.00 ?  571  PRO A HG2  3  
ATOM 3493  H HG3  . PRO A 1 15 ? 2.060   18.895  1.325   1.00 0.00 ?  571  PRO A HG3  3  
ATOM 3494  H HD2  . PRO A 1 15 ? 4.626   18.760  0.508   1.00 0.00 ?  571  PRO A HD2  3  
ATOM 3495  H HD3  . PRO A 1 15 ? 4.187   19.212  2.167   1.00 0.00 ?  571  PRO A HD3  3  
ATOM 3496  N N    . MET A 1 16 ? 3.136   13.958  1.534   1.00 0.00 ?  572  MET A N    3  
ATOM 3497  C CA   . MET A 1 16 ? 3.166   12.806  0.662   1.00 0.00 ?  572  MET A CA   3  
ATOM 3498  C C    . MET A 1 16 ? 2.467   13.142  -0.650  1.00 0.00 ?  572  MET A C    3  
ATOM 3499  O O    . MET A 1 16 ? 1.235   13.307  -0.712  1.00 0.00 ?  572  MET A O    3  
ATOM 3500  C CB   . MET A 1 16 ? 2.538   11.582  1.347   1.00 0.00 ?  572  MET A CB   3  
ATOM 3501  C CG   . MET A 1 16 ? 3.209   11.224  2.675   1.00 0.00 ?  572  MET A CG   3  
ATOM 3502  S SD   . MET A 1 16 ? 4.980   10.830  2.512   1.00 0.00 ?  572  MET A SD   3  
ATOM 3503  C CE   . MET A 1 16 ? 4.909   9.244   1.676   1.00 0.00 ?  572  MET A CE   3  
ATOM 3504  H H    . MET A 1 16 ? 2.577   13.945  2.341   1.00 0.00 ?  572  MET A H    3  
ATOM 3505  H HA   . MET A 1 16 ? 4.204   12.601  0.445   1.00 0.00 ?  572  MET A HA   3  
ATOM 3506  H HB2  . MET A 1 16 ? 1.495   11.790  1.534   1.00 0.00 ?  572  MET A HB2  3  
ATOM 3507  H HB3  . MET A 1 16 ? 2.613   10.731  0.686   1.00 0.00 ?  572  MET A HB3  3  
ATOM 3508  H HG2  . MET A 1 16 ? 3.104   12.067  3.342   1.00 0.00 ?  572  MET A HG2  3  
ATOM 3509  H HG3  . MET A 1 16 ? 2.700   10.370  3.098   1.00 0.00 ?  572  MET A HG3  3  
ATOM 3510  H HE1  . MET A 1 16 ? 5.910   8.914   1.440   1.00 0.00 ?  572  MET A HE1  3  
ATOM 3511  H HE2  . MET A 1 16 ? 4.323   9.336   0.775   1.00 0.00 ?  572  MET A HE2  3  
ATOM 3512  H HE3  . MET A 1 16 ? 4.440   8.523   2.328   1.00 0.00 ?  572  MET A HE3  3  
ATOM 3513  N N    . SER A 1 17 ? 3.263   13.302  -1.672  1.00 0.00 ?  573  SER A N    3  
ATOM 3514  C CA   . SER A 1 17 ? 2.812   13.683  -2.970  1.00 0.00 ?  573  SER A CA   3  
ATOM 3515  C C    . SER A 1 17 ? 2.099   12.529  -3.646  1.00 0.00 ?  573  SER A C    3  
ATOM 3516  O O    . SER A 1 17 ? 2.159   11.394  -3.158  1.00 0.00 ?  573  SER A O    3  
ATOM 3517  C CB   . SER A 1 17 ? 4.024   14.137  -3.777  1.00 0.00 ?  573  SER A CB   3  
ATOM 3518  O OG   . SER A 1 17 ? 5.025   13.133  -3.778  1.00 0.00 ?  573  SER A OG   3  
ATOM 3519  H H    . SER A 1 17 ? 4.228   13.158  -1.570  1.00 0.00 ?  573  SER A H    3  
ATOM 3520  H HA   . SER A 1 17 ? 2.138   14.518  -2.867  1.00 0.00 ?  573  SER A HA   3  
ATOM 3521  H HB2  . SER A 1 17 ? 3.730   14.348  -4.794  1.00 0.00 ?  573  SER A HB2  3  
ATOM 3522  H HB3  . SER A 1 17 ? 4.434   15.029  -3.328  1.00 0.00 ?  573  SER A HB3  3  
ATOM 3523  H HG   . SER A 1 17 ? 5.846   13.536  -4.084  1.00 0.00 ?  573  SER A HG   3  
ATOM 3524  N N    . TYR A 1 18 ? 1.440   12.797  -4.768  1.00 0.00 ?  574  TYR A N    3  
ATOM 3525  C CA   . TYR A 1 18 ? 0.738   11.753  -5.496  1.00 0.00 ?  574  TYR A CA   3  
ATOM 3526  C C    . TYR A 1 18 ? 1.695   10.719  -6.006  1.00 0.00 ?  574  TYR A C    3  
ATOM 3527  O O    . TYR A 1 18 ? 1.346   9.555   -6.103  1.00 0.00 ?  574  TYR A O    3  
ATOM 3528  C CB   . TYR A 1 18 ? -0.132  12.310  -6.621  1.00 0.00 ?  574  TYR A CB   3  
ATOM 3529  C CG   . TYR A 1 18 ? -1.319  13.066  -6.105  1.00 0.00 ?  574  TYR A CG   3  
ATOM 3530  C CD1  . TYR A 1 18 ? -1.317  14.445  -6.036  1.00 0.00 ?  574  TYR A CD1  3  
ATOM 3531  C CD2  . TYR A 1 18 ? -2.440  12.385  -5.656  1.00 0.00 ?  574  TYR A CD2  3  
ATOM 3532  C CE1  . TYR A 1 18 ? -2.398  15.129  -5.534  1.00 0.00 ?  574  TYR A CE1  3  
ATOM 3533  C CE2  . TYR A 1 18 ? -3.527  13.061  -5.159  1.00 0.00 ?  574  TYR A CE2  3  
ATOM 3534  C CZ   . TYR A 1 18 ? -3.502  14.431  -5.098  1.00 0.00 ?  574  TYR A CZ   3  
ATOM 3535  O OH   . TYR A 1 18 ? -4.584  15.108  -4.577  1.00 0.00 ?  574  TYR A OH   3  
ATOM 3536  H H    . TYR A 1 18 ? 1.438   13.714  -5.124  1.00 0.00 ?  574  TYR A H    3  
ATOM 3537  H HA   . TYR A 1 18 ? 0.097   11.267  -4.776  1.00 0.00 ?  574  TYR A HA   3  
ATOM 3538  H HB2  . TYR A 1 18 ? 0.457   12.982  -7.227  1.00 0.00 ?  574  TYR A HB2  3  
ATOM 3539  H HB3  . TYR A 1 18 ? -0.493  11.494  -7.229  1.00 0.00 ?  574  TYR A HB3  3  
ATOM 3540  H HD1  . TYR A 1 18 ? -0.450  14.987  -6.384  1.00 0.00 ?  574  TYR A HD1  3  
ATOM 3541  H HD2  . TYR A 1 18 ? -2.454  11.307  -5.705  1.00 0.00 ?  574  TYR A HD2  3  
ATOM 3542  H HE1  . TYR A 1 18 ? -2.376  16.207  -5.491  1.00 0.00 ?  574  TYR A HE1  3  
ATOM 3543  H HE2  . TYR A 1 18 ? -4.391  12.509  -4.818  1.00 0.00 ?  574  TYR A HE2  3  
ATOM 3544  H HH   . TYR A 1 18 ? -4.830  15.790  -5.215  1.00 0.00 ?  574  TYR A HH   3  
ATOM 3545  N N    . ASP A 1 19 ? 2.910   11.147  -6.283  1.00 0.00 ?  575  ASP A N    3  
ATOM 3546  C CA   . ASP A 1 19 ? 3.975   10.247  -6.704  1.00 0.00 ?  575  ASP A CA   3  
ATOM 3547  C C    . ASP A 1 19 ? 4.291   9.272   -5.568  1.00 0.00 ?  575  ASP A C    3  
ATOM 3548  O O    . ASP A 1 19 ? 4.305   8.061   -5.762  1.00 0.00 ?  575  ASP A O    3  
ATOM 3549  C CB   . ASP A 1 19 ? 5.227   11.045  -7.066  1.00 0.00 ?  575  ASP A CB   3  
ATOM 3550  C CG   . ASP A 1 19 ? 6.315   10.182  -7.661  1.00 0.00 ?  575  ASP A CG   3  
ATOM 3551  O OD1  . ASP A 1 19 ? 6.411   10.106  -8.900  1.00 0.00 ?  575  ASP A OD1  3  
ATOM 3552  O OD2  . ASP A 1 19 ? 7.112   9.591   -6.916  1.00 0.00 -1 575  ASP A OD2  3  
ATOM 3553  H H    . ASP A 1 19 ? 3.079   12.111  -6.219  1.00 0.00 ?  575  ASP A H    3  
ATOM 3554  H HA   . ASP A 1 19 ? 3.638   9.694   -7.568  1.00 0.00 ?  575  ASP A HA   3  
ATOM 3555  H HB2  . ASP A 1 19 ? 4.969   11.807  -7.784  1.00 0.00 ?  575  ASP A HB2  3  
ATOM 3556  H HB3  . ASP A 1 19 ? 5.612   11.514  -6.173  1.00 0.00 ?  575  ASP A HB3  3  
ATOM 3557  N N    . GLU A 1 20 ? 4.489   9.824   -4.365  1.00 0.00 ?  576  GLU A N    3  
ATOM 3558  C CA   . GLU A 1 20 ? 4.756   9.032   -3.155  1.00 0.00 ?  576  GLU A CA   3  
ATOM 3559  C C    . GLU A 1 20 ? 3.594   8.074   -2.867  1.00 0.00 ?  576  GLU A C    3  
ATOM 3560  O O    . GLU A 1 20 ? 3.812   6.906   -2.553  1.00 0.00 ?  576  GLU A O    3  
ATOM 3561  C CB   . GLU A 1 20 ? 4.953   9.950   -1.948  1.00 0.00 ?  576  GLU A CB   3  
ATOM 3562  C CG   . GLU A 1 20 ? 6.184   10.843  -1.990  1.00 0.00 ?  576  GLU A CG   3  
ATOM 3563  C CD   . GLU A 1 20 ? 7.477   10.088  -1.813  1.00 0.00 ?  576  GLU A CD   3  
ATOM 3564  O OE1  . GLU A 1 20 ? 7.848   9.798   -0.663  1.00 0.00 ?  576  GLU A OE1  3  
ATOM 3565  O OE2  . GLU A 1 20 ? 8.180   9.819   -2.812  1.00 0.00 -1 576  GLU A OE2  3  
ATOM 3566  H H    . GLU A 1 20 ? 4.462   10.801  -4.290  1.00 0.00 ?  576  GLU A H    3  
ATOM 3567  H HA   . GLU A 1 20 ? 5.659   8.462   -3.316  1.00 0.00 ?  576  GLU A HA   3  
ATOM 3568  H HB2  . GLU A 1 20 ? 4.083   10.583  -1.846  1.00 0.00 ?  576  GLU A HB2  3  
ATOM 3569  H HB3  . GLU A 1 20 ? 5.029   9.321   -1.073  1.00 0.00 ?  576  GLU A HB3  3  
ATOM 3570  H HG2  . GLU A 1 20 ? 6.215   11.341  -2.947  1.00 0.00 ?  576  GLU A HG2  3  
ATOM 3571  H HG3  . GLU A 1 20 ? 6.103   11.582  -1.207  1.00 0.00 ?  576  GLU A HG3  3  
ATOM 3572  N N    . LYS A 1 21 ? 2.358   8.591   -2.980  1.00 0.00 ?  577  LYS A N    3  
ATOM 3573  C CA   . LYS A 1 21 ? 1.138   7.791   -2.763  1.00 0.00 ?  577  LYS A CA   3  
ATOM 3574  C C    . LYS A 1 21 ? 1.122   6.625   -3.724  1.00 0.00 ?  577  LYS A C    3  
ATOM 3575  O O    . LYS A 1 21 ? 0.905   5.471   -3.355  1.00 0.00 ?  577  LYS A O    3  
ATOM 3576  C CB   . LYS A 1 21 ? -0.139  8.611   -3.069  1.00 0.00 ?  577  LYS A CB   3  
ATOM 3577  C CG   . LYS A 1 21 ? -0.358  9.893   -2.276  1.00 0.00 ?  577  LYS A CG   3  
ATOM 3578  C CD   . LYS A 1 21 ? -0.548  9.628   -0.804  1.00 0.00 ?  577  LYS A CD   3  
ATOM 3579  C CE   . LYS A 1 21 ? -1.032  10.863  -0.073  1.00 0.00 ?  577  LYS A CE   3  
ATOM 3580  N NZ   . LYS A 1 21 ? -2.323  11.352  -0.614  1.00 0.00 1  577  LYS A NZ   3  
ATOM 3581  H H    . LYS A 1 21 ? 2.286   9.544   -3.211  1.00 0.00 ?  577  LYS A H    3  
ATOM 3582  H HA   . LYS A 1 21 ? 1.098   7.442   -1.742  1.00 0.00 ?  577  LYS A HA   3  
ATOM 3583  H HB2  . LYS A 1 21 ? -0.158  8.852   -4.121  1.00 0.00 ?  577  LYS A HB2  3  
ATOM 3584  H HB3  . LYS A 1 21 ? -0.981  7.959   -2.878  1.00 0.00 ?  577  LYS A HB3  3  
ATOM 3585  H HG2  . LYS A 1 21 ? 0.500   10.536  -2.403  1.00 0.00 ?  577  LYS A HG2  3  
ATOM 3586  H HG3  . LYS A 1 21 ? -1.237  10.393  -2.659  1.00 0.00 ?  577  LYS A HG3  3  
ATOM 3587  H HD2  . LYS A 1 21 ? -1.274  8.838   -0.679  1.00 0.00 ?  577  LYS A HD2  3  
ATOM 3588  H HD3  . LYS A 1 21 ? 0.399   9.321   -0.386  1.00 0.00 ?  577  LYS A HD3  3  
ATOM 3589  H HE2  . LYS A 1 21 ? -1.156  10.627  0.973   1.00 0.00 ?  577  LYS A HE2  3  
ATOM 3590  H HE3  . LYS A 1 21 ? -0.289  11.640  -0.182  1.00 0.00 ?  577  LYS A HE3  3  
ATOM 3591  H HZ1  . LYS A 1 21 ? -3.022  10.585  -0.683  1.00 0.00 ?  577  LYS A HZ1  3  
ATOM 3592  H HZ2  . LYS A 1 21 ? -2.196  11.784  -1.553  1.00 0.00 ?  577  LYS A HZ2  3  
ATOM 3593  H HZ3  . LYS A 1 21 ? -2.713  12.088  0.008   1.00 0.00 ?  577  LYS A HZ3  3  
ATOM 3594  N N    . ARG A 1 22 ? 1.376   6.953   -4.956  1.00 0.00 ?  578  ARG A N    3  
ATOM 3595  C CA   . ARG A 1 22 ? 1.275   6.049   -6.036  1.00 0.00 ?  578  ARG A CA   3  
ATOM 3596  C C    . ARG A 1 22 ? 2.390   5.046   -6.101  1.00 0.00 ?  578  ARG A C    3  
ATOM 3597  O O    . ARG A 1 22 ? 2.216   3.993   -6.660  1.00 0.00 ?  578  ARG A O    3  
ATOM 3598  C CB   . ARG A 1 22 ? 0.966   6.744   -7.332  1.00 0.00 ?  578  ARG A CB   3  
ATOM 3599  C CG   . ARG A 1 22 ? 0.496   5.817   -8.413  1.00 0.00 ?  578  ARG A CG   3  
ATOM 3600  C CD   . ARG A 1 22 ? -0.406  6.556   -9.346  1.00 0.00 ?  578  ARG A CD   3  
ATOM 3601  N NE   . ARG A 1 22 ? 0.167   6.727   -10.677 1.00 0.00 ?  578  ARG A NE   3  
ATOM 3602  C CZ   . ARG A 1 22 ? -0.468  6.467   -11.825 1.00 0.00 ?  578  ARG A CZ   3  
ATOM 3603  N NH1  . ARG A 1 22 ? -1.639  5.814   -11.819 1.00 0.00 1  578  ARG A NH1  3  
ATOM 3604  N NH2  . ARG A 1 22 ? 0.080   6.821   -12.977 1.00 0.00 ?  578  ARG A NH2  3  
ATOM 3605  H H    . ARG A 1 22 ? 1.652   7.878   -5.149  1.00 0.00 ?  578  ARG A H    3  
ATOM 3606  H HA   . ARG A 1 22 ? 0.402   5.466   -5.774  1.00 0.00 ?  578  ARG A HA   3  
ATOM 3607  H HB2  . ARG A 1 22 ? 0.197   7.471   -7.122  1.00 0.00 ?  578  ARG A HB2  3  
ATOM 3608  H HB3  . ARG A 1 22 ? 1.823   7.288   -7.677  1.00 0.00 ?  578  ARG A HB3  3  
ATOM 3609  H HG2  . ARG A 1 22 ? 1.332   5.376   -8.942  1.00 0.00 ?  578  ARG A HG2  3  
ATOM 3610  H HG3  . ARG A 1 22 ? -0.071  5.021   -7.951  1.00 0.00 ?  578  ARG A HG3  3  
ATOM 3611  H HD2  . ARG A 1 22 ? -1.361  6.055   -9.330  1.00 0.00 ?  578  ARG A HD2  3  
ATOM 3612  H HD3  . ARG A 1 22 ? -0.582  7.527   -8.908  1.00 0.00 ?  578  ARG A HD3  3  
ATOM 3613  H HE   . ARG A 1 22 ? 1.073   7.120   -10.676 1.00 0.00 ?  578  ARG A HE   3  
ATOM 3614  H HH11 . ARG A 1 22 ? -2.087  5.496   -10.977 1.00 0.00 ?  578  ARG A HH11 3  
ATOM 3615  H HH12 . ARG A 1 22 ? -2.117  5.626   -12.684 1.00 0.00 ?  578  ARG A HH12 3  
ATOM 3616  H HH21 . ARG A 1 22 ? 0.970   7.284   -13.027 1.00 0.00 ?  578  ARG A HH21 3  
ATOM 3617  H HH22 . ARG A 1 22 ? -0.371  6.670   -13.863 1.00 0.00 ?  578  ARG A HH22 3  
ATOM 3618  N N    . GLN A 1 23 ? 3.534   5.371   -5.555  1.00 0.00 ?  579  GLN A N    3  
ATOM 3619  C CA   . GLN A 1 23 ? 4.649   4.428   -5.514  1.00 0.00 ?  579  GLN A CA   3  
ATOM 3620  C C    . GLN A 1 23 ? 4.170   3.119   -4.840  1.00 0.00 ?  579  GLN A C    3  
ATOM 3621  O O    . GLN A 1 23 ? 4.498   2.019   -5.277  1.00 0.00 ?  579  GLN A O    3  
ATOM 3622  C CB   . GLN A 1 23 ? 5.797   5.023   -4.701  1.00 0.00 ?  579  GLN A CB   3  
ATOM 3623  C CG   . GLN A 1 23 ? 7.065   4.192   -4.709  1.00 0.00 ?  579  GLN A CG   3  
ATOM 3624  C CD   . GLN A 1 23 ? 8.089   4.704   -3.730  1.00 0.00 ?  579  GLN A CD   3  
ATOM 3625  O OE1  . GLN A 1 23 ? 8.910   5.569   -4.057  1.00 0.00 ?  579  GLN A OE1  3  
ATOM 3626  N NE2  . GLN A 1 23 ? 8.076   4.170   -2.540  1.00 0.00 ?  579  GLN A NE2  3  
ATOM 3627  H H    . GLN A 1 23 ? 3.659   6.280   -5.200  1.00 0.00 ?  579  GLN A H    3  
ATOM 3628  H HA   . GLN A 1 23 ? 4.976   4.222   -6.523  1.00 0.00 ?  579  GLN A HA   3  
ATOM 3629  H HB2  . GLN A 1 23 ? 6.033   5.998   -5.100  1.00 0.00 ?  579  GLN A HB2  3  
ATOM 3630  H HB3  . GLN A 1 23 ? 5.474   5.138   -3.677  1.00 0.00 ?  579  GLN A HB3  3  
ATOM 3631  H HG2  . GLN A 1 23 ? 6.813   3.176   -4.442  1.00 0.00 ?  579  GLN A HG2  3  
ATOM 3632  H HG3  . GLN A 1 23 ? 7.489   4.211   -5.702  1.00 0.00 ?  579  GLN A HG3  3  
ATOM 3633  H HE21 . GLN A 1 23 ? 7.412   3.469   -2.342  1.00 0.00 ?  579  GLN A HE21 3  
ATOM 3634  H HE22 . GLN A 1 23 ? 8.735   4.477   -1.883  1.00 0.00 ?  579  GLN A HE22 3  
ATOM 3635  N N    . LEU A 1 24 ? 3.308   3.261   -3.849  1.00 0.00 ?  580  LEU A N    3  
ATOM 3636  C CA   . LEU A 1 24 ? 2.743   2.119   -3.156  1.00 0.00 ?  580  LEU A CA   3  
ATOM 3637  C C    . LEU A 1 24 ? 1.682   1.387   -3.998  1.00 0.00 ?  580  LEU A C    3  
ATOM 3638  O O    . LEU A 1 24 ? 1.436   0.194   -3.798  1.00 0.00 ?  580  LEU A O    3  
ATOM 3639  C CB   . LEU A 1 24 ? 2.230   2.479   -1.750  1.00 0.00 ?  580  LEU A CB   3  
ATOM 3640  C CG   . LEU A 1 24 ? 3.317   2.687   -0.663  1.00 0.00 ?  580  LEU A CG   3  
ATOM 3641  C CD1  . LEU A 1 24 ? 4.208   3.877   -0.955  1.00 0.00 ?  580  LEU A CD1  3  
ATOM 3642  C CD2  . LEU A 1 24 ? 2.695   2.826   0.703   1.00 0.00 ?  580  LEU A CD2  3  
ATOM 3643  H H    . LEU A 1 24 ? 3.047   4.166   -3.574  1.00 0.00 ?  580  LEU A H    3  
ATOM 3644  H HA   . LEU A 1 24 ? 3.570   1.439   -3.045  1.00 0.00 ?  580  LEU A HA   3  
ATOM 3645  H HB2  . LEU A 1 24 ? 1.648   3.386   -1.829  1.00 0.00 ?  580  LEU A HB2  3  
ATOM 3646  H HB3  . LEU A 1 24 ? 1.578   1.683   -1.422  1.00 0.00 ?  580  LEU A HB3  3  
ATOM 3647  H HG   . LEU A 1 24 ? 3.953   1.814   -0.649  1.00 0.00 ?  580  LEU A HG   3  
ATOM 3648  H HD11 . LEU A 1 24 ? 4.958   3.962   -0.185  1.00 0.00 ?  580  LEU A HD11 3  
ATOM 3649  H HD12 . LEU A 1 24 ? 3.608   4.775   -0.981  1.00 0.00 ?  580  LEU A HD12 3  
ATOM 3650  H HD13 . LEU A 1 24 ? 4.685   3.729   -1.913  1.00 0.00 ?  580  LEU A HD13 3  
ATOM 3651  H HD21 . LEU A 1 24 ? 2.067   1.971   0.908   1.00 0.00 ?  580  LEU A HD21 3  
ATOM 3652  H HD22 . LEU A 1 24 ? 2.124   3.739   0.754   1.00 0.00 ?  580  LEU A HD22 3  
ATOM 3653  H HD23 . LEU A 1 24 ? 3.481   2.866   1.443   1.00 0.00 ?  580  LEU A HD23 3  
ATOM 3654  N N    . SER A 1 25 ? 1.087   2.105   -4.962  1.00 0.00 ?  581  SER A N    3  
ATOM 3655  C CA   . SER A 1 25 ? 0.071   1.554   -5.866  1.00 0.00 ?  581  SER A CA   3  
ATOM 3656  C C    . SER A 1 25 ? 0.683   0.391   -6.653  1.00 0.00 ?  581  SER A C    3  
ATOM 3657  O O    . SER A 1 25 ? 0.069   -0.663  -6.842  1.00 0.00 ?  581  SER A O    3  
ATOM 3658  C CB   . SER A 1 25 ? -0.334  2.604   -6.901  1.00 0.00 ?  581  SER A CB   3  
ATOM 3659  O OG   . SER A 1 25 ? -1.637  2.367   -7.424  1.00 0.00 ?  581  SER A OG   3  
ATOM 3660  H H    . SER A 1 25 ? 1.364   3.039   -5.072  1.00 0.00 ?  581  SER A H    3  
ATOM 3661  H HA   . SER A 1 25 ? -0.798  1.298   -5.277  1.00 0.00 ?  581  SER A HA   3  
ATOM 3662  H HB2  . SER A 1 25 ? -0.223  3.602   -6.512  1.00 0.00 ?  581  SER A HB2  3  
ATOM 3663  H HB3  . SER A 1 25 ? 0.365   2.512   -7.720  1.00 0.00 ?  581  SER A HB3  3  
ATOM 3664  H HG   . SER A 1 25 ? -2.227  2.101   -6.706  1.00 0.00 ?  581  SER A HG   3  
ATOM 3665  N N    . LEU A 1 26 ? 1.911   0.602   -7.109  1.00 0.00 ?  582  LEU A N    3  
ATOM 3666  C CA   . LEU A 1 26 ? 2.603   -0.371  -7.913  1.00 0.00 ?  582  LEU A CA   3  
ATOM 3667  C C    . LEU A 1 26 ? 2.970   -1.611  -7.105  1.00 0.00 ?  582  LEU A C    3  
ATOM 3668  O O    . LEU A 1 26 ? 2.946   -2.719  -7.632  1.00 0.00 ?  582  LEU A O    3  
ATOM 3669  C CB   . LEU A 1 26 ? 3.846   0.233   -8.609  1.00 0.00 ?  582  LEU A CB   3  
ATOM 3670  C CG   . LEU A 1 26 ? 3.618   1.271   -9.749  1.00 0.00 ?  582  LEU A CG   3  
ATOM 3671  C CD1  . LEU A 1 26 ? 2.720   0.717   -10.843 1.00 0.00 ?  582  LEU A CD1  3  
ATOM 3672  C CD2  . LEU A 1 26 ? 3.098   2.619   -9.240  1.00 0.00 ?  582  LEU A CD2  3  
ATOM 3673  H H    . LEU A 1 26 ? 2.367   1.447   -6.903  1.00 0.00 ?  582  LEU A H    3  
ATOM 3674  H HA   . LEU A 1 26 ? 1.907   -0.683  -8.678  1.00 0.00 ?  582  LEU A HA   3  
ATOM 3675  H HB2  . LEU A 1 26 ? 4.436   0.717   -7.846  1.00 0.00 ?  582  LEU A HB2  3  
ATOM 3676  H HB3  . LEU A 1 26 ? 4.425   -0.585  -9.011  1.00 0.00 ?  582  LEU A HB3  3  
ATOM 3677  H HG   . LEU A 1 26 ? 4.584   1.434   -10.204 1.00 0.00 ?  582  LEU A HG   3  
ATOM 3678  H HD11 . LEU A 1 26 ? 2.614   1.456   -11.624 1.00 0.00 ?  582  LEU A HD11 3  
ATOM 3679  H HD12 . LEU A 1 26 ? 1.746   0.496   -10.434 1.00 0.00 ?  582  LEU A HD12 3  
ATOM 3680  H HD13 . LEU A 1 26 ? 3.157   -0.182  -11.252 1.00 0.00 ?  582  LEU A HD13 3  
ATOM 3681  H HD21 . LEU A 1 26 ? 3.814   3.048   -8.554  1.00 0.00 ?  582  LEU A HD21 3  
ATOM 3682  H HD22 . LEU A 1 26 ? 2.162   2.485   -8.722  1.00 0.00 ?  582  LEU A HD22 3  
ATOM 3683  H HD23 . LEU A 1 26 ? 2.935   3.310   -10.055 1.00 0.00 ?  582  LEU A HD23 3  
ATOM 3684  N N    . ASP A 1 27 ? 3.255   -1.432  -5.818  1.00 0.00 ?  583  ASP A N    3  
ATOM 3685  C CA   . ASP A 1 27 ? 3.613   -2.565  -4.962  1.00 0.00 ?  583  ASP A CA   3  
ATOM 3686  C C    . ASP A 1 27 ? 2.454   -3.486  -4.748  1.00 0.00 ?  583  ASP A C    3  
ATOM 3687  O O    . ASP A 1 27 ? 2.586   -4.692  -4.921  1.00 0.00 ?  583  ASP A O    3  
ATOM 3688  C CB   . ASP A 1 27 ? 4.229   -2.154  -3.621  1.00 0.00 ?  583  ASP A CB   3  
ATOM 3689  C CG   . ASP A 1 27 ? 5.645   -1.634  -3.774  1.00 0.00 ?  583  ASP A CG   3  
ATOM 3690  O OD1  . ASP A 1 27 ? 5.880   -0.425  -3.613  1.00 0.00 ?  583  ASP A OD1  3  
ATOM 3691  O OD2  . ASP A 1 27 ? 6.555   -2.440  -4.095  1.00 0.00 -1 583  ASP A OD2  3  
ATOM 3692  H H    . ASP A 1 27 ? 3.217   -0.530  -5.433  1.00 0.00 ?  583  ASP A H    3  
ATOM 3693  H HA   . ASP A 1 27 ? 4.352   -3.128  -5.516  1.00 0.00 ?  583  ASP A HA   3  
ATOM 3694  H HB2  . ASP A 1 27 ? 3.612   -1.386  -3.179  1.00 0.00 ?  583  ASP A HB2  3  
ATOM 3695  H HB3  . ASP A 1 27 ? 4.227   -3.007  -2.954  1.00 0.00 ?  583  ASP A HB3  3  
ATOM 3696  N N    . ILE A 1 28 ? 1.304   -2.928  -4.402  1.00 0.00 ?  584  ILE A N    3  
ATOM 3697  C CA   . ILE A 1 28 ? 0.104   -3.738  -4.218  1.00 0.00 ?  584  ILE A CA   3  
ATOM 3698  C C    . ILE A 1 28 ? -0.305  -4.426  -5.533  1.00 0.00 ?  584  ILE A C    3  
ATOM 3699  O O    . ILE A 1 28 ? -0.723  -5.576  -5.536  1.00 0.00 ?  584  ILE A O    3  
ATOM 3700  C CB   . ILE A 1 28 ? -1.085  -2.942  -3.568  1.00 0.00 ?  584  ILE A CB   3  
ATOM 3701  C CG1  . ILE A 1 28 ? -2.381  -3.747  -3.561  1.00 0.00 ?  584  ILE A CG1  3  
ATOM 3702  C CG2  . ILE A 1 28 ? -1.300  -1.608  -4.243  1.00 0.00 ?  584  ILE A CG2  3  
ATOM 3703  C CD1  . ILE A 1 28 ? -2.311  -5.070  -2.839  1.00 0.00 ?  584  ILE A CD1  3  
ATOM 3704  H H    . ILE A 1 28 ? 1.273   -1.957  -4.257  1.00 0.00 ?  584  ILE A H    3  
ATOM 3705  H HA   . ILE A 1 28 ? 0.395   -4.535  -3.552  1.00 0.00 ?  584  ILE A HA   3  
ATOM 3706  H HB   . ILE A 1 28 ? -0.811  -2.737  -2.546  1.00 0.00 ?  584  ILE A HB   3  
ATOM 3707  H HG12 . ILE A 1 28 ? -3.164  -3.162  -3.102  1.00 0.00 ?  584  ILE A HG12 3  
ATOM 3708  H HG13 . ILE A 1 28 ? -2.637  -3.940  -4.590  1.00 0.00 ?  584  ILE A HG13 3  
ATOM 3709  H HG21 . ILE A 1 28 ? -2.256  -1.172  -3.982  1.00 0.00 ?  584  ILE A HG21 3  
ATOM 3710  H HG22 . ILE A 1 28 ? -1.283  -1.765  -5.311  1.00 0.00 ?  584  ILE A HG22 3  
ATOM 3711  H HG23 . ILE A 1 28 ? -0.505  -0.929  -3.969  1.00 0.00 ?  584  ILE A HG23 3  
ATOM 3712  H HD11 . ILE A 1 28 ? -3.272  -5.556  -2.940  1.00 0.00 ?  584  ILE A HD11 3  
ATOM 3713  H HD12 . ILE A 1 28 ? -2.066  -4.911  -1.801  1.00 0.00 ?  584  ILE A HD12 3  
ATOM 3714  H HD13 . ILE A 1 28 ? -1.559  -5.685  -3.311  1.00 0.00 ?  584  ILE A HD13 3  
ATOM 3715  N N    . ASN A 1 29 ? -0.108  -3.742  -6.644  1.00 0.00 ?  585  ASN A N    3  
ATOM 3716  C CA   . ASN A 1 29 ? -0.424  -4.307  -7.960  1.00 0.00 ?  585  ASN A CA   3  
ATOM 3717  C C    . ASN A 1 29 ? 0.475   -5.521  -8.283  1.00 0.00 ?  585  ASN A C    3  
ATOM 3718  O O    . ASN A 1 29 ? 0.137   -6.364  -9.119  1.00 0.00 ?  585  ASN A O    3  
ATOM 3719  C CB   . ASN A 1 29 ? -0.296  -3.234  -9.058  1.00 0.00 ?  585  ASN A CB   3  
ATOM 3720  C CG   . ASN A 1 29 ? -0.670  -3.743  -10.445 1.00 0.00 ?  585  ASN A CG   3  
ATOM 3721  O OD1  . ASN A 1 29 ? 0.176   -4.224  -11.198 1.00 0.00 ?  585  ASN A OD1  3  
ATOM 3722  N ND2  . ASN A 1 29 ? -1.930  -3.637  -10.793 1.00 0.00 ?  585  ASN A ND2  3  
ATOM 3723  H H    . ASN A 1 29 ? 0.242   -2.827  -6.575  1.00 0.00 ?  585  ASN A H    3  
ATOM 3724  H HA   . ASN A 1 29 ? -1.449  -4.648  -7.926  1.00 0.00 ?  585  ASN A HA   3  
ATOM 3725  H HB2  . ASN A 1 29 ? -0.940  -2.400  -8.822  1.00 0.00 ?  585  ASN A HB2  3  
ATOM 3726  H HB3  . ASN A 1 29 ? 0.728   -2.889  -9.087  1.00 0.00 ?  585  ASN A HB3  3  
ATOM 3727  H HD21 . ASN A 1 29 ? -2.555  -3.237  -10.153 1.00 0.00 ?  585  ASN A HD21 3  
ATOM 3728  H HD22 . ASN A 1 29 ? -2.203  -3.971  -11.673 1.00 0.00 ?  585  ASN A HD22 3  
ATOM 3729  N N    . ARG A 1 30 ? 1.618   -5.605  -7.621  1.00 0.00 ?  586  ARG A N    3  
ATOM 3730  C CA   . ARG A 1 30 ? 2.541   -6.707  -7.834  1.00 0.00 ?  586  ARG A CA   3  
ATOM 3731  C C    . ARG A 1 30 ? 2.412   -7.776  -6.748  1.00 0.00 ?  586  ARG A C    3  
ATOM 3732  O O    . ARG A 1 30 ? 2.990   -8.875  -6.874  1.00 0.00 ?  586  ARG A O    3  
ATOM 3733  C CB   . ARG A 1 30 ? 3.993   -6.210  -7.943  1.00 0.00 ?  586  ARG A CB   3  
ATOM 3734  C CG   . ARG A 1 30 ? 4.284   -5.268  -9.132  1.00 0.00 ?  586  ARG A CG   3  
ATOM 3735  C CD   . ARG A 1 30 ? 4.085   -5.939  -10.504 1.00 0.00 ?  586  ARG A CD   3  
ATOM 3736  N NE   . ARG A 1 30 ? 2.681   -6.292  -10.773 1.00 0.00 ?  586  ARG A NE   3  
ATOM 3737  C CZ   . ARG A 1 30 ? 2.256   -7.130  -11.718 1.00 0.00 ?  586  ARG A CZ   3  
ATOM 3738  N NH1  . ARG A 1 30 ? 3.113   -7.666  -12.582 1.00 0.00 1  586  ARG A NH1  3  
ATOM 3739  N NH2  . ARG A 1 30 ? 0.957   -7.418  -11.798 1.00 0.00 ?  586  ARG A NH2  3  
ATOM 3740  H H    . ARG A 1 30 ? 1.846   -4.914  -6.961  1.00 0.00 ?  586  ARG A H    3  
ATOM 3741  H HA   . ARG A 1 30 ? 2.268   -7.167  -8.772  1.00 0.00 ?  586  ARG A HA   3  
ATOM 3742  H HB2  . ARG A 1 30 ? 4.240   -5.679  -7.035  1.00 0.00 ?  586  ARG A HB2  3  
ATOM 3743  H HB3  . ARG A 1 30 ? 4.644   -7.069  -8.025  1.00 0.00 ?  586  ARG A HB3  3  
ATOM 3744  H HG2  . ARG A 1 30 ? 3.619   -4.420  -9.067  1.00 0.00 ?  586  ARG A HG2  3  
ATOM 3745  H HG3  . ARG A 1 30 ? 5.304   -4.922  -9.051  1.00 0.00 ?  586  ARG A HG3  3  
ATOM 3746  H HD2  . ARG A 1 30 ? 4.416   -5.259  -11.275 1.00 0.00 ?  586  ARG A HD2  3  
ATOM 3747  H HD3  . ARG A 1 30 ? 4.684   -6.835  -10.541 1.00 0.00 ?  586  ARG A HD3  3  
ATOM 3748  H HE   . ARG A 1 30 ? 2.021   -5.874  -10.176 1.00 0.00 ?  586  ARG A HE   3  
ATOM 3749  H HH11 . ARG A 1 30 ? 4.096   -7.468  -12.552 1.00 0.00 ?  586  ARG A HH11 3  
ATOM 3750  H HH12 . ARG A 1 30 ? 2.819   -8.283  -13.314 1.00 0.00 ?  586  ARG A HH12 3  
ATOM 3751  H HH21 . ARG A 1 30 ? 0.295   -7.011  -11.158 1.00 0.00 ?  586  ARG A HH21 3  
ATOM 3752  H HH22 . ARG A 1 30 ? 0.589   -8.052  -12.483 1.00 0.00 ?  586  ARG A HH22 3  
ATOM 3753  N N    . LEU A 1 31 ? 1.661   -7.482  -5.704  1.00 0.00 ?  587  LEU A N    3  
ATOM 3754  C CA   . LEU A 1 31 ? 1.468   -8.423  -4.632  1.00 0.00 ?  587  LEU A CA   3  
ATOM 3755  C C    . LEU A 1 31 ? 0.477   -9.527  -5.001  1.00 0.00 ?  587  LEU A C    3  
ATOM 3756  O O    . LEU A 1 31 ? -0.574  -9.256  -5.589  1.00 0.00 ?  587  LEU A O    3  
ATOM 3757  C CB   . LEU A 1 31 ? 1.072   -7.714  -3.355  1.00 0.00 ?  587  LEU A CB   3  
ATOM 3758  C CG   . LEU A 1 31 ? 2.227   -7.012  -2.674  1.00 0.00 ?  587  LEU A CG   3  
ATOM 3759  C CD1  . LEU A 1 31 ? 1.742   -6.087  -1.605  1.00 0.00 ?  587  LEU A CD1  3  
ATOM 3760  C CD2  . LEU A 1 31 ? 3.167   -8.003  -2.049  1.00 0.00 ?  587  LEU A CD2  3  
ATOM 3761  H H    . LEU A 1 31 ? 1.207   -6.614  -5.638  1.00 0.00 ?  587  LEU A H    3  
ATOM 3762  H HA   . LEU A 1 31 ? 2.459   -8.826  -4.484  1.00 0.00 ?  587  LEU A HA   3  
ATOM 3763  H HB2  . LEU A 1 31 ? 0.311   -6.984  -3.596  1.00 0.00 ?  587  LEU A HB2  3  
ATOM 3764  H HB3  . LEU A 1 31 ? 0.660   -8.438  -2.669  1.00 0.00 ?  587  LEU A HB3  3  
ATOM 3765  H HG   . LEU A 1 31 ? 2.764   -6.514  -3.467  1.00 0.00 ?  587  LEU A HG   3  
ATOM 3766  H HD11 . LEU A 1 31 ? 1.317   -5.200  -2.047  1.00 0.00 ?  587  LEU A HD11 3  
ATOM 3767  H HD12 . LEU A 1 31 ? 2.555   -5.859  -0.930  1.00 0.00 ?  587  LEU A HD12 3  
ATOM 3768  H HD13 . LEU A 1 31 ? 0.972   -6.617  -1.066  1.00 0.00 ?  587  LEU A HD13 3  
ATOM 3769  H HD21 . LEU A 1 31 ? 3.594   -8.662  -2.789  1.00 0.00 ?  587  LEU A HD21 3  
ATOM 3770  H HD22 . LEU A 1 31 ? 2.620   -8.571  -1.310  1.00 0.00 ?  587  LEU A HD22 3  
ATOM 3771  H HD23 . LEU A 1 31 ? 3.952   -7.459  -1.542  1.00 0.00 ?  587  LEU A HD23 3  
ATOM 3772  N N    . PRO A 1 32 ? 0.826   -10.795 -4.694  1.00 0.00 ?  588  PRO A N    3  
ATOM 3773  C CA   . PRO A 1 32 ? -0.014  -11.962 -5.006  1.00 0.00 ?  588  PRO A CA   3  
ATOM 3774  C C    . PRO A 1 32 ? -1.371  -11.967 -4.264  1.00 0.00 ?  588  PRO A C    3  
ATOM 3775  O O    . PRO A 1 32 ? -1.601  -11.168 -3.336  1.00 0.00 ?  588  PRO A O    3  
ATOM 3776  C CB   . PRO A 1 32 ? 0.847   -13.150 -4.565  1.00 0.00 ?  588  PRO A CB   3  
ATOM 3777  C CG   . PRO A 1 32 ? 1.805   -12.591 -3.583  1.00 0.00 ?  588  PRO A CG   3  
ATOM 3778  C CD   . PRO A 1 32 ? 2.084   -11.194 -4.040  1.00 0.00 ?  588  PRO A CD   3  
ATOM 3779  H HA   . PRO A 1 32 ? -0.198  -12.026 -6.068  1.00 0.00 ?  588  PRO A HA   3  
ATOM 3780  H HB2  . PRO A 1 32 ? 0.217   -13.905 -4.117  1.00 0.00 ?  588  PRO A HB2  3  
ATOM 3781  H HB3  . PRO A 1 32 ? 1.361   -13.557 -5.423  1.00 0.00 ?  588  PRO A HB3  3  
ATOM 3782  H HG2  . PRO A 1 32 ? 1.358   -12.584 -2.601  1.00 0.00 ?  588  PRO A HG2  3  
ATOM 3783  H HG3  . PRO A 1 32 ? 2.715   -13.174 -3.579  1.00 0.00 ?  588  PRO A HG3  3  
ATOM 3784  H HD2  . PRO A 1 32 ? 2.297   -10.560 -3.192  1.00 0.00 ?  588  PRO A HD2  3  
ATOM 3785  H HD3  . PRO A 1 32 ? 2.904   -11.179 -4.743  1.00 0.00 ?  588  PRO A HD3  3  
ATOM 3786  N N    . GLY A 1 33 ? -2.231  -12.908 -4.655  1.00 0.00 ?  589  GLY A N    3  
ATOM 3787  C CA   . GLY A 1 33 ? -3.602  -13.010 -4.151  1.00 0.00 ?  589  GLY A CA   3  
ATOM 3788  C C    . GLY A 1 33 ? -3.718  -13.064 -2.641  1.00 0.00 ?  589  GLY A C    3  
ATOM 3789  O O    . GLY A 1 33 ? -4.514  -12.328 -2.044  1.00 0.00 ?  589  GLY A O    3  
ATOM 3790  H H    . GLY A 1 33 ? -1.927  -13.567 -5.318  1.00 0.00 ?  589  GLY A H    3  
ATOM 3791  H HA2  . GLY A 1 33 ? -4.162  -12.156 -4.500  1.00 0.00 ?  589  GLY A HA2  3  
ATOM 3792  H HA3  . GLY A 1 33 ? -4.054  -13.897 -4.565  1.00 0.00 ?  589  GLY A HA3  3  
ATOM 3793  N N    . GLU A 1 34 ? -2.895  -13.882 -2.016  1.00 0.00 ?  590  GLU A N    3  
ATOM 3794  C CA   . GLU A 1 34 ? -2.932  -14.052 -0.567  1.00 0.00 ?  590  GLU A CA   3  
ATOM 3795  C C    . GLU A 1 34 ? -2.430  -12.817 0.169   1.00 0.00 ?  590  GLU A C    3  
ATOM 3796  O O    . GLU A 1 34 ? -2.623  -12.672 1.376   1.00 0.00 ?  590  GLU A O    3  
ATOM 3797  C CB   . GLU A 1 34 ? -2.168  -15.307 -0.099  1.00 0.00 ?  590  GLU A CB   3  
ATOM 3798  C CG   . GLU A 1 34 ? -0.763  -15.483 -0.678  1.00 0.00 ?  590  GLU A CG   3  
ATOM 3799  C CD   . GLU A 1 34 ? -0.781  -16.111 -2.054  1.00 0.00 ?  590  GLU A CD   3  
ATOM 3800  O OE1  . GLU A 1 34 ? -0.717  -17.351 -2.140  1.00 0.00 ?  590  GLU A OE1  3  
ATOM 3801  O OE2  . GLU A 1 34 ? -0.895  -15.381 -3.068  1.00 0.00 -1 590  GLU A OE2  3  
ATOM 3802  H H    . GLU A 1 34 ? -2.220  -14.383 -2.536  1.00 0.00 ?  590  GLU A H    3  
ATOM 3803  H HA   . GLU A 1 34 ? -3.973  -14.173 -0.306  1.00 0.00 ?  590  GLU A HA   3  
ATOM 3804  H HB2  . GLU A 1 34 ? -2.078  -15.275 0.976   1.00 0.00 ?  590  GLU A HB2  3  
ATOM 3805  H HB3  . GLU A 1 34 ? -2.750  -16.178 -0.363  1.00 0.00 ?  590  GLU A HB3  3  
ATOM 3806  H HG2  . GLU A 1 34 ? -0.300  -14.510 -0.756  1.00 0.00 ?  590  GLU A HG2  3  
ATOM 3807  H HG3  . GLU A 1 34 ? -0.180  -16.104 -0.016  1.00 0.00 ?  590  GLU A HG3  3  
ATOM 3808  N N    . LYS A 1 35 ? -1.787  -11.936 -0.547  1.00 0.00 ?  591  LYS A N    3  
ATOM 3809  C CA   . LYS A 1 35 ? -1.311  -10.725 0.039   1.00 0.00 ?  591  LYS A CA   3  
ATOM 3810  C C    . LYS A 1 35 ? -2.339  -9.613  -0.133  1.00 0.00 ?  591  LYS A C    3  
ATOM 3811  O O    . LYS A 1 35 ? -2.679  -8.942  0.837   1.00 0.00 ?  591  LYS A O    3  
ATOM 3812  C CB   . LYS A 1 35 ? 0.054   -10.324 -0.532  1.00 0.00 ?  591  LYS A CB   3  
ATOM 3813  C CG   . LYS A 1 35 ? 1.205   -11.284 -0.192  1.00 0.00 ?  591  LYS A CG   3  
ATOM 3814  C CD   . LYS A 1 35 ? 1.494   -11.366 1.314   1.00 0.00 ?  591  LYS A CD   3  
ATOM 3815  C CE   . LYS A 1 35 ? 2.731   -12.219 1.586   1.00 0.00 ?  591  LYS A CE   3  
ATOM 3816  N NZ   . LYS A 1 35 ? 3.087   -12.285 3.022   1.00 0.00 1  591  LYS A NZ   3  
ATOM 3817  H H    . LYS A 1 35 ? -1.654  -12.097 -1.507  1.00 0.00 ?  591  LYS A H    3  
ATOM 3818  H HA   . LYS A 1 35 ? -1.203  -10.912 1.096   1.00 0.00 ?  591  LYS A HA   3  
ATOM 3819  H HB2  . LYS A 1 35 ? -0.034  -10.281 -1.608  1.00 0.00 ?  591  LYS A HB2  3  
ATOM 3820  H HB3  . LYS A 1 35 ? 0.310   -9.341  -0.163  1.00 0.00 ?  591  LYS A HB3  3  
ATOM 3821  H HG2  . LYS A 1 35 ? 0.939   -12.271 -0.541  1.00 0.00 ?  591  LYS A HG2  3  
ATOM 3822  H HG3  . LYS A 1 35 ? 2.096   -10.953 -0.704  1.00 0.00 ?  591  LYS A HG3  3  
ATOM 3823  H HD2  . LYS A 1 35 ? 1.667   -10.374 1.702   1.00 0.00 ?  591  LYS A HD2  3  
ATOM 3824  H HD3  . LYS A 1 35 ? 0.646   -11.812 1.812   1.00 0.00 ?  591  LYS A HD3  3  
ATOM 3825  H HE2  . LYS A 1 35 ? 2.546   -13.224 1.234   1.00 0.00 ?  591  LYS A HE2  3  
ATOM 3826  H HE3  . LYS A 1 35 ? 3.560   -11.800 1.035   1.00 0.00 ?  591  LYS A HE3  3  
ATOM 3827  H HZ1  . LYS A 1 35 ? 4.012   -12.749 3.148   1.00 0.00 ?  591  LYS A HZ1  3  
ATOM 3828  H HZ2  . LYS A 1 35 ? 2.393   -12.830 3.568   1.00 0.00 ?  591  LYS A HZ2  3  
ATOM 3829  H HZ3  . LYS A 1 35 ? 3.159   -11.341 3.451   1.00 0.00 ?  591  LYS A HZ3  3  
ATOM 3830  N N    . LEU A 1 36 ? -2.878  -9.464  -1.357  1.00 0.00 ?  592  LEU A N    3  
ATOM 3831  C CA   . LEU A 1 36 ? -3.845  -8.410  -1.665  1.00 0.00 ?  592  LEU A CA   3  
ATOM 3832  C C    . LEU A 1 36 ? -5.091  -8.492  -0.758  1.00 0.00 ?  592  LEU A C    3  
ATOM 3833  O O    . LEU A 1 36 ? -5.585  -7.473  -0.267  1.00 0.00 ?  592  LEU A O    3  
ATOM 3834  C CB   . LEU A 1 36 ? -4.211  -8.427  -3.189  1.00 0.00 ?  592  LEU A CB   3  
ATOM 3835  C CG   . LEU A 1 36 ? -5.083  -9.600  -3.738  1.00 0.00 ?  592  LEU A CG   3  
ATOM 3836  C CD1  . LEU A 1 36 ? -6.573  -9.329  -3.567  1.00 0.00 ?  592  LEU A CD1  3  
ATOM 3837  C CD2  . LEU A 1 36 ? -4.802  -9.830  -5.189  1.00 0.00 ?  592  LEU A CD2  3  
ATOM 3838  H H    . LEU A 1 36 ? -2.611  -10.051 -2.100  1.00 0.00 ?  592  LEU A H    3  
ATOM 3839  H HA   . LEU A 1 36 ? -3.350  -7.475  -1.446  1.00 0.00 ?  592  LEU A HA   3  
ATOM 3840  H HB2  . LEU A 1 36 ? -4.693  -7.491  -3.431  1.00 0.00 ?  592  LEU A HB2  3  
ATOM 3841  H HB3  . LEU A 1 36 ? -3.277  -8.433  -3.730  1.00 0.00 ?  592  LEU A HB3  3  
ATOM 3842  H HG   . LEU A 1 36 ? -4.840  -10.503 -3.197  1.00 0.00 ?  592  LEU A HG   3  
ATOM 3843  H HD11 . LEU A 1 36 ? -6.836  -8.502  -4.212  1.00 0.00 ?  592  LEU A HD11 3  
ATOM 3844  H HD12 . LEU A 1 36 ? -6.783  -9.077  -2.538  1.00 0.00 ?  592  LEU A HD12 3  
ATOM 3845  H HD13 . LEU A 1 36 ? -7.137  -10.204 -3.857  1.00 0.00 ?  592  LEU A HD13 3  
ATOM 3846  H HD21 . LEU A 1 36 ? -3.746  -9.993  -5.353  1.00 0.00 ?  592  LEU A HD21 3  
ATOM 3847  H HD22 . LEU A 1 36 ? -5.144  -8.938  -5.694  1.00 0.00 ?  592  LEU A HD22 3  
ATOM 3848  H HD23 . LEU A 1 36 ? -5.379  -10.673 -5.539  1.00 0.00 ?  592  LEU A HD23 3  
ATOM 3849  N N    . GLY A 1 37 ? -5.562  -9.706  -0.517  1.00 0.00 ?  593  GLY A N    3  
ATOM 3850  C CA   . GLY A 1 37 ? -6.733  -9.893  0.320   1.00 0.00 ?  593  GLY A CA   3  
ATOM 3851  C C    . GLY A 1 37 ? -6.452  -9.583  1.775   1.00 0.00 ?  593  GLY A C    3  
ATOM 3852  O O    . GLY A 1 37 ? -7.308  -9.072  2.488   1.00 0.00 ?  593  GLY A O    3  
ATOM 3853  H H    . GLY A 1 37 ? -5.122  -10.475 -0.940  1.00 0.00 ?  593  GLY A H    3  
ATOM 3854  H HA2  . GLY A 1 37 ? -7.518  -9.241  -0.031  1.00 0.00 ?  593  GLY A HA2  3  
ATOM 3855  H HA3  . GLY A 1 37 ? -7.065  -10.916 0.237   1.00 0.00 ?  593  GLY A HA3  3  
ATOM 3856  N N    . ARG A 1 38 ? -5.267  -9.914  2.211   1.00 0.00 ?  594  ARG A N    3  
ATOM 3857  C CA   . ARG A 1 38 ? -4.846  -9.685  3.589   1.00 0.00 ?  594  ARG A CA   3  
ATOM 3858  C C    . ARG A 1 38 ? -4.623  -8.219  3.865   1.00 0.00 ?  594  ARG A C    3  
ATOM 3859  O O    . ARG A 1 38 ? -5.191  -7.662  4.806   1.00 0.00 ?  594  ARG A O    3  
ATOM 3860  C CB   . ARG A 1 38 ? -3.596  -10.503 3.940   1.00 0.00 ?  594  ARG A CB   3  
ATOM 3861  C CG   . ARG A 1 38 ? -3.039  -10.203 5.327   1.00 0.00 ?  594  ARG A CG   3  
ATOM 3862  C CD   . ARG A 1 38 ? -1.807  -11.025 5.652   1.00 0.00 ?  594  ARG A CD   3  
ATOM 3863  N NE   . ARG A 1 38 ? -2.105  -12.455 5.766   1.00 0.00 ?  594  ARG A NE   3  
ATOM 3864  C CZ   . ARG A 1 38 ? -1.502  -13.296 6.620   1.00 0.00 ?  594  ARG A CZ   3  
ATOM 3865  N NH1  . ARG A 1 38 ? -0.565  -12.849 7.449   1.00 0.00 1  594  ARG A NH1  3  
ATOM 3866  N NH2  . ARG A 1 38 ? -1.846  -14.579 6.638   1.00 0.00 ?  594  ARG A NH2  3  
ATOM 3867  H H    . ARG A 1 38 ? -4.639  -10.282 1.558   1.00 0.00 ?  594  ARG A H    3  
ATOM 3868  H HA   . ARG A 1 38 ? -5.648  -9.977  4.251   1.00 0.00 ?  594  ARG A HA   3  
ATOM 3869  H HB2  . ARG A 1 38 ? -3.851  -11.551 3.903   1.00 0.00 ?  594  ARG A HB2  3  
ATOM 3870  H HB3  . ARG A 1 38 ? -2.829  -10.296 3.210   1.00 0.00 ?  594  ARG A HB3  3  
ATOM 3871  H HG2  . ARG A 1 38 ? -2.774  -9.157  5.373   1.00 0.00 ?  594  ARG A HG2  3  
ATOM 3872  H HG3  . ARG A 1 38 ? -3.805  -10.407 6.061   1.00 0.00 ?  594  ARG A HG3  3  
ATOM 3873  H HD2  . ARG A 1 38 ? -1.080  -10.888 4.866   1.00 0.00 ?  594  ARG A HD2  3  
ATOM 3874  H HD3  . ARG A 1 38 ? -1.394  -10.679 6.586   1.00 0.00 ?  594  ARG A HD3  3  
ATOM 3875  H HE   . ARG A 1 38 ? -2.800  -12.791 5.158   1.00 0.00 ?  594  ARG A HE   3  
ATOM 3876  H HH11 . ARG A 1 38 ? -0.276  -11.890 7.473   1.00 0.00 ?  594  ARG A HH11 3  
ATOM 3877  H HH12 . ARG A 1 38 ? -0.095  -13.454 8.100   1.00 0.00 ?  594  ARG A HH12 3  
ATOM 3878  H HH21 . ARG A 1 38 ? -2.547  -14.942 6.021   1.00 0.00 ?  594  ARG A HH21 3  
ATOM 3879  H HH22 . ARG A 1 38 ? -1.451  -15.235 7.290   1.00 0.00 ?  594  ARG A HH22 3  
ATOM 3880  N N    . VAL A 1 39 ? -3.818  -7.596  3.028   1.00 0.00 ?  595  VAL A N    3  
ATOM 3881  C CA   . VAL A 1 39 ? -3.415  -6.213  3.209   1.00 0.00 ?  595  VAL A CA   3  
ATOM 3882  C C    . VAL A 1 39 ? -4.581  -5.282  3.298   1.00 0.00 ?  595  VAL A C    3  
ATOM 3883  O O    . VAL A 1 39 ? -4.553  -4.368  4.118   1.00 0.00 ?  595  VAL A O    3  
ATOM 3884  C CB   . VAL A 1 39 ? -2.414  -5.752  2.123   1.00 0.00 ?  595  VAL A CB   3  
ATOM 3885  C CG1  . VAL A 1 39 ? -3.010  -5.753  0.734   1.00 0.00 ?  595  VAL A CG1  3  
ATOM 3886  C CG2  . VAL A 1 39 ? -1.812  -4.412  2.441   1.00 0.00 ?  595  VAL A CG2  3  
ATOM 3887  H H    . VAL A 1 39 ? -3.471  -8.086  2.248   1.00 0.00 ?  595  VAL A H    3  
ATOM 3888  H HA   . VAL A 1 39 ? -2.928  -6.115  4.169   1.00 0.00 ?  595  VAL A HA   3  
ATOM 3889  H HB   . VAL A 1 39 ? -1.627  -6.487  2.147   1.00 0.00 ?  595  VAL A HB   3  
ATOM 3890  H HG11 . VAL A 1 39 ? -3.370  -6.745  0.504   1.00 0.00 ?  595  VAL A HG11 3  
ATOM 3891  H HG12 . VAL A 1 39 ? -2.239  -5.477  0.031   1.00 0.00 ?  595  VAL A HG12 3  
ATOM 3892  H HG13 . VAL A 1 39 ? -3.824  -5.045  0.680   1.00 0.00 ?  595  VAL A HG13 3  
ATOM 3893  H HG21 . VAL A 1 39 ? -2.591  -3.666  2.473   1.00 0.00 ?  595  VAL A HG21 3  
ATOM 3894  H HG22 . VAL A 1 39 ? -1.093  -4.159  1.676   1.00 0.00 ?  595  VAL A HG22 3  
ATOM 3895  H HG23 . VAL A 1 39 ? -1.316  -4.460  3.400   1.00 0.00 ?  595  VAL A HG23 3  
ATOM 3896  N N    . VAL A 1 40 ? -5.643  -5.561  2.538   1.00 0.00 ?  596  VAL A N    3  
ATOM 3897  C CA   . VAL A 1 40 ? -6.790  -4.695  2.545   1.00 0.00 ?  596  VAL A CA   3  
ATOM 3898  C C    . VAL A 1 40 ? -7.348  -4.597  3.950   1.00 0.00 ?  596  VAL A C    3  
ATOM 3899  O O    . VAL A 1 40 ? -7.697  -3.543  4.376   1.00 0.00 ?  596  VAL A O    3  
ATOM 3900  C CB   . VAL A 1 40 ? -7.921  -5.121  1.547   1.00 0.00 ?  596  VAL A CB   3  
ATOM 3901  C CG1  . VAL A 1 40 ? -8.849  -6.204  2.100   1.00 0.00 ?  596  VAL A CG1  3  
ATOM 3902  C CG2  . VAL A 1 40 ? -8.715  -3.915  1.103   1.00 0.00 ?  596  VAL A CG2  3  
ATOM 3903  H H    . VAL A 1 40 ? -5.627  -6.351  1.955   1.00 0.00 ?  596  VAL A H    3  
ATOM 3904  H HA   . VAL A 1 40 ? -6.432  -3.714  2.267   1.00 0.00 ?  596  VAL A HA   3  
ATOM 3905  H HB   . VAL A 1 40 ? -7.431  -5.541  0.682   1.00 0.00 ?  596  VAL A HB   3  
ATOM 3906  H HG11 . VAL A 1 40 ? -9.323  -5.805  2.990   1.00 0.00 ?  596  VAL A HG11 3  
ATOM 3907  H HG12 . VAL A 1 40 ? -8.276  -7.080  2.358   1.00 0.00 ?  596  VAL A HG12 3  
ATOM 3908  H HG13 . VAL A 1 40 ? -9.608  -6.453  1.374   1.00 0.00 ?  596  VAL A HG13 3  
ATOM 3909  H HG21 . VAL A 1 40 ? -9.581  -4.255  0.554   1.00 0.00 ?  596  VAL A HG21 3  
ATOM 3910  H HG22 . VAL A 1 40 ? -8.102  -3.291  0.471   1.00 0.00 ?  596  VAL A HG22 3  
ATOM 3911  H HG23 . VAL A 1 40 ? -9.034  -3.359  1.972   1.00 0.00 ?  596  VAL A HG23 3  
ATOM 3912  N N    . HIS A 1 41 ? -7.294  -5.700  4.686   1.00 0.00 ?  597  HIS A N    3  
ATOM 3913  C CA   . HIS A 1 41 ? -7.873  -5.768  6.025   1.00 0.00 ?  597  HIS A CA   3  
ATOM 3914  C C    . HIS A 1 41 ? -7.027  -5.041  7.031   1.00 0.00 ?  597  HIS A C    3  
ATOM 3915  O O    . HIS A 1 41 ? -7.548  -4.401  7.961   1.00 0.00 ?  597  HIS A O    3  
ATOM 3916  C CB   . HIS A 1 41 ? -8.173  -7.206  6.481   1.00 0.00 ?  597  HIS A CB   3  
ATOM 3917  C CG   . HIS A 1 41 ? -9.376  -7.818  5.816   1.00 0.00 ?  597  HIS A CG   3  
ATOM 3918  N ND1  . HIS A 1 41 ? -10.654 -7.770  6.339   1.00 0.00 ?  597  HIS A ND1  3  
ATOM 3919  C CD2  . HIS A 1 41 ? -9.479  -8.500  4.661   1.00 0.00 ?  597  HIS A CD2  3  
ATOM 3920  C CE1  . HIS A 1 41 ? -11.468 -8.408  5.499   1.00 0.00 ?  597  HIS A CE1  3  
ATOM 3921  N NE2  . HIS A 1 41 ? -10.805 -8.877  4.458   1.00 0.00 ?  597  HIS A NE2  3  
ATOM 3922  H H    . HIS A 1 41 ? -6.774  -6.447  4.310   1.00 0.00 ?  597  HIS A H    3  
ATOM 3923  H HA   . HIS A 1 41 ? -8.809  -5.231  5.959   1.00 0.00 ?  597  HIS A HA   3  
ATOM 3924  H HB2  . HIS A 1 41 ? -7.319  -7.825  6.243   1.00 0.00 ?  597  HIS A HB2  3  
ATOM 3925  H HB3  . HIS A 1 41 ? -8.332  -7.214  7.548   1.00 0.00 ?  597  HIS A HB3  3  
ATOM 3926  H HD1  . HIS A 1 41 ? -10.933 -7.348  7.180   1.00 0.00 ?  597  HIS A HD1  3  
ATOM 3927  H HD2  . HIS A 1 41 ? -8.665  -8.720  3.986   1.00 0.00 ?  597  HIS A HD2  3  
ATOM 3928  H HE1  . HIS A 1 41 ? -12.531 -8.524  5.650   1.00 0.00 ?  597  HIS A HE1  3  
ATOM 3929  N N    . ILE A 1 42 ? -5.725  -5.114  6.842   1.00 0.00 ?  598  ILE A N    3  
ATOM 3930  C CA   . ILE A 1 42 ? -4.803  -4.445  7.727   1.00 0.00 ?  598  ILE A CA   3  
ATOM 3931  C C    . ILE A 1 42 ? -4.891  -2.936  7.513   1.00 0.00 ?  598  ILE A C    3  
ATOM 3932  O O    . ILE A 1 42 ? -5.050  -2.179  8.468   1.00 0.00 ?  598  ILE A O    3  
ATOM 3933  C CB   . ILE A 1 42 ? -3.315  -4.956  7.586   1.00 0.00 ?  598  ILE A CB   3  
ATOM 3934  C CG1  . ILE A 1 42 ? -3.096  -6.347  8.237   1.00 0.00 ?  598  ILE A CG1  3  
ATOM 3935  C CG2  . ILE A 1 42 ? -2.347  -3.964  8.198   1.00 0.00 ?  598  ILE A CG2  3  
ATOM 3936  C CD1  . ILE A 1 42 ? -3.895  -7.488  7.661   1.00 0.00 ?  598  ILE A CD1  3  
ATOM 3937  H H    . ILE A 1 42 ? -5.385  -5.626  6.074   1.00 0.00 ?  598  ILE A H    3  
ATOM 3938  H HA   . ILE A 1 42 ? -5.146  -4.646  8.732   1.00 0.00 ?  598  ILE A HA   3  
ATOM 3939  H HB   . ILE A 1 42 ? -3.098  -5.025  6.530   1.00 0.00 ?  598  ILE A HB   3  
ATOM 3940  H HG12 . ILE A 1 42 ? -2.055  -6.612  8.131   1.00 0.00 ?  598  ILE A HG12 3  
ATOM 3941  H HG13 . ILE A 1 42 ? -3.320  -6.274  9.290   1.00 0.00 ?  598  ILE A HG13 3  
ATOM 3942  H HG21 . ILE A 1 42 ? -2.443  -3.030  7.661   1.00 0.00 ?  598  ILE A HG21 3  
ATOM 3943  H HG22 . ILE A 1 42 ? -1.335  -4.334  8.130   1.00 0.00 ?  598  ILE A HG22 3  
ATOM 3944  H HG23 . ILE A 1 42 ? -2.622  -3.806  9.231   1.00 0.00 ?  598  ILE A HG23 3  
ATOM 3945  H HD11 . ILE A 1 42 ? -4.950  -7.279  7.770   1.00 0.00 ?  598  ILE A HD11 3  
ATOM 3946  H HD12 . ILE A 1 42 ? -3.652  -8.400  8.184   1.00 0.00 ?  598  ILE A HD12 3  
ATOM 3947  H HD13 . ILE A 1 42 ? -3.661  -7.597  6.612   1.00 0.00 ?  598  ILE A HD13 3  
ATOM 3948  N N    . ILE A 1 43 ? -4.851  -2.510  6.264   1.00 0.00 ?  599  ILE A N    3  
ATOM 3949  C CA   . ILE A 1 43 ? -4.940  -1.067  5.962   1.00 0.00 ?  599  ILE A CA   3  
ATOM 3950  C C    . ILE A 1 43 ? -6.316  -0.540  6.402   1.00 0.00 ?  599  ILE A C    3  
ATOM 3951  O O    . ILE A 1 43 ? -6.428  0.513   7.039   1.00 0.00 ?  599  ILE A O    3  
ATOM 3952  C CB   . ILE A 1 43 ? -4.717  -0.742  4.446   1.00 0.00 ?  599  ILE A CB   3  
ATOM 3953  C CG1  . ILE A 1 43 ? -3.562  -1.557  3.839   1.00 0.00 ?  599  ILE A CG1  3  
ATOM 3954  C CG2  . ILE A 1 43 ? -4.449  0.740   4.255   1.00 0.00 ?  599  ILE A CG2  3  
ATOM 3955  C CD1  . ILE A 1 43 ? -2.292  -1.590  4.653   1.00 0.00 ?  599  ILE A CD1  3  
ATOM 3956  H H    . ILE A 1 43 ? -4.715  -3.174  5.546   1.00 0.00 ?  599  ILE A H    3  
ATOM 3957  H HA   . ILE A 1 43 ? -4.199  -0.554  6.558   1.00 0.00 ?  599  ILE A HA   3  
ATOM 3958  H HB   . ILE A 1 43 ? -5.631  -0.984  3.923   1.00 0.00 ?  599  ILE A HB   3  
ATOM 3959  H HG12 . ILE A 1 43 ? -3.876  -2.585  3.727   1.00 0.00 ?  599  ILE A HG12 3  
ATOM 3960  H HG13 . ILE A 1 43 ? -3.322  -1.155  2.864   1.00 0.00 ?  599  ILE A HG13 3  
ATOM 3961  H HG21 . ILE A 1 43 ? -3.586  1.020   4.844   1.00 0.00 ?  599  ILE A HG21 3  
ATOM 3962  H HG22 . ILE A 1 43 ? -5.312  1.299   4.583   1.00 0.00 ?  599  ILE A HG22 3  
ATOM 3963  H HG23 . ILE A 1 43 ? -4.257  0.942   3.211   1.00 0.00 ?  599  ILE A HG23 3  
ATOM 3964  H HD11 . ILE A 1 43 ? -1.940  -0.593  4.865   1.00 0.00 ?  599  ILE A HD11 3  
ATOM 3965  H HD12 . ILE A 1 43 ? -1.547  -2.147  4.103   1.00 0.00 ?  599  ILE A HD12 3  
ATOM 3966  H HD13 . ILE A 1 43 ? -2.525  -2.118  5.568   1.00 0.00 ?  599  ILE A HD13 3  
ATOM 3967  N N    . GLN A 1 44 ? -7.332  -1.331  6.116   1.00 0.00 ?  600  GLN A N    3  
ATOM 3968  C CA   . GLN A 1 44 ? -8.724  -1.052  6.457   1.00 0.00 ?  600  GLN A CA   3  
ATOM 3969  C C    . GLN A 1 44 ? -8.930  -0.812  7.939   1.00 0.00 ?  600  GLN A C    3  
ATOM 3970  O O    . GLN A 1 44 ? -9.682  0.067   8.312   1.00 0.00 ?  600  GLN A O    3  
ATOM 3971  C CB   . GLN A 1 44 ? -9.572  -2.219  5.996   1.00 0.00 ?  600  GLN A CB   3  
ATOM 3972  C CG   . GLN A 1 44 ? -10.989 -2.260  6.462   1.00 0.00 ?  600  GLN A CG   3  
ATOM 3973  C CD   . GLN A 1 44 ? -11.730 -3.438  5.899   1.00 0.00 ?  600  GLN A CD   3  
ATOM 3974  O OE1  . GLN A 1 44 ? -12.616 -3.978  6.540   1.00 0.00 ?  600  GLN A OE1  3  
ATOM 3975  N NE2  . GLN A 1 44 ? -11.400 -3.819  4.690   1.00 0.00 ?  600  GLN A NE2  3  
ATOM 3976  H H    . GLN A 1 44 ? -7.153  -2.163  5.622   1.00 0.00 ?  600  GLN A H    3  
ATOM 3977  H HA   . GLN A 1 44 ? -9.037  -0.178  5.910   1.00 0.00 ?  600  GLN A HA   3  
ATOM 3978  H HB2  . GLN A 1 44 ? -9.585  -2.210  4.917   1.00 0.00 ?  600  GLN A HB2  3  
ATOM 3979  H HB3  . GLN A 1 44 ? -9.085  -3.128  6.315   1.00 0.00 ?  600  GLN A HB3  3  
ATOM 3980  H HG2  . GLN A 1 44 ? -10.998 -2.341  7.537   1.00 0.00 ?  600  GLN A HG2  3  
ATOM 3981  H HG3  . GLN A 1 44 ? -11.481 -1.359  6.133   1.00 0.00 ?  600  GLN A HG3  3  
ATOM 3982  H HE21 . GLN A 1 44 ? -10.695 -3.339  4.210   1.00 0.00 ?  600  GLN A HE21 3  
ATOM 3983  H HE22 . GLN A 1 44 ? -11.886 -4.567  4.284   1.00 0.00 ?  600  GLN A HE22 3  
ATOM 3984  N N    . SER A 1 45 ? -8.237  -1.561  8.778   1.00 0.00 ?  601  SER A N    3  
ATOM 3985  C CA   . SER A 1 45 ? -8.422  -1.454  10.217  1.00 0.00 ?  601  SER A CA   3  
ATOM 3986  C C    . SER A 1 45 ? -8.070  -0.051  10.745  1.00 0.00 ?  601  SER A C    3  
ATOM 3987  O O    . SER A 1 45 ? -8.544  0.358   11.803  1.00 0.00 ?  601  SER A O    3  
ATOM 3988  C CB   . SER A 1 45 ? -7.621  -2.536  10.957  1.00 0.00 ?  601  SER A CB   3  
ATOM 3989  O OG   . SER A 1 45 ? -6.224  -2.389  10.766  1.00 0.00 ?  601  SER A OG   3  
ATOM 3990  H H    . SER A 1 45 ? -7.605  -2.216  8.412   1.00 0.00 ?  601  SER A H    3  
ATOM 3991  H HA   . SER A 1 45 ? -9.472  -1.621  10.405  1.00 0.00 ?  601  SER A HA   3  
ATOM 3992  H HB2  . SER A 1 45 ? -7.817  -2.484  12.017  1.00 0.00 ?  601  SER A HB2  3  
ATOM 3993  H HB3  . SER A 1 45 ? -7.902  -3.510  10.584  1.00 0.00 ?  601  SER A HB3  3  
ATOM 3994  H HG   . SER A 1 45 ? -6.000  -2.210  9.840   1.00 0.00 ?  601  SER A HG   3  
ATOM 3995  N N    . ARG A 1 46 ? -7.280  0.690   9.982   1.00 0.00 ?  602  ARG A N    3  
ATOM 3996  C CA   . ARG A 1 46 ? -6.843  2.011   10.390  1.00 0.00 ?  602  ARG A CA   3  
ATOM 3997  C C    . ARG A 1 46 ? -7.722  3.101   9.791   1.00 0.00 ?  602  ARG A C    3  
ATOM 3998  O O    . ARG A 1 46 ? -7.653  4.252   10.202  1.00 0.00 ?  602  ARG A O    3  
ATOM 3999  C CB   . ARG A 1 46 ? -5.385  2.220   10.012  1.00 0.00 ?  602  ARG A CB   3  
ATOM 4000  C CG   . ARG A 1 46 ? -4.462  1.211   10.667  1.00 0.00 ?  602  ARG A CG   3  
ATOM 4001  C CD   . ARG A 1 46 ? -3.027  1.383   10.225  1.00 0.00 ?  602  ARG A CD   3  
ATOM 4002  N NE   . ARG A 1 46 ? -2.465  2.670   10.613  1.00 0.00 ?  602  ARG A NE   3  
ATOM 4003  C CZ   . ARG A 1 46 ? -1.202  2.872   11.008  1.00 0.00 ?  602  ARG A CZ   3  
ATOM 4004  N NH1  . ARG A 1 46 ? -0.343  1.850   11.130  1.00 0.00 1  602  ARG A NH1  3  
ATOM 4005  N NH2  . ARG A 1 46 ? -0.806  4.102   11.279  1.00 0.00 ?  602  ARG A NH2  3  
ATOM 4006  H H    . ARG A 1 46 ? -6.990  0.344   9.109   1.00 0.00 ?  602  ARG A H    3  
ATOM 4007  H HA   . ARG A 1 46 ? -6.928  2.060   11.466  1.00 0.00 ?  602  ARG A HA   3  
ATOM 4008  H HB2  . ARG A 1 46 ? -5.287  2.128   8.939   1.00 0.00 ?  602  ARG A HB2  3  
ATOM 4009  H HB3  . ARG A 1 46 ? -5.085  3.211   10.318  1.00 0.00 ?  602  ARG A HB3  3  
ATOM 4010  H HG2  . ARG A 1 46 ? -4.512  1.337   11.738  1.00 0.00 ?  602  ARG A HG2  3  
ATOM 4011  H HG3  . ARG A 1 46 ? -4.796  0.218   10.408  1.00 0.00 ?  602  ARG A HG3  3  
ATOM 4012  H HD2  . ARG A 1 46 ? -2.426  0.597   10.656  1.00 0.00 ?  602  ARG A HD2  3  
ATOM 4013  H HD3  . ARG A 1 46 ? -2.999  1.302   9.148   1.00 0.00 ?  602  ARG A HD3  3  
ATOM 4014  H HE   . ARG A 1 46 ? -3.077  3.438   10.553  1.00 0.00 ?  602  ARG A HE   3  
ATOM 4015  H HH11 . ARG A 1 46 ? -0.601  0.893   10.931  1.00 0.00 ?  602  ARG A HH11 3  
ATOM 4016  H HH12 . ARG A 1 46 ? 0.601   2.008   11.434  1.00 0.00 ?  602  ARG A HH12 3  
ATOM 4017  H HH21 . ARG A 1 46 ? -1.446  4.867   11.187  1.00 0.00 ?  602  ARG A HH21 3  
ATOM 4018  H HH22 . ARG A 1 46 ? 0.129   4.334   11.571  1.00 0.00 ?  602  ARG A HH22 3  
ATOM 4019  N N    . GLU A 1 47 ? -8.542  2.739   8.826   1.00 0.00 ?  603  GLU A N    3  
ATOM 4020  C CA   . GLU A 1 47 ? -9.460  3.685   8.209   1.00 0.00 ?  603  GLU A CA   3  
ATOM 4021  C C    . GLU A 1 47 ? -10.901 3.344   8.505   1.00 0.00 ?  603  GLU A C    3  
ATOM 4022  O O    . GLU A 1 47 ? -11.451 2.417   7.923   1.00 0.00 ?  603  GLU A O    3  
ATOM 4023  C CB   . GLU A 1 47 ? -9.240  3.789   6.707   1.00 0.00 ?  603  GLU A CB   3  
ATOM 4024  C CG   . GLU A 1 47 ? -8.452  5.009   6.309   1.00 0.00 ?  603  GLU A CG   3  
ATOM 4025  C CD   . GLU A 1 47 ? -9.201  6.292   6.595   1.00 0.00 ?  603  GLU A CD   3  
ATOM 4026  O OE1  . GLU A 1 47 ? -9.039  6.862   7.697   1.00 0.00 ?  603  GLU A OE1  3  
ATOM 4027  O OE2  . GLU A 1 47 ? -9.946  6.772   5.721   1.00 0.00 -1 603  GLU A OE2  3  
ATOM 4028  H H    . GLU A 1 47 ? -8.556  1.807   8.515   1.00 0.00 ?  603  GLU A H    3  
ATOM 4029  H HA   . GLU A 1 47 ? -9.248  4.649   8.648   1.00 0.00 ?  603  GLU A HA   3  
ATOM 4030  H HB2  . GLU A 1 47 ? -8.707  2.912   6.368   1.00 0.00 ?  603  GLU A HB2  3  
ATOM 4031  H HB3  . GLU A 1 47 ? -10.202 3.832   6.216   1.00 0.00 ?  603  GLU A HB3  3  
ATOM 4032  H HG2  . GLU A 1 47 ? -7.530  5.018   6.869   1.00 0.00 ?  603  GLU A HG2  3  
ATOM 4033  H HG3  . GLU A 1 47 ? -8.226  4.962   5.255   1.00 0.00 ?  603  GLU A HG3  3  
ATOM 4034  N N    . PRO A 1 48 ? -11.546 4.101   9.411   1.00 0.00 ?  604  PRO A N    3  
ATOM 4035  C CA   . PRO A 1 48 ? -12.947 3.874   9.781   1.00 0.00 ?  604  PRO A CA   3  
ATOM 4036  C C    . PRO A 1 48 ? -13.879 3.998   8.578   1.00 0.00 ?  604  PRO A C    3  
ATOM 4037  O O    . PRO A 1 48 ? -14.850 3.246   8.453   1.00 0.00 ?  604  PRO A O    3  
ATOM 4038  C CB   . PRO A 1 48 ? -13.243 4.996   10.791  1.00 0.00 ?  604  PRO A CB   3  
ATOM 4039  C CG   . PRO A 1 48 ? -11.911 5.416   11.302  1.00 0.00 ?  604  PRO A CG   3  
ATOM 4040  C CD   . PRO A 1 48 ? -10.961 5.239   10.157  1.00 0.00 ?  604  PRO A CD   3  
ATOM 4041  H HA   . PRO A 1 48 ? -13.086 2.910   10.250  1.00 0.00 ?  604  PRO A HA   3  
ATOM 4042  H HB2  . PRO A 1 48 ? -13.749 5.809   10.291  1.00 0.00 ?  604  PRO A HB2  3  
ATOM 4043  H HB3  . PRO A 1 48 ? -13.865 4.616   11.588  1.00 0.00 ?  604  PRO A HB3  3  
ATOM 4044  H HG2  . PRO A 1 48 ? -11.941 6.450   11.610  1.00 0.00 ?  604  PRO A HG2  3  
ATOM 4045  H HG3  . PRO A 1 48 ? -11.620 4.788   12.131  1.00 0.00 ?  604  PRO A HG3  3  
ATOM 4046  H HD2  . PRO A 1 48 ? -10.929 6.132   9.549   1.00 0.00 ?  604  PRO A HD2  3  
ATOM 4047  H HD3  . PRO A 1 48 ? -9.977  4.992   10.527  1.00 0.00 ?  604  PRO A HD3  3  
ATOM 4048  N N    . SER A 1 49 ? -13.491 4.880   7.667   1.00 0.00 ?  605  SER A N    3  
ATOM 4049  C CA   . SER A 1 49 ? -14.250 5.273   6.486   1.00 0.00 ?  605  SER A CA   3  
ATOM 4050  C C    . SER A 1 49 ? -14.879 4.088   5.693   1.00 0.00 ?  605  SER A C    3  
ATOM 4051  O O    . SER A 1 49 ? -16.015 4.196   5.218   1.00 0.00 ?  605  SER A O    3  
ATOM 4052  C CB   . SER A 1 49 ? -13.347 6.126   5.574   1.00 0.00 ?  605  SER A CB   3  
ATOM 4053  O OG   . SER A 1 49 ? -14.054 6.677   4.473   1.00 0.00 ?  605  SER A OG   3  
ATOM 4054  H H    . SER A 1 49 ? -12.622 5.312   7.814   1.00 0.00 ?  605  SER A H    3  
ATOM 4055  H HA   . SER A 1 49 ? -15.051 5.911   6.828   1.00 0.00 ?  605  SER A HA   3  
ATOM 4056  H HB2  . SER A 1 49 ? -12.924 6.940   6.143   1.00 0.00 ?  605  SER A HB2  3  
ATOM 4057  H HB3  . SER A 1 49 ? -12.548 5.508   5.192   1.00 0.00 ?  605  SER A HB3  3  
ATOM 4058  H HG   . SER A 1 49 ? -13.409 7.143   3.924   1.00 0.00 ?  605  SER A HG   3  
ATOM 4059  N N    . LEU A 1 50 ? -14.181 2.965   5.558   1.00 0.00 ?  606  LEU A N    3  
ATOM 4060  C CA   . LEU A 1 50 ? -14.734 1.873   4.763   1.00 0.00 ?  606  LEU A CA   3  
ATOM 4061  C C    . LEU A 1 50 ? -15.059 0.640   5.613   1.00 0.00 ?  606  LEU A C    3  
ATOM 4062  O O    . LEU A 1 50 ? -15.581 -0.339  5.106   1.00 0.00 ?  606  LEU A O    3  
ATOM 4063  C CB   . LEU A 1 50 ? -13.803 1.526   3.540   1.00 0.00 ?  606  LEU A CB   3  
ATOM 4064  C CG   . LEU A 1 50 ? -12.504 0.668   3.742   1.00 0.00 ?  606  LEU A CG   3  
ATOM 4065  C CD1  . LEU A 1 50 ? -11.650 1.107   4.924   1.00 0.00 ?  606  LEU A CD1  3  
ATOM 4066  C CD2  . LEU A 1 50 ? -12.803 -0.827  3.770   1.00 0.00 ?  606  LEU A CD2  3  
ATOM 4067  H H    . LEU A 1 50 ? -13.302 2.872   5.979   1.00 0.00 ?  606  LEU A H    3  
ATOM 4068  H HA   . LEU A 1 50 ? -15.673 2.239   4.374   1.00 0.00 ?  606  LEU A HA   3  
ATOM 4069  H HB2  . LEU A 1 50 ? -14.403 1.024   2.797   1.00 0.00 ?  606  LEU A HB2  3  
ATOM 4070  H HB3  . LEU A 1 50 ? -13.504 2.479   3.129   1.00 0.00 ?  606  LEU A HB3  3  
ATOM 4071  H HG   . LEU A 1 50 ? -11.871 0.841   2.883   1.00 0.00 ?  606  LEU A HG   3  
ATOM 4072  H HD11 . LEU A 1 50 ? -10.766 0.489   4.967   1.00 0.00 ?  606  LEU A HD11 3  
ATOM 4073  H HD12 . LEU A 1 50 ? -12.203 0.991   5.848   1.00 0.00 ?  606  LEU A HD12 3  
ATOM 4074  H HD13 . LEU A 1 50 ? -11.360 2.139   4.801   1.00 0.00 ?  606  LEU A HD13 3  
ATOM 4075  H HD21 . LEU A 1 50 ? -13.266 -1.118  2.839   1.00 0.00 ?  606  LEU A HD21 3  
ATOM 4076  H HD22 . LEU A 1 50 ? -13.470 -1.040  4.592   1.00 0.00 ?  606  LEU A HD22 3  
ATOM 4077  H HD23 . LEU A 1 50 ? -11.883 -1.375  3.902   1.00 0.00 ?  606  LEU A HD23 3  
ATOM 4078  N N    . ARG A 1 51 ? -14.820 0.715   6.911   1.00 0.00 ?  607  ARG A N    3  
ATOM 4079  C CA   . ARG A 1 51 ? -14.955 -0.477  7.764   1.00 0.00 ?  607  ARG A CA   3  
ATOM 4080  C C    . ARG A 1 51 ? -16.389 -0.936  7.939   1.00 0.00 ?  607  ARG A C    3  
ATOM 4081  O O    . ARG A 1 51 ? -16.635 -2.107  8.258   1.00 0.00 ?  607  ARG A O    3  
ATOM 4082  C CB   . ARG A 1 51 ? -14.301 -0.298  9.125   1.00 0.00 ?  607  ARG A CB   3  
ATOM 4083  C CG   . ARG A 1 51 ? -12.809 -0.092  9.069   1.00 0.00 ?  607  ARG A CG   3  
ATOM 4084  C CD   . ARG A 1 51 ? -12.193 -0.075  10.469  1.00 0.00 ?  607  ARG A CD   3  
ATOM 4085  N NE   . ARG A 1 51 ? -12.880 0.859   11.386  1.00 0.00 ?  607  ARG A NE   3  
ATOM 4086  C CZ   . ARG A 1 51 ? -12.303 1.543   12.394  1.00 0.00 ?  607  ARG A CZ   3  
ATOM 4087  N NH1  . ARG A 1 51 ? -10.986 1.490   12.596  1.00 0.00 1  607  ARG A NH1  3  
ATOM 4088  N NH2  . ARG A 1 51 ? -13.058 2.287   13.194  1.00 0.00 ?  607  ARG A NH2  3  
ATOM 4089  H H    . ARG A 1 51 ? -14.585 1.585   7.303   1.00 0.00 ?  607  ARG A H    3  
ATOM 4090  H HA   . ARG A 1 51 ? -14.433 -1.269  7.247   1.00 0.00 ?  607  ARG A HA   3  
ATOM 4091  H HB2  . ARG A 1 51 ? -14.739 0.567   9.600   1.00 0.00 ?  607  ARG A HB2  3  
ATOM 4092  H HB3  . ARG A 1 51 ? -14.502 -1.169  9.730   1.00 0.00 ?  607  ARG A HB3  3  
ATOM 4093  H HG2  . ARG A 1 51 ? -12.384 -0.902  8.493   1.00 0.00 ?  607  ARG A HG2  3  
ATOM 4094  H HG3  . ARG A 1 51 ? -12.594 0.835   8.559   1.00 0.00 ?  607  ARG A HG3  3  
ATOM 4095  H HD2  . ARG A 1 51 ? -12.248 -1.070  10.885  1.00 0.00 ?  607  ARG A HD2  3  
ATOM 4096  H HD3  . ARG A 1 51 ? -11.157 0.217   10.387  1.00 0.00 ?  607  ARG A HD3  3  
ATOM 4097  H HE   . ARG A 1 51 ? -13.853 0.936   11.252  1.00 0.00 ?  607  ARG A HE   3  
ATOM 4098  H HH11 . ARG A 1 51 ? -10.343 0.958   12.038  1.00 0.00 ?  607  ARG A HH11 3  
ATOM 4099  H HH12 . ARG A 1 51 ? -10.554 1.997   13.349  1.00 0.00 ?  607  ARG A HH12 3  
ATOM 4100  H HH21 . ARG A 1 51 ? -14.051 2.354   13.070  1.00 0.00 ?  607  ARG A HH21 3  
ATOM 4101  H HH22 . ARG A 1 51 ? -12.649 2.799   13.956  1.00 0.00 ?  607  ARG A HH22 3  
ATOM 4102  N N    . ASP A 1 52 ? -17.331 -0.047  7.736   1.00 0.00 ?  608  ASP A N    3  
ATOM 4103  C CA   . ASP A 1 52 ? -18.729 -0.415  7.882   1.00 0.00 ?  608  ASP A CA   3  
ATOM 4104  C C    . ASP A 1 52 ? -19.329 -0.700  6.502   1.00 0.00 ?  608  ASP A C    3  
ATOM 4105  O O    . ASP A 1 52 ? -20.453 -1.192  6.371   1.00 0.00 ?  608  ASP A O    3  
ATOM 4106  C CB   . ASP A 1 52 ? -19.510 0.655   8.657   1.00 0.00 ?  608  ASP A CB   3  
ATOM 4107  C CG   . ASP A 1 52 ? -20.901 0.209   9.057   1.00 0.00 ?  608  ASP A CG   3  
ATOM 4108  O OD1  . ASP A 1 52 ? -21.034 -0.754  9.858   1.00 0.00 ?  608  ASP A OD1  3  
ATOM 4109  O OD2  . ASP A 1 52 ? -21.884 0.844   8.642   1.00 0.00 -1 608  ASP A OD2  3  
ATOM 4110  H H    . ASP A 1 52 ? -17.093 0.868   7.473   1.00 0.00 ?  608  ASP A H    3  
ATOM 4111  H HA   . ASP A 1 52 ? -18.735 -1.342  8.439   1.00 0.00 ?  608  ASP A HA   3  
ATOM 4112  H HB2  . ASP A 1 52 ? -18.968 0.902   9.558   1.00 0.00 ?  608  ASP A HB2  3  
ATOM 4113  H HB3  . ASP A 1 52 ? -19.598 1.542   8.046   1.00 0.00 ?  608  ASP A HB3  3  
ATOM 4114  N N    . SER A 1 53 ? -18.527 -0.439  5.480   1.00 0.00 ?  609  SER A N    3  
ATOM 4115  C CA   . SER A 1 53 ? -18.873 -0.728  4.102   1.00 0.00 ?  609  SER A CA   3  
ATOM 4116  C C    . SER A 1 53 ? -18.458 -2.195  3.806   1.00 0.00 ?  609  SER A C    3  
ATOM 4117  O O    . SER A 1 53 ? -18.300 -2.996  4.751   1.00 0.00 ?  609  SER A O    3  
ATOM 4118  C CB   . SER A 1 53 ? -18.111 0.251   3.184   1.00 0.00 ?  609  SER A CB   3  
ATOM 4119  O OG   . SER A 1 53 ? -18.356 1.615   3.549   1.00 0.00 ?  609  SER A OG   3  
ATOM 4120  H H    . SER A 1 53 ? -17.641 -0.065  5.666   1.00 0.00 ?  609  SER A H    3  
ATOM 4121  H HA   . SER A 1 53 ? -19.936 -0.612  3.971   1.00 0.00 ?  609  SER A HA   3  
ATOM 4122  H HB2  . SER A 1 53 ? -17.051 0.062   3.261   1.00 0.00 ?  609  SER A HB2  3  
ATOM 4123  H HB3  . SER A 1 53 ? -18.427 0.106   2.162   1.00 0.00 ?  609  SER A HB3  3  
ATOM 4124  H HG   . SER A 1 53 ? -18.646 1.623   4.470   1.00 0.00 ?  609  SER A HG   3  
ATOM 4125  N N    . ASN A 1 54 ? -18.317 -2.562  2.539   1.00 0.00 ?  610  ASN A N    3  
ATOM 4126  C CA   . ASN A 1 54 ? -17.856 -3.903  2.188   1.00 0.00 ?  610  ASN A CA   3  
ATOM 4127  C C    . ASN A 1 54 ? -16.383 -4.040  2.561   1.00 0.00 ?  610  ASN A C    3  
ATOM 4128  O O    . ASN A 1 54 ? -15.531 -3.361  1.999   1.00 0.00 ?  610  ASN A O    3  
ATOM 4129  C CB   . ASN A 1 54 ? -18.049 -4.198  0.696   1.00 0.00 ?  610  ASN A CB   3  
ATOM 4130  C CG   . ASN A 1 54 ? -17.595 -5.604  0.316   1.00 0.00 ?  610  ASN A CG   3  
ATOM 4131  O OD1  . ASN A 1 54 ? -16.439 -5.834  -0.043  1.00 0.00 ?  610  ASN A OD1  3  
ATOM 4132  N ND2  . ASN A 1 54 ? -18.484 -6.552  0.400   1.00 0.00 ?  610  ASN A ND2  3  
ATOM 4133  H H    . ASN A 1 54 ? -18.517 -1.931  1.815   1.00 0.00 ?  610  ASN A H    3  
ATOM 4134  H HA   . ASN A 1 54 ? -18.432 -4.605  2.774   1.00 0.00 ?  610  ASN A HA   3  
ATOM 4135  H HB2  . ASN A 1 54 ? -19.094 -4.094  0.442   1.00 0.00 ?  610  ASN A HB2  3  
ATOM 4136  H HB3  . ASN A 1 54 ? -17.469 -3.490  0.124   1.00 0.00 ?  610  ASN A HB3  3  
ATOM 4137  H HD21 . ASN A 1 54 ? -19.385 -6.310  0.705   1.00 0.00 ?  610  ASN A HD21 3  
ATOM 4138  H HD22 . ASN A 1 54 ? -18.240 -7.472  0.162   1.00 0.00 ?  610  ASN A HD22 3  
ATOM 4139  N N    . PRO A 1 55 ? -16.068 -4.922  3.511   1.00 0.00 ?  611  PRO A N    3  
ATOM 4140  C CA   . PRO A 1 55 ? -14.712 -5.067  4.034   1.00 0.00 ?  611  PRO A CA   3  
ATOM 4141  C C    . PRO A 1 55 ? -13.812 -5.950  3.168   1.00 0.00 ?  611  PRO A C    3  
ATOM 4142  O O    . PRO A 1 55 ? -12.607 -6.041  3.405   1.00 0.00 ?  611  PRO A O    3  
ATOM 4143  C CB   . PRO A 1 55 ? -14.958 -5.742  5.384   1.00 0.00 ?  611  PRO A CB   3  
ATOM 4144  C CG   . PRO A 1 55 ? -16.159 -6.593  5.158   1.00 0.00 ?  611  PRO A CG   3  
ATOM 4145  C CD   . PRO A 1 55 ? -17.018 -5.846  4.178   1.00 0.00 ?  611  PRO A CD   3  
ATOM 4146  H HA   . PRO A 1 55 ? -14.237 -4.113  4.201   1.00 0.00 ?  611  PRO A HA   3  
ATOM 4147  H HB2  . PRO A 1 55 ? -14.095 -6.332  5.656   1.00 0.00 ?  611  PRO A HB2  3  
ATOM 4148  H HB3  . PRO A 1 55 ? -15.147 -4.993  6.139   1.00 0.00 ?  611  PRO A HB3  3  
ATOM 4149  H HG2  . PRO A 1 55 ? -15.862 -7.542  4.737   1.00 0.00 ?  611  PRO A HG2  3  
ATOM 4150  H HG3  . PRO A 1 55 ? -16.693 -6.742  6.084   1.00 0.00 ?  611  PRO A HG3  3  
ATOM 4151  H HD2  . PRO A 1 55 ? -17.461 -6.524  3.466   1.00 0.00 ?  611  PRO A HD2  3  
ATOM 4152  H HD3  . PRO A 1 55 ? -17.784 -5.293  4.701   1.00 0.00 ?  611  PRO A HD3  3  
ATOM 4153  N N    . ASP A 1 56 ? -14.379 -6.569  2.161   1.00 0.00 ?  612  ASP A N    3  
ATOM 4154  C CA   . ASP A 1 56 ? -13.637 -7.533  1.364   1.00 0.00 ?  612  ASP A CA   3  
ATOM 4155  C C    . ASP A 1 56 ? -13.035 -6.965  0.109   1.00 0.00 ?  612  ASP A C    3  
ATOM 4156  O O    . ASP A 1 56 ? -12.016 -7.479  -0.364  1.00 0.00 ?  612  ASP A O    3  
ATOM 4157  C CB   . ASP A 1 56 ? -14.480 -8.753  1.012   1.00 0.00 ?  612  ASP A CB   3  
ATOM 4158  C CG   . ASP A 1 56 ? -14.623 -9.742  2.137   1.00 0.00 ?  612  ASP A CG   3  
ATOM 4159  O OD1  . ASP A 1 56 ? -15.533 -9.596  2.971   1.00 0.00 ?  612  ASP A OD1  3  
ATOM 4160  O OD2  . ASP A 1 56 ? -13.827 -10.720 2.192   1.00 0.00 -1 612  ASP A OD2  3  
ATOM 4161  H H    . ASP A 1 56 ? -15.312 -6.352  1.949   1.00 0.00 ?  612  ASP A H    3  
ATOM 4162  H HA   . ASP A 1 56 ? -12.824 -7.881  1.982   1.00 0.00 ?  612  ASP A HA   3  
ATOM 4163  H HB2  . ASP A 1 56 ? -15.467 -8.423  0.723   1.00 0.00 ?  612  ASP A HB2  3  
ATOM 4164  H HB3  . ASP A 1 56 ? -14.007 -9.249  0.179   1.00 0.00 ?  612  ASP A HB3  3  
ATOM 4165  N N    . GLU A 1 57 ? -13.643 -5.945  -0.455  1.00 0.00 ?  613  GLU A N    3  
ATOM 4166  C CA   . GLU A 1 57 ? -13.161 -5.399  -1.707  1.00 0.00 ?  613  GLU A CA   3  
ATOM 4167  C C    . GLU A 1 57 ? -11.875 -4.615  -1.508  1.00 0.00 ?  613  GLU A C    3  
ATOM 4168  O O    . GLU A 1 57 ? -11.748 -3.815  -0.582  1.00 0.00 ?  613  GLU A O    3  
ATOM 4169  C CB   . GLU A 1 57 ? -14.216 -4.547  -2.414  1.00 0.00 ?  613  GLU A CB   3  
ATOM 4170  C CG   . GLU A 1 57 ? -13.762 -4.057  -3.783  1.00 0.00 ?  613  GLU A CG   3  
ATOM 4171  C CD   . GLU A 1 57 ? -14.802 -3.266  -4.501  1.00 0.00 ?  613  GLU A CD   3  
ATOM 4172  O OE1  . GLU A 1 57 ? -14.816 -2.036  -4.383  1.00 0.00 ?  613  GLU A OE1  3  
ATOM 4173  O OE2  . GLU A 1 57 ? -15.632 -3.867  -5.213  1.00 0.00 -1 613  GLU A OE2  3  
ATOM 4174  H H    . GLU A 1 57 ? -14.423 -5.541  -0.016  1.00 0.00 ?  613  GLU A H    3  
ATOM 4175  H HA   . GLU A 1 57 ? -12.926 -6.245  -2.337  1.00 0.00 ?  613  GLU A HA   3  
ATOM 4176  H HB2  . GLU A 1 57 ? -15.117 -5.131  -2.538  1.00 0.00 ?  613  GLU A HB2  3  
ATOM 4177  H HB3  . GLU A 1 57 ? -14.440 -3.683  -1.805  1.00 0.00 ?  613  GLU A HB3  3  
ATOM 4178  H HG2  . GLU A 1 57 ? -12.887 -3.436  -3.658  1.00 0.00 ?  613  GLU A HG2  3  
ATOM 4179  H HG3  . GLU A 1 57 ? -13.501 -4.917  -4.383  1.00 0.00 ?  613  GLU A HG3  3  
ATOM 4180  N N    . ILE A 1 58 ? -10.942 -4.849  -2.384  1.00 0.00 ?  614  ILE A N    3  
ATOM 4181  C CA   . ILE A 1 58 ? -9.664  -4.214  -2.320  1.00 0.00 ?  614  ILE A CA   3  
ATOM 4182  C C    . ILE A 1 58 ? -9.632  -2.950  -3.134  1.00 0.00 ?  614  ILE A C    3  
ATOM 4183  O O    . ILE A 1 58 ? -9.570  -2.971  -4.358  1.00 0.00 ?  614  ILE A O    3  
ATOM 4184  C CB   . ILE A 1 58 ? -8.523  -5.185  -2.734  1.00 0.00 ?  614  ILE A CB   3  
ATOM 4185  C CG1  . ILE A 1 58 ? -7.179  -4.442  -2.893  1.00 0.00 ?  614  ILE A CG1  3  
ATOM 4186  C CG2  . ILE A 1 58 ? -8.893  -5.900  -4.033  1.00 0.00 ?  614  ILE A CG2  3  
ATOM 4187  C CD1  . ILE A 1 58 ? -5.976  -5.331  -2.805  1.00 0.00 ?  614  ILE A CD1  3  
ATOM 4188  H H    . ILE A 1 58 ? -11.133 -5.463  -3.120  1.00 0.00 ?  614  ILE A H    3  
ATOM 4189  H HA   . ILE A 1 58 ? -9.495  -3.925  -1.296  1.00 0.00 ?  614  ILE A HA   3  
ATOM 4190  H HB   . ILE A 1 58 ? -8.425  -5.934  -1.962  1.00 0.00 ?  614  ILE A HB   3  
ATOM 4191  H HG12 . ILE A 1 58 ? -7.184  -4.081  -3.911  1.00 0.00 ?  614  ILE A HG12 3  
ATOM 4192  H HG13 . ILE A 1 58 ? -7.036  -3.572  -2.269  1.00 0.00 ?  614  ILE A HG13 3  
ATOM 4193  H HG21 . ILE A 1 58 ? -8.122  -6.609  -4.290  1.00 0.00 ?  614  ILE A HG21 3  
ATOM 4194  H HG22 . ILE A 1 58 ? -9.001  -5.158  -4.820  1.00 0.00 ?  614  ILE A HG22 3  
ATOM 4195  H HG23 . ILE A 1 58 ? -9.832  -6.416  -3.905  1.00 0.00 ?  614  ILE A HG23 3  
ATOM 4196  H HD11 . ILE A 1 58 ? -6.004  -5.899  -1.887  1.00 0.00 ?  614  ILE A HD11 3  
ATOM 4197  H HD12 . ILE A 1 58 ? -5.099  -4.702  -2.796  1.00 0.00 ?  614  ILE A HD12 3  
ATOM 4198  H HD13 . ILE A 1 58 ? -5.920  -5.998  -3.656  1.00 0.00 ?  614  ILE A HD13 3  
ATOM 4199  N N    . GLU A 1 59 ? -9.692  -1.849  -2.472  1.00 0.00 ?  615  GLU A N    3  
ATOM 4200  C CA   . GLU A 1 59 ? -9.600  -0.623  -3.151  1.00 0.00 ?  615  GLU A CA   3  
ATOM 4201  C C    . GLU A 1 59 ? -8.732  0.346   -2.438  1.00 0.00 ?  615  GLU A C    3  
ATOM 4202  O O    . GLU A 1 59 ? -8.748  0.452   -1.215  1.00 0.00 ?  615  GLU A O    3  
ATOM 4203  C CB   . GLU A 1 59 ? -10.968 -0.159  -3.714  1.00 0.00 ?  615  GLU A CB   3  
ATOM 4204  C CG   . GLU A 1 59 ? -11.194 1.126   -4.393  1.00 0.00 ?  615  GLU A CG   3  
ATOM 4205  C CD   . GLU A 1 59 ? -11.261 2.345   -3.499  1.00 0.00 ?  615  GLU A CD   3  
ATOM 4206  O OE1  . GLU A 1 59 ? -10.262 2.762   -2.976  1.00 0.00 ?  615  GLU A OE1  3  
ATOM 4207  O OE2  . GLU A 1 59 ? -12.344 2.941   -3.375  1.00 0.00 -1 615  GLU A OE2  3  
ATOM 4208  H H    . GLU A 1 59 ? -9.806  -1.849  -1.496  1.00 0.00 ?  615  GLU A H    3  
ATOM 4209  H HA   . GLU A 1 59 ? -8.971  -0.891  -3.990  1.00 0.00 ?  615  GLU A HA   3  
ATOM 4210  H HB2  . GLU A 1 59 ? -10.630 -0.536  -4.663  1.00 0.00 ?  615  GLU A HB2  3  
ATOM 4211  H HB3  . GLU A 1 59 ? -11.899 -0.656  -3.493  1.00 0.00 ?  615  GLU A HB3  3  
ATOM 4212  H HG2  . GLU A 1 59 ? -10.545 1.156   -5.258  1.00 0.00 ?  615  GLU A HG2  3  
ATOM 4213  H HG3  . GLU A 1 59 ? -12.166 0.931   -4.819  1.00 0.00 ?  615  GLU A HG3  3  
ATOM 4214  N N    . ILE A 1 60 ? -7.918  0.988   -3.222  1.00 0.00 ?  616  ILE A N    3  
ATOM 4215  C CA   . ILE A 1 60 ? -6.841  1.804   -2.695  1.00 0.00 ?  616  ILE A CA   3  
ATOM 4216  C C    . ILE A 1 60 ? -6.948  3.313   -2.977  1.00 0.00 ?  616  ILE A C    3  
ATOM 4217  O O    . ILE A 1 60 ? -6.361  3.870   -3.870  1.00 0.00 ?  616  ILE A O    3  
ATOM 4218  C CB   . ILE A 1 60 ? -5.468  1.180   -3.000  1.00 0.00 ?  616  ILE A CB   3  
ATOM 4219  C CG1  . ILE A 1 60 ? -5.372  -0.066  -2.137  1.00 0.00 ?  616  ILE A CG1  3  
ATOM 4220  C CG2  . ILE A 1 60 ? -4.303  2.122   -2.685  1.00 0.00 ?  616  ILE A CG2  3  
ATOM 4221  C CD1  . ILE A 1 60 ? -4.117  -0.799  -2.292  1.00 0.00 ?  616  ILE A CD1  3  
ATOM 4222  H H    . ILE A 1 60 ? -8.165  0.905   -4.170  1.00 0.00 ?  616  ILE A H    3  
ATOM 4223  H HA   . ILE A 1 60 ? -6.968  1.671   -1.627  1.00 0.00 ?  616  ILE A HA   3  
ATOM 4224  H HB   . ILE A 1 60 ? -5.449  0.858   -4.032  1.00 0.00 ?  616  ILE A HB   3  
ATOM 4225  H HG12 . ILE A 1 60 ? -5.447  0.223   -1.100  1.00 0.00 ?  616  ILE A HG12 3  
ATOM 4226  H HG13 . ILE A 1 60 ? -6.191  -0.731  -2.370  1.00 0.00 ?  616  ILE A HG13 3  
ATOM 4227  H HG21 . ILE A 1 60 ? -3.369  1.653   -2.952  1.00 0.00 ?  616  ILE A HG21 3  
ATOM 4228  H HG22 . ILE A 1 60 ? -4.303  2.351   -1.629  1.00 0.00 ?  616  ILE A HG22 3  
ATOM 4229  H HG23 . ILE A 1 60 ? -4.432  3.032   -3.251  1.00 0.00 ?  616  ILE A HG23 3  
ATOM 4230  H HD11 . ILE A 1 60 ? -3.343  -0.098  -2.027  1.00 0.00 ?  616  ILE A HD11 3  
ATOM 4231  H HD12 . ILE A 1 60 ? -4.057  -1.105  -3.333  1.00 0.00 ?  616  ILE A HD12 3  
ATOM 4232  H HD13 . ILE A 1 60 ? -4.129  -1.647  -1.628  1.00 0.00 ?  616  ILE A HD13 3  
ATOM 4233  N N    . ASP A 1 61 ? -7.757  3.906   -2.201  1.00 0.00 ?  617  ASP A N    3  
ATOM 4234  C CA   . ASP A 1 61 ? -8.095  5.343   -2.126  1.00 0.00 ?  617  ASP A CA   3  
ATOM 4235  C C    . ASP A 1 61 ? -6.921  6.368   -2.013  1.00 0.00 ?  617  ASP A C    3  
ATOM 4236  O O    . ASP A 1 61 ? -7.135  7.568   -2.034  1.00 0.00 ?  617  ASP A O    3  
ATOM 4237  C CB   . ASP A 1 61 ? -9.298  5.569   -1.225  1.00 0.00 ?  617  ASP A CB   3  
ATOM 4238  C CG   . ASP A 1 61 ? -9.836  6.989   -1.201  1.00 0.00 ?  617  ASP A CG   3  
ATOM 4239  O OD1  . ASP A 1 61 ? -10.667 7.316   -2.085  1.00 0.00 ?  617  ASP A OD1  3  
ATOM 4240  O OD2  . ASP A 1 61 ? -9.471  7.765   -0.326  1.00 0.00 -1 617  ASP A OD2  3  
ATOM 4241  H H    . ASP A 1 61 ? -8.268  3.315   -1.604  1.00 0.00 ?  617  ASP A H    3  
ATOM 4242  H HA   . ASP A 1 61 ? -8.418  5.561   -3.132  1.00 0.00 ?  617  ASP A HA   3  
ATOM 4243  H HB2  . ASP A 1 61 ? -10.023 4.987   -1.783  1.00 0.00 ?  617  ASP A HB2  3  
ATOM 4244  H HB3  . ASP A 1 61 ? -9.149  5.167   -0.236  1.00 0.00 ?  617  ASP A HB3  3  
ATOM 4245  N N    . PHE A 1 62 ? -5.684  5.864   -1.962  1.00 0.00 ?  618  PHE A N    3  
ATOM 4246  C CA   . PHE A 1 62 ? -4.424  6.571   -1.553  1.00 0.00 ?  618  PHE A CA   3  
ATOM 4247  C C    . PHE A 1 62 ? -4.189  7.946   -2.175  1.00 0.00 ?  618  PHE A C    3  
ATOM 4248  O O    . PHE A 1 62 ? -3.395  8.724   -1.641  1.00 0.00 ?  618  PHE A O    3  
ATOM 4249  C CB   . PHE A 1 62 ? -3.274  5.687   -2.022  1.00 0.00 ?  618  PHE A CB   3  
ATOM 4250  C CG   . PHE A 1 62 ? -2.667  4.808   -0.973  1.00 0.00 ?  618  PHE A CG   3  
ATOM 4251  C CD1  . PHE A 1 62 ? -1.299  4.546   -0.948  1.00 0.00 ?  618  PHE A CD1  3  
ATOM 4252  C CD2  . PHE A 1 62 ? -3.465  4.248   0.010   1.00 0.00 ?  618  PHE A CD2  3  
ATOM 4253  C CE1  . PHE A 1 62 ? -0.768  3.750   0.037   1.00 0.00 ?  618  PHE A CE1  3  
ATOM 4254  C CE2  . PHE A 1 62 ? -2.930  3.451   0.990   1.00 0.00 ?  618  PHE A CE2  3  
ATOM 4255  C CZ   . PHE A 1 62 ? -1.584  3.203   1.006   1.00 0.00 ?  618  PHE A CZ   3  
ATOM 4256  H H    . PHE A 1 62 ? -5.614  4.928   -2.245  1.00 0.00 ?  618  PHE A H    3  
ATOM 4257  H HA   . PHE A 1 62 ? -4.348  6.616   -0.479  1.00 0.00 ?  618  PHE A HA   3  
ATOM 4258  H HB2  . PHE A 1 62 ? -3.768  5.016   -2.712  1.00 0.00 ?  618  PHE A HB2  3  
ATOM 4259  H HB3  . PHE A 1 62 ? -2.540  6.208   -2.624  1.00 0.00 ?  618  PHE A HB3  3  
ATOM 4260  H HD1  . PHE A 1 62 ? -0.629  4.946   -1.698  1.00 0.00 ?  618  PHE A HD1  3  
ATOM 4261  H HD2  . PHE A 1 62 ? -4.528  4.437   -0.013  1.00 0.00 ?  618  PHE A HD2  3  
ATOM 4262  H HE1  . PHE A 1 62 ? 0.291   3.547   0.048   1.00 0.00 ?  618  PHE A HE1  3  
ATOM 4263  H HE2  . PHE A 1 62 ? -3.569  3.024   1.749   1.00 0.00 ?  618  PHE A HE2  3  
ATOM 4264  H HZ   . PHE A 1 62 ? -1.165  2.578   1.778   1.00 0.00 ?  618  PHE A HZ   3  
ATOM 4265  N N    . GLU A 1 63 ? -4.856  8.251   -3.241  1.00 0.00 ?  619  GLU A N    3  
ATOM 4266  C CA   . GLU A 1 63 ? -4.844  9.587   -3.785  1.00 0.00 ?  619  GLU A CA   3  
ATOM 4267  C C    . GLU A 1 63 ? -5.340  10.577  -2.702  1.00 0.00 ?  619  GLU A C    3  
ATOM 4268  O O    . GLU A 1 63 ? -4.651  11.543  -2.356  1.00 0.00 ?  619  GLU A O    3  
ATOM 4269  C CB   . GLU A 1 63 ? -5.792  9.635   -4.954  1.00 0.00 ?  619  GLU A CB   3  
ATOM 4270  C CG   . GLU A 1 63 ? -5.357  8.869   -6.180  1.00 0.00 ?  619  GLU A CG   3  
ATOM 4271  C CD   . GLU A 1 63 ? -6.516  8.635   -7.082  1.00 0.00 ?  619  GLU A CD   3  
ATOM 4272  O OE1  . GLU A 1 63 ? -6.916  7.454   -7.224  1.00 0.00 ?  619  GLU A OE1  3  
ATOM 4273  O OE2  . GLU A 1 63 ? -7.051  9.596   -7.652  1.00 0.00 -1 619  GLU A OE2  3  
ATOM 4274  H H    . GLU A 1 63 ? -5.404  7.558   -3.664  1.00 0.00 ?  619  GLU A H    3  
ATOM 4275  H HA   . GLU A 1 63 ? -3.847  9.840   -4.112  1.00 0.00 ?  619  GLU A HA   3  
ATOM 4276  H HB2  . GLU A 1 63 ? -6.732  9.214   -4.631  1.00 0.00 ?  619  GLU A HB2  3  
ATOM 4277  H HB3  . GLU A 1 63 ? -5.947  10.668  -5.226  1.00 0.00 ?  619  GLU A HB3  3  
ATOM 4278  H HG2  . GLU A 1 63 ? -4.576  9.400   -6.705  1.00 0.00 ?  619  GLU A HG2  3  
ATOM 4279  H HG3  . GLU A 1 63 ? -4.927  7.900   -5.982  1.00 0.00 ?  619  GLU A HG3  3  
ATOM 4280  N N    . THR A 1 64 ? -6.491  10.268  -2.128  1.00 0.00 ?  620  THR A N    3  
ATOM 4281  C CA   . THR A 1 64 ? -7.141  11.122  -1.145  1.00 0.00 ?  620  THR A CA   3  
ATOM 4282  C C    . THR A 1 64 ? -7.043  10.510  0.275   1.00 0.00 ?  620  THR A C    3  
ATOM 4283  O O    . THR A 1 64 ? -7.259  11.207  1.290   1.00 0.00 ?  620  THR A O    3  
ATOM 4284  C CB   . THR A 1 64 ? -8.630  11.256  -1.523  1.00 0.00 ?  620  THR A CB   3  
ATOM 4285  O OG1  . THR A 1 64 ? -8.729  11.469  -2.940  1.00 0.00 ?  620  THR A OG1  3  
ATOM 4286  C CG2  . THR A 1 64 ? -9.280  12.434  -0.810  1.00 0.00 ?  620  THR A CG2  3  
ATOM 4287  H H    . THR A 1 64 ? -6.941  9.427   -2.367  1.00 0.00 ?  620  THR A H    3  
ATOM 4288  H HA   . THR A 1 64 ? -6.691  12.104  -1.169  1.00 0.00 ?  620  THR A HA   3  
ATOM 4289  H HB   . THR A 1 64 ? -9.144  10.343  -1.256  1.00 0.00 ?  620  THR A HB   3  
ATOM 4290  H HG1  . THR A 1 64 ? -8.017  12.081  -3.171  1.00 0.00 ?  620  THR A HG1  3  
ATOM 4291  H HG21 . THR A 1 64 ? -8.771  13.343  -1.091  1.00 0.00 ?  620  THR A HG21 3  
ATOM 4292  H HG22 . THR A 1 64 ? -9.200  12.293  0.258   1.00 0.00 ?  620  THR A HG22 3  
ATOM 4293  H HG23 . THR A 1 64 ? -10.320 12.499  -1.093  1.00 0.00 ?  620  THR A HG23 3  
ATOM 4294  N N    . LEU A 1 65 ? -6.713  9.224   0.337   1.00 0.00 ?  621  LEU A N    3  
ATOM 4295  C CA   . LEU A 1 65 ? -6.654  8.493   1.601   1.00 0.00 ?  621  LEU A CA   3  
ATOM 4296  C C    . LEU A 1 65 ? -5.620  9.108   2.547   1.00 0.00 ?  621  LEU A C    3  
ATOM 4297  O O    . LEU A 1 65 ? -4.654  9.755   2.108   1.00 0.00 ?  621  LEU A O    3  
ATOM 4298  C CB   . LEU A 1 65 ? -6.355  7.011   1.366   1.00 0.00 ?  621  LEU A CB   3  
ATOM 4299  C CG   . LEU A 1 65 ? -6.756  6.047   2.488   1.00 0.00 ?  621  LEU A CG   3  
ATOM 4300  C CD1  . LEU A 1 65 ? -8.260  6.069   2.688   1.00 0.00 ?  621  LEU A CD1  3  
ATOM 4301  C CD2  . LEU A 1 65 ? -6.285  4.639   2.180   1.00 0.00 ?  621  LEU A CD2  3  
ATOM 4302  H H    . LEU A 1 65 ? -6.552  8.744   -0.501  1.00 0.00 ?  621  LEU A H    3  
ATOM 4303  H HA   . LEU A 1 65 ? -7.628  8.586   2.058   1.00 0.00 ?  621  LEU A HA   3  
ATOM 4304  H HB2  . LEU A 1 65 ? -6.849  6.701   0.457   1.00 0.00 ?  621  LEU A HB2  3  
ATOM 4305  H HB3  . LEU A 1 65 ? -5.289  6.917   1.226   1.00 0.00 ?  621  LEU A HB3  3  
ATOM 4306  H HG   . LEU A 1 65 ? -6.292  6.370   3.409   1.00 0.00 ?  621  LEU A HG   3  
ATOM 4307  H HD11 . LEU A 1 65 ? -8.747  5.906   1.739   1.00 0.00 ?  621  LEU A HD11 3  
ATOM 4308  H HD12 . LEU A 1 65 ? -8.570  7.015   3.104   1.00 0.00 ?  621  LEU A HD12 3  
ATOM 4309  H HD13 . LEU A 1 65 ? -8.542  5.273   3.359   1.00 0.00 ?  621  LEU A HD13 3  
ATOM 4310  H HD21 . LEU A 1 65 ? -6.587  3.977   2.978   1.00 0.00 ?  621  LEU A HD21 3  
ATOM 4311  H HD22 . LEU A 1 65 ? -5.209  4.629   2.095   1.00 0.00 ?  621  LEU A HD22 3  
ATOM 4312  H HD23 . LEU A 1 65 ? -6.722  4.305   1.250   1.00 0.00 ?  621  LEU A HD23 3  
ATOM 4313  N N    . LYS A 1 66 ? -5.821  8.878   3.822   1.00 0.00 ?  622  LYS A N    3  
ATOM 4314  C CA   . LYS A 1 66 ? -5.043  9.481   4.894   1.00 0.00 ?  622  LYS A CA   3  
ATOM 4315  C C    . LYS A 1 66 ? -3.568  9.038   4.822   1.00 0.00 ?  622  LYS A C    3  
ATOM 4316  O O    . LYS A 1 66 ? -3.283  7.850   4.634   1.00 0.00 ?  622  LYS A O    3  
ATOM 4317  C CB   . LYS A 1 66 ? -5.611  9.040   6.252   1.00 0.00 ?  622  LYS A CB   3  
ATOM 4318  C CG   . LYS A 1 66 ? -7.135  8.957   6.331   1.00 0.00 ?  622  LYS A CG   3  
ATOM 4319  C CD   . LYS A 1 66 ? -7.833  10.291  6.194   1.00 0.00 ?  622  LYS A CD   3  
ATOM 4320  C CE   . LYS A 1 66 ? -9.348  10.103  6.043   1.00 0.00 ?  622  LYS A CE   3  
ATOM 4321  N NZ   . LYS A 1 66 ? -9.980  9.343   7.161   1.00 0.00 1  622  LYS A NZ   3  
ATOM 4322  H H    . LYS A 1 66 ? -6.527  8.243   4.060   1.00 0.00 ?  622  LYS A H    3  
ATOM 4323  H HA   . LYS A 1 66 ? -5.118  10.555  4.823   1.00 0.00 ?  622  LYS A HA   3  
ATOM 4324  H HB2  . LYS A 1 66 ? -5.212  8.065   6.494   1.00 0.00 ?  622  LYS A HB2  3  
ATOM 4325  H HB3  . LYS A 1 66 ? -5.275  9.742   6.999   1.00 0.00 ?  622  LYS A HB3  3  
ATOM 4326  H HG2  . LYS A 1 66 ? -7.495  8.306   5.549   1.00 0.00 ?  622  LYS A HG2  3  
ATOM 4327  H HG3  . LYS A 1 66 ? -7.396  8.526   7.287   1.00 0.00 ?  622  LYS A HG3  3  
ATOM 4328  H HD2  . LYS A 1 66 ? -7.633  10.883  7.074   1.00 0.00 ?  622  LYS A HD2  3  
ATOM 4329  H HD3  . LYS A 1 66 ? -7.455  10.802  5.322   1.00 0.00 ?  622  LYS A HD3  3  
ATOM 4330  H HE2  . LYS A 1 66 ? -9.806  11.078  5.994   1.00 0.00 ?  622  LYS A HE2  3  
ATOM 4331  H HE3  . LYS A 1 66 ? -9.533  9.580   5.116   1.00 0.00 ?  622  LYS A HE3  3  
ATOM 4332  H HZ1  . LYS A 1 66 ? -9.600  8.370   7.223   1.00 0.00 ?  622  LYS A HZ1  3  
ATOM 4333  H HZ2  . LYS A 1 66 ? -10.999 9.236   6.982   1.00 0.00 ?  622  LYS A HZ2  3  
ATOM 4334  H HZ3  . LYS A 1 66 ? -9.859  9.811   8.080   1.00 0.00 ?  622  LYS A HZ3  3  
ATOM 4335  N N    . PRO A 1 67 ? -2.614  9.985   4.981   1.00 0.00 ?  623  PRO A N    3  
ATOM 4336  C CA   . PRO A 1 67 ? -1.167  9.676   5.005   1.00 0.00 ?  623  PRO A CA   3  
ATOM 4337  C C    . PRO A 1 67 ? -0.826  8.672   6.114   1.00 0.00 ?  623  PRO A C    3  
ATOM 4338  O O    . PRO A 1 67 ? 0.008   7.787   5.936   1.00 0.00 ?  623  PRO A O    3  
ATOM 4339  C CB   . PRO A 1 67 ? -0.518  11.033  5.311   1.00 0.00 ?  623  PRO A CB   3  
ATOM 4340  C CG   . PRO A 1 67 ? -1.509  12.037  4.843   1.00 0.00 ?  623  PRO A CG   3  
ATOM 4341  C CD   . PRO A 1 67 ? -2.859  11.438  5.107   1.00 0.00 ?  623  PRO A CD   3  
ATOM 4342  H HA   . PRO A 1 67 ? -0.823  9.300   4.054   1.00 0.00 ?  623  PRO A HA   3  
ATOM 4343  H HB2  . PRO A 1 67 ? -0.342  11.113  6.374   1.00 0.00 ?  623  PRO A HB2  3  
ATOM 4344  H HB3  . PRO A 1 67 ? 0.418   11.123  4.780   1.00 0.00 ?  623  PRO A HB3  3  
ATOM 4345  H HG2  . PRO A 1 67 ? -1.389  12.959  5.394   1.00 0.00 ?  623  PRO A HG2  3  
ATOM 4346  H HG3  . PRO A 1 67 ? -1.378  12.210  3.785   1.00 0.00 ?  623  PRO A HG3  3  
ATOM 4347  H HD2  . PRO A 1 67 ? -3.204  11.691  6.099   1.00 0.00 ?  623  PRO A HD2  3  
ATOM 4348  H HD3  . PRO A 1 67 ? -3.561  11.779  4.362   1.00 0.00 ?  623  PRO A HD3  3  
ATOM 4349  N N    . THR A 1 68 ? -1.522  8.795   7.237   1.00 0.00 ?  624  THR A N    3  
ATOM 4350  C CA   . THR A 1 68 ? -1.345  7.909   8.372   1.00 0.00 ?  624  THR A CA   3  
ATOM 4351  C C    . THR A 1 68 ? -1.709  6.448   7.995   1.00 0.00 ?  624  THR A C    3  
ATOM 4352  O O    . THR A 1 68 ? -1.125  5.498   8.514   1.00 0.00 ?  624  THR A O    3  
ATOM 4353  C CB   . THR A 1 68 ? -2.183  8.409   9.601   1.00 0.00 ?  624  THR A CB   3  
ATOM 4354  O OG1  . THR A 1 68 ? -1.954  7.603   10.775  1.00 0.00 ?  624  THR A OG1  3  
ATOM 4355  C CG2  . THR A 1 68 ? -3.677  8.447   9.293   1.00 0.00 ?  624  THR A CG2  3  
ATOM 4356  H H    . THR A 1 68 ? -2.164  9.533   7.310   1.00 0.00 ?  624  THR A H    3  
ATOM 4357  H HA   . THR A 1 68 ? -0.297  7.938   8.635   1.00 0.00 ?  624  THR A HA   3  
ATOM 4358  H HB   . THR A 1 68 ? -1.854  9.413   9.822   1.00 0.00 ?  624  THR A HB   3  
ATOM 4359  H HG1  . THR A 1 68 ? -2.084  8.198   11.527  1.00 0.00 ?  624  THR A HG1  3  
ATOM 4360  H HG21 . THR A 1 68 ? -4.022  7.455   9.039   1.00 0.00 ?  624  THR A HG21 3  
ATOM 4361  H HG22 . THR A 1 68 ? -3.845  9.107   8.454   1.00 0.00 ?  624  THR A HG22 3  
ATOM 4362  H HG23 . THR A 1 68 ? -4.221  8.815   10.149  1.00 0.00 ?  624  THR A HG23 3  
ATOM 4363  N N    . THR A 1 69 ? -2.626  6.287   7.057   1.00 0.00 ?  625  THR A N    3  
ATOM 4364  C CA   . THR A 1 69 ? -3.056  4.989   6.622   1.00 0.00 ?  625  THR A CA   3  
ATOM 4365  C C    . THR A 1 69 ? -2.056  4.435   5.587   1.00 0.00 ?  625  THR A C    3  
ATOM 4366  O O    . THR A 1 69 ? -1.820  3.225   5.512   1.00 0.00 ?  625  THR A O    3  
ATOM 4367  C CB   . THR A 1 69 ? -4.451  5.111   6.003   1.00 0.00 ?  625  THR A CB   3  
ATOM 4368  O OG1  . THR A 1 69 ? -5.239  5.967   6.850   1.00 0.00 ?  625  THR A OG1  3  
ATOM 4369  C CG2  . THR A 1 69 ? -5.120  3.756   5.924   1.00 0.00 ?  625  THR A CG2  3  
ATOM 4370  H H    . THR A 1 69 ? -3.062  7.058   6.637   1.00 0.00 ?  625  THR A H    3  
ATOM 4371  H HA   . THR A 1 69 ? -3.102  4.329   7.474   1.00 0.00 ?  625  THR A HA   3  
ATOM 4372  H HB   . THR A 1 69 ? -4.370  5.539   5.015   1.00 0.00 ?  625  THR A HB   3  
ATOM 4373  H HG1  . THR A 1 69 ? -5.778  5.421   7.432   1.00 0.00 ?  625  THR A HG1  3  
ATOM 4374  H HG21 . THR A 1 69 ? -5.236  3.346   6.916   1.00 0.00 ?  625  THR A HG21 3  
ATOM 4375  H HG22 . THR A 1 69 ? -4.502  3.098   5.334   1.00 0.00 ?  625  THR A HG22 3  
ATOM 4376  H HG23 . THR A 1 69 ? -6.089  3.855   5.456   1.00 0.00 ?  625  THR A HG23 3  
ATOM 4377  N N    . LEU A 1 70 ? -1.443  5.349   4.828   1.00 0.00 ?  626  LEU A N    3  
ATOM 4378  C CA   . LEU A 1 70 ? -0.422  5.009   3.833   1.00 0.00 ?  626  LEU A CA   3  
ATOM 4379  C C    . LEU A 1 70 ? 0.758   4.359   4.526   1.00 0.00 ?  626  LEU A C    3  
ATOM 4380  O O    . LEU A 1 70 ? 1.343   3.394   4.026   1.00 0.00 ?  626  LEU A O    3  
ATOM 4381  C CB   . LEU A 1 70 ? 0.011   6.293   3.053   1.00 0.00 ?  626  LEU A CB   3  
ATOM 4382  C CG   . LEU A 1 70 ? 1.154   6.181   1.993   1.00 0.00 ?  626  LEU A CG   3  
ATOM 4383  C CD1  . LEU A 1 70 ? 1.111   7.369   1.078   1.00 0.00 ?  626  LEU A CD1  3  
ATOM 4384  C CD2  . LEU A 1 70 ? 2.542   6.141   2.635   1.00 0.00 ?  626  LEU A CD2  3  
ATOM 4385  H H    . LEU A 1 70 ? -1.693  6.290   4.946   1.00 0.00 ?  626  LEU A H    3  
ATOM 4386  H HA   . LEU A 1 70 ? -0.856  4.304   3.141   1.00 0.00 ?  626  LEU A HA   3  
ATOM 4387  H HB2  . LEU A 1 70 ? -0.863  6.672   2.544   1.00 0.00 ?  626  LEU A HB2  3  
ATOM 4388  H HB3  . LEU A 1 70 ? 0.308   7.028   3.786   1.00 0.00 ?  626  LEU A HB3  3  
ATOM 4389  H HG   . LEU A 1 70 ? 1.015   5.287   1.405   1.00 0.00 ?  626  LEU A HG   3  
ATOM 4390  H HD11 . LEU A 1 70 ? 1.912   7.297   0.357   1.00 0.00 ?  626  LEU A HD11 3  
ATOM 4391  H HD12 . LEU A 1 70 ? 1.225   8.276   1.655   1.00 0.00 ?  626  LEU A HD12 3  
ATOM 4392  H HD13 . LEU A 1 70 ? 0.163   7.386   0.561   1.00 0.00 ?  626  LEU A HD13 3  
ATOM 4393  H HD21 . LEU A 1 70 ? 3.292   6.061   1.863   1.00 0.00 ?  626  LEU A HD21 3  
ATOM 4394  H HD22 . LEU A 1 70 ? 2.610   5.287   3.293   1.00 0.00 ?  626  LEU A HD22 3  
ATOM 4395  H HD23 . LEU A 1 70 ? 2.703   7.045   3.202   1.00 0.00 ?  626  LEU A HD23 3  
ATOM 4396  N N    . ARG A 1 71 ? 1.057   4.866   5.707   1.00 0.00 ?  627  ARG A N    3  
ATOM 4397  C CA   . ARG A 1 71 ? 2.170   4.407   6.515   1.00 0.00 ?  627  ARG A CA   3  
ATOM 4398  C C    . ARG A 1 71 ? 2.086   2.923   6.817   1.00 0.00 ?  627  ARG A C    3  
ATOM 4399  O O    . ARG A 1 71 ? 3.108   2.261   6.964   1.00 0.00 ?  627  ARG A O    3  
ATOM 4400  C CB   . ARG A 1 71 ? 2.243   5.198   7.804   1.00 0.00 ?  627  ARG A CB   3  
ATOM 4401  C CG   . ARG A 1 71 ? 2.541   6.658   7.597   1.00 0.00 ?  627  ARG A CG   3  
ATOM 4402  C CD   . ARG A 1 71 ? 2.594   7.380   8.910   1.00 0.00 ?  627  ARG A CD   3  
ATOM 4403  N NE   . ARG A 1 71 ? 2.774   8.814   8.739   1.00 0.00 ?  627  ARG A NE   3  
ATOM 4404  C CZ   . ARG A 1 71 ? 2.620   9.712   9.706   1.00 0.00 ?  627  ARG A CZ   3  
ATOM 4405  N NH1  . ARG A 1 71 ? 2.276   9.311   10.927  1.00 0.00 1  627  ARG A NH1  3  
ATOM 4406  N NH2  . ARG A 1 71 ? 2.791   11.003  9.449   1.00 0.00 ?  627  ARG A NH2  3  
ATOM 4407  H H    . ARG A 1 71 ? 0.495   5.603   6.034   1.00 0.00 ?  627  ARG A H    3  
ATOM 4408  H HA   . ARG A 1 71 ? 3.076   4.593   5.956   1.00 0.00 ?  627  ARG A HA   3  
ATOM 4409  H HB2  . ARG A 1 71 ? 1.285   5.119   8.297   1.00 0.00 ?  627  ARG A HB2  3  
ATOM 4410  H HB3  . ARG A 1 71 ? 2.997   4.776   8.450   1.00 0.00 ?  627  ARG A HB3  3  
ATOM 4411  H HG2  . ARG A 1 71 ? 3.492   6.764   7.096   1.00 0.00 ?  627  ARG A HG2  3  
ATOM 4412  H HG3  . ARG A 1 71 ? 1.761   7.093   6.990   1.00 0.00 ?  627  ARG A HG3  3  
ATOM 4413  H HD2  . ARG A 1 71 ? 1.662   7.209   9.427   1.00 0.00 ?  627  ARG A HD2  3  
ATOM 4414  H HD3  . ARG A 1 71 ? 3.413   6.989   9.496   1.00 0.00 ?  627  ARG A HD3  3  
ATOM 4415  H HE   . ARG A 1 71 ? 3.021   9.096   7.828   1.00 0.00 ?  627  ARG A HE   3  
ATOM 4416  H HH11 . ARG A 1 71 ? 2.122   8.341   11.137  1.00 0.00 ?  627  ARG A HH11 3  
ATOM 4417  H HH12 . ARG A 1 71 ? 2.168   9.951   11.690  1.00 0.00 ?  627  ARG A HH12 3  
ATOM 4418  H HH21 . ARG A 1 71 ? 3.035   11.333  8.533   1.00 0.00 ?  627  ARG A HH21 3  
ATOM 4419  H HH22 . ARG A 1 71 ? 2.673   11.720  10.141  1.00 0.00 ?  627  ARG A HH22 3  
ATOM 4420  N N    . GLU A 1 72 ? 0.881   2.397   6.863   1.00 0.00 ?  628  GLU A N    3  
ATOM 4421  C CA   . GLU A 1 72 ? 0.686   0.999   7.138   1.00 0.00 ?  628  GLU A CA   3  
ATOM 4422  C C    . GLU A 1 72 ? 1.179   0.167   5.950   1.00 0.00 ?  628  GLU A C    3  
ATOM 4423  O O    . GLU A 1 72 ? 2.006   -0.736  6.111   1.00 0.00 ?  628  GLU A O    3  
ATOM 4424  C CB   . GLU A 1 72 ? -0.786  0.711   7.419   1.00 0.00 ?  628  GLU A CB   3  
ATOM 4425  C CG   . GLU A 1 72 ? -1.037  -0.686  7.953   1.00 0.00 ?  628  GLU A CG   3  
ATOM 4426  C CD   . GLU A 1 72 ? -0.281  -0.951  9.234   1.00 0.00 ?  628  GLU A CD   3  
ATOM 4427  O OE1  . GLU A 1 72 ? 0.885   -1.357  9.178   1.00 0.00 ?  628  GLU A OE1  3  
ATOM 4428  O OE2  . GLU A 1 72 ? -0.838  -0.746  10.329  1.00 0.00 -1 628  GLU A OE2  3  
ATOM 4429  H H    . GLU A 1 72 ? 0.101   2.967   6.695   1.00 0.00 ?  628  GLU A H    3  
ATOM 4430  H HA   . GLU A 1 72 ? 1.271   0.741   8.009   1.00 0.00 ?  628  GLU A HA   3  
ATOM 4431  H HB2  . GLU A 1 72 ? -1.172  1.435   8.120   1.00 0.00 ?  628  GLU A HB2  3  
ATOM 4432  H HB3  . GLU A 1 72 ? -1.332  0.815   6.493   1.00 0.00 ?  628  GLU A HB3  3  
ATOM 4433  H HG2  . GLU A 1 72 ? -2.093  -0.804  8.142   1.00 0.00 ?  628  GLU A HG2  3  
ATOM 4434  H HG3  . GLU A 1 72 ? -0.720  -1.402  7.210   1.00 0.00 ?  628  GLU A HG3  3  
ATOM 4435  N N    . LEU A 1 73 ? 0.730   0.533   4.748   1.00 0.00 ?  629  LEU A N    3  
ATOM 4436  C CA   . LEU A 1 73 ? 1.108   -0.185  3.527   1.00 0.00 ?  629  LEU A CA   3  
ATOM 4437  C C    . LEU A 1 73 ? 2.600   -0.016  3.242   1.00 0.00 ?  629  LEU A C    3  
ATOM 4438  O O    . LEU A 1 73 ? 3.237   -0.903  2.676   1.00 0.00 ?  629  LEU A O    3  
ATOM 4439  C CB   . LEU A 1 73 ? 0.256   0.270   2.323   1.00 0.00 ?  629  LEU A CB   3  
ATOM 4440  C CG   . LEU A 1 73 ? 0.538   -0.427  0.967   1.00 0.00 ?  629  LEU A CG   3  
ATOM 4441  C CD1  . LEU A 1 73 ? 0.318   -1.921  1.065   1.00 0.00 ?  629  LEU A CD1  3  
ATOM 4442  C CD2  . LEU A 1 73 ? -0.338  0.145   -0.131  1.00 0.00 ?  629  LEU A CD2  3  
ATOM 4443  H H    . LEU A 1 73 ? 0.140   1.313   4.678   1.00 0.00 ?  629  LEU A H    3  
ATOM 4444  H HA   . LEU A 1 73 ? 0.919   -1.232  3.715   1.00 0.00 ?  629  LEU A HA   3  
ATOM 4445  H HB2  . LEU A 1 73 ? -0.783  0.117   2.571   1.00 0.00 ?  629  LEU A HB2  3  
ATOM 4446  H HB3  . LEU A 1 73 ? 0.427   1.329   2.195   1.00 0.00 ?  629  LEU A HB3  3  
ATOM 4447  H HG   . LEU A 1 73 ? 1.570   -0.266  0.695   1.00 0.00 ?  629  LEU A HG   3  
ATOM 4448  H HD11 . LEU A 1 73 ? 0.508   -2.376  0.103   1.00 0.00 ?  629  LEU A HD11 3  
ATOM 4449  H HD12 . LEU A 1 73 ? -0.703  -2.108  1.360   1.00 0.00 ?  629  LEU A HD12 3  
ATOM 4450  H HD13 . LEU A 1 73 ? 0.987   -2.341  1.801   1.00 0.00 ?  629  LEU A HD13 3  
ATOM 4451  H HD21 . LEU A 1 73 ? -0.107  -0.339  -1.068  1.00 0.00 ?  629  LEU A HD21 3  
ATOM 4452  H HD22 . LEU A 1 73 ? -0.162  1.207   -0.217  1.00 0.00 ?  629  LEU A HD22 3  
ATOM 4453  H HD23 . LEU A 1 73 ? -1.376  -0.025  0.117   1.00 0.00 ?  629  LEU A HD23 3  
ATOM 4454  N N    . GLU A 1 74 ? 3.152   1.092   3.716   1.00 0.00 ?  630  GLU A N    3  
ATOM 4455  C CA   . GLU A 1 74 ? 4.554   1.413   3.547   1.00 0.00 ?  630  GLU A CA   3  
ATOM 4456  C C    . GLU A 1 74 ? 5.398   0.332   4.218   1.00 0.00 ?  630  GLU A C    3  
ATOM 4457  O O    . GLU A 1 74 ? 6.337   -0.219  3.628   1.00 0.00 ?  630  GLU A O    3  
ATOM 4458  C CB   . GLU A 1 74 ? 4.801   2.812   4.162   1.00 0.00 ?  630  GLU A CB   3  
ATOM 4459  C CG   . GLU A 1 74 ? 6.249   3.238   4.348   1.00 0.00 ?  630  GLU A CG   3  
ATOM 4460  C CD   . GLU A 1 74 ? 7.072   3.216   3.088   1.00 0.00 ?  630  GLU A CD   3  
ATOM 4461  O OE1  . GLU A 1 74 ? 7.872   2.283   2.915   1.00 0.00 ?  630  GLU A OE1  3  
ATOM 4462  O OE2  . GLU A 1 74 ? 6.970   4.138   2.274   1.00 0.00 -1 630  GLU A OE2  3  
ATOM 4463  H H    . GLU A 1 74 ? 2.595   1.711   4.237   1.00 0.00 ?  630  GLU A H    3  
ATOM 4464  H HA   . GLU A 1 74 ? 4.776   1.444   2.492   1.00 0.00 ?  630  GLU A HA   3  
ATOM 4465  H HB2  . GLU A 1 74 ? 4.328   3.549   3.530   1.00 0.00 ?  630  GLU A HB2  3  
ATOM 4466  H HB3  . GLU A 1 74 ? 4.314   2.837   5.125   1.00 0.00 ?  630  GLU A HB3  3  
ATOM 4467  H HG2  . GLU A 1 74 ? 6.265   4.243   4.741   1.00 0.00 ?  630  GLU A HG2  3  
ATOM 4468  H HG3  . GLU A 1 74 ? 6.695   2.569   5.068   1.00 0.00 ?  630  GLU A HG3  3  
ATOM 4469  N N    . ARG A 1 75 ? 4.997   -0.019  5.407   1.00 0.00 ?  631  ARG A N    3  
ATOM 4470  C CA   . ARG A 1 75 ? 5.696   -1.000  6.192   1.00 0.00 ?  631  ARG A CA   3  
ATOM 4471  C C    . ARG A 1 75 ? 5.319   -2.385  5.730   1.00 0.00 ?  631  ARG A C    3  
ATOM 4472  O O    . ARG A 1 75 ? 6.136   -3.305  5.776   1.00 0.00 ?  631  ARG A O    3  
ATOM 4473  C CB   . ARG A 1 75 ? 5.332   -0.814  7.640   1.00 0.00 ?  631  ARG A CB   3  
ATOM 4474  C CG   . ARG A 1 75 ? 5.416   0.626   8.041   1.00 0.00 ?  631  ARG A CG   3  
ATOM 4475  C CD   . ARG A 1 75 ? 5.029   0.850   9.463   1.00 0.00 ?  631  ARG A CD   3  
ATOM 4476  N NE   . ARG A 1 75 ? 3.781   0.179   9.838   1.00 0.00 ?  631  ARG A NE   3  
ATOM 4477  C CZ   . ARG A 1 75 ? 3.454   -0.147  11.092  1.00 0.00 ?  631  ARG A CZ   3  
ATOM 4478  N NH1  . ARG A 1 75 ? 4.269   0.156   12.105  1.00 0.00 1  631  ARG A NH1  3  
ATOM 4479  N NH2  . ARG A 1 75 ? 2.322   -0.774  11.326  1.00 0.00 ?  631  ARG A NH2  3  
ATOM 4480  H H    . ARG A 1 75 ? 4.190   0.401   5.775   1.00 0.00 ?  631  ARG A H    3  
ATOM 4481  H HA   . ARG A 1 75 ? 6.759   -0.850  6.074   1.00 0.00 ?  631  ARG A HA   3  
ATOM 4482  H HB2  . ARG A 1 75 ? 4.317   -1.155  7.793   1.00 0.00 ?  631  ARG A HB2  3  
ATOM 4483  H HB3  . ARG A 1 75 ? 6.000   -1.385  8.267   1.00 0.00 ?  631  ARG A HB3  3  
ATOM 4484  H HG2  . ARG A 1 75 ? 6.431   0.965   7.892   1.00 0.00 ?  631  ARG A HG2  3  
ATOM 4485  H HG3  . ARG A 1 75 ? 4.758   1.186   7.393   1.00 0.00 ?  631  ARG A HG3  3  
ATOM 4486  H HD2  . ARG A 1 75 ? 5.827   0.535   10.110  1.00 0.00 ?  631  ARG A HD2  3  
ATOM 4487  H HD3  . ARG A 1 75 ? 4.864   1.915   9.521   1.00 0.00 ?  631  ARG A HD3  3  
ATOM 4488  H HE   . ARG A 1 75 ? 3.170   -0.045  9.100   1.00 0.00 ?  631  ARG A HE   3  
ATOM 4489  H HH11 . ARG A 1 75 ? 5.145   0.626   11.971  1.00 0.00 ?  631  ARG A HH11 3  
ATOM 4490  H HH12 . ARG A 1 75 ? 4.034   -0.078  13.052  1.00 0.00 ?  631  ARG A HH12 3  
ATOM 4491  H HH21 . ARG A 1 75 ? 1.694   -1.012  10.566  1.00 0.00 ?  631  ARG A HH21 3  
ATOM 4492  H HH22 . ARG A 1 75 ? 2.030   -1.067  12.241  1.00 0.00 ?  631  ARG A HH22 3  
ATOM 4493  N N    . TYR A 1 76 ? 4.084   -2.518  5.261   1.00 0.00 ?  632  TYR A N    3  
ATOM 4494  C CA   . TYR A 1 76 ? 3.556   -3.770  4.774   1.00 0.00 ?  632  TYR A CA   3  
ATOM 4495  C C    . TYR A 1 76 ? 4.400   -4.330  3.657   1.00 0.00 ?  632  TYR A C    3  
ATOM 4496  O O    . TYR A 1 76 ? 4.723   -5.502  3.664   1.00 0.00 ?  632  TYR A O    3  
ATOM 4497  C CB   . TYR A 1 76 ? 2.139   -3.599  4.244   1.00 0.00 ?  632  TYR A CB   3  
ATOM 4498  C CG   . TYR A 1 76 ? 1.582   -4.884  3.687   1.00 0.00 ?  632  TYR A CG   3  
ATOM 4499  C CD1  . TYR A 1 76 ? 1.723   -5.179  2.339   1.00 0.00 ?  632  TYR A CD1  3  
ATOM 4500  C CD2  . TYR A 1 76 ? 0.974   -5.817  4.506   1.00 0.00 ?  632  TYR A CD2  3  
ATOM 4501  C CE1  . TYR A 1 76 ? 1.283   -6.355  1.818   1.00 0.00 ?  632  TYR A CE1  3  
ATOM 4502  C CE2  . TYR A 1 76 ? 0.513   -7.010  3.992   1.00 0.00 ?  632  TYR A CE2  3  
ATOM 4503  C CZ   . TYR A 1 76 ? 0.672   -7.274  2.646   1.00 0.00 ?  632  TYR A CZ   3  
ATOM 4504  O OH   . TYR A 1 76 ? 0.235   -8.460  2.133   1.00 0.00 ?  632  TYR A OH   3  
ATOM 4505  H H    . TYR A 1 76 ? 3.477   -1.747  5.264   1.00 0.00 ?  632  TYR A H    3  
ATOM 4506  H HA   . TYR A 1 76 ? 3.525   -4.471  5.594   1.00 0.00 ?  632  TYR A HA   3  
ATOM 4507  H HB2  . TYR A 1 76 ? 1.475   -3.204  4.997   1.00 0.00 ?  632  TYR A HB2  3  
ATOM 4508  H HB3  . TYR A 1 76 ? 2.237   -2.912  3.412   1.00 0.00 ?  632  TYR A HB3  3  
ATOM 4509  H HD1  . TYR A 1 76 ? 2.200   -4.445  1.708   1.00 0.00 ?  632  TYR A HD1  3  
ATOM 4510  H HD2  . TYR A 1 76 ? 0.859   -5.586  5.555   1.00 0.00 ?  632  TYR A HD2  3  
ATOM 4511  H HE1  . TYR A 1 76 ? 1.435   -6.524  0.760   1.00 0.00 ?  632  TYR A HE1  3  
ATOM 4512  H HE2  . TYR A 1 76 ? 0.036   -7.732  4.639   1.00 0.00 ?  632  TYR A HE2  3  
ATOM 4513  H HH   . TYR A 1 76 ? 0.880   -8.740  1.480   1.00 0.00 ?  632  TYR A HH   3  
ATOM 4514  N N    . VAL A 1 77 ? 4.721   -3.498  2.686   1.00 0.00 ?  633  VAL A N    3  
ATOM 4515  C CA   . VAL A 1 77 ? 5.469   -3.942  1.515   1.00 0.00 ?  633  VAL A CA   3  
ATOM 4516  C C    . VAL A 1 77 ? 6.813   -4.540  1.937   1.00 0.00 ?  633  VAL A C    3  
ATOM 4517  O O    . VAL A 1 77 ? 7.178   -5.636  1.531   1.00 0.00 ?  633  VAL A O    3  
ATOM 4518  C CB   . VAL A 1 77 ? 5.691   -2.787  0.513   1.00 0.00 ?  633  VAL A CB   3  
ATOM 4519  C CG1  . VAL A 1 77 ? 6.441   -3.283  -0.690  1.00 0.00 ?  633  VAL A CG1  3  
ATOM 4520  C CG2  . VAL A 1 77 ? 4.363   -2.188  0.079   1.00 0.00 ?  633  VAL A CG2  3  
ATOM 4521  H H    . VAL A 1 77 ? 4.432   -2.559  2.760   1.00 0.00 ?  633  VAL A H    3  
ATOM 4522  H HA   . VAL A 1 77 ? 4.897   -4.722  1.031   1.00 0.00 ?  633  VAL A HA   3  
ATOM 4523  H HB   . VAL A 1 77 ? 6.272   -2.015  0.994   1.00 0.00 ?  633  VAL A HB   3  
ATOM 4524  H HG11 . VAL A 1 77 ? 7.402   -3.665  -0.380  1.00 0.00 ?  633  VAL A HG11 3  
ATOM 4525  H HG12 . VAL A 1 77 ? 6.560   -2.471  -1.390  1.00 0.00 ?  633  VAL A HG12 3  
ATOM 4526  H HG13 . VAL A 1 77 ? 5.856   -4.075  -1.134  1.00 0.00 ?  633  VAL A HG13 3  
ATOM 4527  H HG21 . VAL A 1 77 ? 3.838   -1.803  0.940   1.00 0.00 ?  633  VAL A HG21 3  
ATOM 4528  H HG22 . VAL A 1 77 ? 3.762   -2.950  -0.396  1.00 0.00 ?  633  VAL A HG22 3  
ATOM 4529  H HG23 . VAL A 1 77 ? 4.539   -1.386  -0.624  1.00 0.00 ?  633  VAL A HG23 3  
ATOM 4530  N N    . LYS A 1 78 ? 7.495   -3.839  2.798   1.00 0.00 ?  634  LYS A N    3  
ATOM 4531  C CA   . LYS A 1 78 ? 8.771   -4.276  3.329   1.00 0.00 ?  634  LYS A CA   3  
ATOM 4532  C C    . LYS A 1 78 ? 8.603   -5.505  4.238   1.00 0.00 ?  634  LYS A C    3  
ATOM 4533  O O    . LYS A 1 78 ? 9.485   -6.361  4.330   1.00 0.00 ?  634  LYS A O    3  
ATOM 4534  C CB   . LYS A 1 78 ? 9.449   -3.089  3.996   1.00 0.00 ?  634  LYS A CB   3  
ATOM 4535  C CG   . LYS A 1 78 ? 9.817   -2.043  2.951   1.00 0.00 ?  634  LYS A CG   3  
ATOM 4536  C CD   . LYS A 1 78 ? 10.047  -0.663  3.515   1.00 0.00 ?  634  LYS A CD   3  
ATOM 4537  C CE   . LYS A 1 78 ? 10.491  0.275   2.404   1.00 0.00 ?  634  LYS A CE   3  
ATOM 4538  N NZ   . LYS A 1 78 ? 10.475  1.688   2.820   1.00 0.00 1  634  LYS A NZ   3  
ATOM 4539  H H    . LYS A 1 78 ? 7.127   -2.978  3.092   1.00 0.00 ?  634  LYS A H    3  
ATOM 4540  H HA   . LYS A 1 78 ? 9.363   -4.583  2.479   1.00 0.00 ?  634  LYS A HA   3  
ATOM 4541  H HB2  . LYS A 1 78 ? 8.773   -2.652  4.717   1.00 0.00 ?  634  LYS A HB2  3  
ATOM 4542  H HB3  . LYS A 1 78 ? 10.354  -3.412  4.489   1.00 0.00 ?  634  LYS A HB3  3  
ATOM 4543  H HG2  . LYS A 1 78 ? 10.719  -2.356  2.447   1.00 0.00 ?  634  LYS A HG2  3  
ATOM 4544  H HG3  . LYS A 1 78 ? 9.015   -1.995  2.227   1.00 0.00 ?  634  LYS A HG3  3  
ATOM 4545  H HD2  . LYS A 1 78 ? 9.123   -0.302  3.943   1.00 0.00 ?  634  LYS A HD2  3  
ATOM 4546  H HD3  . LYS A 1 78 ? 10.812  -0.701  4.276   1.00 0.00 ?  634  LYS A HD3  3  
ATOM 4547  H HE2  . LYS A 1 78 ? 11.497  0.009   2.115   1.00 0.00 ?  634  LYS A HE2  3  
ATOM 4548  H HE3  . LYS A 1 78 ? 9.832   0.147   1.558   1.00 0.00 ?  634  LYS A HE3  3  
ATOM 4549  H HZ1  . LYS A 1 78 ? 9.482   1.995   2.924   1.00 0.00 ?  634  LYS A HZ1  3  
ATOM 4550  H HZ2  . LYS A 1 78 ? 10.929  2.312   2.121   1.00 0.00 ?  634  LYS A HZ2  3  
ATOM 4551  H HZ3  . LYS A 1 78 ? 10.942  1.815   3.738   1.00 0.00 ?  634  LYS A HZ3  3  
ATOM 4552  N N    . SER A 1 79 ? 7.454   -5.593  4.869   1.00 0.00 ?  635  SER A N    3  
ATOM 4553  C CA   . SER A 1 79 ? 7.070   -6.747  5.647   1.00 0.00 ?  635  SER A CA   3  
ATOM 4554  C C    . SER A 1 79 ? 6.795   -7.951  4.704   1.00 0.00 ?  635  SER A C    3  
ATOM 4555  O O    . SER A 1 79 ? 7.008   -9.099  5.063   1.00 0.00 ?  635  SER A O    3  
ATOM 4556  C CB   . SER A 1 79 ? 5.838   -6.407  6.506   1.00 0.00 ?  635  SER A CB   3  
ATOM 4557  O OG   . SER A 1 79 ? 5.418   -7.501  7.300   1.00 0.00 ?  635  SER A OG   3  
ATOM 4558  H H    . SER A 1 79 ? 6.835   -4.834  4.822   1.00 0.00 ?  635  SER A H    3  
ATOM 4559  H HA   . SER A 1 79 ? 7.898   -6.993  6.293   1.00 0.00 ?  635  SER A HA   3  
ATOM 4560  H HB2  . SER A 1 79 ? 6.078   -5.582  7.159   1.00 0.00 ?  635  SER A HB2  3  
ATOM 4561  H HB3  . SER A 1 79 ? 5.026   -6.117  5.856   1.00 0.00 ?  635  SER A HB3  3  
ATOM 4562  H HG   . SER A 1 79 ? 5.650   -7.294  8.217   1.00 0.00 ?  635  SER A HG   3  
ATOM 4563  N N    . CYS A 1 80 ? 6.333   -7.683  3.500   1.00 0.00 ?  636  CYS A N    3  
ATOM 4564  C CA   . CYS A 1 80 ? 6.094   -8.734  2.550   1.00 0.00 ?  636  CYS A CA   3  
ATOM 4565  C C    . CYS A 1 80 ? 7.414   -9.253  1.985   1.00 0.00 ?  636  CYS A C    3  
ATOM 4566  O O    . CYS A 1 80 ? 7.490   -10.370 1.483   1.00 0.00 ?  636  CYS A O    3  
ATOM 4567  C CB   . CYS A 1 80 ? 5.192   -8.281  1.414   1.00 0.00 ?  636  CYS A CB   3  
ATOM 4568  S SG   . CYS A 1 80 ? 4.809   -9.626  0.275   1.00 0.00 ?  636  CYS A SG   3  
ATOM 4569  H H    . CYS A 1 80 ? 6.123   -6.753  3.256   1.00 0.00 ?  636  CYS A H    3  
ATOM 4570  H HA   . CYS A 1 80 ? 5.590   -9.528  3.080   1.00 0.00 ?  636  CYS A HA   3  
ATOM 4571  H HB2  . CYS A 1 80 ? 4.266   -7.906  1.821   1.00 0.00 ?  636  CYS A HB2  3  
ATOM 4572  H HB3  . CYS A 1 80 ? 5.684   -7.501  0.852   1.00 0.00 ?  636  CYS A HB3  3  
ATOM 4573  H HG   . CYS A 1 80 ? 5.793   -10.496 0.467   1.00 0.00 ?  636  CYS A HG   3  
ATOM 4574  N N    . LEU A 1 81 ? 8.447   -8.430  2.074   1.00 0.00 ?  637  LEU A N    3  
ATOM 4575  C CA   . LEU A 1 81 ? 9.765   -8.792  1.594   1.00 0.00 ?  637  LEU A CA   3  
ATOM 4576  C C    . LEU A 1 81 ? 10.392  -9.847  2.494   1.00 0.00 ?  637  LEU A C    3  
ATOM 4577  O O    . LEU A 1 81 ? 11.050  -10.765 2.013   1.00 0.00 ?  637  LEU A O    3  
ATOM 4578  C CB   . LEU A 1 81 ? 10.684  -7.563  1.521   1.00 0.00 ?  637  LEU A CB   3  
ATOM 4579  C CG   . LEU A 1 81 ? 10.251  -6.420  0.591   1.00 0.00 ?  637  LEU A CG   3  
ATOM 4580  C CD1  . LEU A 1 81 ? 11.231  -5.264  0.682   1.00 0.00 ?  637  LEU A CD1  3  
ATOM 4581  C CD2  . LEU A 1 81 ? 10.151  -6.899  -0.847  1.00 0.00 ?  637  LEU A CD2  3  
ATOM 4582  H H    . LEU A 1 81 ? 8.308   -7.543  2.468   1.00 0.00 ?  637  LEU A H    3  
ATOM 4583  H HA   . LEU A 1 81 ? 9.660   -9.204  0.601   1.00 0.00 ?  637  LEU A HA   3  
ATOM 4584  H HB2  . LEU A 1 81 ? 10.776  -7.161  2.520   1.00 0.00 ?  637  LEU A HB2  3  
ATOM 4585  H HB3  . LEU A 1 81 ? 11.658  -7.904  1.206   1.00 0.00 ?  637  LEU A HB3  3  
ATOM 4586  H HG   . LEU A 1 81 ? 9.279   -6.063  0.901   1.00 0.00 ?  637  LEU A HG   3  
ATOM 4587  H HD11 . LEU A 1 81 ? 12.207  -5.596  0.358   1.00 0.00 ?  637  LEU A HD11 3  
ATOM 4588  H HD12 . LEU A 1 81 ? 11.295  -4.918  1.703   1.00 0.00 ?  637  LEU A HD12 3  
ATOM 4589  H HD13 . LEU A 1 81 ? 10.898  -4.456  0.046   1.00 0.00 ?  637  LEU A HD13 3  
ATOM 4590  H HD21 . LEU A 1 81 ? 9.866   -6.073  -1.481  1.00 0.00 ?  637  LEU A HD21 3  
ATOM 4591  H HD22 . LEU A 1 81 ? 9.402   -7.672  -0.913  1.00 0.00 ?  637  LEU A HD22 3  
ATOM 4592  H HD23 . LEU A 1 81 ? 11.105  -7.288  -1.167  1.00 0.00 ?  637  LEU A HD23 3  
ATOM 4593  N N    . GLN A 1 82 ? 10.151  -9.722  3.799   1.00 0.00 ?  638  GLN A N    3  
ATOM 4594  C CA   . GLN A 1 82 ? 10.716  -10.646 4.772   1.00 0.00 ?  638  GLN A CA   3  
ATOM 4595  C C    . GLN A 1 82 ? 10.022  -12.004 4.699   1.00 0.00 ?  638  GLN A C    3  
ATOM 4596  O O    . GLN A 1 82 ? 10.677  -13.039 4.782   1.00 0.00 ?  638  GLN A O    3  
ATOM 4597  C CB   . GLN A 1 82 ? 10.681  -10.051 6.202   1.00 0.00 ?  638  GLN A CB   3  
ATOM 4598  C CG   . GLN A 1 82 ? 9.291   -9.752  6.721   1.00 0.00 ?  638  GLN A CG   3  
ATOM 4599  C CD   . GLN A 1 82 ? 9.266   -8.892  7.956   1.00 0.00 ?  638  GLN A CD   3  
ATOM 4600  O OE1  . GLN A 1 82 ? 10.149  -8.062  8.174   1.00 0.00 ?  638  GLN A OE1  3  
ATOM 4601  N NE2  . GLN A 1 82 ? 8.249   -9.051  8.758   1.00 0.00 ?  638  GLN A NE2  3  
ATOM 4602  H H    . GLN A 1 82 ? 9.579   -8.986  4.102   1.00 0.00 ?  638  GLN A H    3  
ATOM 4603  H HA   . GLN A 1 82 ? 11.746  -10.799 4.484   1.00 0.00 ?  638  GLN A HA   3  
ATOM 4604  H HB2  . GLN A 1 82 ? 11.140  -10.756 6.880   1.00 0.00 ?  638  GLN A HB2  3  
ATOM 4605  H HB3  . GLN A 1 82 ? 11.255  -9.136  6.219   1.00 0.00 ?  638  GLN A HB3  3  
ATOM 4606  H HG2  . GLN A 1 82 ? 8.742   -9.239  5.945   1.00 0.00 ?  638  GLN A HG2  3  
ATOM 4607  H HG3  . GLN A 1 82 ? 8.797   -10.686 6.939   1.00 0.00 ?  638  GLN A HG3  3  
ATOM 4608  H HE21 . GLN A 1 82 ? 7.563   -9.714  8.522   1.00 0.00 ?  638  GLN A HE21 3  
ATOM 4609  H HE22 . GLN A 1 82 ? 8.206   -8.489  9.562   1.00 0.00 ?  638  GLN A HE22 3  
ATOM 4610  N N    . LYS A 1 83 ? 8.702   -11.996 4.507   1.00 0.00 ?  639  LYS A N    3  
ATOM 4611  C CA   . LYS A 1 83 ? 7.927   -13.225 4.381   1.00 0.00 ?  639  LYS A CA   3  
ATOM 4612  C C    . LYS A 1 83 ? 6.993   -13.133 3.182   1.00 0.00 ?  639  LYS A C    3  
ATOM 4613  O O    . LYS A 1 83 ? 5.868   -12.610 3.266   1.00 0.00 ?  639  LYS A O    3  
ATOM 4614  C CB   . LYS A 1 83 ? 7.170   -13.573 5.679   1.00 0.00 ?  639  LYS A CB   3  
ATOM 4615  C CG   . LYS A 1 83 ? 8.099   -13.883 6.857   1.00 0.00 ?  639  LYS A CG   3  
ATOM 4616  C CD   . LYS A 1 83 ? 7.352   -14.275 8.122   1.00 0.00 ?  639  LYS A CD   3  
ATOM 4617  C CE   . LYS A 1 83 ? 6.494   -13.144 8.645   1.00 0.00 ?  639  LYS A CE   3  
ATOM 4618  N NZ   . LYS A 1 83 ? 5.824   -13.504 9.904   1.00 0.00 1  639  LYS A NZ   3  
ATOM 4619  H H    . LYS A 1 83 ? 8.230   -11.139 4.435   1.00 0.00 ?  639  LYS A H    3  
ATOM 4620  H HA   . LYS A 1 83 ? 8.641   -14.005 4.165   1.00 0.00 ?  639  LYS A HA   3  
ATOM 4621  H HB2  . LYS A 1 83 ? 6.546   -12.733 5.943   1.00 0.00 ?  639  LYS A HB2  3  
ATOM 4622  H HB3  . LYS A 1 83 ? 6.545   -14.434 5.500   1.00 0.00 ?  639  LYS A HB3  3  
ATOM 4623  H HG2  . LYS A 1 83 ? 8.747   -14.702 6.586   1.00 0.00 ?  639  LYS A HG2  3  
ATOM 4624  H HG3  . LYS A 1 83 ? 8.702   -13.010 7.061   1.00 0.00 ?  639  LYS A HG3  3  
ATOM 4625  H HD2  . LYS A 1 83 ? 6.718   -15.120 7.900   1.00 0.00 ?  639  LYS A HD2  3  
ATOM 4626  H HD3  . LYS A 1 83 ? 8.069   -14.556 8.878   1.00 0.00 ?  639  LYS A HD3  3  
ATOM 4627  H HE2  . LYS A 1 83 ? 7.118   -12.279 8.812   1.00 0.00 ?  639  LYS A HE2  3  
ATOM 4628  H HE3  . LYS A 1 83 ? 5.745   -12.911 7.903   1.00 0.00 ?  639  LYS A HE3  3  
ATOM 4629  H HZ1  . LYS A 1 83 ? 5.210   -14.329 9.774   1.00 0.00 ?  639  LYS A HZ1  3  
ATOM 4630  H HZ2  . LYS A 1 83 ? 5.214   -12.718 10.208  1.00 0.00 ?  639  LYS A HZ2  3  
ATOM 4631  H HZ3  . LYS A 1 83 ? 6.505   -13.693 10.664  1.00 0.00 ?  639  LYS A HZ3  3  
ATOM 4632  N N    . LYS A 1 84 ? 7.492   -13.608 2.059   1.00 0.00 ?  640  LYS A N    3  
ATOM 4633  C CA   . LYS A 1 84 ? 6.811   -13.516 0.775   1.00 0.00 ?  640  LYS A CA   3  
ATOM 4634  C C    . LYS A 1 84 ? 5.684   -14.533 0.643   1.00 0.00 ?  640  LYS A C    3  
ATOM 4635  O O    . LYS A 1 84 ? 4.595   -14.201 0.184   1.00 0.00 ?  640  LYS A O    3  
ATOM 4636  C CB   . LYS A 1 84 ? 7.822   -13.705 -0.363  1.00 0.00 ?  640  LYS A CB   3  
ATOM 4637  C CG   . LYS A 1 84 ? 8.950   -12.686 -0.364  1.00 0.00 ?  640  LYS A CG   3  
ATOM 4638  C CD   . LYS A 1 84 ? 9.976   -12.990 -1.441  1.00 0.00 ?  640  LYS A CD   3  
ATOM 4639  C CE   . LYS A 1 84 ? 11.095  -11.954 -1.459  1.00 0.00 ?  640  LYS A CE   3  
ATOM 4640  N NZ   . LYS A 1 84 ? 10.618  -10.610 -1.873  1.00 0.00 1  640  LYS A NZ   3  
ATOM 4641  H H    . LYS A 1 84 ? 8.369   -14.046 2.092   1.00 0.00 ?  640  LYS A H    3  
ATOM 4642  H HA   . LYS A 1 84 ? 6.397   -12.523 0.691   1.00 0.00 ?  640  LYS A HA   3  
ATOM 4643  H HB2  . LYS A 1 84 ? 8.256   -14.690 -0.279  1.00 0.00 ?  640  LYS A HB2  3  
ATOM 4644  H HB3  . LYS A 1 84 ? 7.301   -13.636 -1.306  1.00 0.00 ?  640  LYS A HB3  3  
ATOM 4645  H HG2  . LYS A 1 84 ? 8.539   -11.703 -0.535  1.00 0.00 ?  640  LYS A HG2  3  
ATOM 4646  H HG3  . LYS A 1 84 ? 9.434   -12.702 0.600   1.00 0.00 ?  640  LYS A HG3  3  
ATOM 4647  H HD2  . LYS A 1 84 ? 10.402  -13.965 -1.255  1.00 0.00 ?  640  LYS A HD2  3  
ATOM 4648  H HD3  . LYS A 1 84 ? 9.480   -12.989 -2.400  1.00 0.00 ?  640  LYS A HD3  3  
ATOM 4649  H HE2  . LYS A 1 84 ? 11.517  -11.882 -0.469  1.00 0.00 ?  640  LYS A HE2  3  
ATOM 4650  H HE3  . LYS A 1 84 ? 11.856  -12.286 -2.148  1.00 0.00 ?  640  LYS A HE3  3  
ATOM 4651  H HZ1  . LYS A 1 84 ? 9.826   -10.290 -1.280  1.00 0.00 ?  640  LYS A HZ1  3  
ATOM 4652  H HZ2  . LYS A 1 84 ? 10.292  -10.621 -2.860  1.00 0.00 ?  640  LYS A HZ2  3  
ATOM 4653  H HZ3  . LYS A 1 84 ? 11.389  -9.916  -1.795  1.00 0.00 ?  640  LYS A HZ3  3  
ATOM 4654  N N    . GLN A 1 85 ? 5.947   -15.746 1.038   1.00 0.00 ?  641  GLN A N    3  
ATOM 4655  C CA   . GLN A 1 85 ? 4.977   -16.814 0.925   1.00 0.00 ?  641  GLN A CA   3  
ATOM 4656  C C    . GLN A 1 85 ? 4.232   -16.960 2.254   1.00 0.00 ?  641  GLN A C    3  
ATOM 4657  O O    . GLN A 1 85 ? 4.796   -16.659 3.314   1.00 0.00 ?  641  GLN A O    3  
ATOM 4658  C CB   . GLN A 1 85 ? 5.700   -18.119 0.571   1.00 0.00 ?  641  GLN A CB   3  
ATOM 4659  C CG   . GLN A 1 85 ? 4.773   -19.283 0.290   1.00 0.00 ?  641  GLN A CG   3  
ATOM 4660  C CD   . GLN A 1 85 ? 5.504   -20.581 0.065   1.00 0.00 ?  641  GLN A CD   3  
ATOM 4661  O OE1  . GLN A 1 85 ? 6.641   -20.608 -0.427  1.00 0.00 ?  641  GLN A OE1  3  
ATOM 4662  N NE2  . GLN A 1 85 ? 4.866   -21.665 0.416   1.00 0.00 ?  641  GLN A NE2  3  
ATOM 4663  H H    . GLN A 1 85 ? 6.819   -15.942 1.444   1.00 0.00 ?  641  GLN A H    3  
ATOM 4664  H HA   . GLN A 1 85 ? 4.279   -16.567 0.140   1.00 0.00 ?  641  GLN A HA   3  
ATOM 4665  H HB2  . GLN A 1 85 ? 6.307   -17.952 -0.307  1.00 0.00 ?  641  GLN A HB2  3  
ATOM 4666  H HB3  . GLN A 1 85 ? 6.344   -18.390 1.395   1.00 0.00 ?  641  GLN A HB3  3  
ATOM 4667  H HG2  . GLN A 1 85 ? 4.111   -19.408 1.135   1.00 0.00 ?  641  GLN A HG2  3  
ATOM 4668  H HG3  . GLN A 1 85 ? 4.191   -19.058 -0.591  1.00 0.00 ?  641  GLN A HG3  3  
ATOM 4669  H HE21 . GLN A 1 85 ? 3.965   -21.543 0.791   1.00 0.00 ?  641  GLN A HE21 3  
ATOM 4670  H HE22 . GLN A 1 85 ? 5.275   -22.548 0.307   1.00 0.00 ?  641  GLN A HE22 3  
ATOM 4671  N N    . ARG A 1 86 ? 2.980   -17.390 2.216   1.00 0.00 ?  642  ARG A N    3  
ATOM 4672  C CA   . ARG A 1 86 ? 2.234   -17.569 3.445   1.00 0.00 ?  642  ARG A CA   3  
ATOM 4673  C C    . ARG A 1 86 ? 2.318   -19.012 3.912   1.00 0.00 ?  642  ARG A C    3  
ATOM 4674  O O    . ARG A 1 86 ? 2.804   -19.886 3.190   1.00 0.00 ?  642  ARG A O    3  
ATOM 4675  C CB   . ARG A 1 86 ? 0.750   -17.190 3.313   1.00 0.00 ?  642  ARG A CB   3  
ATOM 4676  C CG   . ARG A 1 86 ? -0.059  -18.063 2.359   1.00 0.00 ?  642  ARG A CG   3  
ATOM 4677  C CD   . ARG A 1 86 ? -1.523  -18.091 2.773   1.00 0.00 ?  642  ARG A CD   3  
ATOM 4678  N NE   . ARG A 1 86 ? -1.683  -18.756 4.086   1.00 0.00 ?  642  ARG A NE   3  
ATOM 4679  C CZ   . ARG A 1 86 ? -2.675  -18.559 4.964   1.00 0.00 ?  642  ARG A CZ   3  
ATOM 4680  N NH1  . ARG A 1 86 ? -3.694  -17.744 4.679   1.00 0.00 1  642  ARG A NH1  3  
ATOM 4681  N NH2  . ARG A 1 86 ? -2.643  -19.199 6.127   1.00 0.00 ?  642  ARG A NH2  3  
ATOM 4682  H H    . ARG A 1 86 ? 2.564   -17.620 1.356   1.00 0.00 ?  642  ARG A H    3  
ATOM 4683  H HA   . ARG A 1 86 ? 2.690   -16.938 4.195   1.00 0.00 ?  642  ARG A HA   3  
ATOM 4684  H HB2  . ARG A 1 86 ? 0.286   -17.252 4.288   1.00 0.00 ?  642  ARG A HB2  3  
ATOM 4685  H HB3  . ARG A 1 86 ? 0.692   -16.169 2.966   1.00 0.00 ?  642  ARG A HB3  3  
ATOM 4686  H HG2  . ARG A 1 86 ? 0.017   -17.667 1.358   1.00 0.00 ?  642  ARG A HG2  3  
ATOM 4687  H HG3  . ARG A 1 86 ? 0.332   -19.070 2.383   1.00 0.00 ?  642  ARG A HG3  3  
ATOM 4688  H HD2  . ARG A 1 86 ? -1.889  -17.078 2.840   1.00 0.00 ?  642  ARG A HD2  3  
ATOM 4689  H HD3  . ARG A 1 86 ? -2.095  -18.634 2.035   1.00 0.00 ?  642  ARG A HD3  3  
ATOM 4690  H HE   . ARG A 1 86 ? -0.974  -19.401 4.311   1.00 0.00 ?  642  ARG A HE   3  
ATOM 4691  H HH11 . ARG A 1 86 ? -3.770  -17.251 3.807   1.00 0.00 ?  642  ARG A HH11 3  
ATOM 4692  H HH12 . ARG A 1 86 ? -4.442  -17.580 5.329   1.00 0.00 ?  642  ARG A HH12 3  
ATOM 4693  H HH21 . ARG A 1 86 ? -1.881  -19.828 6.360   1.00 0.00 ?  642  ARG A HH21 3  
ATOM 4694  H HH22 . ARG A 1 86 ? -3.356  -19.106 6.827   1.00 0.00 ?  642  ARG A HH22 3  
ATOM 4695  N N    . LYS A 1 87 ? 1.827   -19.251 5.100   1.00 0.00 ?  643  LYS A N    3  
ATOM 4696  C CA   . LYS A 1 87 ? 1.749   -20.569 5.656   1.00 0.00 ?  643  LYS A CA   3  
ATOM 4697  C C    . LYS A 1 87 ? 0.761   -20.513 6.792   1.00 0.00 ?  643  LYS A C    3  
ATOM 4698  O O    . LYS A 1 87 ? -0.433  -20.662 6.541   1.00 0.00 ?  643  LYS A O    3  
ATOM 4699  C CB   . LYS A 1 87 ? 3.128   -21.075 6.142   1.00 0.00 ?  643  LYS A CB   3  
ATOM 4700  C CG   . LYS A 1 87 ? 3.126   -22.527 6.594   1.00 0.00 ?  643  LYS A CG   3  
ATOM 4701  C CD   . LYS A 1 87 ? 4.504   -22.977 7.052   1.00 0.00 ?  643  LYS A CD   3  
ATOM 4702  C CE   . LYS A 1 87 ? 4.502   -24.444 7.467   1.00 0.00 ?  643  LYS A CE   3  
ATOM 4703  N NZ   . LYS A 1 87 ? 4.154   -25.345 6.347   1.00 0.00 1  643  LYS A NZ   3  
ATOM 4704  O OXT  . LYS A 1 87 ? 1.164   -20.240 7.938   1.00 0.00 ?  643  LYS A OXT  3  
ATOM 4705  H H    . LYS A 1 87 ? 1.481   -18.510 5.643   1.00 0.00 ?  643  LYS A H    3  
ATOM 4706  H HA   . LYS A 1 87 ? 1.361   -21.227 4.892   1.00 0.00 ?  643  LYS A HA   3  
ATOM 4707  H HB2  . LYS A 1 87 ? 3.839   -20.976 5.337   1.00 0.00 ?  643  LYS A HB2  3  
ATOM 4708  H HB3  . LYS A 1 87 ? 3.450   -20.463 6.971   1.00 0.00 ?  643  LYS A HB3  3  
ATOM 4709  H HG2  . LYS A 1 87 ? 2.430   -22.641 7.412   1.00 0.00 ?  643  LYS A HG2  3  
ATOM 4710  H HG3  . LYS A 1 87 ? 2.811   -23.144 5.767   1.00 0.00 ?  643  LYS A HG3  3  
ATOM 4711  H HD2  . LYS A 1 87 ? 5.205   -22.847 6.240   1.00 0.00 ?  643  LYS A HD2  3  
ATOM 4712  H HD3  . LYS A 1 87 ? 4.811   -22.375 7.894   1.00 0.00 ?  643  LYS A HD3  3  
ATOM 4713  H HE2  . LYS A 1 87 ? 5.484   -24.704 7.830   1.00 0.00 ?  643  LYS A HE2  3  
ATOM 4714  H HE3  . LYS A 1 87 ? 3.783   -24.578 8.261   1.00 0.00 ?  643  LYS A HE3  3  
ATOM 4715  H HZ1  . LYS A 1 87 ? 3.214   -25.136 5.956   1.00 0.00 ?  643  LYS A HZ1  3  
ATOM 4716  H HZ2  . LYS A 1 87 ? 4.136   -26.338 6.656   1.00 0.00 ?  643  LYS A HZ2  3  
ATOM 4717  H HZ3  . LYS A 1 87 ? 4.843   -25.280 5.570   1.00 0.00 ?  643  LYS A HZ3  3  
ATOM 4718  N N    . ARG B 2 1  ? -1.248  11.522  -17.979 1.00 0.00 ?  1591 ARG B N    3  
ATOM 4719  C CA   . ARG B 2 1  ? -1.030  10.528  -16.933 1.00 0.00 ?  1591 ARG B CA   3  
ATOM 4720  C C    . ARG B 2 1  ? -2.099  10.628  -15.876 1.00 0.00 ?  1591 ARG B C    3  
ATOM 4721  O O    . ARG B 2 1  ? -2.224  11.660  -15.201 1.00 0.00 ?  1591 ARG B O    3  
ATOM 4722  C CB   . ARG B 2 1  ? 0.346   10.700  -16.281 1.00 0.00 ?  1591 ARG B CB   3  
ATOM 4723  C CG   . ARG B 2 1  ? 1.515   10.392  -17.188 1.00 0.00 ?  1591 ARG B CG   3  
ATOM 4724  C CD   . ARG B 2 1  ? 2.825   10.562  -16.453 1.00 0.00 ?  1591 ARG B CD   3  
ATOM 4725  N NE   . ARG B 2 1  ? 3.972   10.203  -17.281 1.00 0.00 ?  1591 ARG B NE   3  
ATOM 4726  C CZ   . ARG B 2 1  ? 5.257   10.339  -16.926 1.00 0.00 ?  1591 ARG B CZ   3  
ATOM 4727  N NH1  . ARG B 2 1  ? 5.583   10.881  -15.752 1.00 0.00 1  1591 ARG B NH1  3  
ATOM 4728  N NH2  . ARG B 2 1  ? 6.209   9.954   -17.762 1.00 0.00 ?  1591 ARG B NH2  3  
ATOM 4729  H H1   . ARG B 2 1  ? -1.187  12.481  -17.582 1.00 0.00 ?  1591 ARG B H1   3  
ATOM 4730  H HA   . ARG B 2 1  ? -1.086  9.546   -17.379 1.00 0.00 ?  1591 ARG B HA   3  
ATOM 4731  H HB2  . ARG B 2 1  ? 0.439   11.723  -15.946 1.00 0.00 ?  1591 ARG B HB2  3  
ATOM 4732  H HB3  . ARG B 2 1  ? 0.401   10.050  -15.420 1.00 0.00 ?  1591 ARG B HB3  3  
ATOM 4733  H HG2  . ARG B 2 1  ? 1.430   9.371   -17.534 1.00 0.00 ?  1591 ARG B HG2  3  
ATOM 4734  H HG3  . ARG B 2 1  ? 1.499   11.060  -18.035 1.00 0.00 ?  1591 ARG B HG3  3  
ATOM 4735  H HD2  . ARG B 2 1  ? 2.927   11.590  -16.141 1.00 0.00 ?  1591 ARG B HD2  3  
ATOM 4736  H HD3  . ARG B 2 1  ? 2.812   9.921   -15.583 1.00 0.00 ?  1591 ARG B HD3  3  
ATOM 4737  H HE   . ARG B 2 1  ? 3.731   9.821   -18.156 1.00 0.00 ?  1591 ARG B HE   3  
ATOM 4738  H HH11 . ARG B 2 1  ? 4.888   11.197  -15.101 1.00 0.00 ?  1591 ARG B HH11 3  
ATOM 4739  H HH12 . ARG B 2 1  ? 6.538   11.017  -15.471 1.00 0.00 ?  1591 ARG B HH12 3  
ATOM 4740  H HH21 . ARG B 2 1  ? 5.984   9.576   -18.661 1.00 0.00 ?  1591 ARG B HH21 3  
ATOM 4741  H HH22 . ARG B 2 1  ? 7.184   10.006  -17.520 1.00 0.00 ?  1591 ARG B HH22 3  
ATOM 4742  N N    . SER B 2 2  ? -2.870  9.572   -15.735 1.00 0.00 ?  1592 SER B N    3  
ATOM 4743  C CA   . SER B 2 2  ? -3.896  9.505   -14.741 1.00 0.00 ?  1592 SER B CA   3  
ATOM 4744  C C    . SER B 2 2  ? -3.265  9.152   -13.399 1.00 0.00 ?  1592 SER B C    3  
ATOM 4745  O O    . SER B 2 2  ? -3.022  7.979   -13.116 1.00 0.00 ?  1592 SER B O    3  
ATOM 4746  C CB   . SER B 2 2  ? -4.914  8.432   -15.127 1.00 0.00 ?  1592 SER B CB   3  
ATOM 4747  O OG   . SER B 2 2  ? -5.447  8.665   -16.427 1.00 0.00 ?  1592 SER B OG   3  
ATOM 4748  H H    . SER B 2 2  ? -2.743  8.787   -16.312 1.00 0.00 ?  1592 SER B H    3  
ATOM 4749  H HA   . SER B 2 2  ? -4.395  10.462  -14.681 1.00 0.00 ?  1592 SER B HA   3  
ATOM 4750  H HB2  . SER B 2 2  ? -4.428  7.468   -15.125 1.00 0.00 ?  1592 SER B HB2  3  
ATOM 4751  H HB3  . SER B 2 2  ? -5.722  8.428   -14.410 1.00 0.00 ?  1592 SER B HB3  3  
ATOM 4752  H HG   . SER B 2 2  ? -5.713  9.592   -16.467 1.00 0.00 ?  1592 SER B HG   3  
ATOM 4753  N N    . VAL B 2 3  ? -2.954  10.151  -12.604 1.00 0.00 ?  1593 VAL B N    3  
ATOM 4754  C CA   . VAL B 2 3  ? -2.334  9.916   -11.313 1.00 0.00 ?  1593 VAL B CA   3  
ATOM 4755  C C    . VAL B 2 3  ? -3.361  9.463   -10.273 1.00 0.00 ?  1593 VAL B C    3  
ATOM 4756  O O    . VAL B 2 3  ? -3.919  10.250  -9.514  1.00 0.00 ?  1593 VAL B O    3  
ATOM 4757  C CB   . VAL B 2 3  ? -1.450  11.111  -10.812 1.00 0.00 ?  1593 VAL B CB   3  
ATOM 4758  C CG1  . VAL B 2 3  ? -0.207  11.241  -11.686 1.00 0.00 ?  1593 VAL B CG1  3  
ATOM 4759  C CG2  . VAL B 2 3  ? -2.221  12.433  -10.824 1.00 0.00 ?  1593 VAL B CG2  3  
ATOM 4760  H H    . VAL B 2 3  ? -3.160  11.069  -12.888 1.00 0.00 ?  1593 VAL B H    3  
ATOM 4761  H HA   . VAL B 2 3  ? -1.693  9.061   -11.474 1.00 0.00 ?  1593 VAL B HA   3  
ATOM 4762  H HB   . VAL B 2 3  ? -1.130  10.899  -9.802  1.00 0.00 ?  1593 VAL B HB   3  
ATOM 4763  H HG11 . VAL B 2 3  ? 0.395   12.065  -11.335 1.00 0.00 ?  1593 VAL B HG11 3  
ATOM 4764  H HG12 . VAL B 2 3  ? -0.503  11.426  -12.707 1.00 0.00 ?  1593 VAL B HG12 3  
ATOM 4765  H HG13 . VAL B 2 3  ? 0.370   10.329  -11.637 1.00 0.00 ?  1593 VAL B HG13 3  
ATOM 4766  H HG21 . VAL B 2 3  ? -3.087  12.346  -10.181 1.00 0.00 ?  1593 VAL B HG21 3  
ATOM 4767  H HG22 . VAL B 2 3  ? -2.540  12.654  -11.832 1.00 0.00 ?  1593 VAL B HG22 3  
ATOM 4768  H HG23 . VAL B 2 3  ? -1.582  13.225  -10.462 1.00 0.00 ?  1593 VAL B HG23 3  
ATOM 4769  N N    . LYS B 2 4  ? -3.654  8.191   -10.316 1.00 0.00 ?  1594 LYS B N    3  
ATOM 4770  C CA   . LYS B 2 4  ? -4.631  7.591   -9.448  1.00 0.00 ?  1594 LYS B CA   3  
ATOM 4771  C C    . LYS B 2 4  ? -4.094  6.308   -8.877  1.00 0.00 ?  1594 LYS B C    3  
ATOM 4772  O O    . LYS B 2 4  ? -3.384  5.541   -9.562  1.00 0.00 ?  1594 LYS B O    3  
ATOM 4773  C CB   . LYS B 2 4  ? -5.966  7.425   -10.197 1.00 0.00 ?  1594 LYS B CB   3  
ATOM 4774  C CG   . LYS B 2 4  ? -5.958  6.513   -11.408 1.00 0.00 ?  1594 LYS B CG   3  
ATOM 4775  C CD   . LYS B 2 4  ? -7.227  6.722   -12.220 1.00 0.00 ?  1594 LYS B CD   3  
ATOM 4776  C CE   . LYS B 2 4  ? -7.415  5.655   -13.276 1.00 0.00 ?  1594 LYS B CE   3  
ATOM 4777  N NZ   . LYS B 2 4  ? -7.669  4.328   -12.675 1.00 0.00 1  1594 LYS B NZ   3  
ATOM 4778  H H    . LYS B 2 4  ? -3.198  7.634   -10.984 1.00 0.00 ?  1594 LYS B H    3  
ATOM 4779  H HA   . LYS B 2 4  ? -4.794  8.198   -8.561  1.00 0.00 ?  1594 LYS B HA   3  
ATOM 4780  H HB2  . LYS B 2 4  ? -6.688  7.028   -9.499  1.00 0.00 ?  1594 LYS B HB2  3  
ATOM 4781  H HB3  . LYS B 2 4  ? -6.303  8.403   -10.508 1.00 0.00 ?  1594 LYS B HB3  3  
ATOM 4782  H HG2  . LYS B 2 4  ? -5.098  6.742   -12.019 1.00 0.00 ?  1594 LYS B HG2  3  
ATOM 4783  H HG3  . LYS B 2 4  ? -5.914  5.485   -11.081 1.00 0.00 ?  1594 LYS B HG3  3  
ATOM 4784  H HD2  . LYS B 2 4  ? -8.078  6.721   -11.559 1.00 0.00 ?  1594 LYS B HD2  3  
ATOM 4785  H HD3  . LYS B 2 4  ? -7.163  7.685   -12.704 1.00 0.00 ?  1594 LYS B HD3  3  
ATOM 4786  H HE2  . LYS B 2 4  ? -8.251  5.925   -13.904 1.00 0.00 ?  1594 LYS B HE2  3  
ATOM 4787  H HE3  . LYS B 2 4  ? -6.520  5.606   -13.876 1.00 0.00 ?  1594 LYS B HE3  3  
ATOM 4788  H HZ1  . LYS B 2 4  ? -7.876  3.628   -13.416 1.00 0.00 ?  1594 LYS B HZ1  3  
ATOM 4789  H HZ2  . LYS B 2 4  ? -8.477  4.350   -12.020 1.00 0.00 ?  1594 LYS B HZ2  3  
ATOM 4790  H HZ3  . LYS B 2 4  ? -6.837  3.991   -12.152 1.00 0.00 ?  1594 LYS B HZ3  3  
ATOM 4791  N N    . VAL B 2 5  ? -4.405  6.081   -7.630  1.00 0.00 ?  1595 VAL B N    3  
ATOM 4792  C CA   . VAL B 2 5  ? -3.802  5.014   -6.878  1.00 0.00 ?  1595 VAL B CA   3  
ATOM 4793  C C    . VAL B 2 5  ? -4.821  3.930   -6.525  1.00 0.00 ?  1595 VAL B C    3  
ATOM 4794  O O    . VAL B 2 5  ? -4.429  2.855   -6.055  1.00 0.00 ?  1595 VAL B O    3  
ATOM 4795  C CB   . VAL B 2 5  ? -3.053  5.560   -5.592  1.00 0.00 ?  1595 VAL B CB   3  
ATOM 4796  C CG1  . VAL B 2 5  ? -2.242  4.475   -4.878  1.00 0.00 ?  1595 VAL B CG1  3  
ATOM 4797  C CG2  . VAL B 2 5  ? -2.179  6.776   -5.938  1.00 0.00 ?  1595 VAL B CG2  3  
ATOM 4798  H H    . VAL B 2 5  ? -5.101  6.644   -7.218  1.00 0.00 ?  1595 VAL B H    3  
ATOM 4799  H HA   . VAL B 2 5  ? -3.062  4.563   -7.524  1.00 0.00 ?  1595 VAL B HA   3  
ATOM 4800  H HB   . VAL B 2 5  ? -3.757  5.870   -4.829  1.00 0.00 ?  1595 VAL B HB   3  
ATOM 4801  H HG11 . VAL B 2 5  ? -1.726  3.814   -5.557  1.00 0.00 ?  1595 VAL B HG11 3  
ATOM 4802  H HG12 . VAL B 2 5  ? -2.906  3.871   -4.281  1.00 0.00 ?  1595 VAL B HG12 3  
ATOM 4803  H HG13 . VAL B 2 5  ? -1.522  4.950   -4.229  1.00 0.00 ?  1595 VAL B HG13 3  
ATOM 4804  H HG21 . VAL B 2 5  ? -2.814  7.601   -6.239  1.00 0.00 ?  1595 VAL B HG21 3  
ATOM 4805  H HG22 . VAL B 2 5  ? -1.496  6.554   -6.760  1.00 0.00 ?  1595 VAL B HG22 3  
ATOM 4806  H HG23 . VAL B 2 5  ? -1.641  7.047   -5.038  1.00 0.00 ?  1595 VAL B HG23 3  
ATOM 4807  N N    . LYS B 2 6  ? -6.135  4.219   -6.776  1.00 0.00 ?  1596 LYS B N    3  
ATOM 4808  C CA   . LYS B 2 6  ? -7.229  3.235   -6.538  1.00 0.00 ?  1596 LYS B CA   3  
ATOM 4809  C C    . LYS B 2 6  ? -6.831  1.895   -7.153  1.00 0.00 ?  1596 LYS B C    3  
ATOM 4810  O O    . LYS B 2 6  ? -6.833  1.744   -8.389  1.00 0.00 ?  1596 LYS B O    3  
ATOM 4811  C CB   . LYS B 2 6  ? -8.537  3.714   -7.172  1.00 0.00 ?  1596 LYS B CB   3  
ATOM 4812  C CG   . LYS B 2 6  ? -9.191  4.981   -6.587  1.00 0.00 ?  1596 LYS B CG   3  
ATOM 4813  C CD   . LYS B 2 6  ? -9.959  4.724   -5.287  1.00 0.00 ?  1596 LYS B CD   3  
ATOM 4814  C CE   . LYS B 2 6  ? -10.971 5.828   -5.030  1.00 0.00 ?  1596 LYS B CE   3  
ATOM 4815  N NZ   . LYS B 2 6  ? -11.754 5.589   -3.790  1.00 0.00 1  1596 LYS B NZ   3  
ATOM 4816  H H    . LYS B 2 6  ? -6.372  5.108   -7.117  1.00 0.00 ?  1596 LYS B H    3  
ATOM 4817  H HA   . LYS B 2 6  ? -7.355  3.112   -5.472  1.00 0.00 ?  1596 LYS B HA   3  
ATOM 4818  H HB2  . LYS B 2 6  ? -8.331  3.906   -8.214  1.00 0.00 ?  1596 LYS B HB2  3  
ATOM 4819  H HB3  . LYS B 2 6  ? -9.251  2.905   -7.116  1.00 0.00 ?  1596 LYS B HB3  3  
ATOM 4820  H HG2  . LYS B 2 6  ? -8.420  5.710   -6.386  1.00 0.00 ?  1596 LYS B HG2  3  
ATOM 4821  H HG3  . LYS B 2 6  ? -9.873  5.384   -7.322  1.00 0.00 ?  1596 LYS B HG3  3  
ATOM 4822  H HD2  . LYS B 2 6  ? -10.520 3.809   -5.393  1.00 0.00 ?  1596 LYS B HD2  3  
ATOM 4823  H HD3  . LYS B 2 6  ? -9.352  4.626   -4.395  1.00 0.00 ?  1596 LYS B HD3  3  
ATOM 4824  H HE2  . LYS B 2 6  ? -10.443 6.766   -4.932  1.00 0.00 ?  1596 LYS B HE2  3  
ATOM 4825  H HE3  . LYS B 2 6  ? -11.646 5.879   -5.872  1.00 0.00 ?  1596 LYS B HE3  3  
ATOM 4826  H HZ1  . LYS B 2 6  ? -12.644 6.124   -3.796  1.00 0.00 ?  1596 LYS B HZ1  3  
ATOM 4827  H HZ2  . LYS B 2 6  ? -11.219 5.981   -2.983  1.00 0.00 ?  1596 LYS B HZ2  3  
ATOM 4828  H HZ3  . LYS B 2 6  ? -11.945 4.576   -3.616  1.00 0.00 ?  1596 LYS B HZ3  3  
ATOM 4829  N N    . ILE B 2 7  ? -6.436  0.943   -6.303  1.00 0.00 ?  1597 ILE B N    3  
ATOM 4830  C CA   . ILE B 2 7  ? -5.865  -0.267  -6.806  1.00 0.00 ?  1597 ILE B CA   3  
ATOM 4831  C C    . ILE B 2 7  ? -6.903  -1.200  -7.487  1.00 0.00 ?  1597 ILE B C    3  
ATOM 4832  O O    . ILE B 2 7  ? -6.818  -1.411  -8.690  1.00 0.00 ?  1597 ILE B O    3  
ATOM 4833  C CB   . ILE B 2 7  ? -4.934  -1.033  -5.778  1.00 0.00 ?  1597 ILE B CB   3  
ATOM 4834  C CG1  . ILE B 2 7  ? -3.702  -1.635  -6.476  1.00 0.00 ?  1597 ILE B CG1  3  
ATOM 4835  C CG2  . ILE B 2 7  ? -5.642  -2.078  -4.927  1.00 0.00 ?  1597 ILE B CG2  3  
ATOM 4836  C CD1  . ILE B 2 7  ? -3.921  -2.432  -7.753  1.00 0.00 ?  1597 ILE B CD1  3  
ATOM 4837  H H    . ILE B 2 7  ? -6.493  1.117   -5.345  1.00 0.00 ?  1597 ILE B H    3  
ATOM 4838  H HA   . ILE B 2 7  ? -5.219  0.137   -7.567  1.00 0.00 ?  1597 ILE B HA   3  
ATOM 4839  H HB   . ILE B 2 7  ? -4.540  -0.321  -5.064  1.00 0.00 ?  1597 ILE B HB   3  
ATOM 4840  H HG12 . ILE B 2 7  ? -3.009  -0.834  -6.683  1.00 0.00 ?  1597 ILE B HG12 3  
ATOM 4841  H HG13 . ILE B 2 7  ? -3.276  -2.266  -5.708  1.00 0.00 ?  1597 ILE B HG13 3  
ATOM 4842  H HG21 . ILE B 2 7  ? -6.207  -2.748  -5.559  1.00 0.00 ?  1597 ILE B HG21 3  
ATOM 4843  H HG22 . ILE B 2 7  ? -6.305  -1.581  -4.230  1.00 0.00 ?  1597 ILE B HG22 3  
ATOM 4844  H HG23 . ILE B 2 7  ? -4.936  -2.654  -4.349  1.00 0.00 ?  1597 ILE B HG23 3  
ATOM 4845  H HD11 . ILE B 2 7  ? -4.302  -1.775  -8.522  1.00 0.00 ?  1597 ILE B HD11 3  
ATOM 4846  H HD12 . ILE B 2 7  ? -4.647  -3.212  -7.583  1.00 0.00 ?  1597 ILE B HD12 3  
ATOM 4847  H HD13 . ILE B 2 7  ? -2.988  -2.866  -8.082  1.00 0.00 ?  1597 ILE B HD13 3  
ATOM 4848  N N    . LYS B 2 8  ? -7.893  -1.699  -6.718  1.00 0.00 ?  1598 LYS B N    3  
ATOM 4849  C CA   . LYS B 2 8  ? -8.857  -2.687  -7.186  1.00 0.00 ?  1598 LYS B CA   3  
ATOM 4850  C C    . LYS B 2 8  ? -8.123  -3.904  -7.796  1.00 0.00 ?  1598 LYS B C    3  
ATOM 4851  O O    . LYS B 2 8  ? -7.958  -3.985  -9.015  1.00 0.00 ?  1598 LYS B O    3  
ATOM 4852  C CB   . LYS B 2 8  ? -9.864  -2.075  -8.195  1.00 0.00 ?  1598 LYS B CB   3  
ATOM 4853  C CG   . LYS B 2 8  ? -10.789 -0.951  -7.665  1.00 0.00 ?  1598 LYS B CG   3  
ATOM 4854  C CD   . LYS B 2 8  ? -11.831 -1.465  -6.739  1.00 0.00 ?  1598 LYS B CD   3  
ATOM 4855  C CE   . LYS B 2 8  ? -12.988 -0.529  -6.617  1.00 0.00 ?  1598 LYS B CE   3  
ATOM 4856  N NZ   . LYS B 2 8  ? -13.888 -0.570  -7.802  1.00 0.00 1  1598 LYS B NZ   3  
ATOM 4857  H H    . LYS B 2 8  ? -7.974  -1.404  -5.791  1.00 0.00 ?  1598 LYS B H    3  
ATOM 4858  H HA   . LYS B 2 8  ? -9.384  -3.075  -6.323  1.00 0.00 ?  1598 LYS B HA   3  
ATOM 4859  H HB2  . LYS B 2 8  ? -9.301  -1.666  -9.020  1.00 0.00 ?  1598 LYS B HB2  3  
ATOM 4860  H HB3  . LYS B 2 8  ? -10.487 -2.873  -8.574  1.00 0.00 ?  1598 LYS B HB3  3  
ATOM 4861  H HG2  . LYS B 2 8  ? -10.229 -0.300  -6.998  1.00 0.00 ?  1598 LYS B HG2  3  
ATOM 4862  H HG3  . LYS B 2 8  ? -11.258 -0.405  -8.467  1.00 0.00 ?  1598 LYS B HG3  3  
ATOM 4863  H HD2  . LYS B 2 8  ? -12.156 -2.473  -6.923  1.00 0.00 ?  1598 LYS B HD2  3  
ATOM 4864  H HD3  . LYS B 2 8  ? -11.334 -1.377  -5.791  1.00 0.00 ?  1598 LYS B HD3  3  
ATOM 4865  H HE2  . LYS B 2 8  ? -13.449 -0.728  -5.658  1.00 0.00 ?  1598 LYS B HE2  3  
ATOM 4866  H HE3  . LYS B 2 8  ? -12.512 0.437   -6.543  1.00 0.00 ?  1598 LYS B HE3  3  
ATOM 4867  H HZ1  . LYS B 2 8  ? -14.684 0.091   -7.700  1.00 0.00 ?  1598 LYS B HZ1  3  
ATOM 4868  H HZ2  . LYS B 2 8  ? -14.298 -1.518  -7.927  1.00 0.00 ?  1598 LYS B HZ2  3  
ATOM 4869  H HZ3  . LYS B 2 8  ? -13.381 -0.324  -8.675  1.00 0.00 ?  1598 LYS B HZ3  3  
ATOM 4870  N N    . LEU B 2 9  ? -7.597  -4.805  -6.938  1.00 0.00 ?  1599 LEU B N    3  
ATOM 4871  C CA   . LEU B 2 9  ? -6.937  -6.017  -7.451  1.00 0.00 ?  1599 LEU B CA   3  
ATOM 4872  C C    . LEU B 2 9  ? -7.929  -6.877  -8.217  1.00 0.00 ?  1599 LEU B C    3  
ATOM 4873  O O    . LEU B 2 9  ? -7.585  -7.498  -9.218  1.00 0.00 ?  1599 LEU B O    3  
ATOM 4874  C CB   . LEU B 2 9  ? -6.194  -6.865  -6.369  1.00 0.00 ?  1599 LEU B CB   3  
ATOM 4875  C CG   . LEU B 2 9  ? -4.683  -6.637  -6.200  1.00 0.00 ?  1599 LEU B CG   3  
ATOM 4876  C CD1  . LEU B 2 9  ? -3.909  -7.005  -7.447  1.00 0.00 ?  1599 LEU B CD1  3  
ATOM 4877  C CD2  . LEU B 2 9  ? -4.394  -5.239  -5.832  1.00 0.00 ?  1599 LEU B CD2  3  
ATOM 4878  H H    . LEU B 2 9  ? -7.672  -4.641  -5.975  1.00 0.00 ?  1599 LEU B H    3  
ATOM 4879  H HA   . LEU B 2 9  ? -6.203  -5.633  -8.147  1.00 0.00 ?  1599 LEU B HA   3  
ATOM 4880  H HB2  . LEU B 2 9  ? -6.609  -6.751  -5.384  1.00 0.00 ?  1599 LEU B HB2  3  
ATOM 4881  H HB3  . LEU B 2 9  ? -6.338  -7.901  -6.628  1.00 0.00 ?  1599 LEU B HB3  3  
ATOM 4882  H HG   . LEU B 2 9  ? -4.367  -7.251  -5.363  1.00 0.00 ?  1599 LEU B HG   3  
ATOM 4883  H HD11 . LEU B 2 9  ? -2.851  -6.867  -7.272  1.00 0.00 ?  1599 LEU B HD11 3  
ATOM 4884  H HD12 . LEU B 2 9  ? -4.220  -6.376  -8.267  1.00 0.00 ?  1599 LEU B HD12 3  
ATOM 4885  H HD13 . LEU B 2 9  ? -4.100  -8.038  -7.694  1.00 0.00 ?  1599 LEU B HD13 3  
ATOM 4886  H HD21 . LEU B 2 9  ? -3.367  -4.999  -6.064  1.00 0.00 ?  1599 LEU B HD21 3  
ATOM 4887  H HD22 . LEU B 2 9  ? -4.496  -5.195  -4.757  1.00 0.00 ?  1599 LEU B HD22 3  
ATOM 4888  H HD23 . LEU B 2 9  ? -5.081  -4.557  -6.306  1.00 0.00 ?  1599 LEU B HD23 3  
ATOM 4889  N N    . GLY B 2 10 ? -9.160  -6.894  -7.748  1.00 0.00 ?  1600 GLY B N    3  
ATOM 4890  C CA   . GLY B 2 10 ? -10.209 -7.590  -8.444  1.00 0.00 ?  1600 GLY B CA   3  
ATOM 4891  C C    . GLY B 2 10 ? -10.906 -6.623  -9.366  1.00 0.00 ?  1600 GLY B C    3  
ATOM 4892  O O    . GLY B 2 10 ? -11.565 -5.685  -8.907  1.00 0.00 ?  1600 GLY B O    3  
ATOM 4893  H H    . GLY B 2 10 ? -9.376  -6.402  -6.929  1.00 0.00 ?  1600 GLY B H    3  
ATOM 4894  H HA2  . GLY B 2 10 ? -9.780  -8.400  -9.017  1.00 0.00 ?  1600 GLY B HA2  3  
ATOM 4895  H HA3  . GLY B 2 10 ? -10.927 -7.979  -7.737  1.00 0.00 ?  1600 GLY B HA3  3  
ATOM 4896  N N    . ARG B 2 11 ? -10.751 -6.811  -10.638 1.00 0.00 ?  1601 ARG B N    3  
ATOM 4897  C CA   . ARG B 2 11 ? -11.290 -5.881  -11.601 1.00 0.00 ?  1601 ARG B CA   3  
ATOM 4898  C C    . ARG B 2 11 ? -12.709 -6.226  -12.013 1.00 0.00 ?  1601 ARG B C    3  
ATOM 4899  O O    . ARG B 2 11 ? -12.940 -7.141  -12.812 1.00 0.00 ?  1601 ARG B O    3  
ATOM 4900  C CB   . ARG B 2 11 ? -10.349 -5.738  -12.805 1.00 0.00 ?  1601 ARG B CB   3  
ATOM 4901  C CG   . ARG B 2 11 ? -9.031  -5.052  -12.454 1.00 0.00 ?  1601 ARG B CG   3  
ATOM 4902  C CD   . ARG B 2 11 ? -9.239  -3.567  -12.169 1.00 0.00 ?  1601 ARG B CD   3  
ATOM 4903  N NE   . ARG B 2 11 ? -8.075  -2.938  -11.541 1.00 0.00 ?  1601 ARG B NE   3  
ATOM 4904  C CZ   . ARG B 2 11 ? -7.247  -2.064  -12.124 1.00 0.00 ?  1601 ARG B CZ   3  
ATOM 4905  N NH1  . ARG B 2 11 ? -7.257  -1.900  -13.438 1.00 0.00 1  1601 ARG B NH1  3  
ATOM 4906  N NH2  . ARG B 2 11 ? -6.387  -1.380  -11.382 1.00 0.00 ?  1601 ARG B NH2  3  
ATOM 4907  H H    . ARG B 2 11 ? -10.276 -7.612  -10.951 1.00 0.00 ?  1601 ARG B H    3  
ATOM 4908  H HA   . ARG B 2 11 ? -11.337 -4.925  -11.099 1.00 0.00 ?  1601 ARG B HA   3  
ATOM 4909  H HB2  . ARG B 2 11 ? -10.130 -6.721  -13.197 1.00 0.00 ?  1601 ARG B HB2  3  
ATOM 4910  H HB3  . ARG B 2 11 ? -10.845 -5.158  -13.568 1.00 0.00 ?  1601 ARG B HB3  3  
ATOM 4911  H HG2  . ARG B 2 11 ? -8.615  -5.523  -11.576 1.00 0.00 ?  1601 ARG B HG2  3  
ATOM 4912  H HG3  . ARG B 2 11 ? -8.343  -5.159  -13.279 1.00 0.00 ?  1601 ARG B HG3  3  
ATOM 4913  H HD2  . ARG B 2 11 ? -9.432  -3.055  -13.100 1.00 0.00 ?  1601 ARG B HD2  3  
ATOM 4914  H HD3  . ARG B 2 11 ? -10.090 -3.446  -11.515 1.00 0.00 ?  1601 ARG B HD3  3  
ATOM 4915  H HE   . ARG B 2 11 ? -7.994  -3.159  -10.580 1.00 0.00 ?  1601 ARG B HE   3  
ATOM 4916  H HH11 . ARG B 2 11 ? -7.878  -2.409  -14.043 1.00 0.00 ?  1601 ARG B HH11 3  
ATOM 4917  H HH12 . ARG B 2 11 ? -6.636  -1.267  -13.905 1.00 0.00 ?  1601 ARG B HH12 3  
ATOM 4918  H HH21 . ARG B 2 11 ? -6.361  -1.507  -10.383 1.00 0.00 ?  1601 ARG B HH21 3  
ATOM 4919  H HH22 . ARG B 2 11 ? -5.741  -0.699  -11.738 1.00 0.00 ?  1601 ARG B HH22 3  
ATOM 4920  N N    . LYS B 2 12 ? -13.647 -5.520  -11.419 1.00 0.00 ?  1602 LYS B N    3  
ATOM 4921  C CA   . LYS B 2 12 ? -15.063 -5.637  -11.738 1.00 0.00 ?  1602 LYS B CA   3  
ATOM 4922  C C    . LYS B 2 12 ? -15.710 -4.279  -11.517 1.00 0.00 ?  1602 LYS B C    3  
ATOM 4923  O O    . LYS B 2 12 ? -15.151 -3.457  -10.759 1.00 0.00 ?  1602 LYS B O    3  
ATOM 4924  C CB   . LYS B 2 12 ? -15.803 -6.710  -10.878 1.00 0.00 ?  1602 LYS B CB   3  
ATOM 4925  C CG   . LYS B 2 12 ? -15.924 -6.393  -9.384  1.00 0.00 ?  1602 LYS B CG   3  
ATOM 4926  C CD   . LYS B 2 12 ? -14.647 -6.666  -8.614  1.00 0.00 ?  1602 LYS B CD   3  
ATOM 4927  C CE   . LYS B 2 12 ? -14.681 -6.030  -7.231  1.00 0.00 ?  1602 LYS B CE   3  
ATOM 4928  N NZ   . LYS B 2 12 ? -15.877 -6.404  -6.437  1.00 0.00 1  1602 LYS B NZ   3  
ATOM 4929  H H    . LYS B 2 12 ? -13.398 -4.854  -10.741 1.00 0.00 ?  1602 LYS B H    3  
ATOM 4930  H HA   . LYS B 2 12 ? -15.137 -5.890  -12.784 1.00 0.00 ?  1602 LYS B HA   3  
ATOM 4931  H HB2  . LYS B 2 12 ? -16.800 -6.836  -11.270 1.00 0.00 ?  1602 LYS B HB2  3  
ATOM 4932  H HB3  . LYS B 2 12 ? -15.275 -7.648  -10.982 1.00 0.00 ?  1602 LYS B HB3  3  
ATOM 4933  H HG2  . LYS B 2 12 ? -16.166 -5.345  -9.275  1.00 0.00 ?  1602 LYS B HG2  3  
ATOM 4934  H HG3  . LYS B 2 12 ? -16.724 -6.988  -8.969  1.00 0.00 ?  1602 LYS B HG3  3  
ATOM 4935  H HD2  . LYS B 2 12 ? -14.524 -7.733  -8.510  1.00 0.00 ?  1602 LYS B HD2  3  
ATOM 4936  H HD3  . LYS B 2 12 ? -13.814 -6.261  -9.170  1.00 0.00 ?  1602 LYS B HD3  3  
ATOM 4937  H HE2  . LYS B 2 12 ? -13.802 -6.347  -6.694  1.00 0.00 ?  1602 LYS B HE2  3  
ATOM 4938  H HE3  . LYS B 2 12 ? -14.646 -4.957  -7.343  1.00 0.00 ?  1602 LYS B HE3  3  
ATOM 4939  H HZ1  . LYS B 2 12 ? -15.887 -7.406  -6.167  1.00 0.00 ?  1602 LYS B HZ1  3  
ATOM 4940  H HZ2  . LYS B 2 12 ? -16.748 -6.213  -6.977  1.00 0.00 ?  1602 LYS B HZ2  3  
ATOM 4941  H HZ3  . LYS B 2 12 ? -15.929 -5.814  -5.580  1.00 0.00 ?  1602 LYS B HZ3  3  
ATOM 4942  N N    . ALA A 1 1  ? 13.765  -7.344  19.105  1.00 0.00 ?  557  ALA A N    4  
ATOM 4943  C CA   . ALA A 1 1  ? 12.577  -7.106  19.902  1.00 0.00 ?  557  ALA A CA   4  
ATOM 4944  C C    . ALA A 1 1  ? 12.113  -5.664  19.762  1.00 0.00 ?  557  ALA A C    4  
ATOM 4945  O O    . ALA A 1 1  ? 10.949  -5.356  19.972  1.00 0.00 ?  557  ALA A O    4  
ATOM 4946  C CB   . ALA A 1 1  ? 12.840  -7.447  21.362  1.00 0.00 ?  557  ALA A CB   4  
ATOM 4947  H H1   . ALA A 1 1  ? 14.635  -7.072  19.481  1.00 0.00 ?  557  ALA A H1   4  
ATOM 4948  H HA   . ALA A 1 1  ? 11.794  -7.752  19.536  1.00 0.00 ?  557  ALA A HA   4  
ATOM 4949  H HB1  . ALA A 1 1  ? 13.602  -6.789  21.755  1.00 0.00 ?  557  ALA A HB1  4  
ATOM 4950  H HB2  . ALA A 1 1  ? 13.178  -8.470  21.435  1.00 0.00 ?  557  ALA A HB2  4  
ATOM 4951  H HB3  . ALA A 1 1  ? 11.932  -7.328  21.933  1.00 0.00 ?  557  ALA A HB3  4  
ATOM 4952  N N    . SER A 1 2  ? 13.022  -4.789  19.423  1.00 0.00 ?  558  SER A N    4  
ATOM 4953  C CA   . SER A 1 2  ? 12.705  -3.391  19.257  1.00 0.00 ?  558  SER A CA   4  
ATOM 4954  C C    . SER A 1 2  ? 12.201  -3.137  17.834  1.00 0.00 ?  558  SER A C    4  
ATOM 4955  O O    . SER A 1 2  ? 11.217  -2.436  17.628  1.00 0.00 ?  558  SER A O    4  
ATOM 4956  C CB   . SER A 1 2  ? 13.951  -2.541  19.532  1.00 0.00 ?  558  SER A CB   4  
ATOM 4957  O OG   . SER A 1 2  ? 14.523  -2.856  20.805  1.00 0.00 ?  558  SER A OG   4  
ATOM 4958  H H    . SER A 1 2  ? 13.944  -5.098  19.273  1.00 0.00 ?  558  SER A H    4  
ATOM 4959  H HA   . SER A 1 2  ? 11.936  -3.126  19.965  1.00 0.00 ?  558  SER A HA   4  
ATOM 4960  H HB2  . SER A 1 2  ? 14.689  -2.728  18.764  1.00 0.00 ?  558  SER A HB2  4  
ATOM 4961  H HB3  . SER A 1 2  ? 13.681  -1.496  19.523  1.00 0.00 ?  558  SER A HB3  4  
ATOM 4962  H HG   . SER A 1 2  ? 13.805  -2.981  21.439  1.00 0.00 ?  558  SER A HG   4  
ATOM 4963  N N    . ALA A 1 3  ? 12.859  -3.777  16.873  1.00 0.00 ?  559  ALA A N    4  
ATOM 4964  C CA   . ALA A 1 3  ? 12.592  -3.592  15.443  1.00 0.00 ?  559  ALA A CA   4  
ATOM 4965  C C    . ALA A 1 3  ? 11.201  -4.058  15.031  1.00 0.00 ?  559  ALA A C    4  
ATOM 4966  O O    . ALA A 1 3  ? 10.639  -3.558  14.049  1.00 0.00 ?  559  ALA A O    4  
ATOM 4967  C CB   . ALA A 1 3  ? 13.658  -4.284  14.608  1.00 0.00 ?  559  ALA A CB   4  
ATOM 4968  H H    . ALA A 1 3  ? 13.564  -4.410  17.135  1.00 0.00 ?  559  ALA A H    4  
ATOM 4969  H HA   . ALA A 1 3  ? 12.661  -2.532  15.249  1.00 0.00 ?  559  ALA A HA   4  
ATOM 4970  H HB1  . ALA A 1 3  ? 13.592  -5.353  14.750  1.00 0.00 ?  559  ALA A HB1  4  
ATOM 4971  H HB2  . ALA A 1 3  ? 14.636  -3.939  14.909  1.00 0.00 ?  559  ALA A HB2  4  
ATOM 4972  H HB3  . ALA A 1 3  ? 13.500  -4.052  13.565  1.00 0.00 ?  559  ALA A HB3  4  
ATOM 4973  N N    . SER A 1 4  ? 10.648  -5.005  15.773  1.00 0.00 ?  560  SER A N    4  
ATOM 4974  C CA   . SER A 1 4  ? 9.332   -5.531  15.486  1.00 0.00 ?  560  SER A CA   4  
ATOM 4975  C C    . SER A 1 4  ? 8.215   -4.519  15.834  1.00 0.00 ?  560  SER A C    4  
ATOM 4976  O O    . SER A 1 4  ? 7.058   -4.673  15.412  1.00 0.00 ?  560  SER A O    4  
ATOM 4977  C CB   . SER A 1 4  ? 9.156   -6.885  16.186  1.00 0.00 ?  560  SER A CB   4  
ATOM 4978  O OG   . SER A 1 4  ? 9.705   -6.861  17.506  1.00 0.00 ?  560  SER A OG   4  
ATOM 4979  H H    . SER A 1 4  ? 11.120  -5.370  16.549  1.00 0.00 ?  560  SER A H    4  
ATOM 4980  H HA   . SER A 1 4  ? 9.294   -5.692  14.419  1.00 0.00 ?  560  SER A HA   4  
ATOM 4981  H HB2  . SER A 1 4  ? 8.103   -7.117  16.251  1.00 0.00 ?  560  SER A HB2  4  
ATOM 4982  H HB3  . SER A 1 4  ? 9.658   -7.652  15.614  1.00 0.00 ?  560  SER A HB3  4  
ATOM 4983  H HG   . SER A 1 4  ? 10.195  -7.684  17.628  1.00 0.00 ?  560  SER A HG   4  
ATOM 4984  N N    . TYR A 1 5  ? 8.578   -3.483  16.569  1.00 0.00 ?  561  TYR A N    4  
ATOM 4985  C CA   . TYR A 1 5  ? 7.671   -2.403  16.916  1.00 0.00 ?  561  TYR A CA   4  
ATOM 4986  C C    . TYR A 1 5  ? 8.182   -1.153  16.254  1.00 0.00 ?  561  TYR A C    4  
ATOM 4987  O O    . TYR A 1 5  ? 9.207   -1.189  15.561  1.00 0.00 ?  561  TYR A O    4  
ATOM 4988  C CB   . TYR A 1 5  ? 7.661   -2.155  18.432  1.00 0.00 ?  561  TYR A CB   4  
ATOM 4989  C CG   . TYR A 1 5  ? 7.157   -3.290  19.274  1.00 0.00 ?  561  TYR A CG   4  
ATOM 4990  C CD1  . TYR A 1 5  ? 8.014   -4.273  19.730  1.00 0.00 ?  561  TYR A CD1  4  
ATOM 4991  C CD2  . TYR A 1 5  ? 5.826   -3.366  19.628  1.00 0.00 ?  561  TYR A CD2  4  
ATOM 4992  C CE1  . TYR A 1 5  ? 7.559   -5.305  20.514  1.00 0.00 ?  561  TYR A CE1  4  
ATOM 4993  C CE2  . TYR A 1 5  ? 5.361   -4.393  20.411  1.00 0.00 ?  561  TYR A CE2  4  
ATOM 4994  C CZ   . TYR A 1 5  ? 6.231   -5.364  20.852  1.00 0.00 ?  561  TYR A CZ   4  
ATOM 4995  O OH   . TYR A 1 5  ? 5.766   -6.403  21.642  1.00 0.00 ?  561  TYR A OH   4  
ATOM 4996  H H    . TYR A 1 5  ? 9.511   -3.404  16.867  1.00 0.00 ?  561  TYR A H    4  
ATOM 4997  H HA   . TYR A 1 5  ? 6.674   -2.637  16.574  1.00 0.00 ?  561  TYR A HA   4  
ATOM 4998  H HB2  . TYR A 1 5  ? 8.668   -1.939  18.757  1.00 0.00 ?  561  TYR A HB2  4  
ATOM 4999  H HB3  . TYR A 1 5  ? 7.043   -1.291  18.634  1.00 0.00 ?  561  TYR A HB3  4  
ATOM 5000  H HD1  . TYR A 1 5  ? 9.059   -4.225  19.461  1.00 0.00 ?  561  TYR A HD1  4  
ATOM 5001  H HD2  . TYR A 1 5  ? 5.144   -2.603  19.281  1.00 0.00 ?  561  TYR A HD2  4  
ATOM 5002  H HE1  . TYR A 1 5  ? 8.251   -6.059  20.860  1.00 0.00 ?  561  TYR A HE1  4  
ATOM 5003  H HE2  . TYR A 1 5  ? 4.315   -4.431  20.671  1.00 0.00 ?  561  TYR A HE2  4  
ATOM 5004  H HH   . TYR A 1 5  ? 6.427   -6.591  22.323  1.00 0.00 ?  561  TYR A HH   4  
ATOM 5005  N N    . ASP A 1 6  ? 7.499   -0.062  16.432  1.00 0.00 ?  562  ASP A N    4  
ATOM 5006  C CA   . ASP A 1 6  ? 8.030   1.198   15.979  1.00 0.00 ?  562  ASP A CA   4  
ATOM 5007  C C    . ASP A 1 6  ? 8.926   1.801   17.048  1.00 0.00 ?  562  ASP A C    4  
ATOM 5008  O O    . ASP A 1 6  ? 8.523   2.648   17.838  1.00 0.00 ?  562  ASP A O    4  
ATOM 5009  C CB   . ASP A 1 6  ? 6.967   2.195   15.415  1.00 0.00 ?  562  ASP A CB   4  
ATOM 5010  C CG   . ASP A 1 6  ? 5.752   2.450   16.301  1.00 0.00 ?  562  ASP A CG   4  
ATOM 5011  O OD1  . ASP A 1 6  ? 5.828   3.236   17.270  1.00 0.00 ?  562  ASP A OD1  4  
ATOM 5012  O OD2  . ASP A 1 6  ? 4.670   1.900   16.007  1.00 0.00 -1 562  ASP A OD2  4  
ATOM 5013  H H    . ASP A 1 6  ? 6.622   -0.104  16.871  1.00 0.00 ?  562  ASP A H    4  
ATOM 5014  H HA   . ASP A 1 6  ? 8.707   0.919   15.181  1.00 0.00 ?  562  ASP A HA   4  
ATOM 5015  H HB2  . ASP A 1 6  ? 7.445   3.148   15.246  1.00 0.00 ?  562  ASP A HB2  4  
ATOM 5016  H HB3  . ASP A 1 6  ? 6.620   1.819   14.462  1.00 0.00 ?  562  ASP A HB3  4  
ATOM 5017  N N    . SER A 1 7  ? 10.138  1.265   17.110  1.00 0.00 ?  563  SER A N    4  
ATOM 5018  C CA   . SER A 1 7  ? 11.155  1.676   18.060  1.00 0.00 ?  563  SER A CA   4  
ATOM 5019  C C    . SER A 1 7  ? 11.541  3.132   17.830  1.00 0.00 ?  563  SER A C    4  
ATOM 5020  O O    . SER A 1 7  ? 11.723  3.911   18.765  1.00 0.00 ?  563  SER A O    4  
ATOM 5021  C CB   . SER A 1 7  ? 12.355  0.750   17.888  1.00 0.00 ?  563  SER A CB   4  
ATOM 5022  O OG   . SER A 1 7  ? 12.707  0.635   16.501  1.00 0.00 ?  563  SER A OG   4  
ATOM 5023  H H    . SER A 1 7  ? 10.379  0.537   16.496  1.00 0.00 ?  563  SER A H    4  
ATOM 5024  H HA   . SER A 1 7  ? 10.762  1.555   19.059  1.00 0.00 ?  563  SER A HA   4  
ATOM 5025  H HB2  . SER A 1 7  ? 13.197  1.146   18.435  1.00 0.00 ?  563  SER A HB2  4  
ATOM 5026  H HB3  . SER A 1 7  ? 12.109  -0.232  18.263  1.00 0.00 ?  563  SER A HB3  4  
ATOM 5027  H HG   . SER A 1 7  ? 13.659  0.768   16.431  1.00 0.00 ?  563  SER A HG   4  
ATOM 5028  N N    . GLU A 1 8  ? 11.658  3.468   16.585  1.00 0.00 ?  564  GLU A N    4  
ATOM 5029  C CA   . GLU A 1 8  ? 11.918  4.787   16.125  1.00 0.00 ?  564  GLU A CA   4  
ATOM 5030  C C    . GLU A 1 8  ? 11.541  4.791   14.683  1.00 0.00 ?  564  GLU A C    4  
ATOM 5031  O O    . GLU A 1 8  ? 11.467  3.710   14.061  1.00 0.00 ?  564  GLU A O    4  
ATOM 5032  C CB   . GLU A 1 8  ? 13.391  5.191   16.328  1.00 0.00 ?  564  GLU A CB   4  
ATOM 5033  C CG   . GLU A 1 8  ? 14.401  4.301   15.632  1.00 0.00 ?  564  GLU A CG   4  
ATOM 5034  C CD   . GLU A 1 8  ? 15.811  4.705   15.948  1.00 0.00 ?  564  GLU A CD   4  
ATOM 5035  O OE1  . GLU A 1 8  ? 16.368  4.216   16.952  1.00 0.00 ?  564  GLU A OE1  4  
ATOM 5036  O OE2  . GLU A 1 8  ? 16.390  5.539   15.219  1.00 0.00 -1 564  GLU A OE2  4  
ATOM 5037  H H    . GLU A 1 8  ? 11.562  2.778   15.893  1.00 0.00 ?  564  GLU A H    4  
ATOM 5038  H HA   . GLU A 1 8  ? 11.266  5.462   16.662  1.00 0.00 ?  564  GLU A HA   4  
ATOM 5039  H HB2  . GLU A 1 8  ? 13.527  6.196   15.957  1.00 0.00 ?  564  GLU A HB2  4  
ATOM 5040  H HB3  . GLU A 1 8  ? 13.606  5.184   17.387  1.00 0.00 ?  564  GLU A HB3  4  
ATOM 5041  H HG2  . GLU A 1 8  ? 14.249  3.282   15.959  1.00 0.00 ?  564  GLU A HG2  4  
ATOM 5042  H HG3  . GLU A 1 8  ? 14.253  4.365   14.564  1.00 0.00 ?  564  GLU A HG3  4  
ATOM 5043  N N    . GLU A 1 9  ? 11.250  5.929   14.152  1.00 0.00 ?  565  GLU A N    4  
ATOM 5044  C CA   . GLU A 1 9  ? 10.842  6.010   12.792  1.00 0.00 ?  565  GLU A CA   4  
ATOM 5045  C C    . GLU A 1 9  ? 11.663  7.011   12.042  1.00 0.00 ?  565  GLU A C    4  
ATOM 5046  O O    . GLU A 1 9  ? 11.842  8.145   12.491  1.00 0.00 ?  565  GLU A O    4  
ATOM 5047  C CB   . GLU A 1 9  ? 9.351   6.313   12.685  1.00 0.00 ?  565  GLU A CB   4  
ATOM 5048  C CG   . GLU A 1 9  ? 8.479   5.208   13.265  1.00 0.00 ?  565  GLU A CG   4  
ATOM 5049  C CD   . GLU A 1 9  ? 7.019   5.455   13.074  1.00 0.00 ?  565  GLU A CD   4  
ATOM 5050  O OE1  . GLU A 1 9  ? 6.343   5.867   14.037  1.00 0.00 ?  565  GLU A OE1  4  
ATOM 5051  O OE2  . GLU A 1 9  ? 6.520   5.236   11.940  1.00 0.00 -1 565  GLU A OE2  4  
ATOM 5052  H H    . GLU A 1 9  ? 11.315  6.761   14.668  1.00 0.00 ?  565  GLU A H    4  
ATOM 5053  H HA   . GLU A 1 9  ? 11.019  5.039   12.353  1.00 0.00 ?  565  GLU A HA   4  
ATOM 5054  H HB2  . GLU A 1 9  ? 9.142   7.228   13.219  1.00 0.00 ?  565  GLU A HB2  4  
ATOM 5055  H HB3  . GLU A 1 9  ? 9.090   6.443   11.645  1.00 0.00 ?  565  GLU A HB3  4  
ATOM 5056  H HG2  . GLU A 1 9  ? 8.735   4.274   12.789  1.00 0.00 ?  565  GLU A HG2  4  
ATOM 5057  H HG3  . GLU A 1 9  ? 8.690   5.139   14.322  1.00 0.00 ?  565  GLU A HG3  4  
ATOM 5058  N N    . GLU A 1 10 ? 12.222  6.558   10.948  1.00 0.00 ?  566  GLU A N    4  
ATOM 5059  C CA   . GLU A 1 10 ? 13.000  7.381   10.055  1.00 0.00 ?  566  GLU A CA   4  
ATOM 5060  C C    . GLU A 1 10 ? 12.100  8.460   9.485   1.00 0.00 ?  566  GLU A C    4  
ATOM 5061  O O    . GLU A 1 10 ? 10.998  8.160   8.993   1.00 0.00 ?  566  GLU A O    4  
ATOM 5062  C CB   . GLU A 1 10 ? 13.572  6.560   8.870   1.00 0.00 ?  566  GLU A CB   4  
ATOM 5063  C CG   . GLU A 1 10 ? 14.243  5.228   9.215   1.00 0.00 ?  566  GLU A CG   4  
ATOM 5064  C CD   . GLU A 1 10 ? 13.252  4.127   9.537   1.00 0.00 ?  566  GLU A CD   4  
ATOM 5065  O OE1  . GLU A 1 10 ? 12.982  3.875   10.722  1.00 0.00 ?  566  GLU A OE1  4  
ATOM 5066  O OE2  . GLU A 1 10 ? 12.698  3.524   8.607   1.00 0.00 -1 566  GLU A OE2  4  
ATOM 5067  H H    . GLU A 1 10 ? 12.146  5.600   10.750  1.00 0.00 ?  566  GLU A H    4  
ATOM 5068  H HA   . GLU A 1 10 ? 13.813  7.829   10.604  1.00 0.00 ?  566  GLU A HA   4  
ATOM 5069  H HB2  . GLU A 1 10 ? 12.761  6.345   8.190   1.00 0.00 ?  566  GLU A HB2  4  
ATOM 5070  H HB3  . GLU A 1 10 ? 14.290  7.178   8.353   1.00 0.00 ?  566  GLU A HB3  4  
ATOM 5071  H HG2  . GLU A 1 10 ? 14.848  4.910   8.379   1.00 0.00 ?  566  GLU A HG2  4  
ATOM 5072  H HG3  . GLU A 1 10 ? 14.878  5.386   10.075  1.00 0.00 ?  566  GLU A HG3  4  
ATOM 5073  N N    . GLU A 1 11 ? 12.515  9.687   9.603   1.00 0.00 ?  567  GLU A N    4  
ATOM 5074  C CA   . GLU A 1 11 ? 11.792  10.780  9.030   1.00 0.00 ?  567  GLU A CA   4  
ATOM 5075  C C    . GLU A 1 11 ? 12.092  10.790  7.558   1.00 0.00 ?  567  GLU A C    4  
ATOM 5076  O O    . GLU A 1 11 ? 13.184  11.200  7.140   1.00 0.00 ?  567  GLU A O    4  
ATOM 5077  C CB   . GLU A 1 11 ? 12.180  12.134  9.651   1.00 0.00 ?  567  GLU A CB   4  
ATOM 5078  C CG   . GLU A 1 11 ? 12.302  12.127  11.167  1.00 0.00 ?  567  GLU A CG   4  
ATOM 5079  C CD   . GLU A 1 11 ? 13.708  11.804  11.630  1.00 0.00 ?  567  GLU A CD   4  
ATOM 5080  O OE1  . GLU A 1 11 ? 14.341  12.676  12.259  1.00 0.00 ?  567  GLU A OE1  4  
ATOM 5081  O OE2  . GLU A 1 11 ? 14.233  10.707  11.338  1.00 0.00 -1 567  GLU A OE2  4  
ATOM 5082  H H    . GLU A 1 11 ? 13.328  9.881   10.126  1.00 0.00 ?  567  GLU A H    4  
ATOM 5083  H HA   . GLU A 1 11 ? 10.738  10.597  9.173   1.00 0.00 ?  567  GLU A HA   4  
ATOM 5084  H HB2  . GLU A 1 11 ? 13.135  12.434  9.246   1.00 0.00 ?  567  GLU A HB2  4  
ATOM 5085  H HB3  . GLU A 1 11 ? 11.439  12.867  9.373   1.00 0.00 ?  567  GLU A HB3  4  
ATOM 5086  H HG2  . GLU A 1 11 ? 12.026  13.098  11.550  1.00 0.00 ?  567  GLU A HG2  4  
ATOM 5087  H HG3  . GLU A 1 11 ? 11.628  11.385  11.565  1.00 0.00 ?  567  GLU A HG3  4  
ATOM 5088  N N    . GLU A 1 12 ? 11.173  10.295  6.795   1.00 0.00 ?  568  GLU A N    4  
ATOM 5089  C CA   . GLU A 1 12 ? 11.355  10.148  5.381   1.00 0.00 ?  568  GLU A CA   4  
ATOM 5090  C C    . GLU A 1 12 ? 11.177  11.471  4.685   1.00 0.00 ?  568  GLU A C    4  
ATOM 5091  O O    . GLU A 1 12 ? 10.227  12.218  4.957   1.00 0.00 ?  568  GLU A O    4  
ATOM 5092  C CB   . GLU A 1 12 ? 10.373  9.122   4.834   1.00 0.00 ?  568  GLU A CB   4  
ATOM 5093  C CG   . GLU A 1 12 ? 10.424  7.790   5.564   1.00 0.00 ?  568  GLU A CG   4  
ATOM 5094  C CD   . GLU A 1 12 ? 11.725  7.024   5.397   1.00 0.00 ?  568  GLU A CD   4  
ATOM 5095  O OE1  . GLU A 1 12 ? 12.795  7.530   5.759   1.00 0.00 ?  568  GLU A OE1  4  
ATOM 5096  O OE2  . GLU A 1 12 ? 11.674  5.859   4.956   1.00 0.00 -1 568  GLU A OE2  4  
ATOM 5097  H H    . GLU A 1 12 ? 10.328  10.004  7.198   1.00 0.00 ?  568  GLU A H    4  
ATOM 5098  H HA   . GLU A 1 12 ? 12.357  9.785   5.211   1.00 0.00 ?  568  GLU A HA   4  
ATOM 5099  H HB2  . GLU A 1 12 ? 9.372   9.520   4.918   1.00 0.00 ?  568  GLU A HB2  4  
ATOM 5100  H HB3  . GLU A 1 12 ? 10.596  8.947   3.792   1.00 0.00 ?  568  GLU A HB3  4  
ATOM 5101  H HG2  . GLU A 1 12 ? 10.302  7.999   6.615   1.00 0.00 ?  568  GLU A HG2  4  
ATOM 5102  H HG3  . GLU A 1 12 ? 9.605   7.180   5.214   1.00 0.00 ?  568  GLU A HG3  4  
ATOM 5103  N N    . GLY A 1 13 ? 12.051  11.731  3.759   1.00 0.00 ?  569  GLY A N    4  
ATOM 5104  C CA   . GLY A 1 13 ? 12.026  12.966  3.008   1.00 0.00 ?  569  GLY A CA   4  
ATOM 5105  C C    . GLY A 1 13 ? 11.146  12.855  1.793   1.00 0.00 ?  569  GLY A C    4  
ATOM 5106  O O    . GLY A 1 13 ? 11.441  13.412  0.737   1.00 0.00 ?  569  GLY A O    4  
ATOM 5107  H H    . GLY A 1 13 ? 12.735  11.049  3.584   1.00 0.00 ?  569  GLY A H    4  
ATOM 5108  H HA2  . GLY A 1 13 ? 11.652  13.756  3.643   1.00 0.00 ?  569  GLY A HA2  4  
ATOM 5109  H HA3  . GLY A 1 13 ? 13.030  13.206  2.693   1.00 0.00 ?  569  GLY A HA3  4  
ATOM 5110  N N    . LEU A 1 14 ? 10.074  12.137  1.947   1.00 0.00 ?  570  LEU A N    4  
ATOM 5111  C CA   . LEU A 1 14 ? 9.128   11.922  0.897   1.00 0.00 ?  570  LEU A CA   4  
ATOM 5112  C C    . LEU A 1 14 ? 7.932   12.803  1.171   1.00 0.00 ?  570  LEU A C    4  
ATOM 5113  O O    . LEU A 1 14 ? 7.257   12.615  2.194   1.00 0.00 ?  570  LEU A O    4  
ATOM 5114  C CB   . LEU A 1 14 ? 8.675   10.451  0.881   1.00 0.00 ?  570  LEU A CB   4  
ATOM 5115  C CG   . LEU A 1 14 ? 9.767   9.387   0.713   1.00 0.00 ?  570  LEU A CG   4  
ATOM 5116  C CD1  . LEU A 1 14 ? 9.163   7.997   0.797   1.00 0.00 ?  570  LEU A CD1  4  
ATOM 5117  C CD2  . LEU A 1 14 ? 10.495  9.560   -0.607  1.00 0.00 ?  570  LEU A CD2  4  
ATOM 5118  H H    . LEU A 1 14 ? 9.892   11.762  2.834   1.00 0.00 ?  570  LEU A H    4  
ATOM 5119  H HA   . LEU A 1 14 ? 9.593   12.168  -0.044  1.00 0.00 ?  570  LEU A HA   4  
ATOM 5120  H HB2  . LEU A 1 14 ? 8.164   10.256  1.811   1.00 0.00 ?  570  LEU A HB2  4  
ATOM 5121  H HB3  . LEU A 1 14 ? 7.962   10.331  0.078   1.00 0.00 ?  570  LEU A HB3  4  
ATOM 5122  H HG   . LEU A 1 14 ? 10.483  9.488   1.516   1.00 0.00 ?  570  LEU A HG   4  
ATOM 5123  H HD11 . LEU A 1 14 ? 8.419   7.881   0.023   1.00 0.00 ?  570  LEU A HD11 4  
ATOM 5124  H HD12 . LEU A 1 14 ? 8.700   7.858   1.764   1.00 0.00 ?  570  LEU A HD12 4  
ATOM 5125  H HD13 . LEU A 1 14 ? 9.939   7.259   0.658   1.00 0.00 ?  570  LEU A HD13 4  
ATOM 5126  H HD21 . LEU A 1 14 ? 10.944  10.542  -0.645  1.00 0.00 ?  570  LEU A HD21 4  
ATOM 5127  H HD22 . LEU A 1 14 ? 9.791   9.450   -1.419  1.00 0.00 ?  570  LEU A HD22 4  
ATOM 5128  H HD23 . LEU A 1 14 ? 11.264  8.807   -0.695  1.00 0.00 ?  570  LEU A HD23 4  
ATOM 5129  N N    . PRO A 1 15 ? 7.674   13.808  0.339   1.00 0.00 ?  571  PRO A N    4  
ATOM 5130  C CA   . PRO A 1 15 ? 6.520   14.643  0.519   1.00 0.00 ?  571  PRO A CA   4  
ATOM 5131  C C    . PRO A 1 15 ? 5.274   13.946  0.010   1.00 0.00 ?  571  PRO A C    4  
ATOM 5132  O O    . PRO A 1 15 ? 5.340   13.052  -0.849  1.00 0.00 ?  571  PRO A O    4  
ATOM 5133  C CB   . PRO A 1 15 ? 6.809   15.871  -0.311  1.00 0.00 ?  571  PRO A CB   4  
ATOM 5134  C CG   . PRO A 1 15 ? 7.718   15.393  -1.400  1.00 0.00 ?  571  PRO A CG   4  
ATOM 5135  C CD   . PRO A 1 15 ? 8.475   14.207  -0.841  1.00 0.00 ?  571  PRO A CD   4  
ATOM 5136  H HA   . PRO A 1 15 ? 6.390   14.912  1.557   1.00 0.00 ?  571  PRO A HA   4  
ATOM 5137  H HB2  . PRO A 1 15 ? 5.844   16.204  -0.662  1.00 0.00 ?  571  PRO A HB2  4  
ATOM 5138  H HB3  . PRO A 1 15 ? 7.260   16.633  0.308   1.00 0.00 ?  571  PRO A HB3  4  
ATOM 5139  H HG2  . PRO A 1 15 ? 7.133   15.089  -2.258  1.00 0.00 ?  571  PRO A HG2  4  
ATOM 5140  H HG3  . PRO A 1 15 ? 8.404   16.180  -1.675  1.00 0.00 ?  571  PRO A HG3  4  
ATOM 5141  H HD2  . PRO A 1 15 ? 8.509   13.410  -1.568  1.00 0.00 ?  571  PRO A HD2  4  
ATOM 5142  H HD3  . PRO A 1 15 ? 9.475   14.496  -0.550  1.00 0.00 ?  571  PRO A HD3  4  
ATOM 5143  N N    . MET A 1 16 ? 4.153   14.341  0.506   1.00 0.00 ?  572  MET A N    4  
ATOM 5144  C CA   . MET A 1 16 ? 2.948   13.691  0.138   1.00 0.00 ?  572  MET A CA   4  
ATOM 5145  C C    . MET A 1 16 ? 2.373   14.314  -1.088  1.00 0.00 ?  572  MET A C    4  
ATOM 5146  O O    . MET A 1 16 ? 1.865   15.432  -1.065  1.00 0.00 ?  572  MET A O    4  
ATOM 5147  C CB   . MET A 1 16 ? 1.979   13.690  1.302   1.00 0.00 ?  572  MET A CB   4  
ATOM 5148  C CG   . MET A 1 16 ? 2.591   13.005  2.493   1.00 0.00 ?  572  MET A CG   4  
ATOM 5149  S SD   . MET A 1 16 ? 2.851   11.242  2.203   1.00 0.00 ?  572  MET A SD   4  
ATOM 5150  C CE   . MET A 1 16 ? 3.850   10.806  3.629   1.00 0.00 ?  572  MET A CE   4  
ATOM 5151  H H    . MET A 1 16 ? 4.126   15.098  1.131   1.00 0.00 ?  572  MET A H    4  
ATOM 5152  H HA   . MET A 1 16 ? 3.202   12.667  -0.092  1.00 0.00 ?  572  MET A HA   4  
ATOM 5153  H HB2  . MET A 1 16 ? 1.726   14.708  1.561   1.00 0.00 ?  572  MET A HB2  4  
ATOM 5154  H HB3  . MET A 1 16 ? 1.085   13.152  1.025   1.00 0.00 ?  572  MET A HB3  4  
ATOM 5155  H HG2  . MET A 1 16 ? 3.558   13.476  2.618   1.00 0.00 ?  572  MET A HG2  4  
ATOM 5156  H HG3  . MET A 1 16 ? 1.979   13.152  3.369   1.00 0.00 ?  572  MET A HG3  4  
ATOM 5157  H HE1  . MET A 1 16 ? 4.057   9.747   3.616   1.00 0.00 ?  572  MET A HE1  4  
ATOM 5158  H HE2  . MET A 1 16 ? 3.328   11.067  4.537   1.00 0.00 ?  572  MET A HE2  4  
ATOM 5159  H HE3  . MET A 1 16 ? 4.781   11.351  3.585   1.00 0.00 ?  572  MET A HE3  4  
ATOM 5160  N N    . SER A 1 17 ? 2.509   13.610  -2.150  1.00 0.00 ?  573  SER A N    4  
ATOM 5161  C CA   . SER A 1 17 ? 1.996   13.989  -3.412  1.00 0.00 ?  573  SER A CA   4  
ATOM 5162  C C    . SER A 1 17 ? 1.203   12.796  -3.895  1.00 0.00 ?  573  SER A C    4  
ATOM 5163  O O    . SER A 1 17 ? 1.448   11.676  -3.425  1.00 0.00 ?  573  SER A O    4  
ATOM 5164  C CB   . SER A 1 17 ? 3.167   14.315  -4.358  1.00 0.00 ?  573  SER A CB   4  
ATOM 5165  O OG   . SER A 1 17 ? 2.724   14.779  -5.619  1.00 0.00 ?  573  SER A OG   4  
ATOM 5166  H H    . SER A 1 17 ? 2.993   12.758  -2.089  1.00 0.00 ?  573  SER A H    4  
ATOM 5167  H HA   . SER A 1 17 ? 1.351   14.847  -3.298  1.00 0.00 ?  573  SER A HA   4  
ATOM 5168  H HB2  . SER A 1 17 ? 3.789   15.076  -3.910  1.00 0.00 ?  573  SER A HB2  4  
ATOM 5169  H HB3  . SER A 1 17 ? 3.757   13.423  -4.505  1.00 0.00 ?  573  SER A HB3  4  
ATOM 5170  H HG   . SER A 1 17 ? 3.418   15.375  -5.939  1.00 0.00 ?  573  SER A HG   4  
ATOM 5171  N N    . TYR A 1 18 ? 0.284   13.003  -4.807  1.00 0.00 ?  574  TYR A N    4  
ATOM 5172  C CA   . TYR A 1 18 ? -0.603  11.939  -5.269  1.00 0.00 ?  574  TYR A CA   4  
ATOM 5173  C C    . TYR A 1 18 ? 0.160   10.840  -5.980  1.00 0.00 ?  574  TYR A C    4  
ATOM 5174  O O    . TYR A 1 18 ? -0.198  9.671   -5.893  1.00 0.00 ?  574  TYR A O    4  
ATOM 5175  C CB   . TYR A 1 18 ? -1.724  12.501  -6.147  1.00 0.00 ?  574  TYR A CB   4  
ATOM 5176  C CG   . TYR A 1 18 ? -2.611  13.469  -5.405  1.00 0.00 ?  574  TYR A CG   4  
ATOM 5177  C CD1  . TYR A 1 18 ? -3.680  13.014  -4.662  1.00 0.00 ?  574  TYR A CD1  4  
ATOM 5178  C CD2  . TYR A 1 18 ? -2.364  14.833  -5.430  1.00 0.00 ?  574  TYR A CD2  4  
ATOM 5179  C CE1  . TYR A 1 18 ? -4.482  13.884  -3.962  1.00 0.00 ?  574  TYR A CE1  4  
ATOM 5180  C CE2  . TYR A 1 18 ? -3.165  15.713  -4.734  1.00 0.00 ?  574  TYR A CE2  4  
ATOM 5181  C CZ   . TYR A 1 18 ? -4.222  15.229  -3.999  1.00 0.00 ?  574  TYR A CZ   4  
ATOM 5182  O OH   . TYR A 1 18 ? -5.031  16.101  -3.292  1.00 0.00 ?  574  TYR A OH   4  
ATOM 5183  H H    . TYR A 1 18 ? 0.200   13.894  -5.211  1.00 0.00 ?  574  TYR A H    4  
ATOM 5184  H HA   . TYR A 1 18 ? -1.047  11.506  -4.384  1.00 0.00 ?  574  TYR A HA   4  
ATOM 5185  H HB2  . TYR A 1 18 ? -1.297  13.019  -6.992  1.00 0.00 ?  574  TYR A HB2  4  
ATOM 5186  H HB3  . TYR A 1 18 ? -2.340  11.688  -6.501  1.00 0.00 ?  574  TYR A HB3  4  
ATOM 5187  H HD1  . TYR A 1 18 ? -3.883  11.954  -4.634  1.00 0.00 ?  574  TYR A HD1  4  
ATOM 5188  H HD2  . TYR A 1 18 ? -1.531  15.204  -6.008  1.00 0.00 ?  574  TYR A HD2  4  
ATOM 5189  H HE1  . TYR A 1 18 ? -5.314  13.506  -3.386  1.00 0.00 ?  574  TYR A HE1  4  
ATOM 5190  H HE2  . TYR A 1 18 ? -2.957  16.772  -4.767  1.00 0.00 ?  574  TYR A HE2  4  
ATOM 5191  H HH   . TYR A 1 18 ? -5.115  15.745  -2.396  1.00 0.00 ?  574  TYR A HH   4  
ATOM 5192  N N    . ASP A 1 19 ? 1.240   11.207  -6.633  1.00 0.00 ?  575  ASP A N    4  
ATOM 5193  C CA   . ASP A 1 19 ? 2.067   10.235  -7.330  1.00 0.00 ?  575  ASP A CA   4  
ATOM 5194  C C    . ASP A 1 19 ? 2.855   9.403   -6.321  1.00 0.00 ?  575  ASP A C    4  
ATOM 5195  O O    . ASP A 1 19 ? 3.040   8.209   -6.506  1.00 0.00 ?  575  ASP A O    4  
ATOM 5196  C CB   . ASP A 1 19 ? 3.002   10.917  -8.328  1.00 0.00 ?  575  ASP A CB   4  
ATOM 5197  C CG   . ASP A 1 19 ? 3.708   9.927   -9.237  1.00 0.00 ?  575  ASP A CG   4  
ATOM 5198  O OD1  . ASP A 1 19 ? 4.909   9.671   -9.053  1.00 0.00 ?  575  ASP A OD1  4  
ATOM 5199  O OD2  . ASP A 1 19 ? 3.060   9.396   -10.174 1.00 0.00 -1 575  ASP A OD2  4  
ATOM 5200  H H    . ASP A 1 19 ? 1.466   12.161  -6.661  1.00 0.00 ?  575  ASP A H    4  
ATOM 5201  H HA   . ASP A 1 19 ? 1.396   9.576   -7.862  1.00 0.00 ?  575  ASP A HA   4  
ATOM 5202  H HB2  . ASP A 1 19 ? 2.435   11.600  -8.941  1.00 0.00 ?  575  ASP A HB2  4  
ATOM 5203  H HB3  . ASP A 1 19 ? 3.751   11.471  -7.780  1.00 0.00 ?  575  ASP A HB3  4  
ATOM 5204  N N    . GLU A 1 20 ? 3.240   10.038  -5.212  1.00 0.00 ?  576  GLU A N    4  
ATOM 5205  C CA   . GLU A 1 20 ? 3.976   9.362   -4.140  1.00 0.00 ?  576  GLU A CA   4  
ATOM 5206  C C    . GLU A 1 20 ? 3.062   8.395   -3.413  1.00 0.00 ?  576  GLU A C    4  
ATOM 5207  O O    . GLU A 1 20 ? 3.452   7.280   -3.094  1.00 0.00 ?  576  GLU A O    4  
ATOM 5208  C CB   . GLU A 1 20 ? 4.563   10.366  -3.160  1.00 0.00 ?  576  GLU A CB   4  
ATOM 5209  C CG   . GLU A 1 20 ? 5.528   11.340  -3.800  1.00 0.00 ?  576  GLU A CG   4  
ATOM 5210  C CD   . GLU A 1 20 ? 6.697   10.676  -4.488  1.00 0.00 ?  576  GLU A CD   4  
ATOM 5211  O OE1  . GLU A 1 20 ? 6.572   10.329  -5.676  1.00 0.00 ?  576  GLU A OE1  4  
ATOM 5212  O OE2  . GLU A 1 20 ? 7.772   10.552  -3.892  1.00 0.00 -1 576  GLU A OE2  4  
ATOM 5213  H H    . GLU A 1 20 ? 3.016   10.985  -5.113  1.00 0.00 ?  576  GLU A H    4  
ATOM 5214  H HA   . GLU A 1 20 ? 4.780   8.819   -4.615  1.00 0.00 ?  576  GLU A HA   4  
ATOM 5215  H HB2  . GLU A 1 20 ? 3.752   10.931  -2.724  1.00 0.00 ?  576  GLU A HB2  4  
ATOM 5216  H HB3  . GLU A 1 20 ? 5.075   9.828   -2.378  1.00 0.00 ?  576  GLU A HB3  4  
ATOM 5217  H HG2  . GLU A 1 20 ? 4.979   11.861  -4.567  1.00 0.00 ?  576  GLU A HG2  4  
ATOM 5218  H HG3  . GLU A 1 20 ? 5.892   12.033  -3.057  1.00 0.00 ?  576  GLU A HG3  4  
ATOM 5219  N N    . LYS A 1 21 ? 1.817   8.841   -3.181  1.00 0.00 ?  577  LYS A N    4  
ATOM 5220  C CA   . LYS A 1 21 ? 0.752   7.996   -2.602  1.00 0.00 ?  577  LYS A CA   4  
ATOM 5221  C C    . LYS A 1 21 ? 0.613   6.765   -3.473  1.00 0.00 ?  577  LYS A C    4  
ATOM 5222  O O    . LYS A 1 21 ? 0.523   5.630   -3.015  1.00 0.00 ?  577  LYS A O    4  
ATOM 5223  C CB   . LYS A 1 21 ? -0.615  8.726   -2.675  1.00 0.00 ?  577  LYS A CB   4  
ATOM 5224  C CG   . LYS A 1 21 ? -0.769  10.033  -1.886  1.00 0.00 ?  577  LYS A CG   4  
ATOM 5225  C CD   . LYS A 1 21 ? -0.630  9.827   -0.391  1.00 0.00 ?  577  LYS A CD   4  
ATOM 5226  C CE   . LYS A 1 21 ? -1.060  11.063  0.401   1.00 0.00 ?  577  LYS A CE   4  
ATOM 5227  N NZ   . LYS A 1 21 ? -2.525  11.314  0.315   1.00 0.00 1  577  LYS A NZ   4  
ATOM 5228  H H    . LYS A 1 21 ? 1.638   9.783   -3.394  1.00 0.00 ?  577  LYS A H    4  
ATOM 5229  H HA   . LYS A 1 21 ? 0.979   7.741   -1.578  1.00 0.00 ?  577  LYS A HA   4  
ATOM 5230  H HB2  . LYS A 1 21 ? -0.789  8.961   -3.715  1.00 0.00 ?  577  LYS A HB2  4  
ATOM 5231  H HB3  . LYS A 1 21 ? -1.397  8.040   -2.385  1.00 0.00 ?  577  LYS A HB3  4  
ATOM 5232  H HG2  . LYS A 1 21 ? -0.004  10.725  -2.207  1.00 0.00 ?  577  LYS A HG2  4  
ATOM 5233  H HG3  . LYS A 1 21 ? -1.738  10.459  -2.098  1.00 0.00 ?  577  LYS A HG3  4  
ATOM 5234  H HD2  . LYS A 1 21 ? -1.256  8.994   -0.100  1.00 0.00 ?  577  LYS A HD2  4  
ATOM 5235  H HD3  . LYS A 1 21 ? 0.402   9.604   -0.165  1.00 0.00 ?  577  LYS A HD3  4  
ATOM 5236  H HE2  . LYS A 1 21 ? -0.793  10.922  1.439   1.00 0.00 ?  577  LYS A HE2  4  
ATOM 5237  H HE3  . LYS A 1 21 ? -0.531  11.921  0.011   1.00 0.00 ?  577  LYS A HE3  4  
ATOM 5238  H HZ1  . LYS A 1 21 ? -3.073  10.532  0.734   1.00 0.00 ?  577  LYS A HZ1  4  
ATOM 5239  H HZ2  . LYS A 1 21 ? -2.854  11.469  -0.661  1.00 0.00 ?  577  LYS A HZ2  4  
ATOM 5240  H HZ3  . LYS A 1 21 ? -2.778  12.180  0.836   1.00 0.00 ?  577  LYS A HZ3  4  
ATOM 5241  N N    . ARG A 1 22 ? 0.658   7.034   -4.739  1.00 0.00 ?  578  ARG A N    4  
ATOM 5242  C CA   . ARG A 1 22 ? 0.455   6.088   -5.767  1.00 0.00 ?  578  ARG A CA   4  
ATOM 5243  C C    . ARG A 1 22 ? 1.578   5.096   -5.916  1.00 0.00 ?  578  ARG A C    4  
ATOM 5244  O O    . ARG A 1 22 ? 1.371   4.038   -6.443  1.00 0.00 ?  578  ARG A O    4  
ATOM 5245  C CB   . ARG A 1 22 ? 0.038   6.753   -7.038  1.00 0.00 ?  578  ARG A CB   4  
ATOM 5246  C CG   . ARG A 1 22 ? -0.556  5.829   -8.063  1.00 0.00 ?  578  ARG A CG   4  
ATOM 5247  C CD   . ARG A 1 22 ? -1.459  6.630   -8.951  1.00 0.00 ?  578  ARG A CD   4  
ATOM 5248  N NE   . ARG A 1 22 ? -1.023  6.633   -10.355 1.00 0.00 ?  578  ARG A NE   4  
ATOM 5249  C CZ   . ARG A 1 22 ? -0.013  7.382   -10.858 1.00 0.00 ?  578  ARG A CZ   4  
ATOM 5250  N NH1  . ARG A 1 22 ? 0.671   8.210   -10.060 1.00 0.00 1  578  ARG A NH1  4  
ATOM 5251  N NH2  . ARG A 1 22 ? 0.297   7.299   -12.146 1.00 0.00 ?  578  ARG A NH2  4  
ATOM 5252  H H    . ARG A 1 22 ? 0.841   7.965   -4.995  1.00 0.00 ?  578  ARG A H    4  
ATOM 5253  H HA   . ARG A 1 22 ? -0.390  5.510   -5.418  1.00 0.00 ?  578  ARG A HA   4  
ATOM 5254  H HB2  . ARG A 1 22 ? -0.676  7.520   -6.780  1.00 0.00 ?  578  ARG A HB2  4  
ATOM 5255  H HB3  . ARG A 1 22 ? 0.878   7.261   -7.469  1.00 0.00 ?  578  ARG A HB3  4  
ATOM 5256  H HG2  . ARG A 1 22 ? 0.226   5.340   -8.633  1.00 0.00 ?  578  ARG A HG2  4  
ATOM 5257  H HG3  . ARG A 1 22 ? -1.138  5.080   -7.547  1.00 0.00 ?  578  ARG A HG3  4  
ATOM 5258  H HD2  . ARG A 1 22 ? -2.446  6.209   -8.825  1.00 0.00 ?  578  ARG A HD2  4  
ATOM 5259  H HD3  . ARG A 1 22 ? -1.501  7.633   -8.555  1.00 0.00 ?  578  ARG A HD3  4  
ATOM 5260  H HE   . ARG A 1 22 ? -1.549  6.022   -10.926 1.00 0.00 ?  578  ARG A HE   4  
ATOM 5261  H HH11 . ARG A 1 22 ? 0.442   8.300   -9.092  1.00 0.00 ?  578  ARG A HH11 4  
ATOM 5262  H HH12 . ARG A 1 22 ? 1.472   8.754   -10.351 1.00 0.00 ?  578  ARG A HH12 4  
ATOM 5263  H HH21 . ARG A 1 22 ? -0.186  6.693   -12.783 1.00 0.00 ?  578  ARG A HH21 4  
ATOM 5264  H HH22 . ARG A 1 22 ? 1.037   7.833   -12.559 1.00 0.00 ?  578  ARG A HH22 4  
ATOM 5265  N N    . GLN A 1 23 ? 2.775   5.445   -5.512  1.00 0.00 ?  579  GLN A N    4  
ATOM 5266  C CA   . GLN A 1 23 ? 3.876   4.477   -5.546  1.00 0.00 ?  579  GLN A CA   4  
ATOM 5267  C C    . GLN A 1 23 ? 3.478   3.216   -4.743  1.00 0.00 ?  579  GLN A C    4  
ATOM 5268  O O    . GLN A 1 23 ? 3.786   2.091   -5.139  1.00 0.00 ?  579  GLN A O    4  
ATOM 5269  C CB   . GLN A 1 23 ? 5.175   5.097   -4.996  1.00 0.00 ?  579  GLN A CB   4  
ATOM 5270  C CG   . GLN A 1 23 ? 6.371   4.137   -4.916  1.00 0.00 ?  579  GLN A CG   4  
ATOM 5271  C CD   . GLN A 1 23 ? 6.751   3.514   -6.252  1.00 0.00 ?  579  GLN A CD   4  
ATOM 5272  O OE1  . GLN A 1 23 ? 7.553   4.064   -7.007  1.00 0.00 ?  579  GLN A OE1  4  
ATOM 5273  N NE2  . GLN A 1 23 ? 6.203   2.363   -6.547  1.00 0.00 ?  579  GLN A NE2  4  
ATOM 5274  H H    . GLN A 1 23 ? 2.925   6.361   -5.194  1.00 0.00 ?  579  GLN A H    4  
ATOM 5275  H HA   . GLN A 1 23 ? 4.015   4.186   -6.578  1.00 0.00 ?  579  GLN A HA   4  
ATOM 5276  H HB2  . GLN A 1 23 ? 5.456   5.923   -5.632  1.00 0.00 ?  579  GLN A HB2  4  
ATOM 5277  H HB3  . GLN A 1 23 ? 4.977   5.476   -4.004  1.00 0.00 ?  579  GLN A HB3  4  
ATOM 5278  H HG2  . GLN A 1 23 ? 7.228   4.677   -4.540  1.00 0.00 ?  579  GLN A HG2  4  
ATOM 5279  H HG3  . GLN A 1 23 ? 6.119   3.346   -4.226  1.00 0.00 ?  579  GLN A HG3  4  
ATOM 5280  H HE21 . GLN A 1 23 ? 5.578   1.969   -5.894  1.00 0.00 ?  579  GLN A HE21 4  
ATOM 5281  H HE22 . GLN A 1 23 ? 6.427   1.936   -7.400  1.00 0.00 ?  579  GLN A HE22 4  
ATOM 5282  N N    . LEU A 1 24 ? 2.711   3.415   -3.678  1.00 0.00 ?  580  LEU A N    4  
ATOM 5283  C CA   . LEU A 1 24 ? 2.195   2.307   -2.905  1.00 0.00 ?  580  LEU A CA   4  
ATOM 5284  C C    . LEU A 1 24 ? 1.055   1.571   -3.633  1.00 0.00 ?  580  LEU A C    4  
ATOM 5285  O O    . LEU A 1 24 ? 0.800   0.392   -3.372  1.00 0.00 ?  580  LEU A O    4  
ATOM 5286  C CB   . LEU A 1 24 ? 1.851   2.685   -1.450  1.00 0.00 ?  580  LEU A CB   4  
ATOM 5287  C CG   . LEU A 1 24 ? 3.065   2.866   -0.496  1.00 0.00 ?  580  LEU A CG   4  
ATOM 5288  C CD1  . LEU A 1 24 ? 3.930   4.055   -0.883  1.00 0.00 ?  580  LEU A CD1  4  
ATOM 5289  C CD2  . LEU A 1 24 ? 2.623   2.982   0.949   1.00 0.00 ?  580  LEU A CD2  4  
ATOM 5290  H H    . LEU A 1 24 ? 2.489   4.328   -3.392  1.00 0.00 ?  580  LEU A H    4  
ATOM 5291  H HA   . LEU A 1 24 ? 3.024   1.617   -2.883  1.00 0.00 ?  580  LEU A HA   4  
ATOM 5292  H HB2  . LEU A 1 24 ? 1.300   3.614   -1.481  1.00 0.00 ?  580  LEU A HB2  4  
ATOM 5293  H HB3  . LEU A 1 24 ? 1.213   1.916   -1.040  1.00 0.00 ?  580  LEU A HB3  4  
ATOM 5294  H HG   . LEU A 1 24 ? 3.687   1.986   -0.585  1.00 0.00 ?  580  LEU A HG   4  
ATOM 5295  H HD11 . LEU A 1 24 ? 4.765   4.135   -0.203  1.00 0.00 ?  580  LEU A HD11 4  
ATOM 5296  H HD12 . LEU A 1 24 ? 3.339   4.958   -0.845  1.00 0.00 ?  580  LEU A HD12 4  
ATOM 5297  H HD13 . LEU A 1 24 ? 4.293   3.900   -1.889  1.00 0.00 ?  580  LEU A HD13 4  
ATOM 5298  H HD21 . LEU A 1 24 ? 1.975   2.158   1.207   1.00 0.00 ?  580  LEU A HD21 4  
ATOM 5299  H HD22 . LEU A 1 24 ? 2.128   3.926   1.111   1.00 0.00 ?  580  LEU A HD22 4  
ATOM 5300  H HD23 . LEU A 1 24 ? 3.499   2.943   1.579   1.00 0.00 ?  580  LEU A HD23 4  
ATOM 5301  N N    . SER A 1 25 ? 0.386   2.271   -4.574  1.00 0.00 ?  581  SER A N    4  
ATOM 5302  C CA   . SER A 1 25 ? -0.659  1.672   -5.421  1.00 0.00 ?  581  SER A CA   4  
ATOM 5303  C C    . SER A 1 25 ? -0.003  0.560   -6.229  1.00 0.00 ?  581  SER A C    4  
ATOM 5304  O O    . SER A 1 25 ? -0.557  -0.514  -6.436  1.00 0.00 ?  581  SER A O    4  
ATOM 5305  C CB   . SER A 1 25 ? -1.178  2.685   -6.445  1.00 0.00 ?  581  SER A CB   4  
ATOM 5306  O OG   . SER A 1 25 ? -2.492  2.376   -6.881  1.00 0.00 ?  581  SER A OG   4  
ATOM 5307  H H    . SER A 1 25 ? 0.619   3.212   -4.705  1.00 0.00 ?  581  SER A H    4  
ATOM 5308  H HA   . SER A 1 25 ? -1.473  1.358   -4.781  1.00 0.00 ?  581  SER A HA   4  
ATOM 5309  H HB2  . SER A 1 25 ? -1.093  3.696   -6.081  1.00 0.00 ?  581  SER A HB2  4  
ATOM 5310  H HB3  . SER A 1 25 ? -0.528  2.619   -7.305  1.00 0.00 ?  581  SER A HB3  4  
ATOM 5311  H HG   . SER A 1 25 ? -2.461  1.734   -7.597  1.00 0.00 ?  581  SER A HG   4  
ATOM 5312  N N    . LEU A 1 26 ? 1.208   0.848   -6.698  1.00 0.00 ?  582  LEU A N    4  
ATOM 5313  C CA   . LEU A 1 26 ? 1.967   -0.088  -7.470  1.00 0.00 ?  582  LEU A CA   4  
ATOM 5314  C C    . LEU A 1 26 ? 2.396   -1.277  -6.625  1.00 0.00 ?  582  LEU A C    4  
ATOM 5315  O O    . LEU A 1 26 ? 2.465   -2.383  -7.130  1.00 0.00 ?  582  LEU A O    4  
ATOM 5316  C CB   . LEU A 1 26 ? 3.175   0.578   -8.170  1.00 0.00 ?  582  LEU A CB   4  
ATOM 5317  C CG   . LEU A 1 26 ? 2.888   1.476   -9.410  1.00 0.00 ?  582  LEU A CG   4  
ATOM 5318  C CD1  . LEU A 1 26 ? 2.183   0.697   -10.508 1.00 0.00 ?  582  LEU A CD1  4  
ATOM 5319  C CD2  . LEU A 1 26 ? 2.108   2.744   -9.066  1.00 0.00 ?  582  LEU A CD2  4  
ATOM 5320  H H    . LEU A 1 26 ? 1.604   1.729   -6.515  1.00 0.00 ?  582  LEU A H    4  
ATOM 5321  H HA   . LEU A 1 26 ? 1.299   -0.460  -8.231  1.00 0.00 ?  582  LEU A HA   4  
ATOM 5322  H HB2  . LEU A 1 26 ? 3.689   1.183   -7.439  1.00 0.00 ?  582  LEU A HB2  4  
ATOM 5323  H HB3  . LEU A 1 26 ? 3.848   -0.210  -8.479  1.00 0.00 ?  582  LEU A HB3  4  
ATOM 5324  H HG   . LEU A 1 26 ? 3.849   1.770   -9.804  1.00 0.00 ?  582  LEU A HG   4  
ATOM 5325  H HD11 . LEU A 1 26 ? 2.035   1.339   -11.364 1.00 0.00 ?  582  LEU A HD11 4  
ATOM 5326  H HD12 . LEU A 1 26 ? 1.223   0.358   -10.148 1.00 0.00 ?  582  LEU A HD12 4  
ATOM 5327  H HD13 . LEU A 1 26 ? 2.783   -0.153  -10.795 1.00 0.00 ?  582  LEU A HD13 4  
ATOM 5328  H HD21 . LEU A 1 26 ? 1.159   2.485   -8.619  1.00 0.00 ?  582  LEU A HD21 4  
ATOM 5329  H HD22 . LEU A 1 26 ? 1.916   3.328   -9.953  1.00 0.00 ?  582  LEU A HD22 4  
ATOM 5330  H HD23 . LEU A 1 26 ? 2.669   3.345   -8.367  1.00 0.00 ?  582  LEU A HD23 4  
ATOM 5331  N N    . ASP A 1 27 ? 2.623   -1.047  -5.336  1.00 0.00 ?  583  ASP A N    4  
ATOM 5332  C CA   . ASP A 1 27 ? 3.024   -2.121  -4.415  1.00 0.00 ?  583  ASP A CA   4  
ATOM 5333  C C    . ASP A 1 27 ? 1.908   -3.102  -4.227  1.00 0.00 ?  583  ASP A C    4  
ATOM 5334  O O    . ASP A 1 27 ? 2.102   -4.300  -4.397  1.00 0.00 ?  583  ASP A O    4  
ATOM 5335  C CB   . ASP A 1 27 ? 3.478   -1.600  -3.053  1.00 0.00 ?  583  ASP A CB   4  
ATOM 5336  C CG   . ASP A 1 27 ? 4.694   -0.712  -3.145  1.00 0.00 ?  583  ASP A CG   4  
ATOM 5337  O OD1  . ASP A 1 27 ? 5.661   -1.069  -3.861  1.00 0.00 ?  583  ASP A OD1  4  
ATOM 5338  O OD2  . ASP A 1 27 ? 4.722   0.344   -2.503  1.00 0.00 -1 583  ASP A OD2  4  
ATOM 5339  H H    . ASP A 1 27 ? 2.527   -0.134  -4.989  1.00 0.00 ?  583  ASP A H    4  
ATOM 5340  H HA   . ASP A 1 27 ? 3.846   -2.644  -4.882  1.00 0.00 ?  583  ASP A HA   4  
ATOM 5341  H HB2  . ASP A 1 27 ? 2.664   -1.045  -2.609  1.00 0.00 ?  583  ASP A HB2  4  
ATOM 5342  H HB3  . ASP A 1 27 ? 3.693   -2.442  -2.407  1.00 0.00 ?  583  ASP A HB3  4  
ATOM 5343  N N    . ILE A 1 28 ? 0.719   -2.598  -3.905  1.00 0.00 ?  584  ILE A N    4  
ATOM 5344  C CA   . ILE A 1 28 ? -0.458  -3.459  -3.771  1.00 0.00 ?  584  ILE A CA   4  
ATOM 5345  C C    . ILE A 1 28 ? -0.759  -4.163  -5.117  1.00 0.00 ?  584  ILE A C    4  
ATOM 5346  O O    . ILE A 1 28 ? -1.148  -5.323  -5.153  1.00 0.00 ?  584  ILE A O    4  
ATOM 5347  C CB   . ILE A 1 28 ? -1.719  -2.706  -3.182  1.00 0.00 ?  584  ILE A CB   4  
ATOM 5348  C CG1  . ILE A 1 28 ? -2.971  -3.559  -3.239  1.00 0.00 ?  584  ILE A CG1  4  
ATOM 5349  C CG2  . ILE A 1 28 ? -1.967  -1.375  -3.852  1.00 0.00 ?  584  ILE A CG2  4  
ATOM 5350  C CD1  . ILE A 1 28 ? -2.935  -4.826  -2.424  1.00 0.00 ?  584  ILE A CD1  4  
ATOM 5351  H H    . ILE A 1 28 ? 0.651   -1.630  -3.745  1.00 0.00 ?  584  ILE A H    4  
ATOM 5352  H HA   . ILE A 1 28 ? -0.159  -4.242  -3.088  1.00 0.00 ?  584  ILE A HA   4  
ATOM 5353  H HB   . ILE A 1 28 ? -1.509  -2.495  -2.145  1.00 0.00 ?  584  ILE A HB   4  
ATOM 5354  H HG12 . ILE A 1 28 ? -3.827  -2.981  -2.924  1.00 0.00 ?  584  ILE A HG12 4  
ATOM 5355  H HG13 . ILE A 1 28 ? -3.088  -3.837  -4.274  1.00 0.00 ?  584  ILE A HG13 4  
ATOM 5356  H HG21 . ILE A 1 28 ? -1.987  -1.536  -4.920  1.00 0.00 ?  584  ILE A HG21 4  
ATOM 5357  H HG22 . ILE A 1 28 ? -1.185  -0.674  -3.605  1.00 0.00 ?  584  ILE A HG22 4  
ATOM 5358  H HG23 . ILE A 1 28 ? -2.930  -0.974  -3.561  1.00 0.00 ?  584  ILE A HG23 4  
ATOM 5359  H HD11 . ILE A 1 28 ? -2.823  -4.598  -1.376  1.00 0.00 ?  584  ILE A HD11 4  
ATOM 5360  H HD12 . ILE A 1 28 ? -2.114  -5.439  -2.766  1.00 0.00 ?  584  ILE A HD12 4  
ATOM 5361  H HD13 . ILE A 1 28 ? -3.865  -5.351  -2.595  1.00 0.00 ?  584  ILE A HD13 4  
ATOM 5362  N N    . ASN A 1 29 ? -0.514  -3.454  -6.207  1.00 0.00 ?  585  ASN A N    4  
ATOM 5363  C CA   . ASN A 1 29 ? -0.651  -4.002  -7.560  1.00 0.00 ?  585  ASN A CA   4  
ATOM 5364  C C    . ASN A 1 29 ? 0.294   -5.212  -7.769  1.00 0.00 ?  585  ASN A C    4  
ATOM 5365  O O    . ASN A 1 29 ? -0.044  -6.159  -8.485  1.00 0.00 ?  585  ASN A O    4  
ATOM 5366  C CB   . ASN A 1 29 ? -0.360  -2.896  -8.595  1.00 0.00 ?  585  ASN A CB   4  
ATOM 5367  C CG   . ASN A 1 29 ? -0.429  -3.342  -10.048 1.00 0.00 ?  585  ASN A CG   4  
ATOM 5368  O OD1  . ASN A 1 29 ? -1.490  -3.313  -10.672 1.00 0.00 ?  585  ASN A OD1  4  
ATOM 5369  N ND2  . ASN A 1 29 ? 0.698   -3.713  -10.611 1.00 0.00 ?  585  ASN A ND2  4  
ATOM 5370  H H    . ASN A 1 29 ? -0.252  -2.515  -6.093  1.00 0.00 ?  585  ASN A H    4  
ATOM 5371  H HA   . ASN A 1 29 ? -1.672  -4.332  -7.677  1.00 0.00 ?  585  ASN A HA   4  
ATOM 5372  H HB2  . ASN A 1 29 ? -1.071  -2.093  -8.465  1.00 0.00 ?  585  ASN A HB2  4  
ATOM 5373  H HB3  . ASN A 1 29 ? 0.633   -2.516  -8.402  1.00 0.00 ?  585  ASN A HB3  4  
ATOM 5374  H HD21 . ASN A 1 29 ? 1.518   -3.692  -10.076 1.00 0.00 ?  585  ASN A HD21 4  
ATOM 5375  H HD22 . ASN A 1 29 ? 0.690   -3.988  -11.555 1.00 0.00 ?  585  ASN A HD22 4  
ATOM 5376  N N    . ARG A 1 30 ? 1.459   -5.185  -7.111  1.00 0.00 ?  586  ARG A N    4  
ATOM 5377  C CA   . ARG A 1 30 ? 2.445   -6.273  -7.216  1.00 0.00 ?  586  ARG A CA   4  
ATOM 5378  C C    . ARG A 1 30 ? 2.052   -7.429  -6.304  1.00 0.00 ?  586  ARG A C    4  
ATOM 5379  O O    . ARG A 1 30 ? 2.369   -8.582  -6.583  1.00 0.00 ?  586  ARG A O    4  
ATOM 5380  C CB   . ARG A 1 30 ? 3.850   -5.818  -6.762  1.00 0.00 ?  586  ARG A CB   4  
ATOM 5381  C CG   . ARG A 1 30 ? 4.450   -4.617  -7.466  1.00 0.00 ?  586  ARG A CG   4  
ATOM 5382  C CD   . ARG A 1 30 ? 4.670   -4.840  -8.946  1.00 0.00 ?  586  ARG A CD   4  
ATOM 5383  N NE   . ARG A 1 30 ? 5.331   -3.675  -9.554  1.00 0.00 ?  586  ARG A NE   4  
ATOM 5384  C CZ   . ARG A 1 30 ? 5.583   -3.514  -10.865 1.00 0.00 ?  586  ARG A CZ   4  
ATOM 5385  N NH1  . ARG A 1 30 ? 5.221   -4.451  -11.739 1.00 0.00 1  586  ARG A NH1  4  
ATOM 5386  N NH2  . ARG A 1 30 ? 6.206   -2.421  -11.289 1.00 0.00 ?  586  ARG A NH2  4  
ATOM 5387  H H    . ARG A 1 30 ? 1.656   -4.421  -6.525  1.00 0.00 ?  586  ARG A H    4  
ATOM 5388  H HA   . ARG A 1 30 ? 2.498   -6.608  -8.241  1.00 0.00 ?  586  ARG A HA   4  
ATOM 5389  H HB2  . ARG A 1 30 ? 3.801   -5.581  -5.711  1.00 0.00 ?  586  ARG A HB2  4  
ATOM 5390  H HB3  . ARG A 1 30 ? 4.527   -6.651  -6.885  1.00 0.00 ?  586  ARG A HB3  4  
ATOM 5391  H HG2  . ARG A 1 30 ? 3.777   -3.781  -7.349  1.00 0.00 ?  586  ARG A HG2  4  
ATOM 5392  H HG3  . ARG A 1 30 ? 5.394   -4.380  -7.000  1.00 0.00 ?  586  ARG A HG3  4  
ATOM 5393  H HD2  . ARG A 1 30 ? 5.291   -5.713  -9.081  1.00 0.00 ?  586  ARG A HD2  4  
ATOM 5394  H HD3  . ARG A 1 30 ? 3.717   -4.992  -9.427  1.00 0.00 ?  586  ARG A HD3  4  
ATOM 5395  H HE   . ARG A 1 30 ? 5.608   -2.990  -8.903  1.00 0.00 ?  586  ARG A HE   4  
ATOM 5396  H HH11 . ARG A 1 30 ? 4.759   -5.294  -11.449 1.00 0.00 ?  586  ARG A HH11 4  
ATOM 5397  H HH12 . ARG A 1 30 ? 5.389   -4.386  -12.728 1.00 0.00 ?  586  ARG A HH12 4  
ATOM 5398  H HH21 . ARG A 1 30 ? 6.501   -1.693  -10.663 1.00 0.00 ?  586  ARG A HH21 4  
ATOM 5399  H HH22 . ARG A 1 30 ? 6.423   -2.278  -12.258 1.00 0.00 ?  586  ARG A HH22 4  
ATOM 5400  N N    . LEU A 1 31 ? 1.369   -7.114  -5.224  1.00 0.00 ?  587  LEU A N    4  
ATOM 5401  C CA   . LEU A 1 31 ? 1.036   -8.089  -4.214  1.00 0.00 ?  587  LEU A CA   4  
ATOM 5402  C C    . LEU A 1 31 ? -0.058  -9.077  -4.661  1.00 0.00 ?  587  LEU A C    4  
ATOM 5403  O O    . LEU A 1 31 ? -1.109  -8.674  -5.162  1.00 0.00 ?  587  LEU A O    4  
ATOM 5404  C CB   . LEU A 1 31 ? 0.699   -7.400  -2.903  1.00 0.00 ?  587  LEU A CB   4  
ATOM 5405  C CG   . LEU A 1 31 ? 1.898   -6.703  -2.272  1.00 0.00 ?  587  LEU A CG   4  
ATOM 5406  C CD1  . LEU A 1 31 ? 1.488   -5.774  -1.167  1.00 0.00 ?  587  LEU A CD1  4  
ATOM 5407  C CD2  . LEU A 1 31 ? 2.913   -7.690  -1.730  1.00 0.00 ?  587  LEU A CD2  4  
ATOM 5408  H H    . LEU A 1 31 ? 1.060   -6.191  -5.104  1.00 0.00 ?  587  LEU A H    4  
ATOM 5409  H HA   . LEU A 1 31 ? 1.986   -8.580  -4.075  1.00 0.00 ?  587  LEU A HA   4  
ATOM 5410  H HB2  . LEU A 1 31 ? -0.075  -6.670  -3.087  1.00 0.00 ?  587  LEU A HB2  4  
ATOM 5411  H HB3  . LEU A 1 31 ? 0.331   -8.137  -2.207  1.00 0.00 ?  587  LEU A HB3  4  
ATOM 5412  H HG   . LEU A 1 31 ? 2.357   -6.205  -3.113  1.00 0.00 ?  587  LEU A HG   4  
ATOM 5413  H HD11 . LEU A 1 31 ? 0.741   -6.275  -0.570  1.00 0.00 ?  587  LEU A HD11 4  
ATOM 5414  H HD12 . LEU A 1 31 ? 1.117   -4.839  -1.556  1.00 0.00 ?  587  LEU A HD12 4  
ATOM 5415  H HD13 . LEU A 1 31 ? 2.358   -5.604  -0.546  1.00 0.00 ?  587  LEU A HD13 4  
ATOM 5416  H HD21 . LEU A 1 31 ? 3.373   -8.255  -2.527  1.00 0.00 ?  587  LEU A HD21 4  
ATOM 5417  H HD22 . LEU A 1 31 ? 2.416   -8.362  -1.047  1.00 0.00 ?  587  LEU A HD22 4  
ATOM 5418  H HD23 . LEU A 1 31 ? 3.668   -7.141  -1.179  1.00 0.00 ?  587  LEU A HD23 4  
ATOM 5419  N N    . PRO A 1 32 ? 0.212   -10.395 -4.517  1.00 0.00 ?  588  PRO A N    4  
ATOM 5420  C CA   . PRO A 1 32 ? -0.704  -11.476 -4.934  1.00 0.00 ?  588  PRO A CA   4  
ATOM 5421  C C    . PRO A 1 32 ? -2.046  -11.522 -4.166  1.00 0.00 ?  588  PRO A C    4  
ATOM 5422  O O    . PRO A 1 32 ? -2.228  -10.839 -3.143  1.00 0.00 ?  588  PRO A O    4  
ATOM 5423  C CB   . PRO A 1 32 ? 0.106   -12.751 -4.692  1.00 0.00 ?  588  PRO A CB   4  
ATOM 5424  C CG   . PRO A 1 32 ? 1.120   -12.369 -3.685  1.00 0.00 ?  588  PRO A CG   4  
ATOM 5425  C CD   . PRO A 1 32 ? 1.461   -10.939 -3.966  1.00 0.00 ?  588  PRO A CD   4  
ATOM 5426  H HA   . PRO A 1 32 ? -0.927  -11.394 -5.987  1.00 0.00 ?  588  PRO A HA   4  
ATOM 5427  H HB2  . PRO A 1 32 ? -0.546  -13.527 -4.317  1.00 0.00 ?  588  PRO A HB2  4  
ATOM 5428  H HB3  . PRO A 1 32 ? 0.568   -13.067 -5.615  1.00 0.00 ?  588  PRO A HB3  4  
ATOM 5429  H HG2  . PRO A 1 32 ? 0.686   -12.467 -2.701  1.00 0.00 ?  588  PRO A HG2  4  
ATOM 5430  H HG3  . PRO A 1 32 ? 1.996   -12.995 -3.778  1.00 0.00 ?  588  PRO A HG3  4  
ATOM 5431  H HD2  . PRO A 1 32 ? 1.734   -10.426 -3.056  1.00 0.00 ?  588  PRO A HD2  4  
ATOM 5432  H HD3  . PRO A 1 32 ? 2.258   -10.874 -4.691  1.00 0.00 ?  588  PRO A HD3  4  
ATOM 5433  N N    . GLY A 1 33 ? -2.939  -12.395 -4.650  1.00 0.00 ?  589  GLY A N    4  
ATOM 5434  C CA   . GLY A 1 33 ? -4.320  -12.516 -4.180  1.00 0.00 ?  589  GLY A CA   4  
ATOM 5435  C C    . GLY A 1 33 ? -4.509  -12.667 -2.678  1.00 0.00 ?  589  GLY A C    4  
ATOM 5436  O O    . GLY A 1 33 ? -5.408  -12.060 -2.098  1.00 0.00 ?  589  GLY A O    4  
ATOM 5437  H H    . GLY A 1 33 ? -2.640  -13.006 -5.360  1.00 0.00 ?  589  GLY A H    4  
ATOM 5438  H HA2  . GLY A 1 33 ? -4.869  -11.647 -4.503  1.00 0.00 ?  589  GLY A HA2  4  
ATOM 5439  H HA3  . GLY A 1 33 ? -4.761  -13.370 -4.672  1.00 0.00 ?  589  GLY A HA3  4  
ATOM 5440  N N    . GLU A 1 34 ? -3.707  -13.482 -2.061  1.00 0.00 ?  590  GLU A N    4  
ATOM 5441  C CA   . GLU A 1 34 ? -3.817  -13.721 -0.629  1.00 0.00 ?  590  GLU A CA   4  
ATOM 5442  C C    . GLU A 1 34 ? -3.329  -12.510 0.150   1.00 0.00 ?  590  GLU A C    4  
ATOM 5443  O O    . GLU A 1 34 ? -3.845  -12.178 1.220   1.00 0.00 ?  590  GLU A O    4  
ATOM 5444  C CB   . GLU A 1 34 ? -2.998  -14.955 -0.200  1.00 0.00 ?  590  GLU A CB   4  
ATOM 5445  C CG   . GLU A 1 34 ? -3.217  -16.214 -1.038  1.00 0.00 ?  590  GLU A CG   4  
ATOM 5446  C CD   . GLU A 1 34 ? -2.388  -16.242 -2.312  1.00 0.00 ?  590  GLU A CD   4  
ATOM 5447  O OE1  . GLU A 1 34 ? -1.334  -16.907 -2.322  1.00 0.00 ?  590  GLU A OE1  4  
ATOM 5448  O OE2  . GLU A 1 34 ? -2.764  -15.612 -3.311  1.00 0.00 -1 590  GLU A OE2  4  
ATOM 5449  H H    . GLU A 1 34 ? -3.060  -14.000 -2.593  1.00 0.00 ?  590  GLU A H    4  
ATOM 5450  H HA   . GLU A 1 34 ? -4.857  -13.895 -0.394  1.00 0.00 ?  590  GLU A HA   4  
ATOM 5451  H HB2  . GLU A 1 34 ? -1.950  -14.704 -0.252  1.00 0.00 ?  590  GLU A HB2  4  
ATOM 5452  H HB3  . GLU A 1 34 ? -3.246  -15.184 0.827   1.00 0.00 ?  590  GLU A HB3  4  
ATOM 5453  H HG2  . GLU A 1 34 ? -2.956  -17.079 -0.445  1.00 0.00 ?  590  GLU A HG2  4  
ATOM 5454  H HG3  . GLU A 1 34 ? -4.261  -16.273 -1.306  1.00 0.00 ?  590  GLU A HG3  4  
ATOM 5455  N N    . LYS A 1 35 ? -2.386  -11.818 -0.429  1.00 0.00 ?  591  LYS A N    4  
ATOM 5456  C CA   . LYS A 1 35 ? -1.743  -10.725 0.233   1.00 0.00 ?  591  LYS A CA   4  
ATOM 5457  C C    . LYS A 1 35 ? -2.545  -9.442  0.166   1.00 0.00 ?  591  LYS A C    4  
ATOM 5458  O O    . LYS A 1 35 ? -2.521  -8.671  1.117   1.00 0.00 ?  591  LYS A O    4  
ATOM 5459  C CB   . LYS A 1 35 ? -0.297  -10.576 -0.233  1.00 0.00 ?  591  LYS A CB   4  
ATOM 5460  C CG   . LYS A 1 35 ? 0.571   -11.731 0.261   1.00 0.00 ?  591  LYS A CG   4  
ATOM 5461  C CD   . LYS A 1 35 ? 1.995   -11.679 -0.260  1.00 0.00 ?  591  LYS A CD   4  
ATOM 5462  C CE   . LYS A 1 35 ? 2.848   -12.798 0.339   1.00 0.00 ?  591  LYS A CE   4  
ATOM 5463  N NZ   . LYS A 1 35 ? 2.248   -14.150 0.150   1.00 0.00 1  591  LYS A NZ   4  
ATOM 5464  H H    . LYS A 1 35 ? -2.149  -12.032 -1.358  1.00 0.00 ?  591  LYS A H    4  
ATOM 5465  H HA   . LYS A 1 35 ? -1.722  -11.007 1.276   1.00 0.00 ?  591  LYS A HA   4  
ATOM 5466  H HB2  . LYS A 1 35 ? -0.281  -10.557 -1.314  1.00 0.00 ?  591  LYS A HB2  4  
ATOM 5467  H HB3  . LYS A 1 35 ? 0.104   -9.651  0.149   1.00 0.00 ?  591  LYS A HB3  4  
ATOM 5468  H HG2  . LYS A 1 35 ? 0.607   -11.700 1.339   1.00 0.00 ?  591  LYS A HG2  4  
ATOM 5469  H HG3  . LYS A 1 35 ? 0.115   -12.659 -0.052  1.00 0.00 ?  591  LYS A HG3  4  
ATOM 5470  H HD2  . LYS A 1 35 ? 1.995   -11.773 -1.335  1.00 0.00 ?  591  LYS A HD2  4  
ATOM 5471  H HD3  . LYS A 1 35 ? 2.427   -10.728 0.017   1.00 0.00 ?  591  LYS A HD3  4  
ATOM 5472  H HE2  . LYS A 1 35 ? 3.815   -12.783 -0.141  1.00 0.00 ?  591  LYS A HE2  4  
ATOM 5473  H HE3  . LYS A 1 35 ? 2.978   -12.609 1.394   1.00 0.00 ?  591  LYS A HE3  4  
ATOM 5474  H HZ1  . LYS A 1 35 ? 1.329   -14.238 0.628   1.00 0.00 ?  591  LYS A HZ1  4  
ATOM 5475  H HZ2  . LYS A 1 35 ? 2.886   -14.872 0.545   1.00 0.00 ?  591  LYS A HZ2  4  
ATOM 5476  H HZ3  . LYS A 1 35 ? 2.130   -14.392 -0.856  1.00 0.00 ?  591  LYS A HZ3  4  
ATOM 5477  N N    . LEU A 1 36 ? -3.289  -9.229  -0.926  1.00 0.00 ?  592  LEU A N    4  
ATOM 5478  C CA   . LEU A 1 36 ? -4.180  -8.067  -1.026  1.00 0.00 ?  592  LEU A CA   4  
ATOM 5479  C C    . LEU A 1 36 ? -5.246  -8.160  0.069   1.00 0.00 ?  592  LEU A C    4  
ATOM 5480  O O    . LEU A 1 36 ? -5.601  -7.162  0.702   1.00 0.00 ?  592  LEU A O    4  
ATOM 5481  C CB   . LEU A 1 36 ? -4.818  -7.978  -2.445  1.00 0.00 ?  592  LEU A CB   4  
ATOM 5482  C CG   . LEU A 1 36 ? -5.852  -9.066  -2.836  1.00 0.00 ?  592  LEU A CG   4  
ATOM 5483  C CD1  . LEU A 1 36 ? -7.270  -8.590  -2.592  1.00 0.00 ?  592  LEU A CD1  4  
ATOM 5484  C CD2  . LEU A 1 36 ? -5.710  -9.437  -4.275  1.00 0.00 ?  592  LEU A CD2  4  
ATOM 5485  H H    . LEU A 1 36 ? -3.212  -9.834  -1.697  1.00 0.00 ?  592  LEU A H    4  
ATOM 5486  H HA   . LEU A 1 36 ? -3.591  -7.179  -0.836  1.00 0.00 ?  592  LEU A HA   4  
ATOM 5487  H HB2  . LEU A 1 36 ? -5.296  -7.011  -2.540  1.00 0.00 ?  592  LEU A HB2  4  
ATOM 5488  H HB3  . LEU A 1 36 ? -4.011  -8.010  -3.163  1.00 0.00 ?  592  LEU A HB3  4  
ATOM 5489  H HG   . LEU A 1 36 ? -5.683  -9.949  -2.238  1.00 0.00 ?  592  LEU A HG   4  
ATOM 5490  H HD11 . LEU A 1 36 ? -7.486  -7.858  -3.361  1.00 0.00 ?  592  LEU A HD11 4  
ATOM 5491  H HD12 . LEU A 1 36 ? -7.333  -8.137  -1.614  1.00 0.00 ?  592  LEU A HD12 4  
ATOM 5492  H HD13 . LEU A 1 36 ? -7.962  -9.415  -2.672  1.00 0.00 ?  592  LEU A HD13 4  
ATOM 5493  H HD21 . LEU A 1 36 ? -4.685  -9.685  -4.506  1.00 0.00 ?  592  LEU A HD21 4  
ATOM 5494  H HD22 . LEU A 1 36 ? -6.035  -8.572  -4.832  1.00 0.00 ?  592  LEU A HD22 4  
ATOM 5495  H HD23 . LEU A 1 36 ? -6.368  -10.264 -4.500  1.00 0.00 ?  592  LEU A HD23 4  
ATOM 5496  N N    . GLY A 1 37 ? -5.698  -9.389  0.325   1.00 0.00 ?  593  GLY A N    4  
ATOM 5497  C CA   . GLY A 1 37 ? -6.679  -9.628  1.348   1.00 0.00 ?  593  GLY A CA   4  
ATOM 5498  C C    . GLY A 1 37 ? -6.099  -9.436  2.728   1.00 0.00 ?  593  GLY A C    4  
ATOM 5499  O O    . GLY A 1 37 ? -6.773  -8.938  3.632   1.00 0.00 ?  593  GLY A O    4  
ATOM 5500  H H    . GLY A 1 37 ? -5.357  -10.139 -0.207  1.00 0.00 ?  593  GLY A H    4  
ATOM 5501  H HA2  . GLY A 1 37 ? -7.508  -8.950  1.209   1.00 0.00 ?  593  GLY A HA2  4  
ATOM 5502  H HA3  . GLY A 1 37 ? -7.035  -10.644 1.261   1.00 0.00 ?  593  GLY A HA3  4  
ATOM 5503  N N    . ARG A 1 38 ? -4.846  -9.820  2.895   1.00 0.00 ?  594  ARG A N    4  
ATOM 5504  C CA   . ARG A 1 38 ? -4.183  -9.673  4.170   1.00 0.00 ?  594  ARG A CA   4  
ATOM 5505  C C    . ARG A 1 38 ? -3.936  -8.195  4.472   1.00 0.00 ?  594  ARG A C    4  
ATOM 5506  O O    . ARG A 1 38 ? -4.372  -7.696  5.495   1.00 0.00 ?  594  ARG A O    4  
ATOM 5507  C CB   . ARG A 1 38 ? -2.870  -10.475 4.233   1.00 0.00 ?  594  ARG A CB   4  
ATOM 5508  C CG   . ARG A 1 38 ? -2.197  -10.421 5.603   1.00 0.00 ?  594  ARG A CG   4  
ATOM 5509  C CD   . ARG A 1 38 ? -0.915  -11.238 5.659   1.00 0.00 ?  594  ARG A CD   4  
ATOM 5510  N NE   . ARG A 1 38 ? -0.298  -11.171 6.995   1.00 0.00 ?  594  ARG A NE   4  
ATOM 5511  C CZ   . ARG A 1 38 ? 0.935   -11.604 7.320   1.00 0.00 ?  594  ARG A CZ   4  
ATOM 5512  N NH1  . ARG A 1 38 ? 1.718   -12.173 6.418   1.00 0.00 1  594  ARG A NH1  4  
ATOM 5513  N NH2  . ARG A 1 38 ? 1.371   -11.467 8.562   1.00 0.00 ?  594  ARG A NH2  4  
ATOM 5514  H H    . ARG A 1 38 ? -4.372  -10.217 2.134   1.00 0.00 ?  594  ARG A H    4  
ATOM 5515  H HA   . ARG A 1 38 ? -4.862  -10.052 4.920   1.00 0.00 ?  594  ARG A HA   4  
ATOM 5516  H HB2  . ARG A 1 38 ? -3.084  -11.506 3.996   1.00 0.00 ?  594  ARG A HB2  4  
ATOM 5517  H HB3  . ARG A 1 38 ? -2.182  -10.080 3.499   1.00 0.00 ?  594  ARG A HB3  4  
ATOM 5518  H HG2  . ARG A 1 38 ? -1.958  -9.393  5.829   1.00 0.00 ?  594  ARG A HG2  4  
ATOM 5519  H HG3  . ARG A 1 38 ? -2.890  -10.797 6.342   1.00 0.00 ?  594  ARG A HG3  4  
ATOM 5520  H HD2  . ARG A 1 38 ? -1.148  -12.266 5.427   1.00 0.00 ?  594  ARG A HD2  4  
ATOM 5521  H HD3  . ARG A 1 38 ? -0.220  -10.847 4.930   1.00 0.00 ?  594  ARG A HD3  4  
ATOM 5522  H HE   . ARG A 1 38 ? -0.860  -10.769 7.699   1.00 0.00 ?  594  ARG A HE   4  
ATOM 5523  H HH11 . ARG A 1 38 ? 1.452   -12.317 5.464   1.00 0.00 ?  594  ARG A HH11 4  
ATOM 5524  H HH12 . ARG A 1 38 ? 2.641   -12.476 6.675   1.00 0.00 ?  594  ARG A HH12 4  
ATOM 5525  H HH21 . ARG A 1 38 ? 0.811   -11.047 9.283   1.00 0.00 ?  594  ARG A HH21 4  
ATOM 5526  H HH22 . ARG A 1 38 ? 2.287   -11.782 8.835   1.00 0.00 ?  594  ARG A HH22 4  
ATOM 5527  N N    . VAL A 1 39 ? -3.291  -7.486  3.554   1.00 0.00 ?  595  VAL A N    4  
ATOM 5528  C CA   . VAL A 1 39 ? -2.972  -6.073  3.761   1.00 0.00 ?  595  VAL A CA   4  
ATOM 5529  C C    . VAL A 1 39 ? -4.221  -5.242  3.976   1.00 0.00 ?  595  VAL A C    4  
ATOM 5530  O O    . VAL A 1 39 ? -4.268  -4.443  4.905   1.00 0.00 ?  595  VAL A O    4  
ATOM 5531  C CB   . VAL A 1 39 ? -2.078  -5.482  2.621   1.00 0.00 ?  595  VAL A CB   4  
ATOM 5532  C CG1  . VAL A 1 39 ? -2.733  -5.568  1.256   1.00 0.00 ?  595  VAL A CG1  4  
ATOM 5533  C CG2  . VAL A 1 39 ? -1.679  -4.056  2.909   1.00 0.00 ?  595  VAL A CG2  4  
ATOM 5534  H H    . VAL A 1 39 ? -3.026  -7.925  2.712   1.00 0.00 ?  595  VAL A H    4  
ATOM 5535  H HA   . VAL A 1 39 ? -2.441  -5.977  4.700   1.00 0.00 ?  595  VAL A HA   4  
ATOM 5536  H HB   . VAL A 1 39 ? -1.180  -6.078  2.589   1.00 0.00 ?  595  VAL A HB   4  
ATOM 5537  H HG11 . VAL A 1 39 ? -2.062  -5.163  0.514   1.00 0.00 ?  595  VAL A HG11 4  
ATOM 5538  H HG12 . VAL A 1 39 ? -3.655  -5.007  1.261   1.00 0.00 ?  595  VAL A HG12 4  
ATOM 5539  H HG13 . VAL A 1 39 ? -2.938  -6.604  1.029   1.00 0.00 ?  595  VAL A HG13 4  
ATOM 5540  H HG21 . VAL A 1 39 ? -1.117  -4.010  3.830   1.00 0.00 ?  595  VAL A HG21 4  
ATOM 5541  H HG22 . VAL A 1 39 ? -2.571  -3.452  2.989   1.00 0.00 ?  595  VAL A HG22 4  
ATOM 5542  H HG23 . VAL A 1 39 ? -1.075  -3.695  2.091   1.00 0.00 ?  595  VAL A HG23 4  
ATOM 5543  N N    . VAL A 1 40 ? -5.257  -5.502  3.191   1.00 0.00 ?  596  VAL A N    4  
ATOM 5544  C CA   . VAL A 1 40 ? -6.488  -4.751  3.291   1.00 0.00 ?  596  VAL A CA   4  
ATOM 5545  C C    . VAL A 1 40 ? -7.114  -4.965  4.679   1.00 0.00 ?  596  VAL A C    4  
ATOM 5546  O O    . VAL A 1 40 ? -7.825  -4.126  5.175   1.00 0.00 ?  596  VAL A O    4  
ATOM 5547  C CB   . VAL A 1 40 ? -7.504  -5.123  2.152   1.00 0.00 ?  596  VAL A CB   4  
ATOM 5548  C CG1  . VAL A 1 40 ? -8.453  -6.259  2.531   1.00 0.00 ?  596  VAL A CG1  4  
ATOM 5549  C CG2  . VAL A 1 40 ? -8.260  -3.909  1.668   1.00 0.00 ?  596  VAL A CG2  4  
ATOM 5550  H H    . VAL A 1 40 ? -5.182  -6.209  2.511   1.00 0.00 ?  596  VAL A H    4  
ATOM 5551  H HA   . VAL A 1 40 ? -6.226  -3.706  3.202   1.00 0.00 ?  596  VAL A HA   4  
ATOM 5552  H HB   . VAL A 1 40 ? -6.908  -5.492  1.329   1.00 0.00 ?  596  VAL A HB   4  
ATOM 5553  H HG11 . VAL A 1 40 ? -9.032  -5.942  3.388   1.00 0.00 ?  596  VAL A HG11 4  
ATOM 5554  H HG12 . VAL A 1 40 ? -7.887  -7.141  2.789   1.00 0.00 ?  596  VAL A HG12 4  
ATOM 5555  H HG13 . VAL A 1 40 ? -9.119  -6.473  1.708   1.00 0.00 ?  596  VAL A HG13 4  
ATOM 5556  H HG21 . VAL A 1 40 ? -8.955  -4.197  0.893   1.00 0.00 ?  596  VAL A HG21 4  
ATOM 5557  H HG22 . VAL A 1 40 ? -7.566  -3.178  1.281   1.00 0.00 ?  596  VAL A HG22 4  
ATOM 5558  H HG23 . VAL A 1 40 ? -8.804  -3.482  2.498   1.00 0.00 ?  596  VAL A HG23 4  
ATOM 5559  N N    . HIS A 1 41 ? -6.819  -6.110  5.283   1.00 0.00 ?  597  HIS A N    4  
ATOM 5560  C CA   . HIS A 1 41 ? -7.341  -6.460  6.592   1.00 0.00 ?  597  HIS A CA   4  
ATOM 5561  C C    . HIS A 1 41 ? -6.600  -5.686  7.688   1.00 0.00 ?  597  HIS A C    4  
ATOM 5562  O O    . HIS A 1 41 ? -7.216  -5.187  8.625   1.00 0.00 ?  597  HIS A O    4  
ATOM 5563  C CB   . HIS A 1 41 ? -7.255  -7.979  6.830   1.00 0.00 ?  597  HIS A CB   4  
ATOM 5564  C CG   . HIS A 1 41 ? -8.000  -8.466  8.045   1.00 0.00 ?  597  HIS A CG   4  
ATOM 5565  N ND1  . HIS A 1 41 ? -7.401  -9.011  9.161   1.00 0.00 ?  597  HIS A ND1  4  
ATOM 5566  C CD2  . HIS A 1 41 ? -9.336  -8.519  8.279   1.00 0.00 ?  597  HIS A CD2  4  
ATOM 5567  C CE1  . HIS A 1 41 ? -8.361  -9.372  10.012  1.00 0.00 ?  597  HIS A CE1  4  
ATOM 5568  N NE2  . HIS A 1 41 ? -9.561  -9.093  9.524   1.00 0.00 ?  597  HIS A NE2  4  
ATOM 5569  H H    . HIS A 1 41 ? -6.186  -6.706  4.827   1.00 0.00 ?  597  HIS A H    4  
ATOM 5570  H HA   . HIS A 1 41 ? -8.377  -6.159  6.615   1.00 0.00 ?  597  HIS A HA   4  
ATOM 5571  H HB2  . HIS A 1 41 ? -7.661  -8.490  5.970   1.00 0.00 ?  597  HIS A HB2  4  
ATOM 5572  H HB3  . HIS A 1 41 ? -6.217  -8.254  6.942   1.00 0.00 ?  597  HIS A HB3  4  
ATOM 5573  H HD1  . HIS A 1 41 ? -6.440  -9.126  9.326   1.00 0.00 ?  597  HIS A HD1  4  
ATOM 5574  H HD2  . HIS A 1 41 ? -10.111 -8.171  7.612   1.00 0.00 ?  597  HIS A HD2  4  
ATOM 5575  H HE1  . HIS A 1 41 ? -8.185  -9.834  10.972  1.00 0.00 ?  597  HIS A HE1  4  
ATOM 5576  N N    . ILE A 1 42 ? -5.281  -5.577  7.550   1.00 0.00 ?  598  ILE A N    4  
ATOM 5577  C CA   . ILE A 1 42 ? -4.448  -4.872  8.533   1.00 0.00 ?  598  ILE A CA   4  
ATOM 5578  C C    . ILE A 1 42 ? -4.714  -3.377  8.474   1.00 0.00 ?  598  ILE A C    4  
ATOM 5579  O O    . ILE A 1 42 ? -5.036  -2.747  9.494   1.00 0.00 ?  598  ILE A O    4  
ATOM 5580  C CB   . ILE A 1 42 ? -2.890  -5.158  8.358   1.00 0.00 ?  598  ILE A CB   4  
ATOM 5581  C CG1  . ILE A 1 42 ? -2.476  -6.548  8.895   1.00 0.00 ?  598  ILE A CG1  4  
ATOM 5582  C CG2  . ILE A 1 42 ? -2.029  -4.087  9.028   1.00 0.00 ?  598  ILE A CG2  4  
ATOM 5583  C CD1  . ILE A 1 42 ? -3.085  -7.725  8.193   1.00 0.00 ?  598  ILE A CD1  4  
ATOM 5584  H H    . ILE A 1 42 ? -4.854  -5.974  6.759   1.00 0.00 ?  598  ILE A H    4  
ATOM 5585  H HA   . ILE A 1 42 ? -4.757  -5.222  9.507   1.00 0.00 ?  598  ILE A HA   4  
ATOM 5586  H HB   . ILE A 1 42 ? -2.677  -5.120  7.300   1.00 0.00 ?  598  ILE A HB   4  
ATOM 5587  H HG12 . ILE A 1 42 ? -1.404  -6.647  8.807   1.00 0.00 ?  598  ILE A HG12 4  
ATOM 5588  H HG13 . ILE A 1 42 ? -2.739  -6.603  9.940   1.00 0.00 ?  598  ILE A HG13 4  
ATOM 5589  H HG21 . ILE A 1 42 ? -0.984  -4.312  8.875   1.00 0.00 ?  598  ILE A HG21 4  
ATOM 5590  H HG22 . ILE A 1 42 ? -2.241  -4.070  10.086  1.00 0.00 ?  598  ILE A HG22 4  
ATOM 5591  H HG23 . ILE A 1 42 ? -2.257  -3.120  8.607   1.00 0.00 ?  598  ILE A HG23 4  
ATOM 5592  H HD11 . ILE A 1 42 ? -2.707  -8.643  8.615   1.00 0.00 ?  598  ILE A HD11 4  
ATOM 5593  H HD12 . ILE A 1 42 ? -2.843  -7.669  7.141   1.00 0.00 ?  598  ILE A HD12 4  
ATOM 5594  H HD13 . ILE A 1 42 ? -4.158  -7.690  8.310   1.00 0.00 ?  598  ILE A HD13 4  
ATOM 5595  N N    . ILE A 1 43 ? -4.635  -2.822  7.268   1.00 0.00 ?  599  ILE A N    4  
ATOM 5596  C CA   . ILE A 1 43 ? -4.800  -1.374  7.077   1.00 0.00 ?  599  ILE A CA   4  
ATOM 5597  C C    . ILE A 1 43 ? -6.216  -0.939  7.468   1.00 0.00 ?  599  ILE A C    4  
ATOM 5598  O O    . ILE A 1 43 ? -6.421  0.170   7.933   1.00 0.00 ?  599  ILE A O    4  
ATOM 5599  C CB   . ILE A 1 43 ? -4.525  -0.920  5.603   1.00 0.00 ?  599  ILE A CB   4  
ATOM 5600  C CG1  . ILE A 1 43 ? -3.314  -1.637  4.988   1.00 0.00 ?  599  ILE A CG1  4  
ATOM 5601  C CG2  . ILE A 1 43 ? -4.302  0.581   5.543   1.00 0.00 ?  599  ILE A CG2  4  
ATOM 5602  C CD1  . ILE A 1 43 ? -2.061  -1.664  5.834   1.00 0.00 ?  599  ILE A CD1  4  
ATOM 5603  H H    . ILE A 1 43 ? -4.421  -3.398  6.495   1.00 0.00 ?  599  ILE A H    4  
ATOM 5604  H HA   . ILE A 1 43 ? -4.108  -0.862  7.730   1.00 0.00 ?  599  ILE A HA   4  
ATOM 5605  H HB   . ILE A 1 43 ? -5.404  -1.149  5.020   1.00 0.00 ?  599  ILE A HB   4  
ATOM 5606  H HG12 . ILE A 1 43 ? -3.585  -2.664  4.792   1.00 0.00 ?  599  ILE A HG12 4  
ATOM 5607  H HG13 . ILE A 1 43 ? -3.079  -1.154  4.051   1.00 0.00 ?  599  ILE A HG13 4  
ATOM 5608  H HG21 . ILE A 1 43 ? -4.091  0.882   4.528   1.00 0.00 ?  599  ILE A HG21 4  
ATOM 5609  H HG22 . ILE A 1 43 ? -3.473  0.845   6.184   1.00 0.00 ?  599  ILE A HG22 4  
ATOM 5610  H HG23 . ILE A 1 43 ? -5.191  1.086   5.891   1.00 0.00 ?  599  ILE A HG23 4  
ATOM 5611  H HD11 . ILE A 1 43 ? -1.276  -2.163  5.285   1.00 0.00 ?  599  ILE A HD11 4  
ATOM 5612  H HD12 . ILE A 1 43 ? -2.288  -2.247  6.715   1.00 0.00 ?  599  ILE A HD12 4  
ATOM 5613  H HD13 . ILE A 1 43 ? -1.764  -0.665  6.114   1.00 0.00 ?  599  ILE A HD13 4  
ATOM 5614  N N    . GLN A 1 44 ? -7.159  -1.865  7.340   1.00 0.00 ?  600  GLN A N    4  
ATOM 5615  C CA   . GLN A 1 44 ? -8.586  -1.643  7.613   1.00 0.00 ?  600  GLN A CA   4  
ATOM 5616  C C    . GLN A 1 44 ? -8.845  -1.157  9.041   1.00 0.00 ?  600  GLN A C    4  
ATOM 5617  O O    . GLN A 1 44 ? -9.803  -0.437  9.297   1.00 0.00 ?  600  GLN A O    4  
ATOM 5618  C CB   . GLN A 1 44 ? -9.347  -2.930  7.341   1.00 0.00 ?  600  GLN A CB   4  
ATOM 5619  C CG   . GLN A 1 44 ? -10.851 -2.850  7.448   1.00 0.00 ?  600  GLN A CG   4  
ATOM 5620  C CD   . GLN A 1 44 ? -11.510 -4.181  7.167   1.00 0.00 ?  600  GLN A CD   4  
ATOM 5621  O OE1  . GLN A 1 44 ? -12.545 -4.501  7.738   1.00 0.00 ?  600  GLN A OE1  4  
ATOM 5622  N NE2  . GLN A 1 44 ? -10.948 -4.950  6.265   1.00 0.00 ?  600  GLN A NE2  4  
ATOM 5623  H H    . GLN A 1 44 ? -6.880  -2.750  7.028   1.00 0.00 ?  600  GLN A H    4  
ATOM 5624  H HA   . GLN A 1 44 ? -8.933  -0.888  6.930   1.00 0.00 ?  600  GLN A HA   4  
ATOM 5625  H HB2  . GLN A 1 44 ? -9.105  -3.255  6.341   1.00 0.00 ?  600  GLN A HB2  4  
ATOM 5626  H HB3  . GLN A 1 44 ? -8.996  -3.679  8.037   1.00 0.00 ?  600  GLN A HB3  4  
ATOM 5627  H HG2  . GLN A 1 44 ? -11.140 -2.513  8.432   1.00 0.00 ?  600  GLN A HG2  4  
ATOM 5628  H HG3  . GLN A 1 44 ? -11.188 -2.155  6.693   1.00 0.00 ?  600  GLN A HG3  4  
ATOM 5629  H HE21 . GLN A 1 44 ? -10.135 -4.619  5.823   1.00 0.00 ?  600  GLN A HE21 4  
ATOM 5630  H HE22 . GLN A 1 44 ? -11.362 -5.814  6.065   1.00 0.00 ?  600  GLN A HE22 4  
ATOM 5631  N N    . SER A 1 45 ? -7.984  -1.525  9.958   1.00 0.00 ?  601  SER A N    4  
ATOM 5632  C CA   . SER A 1 45 ? -8.131  -1.103  11.329  1.00 0.00 ?  601  SER A CA   4  
ATOM 5633  C C    . SER A 1 45 ? -7.785  0.388   11.486  1.00 0.00 ?  601  SER A C    4  
ATOM 5634  O O    . SER A 1 45 ? -8.170  1.032   12.466  1.00 0.00 ?  601  SER A O    4  
ATOM 5635  C CB   . SER A 1 45 ? -7.236  -1.955  12.216  1.00 0.00 ?  601  SER A CB   4  
ATOM 5636  O OG   . SER A 1 45 ? -7.511  -3.339  12.018  1.00 0.00 ?  601  SER A OG   4  
ATOM 5637  H H    . SER A 1 45 ? -7.227  -2.103  9.716   1.00 0.00 ?  601  SER A H    4  
ATOM 5638  H HA   . SER A 1 45 ? -9.158  -1.257  11.621  1.00 0.00 ?  601  SER A HA   4  
ATOM 5639  H HB2  . SER A 1 45 ? -6.201  -1.762  11.974  1.00 0.00 ?  601  SER A HB2  4  
ATOM 5640  H HB3  . SER A 1 45 ? -7.419  -1.710  13.251  1.00 0.00 ?  601  SER A HB3  4  
ATOM 5641  H HG   . SER A 1 45 ? -8.477  -3.413  12.034  1.00 0.00 ?  601  SER A HG   4  
ATOM 5642  N N    . ARG A 1 46 ? -7.087  0.930   10.507  1.00 0.00 ?  602  ARG A N    4  
ATOM 5643  C CA   . ARG A 1 46 ? -6.636  2.303   10.554  1.00 0.00 ?  602  ARG A CA   4  
ATOM 5644  C C    . ARG A 1 46 ? -7.240  3.113   9.412   1.00 0.00 ?  602  ARG A C    4  
ATOM 5645  O O    . ARG A 1 46 ? -6.926  4.293   9.246   1.00 0.00 ?  602  ARG A O    4  
ATOM 5646  C CB   . ARG A 1 46 ? -5.116  2.350   10.454  1.00 0.00 ?  602  ARG A CB   4  
ATOM 5647  C CG   . ARG A 1 46 ? -4.393  1.530   11.508  1.00 0.00 ?  602  ARG A CG   4  
ATOM 5648  C CD   . ARG A 1 46 ? -2.904  1.731   11.403  1.00 0.00 ?  602  ARG A CD   4  
ATOM 5649  N NE   . ARG A 1 46 ? -2.548  3.124   11.668  1.00 0.00 ?  602  ARG A NE   4  
ATOM 5650  C CZ   . ARG A 1 46 ? -1.317  3.617   11.736  1.00 0.00 ?  602  ARG A CZ   4  
ATOM 5651  N NH1  . ARG A 1 46 ? -0.246  2.833   11.572  1.00 0.00 1  602  ARG A NH1  4  
ATOM 5652  N NH2  . ARG A 1 46 ? -1.160  4.907   11.981  1.00 0.00 ?  602  ARG A NH2  4  
ATOM 5653  H H    . ARG A 1 46 ? -6.872  0.403   9.704   1.00 0.00 ?  602  ARG A H    4  
ATOM 5654  H HA   . ARG A 1 46 ? -6.933  2.735   11.499  1.00 0.00 ?  602  ARG A HA   4  
ATOM 5655  H HB2  . ARG A 1 46 ? -4.829  1.967   9.486   1.00 0.00 ?  602  ARG A HB2  4  
ATOM 5656  H HB3  . ARG A 1 46 ? -4.791  3.374   10.534  1.00 0.00 ?  602  ARG A HB3  4  
ATOM 5657  H HG2  . ARG A 1 46 ? -4.721  1.846   12.486  1.00 0.00 ?  602  ARG A HG2  4  
ATOM 5658  H HG3  . ARG A 1 46 ? -4.623  0.485   11.367  1.00 0.00 ?  602  ARG A HG3  4  
ATOM 5659  H HD2  . ARG A 1 46 ? -2.401  1.081   12.105  1.00 0.00 ?  602  ARG A HD2  4  
ATOM 5660  H HD3  . ARG A 1 46 ? -2.603  1.478   10.395  1.00 0.00 ?  602  ARG A HD3  4  
ATOM 5661  H HE   . ARG A 1 46 ? -3.318  3.724   11.803  1.00 0.00 ?  602  ARG A HE   4  
ATOM 5662  H HH11 . ARG A 1 46 ? -0.306  1.835   11.392  1.00 0.00 ?  602  ARG A HH11 4  
ATOM 5663  H HH12 . ARG A 1 46 ? 0.682   3.210   11.622  1.00 0.00 ?  602  ARG A HH12 4  
ATOM 5664  H HH21 . ARG A 1 46 ? -1.952  5.509   12.116  1.00 0.00 ?  602  ARG A HH21 4  
ATOM 5665  H HH22 . ARG A 1 46 ? -0.245  5.316   12.019  1.00 0.00 ?  602  ARG A HH22 4  
ATOM 5666  N N    . GLU A 1 47 ? -8.083  2.486   8.628   1.00 0.00 ?  603  GLU A N    4  
ATOM 5667  C CA   . GLU A 1 47 ? -8.703  3.146   7.511   1.00 0.00 ?  603  GLU A CA   4  
ATOM 5668  C C    . GLU A 1 47 ? -10.211 2.968   7.666   1.00 0.00 ?  603  GLU A C    4  
ATOM 5669  O O    . GLU A 1 47 ? -10.721 1.864   7.560   1.00 0.00 ?  603  GLU A O    4  
ATOM 5670  C CB   . GLU A 1 47 ? -8.205  2.527   6.190   1.00 0.00 ?  603  GLU A CB   4  
ATOM 5671  C CG   . GLU A 1 47 ? -8.301  3.442   4.958   1.00 0.00 ?  603  GLU A CG   4  
ATOM 5672  C CD   . GLU A 1 47 ? -9.697  3.899   4.628   1.00 0.00 ?  603  GLU A CD   4  
ATOM 5673  O OE1  . GLU A 1 47 ? -10.427 3.150   3.963   1.00 0.00 ?  603  GLU A OE1  4  
ATOM 5674  O OE2  . GLU A 1 47 ? -10.092 5.034   5.034   1.00 0.00 -1 603  GLU A OE2  4  
ATOM 5675  H H    . GLU A 1 47 ? -8.325  1.550   8.796   1.00 0.00 ?  603  GLU A H    4  
ATOM 5676  H HA   . GLU A 1 47 ? -8.444  4.194   7.546   1.00 0.00 ?  603  GLU A HA   4  
ATOM 5677  H HB2  . GLU A 1 47 ? -7.174  2.232   6.313   1.00 0.00 ?  603  GLU A HB2  4  
ATOM 5678  H HB3  . GLU A 1 47 ? -8.788  1.640   5.997   1.00 0.00 ?  603  GLU A HB3  4  
ATOM 5679  H HG2  . GLU A 1 47 ? -7.699  4.320   5.132   1.00 0.00 ?  603  GLU A HG2  4  
ATOM 5680  H HG3  . GLU A 1 47 ? -7.902  2.911   4.106   1.00 0.00 ?  603  GLU A HG3  4  
ATOM 5681  N N    . PRO A 1 48 ? -10.925 4.027   8.001   1.00 0.00 ?  604  PRO A N    4  
ATOM 5682  C CA   . PRO A 1 48 ? -12.361 3.966   8.208   1.00 0.00 ?  604  PRO A CA   4  
ATOM 5683  C C    . PRO A 1 48 ? -13.202 3.764   6.928   1.00 0.00 ?  604  PRO A C    4  
ATOM 5684  O O    . PRO A 1 48 ? -14.255 3.141   6.989   1.00 0.00 ?  604  PRO A O    4  
ATOM 5685  C CB   . PRO A 1 48 ? -12.705 5.326   8.838   1.00 0.00 ?  604  PRO A CB   4  
ATOM 5686  C CG   . PRO A 1 48 ? -11.401 5.948   9.199   1.00 0.00 ?  604  PRO A CG   4  
ATOM 5687  C CD   . PRO A 1 48 ? -10.391 5.370   8.266   1.00 0.00 ?  604  PRO A CD   4  
ATOM 5688  H HA   . PRO A 1 48 ? -12.615 3.192   8.916   1.00 0.00 ?  604  PRO A HA   4  
ATOM 5689  H HB2  . PRO A 1 48 ? -13.246 5.930   8.124   1.00 0.00 ?  604  PRO A HB2  4  
ATOM 5690  H HB3  . PRO A 1 48 ? -13.318 5.162   9.711   1.00 0.00 ?  604  PRO A HB3  4  
ATOM 5691  H HG2  . PRO A 1 48 ? -11.456 7.019   9.070   1.00 0.00 ?  604  PRO A HG2  4  
ATOM 5692  H HG3  . PRO A 1 48 ? -11.149 5.708   10.222  1.00 0.00 ?  604  PRO A HG3  4  
ATOM 5693  H HD2  . PRO A 1 48 ? -10.329 5.953   7.360   1.00 0.00 ?  604  PRO A HD2  4  
ATOM 5694  H HD3  . PRO A 1 48 ? -9.433  5.317   8.762   1.00 0.00 ?  604  PRO A HD3  4  
ATOM 5695  N N    . SER A 1 49 ? -12.715 4.219   5.789   1.00 0.00 ?  605  SER A N    4  
ATOM 5696  C CA   . SER A 1 49 ? -13.543 4.305   4.586   1.00 0.00 ?  605  SER A CA   4  
ATOM 5697  C C    . SER A 1 49 ? -13.979 2.946   4.012   1.00 0.00 ?  605  SER A C    4  
ATOM 5698  O O    . SER A 1 49 ? -15.149 2.769   3.666   1.00 0.00 ?  605  SER A O    4  
ATOM 5699  C CB   . SER A 1 49 ? -12.803 5.089   3.522   1.00 0.00 ?  605  SER A CB   4  
ATOM 5700  O OG   . SER A 1 49 ? -12.266 6.290   4.064   1.00 0.00 ?  605  SER A OG   4  
ATOM 5701  H H    . SER A 1 49 ? -11.766 4.481   5.717   1.00 0.00 ?  605  SER A H    4  
ATOM 5702  H HA   . SER A 1 49 ? -14.427 4.869   4.844   1.00 0.00 ?  605  SER A HA   4  
ATOM 5703  H HB2  . SER A 1 49 ? -11.998 4.488   3.125   1.00 0.00 ?  605  SER A HB2  4  
ATOM 5704  H HB3  . SER A 1 49 ? -13.492 5.341   2.732   1.00 0.00 ?  605  SER A HB3  4  
ATOM 5705  H HG   . SER A 1 49 ? -11.401 5.987   4.396   1.00 0.00 ?  605  SER A HG   4  
ATOM 5706  N N    . LEU A 1 50 ? -13.081 1.979   3.962   1.00 0.00 ?  606  LEU A N    4  
ATOM 5707  C CA   . LEU A 1 50 ? -13.418 0.679   3.352   1.00 0.00 ?  606  LEU A CA   4  
ATOM 5708  C C    . LEU A 1 50 ? -14.225 -0.207  4.296   1.00 0.00 ?  606  LEU A C    4  
ATOM 5709  O O    . LEU A 1 50 ? -14.690 -1.276  3.910   1.00 0.00 ?  606  LEU A O    4  
ATOM 5710  C CB   . LEU A 1 50 ? -12.169 -0.098  2.890   1.00 0.00 ?  606  LEU A CB   4  
ATOM 5711  C CG   . LEU A 1 50 ? -11.361 -0.845  3.966   1.00 0.00 ?  606  LEU A CG   4  
ATOM 5712  C CD1  . LEU A 1 50 ? -10.259 -1.640  3.332   1.00 0.00 ?  606  LEU A CD1  4  
ATOM 5713  C CD2  . LEU A 1 50 ? -10.783 0.093   4.984   1.00 0.00 ?  606  LEU A CD2  4  
ATOM 5714  H H    . LEU A 1 50 ? -12.164 2.159   4.279   1.00 0.00 ?  606  LEU A H    4  
ATOM 5715  H HA   . LEU A 1 50 ? -14.030 0.885   2.487   1.00 0.00 ?  606  LEU A HA   4  
ATOM 5716  H HB2  . LEU A 1 50 ? -12.482 -0.825  2.156   1.00 0.00 ?  606  LEU A HB2  4  
ATOM 5717  H HB3  . LEU A 1 50 ? -11.505 0.603   2.405   1.00 0.00 ?  606  LEU A HB3  4  
ATOM 5718  H HG   . LEU A 1 50 ? -12.018 -1.539  4.471   1.00 0.00 ?  606  LEU A HG   4  
ATOM 5719  H HD11 . LEU A 1 50 ? -9.697  -2.146  4.104   1.00 0.00 ?  606  LEU A HD11 4  
ATOM 5720  H HD12 . LEU A 1 50 ? -9.605  -0.978  2.784   1.00 0.00 ?  606  LEU A HD12 4  
ATOM 5721  H HD13 . LEU A 1 50 ? -10.686 -2.370  2.661   1.00 0.00 ?  606  LEU A HD13 4  
ATOM 5722  H HD21 . LEU A 1 50 ? -10.123 0.795   4.497   1.00 0.00 ?  606  LEU A HD21 4  
ATOM 5723  H HD22 . LEU A 1 50 ? -10.240 -0.490  5.708   1.00 0.00 ?  606  LEU A HD22 4  
ATOM 5724  H HD23 . LEU A 1 50 ? -11.584 0.623   5.480   1.00 0.00 ?  606  LEU A HD23 4  
ATOM 5725  N N    . ARG A 1 51 ? -14.425 0.250   5.524   1.00 0.00 ?  607  ARG A N    4  
ATOM 5726  C CA   . ARG A 1 51 ? -15.111 -0.558  6.525   1.00 0.00 ?  607  ARG A CA   4  
ATOM 5727  C C    . ARG A 1 51 ? -16.604 -0.623  6.249   1.00 0.00 ?  607  ARG A C    4  
ATOM 5728  O O    . ARG A 1 51 ? -17.328 -1.384  6.873   1.00 0.00 ?  607  ARG A O    4  
ATOM 5729  C CB   . ARG A 1 51 ? -14.865 -0.034  7.931   1.00 0.00 ?  607  ARG A CB   4  
ATOM 5730  C CG   . ARG A 1 51 ? -13.406 0.046   8.311   1.00 0.00 ?  607  ARG A CG   4  
ATOM 5731  C CD   . ARG A 1 51 ? -13.239 0.450   9.759   1.00 0.00 ?  607  ARG A CD   4  
ATOM 5732  N NE   . ARG A 1 51 ? -13.910 1.725   10.092  1.00 0.00 ?  607  ARG A NE   4  
ATOM 5733  C CZ   . ARG A 1 51 ? -13.771 2.365   11.266  1.00 0.00 ?  607  ARG A CZ   4  
ATOM 5734  N NH1  . ARG A 1 51 ? -12.963 1.872   12.197  1.00 0.00 1  607  ARG A NH1  4  
ATOM 5735  N NH2  . ARG A 1 51 ? -14.435 3.493   11.503  1.00 0.00 ?  607  ARG A NH2  4  
ATOM 5736  H H    . ARG A 1 51 ? -14.113 1.155   5.745   1.00 0.00 ?  607  ARG A H    4  
ATOM 5737  H HA   . ARG A 1 51 ? -14.699 -1.555  6.449   1.00 0.00 ?  607  ARG A HA   4  
ATOM 5738  H HB2  . ARG A 1 51 ? -15.282 0.959   8.001   1.00 0.00 ?  607  ARG A HB2  4  
ATOM 5739  H HB3  . ARG A 1 51 ? -15.367 -0.678  8.638   1.00 0.00 ?  607  ARG A HB3  4  
ATOM 5740  H HG2  . ARG A 1 51 ? -12.949 -0.921  8.159   1.00 0.00 ?  607  ARG A HG2  4  
ATOM 5741  H HG3  . ARG A 1 51 ? -12.920 0.775   7.681   1.00 0.00 ?  607  ARG A HG3  4  
ATOM 5742  H HD2  . ARG A 1 51 ? -13.655 -0.327  10.383  1.00 0.00 ?  607  ARG A HD2  4  
ATOM 5743  H HD3  . ARG A 1 51 ? -12.184 0.549   9.971   1.00 0.00 ?  607  ARG A HD3  4  
ATOM 5744  H HE   . ARG A 1 51 ? -14.496 2.089   9.387   1.00 0.00 ?  607  ARG A HE   4  
ATOM 5745  H HH11 . ARG A 1 51 ? -12.444 1.025   12.050  1.00 0.00 ?  607  ARG A HH11 4  
ATOM 5746  H HH12 . ARG A 1 51 ? -12.836 2.304   13.092  1.00 0.00 ?  607  ARG A HH12 4  
ATOM 5747  H HH21 . ARG A 1 51 ? -15.062 3.900   10.833  1.00 0.00 ?  607  ARG A HH21 4  
ATOM 5748  H HH22 . ARG A 1 51 ? -14.330 3.997   12.365  1.00 0.00 ?  607  ARG A HH22 4  
ATOM 5749  N N    . ASP A 1 52 ? -17.047 0.171   5.297   1.00 0.00 ?  608  ASP A N    4  
ATOM 5750  C CA   . ASP A 1 52 ? -18.439 0.190   4.874   1.00 0.00 ?  608  ASP A CA   4  
ATOM 5751  C C    . ASP A 1 52 ? -18.659 -0.779  3.712   1.00 0.00 ?  608  ASP A C    4  
ATOM 5752  O O    . ASP A 1 52 ? -19.721 -0.780  3.061   1.00 0.00 ?  608  ASP A O    4  
ATOM 5753  C CB   . ASP A 1 52 ? -18.884 1.614   4.500   1.00 0.00 ?  608  ASP A CB   4  
ATOM 5754  C CG   . ASP A 1 52 ? -19.116 2.507   5.709   1.00 0.00 ?  608  ASP A CG   4  
ATOM 5755  O OD1  . ASP A 1 52 ? -18.165 3.165   6.197   1.00 0.00 ?  608  ASP A OD1  4  
ATOM 5756  O OD2  . ASP A 1 52 ? -20.273 2.580   6.192   1.00 0.00 -1 608  ASP A OD2  4  
ATOM 5757  H H    . ASP A 1 52 ? -16.408 0.773   4.861   1.00 0.00 ?  608  ASP A H    4  
ATOM 5758  H HA   . ASP A 1 52 ? -19.029 -0.153  5.711   1.00 0.00 ?  608  ASP A HA   4  
ATOM 5759  H HB2  . ASP A 1 52 ? -18.123 2.071   3.885   1.00 0.00 ?  608  ASP A HB2  4  
ATOM 5760  H HB3  . ASP A 1 52 ? -19.801 1.555   3.935   1.00 0.00 ?  608  ASP A HB3  4  
ATOM 5761  N N    . SER A 1 53 ? -17.657 -1.601  3.458   1.00 0.00 ?  609  SER A N    4  
ATOM 5762  C CA   . SER A 1 53 ? -17.710 -2.625  2.445   1.00 0.00 ?  609  SER A CA   4  
ATOM 5763  C C    . SER A 1 53 ? -17.014 -3.886  2.946   1.00 0.00 ?  609  SER A C    4  
ATOM 5764  O O    . SER A 1 53 ? -16.448 -3.907  4.055   1.00 0.00 ?  609  SER A O    4  
ATOM 5765  C CB   . SER A 1 53 ? -17.056 -2.145  1.143   1.00 0.00 ?  609  SER A CB   4  
ATOM 5766  O OG   . SER A 1 53 ? -17.730 -1.009  0.615   1.00 0.00 ?  609  SER A OG   4  
ATOM 5767  H H    . SER A 1 53 ? -16.830 -1.539  3.984   1.00 0.00 ?  609  SER A H    4  
ATOM 5768  H HA   . SER A 1 53 ? -18.746 -2.858  2.257   1.00 0.00 ?  609  SER A HA   4  
ATOM 5769  H HB2  . SER A 1 53 ? -16.027 -1.883  1.333   1.00 0.00 ?  609  SER A HB2  4  
ATOM 5770  H HB3  . SER A 1 53 ? -17.092 -2.940  0.413   1.00 0.00 ?  609  SER A HB3  4  
ATOM 5771  H HG   . SER A 1 53 ? -17.341 -0.248  1.065   1.00 0.00 ?  609  SER A HG   4  
ATOM 5772  N N    . ASN A 1 54 ? -17.081 -4.920  2.157   1.00 0.00 ?  610  ASN A N    4  
ATOM 5773  C CA   . ASN A 1 54 ? -16.429 -6.170  2.441   1.00 0.00 ?  610  ASN A CA   4  
ATOM 5774  C C    . ASN A 1 54 ? -15.027 -6.138  1.812   1.00 0.00 ?  610  ASN A C    4  
ATOM 5775  O O    . ASN A 1 54 ? -14.854 -5.515  0.781   1.00 0.00 ?  610  ASN A O    4  
ATOM 5776  C CB   . ASN A 1 54 ? -17.310 -7.321  1.895   1.00 0.00 ?  610  ASN A CB   4  
ATOM 5777  C CG   . ASN A 1 54 ? -16.594 -8.634  1.702   1.00 0.00 ?  610  ASN A CG   4  
ATOM 5778  O OD1  . ASN A 1 54 ? -16.486 -9.447  2.607   1.00 0.00 ?  610  ASN A OD1  4  
ATOM 5779  N ND2  . ASN A 1 54 ? -16.150 -8.867  0.498   1.00 0.00 ?  610  ASN A ND2  4  
ATOM 5780  H H    . ASN A 1 54 ? -17.553 -4.865  1.294   1.00 0.00 ?  610  ASN A H    4  
ATOM 5781  H HA   . ASN A 1 54 ? -16.333 -6.261  3.512   1.00 0.00 ?  610  ASN A HA   4  
ATOM 5782  H HB2  . ASN A 1 54 ? -18.134 -7.491  2.571   1.00 0.00 ?  610  ASN A HB2  4  
ATOM 5783  H HB3  . ASN A 1 54 ? -17.709 -7.008  0.940   1.00 0.00 ?  610  ASN A HB3  4  
ATOM 5784  H HD21 . ASN A 1 54 ? -16.329 -8.173  -0.188  1.00 0.00 ?  610  ASN A HD21 4  
ATOM 5785  H HD22 . ASN A 1 54 ? -15.639 -9.697  0.328   1.00 0.00 ?  610  ASN A HD22 4  
ATOM 5786  N N    . PRO A 1 55 ? -14.009 -6.775  2.443   1.00 0.00 ?  611  PRO A N    4  
ATOM 5787  C CA   . PRO A 1 55 ? -12.593 -6.773  1.971   1.00 0.00 ?  611  PRO A CA   4  
ATOM 5788  C C    . PRO A 1 55 ? -12.369 -7.176  0.495   1.00 0.00 ?  611  PRO A C    4  
ATOM 5789  O O    . PRO A 1 55 ? -11.302 -6.920  -0.060  1.00 0.00 ?  611  PRO A O    4  
ATOM 5790  C CB   . PRO A 1 55 ? -11.888 -7.768  2.910   1.00 0.00 ?  611  PRO A CB   4  
ATOM 5791  C CG   . PRO A 1 55 ? -12.983 -8.455  3.655   1.00 0.00 ?  611  PRO A CG   4  
ATOM 5792  C CD   . PRO A 1 55 ? -14.124 -7.498  3.710   1.00 0.00 ?  611  PRO A CD   4  
ATOM 5793  H HA   . PRO A 1 55 ? -12.153 -5.797  2.113   1.00 0.00 ?  611  PRO A HA   4  
ATOM 5794  H HB2  . PRO A 1 55 ? -11.309 -8.467  2.326   1.00 0.00 ?  611  PRO A HB2  4  
ATOM 5795  H HB3  . PRO A 1 55 ? -11.236 -7.230  3.582   1.00 0.00 ?  611  PRO A HB3  4  
ATOM 5796  H HG2  . PRO A 1 55 ? -13.287 -9.344  3.126   1.00 0.00 ?  611  PRO A HG2  4  
ATOM 5797  H HG3  . PRO A 1 55 ? -12.653 -8.705  4.651   1.00 0.00 ?  611  PRO A HG3  4  
ATOM 5798  H HD2  . PRO A 1 55 ? -15.063 -8.029  3.769   1.00 0.00 ?  611  PRO A HD2  4  
ATOM 5799  H HD3  . PRO A 1 55 ? -14.012 -6.821  4.541   1.00 0.00 ?  611  PRO A HD3  4  
ATOM 5800  N N    . ASP A 1 56 ? -13.353 -7.813  -0.130  1.00 0.00 ?  612  ASP A N    4  
ATOM 5801  C CA   . ASP A 1 56 ? -13.234 -8.169  -1.550  1.00 0.00 ?  612  ASP A CA   4  
ATOM 5802  C C    . ASP A 1 56 ? -13.466 -6.936  -2.408  1.00 0.00 ?  612  ASP A C    4  
ATOM 5803  O O    . ASP A 1 56 ? -13.049 -6.875  -3.576  1.00 0.00 ?  612  ASP A O    4  
ATOM 5804  C CB   . ASP A 1 56 ? -14.184 -9.311  -1.963  1.00 0.00 ?  612  ASP A CB   4  
ATOM 5805  C CG   . ASP A 1 56 ? -13.870 -10.630 -1.282  1.00 0.00 ?  612  ASP A CG   4  
ATOM 5806  O OD1  . ASP A 1 56 ? -13.210 -11.512 -1.901  1.00 0.00 ?  612  ASP A OD1  4  
ATOM 5807  O OD2  . ASP A 1 56 ? -14.269 -10.818 -0.106  1.00 0.00 -1 612  ASP A OD2  4  
ATOM 5808  H H    . ASP A 1 56 ? -14.162 -8.032  0.380   1.00 0.00 ?  612  ASP A H    4  
ATOM 5809  H HA   . ASP A 1 56 ? -12.211 -8.481  -1.699  1.00 0.00 ?  612  ASP A HA   4  
ATOM 5810  H HB2  . ASP A 1 56 ? -15.194 -9.033  -1.704  1.00 0.00 ?  612  ASP A HB2  4  
ATOM 5811  H HB3  . ASP A 1 56 ? -14.118 -9.450  -3.032  1.00 0.00 ?  612  ASP A HB3  4  
ATOM 5812  N N    . GLU A 1 57 ? -14.133 -5.954  -1.842  1.00 0.00 ?  613  GLU A N    4  
ATOM 5813  C CA   . GLU A 1 57 ? -14.288 -4.683  -2.481  1.00 0.00 ?  613  GLU A CA   4  
ATOM 5814  C C    . GLU A 1 57 ? -13.111 -3.848  -2.039  1.00 0.00 ?  613  GLU A C    4  
ATOM 5815  O O    . GLU A 1 57 ? -13.146 -3.180  -1.009  1.00 0.00 ?  613  GLU A O    4  
ATOM 5816  C CB   . GLU A 1 57 ? -15.617 -3.975  -2.132  1.00 0.00 ?  613  GLU A CB   4  
ATOM 5817  C CG   . GLU A 1 57 ? -16.895 -4.770  -2.429  1.00 0.00 ?  613  GLU A CG   4  
ATOM 5818  C CD   . GLU A 1 57 ? -17.294 -5.736  -1.328  1.00 0.00 ?  613  GLU A CD   4  
ATOM 5819  O OE1  . GLU A 1 57 ? -16.838 -6.900  -1.324  1.00 0.00 ?  613  GLU A OE1  4  
ATOM 5820  O OE2  . GLU A 1 57 ? -18.116 -5.351  -0.456  1.00 0.00 -1 613  GLU A OE2  4  
ATOM 5821  H H    . GLU A 1 57 ? -14.518 -6.072  -0.944  1.00 0.00 ?  613  GLU A H    4  
ATOM 5822  H HA   . GLU A 1 57 ? -14.215 -4.844  -3.548  1.00 0.00 ?  613  GLU A HA   4  
ATOM 5823  H HB2  . GLU A 1 57 ? -15.611 -3.744  -1.077  1.00 0.00 ?  613  GLU A HB2  4  
ATOM 5824  H HB3  . GLU A 1 57 ? -15.660 -3.048  -2.685  1.00 0.00 ?  613  GLU A HB3  4  
ATOM 5825  H HG2  . GLU A 1 57 ? -17.708 -4.075  -2.571  1.00 0.00 ?  613  GLU A HG2  4  
ATOM 5826  H HG3  . GLU A 1 57 ? -16.745 -5.328  -3.342  1.00 0.00 ?  613  GLU A HG3  4  
ATOM 5827  N N    . ILE A 1 58 ? -12.049 -3.965  -2.775  1.00 0.00 ?  614  ILE A N    4  
ATOM 5828  C CA   . ILE A 1 58 ? -10.789 -3.372  -2.424  1.00 0.00 ?  614  ILE A CA   4  
ATOM 5829  C C    . ILE A 1 58 ? -10.410 -2.223  -3.328  1.00 0.00 ?  614  ILE A C    4  
ATOM 5830  O O    . ILE A 1 58 ? -10.018 -2.422  -4.462  1.00 0.00 ?  614  ILE A O    4  
ATOM 5831  C CB   . ILE A 1 58 ? -9.663  -4.471  -2.436  1.00 0.00 ?  614  ILE A CB   4  
ATOM 5832  C CG1  . ILE A 1 58 ? -8.228  -3.872  -2.392  1.00 0.00 ?  614  ILE A CG1  4  
ATOM 5833  C CG2  . ILE A 1 58 ? -9.823  -5.380  -3.657  1.00 0.00 ?  614  ILE A CG2  4  
ATOM 5834  C CD1  . ILE A 1 58 ? -7.151  -4.881  -2.041  1.00 0.00 ?  614  ILE A CD1  4  
ATOM 5835  H H    . ILE A 1 58 ? -12.120 -4.487  -3.600  1.00 0.00 ?  614  ILE A H    4  
ATOM 5836  H HA   . ILE A 1 58 ? -10.850 -3.006  -1.410  1.00 0.00 ?  614  ILE A HA   4  
ATOM 5837  H HB   . ILE A 1 58 ? -9.812  -5.085  -1.560  1.00 0.00 ?  614  ILE A HB   4  
ATOM 5838  H HG12 . ILE A 1 58 ? -8.016  -3.567  -3.406  1.00 0.00 ?  614  ILE A HG12 4  
ATOM 5839  H HG13 . ILE A 1 58 ? -8.117  -2.991  -1.778  1.00 0.00 ?  614  ILE A HG13 4  
ATOM 5840  H HG21 . ILE A 1 58 ? -9.048  -6.130  -3.646  1.00 0.00 ?  614  ILE A HG21 4  
ATOM 5841  H HG22 . ILE A 1 58 ? -9.761  -4.770  -4.553  1.00 0.00 ?  614  ILE A HG22 4  
ATOM 5842  H HG23 . ILE A 1 58 ? -10.791 -5.855  -3.622  1.00 0.00 ?  614  ILE A HG23 4  
ATOM 5843  H HD11 . ILE A 1 58 ? -7.039  -5.620  -2.826  1.00 0.00 ?  614  ILE A HD11 4  
ATOM 5844  H HD12 . ILE A 1 58 ? -7.439  -5.375  -1.124  1.00 0.00 ?  614  ILE A HD12 4  
ATOM 5845  H HD13 . ILE A 1 58 ? -6.214  -4.366  -1.889  1.00 0.00 ?  614  ILE A HD13 4  
ATOM 5846  N N    . GLU A 1 59 ? -10.572 -1.032  -2.851  1.00 0.00 ?  615  GLU A N    4  
ATOM 5847  C CA   . GLU A 1 59 ? -10.038 0.090   -3.489  1.00 0.00 ?  615  GLU A CA   4  
ATOM 5848  C C    . GLU A 1 59 ? -9.441  1.084   -2.556  1.00 0.00 ?  615  GLU A C    4  
ATOM 5849  O O    . GLU A 1 59 ? -10.035 1.503   -1.589  1.00 0.00 ?  615  GLU A O    4  
ATOM 5850  C CB   . GLU A 1 59 ? -10.784 0.636   -4.693  1.00 0.00 ?  615  GLU A CB   4  
ATOM 5851  C CG   . GLU A 1 59 ? -12.253 0.800   -4.666  1.00 0.00 ?  615  GLU A CG   4  
ATOM 5852  C CD   . GLU A 1 59 ? -12.876 1.256   -3.380  1.00 0.00 ?  615  GLU A CD   4  
ATOM 5853  O OE1  . GLU A 1 59 ? -12.783 2.453   -3.056  1.00 0.00 ?  615  GLU A OE1  4  
ATOM 5854  O OE2  . GLU A 1 59 ? -13.514 0.439   -2.694  1.00 0.00 -1 615  GLU A OE2  4  
ATOM 5855  H H    . GLU A 1 59 ? -11.092 -0.865  -2.038  1.00 0.00 ?  615  GLU A H    4  
ATOM 5856  H HA   . GLU A 1 59 ? -9.136  -0.374  -3.869  1.00 0.00 ?  615  GLU A HA   4  
ATOM 5857  H HB2  . GLU A 1 59 ? -10.372 1.481   -5.216  1.00 0.00 ?  615  GLU A HB2  4  
ATOM 5858  H HB3  . GLU A 1 59 ? -10.680 -0.211  -5.355  1.00 0.00 ?  615  GLU A HB3  4  
ATOM 5859  H HG2  . GLU A 1 59 ? -12.347 1.603   -5.386  1.00 0.00 ?  615  GLU A HG2  4  
ATOM 5860  H HG3  . GLU A 1 59 ? -12.615 -0.107  -5.127  1.00 0.00 ?  615  GLU A HG3  4  
ATOM 5861  N N    . ILE A 1 60 ? -8.247  1.421   -2.868  1.00 0.00 ?  616  ILE A N    4  
ATOM 5862  C CA   . ILE A 1 60 ? -7.378  2.146   -1.985  1.00 0.00 ?  616  ILE A CA   4  
ATOM 5863  C C    . ILE A 1 60 ? -7.495  3.684   -2.075  1.00 0.00 ?  616  ILE A C    4  
ATOM 5864  O O    . ILE A 1 60 ? -7.087  4.303   -3.022  1.00 0.00 ?  616  ILE A O    4  
ATOM 5865  C CB   . ILE A 1 60 ? -5.956  1.602   -2.156  1.00 0.00 ?  616  ILE A CB   4  
ATOM 5866  C CG1  . ILE A 1 60 ? -5.948  0.261   -1.441  1.00 0.00 ?  616  ILE A CG1  4  
ATOM 5867  C CG2  . ILE A 1 60 ? -4.914  2.522   -1.558  1.00 0.00 ?  616  ILE A CG2  4  
ATOM 5868  C CD1  . ILE A 1 60 ? -4.769  -0.566  -1.718  1.00 0.00 ?  616  ILE A CD1  4  
ATOM 5869  H H    . ILE A 1 60 ? -7.969  1.184   -3.778  1.00 0.00 ?  616  ILE A H    4  
ATOM 5870  H HA   . ILE A 1 60 ? -7.684  1.801   -1.006  1.00 0.00 ?  616  ILE A HA   4  
ATOM 5871  H HB   . ILE A 1 60 ? -5.764  1.409   -3.204  1.00 0.00 ?  616  ILE A HB   4  
ATOM 5872  H HG12 . ILE A 1 60 ? -5.964  0.436   -0.376  1.00 0.00 ?  616  ILE A HG12 4  
ATOM 5873  H HG13 . ILE A 1 60 ? -6.831  -0.298  -1.714  1.00 0.00 ?  616  ILE A HG13 4  
ATOM 5874  H HG21 . ILE A 1 60 ? -5.007  3.478   -2.047  1.00 0.00 ?  616  ILE A HG21 4  
ATOM 5875  H HG22 . ILE A 1 60 ? -3.927  2.115   -1.724  1.00 0.00 ?  616  ILE A HG22 4  
ATOM 5876  H HG23 . ILE A 1 60 ? -5.086  2.639   -0.498  1.00 0.00 ?  616  ILE A HG23 4  
ATOM 5877  H HD11 . ILE A 1 60 ? -4.770  -0.778  -2.782  1.00 0.00 ?  616  ILE A HD11 4  
ATOM 5878  H HD12 . ILE A 1 60 ? -4.893  -1.477  -1.153  1.00 0.00 ?  616  ILE A HD12 4  
ATOM 5879  H HD13 . ILE A 1 60 ? -3.902  0.003   -1.433  1.00 0.00 ?  616  ILE A HD13 4  
ATOM 5880  N N    . ASP A 1 61 ? -8.066  4.261   -1.063  1.00 0.00 ?  617  ASP A N    4  
ATOM 5881  C CA   . ASP A 1 61 ? -8.350  5.717   -0.944  1.00 0.00 ?  617  ASP A CA   4  
ATOM 5882  C C    . ASP A 1 61 ? -7.132  6.682   -0.983  1.00 0.00 ?  617  ASP A C    4  
ATOM 5883  O O    . ASP A 1 61 ? -7.288  7.892   -0.994  1.00 0.00 ?  617  ASP A O    4  
ATOM 5884  C CB   . ASP A 1 61 ? -9.426  6.037   0.097   1.00 0.00 ?  617  ASP A CB   4  
ATOM 5885  C CG   . ASP A 1 61 ? -9.964  7.465   0.020   1.00 0.00 ?  617  ASP A CG   4  
ATOM 5886  O OD1  . ASP A 1 61 ? -9.446  8.384   0.706   1.00 0.00 ?  617  ASP A OD1  4  
ATOM 5887  O OD2  . ASP A 1 61 ? -10.920 7.703   -0.745  1.00 0.00 -1 617  ASP A OD2  4  
ATOM 5888  H H    . ASP A 1 61 ? -8.352  3.698   -0.308  1.00 0.00 ?  617  ASP A H    4  
ATOM 5889  H HA   . ASP A 1 61 ? -8.783  5.920   -1.912  1.00 0.00 ?  617  ASP A HA   4  
ATOM 5890  H HB2  . ASP A 1 61 ? -10.242 5.408   -0.238  1.00 0.00 ?  617  ASP A HB2  4  
ATOM 5891  H HB3  . ASP A 1 61 ? -9.107  5.791   1.098   1.00 0.00 ?  617  ASP A HB3  4  
ATOM 5892  N N    . PHE A 1 62 ? -5.927  6.116   -1.075  1.00 0.00 ?  618  PHE A N    4  
ATOM 5893  C CA   . PHE A 1 62 ? -4.614  6.785   -0.844  1.00 0.00 ?  618  PHE A CA   4  
ATOM 5894  C C    . PHE A 1 62 ? -4.403  8.115   -1.541  1.00 0.00 ?  618  PHE A C    4  
ATOM 5895  O O    . PHE A 1 62 ? -3.562  8.876   -1.090  1.00 0.00 ?  618  PHE A O    4  
ATOM 5896  C CB   . PHE A 1 62 ? -3.543  5.865   -1.384  1.00 0.00 ?  618  PHE A CB   4  
ATOM 5897  C CG   . PHE A 1 62 ? -2.721  5.166   -0.355  1.00 0.00 ?  618  PHE A CG   4  
ATOM 5898  C CD1  . PHE A 1 62 ? -3.317  4.624   0.766   1.00 0.00 ?  618  PHE A CD1  4  
ATOM 5899  C CD2  . PHE A 1 62 ? -1.357  5.028   -0.512  1.00 0.00 ?  618  PHE A CD2  4  
ATOM 5900  C CE1  . PHE A 1 62 ? -2.571  3.968   1.713   1.00 0.00 ?  618  PHE A CE1  4  
ATOM 5901  C CE2  . PHE A 1 62 ? -0.614  4.375   0.429   1.00 0.00 ?  618  PHE A CE2  4  
ATOM 5902  C CZ   . PHE A 1 62 ? -1.216  3.845   1.545   1.00 0.00 ?  618  PHE A CZ   4  
ATOM 5903  H H    . PHE A 1 62 ? -5.928  5.171   -1.332  1.00 0.00 ?  618  PHE A H    4  
ATOM 5904  H HA   . PHE A 1 62 ? -4.412  6.875   0.208   1.00 0.00 ?  618  PHE A HA   4  
ATOM 5905  H HB2  . PHE A 1 62 ? -4.086  5.105   -1.925  1.00 0.00 ?  618  PHE A HB2  4  
ATOM 5906  H HB3  . PHE A 1 62 ? -2.928  6.364   -2.124  1.00 0.00 ?  618  PHE A HB3  4  
ATOM 5907  H HD1  . PHE A 1 62 ? -4.385  4.722   0.887   1.00 0.00 ?  618  PHE A HD1  4  
ATOM 5908  H HD2  . PHE A 1 62 ? -0.852  5.427   -1.380  1.00 0.00 ?  618  PHE A HD2  4  
ATOM 5909  H HE1  . PHE A 1 62 ? -3.049  3.546   2.585   1.00 0.00 ?  618  PHE A HE1  4  
ATOM 5910  H HE2  . PHE A 1 62 ? 0.451   4.282   0.288   1.00 0.00 ?  618  PHE A HE2  4  
ATOM 5911  H HZ   . PHE A 1 62 ? -0.620  3.329   2.282   1.00 0.00 ?  618  PHE A HZ   4  
ATOM 5912  N N    . GLU A 1 63 ? -5.135  8.410   -2.596  1.00 0.00 ?  619  GLU A N    4  
ATOM 5913  C CA   . GLU A 1 63 ? -5.067  9.740   -3.193  1.00 0.00 ?  619  GLU A CA   4  
ATOM 5914  C C    . GLU A 1 63 ? -5.390  10.784  -2.112  1.00 0.00 ?  619  GLU A C    4  
ATOM 5915  O O    . GLU A 1 63 ? -4.584  11.658  -1.802  1.00 0.00 ?  619  GLU A O    4  
ATOM 5916  C CB   . GLU A 1 63 ? -6.121  9.871   -4.276  1.00 0.00 ?  619  GLU A CB   4  
ATOM 5917  C CG   . GLU A 1 63 ? -5.892  9.089   -5.542  1.00 0.00 ?  619  GLU A CG   4  
ATOM 5918  C CD   . GLU A 1 63 ? -7.118  9.111   -6.377  1.00 0.00 ?  619  GLU A CD   4  
ATOM 5919  O OE1  . GLU A 1 63 ? -7.912  8.155   -6.289  1.00 0.00 ?  619  GLU A OE1  4  
ATOM 5920  O OE2  . GLU A 1 63 ? -7.324  10.074  -7.120  1.00 0.00 -1 619  GLU A OE2  4  
ATOM 5921  H H    . GLU A 1 63 ? -5.740  7.729   -2.955  1.00 0.00 ?  619  GLU A H    4  
ATOM 5922  H HA   . GLU A 1 63 ? -4.086  9.907   -3.611  1.00 0.00 ?  619  GLU A HA   4  
ATOM 5923  H HB2  . GLU A 1 63 ? -7.059  9.530   -3.866  1.00 0.00 ?  619  GLU A HB2  4  
ATOM 5924  H HB3  . GLU A 1 63 ? -6.216  10.915  -4.533  1.00 0.00 ?  619  GLU A HB3  4  
ATOM 5925  H HG2  . GLU A 1 63 ? -5.084  9.534   -6.105  1.00 0.00 ?  619  GLU A HG2  4  
ATOM 5926  H HG3  . GLU A 1 63 ? -5.632  8.054   -5.391  1.00 0.00 ?  619  GLU A HG3  4  
ATOM 5927  N N    . THR A 1 64 ? -6.518  10.597  -1.482  1.00 0.00 ?  620  THR A N    4  
ATOM 5928  C CA   . THR A 1 64 ? -7.020  11.496  -0.489  1.00 0.00 ?  620  THR A CA   4  
ATOM 5929  C C    . THR A 1 64 ? -6.658  11.070  0.928   1.00 0.00 ?  620  THR A C    4  
ATOM 5930  O O    . THR A 1 64 ? -6.486  11.925  1.814   1.00 0.00 ?  620  THR A O    4  
ATOM 5931  C CB   . THR A 1 64 ? -8.528  11.563  -0.626  1.00 0.00 ?  620  THR A CB   4  
ATOM 5932  O OG1  . THR A 1 64 ? -9.000  10.304  -1.157  1.00 0.00 ?  620  THR A OG1  4  
ATOM 5933  C CG2  . THR A 1 64 ? -8.961  12.709  -1.521  1.00 0.00 ?  620  THR A CG2  4  
ATOM 5934  H H    . THR A 1 64 ? -7.077  9.813   -1.681  1.00 0.00 ?  620  THR A H    4  
ATOM 5935  H HA   . THR A 1 64 ? -6.634  12.485  -0.686  1.00 0.00 ?  620  THR A HA   4  
ATOM 5936  H HB   . THR A 1 64 ? -8.929  11.687  0.365   1.00 0.00 ?  620  THR A HB   4  
ATOM 5937  H HG1  . THR A 1 64 ? -9.099  9.659   -0.434  1.00 0.00 ?  620  THR A HG1  4  
ATOM 5938  H HG21 . THR A 1 64 ? -10.037 12.714  -1.602  1.00 0.00 ?  620  THR A HG21 4  
ATOM 5939  H HG22 . THR A 1 64 ? -8.525  12.585  -2.501  1.00 0.00 ?  620  THR A HG22 4  
ATOM 5940  H HG23 . THR A 1 64 ? -8.628  13.643  -1.095  1.00 0.00 ?  620  THR A HG23 4  
ATOM 5941  N N    . LEU A 1 65 ? -6.567  9.761   1.136   1.00 0.00 ?  621  LEU A N    4  
ATOM 5942  C CA   . LEU A 1 65 ? -6.233  9.175   2.442   1.00 0.00 ?  621  LEU A CA   4  
ATOM 5943  C C    . LEU A 1 65 ? -4.966  9.788   3.032   1.00 0.00 ?  621  LEU A C    4  
ATOM 5944  O O    . LEU A 1 65 ? -3.950  9.998   2.333   1.00 0.00 ?  621  LEU A O    4  
ATOM 5945  C CB   . LEU A 1 65 ? -6.114  7.653   2.356   1.00 0.00 ?  621  LEU A CB   4  
ATOM 5946  C CG   . LEU A 1 65 ? -5.827  6.899   3.664   1.00 0.00 ?  621  LEU A CG   4  
ATOM 5947  C CD1  . LEU A 1 65 ? -6.938  7.103   4.676   1.00 0.00 ?  621  LEU A CD1  4  
ATOM 5948  C CD2  . LEU A 1 65 ? -5.629  5.425   3.386   1.00 0.00 ?  621  LEU A CD2  4  
ATOM 5949  H H    . LEU A 1 65 ? -6.786  9.173   0.381   1.00 0.00 ?  621  LEU A H    4  
ATOM 5950  H HA   . LEU A 1 65 ? -7.047  9.420   3.104   1.00 0.00 ?  621  LEU A HA   4  
ATOM 5951  H HB2  . LEU A 1 65 ? -7.020  7.257   1.924   1.00 0.00 ?  621  LEU A HB2  4  
ATOM 5952  H HB3  . LEU A 1 65 ? -5.299  7.447   1.684   1.00 0.00 ?  621  LEU A HB3  4  
ATOM 5953  H HG   . LEU A 1 65 ? -4.914  7.285   4.092   1.00 0.00 ?  621  LEU A HG   4  
ATOM 5954  H HD11 . LEU A 1 65 ? -7.870  6.744   4.264   1.00 0.00 ?  621  LEU A HD11 4  
ATOM 5955  H HD12 . LEU A 1 65 ? -7.027  8.153   4.914   1.00 0.00 ?  621  LEU A HD12 4  
ATOM 5956  H HD13 . LEU A 1 65 ? -6.710  6.551   5.576   1.00 0.00 ?  621  LEU A HD13 4  
ATOM 5957  H HD21 . LEU A 1 65 ? -6.492  5.033   2.867   1.00 0.00 ?  621  LEU A HD21 4  
ATOM 5958  H HD22 . LEU A 1 65 ? -5.505  4.898   4.320   1.00 0.00 ?  621  LEU A HD22 4  
ATOM 5959  H HD23 . LEU A 1 65 ? -4.745  5.290   2.782   1.00 0.00 ?  621  LEU A HD23 4  
ATOM 5960  N N    . LYS A 1 66 ? -5.051  10.046  4.306   1.00 0.00 ?  622  LYS A N    4  
ATOM 5961  C CA   . LYS A 1 66 ? -4.067  10.764  5.070   1.00 0.00 ?  622  LYS A CA   4  
ATOM 5962  C C    . LYS A 1 66 ? -2.813  9.902   5.330   1.00 0.00 ?  622  LYS A C    4  
ATOM 5963  O O    . LYS A 1 66 ? -2.900  8.661   5.399   1.00 0.00 ?  622  LYS A O    4  
ATOM 5964  C CB   . LYS A 1 66 ? -4.733  11.203  6.380   1.00 0.00 ?  622  LYS A CB   4  
ATOM 5965  C CG   . LYS A 1 66 ? -6.060  11.932  6.136   1.00 0.00 ?  622  LYS A CG   4  
ATOM 5966  C CD   . LYS A 1 66 ? -6.812  12.236  7.418   1.00 0.00 ?  622  LYS A CD   4  
ATOM 5967  C CE   . LYS A 1 66 ? -6.140  13.314  8.241   1.00 0.00 ?  622  LYS A CE   4  
ATOM 5968  N NZ   . LYS A 1 66 ? -6.852  13.540  9.511   1.00 0.00 1  622  LYS A NZ   4  
ATOM 5969  H H    . LYS A 1 66 ? -5.842  9.712   4.777   1.00 0.00 ?  622  LYS A H    4  
ATOM 5970  H HA   . LYS A 1 66 ? -3.799  11.650  4.515   1.00 0.00 ?  622  LYS A HA   4  
ATOM 5971  H HB2  . LYS A 1 66 ? -4.919  10.327  6.986   1.00 0.00 ?  622  LYS A HB2  4  
ATOM 5972  H HB3  . LYS A 1 66 ? -4.068  11.870  6.909   1.00 0.00 ?  622  LYS A HB3  4  
ATOM 5973  H HG2  . LYS A 1 66 ? -5.857  12.866  5.630   1.00 0.00 ?  622  LYS A HG2  4  
ATOM 5974  H HG3  . LYS A 1 66 ? -6.678  11.315  5.500   1.00 0.00 ?  622  LYS A HG3  4  
ATOM 5975  H HD2  . LYS A 1 66 ? -7.816  12.551  7.177   1.00 0.00 ?  622  LYS A HD2  4  
ATOM 5976  H HD3  . LYS A 1 66 ? -6.860  11.330  8.003   1.00 0.00 ?  622  LYS A HD3  4  
ATOM 5977  H HE2  . LYS A 1 66 ? -5.124  13.018  8.451   1.00 0.00 ?  622  LYS A HE2  4  
ATOM 5978  H HE3  . LYS A 1 66 ? -6.139  14.233  7.674   1.00 0.00 ?  622  LYS A HE3  4  
ATOM 5979  H HZ1  . LYS A 1 66 ? -7.818  13.881  9.343   1.00 0.00 ?  622  LYS A HZ1  4  
ATOM 5980  H HZ2  . LYS A 1 66 ? -6.360  14.217  10.126  1.00 0.00 ?  622  LYS A HZ2  4  
ATOM 5981  H HZ3  . LYS A 1 66 ? -6.928  12.640  10.029  1.00 0.00 ?  622  LYS A HZ3  4  
ATOM 5982  N N    . PRO A 1 67 ? -1.627  10.556  5.483   1.00 0.00 ?  623  PRO A N    4  
ATOM 5983  C CA   . PRO A 1 67 ? -0.325  9.877   5.693   1.00 0.00 ?  623  PRO A CA   4  
ATOM 5984  C C    . PRO A 1 67 ? -0.305  8.900   6.877   1.00 0.00 ?  623  PRO A C    4  
ATOM 5985  O O    . PRO A 1 67 ? 0.493   7.954   6.890   1.00 0.00 ?  623  PRO A O    4  
ATOM 5986  C CB   . PRO A 1 67 ? 0.637   11.035  5.966   1.00 0.00 ?  623  PRO A CB   4  
ATOM 5987  C CG   . PRO A 1 67 ? 0.029   12.190  5.264   1.00 0.00 ?  623  PRO A CG   4  
ATOM 5988  C CD   . PRO A 1 67 ? -1.450  12.029  5.429   1.00 0.00 ?  623  PRO A CD   4  
ATOM 5989  H HA   . PRO A 1 67 ? -0.012  9.362   4.797   1.00 0.00 ?  623  PRO A HA   4  
ATOM 5990  H HB2  . PRO A 1 67 ? 0.707   11.204  7.030   1.00 0.00 ?  623  PRO A HB2  4  
ATOM 5991  H HB3  . PRO A 1 67 ? 1.611   10.795  5.569   1.00 0.00 ?  623  PRO A HB3  4  
ATOM 5992  H HG2  . PRO A 1 67 ? 0.362   13.115  5.711   1.00 0.00 ?  623  PRO A HG2  4  
ATOM 5993  H HG3  . PRO A 1 67 ? 0.290   12.162  4.216   1.00 0.00 ?  623  PRO A HG3  4  
ATOM 5994  H HD2  . PRO A 1 67 ? -1.787  12.500  6.340   1.00 0.00 ?  623  PRO A HD2  4  
ATOM 5995  H HD3  . PRO A 1 67 ? -1.956  12.443  4.570   1.00 0.00 ?  623  PRO A HD3  4  
ATOM 5996  N N    . THR A 1 68 ? -1.176  9.134   7.848   1.00 0.00 ?  624  THR A N    4  
ATOM 5997  C CA   . THR A 1 68 ? -1.291  8.310   9.033   1.00 0.00 ?  624  THR A CA   4  
ATOM 5998  C C    . THR A 1 68 ? -1.524  6.831   8.652   1.00 0.00 ?  624  THR A C    4  
ATOM 5999  O O    . THR A 1 68 ? -0.816  5.937   9.116   1.00 0.00 ?  624  THR A O    4  
ATOM 6000  C CB   . THR A 1 68 ? -2.476  8.810   9.880   1.00 0.00 ?  624  THR A CB   4  
ATOM 6001  O OG1  . THR A 1 68 ? -2.375  10.244  10.036  1.00 0.00 ?  624  THR A OG1  4  
ATOM 6002  C CG2  . THR A 1 68 ? -2.488  8.150   11.254  1.00 0.00 ?  624  THR A CG2  4  
ATOM 6003  H H    . THR A 1 68 ? -1.771  9.911   7.783   1.00 0.00 ?  624  THR A H    4  
ATOM 6004  H HA   . THR A 1 68 ? -0.386  8.404   9.615   1.00 0.00 ?  624  THR A HA   4  
ATOM 6005  H HB   . THR A 1 68 ? -3.393  8.577   9.359   1.00 0.00 ?  624  THR A HB   4  
ATOM 6006  H HG1  . THR A 1 68 ? -1.980  10.432  10.898  1.00 0.00 ?  624  THR A HG1  4  
ATOM 6007  H HG21 . THR A 1 68 ? -2.579  7.080   11.135  1.00 0.00 ?  624  THR A HG21 4  
ATOM 6008  H HG22 . THR A 1 68 ? -3.325  8.520   11.826  1.00 0.00 ?  624  THR A HG22 4  
ATOM 6009  H HG23 . THR A 1 68 ? -1.569  8.375   11.773  1.00 0.00 ?  624  THR A HG23 4  
ATOM 6010  N N    . THR A 1 69 ? -2.464  6.600   7.766   1.00 0.00 ?  625  THR A N    4  
ATOM 6011  C CA   . THR A 1 69 ? -2.804  5.265   7.361   1.00 0.00 ?  625  THR A CA   4  
ATOM 6012  C C    . THR A 1 69 ? -1.823  4.765   6.279   1.00 0.00 ?  625  THR A C    4  
ATOM 6013  O O    . THR A 1 69 ? -1.553  3.560   6.170   1.00 0.00 ?  625  THR A O    4  
ATOM 6014  C CB   . THR A 1 69 ? -4.245  5.248   6.839   1.00 0.00 ?  625  THR A CB   4  
ATOM 6015  O OG1  . THR A 1 69 ? -5.073  5.969   7.772   1.00 0.00 ?  625  THR A OG1  4  
ATOM 6016  C CG2  . THR A 1 69 ? -4.756  3.824   6.719   1.00 0.00 ?  625  THR A CG2  4  
ATOM 6017  H H    . THR A 1 69 ? -2.983  7.334   7.373   1.00 0.00 ?  625  THR A H    4  
ATOM 6018  H HA   . THR A 1 69 ? -2.738  4.620   8.224   1.00 0.00 ?  625  THR A HA   4  
ATOM 6019  H HB   . THR A 1 69 ? -4.283  5.734   5.874   1.00 0.00 ?  625  THR A HB   4  
ATOM 6020  H HG1  . THR A 1 69 ? -5.737  5.376   8.150   1.00 0.00 ?  625  THR A HG1  4  
ATOM 6021  H HG21 . THR A 1 69 ? -5.772  3.834   6.355   1.00 0.00 ?  625  THR A HG21 4  
ATOM 6022  H HG22 . THR A 1 69 ? -4.725  3.339   7.684   1.00 0.00 ?  625  THR A HG22 4  
ATOM 6023  H HG23 . THR A 1 69 ? -4.136  3.270   6.031   1.00 0.00 ?  625  THR A HG23 4  
ATOM 6024  N N    . LEU A 1 70 ? -1.253  5.713   5.523   1.00 0.00 ?  626  LEU A N    4  
ATOM 6025  C CA   . LEU A 1 70 ? -0.280  5.412   4.468   1.00 0.00 ?  626  LEU A CA   4  
ATOM 6026  C C    . LEU A 1 70 ? 0.905   4.671   5.055   1.00 0.00 ?  626  LEU A C    4  
ATOM 6027  O O    . LEU A 1 70 ? 1.392   3.688   4.480   1.00 0.00 ?  626  LEU A O    4  
ATOM 6028  C CB   . LEU A 1 70 ? 0.170   6.728   3.762   1.00 0.00 ?  626  LEU A CB   4  
ATOM 6029  C CG   . LEU A 1 70 ? 1.176   6.638   2.573   1.00 0.00 ?  626  LEU A CG   4  
ATOM 6030  C CD1  . LEU A 1 70 ? 1.145   7.923   1.797   1.00 0.00 ?  626  LEU A CD1  4  
ATOM 6031  C CD2  . LEU A 1 70 ? 2.614   6.408   3.042   1.00 0.00 ?  626  LEU A CD2  4  
ATOM 6032  H H    . LEU A 1 70 ? -1.507  6.645   5.690   1.00 0.00 ?  626  LEU A H    4  
ATOM 6033  H HA   . LEU A 1 70 ? -0.771  4.777   3.746   1.00 0.00 ?  626  LEU A HA   4  
ATOM 6034  H HB2  . LEU A 1 70 ? -0.718  7.223   3.398   1.00 0.00 ?  626  LEU A HB2  4  
ATOM 6035  H HB3  . LEU A 1 70 ? 0.610   7.356   4.522   1.00 0.00 ?  626  LEU A HB3  4  
ATOM 6036  H HG   . LEU A 1 70 ? 0.888   5.832   1.916   1.00 0.00 ?  626  LEU A HG   4  
ATOM 6037  H HD11 . LEU A 1 70 ? 1.840   7.863   0.973   1.00 0.00 ?  626  LEU A HD11 4  
ATOM 6038  H HD12 . LEU A 1 70 ? 1.419   8.742   2.446   1.00 0.00 ?  626  LEU A HD12 4  
ATOM 6039  H HD13 . LEU A 1 70 ? 0.148   8.082   1.415   1.00 0.00 ?  626  LEU A HD13 4  
ATOM 6040  H HD21 . LEU A 1 70 ? 2.665   5.487   3.604   1.00 0.00 ?  626  LEU A HD21 4  
ATOM 6041  H HD22 . LEU A 1 70 ? 2.925   7.229   3.670   1.00 0.00 ?  626  LEU A HD22 4  
ATOM 6042  H HD23 . LEU A 1 70 ? 3.265   6.343   2.182   1.00 0.00 ?  626  LEU A HD23 4  
ATOM 6043  N N    . ARG A 1 71 ? 1.336   5.129   6.218   1.00 0.00 ?  627  ARG A N    4  
ATOM 6044  C CA   . ARG A 1 71 ? 2.473   4.563   6.912   1.00 0.00 ?  627  ARG A CA   4  
ATOM 6045  C C    . ARG A 1 71 ? 2.278   3.079   7.185   1.00 0.00 ?  627  ARG A C    4  
ATOM 6046  O O    . ARG A 1 71 ? 3.204   2.315   7.045   1.00 0.00 ?  627  ARG A O    4  
ATOM 6047  C CB   . ARG A 1 71 ? 2.730   5.335   8.214   1.00 0.00 ?  627  ARG A CB   4  
ATOM 6048  C CG   . ARG A 1 71 ? 3.910   4.849   9.068   1.00 0.00 ?  627  ARG A CG   4  
ATOM 6049  C CD   . ARG A 1 71 ? 5.231   4.841   8.301   1.00 0.00 ?  627  ARG A CD   4  
ATOM 6050  N NE   . ARG A 1 71 ? 6.377   4.740   9.217   1.00 0.00 ?  627  ARG A NE   4  
ATOM 6051  C CZ   . ARG A 1 71 ? 7.658   4.594   8.859   1.00 0.00 ?  627  ARG A CZ   4  
ATOM 6052  N NH1  . ARG A 1 71 ? 7.986   4.105   7.684   1.00 0.00 1  627  ARG A NH1  4  
ATOM 6053  N NH2  . ARG A 1 71 ? 8.605   4.819   9.748   1.00 0.00 ?  627  ARG A NH2  4  
ATOM 6054  H H    . ARG A 1 71 ? 0.862   5.892   6.616   1.00 0.00 ?  627  ARG A H    4  
ATOM 6055  H HA   . ARG A 1 71 ? 3.336   4.679   6.273   1.00 0.00 ?  627  ARG A HA   4  
ATOM 6056  H HB2  . ARG A 1 71 ? 2.912   6.371   7.965   1.00 0.00 ?  627  ARG A HB2  4  
ATOM 6057  H HB3  . ARG A 1 71 ? 1.836   5.281   8.817   1.00 0.00 ?  627  ARG A HB3  4  
ATOM 6058  H HG2  . ARG A 1 71 ? 4.017   5.501   9.922   1.00 0.00 ?  627  ARG A HG2  4  
ATOM 6059  H HG3  . ARG A 1 71 ? 3.696   3.849   9.415   1.00 0.00 ?  627  ARG A HG3  4  
ATOM 6060  H HD2  . ARG A 1 71 ? 5.239   3.996   7.629   1.00 0.00 ?  627  ARG A HD2  4  
ATOM 6061  H HD3  . ARG A 1 71 ? 5.316   5.757   7.734   1.00 0.00 ?  627  ARG A HD3  4  
ATOM 6062  H HE   . ARG A 1 71 ? 6.157   4.905   10.167  1.00 0.00 ?  627  ARG A HE   4  
ATOM 6063  H HH11 . ARG A 1 71 ? 7.328   3.785   6.983   1.00 0.00 ?  627  ARG A HH11 4  
ATOM 6064  H HH12 . ARG A 1 71 ? 8.942   4.030   7.396   1.00 0.00 ?  627  ARG A HH12 4  
ATOM 6065  H HH21 . ARG A 1 71 ? 8.341   5.091   10.678  1.00 0.00 ?  627  ARG A HH21 4  
ATOM 6066  H HH22 . ARG A 1 71 ? 9.578   4.742   9.523   1.00 0.00 ?  627  ARG A HH22 4  
ATOM 6067  N N    . GLU A 1 72 ? 1.057   2.679   7.503   1.00 0.00 ?  628  GLU A N    4  
ATOM 6068  C CA   . GLU A 1 72 ? 0.777   1.290   7.837   1.00 0.00 ?  628  GLU A CA   4  
ATOM 6069  C C    . GLU A 1 72 ? 1.007   0.393   6.622   1.00 0.00 ?  628  GLU A C    4  
ATOM 6070  O O    . GLU A 1 72 ? 1.620   -0.676  6.721   1.00 0.00 ?  628  GLU A O    4  
ATOM 6071  C CB   . GLU A 1 72 ? -0.656  1.133   8.338   1.00 0.00 ?  628  GLU A CB   4  
ATOM 6072  C CG   . GLU A 1 72 ? -0.939  -0.236  8.934   1.00 0.00 ?  628  GLU A CG   4  
ATOM 6073  C CD   . GLU A 1 72 ? -0.026  -0.519  10.097  1.00 0.00 ?  628  GLU A CD   4  
ATOM 6074  O OE1  . GLU A 1 72 ? -0.119  0.188   11.103  1.00 0.00 ?  628  GLU A OE1  4  
ATOM 6075  O OE2  . GLU A 1 72 ? 0.798   -1.442  10.026  1.00 0.00 -1 628  GLU A OE2  4  
ATOM 6076  H H    . GLU A 1 72 ? 0.322   3.329   7.491   1.00 0.00 ?  628  GLU A H    4  
ATOM 6077  H HA   . GLU A 1 72 ? 1.461   1.000   8.621   1.00 0.00 ?  628  GLU A HA   4  
ATOM 6078  H HB2  . GLU A 1 72 ? -0.844  1.881   9.093   1.00 0.00 ?  628  GLU A HB2  4  
ATOM 6079  H HB3  . GLU A 1 72 ? -1.332  1.290   7.512   1.00 0.00 ?  628  GLU A HB3  4  
ATOM 6080  H HG2  . GLU A 1 72 ? -1.965  -0.279  9.266   1.00 0.00 ?  628  GLU A HG2  4  
ATOM 6081  H HG3  . GLU A 1 72 ? -0.783  -0.991  8.177   1.00 0.00 ?  628  GLU A HG3  4  
ATOM 6082  N N    . LEU A 1 73 ? 0.554   0.851   5.473   1.00 0.00 ?  629  LEU A N    4  
ATOM 6083  C CA   . LEU A 1 73 ? 0.695   0.085   4.258   1.00 0.00 ?  629  LEU A CA   4  
ATOM 6084  C C    . LEU A 1 73 ? 2.179   0.056   3.861   1.00 0.00 ?  629  LEU A C    4  
ATOM 6085  O O    . LEU A 1 73 ? 2.676   -0.954  3.399   1.00 0.00 ?  629  LEU A O    4  
ATOM 6086  C CB   . LEU A 1 73 ? -0.204  0.675   3.146   1.00 0.00 ?  629  LEU A CB   4  
ATOM 6087  C CG   . LEU A 1 73 ? -0.888  -0.338  2.191   1.00 0.00 ?  629  LEU A CG   4  
ATOM 6088  C CD1  . LEU A 1 73 ? -1.824  0.363   1.231   1.00 0.00 ?  629  LEU A CD1  4  
ATOM 6089  C CD2  . LEU A 1 73 ? 0.114   -1.166  1.421   1.00 0.00 ?  629  LEU A CD2  4  
ATOM 6090  H H    . LEU A 1 73 ? 0.120   1.732   5.452   1.00 0.00 ?  629  LEU A H    4  
ATOM 6091  H HA   . LEU A 1 73 ? 0.390   -0.928  4.471   1.00 0.00 ?  629  LEU A HA   4  
ATOM 6092  H HB2  . LEU A 1 73 ? -0.977  1.260   3.619   1.00 0.00 ?  629  LEU A HB2  4  
ATOM 6093  H HB3  . LEU A 1 73 ? 0.402   1.339   2.549   1.00 0.00 ?  629  LEU A HB3  4  
ATOM 6094  H HG   . LEU A 1 73 ? -1.491  -1.006  2.789   1.00 0.00 ?  629  LEU A HG   4  
ATOM 6095  H HD11 . LEU A 1 73 ? -2.279  -0.369  0.580   1.00 0.00 ?  629  LEU A HD11 4  
ATOM 6096  H HD12 . LEU A 1 73 ? -1.270  1.078   0.639   1.00 0.00 ?  629  LEU A HD12 4  
ATOM 6097  H HD13 . LEU A 1 73 ? -2.594  0.869   1.793   1.00 0.00 ?  629  LEU A HD13 4  
ATOM 6098  H HD21 . LEU A 1 73 ? -0.408  -1.846  0.765   1.00 0.00 ?  629  LEU A HD21 4  
ATOM 6099  H HD22 . LEU A 1 73 ? 0.704   -1.729  2.129   1.00 0.00 ?  629  LEU A HD22 4  
ATOM 6100  H HD23 . LEU A 1 73 ? 0.758   -0.520  0.843   1.00 0.00 ?  629  LEU A HD23 4  
ATOM 6101  N N    . GLU A 1 74 ? 2.876   1.155   4.127   1.00 0.00 ?  630  GLU A N    4  
ATOM 6102  C CA   . GLU A 1 74 ? 4.309   1.287   3.845   1.00 0.00 ?  630  GLU A CA   4  
ATOM 6103  C C    . GLU A 1 74 ? 5.093   0.245   4.675   1.00 0.00 ?  630  GLU A C    4  
ATOM 6104  O O    . GLU A 1 74 ? 6.018   -0.411  4.165   1.00 0.00 ?  630  GLU A O    4  
ATOM 6105  C CB   . GLU A 1 74 ? 4.733   2.757   4.142   1.00 0.00 ?  630  GLU A CB   4  
ATOM 6106  C CG   . GLU A 1 74 ? 6.160   3.192   3.751   1.00 0.00 ?  630  GLU A CG   4  
ATOM 6107  C CD   . GLU A 1 74 ? 7.240   2.747   4.712   1.00 0.00 ?  630  GLU A CD   4  
ATOM 6108  O OE1  . GLU A 1 74 ? 6.938   2.531   5.897   1.00 0.00 ?  630  GLU A OE1  4  
ATOM 6109  O OE2  . GLU A 1 74 ? 8.433   2.678   4.304   1.00 0.00 -1 630  GLU A OE2  4  
ATOM 6110  H H    . GLU A 1 74 ? 2.403   1.921   4.520   1.00 0.00 ?  630  GLU A H    4  
ATOM 6111  H HA   . GLU A 1 74 ? 4.458   1.073   2.797   1.00 0.00 ?  630  GLU A HA   4  
ATOM 6112  H HB2  . GLU A 1 74 ? 4.047   3.415   3.631   1.00 0.00 ?  630  GLU A HB2  4  
ATOM 6113  H HB3  . GLU A 1 74 ? 4.612   2.921   5.204   1.00 0.00 ?  630  GLU A HB3  4  
ATOM 6114  H HG2  . GLU A 1 74 ? 6.389   2.776   2.780   1.00 0.00 ?  630  GLU A HG2  4  
ATOM 6115  H HG3  . GLU A 1 74 ? 6.181   4.270   3.680   1.00 0.00 ?  630  GLU A HG3  4  
ATOM 6116  N N    . ARG A 1 75 ? 4.669   0.063   5.927   1.00 0.00 ?  631  ARG A N    4  
ATOM 6117  C CA   . ARG A 1 75 ? 5.262   -0.930  6.833   1.00 0.00 ?  631  ARG A CA   4  
ATOM 6118  C C    . ARG A 1 75 ? 5.039   -2.315  6.280   1.00 0.00 ?  631  ARG A C    4  
ATOM 6119  O O    . ARG A 1 75 ? 5.962   -3.152  6.254   1.00 0.00 ?  631  ARG A O    4  
ATOM 6120  C CB   . ARG A 1 75 ? 4.604   -0.882  8.206   1.00 0.00 ?  631  ARG A CB   4  
ATOM 6121  C CG   . ARG A 1 75 ? 4.604   0.467   8.849   1.00 0.00 ?  631  ARG A CG   4  
ATOM 6122  C CD   . ARG A 1 75 ? 3.895   0.428   10.187  1.00 0.00 ?  631  ARG A CD   4  
ATOM 6123  N NE   . ARG A 1 75 ? 4.625   -0.392  11.160  1.00 0.00 ?  631  ARG A NE   4  
ATOM 6124  C CZ   . ARG A 1 75 ? 4.077   -1.325  11.959  1.00 0.00 ?  631  ARG A CZ   4  
ATOM 6125  N NH1  . ARG A 1 75 ? 2.783   -1.653  11.843  1.00 0.00 1  631  ARG A NH1  4  
ATOM 6126  N NH2  . ARG A 1 75 ? 4.844   -1.967  12.843  1.00 0.00 ?  631  ARG A NH2  4  
ATOM 6127  H H    . ARG A 1 75 ? 3.940   0.639   6.245   1.00 0.00 ?  631  ARG A H    4  
ATOM 6128  H HA   . ARG A 1 75 ? 6.319   -0.733  6.935   1.00 0.00 ?  631  ARG A HA   4  
ATOM 6129  H HB2  . ARG A 1 75 ? 3.578   -1.200  8.107   1.00 0.00 ?  631  ARG A HB2  4  
ATOM 6130  H HB3  . ARG A 1 75 ? 5.119   -1.571  8.861   1.00 0.00 ?  631  ARG A HB3  4  
ATOM 6131  H HG2  . ARG A 1 75 ? 5.624   0.792   8.966   1.00 0.00 ?  631  ARG A HG2  4  
ATOM 6132  H HG3  . ARG A 1 75 ? 4.080   1.132   8.179   1.00 0.00 ?  631  ARG A HG3  4  
ATOM 6133  H HD2  . ARG A 1 75 ? 3.797   1.438   10.559  1.00 0.00 ?  631  ARG A HD2  4  
ATOM 6134  H HD3  . ARG A 1 75 ? 2.913   0.007   10.037  1.00 0.00 ?  631  ARG A HD3  4  
ATOM 6135  H HE   . ARG A 1 75 ? 5.585   -0.196  11.215  1.00 0.00 ?  631  ARG A HE   4  
ATOM 6136  H HH11 . ARG A 1 75 ? 2.148   -1.245  11.170  1.00 0.00 ?  631  ARG A HH11 4  
ATOM 6137  H HH12 . ARG A 1 75 ? 2.359   -2.337  12.438  1.00 0.00 ?  631  ARG A HH12 4  
ATOM 6138  H HH21 . ARG A 1 75 ? 5.826   -1.776  12.938  1.00 0.00 ?  631  ARG A HH21 4  
ATOM 6139  H HH22 . ARG A 1 75 ? 4.470   -2.675  13.449  1.00 0.00 ?  631  ARG A HH22 4  
ATOM 6140  N N    . TYR A 1 76 ? 3.805   -2.558  5.846   1.00 0.00 ?  632  TYR A N    4  
ATOM 6141  C CA   . TYR A 1 76 ? 3.418   -3.823  5.293   1.00 0.00 ?  632  TYR A CA   4  
ATOM 6142  C C    . TYR A 1 76 ? 4.245   -4.149  4.081   1.00 0.00 ?  632  TYR A C    4  
ATOM 6143  O O    . TYR A 1 76 ? 4.827   -5.217  4.003   1.00 0.00 ?  632  TYR A O    4  
ATOM 6144  C CB   . TYR A 1 76 ? 1.944   -3.825  4.876   1.00 0.00 ?  632  TYR A CB   4  
ATOM 6145  C CG   . TYR A 1 76 ? 1.553   -5.131  4.227   1.00 0.00 ?  632  TYR A CG   4  
ATOM 6146  C CD1  . TYR A 1 76 ? 1.622   -5.271  2.853   1.00 0.00 ?  632  TYR A CD1  4  
ATOM 6147  C CD2  . TYR A 1 76 ? 1.191   -6.230  4.983   1.00 0.00 ?  632  TYR A CD2  4  
ATOM 6148  C CE1  . TYR A 1 76 ? 1.353   -6.452  2.243   1.00 0.00 ?  632  TYR A CE1  4  
ATOM 6149  C CE2  . TYR A 1 76 ? 0.896   -7.436  4.377   1.00 0.00 ?  632  TYR A CE2  4  
ATOM 6150  C CZ   . TYR A 1 76 ? 0.985   -7.543  3.001   1.00 0.00 ?  632  TYR A CZ   4  
ATOM 6151  O OH   . TYR A 1 76 ? 0.744   -8.753  2.383   1.00 0.00 ?  632  TYR A OH   4  
ATOM 6152  H H    . TYR A 1 76 ? 3.122   -1.854  5.910   1.00 0.00 ?  632  TYR A H    4  
ATOM 6153  H HA   . TYR A 1 76 ? 3.558   -4.587  6.041   1.00 0.00 ?  632  TYR A HA   4  
ATOM 6154  H HB2  . TYR A 1 76 ? 1.291   -3.620  5.712   1.00 0.00 ?  632  TYR A HB2  4  
ATOM 6155  H HB3  . TYR A 1 76 ? 1.859   -3.058  4.117   1.00 0.00 ?  632  TYR A HB3  4  
ATOM 6156  H HD1  . TYR A 1 76 ? 1.906   -4.408  2.270   1.00 0.00 ?  632  TYR A HD1  4  
ATOM 6157  H HD2  . TYR A 1 76 ? 1.130   -6.123  6.055   1.00 0.00 ?  632  TYR A HD2  4  
ATOM 6158  H HE1  . TYR A 1 76 ? 1.432   -6.484  1.166   1.00 0.00 ?  632  TYR A HE1  4  
ATOM 6159  H HE2  . TYR A 1 76 ? 0.606   -8.283  4.981   1.00 0.00 ?  632  TYR A HE2  4  
ATOM 6160  H HH   . TYR A 1 76 ? 1.421   -8.835  1.701   1.00 0.00 ?  632  TYR A HH   4  
ATOM 6161  N N    . VAL A 1 77 ? 4.277   -3.218  3.137   1.00 0.00 ?  633  VAL A N    4  
ATOM 6162  C CA   . VAL A 1 77 ? 4.950   -3.425  1.861   1.00 0.00 ?  633  VAL A CA   4  
ATOM 6163  C C    . VAL A 1 77 ? 6.389   -3.796  2.092   1.00 0.00 ?  633  VAL A C    4  
ATOM 6164  O O    . VAL A 1 77 ? 6.861   -4.794  1.567   1.00 0.00 ?  633  VAL A O    4  
ATOM 6165  C CB   . VAL A 1 77 ? 4.872   -2.177  0.951   1.00 0.00 ?  633  VAL A CB   4  
ATOM 6166  C CG1  . VAL A 1 77 ? 5.676   -2.391  -0.297  1.00 0.00 ?  633  VAL A CG1  4  
ATOM 6167  C CG2  . VAL A 1 77 ? 3.441   -1.888  0.572   1.00 0.00 ?  633  VAL A CG2  4  
ATOM 6168  H H    . VAL A 1 77 ? 3.839   -2.354  3.332   1.00 0.00 ?  633  VAL A H    4  
ATOM 6169  H HA   . VAL A 1 77 ? 4.473   -4.255  1.351   1.00 0.00 ?  633  VAL A HA   4  
ATOM 6170  H HB   . VAL A 1 77 ? 5.263   -1.324  1.485   1.00 0.00 ?  633  VAL A HB   4  
ATOM 6171  H HG11 . VAL A 1 77 ? 5.604   -1.515  -0.922  1.00 0.00 ?  633  VAL A HG11 4  
ATOM 6172  H HG12 . VAL A 1 77 ? 5.265   -3.249  -0.807  1.00 0.00 ?  633  VAL A HG12 4  
ATOM 6173  H HG13 . VAL A 1 77 ? 6.704   -2.578  -0.028  1.00 0.00 ?  633  VAL A HG13 4  
ATOM 6174  H HG21 . VAL A 1 77 ? 3.406   -1.020  -0.070  1.00 0.00 ?  633  VAL A HG21 4  
ATOM 6175  H HG22 . VAL A 1 77 ? 2.870   -1.696  1.468   1.00 0.00 ?  633  VAL A HG22 4  
ATOM 6176  H HG23 . VAL A 1 77 ? 3.026   -2.741  0.054   1.00 0.00 ?  633  VAL A HG23 4  
ATOM 6177  N N    . LYS A 1 78 ? 7.041   -3.023  2.936   1.00 0.00 ?  634  LYS A N    4  
ATOM 6178  C CA   . LYS A 1 78 ? 8.421   -3.243  3.299   1.00 0.00 ?  634  LYS A CA   4  
ATOM 6179  C C    . LYS A 1 78 ? 8.596   -4.674  3.808   1.00 0.00 ?  634  LYS A C    4  
ATOM 6180  O O    . LYS A 1 78 ? 9.372   -5.444  3.258   1.00 0.00 ?  634  LYS A O    4  
ATOM 6181  C CB   . LYS A 1 78 ? 8.796   -2.231  4.375   1.00 0.00 ?  634  LYS A CB   4  
ATOM 6182  C CG   . LYS A 1 78 ? 10.271  -2.182  4.766   1.00 0.00 ?  634  LYS A CG   4  
ATOM 6183  C CD   . LYS A 1 78 ? 10.537  -1.038  5.755   1.00 0.00 ?  634  LYS A CD   4  
ATOM 6184  C CE   . LYS A 1 78 ? 10.051  0.291   5.181   1.00 0.00 ?  634  LYS A CE   4  
ATOM 6185  N NZ   . LYS A 1 78 ? 10.372  1.454   6.022   1.00 0.00 1  634  LYS A NZ   4  
ATOM 6186  H H    . LYS A 1 78 ? 6.563   -2.260  3.330   1.00 0.00 ?  634  LYS A H    4  
ATOM 6187  H HA   . LYS A 1 78 ? 9.040   -3.082  2.431   1.00 0.00 ?  634  LYS A HA   4  
ATOM 6188  H HB2  . LYS A 1 78 ? 8.514   -1.260  3.998   1.00 0.00 ?  634  LYS A HB2  4  
ATOM 6189  H HB3  . LYS A 1 78 ? 8.211   -2.435  5.261   1.00 0.00 ?  634  LYS A HB3  4  
ATOM 6190  H HG2  . LYS A 1 78 ? 10.542  -3.120  5.228   1.00 0.00 ?  634  LYS A HG2  4  
ATOM 6191  H HG3  . LYS A 1 78 ? 10.867  -2.025  3.879   1.00 0.00 ?  634  LYS A HG3  4  
ATOM 6192  H HD2  . LYS A 1 78 ? 10.009  -1.237  6.676   1.00 0.00 ?  634  LYS A HD2  4  
ATOM 6193  H HD3  . LYS A 1 78 ? 11.598  -0.971  5.948   1.00 0.00 ?  634  LYS A HD3  4  
ATOM 6194  H HE2  . LYS A 1 78 ? 10.496  0.444   4.209   1.00 0.00 ?  634  LYS A HE2  4  
ATOM 6195  H HE3  . LYS A 1 78 ? 8.978   0.248   5.068   1.00 0.00 ?  634  LYS A HE3  4  
ATOM 6196  H HZ1  . LYS A 1 78 ? 11.396  1.640   6.042   1.00 0.00 ?  634  LYS A HZ1  4  
ATOM 6197  H HZ2  . LYS A 1 78 ? 10.038  1.338   6.998   1.00 0.00 ?  634  LYS A HZ2  4  
ATOM 6198  H HZ3  . LYS A 1 78 ? 9.901   2.287   5.608   1.00 0.00 ?  634  LYS A HZ3  4  
ATOM 6199  N N    . SER A 1 79 ? 7.788   -5.042  4.772   1.00 0.00 ?  635  SER A N    4  
ATOM 6200  C CA   . SER A 1 79 ? 7.859   -6.351  5.380   1.00 0.00 ?  635  SER A CA   4  
ATOM 6201  C C    . SER A 1 79 ? 7.490   -7.480  4.384   1.00 0.00 ?  635  SER A C    4  
ATOM 6202  O O    . SER A 1 79 ? 8.091   -8.555  4.408   1.00 0.00 ?  635  SER A O    4  
ATOM 6203  C CB   . SER A 1 79 ? 6.949   -6.377  6.604   1.00 0.00 ?  635  SER A CB   4  
ATOM 6204  O OG   . SER A 1 79 ? 7.290   -5.306  7.488   1.00 0.00 ?  635  SER A OG   4  
ATOM 6205  H H    . SER A 1 79 ? 7.107   -4.412  5.093   1.00 0.00 ?  635  SER A H    4  
ATOM 6206  H HA   . SER A 1 79 ? 8.874   -6.508  5.708   1.00 0.00 ?  635  SER A HA   4  
ATOM 6207  H HB2  . SER A 1 79 ? 5.922   -6.266  6.292   1.00 0.00 ?  635  SER A HB2  4  
ATOM 6208  H HB3  . SER A 1 79 ? 7.072   -7.312  7.131   1.00 0.00 ?  635  SER A HB3  4  
ATOM 6209  H HG   . SER A 1 79 ? 6.673   -4.581  7.316   1.00 0.00 ?  635  SER A HG   4  
ATOM 6210  N N    . CYS A 1 80 ? 6.546   -7.215  3.496   1.00 0.00 ?  636  CYS A N    4  
ATOM 6211  C CA   . CYS A 1 80 ? 6.079   -8.193  2.543   1.00 0.00 ?  636  CYS A CA   4  
ATOM 6212  C C    . CYS A 1 80 ? 7.091   -8.409  1.409   1.00 0.00 ?  636  CYS A C    4  
ATOM 6213  O O    . CYS A 1 80 ? 6.993   -9.384  0.650   1.00 0.00 ?  636  CYS A O    4  
ATOM 6214  C CB   . CYS A 1 80 ? 4.721   -7.777  1.986   1.00 0.00 ?  636  CYS A CB   4  
ATOM 6215  S SG   . CYS A 1 80 ? 3.884   -9.098  1.086   1.00 0.00 ?  636  CYS A SG   4  
ATOM 6216  H H    . CYS A 1 80 ? 6.119   -6.328  3.481   1.00 0.00 ?  636  CYS A H    4  
ATOM 6217  H HA   . CYS A 1 80 ? 5.944   -9.127  3.062   1.00 0.00 ?  636  CYS A HA   4  
ATOM 6218  H HB2  . CYS A 1 80 ? 4.078   -7.473  2.799   1.00 0.00 ?  636  CYS A HB2  4  
ATOM 6219  H HB3  . CYS A 1 80 ? 4.857   -6.949  1.306   1.00 0.00 ?  636  CYS A HB3  4  
ATOM 6220  H HG   . CYS A 1 80 ? 4.862   -9.671  0.394   1.00 0.00 ?  636  CYS A HG   4  
ATOM 6221  N N    . LEU A 1 81 ? 8.040   -7.506  1.284   1.00 0.00 ?  637  LEU A N    4  
ATOM 6222  C CA   . LEU A 1 81 ? 9.057   -7.615  0.256   1.00 0.00 ?  637  LEU A CA   4  
ATOM 6223  C C    . LEU A 1 81 ? 10.352  -8.155  0.830   1.00 0.00 ?  637  LEU A C    4  
ATOM 6224  O O    . LEU A 1 81 ? 11.029  -8.967  0.191   1.00 0.00 ?  637  LEU A O    4  
ATOM 6225  C CB   . LEU A 1 81 ? 9.332   -6.257  -0.388  1.00 0.00 ?  637  LEU A CB   4  
ATOM 6226  C CG   . LEU A 1 81 ? 8.152   -5.559  -1.059  1.00 0.00 ?  637  LEU A CG   4  
ATOM 6227  C CD1  . LEU A 1 81 ? 8.588   -4.217  -1.602  1.00 0.00 ?  637  LEU A CD1  4  
ATOM 6228  C CD2  . LEU A 1 81 ? 7.556   -6.420  -2.164  1.00 0.00 ?  637  LEU A CD2  4  
ATOM 6229  H H    . LEU A 1 81 ? 8.042   -6.732  1.888   1.00 0.00 ?  637  LEU A H    4  
ATOM 6230  H HA   . LEU A 1 81 ? 8.699   -8.290  -0.506  1.00 0.00 ?  637  LEU A HA   4  
ATOM 6231  H HB2  . LEU A 1 81 ? 9.716   -5.599  0.378   1.00 0.00 ?  637  LEU A HB2  4  
ATOM 6232  H HB3  . LEU A 1 81 ? 10.106  -6.391  -1.128  1.00 0.00 ?  637  LEU A HB3  4  
ATOM 6233  H HG   . LEU A 1 81 ? 7.390   -5.378  -0.316  1.00 0.00 ?  637  LEU A HG   4  
ATOM 6234  H HD11 . LEU A 1 81 ? 7.741   -3.726  -2.058  1.00 0.00 ?  637  LEU A HD11 4  
ATOM 6235  H HD12 . LEU A 1 81 ? 9.362   -4.363  -2.339  1.00 0.00 ?  637  LEU A HD12 4  
ATOM 6236  H HD13 . LEU A 1 81 ? 8.968   -3.608  -0.797  1.00 0.00 ?  637  LEU A HD13 4  
ATOM 6237  H HD21 . LEU A 1 81 ? 8.316   -6.632  -2.900  1.00 0.00 ?  637  LEU A HD21 4  
ATOM 6238  H HD22 . LEU A 1 81 ? 6.740   -5.889  -2.631  1.00 0.00 ?  637  LEU A HD22 4  
ATOM 6239  H HD23 . LEU A 1 81 ? 7.188   -7.344  -1.743  1.00 0.00 ?  637  LEU A HD23 4  
ATOM 6240  N N    . GLN A 1 82 ? 10.696  -7.692  2.020   1.00 0.00 ?  638  GLN A N    4  
ATOM 6241  C CA   . GLN A 1 82 ? 11.940  -8.061  2.690   1.00 0.00 ?  638  GLN A CA   4  
ATOM 6242  C C    . GLN A 1 82 ? 12.047  -9.545  2.978   1.00 0.00 ?  638  GLN A C    4  
ATOM 6243  O O    . GLN A 1 82 ? 11.299  -10.076 3.801   1.00 0.00 ?  638  GLN A O    4  
ATOM 6244  C CB   . GLN A 1 82 ? 12.123  -7.280  3.990   1.00 0.00 ?  638  GLN A CB   4  
ATOM 6245  C CG   . GLN A 1 82 ? 12.321  -5.790  3.807   1.00 0.00 ?  638  GLN A CG   4  
ATOM 6246  C CD   . GLN A 1 82 ? 13.507  -5.474  2.940   1.00 0.00 ?  638  GLN A CD   4  
ATOM 6247  O OE1  . GLN A 1 82 ? 13.394  -5.340  1.726   1.00 0.00 ?  638  GLN A OE1  4  
ATOM 6248  N NE2  . GLN A 1 82 ? 14.646  -5.408  3.541   1.00 0.00 ?  638  GLN A NE2  4  
ATOM 6249  H H    . GLN A 1 82 ? 10.095  -7.061  2.472   1.00 0.00 ?  638  GLN A H    4  
ATOM 6250  H HA   . GLN A 1 82 ? 12.746  -7.788  2.026   1.00 0.00 ?  638  GLN A HA   4  
ATOM 6251  H HB2  . GLN A 1 82 ? 11.249  -7.426  4.606   1.00 0.00 ?  638  GLN A HB2  4  
ATOM 6252  H HB3  . GLN A 1 82 ? 12.984  -7.677  4.508   1.00 0.00 ?  638  GLN A HB3  4  
ATOM 6253  H HG2  . GLN A 1 82 ? 11.437  -5.376  3.344   1.00 0.00 ?  638  GLN A HG2  4  
ATOM 6254  H HG3  . GLN A 1 82 ? 12.468  -5.336  4.776   1.00 0.00 ?  638  GLN A HG3  4  
ATOM 6255  H HE21 . GLN A 1 82 ? 14.654  -5.574  4.508   1.00 0.00 ?  638  GLN A HE21 4  
ATOM 6256  H HE22 . GLN A 1 82 ? 15.443  -5.181  3.018   1.00 0.00 ?  638  GLN A HE22 4  
ATOM 6257  N N    . LYS A 1 83 ? 12.998  -10.178 2.288   1.00 0.00 ?  639  LYS A N    4  
ATOM 6258  C CA   . LYS A 1 83 ? 13.364  -11.587 2.436   1.00 0.00 ?  639  LYS A CA   4  
ATOM 6259  C C    . LYS A 1 83 ? 12.179  -12.536 2.513   1.00 0.00 ?  639  LYS A C    4  
ATOM 6260  O O    . LYS A 1 83 ? 11.721  -12.907 3.594   1.00 0.00 ?  639  LYS A O    4  
ATOM 6261  C CB   . LYS A 1 83 ? 14.344  -11.789 3.595   1.00 0.00 ?  639  LYS A CB   4  
ATOM 6262  C CG   . LYS A 1 83 ? 15.677  -11.100 3.372   1.00 0.00 ?  639  LYS A CG   4  
ATOM 6263  C CD   . LYS A 1 83 ? 16.608  -11.290 4.549   1.00 0.00 ?  639  LYS A CD   4  
ATOM 6264  C CE   . LYS A 1 83 ? 17.914  -10.544 4.329   1.00 0.00 ?  639  LYS A CE   4  
ATOM 6265  N NZ   . LYS A 1 83 ? 18.831  -10.659 5.483   1.00 0.00 1  639  LYS A NZ   4  
ATOM 6266  H H    . LYS A 1 83 ? 13.497  -9.646  1.632   1.00 0.00 ?  639  LYS A H    4  
ATOM 6267  H HA   . LYS A 1 83 ? 13.887  -11.839 1.525   1.00 0.00 ?  639  LYS A HA   4  
ATOM 6268  H HB2  . LYS A 1 83 ? 13.902  -11.359 4.482   1.00 0.00 ?  639  LYS A HB2  4  
ATOM 6269  H HB3  . LYS A 1 83 ? 14.520  -12.844 3.744   1.00 0.00 ?  639  LYS A HB3  4  
ATOM 6270  H HG2  . LYS A 1 83 ? 16.143  -11.514 2.491   1.00 0.00 ?  639  LYS A HG2  4  
ATOM 6271  H HG3  . LYS A 1 83 ? 15.501  -10.045 3.230   1.00 0.00 ?  639  LYS A HG3  4  
ATOM 6272  H HD2  . LYS A 1 83 ? 16.122  -10.912 5.436   1.00 0.00 ?  639  LYS A HD2  4  
ATOM 6273  H HD3  . LYS A 1 83 ? 16.813  -12.341 4.679   1.00 0.00 ?  639  LYS A HD3  4  
ATOM 6274  H HE2  . LYS A 1 83 ? 18.398  -10.966 3.460   1.00 0.00 ?  639  LYS A HE2  4  
ATOM 6275  H HE3  . LYS A 1 83 ? 17.699  -9.504  4.144   1.00 0.00 ?  639  LYS A HE3  4  
ATOM 6276  H HZ1  . LYS A 1 83 ? 18.356  -10.388 6.367   1.00 0.00 ?  639  LYS A HZ1  4  
ATOM 6277  H HZ2  . LYS A 1 83 ? 19.630  -10.006 5.366   1.00 0.00 ?  639  LYS A HZ2  4  
ATOM 6278  H HZ3  . LYS A 1 83 ? 19.200  -11.626 5.580   1.00 0.00 ?  639  LYS A HZ3  4  
ATOM 6279  N N    . LYS A 1 84 ? 11.675  -12.891 1.370   1.00 0.00 ?  640  LYS A N    4  
ATOM 6280  C CA   . LYS A 1 84 ? 10.552  -13.788 1.252   1.00 0.00 ?  640  LYS A CA   4  
ATOM 6281  C C    . LYS A 1 84 ? 10.890  -14.829 0.226   1.00 0.00 ?  640  LYS A C    4  
ATOM 6282  O O    . LYS A 1 84 ? 11.880  -14.665 -0.510  1.00 0.00 ?  640  LYS A O    4  
ATOM 6283  C CB   . LYS A 1 84 ? 9.302   -13.022 0.799   1.00 0.00 ?  640  LYS A CB   4  
ATOM 6284  C CG   . LYS A 1 84 ? 8.785   -11.982 1.784   1.00 0.00 ?  640  LYS A CG   4  
ATOM 6285  C CD   . LYS A 1 84 ? 8.358   -12.630 3.084   1.00 0.00 ?  640  LYS A CD   4  
ATOM 6286  C CE   . LYS A 1 84 ? 7.697   -11.636 4.010   1.00 0.00 ?  640  LYS A CE   4  
ATOM 6287  N NZ   . LYS A 1 84 ? 7.212   -12.277 5.243   1.00 0.00 1  640  LYS A NZ   4  
ATOM 6288  H H    . LYS A 1 84 ? 12.086  -12.556 0.546   1.00 0.00 ?  640  LYS A H    4  
ATOM 6289  H HA   . LYS A 1 84 ? 10.364  -14.253 2.208   1.00 0.00 ?  640  LYS A HA   4  
ATOM 6290  H HB2  . LYS A 1 84 ? 9.536   -12.516 -0.126  1.00 0.00 ?  640  LYS A HB2  4  
ATOM 6291  H HB3  . LYS A 1 84 ? 8.514   -13.735 0.607   1.00 0.00 ?  640  LYS A HB3  4  
ATOM 6292  H HG2  . LYS A 1 84 ? 9.575   -11.275 1.989   1.00 0.00 ?  640  LYS A HG2  4  
ATOM 6293  H HG3  . LYS A 1 84 ? 7.941   -11.468 1.347   1.00 0.00 ?  640  LYS A HG3  4  
ATOM 6294  H HD2  . LYS A 1 84 ? 7.667   -13.426 2.857   1.00 0.00 ?  640  LYS A HD2  4  
ATOM 6295  H HD3  . LYS A 1 84 ? 9.230   -13.042 3.571   1.00 0.00 ?  640  LYS A HD3  4  
ATOM 6296  H HE2  . LYS A 1 84 ? 8.412   -10.868 4.268   1.00 0.00 ?  640  LYS A HE2  4  
ATOM 6297  H HE3  . LYS A 1 84 ? 6.861   -11.185 3.494   1.00 0.00 ?  640  LYS A HE3  4  
ATOM 6298  H HZ1  . LYS A 1 84 ? 6.697   -11.590 5.831   1.00 0.00 ?  640  LYS A HZ1  4  
ATOM 6299  H HZ2  . LYS A 1 84 ? 8.004   -12.634 5.814   1.00 0.00 ?  640  LYS A HZ2  4  
ATOM 6300  H HZ3  . LYS A 1 84 ? 6.567   -13.062 5.024   1.00 0.00 ?  640  LYS A HZ3  4  
ATOM 6301  N N    . GLN A 1 85 ? 10.111  -15.891 0.166   1.00 0.00 ?  641  GLN A N    4  
ATOM 6302  C CA   . GLN A 1 85 ? 10.319  -16.907 -0.841  1.00 0.00 ?  641  GLN A CA   4  
ATOM 6303  C C    . GLN A 1 85 ? 9.823   -16.342 -2.156  1.00 0.00 ?  641  GLN A C    4  
ATOM 6304  O O    . GLN A 1 85 ? 8.615   -16.277 -2.405  1.00 0.00 ?  641  GLN A O    4  
ATOM 6305  C CB   . GLN A 1 85 ? 9.587   -18.234 -0.528  1.00 0.00 ?  641  GLN A CB   4  
ATOM 6306  C CG   . GLN A 1 85 ? 10.050  -19.011 0.721   1.00 0.00 ?  641  GLN A CG   4  
ATOM 6307  C CD   . GLN A 1 85 ? 9.687   -18.350 2.046   1.00 0.00 ?  641  GLN A CD   4  
ATOM 6308  O OE1  . GLN A 1 85 ? 8.598   -18.577 2.588   1.00 0.00 ?  641  GLN A OE1  4  
ATOM 6309  N NE2  . GLN A 1 85 ? 10.581  -17.574 2.596   1.00 0.00 ?  641  GLN A NE2  4  
ATOM 6310  H H    . GLN A 1 85 ? 9.364   -15.977 0.797   1.00 0.00 ?  641  GLN A H    4  
ATOM 6311  H HA   . GLN A 1 85 ? 11.383  -17.077 -0.918  1.00 0.00 ?  641  GLN A HA   4  
ATOM 6312  H HB2  . GLN A 1 85 ? 8.539   -18.011 -0.399  1.00 0.00 ?  641  GLN A HB2  4  
ATOM 6313  H HB3  . GLN A 1 85 ? 9.690   -18.884 -1.385  1.00 0.00 ?  641  GLN A HB3  4  
ATOM 6314  H HG2  . GLN A 1 85 ? 9.601   -19.993 0.706   1.00 0.00 ?  641  GLN A HG2  4  
ATOM 6315  H HG3  . GLN A 1 85 ? 11.124  -19.118 0.675   1.00 0.00 ?  641  GLN A HG3  4  
ATOM 6316  H HE21 . GLN A 1 85 ? 11.447  -17.438 2.147   1.00 0.00 ?  641  GLN A HE21 4  
ATOM 6317  H HE22 . GLN A 1 85 ? 10.362  -17.161 3.460   1.00 0.00 ?  641  GLN A HE22 4  
ATOM 6318  N N    . ARG A 1 86 ? 10.735  -15.905 -2.963  1.00 0.00 ?  642  ARG A N    4  
ATOM 6319  C CA   . ARG A 1 86 ? 10.401  -15.224 -4.180  1.00 0.00 ?  642  ARG A CA   4  
ATOM 6320  C C    . ARG A 1 86 ? 10.425  -16.141 -5.367  1.00 0.00 ?  642  ARG A C    4  
ATOM 6321  O O    . ARG A 1 86 ? 10.948  -17.260 -5.307  1.00 0.00 ?  642  ARG A O    4  
ATOM 6322  C CB   . ARG A 1 86 ? 11.356  -14.064 -4.417  1.00 0.00 ?  642  ARG A CB   4  
ATOM 6323  C CG   . ARG A 1 86 ? 11.298  -12.992 -3.357  1.00 0.00 ?  642  ARG A CG   4  
ATOM 6324  C CD   . ARG A 1 86 ? 12.326  -11.923 -3.629  1.00 0.00 ?  642  ARG A CD   4  
ATOM 6325  N NE   . ARG A 1 86 ? 12.304  -10.860 -2.623  1.00 0.00 ?  642  ARG A NE   4  
ATOM 6326  C CZ   . ARG A 1 86 ? 13.378  -10.161 -2.237  1.00 0.00 ?  642  ARG A CZ   4  
ATOM 6327  N NH1  . ARG A 1 86 ? 14.582  -10.457 -2.739  1.00 0.00 1  642  ARG A NH1  4  
ATOM 6328  N NH2  . ARG A 1 86 ? 13.247  -9.184  -1.349  1.00 0.00 ?  642  ARG A NH2  4  
ATOM 6329  H H    . ARG A 1 86 ? 11.678  -16.053 -2.736  1.00 0.00 ?  642  ARG A H    4  
ATOM 6330  H HA   . ARG A 1 86 ? 9.409   -14.816 -4.064  1.00 0.00 ?  642  ARG A HA   4  
ATOM 6331  H HB2  . ARG A 1 86 ? 12.363  -14.452 -4.448  1.00 0.00 ?  642  ARG A HB2  4  
ATOM 6332  H HB3  . ARG A 1 86 ? 11.124  -13.613 -5.372  1.00 0.00 ?  642  ARG A HB3  4  
ATOM 6333  H HG2  . ARG A 1 86 ? 10.312  -12.550 -3.357  1.00 0.00 ?  642  ARG A HG2  4  
ATOM 6334  H HG3  . ARG A 1 86 ? 11.497  -13.438 -2.393  1.00 0.00 ?  642  ARG A HG3  4  
ATOM 6335  H HD2  . ARG A 1 86 ? 13.302  -12.383 -3.633  1.00 0.00 ?  642  ARG A HD2  4  
ATOM 6336  H HD3  . ARG A 1 86 ? 12.130  -11.492 -4.599  1.00 0.00 ?  642  ARG A HD3  4  
ATOM 6337  H HE   . ARG A 1 86 ? 11.405  -10.667 -2.266  1.00 0.00 ?  642  ARG A HE   4  
ATOM 6338  H HH11 . ARG A 1 86 ? 14.719  -11.199 -3.402  1.00 0.00 ?  642  ARG A HH11 4  
ATOM 6339  H HH12 . ARG A 1 86 ? 15.418  -9.956  -2.499  1.00 0.00 ?  642  ARG A HH12 4  
ATOM 6340  H HH21 . ARG A 1 86 ? 12.354  -8.948  -0.945  1.00 0.00 ?  642  ARG A HH21 4  
ATOM 6341  H HH22 . ARG A 1 86 ? 14.008  -8.612  -1.026  1.00 0.00 ?  642  ARG A HH22 4  
ATOM 6342  N N    . LYS A 1 87 ? 9.827   -15.679 -6.418  1.00 0.00 ?  643  LYS A N    4  
ATOM 6343  C CA   . LYS A 1 87 ? 9.842   -16.348 -7.673  1.00 0.00 ?  643  LYS A CA   4  
ATOM 6344  C C    . LYS A 1 87 ? 10.684  -15.529 -8.634  1.00 0.00 ?  643  LYS A C    4  
ATOM 6345  O O    . LYS A 1 87 ? 10.281  -14.405 -8.994  1.00 0.00 ?  643  LYS A O    4  
ATOM 6346  C CB   . LYS A 1 87 ? 8.411   -16.622 -8.206  1.00 0.00 ?  643  LYS A CB   4  
ATOM 6347  C CG   . LYS A 1 87 ? 7.478   -15.415 -8.226  1.00 0.00 ?  643  LYS A CG   4  
ATOM 6348  C CD   . LYS A 1 87 ? 6.144   -15.757 -8.870  1.00 0.00 ?  643  LYS A CD   4  
ATOM 6349  C CE   . LYS A 1 87 ? 5.187   -14.575 -8.822  1.00 0.00 ?  643  LYS A CE   4  
ATOM 6350  N NZ   . LYS A 1 87 ? 3.934   -14.848 -9.555  1.00 0.00 1  643  LYS A NZ   4  
ATOM 6351  O OXT  . LYS A 1 87 ? 11.787  -15.964 -8.988  1.00 0.00 ?  643  LYS A OXT  4  
ATOM 6352  H H    . LYS A 1 87 ? 9.352   -14.819 -6.365  1.00 0.00 ?  643  LYS A H    4  
ATOM 6353  H HA   . LYS A 1 87 ? 10.353  -17.288 -7.515  1.00 0.00 ?  643  LYS A HA   4  
ATOM 6354  H HB2  . LYS A 1 87 ? 8.484   -16.997 -9.216  1.00 0.00 ?  643  LYS A HB2  4  
ATOM 6355  H HB3  . LYS A 1 87 ? 7.960   -17.386 -7.592  1.00 0.00 ?  643  LYS A HB3  4  
ATOM 6356  H HG2  . LYS A 1 87 ? 7.301   -15.093 -7.211  1.00 0.00 ?  643  LYS A HG2  4  
ATOM 6357  H HG3  . LYS A 1 87 ? 7.948   -14.618 -8.784  1.00 0.00 ?  643  LYS A HG3  4  
ATOM 6358  H HD2  . LYS A 1 87 ? 6.306   -16.033 -9.900  1.00 0.00 ?  643  LYS A HD2  4  
ATOM 6359  H HD3  . LYS A 1 87 ? 5.704   -16.588 -8.338  1.00 0.00 ?  643  LYS A HD3  4  
ATOM 6360  H HE2  . LYS A 1 87 ? 4.944   -14.371 -7.790  1.00 0.00 ?  643  LYS A HE2  4  
ATOM 6361  H HE3  . LYS A 1 87 ? 5.671   -13.713 -9.254  1.00 0.00 ?  643  LYS A HE3  4  
ATOM 6362  H HZ1  . LYS A 1 87 ? 3.290   -14.038 -9.464  1.00 0.00 ?  643  LYS A HZ1  4  
ATOM 6363  H HZ2  . LYS A 1 87 ? 3.453   -15.692 -9.190  1.00 0.00 ?  643  LYS A HZ2  4  
ATOM 6364  H HZ3  . LYS A 1 87 ? 4.123   -14.997 -10.567 1.00 0.00 ?  643  LYS A HZ3  4  
ATOM 6365  N N    . ARG B 2 1  ? -3.119  4.708   -16.377 1.00 0.00 ?  1591 ARG B N    4  
ATOM 6366  C CA   . ARG B 2 1  ? -3.993  5.562   -17.175 1.00 0.00 ?  1591 ARG B CA   4  
ATOM 6367  C C    . ARG B 2 1  ? -4.562  6.706   -16.318 1.00 0.00 ?  1591 ARG B C    4  
ATOM 6368  O O    . ARG B 2 1  ? -4.970  7.744   -16.847 1.00 0.00 ?  1591 ARG B O    4  
ATOM 6369  C CB   . ARG B 2 1  ? -5.131  4.725   -17.793 1.00 0.00 ?  1591 ARG B CB   4  
ATOM 6370  C CG   . ARG B 2 1  ? -6.061  5.506   -18.705 1.00 0.00 ?  1591 ARG B CG   4  
ATOM 6371  C CD   . ARG B 2 1  ? -7.170  4.636   -19.264 1.00 0.00 ?  1591 ARG B CD   4  
ATOM 6372  N NE   . ARG B 2 1  ? -8.068  5.413   -20.130 1.00 0.00 ?  1591 ARG B NE   4  
ATOM 6373  C CZ   . ARG B 2 1  ? -9.195  4.957   -20.698 1.00 0.00 ?  1591 ARG B CZ   4  
ATOM 6374  N NH1  . ARG B 2 1  ? -9.564  3.688   -20.542 1.00 0.00 1  1591 ARG B NH1  4  
ATOM 6375  N NH2  . ARG B 2 1  ? -9.943  5.768   -21.434 1.00 0.00 ?  1591 ARG B NH2  4  
ATOM 6376  H H1   . ARG B 2 1  ? -2.348  5.278   -15.978 1.00 0.00 ?  1591 ARG B H1   4  
ATOM 6377  H HA   . ARG B 2 1  ? -3.401  5.993   -17.969 1.00 0.00 ?  1591 ARG B HA   4  
ATOM 6378  H HB2  . ARG B 2 1  ? -4.699  3.918   -18.366 1.00 0.00 ?  1591 ARG B HB2  4  
ATOM 6379  H HB3  . ARG B 2 1  ? -5.721  4.297   -16.997 1.00 0.00 ?  1591 ARG B HB3  4  
ATOM 6380  H HG2  . ARG B 2 1  ? -6.504  6.317   -18.146 1.00 0.00 ?  1591 ARG B HG2  4  
ATOM 6381  H HG3  . ARG B 2 1  ? -5.486  5.911   -19.524 1.00 0.00 ?  1591 ARG B HG3  4  
ATOM 6382  H HD2  . ARG B 2 1  ? -6.732  3.833   -19.838 1.00 0.00 ?  1591 ARG B HD2  4  
ATOM 6383  H HD3  . ARG B 2 1  ? -7.742  4.227   -18.446 1.00 0.00 ?  1591 ARG B HD3  4  
ATOM 6384  H HE   . ARG B 2 1  ? -7.778  6.345   -20.268 1.00 0.00 ?  1591 ARG B HE   4  
ATOM 6385  H HH11 . ARG B 2 1  ? -9.018  3.037   -20.006 1.00 0.00 ?  1591 ARG B HH11 4  
ATOM 6386  H HH12 . ARG B 2 1  ? -10.409 3.338   -20.955 1.00 0.00 ?  1591 ARG B HH12 4  
ATOM 6387  H HH21 . ARG B 2 1  ? -9.694  6.725   -21.592 1.00 0.00 ?  1591 ARG B HH21 4  
ATOM 6388  H HH22 . ARG B 2 1  ? -10.804 5.480   -21.863 1.00 0.00 ?  1591 ARG B HH22 4  
ATOM 6389  N N    . SER B 2 2  ? -4.562  6.544   -15.004 1.00 0.00 ?  1592 SER B N    4  
ATOM 6390  C CA   . SER B 2 2  ? -5.131  7.546   -14.136 1.00 0.00 ?  1592 SER B CA   4  
ATOM 6391  C C    . SER B 2 2  ? -4.234  7.745   -12.908 1.00 0.00 ?  1592 SER B C    4  
ATOM 6392  O O    . SER B 2 2  ? -3.545  6.827   -12.490 1.00 0.00 ?  1592 SER B O    4  
ATOM 6393  C CB   . SER B 2 2  ? -6.527  7.096   -13.704 1.00 0.00 ?  1592 SER B CB   4  
ATOM 6394  O OG   . SER B 2 2  ? -7.365  6.821   -14.828 1.00 0.00 ?  1592 SER B OG   4  
ATOM 6395  H H    . SER B 2 2  ? -4.166  5.763   -14.558 1.00 0.00 ?  1592 SER B H    4  
ATOM 6396  H HA   . SER B 2 2  ? -5.212  8.470   -14.686 1.00 0.00 ?  1592 SER B HA   4  
ATOM 6397  H HB2  . SER B 2 2  ? -6.426  6.186   -13.132 1.00 0.00 ?  1592 SER B HB2  4  
ATOM 6398  H HB3  . SER B 2 2  ? -6.988  7.858   -13.096 1.00 0.00 ?  1592 SER B HB3  4  
ATOM 6399  H HG   . SER B 2 2  ? -7.893  7.608   -15.022 1.00 0.00 ?  1592 SER B HG   4  
ATOM 6400  N N    . VAL B 2 3  ? -4.264  8.929   -12.327 1.00 0.00 ?  1593 VAL B N    4  
ATOM 6401  C CA   . VAL B 2 3  ? -3.438  9.247   -11.145 1.00 0.00 ?  1593 VAL B CA   4  
ATOM 6402  C C    . VAL B 2 3  ? -4.154  8.903   -9.830  1.00 0.00 ?  1593 VAL B C    4  
ATOM 6403  O O    . VAL B 2 3  ? -3.851  9.453   -8.764  1.00 0.00 ?  1593 VAL B O    4  
ATOM 6404  C CB   . VAL B 2 3  ? -2.978  10.726  -11.136 1.00 0.00 ?  1593 VAL B CB   4  
ATOM 6405  C CG1  . VAL B 2 3  ? -1.984  10.970  -12.254 1.00 0.00 ?  1593 VAL B CG1  4  
ATOM 6406  C CG2  . VAL B 2 3  ? -4.166  11.673  -11.276 1.00 0.00 ?  1593 VAL B CG2  4  
ATOM 6407  H H    . VAL B 2 3  ? -4.847  9.626   -12.700 1.00 0.00 ?  1593 VAL B H    4  
ATOM 6408  H HA   . VAL B 2 3  ? -2.564  8.615   -11.209 1.00 0.00 ?  1593 VAL B HA   4  
ATOM 6409  H HB   . VAL B 2 3  ? -2.488  10.922  -10.194 1.00 0.00 ?  1593 VAL B HB   4  
ATOM 6410  H HG11 . VAL B 2 3  ? -1.676  12.006  -12.245 1.00 0.00 ?  1593 VAL B HG11 4  
ATOM 6411  H HG12 . VAL B 2 3  ? -2.446  10.740  -13.201 1.00 0.00 ?  1593 VAL B HG12 4  
ATOM 6412  H HG13 . VAL B 2 3  ? -1.119  10.338  -12.115 1.00 0.00 ?  1593 VAL B HG13 4  
ATOM 6413  H HG21 . VAL B 2 3  ? -4.864  11.496  -10.471 1.00 0.00 ?  1593 VAL B HG21 4  
ATOM 6414  H HG22 . VAL B 2 3  ? -4.657  11.499  -12.222 1.00 0.00 ?  1593 VAL B HG22 4  
ATOM 6415  H HG23 . VAL B 2 3  ? -3.818  12.694  -11.231 1.00 0.00 ?  1593 VAL B HG23 4  
ATOM 6416  N N    . LYS B 2 4  ? -5.048  7.953   -9.915  1.00 0.00 ?  1594 LYS B N    4  
ATOM 6417  C CA   . LYS B 2 4  ? -5.805  7.472   -8.777  1.00 0.00 ?  1594 LYS B CA   4  
ATOM 6418  C C    . LYS B 2 4  ? -5.122  6.277   -8.173  1.00 0.00 ?  1594 LYS B C    4  
ATOM 6419  O O    . LYS B 2 4  ? -4.476  5.493   -8.874  1.00 0.00 ?  1594 LYS B O    4  
ATOM 6420  C CB   . LYS B 2 4  ? -7.250  7.133   -9.187  1.00 0.00 ?  1594 LYS B CB   4  
ATOM 6421  C CG   . LYS B 2 4  ? -7.369  6.164   -10.346 1.00 0.00 ?  1594 LYS B CG   4  
ATOM 6422  C CD   . LYS B 2 4  ? -8.818  5.834   -10.636 1.00 0.00 ?  1594 LYS B CD   4  
ATOM 6423  C CE   . LYS B 2 4  ? -8.949  4.961   -11.872 1.00 0.00 ?  1594 LYS B CE   4  
ATOM 6424  N NZ   . LYS B 2 4  ? -10.331 4.496   -12.064 1.00 0.00 1  1594 LYS B NZ   4  
ATOM 6425  H H    . LYS B 2 4  ? -5.173  7.531   -10.788 1.00 0.00 ?  1594 LYS B H    4  
ATOM 6426  H HA   . LYS B 2 4  ? -5.827  8.193   -7.966  1.00 0.00 ?  1594 LYS B HA   4  
ATOM 6427  H HB2  . LYS B 2 4  ? -7.754  6.698   -8.337  1.00 0.00 ?  1594 LYS B HB2  4  
ATOM 6428  H HB3  . LYS B 2 4  ? -7.754  8.049   -9.457  1.00 0.00 ?  1594 LYS B HB3  4  
ATOM 6429  H HG2  . LYS B 2 4  ? -6.929  6.619   -11.219 1.00 0.00 ?  1594 LYS B HG2  4  
ATOM 6430  H HG3  . LYS B 2 4  ? -6.839  5.256   -10.101 1.00 0.00 ?  1594 LYS B HG3  4  
ATOM 6431  H HD2  . LYS B 2 4  ? -9.241  5.316   -9.789  1.00 0.00 ?  1594 LYS B HD2  4  
ATOM 6432  H HD3  . LYS B 2 4  ? -9.358  6.755   -10.796 1.00 0.00 ?  1594 LYS B HD3  4  
ATOM 6433  H HE2  . LYS B 2 4  ? -8.654  5.538   -12.736 1.00 0.00 ?  1594 LYS B HE2  4  
ATOM 6434  H HE3  . LYS B 2 4  ? -8.295  4.108   -11.772 1.00 0.00 ?  1594 LYS B HE3  4  
ATOM 6435  H HZ1  . LYS B 2 4  ? -10.619 3.869   -11.284 1.00 0.00 ?  1594 LYS B HZ1  4  
ATOM 6436  H HZ2  . LYS B 2 4  ? -10.428 3.969   -12.951 1.00 0.00 ?  1594 LYS B HZ2  4  
ATOM 6437  H HZ3  . LYS B 2 4  ? -10.994 5.296   -12.092 1.00 0.00 ?  1594 LYS B HZ3  4  
ATOM 6438  N N    . VAL B 2 5  ? -5.257  6.149   -6.882  1.00 0.00 ?  1595 VAL B N    4  
ATOM 6439  C CA   . VAL B 2 5  ? -4.621  5.083   -6.147  1.00 0.00 ?  1595 VAL B CA   4  
ATOM 6440  C C    . VAL B 2 5  ? -5.701  4.123   -5.647  1.00 0.00 ?  1595 VAL B C    4  
ATOM 6441  O O    . VAL B 2 5  ? -5.429  3.183   -4.904  1.00 0.00 ?  1595 VAL B O    4  
ATOM 6442  C CB   . VAL B 2 5  ? -3.737  5.637   -4.952  1.00 0.00 ?  1595 VAL B CB   4  
ATOM 6443  C CG1  . VAL B 2 5  ? -2.897  4.540   -4.288  1.00 0.00 ?  1595 VAL B CG1  4  
ATOM 6444  C CG2  . VAL B 2 5  ? -2.864  6.829   -5.395  1.00 0.00 ?  1595 VAL B CG2  4  
ATOM 6445  H H    . VAL B 2 5  ? -5.827  6.791   -6.409  1.00 0.00 ?  1595 VAL B H    4  
ATOM 6446  H HA   . VAL B 2 5  ? -3.987  4.549   -6.841  1.00 0.00 ?  1595 VAL B HA   4  
ATOM 6447  H HB   . VAL B 2 5  ? -4.376  5.977   -4.145  1.00 0.00 ?  1595 VAL B HB   4  
ATOM 6448  H HG11 . VAL B 2 5  ? -3.547  3.995   -3.620  1.00 0.00 ?  1595 VAL B HG11 4  
ATOM 6449  H HG12 . VAL B 2 5  ? -2.070  4.953   -3.732  1.00 0.00 ?  1595 VAL B HG12 4  
ATOM 6450  H HG13 . VAL B 2 5  ? -2.526  3.822   -5.006  1.00 0.00 ?  1595 VAL B HG13 4  
ATOM 6451  H HG21 . VAL B 2 5  ? -3.500  7.661   -5.661  1.00 0.00 ?  1595 VAL B HG21 4  
ATOM 6452  H HG22 . VAL B 2 5  ? -2.254  6.604   -6.271  1.00 0.00 ?  1595 VAL B HG22 4  
ATOM 6453  H HG23 . VAL B 2 5  ? -2.245  7.120   -4.552  1.00 0.00 ?  1595 VAL B HG23 4  
ATOM 6454  N N    . LYS B 2 6  ? -6.960  4.377   -6.074  1.00 0.00 ?  1596 LYS B N    4  
ATOM 6455  C CA   . LYS B 2 6  ? -8.097  3.510   -5.726  1.00 0.00 ?  1596 LYS B CA   4  
ATOM 6456  C C    . LYS B 2 6  ? -7.894  2.173   -6.457  1.00 0.00 ?  1596 LYS B C    4  
ATOM 6457  O O    . LYS B 2 6  ? -8.399  1.964   -7.535  1.00 0.00 ?  1596 LYS B O    4  
ATOM 6458  C CB   . LYS B 2 6  ? -9.458  4.186   -6.101  1.00 0.00 ?  1596 LYS B CB   4  
ATOM 6459  C CG   . LYS B 2 6  ? -10.498 4.300   -4.946  1.00 0.00 ?  1596 LYS B CG   4  
ATOM 6460  C CD   . LYS B 2 6  ? -10.025 5.215   -3.799  1.00 0.00 ?  1596 LYS B CD   4  
ATOM 6461  C CE   . LYS B 2 6  ? -9.953  6.691   -4.202  1.00 0.00 ?  1596 LYS B CE   4  
ATOM 6462  N NZ   . LYS B 2 6  ? -11.282 7.274   -4.493  1.00 0.00 1  1596 LYS B NZ   4  
ATOM 6463  H H    . LYS B 2 6  ? -7.100  5.158   -6.645  1.00 0.00 ?  1596 LYS B H    4  
ATOM 6464  H HA   . LYS B 2 6  ? -8.045  3.325   -4.663  1.00 0.00 ?  1596 LYS B HA   4  
ATOM 6465  H HB2  . LYS B 2 6  ? -9.257  5.178   -6.473  1.00 0.00 ?  1596 LYS B HB2  4  
ATOM 6466  H HB3  . LYS B 2 6  ? -9.906  3.612   -6.899  1.00 0.00 ?  1596 LYS B HB3  4  
ATOM 6467  H HG2  . LYS B 2 6  ? -11.415 4.704   -5.345  1.00 0.00 ?  1596 LYS B HG2  4  
ATOM 6468  H HG3  . LYS B 2 6  ? -10.692 3.315   -4.546  1.00 0.00 ?  1596 LYS B HG3  4  
ATOM 6469  H HD2  . LYS B 2 6  ? -10.614 5.113   -2.892  1.00 0.00 ?  1596 LYS B HD2  4  
ATOM 6470  H HD3  . LYS B 2 6  ? -9.023  4.897   -3.555  1.00 0.00 ?  1596 LYS B HD3  4  
ATOM 6471  H HE2  . LYS B 2 6  ? -9.507  7.253   -3.396  1.00 0.00 ?  1596 LYS B HE2  4  
ATOM 6472  H HE3  . LYS B 2 6  ? -9.329  6.782   -5.079  1.00 0.00 ?  1596 LYS B HE3  4  
ATOM 6473  H HZ1  . LYS B 2 6  ? -11.763 6.799   -5.282  1.00 0.00 ?  1596 LYS B HZ1  4  
ATOM 6474  H HZ2  . LYS B 2 6  ? -11.182 8.279   -4.741  1.00 0.00 ?  1596 LYS B HZ2  4  
ATOM 6475  H HZ3  . LYS B 2 6  ? -11.908 7.228   -3.665  1.00 0.00 ?  1596 LYS B HZ3  4  
ATOM 6476  N N    . ILE B 2 7  ? -7.065  1.340   -5.839  1.00 0.00 ?  1597 ILE B N    4  
ATOM 6477  C CA   . ILE B 2 7  ? -6.494  0.114   -6.379  1.00 0.00 ?  1597 ILE B CA   4  
ATOM 6478  C C    . ILE B 2 7  ? -7.418  -0.824  -7.247  1.00 0.00 ?  1597 ILE B C    4  
ATOM 6479  O O    . ILE B 2 7  ? -7.207  -0.943  -8.450  1.00 0.00 ?  1597 ILE B O    4  
ATOM 6480  C CB   . ILE B 2 7  ? -5.727  -0.700  -5.272  1.00 0.00 ?  1597 ILE B CB   4  
ATOM 6481  C CG1  . ILE B 2 7  ? -4.853  -1.757  -5.891  1.00 0.00 ?  1597 ILE B CG1  4  
ATOM 6482  C CG2  . ILE B 2 7  ? -6.680  -1.357  -4.276  1.00 0.00 ?  1597 ILE B CG2  4  
ATOM 6483  C CD1  . ILE B 2 7  ? -3.843  -1.241  -6.906  1.00 0.00 ?  1597 ILE B CD1  4  
ATOM 6484  H H    . ILE B 2 7  ? -6.718  1.644   -4.975  1.00 0.00 ?  1597 ILE B H    4  
ATOM 6485  H HA   . ILE B 2 7  ? -5.718  0.519   -7.009  1.00 0.00 ?  1597 ILE B HA   4  
ATOM 6486  H HB   . ILE B 2 7  ? -5.087  -0.032  -4.708  1.00 0.00 ?  1597 ILE B HB   4  
ATOM 6487  H HG12 . ILE B 2 7  ? -4.314  -2.142  -5.036  1.00 0.00 ?  1597 ILE B HG12 4  
ATOM 6488  H HG13 . ILE B 2 7  ? -5.464  -2.530  -6.334  1.00 0.00 ?  1597 ILE B HG13 4  
ATOM 6489  H HG21 . ILE B 2 7  ? -6.167  -1.993  -3.567  1.00 0.00 ?  1597 ILE B HG21 4  
ATOM 6490  H HG22 . ILE B 2 7  ? -7.413  -1.957  -4.793  1.00 0.00 ?  1597 ILE B HG22 4  
ATOM 6491  H HG23 . ILE B 2 7  ? -7.185  -0.577  -3.727  1.00 0.00 ?  1597 ILE B HG23 4  
ATOM 6492  H HD11 . ILE B 2 7  ? -3.221  -0.487  -6.445  1.00 0.00 ?  1597 ILE B HD11 4  
ATOM 6493  H HD12 . ILE B 2 7  ? -4.352  -0.824  -7.762  1.00 0.00 ?  1597 ILE B HD12 4  
ATOM 6494  H HD13 . ILE B 2 7  ? -3.220  -2.060  -7.232  1.00 0.00 ?  1597 ILE B HD13 4  
ATOM 6495  N N    . LYS B 2 8  ? -8.432  -1.431  -6.622  1.00 0.00 ?  1598 LYS B N    4  
ATOM 6496  C CA   . LYS B 2 8  ? -9.244  -2.514  -7.185  1.00 0.00 ?  1598 LYS B CA   4  
ATOM 6497  C C    . LYS B 2 8  ? -8.405  -3.719  -7.599  1.00 0.00 ?  1598 LYS B C    4  
ATOM 6498  O O    . LYS B 2 8  ? -7.861  -3.785  -8.704  1.00 0.00 ?  1598 LYS B O    4  
ATOM 6499  C CB   . LYS B 2 8  ? -10.240 -2.121  -8.296  1.00 0.00 ?  1598 LYS B CB   4  
ATOM 6500  C CG   . LYS B 2 8  ? -11.386 -1.172  -7.909  1.00 0.00 ?  1598 LYS B CG   4  
ATOM 6501  C CD   . LYS B 2 8  ? -10.957 0.269   -7.896  1.00 0.00 ?  1598 LYS B CD   4  
ATOM 6502  C CE   . LYS B 2 8  ? -12.112 1.172   -7.891  1.00 0.00 ?  1598 LYS B CE   4  
ATOM 6503  N NZ   . LYS B 2 8  ? -12.955 1.048   -9.109  1.00 0.00 1  1598 LYS B NZ   4  
ATOM 6504  H H    . LYS B 2 8  ? -8.665  -1.146  -5.717  1.00 0.00 ?  1598 LYS B H    4  
ATOM 6505  H HA   . LYS B 2 8  ? -9.803  -2.903  -6.339  1.00 0.00 ?  1598 LYS B HA   4  
ATOM 6506  H HB2  . LYS B 2 8  ? -9.681  -1.644  -9.088  1.00 0.00 ?  1598 LYS B HB2  4  
ATOM 6507  H HB3  . LYS B 2 8  ? -10.672 -3.030  -8.690  1.00 0.00 ?  1598 LYS B HB3  4  
ATOM 6508  H HG2  . LYS B 2 8  ? -12.201 -1.270  -8.606  1.00 0.00 ?  1598 LYS B HG2  4  
ATOM 6509  H HG3  . LYS B 2 8  ? -11.742 -1.390  -6.905  1.00 0.00 ?  1598 LYS B HG3  4  
ATOM 6510  H HD2  . LYS B 2 8  ? -10.602 0.475   -6.893  1.00 0.00 ?  1598 LYS B HD2  4  
ATOM 6511  H HD3  . LYS B 2 8  ? -10.259 0.537   -8.672  1.00 0.00 ?  1598 LYS B HD3  4  
ATOM 6512  H HE2  . LYS B 2 8  ? -12.594 0.807   -6.995  1.00 0.00 ?  1598 LYS B HE2  4  
ATOM 6513  H HE3  . LYS B 2 8  ? -11.753 2.172   -7.699  1.00 0.00 ?  1598 LYS B HE3  4  
ATOM 6514  H HZ1  . LYS B 2 8  ? -13.757 1.704   -9.072  1.00 0.00 ?  1598 LYS B HZ1  4  
ATOM 6515  H HZ2  . LYS B 2 8  ? -13.333 0.086   -9.224  1.00 0.00 ?  1598 LYS B HZ2  4  
ATOM 6516  H HZ3  . LYS B 2 8  ? -12.406 1.273   -9.964  1.00 0.00 ?  1598 LYS B HZ3  4  
ATOM 6517  N N    . LEU B 2 9  ? -8.257  -4.656  -6.673  1.00 0.00 ?  1599 LEU B N    4  
ATOM 6518  C CA   . LEU B 2 9  ? -7.642  -5.937  -6.996  1.00 0.00 ?  1599 LEU B CA   4  
ATOM 6519  C C    . LEU B 2 9  ? -8.651  -6.810  -7.728  1.00 0.00 ?  1599 LEU B C    4  
ATOM 6520  O O    . LEU B 2 9  ? -8.309  -7.840  -8.319  1.00 0.00 ?  1599 LEU B O    4  
ATOM 6521  C CB   . LEU B 2 9  ? -7.054  -6.660  -5.766  1.00 0.00 ?  1599 LEU B CB   4  
ATOM 6522  C CG   . LEU B 2 9  ? -5.612  -6.317  -5.386  1.00 0.00 ?  1599 LEU B CG   4  
ATOM 6523  C CD1  . LEU B 2 9  ? -4.619  -6.702  -6.470  1.00 0.00 ?  1599 LEU B CD1  4  
ATOM 6524  C CD2  . LEU B 2 9  ? -5.486  -4.884  -5.072  1.00 0.00 ?  1599 LEU B CD2  4  
ATOM 6525  H H    . LEU B 2 9  ? -8.556  -4.469  -5.760  1.00 0.00 ?  1599 LEU B H    4  
ATOM 6526  H HA   . LEU B 2 9  ? -6.840  -5.689  -7.678  1.00 0.00 ?  1599 LEU B HA   4  
ATOM 6527  H HB2  . LEU B 2 9  ? -7.632  -6.465  -4.879  1.00 0.00 ?  1599 LEU B HB2  4  
ATOM 6528  H HB3  . LEU B 2 9  ? -7.124  -7.721  -5.931  1.00 0.00 ?  1599 LEU B HB3  4  
ATOM 6529  H HG   . LEU B 2 9  ? -5.387  -6.856  -4.472  1.00 0.00 ?  1599 LEU B HG   4  
ATOM 6530  H HD11 . LEU B 2 9  ? -4.698  -7.761  -6.671  1.00 0.00 ?  1599 LEU B HD11 4  
ATOM 6531  H HD12 . LEU B 2 9  ? -3.619  -6.475  -6.132  1.00 0.00 ?  1599 LEU B HD12 4  
ATOM 6532  H HD13 . LEU B 2 9  ? -4.822  -6.146  -7.373  1.00 0.00 ?  1599 LEU B HD13 4  
ATOM 6533  H HD21 . LEU B 2 9  ? -4.471  -4.569  -5.252  1.00 0.00 ?  1599 LEU B HD21 4  
ATOM 6534  H HD22 . LEU B 2 9  ? -5.661  -4.799  -4.007  1.00 0.00 ?  1599 LEU B HD22 4  
ATOM 6535  H HD23 . LEU B 2 9  ? -6.190  -4.290  -5.633  1.00 0.00 ?  1599 LEU B HD23 4  
ATOM 6536  N N    . GLY B 2 10 ? -9.898  -6.390  -7.656  1.00 0.00 ?  1600 GLY B N    4  
ATOM 6537  C CA   . GLY B 2 10 ? -10.950 -6.982  -8.428  1.00 0.00 ?  1600 GLY B CA   4  
ATOM 6538  C C    . GLY B 2 10 ? -10.969 -6.291  -9.765  1.00 0.00 ?  1600 GLY B C    4  
ATOM 6539  O O    . GLY B 2 10 ? -10.383 -5.214  -9.882  1.00 0.00 ?  1600 GLY B O    4  
ATOM 6540  H H    . GLY B 2 10 ? -10.105 -5.622  -7.088  1.00 0.00 ?  1600 GLY B H    4  
ATOM 6541  H HA2  . GLY B 2 10 ? -10.769 -8.039  -8.553  1.00 0.00 ?  1600 GLY B HA2  4  
ATOM 6542  H HA3  . GLY B 2 10 ? -11.898 -6.818  -7.938  1.00 0.00 ?  1600 GLY B HA3  4  
ATOM 6543  N N    . ARG B 2 11 ? -11.584 -6.906  -10.781 1.00 0.00 ?  1601 ARG B N    4  
ATOM 6544  C CA   . ARG B 2 11 ? -11.609 -6.354  -12.164 1.00 0.00 ?  1601 ARG B CA   4  
ATOM 6545  C C    . ARG B 2 11 ? -10.190 -6.414  -12.788 1.00 0.00 ?  1601 ARG B C    4  
ATOM 6546  O O    . ARG B 2 11 ? -9.947  -5.951  -13.911 1.00 0.00 ?  1601 ARG B O    4  
ATOM 6547  C CB   . ARG B 2 11 ? -12.187 -4.894  -12.172 1.00 0.00 ?  1601 ARG B CB   4  
ATOM 6548  C CG   . ARG B 2 11 ? -12.329 -4.198  -13.536 1.00 0.00 ?  1601 ARG B CG   4  
ATOM 6549  C CD   . ARG B 2 11 ? -13.355 -4.871  -14.437 1.00 0.00 ?  1601 ARG B CD   4  
ATOM 6550  N NE   . ARG B 2 11 ? -12.956 -6.222  -14.862 1.00 0.00 ?  1601 ARG B NE   4  
ATOM 6551  C CZ   . ARG B 2 11 ? -13.792 -7.274  -14.953 1.00 0.00 ?  1601 ARG B CZ   4  
ATOM 6552  N NH1  . ARG B 2 11 ? -15.091 -7.125  -14.706 1.00 0.00 1  1601 ARG B NH1  4  
ATOM 6553  N NH2  . ARG B 2 11 ? -13.324 -8.455  -15.314 1.00 0.00 ?  1601 ARG B NH2  4  
ATOM 6554  H H    . ARG B 2 11 ? -12.068 -7.743  -10.611 1.00 0.00 ?  1601 ARG B H    4  
ATOM 6555  H HA   . ARG B 2 11 ? -12.250 -6.999  -12.747 1.00 0.00 ?  1601 ARG B HA   4  
ATOM 6556  H HB2  . ARG B 2 11 ? -13.171 -4.921  -11.731 1.00 0.00 ?  1601 ARG B HB2  4  
ATOM 6557  H HB3  . ARG B 2 11 ? -11.554 -4.284  -11.544 1.00 0.00 ?  1601 ARG B HB3  4  
ATOM 6558  H HG2  . ARG B 2 11 ? -12.635 -3.175  -13.371 1.00 0.00 ?  1601 ARG B HG2  4  
ATOM 6559  H HG3  . ARG B 2 11 ? -11.366 -4.207  -14.025 1.00 0.00 ?  1601 ARG B HG3  4  
ATOM 6560  H HD2  . ARG B 2 11 ? -14.290 -4.935  -13.899 1.00 0.00 ?  1601 ARG B HD2  4  
ATOM 6561  H HD3  . ARG B 2 11 ? -13.490 -4.255  -15.313 1.00 0.00 ?  1601 ARG B HD3  4  
ATOM 6562  H HE   . ARG B 2 11 ? -11.999 -6.317  -15.072 1.00 0.00 ?  1601 ARG B HE   4  
ATOM 6563  H HH11 . ARG B 2 11 ? -15.495 -6.237  -14.465 1.00 0.00 ?  1601 ARG B HH11 4  
ATOM 6564  H HH12 . ARG B 2 11 ? -15.730 -7.897  -14.708 1.00 0.00 ?  1601 ARG B HH12 4  
ATOM 6565  H HH21 . ARG B 2 11 ? -12.355 -8.602  -15.526 1.00 0.00 ?  1601 ARG B HH21 4  
ATOM 6566  H HH22 . ARG B 2 11 ? -13.914 -9.265  -15.384 1.00 0.00 ?  1601 ARG B HH22 4  
ATOM 6567  N N    . LYS B 2 12 ? -9.293  -7.043  -12.080 1.00 0.00 ?  1602 LYS B N    4  
ATOM 6568  C CA   . LYS B 2 12 ? -7.901  -7.128  -12.462 1.00 0.00 ?  1602 LYS B CA   4  
ATOM 6569  C C    . LYS B 2 12 ? -7.512  -8.569  -12.793 1.00 0.00 ?  1602 LYS B C    4  
ATOM 6570  O O    . LYS B 2 12 ? -8.341  -9.340  -13.324 1.00 0.00 ?  1602 LYS B O    4  
ATOM 6571  C CB   . LYS B 2 12 ? -7.035  -6.568  -11.327 1.00 0.00 ?  1602 LYS B CB   4  
ATOM 6572  C CG   . LYS B 2 12 ? -5.547  -6.643  -11.569 1.00 0.00 ?  1602 LYS B CG   4  
ATOM 6573  C CD   . LYS B 2 12 ? -4.765  -6.012  -10.430 1.00 0.00 ?  1602 LYS B CD   4  
ATOM 6574  C CE   . LYS B 2 12 ? -3.264  -6.066  -10.689 1.00 0.00 ?  1602 LYS B CE   4  
ATOM 6575  N NZ   . LYS B 2 12 ? -2.898  -5.443  -11.982 1.00 0.00 1  1602 LYS B NZ   4  
ATOM 6576  H H    . LYS B 2 12 ? -9.594  -7.479  -11.258 1.00 0.00 ?  1602 LYS B H    4  
ATOM 6577  H HA   . LYS B 2 12 ? -7.754  -6.515  -13.339 1.00 0.00 ?  1602 LYS B HA   4  
ATOM 6578  H HB2  . LYS B 2 12 ? -7.295  -5.530  -11.174 1.00 0.00 ?  1602 LYS B HB2  4  
ATOM 6579  H HB3  . LYS B 2 12 ? -7.262  -7.112  -10.421 1.00 0.00 ?  1602 LYS B HB3  4  
ATOM 6580  H HG2  . LYS B 2 12 ? -5.270  -7.684  -11.650 1.00 0.00 ?  1602 LYS B HG2  4  
ATOM 6581  H HG3  . LYS B 2 12 ? -5.310  -6.132  -12.491 1.00 0.00 ?  1602 LYS B HG3  4  
ATOM 6582  H HD2  . LYS B 2 12 ? -5.069  -4.982  -10.310 1.00 0.00 ?  1602 LYS B HD2  4  
ATOM 6583  H HD3  . LYS B 2 12 ? -4.984  -6.556  -9.523  1.00 0.00 ?  1602 LYS B HD3  4  
ATOM 6584  H HE2  . LYS B 2 12 ? -2.753  -5.541  -9.894  1.00 0.00 ?  1602 LYS B HE2  4  
ATOM 6585  H HE3  . LYS B 2 12 ? -2.945  -7.098  -10.694 1.00 0.00 ?  1602 LYS B HE3  4  
ATOM 6586  H HZ1  . LYS B 2 12 ? -3.316  -5.973  -12.771 1.00 0.00 ?  1602 LYS B HZ1  4  
ATOM 6587  H HZ2  . LYS B 2 12 ? -1.866  -5.456  -12.106 1.00 0.00 ?  1602 LYS B HZ2  4  
ATOM 6588  H HZ3  . LYS B 2 12 ? -3.231  -4.458  -12.016 1.00 0.00 ?  1602 LYS B HZ3  4  
ATOM 6589  N N    . ALA A 1 1  ? -1.209  32.668  25.112  1.00 0.00 ?  557  ALA A N    5  
ATOM 6590  C CA   . ALA A 1 1  ? -1.484  31.307  24.675  1.00 0.00 ?  557  ALA A CA   5  
ATOM 6591  C C    . ALA A 1 1  ? -1.960  31.311  23.234  1.00 0.00 ?  557  ALA A C    5  
ATOM 6592  O O    . ALA A 1 1  ? -1.853  30.315  22.516  1.00 0.00 ?  557  ALA A O    5  
ATOM 6593  C CB   . ALA A 1 1  ? -2.538  30.675  25.573  1.00 0.00 ?  557  ALA A CB   5  
ATOM 6594  H H1   . ALA A 1 1  ? -0.563  33.193  24.592  1.00 0.00 ?  557  ALA A H1   5  
ATOM 6595  H HA   . ALA A 1 1  ? -0.574  30.729  24.747  1.00 0.00 ?  557  ALA A HA   5  
ATOM 6596  H HB1  . ALA A 1 1  ? -2.197  30.684  26.598  1.00 0.00 ?  557  ALA A HB1  5  
ATOM 6597  H HB2  . ALA A 1 1  ? -2.708  29.657  25.258  1.00 0.00 ?  557  ALA A HB2  5  
ATOM 6598  H HB3  . ALA A 1 1  ? -3.459  31.233  25.493  1.00 0.00 ?  557  ALA A HB3  5  
ATOM 6599  N N    . SER A 1 2  ? -2.444  32.443  22.825  1.00 0.00 ?  558  SER A N    5  
ATOM 6600  C CA   . SER A 1 2  ? -3.015  32.652  21.524  1.00 0.00 ?  558  SER A CA   5  
ATOM 6601  C C    . SER A 1 2  ? -1.983  32.571  20.381  1.00 0.00 ?  558  SER A C    5  
ATOM 6602  O O    . SER A 1 2  ? -2.270  31.999  19.322  1.00 0.00 ?  558  SER A O    5  
ATOM 6603  C CB   . SER A 1 2  ? -3.732  33.986  21.566  1.00 0.00 ?  558  SER A CB   5  
ATOM 6604  O OG   . SER A 1 2  ? -3.023  34.875  22.439  1.00 0.00 ?  558  SER A OG   5  
ATOM 6605  H H    . SER A 1 2  ? -2.433  33.217  23.431  1.00 0.00 ?  558  SER A H    5  
ATOM 6606  H HA   . SER A 1 2  ? -3.761  31.888  21.367  1.00 0.00 ?  558  SER A HA   5  
ATOM 6607  H HB2  . SER A 1 2  ? -3.758  34.411  20.573  1.00 0.00 ?  558  SER A HB2  5  
ATOM 6608  H HB3  . SER A 1 2  ? -4.735  33.855  21.942  1.00 0.00 ?  558  SER A HB3  5  
ATOM 6609  H HG   . SER A 1 2  ? -2.575  35.543  21.900  1.00 0.00 ?  558  SER A HG   5  
ATOM 6610  N N    . ALA A 1 3  ? -0.784  33.102  20.604  1.00 0.00 ?  559  ALA A N    5  
ATOM 6611  C CA   . ALA A 1 3  ? 0.252   33.090  19.569  1.00 0.00 ?  559  ALA A CA   5  
ATOM 6612  C C    . ALA A 1 3  ? 0.822   31.697  19.360  1.00 0.00 ?  559  ALA A C    5  
ATOM 6613  O O    . ALA A 1 3  ? 1.196   31.335  18.250  1.00 0.00 ?  559  ALA A O    5  
ATOM 6614  C CB   . ALA A 1 3  ? 1.359   34.070  19.880  1.00 0.00 ?  559  ALA A CB   5  
ATOM 6615  H H    . ALA A 1 3  ? -0.601  33.527  21.471  1.00 0.00 ?  559  ALA A H    5  
ATOM 6616  H HA   . ALA A 1 3  ? -0.222  33.394  18.648  1.00 0.00 ?  559  ALA A HA   5  
ATOM 6617  H HB1  . ALA A 1 3  ? 0.938   35.053  20.025  1.00 0.00 ?  559  ALA A HB1  5  
ATOM 6618  H HB2  . ALA A 1 3  ? 2.058   34.092  19.057  1.00 0.00 ?  559  ALA A HB2  5  
ATOM 6619  H HB3  . ALA A 1 3  ? 1.870   33.759  20.779  1.00 0.00 ?  559  ALA A HB3  5  
ATOM 6620  N N    . SER A 1 4  ? 0.882   30.912  20.419  1.00 0.00 ?  560  SER A N    5  
ATOM 6621  C CA   . SER A 1 4  ? 1.365   29.550  20.312  1.00 0.00 ?  560  SER A CA   5  
ATOM 6622  C C    . SER A 1 4  ? 0.304   28.655  19.685  1.00 0.00 ?  560  SER A C    5  
ATOM 6623  O O    . SER A 1 4  ? 0.633   27.604  19.122  1.00 0.00 ?  560  SER A O    5  
ATOM 6624  C CB   . SER A 1 4  ? 1.793   29.014  21.677  1.00 0.00 ?  560  SER A CB   5  
ATOM 6625  O OG   . SER A 1 4  ? 2.853   29.798  22.217  1.00 0.00 ?  560  SER A OG   5  
ATOM 6626  H H    . SER A 1 4  ? 0.608   31.253  21.296  1.00 0.00 ?  560  SER A H    5  
ATOM 6627  H HA   . SER A 1 4  ? 2.224   29.565  19.657  1.00 0.00 ?  560  SER A HA   5  
ATOM 6628  H HB2  . SER A 1 4  ? 0.951   29.059  22.353  1.00 0.00 ?  560  SER A HB2  5  
ATOM 6629  H HB3  . SER A 1 4  ? 2.125   27.991  21.581  1.00 0.00 ?  560  SER A HB3  5  
ATOM 6630  H HG   . SER A 1 4  ? 3.603   29.199  22.322  1.00 0.00 ?  560  SER A HG   5  
ATOM 6631  N N    . TYR A 1 5  ? -0.964  29.135  19.740  1.00 0.00 ?  561  TYR A N    5  
ATOM 6632  C CA   . TYR A 1 5  ? -2.140  28.463  19.222  1.00 0.00 ?  561  TYR A CA   5  
ATOM 6633  C C    . TYR A 1 5  ? -2.404  27.178  20.015  1.00 0.00 ?  561  TYR A C    5  
ATOM 6634  O O    . TYR A 1 5  ? -1.583  26.279  20.056  1.00 0.00 ?  561  TYR A O    5  
ATOM 6635  C CB   . TYR A 1 5  ? -1.935  28.233  17.740  1.00 0.00 ?  561  TYR A CB   5  
ATOM 6636  C CG   . TYR A 1 5  ? -3.157  27.877  16.928  1.00 0.00 ?  561  TYR A CG   5  
ATOM 6637  C CD1  . TYR A 1 5  ? -3.358  26.590  16.446  1.00 0.00 ?  561  TYR A CD1  5  
ATOM 6638  C CD2  . TYR A 1 5  ? -4.084  28.850  16.598  1.00 0.00 ?  561  TYR A CD2  5  
ATOM 6639  C CE1  . TYR A 1 5  ? -4.449  26.290  15.654  1.00 0.00 ?  561  TYR A CE1  5  
ATOM 6640  C CE2  . TYR A 1 5  ? -5.182  28.560  15.820  1.00 0.00 ?  561  TYR A CE2  5  
ATOM 6641  C CZ   . TYR A 1 5  ? -5.358  27.280  15.345  1.00 0.00 ?  561  TYR A CZ   5  
ATOM 6642  O OH   . TYR A 1 5  ? -6.443  26.995  14.539  1.00 0.00 ?  561  TYR A OH   5  
ATOM 6643  H H    . TYR A 1 5  ? -1.109  30.021  20.120  1.00 0.00 ?  561  TYR A H    5  
ATOM 6644  H HA   . TYR A 1 5  ? -2.977  29.129  19.369  1.00 0.00 ?  561  TYR A HA   5  
ATOM 6645  H HB2  . TYR A 1 5  ? -1.538  29.176  17.395  1.00 0.00 ?  561  TYR A HB2  5  
ATOM 6646  H HB3  . TYR A 1 5  ? -1.176  27.474  17.620  1.00 0.00 ?  561  TYR A HB3  5  
ATOM 6647  H HD1  . TYR A 1 5  ? -2.643  25.822  16.700  1.00 0.00 ?  561  TYR A HD1  5  
ATOM 6648  H HD2  . TYR A 1 5  ? -3.936  29.848  16.980  1.00 0.00 ?  561  TYR A HD2  5  
ATOM 6649  H HE1  . TYR A 1 5  ? -4.593  25.285  15.287  1.00 0.00 ?  561  TYR A HE1  5  
ATOM 6650  H HE2  . TYR A 1 5  ? -5.895  29.335  15.576  1.00 0.00 ?  561  TYR A HE2  5  
ATOM 6651  H HH   . TYR A 1 5  ? -6.860  26.181  14.851  1.00 0.00 ?  561  TYR A HH   5  
ATOM 6652  N N    . ASP A 1 6  ? -3.560  27.104  20.635  1.00 0.00 ?  562  ASP A N    5  
ATOM 6653  C CA   . ASP A 1 6  ? -3.895  26.005  21.587  1.00 0.00 ?  562  ASP A CA   5  
ATOM 6654  C C    . ASP A 1 6  ? -3.824  24.611  20.977  1.00 0.00 ?  562  ASP A C    5  
ATOM 6655  O O    . ASP A 1 6  ? -3.548  23.637  21.674  1.00 0.00 ?  562  ASP A O    5  
ATOM 6656  C CB   . ASP A 1 6  ? -5.253  26.220  22.292  1.00 0.00 ?  562  ASP A CB   5  
ATOM 6657  C CG   . ASP A 1 6  ? -6.442  26.184  21.361  1.00 0.00 ?  562  ASP A CG   5  
ATOM 6658  O OD1  . ASP A 1 6  ? -6.796  27.236  20.786  1.00 0.00 ?  562  ASP A OD1  5  
ATOM 6659  O OD2  . ASP A 1 6  ? -7.052  25.111  21.171  1.00 0.00 -1 562  ASP A OD2  5  
ATOM 6660  H H    . ASP A 1 6  ? -4.217  27.812  20.457  1.00 0.00 ?  562  ASP A H    5  
ATOM 6661  H HA   . ASP A 1 6  ? -3.122  26.031  22.337  1.00 0.00 ?  562  ASP A HA   5  
ATOM 6662  H HB2  . ASP A 1 6  ? -5.389  25.451  23.037  1.00 0.00 ?  562  ASP A HB2  5  
ATOM 6663  H HB3  . ASP A 1 6  ? -5.233  27.180  22.786  1.00 0.00 ?  562  ASP A HB3  5  
ATOM 6664  N N    . SER A 1 7  ? -4.036  24.519  19.709  1.00 0.00 ?  563  SER A N    5  
ATOM 6665  C CA   . SER A 1 7  ? -3.987  23.240  19.038  1.00 0.00 ?  563  SER A CA   5  
ATOM 6666  C C    . SER A 1 7  ? -2.563  22.953  18.523  1.00 0.00 ?  563  SER A C    5  
ATOM 6667  O O    . SER A 1 7  ? -2.188  21.807  18.327  1.00 0.00 ?  563  SER A O    5  
ATOM 6668  C CB   . SER A 1 7  ? -4.984  23.256  17.890  1.00 0.00 ?  563  SER A CB   5  
ATOM 6669  O OG   . SER A 1 7  ? -6.250  23.707  18.358  1.00 0.00 ?  563  SER A OG   5  
ATOM 6670  H H    . SER A 1 7  ? -4.247  25.342  19.225  1.00 0.00 ?  563  SER A H    5  
ATOM 6671  H HA   . SER A 1 7  ? -4.273  22.474  19.742  1.00 0.00 ?  563  SER A HA   5  
ATOM 6672  H HB2  . SER A 1 7  ? -4.633  23.923  17.117  1.00 0.00 ?  563  SER A HB2  5  
ATOM 6673  H HB3  . SER A 1 7  ? -5.096  22.258  17.491  1.00 0.00 ?  563  SER A HB3  5  
ATOM 6674  H HG   . SER A 1 7  ? -6.538  23.090  19.045  1.00 0.00 ?  563  SER A HG   5  
ATOM 6675  N N    . GLU A 1 8  ? -1.777  24.021  18.384  1.00 0.00 ?  564  GLU A N    5  
ATOM 6676  C CA   . GLU A 1 8  ? -0.429  24.016  17.805  1.00 0.00 ?  564  GLU A CA   5  
ATOM 6677  C C    . GLU A 1 8  ? -0.341  23.432  16.391  1.00 0.00 ?  564  GLU A C    5  
ATOM 6678  O O    . GLU A 1 8  ? -1.297  22.878  15.856  1.00 0.00 ?  564  GLU A O    5  
ATOM 6679  C CB   . GLU A 1 8  ? 0.664   23.434  18.716  1.00 0.00 ?  564  GLU A CB   5  
ATOM 6680  C CG   . GLU A 1 8  ? 0.934   24.250  19.970  1.00 0.00 ?  564  GLU A CG   5  
ATOM 6681  C CD   . GLU A 1 8  ? 2.261   23.911  20.595  1.00 0.00 ?  564  GLU A CD   5  
ATOM 6682  O OE1  . GLU A 1 8  ? 2.429   22.785  21.102  1.00 0.00 ?  564  GLU A OE1  5  
ATOM 6683  O OE2  . GLU A 1 8  ? 3.176   24.775  20.596  1.00 0.00 -1 564  GLU A OE2  5  
ATOM 6684  H H    . GLU A 1 8  ? -2.091  24.881  18.731  1.00 0.00 ?  564  GLU A H    5  
ATOM 6685  H HA   . GLU A 1 8  ? -0.233  25.071  17.691  1.00 0.00 ?  564  GLU A HA   5  
ATOM 6686  H HB2  . GLU A 1 8  ? 0.369   22.440  19.020  1.00 0.00 ?  564  GLU A HB2  5  
ATOM 6687  H HB3  . GLU A 1 8  ? 1.584   23.364  18.153  1.00 0.00 ?  564  GLU A HB3  5  
ATOM 6688  H HG2  . GLU A 1 8  ? 0.935   25.298  19.714  1.00 0.00 ?  564  GLU A HG2  5  
ATOM 6689  H HG3  . GLU A 1 8  ? 0.152   24.052  20.688  1.00 0.00 ?  564  GLU A HG3  5  
ATOM 6690  N N    . GLU A 1 9  ? 0.785   23.629  15.776  1.00 0.00 ?  565  GLU A N    5  
ATOM 6691  C CA   . GLU A 1 9  ? 1.033   23.118  14.456  1.00 0.00 ?  565  GLU A CA   5  
ATOM 6692  C C    . GLU A 1 9  ? 1.583   21.704  14.517  1.00 0.00 ?  565  GLU A C    5  
ATOM 6693  O O    . GLU A 1 9  ? 2.559   21.427  15.229  1.00 0.00 ?  565  GLU A O    5  
ATOM 6694  C CB   . GLU A 1 9  ? 1.964   24.067  13.674  1.00 0.00 ?  565  GLU A CB   5  
ATOM 6695  C CG   . GLU A 1 9  ? 3.270   24.424  14.382  1.00 0.00 ?  565  GLU A CG   5  
ATOM 6696  C CD   . GLU A 1 9  ? 4.063   25.474  13.640  1.00 0.00 ?  565  GLU A CD   5  
ATOM 6697  O OE1  . GLU A 1 9  ? 4.965   25.128  12.862  1.00 0.00 ?  565  GLU A OE1  5  
ATOM 6698  O OE2  . GLU A 1 9  ? 3.789   26.692  13.821  1.00 0.00 -1 565  GLU A OE2  5  
ATOM 6699  H H    . GLU A 1 9  ? 1.485   24.143  16.234  1.00 0.00 ?  565  GLU A H    5  
ATOM 6700  H HA   . GLU A 1 9  ? 0.080   23.081  13.950  1.00 0.00 ?  565  GLU A HA   5  
ATOM 6701  H HB2  . GLU A 1 9  ? 2.218   23.601  12.733  1.00 0.00 ?  565  GLU A HB2  5  
ATOM 6702  H HB3  . GLU A 1 9  ? 1.425   24.980  13.471  1.00 0.00 ?  565  GLU A HB3  5  
ATOM 6703  H HG2  . GLU A 1 9  ? 3.044   24.802  15.368  1.00 0.00 ?  565  GLU A HG2  5  
ATOM 6704  H HG3  . GLU A 1 9  ? 3.872   23.532  14.471  1.00 0.00 ?  565  GLU A HG3  5  
ATOM 6705  N N    . GLU A 1 10 ? 0.918   20.799  13.834  1.00 0.00 ?  566  GLU A N    5  
ATOM 6706  C CA   . GLU A 1 10 ? 1.374   19.436  13.748  1.00 0.00 ?  566  GLU A CA   5  
ATOM 6707  C C    . GLU A 1 10 ? 2.388   19.362  12.643  1.00 0.00 ?  566  GLU A C    5  
ATOM 6708  O O    . GLU A 1 10 ? 2.160   19.908  11.548  1.00 0.00 ?  566  GLU A O    5  
ATOM 6709  C CB   . GLU A 1 10 ? 0.228   18.490  13.443  1.00 0.00 ?  566  GLU A CB   5  
ATOM 6710  C CG   . GLU A 1 10 ? -0.892  18.506  14.457  1.00 0.00 ?  566  GLU A CG   5  
ATOM 6711  C CD   . GLU A 1 10 ? -1.930  17.479  14.131  1.00 0.00 ?  566  GLU A CD   5  
ATOM 6712  O OE1  . GLU A 1 10 ? -1.826  16.338  14.631  1.00 0.00 ?  566  GLU A OE1  5  
ATOM 6713  O OE2  . GLU A 1 10 ? -2.841  17.777  13.335  1.00 0.00 -1 566  GLU A OE2  5  
ATOM 6714  H H    . GLU A 1 10 ? 0.098   21.048  13.356  1.00 0.00 ?  566  GLU A H    5  
ATOM 6715  H HA   . GLU A 1 10 ? 1.836   19.167  14.686  1.00 0.00 ?  566  GLU A HA   5  
ATOM 6716  H HB2  . GLU A 1 10 ? -0.188  18.755  12.483  1.00 0.00 ?  566  GLU A HB2  5  
ATOM 6717  H HB3  . GLU A 1 10 ? 0.618   17.484  13.386  1.00 0.00 ?  566  GLU A HB3  5  
ATOM 6718  H HG2  . GLU A 1 10 ? -0.486  18.297  15.436  1.00 0.00 ?  566  GLU A HG2  5  
ATOM 6719  H HG3  . GLU A 1 10 ? -1.353  19.483  14.458  1.00 0.00 ?  566  GLU A HG3  5  
ATOM 6720  N N    . GLU A 1 11 ? 3.484   18.719  12.888  1.00 0.00 ?  567  GLU A N    5  
ATOM 6721  C CA   . GLU A 1 11 ? 4.521   18.698  11.910  1.00 0.00 ?  567  GLU A CA   5  
ATOM 6722  C C    . GLU A 1 11 ? 4.711   17.349  11.290  1.00 0.00 ?  567  GLU A C    5  
ATOM 6723  O O    . GLU A 1 11 ? 4.816   16.337  11.989  1.00 0.00 ?  567  GLU A O    5  
ATOM 6724  C CB   . GLU A 1 11 ? 5.829   19.216  12.458  1.00 0.00 ?  567  GLU A CB   5  
ATOM 6725  C CG   . GLU A 1 11 ? 5.758   20.638  12.949  1.00 0.00 ?  567  GLU A CG   5  
ATOM 6726  C CD   . GLU A 1 11 ? 7.108   21.173  13.257  1.00 0.00 ?  567  GLU A CD   5  
ATOM 6727  O OE1  . GLU A 1 11 ? 7.605   20.971  14.384  1.00 0.00 ?  567  GLU A OE1  5  
ATOM 6728  O OE2  . GLU A 1 11 ? 7.714   21.796  12.377  1.00 0.00 -1 567  GLU A OE2  5  
ATOM 6729  H H    . GLU A 1 11 ? 3.590   18.225  13.730  1.00 0.00 ?  567  GLU A H    5  
ATOM 6730  H HA   . GLU A 1 11 ? 4.199   19.377  11.138  1.00 0.00 ?  567  GLU A HA   5  
ATOM 6731  H HB2  . GLU A 1 11 ? 6.135   18.587  13.281  1.00 0.00 ?  567  GLU A HB2  5  
ATOM 6732  H HB3  . GLU A 1 11 ? 6.577   19.163  11.680  1.00 0.00 ?  567  GLU A HB3  5  
ATOM 6733  H HG2  . GLU A 1 11 ? 5.306   21.255  12.185  1.00 0.00 ?  567  GLU A HG2  5  
ATOM 6734  H HG3  . GLU A 1 11 ? 5.155   20.670  13.844  1.00 0.00 ?  567  GLU A HG3  5  
ATOM 6735  N N    . GLU A 1 12 ? 4.729   17.344  9.983   1.00 0.00 ?  568  GLU A N    5  
ATOM 6736  C CA   . GLU A 1 12 ? 5.013   16.174  9.195   1.00 0.00 ?  568  GLU A CA   5  
ATOM 6737  C C    . GLU A 1 12 ? 6.042   16.530  8.161   1.00 0.00 ?  568  GLU A C    5  
ATOM 6738  O O    . GLU A 1 12 ? 5.757   17.255  7.187   1.00 0.00 ?  568  GLU A O    5  
ATOM 6739  C CB   . GLU A 1 12 ? 3.754   15.578  8.555   1.00 0.00 ?  568  GLU A CB   5  
ATOM 6740  C CG   . GLU A 1 12 ? 2.890   14.790  9.526   1.00 0.00 ?  568  GLU A CG   5  
ATOM 6741  C CD   . GLU A 1 12 ? 3.505   13.457  9.918   1.00 0.00 ?  568  GLU A CD   5  
ATOM 6742  O OE1  . GLU A 1 12 ? 2.990   12.393  9.473   1.00 0.00 ?  568  GLU A OE1  5  
ATOM 6743  O OE2  . GLU A 1 12 ? 4.522   13.427  10.649  1.00 0.00 -1 568  GLU A OE2  5  
ATOM 6744  H H    . GLU A 1 12 ? 4.553   18.185  9.505   1.00 0.00 ?  568  GLU A H    5  
ATOM 6745  H HA   . GLU A 1 12 ? 5.453   15.450  9.865   1.00 0.00 ?  568  GLU A HA   5  
ATOM 6746  H HB2  . GLU A 1 12 ? 3.162   16.381  8.143   1.00 0.00 ?  568  GLU A HB2  5  
ATOM 6747  H HB3  . GLU A 1 12 ? 4.052   14.915  7.755   1.00 0.00 ?  568  GLU A HB3  5  
ATOM 6748  H HG2  . GLU A 1 12 ? 2.785   15.386  10.420  1.00 0.00 ?  568  GLU A HG2  5  
ATOM 6749  H HG3  . GLU A 1 12 ? 1.922   14.615  9.083   1.00 0.00 ?  568  GLU A HG3  5  
ATOM 6750  N N    . GLY A 1 13 ? 7.237   16.065  8.396   1.00 0.00 ?  569  GLY A N    5  
ATOM 6751  C CA   . GLY A 1 13 ? 8.343   16.355  7.541   1.00 0.00 ?  569  GLY A CA   5  
ATOM 6752  C C    . GLY A 1 13 ? 8.312   15.510  6.316   1.00 0.00 ?  569  GLY A C    5  
ATOM 6753  O O    . GLY A 1 13 ? 8.789   15.917  5.264   1.00 0.00 ?  569  GLY A O    5  
ATOM 6754  H H    . GLY A 1 13 ? 7.362   15.487  9.177   1.00 0.00 ?  569  GLY A H    5  
ATOM 6755  H HA2  . GLY A 1 13 ? 8.314   17.397  7.260   1.00 0.00 ?  569  GLY A HA2  5  
ATOM 6756  H HA3  . GLY A 1 13 ? 9.257   16.154  8.079   1.00 0.00 ?  569  GLY A HA3  5  
ATOM 6757  N N    . LEU A 1 14 ? 7.751   14.335  6.441   1.00 0.00 ?  570  LEU A N    5  
ATOM 6758  C CA   . LEU A 1 14 ? 7.606   13.470  5.310   1.00 0.00 ?  570  LEU A CA   5  
ATOM 6759  C C    . LEU A 1 14 ? 6.398   13.928  4.499   1.00 0.00 ?  570  LEU A C    5  
ATOM 6760  O O    . LEU A 1 14 ? 5.259   13.865  4.986   1.00 0.00 ?  570  LEU A O    5  
ATOM 6761  C CB   . LEU A 1 14 ? 7.489   12.005  5.738   1.00 0.00 ?  570  LEU A CB   5  
ATOM 6762  C CG   . LEU A 1 14 ? 8.721   11.410  6.439   1.00 0.00 ?  570  LEU A CG   5  
ATOM 6763  C CD1  . LEU A 1 14 ? 8.453   9.979   6.866   1.00 0.00 ?  570  LEU A CD1  5  
ATOM 6764  C CD2  . LEU A 1 14 ? 9.945   11.468  5.526   1.00 0.00 ?  570  LEU A CD2  5  
ATOM 6765  H H    . LEU A 1 14 ? 7.410   14.057  7.317   1.00 0.00 ?  570  LEU A H    5  
ATOM 6766  H HA   . LEU A 1 14 ? 8.504   13.612  4.731   1.00 0.00 ?  570  LEU A HA   5  
ATOM 6767  H HB2  . LEU A 1 14 ? 6.648   11.928  6.410   1.00 0.00 ?  570  LEU A HB2  5  
ATOM 6768  H HB3  . LEU A 1 14 ? 7.280   11.409  4.864   1.00 0.00 ?  570  LEU A HB3  5  
ATOM 6769  H HG   . LEU A 1 14 ? 8.935   11.986  7.327   1.00 0.00 ?  570  LEU A HG   5  
ATOM 6770  H HD11 . LEU A 1 14 ? 8.200   9.379   6.003   1.00 0.00 ?  570  LEU A HD11 5  
ATOM 6771  H HD12 . LEU A 1 14 ? 7.634   9.966   7.570   1.00 0.00 ?  570  LEU A HD12 5  
ATOM 6772  H HD13 . LEU A 1 14 ? 9.337   9.577   7.338   1.00 0.00 ?  570  LEU A HD13 5  
ATOM 6773  H HD21 . LEU A 1 14 ? 10.788  11.020  6.029   1.00 0.00 ?  570  LEU A HD21 5  
ATOM 6774  H HD22 . LEU A 1 14 ? 10.182  12.497  5.298   1.00 0.00 ?  570  LEU A HD22 5  
ATOM 6775  H HD23 . LEU A 1 14 ? 9.743   10.929  4.612   1.00 0.00 ?  570  LEU A HD23 5  
ATOM 6776  N N    . PRO A 1 15 ? 6.635   14.393  3.261   1.00 0.00 ?  571  PRO A N    5  
ATOM 6777  C CA   . PRO A 1 15 ? 5.605   15.010  2.417   1.00 0.00 ?  571  PRO A CA   5  
ATOM 6778  C C    . PRO A 1 15 ? 4.513   14.047  1.963   1.00 0.00 ?  571  PRO A C    5  
ATOM 6779  O O    . PRO A 1 15 ? 4.626   12.817  2.098   1.00 0.00 ?  571  PRO A O    5  
ATOM 6780  C CB   . PRO A 1 15 ? 6.393   15.532  1.209   1.00 0.00 ?  571  PRO A CB   5  
ATOM 6781  C CG   . PRO A 1 15 ? 7.597   14.667  1.143   1.00 0.00 ?  571  PRO A CG   5  
ATOM 6782  C CD   . PRO A 1 15 ? 7.941   14.336  2.562   1.00 0.00 ?  571  PRO A CD   5  
ATOM 6783  H HA   . PRO A 1 15 ? 5.142   15.845  2.922   1.00 0.00 ?  571  PRO A HA   5  
ATOM 6784  H HB2  . PRO A 1 15 ? 5.791   15.438  0.318   1.00 0.00 ?  571  PRO A HB2  5  
ATOM 6785  H HB3  . PRO A 1 15 ? 6.658   16.568  1.363   1.00 0.00 ?  571  PRO A HB3  5  
ATOM 6786  H HG2  . PRO A 1 15 ? 7.376   13.764  0.593   1.00 0.00 ?  571  PRO A HG2  5  
ATOM 6787  H HG3  . PRO A 1 15 ? 8.412   15.202  0.677   1.00 0.00 ?  571  PRO A HG3  5  
ATOM 6788  H HD2  . PRO A 1 15 ? 8.369   13.346  2.621   1.00 0.00 ?  571  PRO A HD2  5  
ATOM 6789  H HD3  . PRO A 1 15 ? 8.623   15.070  2.966   1.00 0.00 ?  571  PRO A HD3  5  
ATOM 6790  N N    . MET A 1 16 ? 3.454   14.614  1.458   1.00 0.00 ?  572  MET A N    5  
ATOM 6791  C CA   . MET A 1 16 ? 2.350   13.871  0.942   1.00 0.00 ?  572  MET A CA   5  
ATOM 6792  C C    . MET A 1 16 ? 2.119   14.246  -0.514  1.00 0.00 ?  572  MET A C    5  
ATOM 6793  O O    . MET A 1 16 ? 1.651   15.339  -0.828  1.00 0.00 ?  572  MET A O    5  
ATOM 6794  C CB   . MET A 1 16 ? 1.061   14.095  1.781   1.00 0.00 ?  572  MET A CB   5  
ATOM 6795  C CG   . MET A 1 16 ? 0.647   15.567  1.957   1.00 0.00 ?  572  MET A CG   5  
ATOM 6796  S SD   . MET A 1 16 ? -0.985  15.778  2.715   1.00 0.00 ?  572  MET A SD   5  
ATOM 6797  C CE   . MET A 1 16 ? -2.048  15.067  1.452   1.00 0.00 ?  572  MET A CE   5  
ATOM 6798  H H    . MET A 1 16 ? 3.422   15.595  1.397   1.00 0.00 ?  572  MET A H    5  
ATOM 6799  H HA   . MET A 1 16 ? 2.614   12.824  0.983   1.00 0.00 ?  572  MET A HA   5  
ATOM 6800  H HB2  . MET A 1 16 ? 0.246   13.576  1.298   1.00 0.00 ?  572  MET A HB2  5  
ATOM 6801  H HB3  . MET A 1 16 ? 1.209   13.667  2.762   1.00 0.00 ?  572  MET A HB3  5  
ATOM 6802  H HG2  . MET A 1 16 ? 1.378   16.050  2.589   1.00 0.00 ?  572  MET A HG2  5  
ATOM 6803  H HG3  . MET A 1 16 ? 0.646   16.042  0.987   1.00 0.00 ?  572  MET A HG3  5  
ATOM 6804  H HE1  . MET A 1 16 ? -3.077  15.161  1.766   1.00 0.00 ?  572  MET A HE1  5  
ATOM 6805  H HE2  . MET A 1 16 ? -1.814  14.020  1.328   1.00 0.00 ?  572  MET A HE2  5  
ATOM 6806  H HE3  . MET A 1 16 ? -1.907  15.587  0.517   1.00 0.00 ?  572  MET A HE3  5  
ATOM 6807  N N    . SER A 1 17 ? 2.475   13.370  -1.392  1.00 0.00 ?  573  SER A N    5  
ATOM 6808  C CA   . SER A 1 17 ? 2.265   13.595  -2.782  1.00 0.00 ?  573  SER A CA   5  
ATOM 6809  C C    . SER A 1 17 ? 1.490   12.417  -3.339  1.00 0.00 ?  573  SER A C    5  
ATOM 6810  O O    . SER A 1 17 ? 1.488   11.332  -2.718  1.00 0.00 ?  573  SER A O    5  
ATOM 6811  C CB   . SER A 1 17 ? 3.623   13.770  -3.481  1.00 0.00 ?  573  SER A CB   5  
ATOM 6812  O OG   . SER A 1 17 ? 4.461   12.644  -3.258  1.00 0.00 ?  573  SER A OG   5  
ATOM 6813  H H    . SER A 1 17 ? 2.910   12.529  -1.132  1.00 0.00 ?  573  SER A H    5  
ATOM 6814  H HA   . SER A 1 17 ? 1.683   14.498  -2.898  1.00 0.00 ?  573  SER A HA   5  
ATOM 6815  H HB2  . SER A 1 17 ? 3.481   13.887  -4.543  1.00 0.00 ?  573  SER A HB2  5  
ATOM 6816  H HB3  . SER A 1 17 ? 4.116   14.646  -3.087  1.00 0.00 ?  573  SER A HB3  5  
ATOM 6817  H HG   . SER A 1 17 ? 4.868   12.724  -2.377  1.00 0.00 ?  573  SER A HG   5  
ATOM 6818  N N    . TYR A 1 18 ? 0.830   12.605  -4.476  1.00 0.00 ?  574  TYR A N    5  
ATOM 6819  C CA   . TYR A 1 18 ? 0.082   11.532  -5.112  1.00 0.00 ?  574  TYR A CA   5  
ATOM 6820  C C    . TYR A 1 18 ? 1.027   10.432  -5.487  1.00 0.00 ?  574  TYR A C    5  
ATOM 6821  O O    . TYR A 1 18 ? 0.717   9.279   -5.327  1.00 0.00 ?  574  TYR A O    5  
ATOM 6822  C CB   . TYR A 1 18 ? -0.634  11.993  -6.390  1.00 0.00 ?  574  TYR A CB   5  
ATOM 6823  C CG   . TYR A 1 18 ? -1.699  13.044  -6.214  1.00 0.00 ?  574  TYR A CG   5  
ATOM 6824  C CD1  . TYR A 1 18 ? -1.404  14.386  -6.371  1.00 0.00 ?  574  TYR A CD1  5  
ATOM 6825  C CD2  . TYR A 1 18 ? -3.011  12.689  -5.931  1.00 0.00 ?  574  TYR A CD2  5  
ATOM 6826  C CE1  . TYR A 1 18 ? -2.376  15.346  -6.249  1.00 0.00 ?  574  TYR A CE1  5  
ATOM 6827  C CE2  . TYR A 1 18 ? -3.993  13.648  -5.799  1.00 0.00 ?  574  TYR A CE2  5  
ATOM 6828  C CZ   . TYR A 1 18 ? -3.668  14.977  -5.963  1.00 0.00 ?  574  TYR A CZ   5  
ATOM 6829  O OH   . TYR A 1 18 ? -4.643  15.944  -5.861  1.00 0.00 ?  574  TYR A OH   5  
ATOM 6830  H H    . TYR A 1 18 ? 0.872   13.477  -4.924  1.00 0.00 ?  574  TYR A H    5  
ATOM 6831  H HA   . TYR A 1 18 ? -0.649  11.157  -4.410  1.00 0.00 ?  574  TYR A HA   5  
ATOM 6832  H HB2  . TYR A 1 18 ? 0.096   12.394  -7.077  1.00 0.00 ?  574  TYR A HB2  5  
ATOM 6833  H HB3  . TYR A 1 18 ? -1.091  11.130  -6.854  1.00 0.00 ?  574  TYR A HB3  5  
ATOM 6834  H HD1  . TYR A 1 18 ? -0.388  14.678  -6.592  1.00 0.00 ?  574  TYR A HD1  5  
ATOM 6835  H HD2  . TYR A 1 18 ? -3.258  11.646  -5.803  1.00 0.00 ?  574  TYR A HD2  5  
ATOM 6836  H HE1  . TYR A 1 18 ? -2.124  16.389  -6.375  1.00 0.00 ?  574  TYR A HE1  5  
ATOM 6837  H HE2  . TYR A 1 18 ? -5.006  13.353  -5.574  1.00 0.00 ?  574  TYR A HE2  5  
ATOM 6838  H HH   . TYR A 1 18 ? -5.251  15.705  -5.151  1.00 0.00 ?  574  TYR A HH   5  
ATOM 6839  N N    . ASP A 1 19 ? 2.208   10.822  -5.944  1.00 0.00 ?  575  ASP A N    5  
ATOM 6840  C CA   . ASP A 1 19 ? 3.239   9.886   -6.393  1.00 0.00 ?  575  ASP A CA   5  
ATOM 6841  C C    . ASP A 1 19 ? 3.688   8.968   -5.267  1.00 0.00 ?  575  ASP A C    5  
ATOM 6842  O O    . ASP A 1 19 ? 3.923   7.784   -5.483  1.00 0.00 ?  575  ASP A O    5  
ATOM 6843  C CB   . ASP A 1 19 ? 4.446   10.624  -6.994  1.00 0.00 ?  575  ASP A CB   5  
ATOM 6844  C CG   . ASP A 1 19 ? 4.084   11.455  -8.208  1.00 0.00 ?  575  ASP A CG   5  
ATOM 6845  O OD1  . ASP A 1 19 ? 3.874   12.669  -8.070  1.00 0.00 ?  575  ASP A OD1  5  
ATOM 6846  O OD2  . ASP A 1 19 ? 3.975   10.914  -9.323  1.00 0.00 -1 575  ASP A OD2  5  
ATOM 6847  H H    . ASP A 1 19 ? 2.381   11.788  -5.983  1.00 0.00 ?  575  ASP A H    5  
ATOM 6848  H HA   . ASP A 1 19 ? 2.794   9.273   -7.162  1.00 0.00 ?  575  ASP A HA   5  
ATOM 6849  H HB2  . ASP A 1 19 ? 4.860   11.285  -6.247  1.00 0.00 ?  575  ASP A HB2  5  
ATOM 6850  H HB3  . ASP A 1 19 ? 5.196   9.903   -7.282  1.00 0.00 ?  575  ASP A HB3  5  
ATOM 6851  N N    . GLU A 1 20 ? 3.777   9.505   -4.055  1.00 0.00 ?  576  GLU A N    5  
ATOM 6852  C CA   . GLU A 1 20 ? 4.151   8.696   -2.898  1.00 0.00 ?  576  GLU A CA   5  
ATOM 6853  C C    . GLU A 1 20 ? 3.046   7.764   -2.500  1.00 0.00 ?  576  GLU A C    5  
ATOM 6854  O O    . GLU A 1 20 ? 3.301   6.618   -2.166  1.00 0.00 ?  576  GLU A O    5  
ATOM 6855  C CB   . GLU A 1 20 ? 4.582   9.545   -1.732  1.00 0.00 ?  576  GLU A CB   5  
ATOM 6856  C CG   . GLU A 1 20 ? 5.896   10.215  -1.980  1.00 0.00 ?  576  GLU A CG   5  
ATOM 6857  C CD   . GLU A 1 20 ? 6.278   11.152  -0.896  1.00 0.00 ?  576  GLU A CD   5  
ATOM 6858  O OE1  . GLU A 1 20 ? 7.080   10.760  -0.019  1.00 0.00 ?  576  GLU A OE1  5  
ATOM 6859  O OE2  . GLU A 1 20 ? 5.808   12.310  -0.923  1.00 0.00 -1 576  GLU A OE2  5  
ATOM 6860  H H    . GLU A 1 20 ? 3.598   10.464  -3.940  1.00 0.00 ?  576  GLU A H    5  
ATOM 6861  H HA   . GLU A 1 20 ? 4.990   8.094   -3.213  1.00 0.00 ?  576  GLU A HA   5  
ATOM 6862  H HB2  . GLU A 1 20 ? 3.831   10.301  -1.560  1.00 0.00 ?  576  GLU A HB2  5  
ATOM 6863  H HB3  . GLU A 1 20 ? 4.669   8.925   -0.853  1.00 0.00 ?  576  GLU A HB3  5  
ATOM 6864  H HG2  . GLU A 1 20 ? 6.663   9.463   -2.079  1.00 0.00 ?  576  GLU A HG2  5  
ATOM 6865  H HG3  . GLU A 1 20 ? 5.807   10.767  -2.903  1.00 0.00 ?  576  GLU A HG3  5  
ATOM 6866  N N    . LYS A 1 21 ? 1.815   8.249   -2.562  1.00 0.00 ?  577  LYS A N    5  
ATOM 6867  C CA   . LYS A 1 21 ? 0.650   7.414   -2.274  1.00 0.00 ?  577  LYS A CA   5  
ATOM 6868  C C    . LYS A 1 21 ? 0.579   6.305   -3.297  1.00 0.00 ?  577  LYS A C    5  
ATOM 6869  O O    . LYS A 1 21 ? 0.313   5.147   -2.997  1.00 0.00 ?  577  LYS A O    5  
ATOM 6870  C CB   . LYS A 1 21 ? -0.651  8.230   -2.357  1.00 0.00 ?  577  LYS A CB   5  
ATOM 6871  C CG   . LYS A 1 21 ? -0.784  9.347   -1.316  1.00 0.00 ?  577  LYS A CG   5  
ATOM 6872  C CD   . LYS A 1 21 ? -2.126  10.042  -1.445  1.00 0.00 ?  577  LYS A CD   5  
ATOM 6873  C CE   . LYS A 1 21 ? -2.368  11.065  -0.361  1.00 0.00 ?  577  LYS A CE   5  
ATOM 6874  N NZ   . LYS A 1 21 ? -3.737  11.630  -0.455  1.00 0.00 1  577  LYS A NZ   5  
ATOM 6875  H H    . LYS A 1 21 ? 1.694   9.193   -2.804  1.00 0.00 ?  577  LYS A H    5  
ATOM 6876  H HA   . LYS A 1 21 ? 0.759   7.009   -1.281  1.00 0.00 ?  577  LYS A HA   5  
ATOM 6877  H HB2  . LYS A 1 21 ? -0.725  8.644   -3.352  1.00 0.00 ?  577  LYS A HB2  5  
ATOM 6878  H HB3  . LYS A 1 21 ? -1.490  7.555   -2.264  1.00 0.00 ?  577  LYS A HB3  5  
ATOM 6879  H HG2  . LYS A 1 21 ? -0.708  8.934   -0.323  1.00 0.00 ?  577  LYS A HG2  5  
ATOM 6880  H HG3  . LYS A 1 21 ? 0.002   10.071  -1.472  1.00 0.00 ?  577  LYS A HG3  5  
ATOM 6881  H HD2  . LYS A 1 21 ? -2.166  10.543  -2.401  1.00 0.00 ?  577  LYS A HD2  5  
ATOM 6882  H HD3  . LYS A 1 21 ? -2.905  9.296   -1.405  1.00 0.00 ?  577  LYS A HD3  5  
ATOM 6883  H HE2  . LYS A 1 21 ? -2.250  10.587  0.600   1.00 0.00 ?  577  LYS A HE2  5  
ATOM 6884  H HE3  . LYS A 1 21 ? -1.647  11.863  -0.458  1.00 0.00 ?  577  LYS A HE3  5  
ATOM 6885  H HZ1  . LYS A 1 21 ? -3.933  11.979  -1.414  1.00 0.00 ?  577  LYS A HZ1  5  
ATOM 6886  H HZ2  . LYS A 1 21 ? -3.833  12.441  0.187   1.00 0.00 ?  577  LYS A HZ2  5  
ATOM 6887  H HZ3  . LYS A 1 21 ? -4.461  10.930  -0.183  1.00 0.00 ?  577  LYS A HZ3  5  
ATOM 6888  N N    . ARG A 1 22 ? 0.880   6.688   -4.495  1.00 0.00 ?  578  ARG A N    5  
ATOM 6889  C CA   . ARG A 1 22 ? 0.798   5.865   -5.640  1.00 0.00 ?  578  ARG A CA   5  
ATOM 6890  C C    . ARG A 1 22 ? 1.872   4.849   -5.699  1.00 0.00 ?  578  ARG A C    5  
ATOM 6891  O O    . ARG A 1 22 ? 1.693   3.820   -6.301  1.00 0.00 ?  578  ARG A O    5  
ATOM 6892  C CB   . ARG A 1 22 ? 0.741   6.693   -6.848  1.00 0.00 ?  578  ARG A CB   5  
ATOM 6893  C CG   . ARG A 1 22 ? -0.036  6.069   -7.943  1.00 0.00 ?  578  ARG A CG   5  
ATOM 6894  C CD   . ARG A 1 22 ? -0.616  7.166   -8.752  1.00 0.00 ?  578  ARG A CD   5  
ATOM 6895  N NE   . ARG A 1 22 ? 0.409   7.747   -9.631  1.00 0.00 ?  578  ARG A NE   5  
ATOM 6896  C CZ   . ARG A 1 22 ? 0.783   9.033   -9.675  1.00 0.00 ?  578  ARG A CZ   5  
ATOM 6897  N NH1  . ARG A 1 22 ? 0.050   9.977   -9.097  1.00 0.00 1  578  ARG A NH1  5  
ATOM 6898  N NH2  . ARG A 1 22 ? 1.869   9.368   -10.350 1.00 0.00 ?  578  ARG A NH2  5  
ATOM 6899  H H    . ARG A 1 22 ? 1.152   7.625   -4.621  1.00 0.00 ?  578  ARG A H    5  
ATOM 6900  H HA   . ARG A 1 22 ? -0.133  5.328   -5.576  1.00 0.00 ?  578  ARG A HA   5  
ATOM 6901  H HB2  . ARG A 1 22 ? 0.294   7.638   -6.578  1.00 0.00 ?  578  ARG A HB2  5  
ATOM 6902  H HB3  . ARG A 1 22 ? 1.739   6.880   -7.196  1.00 0.00 ?  578  ARG A HB3  5  
ATOM 6903  H HG2  . ARG A 1 22 ? 0.633   5.458   -8.540  1.00 0.00 ?  578  ARG A HG2  5  
ATOM 6904  H HG3  . ARG A 1 22 ? -0.819  5.445   -7.544  1.00 0.00 ?  578  ARG A HG3  5  
ATOM 6905  H HD2  . ARG A 1 22 ? -1.543  6.805   -9.161  1.00 0.00 ?  578  ARG A HD2  5  
ATOM 6906  H HD3  . ARG A 1 22 ? -0.928  7.927   -8.049  1.00 0.00 ?  578  ARG A HD3  5  
ATOM 6907  H HE   . ARG A 1 22 ? 0.907   7.092   -10.177 1.00 0.00 ?  578  ARG A HE   5  
ATOM 6908  H HH11 . ARG A 1 22 ? -0.804  9.757   -8.620  1.00 0.00 ?  578  ARG A HH11 5  
ATOM 6909  H HH12 . ARG A 1 22 ? 0.325   10.942  -9.142  1.00 0.00 ?  578  ARG A HH12 5  
ATOM 6910  H HH21 . ARG A 1 22 ? 2.403   8.670   -10.837 1.00 0.00 ?  578  ARG A HH21 5  
ATOM 6911  H HH22 . ARG A 1 22 ? 2.245   10.298  -10.363 1.00 0.00 ?  578  ARG A HH22 5  
ATOM 6912  N N    . GLN A 1 23 ? 2.990   5.136   -5.087  1.00 0.00 ?  579  GLN A N    5  
ATOM 6913  C CA   . GLN A 1 23 ? 4.085   4.191   -5.022  1.00 0.00 ?  579  GLN A CA   5  
ATOM 6914  C C    . GLN A 1 23 ? 3.574   2.885   -4.380  1.00 0.00 ?  579  GLN A C    5  
ATOM 6915  O O    . GLN A 1 23 ? 3.992   1.792   -4.741  1.00 0.00 ?  579  GLN A O    5  
ATOM 6916  C CB   . GLN A 1 23 ? 5.229   4.786   -4.196  1.00 0.00 ?  579  GLN A CB   5  
ATOM 6917  C CG   . GLN A 1 23 ? 6.538   4.037   -4.339  1.00 0.00 ?  579  GLN A CG   5  
ATOM 6918  C CD   . GLN A 1 23 ? 7.067   4.060   -5.762  1.00 0.00 ?  579  GLN A CD   5  
ATOM 6919  O OE1  . GLN A 1 23 ? 7.729   3.119   -6.204  1.00 0.00 ?  579  GLN A OE1  5  
ATOM 6920  N NE2  . GLN A 1 23 ? 6.816   5.134   -6.479  1.00 0.00 ?  579  GLN A NE2  5  
ATOM 6921  H H    . GLN A 1 23 ? 3.086   6.026   -4.687  1.00 0.00 ?  579  GLN A H    5  
ATOM 6922  H HA   . GLN A 1 23 ? 4.423   3.989   -6.027  1.00 0.00 ?  579  GLN A HA   5  
ATOM 6923  H HB2  . GLN A 1 23 ? 5.386   5.811   -4.502  1.00 0.00 ?  579  GLN A HB2  5  
ATOM 6924  H HB3  . GLN A 1 23 ? 4.945   4.776   -3.155  1.00 0.00 ?  579  GLN A HB3  5  
ATOM 6925  H HG2  . GLN A 1 23 ? 7.276   4.489   -3.694  1.00 0.00 ?  579  GLN A HG2  5  
ATOM 6926  H HG3  . GLN A 1 23 ? 6.384   3.009   -4.046  1.00 0.00 ?  579  GLN A HG3  5  
ATOM 6927  H HE21 . GLN A 1 23 ? 6.312   5.873   -6.076  1.00 0.00 ?  579  GLN A HE21 5  
ATOM 6928  H HE22 . GLN A 1 23 ? 7.129   5.169   -7.411  1.00 0.00 ?  579  GLN A HE22 5  
ATOM 6929  N N    . LEU A 1 24 ? 2.599   3.032   -3.492  1.00 0.00 ?  580  LEU A N    5  
ATOM 6930  C CA   . LEU A 1 24 ? 1.952   1.913   -2.854  1.00 0.00 ?  580  LEU A CA   5  
ATOM 6931  C C    . LEU A 1 24 ? 1.012   1.189   -3.809  1.00 0.00 ?  580  LEU A C    5  
ATOM 6932  O O    . LEU A 1 24 ? 0.870   -0.027  -3.724  1.00 0.00 ?  580  LEU A O    5  
ATOM 6933  C CB   . LEU A 1 24 ? 1.234   2.326   -1.555  1.00 0.00 ?  580  LEU A CB   5  
ATOM 6934  C CG   . LEU A 1 24 ? 2.136   2.638   -0.336  1.00 0.00 ?  580  LEU A CG   5  
ATOM 6935  C CD1  . LEU A 1 24 ? 3.021   1.467   -0.023  1.00 0.00 ?  580  LEU A CD1  5  
ATOM 6936  C CD2  . LEU A 1 24 ? 2.981   3.888   -0.525  1.00 0.00 ?  580  LEU A CD2  5  
ATOM 6937  H H    . LEU A 1 24 ? 2.305   3.941   -3.266  1.00 0.00 ?  580  LEU A H    5  
ATOM 6938  H HA   . LEU A 1 24 ? 2.718   1.200   -2.603  1.00 0.00 ?  580  LEU A HA   5  
ATOM 6939  H HB2  . LEU A 1 24 ? 0.645   3.205   -1.771  1.00 0.00 ?  580  LEU A HB2  5  
ATOM 6940  H HB3  . LEU A 1 24 ? 0.561   1.529   -1.279  1.00 0.00 ?  580  LEU A HB3  5  
ATOM 6941  H HG   . LEU A 1 24 ? 1.496   2.786   0.522   1.00 0.00 ?  580  LEU A HG   5  
ATOM 6942  H HD11 . LEU A 1 24 ? 3.641   1.229   -0.872  1.00 0.00 ?  580  LEU A HD11 5  
ATOM 6943  H HD12 . LEU A 1 24 ? 2.423   0.611   0.252   1.00 0.00 ?  580  LEU A HD12 5  
ATOM 6944  H HD13 . LEU A 1 24 ? 3.650   1.742   0.808   1.00 0.00 ?  580  LEU A HD13 5  
ATOM 6945  H HD21 . LEU A 1 24 ? 3.613   3.767   -1.392  1.00 0.00 ?  580  LEU A HD21 5  
ATOM 6946  H HD22 . LEU A 1 24 ? 3.597   4.035   0.351   1.00 0.00 ?  580  LEU A HD22 5  
ATOM 6947  H HD23 . LEU A 1 24 ? 2.345   4.751   -0.656  1.00 0.00 ?  580  LEU A HD23 5  
ATOM 6948  N N    . SER A 1 25 ? 0.416   1.933   -4.752  1.00 0.00 ?  581  SER A N    5  
ATOM 6949  C CA   . SER A 1 25 ? -0.476  1.363   -5.760  1.00 0.00 ?  581  SER A CA   5  
ATOM 6950  C C    . SER A 1 25 ? 0.296   0.329   -6.591  1.00 0.00 ?  581  SER A C    5  
ATOM 6951  O O    . SER A 1 25 ? -0.205  -0.748  -6.920  1.00 0.00 ?  581  SER A O    5  
ATOM 6952  C CB   . SER A 1 25 ? -0.959  2.438   -6.740  1.00 0.00 ?  581  SER A CB   5  
ATOM 6953  O OG   . SER A 1 25 ? -2.053  1.974   -7.518  1.00 0.00 ?  581  SER A OG   5  
ATOM 6954  H H    . SER A 1 25 ? 0.601   2.895   -4.756  1.00 0.00 ?  581  SER A H    5  
ATOM 6955  H HA   . SER A 1 25 ? -1.334  0.985   -5.217  1.00 0.00 ?  581  SER A HA   5  
ATOM 6956  H HB2  . SER A 1 25 ? -1.253  3.326   -6.208  1.00 0.00 ?  581  SER A HB2  5  
ATOM 6957  H HB3  . SER A 1 25 ? -0.148  2.688   -7.409  1.00 0.00 ?  581  SER A HB3  5  
ATOM 6958  H HG   . SER A 1 25 ? -2.780  1.801   -6.903  1.00 0.00 ?  581  SER A HG   5  
ATOM 6959  N N    . LEU A 1 26 ? 1.529   0.681   -6.927  1.00 0.00 ?  582  LEU A N    5  
ATOM 6960  C CA   . LEU A 1 26 ? 2.370   -0.164  -7.725  1.00 0.00 ?  582  LEU A CA   5  
ATOM 6961  C C    . LEU A 1 26 ? 2.793   -1.419  -6.975  1.00 0.00 ?  582  LEU A C    5  
ATOM 6962  O O    . LEU A 1 26 ? 2.919   -2.479  -7.580  1.00 0.00 ?  582  LEU A O    5  
ATOM 6963  C CB   . LEU A 1 26 ? 3.590   0.597   -8.290  1.00 0.00 ?  582  LEU A CB   5  
ATOM 6964  C CG   . LEU A 1 26 ? 3.341   1.615   -9.443  1.00 0.00 ?  582  LEU A CG   5  
ATOM 6965  C CD1  . LEU A 1 26 ? 2.665   0.955   -10.632 1.00 0.00 ?  582  LEU A CD1  5  
ATOM 6966  C CD2  . LEU A 1 26 ? 2.567   2.859   -8.995  1.00 0.00 ?  582  LEU A CD2  5  
ATOM 6967  H H    . LEU A 1 26 ? 1.887   1.548   -6.634  1.00 0.00 ?  582  LEU A H    5  
ATOM 6968  H HA   . LEU A 1 26 ? 1.765   -0.490  -8.557  1.00 0.00 ?  582  LEU A HA   5  
ATOM 6969  H HB2  . LEU A 1 26 ? 4.051   1.135   -7.475  1.00 0.00 ?  582  LEU A HB2  5  
ATOM 6970  H HB3  . LEU A 1 26 ? 4.296   -0.140  -8.642  1.00 0.00 ?  582  LEU A HB3  5  
ATOM 6971  H HG   . LEU A 1 26 ? 4.320   1.930   -9.774  1.00 0.00 ?  582  LEU A HG   5  
ATOM 6972  H HD11 . LEU A 1 26 ? 3.284   0.150   -10.998 1.00 0.00 ?  582  LEU A HD11 5  
ATOM 6973  H HD12 . LEU A 1 26 ? 2.528   1.688   -11.415 1.00 0.00 ?  582  LEU A HD12 5  
ATOM 6974  H HD13 . LEU A 1 26 ? 1.701   0.569   -10.341 1.00 0.00 ?  582  LEU A HD13 5  
ATOM 6975  H HD21 . LEU A 1 26 ? 1.594   2.574   -8.624  1.00 0.00 ?  582  LEU A HD21 5  
ATOM 6976  H HD22 . LEU A 1 26 ? 2.434   3.557   -9.808  1.00 0.00 ?  582  LEU A HD22 5  
ATOM 6977  H HD23 . LEU A 1 26 ? 3.105   3.354   -8.199  1.00 0.00 ?  582  LEU A HD23 5  
ATOM 6978  N N    . ASP A 1 27 ? 2.969   -1.316  -5.662  1.00 0.00 ?  583  ASP A N    5  
ATOM 6979  C CA   . ASP A 1 27 ? 3.365   -2.482  -4.862  1.00 0.00 ?  583  ASP A CA   5  
ATOM 6980  C C    . ASP A 1 27 ? 2.221   -3.411  -4.604  1.00 0.00 ?  583  ASP A C    5  
ATOM 6981  O O    . ASP A 1 27 ? 2.394   -4.622  -4.666  1.00 0.00 ?  583  ASP A O    5  
ATOM 6982  C CB   . ASP A 1 27 ? 4.087   -2.131  -3.564  1.00 0.00 ?  583  ASP A CB   5  
ATOM 6983  C CG   . ASP A 1 27 ? 5.484   -1.607  -3.824  1.00 0.00 ?  583  ASP A CG   5  
ATOM 6984  O OD1  . ASP A 1 27 ? 6.345   -2.378  -4.316  1.00 0.00 ?  583  ASP A OD1  5  
ATOM 6985  O OD2  . ASP A 1 27 ? 5.754   -0.416  -3.561  1.00 0.00 -1 583  ASP A OD2  5  
ATOM 6986  H H    . ASP A 1 27 ? 2.839   -0.447  -5.225  1.00 0.00 ?  583  ASP A H    5  
ATOM 6987  H HA   . ASP A 1 27 ? 4.052   -3.027  -5.492  1.00 0.00 ?  583  ASP A HA   5  
ATOM 6988  H HB2  . ASP A 1 27 ? 3.514   -1.384  -3.034  1.00 0.00 ?  583  ASP A HB2  5  
ATOM 6989  H HB3  . ASP A 1 27 ? 4.144   -3.013  -2.939  1.00 0.00 ?  583  ASP A HB3  5  
ATOM 6990  N N    . ILE A 1 28 ? 1.037   -2.868  -4.341  1.00 0.00 ?  584  ILE A N    5  
ATOM 6991  C CA   . ILE A 1 28 ? -0.145  -3.715  -4.179  1.00 0.00 ?  584  ILE A CA   5  
ATOM 6992  C C    . ILE A 1 28 ? -0.425  -4.473  -5.489  1.00 0.00 ?  584  ILE A C    5  
ATOM 6993  O O    . ILE A 1 28 ? -0.795  -5.640  -5.484  1.00 0.00 ?  584  ILE A O    5  
ATOM 6994  C CB   . ILE A 1 28 ? -1.412  -2.950  -3.636  1.00 0.00 ?  584  ILE A CB   5  
ATOM 6995  C CG1  . ILE A 1 28 ? -2.647  -3.827  -3.634  1.00 0.00 ?  584  ILE A CG1  5  
ATOM 6996  C CG2  . ILE A 1 28 ? -1.691  -1.680  -4.394  1.00 0.00 ?  584  ILE A CG2  5  
ATOM 6997  C CD1  . ILE A 1 28 ? -2.535  -5.071  -2.806  1.00 0.00 ?  584  ILE A CD1  5  
ATOM 6998  H H    . ILE A 1 28 ? 0.968   -1.892  -4.246  1.00 0.00 ?  584  ILE A H    5  
ATOM 6999  H HA   . ILE A 1 28 ? 0.153   -4.470  -3.465  1.00 0.00 ?  584  ILE A HA   5  
ATOM 7000  H HB   . ILE A 1 28 ? -1.203  -2.670  -2.617  1.00 0.00 ?  584  ILE A HB   5  
ATOM 7001  H HG12 . ILE A 1 28 ? -3.489  -3.257  -3.272  1.00 0.00 ?  584  ILE A HG12 5  
ATOM 7002  H HG13 . ILE A 1 28 ? -2.823  -4.120  -4.658  1.00 0.00 ?  584  ILE A HG13 5  
ATOM 7003  H HG21 . ILE A 1 28 ? -2.631  -1.239  -4.092  1.00 0.00 ?  584  ILE A HG21 5  
ATOM 7004  H HG22 . ILE A 1 28 ? -1.738  -1.905  -5.449  1.00 0.00 ?  584  ILE A HG22 5  
ATOM 7005  H HG23 . ILE A 1 28 ? -0.891  -0.975  -4.220  1.00 0.00 ?  584  ILE A HG23 5  
ATOM 7006  H HD11 . ILE A 1 28 ? -2.378  -4.811  -1.772  1.00 0.00 ?  584  ILE A HD11 5  
ATOM 7007  H HD12 . ILE A 1 28 ? -1.721  -5.673  -3.181  1.00 0.00 ?  584  ILE A HD12 5  
ATOM 7008  H HD13 . ILE A 1 28 ? -3.461  -5.617  -2.919  1.00 0.00 ?  584  ILE A HD13 5  
ATOM 7009  N N    . ASN A 1 29 ? -0.156  -3.805  -6.593  1.00 0.00 ?  585  ASN A N    5  
ATOM 7010  C CA   . ASN A 1 29 ? -0.239  -4.389  -7.938  1.00 0.00 ?  585  ASN A CA   5  
ATOM 7011  C C    . ASN A 1 29 ? 0.692   -5.624  -8.083  1.00 0.00 ?  585  ASN A C    5  
ATOM 7012  O O    . ASN A 1 29 ? 0.472   -6.480  -8.939  1.00 0.00 ?  585  ASN A O    5  
ATOM 7013  C CB   . ASN A 1 29 ? 0.119   -3.300  -8.984  1.00 0.00 ?  585  ASN A CB   5  
ATOM 7014  C CG   . ASN A 1 29 ? 0.284   -3.815  -10.409 1.00 0.00 ?  585  ASN A CG   5  
ATOM 7015  O OD1  . ASN A 1 29 ? -0.676  -3.916  -11.164 1.00 0.00 ?  585  ASN A OD1  5  
ATOM 7016  N ND2  . ASN A 1 29 ? 1.510   -4.090  -10.801 1.00 0.00 ?  585  ASN A ND2  5  
ATOM 7017  H H    . ASN A 1 29 ? 0.092   -2.860  -6.501  1.00 0.00 ?  585  ASN A H    5  
ATOM 7018  H HA   . ASN A 1 29 ? -1.260  -4.699  -8.101  1.00 0.00 ?  585  ASN A HA   5  
ATOM 7019  H HB2  . ASN A 1 29 ? -0.659  -2.553  -8.991  1.00 0.00 ?  585  ASN A HB2  5  
ATOM 7020  H HB3  . ASN A 1 29 ? 1.046   -2.834  -8.680  1.00 0.00 ?  585  ASN A HB3  5  
ATOM 7021  H HD21 . ASN A 1 29 ? 2.244   -3.948  -10.168 1.00 0.00 ?  585  ASN A HD21 5  
ATOM 7022  H HD22 . ASN A 1 29 ? 1.629   -4.429  -11.713 1.00 0.00 ?  585  ASN A HD22 5  
ATOM 7023  N N    . ARG A 1 30 ? 1.710   -5.718  -7.229  1.00 0.00 ?  586  ARG A N    5  
ATOM 7024  C CA   . ARG A 1 30 ? 2.674   -6.818  -7.293  1.00 0.00 ?  586  ARG A CA   5  
ATOM 7025  C C    . ARG A 1 30 ? 2.272   -7.934  -6.327  1.00 0.00 ?  586  ARG A C    5  
ATOM 7026  O O    . ARG A 1 30 ? 2.744   -9.078  -6.444  1.00 0.00 ?  586  ARG A O    5  
ATOM 7027  C CB   . ARG A 1 30 ? 4.086   -6.347  -6.886  1.00 0.00 ?  586  ARG A CB   5  
ATOM 7028  C CG   . ARG A 1 30 ? 4.567   -5.066  -7.539  1.00 0.00 ?  586  ARG A CG   5  
ATOM 7029  C CD   . ARG A 1 30 ? 4.602   -5.144  -9.047  1.00 0.00 ?  586  ARG A CD   5  
ATOM 7030  N NE   . ARG A 1 30 ? 4.940   -3.839  -9.630  1.00 0.00 ?  586  ARG A NE   5  
ATOM 7031  C CZ   . ARG A 1 30 ? 4.919   -3.549  -10.937 1.00 0.00 ?  586  ARG A CZ   5  
ATOM 7032  N NH1  . ARG A 1 30 ? 4.603   -4.482  -11.826 1.00 0.00 1  586  ARG A NH1  5  
ATOM 7033  N NH2  . ARG A 1 30 ? 5.225   -2.330  -11.353 1.00 0.00 ?  586  ARG A NH2  5  
ATOM 7034  H H    . ARG A 1 30 ? 1.808   -5.045  -6.520  1.00 0.00 ?  586  ARG A H    5  
ATOM 7035  H HA   . ARG A 1 30 ? 2.704   -7.192  -8.303  1.00 0.00 ?  586  ARG A HA   5  
ATOM 7036  H HB2  . ARG A 1 30 ? 4.086   -6.186  -5.818  1.00 0.00 ?  586  ARG A HB2  5  
ATOM 7037  H HB3  . ARG A 1 30 ? 4.789   -7.136  -7.116  1.00 0.00 ?  586  ARG A HB3  5  
ATOM 7038  H HG2  . ARG A 1 30 ? 3.895   -4.268  -7.260  1.00 0.00 ?  586  ARG A HG2  5  
ATOM 7039  H HG3  . ARG A 1 30 ? 5.558   -4.842  -7.170  1.00 0.00 ?  586  ARG A HG3  5  
ATOM 7040  H HD2  . ARG A 1 30 ? 5.343   -5.867  -9.347  1.00 0.00 ?  586  ARG A HD2  5  
ATOM 7041  H HD3  . ARG A 1 30 ? 3.631   -5.446  -9.412  1.00 0.00 ?  586  ARG A HD3  5  
ATOM 7042  H HE   . ARG A 1 30 ? 5.193   -3.163  -8.957  1.00 0.00 ?  586  ARG A HE   5  
ATOM 7043  H HH11 . ARG A 1 30 ? 4.371   -5.424  -11.576 1.00 0.00 ?  586  ARG A HH11 5  
ATOM 7044  H HH12 . ARG A 1 30 ? 4.601   -4.268  -12.806 1.00 0.00 ?  586  ARG A HH12 5  
ATOM 7045  H HH21 . ARG A 1 30 ? 5.479   -1.593  -10.722 1.00 0.00 ?  586  ARG A HH21 5  
ATOM 7046  H HH22 . ARG A 1 30 ? 5.229   -2.084  -12.329 1.00 0.00 ?  586  ARG A HH22 5  
ATOM 7047  N N    . LEU A 1 31 ? 1.412   -7.612  -5.383  1.00 0.00 ?  587  LEU A N    5  
ATOM 7048  C CA   . LEU A 1 31 ? 1.082   -8.530  -4.328  1.00 0.00 ?  587  LEU A CA   5  
ATOM 7049  C C    . LEU A 1 31 ? -0.003  -9.546  -4.711  1.00 0.00 ?  587  LEU A C    5  
ATOM 7050  O O    . LEU A 1 31 ? -1.024  -9.192  -5.306  1.00 0.00 ?  587  LEU A O    5  
ATOM 7051  C CB   . LEU A 1 31 ? 0.751   -7.780  -3.056  1.00 0.00 ?  587  LEU A CB   5  
ATOM 7052  C CG   . LEU A 1 31 ? 1.949   -7.054  -2.461  1.00 0.00 ?  587  LEU A CG   5  
ATOM 7053  C CD1  . LEU A 1 31 ? 1.525   -6.061  -1.425  1.00 0.00 ?  587  LEU A CD1  5  
ATOM 7054  C CD2  . LEU A 1 31 ? 2.948   -8.008  -1.839  1.00 0.00 ?  587  LEU A CD2  5  
ATOM 7055  H H    . LEU A 1 31 ? 0.960   -6.740  -5.400  1.00 0.00 ?  587  LEU A H    5  
ATOM 7056  H HA   . LEU A 1 31 ? 2.035   -9.012  -4.163  1.00 0.00 ?  587  LEU A HA   5  
ATOM 7057  H HB2  . LEU A 1 31 ? -0.024  -7.060  -3.275  1.00 0.00 ?  587  LEU A HB2  5  
ATOM 7058  H HB3  . LEU A 1 31 ? 0.385   -8.485  -2.325  1.00 0.00 ?  587  LEU A HB3  5  
ATOM 7059  H HG   . LEU A 1 31 ? 2.420   -6.608  -3.325  1.00 0.00 ?  587  LEU A HG   5  
ATOM 7060  H HD11 . LEU A 1 31 ? 2.392   -5.799  -0.832  1.00 0.00 ?  587  LEU A HD11 5  
ATOM 7061  H HD12 . LEU A 1 31 ? 0.765   -6.515  -0.809  1.00 0.00 ?  587  LEU A HD12 5  
ATOM 7062  H HD13 . LEU A 1 31 ? 1.135   -5.180  -1.911  1.00 0.00 ?  587  LEU A HD13 5  
ATOM 7063  H HD21 . LEU A 1 31 ? 3.416   -8.628  -2.588  1.00 0.00 ?  587  LEU A HD21 5  
ATOM 7064  H HD22 . LEU A 1 31 ? 2.436   -8.630  -1.120  1.00 0.00 ?  587  LEU A HD22 5  
ATOM 7065  H HD23 . LEU A 1 31 ? 3.697   -7.425  -1.313  1.00 0.00 ?  587  LEU A HD23 5  
ATOM 7066  N N    . PRO A 1 32 ? 0.263   -10.834 -4.430  1.00 0.00 ?  588  PRO A N    5  
ATOM 7067  C CA   . PRO A 1 32 ? -0.654  -11.957 -4.712  1.00 0.00 ?  588  PRO A CA   5  
ATOM 7068  C C    . PRO A 1 32 ? -2.000  -11.925 -3.944  1.00 0.00 ?  588  PRO A C    5  
ATOM 7069  O O    . PRO A 1 32 ? -2.192  -11.136 -3.004  1.00 0.00 ?  588  PRO A O    5  
ATOM 7070  C CB   . PRO A 1 32 ? 0.159   -13.190 -4.322  1.00 0.00 ?  588  PRO A CB   5  
ATOM 7071  C CG   . PRO A 1 32 ? 1.206   -12.683 -3.408  1.00 0.00 ?  588  PRO A CG   5  
ATOM 7072  C CD   . PRO A 1 32 ? 1.531   -11.310 -3.862  1.00 0.00 ?  588  PRO A CD   5  
ATOM 7073  H HA   . PRO A 1 32 ? -0.882  -12.008 -5.766  1.00 0.00 ?  588  PRO A HA   5  
ATOM 7074  H HB2  . PRO A 1 32 ? -0.489  -13.892 -3.816  1.00 0.00 ?  588  PRO A HB2  5  
ATOM 7075  H HB3  . PRO A 1 32 ? 0.590   -13.637 -5.205  1.00 0.00 ?  588  PRO A HB3  5  
ATOM 7076  H HG2  . PRO A 1 32 ? 0.798   -12.627 -2.413  1.00 0.00 ?  588  PRO A HG2  5  
ATOM 7077  H HG3  . PRO A 1 32 ? 2.083   -13.312 -3.437  1.00 0.00 ?  588  PRO A HG3  5  
ATOM 7078  H HD2  . PRO A 1 32 ? 1.830   -10.708 -3.017  1.00 0.00 ?  588  PRO A HD2  5  
ATOM 7079  H HD3  . PRO A 1 32 ? 2.307   -11.330 -4.612  1.00 0.00 ?  588  PRO A HD3  5  
ATOM 7080  N N    . GLY A 1 33 ? -2.881  -12.856 -4.336  1.00 0.00 ?  589  GLY A N    5  
ATOM 7081  C CA   . GLY A 1 33 ? -4.273  -12.951 -3.870  1.00 0.00 ?  589  GLY A CA   5  
ATOM 7082  C C    . GLY A 1 33 ? -4.500  -12.835 -2.373  1.00 0.00 ?  589  GLY A C    5  
ATOM 7083  O O    . GLY A 1 33 ? -5.246  -11.963 -1.927  1.00 0.00 ?  589  GLY A O    5  
ATOM 7084  H H    . GLY A 1 33 ? -2.568  -13.527 -4.981  1.00 0.00 ?  589  GLY A H    5  
ATOM 7085  H HA2  . GLY A 1 33 ? -4.840  -12.168 -4.345  1.00 0.00 ?  589  GLY A HA2  5  
ATOM 7086  H HA3  . GLY A 1 33 ? -4.673  -13.894 -4.213  1.00 0.00 ?  589  GLY A HA3  5  
ATOM 7087  N N    . GLU A 1 34 ? -3.887  -13.694 -1.594  1.00 0.00 ?  590  GLU A N    5  
ATOM 7088  C CA   . GLU A 1 34 ? -4.092  -13.636 -0.155  1.00 0.00 ?  590  GLU A CA   5  
ATOM 7089  C C    . GLU A 1 34 ? -3.529  -12.358 0.466   1.00 0.00 ?  590  GLU A C    5  
ATOM 7090  O O    . GLU A 1 34 ? -4.078  -11.843 1.445   1.00 0.00 ?  590  GLU A O    5  
ATOM 7091  C CB   . GLU A 1 34 ? -3.563  -14.868 0.573   1.00 0.00 ?  590  GLU A CB   5  
ATOM 7092  C CG   . GLU A 1 34 ? -2.133  -15.229 0.264   1.00 0.00 ?  590  GLU A CG   5  
ATOM 7093  C CD   . GLU A 1 34 ? -1.490  -15.965 1.405   1.00 0.00 ?  590  GLU A CD   5  
ATOM 7094  O OE1  . GLU A 1 34 ? -0.664  -15.362 2.125   1.00 0.00 ?  590  GLU A OE1  5  
ATOM 7095  O OE2  . GLU A 1 34 ? -1.808  -17.135 1.633   1.00 0.00 -1 590  GLU A OE2  5  
ATOM 7096  H H    . GLU A 1 34 ? -3.327  -14.391 -1.997  1.00 0.00 ?  590  GLU A H    5  
ATOM 7097  H HA   . GLU A 1 34 ? -5.163  -13.598 -0.021  1.00 0.00 ?  590  GLU A HA   5  
ATOM 7098  H HB2  . GLU A 1 34 ? -3.631  -14.695 1.636   1.00 0.00 ?  590  GLU A HB2  5  
ATOM 7099  H HB3  . GLU A 1 34 ? -4.189  -15.709 0.314   1.00 0.00 ?  590  GLU A HB3  5  
ATOM 7100  H HG2  . GLU A 1 34 ? -2.120  -15.864 -0.609  1.00 0.00 ?  590  GLU A HG2  5  
ATOM 7101  H HG3  . GLU A 1 34 ? -1.580  -14.329 0.057   1.00 0.00 ?  590  GLU A HG3  5  
ATOM 7102  N N    . LYS A 1 35 ? -2.480  -11.821 -0.132  1.00 0.00 ?  591  LYS A N    5  
ATOM 7103  C CA   . LYS A 1 35 ? -1.838  -10.631 0.393   1.00 0.00 ?  591  LYS A CA   5  
ATOM 7104  C C    . LYS A 1 35 ? -2.677  -9.385  0.122   1.00 0.00 ?  591  LYS A C    5  
ATOM 7105  O O    . LYS A 1 35 ? -2.871  -8.569  1.028   1.00 0.00 ?  591  LYS A O    5  
ATOM 7106  C CB   . LYS A 1 35 ? -0.396  -10.444 -0.151  1.00 0.00 ?  591  LYS A CB   5  
ATOM 7107  C CG   . LYS A 1 35 ? 0.697   -11.385 0.423   1.00 0.00 ?  591  LYS A CG   5  
ATOM 7108  C CD   . LYS A 1 35 ? 0.423   -12.853 0.141   1.00 0.00 ?  591  LYS A CD   5  
ATOM 7109  C CE   . LYS A 1 35 ? 1.603   -13.761 0.466   1.00 0.00 ?  591  LYS A CE   5  
ATOM 7110  N NZ   . LYS A 1 35 ? 1.697   -14.063 1.899   1.00 0.00 1  591  LYS A NZ   5  
ATOM 7111  H H    . LYS A 1 35 ? -2.144  -12.218 -0.965  1.00 0.00 ?  591  LYS A H    5  
ATOM 7112  H HA   . LYS A 1 35 ? -1.786  -10.759 1.464   1.00 0.00 ?  591  LYS A HA   5  
ATOM 7113  H HB2  . LYS A 1 35 ? -0.419  -10.588 -1.220  1.00 0.00 ?  591  LYS A HB2  5  
ATOM 7114  H HB3  . LYS A 1 35 ? -0.095  -9.426  0.046   1.00 0.00 ?  591  LYS A HB3  5  
ATOM 7115  H HG2  . LYS A 1 35 ? 1.645   -11.124 -0.022  1.00 0.00 ?  591  LYS A HG2  5  
ATOM 7116  H HG3  . LYS A 1 35 ? 0.755   -11.232 1.491   1.00 0.00 ?  591  LYS A HG3  5  
ATOM 7117  H HD2  . LYS A 1 35 ? -0.359  -13.113 0.838   1.00 0.00 ?  591  LYS A HD2  5  
ATOM 7118  H HD3  . LYS A 1 35 ? 0.050   -13.035 -0.852  1.00 0.00 ?  591  LYS A HD3  5  
ATOM 7119  H HE2  . LYS A 1 35 ? 1.478   -14.691 -0.067  1.00 0.00 ?  591  LYS A HE2  5  
ATOM 7120  H HE3  . LYS A 1 35 ? 2.514   -13.279 0.143   1.00 0.00 ?  591  LYS A HE3  5  
ATOM 7121  H HZ1  . LYS A 1 35 ? 0.839   -14.602 2.157   1.00 0.00 ?  591  LYS A HZ1  5  
ATOM 7122  H HZ2  . LYS A 1 35 ? 1.726   -13.222 2.507   1.00 0.00 ?  591  LYS A HZ2  5  
ATOM 7123  H HZ3  . LYS A 1 35 ? 2.516   -14.675 2.106   1.00 0.00 ?  591  LYS A HZ3  5  
ATOM 7124  N N    . LEU A 1 36 ? -3.207  -9.274  -1.106  1.00 0.00 ?  592  LEU A N    5  
ATOM 7125  C CA   . LEU A 1 36 ? -3.970  -8.115  -1.555  1.00 0.00 ?  592  LEU A CA   5  
ATOM 7126  C C    . LEU A 1 36 ? -5.205  -7.819  -0.657  1.00 0.00 ?  592  LEU A C    5  
ATOM 7127  O O    . LEU A 1 36 ? -5.428  -6.678  -0.253  1.00 0.00 ?  592  LEU A O    5  
ATOM 7128  C CB   . LEU A 1 36 ? -4.322  -8.276  -3.085  1.00 0.00 ?  592  LEU A CB   5  
ATOM 7129  C CG   . LEU A 1 36 ? -5.306  -9.422  -3.512  1.00 0.00 ?  592  LEU A CG   5  
ATOM 7130  C CD1  . LEU A 1 36 ? -6.754  -9.039  -3.317  1.00 0.00 ?  592  LEU A CD1  5  
ATOM 7131  C CD2  . LEU A 1 36 ? -5.113  -9.805  -4.949  1.00 0.00 ?  592  LEU A CD2  5  
ATOM 7132  H H    . LEU A 1 36 ? -3.072  -9.977  -1.782  1.00 0.00 ?  592  LEU A H    5  
ATOM 7133  H HA   . LEU A 1 36 ? -3.316  -7.260  -1.448  1.00 0.00 ?  592  LEU A HA   5  
ATOM 7134  H HB2  . LEU A 1 36 ? -4.670  -7.332  -3.478  1.00 0.00 ?  592  LEU A HB2  5  
ATOM 7135  H HB3  . LEU A 1 36 ? -3.384  -8.460  -3.588  1.00 0.00 ?  592  LEU A HB3  5  
ATOM 7136  H HG   . LEU A 1 36 ? -5.109  -10.295 -2.906  1.00 0.00 ?  592  LEU A HG   5  
ATOM 7137  H HD11 . LEU A 1 36 ? -6.913  -8.681  -2.310  1.00 0.00 ?  592  LEU A HD11 5  
ATOM 7138  H HD12 . LEU A 1 36 ? -7.375  -9.903  -3.501  1.00 0.00 ?  592  LEU A HD12 5  
ATOM 7139  H HD13 . LEU A 1 36 ? -6.983  -8.265  -4.034  1.00 0.00 ?  592  LEU A HD13 5  
ATOM 7140  H HD21 . LEU A 1 36 ? -5.430  -8.944  -5.520  1.00 0.00 ?  592  LEU A HD21 5  
ATOM 7141  H HD22 . LEU A 1 36 ? -5.749  -10.642 -5.195  1.00 0.00 ?  592  LEU A HD22 5  
ATOM 7142  H HD23 . LEU A 1 36 ? -4.078  -10.024 -5.158  1.00 0.00 ?  592  LEU A HD23 5  
ATOM 7143  N N    . GLY A 1 37 ? -5.973  -8.836  -0.332  1.00 0.00 ?  593  GLY A N    5  
ATOM 7144  C CA   . GLY A 1 37 ? -7.153  -8.619  0.491   1.00 0.00 ?  593  GLY A CA   5  
ATOM 7145  C C    . GLY A 1 37 ? -6.798  -8.377  1.931   1.00 0.00 ?  593  GLY A C    5  
ATOM 7146  O O    . GLY A 1 37 ? -7.493  -7.646  2.641   1.00 0.00 ?  593  GLY A O    5  
ATOM 7147  H H    . GLY A 1 37 ? -5.741  -9.730  -0.662  1.00 0.00 ?  593  GLY A H    5  
ATOM 7148  H HA2  . GLY A 1 37 ? -7.669  -7.737  0.133   1.00 0.00 ?  593  GLY A HA2  5  
ATOM 7149  H HA3  . GLY A 1 37 ? -7.810  -9.471  0.424   1.00 0.00 ?  593  GLY A HA3  5  
ATOM 7150  N N    . ARG A 1 38 ? -5.708  -8.985  2.359   1.00 0.00 ?  594  ARG A N    5  
ATOM 7151  C CA   . ARG A 1 38 ? -5.259  -8.887  3.732   1.00 0.00 ?  594  ARG A CA   5  
ATOM 7152  C C    . ARG A 1 38 ? -4.744  -7.483  4.029   1.00 0.00 ?  594  ARG A C    5  
ATOM 7153  O O    . ARG A 1 38 ? -5.083  -6.898  5.045   1.00 0.00 ?  594  ARG A O    5  
ATOM 7154  C CB   . ARG A 1 38 ? -4.175  -9.938  4.015   1.00 0.00 ?  594  ARG A CB   5  
ATOM 7155  C CG   . ARG A 1 38 ? -3.739  -10.017 5.467   1.00 0.00 ?  594  ARG A CG   5  
ATOM 7156  C CD   . ARG A 1 38 ? -2.712  -11.120 5.682   1.00 0.00 ?  594  ARG A CD   5  
ATOM 7157  N NE   . ARG A 1 38 ? -3.235  -12.460 5.345   1.00 0.00 ?  594  ARG A NE   5  
ATOM 7158  C CZ   . ARG A 1 38 ? -2.781  -13.617 5.863   1.00 0.00 ?  594  ARG A CZ   5  
ATOM 7159  N NH1  . ARG A 1 38 ? -1.887  -13.612 6.858   1.00 0.00 1  594  ARG A NH1  5  
ATOM 7160  N NH2  . ARG A 1 38 ? -3.253  -14.770 5.420   1.00 0.00 ?  594  ARG A NH2  5  
ATOM 7161  H H    . ARG A 1 38 ? -5.190  -9.508  1.713   1.00 0.00 ?  594  ARG A H    5  
ATOM 7162  H HA   . ARG A 1 38 ? -6.108  -9.083  4.368   1.00 0.00 ?  594  ARG A HA   5  
ATOM 7163  H HB2  . ARG A 1 38 ? -4.542  -10.911 3.721   1.00 0.00 ?  594  ARG A HB2  5  
ATOM 7164  H HB3  . ARG A 1 38 ? -3.309  -9.700  3.415   1.00 0.00 ?  594  ARG A HB3  5  
ATOM 7165  H HG2  . ARG A 1 38 ? -3.302  -9.072  5.753   1.00 0.00 ?  594  ARG A HG2  5  
ATOM 7166  H HG3  . ARG A 1 38 ? -4.603  -10.215 6.083   1.00 0.00 ?  594  ARG A HG3  5  
ATOM 7167  H HD2  . ARG A 1 38 ? -1.856  -10.918 5.057   1.00 0.00 ?  594  ARG A HD2  5  
ATOM 7168  H HD3  . ARG A 1 38 ? -2.406  -11.112 6.717   1.00 0.00 ?  594  ARG A HD3  5  
ATOM 7169  H HE   . ARG A 1 38 ? -3.946  -12.478 4.667   1.00 0.00 ?  594  ARG A HE   5  
ATOM 7170  H HH11 . ARG A 1 38 ? -1.527  -12.766 7.256   1.00 0.00 ?  594  ARG A HH11 5  
ATOM 7171  H HH12 . ARG A 1 38 ? -1.547  -14.470 7.253   1.00 0.00 ?  594  ARG A HH12 5  
ATOM 7172  H HH21 . ARG A 1 38 ? -3.953  -14.833 4.701   1.00 0.00 ?  594  ARG A HH21 5  
ATOM 7173  H HH22 . ARG A 1 38 ? -2.923  -15.644 5.783   1.00 0.00 ?  594  ARG A HH22 5  
ATOM 7174  N N    . VAL A 1 39 ? -3.954  -6.938  3.111   1.00 0.00 ?  595  VAL A N    5  
ATOM 7175  C CA   . VAL A 1 39 ? -3.358  -5.614  3.283   1.00 0.00 ?  595  VAL A CA   5  
ATOM 7176  C C    . VAL A 1 39 ? -4.379  -4.535  3.404   1.00 0.00 ?  595  VAL A C    5  
ATOM 7177  O O    . VAL A 1 39 ? -4.297  -3.740  4.317   1.00 0.00 ?  595  VAL A O    5  
ATOM 7178  C CB   . VAL A 1 39 ? -2.304  -5.279  2.201   1.00 0.00 ?  595  VAL A CB   5  
ATOM 7179  C CG1  . VAL A 1 39 ? -2.828  -5.427  0.799   1.00 0.00 ?  595  VAL A CG1  5  
ATOM 7180  C CG2  . VAL A 1 39 ? -1.729  -3.905  2.378   1.00 0.00 ?  595  VAL A CG2  5  
ATOM 7181  H H    . VAL A 1 39 ? -3.770  -7.449  2.290   1.00 0.00 ?  595  VAL A H    5  
ATOM 7182  H HA   . VAL A 1 39 ? -2.866  -5.590  4.245   1.00 0.00 ?  595  VAL A HA   5  
ATOM 7183  H HB   . VAL A 1 39 ? -1.517  -5.993  2.363   1.00 0.00 ?  595  VAL A HB   5  
ATOM 7184  H HG11 . VAL A 1 39 ? -3.646  -4.739  0.638   1.00 0.00 ?  595  VAL A HG11 5  
ATOM 7185  H HG12 . VAL A 1 39 ? -3.173  -6.440  0.652   1.00 0.00 ?  595  VAL A HG12 5  
ATOM 7186  H HG13 . VAL A 1 39 ? -2.028  -5.212  0.109   1.00 0.00 ?  595  VAL A HG13 5  
ATOM 7187  H HG21 . VAL A 1 39 ? -2.531  -3.185  2.321   1.00 0.00 ?  595  VAL A HG21 5  
ATOM 7188  H HG22 . VAL A 1 39 ? -1.037  -3.736  1.566   1.00 0.00 ?  595  VAL A HG22 5  
ATOM 7189  H HG23 . VAL A 1 39 ? -1.220  -3.830  3.327   1.00 0.00 ?  595  VAL A HG23 5  
ATOM 7190  N N    . VAL A 1 40 ? -5.357  -4.546  2.533   1.00 0.00 ?  596  VAL A N    5  
ATOM 7191  C CA   . VAL A 1 40 ? -6.428  -3.574  2.566   1.00 0.00 ?  596  VAL A CA   5  
ATOM 7192  C C    . VAL A 1 40 ? -7.094  -3.556  3.908   1.00 0.00 ?  596  VAL A C    5  
ATOM 7193  O O    . VAL A 1 40 ? -7.318  -2.497  4.468   1.00 0.00 ?  596  VAL A O    5  
ATOM 7194  C CB   . VAL A 1 40 ? -7.434  -3.819  1.408   1.00 0.00 ?  596  VAL A CB   5  
ATOM 7195  C CG1  . VAL A 1 40 ? -8.785  -3.157  1.641   1.00 0.00 ?  596  VAL A CG1  5  
ATOM 7196  C CG2  . VAL A 1 40 ? -6.836  -3.281  0.144   1.00 0.00 ?  596  VAL A CG2  5  
ATOM 7197  H H    . VAL A 1 40 ? -5.363  -5.236  1.833   1.00 0.00 ?  596  VAL A H    5  
ATOM 7198  H HA   . VAL A 1 40 ? -6.001  -2.589  2.450   1.00 0.00 ?  596  VAL A HA   5  
ATOM 7199  H HB   . VAL A 1 40 ? -7.578  -4.880  1.268   1.00 0.00 ?  596  VAL A HB   5  
ATOM 7200  H HG11 . VAL A 1 40 ? -9.419  -3.395  0.799   1.00 0.00 ?  596  VAL A HG11 5  
ATOM 7201  H HG12 . VAL A 1 40 ? -8.668  -2.088  1.730   1.00 0.00 ?  596  VAL A HG12 5  
ATOM 7202  H HG13 . VAL A 1 40 ? -9.222  -3.566  2.540   1.00 0.00 ?  596  VAL A HG13 5  
ATOM 7203  H HG21 . VAL A 1 40 ? -7.577  -3.342  -0.638  1.00 0.00 ?  596  VAL A HG21 5  
ATOM 7204  H HG22 . VAL A 1 40 ? -5.963  -3.859  -0.120  1.00 0.00 ?  596  VAL A HG22 5  
ATOM 7205  H HG23 . VAL A 1 40 ? -6.563  -2.247  0.301   1.00 0.00 ?  596  VAL A HG23 5  
ATOM 7206  N N    . HIS A 1 41 ? -7.277  -4.715  4.460   1.00 0.00 ?  597  HIS A N    5  
ATOM 7207  C CA   . HIS A 1 41 ? -7.954  -4.847  5.732   1.00 0.00 ?  597  HIS A CA   5  
ATOM 7208  C C    . HIS A 1 41 ? -6.987  -4.389  6.870   1.00 0.00 ?  597  HIS A C    5  
ATOM 7209  O O    . HIS A 1 41 ? -7.408  -3.816  7.866   1.00 0.00 ?  597  HIS A O    5  
ATOM 7210  C CB   . HIS A 1 41 ? -8.443  -6.303  5.923   1.00 0.00 ?  597  HIS A CB   5  
ATOM 7211  C CG   . HIS A 1 41 ? -9.338  -6.569  7.122   1.00 0.00 ?  597  HIS A CG   5  
ATOM 7212  N ND1  . HIS A 1 41 ? -9.815  -7.823  7.447   1.00 0.00 ?  597  HIS A ND1  5  
ATOM 7213  C CD2  . HIS A 1 41 ? -9.858  -5.726  8.056   1.00 0.00 ?  597  HIS A CD2  5  
ATOM 7214  C CE1  . HIS A 1 41 ? -10.585 -7.711  8.531   1.00 0.00 ?  597  HIS A CE1  5  
ATOM 7215  N NE2  . HIS A 1 41 ? -10.646 -6.455  8.945   1.00 0.00 ?  597  HIS A NE2  5  
ATOM 7216  H H    . HIS A 1 41 ? -6.884  -5.494  4.006   1.00 0.00 ?  597  HIS A H    5  
ATOM 7217  H HA   . HIS A 1 41 ? -8.803  -4.171  5.646   1.00 0.00 ?  597  HIS A HA   5  
ATOM 7218  H HB2  . HIS A 1 41 ? -9.001  -6.597  5.046   1.00 0.00 ?  597  HIS A HB2  5  
ATOM 7219  H HB3  . HIS A 1 41 ? -7.579  -6.945  6.006   1.00 0.00 ?  597  HIS A HB3  5  
ATOM 7220  H HD1  . HIS A 1 41 ? -9.632  -8.653  6.952   1.00 0.00 ?  597  HIS A HD1  5  
ATOM 7221  H HD2  . HIS A 1 41 ? -9.694  -4.661  8.108   1.00 0.00 ?  597  HIS A HD2  5  
ATOM 7222  H HE1  . HIS A 1 41 ? -11.092 -8.536  9.008   1.00 0.00 ?  597  HIS A HE1  5  
ATOM 7223  N N    . ILE A 1 42 ? -5.681  -4.652  6.689   1.00 0.00 ?  598  ILE A N    5  
ATOM 7224  C CA   . ILE A 1 42 ? -4.657  -4.232  7.629   1.00 0.00 ?  598  ILE A CA   5  
ATOM 7225  C C    . ILE A 1 42 ? -4.593  -2.725  7.699   1.00 0.00 ?  598  ILE A C    5  
ATOM 7226  O O    . ILE A 1 42 ? -4.502  -2.137  8.776   1.00 0.00 ?  598  ILE A O    5  
ATOM 7227  C CB   . ILE A 1 42 ? -3.288  -4.807  7.244   1.00 0.00 ?  598  ILE A CB   5  
ATOM 7228  C CG1  . ILE A 1 42 ? -3.320  -6.298  7.558   1.00 0.00 ?  598  ILE A CG1  5  
ATOM 7229  C CG2  . ILE A 1 42 ? -2.138  -4.085  7.965   1.00 0.00 ?  598  ILE A CG2  5  
ATOM 7230  C CD1  . ILE A 1 42 ? -2.008  -6.954  7.464   1.00 0.00 ?  598  ILE A CD1  5  
ATOM 7231  H H    . ILE A 1 42 ? -5.391  -5.118  5.874   1.00 0.00 ?  598  ILE A H    5  
ATOM 7232  H HA   . ILE A 1 42 ? -4.911  -4.651  8.594   1.00 0.00 ?  598  ILE A HA   5  
ATOM 7233  H HB   . ILE A 1 42 ? -3.155  -4.690  6.179   1.00 0.00 ?  598  ILE A HB   5  
ATOM 7234  H HG12 . ILE A 1 42 ? -3.684  -6.444  8.563   1.00 0.00 ?  598  ILE A HG12 5  
ATOM 7235  H HG13 . ILE A 1 42 ? -3.992  -6.787  6.867   1.00 0.00 ?  598  ILE A HG13 5  
ATOM 7236  H HG21 . ILE A 1 42 ? -2.183  -3.044  7.680   1.00 0.00 ?  598  ILE A HG21 5  
ATOM 7237  H HG22 . ILE A 1 42 ? -1.194  -4.509  7.660   1.00 0.00 ?  598  ILE A HG22 5  
ATOM 7238  H HG23 . ILE A 1 42 ? -2.258  -4.176  9.034   1.00 0.00 ?  598  ILE A HG23 5  
ATOM 7239  H HD11 . ILE A 1 42 ? -1.418  -6.433  8.202   1.00 0.00 ?  598  ILE A HD11 5  
ATOM 7240  H HD12 . ILE A 1 42 ? -1.617  -6.810  6.469   1.00 0.00 ?  598  ILE A HD12 5  
ATOM 7241  H HD13 . ILE A 1 42 ? -2.106  -7.994  7.727   1.00 0.00 ?  598  ILE A HD13 5  
ATOM 7242  N N    . ILE A 1 43 ? -4.662  -2.105  6.548   1.00 0.00 ?  599  ILE A N    5  
ATOM 7243  C CA   . ILE A 1 43 ? -4.705  -0.650  6.462   1.00 0.00 ?  599  ILE A CA   5  
ATOM 7244  C C    . ILE A 1 43 ? -5.970  -0.135  7.194   1.00 0.00 ?  599  ILE A C    5  
ATOM 7245  O O    . ILE A 1 43 ? -5.930  0.864   7.924   1.00 0.00 ?  599  ILE A O    5  
ATOM 7246  C CB   . ILE A 1 43 ? -4.679  -0.143  4.979   1.00 0.00 ?  599  ILE A CB   5  
ATOM 7247  C CG1  . ILE A 1 43 ? -3.595  -0.870  4.154   1.00 0.00 ?  599  ILE A CG1  5  
ATOM 7248  C CG2  . ILE A 1 43 ? -4.438  1.355   4.932   1.00 0.00 ?  599  ILE A CG2  5  
ATOM 7249  C CD1  . ILE A 1 43 ? -2.252  -0.992  4.835   1.00 0.00 ?  599  ILE A CD1  5  
ATOM 7250  H H    . ILE A 1 43 ? -4.622  -2.672  5.741   1.00 0.00 ?  599  ILE A H    5  
ATOM 7251  H HA   . ILE A 1 43 ? -3.848  -0.254  6.990   1.00 0.00 ?  599  ILE A HA   5  
ATOM 7252  H HB   . ILE A 1 43 ? -5.644  -0.340  4.539   1.00 0.00 ?  599  ILE A HB   5  
ATOM 7253  H HG12 . ILE A 1 43 ? -3.914  -1.879  3.941   1.00 0.00 ?  599  ILE A HG12 5  
ATOM 7254  H HG13 . ILE A 1 43 ? -3.446  -0.342  3.224   1.00 0.00 ?  599  ILE A HG13 5  
ATOM 7255  H HG21 . ILE A 1 43 ? -5.248  1.851   5.442   1.00 0.00 ?  599  ILE A HG21 5  
ATOM 7256  H HG22 . ILE A 1 43 ? -4.402  1.685   3.903   1.00 0.00 ?  599  ILE A HG22 5  
ATOM 7257  H HG23 . ILE A 1 43 ? -3.503  1.587   5.422   1.00 0.00 ?  599  ILE A HG23 5  
ATOM 7258  H HD11 . ILE A 1 43 ? -1.553  -1.469  4.164   1.00 0.00 ?  599  ILE A HD11 5  
ATOM 7259  H HD12 . ILE A 1 43 ? -2.406  -1.640  5.688   1.00 0.00 ?  599  ILE A HD12 5  
ATOM 7260  H HD13 . ILE A 1 43 ? -1.894  -0.023  5.146   1.00 0.00 ?  599  ILE A HD13 5  
ATOM 7261  N N    . GLN A 1 44 ? -7.075  -0.875  7.050   1.00 0.00 ?  600  GLN A N    5  
ATOM 7262  C CA   . GLN A 1 44 ? -8.341  -0.555  7.786   1.00 0.00 ?  600  GLN A CA   5  
ATOM 7263  C C    . GLN A 1 44 ? -8.220  -0.831  9.274   1.00 0.00 ?  600  GLN A C    5  
ATOM 7264  O O    . GLN A 1 44 ? -9.133  -0.522  10.044  1.00 0.00 ?  600  GLN A O    5  
ATOM 7265  C CB   . GLN A 1 44 ? -9.491  -1.397  7.323   1.00 0.00 ?  600  GLN A CB   5  
ATOM 7266  C CG   . GLN A 1 44 ? -9.611  -1.457  5.878   1.00 0.00 ?  600  GLN A CG   5  
ATOM 7267  C CD   . GLN A 1 44 ? -10.728 -2.274  5.420   1.00 0.00 ?  600  GLN A CD   5  
ATOM 7268  O OE1  . GLN A 1 44 ? -11.173 -3.173  6.098   1.00 0.00 ?  600  GLN A OE1  5  
ATOM 7269  N NE2  . GLN A 1 44 ? -11.092 -2.050  4.206   1.00 0.00 ?  600  GLN A NE2  5  
ATOM 7270  H H    . GLN A 1 44 ? -7.044  -1.616  6.396   1.00 0.00 ?  600  GLN A H    5  
ATOM 7271  H HA   . GLN A 1 44 ? -8.578  0.484   7.615   1.00 0.00 ?  600  GLN A HA   5  
ATOM 7272  H HB2  . GLN A 1 44 ? -9.359  -2.403  7.693   1.00 0.00 ?  600  GLN A HB2  5  
ATOM 7273  H HB3  . GLN A 1 44 ? -10.407 -0.994  7.729   1.00 0.00 ?  600  GLN A HB3  5  
ATOM 7274  H HG2  . GLN A 1 44 ? -9.790  -0.459  5.507   1.00 0.00 ?  600  GLN A HG2  5  
ATOM 7275  H HG3  . GLN A 1 44 ? -8.690  -1.850  5.478   1.00 0.00 ?  600  GLN A HG3  5  
ATOM 7276  H HE21 . GLN A 1 44 ? -10.547 -1.390  3.746   1.00 0.00 ?  600  GLN A HE21 5  
ATOM 7277  H HE22 . GLN A 1 44 ? -11.847 -2.512  3.817   1.00 0.00 ?  600  GLN A HE22 5  
ATOM 7278  N N    . SER A 1 45 ? -7.135  -1.429  9.696   1.00 0.00 ?  601  SER A N    5  
ATOM 7279  C CA   . SER A 1 45 ? -6.995  -1.724  11.079  1.00 0.00 ?  601  SER A CA   5  
ATOM 7280  C C    . SER A 1 45 ? -6.687  -0.440  11.840  1.00 0.00 ?  601  SER A C    5  
ATOM 7281  O O    . SER A 1 45 ? -6.898  -0.361  13.046  1.00 0.00 ?  601  SER A O    5  
ATOM 7282  C CB   . SER A 1 45 ? -5.951  -2.823  11.339  1.00 0.00 ?  601  SER A CB   5  
ATOM 7283  O OG   . SER A 1 45 ? -5.913  -3.196  12.712  1.00 0.00 ?  601  SER A OG   5  
ATOM 7284  H H    . SER A 1 45 ? -6.427  -1.685  9.065   1.00 0.00 ?  601  SER A H    5  
ATOM 7285  H HA   . SER A 1 45 ? -7.974  -2.086  11.353  1.00 0.00 ?  601  SER A HA   5  
ATOM 7286  H HB2  . SER A 1 45 ? -6.195  -3.698  10.755  1.00 0.00 ?  601  SER A HB2  5  
ATOM 7287  H HB3  . SER A 1 45 ? -4.974  -2.460  11.050  1.00 0.00 ?  601  SER A HB3  5  
ATOM 7288  H HG   . SER A 1 45 ? -6.307  -2.475  13.221  1.00 0.00 ?  601  SER A HG   5  
ATOM 7289  N N    . ARG A 1 46 ? -6.233  0.565   11.112  1.00 0.00 ?  602  ARG A N    5  
ATOM 7290  C CA   . ARG A 1 46 ? -5.983  1.863   11.687  1.00 0.00 ?  602  ARG A CA   5  
ATOM 7291  C C    . ARG A 1 46 ? -7.277  2.637   11.669  1.00 0.00 ?  602  ARG A C    5  
ATOM 7292  O O    . ARG A 1 46 ? -7.773  3.067   12.713  1.00 0.00 ?  602  ARG A O    5  
ATOM 7293  C CB   . ARG A 1 46 ? -4.899  2.587   10.911  1.00 0.00 ?  602  ARG A CB   5  
ATOM 7294  C CG   . ARG A 1 46 ? -3.604  1.814   10.881  1.00 0.00 ?  602  ARG A CG   5  
ATOM 7295  C CD   . ARG A 1 46 ? -2.523  2.547   10.138  1.00 0.00 ?  602  ARG A CD   5  
ATOM 7296  N NE   . ARG A 1 46 ? -2.139  3.796   10.777  1.00 0.00 ?  602  ARG A NE   5  
ATOM 7297  C CZ   . ARG A 1 46 ? -0.878  4.147   11.063  1.00 0.00 ?  602  ARG A CZ   5  
ATOM 7298  N NH1  . ARG A 1 46 ? 0.124   3.268   10.916  1.00 0.00 1  602  ARG A NH1  5  
ATOM 7299  N NH2  . ARG A 1 46 ? -0.630  5.361   11.535  1.00 0.00 ?  602  ARG A NH2  5  
ATOM 7300  H H    . ARG A 1 46 ? -6.079  0.417   10.155  1.00 0.00 ?  602  ARG A H    5  
ATOM 7301  H HA   . ARG A 1 46 ? -5.669  1.717   12.710  1.00 0.00 ?  602  ARG A HA   5  
ATOM 7302  H HB2  . ARG A 1 46 ? -5.237  2.735   9.895   1.00 0.00 ?  602  ARG A HB2  5  
ATOM 7303  H HB3  . ARG A 1 46 ? -4.714  3.550   11.366  1.00 0.00 ?  602  ARG A HB3  5  
ATOM 7304  H HG2  . ARG A 1 46 ? -3.276  1.646   11.896  1.00 0.00 ?  602  ARG A HG2  5  
ATOM 7305  H HG3  . ARG A 1 46 ? -3.781  0.862   10.401  1.00 0.00 ?  602  ARG A HG3  5  
ATOM 7306  H HD2  . ARG A 1 46 ? -1.660  1.901   10.079  1.00 0.00 ?  602  ARG A HD2  5  
ATOM 7307  H HD3  . ARG A 1 46 ? -2.877  2.755   9.138   1.00 0.00 ?  602  ARG A HD3  5  
ATOM 7308  H HE   . ARG A 1 46 ? -2.874  4.422   10.971  1.00 0.00 ?  602  ARG A HE   5  
ATOM 7309  H HH11 . ARG A 1 46 ? -0.019  2.317   10.598  1.00 0.00 ?  602  ARG A HH11 5  
ATOM 7310  H HH12 . ARG A 1 46 ? 1.076   3.507   11.120  1.00 0.00 ?  602  ARG A HH12 5  
ATOM 7311  H HH21 . ARG A 1 46 ? -1.383  6.009   11.680  1.00 0.00 ?  602  ARG A HH21 5  
ATOM 7312  H HH22 . ARG A 1 46 ? 0.293   5.679   11.764  1.00 0.00 ?  602  ARG A HH22 5  
ATOM 7313  N N    . GLU A 1 47 ? -7.851  2.779   10.491  1.00 0.00 ?  603  GLU A N    5  
ATOM 7314  C CA   . GLU A 1 47 ? -9.138  3.388   10.371  1.00 0.00 ?  603  GLU A CA   5  
ATOM 7315  C C    . GLU A 1 47 ? -10.085 2.449   9.614   1.00 0.00 ?  603  GLU A C    5  
ATOM 7316  O O    . GLU A 1 47 ? -9.914  2.199   8.417   1.00 0.00 ?  603  GLU A O    5  
ATOM 7317  C CB   . GLU A 1 47 ? -9.067  4.823   9.798   1.00 0.00 ?  603  GLU A CB   5  
ATOM 7318  C CG   . GLU A 1 47 ? -8.537  5.017   8.381   1.00 0.00 ?  603  GLU A CG   5  
ATOM 7319  C CD   . GLU A 1 47 ? -8.408  6.479   8.083   1.00 0.00 ?  603  GLU A CD   5  
ATOM 7320  O OE1  . GLU A 1 47 ? -7.275  7.004   8.141   1.00 0.00 ?  603  GLU A OE1  5  
ATOM 7321  O OE2  . GLU A 1 47 ? -9.437  7.146   7.855   1.00 0.00 -1 603  GLU A OE2  5  
ATOM 7322  H H    . GLU A 1 47 ? -7.408  2.457   9.679   1.00 0.00 ?  603  GLU A H    5  
ATOM 7323  H HA   . GLU A 1 47 ? -9.504  3.430   11.387  1.00 0.00 ?  603  GLU A HA   5  
ATOM 7324  H HB2  . GLU A 1 47 ? -10.058 5.243   9.823   1.00 0.00 ?  603  GLU A HB2  5  
ATOM 7325  H HB3  . GLU A 1 47 ? -8.439  5.400   10.461  1.00 0.00 ?  603  GLU A HB3  5  
ATOM 7326  H HG2  . GLU A 1 47 ? -7.561  4.573   8.262   1.00 0.00 ?  603  GLU A HG2  5  
ATOM 7327  H HG3  . GLU A 1 47 ? -9.215  4.603   7.650   1.00 0.00 ?  603  GLU A HG3  5  
ATOM 7328  N N    . PRO A 1 48 ? -11.090 1.888   10.327  1.00 0.00 ?  604  PRO A N    5  
ATOM 7329  C CA   . PRO A 1 48 ? -11.985 0.844   9.782   1.00 0.00 ?  604  PRO A CA   5  
ATOM 7330  C C    . PRO A 1 48 ? -12.868 1.367   8.669   1.00 0.00 ?  604  PRO A C    5  
ATOM 7331  O O    . PRO A 1 48 ? -13.229 0.647   7.735   1.00 0.00 ?  604  PRO A O    5  
ATOM 7332  C CB   . PRO A 1 48 ? -12.827 0.429   10.990  1.00 0.00 ?  604  PRO A CB   5  
ATOM 7333  C CG   . PRO A 1 48 ? -12.784 1.591   11.917  1.00 0.00 ?  604  PRO A CG   5  
ATOM 7334  C CD   . PRO A 1 48 ? -11.447 2.245   11.718  1.00 0.00 ?  604  PRO A CD   5  
ATOM 7335  H HA   . PRO A 1 48 ? -11.423 -0.004  9.421   1.00 0.00 ?  604  PRO A HA   5  
ATOM 7336  H HB2  . PRO A 1 48 ? -13.836 0.224   10.665  1.00 0.00 ?  604  PRO A HB2  5  
ATOM 7337  H HB3  . PRO A 1 48 ? -12.401 -0.454  11.443  1.00 0.00 ?  604  PRO A HB3  5  
ATOM 7338  H HG2  . PRO A 1 48 ? -13.577 2.282   11.669  1.00 0.00 ?  604  PRO A HG2  5  
ATOM 7339  H HG3  . PRO A 1 48 ? -12.888 1.252   12.937  1.00 0.00 ?  604  PRO A HG3  5  
ATOM 7340  H HD2  . PRO A 1 48 ? -11.547 3.315   11.828  1.00 0.00 ?  604  PRO A HD2  5  
ATOM 7341  H HD3  . PRO A 1 48 ? -10.721 1.863   12.420  1.00 0.00 ?  604  PRO A HD3  5  
ATOM 7342  N N    . SER A 1 49 ? -13.128 2.645   8.743   1.00 0.00 ?  605  SER A N    5  
ATOM 7343  C CA   . SER A 1 49 ? -13.948 3.372   7.820   1.00 0.00 ?  605  SER A CA   5  
ATOM 7344  C C    . SER A 1 49 ? -13.257 3.566   6.464   1.00 0.00 ?  605  SER A C    5  
ATOM 7345  O O    . SER A 1 49 ? -13.793 4.265   5.599   1.00 0.00 ?  605  SER A O    5  
ATOM 7346  C CB   . SER A 1 49 ? -14.315 4.694   8.449   1.00 0.00 ?  605  SER A CB   5  
ATOM 7347  O OG   . SER A 1 49 ? -14.910 4.463   9.724   1.00 0.00 ?  605  SER A OG   5  
ATOM 7348  H H    . SER A 1 49 ? -12.735 3.150   9.487   1.00 0.00 ?  605  SER A H    5  
ATOM 7349  H HA   . SER A 1 49 ? -14.858 2.811   7.662   1.00 0.00 ?  605  SER A HA   5  
ATOM 7350  H HB2  . SER A 1 49 ? -13.425 5.291   8.571   1.00 0.00 ?  605  SER A HB2  5  
ATOM 7351  H HB3  . SER A 1 49 ? -15.022 5.212   7.820   1.00 0.00 ?  605  SER A HB3  5  
ATOM 7352  H HG   . SER A 1 49 ? -15.422 3.646   9.644   1.00 0.00 ?  605  SER A HG   5  
ATOM 7353  N N    . LEU A 1 50 ? -12.029 2.990   6.327   1.00 0.00 ?  606  LEU A N    5  
ATOM 7354  C CA   . LEU A 1 50 ? -11.231 3.056   5.111   1.00 0.00 ?  606  LEU A CA   5  
ATOM 7355  C C    . LEU A 1 50 ? -12.107 2.868   3.899   1.00 0.00 ?  606  LEU A C    5  
ATOM 7356  O O    . LEU A 1 50 ? -12.373 3.828   3.184   1.00 0.00 ?  606  LEU A O    5  
ATOM 7357  C CB   . LEU A 1 50 ? -10.185 1.937   5.122   1.00 0.00 ?  606  LEU A CB   5  
ATOM 7358  C CG   . LEU A 1 50 ? -9.259  1.849   3.901   1.00 0.00 ?  606  LEU A CG   5  
ATOM 7359  C CD1  . LEU A 1 50 ? -7.850  2.009   4.333   1.00 0.00 ?  606  LEU A CD1  5  
ATOM 7360  C CD2  . LEU A 1 50 ? -9.380  0.524   3.180   1.00 0.00 ?  606  LEU A CD2  5  
ATOM 7361  H H    . LEU A 1 50 ? -11.658 2.515   7.101   1.00 0.00 ?  606  LEU A H    5  
ATOM 7362  H HA   . LEU A 1 50 ? -10.718 4.006   5.064   1.00 0.00 ?  606  LEU A HA   5  
ATOM 7363  H HB2  . LEU A 1 50 ? -9.587  2.029   6.017   1.00 0.00 ?  606  LEU A HB2  5  
ATOM 7364  H HB3  . LEU A 1 50 ? -10.768 1.031   5.177   1.00 0.00 ?  606  LEU A HB3  5  
ATOM 7365  H HG   . LEU A 1 50 ? -9.553  2.624   3.212   1.00 0.00 ?  606  LEU A HG   5  
ATOM 7366  H HD11 . LEU A 1 50 ? -7.645  1.177   4.992   1.00 0.00 ?  606  LEU A HD11 5  
ATOM 7367  H HD12 . LEU A 1 50 ? -7.722  2.945   4.852   1.00 0.00 ?  606  LEU A HD12 5  
ATOM 7368  H HD13 . LEU A 1 50 ? -7.202  1.947   3.472   1.00 0.00 ?  606  LEU A HD13 5  
ATOM 7369  H HD21 . LEU A 1 50 ? -8.916  -0.255  3.765   1.00 0.00 ?  606  LEU A HD21 5  
ATOM 7370  H HD22 . LEU A 1 50 ? -8.905  0.581   2.212   1.00 0.00 ?  606  LEU A HD22 5  
ATOM 7371  H HD23 . LEU A 1 50 ? -10.425 0.286   3.057   1.00 0.00 ?  606  LEU A HD23 5  
ATOM 7372  N N    . ARG A 1 51 ? -12.506 1.636   3.589   1.00 0.00 ?  607  ARG A N    5  
ATOM 7373  C CA   . ARG A 1 51 ? -13.495 1.518   2.579   1.00 0.00 ?  607  ARG A CA   5  
ATOM 7374  C C    . ARG A 1 51 ? -14.892 1.381   3.153   1.00 0.00 ?  607  ARG A C    5  
ATOM 7375  O O    . ARG A 1 51 ? -15.790 2.155   2.861   1.00 0.00 ?  607  ARG A O    5  
ATOM 7376  C CB   . ARG A 1 51 ? -13.143 0.462   1.563   1.00 0.00 ?  607  ARG A CB   5  
ATOM 7377  C CG   . ARG A 1 51 ? -11.895 0.795   0.739   1.00 0.00 ?  607  ARG A CG   5  
ATOM 7378  C CD   . ARG A 1 51 ? -12.079 2.000   -0.188  1.00 0.00 ?  607  ARG A CD   5  
ATOM 7379  N NE   . ARG A 1 51 ? -12.377 3.271   0.493   1.00 0.00 ?  607  ARG A NE   5  
ATOM 7380  C CZ   . ARG A 1 51 ? -13.043 4.293   -0.067  1.00 0.00 ?  607  ARG A CZ   5  
ATOM 7381  N NH1  . ARG A 1 51 ? -13.475 4.201   -1.337  1.00 0.00 1  607  ARG A NH1  5  
ATOM 7382  N NH2  . ARG A 1 51 ? -13.282 5.398   0.648   1.00 0.00 ?  607  ARG A NH2  5  
ATOM 7383  H H    . ARG A 1 51 ? -12.148 0.868   4.077   1.00 0.00 ?  607  ARG A H    5  
ATOM 7384  H HA   . ARG A 1 51 ? -13.389 2.479   2.113   1.00 0.00 ?  607  ARG A HA   5  
ATOM 7385  H HB2  . ARG A 1 51 ? -12.967 -0.461  2.093   1.00 0.00 ?  607  ARG A HB2  5  
ATOM 7386  H HB3  . ARG A 1 51 ? -13.977 0.340   0.888   1.00 0.00 ?  607  ARG A HB3  5  
ATOM 7387  H HG2  . ARG A 1 51 ? -11.085 1.035   1.410   1.00 0.00 ?  607  ARG A HG2  5  
ATOM 7388  H HG3  . ARG A 1 51 ? -11.630 -0.067  0.145   1.00 0.00 ?  607  ARG A HG3  5  
ATOM 7389  H HD2  . ARG A 1 51 ? -11.172 2.132   -0.758  1.00 0.00 ?  607  ARG A HD2  5  
ATOM 7390  H HD3  . ARG A 1 51 ? -12.881 1.777   -0.877  1.00 0.00 ?  607  ARG A HD3  5  
ATOM 7391  H HE   . ARG A 1 51 ? -12.073 3.362   1.426   1.00 0.00 ?  607  ARG A HE   5  
ATOM 7392  H HH11 . ARG A 1 51 ? -13.304 3.362   -1.875  1.00 0.00 ?  607  ARG A HH11 5  
ATOM 7393  H HH12 . ARG A 1 51 ? -13.979 4.939   -1.790  1.00 0.00 ?  607  ARG A HH12 5  
ATOM 7394  H HH21 . ARG A 1 51 ? -12.984 5.494   1.603   1.00 0.00 ?  607  ARG A HH21 5  
ATOM 7395  H HH22 . ARG A 1 51 ? -13.768 6.187   0.260   1.00 0.00 ?  607  ARG A HH22 5  
ATOM 7396  N N    . ASP A 1 52 ? -15.046 0.367   3.983   1.00 0.00 ?  608  ASP A N    5  
ATOM 7397  C CA   . ASP A 1 52 ? -16.247 0.140   4.796   1.00 0.00 ?  608  ASP A CA   5  
ATOM 7398  C C    . ASP A 1 52 ? -15.811 -0.645  6.011   1.00 0.00 ?  608  ASP A C    5  
ATOM 7399  O O    . ASP A 1 52 ? -16.068 -0.295  7.157   1.00 0.00 ?  608  ASP A O    5  
ATOM 7400  C CB   . ASP A 1 52 ? -17.258 -0.700  3.992   1.00 0.00 ?  608  ASP A CB   5  
ATOM 7401  C CG   . ASP A 1 52 ? -18.507 -1.060  4.775   1.00 0.00 ?  608  ASP A CG   5  
ATOM 7402  O OD1  . ASP A 1 52 ? -19.532 -0.368  4.626   1.00 0.00 ?  608  ASP A OD1  5  
ATOM 7403  O OD2  . ASP A 1 52 ? -18.493 -2.061  5.518   1.00 0.00 -1 608  ASP A OD2  5  
ATOM 7404  H H    . ASP A 1 52 ? -14.294 -0.243  4.104   1.00 0.00 ?  608  ASP A H    5  
ATOM 7405  H HA   . ASP A 1 52 ? -16.686 1.084   5.082   1.00 0.00 ?  608  ASP A HA   5  
ATOM 7406  H HB2  . ASP A 1 52 ? -17.563 -0.141  3.119   1.00 0.00 ?  608  ASP A HB2  5  
ATOM 7407  H HB3  . ASP A 1 52 ? -16.778 -1.612  3.671   1.00 0.00 ?  608  ASP A HB3  5  
ATOM 7408  N N    . SER A 1 53 ? -15.056 -1.691  5.646   1.00 0.00 ?  609  SER A N    5  
ATOM 7409  C CA   . SER A 1 53 ? -14.429 -2.721  6.454   1.00 0.00 ?  609  SER A CA   5  
ATOM 7410  C C    . SER A 1 53 ? -14.336 -3.915  5.482   1.00 0.00 ?  609  SER A C    5  
ATOM 7411  O O    . SER A 1 53 ? -13.319 -4.145  4.868   1.00 0.00 ?  609  SER A O    5  
ATOM 7412  C CB   . SER A 1 53 ? -15.267 -3.102  7.704   1.00 0.00 ?  609  SER A CB   5  
ATOM 7413  O OG   . SER A 1 53 ? -14.620 -4.091  8.498   1.00 0.00 ?  609  SER A OG   5  
ATOM 7414  H H    . SER A 1 53 ? -14.939 -1.819  4.686   1.00 0.00 ?  609  SER A H    5  
ATOM 7415  H HA   . SER A 1 53 ? -13.431 -2.392  6.710   1.00 0.00 ?  609  SER A HA   5  
ATOM 7416  H HB2  . SER A 1 53 ? -15.413 -2.221  8.312   1.00 0.00 ?  609  SER A HB2  5  
ATOM 7417  H HB3  . SER A 1 53 ? -16.229 -3.480  7.395   1.00 0.00 ?  609  SER A HB3  5  
ATOM 7418  H HG   . SER A 1 53 ? -13.969 -3.636  9.048   1.00 0.00 ?  609  SER A HG   5  
ATOM 7419  N N    . ASN A 1 54 ? -15.438 -4.609  5.313   1.00 0.00 ?  610  ASN A N    5  
ATOM 7420  C CA   . ASN A 1 54 ? -15.651 -5.649  4.272   1.00 0.00 ?  610  ASN A CA   5  
ATOM 7421  C C    . ASN A 1 54 ? -16.318 -5.000  3.009   1.00 0.00 ?  610  ASN A C    5  
ATOM 7422  O O    . ASN A 1 54 ? -17.538 -4.962  2.895   1.00 0.00 ?  610  ASN A O    5  
ATOM 7423  C CB   . ASN A 1 54 ? -16.560 -6.759  4.862   1.00 0.00 ?  610  ASN A CB   5  
ATOM 7424  C CG   . ASN A 1 54 ? -17.709 -6.200  5.742   1.00 0.00 ?  610  ASN A CG   5  
ATOM 7425  O OD1  . ASN A 1 54 ? -18.147 -6.841  6.676   1.00 0.00 ?  610  ASN A OD1  5  
ATOM 7426  N ND2  . ASN A 1 54 ? -18.195 -5.015  5.425   1.00 0.00 ?  610  ASN A ND2  5  
ATOM 7427  H H    . ASN A 1 54 ? -16.192 -4.432  5.914   1.00 0.00 ?  610  ASN A H    5  
ATOM 7428  H HA   . ASN A 1 54 ? -14.691 -6.067  4.008   1.00 0.00 ?  610  ASN A HA   5  
ATOM 7429  H HB2  . ASN A 1 54 ? -16.998 -7.308  4.043   1.00 0.00 ?  610  ASN A HB2  5  
ATOM 7430  H HB3  . ASN A 1 54 ? -15.962 -7.430  5.461   1.00 0.00 ?  610  ASN A HB3  5  
ATOM 7431  H HD21 . ASN A 1 54 ? -17.816 -4.589  4.624   1.00 0.00 ?  610  ASN A HD21 5  
ATOM 7432  H HD22 . ASN A 1 54 ? -18.840 -4.520  5.963   1.00 0.00 ?  610  ASN A HD22 5  
ATOM 7433  N N    . PRO A 1 55 ? -15.573 -4.424  2.089   1.00 0.00 ?  611  PRO A N    5  
ATOM 7434  C CA   . PRO A 1 55 ? -16.190 -3.635  1.019   1.00 0.00 ?  611  PRO A CA   5  
ATOM 7435  C C    . PRO A 1 55 ? -16.202 -4.303  -0.381  1.00 0.00 ?  611  PRO A C    5  
ATOM 7436  O O    . PRO A 1 55 ? -17.260 -4.461  -0.989  1.00 0.00 ?  611  PRO A O    5  
ATOM 7437  C CB   . PRO A 1 55 ? -15.168 -2.458  1.016   1.00 0.00 ?  611  PRO A CB   5  
ATOM 7438  C CG   . PRO A 1 55 ? -14.179 -2.836  2.091   1.00 0.00 ?  611  PRO A CG   5  
ATOM 7439  C CD   . PRO A 1 55 ? -14.176 -4.294  2.071   1.00 0.00 ?  611  PRO A CD   5  
ATOM 7440  H HA   . PRO A 1 55 ? -17.153 -3.223  1.274   1.00 0.00 ?  611  PRO A HA   5  
ATOM 7441  H HB2  . PRO A 1 55 ? -14.688 -2.424  0.051   1.00 0.00 ?  611  PRO A HB2  5  
ATOM 7442  H HB3  . PRO A 1 55 ? -15.600 -1.499  1.257   1.00 0.00 ?  611  PRO A HB3  5  
ATOM 7443  H HG2  . PRO A 1 55 ? -13.188 -2.435  1.957   1.00 0.00 ?  611  PRO A HG2  5  
ATOM 7444  H HG3  . PRO A 1 55 ? -14.633 -2.543  3.035   1.00 0.00 ?  611  PRO A HG3  5  
ATOM 7445  H HD2  . PRO A 1 55 ? -13.720 -4.680  1.173   1.00 0.00 ?  611  PRO A HD2  5  
ATOM 7446  H HD3  . PRO A 1 55 ? -13.728 -4.695  2.965   1.00 0.00 ?  611  PRO A HD3  5  
ATOM 7447  N N    . ASP A 1 56 ? -15.058 -4.678  -0.886  1.00 0.00 ?  612  ASP A N    5  
ATOM 7448  C CA   . ASP A 1 56 ? -15.002 -5.467  -2.109  1.00 0.00 ?  612  ASP A CA   5  
ATOM 7449  C C    . ASP A 1 56 ? -14.318 -6.751  -1.822  1.00 0.00 ?  612  ASP A C    5  
ATOM 7450  O O    . ASP A 1 56 ? -14.814 -7.853  -2.084  1.00 0.00 ?  612  ASP A O    5  
ATOM 7451  C CB   . ASP A 1 56 ? -14.179 -4.758  -3.189  1.00 0.00 ?  612  ASP A CB   5  
ATOM 7452  C CG   . ASP A 1 56 ? -14.808 -3.529  -3.751  1.00 0.00 ?  612  ASP A CG   5  
ATOM 7453  O OD1  . ASP A 1 56 ? -14.601 -2.438  -3.217  1.00 0.00 ?  612  ASP A OD1  5  
ATOM 7454  O OD2  . ASP A 1 56 ? -15.503 -3.631  -4.775  1.00 0.00 -1 612  ASP A OD2  5  
ATOM 7455  H H    . ASP A 1 56 ? -14.242 -4.405  -0.429  1.00 0.00 ?  612  ASP A H    5  
ATOM 7456  H HA   . ASP A 1 56 ? -16.007 -5.612  -2.468  1.00 0.00 ?  612  ASP A HA   5  
ATOM 7457  H HB2  . ASP A 1 56 ? -13.219 -4.482  -2.779  1.00 0.00 ?  612  ASP A HB2  5  
ATOM 7458  H HB3  . ASP A 1 56 ? -14.023 -5.463  -3.991  1.00 0.00 ?  612  ASP A HB3  5  
ATOM 7459  N N    . GLU A 1 57 ? -13.168 -6.528  -1.224  1.00 0.00 ?  613  GLU A N    5  
ATOM 7460  C CA   . GLU A 1 57 ? -12.121 -7.450  -0.880  1.00 0.00 ?  613  GLU A CA   5  
ATOM 7461  C C    . GLU A 1 57 ? -10.888 -6.575  -0.905  1.00 0.00 ?  613  GLU A C    5  
ATOM 7462  O O    . GLU A 1 57 ? -10.073 -6.564  0.014   1.00 0.00 ?  613  GLU A O    5  
ATOM 7463  C CB   . GLU A 1 57 ? -11.940 -8.568  -1.934  1.00 0.00 ?  613  GLU A CB   5  
ATOM 7464  C CG   . GLU A 1 57 ? -10.859 -9.587  -1.589  1.00 0.00 ?  613  GLU A CG   5  
ATOM 7465  C CD   . GLU A 1 57 ? -11.162 -10.359 -0.325  1.00 0.00 ?  613  GLU A CD   5  
ATOM 7466  O OE1  . GLU A 1 57 ? -10.757 -9.926  0.775   1.00 0.00 ?  613  GLU A OE1  5  
ATOM 7467  O OE2  . GLU A 1 57 ? -11.792 -11.436 -0.410  1.00 0.00 -1 613  GLU A OE2  5  
ATOM 7468  H H    . GLU A 1 57 ? -12.978 -5.603  -0.973  1.00 0.00 ?  613  GLU A H    5  
ATOM 7469  H HA   . GLU A 1 57 ? -12.273 -7.847  0.110   1.00 0.00 ?  613  GLU A HA   5  
ATOM 7470  H HB2  . GLU A 1 57 ? -12.876 -9.095  -2.037  1.00 0.00 ?  613  GLU A HB2  5  
ATOM 7471  H HB3  . GLU A 1 57 ? -11.693 -8.113  -2.883  1.00 0.00 ?  613  GLU A HB3  5  
ATOM 7472  H HG2  . GLU A 1 57 ? -10.766 -10.290 -2.405  1.00 0.00 ?  613  GLU A HG2  5  
ATOM 7473  H HG3  . GLU A 1 57 ? -9.923  -9.064  -1.459  1.00 0.00 ?  613  GLU A HG3  5  
ATOM 7474  N N    . ILE A 1 58 ? -10.809 -5.779  -1.976  1.00 0.00 ?  614  ILE A N    5  
ATOM 7475  C CA   . ILE A 1 58 ? -9.697  -4.891  -2.185  1.00 0.00 ?  614  ILE A CA   5  
ATOM 7476  C C    . ILE A 1 58 ? -10.038 -3.619  -3.012  1.00 0.00 ?  614  ILE A C    5  
ATOM 7477  O O    . ILE A 1 58 ? -10.308 -3.687  -4.225  1.00 0.00 ?  614  ILE A O    5  
ATOM 7478  C CB   . ILE A 1 58 ? -8.521  -5.647  -2.842  1.00 0.00 ?  614  ILE A CB   5  
ATOM 7479  C CG1  . ILE A 1 58 ? -7.393  -4.671  -3.132  1.00 0.00 ?  614  ILE A CG1  5  
ATOM 7480  C CG2  . ILE A 1 58 ? -9.012  -6.316  -4.136  1.00 0.00 ?  614  ILE A CG2  5  
ATOM 7481  C CD1  . ILE A 1 58 ? -6.026  -5.261  -3.126  1.00 0.00 ?  614  ILE A CD1  5  
ATOM 7482  H H    . ILE A 1 58 ? -11.523 -5.831  -2.644  1.00 0.00 ?  614  ILE A H    5  
ATOM 7483  H HA   . ILE A 1 58 ? -9.364  -4.577  -1.207  1.00 0.00 ?  614  ILE A HA   5  
ATOM 7484  H HB   . ILE A 1 58 ? -8.175  -6.411  -2.163  1.00 0.00 ?  614  ILE A HB   5  
ATOM 7485  H HG12 . ILE A 1 58 ? -7.552  -4.286  -4.128  1.00 0.00 ?  614  ILE A HG12 5  
ATOM 7486  H HG13 . ILE A 1 58 ? -7.417  -3.841  -2.446  1.00 0.00 ?  614  ILE A HG13 5  
ATOM 7487  H HG21 . ILE A 1 58 ? -8.236  -6.911  -4.588  1.00 0.00 ?  614  ILE A HG21 5  
ATOM 7488  H HG22 . ILE A 1 58 ? -9.309  -5.534  -4.831  1.00 0.00 ?  614  ILE A HG22 5  
ATOM 7489  H HG23 . ILE A 1 58 ? -9.867  -6.933  -3.898  1.00 0.00 ?  614  ILE A HG23 5  
ATOM 7490  H HD11 . ILE A 1 58 ? -5.896  -6.014  -3.888  1.00 0.00 ?  614  ILE A HD11 5  
ATOM 7491  H HD12 . ILE A 1 58 ? -5.838  -5.701  -2.158  1.00 0.00 ?  614  ILE A HD12 5  
ATOM 7492  H HD13 . ILE A 1 58 ? -5.309  -4.471  -3.283  1.00 0.00 ?  614  ILE A HD13 5  
ATOM 7493  N N    . GLU A 1 59 ? -10.071 -2.488  -2.369  1.00 0.00 ?  615  GLU A N    5  
ATOM 7494  C CA   . GLU A 1 59 ? -10.126 -1.241  -3.078  1.00 0.00 ?  615  GLU A CA   5  
ATOM 7495  C C    . GLU A 1 59 ? -9.321  -0.187  -2.403  1.00 0.00 ?  615  GLU A C    5  
ATOM 7496  O O    . GLU A 1 59 ? -9.392  -0.003  -1.189  1.00 0.00 ?  615  GLU A O    5  
ATOM 7497  C CB   . GLU A 1 59 ? -11.530 -0.874  -3.667  1.00 0.00 ?  615  GLU A CB   5  
ATOM 7498  C CG   . GLU A 1 59 ? -11.831 0.422   -4.341  1.00 0.00 ?  615  GLU A CG   5  
ATOM 7499  C CD   . GLU A 1 59 ? -11.860 1.651   -3.501  1.00 0.00 ?  615  GLU A CD   5  
ATOM 7500  O OE1  . GLU A 1 59 ? -10.857 2.305   -3.372  1.00 0.00 ?  615  GLU A OE1  5  
ATOM 7501  O OE2  . GLU A 1 59 ? -12.953 2.034   -3.035  1.00 0.00 -1 615  GLU A OE2  5  
ATOM 7502  H H    . GLU A 1 59 ? -10.037 -2.459  -1.390  1.00 0.00 ?  615  GLU A H    5  
ATOM 7503  H HA   . GLU A 1 59 ? -9.466  -1.479  -3.904  1.00 0.00 ?  615  GLU A HA   5  
ATOM 7504  H HB2  . GLU A 1 59 ? -11.204 -1.299  -4.603  1.00 0.00 ?  615  GLU A HB2  5  
ATOM 7505  H HB3  . GLU A 1 59 ? -12.445 -1.403  -3.461  1.00 0.00 ?  615  GLU A HB3  5  
ATOM 7506  H HG2  . GLU A 1 59 ? -11.303 0.501   -5.276  1.00 0.00 ?  615  GLU A HG2  5  
ATOM 7507  H HG3  . GLU A 1 59 ? -12.848 0.248   -4.635  1.00 0.00 ?  615  GLU A HG3  5  
ATOM 7508  N N    . ILE A 1 60 ? -8.502  0.437   -3.190  1.00 0.00 ?  616  ILE A N    5  
ATOM 7509  C CA   . ILE A 1 60 ? -7.509  1.394   -2.671  1.00 0.00 ?  616  ILE A CA   5  
ATOM 7510  C C    . ILE A 1 60 ? -7.740  2.809   -3.140  1.00 0.00 ?  616  ILE A C    5  
ATOM 7511  O O    . ILE A 1 60 ? -7.331  3.201   -4.171  1.00 0.00 ?  616  ILE A O    5  
ATOM 7512  C CB   . ILE A 1 60 ? -6.061  0.929   -2.921  1.00 0.00 ?  616  ILE A CB   5  
ATOM 7513  C CG1  . ILE A 1 60 ? -5.800  -0.232  -1.980  1.00 0.00 ?  616  ILE A CG1  5  
ATOM 7514  C CG2  . ILE A 1 60 ? -5.044  2.043   -2.655  1.00 0.00 ?  616  ILE A CG2  5  
ATOM 7515  C CD1  . ILE A 1 60 ? -4.477  -0.839  -2.166  1.00 0.00 ?  616  ILE A CD1  5  
ATOM 7516  H H    . ILE A 1 60 ? -8.689  0.256   -4.141  1.00 0.00 ?  616  ILE A H    5  
ATOM 7517  H HA   . ILE A 1 60 ? -7.641  1.346   -1.598  1.00 0.00 ?  616  ILE A HA   5  
ATOM 7518  H HB   . ILE A 1 60 ? -5.960  0.572   -3.939  1.00 0.00 ?  616  ILE A HB   5  
ATOM 7519  H HG12 . ILE A 1 60 ? -5.858  0.120   -0.962  1.00 0.00 ?  616  ILE A HG12 5  
ATOM 7520  H HG13 . ILE A 1 60 ? -6.548  -0.996  -2.133  1.00 0.00 ?  616  ILE A HG13 5  
ATOM 7521  H HG21 . ILE A 1 60 ? -4.047  1.670   -2.834  1.00 0.00 ?  616  ILE A HG21 5  
ATOM 7522  H HG22 . ILE A 1 60 ? -5.131  2.372   -1.630  1.00 0.00 ?  616  ILE A HG22 5  
ATOM 7523  H HG23 . ILE A 1 60 ? -5.246  2.870   -3.319  1.00 0.00 ?  616  ILE A HG23 5  
ATOM 7524  H HD11 . ILE A 1 60 ? -4.430  -1.207  -3.186  1.00 0.00 ?  616  ILE A HD11 5  
ATOM 7525  H HD12 . ILE A 1 60 ? -4.371  -1.631  -1.442  1.00 0.00 ?  616  ILE A HD12 5  
ATOM 7526  H HD13 . ILE A 1 60 ? -3.783  -0.030  -2.019  1.00 0.00 ?  616  ILE A HD13 5  
ATOM 7527  N N    . ASP A 1 61 ? -8.424  3.528   -2.361  1.00 0.00 ?  617  ASP A N    5  
ATOM 7528  C CA   . ASP A 1 61 ? -8.836  4.905   -2.618  1.00 0.00 ?  617  ASP A CA   5  
ATOM 7529  C C    . ASP A 1 61 ? -7.733  5.983   -2.564  1.00 0.00 ?  617  ASP A C    5  
ATOM 7530  O O    . ASP A 1 61 ? -7.984  7.152   -2.817  1.00 0.00 ?  617  ASP A O    5  
ATOM 7531  C CB   . ASP A 1 61 ? -10.162 5.230   -1.967  1.00 0.00 ?  617  ASP A CB   5  
ATOM 7532  C CG   . ASP A 1 61 ? -10.723 6.603   -2.270  1.00 0.00 ?  617  ASP A CG   5  
ATOM 7533  O OD1  . ASP A 1 61 ? -11.435 6.735   -3.303  1.00 0.00 ?  617  ASP A OD1  5  
ATOM 7534  O OD2  . ASP A 1 61 ? -10.504 7.536   -1.496  1.00 0.00 -1 617  ASP A OD2  5  
ATOM 7535  H H    . ASP A 1 61 ? -8.730  3.107   -1.531  1.00 0.00 ?  617  ASP A H    5  
ATOM 7536  H HA   . ASP A 1 61 ? -9.016  4.864   -3.684  1.00 0.00 ?  617  ASP A HA   5  
ATOM 7537  H HB2  . ASP A 1 61 ? -10.776 4.548   -2.547  1.00 0.00 ?  617  ASP A HB2  5  
ATOM 7538  H HB3  . ASP A 1 61 ? -10.177 4.997   -0.912  1.00 0.00 ?  617  ASP A HB3  5  
ATOM 7539  N N    . PHE A 1 62 ? -6.508  5.557   -2.235  1.00 0.00 ?  618  PHE A N    5  
ATOM 7540  C CA   . PHE A 1 62 ? -5.306  6.404   -1.903  1.00 0.00 ?  618  PHE A CA   5  
ATOM 7541  C C    . PHE A 1 62 ? -4.936  7.549   -2.878  1.00 0.00 ?  618  PHE A C    5  
ATOM 7542  O O    . PHE A 1 62 ? -3.880  8.107   -2.754  1.00 0.00 ?  618  PHE A O    5  
ATOM 7543  C CB   . PHE A 1 62 ? -4.085  5.503   -1.887  1.00 0.00 ?  618  PHE A CB   5  
ATOM 7544  C CG   . PHE A 1 62 ? -3.758  4.744   -0.618  1.00 0.00 ?  618  PHE A CG   5  
ATOM 7545  C CD1  . PHE A 1 62 ? -4.359  5.053   0.598   1.00 0.00 ?  618  PHE A CD1  5  
ATOM 7546  C CD2  . PHE A 1 62 ? -2.831  3.704   -0.647  1.00 0.00 ?  618  PHE A CD2  5  
ATOM 7547  C CE1  . PHE A 1 62 ? -4.054  4.344   1.742   1.00 0.00 ?  618  PHE A CE1  5  
ATOM 7548  C CE2  . PHE A 1 62 ? -2.529  3.001   0.499   1.00 0.00 ?  618  PHE A CE2  5  
ATOM 7549  C CZ   . PHE A 1 62 ? -3.138  3.319   1.692   1.00 0.00 ?  618  PHE A CZ   5  
ATOM 7550  H H    . PHE A 1 62 ? -6.392  4.584   -2.223  1.00 0.00 ?  618  PHE A H    5  
ATOM 7551  H HA   . PHE A 1 62 ? -5.387  6.811   -0.911  1.00 0.00 ?  618  PHE A HA   5  
ATOM 7552  H HB2  . PHE A 1 62 ? -4.387  4.734   -2.587  1.00 0.00 ?  618  PHE A HB2  5  
ATOM 7553  H HB3  . PHE A 1 62 ? -3.237  5.998   -2.342  1.00 0.00 ?  618  PHE A HB3  5  
ATOM 7554  H HD1  . PHE A 1 62 ? -5.078  5.851   0.668   1.00 0.00 ?  618  PHE A HD1  5  
ATOM 7555  H HD2  . PHE A 1 62 ? -2.324  3.428   -1.565  1.00 0.00 ?  618  PHE A HD2  5  
ATOM 7556  H HE1  . PHE A 1 62 ? -4.531  4.598   2.678   1.00 0.00 ?  618  PHE A HE1  5  
ATOM 7557  H HE2  . PHE A 1 62 ? -1.806  2.202   0.452   1.00 0.00 ?  618  PHE A HE2  5  
ATOM 7558  H HZ   . PHE A 1 62 ? -2.896  2.763   2.586   1.00 0.00 ?  618  PHE A HZ   5  
ATOM 7559  N N    . GLU A 1 63 ? -5.742  7.873   -3.813  1.00 0.00 ?  619  GLU A N    5  
ATOM 7560  C CA   . GLU A 1 63 ? -5.568  9.111   -4.513  1.00 0.00 ?  619  GLU A CA   5  
ATOM 7561  C C    . GLU A 1 63 ? -6.131  10.194  -3.598  1.00 0.00 ?  619  GLU A C    5  
ATOM 7562  O O    . GLU A 1 63 ? -5.493  11.220  -3.312  1.00 0.00 ?  619  GLU A O    5  
ATOM 7563  C CB   . GLU A 1 63 ? -6.380  9.122   -5.783  1.00 0.00 ?  619  GLU A CB   5  
ATOM 7564  C CG   . GLU A 1 63 ? -5.855  8.345   -6.959  1.00 0.00 ?  619  GLU A CG   5  
ATOM 7565  C CD   . GLU A 1 63 ? -6.869  8.395   -8.063  1.00 0.00 ?  619  GLU A CD   5  
ATOM 7566  O OE1  . GLU A 1 63 ? -7.706  7.495   -8.133  1.00 0.00 ?  619  GLU A OE1  5  
ATOM 7567  O OE2  . GLU A 1 63 ? -6.872  9.359   -8.860  1.00 0.00 -1 619  GLU A OE2  5  
ATOM 7568  H H    . GLU A 1 63 ? -6.502  7.285   -4.010  1.00 0.00 ?  619  GLU A H    5  
ATOM 7569  H HA   . GLU A 1 63 ? -4.522  9.278   -4.722  1.00 0.00 ?  619  GLU A HA   5  
ATOM 7570  H HB2  . GLU A 1 63 ? -7.324  8.666   -5.531  1.00 0.00 ?  619  GLU A HB2  5  
ATOM 7571  H HB3  . GLU A 1 63 ? -6.541  10.148  -6.080  1.00 0.00 ?  619  GLU A HB3  5  
ATOM 7572  H HG2  . GLU A 1 63 ? -4.915  8.761   -7.290  1.00 0.00 ?  619  GLU A HG2  5  
ATOM 7573  H HG3  . GLU A 1 63 ? -5.669  7.307   -6.733  1.00 0.00 ?  619  GLU A HG3  5  
ATOM 7574  N N    . THR A 1 64 ? -7.307  9.894   -3.084  1.00 0.00 ?  620  THR A N    5  
ATOM 7575  C CA   . THR A 1 64 ? -8.084  10.797  -2.290  1.00 0.00 ?  620  THR A CA   5  
ATOM 7576  C C    . THR A 1 64 ? -7.964  10.465  -0.786  1.00 0.00 ?  620  THR A C    5  
ATOM 7577  O O    . THR A 1 64 ? -8.079  11.352  0.060   1.00 0.00 ?  620  THR A O    5  
ATOM 7578  C CB   . THR A 1 64 ? -9.556  10.692  -2.748  1.00 0.00 ?  620  THR A CB   5  
ATOM 7579  O OG1  . THR A 1 64 ? -9.598  10.829  -4.192  1.00 0.00 ?  620  THR A OG1  5  
ATOM 7580  C CG2  . THR A 1 64 ? -10.418 11.780  -2.120  1.00 0.00 ?  620  THR A CG2  5  
ATOM 7581  H H    . THR A 1 64 ? -7.688  9.004   -3.248  1.00 0.00 ?  620  THR A H    5  
ATOM 7582  H HA   . THR A 1 64 ? -7.747  11.808  -2.472  1.00 0.00 ?  620  THR A HA   5  
ATOM 7583  H HB   . THR A 1 64 ? -9.935  9.717   -2.473  1.00 0.00 ?  620  THR A HB   5  
ATOM 7584  H HG1  . THR A 1 64 ? -10.103 10.084  -4.541  1.00 0.00 ?  620  THR A HG1  5  
ATOM 7585  H HG21 . THR A 1 64 ? -10.031 12.748  -2.401  1.00 0.00 ?  620  THR A HG21 5  
ATOM 7586  H HG22 . THR A 1 64 ? -10.398 11.679  -1.045  1.00 0.00 ?  620  THR A HG22 5  
ATOM 7587  H HG23 . THR A 1 64 ? -11.433 11.680  -2.475  1.00 0.00 ?  620  THR A HG23 5  
ATOM 7588  N N    . LEU A 1 65 ? -7.695  9.200   -0.469  1.00 0.00 ?  621  LEU A N    5  
ATOM 7589  C CA   . LEU A 1 65 ? -7.598  8.756   0.929   1.00 0.00 ?  621  LEU A CA   5  
ATOM 7590  C C    . LEU A 1 65 ? -6.358  9.379   1.643   1.00 0.00 ?  621  LEU A C    5  
ATOM 7591  O O    . LEU A 1 65 ? -5.446  9.931   0.979   1.00 0.00 ?  621  LEU A O    5  
ATOM 7592  C CB   . LEU A 1 65 ? -7.627  7.211   1.005   1.00 0.00 ?  621  LEU A CB   5  
ATOM 7593  C CG   . LEU A 1 65 ? -7.745  6.560   2.394   1.00 0.00 ?  621  LEU A CG   5  
ATOM 7594  C CD1  . LEU A 1 65 ? -9.031  6.987   3.093   1.00 0.00 ?  621  LEU A CD1  5  
ATOM 7595  C CD2  . LEU A 1 65 ? -7.701  5.051   2.264   1.00 0.00 ?  621  LEU A CD2  5  
ATOM 7596  H H    . LEU A 1 65 ? -7.594  8.548   -1.192  1.00 0.00 ?  621  LEU A H    5  
ATOM 7597  H HA   . LEU A 1 65 ? -8.475  9.149   1.423   1.00 0.00 ?  621  LEU A HA   5  
ATOM 7598  H HB2  . LEU A 1 65 ? -8.465  6.868   0.417   1.00 0.00 ?  621  LEU A HB2  5  
ATOM 7599  H HB3  . LEU A 1 65 ? -6.727  6.841   0.543   1.00 0.00 ?  621  LEU A HB3  5  
ATOM 7600  H HG   . LEU A 1 65 ? -6.910  6.868   3.005   1.00 0.00 ?  621  LEU A HG   5  
ATOM 7601  H HD11 . LEU A 1 65 ? -9.034  8.060   3.228   1.00 0.00 ?  621  LEU A HD11 5  
ATOM 7602  H HD12 . LEU A 1 65 ? -9.095  6.504   4.056   1.00 0.00 ?  621  LEU A HD12 5  
ATOM 7603  H HD13 . LEU A 1 65 ? -9.880  6.700   2.491   1.00 0.00 ?  621  LEU A HD13 5  
ATOM 7604  H HD21 . LEU A 1 65 ? -7.790  4.604   3.244   1.00 0.00 ?  621  LEU A HD21 5  
ATOM 7605  H HD22 . LEU A 1 65 ? -6.765  4.752   1.815   1.00 0.00 ?  621  LEU A HD22 5  
ATOM 7606  H HD23 . LEU A 1 65 ? -8.520  4.718   1.644   1.00 0.00 ?  621  LEU A HD23 5  
ATOM 7607  N N    . LYS A 1 66 ? -6.325  9.260   2.968   1.00 0.00 ?  622  LYS A N    5  
ATOM 7608  C CA   . LYS A 1 66 ? -5.377  9.976   3.836   1.00 0.00 ?  622  LYS A CA   5  
ATOM 7609  C C    . LYS A 1 66 ? -3.926  9.470   3.735   1.00 0.00 ?  622  LYS A C    5  
ATOM 7610  O O    . LYS A 1 66 ? -3.677  8.286   3.485   1.00 0.00 ?  622  LYS A O    5  
ATOM 7611  C CB   . LYS A 1 66 ? -5.861  9.855   5.270   1.00 0.00 ?  622  LYS A CB   5  
ATOM 7612  C CG   . LYS A 1 66 ? -7.273  10.359  5.479   1.00 0.00 ?  622  LYS A CG   5  
ATOM 7613  C CD   . LYS A 1 66 ? -7.767  9.971   6.841   1.00 0.00 ?  622  LYS A CD   5  
ATOM 7614  C CE   . LYS A 1 66 ? -9.216  10.339  7.043   1.00 0.00 ?  622  LYS A CE   5  
ATOM 7615  N NZ   . LYS A 1 66 ? -9.743  9.747   8.285   1.00 0.00 1  622  LYS A NZ   5  
ATOM 7616  H H    . LYS A 1 66 ? -6.946  8.641   3.415   1.00 0.00 ?  622  LYS A H    5  
ATOM 7617  H HA   . LYS A 1 66 ? -5.408  11.021  3.570   1.00 0.00 ?  622  LYS A HA   5  
ATOM 7618  H HB2  . LYS A 1 66 ? -5.822  8.815   5.557   1.00 0.00 ?  622  LYS A HB2  5  
ATOM 7619  H HB3  . LYS A 1 66 ? -5.199  10.419  5.910   1.00 0.00 ?  622  LYS A HB3  5  
ATOM 7620  H HG2  . LYS A 1 66 ? -7.280  11.436  5.388   1.00 0.00 ?  622  LYS A HG2  5  
ATOM 7621  H HG3  . LYS A 1 66 ? -7.919  9.925   4.728   1.00 0.00 ?  622  LYS A HG3  5  
ATOM 7622  H HD2  . LYS A 1 66 ? -7.658  8.904   6.969   1.00 0.00 ?  622  LYS A HD2  5  
ATOM 7623  H HD3  . LYS A 1 66 ? -7.168  10.486  7.577   1.00 0.00 ?  622  LYS A HD3  5  
ATOM 7624  H HE2  . LYS A 1 66 ? -9.295  11.414  7.097   1.00 0.00 ?  622  LYS A HE2  5  
ATOM 7625  H HE3  . LYS A 1 66 ? -9.792  9.976   6.205   1.00 0.00 ?  622  LYS A HE3  5  
ATOM 7626  H HZ1  . LYS A 1 66 ? -9.669  8.704   8.205   1.00 0.00 ?  622  LYS A HZ1  5  
ATOM 7627  H HZ2  . LYS A 1 66 ? -10.737 9.995   8.457   1.00 0.00 ?  622  LYS A HZ2  5  
ATOM 7628  H HZ3  . LYS A 1 66 ? -9.201  10.026  9.126   1.00 0.00 ?  622  LYS A HZ3  5  
ATOM 7629  N N    . PRO A 1 67 ? -2.936  10.377  3.957   1.00 0.00 ?  623  PRO A N    5  
ATOM 7630  C CA   . PRO A 1 67 ? -1.519  10.034  3.902   1.00 0.00 ?  623  PRO A CA   5  
ATOM 7631  C C    . PRO A 1 67 ? -1.040  9.272   5.147   1.00 0.00 ?  623  PRO A C    5  
ATOM 7632  O O    . PRO A 1 67 ? -0.089  8.506   5.072   1.00 0.00 ?  623  PRO A O    5  
ATOM 7633  C CB   . PRO A 1 67 ? -0.822  11.393  3.801   1.00 0.00 ?  623  PRO A CB   5  
ATOM 7634  C CG   . PRO A 1 67 ? -1.742  12.339  4.493   1.00 0.00 ?  623  PRO A CG   5  
ATOM 7635  C CD   . PRO A 1 67 ? -3.135  11.823  4.252   1.00 0.00 ?  623  PRO A CD   5  
ATOM 7636  H HA   . PRO A 1 67 ? -1.297  9.449   3.021   1.00 0.00 ?  623  PRO A HA   5  
ATOM 7637  H HB2  . PRO A 1 67 ? 0.141   11.344  4.289   1.00 0.00 ?  623  PRO A HB2  5  
ATOM 7638  H HB3  . PRO A 1 67 ? -0.687  11.664  2.764   1.00 0.00 ?  623  PRO A HB3  5  
ATOM 7639  H HG2  . PRO A 1 67 ? -1.526  12.350  5.551   1.00 0.00 ?  623  PRO A HG2  5  
ATOM 7640  H HG3  . PRO A 1 67 ? -1.632  13.330  4.079   1.00 0.00 ?  623  PRO A HG3  5  
ATOM 7641  H HD2  . PRO A 1 67 ? -3.747  11.959  5.133   1.00 0.00 ?  623  PRO A HD2  5  
ATOM 7642  H HD3  . PRO A 1 67 ? -3.571  12.329  3.404   1.00 0.00 ?  623  PRO A HD3  5  
ATOM 7643  N N    . THR A 1 68 ? -1.707  9.477   6.272   1.00 0.00 ?  624  THR A N    5  
ATOM 7644  C CA   . THR A 1 68 ? -1.354  8.811   7.510   1.00 0.00 ?  624  THR A CA   5  
ATOM 7645  C C    . THR A 1 68 ? -1.615  7.298   7.370   1.00 0.00 ?  624  THR A C    5  
ATOM 7646  O O    . THR A 1 68 ? -0.765  6.467   7.709   1.00 0.00 ?  624  THR A O    5  
ATOM 7647  C CB   . THR A 1 68 ? -2.200  9.382   8.662   1.00 0.00 ?  624  THR A CB   5  
ATOM 7648  O OG1  . THR A 1 68 ? -2.161  10.835  8.610   1.00 0.00 ?  624  THR A OG1  5  
ATOM 7649  C CG2  . THR A 1 68 ? -1.671  8.923   10.013  1.00 0.00 ?  624  THR A CG2  5  
ATOM 7650  H H    . THR A 1 68 ? -2.456  10.108  6.291   1.00 0.00 ?  624  THR A H    5  
ATOM 7651  H HA   . THR A 1 68 ? -0.308  8.984   7.715   1.00 0.00 ?  624  THR A HA   5  
ATOM 7652  H HB   . THR A 1 68 ? -3.216  9.037   8.534   1.00 0.00 ?  624  THR A HB   5  
ATOM 7653  H HG1  . THR A 1 68 ? -1.308  11.089  8.991   1.00 0.00 ?  624  THR A HG1  5  
ATOM 7654  H HG21 . THR A 1 68 ? -2.302  9.307   10.799  1.00 0.00 ?  624  THR A HG21 5  
ATOM 7655  H HG22 . THR A 1 68 ? -0.668  9.299   10.147  1.00 0.00 ?  624  THR A HG22 5  
ATOM 7656  H HG23 . THR A 1 68 ? -1.661  7.844   10.049  1.00 0.00 ?  624  THR A HG23 5  
ATOM 7657  N N    . THR A 1 69 ? -2.769  6.965   6.818   1.00 0.00 ?  625  THR A N    5  
ATOM 7658  C CA   . THR A 1 69 ? -3.177  5.602   6.592   1.00 0.00 ?  625  THR A CA   5  
ATOM 7659  C C    . THR A 1 69 ? -2.256  4.958   5.537   1.00 0.00 ?  625  THR A C    5  
ATOM 7660  O O    . THR A 1 69 ? -1.918  3.773   5.612   1.00 0.00 ?  625  THR A O    5  
ATOM 7661  C CB   . THR A 1 69 ? -4.605  5.638   6.060   1.00 0.00 ?  625  THR A CB   5  
ATOM 7662  O OG1  . THR A 1 69 ? -5.201  6.892   6.491   1.00 0.00 ?  625  THR A OG1  5  
ATOM 7663  C CG2  . THR A 1 69 ? -5.408  4.481   6.629   1.00 0.00 ?  625  THR A CG2  5  
ATOM 7664  H H    . THR A 1 69 ? -3.443  7.630   6.558   1.00 0.00 ?  625  THR A H    5  
ATOM 7665  H HA   . THR A 1 69 ? -3.158  5.048   7.519   1.00 0.00 ?  625  THR A HA   5  
ATOM 7666  H HB   . THR A 1 69 ? -4.594  5.590   4.980   1.00 0.00 ?  625  THR A HB   5  
ATOM 7667  H HG1  . THR A 1 69 ? -5.980  6.743   7.055   1.00 0.00 ?  625  THR A HG1  5  
ATOM 7668  H HG21 . THR A 1 69 ? -6.389  4.466   6.178   1.00 0.00 ?  625  THR A HG21 5  
ATOM 7669  H HG22 . THR A 1 69 ? -5.512  4.613   7.697   1.00 0.00 ?  625  THR A HG22 5  
ATOM 7670  H HG23 . THR A 1 69 ? -4.896  3.550   6.432   1.00 0.00 ?  625  THR A HG23 5  
ATOM 7671  N N    . LEU A 1 70 ? -1.827  5.788   4.593   1.00 0.00 ?  626  LEU A N    5  
ATOM 7672  C CA   . LEU A 1 70 ? -0.924  5.413   3.501   1.00 0.00 ?  626  LEU A CA   5  
ATOM 7673  C C    . LEU A 1 70 ? 0.392   4.852   4.047   1.00 0.00 ?  626  LEU A C    5  
ATOM 7674  O O    . LEU A 1 70 ? 0.963   3.902   3.485   1.00 0.00 ?  626  LEU A O    5  
ATOM 7675  C CB   . LEU A 1 70 ? -0.701  6.671   2.593   1.00 0.00 ?  626  LEU A CB   5  
ATOM 7676  C CG   . LEU A 1 70 ? 0.222   6.586   1.352   1.00 0.00 ?  626  LEU A CG   5  
ATOM 7677  C CD1  . LEU A 1 70 ? 1.705   6.597   1.708   1.00 0.00 ?  626  LEU A CD1  5  
ATOM 7678  C CD2  . LEU A 1 70 ? -0.121  5.379   0.527   1.00 0.00 ?  626  LEU A CD2  5  
ATOM 7679  H H    . LEU A 1 70 ? -2.160  6.709   4.633   1.00 0.00 ?  626  LEU A H    5  
ATOM 7680  H HA   . LEU A 1 70 ? -1.412  4.648   2.916   1.00 0.00 ?  626  LEU A HA   5  
ATOM 7681  H HB2  . LEU A 1 70 ? -1.667  6.982   2.229   1.00 0.00 ?  626  LEU A HB2  5  
ATOM 7682  H HB3  . LEU A 1 70 ? -0.320  7.454   3.231   1.00 0.00 ?  626  LEU A HB3  5  
ATOM 7683  H HG   . LEU A 1 70 ? 0.045   7.459   0.743   1.00 0.00 ?  626  LEU A HG   5  
ATOM 7684  H HD11 . LEU A 1 70 ? 2.291   6.539   0.801   1.00 0.00 ?  626  LEU A HD11 5  
ATOM 7685  H HD12 . LEU A 1 70 ? 1.929   5.748   2.336   1.00 0.00 ?  626  LEU A HD12 5  
ATOM 7686  H HD13 . LEU A 1 70 ? 1.943   7.509   2.233   1.00 0.00 ?  626  LEU A HD13 5  
ATOM 7687  H HD21 . LEU A 1 70 ? 0.021   4.488   1.121   1.00 0.00 ?  626  LEU A HD21 5  
ATOM 7688  H HD22 . LEU A 1 70 ? 0.497   5.325   -0.354  1.00 0.00 ?  626  LEU A HD22 5  
ATOM 7689  H HD23 . LEU A 1 70 ? -1.159  5.433   0.230   1.00 0.00 ?  626  LEU A HD23 5  
ATOM 7690  N N    . ARG A 1 71 ? 0.839   5.397   5.172   1.00 0.00 ?  627  ARG A N    5  
ATOM 7691  C CA   . ARG A 1 71 ? 2.116   5.010   5.755   1.00 0.00 ?  627  ARG A CA   5  
ATOM 7692  C C    . ARG A 1 71 ? 2.099   3.553   6.204   1.00 0.00 ?  627  ARG A C    5  
ATOM 7693  O O    . ARG A 1 71 ? 3.137   2.903   6.262   1.00 0.00 ?  627  ARG A O    5  
ATOM 7694  C CB   . ARG A 1 71 ? 2.511   5.920   6.930   1.00 0.00 ?  627  ARG A CB   5  
ATOM 7695  C CG   . ARG A 1 71 ? 2.482   7.419   6.626   1.00 0.00 ?  627  ARG A CG   5  
ATOM 7696  C CD   . ARG A 1 71 ? 3.236   7.784   5.349   1.00 0.00 ?  627  ARG A CD   5  
ATOM 7697  N NE   . ARG A 1 71 ? 4.649   7.393   5.375   1.00 0.00 ?  627  ARG A NE   5  
ATOM 7698  C CZ   . ARG A 1 71 ? 5.414   7.250   4.285   1.00 0.00 ?  627  ARG A CZ   5  
ATOM 7699  N NH1  . ARG A 1 71 ? 4.916   7.529   3.074   1.00 0.00 1  627  ARG A NH1  5  
ATOM 7700  N NH2  . ARG A 1 71 ? 6.673   6.863   4.408   1.00 0.00 ?  627  ARG A NH2  5  
ATOM 7701  H H    . ARG A 1 71 ? 0.281   6.070   5.623   1.00 0.00 ?  627  ARG A H    5  
ATOM 7702  H HA   . ARG A 1 71 ? 2.862   5.105   4.979   1.00 0.00 ?  627  ARG A HA   5  
ATOM 7703  H HB2  . ARG A 1 71 ? 1.835   5.735   7.752   1.00 0.00 ?  627  ARG A HB2  5  
ATOM 7704  H HB3  . ARG A 1 71 ? 3.511   5.659   7.243   1.00 0.00 ?  627  ARG A HB3  5  
ATOM 7705  H HG2  . ARG A 1 71 ? 1.453   7.729   6.512   1.00 0.00 ?  627  ARG A HG2  5  
ATOM 7706  H HG3  . ARG A 1 71 ? 2.920   7.950   7.458   1.00 0.00 ?  627  ARG A HG3  5  
ATOM 7707  H HD2  . ARG A 1 71 ? 2.760   7.291   4.514   1.00 0.00 ?  627  ARG A HD2  5  
ATOM 7708  H HD3  . ARG A 1 71 ? 3.170   8.852   5.212   1.00 0.00 ?  627  ARG A HD3  5  
ATOM 7709  H HE   . ARG A 1 71 ? 5.020   7.241   6.278   1.00 0.00 ?  627  ARG A HE   5  
ATOM 7710  H HH11 . ARG A 1 71 ? 3.977   7.859   2.966   1.00 0.00 ?  627  ARG A HH11 5  
ATOM 7711  H HH12 . ARG A 1 71 ? 5.436   7.404   2.222   1.00 0.00 ?  627  ARG A HH12 5  
ATOM 7712  H HH21 . ARG A 1 71 ? 7.085   6.662   5.301   1.00 0.00 ?  627  ARG A HH21 5  
ATOM 7713  H HH22 . ARG A 1 71 ? 7.286   6.782   3.619   1.00 0.00 ?  627  ARG A HH22 5  
ATOM 7714  N N    . GLU A 1 72 ? 0.914   3.036   6.485   1.00 0.00 ?  628  GLU A N    5  
ATOM 7715  C CA   . GLU A 1 72 ? 0.767   1.669   6.936   1.00 0.00 ?  628  GLU A CA   5  
ATOM 7716  C C    . GLU A 1 72 ? 1.097   0.696   5.806   1.00 0.00 ?  628  GLU A C    5  
ATOM 7717  O O    . GLU A 1 72 ? 1.762   -0.317  6.023   1.00 0.00 ?  628  GLU A O    5  
ATOM 7718  C CB   . GLU A 1 72 ? -0.647  1.433   7.448   1.00 0.00 ?  628  GLU A CB   5  
ATOM 7719  C CG   . GLU A 1 72 ? -0.849  0.090   8.130   1.00 0.00 ?  628  GLU A CG   5  
ATOM 7720  C CD   . GLU A 1 72 ? 0.096   -0.096  9.290   1.00 0.00 ?  628  GLU A CD   5  
ATOM 7721  O OE1  . GLU A 1 72 ? 0.947   -0.987  9.240   1.00 0.00 ?  628  GLU A OE1  5  
ATOM 7722  O OE2  . GLU A 1 72 ? 0.028   0.670   10.261  1.00 0.00 -1 628  GLU A OE2  5  
ATOM 7723  H H    . GLU A 1 72 ? 0.113   3.592   6.372   1.00 0.00 ?  628  GLU A H    5  
ATOM 7724  H HA   . GLU A 1 72 ? 1.463   1.511   7.745   1.00 0.00 ?  628  GLU A HA   5  
ATOM 7725  H HB2  . GLU A 1 72 ? -0.887  2.212   8.155   1.00 0.00 ?  628  GLU A HB2  5  
ATOM 7726  H HB3  . GLU A 1 72 ? -1.333  1.502   6.617   1.00 0.00 ?  628  GLU A HB3  5  
ATOM 7727  H HG2  . GLU A 1 72 ? -1.863  0.026   8.494   1.00 0.00 ?  628  GLU A HG2  5  
ATOM 7728  H HG3  . GLU A 1 72 ? -0.673  -0.695  7.410   1.00 0.00 ?  628  GLU A HG3  5  
ATOM 7729  N N    . LEU A 1 73 ? 0.674   1.024   4.592   1.00 0.00 ?  629  LEU A N    5  
ATOM 7730  C CA   . LEU A 1 73 ? 0.937   0.152   3.462   1.00 0.00 ?  629  LEU A CA   5  
ATOM 7731  C C    . LEU A 1 73 ? 2.440   0.186   3.142   1.00 0.00 ?  629  LEU A C    5  
ATOM 7732  O O    . LEU A 1 73 ? 3.015   -0.810  2.732   1.00 0.00 ?  629  LEU A O    5  
ATOM 7733  C CB   . LEU A 1 73 ? 0.045   0.515   2.246   1.00 0.00 ?  629  LEU A CB   5  
ATOM 7734  C CG   . LEU A 1 73 ? -0.521  -0.689  1.433   1.00 0.00 ?  629  LEU A CG   5  
ATOM 7735  C CD1  . LEU A 1 73 ? -1.511  -0.240  0.389   1.00 0.00 ?  629  LEU A CD1  5  
ATOM 7736  C CD2  . LEU A 1 73 ? 0.573   -1.500  0.779   1.00 0.00 ?  629  LEU A CD2  5  
ATOM 7737  H H    . LEU A 1 73 ? 0.193   1.871   4.468   1.00 0.00 ?  629  LEU A H    5  
ATOM 7738  H HA   . LEU A 1 73 ? 0.715   -0.856  3.787   1.00 0.00 ?  629  LEU A HA   5  
ATOM 7739  H HB2  . LEU A 1 73 ? -0.790  1.095   2.608   1.00 0.00 ?  629  LEU A HB2  5  
ATOM 7740  H HB3  . LEU A 1 73 ? 0.624   1.129   1.574   1.00 0.00 ?  629  LEU A HB3  5  
ATOM 7741  H HG   . LEU A 1 73 ? -1.056  -1.336  2.113   1.00 0.00 ?  629  LEU A HG   5  
ATOM 7742  H HD11 . LEU A 1 73 ? -1.880  -1.103  -0.146  1.00 0.00 ?  629  LEU A HD11 5  
ATOM 7743  H HD12 . LEU A 1 73 ? -1.035  0.436   -0.304  1.00 0.00 ?  629  LEU A HD12 5  
ATOM 7744  H HD13 . LEU A 1 73 ? -2.338  0.250   0.880   1.00 0.00 ?  629  LEU A HD13 5  
ATOM 7745  H HD21 . LEU A 1 73 ? 1.252   -1.840  1.547   1.00 0.00 ?  629  LEU A HD21 5  
ATOM 7746  H HD22 . LEU A 1 73 ? 1.095   -0.895  0.054   1.00 0.00 ?  629  LEU A HD22 5  
ATOM 7747  H HD23 . LEU A 1 73 ? 0.138   -2.355  0.284   1.00 0.00 ?  629  LEU A HD23 5  
ATOM 7748  N N    . GLU A 1 74 ? 3.070   1.337   3.401   1.00 0.00 ?  630  GLU A N    5  
ATOM 7749  C CA   . GLU A 1 74 ? 4.530   1.508   3.261   1.00 0.00 ?  630  GLU A CA   5  
ATOM 7750  C C    . GLU A 1 74 ? 5.247   0.480   4.156   1.00 0.00 ?  630  GLU A C    5  
ATOM 7751  O O    . GLU A 1 74 ? 6.193   -0.197  3.735   1.00 0.00 ?  630  GLU A O    5  
ATOM 7752  C CB   . GLU A 1 74 ? 4.901   2.958   3.663   1.00 0.00 ?  630  GLU A CB   5  
ATOM 7753  C CG   . GLU A 1 74 ? 6.384   3.323   3.628   1.00 0.00 ?  630  GLU A CG   5  
ATOM 7754  C CD   . GLU A 1 74 ? 7.005   3.232   2.254   1.00 0.00 ?  630  GLU A CD   5  
ATOM 7755  O OE1  . GLU A 1 74 ? 7.788   2.292   2.006   1.00 0.00 ?  630  GLU A OE1  5  
ATOM 7756  O OE2  . GLU A 1 74 ? 6.739   4.113   1.400   1.00 0.00 -1 630  GLU A OE2  5  
ATOM 7757  H H    . GLU A 1 74 ? 2.526   2.102   3.686   1.00 0.00 ?  630  GLU A H    5  
ATOM 7758  H HA   . GLU A 1 74 ? 4.829   1.323   2.241   1.00 0.00 ?  630  GLU A HA   5  
ATOM 7759  H HB2  . GLU A 1 74 ? 4.384   3.635   3.001   1.00 0.00 ?  630  GLU A HB2  5  
ATOM 7760  H HB3  . GLU A 1 74 ? 4.535   3.127   4.665   1.00 0.00 ?  630  GLU A HB3  5  
ATOM 7761  H HG2  . GLU A 1 74 ? 6.498   4.337   3.981   1.00 0.00 ?  630  GLU A HG2  5  
ATOM 7762  H HG3  . GLU A 1 74 ? 6.913   2.657   4.295   1.00 0.00 ?  630  GLU A HG3  5  
ATOM 7763  N N    . ARG A 1 75 ? 4.738   0.322   5.358   1.00 0.00 ?  631  ARG A N    5  
ATOM 7764  C CA   . ARG A 1 75 ? 5.288   -0.629  6.319   1.00 0.00 ?  631  ARG A CA   5  
ATOM 7765  C C    . ARG A 1 75 ? 5.002   -2.042  5.847   1.00 0.00 ?  631  ARG A C    5  
ATOM 7766  O O    . ARG A 1 75 ? 5.877   -2.920  5.891   1.00 0.00 ?  631  ARG A O    5  
ATOM 7767  C CB   . ARG A 1 75 ? 4.634   -0.430  7.676   1.00 0.00 ?  631  ARG A CB   5  
ATOM 7768  C CG   . ARG A 1 75 ? 4.686   0.989   8.163   1.00 0.00 ?  631  ARG A CG   5  
ATOM 7769  C CD   . ARG A 1 75 ? 3.924   1.151   9.462   1.00 0.00 ?  631  ARG A CD   5  
ATOM 7770  N NE   . ARG A 1 75 ? 4.528   0.389   10.560  1.00 0.00 ?  631  ARG A NE   5  
ATOM 7771  C CZ   . ARG A 1 75 ? 3.843   -0.170  11.567  1.00 0.00 ?  631  ARG A CZ   5  
ATOM 7772  N NH1  . ARG A 1 75 ? 2.518   -0.294  11.499  1.00 0.00 1  631  ARG A NH1  5  
ATOM 7773  N NH2  . ARG A 1 75 ? 4.492   -0.677  12.603  1.00 0.00 ?  631  ARG A NH2  5  
ATOM 7774  H H    . ARG A 1 75 ? 3.959   0.868   5.597   1.00 0.00 ?  631  ARG A H    5  
ATOM 7775  H HA   . ARG A 1 75 ? 6.352   -0.472  6.406   1.00 0.00 ?  631  ARG A HA   5  
ATOM 7776  H HB2  . ARG A 1 75 ? 3.598   -0.723  7.603   1.00 0.00 ?  631  ARG A HB2  5  
ATOM 7777  H HB3  . ARG A 1 75 ? 5.129   -1.061  8.400   1.00 0.00 ?  631  ARG A HB3  5  
ATOM 7778  H HG2  . ARG A 1 75 ? 5.720   1.273   8.290   1.00 0.00 ?  631  ARG A HG2  5  
ATOM 7779  H HG3  . ARG A 1 75 ? 4.230   1.595   7.394   1.00 0.00 ?  631  ARG A HG3  5  
ATOM 7780  H HD2  . ARG A 1 75 ? 3.912   2.197   9.728   1.00 0.00 ?  631  ARG A HD2  5  
ATOM 7781  H HD3  . ARG A 1 75 ? 2.911   0.808   9.313   1.00 0.00 ?  631  ARG A HD3  5  
ATOM 7782  H HE   . ARG A 1 75 ? 5.513   0.382   10.544  1.00 0.00 ?  631  ARG A HE   5  
ATOM 7783  H HH11 . ARG A 1 75 ? 1.954   -0.001  10.714  1.00 0.00 ?  631  ARG A HH11 5  
ATOM 7784  H HH12 . ARG A 1 75 ? 1.984   -0.683  12.253  1.00 0.00 ?  631  ARG A HH12 5  
ATOM 7785  H HH21 . ARG A 1 75 ? 5.493   -0.672  12.673  1.00 0.00 ?  631  ARG A HH21 5  
ATOM 7786  H HH22 . ARG A 1 75 ? 4.000   -1.058  13.389  1.00 0.00 ?  631  ARG A HH22 5  
ATOM 7787  N N    . TYR A 1 76 ? 3.780   -2.243  5.372   1.00 0.00 ?  632  TYR A N    5  
ATOM 7788  C CA   . TYR A 1 76 ? 3.313   -3.524  4.901   1.00 0.00 ?  632  TYR A CA   5  
ATOM 7789  C C    . TYR A 1 76 ? 4.189   -4.065  3.800   1.00 0.00 ?  632  TYR A C    5  
ATOM 7790  O O    . TYR A 1 76 ? 4.601   -5.219  3.855   1.00 0.00 ?  632  TYR A O    5  
ATOM 7791  C CB   . TYR A 1 76 ? 1.886   -3.414  4.355   1.00 0.00 ?  632  TYR A CB   5  
ATOM 7792  C CG   . TYR A 1 76 ? 1.368   -4.726  3.815   1.00 0.00 ?  632  TYR A CG   5  
ATOM 7793  C CD1  . TYR A 1 76 ? 0.685   -5.620  4.617   1.00 0.00 ?  632  TYR A CD1  5  
ATOM 7794  C CD2  . TYR A 1 76 ? 1.613   -5.077  2.498   1.00 0.00 ?  632  TYR A CD2  5  
ATOM 7795  C CE1  . TYR A 1 76 ? 0.259   -6.837  4.111   1.00 0.00 ?  632  TYR A CE1  5  
ATOM 7796  C CE2  . TYR A 1 76 ? 1.200   -6.261  1.985   1.00 0.00 ?  632  TYR A CE2  5  
ATOM 7797  C CZ   . TYR A 1 76 ? 0.523   -7.152  2.789   1.00 0.00 ?  632  TYR A CZ   5  
ATOM 7798  O OH   . TYR A 1 76 ? 0.113   -8.356  2.278   1.00 0.00 ?  632  TYR A OH   5  
ATOM 7799  H H    . TYR A 1 76 ? 3.145   -1.494  5.363   1.00 0.00 ?  632  TYR A H    5  
ATOM 7800  H HA   . TYR A 1 76 ? 3.298   -4.216  5.728   1.00 0.00 ?  632  TYR A HA   5  
ATOM 7801  H HB2  . TYR A 1 76 ? 1.204   -3.028  5.096   1.00 0.00 ?  632  TYR A HB2  5  
ATOM 7802  H HB3  . TYR A 1 76 ? 1.955   -2.736  3.513   1.00 0.00 ?  632  TYR A HB3  5  
ATOM 7803  H HD1  . TYR A 1 76 ? 0.487   -5.343  5.642   1.00 0.00 ?  632  TYR A HD1  5  
ATOM 7804  H HD2  . TYR A 1 76 ? 2.143   -4.368  1.880   1.00 0.00 ?  632  TYR A HD2  5  
ATOM 7805  H HE1  . TYR A 1 76 ? -0.275  -7.530  4.745   1.00 0.00 ?  632  TYR A HE1  5  
ATOM 7806  H HE2  . TYR A 1 76 ? 1.436   -6.457  0.948   1.00 0.00 ?  632  TYR A HE2  5  
ATOM 7807  H HH   . TYR A 1 76 ? -0.821  -8.479  2.476   1.00 0.00 ?  632  TYR A HH   5  
ATOM 7808  N N    . VAL A 1 77 ? 4.436   -3.244  2.793   1.00 0.00 ?  633  VAL A N    5  
ATOM 7809  C CA   . VAL A 1 77 ? 5.179   -3.677  1.612   1.00 0.00 ?  633  VAL A CA   5  
ATOM 7810  C C    . VAL A 1 77 ? 6.548   -4.178  2.008   1.00 0.00 ?  633  VAL A C    5  
ATOM 7811  O O    . VAL A 1 77 ? 6.936   -5.280  1.643   1.00 0.00 ?  633  VAL A O    5  
ATOM 7812  C CB   . VAL A 1 77 ? 5.315   -2.548  0.561   1.00 0.00 ?  633  VAL A CB   5  
ATOM 7813  C CG1  . VAL A 1 77 ? 6.136   -3.019  -0.609  1.00 0.00 ?  633  VAL A CG1  5  
ATOM 7814  C CG2  . VAL A 1 77 ? 3.958   -2.121  0.069   1.00 0.00 ?  633  VAL A CG2  5  
ATOM 7815  H H    . VAL A 1 77 ? 4.110   -2.314  2.869   1.00 0.00 ?  633  VAL A H    5  
ATOM 7816  H HA   . VAL A 1 77 ? 4.649   -4.509  1.160   1.00 0.00 ?  633  VAL A HA   5  
ATOM 7817  H HB   . VAL A 1 77 ? 5.798   -1.696  1.015   1.00 0.00 ?  633  VAL A HB   5  
ATOM 7818  H HG11 . VAL A 1 77 ? 6.221   -2.222  -1.331  1.00 0.00 ?  633  VAL A HG11 5  
ATOM 7819  H HG12 . VAL A 1 77 ? 5.626   -3.863  -1.046  1.00 0.00 ?  633  VAL A HG12 5  
ATOM 7820  H HG13 . VAL A 1 77 ? 7.114   -3.318  -0.261  1.00 0.00 ?  633  VAL A HG13 5  
ATOM 7821  H HG21 . VAL A 1 77 ? 3.454   -2.964  -0.382  1.00 0.00 ?  633  VAL A HG21 5  
ATOM 7822  H HG22 . VAL A 1 77 ? 4.072   -1.335  -0.663  1.00 0.00 ?  633  VAL A HG22 5  
ATOM 7823  H HG23 . VAL A 1 77 ? 3.376   -1.759  0.902   1.00 0.00 ?  633  VAL A HG23 5  
ATOM 7824  N N    . LYS A 1 78 ? 7.236   -3.406  2.822   1.00 0.00 ?  634  LYS A N    5  
ATOM 7825  C CA   . LYS A 1 78 ? 8.557   -3.776  3.277   1.00 0.00 ?  634  LYS A CA   5  
ATOM 7826  C C    . LYS A 1 78 ? 8.490   -5.065  4.106   1.00 0.00 ?  634  LYS A C    5  
ATOM 7827  O O    . LYS A 1 78 ? 9.345   -5.932  3.984   1.00 0.00 ?  634  LYS A O    5  
ATOM 7828  C CB   . LYS A 1 78 ? 9.195   -2.617  4.049   1.00 0.00 ?  634  LYS A CB   5  
ATOM 7829  C CG   . LYS A 1 78 ? 10.630  -2.860  4.492   1.00 0.00 ?  634  LYS A CG   5  
ATOM 7830  C CD   . LYS A 1 78 ? 11.287  -1.572  4.987   1.00 0.00 ?  634  LYS A CD   5  
ATOM 7831  C CE   . LYS A 1 78 ? 10.565  -0.964  6.184   1.00 0.00 ?  634  LYS A CE   5  
ATOM 7832  N NZ   . LYS A 1 78 ? 10.589  -1.851  7.356   1.00 0.00 1  634  LYS A NZ   5  
ATOM 7833  H H    . LYS A 1 78 ? 6.841   -2.559  3.119   1.00 0.00 ?  634  LYS A H    5  
ATOM 7834  H HA   . LYS A 1 78 ? 9.148   -3.982  2.396   1.00 0.00 ?  634  LYS A HA   5  
ATOM 7835  H HB2  . LYS A 1 78 ? 9.187   -1.736  3.425   1.00 0.00 ?  634  LYS A HB2  5  
ATOM 7836  H HB3  . LYS A 1 78 ? 8.595   -2.427  4.927   1.00 0.00 ?  634  LYS A HB3  5  
ATOM 7837  H HG2  . LYS A 1 78 ? 10.629  -3.586  5.292   1.00 0.00 ?  634  LYS A HG2  5  
ATOM 7838  H HG3  . LYS A 1 78 ? 11.194  -3.245  3.656   1.00 0.00 ?  634  LYS A HG3  5  
ATOM 7839  H HD2  . LYS A 1 78 ? 12.306  -1.786  5.271   1.00 0.00 ?  634  LYS A HD2  5  
ATOM 7840  H HD3  . LYS A 1 78 ? 11.289  -0.859  4.176   1.00 0.00 ?  634  LYS A HD3  5  
ATOM 7841  H HE2  . LYS A 1 78 ? 11.056  -0.038  6.444   1.00 0.00 ?  634  LYS A HE2  5  
ATOM 7842  H HE3  . LYS A 1 78 ? 9.540   -0.759  5.912   1.00 0.00 ?  634  LYS A HE3  5  
ATOM 7843  H HZ1  . LYS A 1 78 ? 10.100  -1.385  8.146   1.00 0.00 ?  634  LYS A HZ1  5  
ATOM 7844  H HZ2  . LYS A 1 78 ? 11.568  -2.025  7.658   1.00 0.00 ?  634  LYS A HZ2  5  
ATOM 7845  H HZ3  . LYS A 1 78 ? 10.121  -2.762  7.177   1.00 0.00 ?  634  LYS A HZ3  5  
ATOM 7846  N N    . SER A 1 79 ? 7.426   -5.213  4.877   1.00 0.00 ?  635  SER A N    5  
ATOM 7847  C CA   . SER A 1 79 ? 7.210   -6.410  5.658   1.00 0.00 ?  635  SER A CA   5  
ATOM 7848  C C    . SER A 1 79 ? 6.900   -7.625  4.739   1.00 0.00 ?  635  SER A C    5  
ATOM 7849  O O    . SER A 1 79 ? 7.315   -8.750  5.017   1.00 0.00 ?  635  SER A O    5  
ATOM 7850  C CB   . SER A 1 79 ? 6.084   -6.174  6.665   1.00 0.00 ?  635  SER A CB   5  
ATOM 7851  O OG   . SER A 1 79 ? 6.382   -5.046  7.488   1.00 0.00 ?  635  SER A OG   5  
ATOM 7852  H H    . SER A 1 79 ? 6.772   -4.484  4.930   1.00 0.00 ?  635  SER A H    5  
ATOM 7853  H HA   . SER A 1 79 ? 8.123   -6.605  6.199   1.00 0.00 ?  635  SER A HA   5  
ATOM 7854  H HB2  . SER A 1 79 ? 5.164   -5.981  6.133   1.00 0.00 ?  635  SER A HB2  5  
ATOM 7855  H HB3  . SER A 1 79 ? 5.966   -7.042  7.296   1.00 0.00 ?  635  SER A HB3  5  
ATOM 7856  H HG   . SER A 1 79 ? 6.176   -4.249  6.974   1.00 0.00 ?  635  SER A HG   5  
ATOM 7857  N N    . CYS A 1 80 ? 6.213   -7.385  3.635   1.00 0.00 ?  636  CYS A N    5  
ATOM 7858  C CA   . CYS A 1 80 ? 5.874   -8.435  2.716   1.00 0.00 ?  636  CYS A CA   5  
ATOM 7859  C C    . CYS A 1 80 ? 7.120   -8.836  1.915   1.00 0.00 ?  636  CYS A C    5  
ATOM 7860  O O    . CYS A 1 80 ? 7.345   -10.016 1.623   1.00 0.00 ?  636  CYS A O    5  
ATOM 7861  C CB   . CYS A 1 80 ? 4.743   -7.985  1.787   1.00 0.00 ?  636  CYS A CB   5  
ATOM 7862  S SG   . CYS A 1 80 ? 3.819   -9.358  1.069   1.00 0.00 ?  636  CYS A SG   5  
ATOM 7863  H H    . CYS A 1 80 ? 5.910   -6.471  3.439   1.00 0.00 ?  636  CYS A H    5  
ATOM 7864  H HA   . CYS A 1 80 ? 5.525   -9.281  3.288   1.00 0.00 ?  636  CYS A HA   5  
ATOM 7865  H HB2  . CYS A 1 80 ? 4.049   -7.372  2.344   1.00 0.00 ?  636  CYS A HB2  5  
ATOM 7866  H HB3  . CYS A 1 80 ? 5.165   -7.407  0.977   1.00 0.00 ?  636  CYS A HB3  5  
ATOM 7867  H HG   . CYS A 1 80 ? 2.569   -8.947  0.902   1.00 0.00 ?  636  CYS A HG   5  
ATOM 7868  N N    . LEU A 1 81 ? 7.961   -7.849  1.612   1.00 0.00 ?  637  LEU A N    5  
ATOM 7869  C CA   . LEU A 1 81 ? 9.193   -8.066  0.861   1.00 0.00 ?  637  LEU A CA   5  
ATOM 7870  C C    . LEU A 1 81 ? 10.265  -8.740  1.710   1.00 0.00 ?  637  LEU A C    5  
ATOM 7871  O O    . LEU A 1 81 ? 11.092  -9.498  1.187   1.00 0.00 ?  637  LEU A O    5  
ATOM 7872  C CB   . LEU A 1 81 ? 9.719   -6.762  0.263   1.00 0.00 ?  637  LEU A CB   5  
ATOM 7873  C CG   . LEU A 1 81 ? 8.808   -6.069  -0.758  1.00 0.00 ?  637  LEU A CG   5  
ATOM 7874  C CD1  . LEU A 1 81 ? 9.441   -4.780  -1.242  1.00 0.00 ?  637  LEU A CD1  5  
ATOM 7875  C CD2  . LEU A 1 81 ? 8.507   -6.988  -1.935  1.00 0.00 ?  637  LEU A CD2  5  
ATOM 7876  H H    . LEU A 1 81 ? 7.729   -6.931  1.879   1.00 0.00 ?  637  LEU A H    5  
ATOM 7877  H HA   . LEU A 1 81 ? 8.954   -8.741  0.053   1.00 0.00 ?  637  LEU A HA   5  
ATOM 7878  H HB2  . LEU A 1 81 ? 9.903   -6.074  1.075   1.00 0.00 ?  637  LEU A HB2  5  
ATOM 7879  H HB3  . LEU A 1 81 ? 10.662  -6.974  -0.218  1.00 0.00 ?  637  LEU A HB3  5  
ATOM 7880  H HG   . LEU A 1 81 ? 7.875   -5.817  -0.275  1.00 0.00 ?  637  LEU A HG   5  
ATOM 7881  H HD11 . LEU A 1 81 ? 8.781   -4.294  -1.946  1.00 0.00 ?  637  LEU A HD11 5  
ATOM 7882  H HD12 . LEU A 1 81 ? 10.380  -5.000  -1.724  1.00 0.00 ?  637  LEU A HD12 5  
ATOM 7883  H HD13 . LEU A 1 81 ? 9.608   -4.129  -0.397  1.00 0.00 ?  637  LEU A HD13 5  
ATOM 7884  H HD21 . LEU A 1 81 ? 9.430   -7.276  -2.416  1.00 0.00 ?  637  LEU A HD21 5  
ATOM 7885  H HD22 . LEU A 1 81 ? 7.881   -6.466  -2.643  1.00 0.00 ?  637  LEU A HD22 5  
ATOM 7886  H HD23 . LEU A 1 81 ? 7.987   -7.869  -1.590  1.00 0.00 ?  637  LEU A HD23 5  
ATOM 7887  N N    . GLN A 1 82 ? 10.248  -8.494  3.026   1.00 0.00 ?  638  GLN A N    5  
ATOM 7888  C CA   . GLN A 1 82 ? 11.193  -9.176  3.923   1.00 0.00 ?  638  GLN A CA   5  
ATOM 7889  C C    . GLN A 1 82 ? 10.749  -10.618 4.182   1.00 0.00 ?  638  GLN A C    5  
ATOM 7890  O O    . GLN A 1 82 ? 11.398  -11.361 4.932   1.00 0.00 ?  638  GLN A O    5  
ATOM 7891  C CB   . GLN A 1 82 ? 11.476  -8.370  5.230   1.00 0.00 ?  638  GLN A CB   5  
ATOM 7892  C CG   . GLN A 1 82 ? 10.302  -8.133  6.192   1.00 0.00 ?  638  GLN A CG   5  
ATOM 7893  C CD   . GLN A 1 82 ? 9.959   -9.328  7.073   1.00 0.00 ?  638  GLN A CD   5  
ATOM 7894  O OE1  . GLN A 1 82 ? 10.496  -9.485  8.162   1.00 0.00 ?  638  GLN A OE1  5  
ATOM 7895  N NE2  . GLN A 1 82 ? 9.047   -10.145 6.639   1.00 0.00 ?  638  GLN A NE2  5  
ATOM 7896  H H    . GLN A 1 82 ? 9.633   -7.819  3.387   1.00 0.00 ?  638  GLN A H    5  
ATOM 7897  H HA   . GLN A 1 82 ? 12.106  -9.244  3.350   1.00 0.00 ?  638  GLN A HA   5  
ATOM 7898  H HB2  . GLN A 1 82 ? 12.234  -8.897  5.789   1.00 0.00 ?  638  GLN A HB2  5  
ATOM 7899  H HB3  . GLN A 1 82 ? 11.878  -7.408  4.945   1.00 0.00 ?  638  GLN A HB3  5  
ATOM 7900  H HG2  . GLN A 1 82 ? 10.521  -7.286  6.825   1.00 0.00 ?  638  GLN A HG2  5  
ATOM 7901  H HG3  . GLN A 1 82 ? 9.447   -7.908  5.572   1.00 0.00 ?  638  GLN A HG3  5  
ATOM 7902  H HE21 . GLN A 1 82 ? 8.616   -9.944  5.778   1.00 0.00 ?  638  GLN A HE21 5  
ATOM 7903  H HE22 . GLN A 1 82 ? 8.827   -10.965 7.134   1.00 0.00 ?  638  GLN A HE22 5  
ATOM 7904  N N    . LYS A 1 83 ? 9.616   -10.981 3.535   1.00 0.00 ?  639  LYS A N    5  
ATOM 7905  C CA   . LYS A 1 83 ? 9.018   -12.311 3.532   1.00 0.00 ?  639  LYS A CA   5  
ATOM 7906  C C    . LYS A 1 83 ? 8.177   -12.631 4.741   1.00 0.00 ?  639  LYS A C    5  
ATOM 7907  O O    . LYS A 1 83 ? 8.679   -12.809 5.843   1.00 0.00 ?  639  LYS A O    5  
ATOM 7908  C CB   . LYS A 1 83 ? 10.033  -13.410 3.288   1.00 0.00 ?  639  LYS A CB   5  
ATOM 7909  C CG   . LYS A 1 83 ? 10.649  -13.408 1.902   1.00 0.00 ?  639  LYS A CG   5  
ATOM 7910  C CD   . LYS A 1 83 ? 11.760  -14.437 1.813   1.00 0.00 ?  639  LYS A CD   5  
ATOM 7911  C CE   . LYS A 1 83 ? 11.289  -15.791 2.299   1.00 0.00 ?  639  LYS A CE   5  
ATOM 7912  N NZ   . LYS A 1 83 ? 12.345  -16.814 2.187   1.00 0.00 1  639  LYS A NZ   5  
ATOM 7913  H H    . LYS A 1 83 ? 9.162   -10.280 3.022   1.00 0.00 ?  639  LYS A H    5  
ATOM 7914  H HA   . LYS A 1 83 ? 8.344   -12.311 2.688   1.00 0.00 ?  639  LYS A HA   5  
ATOM 7915  H HB2  . LYS A 1 83 ? 10.828  -13.318 4.013   1.00 0.00 ?  639  LYS A HB2  5  
ATOM 7916  H HB3  . LYS A 1 83 ? 9.528   -14.352 3.435   1.00 0.00 ?  639  LYS A HB3  5  
ATOM 7917  H HG2  . LYS A 1 83 ? 9.886   -13.646 1.176   1.00 0.00 ?  639  LYS A HG2  5  
ATOM 7918  H HG3  . LYS A 1 83 ? 11.056  -12.430 1.695   1.00 0.00 ?  639  LYS A HG3  5  
ATOM 7919  H HD2  . LYS A 1 83 ? 12.089  -14.521 0.788   1.00 0.00 ?  639  LYS A HD2  5  
ATOM 7920  H HD3  . LYS A 1 83 ? 12.585  -14.113 2.427   1.00 0.00 ?  639  LYS A HD3  5  
ATOM 7921  H HE2  . LYS A 1 83 ? 11.015  -15.658 3.338   1.00 0.00 ?  639  LYS A HE2  5  
ATOM 7922  H HE3  . LYS A 1 83 ? 10.414  -16.079 1.736   1.00 0.00 ?  639  LYS A HE3  5  
ATOM 7923  H HZ1  . LYS A 1 83 ? 12.712  -16.856 1.215   1.00 0.00 ?  639  LYS A HZ1  5  
ATOM 7924  H HZ2  . LYS A 1 83 ? 11.957  -17.755 2.413   1.00 0.00 ?  639  LYS A HZ2  5  
ATOM 7925  H HZ3  . LYS A 1 83 ? 13.130  -16.630 2.844   1.00 0.00 ?  639  LYS A HZ3  5  
ATOM 7926  N N    . LYS A 1 84 ? 6.888   -12.733 4.511   1.00 0.00 ?  640  LYS A N    5  
ATOM 7927  C CA   . LYS A 1 84 ? 5.937   -13.154 5.534   1.00 0.00 ?  640  LYS A CA   5  
ATOM 7928  C C    . LYS A 1 84 ? 5.665   -14.640 5.385   1.00 0.00 ?  640  LYS A C    5  
ATOM 7929  O O    . LYS A 1 84 ? 4.560   -15.140 5.658   1.00 0.00 ?  640  LYS A O    5  
ATOM 7930  C CB   . LYS A 1 84 ? 4.650   -12.334 5.448   1.00 0.00 ?  640  LYS A CB   5  
ATOM 7931  C CG   . LYS A 1 84 ? 4.756   -10.954 6.068   1.00 0.00 ?  640  LYS A CG   5  
ATOM 7932  C CD   . LYS A 1 84 ? 4.997   -11.077 7.564   1.00 0.00 ?  640  LYS A CD   5  
ATOM 7933  C CE   . LYS A 1 84 ? 5.064   -9.737  8.253   1.00 0.00 ?  640  LYS A CE   5  
ATOM 7934  N NZ   . LYS A 1 84 ? 5.276   -9.908  9.697   1.00 0.00 1  640  LYS A NZ   5  
ATOM 7935  H H    . LYS A 1 84 ? 6.550   -12.524 3.614   1.00 0.00 ?  640  LYS A H    5  
ATOM 7936  H HA   . LYS A 1 84 ? 6.409   -12.996 6.491   1.00 0.00 ?  640  LYS A HA   5  
ATOM 7937  H HB2  . LYS A 1 84 ? 4.375   -12.220 4.410   1.00 0.00 ?  640  LYS A HB2  5  
ATOM 7938  H HB3  . LYS A 1 84 ? 3.870   -12.874 5.962   1.00 0.00 ?  640  LYS A HB3  5  
ATOM 7939  H HG2  . LYS A 1 84 ? 5.579   -10.420 5.615   1.00 0.00 ?  640  LYS A HG2  5  
ATOM 7940  H HG3  . LYS A 1 84 ? 3.833   -10.419 5.904   1.00 0.00 ?  640  LYS A HG3  5  
ATOM 7941  H HD2  . LYS A 1 84 ? 4.192   -11.645 8.006   1.00 0.00 ?  640  LYS A HD2  5  
ATOM 7942  H HD3  . LYS A 1 84 ? 5.928   -11.595 7.735   1.00 0.00 ?  640  LYS A HD3  5  
ATOM 7943  H HE2  . LYS A 1 84 ? 5.886   -9.172  7.839   1.00 0.00 ?  640  LYS A HE2  5  
ATOM 7944  H HE3  . LYS A 1 84 ? 4.138   -9.206  8.088   1.00 0.00 ?  640  LYS A HE3  5  
ATOM 7945  H HZ1  . LYS A 1 84 ? 5.316   -8.992  10.187  1.00 0.00 ?  640  LYS A HZ1  5  
ATOM 7946  H HZ2  . LYS A 1 84 ? 6.164   -10.415 9.886   1.00 0.00 ?  640  LYS A HZ2  5  
ATOM 7947  H HZ3  . LYS A 1 84 ? 4.504   -10.463 10.122  1.00 0.00 ?  640  LYS A HZ3  5  
ATOM 7948  N N    . GLN A 1 85 ? 6.700   -15.331 4.976   1.00 0.00 ?  641  GLN A N    5  
ATOM 7949  C CA   . GLN A 1 85 ? 6.699   -16.747 4.787   1.00 0.00 ?  641  GLN A CA   5  
ATOM 7950  C C    . GLN A 1 85 ? 7.780   -17.263 5.700   1.00 0.00 ?  641  GLN A C    5  
ATOM 7951  O O    . GLN A 1 85 ? 8.823   -16.609 5.829   1.00 0.00 ?  641  GLN A O    5  
ATOM 7952  C CB   . GLN A 1 85 ? 7.027   -17.094 3.319   1.00 0.00 ?  641  GLN A CB   5  
ATOM 7953  C CG   . GLN A 1 85 ? 6.161   -16.355 2.294   1.00 0.00 ?  641  GLN A CG   5  
ATOM 7954  C CD   . GLN A 1 85 ? 4.664   -16.602 2.452   1.00 0.00 ?  641  GLN A CD   5  
ATOM 7955  O OE1  . GLN A 1 85 ? 3.847   -15.721 2.170   1.00 0.00 ?  641  GLN A OE1  5  
ATOM 7956  N NE2  . GLN A 1 85 ? 4.286   -17.785 2.848   1.00 0.00 ?  641  GLN A NE2  5  
ATOM 7957  H H    . GLN A 1 85 ? 7.549   -14.859 4.849   1.00 0.00 ?  641  GLN A H    5  
ATOM 7958  H HA   . GLN A 1 85 ? 5.736   -17.147 5.067   1.00 0.00 ?  641  GLN A HA   5  
ATOM 7959  H HB2  . GLN A 1 85 ? 8.061   -16.846 3.130   1.00 0.00 ?  641  GLN A HB2  5  
ATOM 7960  H HB3  . GLN A 1 85 ? 6.895   -18.156 3.175   1.00 0.00 ?  641  GLN A HB3  5  
ATOM 7961  H HG2  . GLN A 1 85 ? 6.336   -15.295 2.402   1.00 0.00 ?  641  GLN A HG2  5  
ATOM 7962  H HG3  . GLN A 1 85 ? 6.461   -16.663 1.305   1.00 0.00 ?  641  GLN A HG3  5  
ATOM 7963  H HE21 . GLN A 1 85 ? 4.963   -18.476 3.024   1.00 0.00 ?  641  GLN A HE21 5  
ATOM 7964  H HE22 . GLN A 1 85 ? 3.328   -17.955 2.968   1.00 0.00 ?  641  GLN A HE22 5  
ATOM 7965  N N    . ARG A 1 86 ? 7.554   -18.383 6.325   1.00 0.00 ?  642  ARG A N    5  
ATOM 7966  C CA   . ARG A 1 86 ? 8.474   -18.887 7.327   1.00 0.00 ?  642  ARG A CA   5  
ATOM 7967  C C    . ARG A 1 86 ? 9.780   -19.381 6.716   1.00 0.00 ?  642  ARG A C    5  
ATOM 7968  O O    . ARG A 1 86 ? 9.820   -19.848 5.569   1.00 0.00 ?  642  ARG A O    5  
ATOM 7969  C CB   . ARG A 1 86 ? 7.817   -19.977 8.176   1.00 0.00 ?  642  ARG A CB   5  
ATOM 7970  C CG   . ARG A 1 86 ? 7.510   -21.274 7.443   1.00 0.00 ?  642  ARG A CG   5  
ATOM 7971  C CD   . ARG A 1 86 ? 6.692   -22.197 8.322   1.00 0.00 ?  642  ARG A CD   5  
ATOM 7972  N NE   . ARG A 1 86 ? 5.365   -21.625 8.593   1.00 0.00 ?  642  ARG A NE   5  
ATOM 7973  C CZ   . ARG A 1 86 ? 4.768   -21.549 9.785   1.00 0.00 ?  642  ARG A CZ   5  
ATOM 7974  N NH1  . ARG A 1 86 ? 5.379   -21.987 10.878  1.00 0.00 1  642  ARG A NH1  5  
ATOM 7975  N NH2  . ARG A 1 86 ? 3.567   -21.013 9.877   1.00 0.00 ?  642  ARG A NH2  5  
ATOM 7976  H H    . ARG A 1 86 ? 6.751   -18.895 6.093   1.00 0.00 ?  642  ARG A H    5  
ATOM 7977  H HA   . ARG A 1 86 ? 8.712   -18.056 7.975   1.00 0.00 ?  642  ARG A HA   5  
ATOM 7978  H HB2  . ARG A 1 86 ? 8.465   -20.210 9.005   1.00 0.00 ?  642  ARG A HB2  5  
ATOM 7979  H HB3  . ARG A 1 86 ? 6.890   -19.588 8.566   1.00 0.00 ?  642  ARG A HB3  5  
ATOM 7980  H HG2  . ARG A 1 86 ? 6.946   -21.051 6.552   1.00 0.00 ?  642  ARG A HG2  5  
ATOM 7981  H HG3  . ARG A 1 86 ? 8.435   -21.764 7.177   1.00 0.00 ?  642  ARG A HG3  5  
ATOM 7982  H HD2  . ARG A 1 86 ? 6.578   -23.149 7.825   1.00 0.00 ?  642  ARG A HD2  5  
ATOM 7983  H HD3  . ARG A 1 86 ? 7.211   -22.339 9.258   1.00 0.00 ?  642  ARG A HD3  5  
ATOM 7984  H HE   . ARG A 1 86 ? 4.899   -21.280 7.796   1.00 0.00 ?  642  ARG A HE   5  
ATOM 7985  H HH11 . ARG A 1 86 ? 6.300   -22.384 10.855  1.00 0.00 ?  642  ARG A HH11 5  
ATOM 7986  H HH12 . ARG A 1 86 ? 4.940   -21.945 11.780  1.00 0.00 ?  642  ARG A HH12 5  
ATOM 7987  H HH21 . ARG A 1 86 ? 3.093   -20.659 9.065   1.00 0.00 ?  642  ARG A HH21 5  
ATOM 7988  H HH22 . ARG A 1 86 ? 3.082   -20.923 10.751  1.00 0.00 ?  642  ARG A HH22 5  
ATOM 7989  N N    . LYS A 1 87 ? 10.830  -19.247 7.467   1.00 0.00 ?  643  LYS A N    5  
ATOM 7990  C CA   . LYS A 1 87 ? 12.125  -19.688 7.065   1.00 0.00 ?  643  LYS A CA   5  
ATOM 7991  C C    . LYS A 1 87 ? 12.555  -20.775 8.014   1.00 0.00 ?  643  LYS A C    5  
ATOM 7992  O O    . LYS A 1 87 ? 12.476  -21.959 7.649   1.00 0.00 ?  643  LYS A O    5  
ATOM 7993  C CB   . LYS A 1 87 ? 13.125  -18.520 7.063   1.00 0.00 ?  643  LYS A CB   5  
ATOM 7994  C CG   . LYS A 1 87 ? 14.559  -18.925 6.762   1.00 0.00 ?  643  LYS A CG   5  
ATOM 7995  C CD   . LYS A 1 87 ? 15.488  -17.728 6.806   1.00 0.00 ?  643  LYS A CD   5  
ATOM 7996  C CE   . LYS A 1 87 ? 16.931  -18.149 6.609   1.00 0.00 ?  643  LYS A CE   5  
ATOM 7997  N NZ   . LYS A 1 87 ? 17.858  -16.998 6.601   1.00 0.00 1  643  LYS A NZ   5  
ATOM 7998  O OXT  . LYS A 1 87 ? 12.884  -20.467 9.178   1.00 0.00 ?  643  LYS A OXT  5  
ATOM 7999  H H    . LYS A 1 87 ? 10.746  -18.850 8.360   1.00 0.00 ?  643  LYS A H    5  
ATOM 8000  H HA   . LYS A 1 87 ? 12.046  -20.098 6.069   1.00 0.00 ?  643  LYS A HA   5  
ATOM 8001  H HB2  . LYS A 1 87 ? 12.817  -17.810 6.310   1.00 0.00 ?  643  LYS A HB2  5  
ATOM 8002  H HB3  . LYS A 1 87 ? 13.103  -18.036 8.027   1.00 0.00 ?  643  LYS A HB3  5  
ATOM 8003  H HG2  . LYS A 1 87 ? 14.880  -19.644 7.500   1.00 0.00 ?  643  LYS A HG2  5  
ATOM 8004  H HG3  . LYS A 1 87 ? 14.602  -19.374 5.780   1.00 0.00 ?  643  LYS A HG3  5  
ATOM 8005  H HD2  . LYS A 1 87 ? 15.210  -17.044 6.019   1.00 0.00 ?  643  LYS A HD2  5  
ATOM 8006  H HD3  . LYS A 1 87 ? 15.388  -17.240 7.763   1.00 0.00 ?  643  LYS A HD3  5  
ATOM 8007  H HE2  . LYS A 1 87 ? 17.203  -18.813 7.415   1.00 0.00 ?  643  LYS A HE2  5  
ATOM 8008  H HE3  . LYS A 1 87 ? 17.008  -18.682 5.673   1.00 0.00 ?  643  LYS A HE3  5  
ATOM 8009  H HZ1  . LYS A 1 87 ? 17.833  -16.483 7.504   1.00 0.00 ?  643  LYS A HZ1  5  
ATOM 8010  H HZ2  . LYS A 1 87 ? 17.600  -16.334 5.845   1.00 0.00 ?  643  LYS A HZ2  5  
ATOM 8011  H HZ3  . LYS A 1 87 ? 18.830  -17.323 6.427   1.00 0.00 ?  643  LYS A HZ3  5  
ATOM 8012  N N    . ARG B 2 1  ? -2.721  1.785   -10.133 1.00 0.00 ?  1591 ARG B N    5  
ATOM 8013  C CA   . ARG B 2 1  ? -1.909  1.751   -11.355 1.00 0.00 ?  1591 ARG B CA   5  
ATOM 8014  C C    . ARG B 2 1  ? -0.874  2.853   -11.322 1.00 0.00 ?  1591 ARG B C    5  
ATOM 8015  O O    . ARG B 2 1  ? -0.682  3.489   -10.287 1.00 0.00 ?  1591 ARG B O    5  
ATOM 8016  C CB   . ARG B 2 1  ? -2.791  1.942   -12.582 1.00 0.00 ?  1591 ARG B CB   5  
ATOM 8017  C CG   . ARG B 2 1  ? -3.637  0.757   -12.983 1.00 0.00 ?  1591 ARG B CG   5  
ATOM 8018  C CD   . ARG B 2 1  ? -4.572  1.155   -14.097 1.00 0.00 ?  1591 ARG B CD   5  
ATOM 8019  N NE   . ARG B 2 1  ? -5.456  2.233   -13.657 1.00 0.00 ?  1591 ARG B NE   5  
ATOM 8020  C CZ   . ARG B 2 1  ? -5.952  3.205   -14.421 1.00 0.00 ?  1591 ARG B CZ   5  
ATOM 8021  N NH1  . ARG B 2 1  ? -5.716  3.230   -15.732 1.00 0.00 1  1591 ARG B NH1  5  
ATOM 8022  N NH2  . ARG B 2 1  ? -6.689  4.149   -13.857 1.00 0.00 ?  1591 ARG B NH2  5  
ATOM 8023  H H1   . ARG B 2 1  ? -2.127  1.740   -9.278  1.00 0.00 ?  1591 ARG B H1   5  
ATOM 8024  H HA   . ARG B 2 1  ? -1.418  0.791   -11.411 1.00 0.00 ?  1591 ARG B HA   5  
ATOM 8025  H HB2  . ARG B 2 1  ? -3.468  2.759   -12.377 1.00 0.00 ?  1591 ARG B HB2  5  
ATOM 8026  H HB3  . ARG B 2 1  ? -2.176  2.223   -13.422 1.00 0.00 ?  1591 ARG B HB3  5  
ATOM 8027  H HG2  . ARG B 2 1  ? -2.993  -0.038  -13.326 1.00 0.00 ?  1591 ARG B HG2  5  
ATOM 8028  H HG3  . ARG B 2 1  ? -4.219  0.417   -12.143 1.00 0.00 ?  1591 ARG B HG3  5  
ATOM 8029  H HD2  . ARG B 2 1  ? -3.984  1.496   -14.937 1.00 0.00 ?  1591 ARG B HD2  5  
ATOM 8030  H HD3  . ARG B 2 1  ? -5.169  0.304   -14.387 1.00 0.00 ?  1591 ARG B HD3  5  
ATOM 8031  H HE   . ARG B 2 1  ? -5.674  2.223   -12.697 1.00 0.00 ?  1591 ARG B HE   5  
ATOM 8032  H HH11 . ARG B 2 1  ? -5.161  2.532   -16.194 1.00 0.00 ?  1591 ARG B HH11 5  
ATOM 8033  H HH12 . ARG B 2 1  ? -6.097  3.945   -16.324 1.00 0.00 ?  1591 ARG B HH12 5  
ATOM 8034  H HH21 . ARG B 2 1  ? -6.875  4.133   -12.871 1.00 0.00 ?  1591 ARG B HH21 5  
ATOM 8035  H HH22 . ARG B 2 1  ? -7.077  4.922   -14.369 1.00 0.00 ?  1591 ARG B HH22 5  
ATOM 8036  N N    . SER B 2 2  ? -0.208  3.072   -12.469 1.00 0.00 ?  1592 SER B N    5  
ATOM 8037  C CA   . SER B 2 2  ? 0.781   4.137   -12.648 1.00 0.00 ?  1592 SER B CA   5  
ATOM 8038  C C    . SER B 2 2  ? 0.098   5.488   -12.454 1.00 0.00 ?  1592 SER B C    5  
ATOM 8039  O O    . SER B 2 2  ? 0.693   6.453   -12.012 1.00 0.00 ?  1592 SER B O    5  
ATOM 8040  C CB   . SER B 2 2  ? 1.315   4.053   -14.062 1.00 0.00 ?  1592 SER B CB   5  
ATOM 8041  O OG   . SER B 2 2  ? 1.604   2.699   -14.401 1.00 0.00 ?  1592 SER B OG   5  
ATOM 8042  H H    . SER B 2 2  ? -0.359  2.482   -13.239 1.00 0.00 ?  1592 SER B H    5  
ATOM 8043  H HA   . SER B 2 2  ? 1.590   4.008   -11.945 1.00 0.00 ?  1592 SER B HA   5  
ATOM 8044  H HB2  . SER B 2 2  ? 0.573   4.438   -14.745 1.00 0.00 ?  1592 SER B HB2  5  
ATOM 8045  H HB3  . SER B 2 2  ? 2.221   4.635   -14.138 1.00 0.00 ?  1592 SER B HB3  5  
ATOM 8046  H HG   . SER B 2 2  ? 2.325   2.396   -13.836 1.00 0.00 ?  1592 SER B HG   5  
ATOM 8047  N N    . VAL B 2 3  ? -1.148  5.524   -12.823 1.00 0.00 ?  1593 VAL B N    5  
ATOM 8048  C CA   . VAL B 2 3  ? -2.008  6.639   -12.611 1.00 0.00 ?  1593 VAL B CA   5  
ATOM 8049  C C    . VAL B 2 3  ? -3.154  6.100   -11.783 1.00 0.00 ?  1593 VAL B C    5  
ATOM 8050  O O    . VAL B 2 3  ? -3.574  4.956   -12.022 1.00 0.00 ?  1593 VAL B O    5  
ATOM 8051  C CB   . VAL B 2 3  ? -2.505  7.246   -13.969 1.00 0.00 ?  1593 VAL B CB   5  
ATOM 8052  C CG1  . VAL B 2 3  ? -3.210  6.212   -14.844 1.00 0.00 ?  1593 VAL B CG1  5  
ATOM 8053  C CG2  . VAL B 2 3  ? -3.401  8.447   -13.737 1.00 0.00 ?  1593 VAL B CG2  5  
ATOM 8054  H H    . VAL B 2 3  ? -1.549  4.741   -13.253 1.00 0.00 ?  1593 VAL B H    5  
ATOM 8055  H HA   . VAL B 2 3  ? -1.469  7.381   -12.039 1.00 0.00 ?  1593 VAL B HA   5  
ATOM 8056  H HB   . VAL B 2 3  ? -1.631  7.580   -14.508 1.00 0.00 ?  1593 VAL B HB   5  
ATOM 8057  H HG11 . VAL B 2 3  ? -4.062  5.814   -14.314 1.00 0.00 ?  1593 VAL B HG11 5  
ATOM 8058  H HG12 . VAL B 2 3  ? -2.524  5.411   -15.077 1.00 0.00 ?  1593 VAL B HG12 5  
ATOM 8059  H HG13 . VAL B 2 3  ? -3.539  6.682   -15.759 1.00 0.00 ?  1593 VAL B HG13 5  
ATOM 8060  H HG21 . VAL B 2 3  ? -3.723  8.849   -14.686 1.00 0.00 ?  1593 VAL B HG21 5  
ATOM 8061  H HG22 . VAL B 2 3  ? -2.851  9.201   -13.192 1.00 0.00 ?  1593 VAL B HG22 5  
ATOM 8062  H HG23 . VAL B 2 3  ? -4.264  8.144   -13.161 1.00 0.00 ?  1593 VAL B HG23 5  
ATOM 8063  N N    . LYS B 2 4  ? -3.599  6.860   -10.778 1.00 0.00 ?  1594 LYS B N    5  
ATOM 8064  C CA   . LYS B 2 4  ? -4.644  6.415   -9.843  1.00 0.00 ?  1594 LYS B CA   5  
ATOM 8065  C C    . LYS B 2 4  ? -4.161  5.304   -8.942  1.00 0.00 ?  1594 LYS B C    5  
ATOM 8066  O O    . LYS B 2 4  ? -3.816  4.198   -9.381  1.00 0.00 ?  1594 LYS B O    5  
ATOM 8067  C CB   . LYS B 2 4  ? -5.949  6.008   -10.544 1.00 0.00 ?  1594 LYS B CB   5  
ATOM 8068  C CG   . LYS B 2 4  ? -6.684  7.159   -11.166 1.00 0.00 ?  1594 LYS B CG   5  
ATOM 8069  C CD   . LYS B 2 4  ? -8.071  6.758   -11.595 1.00 0.00 ?  1594 LYS B CD   5  
ATOM 8070  C CE   . LYS B 2 4  ? -8.916  7.989   -11.820 1.00 0.00 ?  1594 LYS B CE   5  
ATOM 8071  N NZ   . LYS B 2 4  ? -9.132  8.746   -10.553 1.00 0.00 1  1594 LYS B NZ   5  
ATOM 8072  H H    . LYS B 2 4  ? -3.217  7.756   -10.649 1.00 0.00 ?  1594 LYS B H    5  
ATOM 8073  H HA   . LYS B 2 4  ? -4.871  7.216   -9.146  1.00 0.00 ?  1594 LYS B HA   5  
ATOM 8074  H HB2  . LYS B 2 4  ? -5.710  5.301   -11.326 1.00 0.00 ?  1594 LYS B HB2  5  
ATOM 8075  H HB3  . LYS B 2 4  ? -6.596  5.532   -9.822  1.00 0.00 ?  1594 LYS B HB3  5  
ATOM 8076  H HG2  . LYS B 2 4  ? -6.757  7.954   -10.440 1.00 0.00 ?  1594 LYS B HG2  5  
ATOM 8077  H HG3  . LYS B 2 4  ? -6.132  7.504   -12.029 1.00 0.00 ?  1594 LYS B HG3  5  
ATOM 8078  H HD2  . LYS B 2 4  ? -8.011  6.187   -12.510 1.00 0.00 ?  1594 LYS B HD2  5  
ATOM 8079  H HD3  . LYS B 2 4  ? -8.523  6.159   -10.818 1.00 0.00 ?  1594 LYS B HD3  5  
ATOM 8080  H HE2  . LYS B 2 4  ? -8.411  8.629   -12.526 1.00 0.00 ?  1594 LYS B HE2  5  
ATOM 8081  H HE3  . LYS B 2 4  ? -9.871  7.695   -12.227 1.00 0.00 ?  1594 LYS B HE3  5  
ATOM 8082  H HZ1  . LYS B 2 4  ? -8.233  8.976   -10.073 1.00 0.00 ?  1594 LYS B HZ1  5  
ATOM 8083  H HZ2  . LYS B 2 4  ? -9.715  8.215   -9.876  1.00 0.00 ?  1594 LYS B HZ2  5  
ATOM 8084  H HZ3  . LYS B 2 4  ? -9.613  9.641   -10.768 1.00 0.00 ?  1594 LYS B HZ3  5  
ATOM 8085  N N    . VAL B 2 5  ? -4.141  5.596   -7.669  1.00 0.00 ?  1595 VAL B N    5  
ATOM 8086  C CA   . VAL B 2 5  ? -3.730  4.632   -6.684  1.00 0.00 ?  1595 VAL B CA   5  
ATOM 8087  C C    . VAL B 2 5  ? -4.868  3.625   -6.457  1.00 0.00 ?  1595 VAL B C    5  
ATOM 8088  O O    . VAL B 2 5  ? -4.653  2.560   -5.876  1.00 0.00 ?  1595 VAL B O    5  
ATOM 8089  C CB   . VAL B 2 5  ? -3.313  5.289   -5.327  1.00 0.00 ?  1595 VAL B CB   5  
ATOM 8090  C CG1  . VAL B 2 5  ? -2.474  4.322   -4.489  1.00 0.00 ?  1595 VAL B CG1  5  
ATOM 8091  C CG2  . VAL B 2 5  ? -2.589  6.640   -5.567  1.00 0.00 ?  1595 VAL B CG2  5  
ATOM 8092  H H    . VAL B 2 5  ? -4.397  6.498   -7.388  1.00 0.00 ?  1595 VAL B H    5  
ATOM 8093  H HA   . VAL B 2 5  ? -2.885  4.101   -7.098  1.00 0.00 ?  1595 VAL B HA   5  
ATOM 8094  H HB   . VAL B 2 5  ? -4.164  5.474   -4.683  1.00 0.00 ?  1595 VAL B HB   5  
ATOM 8095  H HG11 . VAL B 2 5  ? -1.427  4.420   -4.716  1.00 0.00 ?  1595 VAL B HG11 5  
ATOM 8096  H HG12 . VAL B 2 5  ? -2.726  3.289   -4.708  1.00 0.00 ?  1595 VAL B HG12 5  
ATOM 8097  H HG13 . VAL B 2 5  ? -2.623  4.528   -3.442  1.00 0.00 ?  1595 VAL B HG13 5  
ATOM 8098  H HG21 . VAL B 2 5  ? -3.321  7.356   -5.924  1.00 0.00 ?  1595 VAL B HG21 5  
ATOM 8099  H HG22 . VAL B 2 5  ? -1.847  6.563   -6.364  1.00 0.00 ?  1595 VAL B HG22 5  
ATOM 8100  H HG23 . VAL B 2 5  ? -2.172  6.981   -4.622  1.00 0.00 ?  1595 VAL B HG23 5  
ATOM 8101  N N    . LYS B 2 6  ? -6.069  3.987   -6.972  1.00 0.00 ?  1596 LYS B N    5  
ATOM 8102  C CA   . LYS B 2 6  ? -7.300  3.194   -6.879  1.00 0.00 ?  1596 LYS B CA   5  
ATOM 8103  C C    . LYS B 2 6  ? -7.013  1.774   -7.375  1.00 0.00 ?  1596 LYS B C    5  
ATOM 8104  O O    . LYS B 2 6  ? -6.887  1.550   -8.583  1.00 0.00 ?  1596 LYS B O    5  
ATOM 8105  C CB   . LYS B 2 6  ? -8.390  3.877   -7.711  1.00 0.00 ?  1596 LYS B CB   5  
ATOM 8106  C CG   . LYS B 2 6  ? -9.839  3.549   -7.339  1.00 0.00 ?  1596 LYS B CG   5  
ATOM 8107  C CD   . LYS B 2 6  ? -10.281 4.164   -5.984  1.00 0.00 ?  1596 LYS B CD   5  
ATOM 8108  C CE   . LYS B 2 6  ? -11.782 4.130   -5.880  1.00 0.00 ?  1596 LYS B CE   5  
ATOM 8109  N NZ   . LYS B 2 6  ? -12.240 4.496   -4.539  1.00 0.00 1  1596 LYS B NZ   5  
ATOM 8110  H H    . LYS B 2 6  ? -6.112  4.840   -7.451  1.00 0.00 ?  1596 LYS B H    5  
ATOM 8111  H HA   . LYS B 2 6  ? -7.603  3.150   -5.843  1.00 0.00 ?  1596 LYS B HA   5  
ATOM 8112  H HB2  . LYS B 2 6  ? -8.266  4.946   -7.625  1.00 0.00 ?  1596 LYS B HB2  5  
ATOM 8113  H HB3  . LYS B 2 6  ? -8.243  3.604   -8.746  1.00 0.00 ?  1596 LYS B HB3  5  
ATOM 8114  H HG2  . LYS B 2 6  ? -10.492 3.926   -8.113  1.00 0.00 ?  1596 LYS B HG2  5  
ATOM 8115  H HG3  . LYS B 2 6  ? -9.942  2.476   -7.283  1.00 0.00 ?  1596 LYS B HG3  5  
ATOM 8116  H HD2  . LYS B 2 6  ? -9.913  3.671   -5.090  1.00 0.00 ?  1596 LYS B HD2  5  
ATOM 8117  H HD3  . LYS B 2 6  ? -9.991  5.201   -5.932  1.00 0.00 ?  1596 LYS B HD3  5  
ATOM 8118  H HE2  . LYS B 2 6  ? -12.187 4.834   -6.589  1.00 0.00 ?  1596 LYS B HE2  5  
ATOM 8119  H HE3  . LYS B 2 6  ? -12.129 3.136   -6.117  1.00 0.00 ?  1596 LYS B HE3  5  
ATOM 8120  H HZ1  . LYS B 2 6  ? -11.890 3.771   -3.871  1.00 0.00 ?  1596 LYS B HZ1  5  
ATOM 8121  H HZ2  . LYS B 2 6  ? -13.277 4.533   -4.500  1.00 0.00 ?  1596 LYS B HZ2  5  
ATOM 8122  H HZ3  . LYS B 2 6  ? -11.862 5.421   -4.233  1.00 0.00 ?  1596 LYS B HZ3  5  
ATOM 8123  N N    . ILE B 2 7  ? -6.842  0.832   -6.438  1.00 0.00 ?  1597 ILE B N    5  
ATOM 8124  C CA   . ILE B 2 7  ? -6.339  -0.467  -6.810  1.00 0.00 ?  1597 ILE B CA   5  
ATOM 8125  C C    . ILE B 2 7  ? -7.360  -1.419  -7.511  1.00 0.00 ?  1597 ILE B C    5  
ATOM 8126  O O    . ILE B 2 7  ? -7.289  -1.578  -8.718  1.00 0.00 ?  1597 ILE B O    5  
ATOM 8127  C CB   . ILE B 2 7  ? -5.501  -1.186  -5.687  1.00 0.00 ?  1597 ILE B CB   5  
ATOM 8128  C CG1  . ILE B 2 7  ? -4.607  -2.230  -6.282  1.00 0.00 ?  1597 ILE B CG1  5  
ATOM 8129  C CG2  . ILE B 2 7  ? -6.373  -1.884  -4.683  1.00 0.00 ?  1597 ILE B CG2  5  
ATOM 8130  C CD1  . ILE B 2 7  ? -3.639  -1.732  -7.345  1.00 0.00 ?  1597 ILE B CD1  5  
ATOM 8131  H H    . ILE B 2 7  ? -7.005  1.082   -5.506  1.00 0.00 ?  1597 ILE B H    5  
ATOM 8132  H HA   . ILE B 2 7  ? -5.627  -0.155  -7.555  1.00 0.00 ?  1597 ILE B HA   5  
ATOM 8133  H HB   . ILE B 2 7  ? -4.865  -0.477  -5.172  1.00 0.00 ?  1597 ILE B HB   5  
ATOM 8134  H HG12 . ILE B 2 7  ? -4.033  -2.562  -5.427  1.00 0.00 ?  1597 ILE B HG12 5  
ATOM 8135  H HG13 . ILE B 2 7  ? -5.210  -3.035  -6.671  1.00 0.00 ?  1597 ILE B HG13 5  
ATOM 8136  H HG21 . ILE B 2 7  ? -5.777  -2.384  -3.933  1.00 0.00 ?  1597 ILE B HG21 5  
ATOM 8137  H HG22 . ILE B 2 7  ? -6.959  -2.626  -5.205  1.00 0.00 ?  1597 ILE B HG22 5  
ATOM 8138  H HG23 . ILE B 2 7  ? -7.040  -1.177  -4.212  1.00 0.00 ?  1597 ILE B HG23 5  
ATOM 8139  H HD11 . ILE B 2 7  ? -4.191  -1.401  -8.210  1.00 0.00 ?  1597 ILE B HD11 5  
ATOM 8140  H HD12 . ILE B 2 7  ? -2.973  -2.533  -7.630  1.00 0.00 ?  1597 ILE B HD12 5  
ATOM 8141  H HD13 . ILE B 2 7  ? -3.065  -0.906  -6.951  1.00 0.00 ?  1597 ILE B HD13 5  
ATOM 8142  N N    . LYS B 2 8  ? -8.321  -2.006  -6.743  1.00 0.00 ?  1598 LYS B N    5  
ATOM 8143  C CA   . LYS B 2 8  ? -9.229  -3.033  -7.228  1.00 0.00 ?  1598 LYS B CA   5  
ATOM 8144  C C    . LYS B 2 8  ? -8.416  -4.177  -7.901  1.00 0.00 ?  1598 LYS B C    5  
ATOM 8145  O O    . LYS B 2 8  ? -8.345  -4.261  -9.128  1.00 0.00 ?  1598 LYS B O    5  
ATOM 8146  C CB   . LYS B 2 8  ? -10.266 -2.432  -8.196  1.00 0.00 ?  1598 LYS B CB   5  
ATOM 8147  C CG   . LYS B 2 8  ? -11.261 -1.396  -7.612  1.00 0.00 ?  1598 LYS B CG   5  
ATOM 8148  C CD   . LYS B 2 8  ? -12.391 -2.045  -6.860  1.00 0.00 ?  1598 LYS B CD   5  
ATOM 8149  C CE   . LYS B 2 8  ? -13.613 -1.158  -6.780  1.00 0.00 ?  1598 LYS B CE   5  
ATOM 8150  N NZ   . LYS B 2 8  ? -14.901 -1.871  -6.640  1.00 0.00 1  1598 LYS B NZ   5  
ATOM 8151  H H    . LYS B 2 8  ? -8.403  -1.723  -5.812  1.00 0.00 ?  1598 LYS B H    5  
ATOM 8152  H HA   . LYS B 2 8  ? -9.726  -3.490  -6.380  1.00 0.00 ?  1598 LYS B HA   5  
ATOM 8153  H HB2  . LYS B 2 8  ? -9.725  -1.951  -8.997  1.00 0.00 ?  1598 LYS B HB2  5  
ATOM 8154  H HB3  . LYS B 2 8  ? -10.827 -3.256  -8.609  1.00 0.00 ?  1598 LYS B HB3  5  
ATOM 8155  H HG2  . LYS B 2 8  ? -10.739 -0.825  -6.852  1.00 0.00 ?  1598 LYS B HG2  5  
ATOM 8156  H HG3  . LYS B 2 8  ? -11.652 -0.755  -8.387  1.00 0.00 ?  1598 LYS B HG3  5  
ATOM 8157  H HD2  . LYS B 2 8  ? -12.628 -3.062  -7.118  1.00 0.00 ?  1598 LYS B HD2  5  
ATOM 8158  H HD3  . LYS B 2 8  ? -11.973 -1.954  -5.864  1.00 0.00 ?  1598 LYS B HD3  5  
ATOM 8159  H HE2  . LYS B 2 8  ? -13.430 -0.773  -5.791  1.00 0.00 ?  1598 LYS B HE2  5  
ATOM 8160  H HE3  . LYS B 2 8  ? -13.628 -0.386  -7.533  1.00 0.00 ?  1598 LYS B HE3  5  
ATOM 8161  H HZ1  . LYS B 2 8  ? -14.950 -2.479  -5.791  1.00 0.00 ?  1598 LYS B HZ1  5  
ATOM 8162  H HZ2  . LYS B 2 8  ? -15.161 -2.451  -7.461  1.00 0.00 ?  1598 LYS B HZ2  5  
ATOM 8163  H HZ3  . LYS B 2 8  ? -15.662 -1.171  -6.532  1.00 0.00 ?  1598 LYS B HZ3  5  
ATOM 8164  N N    . LEU B 2 9  ? -7.730  -4.992  -7.069  1.00 0.00 ?  1599 LEU B N    5  
ATOM 8165  C CA   . LEU B 2 9  ? -6.918  -6.117  -7.567  1.00 0.00 ?  1599 LEU B CA   5  
ATOM 8166  C C    . LEU B 2 9  ? -7.810  -7.107  -8.290  1.00 0.00 ?  1599 LEU B C    5  
ATOM 8167  O O    . LEU B 2 9  ? -8.569  -7.844  -7.648  1.00 0.00 ?  1599 LEU B O    5  
ATOM 8168  C CB   . LEU B 2 9  ? -6.218  -6.877  -6.418  1.00 0.00 ?  1599 LEU B CB   5  
ATOM 8169  C CG   . LEU B 2 9  ? -4.677  -6.896  -6.369  1.00 0.00 ?  1599 LEU B CG   5  
ATOM 8170  C CD1  . LEU B 2 9  ? -4.066  -7.545  -7.591  1.00 0.00 ?  1599 LEU B CD1  5  
ATOM 8171  C CD2  . LEU B 2 9  ? -4.126  -5.533  -6.184  1.00 0.00 ?  1599 LEU B CD2  5  
ATOM 8172  H H    . LEU B 2 9  ? -7.785  -4.848  -6.104  1.00 0.00 ?  1599 LEU B H    5  
ATOM 8173  H HA   . LEU B 2 9  ? -6.163  -5.710  -8.223  1.00 0.00 ?  1599 LEU B HA   5  
ATOM 8174  H HB2  . LEU B 2 9  ? -6.563  -6.547  -5.458  1.00 0.00 ?  1599 LEU B HB2  5  
ATOM 8175  H HB3  . LEU B 2 9  ? -6.557  -7.898  -6.502  1.00 0.00 ?  1599 LEU B HB3  5  
ATOM 8176  H HG   . LEU B 2 9  ? -4.409  -7.460  -5.479  1.00 0.00 ?  1599 LEU B HG   5  
ATOM 8177  H HD11 . LEU B 2 9  ? -2.990  -7.527  -7.505  1.00 0.00 ?  1599 LEU B HD11 5  
ATOM 8178  H HD12 . LEU B 2 9  ? -4.368  -7.010  -8.479  1.00 0.00 ?  1599 LEU B HD12 5  
ATOM 8179  H HD13 . LEU B 2 9  ? -4.401  -8.569  -7.661  1.00 0.00 ?  1599 LEU B HD13 5  
ATOM 8180  H HD21 . LEU B 2 9  ? -4.458  -5.212  -5.206  1.00 0.00 ?  1599 LEU B HD21 5  
ATOM 8181  H HD22 . LEU B 2 9  ? -4.480  -4.869  -6.957  1.00 0.00 ?  1599 LEU B HD22 5  
ATOM 8182  H HD23 . LEU B 2 9  ? -3.047  -5.577  -6.184  1.00 0.00 ?  1599 LEU B HD23 5  
ATOM 8183  N N    . GLY B 2 10 ? -7.741  -7.112  -9.590  1.00 0.00 ?  1600 GLY B N    5  
ATOM 8184  C CA   . GLY B 2 10 ? -8.550  -8.004  -10.382 1.00 0.00 ?  1600 GLY B CA   5  
ATOM 8185  C C    . GLY B 2 10 ? -9.940  -7.461  -10.575 1.00 0.00 ?  1600 GLY B C    5  
ATOM 8186  O O    . GLY B 2 10 ? -10.218 -6.800  -11.570 1.00 0.00 ?  1600 GLY B O    5  
ATOM 8187  H H    . GLY B 2 10 ? -7.150  -6.472  -10.041 1.00 0.00 ?  1600 GLY B H    5  
ATOM 8188  H HA2  . GLY B 2 10 ? -8.084  -8.129  -11.348 1.00 0.00 ?  1600 GLY B HA2  5  
ATOM 8189  H HA3  . GLY B 2 10 ? -8.615  -8.963  -9.892  1.00 0.00 ?  1600 GLY B HA3  5  
ATOM 8190  N N    . ARG B 2 11 ? -10.797 -7.715  -9.609  1.00 0.00 ?  1601 ARG B N    5  
ATOM 8191  C CA   . ARG B 2 11 ? -12.168 -7.244  -9.652  1.00 0.00 ?  1601 ARG B CA   5  
ATOM 8192  C C    . ARG B 2 11 ? -12.266 -5.719  -9.497  1.00 0.00 ?  1601 ARG B C    5  
ATOM 8193  O O    . ARG B 2 11 ? -12.018 -5.155  -8.410  1.00 0.00 ?  1601 ARG B O    5  
ATOM 8194  C CB   . ARG B 2 11 ? -13.065 -7.954  -8.620  1.00 0.00 ?  1601 ARG B CB   5  
ATOM 8195  C CG   . ARG B 2 11 ? -12.493 -8.032  -7.209  1.00 0.00 ?  1601 ARG B CG   5  
ATOM 8196  C CD   . ARG B 2 11 ? -13.592 -8.267  -6.181  1.00 0.00 ?  1601 ARG B CD   5  
ATOM 8197  N NE   . ARG B 2 11 ? -14.433 -7.061  -6.016  1.00 0.00 ?  1601 ARG B NE   5  
ATOM 8198  C CZ   . ARG B 2 11 ? -15.761 -6.989  -6.230  1.00 0.00 ?  1601 ARG B CZ   5  
ATOM 8199  N NH1  . ARG B 2 11 ? -16.450 -8.067  -6.585  1.00 0.00 1  1601 ARG B NH1  5  
ATOM 8200  N NH2  . ARG B 2 11 ? -16.401 -5.839  -6.045  1.00 0.00 ?  1601 ARG B NH2  5  
ATOM 8201  H H    . ARG B 2 11 ? -10.469 -8.238  -8.847  1.00 0.00 ?  1601 ARG B H    5  
ATOM 8202  H HA   . ARG B 2 11 ? -12.532 -7.488  -10.639 1.00 0.00 ?  1601 ARG B HA   5  
ATOM 8203  H HB2  . ARG B 2 11 ? -14.008 -7.431  -8.566  1.00 0.00 ?  1601 ARG B HB2  5  
ATOM 8204  H HB3  . ARG B 2 11 ? -13.252 -8.962  -8.965  1.00 0.00 ?  1601 ARG B HB3  5  
ATOM 8205  H HG2  . ARG B 2 11 ? -11.780 -8.842  -7.163  1.00 0.00 ?  1601 ARG B HG2  5  
ATOM 8206  H HG3  . ARG B 2 11 ? -11.988 -7.105  -6.992  1.00 0.00 ?  1601 ARG B HG3  5  
ATOM 8207  H HD2  . ARG B 2 11 ? -14.207 -9.088  -6.516  1.00 0.00 ?  1601 ARG B HD2  5  
ATOM 8208  H HD3  . ARG B 2 11 ? -13.140 -8.512  -5.231  1.00 0.00 ?  1601 ARG B HD3  5  
ATOM 8209  H HE   . ARG B 2 11 ? -13.930 -6.266  -5.726  1.00 0.00 ?  1601 ARG B HE   5  
ATOM 8210  H HH11 . ARG B 2 11 ? -16.037 -8.974  -6.692  1.00 0.00 ?  1601 ARG B HH11 5  
ATOM 8211  H HH12 . ARG B 2 11 ? -17.432 -8.003  -6.795  1.00 0.00 ?  1601 ARG B HH12 5  
ATOM 8212  H HH21 . ARG B 2 11 ? -15.968 -4.980  -5.735  1.00 0.00 ?  1601 ARG B HH21 5  
ATOM 8213  H HH22 . ARG B 2 11 ? -17.386 -5.776  -6.227  1.00 0.00 ?  1601 ARG B HH22 5  
ATOM 8214  N N    . LYS B 2 12 ? -12.602 -5.072  -10.581 1.00 0.00 ?  1602 LYS B N    5  
ATOM 8215  C CA   . LYS B 2 12 ? -12.807 -3.633  -10.621 1.00 0.00 ?  1602 LYS B CA   5  
ATOM 8216  C C    . LYS B 2 12 ? -14.298 -3.334  -10.683 1.00 0.00 ?  1602 LYS B C    5  
ATOM 8217  O O    . LYS B 2 12 ? -15.114 -4.269  -10.779 1.00 0.00 ?  1602 LYS B O    5  
ATOM 8218  C CB   . LYS B 2 12 ? -12.100 -3.014  -11.834 1.00 0.00 ?  1602 LYS B CB   5  
ATOM 8219  C CG   . LYS B 2 12 ? -10.593 -3.257  -11.872 1.00 0.00 ?  1602 LYS B CG   5  
ATOM 8220  C CD   . LYS B 2 12 ? -9.925  -2.551  -13.052 1.00 0.00 ?  1602 LYS B CD   5  
ATOM 8221  C CE   . LYS B 2 12 ? -10.438 -3.047  -14.400 1.00 0.00 ?  1602 LYS B CE   5  
ATOM 8222  N NZ   . LYS B 2 12 ? -9.770  -2.362  -15.530 1.00 0.00 1  1602 LYS B NZ   5  
ATOM 8223  H H    . LYS B 2 12 ? -12.735 -5.596  -11.401 1.00 0.00 ?  1602 LYS B H    5  
ATOM 8224  H HA   . LYS B 2 12 ? -12.412 -3.200  -9.716  1.00 0.00 ?  1602 LYS B HA   5  
ATOM 8225  H HB2  . LYS B 2 12 ? -12.530 -3.436  -12.730 1.00 0.00 ?  1602 LYS B HB2  5  
ATOM 8226  H HB3  . LYS B 2 12 ? -12.272 -1.948  -11.835 1.00 0.00 ?  1602 LYS B HB3  5  
ATOM 8227  H HG2  . LYS B 2 12 ? -10.155 -2.891  -10.956 1.00 0.00 ?  1602 LYS B HG2  5  
ATOM 8228  H HG3  . LYS B 2 12 ? -10.416 -4.320  -11.950 1.00 0.00 ?  1602 LYS B HG3  5  
ATOM 8229  H HD2  . LYS B 2 12 ? -10.113 -1.490  -12.978 1.00 0.00 ?  1602 LYS B HD2  5  
ATOM 8230  H HD3  . LYS B 2 12 ? -8.863  -2.733  -12.992 1.00 0.00 ?  1602 LYS B HD3  5  
ATOM 8231  H HE2  . LYS B 2 12 ? -10.249 -4.105  -14.476 1.00 0.00 ?  1602 LYS B HE2  5  
ATOM 8232  H HE3  . LYS B 2 12 ? -11.501 -2.863  -14.460 1.00 0.00 ?  1602 LYS B HE3  5  
ATOM 8233  H HZ1  . LYS B 2 12 ? -8.741  -2.519  -15.519 1.00 0.00 ?  1602 LYS B HZ1  5  
ATOM 8234  H HZ2  . LYS B 2 12 ? -9.932  -1.336  -15.485 1.00 0.00 ?  1602 LYS B HZ2  5  
ATOM 8235  H HZ3  . LYS B 2 12 ? -10.144 -2.693  -16.443 1.00 0.00 ?  1602 LYS B HZ3  5  
ATOM 8236  N N    . ALA A 1 1  ? 34.476  13.880  5.009   1.00 0.00 ?  557  ALA A N    6  
ATOM 8237  C CA   . ALA A 1 1  ? 33.434  14.793  4.537   1.00 0.00 ?  557  ALA A CA   6  
ATOM 8238  C C    . ALA A 1 1  ? 33.412  14.818  3.012   1.00 0.00 ?  557  ALA A C    6  
ATOM 8239  O O    . ALA A 1 1  ? 32.747  15.649  2.386   1.00 0.00 ?  557  ALA A O    6  
ATOM 8240  C CB   . ALA A 1 1  ? 33.693  16.189  5.078   1.00 0.00 ?  557  ALA A CB   6  
ATOM 8241  H H1   . ALA A 1 1  ? 35.410  14.181  4.933   1.00 0.00 ?  557  ALA A H1   6  
ATOM 8242  H HA   . ALA A 1 1  ? 32.484  14.445  4.912   1.00 0.00 ?  557  ALA A HA   6  
ATOM 8243  H HB1  . ALA A 1 1  ? 34.659  16.531  4.739   1.00 0.00 ?  557  ALA A HB1  6  
ATOM 8244  H HB2  . ALA A 1 1  ? 33.668  16.171  6.157   1.00 0.00 ?  557  ALA A HB2  6  
ATOM 8245  H HB3  . ALA A 1 1  ? 32.927  16.857  4.715   1.00 0.00 ?  557  ALA A HB3  6  
ATOM 8246  N N    . SER A 1 2  ? 34.122  13.895  2.436   1.00 0.00 ?  558  SER A N    6  
ATOM 8247  C CA   . SER A 1 2  ? 34.301  13.821  1.006   1.00 0.00 ?  558  SER A CA   6  
ATOM 8248  C C    . SER A 1 2  ? 33.165  13.039  0.323   1.00 0.00 ?  558  SER A C    6  
ATOM 8249  O O    . SER A 1 2  ? 32.813  13.314  -0.832  1.00 0.00 ?  558  SER A O    6  
ATOM 8250  C CB   . SER A 1 2  ? 35.671  13.174  0.717   1.00 0.00 ?  558  SER A CB   6  
ATOM 8251  O OG   . SER A 1 2  ? 35.941  13.050  -0.671  1.00 0.00 ?  558  SER A OG   6  
ATOM 8252  H H    . SER A 1 2  ? 34.535  13.219  3.017   1.00 0.00 ?  558  SER A H    6  
ATOM 8253  H HA   . SER A 1 2  ? 34.319  14.828  0.616   1.00 0.00 ?  558  SER A HA   6  
ATOM 8254  H HB2  . SER A 1 2  ? 36.448  13.779  1.157   1.00 0.00 ?  558  SER A HB2  6  
ATOM 8255  H HB3  . SER A 1 2  ? 35.690  12.191  1.165   1.00 0.00 ?  558  SER A HB3  6  
ATOM 8256  H HG   . SER A 1 2  ? 35.984  13.941  -1.047  1.00 0.00 ?  558  SER A HG   6  
ATOM 8257  N N    . ALA A 1 3  ? 32.579  12.096  1.035   1.00 0.00 ?  559  ALA A N    6  
ATOM 8258  C CA   . ALA A 1 3  ? 31.588  11.216  0.440   1.00 0.00 ?  559  ALA A CA   6  
ATOM 8259  C C    . ALA A 1 3  ? 30.257  11.918  0.207   1.00 0.00 ?  559  ALA A C    6  
ATOM 8260  O O    . ALA A 1 3  ? 29.770  11.987  -0.924  1.00 0.00 ?  559  ALA A O    6  
ATOM 8261  C CB   . ALA A 1 3  ? 31.400  9.969   1.295   1.00 0.00 ?  559  ALA A CB   6  
ATOM 8262  H H    . ALA A 1 3  ? 32.812  12.003  1.985   1.00 0.00 ?  559  ALA A H    6  
ATOM 8263  H HA   . ALA A 1 3  ? 31.975  10.902  -0.520  1.00 0.00 ?  559  ALA A HA   6  
ATOM 8264  H HB1  . ALA A 1 3  ? 30.731  9.286   0.794   1.00 0.00 ?  559  ALA A HB1  6  
ATOM 8265  H HB2  . ALA A 1 3  ? 30.980  10.251  2.250   1.00 0.00 ?  559  ALA A HB2  6  
ATOM 8266  H HB3  . ALA A 1 3  ? 32.356  9.490   1.450   1.00 0.00 ?  559  ALA A HB3  6  
ATOM 8267  N N    . SER A 1 4  ? 29.701  12.460  1.246   1.00 0.00 ?  560  SER A N    6  
ATOM 8268  C CA   . SER A 1 4  ? 28.418  13.108  1.166   1.00 0.00 ?  560  SER A CA   6  
ATOM 8269  C C    . SER A 1 4  ? 28.567  14.616  0.971   1.00 0.00 ?  560  SER A C    6  
ATOM 8270  O O    . SER A 1 4  ? 27.814  15.222  0.191   1.00 0.00 ?  560  SER A O    6  
ATOM 8271  C CB   . SER A 1 4  ? 27.632  12.822  2.443   1.00 0.00 ?  560  SER A CB   6  
ATOM 8272  O OG   . SER A 1 4  ? 27.619  11.427  2.720   1.00 0.00 ?  560  SER A OG   6  
ATOM 8273  H H    . SER A 1 4  ? 30.150  12.400  2.114   1.00 0.00 ?  560  SER A H    6  
ATOM 8274  H HA   . SER A 1 4  ? 27.875  12.688  0.333   1.00 0.00 ?  560  SER A HA   6  
ATOM 8275  H HB2  . SER A 1 4  ? 28.092  13.339  3.273   1.00 0.00 ?  560  SER A HB2  6  
ATOM 8276  H HB3  . SER A 1 4  ? 26.614  13.163  2.324   1.00 0.00 ?  560  SER A HB3  6  
ATOM 8277  H HG   . SER A 1 4  ? 27.666  11.340  3.680   1.00 0.00 ?  560  SER A HG   6  
ATOM 8278  N N    . TYR A 1 5  ? 29.590  15.193  1.628   1.00 0.00 ?  561  TYR A N    6  
ATOM 8279  C CA   . TYR A 1 5  ? 29.823  16.629  1.717   1.00 0.00 ?  561  TYR A CA   6  
ATOM 8280  C C    . TYR A 1 5  ? 28.616  17.325  2.374   1.00 0.00 ?  561  TYR A C    6  
ATOM 8281  O O    . TYR A 1 5  ? 28.600  17.544  3.594   1.00 0.00 ?  561  TYR A O    6  
ATOM 8282  C CB   . TYR A 1 5  ? 30.170  17.198  0.345   1.00 0.00 ?  561  TYR A CB   6  
ATOM 8283  C CG   . TYR A 1 5  ? 30.632  18.645  0.349   1.00 0.00 ?  561  TYR A CG   6  
ATOM 8284  C CD1  . TYR A 1 5  ? 31.970  18.947  0.456   1.00 0.00 ?  561  TYR A CD1  6  
ATOM 8285  C CD2  . TYR A 1 5  ? 29.729  19.698  0.251   1.00 0.00 ?  561  TYR A CD2  6  
ATOM 8286  C CE1  . TYR A 1 5  ? 32.412  20.251  0.471   1.00 0.00 ?  561  TYR A CE1  6  
ATOM 8287  C CE2  . TYR A 1 5  ? 30.160  21.007  0.263   1.00 0.00 ?  561  TYR A CE2  6  
ATOM 8288  C CZ   . TYR A 1 5  ? 31.504  21.277  0.374   1.00 0.00 ?  561  TYR A CZ   6  
ATOM 8289  O OH   . TYR A 1 5  ? 31.943  22.584  0.387   1.00 0.00 ?  561  TYR A OH   6  
ATOM 8290  H H    . TYR A 1 5  ? 30.274  14.636  2.046   1.00 0.00 ?  561  TYR A H    6  
ATOM 8291  H HA   . TYR A 1 5  ? 30.663  16.758  2.383   1.00 0.00 ?  561  TYR A HA   6  
ATOM 8292  H HB2  . TYR A 1 5  ? 30.968  16.560  -0.004  1.00 0.00 ?  561  TYR A HB2  6  
ATOM 8293  H HB3  . TYR A 1 5  ? 29.315  17.082  -0.304  1.00 0.00 ?  561  TYR A HB3  6  
ATOM 8294  H HD1  . TYR A 1 5  ? 32.673  18.132  0.528   1.00 0.00 ?  561  TYR A HD1  6  
ATOM 8295  H HD2  . TYR A 1 5  ? 28.676  19.481  0.163   1.00 0.00 ?  561  TYR A HD2  6  
ATOM 8296  H HE1  . TYR A 1 5  ? 33.467  20.463  0.554   1.00 0.00 ?  561  TYR A HE1  6  
ATOM 8297  H HE2  . TYR A 1 5  ? 29.446  21.814  0.186   1.00 0.00 ?  561  TYR A HE2  6  
ATOM 8298  H HH   . TYR A 1 5  ? 32.696  22.620  -0.219  1.00 0.00 ?  561  TYR A HH   6  
ATOM 8299  N N    . ASP A 1 6  ? 27.613  17.596  1.587   1.00 0.00 ?  562  ASP A N    6  
ATOM 8300  C CA   . ASP A 1 6  ? 26.364  18.149  2.038   1.00 0.00 ?  562  ASP A CA   6  
ATOM 8301  C C    . ASP A 1 6  ? 25.294  17.578  1.162   1.00 0.00 ?  562  ASP A C    6  
ATOM 8302  O O    . ASP A 1 6  ? 25.505  17.396  -0.040  1.00 0.00 ?  562  ASP A O    6  
ATOM 8303  C CB   . ASP A 1 6  ? 26.325  19.687  1.968   1.00 0.00 ?  562  ASP A CB   6  
ATOM 8304  C CG   . ASP A 1 6  ? 25.004  20.244  2.492   1.00 0.00 ?  562  ASP A CG   6  
ATOM 8305  O OD1  . ASP A 1 6  ? 24.926  20.619  3.694   1.00 0.00 ?  562  ASP A OD1  6  
ATOM 8306  O OD2  . ASP A 1 6  ? 24.017  20.286  1.736   1.00 0.00 -1 562  ASP A OD2  6  
ATOM 8307  H H    . ASP A 1 6  ? 27.686  17.380  0.632   1.00 0.00 ?  562  ASP A H    6  
ATOM 8308  H HA   . ASP A 1 6  ? 26.203  17.822  3.053   1.00 0.00 ?  562  ASP A HA   6  
ATOM 8309  H HB2  . ASP A 1 6  ? 27.130  20.091  2.566   1.00 0.00 ?  562  ASP A HB2  6  
ATOM 8310  H HB3  . ASP A 1 6  ? 26.447  20.000  0.942   1.00 0.00 ?  562  ASP A HB3  6  
ATOM 8311  N N    . SER A 1 7  ? 24.198  17.227  1.733   1.00 0.00 ?  563  SER A N    6  
ATOM 8312  C CA   . SER A 1 7  ? 23.104  16.672  0.985   1.00 0.00 ?  563  SER A CA   6  
ATOM 8313  C C    . SER A 1 7  ? 21.823  17.181  1.553   1.00 0.00 ?  563  SER A C    6  
ATOM 8314  O O    . SER A 1 7  ? 20.789  16.507  1.448   1.00 0.00 ?  563  SER A O    6  
ATOM 8315  C CB   . SER A 1 7  ? 23.122  15.174  1.122   1.00 0.00 ?  563  SER A CB   6  
ATOM 8316  O OG   . SER A 1 7  ? 24.378  14.637  0.703   1.00 0.00 ?  563  SER A OG   6  
ATOM 8317  H H    . SER A 1 7  ? 24.097  17.336  2.704   1.00 0.00 ?  563  SER A H    6  
ATOM 8318  H HA   . SER A 1 7  ? 23.200  16.933  -0.057  1.00 0.00 ?  563  SER A HA   6  
ATOM 8319  H HB2  . SER A 1 7  ? 22.919  14.964  2.162   1.00 0.00 ?  563  SER A HB2  6  
ATOM 8320  H HB3  . SER A 1 7  ? 22.312  14.800  0.514   1.00 0.00 ?  563  SER A HB3  6  
ATOM 8321  H HG   . SER A 1 7  ? 24.892  15.384  0.374   1.00 0.00 ?  563  SER A HG   6  
ATOM 8322  N N    . GLU A 1 8  ? 21.889  18.399  2.089   1.00 0.00 ?  564  GLU A N    6  
ATOM 8323  C CA   . GLU A 1 8  ? 20.822  19.029  2.833   1.00 0.00 ?  564  GLU A CA   6  
ATOM 8324  C C    . GLU A 1 8  ? 20.274  18.107  3.920   1.00 0.00 ?  564  GLU A C    6  
ATOM 8325  O O    . GLU A 1 8  ? 19.396  17.256  3.691   1.00 0.00 ?  564  GLU A O    6  
ATOM 8326  C CB   . GLU A 1 8  ? 19.765  19.694  1.941   1.00 0.00 ?  564  GLU A CB   6  
ATOM 8327  C CG   . GLU A 1 8  ? 18.968  18.806  1.020   1.00 0.00 ?  564  GLU A CG   6  
ATOM 8328  C CD   . GLU A 1 8  ? 17.942  19.575  0.259   1.00 0.00 ?  564  GLU A CD   6  
ATOM 8329  O OE1  . GLU A 1 8  ? 16.787  19.640  0.718   1.00 0.00 ?  564  GLU A OE1  6  
ATOM 8330  O OE2  . GLU A 1 8  ? 18.265  20.143  -0.811  1.00 0.00 -1 564  GLU A OE2  6  
ATOM 8331  H H    . GLU A 1 8  ? 22.707  18.932  1.959   1.00 0.00 ?  564  GLU A H    6  
ATOM 8332  H HA   . GLU A 1 8  ? 21.344  19.801  3.379   1.00 0.00 ?  564  GLU A HA   6  
ATOM 8333  H HB2  . GLU A 1 8  ? 19.080  20.255  2.552   1.00 0.00 ?  564  GLU A HB2  6  
ATOM 8334  H HB3  . GLU A 1 8  ? 20.345  20.358  1.319   1.00 0.00 ?  564  GLU A HB3  6  
ATOM 8335  H HG2  . GLU A 1 8  ? 19.655  18.333  0.335   1.00 0.00 ?  564  GLU A HG2  6  
ATOM 8336  H HG3  . GLU A 1 8  ? 18.479  18.053  1.617   1.00 0.00 ?  564  GLU A HG3  6  
ATOM 8337  N N    . GLU A 1 9  ? 20.841  18.255  5.097   1.00 0.00 ?  565  GLU A N    6  
ATOM 8338  C CA   . GLU A 1 9  ? 20.593  17.352  6.202   1.00 0.00 ?  565  GLU A CA   6  
ATOM 8339  C C    . GLU A 1 9  ? 19.212  17.483  6.852   1.00 0.00 ?  565  GLU A C    6  
ATOM 8340  O O    . GLU A 1 9  ? 19.041  18.064  7.932   1.00 0.00 ?  565  GLU A O    6  
ATOM 8341  C CB   . GLU A 1 9  ? 21.757  17.355  7.205   1.00 0.00 ?  565  GLU A CB   6  
ATOM 8342  C CG   . GLU A 1 9  ? 22.170  18.734  7.703   1.00 0.00 ?  565  GLU A CG   6  
ATOM 8343  C CD   . GLU A 1 9  ? 23.452  18.692  8.487   1.00 0.00 ?  565  GLU A CD   6  
ATOM 8344  O OE1  . GLU A 1 9  ? 23.410  18.768  9.735   1.00 0.00 ?  565  GLU A OE1  6  
ATOM 8345  O OE2  . GLU A 1 9  ? 24.533  18.530  7.874   1.00 0.00 -1 565  GLU A OE2  6  
ATOM 8346  H H    . GLU A 1 9  ? 21.441  19.022  5.231   1.00 0.00 ?  565  GLU A H    6  
ATOM 8347  H HA   . GLU A 1 9  ? 20.582  16.379  5.734   1.00 0.00 ?  565  GLU A HA   6  
ATOM 8348  H HB2  . GLU A 1 9  ? 21.472  16.759  8.060   1.00 0.00 ?  565  GLU A HB2  6  
ATOM 8349  H HB3  . GLU A 1 9  ? 22.613  16.894  6.734   1.00 0.00 ?  565  GLU A HB3  6  
ATOM 8350  H HG2  . GLU A 1 9  ? 22.307  19.389  6.858   1.00 0.00 ?  565  GLU A HG2  6  
ATOM 8351  H HG3  . GLU A 1 9  ? 21.388  19.124  8.339   1.00 0.00 ?  565  GLU A HG3  6  
ATOM 8352  N N    . GLU A 1 10 ? 18.239  16.984  6.146   1.00 0.00 ?  566  GLU A N    6  
ATOM 8353  C CA   . GLU A 1 10 ? 16.893  16.896  6.600   1.00 0.00 ?  566  GLU A CA   6  
ATOM 8354  C C    . GLU A 1 10 ? 16.643  15.486  7.087   1.00 0.00 ?  566  GLU A C    6  
ATOM 8355  O O    . GLU A 1 10 ? 17.128  14.513  6.491   1.00 0.00 ?  566  GLU A O    6  
ATOM 8356  C CB   . GLU A 1 10 ? 15.920  17.261  5.472   1.00 0.00 ?  566  GLU A CB   6  
ATOM 8357  C CG   . GLU A 1 10 ? 14.470  17.160  5.891   1.00 0.00 ?  566  GLU A CG   6  
ATOM 8358  C CD   . GLU A 1 10 ? 14.101  18.103  7.013   1.00 0.00 ?  566  GLU A CD   6  
ATOM 8359  O OE1  . GLU A 1 10 ? 13.482  19.150  6.754   1.00 0.00 ?  566  GLU A OE1  6  
ATOM 8360  O OE2  . GLU A 1 10 ? 14.423  17.802  8.191   1.00 0.00 -1 566  GLU A OE2  6  
ATOM 8361  H H    . GLU A 1 10 ? 18.466  16.666  5.245   1.00 0.00 ?  566  GLU A H    6  
ATOM 8362  H HA   . GLU A 1 10 ? 16.705  17.545  7.440   1.00 0.00 ?  566  GLU A HA   6  
ATOM 8363  H HB2  . GLU A 1 10 ? 16.116  18.275  5.156   1.00 0.00 ?  566  GLU A HB2  6  
ATOM 8364  H HB3  . GLU A 1 10 ? 16.085  16.595  4.638   1.00 0.00 ?  566  GLU A HB3  6  
ATOM 8365  H HG2  . GLU A 1 10 ? 13.804  17.291  5.053   1.00 0.00 ?  566  GLU A HG2  6  
ATOM 8366  H HG3  . GLU A 1 10 ? 14.409  16.159  6.291   1.00 0.00 ?  566  GLU A HG3  6  
ATOM 8367  N N    . GLU A 1 11 ? 15.918  15.371  8.150   1.00 0.00 ?  567  GLU A N    6  
ATOM 8368  C CA   . GLU A 1 11 ? 15.599  14.093  8.731   1.00 0.00 ?  567  GLU A CA   6  
ATOM 8369  C C    . GLU A 1 11 ? 14.188  13.743  8.258   1.00 0.00 ?  567  GLU A C    6  
ATOM 8370  O O    . GLU A 1 11 ? 13.804  14.121  7.141   1.00 0.00 ?  567  GLU A O    6  
ATOM 8371  C CB   . GLU A 1 11 ? 15.645  14.209  10.259  1.00 0.00 ?  567  GLU A CB   6  
ATOM 8372  C CG   . GLU A 1 11 ? 16.938  14.807  10.820  1.00 0.00 ?  567  GLU A CG   6  
ATOM 8373  C CD   . GLU A 1 11 ? 18.186  14.070  10.387  1.00 0.00 ?  567  GLU A CD   6  
ATOM 8374  O OE1  . GLU A 1 11 ? 18.393  12.922  10.809  1.00 0.00 ?  567  GLU A OE1  6  
ATOM 8375  O OE2  . GLU A 1 11 ? 19.006  14.648  9.642   1.00 0.00 -1 567  GLU A OE2  6  
ATOM 8376  H H    . GLU A 1 11 ? 15.534  16.193  8.533   1.00 0.00 ?  567  GLU A H    6  
ATOM 8377  H HA   . GLU A 1 11 ? 16.306  13.353  8.386   1.00 0.00 ?  567  GLU A HA   6  
ATOM 8378  H HB2  . GLU A 1 11 ? 14.823  14.831  10.578  1.00 0.00 ?  567  GLU A HB2  6  
ATOM 8379  H HB3  . GLU A 1 11 ? 15.522  13.224  10.683  1.00 0.00 ?  567  GLU A HB3  6  
ATOM 8380  H HG2  . GLU A 1 11 ? 17.020  15.830  10.485  1.00 0.00 ?  567  GLU A HG2  6  
ATOM 8381  H HG3  . GLU A 1 11 ? 16.878  14.792  11.899  1.00 0.00 ?  567  GLU A HG3  6  
ATOM 8382  N N    . GLU A 1 12 ? 13.432  13.009  9.045   1.00 0.00 ?  568  GLU A N    6  
ATOM 8383  C CA   . GLU A 1 12 ? 12.043  12.747  8.715   1.00 0.00 ?  568  GLU A CA   6  
ATOM 8384  C C    . GLU A 1 12 ? 11.208  14.014  8.813   1.00 0.00 ?  568  GLU A C    6  
ATOM 8385  O O    . GLU A 1 12 ? 10.741  14.409  9.882   1.00 0.00 ?  568  GLU A O    6  
ATOM 8386  C CB   . GLU A 1 12 ? 11.448  11.630  9.558   1.00 0.00 ?  568  GLU A CB   6  
ATOM 8387  C CG   . GLU A 1 12 ? 11.887  10.246  9.133   1.00 0.00 ?  568  GLU A CG   6  
ATOM 8388  C CD   . GLU A 1 12 ? 11.254  9.800   7.832   1.00 0.00 ?  568  GLU A CD   6  
ATOM 8389  O OE1  . GLU A 1 12 ? 11.822  10.060  6.753   1.00 0.00 ?  568  GLU A OE1  6  
ATOM 8390  O OE2  . GLU A 1 12 ? 10.182  9.150   7.871   1.00 0.00 -1 568  GLU A OE2  6  
ATOM 8391  H H    . GLU A 1 12 ? 13.812  12.617  9.861   1.00 0.00 ?  568  GLU A H    6  
ATOM 8392  H HA   . GLU A 1 12 ? 12.034  12.443  7.678   1.00 0.00 ?  568  GLU A HA   6  
ATOM 8393  H HB2  . GLU A 1 12 ? 11.732  11.779  10.589  1.00 0.00 ?  568  GLU A HB2  6  
ATOM 8394  H HB3  . GLU A 1 12 ? 10.372  11.682  9.477   1.00 0.00 ?  568  GLU A HB3  6  
ATOM 8395  H HG2  . GLU A 1 12 ? 12.954  10.288  8.973   1.00 0.00 ?  568  GLU A HG2  6  
ATOM 8396  H HG3  . GLU A 1 12 ? 11.652  9.534   9.911   1.00 0.00 ?  568  GLU A HG3  6  
ATOM 8397  N N    . GLY A 1 13 ? 11.122  14.676  7.714   1.00 0.00 ?  569  GLY A N    6  
ATOM 8398  C CA   . GLY A 1 13 ? 10.340  15.864  7.575   1.00 0.00 ?  569  GLY A CA   6  
ATOM 8399  C C    . GLY A 1 13 ? 10.012  16.056  6.132   1.00 0.00 ?  569  GLY A C    6  
ATOM 8400  O O    . GLY A 1 13 ? 10.120  17.146  5.595   1.00 0.00 ?  569  GLY A O    6  
ATOM 8401  H H    . GLY A 1 13 ? 11.663  14.351  6.961   1.00 0.00 ?  569  GLY A H    6  
ATOM 8402  H HA2  . GLY A 1 13 ? 9.430   15.766  8.149   1.00 0.00 ?  569  GLY A HA2  6  
ATOM 8403  H HA3  . GLY A 1 13 ? 10.904  16.718  7.923   1.00 0.00 ?  569  GLY A HA3  6  
ATOM 8404  N N    . LEU A 1 14 ? 9.645   14.972  5.494   1.00 0.00 ?  570  LEU A N    6  
ATOM 8405  C CA   . LEU A 1 14 ? 9.345   14.985  4.082   1.00 0.00 ?  570  LEU A CA   6  
ATOM 8406  C C    . LEU A 1 14 ? 7.858   14.768  3.869   1.00 0.00 ?  570  LEU A C    6  
ATOM 8407  O O    . LEU A 1 14 ? 7.217   14.062  4.652   1.00 0.00 ?  570  LEU A O    6  
ATOM 8408  C CB   . LEU A 1 14 ? 10.131  13.883  3.351   1.00 0.00 ?  570  LEU A CB   6  
ATOM 8409  C CG   . LEU A 1 14 ? 11.660  13.943  3.440   1.00 0.00 ?  570  LEU A CG   6  
ATOM 8410  C CD1  . LEU A 1 14 ? 12.275  12.790  2.667   1.00 0.00 ?  570  LEU A CD1  6  
ATOM 8411  C CD2  . LEU A 1 14 ? 12.189  15.275  2.922   1.00 0.00 ?  570  LEU A CD2  6  
ATOM 8412  H H    . LEU A 1 14 ? 9.541   14.130  5.983   1.00 0.00 ?  570  LEU A H    6  
ATOM 8413  H HA   . LEU A 1 14 ? 9.635   15.945  3.682   1.00 0.00 ?  570  LEU A HA   6  
ATOM 8414  H HB2  . LEU A 1 14 ? 9.811   12.931  3.750   1.00 0.00 ?  570  LEU A HB2  6  
ATOM 8415  H HB3  . LEU A 1 14 ? 9.855   13.914  2.307   1.00 0.00 ?  570  LEU A HB3  6  
ATOM 8416  H HG   . LEU A 1 14 ? 11.950  13.839  4.475   1.00 0.00 ?  570  LEU A HG   6  
ATOM 8417  H HD11 . LEU A 1 14 ? 11.951  11.854  3.095   1.00 0.00 ?  570  LEU A HD11 6  
ATOM 8418  H HD12 . LEU A 1 14 ? 13.352  12.856  2.709   1.00 0.00 ?  570  LEU A HD12 6  
ATOM 8419  H HD13 . LEU A 1 14 ? 11.954  12.841  1.637   1.00 0.00 ?  570  LEU A HD13 6  
ATOM 8420  H HD21 . LEU A 1 14 ? 11.796  16.082  3.523   1.00 0.00 ?  570  LEU A HD21 6  
ATOM 8421  H HD22 . LEU A 1 14 ? 11.883  15.411  1.895   1.00 0.00 ?  570  LEU A HD22 6  
ATOM 8422  H HD23 . LEU A 1 14 ? 13.268  15.277  2.977   1.00 0.00 ?  570  LEU A HD23 6  
ATOM 8423  N N    . PRO A 1 15 ? 7.276   15.401  2.850   1.00 0.00 ?  571  PRO A N    6  
ATOM 8424  C CA   . PRO A 1 15 ? 5.883   15.199  2.499   1.00 0.00 ?  571  PRO A CA   6  
ATOM 8425  C C    . PRO A 1 15 ? 5.721   14.016  1.558   1.00 0.00 ?  571  PRO A C    6  
ATOM 8426  O O    . PRO A 1 15 ? 6.706   13.493  1.025   1.00 0.00 ?  571  PRO A O    6  
ATOM 8427  C CB   . PRO A 1 15 ? 5.516   16.471  1.774   1.00 0.00 ?  571  PRO A CB   6  
ATOM 8428  C CG   . PRO A 1 15 ? 6.778   16.888  1.090   1.00 0.00 ?  571  PRO A CG   6  
ATOM 8429  C CD   . PRO A 1 15 ? 7.919   16.397  1.957   1.00 0.00 ?  571  PRO A CD   6  
ATOM 8430  H HA   . PRO A 1 15 ? 5.257   15.069  3.370   1.00 0.00 ?  571  PRO A HA   6  
ATOM 8431  H HB2  . PRO A 1 15 ? 4.722   16.214  1.086   1.00 0.00 ?  571  PRO A HB2  6  
ATOM 8432  H HB3  . PRO A 1 15 ? 5.169   17.208  2.483   1.00 0.00 ?  571  PRO A HB3  6  
ATOM 8433  H HG2  . PRO A 1 15 ? 6.828   16.434  0.111   1.00 0.00 ?  571  PRO A HG2  6  
ATOM 8434  H HG3  . PRO A 1 15 ? 6.809   17.965  1.002   1.00 0.00 ?  571  PRO A HG3  6  
ATOM 8435  H HD2  . PRO A 1 15 ? 8.679   15.928  1.349   1.00 0.00 ?  571  PRO A HD2  6  
ATOM 8436  H HD3  . PRO A 1 15 ? 8.342   17.207  2.530   1.00 0.00 ?  571  PRO A HD3  6  
ATOM 8437  N N    . MET A 1 16 ? 4.519   13.582  1.381   1.00 0.00 ?  572  MET A N    6  
ATOM 8438  C CA   . MET A 1 16 ? 4.227   12.501  0.476   1.00 0.00 ?  572  MET A CA   6  
ATOM 8439  C C    . MET A 1 16 ? 3.429   13.017  -0.729  1.00 0.00 ?  572  MET A C    6  
ATOM 8440  O O    . MET A 1 16 ? 2.245   13.346  -0.619  1.00 0.00 ?  572  MET A O    6  
ATOM 8441  C CB   . MET A 1 16 ? 3.490   11.352  1.204   1.00 0.00 ?  572  MET A CB   6  
ATOM 8442  C CG   . MET A 1 16 ? 2.225   11.771  1.974   1.00 0.00 ?  572  MET A CG   6  
ATOM 8443  S SD   . MET A 1 16 ? 2.529   12.723  3.496   1.00 0.00 ?  572  MET A SD   6  
ATOM 8444  C CE   . MET A 1 16 ? 3.477   11.550  4.474   1.00 0.00 ?  572  MET A CE   6  
ATOM 8445  H H    . MET A 1 16 ? 3.775   14.004  1.868   1.00 0.00 ?  572  MET A H    6  
ATOM 8446  H HA   . MET A 1 16 ? 5.172   12.131  0.106   1.00 0.00 ?  572  MET A HA   6  
ATOM 8447  H HB2  . MET A 1 16 ? 3.198   10.618  0.467   1.00 0.00 ?  572  MET A HB2  6  
ATOM 8448  H HB3  . MET A 1 16 ? 4.174   10.888  1.898   1.00 0.00 ?  572  MET A HB3  6  
ATOM 8449  H HG2  . MET A 1 16 ? 1.706   12.448  1.310   1.00 0.00 ?  572  MET A HG2  6  
ATOM 8450  H HG3  . MET A 1 16 ? 1.615   10.910  2.195   1.00 0.00 ?  572  MET A HG3  6  
ATOM 8451  H HE1  . MET A 1 16 ? 2.900   10.647  4.611   1.00 0.00 ?  572  MET A HE1  6  
ATOM 8452  H HE2  . MET A 1 16 ? 3.699   11.986  5.437   1.00 0.00 ?  572  MET A HE2  6  
ATOM 8453  H HE3  . MET A 1 16 ? 4.403   11.317  3.969   1.00 0.00 ?  572  MET A HE3  6  
ATOM 8454  N N    . SER A 1 17 ? 4.083   13.103  -1.860  1.00 0.00 ?  573  SER A N    6  
ATOM 8455  C CA   . SER A 1 17 ? 3.469   13.622  -3.077  1.00 0.00 ?  573  SER A CA   6  
ATOM 8456  C C    . SER A 1 17 ? 2.489   12.587  -3.681  1.00 0.00 ?  573  SER A C    6  
ATOM 8457  O O    . SER A 1 17 ? 2.448   11.435  -3.239  1.00 0.00 ?  573  SER A O    6  
ATOM 8458  C CB   . SER A 1 17 ? 4.577   13.962  -4.062  1.00 0.00 ?  573  SER A CB   6  
ATOM 8459  O OG   . SER A 1 17 ? 5.617   14.675  -3.399  1.00 0.00 ?  573  SER A OG   6  
ATOM 8460  H H    . SER A 1 17 ? 5.025   12.822  -1.904  1.00 0.00 ?  573  SER A H    6  
ATOM 8461  H HA   . SER A 1 17 ? 2.921   14.521  -2.836  1.00 0.00 ?  573  SER A HA   6  
ATOM 8462  H HB2  . SER A 1 17 ? 4.981   13.054  -4.486  1.00 0.00 ?  573  SER A HB2  6  
ATOM 8463  H HB3  . SER A 1 17 ? 4.181   14.585  -4.850  1.00 0.00 ?  573  SER A HB3  6  
ATOM 8464  H HG   . SER A 1 17 ? 6.203   13.990  -3.034  1.00 0.00 ?  573  SER A HG   6  
ATOM 8465  N N    . TYR A 1 18 ? 1.727   12.988  -4.694  1.00 0.00 ?  574  TYR A N    6  
ATOM 8466  C CA   . TYR A 1 18 ? 0.730   12.118  -5.326  1.00 0.00 ?  574  TYR A CA   6  
ATOM 8467  C C    . TYR A 1 18 ? 1.337   10.898  -5.989  1.00 0.00 ?  574  TYR A C    6  
ATOM 8468  O O    . TYR A 1 18 ? 0.775   9.804   -5.924  1.00 0.00 ?  574  TYR A O    6  
ATOM 8469  C CB   . TYR A 1 18 ? -0.159  12.885  -6.300  1.00 0.00 ?  574  TYR A CB   6  
ATOM 8470  C CG   . TYR A 1 18 ? -1.381  13.518  -5.666  1.00 0.00 ?  574  TYR A CG   6  
ATOM 8471  C CD1  . TYR A 1 18 ? -1.280  14.588  -4.785  1.00 0.00 ?  574  TYR A CD1  6  
ATOM 8472  C CD2  . TYR A 1 18 ? -2.647  13.040  -5.968  1.00 0.00 ?  574  TYR A CD2  6  
ATOM 8473  C CE1  . TYR A 1 18 ? -2.408  15.156  -4.220  1.00 0.00 ?  574  TYR A CE1  6  
ATOM 8474  C CE2  . TYR A 1 18 ? -3.774  13.599  -5.413  1.00 0.00 ?  574  TYR A CE2  6  
ATOM 8475  C CZ   . TYR A 1 18 ? -3.654  14.655  -4.540  1.00 0.00 ?  574  TYR A CZ   6  
ATOM 8476  O OH   . TYR A 1 18 ? -4.789  15.217  -3.991  1.00 0.00 ?  574  TYR A OH   6  
ATOM 8477  H H    . TYR A 1 18 ? 1.847   13.899  -5.047  1.00 0.00 ?  574  TYR A H    6  
ATOM 8478  H HA   . TYR A 1 18 ? 0.105   11.758  -4.522  1.00 0.00 ?  574  TYR A HA   6  
ATOM 8479  H HB2  . TYR A 1 18 ? 0.419   13.673  -6.762  1.00 0.00 ?  574  TYR A HB2  6  
ATOM 8480  H HB3  . TYR A 1 18 ? -0.495  12.201  -7.063  1.00 0.00 ?  574  TYR A HB3  6  
ATOM 8481  H HD1  . TYR A 1 18 ? -0.301  14.971  -4.538  1.00 0.00 ?  574  TYR A HD1  6  
ATOM 8482  H HD2  . TYR A 1 18 ? -2.745  12.210  -6.653  1.00 0.00 ?  574  TYR A HD2  6  
ATOM 8483  H HE1  . TYR A 1 18 ? -2.309  15.988  -3.537  1.00 0.00 ?  574  TYR A HE1  6  
ATOM 8484  H HE2  . TYR A 1 18 ? -4.749  13.206  -5.662  1.00 0.00 ?  574  TYR A HE2  6  
ATOM 8485  H HH   . TYR A 1 18 ? -5.443  14.505  -3.944  1.00 0.00 ?  574  TYR A HH   6  
ATOM 8486  N N    . ASP A 1 19 ? 2.478   11.071  -6.600  1.00 0.00 ?  575  ASP A N    6  
ATOM 8487  C CA   . ASP A 1 19 ? 3.179   9.956   -7.238  1.00 0.00 ?  575  ASP A CA   6  
ATOM 8488  C C    . ASP A 1 19 ? 3.714   9.010   -6.179  1.00 0.00 ?  575  ASP A C    6  
ATOM 8489  O O    . ASP A 1 19 ? 3.756   7.804   -6.370  1.00 0.00 ?  575  ASP A O    6  
ATOM 8490  C CB   . ASP A 1 19 ? 4.308   10.447  -8.145  1.00 0.00 ?  575  ASP A CB   6  
ATOM 8491  C CG   . ASP A 1 19 ? 5.072   9.313   -8.800  1.00 0.00 ?  575  ASP A CG   6  
ATOM 8492  O OD1  . ASP A 1 19 ? 4.525   8.640   -9.694  1.00 0.00 ?  575  ASP A OD1  6  
ATOM 8493  O OD2  . ASP A 1 19 ? 6.251   9.092   -8.458  1.00 0.00 -1 575  ASP A OD2  6  
ATOM 8494  H H    . ASP A 1 19 ? 2.853   11.978  -6.642  1.00 0.00 ?  575  ASP A H    6  
ATOM 8495  H HA   . ASP A 1 19 ? 2.453   9.419   -7.830  1.00 0.00 ?  575  ASP A HA   6  
ATOM 8496  H HB2  . ASP A 1 19 ? 3.890   11.070  -8.922  1.00 0.00 ?  575  ASP A HB2  6  
ATOM 8497  H HB3  . ASP A 1 19 ? 4.997   11.032  -7.555  1.00 0.00 ?  575  ASP A HB3  6  
ATOM 8498  N N    . GLU A 1 20 ? 4.061   9.576   -5.036  1.00 0.00 ?  576  GLU A N    6  
ATOM 8499  C CA   . GLU A 1 20 ? 4.549   8.809   -3.899  1.00 0.00 ?  576  GLU A CA   6  
ATOM 8500  C C    . GLU A 1 20 ? 3.418   7.989   -3.285  1.00 0.00 ?  576  GLU A C    6  
ATOM 8501  O O    . GLU A 1 20 ? 3.622   6.850   -2.889  1.00 0.00 ?  576  GLU A O    6  
ATOM 8502  C CB   . GLU A 1 20 ? 5.175   9.733   -2.867  1.00 0.00 ?  576  GLU A CB   6  
ATOM 8503  C CG   . GLU A 1 20 ? 6.429   10.423  -3.361  1.00 0.00 ?  576  GLU A CG   6  
ATOM 8504  C CD   . GLU A 1 20 ? 7.037   11.328  -2.334  1.00 0.00 ?  576  GLU A CD   6  
ATOM 8505  O OE1  . GLU A 1 20 ? 7.685   10.833  -1.397  1.00 0.00 ?  576  GLU A OE1  6  
ATOM 8506  O OE2  . GLU A 1 20 ? 6.896   12.563  -2.455  1.00 0.00 -1 576  GLU A OE2  6  
ATOM 8507  H H    . GLU A 1 20 ? 3.976   10.548  -4.962  1.00 0.00 ?  576  GLU A H    6  
ATOM 8508  H HA   . GLU A 1 20 ? 5.301   8.128   -4.269  1.00 0.00 ?  576  GLU A HA   6  
ATOM 8509  H HB2  . GLU A 1 20 ? 4.450   10.494  -2.613  1.00 0.00 ?  576  GLU A HB2  6  
ATOM 8510  H HB3  . GLU A 1 20 ? 5.410   9.165   -1.980  1.00 0.00 ?  576  GLU A HB3  6  
ATOM 8511  H HG2  . GLU A 1 20 ? 7.157   9.671   -3.629  1.00 0.00 ?  576  GLU A HG2  6  
ATOM 8512  H HG3  . GLU A 1 20 ? 6.183   11.004  -4.238  1.00 0.00 ?  576  GLU A HG3  6  
ATOM 8513  N N    . LYS A 1 21 ? 2.219   8.590   -3.223  1.00 0.00 ?  577  LYS A N    6  
ATOM 8514  C CA   . LYS A 1 21 ? 0.997   7.897   -2.760  1.00 0.00 ?  577  LYS A CA   6  
ATOM 8515  C C    . LYS A 1 21 ? 0.747   6.721   -3.673  1.00 0.00 ?  577  LYS A C    6  
ATOM 8516  O O    . LYS A 1 21 ? 0.465   5.600   -3.255  1.00 0.00 ?  577  LYS A O    6  
ATOM 8517  C CB   . LYS A 1 21 ? -0.247  8.817   -2.902  1.00 0.00 ?  577  LYS A CB   6  
ATOM 8518  C CG   . LYS A 1 21 ? -0.176  10.167  -2.181  1.00 0.00 ?  577  LYS A CG   6  
ATOM 8519  C CD   . LYS A 1 21 ? -1.435  10.987  -2.430  1.00 0.00 ?  577  LYS A CD   6  
ATOM 8520  C CE   . LYS A 1 21 ? -1.374  12.364  -1.777  1.00 0.00 ?  577  LYS A CE   6  
ATOM 8521  N NZ   . LYS A 1 21 ? -1.285  12.299  -0.306  1.00 0.00 1  577  LYS A NZ   6  
ATOM 8522  H H    . LYS A 1 21 ? 2.184   9.538   -3.473  1.00 0.00 ?  577  LYS A H    6  
ATOM 8523  H HA   . LYS A 1 21 ? 1.103   7.583   -1.733  1.00 0.00 ?  577  LYS A HA   6  
ATOM 8524  H HB2  . LYS A 1 21 ? -0.390  8.999   -3.958  1.00 0.00 ?  577  LYS A HB2  6  
ATOM 8525  H HB3  . LYS A 1 21 ? -1.130  8.283   -2.581  1.00 0.00 ?  577  LYS A HB3  6  
ATOM 8526  H HG2  . LYS A 1 21 ? -0.061  10.023  -1.118  1.00 0.00 ?  577  LYS A HG2  6  
ATOM 8527  H HG3  . LYS A 1 21 ? 0.674   10.715  -2.561  1.00 0.00 ?  577  LYS A HG3  6  
ATOM 8528  H HD2  . LYS A 1 21 ? -1.581  11.108  -3.492  1.00 0.00 ?  577  LYS A HD2  6  
ATOM 8529  H HD3  . LYS A 1 21 ? -2.277  10.445  -2.022  1.00 0.00 ?  577  LYS A HD3  6  
ATOM 8530  H HE2  . LYS A 1 21 ? -0.506  12.888  -2.150  1.00 0.00 ?  577  LYS A HE2  6  
ATOM 8531  H HE3  . LYS A 1 21 ? -2.264  12.911  -2.053  1.00 0.00 ?  577  LYS A HE3  6  
ATOM 8532  H HZ1  . LYS A 1 21 ? -0.412  11.853  0.031   1.00 0.00 ?  577  LYS A HZ1  6  
ATOM 8533  H HZ2  . LYS A 1 21 ? -2.095  11.778  0.085   1.00 0.00 ?  577  LYS A HZ2  6  
ATOM 8534  H HZ3  . LYS A 1 21 ? -1.335  13.254  0.107   1.00 0.00 ?  577  LYS A HZ3  6  
ATOM 8535  N N    . ARG A 1 22 ? 0.890   7.011   -4.925  1.00 0.00 ?  578  ARG A N    6  
ATOM 8536  C CA   . ARG A 1 22 ? 0.566   6.123   -5.964  1.00 0.00 ?  578  ARG A CA   6  
ATOM 8537  C C    . ARG A 1 22 ? 1.585   5.040   -6.180  1.00 0.00 ?  578  ARG A C    6  
ATOM 8538  O O    . ARG A 1 22 ? 1.267   4.019   -6.710  1.00 0.00 ?  578  ARG A O    6  
ATOM 8539  C CB   . ARG A 1 22 ? 0.180   6.857   -7.192  1.00 0.00 ?  578  ARG A CB   6  
ATOM 8540  C CG   . ARG A 1 22 ? -0.686  6.049   -8.097  1.00 0.00 ?  578  ARG A CG   6  
ATOM 8541  C CD   . ARG A 1 22 ? -1.447  6.974   -8.990  1.00 0.00 ?  578  ARG A CD   6  
ATOM 8542  N NE   . ARG A 1 22 ? -0.739  7.221   -10.248 1.00 0.00 ?  578  ARG A NE   6  
ATOM 8543  C CZ   . ARG A 1 22 ? 0.025   8.282   -10.533 1.00 0.00 ?  578  ARG A CZ   6  
ATOM 8544  N NH1  . ARG A 1 22 ? 0.171   9.276   -9.663  1.00 0.00 1  578  ARG A NH1  6  
ATOM 8545  N NH2  . ARG A 1 22 ? 0.625   8.353   -11.704 1.00 0.00 ?  578  ARG A NH2  6  
ATOM 8546  H H    . ARG A 1 22 ? 1.227   7.903   -5.157  1.00 0.00 ?  578  ARG A H    6  
ATOM 8547  H HA   . ARG A 1 22 ? -0.319  5.619   -5.605  1.00 0.00 ?  578  ARG A HA   6  
ATOM 8548  H HB2  . ARG A 1 22 ? -0.368  7.732   -6.878  1.00 0.00 ?  578  ARG A HB2  6  
ATOM 8549  H HB3  . ARG A 1 22 ? 1.044   7.188   -7.734  1.00 0.00 ?  578  ARG A HB3  6  
ATOM 8550  H HG2  . ARG A 1 22 ? -0.070  5.360   -8.667  1.00 0.00 ?  578  ARG A HG2  6  
ATOM 8551  H HG3  . ARG A 1 22 ? -1.373  5.483   -7.489  1.00 0.00 ?  578  ARG A HG3  6  
ATOM 8552  H HD2  . ARG A 1 22 ? -2.452  6.594   -9.077  1.00 0.00 ?  578  ARG A HD2  6  
ATOM 8553  H HD3  . ARG A 1 22 ? -1.542  7.913   -8.464  1.00 0.00 ?  578  ARG A HD3  6  
ATOM 8554  H HE   . ARG A 1 22 ? -0.861  6.514   -10.930 1.00 0.00 ?  578  ARG A HE   6  
ATOM 8555  H HH11 . ARG A 1 22 ? -0.276  9.288   -8.767  1.00 0.00 ?  578  ARG A HH11 6  
ATOM 8556  H HH12 . ARG A 1 22 ? 0.745   10.072  -9.879  1.00 0.00 ?  578  ARG A HH12 6  
ATOM 8557  H HH21 . ARG A 1 22 ? 0.539   7.641   -12.404 1.00 0.00 ?  578  ARG A HH21 6  
ATOM 8558  H HH22 . ARG A 1 22 ? 1.214   9.128   -11.946 1.00 0.00 ?  578  ARG A HH22 6  
ATOM 8559  N N    . GLN A 1 23 ? 2.810   5.275   -5.811  1.00 0.00 ?  579  GLN A N    6  
ATOM 8560  C CA   . GLN A 1 23 ? 3.837   4.229   -5.899  1.00 0.00 ?  579  GLN A CA   6  
ATOM 8561  C C    . GLN A 1 23 ? 3.363   2.985   -5.118  1.00 0.00 ?  579  GLN A C    6  
ATOM 8562  O O    . GLN A 1 23 ? 3.554   1.844   -5.543  1.00 0.00 ?  579  GLN A O    6  
ATOM 8563  C CB   . GLN A 1 23 ? 5.147   4.730   -5.296  1.00 0.00 ?  579  GLN A CB   6  
ATOM 8564  C CG   . GLN A 1 23 ? 6.256   3.699   -5.320  1.00 0.00 ?  579  GLN A CG   6  
ATOM 8565  C CD   . GLN A 1 23 ? 7.524   4.170   -4.659  1.00 0.00 ?  579  GLN A CD   6  
ATOM 8566  O OE1  . GLN A 1 23 ? 7.499   4.981   -3.742  1.00 0.00 ?  579  GLN A OE1  6  
ATOM 8567  N NE2  . GLN A 1 23 ? 8.630   3.661   -5.103  1.00 0.00 ?  579  GLN A NE2  6  
ATOM 8568  H H    . GLN A 1 23 ? 3.041   6.175   -5.496  1.00 0.00 ?  579  GLN A H    6  
ATOM 8569  H HA   . GLN A 1 23 ? 3.985   3.970   -6.936  1.00 0.00 ?  579  GLN A HA   6  
ATOM 8570  H HB2  . GLN A 1 23 ? 5.474   5.607   -5.837  1.00 0.00 ?  579  GLN A HB2  6  
ATOM 8571  H HB3  . GLN A 1 23 ? 4.966   5.006   -4.268  1.00 0.00 ?  579  GLN A HB3  6  
ATOM 8572  H HG2  . GLN A 1 23 ? 5.911   2.819   -4.795  1.00 0.00 ?  579  GLN A HG2  6  
ATOM 8573  H HG3  . GLN A 1 23 ? 6.471   3.444   -6.347  1.00 0.00 ?  579  GLN A HG3  6  
ATOM 8574  H HE21 . GLN A 1 23 ? 8.581   3.004   -5.830  1.00 0.00 ?  579  GLN A HE21 6  
ATOM 8575  H HE22 . GLN A 1 23 ? 9.473   3.947   -4.692  1.00 0.00 ?  579  GLN A HE22 6  
ATOM 8576  N N    . LEU A 1 24 ? 2.660   3.238   -4.035  1.00 0.00 ?  580  LEU A N    6  
ATOM 8577  C CA   . LEU A 1 24 ? 2.101   2.196   -3.206  1.00 0.00 ?  580  LEU A CA   6  
ATOM 8578  C C    . LEU A 1 24 ? 0.915   1.505   -3.905  1.00 0.00 ?  580  LEU A C    6  
ATOM 8579  O O    . LEU A 1 24 ? 0.616   0.341   -3.623  1.00 0.00 ?  580  LEU A O    6  
ATOM 8580  C CB   . LEU A 1 24 ? 1.719   2.733   -1.814  1.00 0.00 ?  580  LEU A CB   6  
ATOM 8581  C CG   . LEU A 1 24 ? 2.882   3.032   -0.827  1.00 0.00 ?  580  LEU A CG   6  
ATOM 8582  C CD1  . LEU A 1 24 ? 3.870   4.056   -1.357  1.00 0.00 ?  580  LEU A CD1  6  
ATOM 8583  C CD2  . LEU A 1 24 ? 2.345   3.494   0.496   1.00 0.00 ?  580  LEU A CD2  6  
ATOM 8584  H H    . LEU A 1 24 ? 2.512   4.173   -3.778  1.00 0.00 ?  580  LEU A H    6  
ATOM 8585  H HA   . LEU A 1 24 ? 2.883   1.460   -3.088  1.00 0.00 ?  580  LEU A HA   6  
ATOM 8586  H HB2  . LEU A 1 24 ? 1.155   3.644   -1.950  1.00 0.00 ?  580  LEU A HB2  6  
ATOM 8587  H HB3  . LEU A 1 24 ? 1.071   2.002   -1.352  1.00 0.00 ?  580  LEU A HB3  6  
ATOM 8588  H HG   . LEU A 1 24 ? 3.421   2.114   -0.652  1.00 0.00 ?  580  LEU A HG   6  
ATOM 8589  H HD11 . LEU A 1 24 ? 4.652   4.212   -0.627  1.00 0.00 ?  580  LEU A HD11 6  
ATOM 8590  H HD12 . LEU A 1 24 ? 3.355   4.987   -1.542  1.00 0.00 ?  580  LEU A HD12 6  
ATOM 8591  H HD13 . LEU A 1 24 ? 4.302   3.693   -2.278  1.00 0.00 ?  580  LEU A HD13 6  
ATOM 8592  H HD21 . LEU A 1 24 ? 1.741   2.715   0.934   1.00 0.00 ?  580  LEU A HD21 6  
ATOM 8593  H HD22 . LEU A 1 24 ? 1.758   4.390   0.355   1.00 0.00 ?  580  LEU A HD22 6  
ATOM 8594  H HD23 . LEU A 1 24 ? 3.178   3.712   1.146   1.00 0.00 ?  580  LEU A HD23 6  
ATOM 8595  N N    . SER A 1 25 ? 0.272   2.224   -4.848  1.00 0.00 ?  581  SER A N    6  
ATOM 8596  C CA   . SER A 1 25 ? -0.820  1.678   -5.651  1.00 0.00 ?  581  SER A CA   6  
ATOM 8597  C C    . SER A 1 25 ? -0.245  0.509   -6.465  1.00 0.00 ?  581  SER A C    6  
ATOM 8598  O O    . SER A 1 25 ? -0.864  -0.534  -6.645  1.00 0.00 ?  581  SER A O    6  
ATOM 8599  C CB   . SER A 1 25 ? -1.290  2.709   -6.684  1.00 0.00 ?  581  SER A CB   6  
ATOM 8600  O OG   . SER A 1 25 ? -2.634  2.486   -7.086  1.00 0.00 ?  581  SER A OG   6  
ATOM 8601  H H    . SER A 1 25 ? 0.559   3.147   -5.007  1.00 0.00 ?  581  SER A H    6  
ATOM 8602  H HA   . SER A 1 25 ? -1.641  1.457   -4.980  1.00 0.00 ?  581  SER A HA   6  
ATOM 8603  H HB2  . SER A 1 25 ? -1.112  3.717   -6.349  1.00 0.00 ?  581  SER A HB2  6  
ATOM 8604  H HB3  . SER A 1 25 ? -0.668  2.567   -7.555  1.00 0.00 ?  581  SER A HB3  6  
ATOM 8605  H HG   . SER A 1 25 ? -2.695  1.637   -7.535  1.00 0.00 ?  581  SER A HG   6  
ATOM 8606  N N    . LEU A 1 26 ? 0.970   0.731   -6.962  1.00 0.00 ?  582  LEU A N    6  
ATOM 8607  C CA   . LEU A 1 26 ? 1.665   -0.216  -7.781  1.00 0.00 ?  582  LEU A CA   6  
ATOM 8608  C C    . LEU A 1 26 ? 2.147   -1.431  -6.978  1.00 0.00 ?  582  LEU A C    6  
ATOM 8609  O O    . LEU A 1 26 ? 2.136   -2.548  -7.495  1.00 0.00 ?  582  LEU A O    6  
ATOM 8610  C CB   . LEU A 1 26 ? 2.827   0.455   -8.560  1.00 0.00 ?  582  LEU A CB   6  
ATOM 8611  C CG   . LEU A 1 26 ? 2.470   1.377   -9.777  1.00 0.00 ?  582  LEU A CG   6  
ATOM 8612  C CD1  . LEU A 1 26 ? 1.731   0.604   -10.855 1.00 0.00 ?  582  LEU A CD1  6  
ATOM 8613  C CD2  . LEU A 1 26 ? 1.677   2.636   -9.382  1.00 0.00 ?  582  LEU A CD2  6  
ATOM 8614  H H    . LEU A 1 26 ? 1.425   1.579   -6.762  1.00 0.00 ?  582  LEU A H    6  
ATOM 8615  H HA   . LEU A 1 26 ? 0.947   -0.579  -8.501  1.00 0.00 ?  582  LEU A HA   6  
ATOM 8616  H HB2  . LEU A 1 26 ? 3.396   1.047   -7.858  1.00 0.00 ?  582  LEU A HB2  6  
ATOM 8617  H HB3  . LEU A 1 26 ? 3.471   -0.334  -8.920  1.00 0.00 ?  582  LEU A HB3  6  
ATOM 8618  H HG   . LEU A 1 26 ? 3.409   1.690   -10.211 1.00 0.00 ?  582  LEU A HG   6  
ATOM 8619  H HD11 . LEU A 1 26 ? 2.347   -0.215  -11.195 1.00 0.00 ?  582  LEU A HD11 6  
ATOM 8620  H HD12 . LEU A 1 26 ? 1.522   1.263   -11.684 1.00 0.00 ?  582  LEU A HD12 6  
ATOM 8621  H HD13 . LEU A 1 26 ? 0.801   0.222   -10.459 1.00 0.00 ?  582  LEU A HD13 6  
ATOM 8622  H HD21 . LEU A 1 26 ? 0.732   2.353   -8.947  1.00 0.00 ?  582  LEU A HD21 6  
ATOM 8623  H HD22 . LEU A 1 26 ? 1.479   3.264   -10.237 1.00 0.00 ?  582  LEU A HD22 6  
ATOM 8624  H HD23 . LEU A 1 26 ? 2.225   3.219   -8.656  1.00 0.00 ?  582  LEU A HD23 6  
ATOM 8625  N N    . ASP A 1 27 ? 2.545   -1.225  -5.714  1.00 0.00 ?  583  ASP A N    6  
ATOM 8626  C CA   . ASP A 1 27 ? 3.021   -2.350  -4.876  1.00 0.00 ?  583  ASP A CA   6  
ATOM 8627  C C    . ASP A 1 27 ? 1.957   -3.351  -4.565  1.00 0.00 ?  583  ASP A C    6  
ATOM 8628  O O    . ASP A 1 27 ? 2.219   -4.548  -4.606  1.00 0.00 ?  583  ASP A O    6  
ATOM 8629  C CB   . ASP A 1 27 ? 3.762   -1.944  -3.597  1.00 0.00 ?  583  ASP A CB   6  
ATOM 8630  C CG   . ASP A 1 27 ? 5.188   -1.522  -3.883  1.00 0.00 ?  583  ASP A CG   6  
ATOM 8631  O OD1  . ASP A 1 27 ? 5.570   -0.377  -3.555  1.00 0.00 ?  583  ASP A OD1  6  
ATOM 8632  O OD2  . ASP A 1 27 ? 5.949   -2.334  -4.474  1.00 0.00 -1 583  ASP A OD2  6  
ATOM 8633  H H    . ASP A 1 27 ? 2.534   -0.312  -5.352  1.00 0.00 ?  583  ASP A H    6  
ATOM 8634  H HA   . ASP A 1 27 ? 3.722   -2.873  -5.511  1.00 0.00 ?  583  ASP A HA   6  
ATOM 8635  H HB2  . ASP A 1 27 ? 3.233   -1.133  -3.120  1.00 0.00 ?  583  ASP A HB2  6  
ATOM 8636  H HB3  . ASP A 1 27 ? 3.770   -2.789  -2.916  1.00 0.00 ?  583  ASP A HB3  6  
ATOM 8637  N N    . ILE A 1 28 ? 0.752   -2.894  -4.277  1.00 0.00 ?  584  ILE A N    6  
ATOM 8638  C CA   . ILE A 1 28 ? -0.343  -3.823  -4.021  1.00 0.00 ?  584  ILE A CA   6  
ATOM 8639  C C    . ILE A 1 28 ? -0.660  -4.653  -5.285  1.00 0.00 ?  584  ILE A C    6  
ATOM 8640  O O    . ILE A 1 28 ? -0.934  -5.840  -5.207  1.00 0.00 ?  584  ILE A O    6  
ATOM 8641  C CB   . ILE A 1 28 ? -1.618  -3.140  -3.395  1.00 0.00 ?  584  ILE A CB   6  
ATOM 8642  C CG1  . ILE A 1 28 ? -2.826  -4.075  -3.345  1.00 0.00 ?  584  ILE A CG1  6  
ATOM 8643  C CG2  . ILE A 1 28 ? -1.987  -1.876  -4.107  1.00 0.00 ?  584  ILE A CG2  6  
ATOM 8644  C CD1  . ILE A 1 28 ? -2.673  -5.295  -2.476  1.00 0.00 ?  584  ILE A CD1  6  
ATOM 8645  H H    . ILE A 1 28 ? 0.604   -1.924  -4.232  1.00 0.00 ?  584  ILE A H    6  
ATOM 8646  H HA   . ILE A 1 28 ? 0.080   -4.510  -3.304  1.00 0.00 ?  584  ILE A HA   6  
ATOM 8647  H HB   . ILE A 1 28 ? -1.367  -2.867  -2.382  1.00 0.00 ?  584  ILE A HB   6  
ATOM 8648  H HG12 . ILE A 1 28 ? -3.686  -3.527  -2.987  1.00 0.00 ?  584  ILE A HG12 6  
ATOM 8649  H HG13 . ILE A 1 28 ? -3.013  -4.403  -4.357  1.00 0.00 ?  584  ILE A HG13 6  
ATOM 8650  H HG21 . ILE A 1 28 ? -1.192  -1.148  -4.034  1.00 0.00 ?  584  ILE A HG21 6  
ATOM 8651  H HG22 . ILE A 1 28 ? -2.906  -1.481  -3.698  1.00 0.00 ?  584  ILE A HG22 6  
ATOM 8652  H HG23 . ILE A 1 28 ? -2.152  -2.124  -5.145  1.00 0.00 ?  584  ILE A HG23 6  
ATOM 8653  H HD11 . ILE A 1 28 ? -1.809  -5.859  -2.790  1.00 0.00 ?  584  ILE A HD11 6  
ATOM 8654  H HD12 . ILE A 1 28 ? -3.559  -5.897  -2.623  1.00 0.00 ?  584  ILE A HD12 6  
ATOM 8655  H HD13 . ILE A 1 28 ? -2.587  -5.002  -1.441  1.00 0.00 ?  584  ILE A HD13 6  
ATOM 8656  N N    . ASN A 1 29 ? -0.531  -4.032  -6.445  1.00 0.00 ?  585  ASN A N    6  
ATOM 8657  C CA   . ASN A 1 29 ? -0.749  -4.731  -7.727  1.00 0.00 ?  585  ASN A CA   6  
ATOM 8658  C C    . ASN A 1 29 ? 0.422   -5.718  -8.029  1.00 0.00 ?  585  ASN A C    6  
ATOM 8659  O O    . ASN A 1 29 ? 0.337   -6.567  -8.923  1.00 0.00 ?  585  ASN A O    6  
ATOM 8660  C CB   . ASN A 1 29 ? -0.963  -3.702  -8.874  1.00 0.00 ?  585  ASN A CB   6  
ATOM 8661  C CG   . ASN A 1 29 ? -1.291  -4.326  -10.241 1.00 0.00 ?  585  ASN A CG   6  
ATOM 8662  O OD1  . ASN A 1 29 ? -2.460  -4.616  -10.554 1.00 0.00 ?  585  ASN A OD1  6  
ATOM 8663  N ND2  . ASN A 1 29 ? -0.299  -4.467  -11.080 1.00 0.00 ?  585  ASN A ND2  6  
ATOM 8664  H H    . ASN A 1 29 ? -0.300  -3.080  -6.446  1.00 0.00 ?  585  ASN A H    6  
ATOM 8665  H HA   . ASN A 1 29 ? -1.648  -5.319  -7.605  1.00 0.00 ?  585  ASN A HA   6  
ATOM 8666  H HB2  . ASN A 1 29 ? -1.779  -3.046  -8.607  1.00 0.00 ?  585  ASN A HB2  6  
ATOM 8667  H HB3  . ASN A 1 29 ? -0.067  -3.108  -8.973  1.00 0.00 ?  585  ASN A HB3  6  
ATOM 8668  H HD21 . ASN A 1 29 ? 0.595   -4.167  -10.807 1.00 0.00 ?  585  ASN A HD21 6  
ATOM 8669  H HD22 . ASN A 1 29 ? -0.483  -4.871  -11.953 1.00 0.00 ?  585  ASN A HD22 6  
ATOM 8670  N N    . ARG A 1 30 ? 1.501   -5.619  -7.259  1.00 0.00 ?  586  ARG A N    6  
ATOM 8671  C CA   . ARG A 1 30 ? 2.643   -6.538  -7.383  1.00 0.00 ?  586  ARG A CA   6  
ATOM 8672  C C    . ARG A 1 30 ? 2.490   -7.688  -6.406  1.00 0.00 ?  586  ARG A C    6  
ATOM 8673  O O    . ARG A 1 30 ? 3.042   -8.774  -6.608  1.00 0.00 ?  586  ARG A O    6  
ATOM 8674  C CB   . ARG A 1 30 ? 3.962   -5.826  -7.094  1.00 0.00 ?  586  ARG A CB   6  
ATOM 8675  C CG   . ARG A 1 30 ? 4.321   -4.742  -8.077  1.00 0.00 ?  586  ARG A CG   6  
ATOM 8676  C CD   . ARG A 1 30 ? 5.572   -4.017  -7.637  1.00 0.00 ?  586  ARG A CD   6  
ATOM 8677  N NE   . ARG A 1 30 ? 5.971   -2.964  -8.574  1.00 0.00 ?  586  ARG A NE   6  
ATOM 8678  C CZ   . ARG A 1 30 ? 6.624   -1.846  -8.223  1.00 0.00 ?  586  ARG A CZ   6  
ATOM 8679  N NH1  . ARG A 1 30 ? 6.840   -1.567  -6.943  1.00 0.00 1  586  ARG A NH1  6  
ATOM 8680  N NH2  . ARG A 1 30 ? 7.034   -0.994  -9.153  1.00 0.00 ?  586  ARG A NH2  6  
ATOM 8681  H H    . ARG A 1 30 ? 1.528   -4.912  -6.579  1.00 0.00 ?  586  ARG A H    6  
ATOM 8682  H HA   . ARG A 1 30 ? 2.662   -6.929  -8.388  1.00 0.00 ?  586  ARG A HA   6  
ATOM 8683  H HB2  . ARG A 1 30 ? 3.903   -5.381  -6.112  1.00 0.00 ?  586  ARG A HB2  6  
ATOM 8684  H HB3  . ARG A 1 30 ? 4.753   -6.561  -7.093  1.00 0.00 ?  586  ARG A HB3  6  
ATOM 8685  H HG2  . ARG A 1 30 ? 4.486   -5.182  -9.049  1.00 0.00 ?  586  ARG A HG2  6  
ATOM 8686  H HG3  . ARG A 1 30 ? 3.507   -4.035  -8.127  1.00 0.00 ?  586  ARG A HG3  6  
ATOM 8687  H HD2  . ARG A 1 30 ? 5.399   -3.574  -6.667  1.00 0.00 ?  586  ARG A HD2  6  
ATOM 8688  H HD3  . ARG A 1 30 ? 6.373   -4.735  -7.557  1.00 0.00 ?  586  ARG A HD3  6  
ATOM 8689  H HE   . ARG A 1 30 ? 5.758   -3.147  -9.519  1.00 0.00 ?  586  ARG A HE   6  
ATOM 8690  H HH11 . ARG A 1 30 ? 6.544   -2.131  -6.160  1.00 0.00 ?  586  ARG A HH11 6  
ATOM 8691  H HH12 . ARG A 1 30 ? 7.326   -0.734  -6.663  1.00 0.00 ?  586  ARG A HH12 6  
ATOM 8692  H HH21 . ARG A 1 30 ? 6.879   -1.135  -10.136 1.00 0.00 ?  586  ARG A HH21 6  
ATOM 8693  H HH22 . ARG A 1 30 ? 7.529   -0.152  -8.916  1.00 0.00 ?  586  ARG A HH22 6  
ATOM 8694  N N    . LEU A 1 31 ? 1.749   -7.436  -5.349  1.00 0.00 ?  587  LEU A N    6  
ATOM 8695  C CA   . LEU A 1 31 ? 1.515   -8.407  -4.321  1.00 0.00 ?  587  LEU A CA   6  
ATOM 8696  C C    . LEU A 1 31 ? 0.554   -9.495  -4.806  1.00 0.00 ?  587  LEU A C    6  
ATOM 8697  O O    . LEU A 1 31 ? -0.362  -9.218  -5.596  1.00 0.00 ?  587  LEU A O    6  
ATOM 8698  C CB   . LEU A 1 31 ? 1.032   -7.713  -3.049  1.00 0.00 ?  587  LEU A CB   6  
ATOM 8699  C CG   . LEU A 1 31 ? 2.134   -6.937  -2.332  1.00 0.00 ?  587  LEU A CG   6  
ATOM 8700  C CD1  . LEU A 1 31 ? 1.568   -5.916  -1.381  1.00 0.00 ?  587  LEU A CD1  6  
ATOM 8701  C CD2  . LEU A 1 31 ? 3.054   -7.870  -1.561  1.00 0.00 ?  587  LEU A CD2  6  
ATOM 8702  H H    . LEU A 1 31 ? 1.313   -6.561  -5.269  1.00 0.00 ?  587  LEU A H    6  
ATOM 8703  H HA   . LEU A 1 31 ? 2.500   -8.806  -4.125  1.00 0.00 ?  587  LEU A HA   6  
ATOM 8704  H HB2  . LEU A 1 31 ? 0.237   -7.032  -3.316  1.00 0.00 ?  587  LEU A HB2  6  
ATOM 8705  H HB3  . LEU A 1 31 ? 0.644   -8.458  -2.372  1.00 0.00 ?  587  LEU A HB3  6  
ATOM 8706  H HG   . LEU A 1 31 ? 2.719   -6.492  -3.123  1.00 0.00 ?  587  LEU A HG   6  
ATOM 8707  H HD11 . LEU A 1 31 ? 2.373   -5.568  -0.748  1.00 0.00 ?  587  LEU A HD11 6  
ATOM 8708  H HD12 . LEU A 1 31 ? 0.784   -6.357  -0.784  1.00 0.00 ?  587  LEU A HD12 6  
ATOM 8709  H HD13 . LEU A 1 31 ? 1.177   -5.075  -1.927  1.00 0.00 ?  587  LEU A HD13 6  
ATOM 8710  H HD21 . LEU A 1 31 ? 3.575   -8.526  -2.242  1.00 0.00 ?  587  LEU A HD21 6  
ATOM 8711  H HD22 . LEU A 1 31 ? 2.468   -8.453  -0.868  1.00 0.00 ?  587  LEU A HD22 6  
ATOM 8712  H HD23 . LEU A 1 31 ? 3.769   -7.274  -1.006  1.00 0.00 ?  587  LEU A HD23 6  
ATOM 8713  N N    . PRO A 1 32 ? 0.773   -10.753 -4.385  1.00 0.00 ?  588  PRO A N    6  
ATOM 8714  C CA   . PRO A 1 32 ? -0.016  -11.894 -4.851  1.00 0.00 ?  588  PRO A CA   6  
ATOM 8715  C C    . PRO A 1 32 ? -1.489  -11.874 -4.402  1.00 0.00 ?  588  PRO A C    6  
ATOM 8716  O O    . PRO A 1 32 ? -1.870  -11.178 -3.442  1.00 0.00 ?  588  PRO A O    6  
ATOM 8717  C CB   . PRO A 1 32 ? 0.716   -13.102 -4.271  1.00 0.00 ?  588  PRO A CB   6  
ATOM 8718  C CG   . PRO A 1 32 ? 1.463   -12.573 -3.103  1.00 0.00 ?  588  PRO A CG   6  
ATOM 8719  C CD   . PRO A 1 32 ? 1.822   -11.160 -3.439  1.00 0.00 ?  588  PRO A CD   6  
ATOM 8720  H HA   . PRO A 1 32 ? 0.012   -11.948 -5.928  1.00 0.00 ?  588  PRO A HA   6  
ATOM 8721  H HB2  . PRO A 1 32 ? -0.003  -13.849 -3.972  1.00 0.00 ?  588  PRO A HB2  6  
ATOM 8722  H HB3  . PRO A 1 32 ? 1.386   -13.518 -5.010  1.00 0.00 ?  588  PRO A HB3  6  
ATOM 8723  H HG2  . PRO A 1 32 ? 0.830   -12.599 -2.228  1.00 0.00 ?  588  PRO A HG2  6  
ATOM 8724  H HG3  . PRO A 1 32 ? 2.357   -13.156 -2.940  1.00 0.00 ?  588  PRO A HG3  6  
ATOM 8725  H HD2  . PRO A 1 32 ? 1.805   -10.545 -2.550  1.00 0.00 ?  588  PRO A HD2  6  
ATOM 8726  H HD3  . PRO A 1 32 ? 2.794   -11.122 -3.907  1.00 0.00 ?  588  PRO A HD3  6  
ATOM 8727  N N    . GLY A 1 33 ? -2.284  -12.712 -5.054  1.00 0.00 ?  589  GLY A N    6  
ATOM 8728  C CA   . GLY A 1 33 ? -3.728  -12.762 -4.856  1.00 0.00 ?  589  GLY A CA   6  
ATOM 8729  C C    . GLY A 1 33 ? -4.178  -13.197 -3.465  1.00 0.00 ?  589  GLY A C    6  
ATOM 8730  O O    . GLY A 1 33 ? -5.355  -13.065 -3.123  1.00 0.00 ?  589  GLY A O    6  
ATOM 8731  H H    . GLY A 1 33 ? -1.870  -13.332 -5.694  1.00 0.00 ?  589  GLY A H    6  
ATOM 8732  H HA2  . GLY A 1 33 ? -4.126  -11.779 -5.047  1.00 0.00 ?  589  GLY A HA2  6  
ATOM 8733  H HA3  . GLY A 1 33 ? -4.143  -13.446 -5.583  1.00 0.00 ?  589  GLY A HA3  6  
ATOM 8734  N N    . GLU A 1 34 ? -3.276  -13.751 -2.689  1.00 0.00 ?  590  GLU A N    6  
ATOM 8735  C CA   . GLU A 1 34 ? -3.571  -14.162 -1.322  1.00 0.00 ?  590  GLU A CA   6  
ATOM 8736  C C    . GLU A 1 34 ? -3.260  -13.031 -0.353  1.00 0.00 ?  590  GLU A C    6  
ATOM 8737  O O    . GLU A 1 34 ? -3.741  -13.005 0.778   1.00 0.00 ?  590  GLU A O    6  
ATOM 8738  C CB   . GLU A 1 34 ? -2.764  -15.413 -0.939  1.00 0.00 ?  590  GLU A CB   6  
ATOM 8739  C CG   . GLU A 1 34 ? -1.253  -15.213 -0.935  1.00 0.00 ?  590  GLU A CG   6  
ATOM 8740  C CD   . GLU A 1 34 ? -0.517  -16.456 -0.543  1.00 0.00 ?  590  GLU A CD   6  
ATOM 8741  O OE1  . GLU A 1 34 ? -0.397  -16.731 0.666   1.00 0.00 ?  590  GLU A OE1  6  
ATOM 8742  O OE2  . GLU A 1 34 ? -0.052  -17.189 -1.425  1.00 0.00 -1 590  GLU A OE2  6  
ATOM 8743  H H    . GLU A 1 34 ? -2.388  -13.905 -3.070  1.00 0.00 ?  590  GLU A H    6  
ATOM 8744  H HA   . GLU A 1 34 ? -4.623  -14.389 -1.259  1.00 0.00 ?  590  GLU A HA   6  
ATOM 8745  H HB2  . GLU A 1 34 ? -3.059  -15.725 0.051   1.00 0.00 ?  590  GLU A HB2  6  
ATOM 8746  H HB3  . GLU A 1 34 ? -2.998  -16.204 -1.635  1.00 0.00 ?  590  GLU A HB3  6  
ATOM 8747  H HG2  . GLU A 1 34 ? -0.927  -14.908 -1.918  1.00 0.00 ?  590  GLU A HG2  6  
ATOM 8748  H HG3  . GLU A 1 34 ? -1.020  -14.437 -0.221  1.00 0.00 ?  590  GLU A HG3  6  
ATOM 8749  N N    . LYS A 1 35 ? -2.471  -12.088 -0.810  1.00 0.00 ?  591  LYS A N    6  
ATOM 8750  C CA   . LYS A 1 35 ? -2.018  -11.014 0.029   1.00 0.00 ?  591  LYS A CA   6  
ATOM 8751  C C    . LYS A 1 35 ? -2.876  -9.789  -0.110  1.00 0.00 ?  591  LYS A C    6  
ATOM 8752  O O    . LYS A 1 35 ? -2.942  -8.988  0.805   1.00 0.00 ?  591  LYS A O    6  
ATOM 8753  C CB   . LYS A 1 35 ? -0.554  -10.687 -0.248  1.00 0.00 ?  591  LYS A CB   6  
ATOM 8754  C CG   . LYS A 1 35 ? 0.433   -11.745 0.251   1.00 0.00 ?  591  LYS A CG   6  
ATOM 8755  C CD   . LYS A 1 35 ? 0.449   -11.828 1.774   1.00 0.00 ?  591  LYS A CD   6  
ATOM 8756  C CE   . LYS A 1 35 ? 1.386   -12.920 2.299   1.00 0.00 ?  591  LYS A CE   6  
ATOM 8757  N NZ   . LYS A 1 35 ? 0.962   -14.293 1.913   1.00 0.00 1  591  LYS A NZ   6  
ATOM 8758  H H    . LYS A 1 35 ? -2.203  -12.099 -1.754  1.00 0.00 ?  591  LYS A H    6  
ATOM 8759  H HA   . LYS A 1 35 ? -2.095  -11.355 1.049   1.00 0.00 ?  591  LYS A HA   6  
ATOM 8760  H HB2  . LYS A 1 35 ? -0.430  -10.585 -1.317  1.00 0.00 ?  591  LYS A HB2  6  
ATOM 8761  H HB3  . LYS A 1 35 ? -0.331  -9.741  0.220   1.00 0.00 ?  591  LYS A HB3  6  
ATOM 8762  H HG2  . LYS A 1 35 ? 0.148   -12.707 -0.147  1.00 0.00 ?  591  LYS A HG2  6  
ATOM 8763  H HG3  . LYS A 1 35 ? 1.421   -11.487 -0.099  1.00 0.00 ?  591  LYS A HG3  6  
ATOM 8764  H HD2  . LYS A 1 35 ? 0.786   -10.878 2.165   1.00 0.00 ?  591  LYS A HD2  6  
ATOM 8765  H HD3  . LYS A 1 35 ? -0.552  -12.018 2.131   1.00 0.00 ?  591  LYS A HD3  6  
ATOM 8766  H HE2  . LYS A 1 35 ? 2.380   -12.742 1.918   1.00 0.00 ?  591  LYS A HE2  6  
ATOM 8767  H HE3  . LYS A 1 35 ? 1.407   -12.850 3.377   1.00 0.00 ?  591  LYS A HE3  6  
ATOM 8768  H HZ1  . LYS A 1 35 ? -0.019  -14.482 2.204   1.00 0.00 ?  591  LYS A HZ1  6  
ATOM 8769  H HZ2  . LYS A 1 35 ? 1.553   -14.997 2.401   1.00 0.00 ?  591  LYS A HZ2  6  
ATOM 8770  H HZ3  . LYS A 1 35 ? 1.055   -14.470 0.894   1.00 0.00 ?  591  LYS A HZ3  6  
ATOM 8771  N N    . LEU A 1 36 ? -3.550  -9.657  -1.237  1.00 0.00 ?  592  LEU A N    6  
ATOM 8772  C CA   . LEU A 1 36 ? -4.408  -8.506  -1.485  1.00 0.00 ?  592  LEU A CA   6  
ATOM 8773  C C    . LEU A 1 36 ? -5.498  -8.382  -0.393  1.00 0.00 ?  592  LEU A C    6  
ATOM 8774  O O    . LEU A 1 36 ? -5.754  -7.288  0.134   1.00 0.00 ?  592  LEU A O    6  
ATOM 8775  C CB   . LEU A 1 36 ? -4.986  -8.549  -2.942  1.00 0.00 ?  592  LEU A CB   6  
ATOM 8776  C CG   . LEU A 1 36 ? -6.109  -9.584  -3.297  1.00 0.00 ?  592  LEU A CG   6  
ATOM 8777  C CD1  . LEU A 1 36 ? -7.484  -9.049  -2.959  1.00 0.00 ?  592  LEU A CD1  6  
ATOM 8778  C CD2  . LEU A 1 36 ? -6.100  -9.878  -4.758  1.00 0.00 ?  592  LEU A CD2  6  
ATOM 8779  H H    . LEU A 1 36 ? -3.433  -10.331 -1.938  1.00 0.00 ?  592  LEU A H    6  
ATOM 8780  H HA   . LEU A 1 36 ? -3.771  -7.638  -1.389  1.00 0.00 ?  592  LEU A HA   6  
ATOM 8781  H HB2  . LEU A 1 36 ? -5.336  -7.555  -3.182  1.00 0.00 ?  592  LEU A HB2  6  
ATOM 8782  H HB3  . LEU A 1 36 ? -4.146  -8.730  -3.599  1.00 0.00 ?  592  LEU A HB3  6  
ATOM 8783  H HG   . LEU A 1 36 ? -5.946  -10.509 -2.763  1.00 0.00 ?  592  LEU A HG   6  
ATOM 8784  H HD11 . LEU A 1 36 ? -8.217  -9.840  -3.041  1.00 0.00 ?  592  LEU A HD11 6  
ATOM 8785  H HD12 . LEU A 1 36 ? -7.697  -8.318  -3.732  1.00 0.00 ?  592  LEU A HD12 6  
ATOM 8786  H HD13 . LEU A 1 36 ? -7.497  -8.591  -1.982  1.00 0.00 ?  592  LEU A HD13 6  
ATOM 8787  H HD21 . LEU A 1 36 ? -6.765  -10.696 -4.991  1.00 0.00 ?  592  LEU A HD21 6  
ATOM 8788  H HD22 . LEU A 1 36 ? -5.098  -10.056 -5.118  1.00 0.00 ?  592  LEU A HD22 6  
ATOM 8789  H HD23 . LEU A 1 36 ? -6.500  -8.974  -5.206  1.00 0.00 ?  592  LEU A HD23 6  
ATOM 8790  N N    . GLY A 1 37 ? -6.070  -9.516  -0.009  1.00 0.00 ?  593  GLY A N    6  
ATOM 8791  C CA   . GLY A 1 37 ? -7.098  -9.531  1.021   1.00 0.00 ?  593  GLY A CA   6  
ATOM 8792  C C    . GLY A 1 37 ? -6.509  -9.312  2.392   1.00 0.00 ?  593  GLY A C    6  
ATOM 8793  O O    . GLY A 1 37 ? -7.193  -8.870  3.323   1.00 0.00 ?  593  GLY A O    6  
ATOM 8794  H H    . GLY A 1 37 ? -5.795  -10.362 -0.433  1.00 0.00 ?  593  GLY A H    6  
ATOM 8795  H HA2  . GLY A 1 37 ? -7.815  -8.750  0.815   1.00 0.00 ?  593  GLY A HA2  6  
ATOM 8796  H HA3  . GLY A 1 37 ? -7.604  -10.485 1.014   1.00 0.00 ?  593  GLY A HA3  6  
ATOM 8797  N N    . ARG A 1 38 ? -5.248  -9.628  2.516   1.00 0.00 ?  594  ARG A N    6  
ATOM 8798  C CA   . ARG A 1 38 ? -4.524  -9.459  3.748   1.00 0.00 ?  594  ARG A CA   6  
ATOM 8799  C C    . ARG A 1 38 ? -4.318  -7.973  3.996   1.00 0.00 ?  594  ARG A C    6  
ATOM 8800  O O    . ARG A 1 38 ? -4.691  -7.459  5.040   1.00 0.00 ?  594  ARG A O    6  
ATOM 8801  C CB   . ARG A 1 38 ? -3.187  -10.234 3.686   1.00 0.00 ?  594  ARG A CB   6  
ATOM 8802  C CG   . ARG A 1 38 ? -2.308  -10.165 4.935   1.00 0.00 ?  594  ARG A CG   6  
ATOM 8803  C CD   . ARG A 1 38 ? -3.049  -10.593 6.200   1.00 0.00 ?  594  ARG A CD   6  
ATOM 8804  N NE   . ARG A 1 38 ? -3.674  -11.919 6.107   1.00 0.00 ?  594  ARG A NE   6  
ATOM 8805  C CZ   . ARG A 1 38 ? -4.378  -12.482 7.097   1.00 0.00 ?  594  ARG A CZ   6  
ATOM 8806  N NH1  . ARG A 1 38 ? -4.377  -11.931 8.314   1.00 0.00 1  594  ARG A NH1  6  
ATOM 8807  N NH2  . ARG A 1 38 ? -5.048  -13.608 6.886   1.00 0.00 ?  594  ARG A NH2  6  
ATOM 8808  H H    . ARG A 1 38 ? -4.794  -9.952  1.712   1.00 0.00 ?  594  ARG A H    6  
ATOM 8809  H HA   . ARG A 1 38 ? -5.134  -9.860  4.544   1.00 0.00 ?  594  ARG A HA   6  
ATOM 8810  H HB2  . ARG A 1 38 ? -3.397  -11.275 3.492   1.00 0.00 ?  594  ARG A HB2  6  
ATOM 8811  H HB3  . ARG A 1 38 ? -2.618  -9.845  2.854   1.00 0.00 ?  594  ARG A HB3  6  
ATOM 8812  H HG2  . ARG A 1 38 ? -1.456  -10.815 4.801   1.00 0.00 ?  594  ARG A HG2  6  
ATOM 8813  H HG3  . ARG A 1 38 ? -1.964  -9.149  5.058   1.00 0.00 ?  594  ARG A HG3  6  
ATOM 8814  H HD2  . ARG A 1 38 ? -2.347  -10.611 7.020   1.00 0.00 ?  594  ARG A HD2  6  
ATOM 8815  H HD3  . ARG A 1 38 ? -3.814  -9.861  6.414   1.00 0.00 ?  594  ARG A HD3  6  
ATOM 8816  H HE   . ARG A 1 38 ? -3.598  -12.362 5.231   1.00 0.00 ?  594  ARG A HE   6  
ATOM 8817  H HH11 . ARG A 1 38 ? -3.855  -11.103 8.542   1.00 0.00 ?  594  ARG A HH11 6  
ATOM 8818  H HH12 . ARG A 1 38 ? -4.932  -12.326 9.051   1.00 0.00 ?  594  ARG A HH12 6  
ATOM 8819  H HH21 . ARG A 1 38 ? -5.064  -14.083 6.003   1.00 0.00 ?  594  ARG A HH21 6  
ATOM 8820  H HH22 . ARG A 1 38 ? -5.600  -14.017 7.621   1.00 0.00 ?  594  ARG A HH22 6  
ATOM 8821  N N    . VAL A 1 39 ? -3.788  -7.288  2.990   1.00 0.00 ?  595  VAL A N    6  
ATOM 8822  C CA   . VAL A 1 39 ? -3.507  -5.840  3.046   1.00 0.00 ?  595  VAL A CA   6  
ATOM 8823  C C    . VAL A 1 39 ? -4.732  -5.068  3.439   1.00 0.00 ?  595  VAL A C    6  
ATOM 8824  O O    . VAL A 1 39 ? -4.681  -4.297  4.399   1.00 0.00 ?  595  VAL A O    6  
ATOM 8825  C CB   . VAL A 1 39 ? -3.019  -5.289  1.680   1.00 0.00 ?  595  VAL A CB   6  
ATOM 8826  C CG1  . VAL A 1 39 ? -2.673  -3.824  1.761   1.00 0.00 ?  595  VAL A CG1  6  
ATOM 8827  C CG2  . VAL A 1 39 ? -1.863  -6.081  1.129   1.00 0.00 ?  595  VAL A CG2  6  
ATOM 8828  H H    . VAL A 1 39 ? -3.568  -7.777  2.165   1.00 0.00 ?  595  VAL A H    6  
ATOM 8829  H HA   . VAL A 1 39 ? -2.775  -5.604  3.806   1.00 0.00 ?  595  VAL A HA   6  
ATOM 8830  H HB   . VAL A 1 39 ? -3.845  -5.365  0.991   1.00 0.00 ?  595  VAL A HB   6  
ATOM 8831  H HG11 . VAL A 1 39 ? -2.346  -3.481  0.791   1.00 0.00 ?  595  VAL A HG11 6  
ATOM 8832  H HG12 . VAL A 1 39 ? -1.885  -3.682  2.485   1.00 0.00 ?  595  VAL A HG12 6  
ATOM 8833  H HG13 . VAL A 1 39 ? -3.546  -3.264  2.065   1.00 0.00 ?  595  VAL A HG13 6  
ATOM 8834  H HG21 . VAL A 1 39 ? -1.050  -6.073  1.840   1.00 0.00 ?  595  VAL A HG21 6  
ATOM 8835  H HG22 . VAL A 1 39 ? -1.528  -5.632  0.205   1.00 0.00 ?  595  VAL A HG22 6  
ATOM 8836  H HG23 . VAL A 1 39 ? -2.171  -7.100  0.947   1.00 0.00 ?  595  VAL A HG23 6  
ATOM 8837  N N    . VAL A 1 40 ? -5.841  -5.324  2.746   1.00 0.00 ?  596  VAL A N    6  
ATOM 8838  C CA   . VAL A 1 40 ? -7.068  -4.578  2.963   1.00 0.00 ?  596  VAL A CA   6  
ATOM 8839  C C    . VAL A 1 40 ? -7.500  -4.662  4.424   1.00 0.00 ?  596  VAL A C    6  
ATOM 8840  O O    . VAL A 1 40 ? -8.025  -3.721  4.955   1.00 0.00 ?  596  VAL A O    6  
ATOM 8841  C CB   . VAL A 1 40 ? -8.228  -5.041  2.013   1.00 0.00 ?  596  VAL A CB   6  
ATOM 8842  C CG1  . VAL A 1 40 ? -8.933  -6.311  2.486   1.00 0.00 ?  596  VAL A CG1  6  
ATOM 8843  C CG2  . VAL A 1 40 ? -9.219  -3.920  1.754   1.00 0.00 ?  596  VAL A CG2  6  
ATOM 8844  H H    . VAL A 1 40 ? -5.823  -6.028  2.061   1.00 0.00 ?  596  VAL A H    6  
ATOM 8845  H HA   . VAL A 1 40 ? -6.839  -3.544  2.749   1.00 0.00 ?  596  VAL A HA   6  
ATOM 8846  H HB   . VAL A 1 40 ? -7.757  -5.301  1.078   1.00 0.00 ?  596  VAL A HB   6  
ATOM 8847  H HG11 . VAL A 1 40 ? -9.700  -6.587  1.779   1.00 0.00 ?  596  VAL A HG11 6  
ATOM 8848  H HG12 . VAL A 1 40 ? -9.390  -6.108  3.444   1.00 0.00 ?  596  VAL A HG12 6  
ATOM 8849  H HG13 . VAL A 1 40 ? -8.216  -7.112  2.591   1.00 0.00 ?  596  VAL A HG13 6  
ATOM 8850  H HG21 . VAL A 1 40 ? -8.724  -3.102  1.252   1.00 0.00 ?  596  VAL A HG21 6  
ATOM 8851  H HG22 . VAL A 1 40 ? -9.613  -3.575  2.698   1.00 0.00 ?  596  VAL A HG22 6  
ATOM 8852  H HG23 . VAL A 1 40 ? -10.028 -4.289  1.143   1.00 0.00 ?  596  VAL A HG23 6  
ATOM 8853  N N    . HIS A 1 41 ? -7.199  -5.785  5.055   1.00 0.00 ?  597  HIS A N    6  
ATOM 8854  C CA   . HIS A 1 41 ? -7.557  -6.037  6.442   1.00 0.00 ?  597  HIS A CA   6  
ATOM 8855  C C    . HIS A 1 41 ? -6.629  -5.243  7.393   1.00 0.00 ?  597  HIS A C    6  
ATOM 8856  O O    . HIS A 1 41 ? -7.098  -4.639  8.359   1.00 0.00 ?  597  HIS A O    6  
ATOM 8857  C CB   . HIS A 1 41 ? -7.507  -7.554  6.729   1.00 0.00 ?  597  HIS A CB   6  
ATOM 8858  C CG   . HIS A 1 41 ? -8.108  -8.008  8.044   1.00 0.00 ?  597  HIS A CG   6  
ATOM 8859  N ND1  . HIS A 1 41 ? -8.201  -9.335  8.421   1.00 0.00 ?  597  HIS A ND1  6  
ATOM 8860  C CD2  . HIS A 1 41 ? -8.669  -7.300  9.060   1.00 0.00 ?  597  HIS A CD2  6  
ATOM 8861  C CE1  . HIS A 1 41 ? -8.793  -9.392  9.617   1.00 0.00 ?  597  HIS A CE1  6  
ATOM 8862  N NE2  . HIS A 1 41 ? -9.102  -8.179  10.054  1.00 0.00 ?  597  HIS A NE2  6  
ATOM 8863  H H    . HIS A 1 41 ? -6.686  -6.448  4.547   1.00 0.00 ?  597  HIS A H    6  
ATOM 8864  H HA   . HIS A 1 41 ? -8.572  -5.685  6.563   1.00 0.00 ?  597  HIS A HA   6  
ATOM 8865  H HB2  . HIS A 1 41 ? -8.047  -8.057  5.941   1.00 0.00 ?  597  HIS A HB2  6  
ATOM 8866  H HB3  . HIS A 1 41 ? -6.476  -7.875  6.698   1.00 0.00 ?  597  HIS A HB3  6  
ATOM 8867  H HD1  . HIS A 1 41 ? -7.908  -10.107 7.889   1.00 0.00 ?  597  HIS A HD1  6  
ATOM 8868  H HD2  . HIS A 1 41 ? -8.767  -6.225  9.102   1.00 0.00 ?  597  HIS A HD2  6  
ATOM 8869  H HE1  . HIS A 1 41 ? -8.989  -10.304 10.159  1.00 0.00 ?  597  HIS A HE1  6  
ATOM 8870  N N    . ILE A 1 42 ? -5.319  -5.230  7.105   1.00 0.00 ?  598  ILE A N    6  
ATOM 8871  C CA   . ILE A 1 42 ? -4.367  -4.479  7.942   1.00 0.00 ?  598  ILE A CA   6  
ATOM 8872  C C    . ILE A 1 42 ? -4.678  -2.997  7.867   1.00 0.00 ?  598  ILE A C    6  
ATOM 8873  O O    . ILE A 1 42 ? -4.825  -2.321  8.905   1.00 0.00 ?  598  ILE A O    6  
ATOM 8874  C CB   . ILE A 1 42 ? -2.832  -4.723  7.583   1.00 0.00 ?  598  ILE A CB   6  
ATOM 8875  C CG1  . ILE A 1 42 ? -2.307  -6.079  8.085   1.00 0.00 ?  598  ILE A CG1  6  
ATOM 8876  C CG2  . ILE A 1 42 ? -1.934  -3.614  8.125   1.00 0.00 ?  598  ILE A CG2  6  
ATOM 8877  C CD1  . ILE A 1 42 ? -2.898  -7.275  7.424   1.00 0.00 ?  598  ILE A CD1  6  
ATOM 8878  H H    . ILE A 1 42 ? -5.000  -5.713  6.312   1.00 0.00 ?  598  ILE A H    6  
ATOM 8879  H HA   . ILE A 1 42 ? -4.541  -4.792  8.961   1.00 0.00 ?  598  ILE A HA   6  
ATOM 8880  H HB   . ILE A 1 42 ? -2.752  -4.699  6.506   1.00 0.00 ?  598  ILE A HB   6  
ATOM 8881  H HG12 . ILE A 1 42 ? -1.238  -6.125  7.927   1.00 0.00 ?  598  ILE A HG12 6  
ATOM 8882  H HG13 . ILE A 1 42 ? -2.498  -6.152  9.146   1.00 0.00 ?  598  ILE A HG13 6  
ATOM 8883  H HG21 . ILE A 1 42 ? -0.909  -3.801  7.838   1.00 0.00 ?  598  ILE A HG21 6  
ATOM 8884  H HG22 . ILE A 1 42 ? -2.006  -3.590  9.203   1.00 0.00 ?  598  ILE A HG22 6  
ATOM 8885  H HG23 . ILE A 1 42 ? -2.258  -2.665  7.723   1.00 0.00 ?  598  ILE A HG23 6  
ATOM 8886  H HD11 . ILE A 1 42 ? -2.421  -8.172  7.791   1.00 0.00 ?  598  ILE A HD11 6  
ATOM 8887  H HD12 . ILE A 1 42 ? -2.761  -7.188  6.355   1.00 0.00 ?  598  ILE A HD12 6  
ATOM 8888  H HD13 . ILE A 1 42 ? -3.956  -7.316  7.641   1.00 0.00 ?  598  ILE A HD13 6  
ATOM 8889  N N    . ILE A 1 43 ? -4.815  -2.501  6.647   1.00 0.00 ?  599  ILE A N    6  
ATOM 8890  C CA   . ILE A 1 43 ? -5.074  -1.081  6.440   1.00 0.00 ?  599  ILE A CA   6  
ATOM 8891  C C    . ILE A 1 43 ? -6.487  -0.686  6.990   1.00 0.00 ?  599  ILE A C    6  
ATOM 8892  O O    . ILE A 1 43 ? -6.723  0.440   7.401   1.00 0.00 ?  599  ILE A O    6  
ATOM 8893  C CB   . ILE A 1 43 ? -4.952  -0.639  4.948   1.00 0.00 ?  599  ILE A CB   6  
ATOM 8894  C CG1  . ILE A 1 43 ? -3.855  -1.421  4.175   1.00 0.00 ?  599  ILE A CG1  6  
ATOM 8895  C CG2  . ILE A 1 43 ? -4.629  0.844   4.905   1.00 0.00 ?  599  ILE A CG2  6  
ATOM 8896  C CD1  . ILE A 1 43 ? -2.468  -1.417  4.785   1.00 0.00 ?  599  ILE A CD1  6  
ATOM 8897  H H    . ILE A 1 43 ? -4.690  -3.113  5.880   1.00 0.00 ?  599  ILE A H    6  
ATOM 8898  H HA   . ILE A 1 43 ? -4.320  -0.565  7.016   1.00 0.00 ?  599  ILE A HA   6  
ATOM 8899  H HB   . ILE A 1 43 ? -5.909  -0.788  4.472   1.00 0.00 ?  599  ILE A HB   6  
ATOM 8900  H HG12 . ILE A 1 43 ? -4.140  -2.461  4.108   1.00 0.00 ?  599  ILE A HG12 6  
ATOM 8901  H HG13 . ILE A 1 43 ? -3.780  -1.018  3.176   1.00 0.00 ?  599  ILE A HG13 6  
ATOM 8902  H HG21 . ILE A 1 43 ? -4.473  1.167   3.886   1.00 0.00 ?  599  ILE A HG21 6  
ATOM 8903  H HG22 . ILE A 1 43 ? -3.744  1.028   5.502   1.00 0.00 ?  599  ILE A HG22 6  
ATOM 8904  H HG23 . ILE A 1 43 ? -5.451  1.394   5.339   1.00 0.00 ?  599  ILE A HG23 6  
ATOM 8905  H HD11 . ILE A 1 43 ? -1.818  -1.981  4.130   1.00 0.00 ?  599  ILE A HD11 6  
ATOM 8906  H HD12 . ILE A 1 43 ? -2.534  -1.928  5.736   1.00 0.00 ?  599  ILE A HD12 6  
ATOM 8907  H HD13 . ILE A 1 43 ? -2.099  -0.409  4.913   1.00 0.00 ?  599  ILE A HD13 6  
ATOM 8908  N N    . GLN A 1 44 ? -7.384  -1.658  7.012   1.00 0.00 ?  600  GLN A N    6  
ATOM 8909  C CA   . GLN A 1 44 ? -8.783  -1.524  7.471   1.00 0.00 ?  600  GLN A CA   6  
ATOM 8910  C C    . GLN A 1 44 ? -8.849  -1.092  8.923   1.00 0.00 ?  600  GLN A C    6  
ATOM 8911  O O    . GLN A 1 44 ? -9.727  -0.346  9.329   1.00 0.00 ?  600  GLN A O    6  
ATOM 8912  C CB   . GLN A 1 44 ? -9.459  -2.881  7.325   1.00 0.00 ?  600  GLN A CB   6  
ATOM 8913  C CG   . GLN A 1 44 ? -10.952 -2.895  7.398   1.00 0.00 ?  600  GLN A CG   6  
ATOM 8914  C CD   . GLN A 1 44 ? -11.495 -4.236  6.993   1.00 0.00 ?  600  GLN A CD   6  
ATOM 8915  O OE1  . GLN A 1 44 ? -11.736 -5.113  7.821   1.00 0.00 ?  600  GLN A OE1  6  
ATOM 8916  N NE2  . GLN A 1 44 ? -11.583 -4.442  5.706   1.00 0.00 ?  600  GLN A NE2  6  
ATOM 8917  H H    . GLN A 1 44 ? -7.102  -2.532  6.681   1.00 0.00 ?  600  GLN A H    6  
ATOM 8918  H HA   . GLN A 1 44 ? -9.300  -0.810  6.851   1.00 0.00 ?  600  GLN A HA   6  
ATOM 8919  H HB2  . GLN A 1 44 ? -9.186  -3.292  6.364   1.00 0.00 ?  600  GLN A HB2  6  
ATOM 8920  H HB3  . GLN A 1 44 ? -9.074  -3.537  8.092   1.00 0.00 ?  600  GLN A HB3  6  
ATOM 8921  H HG2  . GLN A 1 44 ? -11.272 -2.670  8.404   1.00 0.00 ?  600  GLN A HG2  6  
ATOM 8922  H HG3  . GLN A 1 44 ? -11.330 -2.159  6.705   1.00 0.00 ?  600  GLN A HG3  6  
ATOM 8923  H HE21 . GLN A 1 44 ? -11.273 -3.717  5.125   1.00 0.00 ?  600  GLN A HE21 6  
ATOM 8924  H HE22 . GLN A 1 44 ? -11.962 -5.270  5.351   1.00 0.00 ?  600  GLN A HE22 6  
ATOM 8925  N N    . SER A 1 45 ? -7.909  -1.540  9.689   1.00 0.00 ?  601  SER A N    6  
ATOM 8926  C CA   . SER A 1 45 ? -7.881  -1.242  11.085  1.00 0.00 ?  601  SER A CA   6  
ATOM 8927  C C    . SER A 1 45 ? -7.338  0.186   11.320  1.00 0.00 ?  601  SER A C    6  
ATOM 8928  O O    . SER A 1 45 ? -7.430  0.730   12.421  1.00 0.00 ?  601  SER A O    6  
ATOM 8929  C CB   . SER A 1 45 ? -7.038  -2.298  11.805  1.00 0.00 ?  601  SER A CB   6  
ATOM 8930  O OG   . SER A 1 45 ? -7.138  -2.188  13.212  1.00 0.00 ?  601  SER A OG   6  
ATOM 8931  H H    . SER A 1 45 ? -7.209  -2.109  9.299   1.00 0.00 ?  601  SER A H    6  
ATOM 8932  H HA   . SER A 1 45 ? -8.894  -1.293  11.455  1.00 0.00 ?  601  SER A HA   6  
ATOM 8933  H HB2  . SER A 1 45 ? -7.372  -3.283  11.512  1.00 0.00 ?  601  SER A HB2  6  
ATOM 8934  H HB3  . SER A 1 45 ? -6.005  -2.172  11.517  1.00 0.00 ?  601  SER A HB3  6  
ATOM 8935  H HG   . SER A 1 45 ? -6.495  -2.818  13.563  1.00 0.00 ?  601  SER A HG   6  
ATOM 8936  N N    . ARG A 1 46 ? -6.812  0.792   10.270  1.00 0.00 ?  602  ARG A N    6  
ATOM 8937  C CA   . ARG A 1 46 ? -6.178  2.091   10.369  1.00 0.00 ?  602  ARG A CA   6  
ATOM 8938  C C    . ARG A 1 46 ? -7.186  3.224   10.288  1.00 0.00 ?  602  ARG A C    6  
ATOM 8939  O O    . ARG A 1 46 ? -7.071  4.198   11.033  1.00 0.00 ?  602  ARG A O    6  
ATOM 8940  C CB   . ARG A 1 46 ? -5.149  2.261   9.268   1.00 0.00 ?  602  ARG A CB   6  
ATOM 8941  C CG   . ARG A 1 46 ? -4.082  1.173   9.184   1.00 0.00 ?  602  ARG A CG   6  
ATOM 8942  C CD   . ARG A 1 46 ? -3.033  1.236   10.284  1.00 0.00 ?  602  ARG A CD   6  
ATOM 8943  N NE   . ARG A 1 46 ? -3.520  0.928   11.648  1.00 0.00 ?  602  ARG A NE   6  
ATOM 8944  C CZ   . ARG A 1 46 ? -2.770  0.345   12.614  1.00 0.00 ?  602  ARG A CZ   6  
ATOM 8945  N NH1  . ARG A 1 46 ? -1.559  -0.121  12.340  1.00 0.00 1  602  ARG A NH1  6  
ATOM 8946  N NH2  . ARG A 1 46 ? -3.256  0.210   13.839  1.00 0.00 ?  602  ARG A NH2  6  
ATOM 8947  H H    . ARG A 1 46 ? -6.883  0.362   9.389   1.00 0.00 ?  602  ARG A H    6  
ATOM 8948  H HA   . ARG A 1 46 ? -5.674  2.160   11.319  1.00 0.00 ?  602  ARG A HA   6  
ATOM 8949  H HB2  . ARG A 1 46 ? -5.686  2.253   8.332   1.00 0.00 ?  602  ARG A HB2  6  
ATOM 8950  H HB3  . ARG A 1 46 ? -4.661  3.217   9.388   1.00 0.00 ?  602  ARG A HB3  6  
ATOM 8951  H HG2  . ARG A 1 46 ? -4.572  0.212   9.244   1.00 0.00 ?  602  ARG A HG2  6  
ATOM 8952  H HG3  . ARG A 1 46 ? -3.595  1.261   8.224   1.00 0.00 ?  602  ARG A HG3  6  
ATOM 8953  H HD2  . ARG A 1 46 ? -2.268  0.527   10.009  1.00 0.00 ?  602  ARG A HD2  6  
ATOM 8954  H HD3  . ARG A 1 46 ? -2.613  2.229   10.254  1.00 0.00 ?  602  ARG A HD3  6  
ATOM 8955  H HE   . ARG A 1 46 ? -4.430  1.219   11.866  1.00 0.00 ?  602  ARG A HE   6  
ATOM 8956  H HH11 . ARG A 1 46 ? -1.160  -0.069  11.408  1.00 0.00 ?  602  ARG A HH11 6  
ATOM 8957  H HH12 . ARG A 1 46 ? -0.958  -0.544  13.021  1.00 0.00 ?  602  ARG A HH12 6  
ATOM 8958  H HH21 . ARG A 1 46 ? -4.175  0.525   14.089  1.00 0.00 ?  602  ARG A HH21 6  
ATOM 8959  H HH22 . ARG A 1 46 ? -2.723  -0.200  14.585  1.00 0.00 ?  602  ARG A HH22 6  
ATOM 8960  N N    . GLU A 1 47 ? -8.169  3.120   9.397   1.00 0.00 ?  603  GLU A N    6  
ATOM 8961  C CA   . GLU A 1 47 ? -9.110  4.226   9.249   1.00 0.00 ?  603  GLU A CA   6  
ATOM 8962  C C    . GLU A 1 47 ? -10.558 3.717   9.040   1.00 0.00 ?  603  GLU A C    6  
ATOM 8963  O O    . GLU A 1 47 ? -10.753 2.551   8.702   1.00 0.00 ?  603  GLU A O    6  
ATOM 8964  C CB   . GLU A 1 47 ? -8.606  5.229   8.165   1.00 0.00 ?  603  GLU A CB   6  
ATOM 8965  C CG   . GLU A 1 47 ? -8.697  4.789   6.717   1.00 0.00 ?  603  GLU A CG   6  
ATOM 8966  C CD   . GLU A 1 47 ? -10.094 4.922   6.188   1.00 0.00 ?  603  GLU A CD   6  
ATOM 8967  O OE1  . GLU A 1 47 ? -10.713 3.922   5.843   1.00 0.00 ?  603  GLU A OE1  6  
ATOM 8968  O OE2  . GLU A 1 47 ? -10.620 6.060   6.177   1.00 0.00 -1 603  GLU A OE2  6  
ATOM 8969  H H    . GLU A 1 47 ? -8.296  2.307   8.851   1.00 0.00 ?  603  GLU A H    6  
ATOM 8970  H HA   . GLU A 1 47 ? -9.104  4.721   10.208  1.00 0.00 ?  603  GLU A HA   6  
ATOM 8971  H HB2  . GLU A 1 47 ? -9.176  6.141   8.255   1.00 0.00 ?  603  GLU A HB2  6  
ATOM 8972  H HB3  . GLU A 1 47 ? -7.575  5.461   8.387   1.00 0.00 ?  603  GLU A HB3  6  
ATOM 8973  H HG2  . GLU A 1 47 ? -8.040  5.406   6.122   1.00 0.00 ?  603  GLU A HG2  6  
ATOM 8974  H HG3  . GLU A 1 47 ? -8.390  3.757   6.646   1.00 0.00 ?  603  GLU A HG3  6  
ATOM 8975  N N    . PRO A 1 48 ? -11.588 4.574   9.267   1.00 0.00 ?  604  PRO A N    6  
ATOM 8976  C CA   . PRO A 1 48 ? -12.991 4.162   9.237   1.00 0.00 ?  604  PRO A CA   6  
ATOM 8977  C C    . PRO A 1 48 ? -13.752 4.268   7.877   1.00 0.00 ?  604  PRO A C    6  
ATOM 8978  O O    . PRO A 1 48 ? -14.880 3.764   7.779   1.00 0.00 ?  604  PRO A O    6  
ATOM 8979  C CB   . PRO A 1 48 ? -13.612 5.104   10.255  1.00 0.00 ?  604  PRO A CB   6  
ATOM 8980  C CG   . PRO A 1 48 ? -12.851 6.379   10.101  1.00 0.00 ?  604  PRO A CG   6  
ATOM 8981  C CD   . PRO A 1 48 ? -11.469 6.008   9.624   1.00 0.00 ?  604  PRO A CD   6  
ATOM 8982  H HA   . PRO A 1 48 ? -13.105 3.159   9.616   1.00 0.00 ?  604  PRO A HA   6  
ATOM 8983  H HB2  . PRO A 1 48 ? -14.660 5.232   10.034  1.00 0.00 ?  604  PRO A HB2  6  
ATOM 8984  H HB3  . PRO A 1 48 ? -13.491 4.695   11.247  1.00 0.00 ?  604  PRO A HB3  6  
ATOM 8985  H HG2  . PRO A 1 48 ? -13.337 7.005   9.367   1.00 0.00 ?  604  PRO A HG2  6  
ATOM 8986  H HG3  . PRO A 1 48 ? -12.796 6.891   11.050  1.00 0.00 ?  604  PRO A HG3  6  
ATOM 8987  H HD2  . PRO A 1 48 ? -11.203 6.595   8.758   1.00 0.00 ?  604  PRO A HD2  6  
ATOM 8988  H HD3  . PRO A 1 48 ? -10.749 6.153   10.415  1.00 0.00 ?  604  PRO A HD3  6  
ATOM 8989  N N    . SER A 1 49 ? -13.193 4.896   6.855   1.00 0.00 ?  605  SER A N    6  
ATOM 8990  C CA   . SER A 1 49 ? -13.952 5.108   5.622   1.00 0.00 ?  605  SER A CA   6  
ATOM 8991  C C    . SER A 1 49 ? -14.070 3.821   4.801   1.00 0.00 ?  605  SER A C    6  
ATOM 8992  O O    . SER A 1 49 ? -15.159 3.488   4.321   1.00 0.00 ?  605  SER A O    6  
ATOM 8993  C CB   . SER A 1 49 ? -13.337 6.246   4.781   1.00 0.00 ?  605  SER A CB   6  
ATOM 8994  O OG   . SER A 1 49 ? -14.119 6.550   3.625   1.00 0.00 ?  605  SER A OG   6  
ATOM 8995  H H    . SER A 1 49 ? -12.248 5.180   6.879   1.00 0.00 ?  605  SER A H    6  
ATOM 8996  H HA   . SER A 1 49 ? -14.950 5.398   5.916   1.00 0.00 ?  605  SER A HA   6  
ATOM 8997  H HB2  . SER A 1 49 ? -13.269 7.136   5.389   1.00 0.00 ?  605  SER A HB2  6  
ATOM 8998  H HB3  . SER A 1 49 ? -12.344 5.959   4.466   1.00 0.00 ?  605  SER A HB3  6  
ATOM 8999  H HG   . SER A 1 49 ? -14.132 5.785   3.034   1.00 0.00 ?  605  SER A HG   6  
ATOM 9000  N N    . LEU A 1 50 ? -12.982 3.071   4.709   1.00 0.00 ?  606  LEU A N    6  
ATOM 9001  C CA   . LEU A 1 50 ? -12.930 1.819   3.938   1.00 0.00 ?  606  LEU A CA   6  
ATOM 9002  C C    . LEU A 1 50 ? -13.830 0.734   4.551   1.00 0.00 ?  606  LEU A C    6  
ATOM 9003  O O    . LEU A 1 50 ? -14.246 -0.234  3.892   1.00 0.00 ?  606  LEU A O    6  
ATOM 9004  C CB   . LEU A 1 50 ? -11.439 1.373   3.793   1.00 0.00 ?  606  LEU A CB   6  
ATOM 9005  C CG   . LEU A 1 50 ? -11.130 -0.084  3.377   1.00 0.00 ?  606  LEU A CG   6  
ATOM 9006  C CD1  . LEU A 1 50 ? -9.731  -0.171  2.804   1.00 0.00 ?  606  LEU A CD1  6  
ATOM 9007  C CD2  . LEU A 1 50 ? -11.177 -0.984  4.594   1.00 0.00 ?  606  LEU A CD2  6  
ATOM 9008  H H    . LEU A 1 50 ? -12.149 3.374   5.160   1.00 0.00 ?  606  LEU A H    6  
ATOM 9009  H HA   . LEU A 1 50 ? -13.314 2.055   2.958   1.00 0.00 ?  606  LEU A HA   6  
ATOM 9010  H HB2  . LEU A 1 50 ? -10.979 2.020   3.060   1.00 0.00 ?  606  LEU A HB2  6  
ATOM 9011  H HB3  . LEU A 1 50 ? -10.953 1.563   4.738   1.00 0.00 ?  606  LEU A HB3  6  
ATOM 9012  H HG   . LEU A 1 50 ? -11.844 -0.452  2.655   1.00 0.00 ?  606  LEU A HG   6  
ATOM 9013  H HD11 . LEU A 1 50 ? -9.025  0.175   3.542   1.00 0.00 ?  606  LEU A HD11 6  
ATOM 9014  H HD12 . LEU A 1 50 ? -9.657  0.429   1.910   1.00 0.00 ?  606  LEU A HD12 6  
ATOM 9015  H HD13 . LEU A 1 50 ? -9.522  -1.206  2.573   1.00 0.00 ?  606  LEU A HD13 6  
ATOM 9016  H HD21 . LEU A 1 50 ? -12.137 -0.903  5.085   1.00 0.00 ?  606  LEU A HD21 6  
ATOM 9017  H HD22 . LEU A 1 50 ? -10.418 -0.663  5.292   1.00 0.00 ?  606  LEU A HD22 6  
ATOM 9018  H HD23 . LEU A 1 50 ? -11.001 -2.010  4.306   1.00 0.00 ?  606  LEU A HD23 6  
ATOM 9019  N N    . ARG A 1 51 ? -14.168 0.932   5.787   1.00 0.00 ?  607  ARG A N    6  
ATOM 9020  C CA   . ARG A 1 51 ? -14.922 -0.033  6.556   1.00 0.00 ?  607  ARG A CA   6  
ATOM 9021  C C    . ARG A 1 51 ? -16.420 0.037   6.252   1.00 0.00 ?  607  ARG A C    6  
ATOM 9022  O O    . ARG A 1 51 ? -17.215 -0.744  6.778   1.00 0.00 ?  607  ARG A O    6  
ATOM 9023  C CB   . ARG A 1 51 ? -14.602 0.146   8.024   1.00 0.00 ?  607  ARG A CB   6  
ATOM 9024  C CG   . ARG A 1 51 ? -13.102 0.065   8.264   1.00 0.00 ?  607  ARG A CG   6  
ATOM 9025  C CD   . ARG A 1 51 ? -12.722 0.310   9.708   1.00 0.00 ?  607  ARG A CD   6  
ATOM 9026  N NE   . ARG A 1 51 ? -13.203 -0.729  10.613  1.00 0.00 ?  607  ARG A NE   6  
ATOM 9027  C CZ   . ARG A 1 51 ? -12.505 -1.230  11.628  1.00 0.00 ?  607  ARG A CZ   6  
ATOM 9028  N NH1  . ARG A 1 51 ? -11.216 -0.943  11.756  1.00 0.00 1  607  ARG A NH1  6  
ATOM 9029  N NH2  . ARG A 1 51 ? -13.085 -2.056  12.484  1.00 0.00 ?  607  ARG A NH2  6  
ATOM 9030  H H    . ARG A 1 51 ? -13.900 1.785   6.189   1.00 0.00 ?  607  ARG A H    6  
ATOM 9031  H HA   . ARG A 1 51 ? -14.572 -1.006  6.248   1.00 0.00 ?  607  ARG A HA   6  
ATOM 9032  H HB2  . ARG A 1 51 ? -14.965 1.108   8.355   1.00 0.00 ?  607  ARG A HB2  6  
ATOM 9033  H HB3  . ARG A 1 51 ? -15.081 -0.637  8.592   1.00 0.00 ?  607  ARG A HB3  6  
ATOM 9034  H HG2  . ARG A 1 51 ? -12.751 -0.908  7.949   1.00 0.00 ?  607  ARG A HG2  6  
ATOM 9035  H HG3  . ARG A 1 51 ? -12.621 0.800   7.634   1.00 0.00 ?  607  ARG A HG3  6  
ATOM 9036  H HD2  . ARG A 1 51 ? -11.647 0.369   9.776   1.00 0.00 ?  607  ARG A HD2  6  
ATOM 9037  H HD3  . ARG A 1 51 ? -13.147 1.253   10.014  1.00 0.00 ?  607  ARG A HD3  6  
ATOM 9038  H HE   . ARG A 1 51 ? -14.134 -1.008  10.463  1.00 0.00 ?  607  ARG A HE   6  
ATOM 9039  H HH11 . ARG A 1 51 ? -10.738 -0.361  11.091  1.00 0.00 ?  607  ARG A HH11 6  
ATOM 9040  H HH12 . ARG A 1 51 ? -10.677 -1.276  12.534  1.00 0.00 ?  607  ARG A HH12 6  
ATOM 9041  H HH21 . ARG A 1 51 ? -14.051 -2.320  12.395  1.00 0.00 ?  607  ARG A HH21 6  
ATOM 9042  H HH22 . ARG A 1 51 ? -12.584 -2.477  13.246  1.00 0.00 ?  607  ARG A HH22 6  
ATOM 9043  N N    . ASP A 1 52 ? -16.793 0.986   5.399   1.00 0.00 ?  608  ASP A N    6  
ATOM 9044  C CA   . ASP A 1 52 ? -18.176 1.130   4.946   1.00 0.00 ?  608  ASP A CA   6  
ATOM 9045  C C    . ASP A 1 52 ? -18.509 0.003   3.971   1.00 0.00 ?  608  ASP A C    6  
ATOM 9046  O O    . ASP A 1 52 ? -19.641 -0.476  3.912   1.00 0.00 ?  608  ASP A O    6  
ATOM 9047  C CB   . ASP A 1 52 ? -18.383 2.490   4.267   1.00 0.00 ?  608  ASP A CB   6  
ATOM 9048  C CG   . ASP A 1 52 ? -19.826 2.762   3.880   1.00 0.00 ?  608  ASP A CG   6  
ATOM 9049  O OD1  . ASP A 1 52 ? -20.242 2.435   2.747   1.00 0.00 ?  608  ASP A OD1  6  
ATOM 9050  O OD2  . ASP A 1 52 ? -20.558 3.358   4.693   1.00 0.00 -1 608  ASP A OD2  6  
ATOM 9051  H H    . ASP A 1 52 ? -16.112 1.605   5.056   1.00 0.00 ?  608  ASP A H    6  
ATOM 9052  H HA   . ASP A 1 52 ? -18.822 1.054   5.810   1.00 0.00 ?  608  ASP A HA   6  
ATOM 9053  H HB2  . ASP A 1 52 ? -18.066 3.271   4.943   1.00 0.00 ?  608  ASP A HB2  6  
ATOM 9054  H HB3  . ASP A 1 52 ? -17.777 2.530   3.375   1.00 0.00 ?  608  ASP A HB3  6  
ATOM 9055  N N    . SER A 1 53 ? -17.511 -0.423  3.219   1.00 0.00 ?  609  SER A N    6  
ATOM 9056  C CA   . SER A 1 53 ? -17.659 -1.525  2.288   1.00 0.00 ?  609  SER A CA   6  
ATOM 9057  C C    . SER A 1 53 ? -17.307 -2.850  2.989   1.00 0.00 ?  609  SER A C    6  
ATOM 9058  O O    . SER A 1 53 ? -16.945 -2.851  4.172   1.00 0.00 ?  609  SER A O    6  
ATOM 9059  C CB   . SER A 1 53 ? -16.771 -1.288  1.069   1.00 0.00 ?  609  SER A CB   6  
ATOM 9060  O OG   . SER A 1 53 ? -17.099 -0.041  0.451   1.00 0.00 ?  609  SER A OG   6  
ATOM 9061  H H    . SER A 1 53 ? -16.636 0.013   3.294   1.00 0.00 ?  609  SER A H    6  
ATOM 9062  H HA   . SER A 1 53 ? -18.693 -1.560  1.977   1.00 0.00 ?  609  SER A HA   6  
ATOM 9063  H HB2  . SER A 1 53 ? -15.736 -1.271  1.376   1.00 0.00 ?  609  SER A HB2  6  
ATOM 9064  H HB3  . SER A 1 53 ? -16.926 -2.082  0.352   1.00 0.00 ?  609  SER A HB3  6  
ATOM 9065  H HG   . SER A 1 53 ? -18.066 -0.012  0.402   1.00 0.00 ?  609  SER A HG   6  
ATOM 9066  N N    . ASN A 1 54 ? -17.405 -3.954  2.289   1.00 0.00 ?  610  ASN A N    6  
ATOM 9067  C CA   . ASN A 1 54 ? -17.170 -5.251  2.890   1.00 0.00 ?  610  ASN A CA   6  
ATOM 9068  C C    . ASN A 1 54 ? -15.729 -5.687  2.755   1.00 0.00 ?  610  ASN A C    6  
ATOM 9069  O O    . ASN A 1 54 ? -14.993 -5.165  1.925   1.00 0.00 ?  610  ASN A O    6  
ATOM 9070  C CB   . ASN A 1 54 ? -18.075 -6.332  2.275   1.00 0.00 ?  610  ASN A CB   6  
ATOM 9071  C CG   . ASN A 1 54 ? -19.517 -6.164  2.625   1.00 0.00 ?  610  ASN A CG   6  
ATOM 9072  O OD1  . ASN A 1 54 ? -20.278 -5.537  1.887   1.00 0.00 ?  610  ASN A OD1  6  
ATOM 9073  N ND2  . ASN A 1 54 ? -19.908 -6.705  3.751   1.00 0.00 ?  610  ASN A ND2  6  
ATOM 9074  H H    . ASN A 1 54 ? -17.583 -3.937  1.317   1.00 0.00 ?  610  ASN A H    6  
ATOM 9075  H HA   . ASN A 1 54 ? -17.412 -5.178  3.940   1.00 0.00 ?  610  ASN A HA   6  
ATOM 9076  H HB2  . ASN A 1 54 ? -17.985 -6.266  1.202   1.00 0.00 ?  610  ASN A HB2  6  
ATOM 9077  H HB3  . ASN A 1 54 ? -17.749 -7.312  2.588   1.00 0.00 ?  610  ASN A HB3  6  
ATOM 9078  H HD21 . ASN A 1 54 ? -19.268 -7.189  4.317   1.00 0.00 ?  610  ASN A HD21 6  
ATOM 9079  H HD22 . ASN A 1 54 ? -20.845 -6.612  4.008   1.00 0.00 ?  610  ASN A HD22 6  
ATOM 9080  N N    . PRO A 1 55 ? -15.307 -6.699  3.563   1.00 0.00 ?  611  PRO A N    6  
ATOM 9081  C CA   . PRO A 1 55 ? -13.972 -7.353  3.445   1.00 0.00 ?  611  PRO A CA   6  
ATOM 9082  C C    . PRO A 1 55 ? -13.811 -8.082  2.095   1.00 0.00 ?  611  PRO A C    6  
ATOM 9083  O O    . PRO A 1 55 ? -12.740 -8.618  1.768   1.00 0.00 ?  611  PRO A O    6  
ATOM 9084  C CB   . PRO A 1 55 ? -14.008 -8.397  4.575   1.00 0.00 ?  611  PRO A CB   6  
ATOM 9085  C CG   . PRO A 1 55 ? -15.462 -8.589  4.866   1.00 0.00 ?  611  PRO A CG   6  
ATOM 9086  C CD   . PRO A 1 55 ? -16.054 -7.244  4.717   1.00 0.00 ?  611  PRO A CD   6  
ATOM 9087  H HA   . PRO A 1 55 ? -13.159 -6.661  3.599   1.00 0.00 ?  611  PRO A HA   6  
ATOM 9088  H HB2  . PRO A 1 55 ? -13.549 -9.312  4.227   1.00 0.00 ?  611  PRO A HB2  6  
ATOM 9089  H HB3  . PRO A 1 55 ? -13.479 -8.024  5.439   1.00 0.00 ?  611  PRO A HB3  6  
ATOM 9090  H HG2  . PRO A 1 55 ? -15.921 -9.251  4.145   1.00 0.00 ?  611  PRO A HG2  6  
ATOM 9091  H HG3  . PRO A 1 55 ? -15.619 -8.953  5.870   1.00 0.00 ?  611  PRO A HG3  6  
ATOM 9092  H HD2  . PRO A 1 55 ? -17.113 -7.310  4.519   1.00 0.00 ?  611  PRO A HD2  6  
ATOM 9093  H HD3  . PRO A 1 55 ? -15.869 -6.652  5.603   1.00 0.00 ?  611  PRO A HD3  6  
ATOM 9094  N N    . ASP A 1 56 ? -14.891 -8.101  1.340   1.00 0.00 ?  612  ASP A N    6  
ATOM 9095  C CA   . ASP A 1 56 ? -14.956 -8.733  0.044   1.00 0.00 ?  612  ASP A CA   6  
ATOM 9096  C C    . ASP A 1 56 ? -14.470 -7.752  -1.026  1.00 0.00 ?  612  ASP A C    6  
ATOM 9097  O O    . ASP A 1 56 ? -14.189 -8.132  -2.157  1.00 0.00 ?  612  ASP A O    6  
ATOM 9098  C CB   . ASP A 1 56 ? -16.395 -9.183  -0.226  1.00 0.00 ?  612  ASP A CB   6  
ATOM 9099  C CG   . ASP A 1 56 ? -16.544 -10.039 -1.460  1.00 0.00 ?  612  ASP A CG   6  
ATOM 9100  O OD1  . ASP A 1 56 ? -15.929 -11.118 -1.519  1.00 0.00 ?  612  ASP A OD1  6  
ATOM 9101  O OD2  . ASP A 1 56 ? -17.346 -9.702  -2.349  1.00 0.00 -1 612  ASP A OD2  6  
ATOM 9102  H H    . ASP A 1 56 ? -15.686 -7.650  1.690   1.00 0.00 ?  612  ASP A H    6  
ATOM 9103  H HA   . ASP A 1 56 ? -14.308 -9.597  0.062   1.00 0.00 ?  612  ASP A HA   6  
ATOM 9104  H HB2  . ASP A 1 56 ? -16.746 -9.757  0.620   1.00 0.00 ?  612  ASP A HB2  6  
ATOM 9105  H HB3  . ASP A 1 56 ? -17.017 -8.306  -0.337  1.00 0.00 ?  612  ASP A HB3  6  
ATOM 9106  N N    . GLU A 1 57 ? -14.354 -6.486  -0.643  1.00 0.00 ?  613  GLU A N    6  
ATOM 9107  C CA   . GLU A 1 57 ? -13.817 -5.461  -1.515  1.00 0.00 ?  613  GLU A CA   6  
ATOM 9108  C C    . GLU A 1 57 ? -12.338 -5.255  -1.220  1.00 0.00 ?  613  GLU A C    6  
ATOM 9109  O O    . GLU A 1 57 ? -11.817 -5.735  -0.201  1.00 0.00 ?  613  GLU A O    6  
ATOM 9110  C CB   . GLU A 1 57 ? -14.544 -4.101  -1.358  1.00 0.00 ?  613  GLU A CB   6  
ATOM 9111  C CG   . GLU A 1 57 ? -15.917 -3.975  -2.020  1.00 0.00 ?  613  GLU A CG   6  
ATOM 9112  C CD   . GLU A 1 57 ? -16.974 -4.867  -1.438  1.00 0.00 ?  613  GLU A CD   6  
ATOM 9113  O OE1  . GLU A 1 57 ? -17.302 -5.898  -2.061  1.00 0.00 ?  613  GLU A OE1  6  
ATOM 9114  O OE2  . GLU A 1 57 ? -17.538 -4.536  -0.380  1.00 0.00 -1 613  GLU A OE2  6  
ATOM 9115  H H    . GLU A 1 57 ? -14.612 -6.218  0.264   1.00 0.00 ?  613  GLU A H    6  
ATOM 9116  H HA   . GLU A 1 57 ? -13.927 -5.802  -2.534  1.00 0.00 ?  613  GLU A HA   6  
ATOM 9117  H HB2  . GLU A 1 57 ? -14.675 -3.909  -0.303  1.00 0.00 ?  613  GLU A HB2  6  
ATOM 9118  H HB3  . GLU A 1 57 ? -13.905 -3.330  -1.764  1.00 0.00 ?  613  GLU A HB3  6  
ATOM 9119  H HG2  . GLU A 1 57 ? -16.254 -2.954  -1.925  1.00 0.00 ?  613  GLU A HG2  6  
ATOM 9120  H HG3  . GLU A 1 57 ? -15.810 -4.208  -3.070  1.00 0.00 ?  613  GLU A HG3  6  
ATOM 9121  N N    . ILE A 1 58 ? -11.670 -4.588  -2.124  1.00 0.00 ?  614  ILE A N    6  
ATOM 9122  C CA   . ILE A 1 58 ? -10.298 -4.198  -1.958  1.00 0.00 ?  614  ILE A CA   6  
ATOM 9123  C C    . ILE A 1 58 ? -10.012 -2.939  -2.717  1.00 0.00 ?  614  ILE A C    6  
ATOM 9124  O O    . ILE A 1 58 ? -9.937  -2.946  -3.947  1.00 0.00 ?  614  ILE A O    6  
ATOM 9125  C CB   . ILE A 1 58 ? -9.252  -5.297  -2.373  1.00 0.00 ?  614  ILE A CB   6  
ATOM 9126  C CG1  . ILE A 1 58 ? -7.834  -4.651  -2.491  1.00 0.00 ?  614  ILE A CG1  6  
ATOM 9127  C CG2  . ILE A 1 58 ? -9.663  -5.965  -3.695  1.00 0.00 ?  614  ILE A CG2  6  
ATOM 9128  C CD1  . ILE A 1 58 ? -6.683  -5.600  -2.515  1.00 0.00 ?  614  ILE A CD1  6  
ATOM 9129  H H    . ILE A 1 58 ? -12.119 -4.323  -2.954  1.00 0.00 ?  614  ILE A H    6  
ATOM 9130  H HA   . ILE A 1 58 ? -10.150 -3.980  -0.910  1.00 0.00 ?  614  ILE A HA   6  
ATOM 9131  H HB   . ILE A 1 58 ? -9.227  -6.056  -1.605  1.00 0.00 ?  614  ILE A HB   6  
ATOM 9132  H HG12 . ILE A 1 58 ? -7.819  -4.173  -3.460  1.00 0.00 ?  614  ILE A HG12 6  
ATOM 9133  H HG13 . ILE A 1 58 ? -7.644  -3.871  -1.769  1.00 0.00 ?  614  ILE A HG13 6  
ATOM 9134  H HG21 . ILE A 1 58 ? -10.632 -6.425  -3.581  1.00 0.00 ?  614  ILE A HG21 6  
ATOM 9135  H HG22 . ILE A 1 58 ? -8.935  -6.714  -3.969  1.00 0.00 ?  614  ILE A HG22 6  
ATOM 9136  H HG23 . ILE A 1 58 ? -9.714  -5.208  -4.468  1.00 0.00 ?  614  ILE A HG23 6  
ATOM 9137  H HD11 . ILE A 1 58 ? -5.762  -5.039  -2.536  1.00 0.00 ?  614  ILE A HD11 6  
ATOM 9138  H HD12 . ILE A 1 58 ? -6.715  -6.244  -3.383  1.00 0.00 ?  614  ILE A HD12 6  
ATOM 9139  H HD13 . ILE A 1 58 ? -6.703  -6.198  -1.615  1.00 0.00 ?  614  ILE A HD13 6  
ATOM 9140  N N    . GLU A 1 59 ? -9.931  -1.860  -2.029  1.00 0.00 ?  615  GLU A N    6  
ATOM 9141  C CA   . GLU A 1 59 ? -9.448  -0.688  -2.593  1.00 0.00 ?  615  GLU A CA   6  
ATOM 9142  C C    . GLU A 1 59 ? -8.593  0.163   -1.716  1.00 0.00 ?  615  GLU A C    6  
ATOM 9143  O O    . GLU A 1 59 ? -8.824  0.334   -0.539  1.00 0.00 ?  615  GLU A O    6  
ATOM 9144  C CB   . GLU A 1 59 ? -10.389 0.062   -3.529  1.00 0.00 ?  615  GLU A CB   6  
ATOM 9145  C CG   . GLU A 1 59 ? -11.823 0.145   -3.202  1.00 0.00 ?  615  GLU A CG   6  
ATOM 9146  C CD   . GLU A 1 59 ? -12.201 0.337   -1.776  1.00 0.00 ?  615  GLU A CD   6  
ATOM 9147  O OE1  . GLU A 1 59 ? -12.254 -0.637  -1.036  1.00 0.00 ?  615  GLU A OE1  6  
ATOM 9148  O OE2  . GLU A 1 59 ? -12.526 1.482   -1.400  1.00 0.00 -1 615  GLU A OE2  6  
ATOM 9149  H H    . GLU A 1 59 ? -10.282 -1.792  -1.116  1.00 0.00 ?  615  GLU A H    6  
ATOM 9150  H HA   . GLU A 1 59 ? -8.705  -1.134  -3.235  1.00 0.00 ?  615  GLU A HA   6  
ATOM 9151  H HB2  . GLU A 1 59 ? -10.102 1.019   -3.930  1.00 0.00 ?  615  GLU A HB2  6  
ATOM 9152  H HB3  . GLU A 1 59 ? -10.406 -0.630  -4.359  1.00 0.00 ?  615  GLU A HB3  6  
ATOM 9153  H HG2  . GLU A 1 59 ? -12.038 1.078   -3.705  1.00 0.00 ?  615  GLU A HG2  6  
ATOM 9154  H HG3  . GLU A 1 59 ? -12.277 -0.669  -3.745  1.00 0.00 ?  615  GLU A HG3  6  
ATOM 9155  N N    . ILE A 1 60 ? -7.559  0.629   -2.331  1.00 0.00 ?  616  ILE A N    6  
ATOM 9156  C CA   . ILE A 1 60 ? -6.598  1.498   -1.741  1.00 0.00 ?  616  ILE A CA   6  
ATOM 9157  C C    . ILE A 1 60 ? -7.009  2.897   -2.168  1.00 0.00 ?  616  ILE A C    6  
ATOM 9158  O O    . ILE A 1 60 ? -6.884  3.234   -3.291  1.00 0.00 ?  616  ILE A O    6  
ATOM 9159  C CB   . ILE A 1 60 ? -5.105  1.146   -2.207  1.00 0.00 ?  616  ILE A CB   6  
ATOM 9160  C CG1  . ILE A 1 60 ? -4.439  0.014   -1.364  1.00 0.00 ?  616  ILE A CG1  6  
ATOM 9161  C CG2  . ILE A 1 60 ? -4.200  2.350   -2.198  1.00 0.00 ?  616  ILE A CG2  6  
ATOM 9162  C CD1  . ILE A 1 60 ? -4.922  -1.392  -1.598  1.00 0.00 ?  616  ILE A CD1  6  
ATOM 9163  H H    . ILE A 1 60 ? -7.491  0.401   -3.279  1.00 0.00 ?  616  ILE A H    6  
ATOM 9164  H HA   . ILE A 1 60 ? -6.682  1.412   -0.667  1.00 0.00 ?  616  ILE A HA   6  
ATOM 9165  H HB   . ILE A 1 60 ? -5.190  0.800   -3.231  1.00 0.00 ?  616  ILE A HB   6  
ATOM 9166  H HG12 . ILE A 1 60 ? -3.380  0.013   -1.569  1.00 0.00 ?  616  ILE A HG12 6  
ATOM 9167  H HG13 . ILE A 1 60 ? -4.582  0.247   -0.319  1.00 0.00 ?  616  ILE A HG13 6  
ATOM 9168  H HG21 . ILE A 1 60 ? -4.665  3.118   -2.798  1.00 0.00 ?  616  ILE A HG21 6  
ATOM 9169  H HG22 . ILE A 1 60 ? -3.239  2.089   -2.617  1.00 0.00 ?  616  ILE A HG22 6  
ATOM 9170  H HG23 . ILE A 1 60 ? -4.077  2.707   -1.186  1.00 0.00 ?  616  ILE A HG23 6  
ATOM 9171  H HD11 . ILE A 1 60 ? -5.974  -1.466  -1.364  1.00 0.00 ?  616  ILE A HD11 6  
ATOM 9172  H HD12 . ILE A 1 60 ? -4.363  -2.092  -0.993  1.00 0.00 ?  616  ILE A HD12 6  
ATOM 9173  H HD13 . ILE A 1 60 ? -4.786  -1.650  -2.648  1.00 0.00 ?  616  ILE A HD13 6  
ATOM 9174  N N    . ASP A 1 61 ? -7.606  3.607   -1.267  1.00 0.00 ?  617  ASP A N    6  
ATOM 9175  C CA   . ASP A 1 61 ? -8.176  4.968   -1.453  1.00 0.00 ?  617  ASP A CA   6  
ATOM 9176  C C    . ASP A 1 61 ? -7.204  6.165   -1.616  1.00 0.00 ?  617  ASP A C    6  
ATOM 9177  O O    . ASP A 1 61 ? -7.621  7.268   -1.937  1.00 0.00 ?  617  ASP A O    6  
ATOM 9178  C CB   . ASP A 1 61 ? -9.480  5.205   -0.650  1.00 0.00 ?  617  ASP A CB   6  
ATOM 9179  C CG   . ASP A 1 61 ? -9.992  6.645   -0.578  1.00 0.00 ?  617  ASP A CG   6  
ATOM 9180  O OD1  . ASP A 1 61 ? -10.728 7.072   -1.486  1.00 0.00 ?  617  ASP A OD1  6  
ATOM 9181  O OD2  . ASP A 1 61 ? -9.671  7.360   0.367   1.00 0.00 -1 617  ASP A OD2  6  
ATOM 9182  H H    . ASP A 1 61 ? -7.712  3.202   -0.380  1.00 0.00 ?  617  ASP A H    6  
ATOM 9183  H HA   . ASP A 1 61 ? -8.476  4.859   -2.485  1.00 0.00 ?  617  ASP A HA   6  
ATOM 9184  H HB2  . ASP A 1 61 ? -10.194 4.710   -1.298  1.00 0.00 ?  617  ASP A HB2  6  
ATOM 9185  H HB3  . ASP A 1 61 ? -9.446  4.743   0.326   1.00 0.00 ?  617  ASP A HB3  6  
ATOM 9186  N N    . PHE A 1 62 ? -5.906  5.879   -1.526  1.00 0.00 ?  618  PHE A N    6  
ATOM 9187  C CA   . PHE A 1 62 ? -4.748  6.817   -1.262  1.00 0.00 ?  618  PHE A CA   6  
ATOM 9188  C C    . PHE A 1 62 ? -4.645  8.131   -2.068  1.00 0.00 ?  618  PHE A C    6  
ATOM 9189  O O    . PHE A 1 62 ? -3.695  8.875   -1.861  1.00 0.00 ?  618  PHE A O    6  
ATOM 9190  C CB   . PHE A 1 62 ? -3.508  6.042   -1.629  1.00 0.00 ?  618  PHE A CB   6  
ATOM 9191  C CG   . PHE A 1 62 ? -2.941  5.129   -0.592  1.00 0.00 ?  618  PHE A CG   6  
ATOM 9192  C CD1  . PHE A 1 62 ? -3.733  4.630   0.427   1.00 0.00 ?  618  PHE A CD1  6  
ATOM 9193  C CD2  . PHE A 1 62 ? -1.624  4.736   -0.656  1.00 0.00 ?  618  PHE A CD2  6  
ATOM 9194  C CE1  . PHE A 1 62 ? -3.220  3.762   1.360   1.00 0.00 ?  618  PHE A CE1  6  
ATOM 9195  C CE2  . PHE A 1 62 ? -1.112  3.873   0.278   1.00 0.00 ?  618  PHE A CE2  6  
ATOM 9196  C CZ   . PHE A 1 62 ? -1.913  3.386   1.285   1.00 0.00 ?  618  PHE A CZ   6  
ATOM 9197  H H    . PHE A 1 62 ? -5.684  4.935   -1.662  1.00 0.00 ?  618  PHE A H    6  
ATOM 9198  H HA   . PHE A 1 62 ? -4.654  7.007   -0.207  1.00 0.00 ?  618  PHE A HA   6  
ATOM 9199  H HB2  . PHE A 1 62 ? -3.911  5.371   -2.377  1.00 0.00 ?  618  PHE A HB2  6  
ATOM 9200  H HB3  . PHE A 1 62 ? -2.773  6.627   -2.163  1.00 0.00 ?  618  PHE A HB3  6  
ATOM 9201  H HD1  . PHE A 1 62 ? -4.769  4.928   0.480   1.00 0.00 ?  618  PHE A HD1  6  
ATOM 9202  H HD2  . PHE A 1 62 ? -0.988  5.109   -1.446  1.00 0.00 ?  618  PHE A HD2  6  
ATOM 9203  H HE1  . PHE A 1 62 ? -3.845  3.374   2.150   1.00 0.00 ?  618  PHE A HE1  6  
ATOM 9204  H HE2  . PHE A 1 62 ? -0.077  3.570   0.222   1.00 0.00 ?  618  PHE A HE2  6  
ATOM 9205  H HZ   . PHE A 1 62 ? -1.512  2.704   2.019   1.00 0.00 ?  618  PHE A HZ   6  
ATOM 9206  N N    . GLU A 1 63 ? -5.541  8.412   -2.941  1.00 0.00 ?  619  GLU A N    6  
ATOM 9207  C CA   . GLU A 1 63 ? -5.628  9.749   -3.487  1.00 0.00 ?  619  GLU A CA   6  
ATOM 9208  C C    . GLU A 1 63 ? -6.197  10.648  -2.378  1.00 0.00 ?  619  GLU A C    6  
ATOM 9209  O O    . GLU A 1 63 ? -5.708  11.746  -2.101  1.00 0.00 ?  619  GLU A O    6  
ATOM 9210  C CB   . GLU A 1 63 ? -6.636  9.811   -4.594  1.00 0.00 ?  619  GLU A CB   6  
ATOM 9211  C CG   . GLU A 1 63 ? -6.341  9.129   -5.892  1.00 0.00 ?  619  GLU A CG   6  
ATOM 9212  C CD   . GLU A 1 63 ? -7.585  9.229   -6.733  1.00 0.00 ?  619  GLU A CD   6  
ATOM 9213  O OE1  . GLU A 1 63 ? -7.783  10.252  -7.428  1.00 0.00 ?  619  GLU A OE1  6  
ATOM 9214  O OE2  . GLU A 1 63 ? -8.421  8.329   -6.652  1.00 0.00 -1 619  GLU A OE2  6  
ATOM 9215  H H    . GLU A 1 63 ? -6.171  7.709   -3.207  1.00 0.00 ?  619  GLU A H    6  
ATOM 9216  H HA   . GLU A 1 63 ? -4.661  10.093  -3.827  1.00 0.00 ?  619  GLU A HA   6  
ATOM 9217  H HB2  . GLU A 1 63 ? -7.539  9.350   -4.220  1.00 0.00 ?  619  GLU A HB2  6  
ATOM 9218  H HB3  . GLU A 1 63 ? -6.841  10.852  -4.792  1.00 0.00 ?  619  GLU A HB3  6  
ATOM 9219  H HG2  . GLU A 1 63 ? -5.482  9.578   -6.369  1.00 0.00 ?  619  GLU A HG2  6  
ATOM 9220  H HG3  . GLU A 1 63 ? -6.089  8.085   -5.792  1.00 0.00 ?  619  GLU A HG3  6  
ATOM 9221  N N    . THR A 1 64 ? -7.249  10.137  -1.774  1.00 0.00 ?  620  THR A N    6  
ATOM 9222  C CA   . THR A 1 64 ? -8.036  10.812  -0.777  1.00 0.00 ?  620  THR A CA   6  
ATOM 9223  C C    . THR A 1 64 ? -7.757  10.314  0.641   1.00 0.00 ?  620  THR A C    6  
ATOM 9224  O O    . THR A 1 64 ? -7.993  11.033  1.624   1.00 0.00 ?  620  THR A O    6  
ATOM 9225  C CB   . THR A 1 64 ? -9.509  10.550  -1.105  1.00 0.00 ?  620  THR A CB   6  
ATOM 9226  O OG1  . THR A 1 64 ? -9.599  9.428   -2.034  1.00 0.00 ?  620  THR A OG1  6  
ATOM 9227  C CG2  . THR A 1 64 ? -10.174 11.775  -1.699  1.00 0.00 ?  620  THR A CG2  6  
ATOM 9228  H H    . THR A 1 64 ? -7.565  9.239   -2.015  1.00 0.00 ?  620  THR A H    6  
ATOM 9229  H HA   . THR A 1 64 ? -7.879  11.877  -0.840  1.00 0.00 ?  620  THR A HA   6  
ATOM 9230  H HB   . THR A 1 64 ? -9.987  10.272  -0.180  1.00 0.00 ?  620  THR A HB   6  
ATOM 9231  H HG1  . THR A 1 64 ? -9.968  8.668   -1.545  1.00 0.00 ?  620  THR A HG1  6  
ATOM 9232  H HG21 . THR A 1 64 ? -11.202 11.547  -1.940  1.00 0.00 ?  620  THR A HG21 6  
ATOM 9233  H HG22 . THR A 1 64 ? -9.652  12.075  -2.595  1.00 0.00 ?  620  THR A HG22 6  
ATOM 9234  H HG23 . THR A 1 64 ? -10.146 12.575  -0.976  1.00 0.00 ?  620  THR A HG23 6  
ATOM 9235  N N    . LEU A 1 65 ? -7.278  9.094   0.733   1.00 0.00 ?  621  LEU A N    6  
ATOM 9236  C CA   . LEU A 1 65 ? -7.054  8.428   2.009   1.00 0.00 ?  621  LEU A CA   6  
ATOM 9237  C C    . LEU A 1 65 ? -6.030  9.168   2.893   1.00 0.00 ?  621  LEU A C    6  
ATOM 9238  O O    . LEU A 1 65 ? -5.259  10.022  2.423   1.00 0.00 ?  621  LEU A O    6  
ATOM 9239  C CB   . LEU A 1 65 ? -6.663  6.959   1.788   1.00 0.00 ?  621  LEU A CB   6  
ATOM 9240  C CG   . LEU A 1 65 ? -6.935  5.986   2.946   1.00 0.00 ?  621  LEU A CG   6  
ATOM 9241  C CD1  . LEU A 1 65 ? -8.411  5.962   3.286   1.00 0.00 ?  621  LEU A CD1  6  
ATOM 9242  C CD2  . LEU A 1 65 ? -6.475  4.593   2.588   1.00 0.00 ?  621  LEU A CD2  6  
ATOM 9243  H H    . LEU A 1 65 ? -7.130  8.615   -0.107  1.00 0.00 ?  621  LEU A H    6  
ATOM 9244  H HA   . LEU A 1 65 ? -7.999  8.452   2.531   1.00 0.00 ?  621  LEU A HA   6  
ATOM 9245  H HB2  . LEU A 1 65 ? -7.182  6.596   0.914   1.00 0.00 ?  621  LEU A HB2  6  
ATOM 9246  H HB3  . LEU A 1 65 ? -5.604  6.934   1.584   1.00 0.00 ?  621  LEU A HB3  6  
ATOM 9247  H HG   . LEU A 1 65 ? -6.388  6.313   3.818   1.00 0.00 ?  621  LEU A HG   6  
ATOM 9248  H HD11 . LEU A 1 65 ? -8.717  6.920   3.680   1.00 0.00 ?  621  LEU A HD11 6  
ATOM 9249  H HD12 . LEU A 1 65 ? -8.601  5.190   4.017   1.00 0.00 ?  621  LEU A HD12 6  
ATOM 9250  H HD13 . LEU A 1 65 ? -8.977  5.746   2.392   1.00 0.00 ?  621  LEU A HD13 6  
ATOM 9251  H HD21 . LEU A 1 65 ? -6.967  4.261   1.685   1.00 0.00 ?  621  LEU A HD21 6  
ATOM 9252  H HD22 . LEU A 1 65 ? -6.717  3.920   3.397   1.00 0.00 ?  621  LEU A HD22 6  
ATOM 9253  H HD23 . LEU A 1 65 ? -5.407  4.603   2.438   1.00 0.00 ?  621  LEU A HD23 6  
ATOM 9254  N N    . LYS A 1 66 ? -6.033  8.822   4.155   1.00 0.00 ?  622  LYS A N    6  
ATOM 9255  C CA   . LYS A 1 66 ? -5.247  9.487   5.178   1.00 0.00 ?  622  LYS A CA   6  
ATOM 9256  C C    . LYS A 1 66 ? -3.762  9.119   5.082   1.00 0.00 ?  622  LYS A C    6  
ATOM 9257  O O    . LYS A 1 66 ? -3.428  7.955   4.890   1.00 0.00 ?  622  LYS A O    6  
ATOM 9258  C CB   . LYS A 1 66 ? -5.792  9.151   6.590   1.00 0.00 ?  622  LYS A CB   6  
ATOM 9259  C CG   . LYS A 1 66 ? -7.236  9.623   6.886   1.00 0.00 ?  622  LYS A CG   6  
ATOM 9260  C CD   . LYS A 1 66 ? -8.299  8.843   6.108   1.00 0.00 ?  622  LYS A CD   6  
ATOM 9261  C CE   . LYS A 1 66 ? -9.698  9.347   6.400   1.00 0.00 ?  622  LYS A CE   6  
ATOM 9262  N NZ   . LYS A 1 66 ? -10.718 8.629   5.611   1.00 0.00 1  622  LYS A NZ   6  
ATOM 9263  H H    . LYS A 1 66 ? -6.585  8.056   4.416   1.00 0.00 ?  622  LYS A H    6  
ATOM 9264  H HA   . LYS A 1 66 ? -5.360  10.549  5.018   1.00 0.00 ?  622  LYS A HA   6  
ATOM 9265  H HB2  . LYS A 1 66 ? -5.765  8.078   6.717   1.00 0.00 ?  622  LYS A HB2  6  
ATOM 9266  H HB3  . LYS A 1 66 ? -5.134  9.594   7.321   1.00 0.00 ?  622  LYS A HB3  6  
ATOM 9267  H HG2  . LYS A 1 66 ? -7.425  9.508   7.942   1.00 0.00 ?  622  LYS A HG2  6  
ATOM 9268  H HG3  . LYS A 1 66 ? -7.315  10.668  6.630   1.00 0.00 ?  622  LYS A HG3  6  
ATOM 9269  H HD2  . LYS A 1 66 ? -8.107  8.953   5.052   1.00 0.00 ?  622  LYS A HD2  6  
ATOM 9270  H HD3  . LYS A 1 66 ? -8.234  7.800   6.379   1.00 0.00 ?  622  LYS A HD3  6  
ATOM 9271  H HE2  . LYS A 1 66 ? -9.910  9.198   7.449   1.00 0.00 ?  622  LYS A HE2  6  
ATOM 9272  H HE3  . LYS A 1 66 ? -9.749  10.400  6.165   1.00 0.00 ?  622  LYS A HE3  6  
ATOM 9273  H HZ1  . LYS A 1 66 ? -11.662 9.002   5.837   1.00 0.00 ?  622  LYS A HZ1  6  
ATOM 9274  H HZ2  . LYS A 1 66 ? -10.705 7.602   5.818   1.00 0.00 ?  622  LYS A HZ2  6  
ATOM 9275  H HZ3  . LYS A 1 66 ? -10.562 8.750   4.590   1.00 0.00 ?  622  LYS A HZ3  6  
ATOM 9276  N N    . PRO A 1 67 ? -2.853  10.115  5.213   1.00 0.00 ?  623  PRO A N    6  
ATOM 9277  C CA   . PRO A 1 67 ? -1.387  9.904   5.143   1.00 0.00 ?  623  PRO A CA   6  
ATOM 9278  C C    . PRO A 1 67 ? -0.860  8.868   6.160   1.00 0.00 ?  623  PRO A C    6  
ATOM 9279  O O    . PRO A 1 67 ? 0.057   8.103   5.855   1.00 0.00 ?  623  PRO A O    6  
ATOM 9280  C CB   . PRO A 1 67 ? -0.812  11.285  5.453   1.00 0.00 ?  623  PRO A CB   6  
ATOM 9281  C CG   . PRO A 1 67 ? -1.885  12.228  5.051   1.00 0.00 ?  623  PRO A CG   6  
ATOM 9282  C CD   . PRO A 1 67 ? -3.174  11.547  5.397   1.00 0.00 ?  623  PRO A CD   6  
ATOM 9283  H HA   . PRO A 1 67 ? -1.089  9.603   4.150   1.00 0.00 ?  623  PRO A HA   6  
ATOM 9284  H HB2  . PRO A 1 67 ? -0.595  11.350  6.509   1.00 0.00 ?  623  PRO A HB2  6  
ATOM 9285  H HB3  . PRO A 1 67 ? 0.089   11.445  4.881   1.00 0.00 ?  623  PRO A HB3  6  
ATOM 9286  H HG2  . PRO A 1 67 ? -1.791  13.159  5.591   1.00 0.00 ?  623  PRO A HG2  6  
ATOM 9287  H HG3  . PRO A 1 67 ? -1.835  12.406  3.988   1.00 0.00 ?  623  PRO A HG3  6  
ATOM 9288  H HD2  . PRO A 1 67 ? -3.464  11.759  6.415   1.00 0.00 ?  623  PRO A HD2  6  
ATOM 9289  H HD3  . PRO A 1 67 ? -3.936  11.862  4.703   1.00 0.00 ?  623  PRO A HD3  6  
ATOM 9290  N N    . THR A 1 68 ? -1.451  8.829   7.337   1.00 0.00 ?  624  THR A N    6  
ATOM 9291  C CA   . THR A 1 68 ? -1.059  7.885   8.372   1.00 0.00 ?  624  THR A CA   6  
ATOM 9292  C C    . THR A 1 68 ? -1.466  6.452   7.993   1.00 0.00 ?  624  THR A C    6  
ATOM 9293  O O    . THR A 1 68 ? -0.801  5.470   8.353   1.00 0.00 ?  624  THR A O    6  
ATOM 9294  C CB   . THR A 1 68 ? -1.704  8.304   9.691   1.00 0.00 ?  624  THR A CB   6  
ATOM 9295  O OG1  . THR A 1 68 ? -3.035  8.788   9.405   1.00 0.00 ?  624  THR A OG1  6  
ATOM 9296  C CG2  . THR A 1 68 ? -0.887  9.397   10.359  1.00 0.00 ?  624  THR A CG2  6  
ATOM 9297  H H    . THR A 1 68 ? -2.186  9.440   7.561   1.00 0.00 ?  624  THR A H    6  
ATOM 9298  H HA   . THR A 1 68 ? 0.015   7.929   8.481   1.00 0.00 ?  624  THR A HA   6  
ATOM 9299  H HB   . THR A 1 68 ? -1.763  7.441   10.339  1.00 0.00 ?  624  THR A HB   6  
ATOM 9300  H HG1  . THR A 1 68 ? -3.655  8.423   10.047  1.00 0.00 ?  624  THR A HG1  6  
ATOM 9301  H HG21 . THR A 1 68 ? -0.836  10.256  9.706   1.00 0.00 ?  624  THR A HG21 6  
ATOM 9302  H HG22 . THR A 1 68 ? 0.112   9.038   10.558  1.00 0.00 ?  624  THR A HG22 6  
ATOM 9303  H HG23 . THR A 1 68 ? -1.355  9.682   11.289  1.00 0.00 ?  624  THR A HG23 6  
ATOM 9304  N N    . THR A 1 69 ? -2.542  6.357   7.254   1.00 0.00 ?  625  THR A N    6  
ATOM 9305  C CA   . THR A 1 69 ? -3.046  5.115   6.739   1.00 0.00 ?  625  THR A CA   6  
ATOM 9306  C C    . THR A 1 69 ? -2.209  4.713   5.511   1.00 0.00 ?  625  THR A C    6  
ATOM 9307  O O    . THR A 1 69 ? -1.955  3.540   5.256   1.00 0.00 ?  625  THR A O    6  
ATOM 9308  C CB   . THR A 1 69 ? -4.506  5.341   6.325   1.00 0.00 ?  625  THR A CB   6  
ATOM 9309  O OG1  . THR A 1 69 ? -5.195  5.962   7.418   1.00 0.00 ?  625  THR A OG1  6  
ATOM 9310  C CG2  . THR A 1 69 ? -5.187  4.044   5.982   1.00 0.00 ?  625  THR A CG2  6  
ATOM 9311  H H    . THR A 1 69 ? -3.059  7.167   7.059   1.00 0.00 ?  625  THR A H    6  
ATOM 9312  H HA   . THR A 1 69 ? -3.005  4.355   7.505   1.00 0.00 ?  625  THR A HA   6  
ATOM 9313  H HB   . THR A 1 69 ? -4.524  6.001   5.471   1.00 0.00 ?  625  THR A HB   6  
ATOM 9314  H HG1  . THR A 1 69 ? -5.998  5.464   7.594   1.00 0.00 ?  625  THR A HG1  6  
ATOM 9315  H HG21 . THR A 1 69 ? -6.220  4.234   5.731   1.00 0.00 ?  625  THR A HG21 6  
ATOM 9316  H HG22 . THR A 1 69 ? -5.131  3.372   6.824   1.00 0.00 ?  625  THR A HG22 6  
ATOM 9317  H HG23 . THR A 1 69 ? -4.690  3.599   5.133   1.00 0.00 ?  625  THR A HG23 6  
ATOM 9318  N N    . LEU A 1 70 ? -1.771  5.725   4.790   1.00 0.00 ?  626  LEU A N    6  
ATOM 9319  C CA   . LEU A 1 70 ? -0.952  5.577   3.612   1.00 0.00 ?  626  LEU A CA   6  
ATOM 9320  C C    . LEU A 1 70 ? 0.384   4.954   3.984   1.00 0.00 ?  626  LEU A C    6  
ATOM 9321  O O    . LEU A 1 70 ? 0.815   3.979   3.368   1.00 0.00 ?  626  LEU A O    6  
ATOM 9322  C CB   . LEU A 1 70 ? -0.796  6.969   2.941   1.00 0.00 ?  626  LEU A CB   6  
ATOM 9323  C CG   . LEU A 1 70 ? -0.050  7.081   1.594   1.00 0.00 ?  626  LEU A CG   6  
ATOM 9324  C CD1  . LEU A 1 70 ? -0.381  8.411   0.963   1.00 0.00 ?  626  LEU A CD1  6  
ATOM 9325  C CD2  . LEU A 1 70 ? 1.464   6.999   1.771   1.00 0.00 ?  626  LEU A CD2  6  
ATOM 9326  H H    . LEU A 1 70 ? -2.044  6.629   5.061   1.00 0.00 ?  626  LEU A H    6  
ATOM 9327  H HA   . LEU A 1 70 ? -1.469  4.921   2.929   1.00 0.00 ?  626  LEU A HA   6  
ATOM 9328  H HB2  . LEU A 1 70 ? -1.787  7.368   2.790   1.00 0.00 ?  626  LEU A HB2  6  
ATOM 9329  H HB3  . LEU A 1 70 ? -0.295  7.607   3.654   1.00 0.00 ?  626  LEU A HB3  6  
ATOM 9330  H HG   . LEU A 1 70 ? -0.369  6.292   0.930   1.00 0.00 ?  626  LEU A HG   6  
ATOM 9331  H HD11 . LEU A 1 70 ? 0.164   8.483   0.035   1.00 0.00 ?  626  LEU A HD11 6  
ATOM 9332  H HD12 . LEU A 1 70 ? -0.091  9.212   1.626   1.00 0.00 ?  626  LEU A HD12 6  
ATOM 9333  H HD13 . LEU A 1 70 ? -1.442  8.469   0.763   1.00 0.00 ?  626  LEU A HD13 6  
ATOM 9334  H HD21 . LEU A 1 70 ? 1.795   7.808   2.406   1.00 0.00 ?  626  LEU A HD21 6  
ATOM 9335  H HD22 . LEU A 1 70 ? 1.945   7.075   0.806   1.00 0.00 ?  626  LEU A HD22 6  
ATOM 9336  H HD23 . LEU A 1 70 ? 1.718   6.054   2.227   1.00 0.00 ?  626  LEU A HD23 6  
ATOM 9337  N N    . ARG A 1 71 ? 1.013   5.482   5.033   1.00 0.00 ?  627  ARG A N    6  
ATOM 9338  C CA   . ARG A 1 71 ? 2.313   4.978   5.468   1.00 0.00 ?  627  ARG A CA   6  
ATOM 9339  C C    . ARG A 1 71 ? 2.227   3.522   5.923   1.00 0.00 ?  627  ARG A C    6  
ATOM 9340  O O    . ARG A 1 71 ? 3.210   2.802   5.869   1.00 0.00 ?  627  ARG A O    6  
ATOM 9341  C CB   . ARG A 1 71 ? 2.973   5.860   6.549   1.00 0.00 ?  627  ARG A CB   6  
ATOM 9342  C CG   . ARG A 1 71 ? 3.157   7.317   6.133   1.00 0.00 ?  627  ARG A CG   6  
ATOM 9343  C CD   . ARG A 1 71 ? 4.050   8.088   7.102   1.00 0.00 ?  627  ARG A CD   6  
ATOM 9344  N NE   . ARG A 1 71 ? 5.471   7.707   6.968   1.00 0.00 ?  627  ARG A NE   6  
ATOM 9345  C CZ   . ARG A 1 71 ? 6.510   8.322   7.577   1.00 0.00 ?  627  ARG A CZ   6  
ATOM 9346  N NH1  . ARG A 1 71 ? 6.295   9.273   8.490   1.00 0.00 1  627  ARG A NH1  6  
ATOM 9347  N NH2  . ARG A 1 71 ? 7.763   7.964   7.276   1.00 0.00 ?  627  ARG A NH2  6  
ATOM 9348  H H    . ARG A 1 71 ? 0.592   6.232   5.508   1.00 0.00 ?  627  ARG A H    6  
ATOM 9349  H HA   . ARG A 1 71 ? 2.937   4.988   4.587   1.00 0.00 ?  627  ARG A HA   6  
ATOM 9350  H HB2  . ARG A 1 71 ? 2.358   5.838   7.437   1.00 0.00 ?  627  ARG A HB2  6  
ATOM 9351  H HB3  . ARG A 1 71 ? 3.943   5.453   6.787   1.00 0.00 ?  627  ARG A HB3  6  
ATOM 9352  H HG2  . ARG A 1 71 ? 3.608   7.345   5.152   1.00 0.00 ?  627  ARG A HG2  6  
ATOM 9353  H HG3  . ARG A 1 71 ? 2.187   7.790   6.092   1.00 0.00 ?  627  ARG A HG3  6  
ATOM 9354  H HD2  . ARG A 1 71 ? 3.949   9.146   6.912   1.00 0.00 ?  627  ARG A HD2  6  
ATOM 9355  H HD3  . ARG A 1 71 ? 3.725   7.871   8.108   1.00 0.00 ?  627  ARG A HD3  6  
ATOM 9356  H HE   . ARG A 1 71 ? 5.643   6.970   6.337   1.00 0.00 ?  627  ARG A HE   6  
ATOM 9357  H HH11 . ARG A 1 71 ? 5.371   9.559   8.757   1.00 0.00 ?  627  ARG A HH11 6  
ATOM 9358  H HH12 . ARG A 1 71 ? 7.042   9.754   8.954   1.00 0.00 ?  627  ARG A HH12 6  
ATOM 9359  H HH21 . ARG A 1 71 ? 7.963   7.237   6.615   1.00 0.00 ?  627  ARG A HH21 6  
ATOM 9360  H HH22 . ARG A 1 71 ? 8.582   8.412   7.666   1.00 0.00 ?  627  ARG A HH22 6  
ATOM 9361  N N    . GLU A 1 72 ? 1.038   3.090   6.339   1.00 0.00 ?  628  GLU A N    6  
ATOM 9362  C CA   . GLU A 1 72 ? 0.825   1.711   6.756   1.00 0.00 ?  628  GLU A CA   6  
ATOM 9363  C C    . GLU A 1 72 ? 1.105   0.746   5.602   1.00 0.00 ?  628  GLU A C    6  
ATOM 9364  O O    . GLU A 1 72 ? 1.749   -0.288  5.781   1.00 0.00 ?  628  GLU A O    6  
ATOM 9365  C CB   . GLU A 1 72 ? -0.598  1.495   7.263   1.00 0.00 ?  628  GLU A CB   6  
ATOM 9366  C CG   . GLU A 1 72 ? -0.856  0.070   7.726   1.00 0.00 ?  628  GLU A CG   6  
ATOM 9367  C CD   . GLU A 1 72 ? 0.031   -0.325  8.877   1.00 0.00 ?  628  GLU A CD   6  
ATOM 9368  O OE1  . GLU A 1 72 ? 1.204   -0.647  8.669   1.00 0.00 ?  628  GLU A OE1  6  
ATOM 9369  O OE2  . GLU A 1 72 ? -0.436  -0.348  10.007  1.00 0.00 -1 628  GLU A OE2  6  
ATOM 9370  H H    . GLU A 1 72 ? 0.284   3.714   6.358   1.00 0.00 ?  628  GLU A H    6  
ATOM 9371  H HA   . GLU A 1 72 ? 1.518   1.499   7.557   1.00 0.00 ?  628  GLU A HA   6  
ATOM 9372  H HB2  . GLU A 1 72 ? -0.797  2.169   8.083   1.00 0.00 ?  628  GLU A HB2  6  
ATOM 9373  H HB3  . GLU A 1 72 ? -1.285  1.714   6.458   1.00 0.00 ?  628  GLU A HB3  6  
ATOM 9374  H HG2  . GLU A 1 72 ? -1.890  -0.042  8.015   1.00 0.00 ?  628  GLU A HG2  6  
ATOM 9375  H HG3  . GLU A 1 72 ? -0.664  -0.599  6.901   1.00 0.00 ?  628  GLU A HG3  6  
ATOM 9376  N N    . LEU A 1 73 ? 0.660   1.098   4.417   1.00 0.00 ?  629  LEU A N    6  
ATOM 9377  C CA   . LEU A 1 73 ? 0.880   0.240   3.276   1.00 0.00 ?  629  LEU A CA   6  
ATOM 9378  C C    . LEU A 1 73 ? 2.355   0.221   2.914   1.00 0.00 ?  629  LEU A C    6  
ATOM 9379  O O    . LEU A 1 73 ? 2.880   -0.795  2.496   1.00 0.00 ?  629  LEU A O    6  
ATOM 9380  C CB   . LEU A 1 73 ? 0.000   0.644   2.088   1.00 0.00 ?  629  LEU A CB   6  
ATOM 9381  C CG   . LEU A 1 73 ? 0.135   -0.209  0.816   1.00 0.00 ?  629  LEU A CG   6  
ATOM 9382  C CD1  . LEU A 1 73 ? -0.115  -1.667  1.129   1.00 0.00 ?  629  LEU A CD1  6  
ATOM 9383  C CD2  . LEU A 1 73 ? -0.846  0.259   -0.238  1.00 0.00 ?  629  LEU A CD2  6  
ATOM 9384  H H    . LEU A 1 73 ? 0.183   1.950   4.312   1.00 0.00 ?  629  LEU A H    6  
ATOM 9385  H HA   . LEU A 1 73 ? 0.608   -0.757  3.594   1.00 0.00 ?  629  LEU A HA   6  
ATOM 9386  H HB2  . LEU A 1 73 ? -1.030  0.599   2.407   1.00 0.00 ?  629  LEU A HB2  6  
ATOM 9387  H HB3  . LEU A 1 73 ? 0.236   1.666   1.835   1.00 0.00 ?  629  LEU A HB3  6  
ATOM 9388  H HG   . LEU A 1 73 ? 1.134   -0.113  0.420   1.00 0.00 ?  629  LEU A HG   6  
ATOM 9389  H HD11 . LEU A 1 73 ? 0.640   -2.025  1.813   1.00 0.00 ?  629  LEU A HD11 6  
ATOM 9390  H HD12 . LEU A 1 73 ? -0.093  -2.251  0.221   1.00 0.00 ?  629  LEU A HD12 6  
ATOM 9391  H HD13 . LEU A 1 73 ? -1.084  -1.756  1.601   1.00 0.00 ?  629  LEU A HD13 6  
ATOM 9392  H HD21 . LEU A 1 73 ? -0.670  1.301   -0.461  1.00 0.00 ?  629  LEU A HD21 6  
ATOM 9393  H HD22 . LEU A 1 73 ? -1.850  0.138   0.139   1.00 0.00 ?  629  LEU A HD22 6  
ATOM 9394  H HD23 . LEU A 1 73 ? -0.725  -0.329  -1.136  1.00 0.00 ?  629  LEU A HD23 6  
ATOM 9395  N N    . GLU A 1 74 ? 3.024   1.329   3.154   1.00 0.00 ?  630  GLU A N    6  
ATOM 9396  C CA   . GLU A 1 74 ? 4.451   1.445   2.898   1.00 0.00 ?  630  GLU A CA   6  
ATOM 9397  C C    . GLU A 1 74 ? 5.179   0.484   3.868   1.00 0.00 ?  630  GLU A C    6  
ATOM 9398  O O    . GLU A 1 74 ? 6.064   -0.266  3.476   1.00 0.00 ?  630  GLU A O    6  
ATOM 9399  C CB   . GLU A 1 74 ? 4.866   2.922   3.100   1.00 0.00 ?  630  GLU A CB   6  
ATOM 9400  C CG   . GLU A 1 74 ? 6.031   3.418   2.236   1.00 0.00 ?  630  GLU A CG   6  
ATOM 9401  C CD   . GLU A 1 74 ? 7.393   3.048   2.745   1.00 0.00 ?  630  GLU A CD   6  
ATOM 9402  O OE1  . GLU A 1 74 ? 7.861   1.927   2.513   1.00 0.00 ?  630  GLU A OE1  6  
ATOM 9403  O OE2  . GLU A 1 74 ? 8.053   3.911   3.370   1.00 0.00 -1 630  GLU A OE2  6  
ATOM 9404  H H    . GLU A 1 74 ? 2.537   2.098   3.517   1.00 0.00 ?  630  GLU A H    6  
ATOM 9405  H HA   . GLU A 1 74 ? 4.641   1.136   1.879   1.00 0.00 ?  630  GLU A HA   6  
ATOM 9406  H HB2  . GLU A 1 74 ? 4.011   3.557   2.922   1.00 0.00 ?  630  GLU A HB2  6  
ATOM 9407  H HB3  . GLU A 1 74 ? 5.150   3.036   4.135   1.00 0.00 ?  630  GLU A HB3  6  
ATOM 9408  H HG2  . GLU A 1 74 ? 5.924   3.007   1.244   1.00 0.00 ?  630  GLU A HG2  6  
ATOM 9409  H HG3  . GLU A 1 74 ? 5.968   4.495   2.170   1.00 0.00 ?  630  GLU A HG3  6  
ATOM 9410  N N    . ARG A 1 75 ? 4.698   0.448   5.118   1.00 0.00 ?  631  ARG A N    6  
ATOM 9411  C CA   . ARG A 1 75 ? 5.236   -0.453  6.155   1.00 0.00 ?  631  ARG A CA   6  
ATOM 9412  C C    . ARG A 1 75 ? 4.954   -1.895  5.774   1.00 0.00 ?  631  ARG A C    6  
ATOM 9413  O O    . ARG A 1 75 ? 5.789   -2.783  5.978   1.00 0.00 ?  631  ARG A O    6  
ATOM 9414  C CB   . ARG A 1 75 ? 4.589   -0.177  7.511   1.00 0.00 ?  631  ARG A CB   6  
ATOM 9415  C CG   . ARG A 1 75 ? 4.755   1.238   7.996   1.00 0.00 ?  631  ARG A CG   6  
ATOM 9416  C CD   . ARG A 1 75 ? 3.963   1.487   9.272   1.00 0.00 ?  631  ARG A CD   6  
ATOM 9417  N NE   . ARG A 1 75 ? 4.495   0.764   10.440  1.00 0.00 ?  631  ARG A NE   6  
ATOM 9418  C CZ   . ARG A 1 75 ? 3.752   0.068   11.316  1.00 0.00 ?  631  ARG A CZ   6  
ATOM 9419  N NH1  . ARG A 1 75 ? 2.522   -0.340  10.998  1.00 0.00 1  631  ARG A NH1  6  
ATOM 9420  N NH2  . ARG A 1 75 ? 4.277   -0.286  12.482  1.00 0.00 ?  631  ARG A NH2  6  
ATOM 9421  H H    . ARG A 1 75 ? 3.952   1.049   5.341   1.00 0.00 ?  631  ARG A H    6  
ATOM 9422  H HA   . ARG A 1 75 ? 6.302   -0.303  6.228   1.00 0.00 ?  631  ARG A HA   6  
ATOM 9423  H HB2  . ARG A 1 75 ? 3.532   -0.386  7.435   1.00 0.00 ?  631  ARG A HB2  6  
ATOM 9424  H HB3  . ARG A 1 75 ? 5.021   -0.845  8.241   1.00 0.00 ?  631  ARG A HB3  6  
ATOM 9425  H HG2  . ARG A 1 75 ? 5.803   1.424   8.172   1.00 0.00 ?  631  ARG A HG2  6  
ATOM 9426  H HG3  . ARG A 1 75 ? 4.395   1.888   7.213   1.00 0.00 ?  631  ARG A HG3  6  
ATOM 9427  H HD2  . ARG A 1 75 ? 3.987   2.545   9.486   1.00 0.00 ?  631  ARG A HD2  6  
ATOM 9428  H HD3  . ARG A 1 75 ? 2.939   1.184   9.112   1.00 0.00 ?  631  ARG A HD3  6  
ATOM 9429  H HE   . ARG A 1 75 ? 5.452   0.922   10.611  1.00 0.00 ?  631  ARG A HE   6  
ATOM 9430  H HH11 . ARG A 1 75 ? 2.090   -0.162  10.099  1.00 0.00 ?  631  ARG A HH11 6  
ATOM 9431  H HH12 . ARG A 1 75 ? 1.930   -0.850  11.625  1.00 0.00 ?  631  ARG A HH12 6  
ATOM 9432  H HH21 . ARG A 1 75 ? 5.221   -0.033  12.716  1.00 0.00 ?  631  ARG A HH21 6  
ATOM 9433  H HH22 . ARG A 1 75 ? 3.779   -0.807  13.178  1.00 0.00 ?  631  ARG A HH22 6  
ATOM 9434  N N    . TYR A 1 76 ? 3.773   -2.122  5.212   1.00 0.00 ?  632  TYR A N    6  
ATOM 9435  C CA   . TYR A 1 76 ? 3.369   -3.427  4.758   1.00 0.00 ?  632  TYR A CA   6  
ATOM 9436  C C    . TYR A 1 76 ? 4.318   -3.937  3.689   1.00 0.00 ?  632  TYR A C    6  
ATOM 9437  O O    . TYR A 1 76 ? 4.711   -5.102  3.704   1.00 0.00 ?  632  TYR A O    6  
ATOM 9438  C CB   . TYR A 1 76 ? 1.944   -3.402  4.188   1.00 0.00 ?  632  TYR A CB   6  
ATOM 9439  C CG   . TYR A 1 76 ? 1.499   -4.760  3.711   1.00 0.00 ?  632  TYR A CG   6  
ATOM 9440  C CD1  . TYR A 1 76 ? 0.873   -5.652  4.559   1.00 0.00 ?  632  TYR A CD1  6  
ATOM 9441  C CD2  . TYR A 1 76 ? 1.775   -5.161  2.419   1.00 0.00 ?  632  TYR A CD2  6  
ATOM 9442  C CE1  . TYR A 1 76 ? 0.533   -6.921  4.125   1.00 0.00 ?  632  TYR A CE1  6  
ATOM 9443  C CE2  . TYR A 1 76 ? 1.443   -6.399  1.967   1.00 0.00 ?  632  TYR A CE2  6  
ATOM 9444  C CZ   . TYR A 1 76 ? 0.822   -7.293  2.826   1.00 0.00 ?  632  TYR A CZ   6  
ATOM 9445  O OH   . TYR A 1 76 ? 0.491   -8.555  2.386   1.00 0.00 ?  632  TYR A OH   6  
ATOM 9446  H H    . TYR A 1 76 ? 3.136   -1.379  5.123   1.00 0.00 ?  632  TYR A H    6  
ATOM 9447  H HA   . TYR A 1 76 ? 3.389   -4.100  5.601   1.00 0.00 ?  632  TYR A HA   6  
ATOM 9448  H HB2  . TYR A 1 76 ? 1.241   -3.030  4.920   1.00 0.00 ?  632  TYR A HB2  6  
ATOM 9449  H HB3  . TYR A 1 76 ? 1.979   -2.755  3.321   1.00 0.00 ?  632  TYR A HB3  6  
ATOM 9450  H HD1  . TYR A 1 76 ? 0.654   -5.334  5.568   1.00 0.00 ?  632  TYR A HD1  6  
ATOM 9451  H HD2  . TYR A 1 76 ? 2.261   -4.450  1.765   1.00 0.00 ?  632  TYR A HD2  6  
ATOM 9452  H HE1  . TYR A 1 76 ? 0.043   -7.611  4.796   1.00 0.00 ?  632  TYR A HE1  6  
ATOM 9453  H HE2  . TYR A 1 76 ? 1.699   -6.627  0.940   1.00 0.00 ?  632  TYR A HE2  6  
ATOM 9454  H HH   . TYR A 1 76 ? 1.226   -8.899  1.873   1.00 0.00 ?  632  TYR A HH   6  
ATOM 9455  N N    . VAL A 1 77 ? 4.675   -3.081  2.759   1.00 0.00 ?  633  VAL A N    6  
ATOM 9456  C CA   . VAL A 1 77 ? 5.537   -3.502  1.678   1.00 0.00 ?  633  VAL A CA   6  
ATOM 9457  C C    . VAL A 1 77 ? 6.945   -3.781  2.233   1.00 0.00 ?  633  VAL A C    6  
ATOM 9458  O O    . VAL A 1 77 ? 7.629   -4.687  1.772   1.00 0.00 ?  633  VAL A O    6  
ATOM 9459  C CB   . VAL A 1 77 ? 5.569   -2.486  0.501   1.00 0.00 ?  633  VAL A CB   6  
ATOM 9460  C CG1  . VAL A 1 77 ? 6.290   -3.082  -0.683  1.00 0.00 ?  633  VAL A CG1  6  
ATOM 9461  C CG2  . VAL A 1 77 ? 4.158   -2.113  0.081   1.00 0.00 ?  633  VAL A CG2  6  
ATOM 9462  H H    . VAL A 1 77 ? 4.349   -2.152  2.808   1.00 0.00 ?  633  VAL A H    6  
ATOM 9463  H HA   . VAL A 1 77 ? 5.137   -4.446  1.321   1.00 0.00 ?  633  VAL A HA   6  
ATOM 9464  H HB   . VAL A 1 77 ? 6.081   -1.589  0.819   1.00 0.00 ?  633  VAL A HB   6  
ATOM 9465  H HG11 . VAL A 1 77 ? 5.718   -3.948  -0.990  1.00 0.00 ?  633  VAL A HG11 6  
ATOM 9466  H HG12 . VAL A 1 77 ? 7.289   -3.379  -0.400  1.00 0.00 ?  633  VAL A HG12 6  
ATOM 9467  H HG13 . VAL A 1 77 ? 6.309   -2.365  -1.489  1.00 0.00 ?  633  VAL A HG13 6  
ATOM 9468  H HG21 . VAL A 1 77 ? 3.622   -3.001  -0.224  1.00 0.00 ?  633  VAL A HG21 6  
ATOM 9469  H HG22 . VAL A 1 77 ? 4.199   -1.423  -0.748  1.00 0.00 ?  633  VAL A HG22 6  
ATOM 9470  H HG23 . VAL A 1 77 ? 3.640   -1.652  0.909   1.00 0.00 ?  633  VAL A HG23 6  
ATOM 9471  N N    . LYS A 1 78 ? 7.333   -3.050  3.292   1.00 0.00 ?  634  LYS A N    6  
ATOM 9472  C CA   . LYS A 1 78 ? 8.597   -3.334  3.997   1.00 0.00 ?  634  LYS A CA   6  
ATOM 9473  C C    . LYS A 1 78 ? 8.510   -4.728  4.611   1.00 0.00 ?  634  LYS A C    6  
ATOM 9474  O O    . LYS A 1 78 ? 9.484   -5.482  4.620   1.00 0.00 ?  634  LYS A O    6  
ATOM 9475  C CB   . LYS A 1 78 ? 8.863   -2.350  5.139   1.00 0.00 ?  634  LYS A CB   6  
ATOM 9476  C CG   . LYS A 1 78 ? 8.849   -0.889  4.769   1.00 0.00 ?  634  LYS A CG   6  
ATOM 9477  C CD   . LYS A 1 78 ? 9.171   -0.045  5.986   1.00 0.00 ?  634  LYS A CD   6  
ATOM 9478  C CE   . LYS A 1 78 ? 8.955   1.430   5.735   1.00 0.00 ?  634  LYS A CE   6  
ATOM 9479  N NZ   . LYS A 1 78 ? 9.680   1.920   4.556   1.00 0.00 1  634  LYS A NZ   6  
ATOM 9480  H H    . LYS A 1 78 ? 6.774   -2.294  3.575   1.00 0.00 ?  634  LYS A H    6  
ATOM 9481  H HA   . LYS A 1 78 ? 9.409   -3.301  3.284   1.00 0.00 ?  634  LYS A HA   6  
ATOM 9482  H HB2  . LYS A 1 78 ? 8.107   -2.500  5.896   1.00 0.00 ?  634  LYS A HB2  6  
ATOM 9483  H HB3  . LYS A 1 78 ? 9.825   -2.582  5.573   1.00 0.00 ?  634  LYS A HB3  6  
ATOM 9484  H HG2  . LYS A 1 78 ? 9.593   -0.711  4.008   1.00 0.00 ?  634  LYS A HG2  6  
ATOM 9485  H HG3  . LYS A 1 78 ? 7.871   -0.618  4.399   1.00 0.00 ?  634  LYS A HG3  6  
ATOM 9486  H HD2  . LYS A 1 78 ? 8.534   -0.352  6.803   1.00 0.00 ?  634  LYS A HD2  6  
ATOM 9487  H HD3  . LYS A 1 78 ? 10.201  -0.211  6.263   1.00 0.00 ?  634  LYS A HD3  6  
ATOM 9488  H HE2  . LYS A 1 78 ? 7.901   1.610   5.588   1.00 0.00 ?  634  LYS A HE2  6  
ATOM 9489  H HE3  . LYS A 1 78 ? 9.293   1.978   6.602   1.00 0.00 ?  634  LYS A HE3  6  
ATOM 9490  H HZ1  . LYS A 1 78 ? 10.697  1.706   4.556   1.00 0.00 ?  634  LYS A HZ1  6  
ATOM 9491  H HZ2  . LYS A 1 78 ? 9.548   2.950   4.498   1.00 0.00 ?  634  LYS A HZ2  6  
ATOM 9492  H HZ3  . LYS A 1 78 ? 9.245   1.572   3.672   1.00 0.00 ?  634  LYS A HZ3  6  
ATOM 9493  N N    . SER A 1 79 ? 7.318   -5.061  5.103   1.00 0.00 ?  635  SER A N    6  
ATOM 9494  C CA   . SER A 1 79 ? 7.049   -6.357  5.701   1.00 0.00 ?  635  SER A CA   6  
ATOM 9495  C C    . SER A 1 79 ? 7.127   -7.438  4.616   1.00 0.00 ?  635  SER A C    6  
ATOM 9496  O O    . SER A 1 79 ? 7.593   -8.526  4.854   1.00 0.00 ?  635  SER A O    6  
ATOM 9497  C CB   . SER A 1 79 ? 5.666   -6.358  6.362   1.00 0.00 ?  635  SER A CB   6  
ATOM 9498  O OG   . SER A 1 79 ? 5.515   -5.247  7.244   1.00 0.00 ?  635  SER A OG   6  
ATOM 9499  H H    . SER A 1 79 ? 6.598   -4.396  5.048   1.00 0.00 ?  635  SER A H    6  
ATOM 9500  H HA   . SER A 1 79 ? 7.807   -6.550  6.446   1.00 0.00 ?  635  SER A HA   6  
ATOM 9501  H HB2  . SER A 1 79 ? 4.907   -6.293  5.597   1.00 0.00 ?  635  SER A HB2  6  
ATOM 9502  H HB3  . SER A 1 79 ? 5.537   -7.271  6.923   1.00 0.00 ?  635  SER A HB3  6  
ATOM 9503  H HG   . SER A 1 79 ? 6.019   -4.494  6.904   1.00 0.00 ?  635  SER A HG   6  
ATOM 9504  N N    . CYS A 1 80 ? 6.671   -7.101  3.420   1.00 0.00 ?  636  CYS A N    6  
ATOM 9505  C CA   . CYS A 1 80 ? 6.792   -7.971  2.268   1.00 0.00 ?  636  CYS A CA   6  
ATOM 9506  C C    . CYS A 1 80 ? 8.272   -8.220  1.983   1.00 0.00 ?  636  CYS A C    6  
ATOM 9507  O O    . CYS A 1 80 ? 8.718   -9.366  1.806   1.00 0.00 ?  636  CYS A O    6  
ATOM 9508  C CB   . CYS A 1 80 ? 6.131   -7.311  1.048   1.00 0.00 ?  636  CYS A CB   6  
ATOM 9509  S SG   . CYS A 1 80 ? 6.420   -8.158  -0.516  1.00 0.00 ?  636  CYS A SG   6  
ATOM 9510  H H    . CYS A 1 80 ? 6.216   -6.234  3.325   1.00 0.00 ?  636  CYS A H    6  
ATOM 9511  H HA   . CYS A 1 80 ? 6.282   -8.898  2.484   1.00 0.00 ?  636  CYS A HA   6  
ATOM 9512  H HB2  . CYS A 1 80 ? 5.064   -7.268  1.201   1.00 0.00 ?  636  CYS A HB2  6  
ATOM 9513  H HB3  . CYS A 1 80 ? 6.512   -6.305  0.954   1.00 0.00 ?  636  CYS A HB3  6  
ATOM 9514  H HG   . CYS A 1 80 ? 7.631   -8.703  -0.458  1.00 0.00 ?  636  CYS A HG   6  
ATOM 9515  N N    . LEU A 1 81 ? 9.034   -7.139  2.028   1.00 0.00 ?  637  LEU A N    6  
ATOM 9516  C CA   . LEU A 1 81 ? 10.455  -7.137  1.738   1.00 0.00 ?  637  LEU A CA   6  
ATOM 9517  C C    . LEU A 1 81 ? 11.298  -7.758  2.853   1.00 0.00 ?  637  LEU A C    6  
ATOM 9518  O O    . LEU A 1 81 ? 12.516  -7.649  2.827   1.00 0.00 ?  637  LEU A O    6  
ATOM 9519  C CB   . LEU A 1 81 ? 10.943  -5.714  1.420   1.00 0.00 ?  637  LEU A CB   6  
ATOM 9520  C CG   . LEU A 1 81 ? 10.333  -5.041  0.182   1.00 0.00 ?  637  LEU A CG   6  
ATOM 9521  C CD1  . LEU A 1 81 ? 10.853  -3.624  0.034   1.00 0.00 ?  637  LEU A CD1  6  
ATOM 9522  C CD2  . LEU A 1 81 ? 10.629  -5.845  -1.079  1.00 0.00 ?  637  LEU A CD2  6  
ATOM 9523  H H    . LEU A 1 81 ? 8.616   -6.279  2.261   1.00 0.00 ?  637  LEU A H    6  
ATOM 9524  H HA   . LEU A 1 81 ? 10.597  -7.739  0.853   1.00 0.00 ?  637  LEU A HA   6  
ATOM 9525  H HB2  . LEU A 1 81 ? 10.736  -5.094  2.279   1.00 0.00 ?  637  LEU A HB2  6  
ATOM 9526  H HB3  . LEU A 1 81 ? 12.014  -5.753  1.284   1.00 0.00 ?  637  LEU A HB3  6  
ATOM 9527  H HG   . LEU A 1 81 ? 9.261   -4.990  0.309   1.00 0.00 ?  637  LEU A HG   6  
ATOM 9528  H HD11 . LEU A 1 81 ? 10.411  -3.170  -0.840  1.00 0.00 ?  637  LEU A HD11 6  
ATOM 9529  H HD12 . LEU A 1 81 ? 11.928  -3.640  -0.075  1.00 0.00 ?  637  LEU A HD12 6  
ATOM 9530  H HD13 . LEU A 1 81 ? 10.587  -3.051  0.909   1.00 0.00 ?  637  LEU A HD13 6  
ATOM 9531  H HD21 . LEU A 1 81 ? 10.188  -6.828  -0.998  1.00 0.00 ?  637  LEU A HD21 6  
ATOM 9532  H HD22 . LEU A 1 81 ? 11.697  -5.939  -1.198  1.00 0.00 ?  637  LEU A HD22 6  
ATOM 9533  H HD23 . LEU A 1 81 ? 10.214  -5.333  -1.935  1.00 0.00 ?  637  LEU A HD23 6  
ATOM 9534  N N    . GLN A 1 82 ? 10.660  -8.405  3.836   1.00 0.00 ?  638  GLN A N    6  
ATOM 9535  C CA   . GLN A 1 82 ? 11.414  -9.170  4.831   1.00 0.00 ?  638  GLN A CA   6  
ATOM 9536  C C    . GLN A 1 82 ? 11.981  -10.381 4.097   1.00 0.00 ?  638  GLN A C    6  
ATOM 9537  O O    . GLN A 1 82 ? 13.061  -10.894 4.396   1.00 0.00 ?  638  GLN A O    6  
ATOM 9538  C CB   . GLN A 1 82 ? 10.508  -9.650  5.991   1.00 0.00 ?  638  GLN A CB   6  
ATOM 9539  C CG   . GLN A 1 82 ? 9.492   -10.734 5.597   1.00 0.00 ?  638  GLN A CG   6  
ATOM 9540  C CD   . GLN A 1 82 ? 8.587   -11.184 6.717   1.00 0.00 ?  638  GLN A CD   6  
ATOM 9541  O OE1  . GLN A 1 82 ? 7.444   -11.578 6.478   1.00 0.00 ?  638  GLN A OE1  6  
ATOM 9542  N NE2  . GLN A 1 82 ? 9.071   -11.163 7.926   1.00 0.00 ?  638  GLN A NE2  6  
ATOM 9543  H H    . GLN A 1 82 ? 9.682   -8.354  3.897   1.00 0.00 ?  638  GLN A H    6  
ATOM 9544  H HA   . GLN A 1 82 ? 12.224  -8.559  5.200   1.00 0.00 ?  638  GLN A HA   6  
ATOM 9545  H HB2  . GLN A 1 82 ? 11.133  -10.041 6.778   1.00 0.00 ?  638  GLN A HB2  6  
ATOM 9546  H HB3  . GLN A 1 82 ? 9.963   -8.799  6.372   1.00 0.00 ?  638  GLN A HB3  6  
ATOM 9547  H HG2  . GLN A 1 82 ? 8.868   -10.344 4.806   1.00 0.00 ?  638  GLN A HG2  6  
ATOM 9548  H HG3  . GLN A 1 82 ? 10.035  -11.589 5.225   1.00 0.00 ?  638  GLN A HG3  6  
ATOM 9549  H HE21 . GLN A 1 82 ? 9.991   -10.859 8.082   1.00 0.00 ?  638  GLN A HE21 6  
ATOM 9550  H HE22 . GLN A 1 82 ? 8.479   -11.456 8.648   1.00 0.00 ?  638  GLN A HE22 6  
ATOM 9551  N N    . LYS A 1 83 ? 11.229  -10.790 3.096   1.00 0.00 ?  639  LYS A N    6  
ATOM 9552  C CA   . LYS A 1 83 ? 11.545  -11.895 2.279   1.00 0.00 ?  639  LYS A CA   6  
ATOM 9553  C C    . LYS A 1 83 ? 12.085  -11.372 0.967   1.00 0.00 ?  639  LYS A C    6  
ATOM 9554  O O    . LYS A 1 83 ? 13.281  -11.491 0.675   1.00 0.00 ?  639  LYS A O    6  
ATOM 9555  C CB   . LYS A 1 83 ? 10.269  -12.721 2.049   1.00 0.00 ?  639  LYS A CB   6  
ATOM 9556  C CG   . LYS A 1 83 ? 10.467  -13.991 1.245   1.00 0.00 ?  639  LYS A CG   6  
ATOM 9557  C CD   . LYS A 1 83 ? 9.152   -14.730 0.995   1.00 0.00 ?  639  LYS A CD   6  
ATOM 9558  C CE   . LYS A 1 83 ? 8.454   -15.110 2.291   1.00 0.00 ?  639  LYS A CE   6  
ATOM 9559  N NZ   . LYS A 1 83 ? 7.221   -15.886 2.045   1.00 0.00 1  639  LYS A NZ   6  
ATOM 9560  H H    . LYS A 1 83 ? 10.412  -10.277 2.916   1.00 0.00 ?  639  LYS A H    6  
ATOM 9561  H HA   . LYS A 1 83 ? 12.283  -12.514 2.762   1.00 0.00 ?  639  LYS A HA   6  
ATOM 9562  H HB2  . LYS A 1 83 ? 9.868   -12.996 3.014   1.00 0.00 ?  639  LYS A HB2  6  
ATOM 9563  H HB3  . LYS A 1 83 ? 9.545   -12.101 1.539   1.00 0.00 ?  639  LYS A HB3  6  
ATOM 9564  H HG2  . LYS A 1 83 ? 10.907  -13.730 0.295   1.00 0.00 ?  639  LYS A HG2  6  
ATOM 9565  H HG3  . LYS A 1 83 ? 11.136  -14.635 1.793   1.00 0.00 ?  639  LYS A HG3  6  
ATOM 9566  H HD2  . LYS A 1 83 ? 8.494   -14.094 0.422   1.00 0.00 ?  639  LYS A HD2  6  
ATOM 9567  H HD3  . LYS A 1 83 ? 9.360   -15.628 0.432   1.00 0.00 ?  639  LYS A HD3  6  
ATOM 9568  H HE2  . LYS A 1 83 ? 9.131   -15.694 2.894   1.00 0.00 ?  639  LYS A HE2  6  
ATOM 9569  H HE3  . LYS A 1 83 ? 8.198   -14.208 2.826   1.00 0.00 ?  639  LYS A HE3  6  
ATOM 9570  H HZ1  . LYS A 1 83 ? 6.547   -15.379 1.440   1.00 0.00 ?  639  LYS A HZ1  6  
ATOM 9571  H HZ2  . LYS A 1 83 ? 6.735   -16.075 2.946   1.00 0.00 ?  639  LYS A HZ2  6  
ATOM 9572  H HZ3  . LYS A 1 83 ? 7.418   -16.814 1.619   1.00 0.00 ?  639  LYS A HZ3  6  
ATOM 9573  N N    . LYS A 1 84 ? 11.200  -10.720 0.228   1.00 0.00 ?  640  LYS A N    6  
ATOM 9574  C CA   . LYS A 1 84 ? 11.441  -10.188 -1.099  1.00 0.00 ?  640  LYS A CA   6  
ATOM 9575  C C    . LYS A 1 84 ? 10.059  -9.781  -1.587  1.00 0.00 ?  640  LYS A C    6  
ATOM 9576  O O    . LYS A 1 84 ? 9.091   -9.950  -0.839  1.00 0.00 ?  640  LYS A O    6  
ATOM 9577  C CB   . LYS A 1 84 ? 12.006  -11.313 -2.001  1.00 0.00 ?  640  LYS A CB   6  
ATOM 9578  C CG   . LYS A 1 84 ? 12.506  -10.874 -3.361  1.00 0.00 ?  640  LYS A CG   6  
ATOM 9579  C CD   . LYS A 1 84 ? 13.024  -12.039 -4.202  1.00 0.00 ?  640  LYS A CD   6  
ATOM 9580  C CE   . LYS A 1 84 ? 11.917  -12.940 -4.773  1.00 0.00 ?  640  LYS A CE   6  
ATOM 9581  N NZ   . LYS A 1 84 ? 11.160  -13.730 -3.765  1.00 0.00 1  640  LYS A NZ   6  
ATOM 9582  H H    . LYS A 1 84 ? 10.293  -10.561 0.573   1.00 0.00 ?  640  LYS A H    6  
ATOM 9583  H HA   . LYS A 1 84 ? 12.111  -9.343  -1.049  1.00 0.00 ?  640  LYS A HA   6  
ATOM 9584  H HB2  . LYS A 1 84 ? 12.829  -11.780 -1.482  1.00 0.00 ?  640  LYS A HB2  6  
ATOM 9585  H HB3  . LYS A 1 84 ? 11.231  -12.051 -2.141  1.00 0.00 ?  640  LYS A HB3  6  
ATOM 9586  H HG2  . LYS A 1 84 ? 11.690  -10.415 -3.895  1.00 0.00 ?  640  LYS A HG2  6  
ATOM 9587  H HG3  . LYS A 1 84 ? 13.302  -10.159 -3.221  1.00 0.00 ?  640  LYS A HG3  6  
ATOM 9588  H HD2  . LYS A 1 84 ? 13.592  -11.640 -5.030  1.00 0.00 ?  640  LYS A HD2  6  
ATOM 9589  H HD3  . LYS A 1 84 ? 13.676  -12.638 -3.584  1.00 0.00 ?  640  LYS A HD3  6  
ATOM 9590  H HE2  . LYS A 1 84 ? 11.211  -12.321 -5.304  1.00 0.00 ?  640  LYS A HE2  6  
ATOM 9591  H HE3  . LYS A 1 84 ? 12.375  -13.617 -5.477  1.00 0.00 ?  640  LYS A HE3  6  
ATOM 9592  H HZ1  . LYS A 1 84 ? 11.788  -14.267 -3.134  1.00 0.00 ?  640  LYS A HZ1  6  
ATOM 9593  H HZ2  . LYS A 1 84 ? 10.615  -14.444 -4.291  1.00 0.00 ?  640  LYS A HZ2  6  
ATOM 9594  H HZ3  . LYS A 1 84 ? 10.481  -13.167 -3.218  1.00 0.00 ?  640  LYS A HZ3  6  
ATOM 9595  N N    . GLN A 1 85 ? 9.924   -9.248  -2.760  1.00 0.00 ?  641  GLN A N    6  
ATOM 9596  C CA   . GLN A 1 85 ? 8.607   -8.990  -3.256  1.00 0.00 ?  641  GLN A CA   6  
ATOM 9597  C C    . GLN A 1 85 ? 8.276   -10.067 -4.277  1.00 0.00 ?  641  GLN A C    6  
ATOM 9598  O O    . GLN A 1 85 ? 9.191   -10.650 -4.893  1.00 0.00 ?  641  GLN A O    6  
ATOM 9599  C CB   . GLN A 1 85 ? 8.489   -7.582  -3.841  1.00 0.00 ?  641  GLN A CB   6  
ATOM 9600  C CG   . GLN A 1 85 ? 7.050   -7.130  -4.073  1.00 0.00 ?  641  GLN A CG   6  
ATOM 9601  C CD   . GLN A 1 85 ? 6.961   -5.687  -4.499  1.00 0.00 ?  641  GLN A CD   6  
ATOM 9602  O OE1  . GLN A 1 85 ? 7.850   -5.164  -5.157  1.00 0.00 ?  641  GLN A OE1  6  
ATOM 9603  N NE2  . GLN A 1 85 ? 5.911   -5.019  -4.104  1.00 0.00 ?  641  GLN A NE2  6  
ATOM 9604  H H    . GLN A 1 85 ? 10.691  -9.023  -3.331  1.00 0.00 ?  641  GLN A H    6  
ATOM 9605  H HA   . GLN A 1 85 ? 7.929   -9.102  -2.423  1.00 0.00 ?  641  GLN A HA   6  
ATOM 9606  H HB2  . GLN A 1 85 ? 8.957   -6.880  -3.166  1.00 0.00 ?  641  GLN A HB2  6  
ATOM 9607  H HB3  . GLN A 1 85 ? 9.008   -7.555  -4.786  1.00 0.00 ?  641  GLN A HB3  6  
ATOM 9608  H HG2  . GLN A 1 85 ? 6.612   -7.745  -4.846  1.00 0.00 ?  641  GLN A HG2  6  
ATOM 9609  H HG3  . GLN A 1 85 ? 6.492   -7.256  -3.157  1.00 0.00 ?  641  GLN A HG3  6  
ATOM 9610  H HE21 . GLN A 1 85 ? 5.228   -5.469  -3.567  1.00 0.00 ?  641  GLN A HE21 6  
ATOM 9611  H HE22 . GLN A 1 85 ? 5.858   -4.059  -4.339  1.00 0.00 ?  641  GLN A HE22 6  
ATOM 9612  N N    . ARG A 1 86 ? 7.009   -10.384 -4.400  1.00 0.00 ?  642  ARG A N    6  
ATOM 9613  C CA   . ARG A 1 86 ? 6.550   -11.406 -5.309  1.00 0.00 ?  642  ARG A CA   6  
ATOM 9614  C C    . ARG A 1 86 ? 6.902   -11.084 -6.752  1.00 0.00 ?  642  ARG A C    6  
ATOM 9615  O O    . ARG A 1 86 ? 6.637   -9.980  -7.256  1.00 0.00 ?  642  ARG A O    6  
ATOM 9616  C CB   . ARG A 1 86 ? 5.038   -11.633 -5.172  1.00 0.00 ?  642  ARG A CB   6  
ATOM 9617  C CG   . ARG A 1 86 ? 4.467   -12.643 -6.167  1.00 0.00 ?  642  ARG A CG   6  
ATOM 9618  C CD   . ARG A 1 86 ? 5.031   -14.039 -5.959  1.00 0.00 ?  642  ARG A CD   6  
ATOM 9619  N NE   . ARG A 1 86 ? 4.684   -14.933 -7.068  1.00 0.00 ?  642  ARG A NE   6  
ATOM 9620  C CZ   . ARG A 1 86 ? 3.906   -16.023 -6.972  1.00 0.00 ?  642  ARG A CZ   6  
ATOM 9621  N NH1  . ARG A 1 86 ? 3.312   -16.326 -5.825  1.00 0.00 1  642  ARG A NH1  6  
ATOM 9622  N NH2  . ARG A 1 86 ? 3.708   -16.791 -8.029  1.00 0.00 ?  642  ARG A NH2  6  
ATOM 9623  H H    . ARG A 1 86 ? 6.344   -9.924  -3.846  1.00 0.00 ?  642  ARG A H    6  
ATOM 9624  H HA   . ARG A 1 86 ? 7.053   -12.320 -5.031  1.00 0.00 ?  642  ARG A HA   6  
ATOM 9625  H HB2  . ARG A 1 86 ? 4.837   -11.998 -4.177  1.00 0.00 ?  642  ARG A HB2  6  
ATOM 9626  H HB3  . ARG A 1 86 ? 4.535   -10.689 -5.319  1.00 0.00 ?  642  ARG A HB3  6  
ATOM 9627  H HG2  . ARG A 1 86 ? 3.393   -12.682 -6.062  1.00 0.00 ?  642  ARG A HG2  6  
ATOM 9628  H HG3  . ARG A 1 86 ? 4.720   -12.314 -7.165  1.00 0.00 ?  642  ARG A HG3  6  
ATOM 9629  H HD2  . ARG A 1 86 ? 6.107   -13.971 -5.891  1.00 0.00 ?  642  ARG A HD2  6  
ATOM 9630  H HD3  . ARG A 1 86 ? 4.639   -14.443 -5.038  1.00 0.00 ?  642  ARG A HD3  6  
ATOM 9631  H HE   . ARG A 1 86 ? 5.099   -14.681 -7.928  1.00 0.00 ?  642  ARG A HE   6  
ATOM 9632  H HH11 . ARG A 1 86 ? 3.427   -15.767 -5.001  1.00 0.00 ?  642  ARG A HH11 6  
ATOM 9633  H HH12 . ARG A 1 86 ? 2.696   -17.114 -5.730  1.00 0.00 ?  642  ARG A HH12 6  
ATOM 9634  H HH21 . ARG A 1 86 ? 4.129   -16.580 -8.917  1.00 0.00 ?  642  ARG A HH21 6  
ATOM 9635  H HH22 . ARG A 1 86 ? 3.138   -17.615 -7.991  1.00 0.00 ?  642  ARG A HH22 6  
ATOM 9636  N N    . LYS A 1 87 ? 7.512   -12.036 -7.380  1.00 0.00 ?  643  LYS A N    6  
ATOM 9637  C CA   . LYS A 1 87 ? 7.829   -11.960 -8.753  1.00 0.00 ?  643  LYS A CA   6  
ATOM 9638  C C    . LYS A 1 87 ? 6.718   -12.681 -9.484  1.00 0.00 ?  643  LYS A C    6  
ATOM 9639  O O    . LYS A 1 87 ? 5.970   -12.049 -10.238 1.00 0.00 ?  643  LYS A O    6  
ATOM 9640  C CB   . LYS A 1 87 ? 9.167   -12.638 -9.035  1.00 0.00 ?  643  LYS A CB   6  
ATOM 9641  C CG   . LYS A 1 87 ? 9.619   -12.480 -10.464 1.00 0.00 ?  643  LYS A CG   6  
ATOM 9642  C CD   . LYS A 1 87 ? 10.834  -13.318 -10.773 1.00 0.00 ?  643  LYS A CD   6  
ATOM 9643  C CE   . LYS A 1 87 ? 11.255  -13.128 -12.213 1.00 0.00 ?  643  LYS A CE   6  
ATOM 9644  N NZ   . LYS A 1 87 ? 10.135  -13.376 -13.148 1.00 0.00 1  643  LYS A NZ   6  
ATOM 9645  O OXT  . LYS A 1 87 ? 6.519   -13.886 -9.215  1.00 0.00 ?  643  LYS A OXT  6  
ATOM 9646  H H    . LYS A 1 87 ? 7.750   -12.857 -6.904  1.00 0.00 ?  643  LYS A H    6  
ATOM 9647  H HA   . LYS A 1 87 ? 7.863   -10.924 -9.057  1.00 0.00 ?  643  LYS A HA   6  
ATOM 9648  H HB2  . LYS A 1 87 ? 9.923   -12.218 -8.387  1.00 0.00 ?  643  LYS A HB2  6  
ATOM 9649  H HB3  . LYS A 1 87 ? 9.079   -13.693 -8.827  1.00 0.00 ?  643  LYS A HB3  6  
ATOM 9650  H HG2  . LYS A 1 87 ? 8.816   -12.781 -11.121 1.00 0.00 ?  643  LYS A HG2  6  
ATOM 9651  H HG3  . LYS A 1 87 ? 9.854   -11.440 -10.639 1.00 0.00 ?  643  LYS A HG3  6  
ATOM 9652  H HD2  . LYS A 1 87 ? 11.647  -13.022 -10.126 1.00 0.00 ?  643  LYS A HD2  6  
ATOM 9653  H HD3  . LYS A 1 87 ? 10.598  -14.359 -10.608 1.00 0.00 ?  643  LYS A HD3  6  
ATOM 9654  H HE2  . LYS A 1 87 ? 11.599  -12.112 -12.340 1.00 0.00 ?  643  LYS A HE2  6  
ATOM 9655  H HE3  . LYS A 1 87 ? 12.061  -13.814 -12.434 1.00 0.00 ?  643  LYS A HE3  6  
ATOM 9656  H HZ1  . LYS A 1 87 ? 9.735   -14.324 -13.004 1.00 0.00 ?  643  LYS A HZ1  6  
ATOM 9657  H HZ2  . LYS A 1 87 ? 10.479  -13.321 -14.128 1.00 0.00 ?  643  LYS A HZ2  6  
ATOM 9658  H HZ3  . LYS A 1 87 ? 9.387   -12.663 -13.027 1.00 0.00 ?  643  LYS A HZ3  6  
ATOM 9659  N N    . ARG B 2 1  ? -4.119  6.108   -18.053 1.00 0.00 ?  1591 ARG B N    6  
ATOM 9660  C CA   . ARG B 2 1  ? -4.982  5.254   -17.223 1.00 0.00 ?  1591 ARG B CA   6  
ATOM 9661  C C    . ARG B 2 1  ? -4.241  4.838   -15.952 1.00 0.00 ?  1591 ARG B C    6  
ATOM 9662  O O    . ARG B 2 1  ? -4.665  3.928   -15.248 1.00 0.00 ?  1591 ARG B O    6  
ATOM 9663  C CB   . ARG B 2 1  ? -5.381  3.994   -18.012 1.00 0.00 ?  1591 ARG B CB   6  
ATOM 9664  C CG   . ARG B 2 1  ? -4.207  3.065   -18.316 1.00 0.00 ?  1591 ARG B CG   6  
ATOM 9665  C CD   . ARG B 2 1  ? -4.625  1.864   -19.142 1.00 0.00 ?  1591 ARG B CD   6  
ATOM 9666  N NE   . ARG B 2 1  ? -3.499  0.949   -19.364 1.00 0.00 ?  1591 ARG B NE   6  
ATOM 9667  C CZ   . ARG B 2 1  ? -2.801  0.840   -20.505 1.00 0.00 ?  1591 ARG B CZ   6  
ATOM 9668  N NH1  . ARG B 2 1  ? -3.026  1.686   -21.510 1.00 0.00 1  1591 ARG B NH1  6  
ATOM 9669  N NH2  . ARG B 2 1  ? -1.859  -0.090  -20.618 1.00 0.00 ?  1591 ARG B NH2  6  
ATOM 9670  H H1   . ARG B 2 1  ? -4.602  6.370   -18.936 1.00 0.00 ?  1591 ARG B H1   6  
ATOM 9671  H HA   . ARG B 2 1  ? -5.871  5.806   -16.958 1.00 0.00 ?  1591 ARG B HA   6  
ATOM 9672  H HB2  . ARG B 2 1  ? -6.110  3.443   -17.439 1.00 0.00 ?  1591 ARG B HB2  6  
ATOM 9673  H HB3  . ARG B 2 1  ? -5.823  4.295   -18.950 1.00 0.00 ?  1591 ARG B HB3  6  
ATOM 9674  H HG2  . ARG B 2 1  ? -3.455  3.615   -18.864 1.00 0.00 ?  1591 ARG B HG2  6  
ATOM 9675  H HG3  . ARG B 2 1  ? -3.790  2.723   -17.381 1.00 0.00 ?  1591 ARG B HG3  6  
ATOM 9676  H HD2  . ARG B 2 1  ? -5.406  1.337   -18.615 1.00 0.00 ?  1591 ARG B HD2  6  
ATOM 9677  H HD3  . ARG B 2 1  ? -5.002  2.199   -20.097 1.00 0.00 ?  1591 ARG B HD3  6  
ATOM 9678  H HE   . ARG B 2 1  ? -3.296  0.366   -18.596 1.00 0.00 ?  1591 ARG B HE   6  
ATOM 9679  H HH11 . ARG B 2 1  ? -3.706  2.422   -21.454 1.00 0.00 ?  1591 ARG B HH11 6  
ATOM 9680  H HH12 . ARG B 2 1  ? -2.528  1.642   -22.381 1.00 0.00 ?  1591 ARG B HH12 6  
ATOM 9681  H HH21 . ARG B 2 1  ? -1.656  -0.721  -19.861 1.00 0.00 ?  1591 ARG B HH21 6  
ATOM 9682  H HH22 . ARG B 2 1  ? -1.296  -0.221  -21.439 1.00 0.00 ?  1591 ARG B HH22 6  
ATOM 9683  N N    . SER B 2 2  ? -3.166  5.520   -15.632 1.00 0.00 ?  1592 SER B N    6  
ATOM 9684  C CA   . SER B 2 2  ? -2.329  5.077   -14.556 1.00 0.00 ?  1592 SER B CA   6  
ATOM 9685  C C    . SER B 2 2  ? -2.358  6.014   -13.346 1.00 0.00 ?  1592 SER B C    6  
ATOM 9686  O O    . SER B 2 2  ? -1.480  5.938   -12.482 1.00 0.00 ?  1592 SER B O    6  
ATOM 9687  C CB   . SER B 2 2  ? -0.919  4.890   -15.091 1.00 0.00 ?  1592 SER B CB   6  
ATOM 9688  O OG   . SER B 2 2  ? -0.951  4.033   -16.234 1.00 0.00 ?  1592 SER B OG   6  
ATOM 9689  H H    . SER B 2 2  ? -2.903  6.344   -16.097 1.00 0.00 ?  1592 SER B H    6  
ATOM 9690  H HA   . SER B 2 2  ? -2.691  4.108   -14.247 1.00 0.00 ?  1592 SER B HA   6  
ATOM 9691  H HB2  . SER B 2 2  ? -0.510  5.847   -15.376 1.00 0.00 ?  1592 SER B HB2  6  
ATOM 9692  H HB3  . SER B 2 2  ? -0.298  4.435   -14.334 1.00 0.00 ?  1592 SER B HB3  6  
ATOM 9693  H HG   . SER B 2 2  ? -0.208  4.262   -16.805 1.00 0.00 ?  1592 SER B HG   6  
ATOM 9694  N N    . VAL B 2 3  ? -3.361  6.883   -13.263 1.00 0.00 ?  1593 VAL B N    6  
ATOM 9695  C CA   . VAL B 2 3  ? -3.502  7.741   -12.090 1.00 0.00 ?  1593 VAL B CA   6  
ATOM 9696  C C    . VAL B 2 3  ? -4.669  7.241   -11.248 1.00 0.00 ?  1593 VAL B C    6  
ATOM 9697  O O    . VAL B 2 3  ? -5.367  6.304   -11.672 1.00 0.00 ?  1593 VAL B O    6  
ATOM 9698  C CB   . VAL B 2 3  ? -3.664  9.267   -12.419 1.00 0.00 ?  1593 VAL B CB   6  
ATOM 9699  C CG1  . VAL B 2 3  ? -2.518  9.765   -13.284 1.00 0.00 ?  1593 VAL B CG1  6  
ATOM 9700  C CG2  . VAL B 2 3  ? -5.014  9.596   -13.050 1.00 0.00 ?  1593 VAL B CG2  6  
ATOM 9701  H H    . VAL B 2 3  ? -4.037  6.920   -13.973 1.00 0.00 ?  1593 VAL B H    6  
ATOM 9702  H HA   . VAL B 2 3  ? -2.604  7.591   -11.504 1.00 0.00 ?  1593 VAL B HA   6  
ATOM 9703  H HB   . VAL B 2 3  ? -3.585  9.796   -11.480 1.00 0.00 ?  1593 VAL B HB   6  
ATOM 9704  H HG11 . VAL B 2 3  ? -2.505  9.217   -14.216 1.00 0.00 ?  1593 VAL B HG11 6  
ATOM 9705  H HG12 . VAL B 2 3  ? -1.583  9.612   -12.766 1.00 0.00 ?  1593 VAL B HG12 6  
ATOM 9706  H HG13 . VAL B 2 3  ? -2.651  10.817  -13.488 1.00 0.00 ?  1593 VAL B HG13 6  
ATOM 9707  H HG21 . VAL B 2 3  ? -5.106  9.087   -13.996 1.00 0.00 ?  1593 VAL B HG21 6  
ATOM 9708  H HG22 . VAL B 2 3  ? -5.095  10.663  -13.201 1.00 0.00 ?  1593 VAL B HG22 6  
ATOM 9709  H HG23 . VAL B 2 3  ? -5.803  9.266   -12.390 1.00 0.00 ?  1593 VAL B HG23 6  
ATOM 9710  N N    . LYS B 2 4  ? -4.879  7.869   -10.086 1.00 0.00 ?  1594 LYS B N    6  
ATOM 9711  C CA   . LYS B 2 4  ? -5.905  7.485   -9.111  1.00 0.00 ?  1594 LYS B CA   6  
ATOM 9712  C C    . LYS B 2 4  ? -5.513  6.285   -8.322  1.00 0.00 ?  1594 LYS B C    6  
ATOM 9713  O O    . LYS B 2 4  ? -5.588  5.142   -8.786  1.00 0.00 ?  1594 LYS B O    6  
ATOM 9714  C CB   . LYS B 2 4  ? -7.327  7.336   -9.697  1.00 0.00 ?  1594 LYS B CB   6  
ATOM 9715  C CG   . LYS B 2 4  ? -7.959  8.644   -10.086 1.00 0.00 ?  1594 LYS B CG   6  
ATOM 9716  C CD   . LYS B 2 4  ? -9.433  8.483   -10.382 1.00 0.00 ?  1594 LYS B CD   6  
ATOM 9717  C CE   . LYS B 2 4  ? -10.120 9.831   -10.360 1.00 0.00 ?  1594 LYS B CE   6  
ATOM 9718  N NZ   . LYS B 2 4  ? -10.050 10.459  -9.012  1.00 0.00 1  1594 LYS B NZ   6  
ATOM 9719  H H    . LYS B 2 4  ? -4.310  8.634   -9.854  1.00 0.00 ?  1594 LYS B H    6  
ATOM 9720  H HA   . LYS B 2 4  ? -5.939  8.247   -8.338  1.00 0.00 ?  1594 LYS B HA   6  
ATOM 9721  H HB2  . LYS B 2 4  ? -7.273  6.711   -10.575 1.00 0.00 ?  1594 LYS B HB2  6  
ATOM 9722  H HB3  . LYS B 2 4  ? -7.953  6.855   -8.961  1.00 0.00 ?  1594 LYS B HB3  6  
ATOM 9723  H HG2  . LYS B 2 4  ? -7.834  9.344   -9.273  1.00 0.00 ?  1594 LYS B HG2  6  
ATOM 9724  H HG3  . LYS B 2 4  ? -7.461  9.027   -10.966 1.00 0.00 ?  1594 LYS B HG3  6  
ATOM 9725  H HD2  . LYS B 2 4  ? -9.551  8.039   -11.359 1.00 0.00 ?  1594 LYS B HD2  6  
ATOM 9726  H HD3  . LYS B 2 4  ? -9.881  7.847   -9.633  1.00 0.00 ?  1594 LYS B HD3  6  
ATOM 9727  H HE2  . LYS B 2 4  ? -9.637  10.477  -11.077 1.00 0.00 ?  1594 LYS B HE2  6  
ATOM 9728  H HE3  . LYS B 2 4  ? -11.156 9.702   -10.634 1.00 0.00 ?  1594 LYS B HE3  6  
ATOM 9729  H HZ1  . LYS B 2 4  ? -10.675 9.962   -8.347  1.00 0.00 ?  1594 LYS B HZ1  6  
ATOM 9730  H HZ2  . LYS B 2 4  ? -10.320 11.462  -9.056  1.00 0.00 ?  1594 LYS B HZ2  6  
ATOM 9731  H HZ3  . LYS B 2 4  ? -9.083  10.416  -8.618  1.00 0.00 ?  1594 LYS B HZ3  6  
ATOM 9732  N N    . VAL B 2 5  ? -5.059  6.546   -7.134  1.00 0.00 ?  1595 VAL B N    6  
ATOM 9733  C CA   . VAL B 2 5  ? -4.731  5.512   -6.223  1.00 0.00 ?  1595 VAL B CA   6  
ATOM 9734  C C    . VAL B 2 5  ? -6.034  5.000   -5.616  1.00 0.00 ?  1595 VAL B C    6  
ATOM 9735  O O    . VAL B 2 5  ? -6.538  5.551   -4.632  1.00 0.00 ?  1595 VAL B O    6  
ATOM 9736  C CB   . VAL B 2 5  ? -3.750  5.963   -5.095  1.00 0.00 ?  1595 VAL B CB   6  
ATOM 9737  C CG1  . VAL B 2 5  ? -2.935  4.776   -4.584  1.00 0.00 ?  1595 VAL B CG1  6  
ATOM 9738  C CG2  . VAL B 2 5  ? -2.881  7.160   -5.527  1.00 0.00 ?  1595 VAL B CG2  6  
ATOM 9739  H H    . VAL B 2 5  ? -4.941  7.481   -6.874  1.00 0.00 ?  1595 VAL B H    6  
ATOM 9740  H HA   . VAL B 2 5  ? -4.284  4.711   -6.794  1.00 0.00 ?  1595 VAL B HA   6  
ATOM 9741  H HB   . VAL B 2 5  ? -4.297  6.249   -4.201  1.00 0.00 ?  1595 VAL B HB   6  
ATOM 9742  H HG11 . VAL B 2 5  ? -2.542  4.133   -5.357  1.00 0.00 ?  1595 VAL B HG11 6  
ATOM 9743  H HG12 . VAL B 2 5  ? -3.566  4.153   -3.973  1.00 0.00 ?  1595 VAL B HG12 6  
ATOM 9744  H HG13 . VAL B 2 5  ? -2.118  5.144   -3.980  1.00 0.00 ?  1595 VAL B HG13 6  
ATOM 9745  H HG21 . VAL B 2 5  ? -2.226  7.423   -4.700  1.00 0.00 ?  1595 VAL B HG21 6  
ATOM 9746  H HG22 . VAL B 2 5  ? -3.572  7.974   -5.728  1.00 0.00 ?  1595 VAL B HG22 6  
ATOM 9747  H HG23 . VAL B 2 5  ? -2.318  6.944   -6.433  1.00 0.00 ?  1595 VAL B HG23 6  
ATOM 9748  N N    . LYS B 2 6  ? -6.632  4.073   -6.341  1.00 0.00 ?  1596 LYS B N    6  
ATOM 9749  C CA   . LYS B 2 6  ? -7.822  3.311   -5.979  1.00 0.00 ?  1596 LYS B CA   6  
ATOM 9750  C C    . LYS B 2 6  ? -7.577  1.931   -6.545  1.00 0.00 ?  1596 LYS B C    6  
ATOM 9751  O O    . LYS B 2 6  ? -7.817  1.715   -7.729  1.00 0.00 ?  1596 LYS B O    6  
ATOM 9752  C CB   . LYS B 2 6  ? -9.104  3.892   -6.617  1.00 0.00 ?  1596 LYS B CB   6  
ATOM 9753  C CG   . LYS B 2 6  ? -9.541  5.280   -6.143  1.00 0.00 ?  1596 LYS B CG   6  
ATOM 9754  C CD   . LYS B 2 6  ? -10.238 5.279   -4.771  1.00 0.00 ?  1596 LYS B CD   6  
ATOM 9755  C CE   . LYS B 2 6  ? -10.714 6.686   -4.433  1.00 0.00 ?  1596 LYS B CE   6  
ATOM 9756  N NZ   . LYS B 2 6  ? -9.599  7.653   -4.348  1.00 0.00 1  1596 LYS B NZ   6  
ATOM 9757  H H    . LYS B 2 6  ? -6.232  3.894   -7.221  1.00 0.00 ?  1596 LYS B H    6  
ATOM 9758  H HA   . LYS B 2 6  ? -7.900  3.266   -4.902  1.00 0.00 ?  1596 LYS B HA   6  
ATOM 9759  H HB2  . LYS B 2 6  ? -8.952  3.947   -7.685  1.00 0.00 ?  1596 LYS B HB2  6  
ATOM 9760  H HB3  . LYS B 2 6  ? -9.913  3.201   -6.429  1.00 0.00 ?  1596 LYS B HB3  6  
ATOM 9761  H HG2  . LYS B 2 6  ? -8.665  5.909   -6.079  1.00 0.00 ?  1596 LYS B HG2  6  
ATOM 9762  H HG3  . LYS B 2 6  ? -10.215 5.694   -6.880  1.00 0.00 ?  1596 LYS B HG3  6  
ATOM 9763  H HD2  . LYS B 2 6  ? -11.114 4.651   -4.831  1.00 0.00 ?  1596 LYS B HD2  6  
ATOM 9764  H HD3  . LYS B 2 6  ? -9.637  4.918   -3.947  1.00 0.00 ?  1596 LYS B HD3  6  
ATOM 9765  H HE2  . LYS B 2 6  ? -11.399 7.016   -5.200  1.00 0.00 ?  1596 LYS B HE2  6  
ATOM 9766  H HE3  . LYS B 2 6  ? -11.229 6.659   -3.485  1.00 0.00 ?  1596 LYS B HE3  6  
ATOM 9767  H HZ1  . LYS B 2 6  ? -9.968  8.581   -4.053  1.00 0.00 ?  1596 LYS B HZ1  6  
ATOM 9768  H HZ2  . LYS B 2 6  ? -9.143  7.789   -5.281  1.00 0.00 ?  1596 LYS B HZ2  6  
ATOM 9769  H HZ3  . LYS B 2 6  ? -8.901  7.348   -3.643  1.00 0.00 ?  1596 LYS B HZ3  6  
ATOM 9770  N N    . ILE B 2 7  ? -7.028  1.029   -5.730  1.00 0.00 ?  1597 ILE B N    6  
ATOM 9771  C CA   . ILE B 2 7  ? -6.564  -0.262  -6.246  1.00 0.00 ?  1597 ILE B CA   6  
ATOM 9772  C C    . ILE B 2 7  ? -7.621  -1.107  -7.014  1.00 0.00 ?  1597 ILE B C    6  
ATOM 9773  O O    . ILE B 2 7  ? -7.550  -1.189  -8.229  1.00 0.00 ?  1597 ILE B O    6  
ATOM 9774  C CB   . ILE B 2 7  ? -5.759  -1.156  -5.213  1.00 0.00 ?  1597 ILE B CB   6  
ATOM 9775  C CG1  . ILE B 2 7  ? -5.022  -2.266  -5.904  1.00 0.00 ?  1597 ILE B CG1  6  
ATOM 9776  C CG2  . ILE B 2 7  ? -6.642  -1.791  -4.176  1.00 0.00 ?  1597 ILE B CG2  6  
ATOM 9777  C CD1  . ILE B 2 7  ? -4.070  -1.819  -7.005  1.00 0.00 ?  1597 ILE B CD1  6  
ATOM 9778  H H    . ILE B 2 7  ? -6.890  1.299   -4.800  1.00 0.00 ?  1597 ILE B H    6  
ATOM 9779  H HA   . ILE B 2 7  ? -5.841  0.082   -6.970  1.00 0.00 ?  1597 ILE B HA   6  
ATOM 9780  H HB   . ILE B 2 7  ? -5.029  -0.539  -4.711  1.00 0.00 ?  1597 ILE B HB   6  
ATOM 9781  H HG12 . ILE B 2 7  ? -4.452  -2.704  -5.094  1.00 0.00 ?  1597 ILE B HG12 6  
ATOM 9782  H HG13 . ILE B 2 7  ? -5.729  -2.988  -6.287  1.00 0.00 ?  1597 ILE B HG13 6  
ATOM 9783  H HG21 . ILE B 2 7  ? -7.544  -2.168  -4.633  1.00 0.00 ?  1597 ILE B HG21 6  
ATOM 9784  H HG22 . ILE B 2 7  ? -6.841  -1.081  -3.392  1.00 0.00 ?  1597 ILE B HG22 6  
ATOM 9785  H HG23 . ILE B 2 7  ? -6.140  -2.629  -3.711  1.00 0.00 ?  1597 ILE B HG23 6  
ATOM 9786  H HD11 . ILE B 2 7  ? -3.353  -1.117  -6.607  1.00 0.00 ?  1597 ILE B HD11 6  
ATOM 9787  H HD12 . ILE B 2 7  ? -4.625  -1.361  -7.809  1.00 0.00 ?  1597 ILE B HD12 6  
ATOM 9788  H HD13 . ILE B 2 7  ? -3.548  -2.684  -7.385  1.00 0.00 ?  1597 ILE B HD13 6  
ATOM 9789  N N    . LYS B 2 8  ? -8.631  -1.638  -6.294  1.00 0.00 ?  1598 LYS B N    6  
ATOM 9790  C CA   . LYS B 2 8  ? -9.532  -2.661  -6.797  1.00 0.00 ?  1598 LYS B CA   6  
ATOM 9791  C C    . LYS B 2 8  ? -8.748  -3.756  -7.533  1.00 0.00 ?  1598 LYS B C    6  
ATOM 9792  O O    . LYS B 2 8  ? -8.566  -3.701  -8.752  1.00 0.00 ?  1598 LYS B O    6  
ATOM 9793  C CB   . LYS B 2 8  ? -10.732 -2.123  -7.596  1.00 0.00 ?  1598 LYS B CB   6  
ATOM 9794  C CG   . LYS B 2 8  ? -11.746 -1.256  -6.809  1.00 0.00 ?  1598 LYS B CG   6  
ATOM 9795  C CD   . LYS B 2 8  ? -11.331 0.205   -6.683  1.00 0.00 ?  1598 LYS B CD   6  
ATOM 9796  C CE   . LYS B 2 8  ? -12.446 1.050   -6.184  1.00 0.00 ?  1598 LYS B CE   6  
ATOM 9797  N NZ   . LYS B 2 8  ? -13.657 1.030   -7.033  1.00 0.00 1  1598 LYS B NZ   6  
ATOM 9798  H H    . LYS B 2 8  ? -8.786  -1.330  -5.380  1.00 0.00 ?  1598 LYS B H    6  
ATOM 9799  H HA   . LYS B 2 8  ? -9.892  -3.162  -5.905  1.00 0.00 ?  1598 LYS B HA   6  
ATOM 9800  H HB2  . LYS B 2 8  ? -10.351 -1.523  -8.409  1.00 0.00 ?  1598 LYS B HB2  6  
ATOM 9801  H HB3  . LYS B 2 8  ? -11.263 -2.965  -8.012  1.00 0.00 ?  1598 LYS B HB3  6  
ATOM 9802  H HG2  . LYS B 2 8  ? -12.723 -1.295  -7.261  1.00 0.00 ?  1598 LYS B HG2  6  
ATOM 9803  H HG3  . LYS B 2 8  ? -11.817 -1.633  -5.794  1.00 0.00 ?  1598 LYS B HG3  6  
ATOM 9804  H HD2  . LYS B 2 8  ? -10.725 0.256   -5.784  1.00 0.00 ?  1598 LYS B HD2  6  
ATOM 9805  H HD3  . LYS B 2 8  ? -10.881 0.640   -7.561  1.00 0.00 ?  1598 LYS B HD3  6  
ATOM 9806  H HE2  . LYS B 2 8  ? -12.630 0.534   -5.254  1.00 0.00 ?  1598 LYS B HE2  6  
ATOM 9807  H HE3  . LYS B 2 8  ? -12.072 2.039   -5.963  1.00 0.00 ?  1598 LYS B HE3  6  
ATOM 9808  H HZ1  . LYS B 2 8  ? -14.061 0.072   -7.088  1.00 0.00 ?  1598 LYS B HZ1  6  
ATOM 9809  H HZ2  . LYS B 2 8  ? -13.473 1.332   -8.009  1.00 0.00 ?  1598 LYS B HZ2  6  
ATOM 9810  H HZ3  . LYS B 2 8  ? -14.408 1.643   -6.654  1.00 0.00 ?  1598 LYS B HZ3  6  
ATOM 9811  N N    . LEU B 2 9  ? -8.213  -4.696  -6.750  1.00 0.00 ?  1599 LEU B N    6  
ATOM 9812  C CA   . LEU B 2 9  ? -7.362  -5.762  -7.272  1.00 0.00 ?  1599 LEU B CA   6  
ATOM 9813  C C    . LEU B 2 9  ? -8.101  -6.546  -8.360  1.00 0.00 ?  1599 LEU B C    6  
ATOM 9814  O O    . LEU B 2 9  ? -9.102  -7.215  -8.086  1.00 0.00 ?  1599 LEU B O    6  
ATOM 9815  C CB   . LEU B 2 9  ? -6.890  -6.709  -6.127  1.00 0.00 ?  1599 LEU B CB   6  
ATOM 9816  C CG   . LEU B 2 9  ? -5.377  -6.939  -5.995  1.00 0.00 ?  1599 LEU B CG   6  
ATOM 9817  C CD1  . LEU B 2 9  ? -4.784  -7.628  -7.202  1.00 0.00 ?  1599 LEU B CD1  6  
ATOM 9818  C CD2  . LEU B 2 9  ? -4.649  -5.660  -5.719  1.00 0.00 ?  1599 LEU B CD2  6  
ATOM 9819  H H    . LEU B 2 9  ? -8.419  -4.680  -5.793  1.00 0.00 ?  1599 LEU B H    6  
ATOM 9820  H HA   . LEU B 2 9  ? -6.493  -5.283  -7.699  1.00 0.00 ?  1599 LEU B HA   6  
ATOM 9821  H HB2  . LEU B 2 9  ? -7.234  -6.383  -5.161  1.00 0.00 ?  1599 LEU B HB2  6  
ATOM 9822  H HB3  . LEU B 2 9  ? -7.351  -7.678  -6.239  1.00 0.00 ?  1599 LEU B HB3  6  
ATOM 9823  H HG   . LEU B 2 9  ? -5.248  -7.557  -5.117  1.00 0.00 ?  1599 LEU B HG   6  
ATOM 9824  H HD11 . LEU B 2 9  ? -5.249  -8.595  -7.333  1.00 0.00 ?  1599 LEU B HD11 6  
ATOM 9825  H HD12 . LEU B 2 9  ? -3.722  -7.757  -7.059  1.00 0.00 ?  1599 LEU B HD12 6  
ATOM 9826  H HD13 . LEU B 2 9  ? -4.959  -7.023  -8.077  1.00 0.00 ?  1599 LEU B HD13 6  
ATOM 9827  H HD21 . LEU B 2 9  ? -4.965  -5.310  -4.747  1.00 0.00 ?  1599 LEU B HD21 6  
ATOM 9828  H HD22 . LEU B 2 9  ? -4.858  -4.918  -6.475  1.00 0.00 ?  1599 LEU B HD22 6  
ATOM 9829  H HD23 . LEU B 2 9  ? -3.587  -5.860  -5.680  1.00 0.00 ?  1599 LEU B HD23 6  
ATOM 9830  N N    . GLY B 2 10 ? -7.645  -6.405  -9.587  1.00 0.00 ?  1600 GLY B N    6  
ATOM 9831  C CA   . GLY B 2 10 ? -8.254  -7.097  -10.688 1.00 0.00 ?  1600 GLY B CA   6  
ATOM 9832  C C    . GLY B 2 10 ? -9.047  -6.180  -11.607 1.00 0.00 ?  1600 GLY B C    6  
ATOM 9833  O O    . GLY B 2 10 ? -9.530  -6.620  -12.650 1.00 0.00 ?  1600 GLY B O    6  
ATOM 9834  H H    . GLY B 2 10 ? -6.866  -5.831  -9.761  1.00 0.00 ?  1600 GLY B H    6  
ATOM 9835  H HA2  . GLY B 2 10 ? -7.479  -7.582  -11.261 1.00 0.00 ?  1600 GLY B HA2  6  
ATOM 9836  H HA3  . GLY B 2 10 ? -8.918  -7.855  -10.297 1.00 0.00 ?  1600 GLY B HA3  6  
ATOM 9837  N N    . ARG B 2 11 ? -9.172  -4.914  -11.245 1.00 0.00 ?  1601 ARG B N    6  
ATOM 9838  C CA   . ARG B 2 11 ? -9.951  -3.968  -12.042 1.00 0.00 ?  1601 ARG B CA   6  
ATOM 9839  C C    . ARG B 2 11 ? -9.155  -3.482  -13.247 1.00 0.00 ?  1601 ARG B C    6  
ATOM 9840  O O    . ARG B 2 11 ? -8.283  -2.617  -13.110 1.00 0.00 ?  1601 ARG B O    6  
ATOM 9841  C CB   . ARG B 2 11 ? -10.352 -2.746  -11.228 1.00 0.00 ?  1601 ARG B CB   6  
ATOM 9842  C CG   . ARG B 2 11 ? -11.410 -1.887  -11.903 1.00 0.00 ?  1601 ARG B CG   6  
ATOM 9843  C CD   . ARG B 2 11 ? -11.436 -0.486  -11.331 1.00 0.00 ?  1601 ARG B CD   6  
ATOM 9844  N NE   . ARG B 2 11 ? -10.332 0.338   -11.861 1.00 0.00 ?  1601 ARG B NE   6  
ATOM 9845  C CZ   . ARG B 2 11 ? -9.370  0.937   -11.145 1.00 0.00 ?  1601 ARG B CZ   6  
ATOM 9846  N NH1  . ARG B 2 11 ? -9.210  0.646   -9.860  1.00 0.00 1  1601 ARG B NH1  6  
ATOM 9847  N NH2  . ARG B 2 11 ? -8.537  1.775   -11.739 1.00 0.00 ?  1601 ARG B NH2  6  
ATOM 9848  H H    . ARG B 2 11 ? -8.746  -4.601  -10.415 1.00 0.00 ?  1601 ARG B H    6  
ATOM 9849  H HA   . ARG B 2 11 ? -10.844 -4.468  -12.381 1.00 0.00 ?  1601 ARG B HA   6  
ATOM 9850  H HB2  . ARG B 2 11 ? -10.736 -3.073  -10.273 1.00 0.00 ?  1601 ARG B HB2  6  
ATOM 9851  H HB3  . ARG B 2 11 ? -9.476  -2.135  -11.064 1.00 0.00 ?  1601 ARG B HB3  6  
ATOM 9852  H HG2  . ARG B 2 11 ? -11.186 -1.828  -12.957 1.00 0.00 ?  1601 ARG B HG2  6  
ATOM 9853  H HG3  . ARG B 2 11 ? -12.378 -2.347  -11.764 1.00 0.00 ?  1601 ARG B HG3  6  
ATOM 9854  H HD2  . ARG B 2 11 ? -12.374 -0.022  -11.591 1.00 0.00 ?  1601 ARG B HD2  6  
ATOM 9855  H HD3  . ARG B 2 11 ? -11.346 -0.543  -10.256 1.00 0.00 ?  1601 ARG B HD3  6  
ATOM 9856  H HE   . ARG B 2 11 ? -10.383 0.485   -12.834 1.00 0.00 ?  1601 ARG B HE   6  
ATOM 9857  H HH11 . ARG B 2 11 ? -9.794  -0.022  -9.402  1.00 0.00 ?  1601 ARG B HH11 6  
ATOM 9858  H HH12 . ARG B 2 11 ? -8.489  1.063   -9.290  1.00 0.00 ?  1601 ARG B HH12 6  
ATOM 9859  H HH21 . ARG B 2 11 ? -8.603  1.979   -12.721 1.00 0.00 ?  1601 ARG B HH21 6  
ATOM 9860  H HH22 . ARG B 2 11 ? -7.796  2.262   -11.263 1.00 0.00 ?  1601 ARG B HH22 6  
ATOM 9861  N N    . LYS B 2 12 ? -9.424  -4.048  -14.398 1.00 0.00 ?  1602 LYS B N    6  
ATOM 9862  C CA   . LYS B 2 12 ? -8.788  -3.639  -15.654 1.00 0.00 ?  1602 LYS B CA   6  
ATOM 9863  C C    . LYS B 2 12 ? -9.774  -3.778  -16.796 1.00 0.00 ?  1602 LYS B C    6  
ATOM 9864  O O    . LYS B 2 12 ? -10.993 -3.895  -16.551 1.00 0.00 ?  1602 LYS B O    6  
ATOM 9865  C CB   . LYS B 2 12 ? -7.490  -4.434  -15.959 1.00 0.00 ?  1602 LYS B CB   6  
ATOM 9866  C CG   . LYS B 2 12 ? -6.339  -4.159  -14.992 1.00 0.00 ?  1602 LYS B CG   6  
ATOM 9867  C CD   . LYS B 2 12 ? -5.071  -4.903  -15.373 1.00 0.00 ?  1602 LYS B CD   6  
ATOM 9868  C CE   . LYS B 2 12 ? -3.933  -4.611  -14.393 1.00 0.00 ?  1602 LYS B CE   6  
ATOM 9869  N NZ   . LYS B 2 12 ? -4.263  -5.003  -12.998 1.00 0.00 1  1602 LYS B NZ   6  
ATOM 9870  H H    . LYS B 2 12 ? -10.099 -4.760  -14.431 1.00 0.00 ?  1602 LYS B H    6  
ATOM 9871  H HA   . LYS B 2 12 ? -8.548  -2.590  -15.554 1.00 0.00 ?  1602 LYS B HA   6  
ATOM 9872  H HB2  . LYS B 2 12 ? -7.714  -5.490  -15.924 1.00 0.00 ?  1602 LYS B HB2  6  
ATOM 9873  H HB3  . LYS B 2 12 ? -7.160  -4.182  -16.956 1.00 0.00 ?  1602 LYS B HB3  6  
ATOM 9874  H HG2  . LYS B 2 12 ? -6.131  -3.100  -14.989 1.00 0.00 ?  1602 LYS B HG2  6  
ATOM 9875  H HG3  . LYS B 2 12 ? -6.645  -4.465  -14.002 1.00 0.00 ?  1602 LYS B HG3  6  
ATOM 9876  H HD2  . LYS B 2 12 ? -5.268  -5.963  -15.384 1.00 0.00 ?  1602 LYS B HD2  6  
ATOM 9877  H HD3  . LYS B 2 12 ? -4.766  -4.587  -16.359 1.00 0.00 ?  1602 LYS B HD3  6  
ATOM 9878  H HE2  . LYS B 2 12 ? -3.058  -5.160  -14.706 1.00 0.00 ?  1602 LYS B HE2  6  
ATOM 9879  H HE3  . LYS B 2 12 ? -3.713  -3.554  -14.419 1.00 0.00 ?  1602 LYS B HE3  6  
ATOM 9880  H HZ1  . LYS B 2 12 ? -3.458  -4.829  -12.363 1.00 0.00 ?  1602 LYS B HZ1  6  
ATOM 9881  H HZ2  . LYS B 2 12 ? -4.477  -6.019  -12.942 1.00 0.00 ?  1602 LYS B HZ2  6  
ATOM 9882  H HZ3  . LYS B 2 12 ? -5.083  -4.487  -12.624 1.00 0.00 ?  1602 LYS B HZ3  6  
ATOM 9883  N N    . ALA A 1 1  ? 29.489  22.218  -10.214 1.00 0.00 ?  557  ALA A N    7  
ATOM 9884  C CA   . ALA A 1 1  ? 30.268  22.318  -8.991  1.00 0.00 ?  557  ALA A CA   7  
ATOM 9885  C C    . ALA A 1 1  ? 29.744  21.353  -7.938  1.00 0.00 ?  557  ALA A C    7  
ATOM 9886  O O    . ALA A 1 1  ? 30.177  21.374  -6.789  1.00 0.00 ?  557  ALA A O    7  
ATOM 9887  C CB   . ALA A 1 1  ? 30.257  23.743  -8.461  1.00 0.00 ?  557  ALA A CB   7  
ATOM 9888  H H1   . ALA A 1 1  ? 29.547  21.363  -10.701 1.00 0.00 ?  557  ALA A H1   7  
ATOM 9889  H HA   . ALA A 1 1  ? 31.283  22.054  -9.245  1.00 0.00 ?  557  ALA A HA   7  
ATOM 9890  H HB1  . ALA A 1 1  ? 29.252  24.012  -8.172  1.00 0.00 ?  557  ALA A HB1  7  
ATOM 9891  H HB2  . ALA A 1 1  ? 30.602  24.418  -9.230  1.00 0.00 ?  557  ALA A HB2  7  
ATOM 9892  H HB3  . ALA A 1 1  ? 30.909  23.813  -7.603  1.00 0.00 ?  557  ALA A HB3  7  
ATOM 9893  N N    . SER A 1 2  ? 28.853  20.475  -8.352  1.00 0.00 ?  558  SER A N    7  
ATOM 9894  C CA   . SER A 1 2  ? 28.212  19.520  -7.474  1.00 0.00 ?  558  SER A CA   7  
ATOM 9895  C C    . SER A 1 2  ? 29.196  18.471  -6.914  1.00 0.00 ?  558  SER A C    7  
ATOM 9896  O O    . SER A 1 2  ? 28.867  17.726  -5.986  1.00 0.00 ?  558  SER A O    7  
ATOM 9897  C CB   . SER A 1 2  ? 27.046  18.878  -8.219  1.00 0.00 ?  558  SER A CB   7  
ATOM 9898  O OG   . SER A 1 2  ? 27.433  18.527  -9.553  1.00 0.00 ?  558  SER A OG   7  
ATOM 9899  H H    . SER A 1 2  ? 28.610  20.437  -9.302  1.00 0.00 ?  558  SER A H    7  
ATOM 9900  H HA   . SER A 1 2  ? 27.811  20.076  -6.639  1.00 0.00 ?  558  SER A HA   7  
ATOM 9901  H HB2  . SER A 1 2  ? 26.735  17.985  -7.697  1.00 0.00 ?  558  SER A HB2  7  
ATOM 9902  H HB3  . SER A 1 2  ? 26.222  19.574  -8.267  1.00 0.00 ?  558  SER A HB3  7  
ATOM 9903  H HG   . SER A 1 2  ? 27.568  17.569  -9.567  1.00 0.00 ?  558  SER A HG   7  
ATOM 9904  N N    . ALA A 1 3  ? 30.375  18.395  -7.499  1.00 0.00 ?  559  ALA A N    7  
ATOM 9905  C CA   . ALA A 1 3  ? 31.408  17.511  -7.017  1.00 0.00 ?  559  ALA A CA   7  
ATOM 9906  C C    . ALA A 1 3  ? 32.035  18.060  -5.737  1.00 0.00 ?  559  ALA A C    7  
ATOM 9907  O O    . ALA A 1 3  ? 32.180  17.346  -4.754  1.00 0.00 ?  559  ALA A O    7  
ATOM 9908  C CB   . ALA A 1 3  ? 32.467  17.288  -8.079  1.00 0.00 ?  559  ALA A CB   7  
ATOM 9909  H H    . ALA A 1 3  ? 30.541  18.946  -8.293  1.00 0.00 ?  559  ALA A H    7  
ATOM 9910  H HA   . ALA A 1 3  ? 30.945  16.562  -6.790  1.00 0.00 ?  559  ALA A HA   7  
ATOM 9911  H HB1  . ALA A 1 3  ? 32.004  16.918  -8.982  1.00 0.00 ?  559  ALA A HB1  7  
ATOM 9912  H HB2  . ALA A 1 3  ? 33.186  16.565  -7.721  1.00 0.00 ?  559  ALA A HB2  7  
ATOM 9913  H HB3  . ALA A 1 3  ? 32.971  18.220  -8.288  1.00 0.00 ?  559  ALA A HB3  7  
ATOM 9914  N N    . SER A 1 4  ? 32.374  19.334  -5.743  1.00 0.00 ?  560  SER A N    7  
ATOM 9915  C CA   . SER A 1 4  ? 33.023  19.940  -4.593  1.00 0.00 ?  560  SER A CA   7  
ATOM 9916  C C    . SER A 1 4  ? 31.988  20.523  -3.625  1.00 0.00 ?  560  SER A C    7  
ATOM 9917  O O    . SER A 1 4  ? 32.220  20.603  -2.408  1.00 0.00 ?  560  SER A O    7  
ATOM 9918  C CB   . SER A 1 4  ? 33.979  21.028  -5.069  1.00 0.00 ?  560  SER A CB   7  
ATOM 9919  O OG   . SER A 1 4  ? 34.833  20.523  -6.093  1.00 0.00 ?  560  SER A OG   7  
ATOM 9920  H H    . SER A 1 4  ? 32.187  19.880  -6.536  1.00 0.00 ?  560  SER A H    7  
ATOM 9921  H HA   . SER A 1 4  ? 33.592  19.175  -4.086  1.00 0.00 ?  560  SER A HA   7  
ATOM 9922  H HB2  . SER A 1 4  ? 33.413  21.859  -5.463  1.00 0.00 ?  560  SER A HB2  7  
ATOM 9923  H HB3  . SER A 1 4  ? 34.588  21.361  -4.241  1.00 0.00 ?  560  SER A HB3  7  
ATOM 9924  H HG   . SER A 1 4  ? 35.027  19.595  -5.899  1.00 0.00 ?  560  SER A HG   7  
ATOM 9925  N N    . TYR A 1 5  ? 30.863  20.927  -4.159  1.00 0.00 ?  561  TYR A N    7  
ATOM 9926  C CA   . TYR A 1 5  ? 29.800  21.499  -3.380  1.00 0.00 ?  561  TYR A CA   7  
ATOM 9927  C C    . TYR A 1 5  ? 28.693  20.492  -3.151  1.00 0.00 ?  561  TYR A C    7  
ATOM 9928  O O    . TYR A 1 5  ? 28.089  19.985  -4.108  1.00 0.00 ?  561  TYR A O    7  
ATOM 9929  C CB   . TYR A 1 5  ? 29.253  22.772  -4.059  1.00 0.00 ?  561  TYR A CB   7  
ATOM 9930  C CG   . TYR A 1 5  ? 27.972  23.311  -3.452  1.00 0.00 ?  561  TYR A CG   7  
ATOM 9931  C CD1  . TYR A 1 5  ? 26.791  23.317  -4.185  1.00 0.00 ?  561  TYR A CD1  7  
ATOM 9932  C CD2  . TYR A 1 5  ? 27.935  23.790  -2.149  1.00 0.00 ?  561  TYR A CD2  7  
ATOM 9933  C CE1  . TYR A 1 5  ? 25.617  23.786  -3.641  1.00 0.00 ?  561  TYR A CE1  7  
ATOM 9934  C CE2  . TYR A 1 5  ? 26.762  24.262  -1.600  1.00 0.00 ?  561  TYR A CE2  7  
ATOM 9935  C CZ   . TYR A 1 5  ? 25.607  24.258  -2.348  1.00 0.00 ?  561  TYR A CZ   7  
ATOM 9936  O OH   . TYR A 1 5  ? 24.433  24.726  -1.798  1.00 0.00 ?  561  TYR A OH   7  
ATOM 9937  H H    . TYR A 1 5  ? 30.718  20.846  -5.130  1.00 0.00 ?  561  TYR A H    7  
ATOM 9938  H HA   . TYR A 1 5  ? 30.214  21.779  -2.424  1.00 0.00 ?  561  TYR A HA   7  
ATOM 9939  H HB2  . TYR A 1 5  ? 29.994  23.555  -3.998  1.00 0.00 ?  561  TYR A HB2  7  
ATOM 9940  H HB3  . TYR A 1 5  ? 29.063  22.555  -5.101  1.00 0.00 ?  561  TYR A HB3  7  
ATOM 9941  H HD1  . TYR A 1 5  ? 26.802  22.947  -5.200  1.00 0.00 ?  561  TYR A HD1  7  
ATOM 9942  H HD2  . TYR A 1 5  ? 28.842  23.792  -1.563  1.00 0.00 ?  561  TYR A HD2  7  
ATOM 9943  H HE1  . TYR A 1 5  ? 24.712  23.780  -4.230  1.00 0.00 ?  561  TYR A HE1  7  
ATOM 9944  H HE2  . TYR A 1 5  ? 26.753  24.634  -0.585  1.00 0.00 ?  561  TYR A HE2  7  
ATOM 9945  H HH   . TYR A 1 5  ? 24.650  25.514  -1.283  1.00 0.00 ?  561  TYR A HH   7  
ATOM 9946  N N    . ASP A 1 6  ? 28.443  20.195  -1.888  1.00 0.00 ?  562  ASP A N    7  
ATOM 9947  C CA   . ASP A 1 6  ? 27.349  19.322  -1.496  1.00 0.00 ?  562  ASP A CA   7  
ATOM 9948  C C    . ASP A 1 6  ? 26.072  20.041  -1.833  1.00 0.00 ?  562  ASP A C    7  
ATOM 9949  O O    . ASP A 1 6  ? 25.723  21.034  -1.187  1.00 0.00 ?  562  ASP A O    7  
ATOM 9950  C CB   . ASP A 1 6  ? 27.380  19.002  0.017   1.00 0.00 ?  562  ASP A CB   7  
ATOM 9951  C CG   . ASP A 1 6  ? 28.645  18.306  0.475   1.00 0.00 ?  562  ASP A CG   7  
ATOM 9952  O OD1  . ASP A 1 6  ? 29.598  19.004  0.885   1.00 0.00 ?  562  ASP A OD1  7  
ATOM 9953  O OD2  . ASP A 1 6  ? 28.715  17.055  0.444   1.00 0.00 -1 562  ASP A OD2  7  
ATOM 9954  H H    . ASP A 1 6  ? 29.011  20.584  -1.191  1.00 0.00 ?  562  ASP A H    7  
ATOM 9955  H HA   . ASP A 1 6  ? 27.408  18.411  -2.071  1.00 0.00 ?  562  ASP A HA   7  
ATOM 9956  H HB2  . ASP A 1 6  ? 27.291  19.925  0.572   1.00 0.00 ?  562  ASP A HB2  7  
ATOM 9957  H HB3  . ASP A 1 6  ? 26.536  18.372  0.256   1.00 0.00 ?  562  ASP A HB3  7  
ATOM 9958  N N    . SER A 1 7  ? 25.403  19.579  -2.853  1.00 0.00 ?  563  SER A N    7  
ATOM 9959  C CA   . SER A 1 7  ? 24.225  20.243  -3.364  1.00 0.00 ?  563  SER A CA   7  
ATOM 9960  C C    . SER A 1 7  ? 23.006  20.029  -2.456  1.00 0.00 ?  563  SER A C    7  
ATOM 9961  O O    . SER A 1 7  ? 22.024  20.774  -2.545  1.00 0.00 ?  563  SER A O    7  
ATOM 9962  C CB   . SER A 1 7  ? 23.966  19.762  -4.785  1.00 0.00 ?  563  SER A CB   7  
ATOM 9963  O OG   . SER A 1 7  ? 25.139  19.949  -5.583  1.00 0.00 ?  563  SER A OG   7  
ATOM 9964  H H    . SER A 1 7  ? 25.705  18.748  -3.281  1.00 0.00 ?  563  SER A H    7  
ATOM 9965  H HA   . SER A 1 7  ? 24.441  21.301  -3.398  1.00 0.00 ?  563  SER A HA   7  
ATOM 9966  H HB2  . SER A 1 7  ? 23.712  18.712  -4.767  1.00 0.00 ?  563  SER A HB2  7  
ATOM 9967  H HB3  . SER A 1 7  ? 23.155  20.326  -5.221  1.00 0.00 ?  563  SER A HB3  7  
ATOM 9968  H HG   . SER A 1 7  ? 25.901  20.006  -4.994  1.00 0.00 ?  563  SER A HG   7  
ATOM 9969  N N    . GLU A 1 8  ? 23.108  19.028  -1.580  1.00 0.00 ?  564  GLU A N    7  
ATOM 9970  C CA   . GLU A 1 8  ? 22.078  18.664  -0.615  1.00 0.00 ?  564  GLU A CA   7  
ATOM 9971  C C    . GLU A 1 8  ? 20.810  18.195  -1.279  1.00 0.00 ?  564  GLU A C    7  
ATOM 9972  O O    . GLU A 1 8  ? 19.946  18.998  -1.678  1.00 0.00 ?  564  GLU A O    7  
ATOM 9973  C CB   . GLU A 1 8  ? 21.808  19.770  0.400   1.00 0.00 ?  564  GLU A CB   7  
ATOM 9974  C CG   . GLU A 1 8  ? 23.001  20.092  1.267   1.00 0.00 ?  564  GLU A CG   7  
ATOM 9975  C CD   . GLU A 1 8  ? 22.728  21.211  2.215   1.00 0.00 ?  564  GLU A CD   7  
ATOM 9976  O OE1  . GLU A 1 8  ? 22.959  22.371  1.860   1.00 0.00 ?  564  GLU A OE1  7  
ATOM 9977  O OE2  . GLU A 1 8  ? 22.295  20.962  3.343   1.00 0.00 -1 564  GLU A OE2  7  
ATOM 9978  H H    . GLU A 1 8  ? 23.928  18.489  -1.588  1.00 0.00 ?  564  GLU A H    7  
ATOM 9979  H HA   . GLU A 1 8  ? 22.473  17.809  -0.084  1.00 0.00 ?  564  GLU A HA   7  
ATOM 9980  H HB2  . GLU A 1 8  ? 21.520  20.667  -0.129  1.00 0.00 ?  564  GLU A HB2  7  
ATOM 9981  H HB3  . GLU A 1 8  ? 20.995  19.464  1.043   1.00 0.00 ?  564  GLU A HB3  7  
ATOM 9982  H HG2  . GLU A 1 8  ? 23.266  19.214  1.837   1.00 0.00 ?  564  GLU A HG2  7  
ATOM 9983  H HG3  . GLU A 1 8  ? 23.828  20.364  0.629   1.00 0.00 ?  564  GLU A HG3  7  
ATOM 9984  N N    . GLU A 1 9  ? 20.737  16.906  -1.427  1.00 0.00 ?  565  GLU A N    7  
ATOM 9985  C CA   . GLU A 1 9  ? 19.629  16.218  -2.012  1.00 0.00 ?  565  GLU A CA   7  
ATOM 9986  C C    . GLU A 1 9  ? 18.369  16.418  -1.160  1.00 0.00 ?  565  GLU A C    7  
ATOM 9987  O O    . GLU A 1 9  ? 18.450  16.853  -0.001  1.00 0.00 ?  565  GLU A O    7  
ATOM 9988  C CB   . GLU A 1 9  ? 19.949  14.705  -2.167  1.00 0.00 ?  565  GLU A CB   7  
ATOM 9989  C CG   . GLU A 1 9  ? 21.209  14.361  -2.998  1.00 0.00 ?  565  GLU A CG   7  
ATOM 9990  C CD   . GLU A 1 9  ? 22.544  14.424  -2.236  1.00 0.00 ?  565  GLU A CD   7  
ATOM 9991  O OE1  . GLU A 1 9  ? 22.704  15.232  -1.312  1.00 0.00 ?  565  GLU A OE1  7  
ATOM 9992  O OE2  . GLU A 1 9  ? 23.474  13.663  -2.587  1.00 0.00 -1 565  GLU A OE2  7  
ATOM 9993  H H    . GLU A 1 9  ? 21.495  16.344  -1.138  1.00 0.00 ?  565  GLU A H    7  
ATOM 9994  H HA   . GLU A 1 9  ? 19.456  16.635  -2.993  1.00 0.00 ?  565  GLU A HA   7  
ATOM 9995  H HB2  . GLU A 1 9  ? 20.086  14.287  -1.180  1.00 0.00 ?  565  GLU A HB2  7  
ATOM 9996  H HB3  . GLU A 1 9  ? 19.100  14.225  -2.629  1.00 0.00 ?  565  GLU A HB3  7  
ATOM 9997  H HG2  . GLU A 1 9  ? 21.100  13.360  -3.385  1.00 0.00 ?  565  GLU A HG2  7  
ATOM 9998  H HG3  . GLU A 1 9  ? 21.259  15.046  -3.831  1.00 0.00 ?  565  GLU A HG3  7  
ATOM 9999  N N    . GLU A 1 10 ? 17.222  16.117  -1.734  1.00 0.00 ?  566  GLU A N    7  
ATOM 10000 C CA   . GLU A 1 10 ? 15.949  16.284  -1.051  1.00 0.00 ?  566  GLU A CA   7  
ATOM 10001 C C    . GLU A 1 10 ? 15.866  15.443  0.215   1.00 0.00 ?  566  GLU A C    7  
ATOM 10002 O O    . GLU A 1 10 ? 16.304  14.283  0.236   1.00 0.00 ?  566  GLU A O    7  
ATOM 10003 C CB   . GLU A 1 10 ? 14.790  15.964  -1.974  1.00 0.00 ?  566  GLU A CB   7  
ATOM 10004 C CG   . GLU A 1 10 ? 14.630  16.943  -3.109  1.00 0.00 ?  566  GLU A CG   7  
ATOM 10005 C CD   . GLU A 1 10 ? 13.484  16.587  -4.003  1.00 0.00 ?  566  GLU A CD   7  
ATOM 10006 O OE1  . GLU A 1 10 ? 12.328  16.617  -3.548  1.00 0.00 ?  566  GLU A OE1  7  
ATOM 10007 O OE2  . GLU A 1 10 ? 13.702  16.306  -5.194  1.00 0.00 -1 566  GLU A OE2  7  
ATOM 10008 H H    . GLU A 1 10 ? 17.236  15.762  -2.649  1.00 0.00 ?  566  GLU A H    7  
ATOM 10009 H HA   . GLU A 1 10 ? 15.881  17.323  -0.770  1.00 0.00 ?  566  GLU A HA   7  
ATOM 10010 H HB2  . GLU A 1 10 ? 14.941  14.981  -2.393  1.00 0.00 ?  566  GLU A HB2  7  
ATOM 10011 H HB3  . GLU A 1 10 ? 13.878  15.965  -1.395  1.00 0.00 ?  566  GLU A HB3  7  
ATOM 10012 H HG2  . GLU A 1 10 ? 14.454  17.927  -2.698  1.00 0.00 ?  566  GLU A HG2  7  
ATOM 10013 H HG3  . GLU A 1 10 ? 15.540  16.954  -3.693  1.00 0.00 ?  566  GLU A HG3  7  
ATOM 10014 N N    . GLU A 1 11 ? 15.322  16.047  1.258   1.00 0.00 ?  567  GLU A N    7  
ATOM 10015 C CA   . GLU A 1 11 ? 15.166  15.424  2.574   1.00 0.00 ?  567  GLU A CA   7  
ATOM 10016 C C    . GLU A 1 11 ? 14.402  14.106  2.491   1.00 0.00 ?  567  GLU A C    7  
ATOM 10017 O O    . GLU A 1 11 ? 13.525  13.928  1.626   1.00 0.00 ?  567  GLU A O    7  
ATOM 10018 C CB   . GLU A 1 11 ? 14.363  16.342  3.486   1.00 0.00 ?  567  GLU A CB   7  
ATOM 10019 C CG   . GLU A 1 11 ? 14.893  17.746  3.618   1.00 0.00 ?  567  GLU A CG   7  
ATOM 10020 C CD   . GLU A 1 11 ? 14.025  18.582  4.510   1.00 0.00 ?  567  GLU A CD   7  
ATOM 10021 O OE1  . GLU A 1 11 ? 14.401  18.809  5.677   1.00 0.00 ?  567  GLU A OE1  7  
ATOM 10022 O OE2  . GLU A 1 11 ? 12.938  19.021  4.070   1.00 0.00 -1 567  GLU A OE2  7  
ATOM 10023 H H    . GLU A 1 11 ? 15.033  16.976  1.140   1.00 0.00 ?  567  GLU A H    7  
ATOM 10024 H HA   . GLU A 1 11 ? 16.137  15.273  3.017   1.00 0.00 ?  567  GLU A HA   7  
ATOM 10025 H HB2  . GLU A 1 11 ? 13.359  16.401  3.095   1.00 0.00 ?  567  GLU A HB2  7  
ATOM 10026 H HB3  . GLU A 1 11 ? 14.314  15.899  4.469   1.00 0.00 ?  567  GLU A HB3  7  
ATOM 10027 H HG2  . GLU A 1 11 ? 15.891  17.715  4.029   1.00 0.00 ?  567  GLU A HG2  7  
ATOM 10028 H HG3  . GLU A 1 11 ? 14.914  18.201  2.640   1.00 0.00 ?  567  GLU A HG3  7  
ATOM 10029 N N    . GLU A 1 12 ? 14.684  13.213  3.423   1.00 0.00 ?  568  GLU A N    7  
ATOM 10030 C CA   . GLU A 1 12 ? 13.972  11.944  3.522   1.00 0.00 ?  568  GLU A CA   7  
ATOM 10031 C C    . GLU A 1 12 ? 12.627  12.117  4.251   1.00 0.00 ?  568  GLU A C    7  
ATOM 10032 O O    . GLU A 1 12 ? 11.858  11.171  4.439   1.00 0.00 ?  568  GLU A O    7  
ATOM 10033 C CB   . GLU A 1 12 ? 14.869  10.828  4.119   1.00 0.00 ?  568  GLU A CB   7  
ATOM 10034 C CG   . GLU A 1 12 ? 15.645  11.190  5.392   1.00 0.00 ?  568  GLU A CG   7  
ATOM 10035 C CD   . GLU A 1 12 ? 14.782  11.448  6.599   1.00 0.00 ?  568  GLU A CD   7  
ATOM 10036 O OE1  . GLU A 1 12 ? 14.522  10.503  7.368   1.00 0.00 ?  568  GLU A OE1  7  
ATOM 10037 O OE2  . GLU A 1 12 ? 14.372  12.595  6.814   1.00 0.00 -1 568  GLU A OE2  7  
ATOM 10038 H H    . GLU A 1 12 ? 15.402  13.401  4.067   1.00 0.00 ?  568  GLU A H    7  
ATOM 10039 H HA   . GLU A 1 12 ? 13.724  11.685  2.502   1.00 0.00 ?  568  GLU A HA   7  
ATOM 10040 H HB2  . GLU A 1 12 ? 14.249  9.974   4.348   1.00 0.00 ?  568  GLU A HB2  7  
ATOM 10041 H HB3  . GLU A 1 12 ? 15.584  10.537  3.362   1.00 0.00 ?  568  GLU A HB3  7  
ATOM 10042 H HG2  . GLU A 1 12 ? 16.309  10.373  5.628   1.00 0.00 ?  568  GLU A HG2  7  
ATOM 10043 H HG3  . GLU A 1 12 ? 16.237  12.073  5.192   1.00 0.00 ?  568  GLU A HG3  7  
ATOM 10044 N N    . GLY A 1 13 ? 12.351  13.355  4.615   1.00 0.00 ?  569  GLY A N    7  
ATOM 10045 C CA   . GLY A 1 13 ? 11.107  13.741  5.212   1.00 0.00 ?  569  GLY A CA   7  
ATOM 10046 C C    . GLY A 1 13 ? 10.159  14.057  4.102   1.00 0.00 ?  569  GLY A C    7  
ATOM 10047 O O    . GLY A 1 13 ? 9.810   15.220  3.849   1.00 0.00 ?  569  GLY A O    7  
ATOM 10048 H H    . GLY A 1 13 ? 13.029  14.029  4.436   1.00 0.00 ?  569  GLY A H    7  
ATOM 10049 H HA2  . GLY A 1 13 ? 10.725  12.927  5.811   1.00 0.00 ?  569  GLY A HA2  7  
ATOM 10050 H HA3  . GLY A 1 13 ? 11.243  14.620  5.824   1.00 0.00 ?  569  GLY A HA3  7  
ATOM 10051 N N    . LEU A 1 14 ? 9.808   13.015  3.419   1.00 0.00 ?  570  LEU A N    7  
ATOM 10052 C CA   . LEU A 1 14 ? 9.000   13.025  2.236   1.00 0.00 ?  570  LEU A CA   7  
ATOM 10053 C C    . LEU A 1 14 ? 7.593   13.542  2.497   1.00 0.00 ?  570  LEU A C    7  
ATOM 10054 O O    . LEU A 1 14 ? 6.959   13.168  3.485   1.00 0.00 ?  570  LEU A O    7  
ATOM 10055 C CB   . LEU A 1 14 ? 8.925   11.597  1.721   1.00 0.00 ?  570  LEU A CB   7  
ATOM 10056 C CG   . LEU A 1 14 ? 10.221  10.970  1.208   1.00 0.00 ?  570  LEU A CG   7  
ATOM 10057 C CD1  . LEU A 1 14 ? 10.006  9.499   0.896   1.00 0.00 ?  570  LEU A CD1  7  
ATOM 10058 C CD2  . LEU A 1 14 ? 10.700  11.695  -0.033  1.00 0.00 ?  570  LEU A CD2  7  
ATOM 10059 H H    . LEU A 1 14 ? 10.125  12.145  3.745   1.00 0.00 ?  570  LEU A H    7  
ATOM 10060 H HA   . LEU A 1 14 ? 9.487   13.620  1.477   1.00 0.00 ?  570  LEU A HA   7  
ATOM 10061 H HB2  . LEU A 1 14 ? 8.637   11.016  2.585   1.00 0.00 ?  570  LEU A HB2  7  
ATOM 10062 H HB3  . LEU A 1 14 ? 8.167   11.532  0.958   1.00 0.00 ?  570  LEU A HB3  7  
ATOM 10063 H HG   . LEU A 1 14 ? 10.984  11.052  1.968   1.00 0.00 ?  570  LEU A HG   7  
ATOM 10064 H HD11 . LEU A 1 14 ? 9.687   8.985   1.791   1.00 0.00 ?  570  LEU A HD11 7  
ATOM 10065 H HD12 . LEU A 1 14 ? 10.933  9.068   0.546   1.00 0.00 ?  570  LEU A HD12 7  
ATOM 10066 H HD13 . LEU A 1 14 ? 9.252   9.393   0.130   1.00 0.00 ?  570  LEU A HD13 7  
ATOM 10067 H HD21 . LEU A 1 14 ? 9.934   11.654  -0.793  1.00 0.00 ?  570  LEU A HD21 7  
ATOM 10068 H HD22 . LEU A 1 14 ? 11.591  11.211  -0.402  1.00 0.00 ?  570  LEU A HD22 7  
ATOM 10069 H HD23 . LEU A 1 14 ? 10.920  12.724  0.207   1.00 0.00 ?  570  LEU A HD23 7  
ATOM 10070 N N    . PRO A 1 15 ? 7.106   14.438  1.641   1.00 0.00 ?  571  PRO A N    7  
ATOM 10071 C CA   . PRO A 1 15 ? 5.737   14.912  1.706   1.00 0.00 ?  571  PRO A CA   7  
ATOM 10072 C C    . PRO A 1 15 ? 4.813   13.935  0.982   1.00 0.00 ?  571  PRO A C    7  
ATOM 10073 O O    . PRO A 1 15 ? 5.284   13.041  0.256   1.00 0.00 ?  571  PRO A O    7  
ATOM 10074 C CB   . PRO A 1 15 ? 5.796   16.242  0.964   1.00 0.00 ?  571  PRO A CB   7  
ATOM 10075 C CG   . PRO A 1 15 ? 6.882   16.068  -0.050  1.00 0.00 ?  571  PRO A CG   7  
ATOM 10076 C CD   . PRO A 1 15 ? 7.862   15.080  0.534   1.00 0.00 ?  571  PRO A CD   7  
ATOM 10077 H HA   . PRO A 1 15 ? 5.402   15.053  2.723   1.00 0.00 ?  571  PRO A HA   7  
ATOM 10078 H HB2  . PRO A 1 15 ? 4.842   16.433  0.496   1.00 0.00 ?  571  PRO A HB2  7  
ATOM 10079 H HB3  . PRO A 1 15 ? 6.027   17.035  1.660   1.00 0.00 ?  571  PRO A HB3  7  
ATOM 10080 H HG2  . PRO A 1 15 ? 6.463   15.682  -0.968  1.00 0.00 ?  571  PRO A HG2  7  
ATOM 10081 H HG3  . PRO A 1 15 ? 7.367   17.015  -0.236  1.00 0.00 ?  571  PRO A HG3  7  
ATOM 10082 H HD2  . PRO A 1 15 ? 8.151   14.351  -0.208  1.00 0.00 ?  571  PRO A HD2  7  
ATOM 10083 H HD3  . PRO A 1 15 ? 8.729   15.600  0.914   1.00 0.00 ?  571  PRO A HD3  7  
ATOM 10084 N N    . MET A 1 16 ? 3.526   14.061  1.170   1.00 0.00 ?  572  MET A N    7  
ATOM 10085 C CA   . MET A 1 16 ? 2.645   13.172  0.470   1.00 0.00 ?  572  MET A CA   7  
ATOM 10086 C C    . MET A 1 16 ? 2.307   13.745  -0.892  1.00 0.00 ?  572  MET A C    7  
ATOM 10087 O O    . MET A 1 16 ? 1.551   14.702  -1.021  1.00 0.00 ?  572  MET A O    7  
ATOM 10088 C CB   . MET A 1 16 ? 1.357   12.822  1.264   1.00 0.00 ?  572  MET A CB   7  
ATOM 10089 C CG   . MET A 1 16 ? 0.492   14.011  1.674   1.00 0.00 ?  572  MET A CG   7  
ATOM 10090 S SD   . MET A 1 16 ? -1.137  13.507  2.259   1.00 0.00 ?  572  MET A SD   7  
ATOM 10091 C CE   . MET A 1 16 ? -1.819  15.090  2.747   1.00 0.00 ?  572  MET A CE   7  
ATOM 10092 H H    . MET A 1 16 ? 3.180   14.779  1.744   1.00 0.00 ?  572  MET A H    7  
ATOM 10093 H HA   . MET A 1 16 ? 3.208   12.266  0.302   1.00 0.00 ?  572  MET A HA   7  
ATOM 10094 H HB2  . MET A 1 16 ? 0.748   12.171  0.656   1.00 0.00 ?  572  MET A HB2  7  
ATOM 10095 H HB3  . MET A 1 16 ? 1.648   12.290  2.159   1.00 0.00 ?  572  MET A HB3  7  
ATOM 10096 H HG2  . MET A 1 16 ? 0.990   14.549  2.467   1.00 0.00 ?  572  MET A HG2  7  
ATOM 10097 H HG3  . MET A 1 16 ? 0.371   14.658  0.818   1.00 0.00 ?  572  MET A HG3  7  
ATOM 10098 H HE1  . MET A 1 16 ? -2.829  14.953  3.105   1.00 0.00 ?  572  MET A HE1  7  
ATOM 10099 H HE2  . MET A 1 16 ? -1.819  15.759  1.900   1.00 0.00 ?  572  MET A HE2  7  
ATOM 10100 H HE3  . MET A 1 16 ? -1.213  15.513  3.535   1.00 0.00 ?  572  MET A HE3  7  
ATOM 10101 N N    . SER A 1 17 ? 2.883   13.189  -1.888  1.00 0.00 ?  573  SER A N    7  
ATOM 10102 C CA   . SER A 1 17 ? 2.595   13.585  -3.226  1.00 0.00 ?  573  SER A CA   7  
ATOM 10103 C C    . SER A 1 17 ? 1.686   12.534  -3.831  1.00 0.00 ?  573  SER A C    7  
ATOM 10104 O O    . SER A 1 17 ? 1.629   11.403  -3.314  1.00 0.00 ?  573  SER A O    7  
ATOM 10105 C CB   . SER A 1 17 ? 3.901   13.680  -3.997  1.00 0.00 ?  573  SER A CB   7  
ATOM 10106 O OG   . SER A 1 17 ? 4.821   14.507  -3.306  1.00 0.00 ?  573  SER A OG   7  
ATOM 10107 H H    . SER A 1 17 ? 3.566   12.505  -1.729  1.00 0.00 ?  573  SER A H    7  
ATOM 10108 H HA   . SER A 1 17 ? 2.104   14.546  -3.218  1.00 0.00 ?  573  SER A HA   7  
ATOM 10109 H HB2  . SER A 1 17 ? 4.326   12.694  -4.110  1.00 0.00 ?  573  SER A HB2  7  
ATOM 10110 H HB3  . SER A 1 17 ? 3.711   14.106  -4.970  1.00 0.00 ?  573  SER A HB3  7  
ATOM 10111 H HG   . SER A 1 17 ? 4.493   15.413  -3.342  1.00 0.00 ?  573  SER A HG   7  
ATOM 10112 N N    . TYR A 1 18 ? 0.972   12.873  -4.894  1.00 0.00 ?  574  TYR A N    7  
ATOM 10113 C CA   . TYR A 1 18 ? 0.094   11.910  -5.542  1.00 0.00 ?  574  TYR A CA   7  
ATOM 10114 C C    . TYR A 1 18 ? 0.887   10.729  -6.061  1.00 0.00 ?  574  TYR A C    7  
ATOM 10115 O O    . TYR A 1 18 ? 0.444   9.597   -5.974  1.00 0.00 ?  574  TYR A O    7  
ATOM 10116 C CB   . TYR A 1 18 ? -0.733  12.541  -6.662  1.00 0.00 ?  574  TYR A CB   7  
ATOM 10117 C CG   . TYR A 1 18 ? -1.800  13.503  -6.189  1.00 0.00 ?  574  TYR A CG   7  
ATOM 10118 C CD1  . TYR A 1 18 ? -1.633  14.874  -6.306  1.00 0.00 ?  574  TYR A CD1  7  
ATOM 10119 C CD2  . TYR A 1 18 ? -2.983  13.035  -5.632  1.00 0.00 ?  574  TYR A CD2  7  
ATOM 10120 C CE1  . TYR A 1 18 ? -2.609  15.749  -5.889  1.00 0.00 ?  574  TYR A CE1  7  
ATOM 10121 C CE2  . TYR A 1 18 ? -3.965  13.907  -5.209  1.00 0.00 ?  574  TYR A CE2  7  
ATOM 10122 C CZ   . TYR A 1 18 ? -3.772  15.265  -5.341  1.00 0.00 ?  574  TYR A CZ   7  
ATOM 10123 O OH   . TYR A 1 18 ? -4.752  16.146  -4.932  1.00 0.00 ?  574  TYR A OH   7  
ATOM 10124 H H    . TYR A 1 18 ? 1.040   13.786  -5.253  1.00 0.00 ?  574  TYR A H    7  
ATOM 10125 H HA   . TYR A 1 18 ? -0.576  11.543  -4.778  1.00 0.00 ?  574  TYR A HA   7  
ATOM 10126 H HB2  . TYR A 1 18 ? -0.073  13.081  -7.325  1.00 0.00 ?  574  TYR A HB2  7  
ATOM 10127 H HB3  . TYR A 1 18 ? -1.221  11.754  -7.219  1.00 0.00 ?  574  TYR A HB3  7  
ATOM 10128 H HD1  . TYR A 1 18 ? -0.723  15.257  -6.738  1.00 0.00 ?  574  TYR A HD1  7  
ATOM 10129 H HD2  . TYR A 1 18 ? -3.129  11.970  -5.530  1.00 0.00 ?  574  TYR A HD2  7  
ATOM 10130 H HE1  . TYR A 1 18 ? -2.458  16.813  -5.989  1.00 0.00 ?  574  TYR A HE1  7  
ATOM 10131 H HE2  . TYR A 1 18 ? -4.878  13.523  -4.777  1.00 0.00 ?  574  TYR A HE2  7  
ATOM 10132 H HH   . TYR A 1 18 ? -4.832  16.809  -5.630  1.00 0.00 ?  574  TYR A HH   7  
ATOM 10133 N N    . ASP A 1 19 ? 2.080   11.001  -6.565  1.00 0.00 ?  575  ASP A N    7  
ATOM 10134 C CA   . ASP A 1 19 ? 2.976   9.953   -7.046  1.00 0.00 ?  575  ASP A CA   7  
ATOM 10135 C C    . ASP A 1 19 ? 3.492   9.093   -5.892  1.00 0.00 ?  575  ASP A C    7  
ATOM 10136 O O    . ASP A 1 19 ? 3.576   7.885   -6.006  1.00 0.00 ?  575  ASP A O    7  
ATOM 10137 C CB   . ASP A 1 19 ? 4.134   10.551  -7.840  1.00 0.00 ?  575  ASP A CB   7  
ATOM 10138 C CG   . ASP A 1 19 ? 5.144   9.521   -8.277  1.00 0.00 ?  575  ASP A CG   7  
ATOM 10139 O OD1  . ASP A 1 19 ? 6.338   9.642   -7.895  1.00 0.00 ?  575  ASP A OD1  7  
ATOM 10140 O OD2  . ASP A 1 19 ? 4.774   8.566   -8.987  1.00 0.00 -1 575  ASP A OD2  7  
ATOM 10141 H H    . ASP A 1 19 ? 2.361   11.939  -6.635  1.00 0.00 ?  575  ASP A H    7  
ATOM 10142 H HA   . ASP A 1 19 ? 2.395   9.318   -7.700  1.00 0.00 ?  575  ASP A HA   7  
ATOM 10143 H HB2  . ASP A 1 19 ? 3.744   11.035  -8.723  1.00 0.00 ?  575  ASP A HB2  7  
ATOM 10144 H HB3  . ASP A 1 19 ? 4.633   11.284  -7.226  1.00 0.00 ?  575  ASP A HB3  7  
ATOM 10145 N N    . GLU A 1 20 ? 3.762   9.727   -4.766  1.00 0.00 ?  576  GLU A N    7  
ATOM 10146 C CA   . GLU A 1 20 ? 4.254   9.029   -3.578  1.00 0.00 ?  576  GLU A CA   7  
ATOM 10147 C C    . GLU A 1 20 ? 3.208   8.085   -2.998  1.00 0.00 ?  576  GLU A C    7  
ATOM 10148 O O    . GLU A 1 20 ? 3.532   6.976   -2.584  1.00 0.00 ?  576  GLU A O    7  
ATOM 10149 C CB   . GLU A 1 20 ? 4.748   10.018  -2.529  1.00 0.00 ?  576  GLU A CB   7  
ATOM 10150 C CG   . GLU A 1 20 ? 6.035   10.719  -2.926  1.00 0.00 ?  576  GLU A CG   7  
ATOM 10151 C CD   . GLU A 1 20 ? 7.182   9.746   -3.078  1.00 0.00 ?  576  GLU A CD   7  
ATOM 10152 O OE1  . GLU A 1 20 ? 7.945   9.563   -2.126  1.00 0.00 ?  576  GLU A OE1  7  
ATOM 10153 O OE2  . GLU A 1 20 ? 7.321   9.126   -4.147  1.00 0.00 -1 576  GLU A OE2  7  
ATOM 10154 H H    . GLU A 1 20 ? 3.630   10.694  -4.731  1.00 0.00 ?  576  GLU A H    7  
ATOM 10155 H HA   . GLU A 1 20 ? 5.091   8.425   -3.900  1.00 0.00 ?  576  GLU A HA   7  
ATOM 10156 H HB2  . GLU A 1 20 ? 3.984   10.766  -2.372  1.00 0.00 ?  576  GLU A HB2  7  
ATOM 10157 H HB3  . GLU A 1 20 ? 4.918   9.488   -1.605  1.00 0.00 ?  576  GLU A HB3  7  
ATOM 10158 H HG2  . GLU A 1 20 ? 5.884   11.221  -3.872  1.00 0.00 ?  576  GLU A HG2  7  
ATOM 10159 H HG3  . GLU A 1 20 ? 6.290   11.444  -2.167  1.00 0.00 ?  576  GLU A HG3  7  
ATOM 10160 N N    . LYS A 1 21 ? 1.950   8.515   -2.989  1.00 0.00 ?  577  LYS A N    7  
ATOM 10161 C CA   . LYS A 1 21 ? 0.847   7.649   -2.542  1.00 0.00 ?  577  LYS A CA   7  
ATOM 10162 C C    . LYS A 1 21 ? 0.690   6.501   -3.516  1.00 0.00 ?  577  LYS A C    7  
ATOM 10163 O O    . LYS A 1 21 ? 0.359   5.374   -3.161  1.00 0.00 ?  577  LYS A O    7  
ATOM 10164 C CB   . LYS A 1 21 ? -0.492  8.418   -2.498  1.00 0.00 ?  577  LYS A CB   7  
ATOM 10165 C CG   . LYS A 1 21 ? -0.539  9.582   -1.506  1.00 0.00 ?  577  LYS A CG   7  
ATOM 10166 C CD   . LYS A 1 21 ? -1.947  10.159  -1.403  1.00 0.00 ?  577  LYS A CD   7  
ATOM 10167 C CE   . LYS A 1 21 ? -2.041  11.308  -0.404  1.00 0.00 ?  577  LYS A CE   7  
ATOM 10168 N NZ   . LYS A 1 21 ? -3.449  11.722  -0.154  1.00 0.00 1  577  LYS A NZ   7  
ATOM 10169 H H    . LYS A 1 21 ? 1.770   9.439   -3.269  1.00 0.00 ?  577  LYS A H    7  
ATOM 10170 H HA   . LYS A 1 21 ? 1.078   7.271   -1.558  1.00 0.00 ?  577  LYS A HA   7  
ATOM 10171 H HB2  . LYS A 1 21 ? -0.676  8.792   -3.496  1.00 0.00 ?  577  LYS A HB2  7  
ATOM 10172 H HB3  . LYS A 1 21 ? -1.292  7.724   -2.289  1.00 0.00 ?  577  LYS A HB3  7  
ATOM 10173 H HG2  . LYS A 1 21 ? -0.229  9.229   -0.533  1.00 0.00 ?  577  LYS A HG2  7  
ATOM 10174 H HG3  . LYS A 1 21 ? 0.137   10.355  -1.840  1.00 0.00 ?  577  LYS A HG3  7  
ATOM 10175 H HD2  . LYS A 1 21 ? -2.247  10.524  -2.373  1.00 0.00 ?  577  LYS A HD2  7  
ATOM 10176 H HD3  . LYS A 1 21 ? -2.620  9.372   -1.098  1.00 0.00 ?  577  LYS A HD3  7  
ATOM 10177 H HE2  . LYS A 1 21 ? -1.600  10.993  0.530   1.00 0.00 ?  577  LYS A HE2  7  
ATOM 10178 H HE3  . LYS A 1 21 ? -1.489  12.150  -0.792  1.00 0.00 ?  577  LYS A HE3  7  
ATOM 10179 H HZ1  . LYS A 1 21 ? -3.490  12.628  0.357   1.00 0.00 ?  577  LYS A HZ1  7  
ATOM 10180 H HZ2  . LYS A 1 21 ? -3.919  11.031  0.470   1.00 0.00 ?  577  LYS A HZ2  7  
ATOM 10181 H HZ3  . LYS A 1 21 ? -4.017  11.801  -1.025  1.00 0.00 ?  577  LYS A HZ3  7  
ATOM 10182 N N    . ARG A 1 22 ? 0.976   6.812   -4.734  1.00 0.00 ?  578  ARG A N    7  
ATOM 10183 C CA   . ARG A 1 22 ? 0.766   5.953   -5.840  1.00 0.00 ?  578  ARG A CA   7  
ATOM 10184 C C    . ARG A 1 22 ? 1.810   4.886   -5.977  1.00 0.00 ?  578  ARG A C    7  
ATOM 10185 O O    . ARG A 1 22 ? 1.539   3.824   -6.528  1.00 0.00 ?  578  ARG A O    7  
ATOM 10186 C CB   . ARG A 1 22 ? 0.543   6.754   -7.053  1.00 0.00 ?  578  ARG A CB   7  
ATOM 10187 C CG   . ARG A 1 22 ? -0.023  6.008   -8.201  1.00 0.00 ?  578  ARG A CG   7  
ATOM 10188 C CD   . ARG A 1 22 ? -0.767  6.990   -9.032  1.00 0.00 ?  578  ARG A CD   7  
ATOM 10189 N NE   . ARG A 1 22 ? -0.227  7.121   -10.396 1.00 0.00 ?  578  ARG A NE   7  
ATOM 10190 C CZ   . ARG A 1 22 ? 0.643   8.062   -10.818 1.00 0.00 ?  578  ARG A CZ   7  
ATOM 10191 N NH1  . ARG A 1 22 ? 1.184   8.930   -9.963  1.00 0.00 1  578  ARG A NH1  7  
ATOM 10192 N NH2  . ARG A 1 22 ? 0.986   8.112   -12.089 1.00 0.00 ?  578  ARG A NH2  7  
ATOM 10193 H H    . ARG A 1 22 ? 1.368   7.696   -4.898  1.00 0.00 ?  578  ARG A H    7  
ATOM 10194 H HA   . ARG A 1 22 ? -0.155  5.440   -5.617  1.00 0.00 ?  578  ARG A HA   7  
ATOM 10195 H HB2  . ARG A 1 22 ? -0.128  7.549   -6.768  1.00 0.00 ?  578  ARG A HB2  7  
ATOM 10196 H HB3  . ARG A 1 22 ? 1.460   7.224   -7.347  1.00 0.00 ?  578  ARG A HB3  7  
ATOM 10197 H HG2  . ARG A 1 22 ? 0.757   5.496   -8.753  1.00 0.00 ?  578  ARG A HG2  7  
ATOM 10198 H HG3  . ARG A 1 22 ? -0.719  5.273   -7.823  1.00 0.00 ?  578  ARG A HG3  7  
ATOM 10199 H HD2  . ARG A 1 22 ? -1.793  6.650   -8.993  1.00 0.00 ?  578  ARG A HD2  7  
ATOM 10200 H HD3  . ARG A 1 22 ? -0.766  7.925   -8.495  1.00 0.00 ?  578  ARG A HD3  7  
ATOM 10201 H HE   . ARG A 1 22 ? -0.566  6.456   -11.041 1.00 0.00 ?  578  ARG A HE   7  
ATOM 10202 H HH11 . ARG A 1 22 ? 0.977   8.927   -8.985  1.00 0.00 ?  578  ARG A HH11 7  
ATOM 10203 H HH12 . ARG A 1 22 ? 1.843   9.613   -10.294 1.00 0.00 ?  578  ARG A HH12 7  
ATOM 10204 H HH21 . ARG A 1 22 ? 0.620   7.473   -12.771 1.00 0.00 ?  578  ARG A HH21 7  
ATOM 10205 H HH22 . ARG A 1 22 ? 1.650   8.790   -12.419 1.00 0.00 ?  578  ARG A HH22 7  
ATOM 10206 N N    . GLN A 1 23 ? 2.993   5.151   -5.477  1.00 0.00 ?  579  GLN A N    7  
ATOM 10207 C CA   . GLN A 1 23 ? 4.057   4.155   -5.441  1.00 0.00 ?  579  GLN A CA   7  
ATOM 10208 C C    . GLN A 1 23 ? 3.512   2.910   -4.710  1.00 0.00 ?  579  GLN A C    7  
ATOM 10209 O O    . GLN A 1 23 ? 3.845   1.775   -5.042  1.00 0.00 ?  579  GLN A O    7  
ATOM 10210 C CB   . GLN A 1 23 ? 5.252   4.732   -4.660  1.00 0.00 ?  579  GLN A CB   7  
ATOM 10211 C CG   . GLN A 1 23 ? 6.499   3.847   -4.619  1.00 0.00 ?  579  GLN A CG   7  
ATOM 10212 C CD   . GLN A 1 23 ? 7.144   3.650   -5.981  1.00 0.00 ?  579  GLN A CD   7  
ATOM 10213 O OE1  . GLN A 1 23 ? 7.746   2.620   -6.251  1.00 0.00 ?  579  GLN A OE1  7  
ATOM 10214 N NE2  . GLN A 1 23 ? 7.069   4.637   -6.825  1.00 0.00 ?  579  GLN A NE2  7  
ATOM 10215 H H    . GLN A 1 23 ? 3.180   6.060   -5.153  1.00 0.00 ?  579  GLN A H    7  
ATOM 10216 H HA   . GLN A 1 23 ? 4.354   3.902   -6.449  1.00 0.00 ?  579  GLN A HA   7  
ATOM 10217 H HB2  . GLN A 1 23 ? 5.525   5.677   -5.104  1.00 0.00 ?  579  GLN A HB2  7  
ATOM 10218 H HB3  . GLN A 1 23 ? 4.933   4.915   -3.645  1.00 0.00 ?  579  GLN A HB3  7  
ATOM 10219 H HG2  . GLN A 1 23 ? 7.226   4.296   -3.958  1.00 0.00 ?  579  GLN A HG2  7  
ATOM 10220 H HG3  . GLN A 1 23 ? 6.218   2.879   -4.231  1.00 0.00 ?  579  GLN A HG3  7  
ATOM 10221 H HE21 . GLN A 1 23 ? 6.615   5.464   -6.551  1.00 0.00 ?  579  GLN A HE21 7  
ATOM 10222 H HE22 . GLN A 1 23 ? 7.454   4.513   -7.718  1.00 0.00 ?  579  GLN A HE22 7  
ATOM 10223 N N    . LEU A 1 24 ? 2.591   3.156   -3.777  1.00 0.00 ?  580  LEU A N    7  
ATOM 10224 C CA   . LEU A 1 24 ? 1.936   2.108   -3.042  1.00 0.00 ?  580  LEU A CA   7  
ATOM 10225 C C    . LEU A 1 24 ? 0.868   1.363   -3.875  1.00 0.00 ?  580  LEU A C    7  
ATOM 10226 O O    . LEU A 1 24 ? 0.663   0.165   -3.654  1.00 0.00 ?  580  LEU A O    7  
ATOM 10227 C CB   . LEU A 1 24 ? 1.396   2.589   -1.683  1.00 0.00 ?  580  LEU A CB   7  
ATOM 10228 C CG   . LEU A 1 24 ? 2.452   2.837   -0.572  1.00 0.00 ?  580  LEU A CG   7  
ATOM 10229 C CD1  . LEU A 1 24 ? 3.423   3.946   -0.928  1.00 0.00 ?  580  LEU A CD1  7  
ATOM 10230 C CD2  . LEU A 1 24 ? 1.782   3.134   0.747   1.00 0.00 ?  580  LEU A CD2  7  
ATOM 10231 H H    . LEU A 1 24 ? 2.359   4.089   -3.583  1.00 0.00 ?  580  LEU A H    7  
ATOM 10232 H HA   . LEU A 1 24 ? 2.718   1.389   -2.849  1.00 0.00 ?  580  LEU A HA   7  
ATOM 10233 H HB2  . LEU A 1 24 ? 0.852   3.509   -1.846  1.00 0.00 ?  580  LEU A HB2  7  
ATOM 10234 H HB3  . LEU A 1 24 ? 0.702   1.844   -1.326  1.00 0.00 ?  580  LEU A HB3  7  
ATOM 10235 H HG   . LEU A 1 24 ? 3.033   1.934   -0.449  1.00 0.00 ?  580  LEU A HG   7  
ATOM 10236 H HD11 . LEU A 1 24 ? 3.938   3.676   -1.839  1.00 0.00 ?  580  LEU A HD11 7  
ATOM 10237 H HD12 . LEU A 1 24 ? 4.141   4.069   -0.131  1.00 0.00 ?  580  LEU A HD12 7  
ATOM 10238 H HD13 . LEU A 1 24 ? 2.882   4.867   -1.081  1.00 0.00 ?  580  LEU A HD13 7  
ATOM 10239 H HD21 . LEU A 1 24 ? 2.536   3.308   1.501   1.00 0.00 ?  580  LEU A HD21 7  
ATOM 10240 H HD22 . LEU A 1 24 ? 1.180   2.286   1.032   1.00 0.00 ?  580  LEU A HD22 7  
ATOM 10241 H HD23 . LEU A 1 24 ? 1.161   4.011   0.648   1.00 0.00 ?  580  LEU A HD23 7  
ATOM 10242 N N    . SER A 1 25 ? 0.191   2.046   -4.860  1.00 0.00 ?  581  SER A N    7  
ATOM 10243 C CA   . SER A 1 25 ? -0.734  1.304   -5.749  1.00 0.00 ?  581  SER A CA   7  
ATOM 10244 C C    . SER A 1 25 ? 0.050   0.259   -6.527  1.00 0.00 ?  581  SER A C    7  
ATOM 10245 O O    . SER A 1 25 ? -0.420  -0.842  -6.812  1.00 0.00 ?  581  SER A O    7  
ATOM 10246 C CB   . SER A 1 25 ? -1.512  2.175   -6.773  1.00 0.00 ?  581  SER A CB   7  
ATOM 10247 O OG   . SER A 1 25 ? -0.697  3.016   -7.558  1.00 0.00 ?  581  SER A OG   7  
ATOM 10248 H H    . SER A 1 25 ? 0.317   3.014   -4.947  1.00 0.00 ?  581  SER A H    7  
ATOM 10249 H HA   . SER A 1 25 ? -1.437  0.910   -5.024  1.00 0.00 ?  581  SER A HA   7  
ATOM 10250 H HB2  . SER A 1 25 ? -2.011  1.502   -7.455  1.00 0.00 ?  581  SER A HB2  7  
ATOM 10251 H HB3  . SER A 1 25 ? -2.272  2.760   -6.280  1.00 0.00 ?  581  SER A HB3  7  
ATOM 10252 H HG   . SER A 1 25 ? 0.177   3.130   -7.158  1.00 0.00 ?  581  SER A HG   7  
ATOM 10253 N N    . LEU A 1 26 ? 1.280   0.627   -6.840  1.00 0.00 ?  582  LEU A N    7  
ATOM 10254 C CA   . LEU A 1 26 ? 2.173   -0.203  -7.578  1.00 0.00 ?  582  LEU A CA   7  
ATOM 10255 C C    . LEU A 1 26 ? 2.611   -1.414  -6.777  1.00 0.00 ?  582  LEU A C    7  
ATOM 10256 O O    . LEU A 1 26 ? 2.786   -2.487  -7.339  1.00 0.00 ?  582  LEU A O    7  
ATOM 10257 C CB   . LEU A 1 26 ? 3.352   0.605   -8.105  1.00 0.00 ?  582  LEU A CB   7  
ATOM 10258 C CG   . LEU A 1 26 ? 3.098   1.386   -9.419  1.00 0.00 ?  582  LEU A CG   7  
ATOM 10259 C CD1  . LEU A 1 26 ? 1.924   2.363   -9.335  1.00 0.00 ?  582  LEU A CD1  7  
ATOM 10260 C CD2  . LEU A 1 26 ? 4.339   2.098   -9.828  1.00 0.00 ?  582  LEU A CD2  7  
ATOM 10261 H H    . LEU A 1 26 ? 1.600   1.506   -6.548  1.00 0.00 ?  582  LEU A H    7  
ATOM 10262 H HA   . LEU A 1 26 ? 1.622   -0.553  -8.439  1.00 0.00 ?  582  LEU A HA   7  
ATOM 10263 H HB2  . LEU A 1 26 ? 3.642   1.310   -7.338  1.00 0.00 ?  582  LEU A HB2  7  
ATOM 10264 H HB3  . LEU A 1 26 ? 4.176   -0.072  -8.273  1.00 0.00 ?  582  LEU A HB3  7  
ATOM 10265 H HG   . LEU A 1 26 ? 2.863   0.673   -10.194 1.00 0.00 ?  582  LEU A HG   7  
ATOM 10266 H HD11 . LEU A 1 26 ? 2.094   3.138   -8.598  1.00 0.00 ?  582  LEU A HD11 7  
ATOM 10267 H HD12 . LEU A 1 26 ? 1.042   1.802   -9.060  1.00 0.00 ?  582  LEU A HD12 7  
ATOM 10268 H HD13 . LEU A 1 26 ? 1.757   2.816   -10.302 1.00 0.00 ?  582  LEU A HD13 7  
ATOM 10269 H HD21 . LEU A 1 26 ? 5.095   1.345   -9.988  1.00 0.00 ?  582  LEU A HD21 7  
ATOM 10270 H HD22 . LEU A 1 26 ? 4.624   2.761   -9.023  1.00 0.00 ?  582  LEU A HD22 7  
ATOM 10271 H HD23 . LEU A 1 26 ? 4.154   2.647   -10.737 1.00 0.00 ?  582  LEU A HD23 7  
ATOM 10272 N N    . ASP A 1 27 ? 2.745   -1.264  -5.459  1.00 0.00 ?  583  ASP A N    7  
ATOM 10273 C CA   . ASP A 1 27 ? 3.075   -2.415  -4.623  1.00 0.00 ?  583  ASP A CA   7  
ATOM 10274 C C    . ASP A 1 27 ? 1.917   -3.327  -4.431  1.00 0.00 ?  583  ASP A C    7  
ATOM 10275 O O    . ASP A 1 27 ? 2.063   -4.503  -4.583  1.00 0.00 ?  583  ASP A O    7  
ATOM 10276 C CB   . ASP A 1 27 ? 3.771   -2.097  -3.290  1.00 0.00 ?  583  ASP A CB   7  
ATOM 10277 C CG   . ASP A 1 27 ? 5.235   -1.778  -3.505  1.00 0.00 ?  583  ASP A CG   7  
ATOM 10278 O OD1  . ASP A 1 27 ? 6.030   -2.711  -3.795  1.00 0.00 ?  583  ASP A OD1  7  
ATOM 10279 O OD2  . ASP A 1 27 ? 5.623   -0.605  -3.408  1.00 0.00 -1 583  ASP A OD2  7  
ATOM 10280 H H    . ASP A 1 27 ? 2.637   -0.375  -5.061  1.00 0.00 ?  583  ASP A H    7  
ATOM 10281 H HA   . ASP A 1 27 ? 3.768   -2.979  -5.233  1.00 0.00 ?  583  ASP A HA   7  
ATOM 10282 H HB2  . ASP A 1 27 ? 3.286   -1.259  -2.811  1.00 0.00 ?  583  ASP A HB2  7  
ATOM 10283 H HB3  . ASP A 1 27 ? 3.693   -2.941  -2.613  1.00 0.00 ?  583  ASP A HB3  7  
ATOM 10284 N N    . ILE A 1 28 ? 0.742   -2.806  -4.163  1.00 0.00 ?  584  ILE A N    7  
ATOM 10285 C CA   . ILE A 1 28 ? -0.413  -3.697  -4.007  1.00 0.00 ?  584  ILE A CA   7  
ATOM 10286 C C    . ILE A 1 28 ? -0.686  -4.478  -5.325  1.00 0.00 ?  584  ILE A C    7  
ATOM 10287 O O    . ILE A 1 28 ? -0.989  -5.661  -5.305  1.00 0.00 ?  584  ILE A O    7  
ATOM 10288 C CB   . ILE A 1 28 ? -1.694  -2.957  -3.495  1.00 0.00 ?  584  ILE A CB   7  
ATOM 10289 C CG1  . ILE A 1 28 ? -2.919  -3.867  -3.494  1.00 0.00 ?  584  ILE A CG1  7  
ATOM 10290 C CG2  . ILE A 1 28 ? -1.973  -1.733  -4.318  1.00 0.00 ?  584  ILE A CG2  7  
ATOM 10291 C CD1  . ILE A 1 28 ? -2.813  -5.101  -2.629  1.00 0.00 ?  584  ILE A CD1  7  
ATOM 10292 H H    . ILE A 1 28 ? 0.651   -1.833  -4.059  1.00 0.00 ?  584  ILE A H    7  
ATOM 10293 H HA   . ILE A 1 28 ? -0.080  -4.404  -3.257  1.00 0.00 ?  584  ILE A HA   7  
ATOM 10294 H HB   . ILE A 1 28 ? -1.506  -2.638  -2.483  1.00 0.00 ?  584  ILE A HB   7  
ATOM 10295 H HG12 . ILE A 1 28 ? -3.780  -3.308  -3.162  1.00 0.00 ?  584  ILE A HG12 7  
ATOM 10296 H HG13 . ILE A 1 28 ? -3.074  -4.187  -4.513  1.00 0.00 ?  584  ILE A HG13 7  
ATOM 10297 H HG21 . ILE A 1 28 ? -1.147  -1.044  -4.238  1.00 0.00 ?  584  ILE A HG21 7  
ATOM 10298 H HG22 . ILE A 1 28 ? -2.893  -1.259  -4.012  1.00 0.00 ?  584  ILE A HG22 7  
ATOM 10299 H HG23 . ILE A 1 28 ? -2.071  -2.044  -5.348  1.00 0.00 ?  584  ILE A HG23 7  
ATOM 10300 H HD11 . ILE A 1 28 ? -2.740  -4.829  -1.588  1.00 0.00 ?  584  ILE A HD11 7  
ATOM 10301 H HD12 . ILE A 1 28 ? -1.946  -5.667  -2.940  1.00 0.00 ?  584  ILE A HD12 7  
ATOM 10302 H HD13 . ILE A 1 28 ? -3.698  -5.698  -2.803  1.00 0.00 ?  584  ILE A HD13 7  
ATOM 10303 N N    . ASN A 1 29 ? -0.476  -3.814  -6.455  1.00 0.00 ?  585  ASN A N    7  
ATOM 10304 C CA   . ASN A 1 29 ? -0.645  -4.436  -7.783  1.00 0.00 ?  585  ASN A CA   7  
ATOM 10305 C C    . ASN A 1 29 ? 0.478   -5.471  -8.048  1.00 0.00 ?  585  ASN A C    7  
ATOM 10306 O O    . ASN A 1 29 ? 0.374   -6.334  -8.920  1.00 0.00 ?  585  ASN A O    7  
ATOM 10307 C CB   . ASN A 1 29 ? -0.636  -3.331  -8.878  1.00 0.00 ?  585  ASN A CB   7  
ATOM 10308 C CG   . ASN A 1 29 ? -0.902  -3.859  -10.283 1.00 0.00 ?  585  ASN A CG   7  
ATOM 10309 O OD1  . ASN A 1 29 ? -2.049  -4.014  -10.690 1.00 0.00 ?  585  ASN A OD1  7  
ATOM 10310 N ND2  . ASN A 1 29 ? 0.138   -4.081  -11.048 1.00 0.00 ?  585  ASN A ND2  7  
ATOM 10311 H H    . ASN A 1 29 ? -0.226  -2.864  -6.400  1.00 0.00 ?  585  ASN A H    7  
ATOM 10312 H HA   . ASN A 1 29 ? -1.600  -4.942  -7.801  1.00 0.00 ?  585  ASN A HA   7  
ATOM 10313 H HB2  . ASN A 1 29 ? -1.370  -2.572  -8.652  1.00 0.00 ?  585  ASN A HB2  7  
ATOM 10314 H HB3  . ASN A 1 29 ? 0.330   -2.844  -8.881  1.00 0.00 ?  585  ASN A HB3  7  
ATOM 10315 H HD21 . ASN A 1 29 ? 1.037   -3.904  -10.698 1.00 0.00 ?  585  ASN A HD21 7  
ATOM 10316 H HD22 . ASN A 1 29 ? -0.031  -4.407  -11.956 1.00 0.00 ?  585  ASN A HD22 7  
ATOM 10317 N N    . ARG A 1 30 ? 1.517   -5.374  -7.254  1.00 0.00 ?  586  ARG A N    7  
ATOM 10318 C CA   . ARG A 1 30 ? 2.728   -6.175  -7.362  1.00 0.00 ?  586  ARG A CA   7  
ATOM 10319 C C    . ARG A 1 30 ? 2.597   -7.430  -6.484  1.00 0.00 ?  586  ARG A C    7  
ATOM 10320 O O    . ARG A 1 30 ? 3.242   -8.456  -6.728  1.00 0.00 ?  586  ARG A O    7  
ATOM 10321 C CB   . ARG A 1 30 ? 3.844   -5.284  -6.846  1.00 0.00 ?  586  ARG A CB   7  
ATOM 10322 C CG   . ARG A 1 30 ? 5.267   -5.664  -7.098  1.00 0.00 ?  586  ARG A CG   7  
ATOM 10323 C CD   . ARG A 1 30 ? 6.122   -4.565  -6.499  1.00 0.00 ?  586  ARG A CD   7  
ATOM 10324 N NE   . ARG A 1 30 ? 7.525   -4.633  -6.858  1.00 0.00 ?  586  ARG A NE   7  
ATOM 10325 C CZ   . ARG A 1 30 ? 8.422   -3.711  -6.486  1.00 0.00 ?  586  ARG A CZ   7  
ATOM 10326 N NH1  . ARG A 1 30 ? 8.108   -2.799  -5.551  1.00 0.00 1  586  ARG A NH1  7  
ATOM 10327 N NH2  . ARG A 1 30 ? 9.644   -3.734  -6.999  1.00 0.00 ?  586  ARG A NH2  7  
ATOM 10328 H H    . ARG A 1 30 ? 1.468   -4.721  -6.524  1.00 0.00 ?  586  ARG A H    7  
ATOM 10329 H HA   . ARG A 1 30 ? 2.926   -6.436  -8.389  1.00 0.00 ?  586  ARG A HA   7  
ATOM 10330 H HB2  . ARG A 1 30 ? 3.704   -4.304  -7.277  1.00 0.00 ?  586  ARG A HB2  7  
ATOM 10331 H HB3  . ARG A 1 30 ? 3.701   -5.190  -5.779  1.00 0.00 ?  586  ARG A HB3  7  
ATOM 10332 H HG2  . ARG A 1 30 ? 5.486   -6.611  -6.627  1.00 0.00 ?  586  ARG A HG2  7  
ATOM 10333 H HG3  . ARG A 1 30 ? 5.452   -5.709  -8.160  1.00 0.00 ?  586  ARG A HG3  7  
ATOM 10334 H HD2  . ARG A 1 30 ? 5.739   -3.613  -6.834  1.00 0.00 ?  586  ARG A HD2  7  
ATOM 10335 H HD3  . ARG A 1 30 ? 6.032   -4.612  -5.424  1.00 0.00 ?  586  ARG A HD3  7  
ATOM 10336 H HE   . ARG A 1 30 ? 7.755   -5.377  -7.459  1.00 0.00 ?  586  ARG A HE   7  
ATOM 10337 H HH11 . ARG A 1 30 ? 7.210   -2.771  -5.081  1.00 0.00 ?  586  ARG A HH11 7  
ATOM 10338 H HH12 . ARG A 1 30 ? 8.729   -2.065  -5.266  1.00 0.00 ?  586  ARG A HH12 7  
ATOM 10339 H HH21 . ARG A 1 30 ? 9.936   -4.425  -7.666  1.00 0.00 ?  586  ARG A HH21 7  
ATOM 10340 H HH22 . ARG A 1 30 ? 10.338  -3.054  -6.748  1.00 0.00 ?  586  ARG A HH22 7  
ATOM 10341 N N    . LEU A 1 31 ? 1.795   -7.323  -5.453  1.00 0.00 ?  587  LEU A N    7  
ATOM 10342 C CA   . LEU A 1 31 ? 1.524   -8.400  -4.547  1.00 0.00 ?  587  LEU A CA   7  
ATOM 10343 C C    . LEU A 1 31 ? 0.509   -9.421  -5.100  1.00 0.00 ?  587  LEU A C    7  
ATOM 10344 O O    . LEU A 1 31 ? -0.284  -9.116  -6.002  1.00 0.00 ?  587  LEU A O    7  
ATOM 10345 C CB   . LEU A 1 31 ? 1.094   -7.851  -3.183  1.00 0.00 ?  587  LEU A CB   7  
ATOM 10346 C CG   . LEU A 1 31 ? 2.237   -7.530  -2.209  1.00 0.00 ?  587  LEU A CG   7  
ATOM 10347 C CD1  . LEU A 1 31 ? 3.157   -6.421  -2.664  1.00 0.00 ?  587  LEU A CD1  7  
ATOM 10348 C CD2  . LEU A 1 31 ? 1.728   -7.267  -0.835  1.00 0.00 ?  587  LEU A CD2  7  
ATOM 10349 H H    . LEU A 1 31 ? 1.364   -6.472  -5.238  1.00 0.00 ?  587  LEU A H    7  
ATOM 10350 H HA   . LEU A 1 31 ? 2.460   -8.919  -4.409  1.00 0.00 ?  587  LEU A HA   7  
ATOM 10351 H HB2  . LEU A 1 31 ? 0.530   -6.947  -3.351  1.00 0.00 ?  587  LEU A HB2  7  
ATOM 10352 H HB3  . LEU A 1 31 ? 0.445   -8.575  -2.715  1.00 0.00 ?  587  LEU A HB3  7  
ATOM 10353 H HG   . LEU A 1 31 ? 2.841   -8.417  -2.170  1.00 0.00 ?  587  LEU A HG   7  
ATOM 10354 H HD11 . LEU A 1 31 ? 2.580   -5.524  -2.834  1.00 0.00 ?  587  LEU A HD11 7  
ATOM 10355 H HD12 . LEU A 1 31 ? 3.666   -6.708  -3.573  1.00 0.00 ?  587  LEU A HD12 7  
ATOM 10356 H HD13 . LEU A 1 31 ? 3.879   -6.226  -1.885  1.00 0.00 ?  587  LEU A HD13 7  
ATOM 10357 H HD21 . LEU A 1 31 ? 1.018   -6.453  -0.862  1.00 0.00 ?  587  LEU A HD21 7  
ATOM 10358 H HD22 . LEU A 1 31 ? 2.569   -6.990  -0.214  1.00 0.00 ?  587  LEU A HD22 7  
ATOM 10359 H HD23 . LEU A 1 31 ? 1.260   -8.158  -0.447  1.00 0.00 ?  587  LEU A HD23 7  
ATOM 10360 N N    . PRO A 1 32 ? 0.576   -10.674 -4.607  1.00 0.00 ?  588  PRO A N    7  
ATOM 10361 C CA   . PRO A 1 32 ? -0.310  -11.756 -5.032  1.00 0.00 ?  588  PRO A CA   7  
ATOM 10362 C C    . PRO A 1 32 ? -1.700  -11.741 -4.362  1.00 0.00 ?  588  PRO A C    7  
ATOM 10363 O O    . PRO A 1 32 ? -1.947  -11.001 -3.384  1.00 0.00 ?  588  PRO A O    7  
ATOM 10364 C CB   . PRO A 1 32 ? 0.450   -12.998 -4.610  1.00 0.00 ?  588  PRO A CB   7  
ATOM 10365 C CG   . PRO A 1 32 ? 1.188   -12.583 -3.401  1.00 0.00 ?  588  PRO A CG   7  
ATOM 10366 C CD   . PRO A 1 32 ? 1.566   -11.150 -3.614  1.00 0.00 ?  588  PRO A CD   7  
ATOM 10367 H HA   . PRO A 1 32 ? -0.431  -11.765 -6.103  1.00 0.00 ?  588  PRO A HA   7  
ATOM 10368 H HB2  . PRO A 1 32 ? -0.270  -13.765 -4.371  1.00 0.00 ?  588  PRO A HB2  7  
ATOM 10369 H HB3  . PRO A 1 32 ? 1.114   -13.324 -5.397  1.00 0.00 ?  588  PRO A HB3  7  
ATOM 10370 H HG2  . PRO A 1 32 ? 0.546   -12.677 -2.537  1.00 0.00 ?  588  PRO A HG2  7  
ATOM 10371 H HG3  . PRO A 1 32 ? 2.070   -13.192 -3.279  1.00 0.00 ?  588  PRO A HG3  7  
ATOM 10372 H HD2  . PRO A 1 32 ? 1.479   -10.598 -2.690  1.00 0.00 ?  588  PRO A HD2  7  
ATOM 10373 H HD3  . PRO A 1 32 ? 2.570   -11.069 -4.002  1.00 0.00 ?  588  PRO A HD3  7  
ATOM 10374 N N    . GLY A 1 33 ? -2.571  -12.622 -4.861  1.00 0.00 ?  589  GLY A N    7  
ATOM 10375 C CA   . GLY A 1 33 ? -3.957  -12.733 -4.423  1.00 0.00 ?  589  GLY A CA   7  
ATOM 10376 C C    . GLY A 1 33 ? -4.135  -12.957 -2.939  1.00 0.00 ?  589  GLY A C    7  
ATOM 10377 O O    . GLY A 1 33 ? -5.050  -12.418 -2.333  1.00 0.00 ?  589  GLY A O    7  
ATOM 10378 H H    . GLY A 1 33 ? -2.265  -13.232 -5.569  1.00 0.00 ?  589  GLY A H    7  
ATOM 10379 H HA2  . GLY A 1 33 ? -4.488  -11.838 -4.697  1.00 0.00 ?  589  GLY A HA2  7  
ATOM 10380 H HA3  . GLY A 1 33 ? -4.409  -13.561 -4.948  1.00 0.00 ?  589  GLY A HA3  7  
ATOM 10381 N N    . GLU A 1 34 ? -3.245  -13.708 -2.357  1.00 0.00 ?  590  GLU A N    7  
ATOM 10382 C CA   . GLU A 1 34 ? -3.334  -14.061 -0.955  1.00 0.00 ?  590  GLU A CA   7  
ATOM 10383 C C    . GLU A 1 34 ? -2.921  -12.897 -0.058  1.00 0.00 ?  590  GLU A C    7  
ATOM 10384 O O    . GLU A 1 34 ? -3.311  -12.828 1.107   1.00 0.00 ?  590  GLU A O    7  
ATOM 10385 C CB   . GLU A 1 34 ? -2.487  -15.292 -0.674  1.00 0.00 ?  590  GLU A CB   7  
ATOM 10386 C CG   . GLU A 1 34 ? -2.878  -16.494 -1.518  1.00 0.00 ?  590  GLU A CG   7  
ATOM 10387 C CD   . GLU A 1 34 ? -2.047  -17.707 -1.221  1.00 0.00 ?  590  GLU A CD   7  
ATOM 10388 O OE1  . GLU A 1 34 ? -2.363  -18.424 -0.249  1.00 0.00 ?  590  GLU A OE1  7  
ATOM 10389 O OE2  . GLU A 1 34 ? -1.069  -17.971 -1.958  1.00 0.00 -1 590  GLU A OE2  7  
ATOM 10390 H H    . GLU A 1 34 ? -2.505  -14.050 -2.896  1.00 0.00 ?  590  GLU A H    7  
ATOM 10391 H HA   . GLU A 1 34 ? -4.366  -14.292 -0.740  1.00 0.00 ?  590  GLU A HA   7  
ATOM 10392 H HB2  . GLU A 1 34 ? -1.453  -15.052 -0.874  1.00 0.00 ?  590  GLU A HB2  7  
ATOM 10393 H HB3  . GLU A 1 34 ? -2.590  -15.560 0.366   1.00 0.00 ?  590  GLU A HB3  7  
ATOM 10394 H HG2  . GLU A 1 34 ? -3.915  -16.732 -1.328  1.00 0.00 ?  590  GLU A HG2  7  
ATOM 10395 H HG3  . GLU A 1 34 ? -2.760  -16.235 -2.561  1.00 0.00 ?  590  GLU A HG3  7  
ATOM 10396 N N    . LYS A 1 35 ? -2.166  -11.970 -0.604  1.00 0.00 ?  591  LYS A N    7  
ATOM 10397 C CA   . LYS A 1 35 ? -1.719  -10.828 0.166   1.00 0.00 ?  591  LYS A CA   7  
ATOM 10398 C C    . LYS A 1 35 ? -2.699  -9.665  0.045   1.00 0.00 ?  591  LYS A C    7  
ATOM 10399 O O    . LYS A 1 35 ? -2.940  -8.955  1.031   1.00 0.00 ?  591  LYS A O    7  
ATOM 10400 C CB   . LYS A 1 35 ? -0.319  -10.369 -0.266  1.00 0.00 ?  591  LYS A CB   7  
ATOM 10401 C CG   . LYS A 1 35 ? 0.836   -11.333 0.043   1.00 0.00 ?  591  LYS A CG   7  
ATOM 10402 C CD   . LYS A 1 35 ? 1.064   -11.506 1.543   1.00 0.00 ?  591  LYS A CD   7  
ATOM 10403 C CE   . LYS A 1 35 ? 2.296   -12.371 1.835   1.00 0.00 ?  591  LYS A CE   7  
ATOM 10404 N NZ   . LYS A 1 35 ? 3.562   -11.744 1.369   1.00 0.00 1  591  LYS A NZ   7  
ATOM 10405 H H    . LYS A 1 35 ? -1.928  -12.044 -1.554  1.00 0.00 ?  591  LYS A H    7  
ATOM 10406 H HA   . LYS A 1 35 ? -1.677  -11.133 1.201   1.00 0.00 ?  591  LYS A HA   7  
ATOM 10407 H HB2  . LYS A 1 35 ? -0.330  -10.194 -1.332  1.00 0.00 ?  591  LYS A HB2  7  
ATOM 10408 H HB3  . LYS A 1 35 ? -0.121  -9.433  0.234   1.00 0.00 ?  591  LYS A HB3  7  
ATOM 10409 H HG2  . LYS A 1 35 ? 0.603   -12.298 -0.381  1.00 0.00 ?  591  LYS A HG2  7  
ATOM 10410 H HG3  . LYS A 1 35 ? 1.738   -10.950 -0.410  1.00 0.00 ?  591  LYS A HG3  7  
ATOM 10411 H HD2  . LYS A 1 35 ? 1.206   -10.534 1.991   1.00 0.00 ?  591  LYS A HD2  7  
ATOM 10412 H HD3  . LYS A 1 35 ? 0.195   -11.977 1.979   1.00 0.00 ?  591  LYS A HD3  7  
ATOM 10413 H HE2  . LYS A 1 35 ? 2.365   -12.534 2.901   1.00 0.00 ?  591  LYS A HE2  7  
ATOM 10414 H HE3  . LYS A 1 35 ? 2.173   -13.321 1.339   1.00 0.00 ?  591  LYS A HE3  7  
ATOM 10415 H HZ1  . LYS A 1 35 ? 4.370   -12.377 1.534   1.00 0.00 ?  591  LYS A HZ1  7  
ATOM 10416 H HZ2  . LYS A 1 35 ? 3.789   -10.879 1.898   1.00 0.00 ?  591  LYS A HZ2  7  
ATOM 10417 H HZ3  . LYS A 1 35 ? 3.551   -11.529 0.353   1.00 0.00 ?  591  LYS A HZ3  7  
ATOM 10418 N N    . LEU A 1 36 ? -3.292  -9.506  -1.151  1.00 0.00 ?  592  LEU A N    7  
ATOM 10419 C CA   . LEU A 1 36 ? -4.166  -8.368  -1.474  1.00 0.00 ?  592  LEU A CA   7  
ATOM 10420 C C    . LEU A 1 36 ? -5.328  -8.203  -0.478  1.00 0.00 ?  592  LEU A C    7  
ATOM 10421 O O    . LEU A 1 36 ? -5.579  -7.095  0.015   1.00 0.00 ?  592  LEU A O    7  
ATOM 10422 C CB   . LEU A 1 36 ? -4.662  -8.450  -2.965  1.00 0.00 ?  592  LEU A CB   7  
ATOM 10423 C CG   . LEU A 1 36 ? -5.763  -9.502  -3.342  1.00 0.00 ?  592  LEU A CG   7  
ATOM 10424 C CD1  . LEU A 1 36 ? -7.162  -8.974  -3.078  1.00 0.00 ?  592  LEU A CD1  7  
ATOM 10425 C CD2  . LEU A 1 36 ? -5.685  -9.844  -4.785  1.00 0.00 ?  592  LEU A CD2  7  
ATOM 10426 H H    . LEU A 1 36 ? -3.115  -10.152 -1.869  1.00 0.00 ?  592  LEU A H    7  
ATOM 10427 H HA   . LEU A 1 36 ? -3.548  -7.487  -1.379  1.00 0.00 ?  592  LEU A HA   7  
ATOM 10428 H HB2  . LEU A 1 36 ? -4.985  -7.466  -3.278  1.00 0.00 ?  592  LEU A HB2  7  
ATOM 10429 H HB3  . LEU A 1 36 ? -3.786  -8.670  -3.559  1.00 0.00 ?  592  LEU A HB3  7  
ATOM 10430 H HG   . LEU A 1 36 ? -5.619  -10.407 -2.769  1.00 0.00 ?  592  LEU A HG   7  
ATOM 10431 H HD11 . LEU A 1 36 ? -7.247  -8.586  -2.074  1.00 0.00 ?  592  LEU A HD11 7  
ATOM 10432 H HD12 . LEU A 1 36 ? -7.868  -9.780  -3.218  1.00 0.00 ?  592  LEU A HD12 7  
ATOM 10433 H HD13 . LEU A 1 36 ? -7.356  -8.199  -3.809  1.00 0.00 ?  592  LEU A HD13 7  
ATOM 10434 H HD21 . LEU A 1 36 ? -6.067  -8.958  -5.276  1.00 0.00 ?  592  LEU A HD21 7  
ATOM 10435 H HD22 . LEU A 1 36 ? -6.295  -10.703 -5.019  1.00 0.00 ?  592  LEU A HD22 7  
ATOM 10436 H HD23 . LEU A 1 36 ? -4.659  -9.983  -5.092  1.00 0.00 ?  592  LEU A HD23 7  
ATOM 10437 N N    . GLY A 1 37 ? -5.996  -9.309  -0.146  1.00 0.00 ?  593  GLY A N    7  
ATOM 10438 C CA   . GLY A 1 37 ? -7.153  -9.233  0.741   1.00 0.00 ?  593  GLY A CA   7  
ATOM 10439 C C    . GLY A 1 37 ? -6.758  -8.925  2.150   1.00 0.00 ?  593  GLY A C    7  
ATOM 10440 O O    . GLY A 1 37 ? -7.523  -8.310  2.898   1.00 0.00 ?  593  GLY A O    7  
ATOM 10441 H H    . GLY A 1 37 ? -5.711  -10.179 -0.510  1.00 0.00 ?  593  GLY A H    7  
ATOM 10442 H HA2  . GLY A 1 37 ? -7.804  -8.432  0.413   1.00 0.00 ?  593  GLY A HA2  7  
ATOM 10443 H HA3  . GLY A 1 37 ? -7.697  -10.164 0.725   1.00 0.00 ?  593  GLY A HA3  7  
ATOM 10444 N N    . ARG A 1 38 ? -5.548  -9.323  2.514   1.00 0.00 ?  594  ARG A N    7  
ATOM 10445 C CA   . ARG A 1 38 ? -5.040  -9.053  3.838   1.00 0.00 ?  594  ARG A CA   7  
ATOM 10446 C C    . ARG A 1 38 ? -4.840  -7.572  4.009   1.00 0.00 ?  594  ARG A C    7  
ATOM 10447 O O    . ARG A 1 38 ? -5.304  -7.001  4.976   1.00 0.00 ?  594  ARG A O    7  
ATOM 10448 C CB   . ARG A 1 38 ? -3.721  -9.772  4.118   1.00 0.00 ?  594  ARG A CB   7  
ATOM 10449 C CG   . ARG A 1 38 ? -3.815  -11.278 4.179   1.00 0.00 ?  594  ARG A CG   7  
ATOM 10450 C CD   . ARG A 1 38 ? -2.478  -11.870 4.576   1.00 0.00 ?  594  ARG A CD   7  
ATOM 10451 N NE   . ARG A 1 38 ? -2.532  -13.324 4.750   1.00 0.00 ?  594  ARG A NE   7  
ATOM 10452 C CZ   . ARG A 1 38 ? -1.814  -14.011 5.661   1.00 0.00 ?  594  ARG A CZ   7  
ATOM 10453 N NH1  . ARG A 1 38 ? -1.018  -13.364 6.530   1.00 0.00 1  594  ARG A NH1  7  
ATOM 10454 N NH2  . ARG A 1 38 ? -1.904  -15.330 5.712   1.00 0.00 ?  594  ARG A NH2  7  
ATOM 10455 H H    . ARG A 1 38 ? -4.994  -9.788  1.852   1.00 0.00 ?  594  ARG A H    7  
ATOM 10456 H HA   . ARG A 1 38 ? -5.781  -9.384  4.549   1.00 0.00 ?  594  ARG A HA   7  
ATOM 10457 H HB2  . ARG A 1 38 ? -3.020  -9.515  3.338   1.00 0.00 ?  594  ARG A HB2  7  
ATOM 10458 H HB3  . ARG A 1 38 ? -3.331  -9.416  5.060   1.00 0.00 ?  594  ARG A HB3  7  
ATOM 10459 H HG2  . ARG A 1 38 ? -4.564  -11.563 4.902   1.00 0.00 ?  594  ARG A HG2  7  
ATOM 10460 H HG3  . ARG A 1 38 ? -4.086  -11.646 3.201   1.00 0.00 ?  594  ARG A HG3  7  
ATOM 10461 H HD2  . ARG A 1 38 ? -1.754  -11.637 3.808   1.00 0.00 ?  594  ARG A HD2  7  
ATOM 10462 H HD3  . ARG A 1 38 ? -2.166  -11.420 5.507   1.00 0.00 ?  594  ARG A HD3  7  
ATOM 10463 H HE   . ARG A 1 38 ? -3.141  -13.795 4.130   1.00 0.00 ?  594  ARG A HE   7  
ATOM 10464 H HH11 . ARG A 1 38 ? -0.924  -12.366 6.539   1.00 0.00 ?  594  ARG A HH11 7  
ATOM 10465 H HH12 . ARG A 1 38 ? -0.482  -13.849 7.227   1.00 0.00 ?  594  ARG A HH12 7  
ATOM 10466 H HH21 . ARG A 1 38 ? -2.502  -15.831 5.078   1.00 0.00 ?  594  ARG A HH21 7  
ATOM 10467 H HH22 . ARG A 1 38 ? -1.391  -15.876 6.377   1.00 0.00 ?  594  ARG A HH22 7  
ATOM 10468 N N    . VAL A 1 39 ? -4.196  -6.950  3.021   1.00 0.00 ?  595  VAL A N    7  
ATOM 10469 C CA   . VAL A 1 39 ? -3.862  -5.512  3.054   1.00 0.00 ?  595  VAL A CA   7  
ATOM 10470 C C    . VAL A 1 39 ? -5.077  -4.708  3.392   1.00 0.00 ?  595  VAL A C    7  
ATOM 10471 O O    . VAL A 1 39 ? -5.066  -3.922  4.332   1.00 0.00 ?  595  VAL A O    7  
ATOM 10472 C CB   . VAL A 1 39 ? -3.339  -5.005  1.684   1.00 0.00 ?  595  VAL A CB   7  
ATOM 10473 C CG1  . VAL A 1 39 ? -2.954  -3.550  1.744   1.00 0.00 ?  595  VAL A CG1  7  
ATOM 10474 C CG2  . VAL A 1 39 ? -2.204  -5.841  1.154   1.00 0.00 ?  595  VAL A CG2  7  
ATOM 10475 H H    . VAL A 1 39 ? -3.951  -7.480  2.230   1.00 0.00 ?  595  VAL A H    7  
ATOM 10476 H HA   . VAL A 1 39 ? -3.131  -5.307  3.822   1.00 0.00 ?  595  VAL A HA   7  
ATOM 10477 H HB   . VAL A 1 39 ? -4.164  -5.070  0.990   1.00 0.00 ?  595  VAL A HB   7  
ATOM 10478 H HG11 . VAL A 1 39 ? -2.235  -3.422  2.538   1.00 0.00 ?  595  VAL A HG11 7  
ATOM 10479 H HG12 . VAL A 1 39 ? -3.830  -2.949  1.945   1.00 0.00 ?  595  VAL A HG12 7  
ATOM 10480 H HG13 . VAL A 1 39 ? -2.515  -3.250  0.805   1.00 0.00 ?  595  VAL A HG13 7  
ATOM 10481 H HG21 . VAL A 1 39 ? -1.394  -5.836  1.869   1.00 0.00 ?  595  VAL A HG21 7  
ATOM 10482 H HG22 . VAL A 1 39 ? -1.855  -5.431  0.218   1.00 0.00 ?  595  VAL A HG22 7  
ATOM 10483 H HG23 . VAL A 1 39 ? -2.540  -6.856  1.003   1.00 0.00 ?  595  VAL A HG23 7  
ATOM 10484 N N    . VAL A 1 40 ? -6.123  -4.959  2.657   1.00 0.00 ?  596  VAL A N    7  
ATOM 10485 C CA   . VAL A 1 40 ? -7.360  -4.258  2.804   1.00 0.00 ?  596  VAL A CA   7  
ATOM 10486 C C    . VAL A 1 40 ? -7.907  -4.338  4.232   1.00 0.00 ?  596  VAL A C    7  
ATOM 10487 O O    . VAL A 1 40 ? -8.485  -3.375  4.723   1.00 0.00 ?  596  VAL A O    7  
ATOM 10488 C CB   . VAL A 1 40 ? -8.364  -4.711  1.717   1.00 0.00 ?  596  VAL A CB   7  
ATOM 10489 C CG1  . VAL A 1 40 ? -9.743  -4.158  1.942   1.00 0.00 ?  596  VAL A CG1  7  
ATOM 10490 C CG2  . VAL A 1 40 ? -7.854  -4.221  0.395   1.00 0.00 ?  596  VAL A CG2  7  
ATOM 10491 H H    . VAL A 1 40 ? -6.056  -5.669  1.982   1.00 0.00 ?  596  VAL A H    7  
ATOM 10492 H HA   . VAL A 1 40 ? -7.125  -3.219  2.624   1.00 0.00 ?  596  VAL A HA   7  
ATOM 10493 H HB   . VAL A 1 40 ? -8.416  -5.789  1.651   1.00 0.00 ?  596  VAL A HB   7  
ATOM 10494 H HG11 . VAL A 1 40 ? -10.095 -4.494  2.906   1.00 0.00 ?  596  VAL A HG11 7  
ATOM 10495 H HG12 . VAL A 1 40 ? -10.385 -4.560  1.171   1.00 0.00 ?  596  VAL A HG12 7  
ATOM 10496 H HG13 . VAL A 1 40 ? -9.723  -3.079  1.901   1.00 0.00 ?  596  VAL A HG13 7  
ATOM 10497 H HG21 . VAL A 1 40 ? -6.870  -4.629  0.222   1.00 0.00 ?  596  VAL A HG21 7  
ATOM 10498 H HG22 . VAL A 1 40 ? -7.793  -3.143  0.437   1.00 0.00 ?  596  VAL A HG22 7  
ATOM 10499 H HG23 . VAL A 1 40 ? -8.525  -4.526  -0.392  1.00 0.00 ?  596  VAL A HG23 7  
ATOM 10500 N N    . HIS A 1 41 ? -7.669  -5.447  4.901   1.00 0.00 ?  597  HIS A N    7  
ATOM 10501 C CA   . HIS A 1 41 ? -8.072  -5.595  6.286   1.00 0.00 ?  597  HIS A CA   7  
ATOM 10502 C C    . HIS A 1 41 ? -7.119  -4.817  7.220   1.00 0.00 ?  597  HIS A C    7  
ATOM 10503 O O    . HIS A 1 41 ? -7.570  -4.072  8.084   1.00 0.00 ?  597  HIS A O    7  
ATOM 10504 C CB   . HIS A 1 41 ? -8.180  -7.070  6.714   1.00 0.00 ?  597  HIS A CB   7  
ATOM 10505 C CG   . HIS A 1 41 ? -8.773  -7.232  8.090   1.00 0.00 ?  597  HIS A CG   7  
ATOM 10506 N ND1  . HIS A 1 41 ? -8.042  -7.489  9.232   1.00 0.00 ?  597  HIS A ND1  7  
ATOM 10507 C CD2  . HIS A 1 41 ? -10.062 -7.127  8.494   1.00 0.00 ?  597  HIS A CD2  7  
ATOM 10508 C CE1  . HIS A 1 41 ? -8.884  -7.524  10.261  1.00 0.00 ?  597  HIS A CE1  7  
ATOM 10509 N NE2  . HIS A 1 41 ? -10.127 -7.310  9.874   1.00 0.00 ?  597  HIS A NE2  7  
ATOM 10510 H H    . HIS A 1 41 ? -7.160  -6.164  4.466   1.00 0.00 ?  597  HIS A H    7  
ATOM 10511 H HA   . HIS A 1 41 ? -9.045  -5.132  6.366   1.00 0.00 ?  597  HIS A HA   7  
ATOM 10512 H HB2  . HIS A 1 41 ? -8.805  -7.603  6.012   1.00 0.00 ?  597  HIS A HB2  7  
ATOM 10513 H HB3  . HIS A 1 41 ? -7.194  -7.511  6.719   1.00 0.00 ?  597  HIS A HB3  7  
ATOM 10514 H HD1  . HIS A 1 41 ? -7.069  -7.622  9.296   1.00 0.00 ?  597  HIS A HD1  7  
ATOM 10515 H HD2  . HIS A 1 41 ? -10.911 -6.931  7.857   1.00 0.00 ?  597  HIS A HD2  7  
ATOM 10516 H HE1  . HIS A 1 41 ? -8.593  -7.711  11.284  1.00 0.00 ?  597  HIS A HE1  7  
ATOM 10517 N N    . ILE A 1 42 ? -5.790  -4.972  7.005   1.00 0.00 ?  598  ILE A N    7  
ATOM 10518 C CA   . ILE A 1 42 ? -4.775  -4.326  7.860   1.00 0.00 ?  598  ILE A CA   7  
ATOM 10519 C C    . ILE A 1 42 ? -4.952  -2.820  7.842   1.00 0.00 ?  598  ILE A C    7  
ATOM 10520 O O    . ILE A 1 42 ? -4.977  -2.163  8.901   1.00 0.00 ?  598  ILE A O    7  
ATOM 10521 C CB   . ILE A 1 42 ? -3.272  -4.701  7.460   1.00 0.00 ?  598  ILE A CB   7  
ATOM 10522 C CG1  . ILE A 1 42 ? -2.833  -6.094  7.960   1.00 0.00 ?  598  ILE A CG1  7  
ATOM 10523 C CG2  . ILE A 1 42 ? -2.261  -3.663  7.927   1.00 0.00 ?  598  ILE A CG2  7  
ATOM 10524 C CD1  . ILE A 1 42 ? -3.483  -7.257  7.286   1.00 0.00 ?  598  ILE A CD1  7  
ATOM 10525 H H    . ILE A 1 42 ? -5.489  -5.503  6.233   1.00 0.00 ?  598  ILE A H    7  
ATOM 10526 H HA   . ILE A 1 42 ? -4.957  -4.665  8.870   1.00 0.00 ?  598  ILE A HA   7  
ATOM 10527 H HB   . ILE A 1 42 ? -3.243  -4.699  6.381   1.00 0.00 ?  598  ILE A HB   7  
ATOM 10528 H HG12 . ILE A 1 42 ? -1.769  -6.197  7.815   1.00 0.00 ?  598  ILE A HG12 7  
ATOM 10529 H HG13 . ILE A 1 42 ? -3.040  -6.161  9.018   1.00 0.00 ?  598  ILE A HG13 7  
ATOM 10530 H HG21 . ILE A 1 42 ? -1.268  -3.960  7.625   1.00 0.00 ?  598  ILE A HG21 7  
ATOM 10531 H HG22 . ILE A 1 42 ? -2.303  -3.578  9.000   1.00 0.00 ?  598  ILE A HG22 7  
ATOM 10532 H HG23 . ILE A 1 42 ? -2.500  -2.705  7.490   1.00 0.00 ?  598  ILE A HG23 7  
ATOM 10533 H HD11 . ILE A 1 42 ? -3.058  -8.182  7.648   1.00 0.00 ?  598  ILE A HD11 7  
ATOM 10534 H HD12 . ILE A 1 42 ? -3.330  -7.156  6.218   1.00 0.00 ?  598  ILE A HD12 7  
ATOM 10535 H HD13 . ILE A 1 42 ? -4.542  -7.238  7.492   1.00 0.00 ?  598  ILE A HD13 7  
ATOM 10536 N N    . ILE A 1 43 ? -5.116  -2.280  6.653   1.00 0.00 ?  599  ILE A N    7  
ATOM 10537 C CA   . ILE A 1 43 ? -5.259  -0.839  6.499   1.00 0.00 ?  599  ILE A CA   7  
ATOM 10538 C C    . ILE A 1 43 ? -6.598  -0.361  7.134   1.00 0.00 ?  599  ILE A C    7  
ATOM 10539 O O    . ILE A 1 43 ? -6.665  0.677   7.801   1.00 0.00 ?  599  ILE A O    7  
ATOM 10540 C CB   . ILE A 1 43 ? -5.213  -0.389  4.996   1.00 0.00 ?  599  ILE A CB   7  
ATOM 10541 C CG1  . ILE A 1 43 ? -4.121  -1.134  4.183   1.00 0.00 ?  599  ILE A CG1  7  
ATOM 10542 C CG2  . ILE A 1 43 ? -5.000  1.116   4.892   1.00 0.00 ?  599  ILE A CG2  7  
ATOM 10543 C CD1  . ILE A 1 43 ? -2.762  -1.210  4.815   1.00 0.00 ?  599  ILE A CD1  7  
ATOM 10544 H H    . ILE A 1 43 ? -5.099  -2.884  5.871   1.00 0.00 ?  599  ILE A H    7  
ATOM 10545 H HA   . ILE A 1 43 ? -4.430  -0.384  7.024   1.00 0.00 ?  599  ILE A HA   7  
ATOM 10546 H HB   . ILE A 1 43 ? -6.180  -0.608  4.566   1.00 0.00 ?  599  ILE A HB   7  
ATOM 10547 H HG12 . ILE A 1 43 ? -4.408  -2.168  4.046   1.00 0.00 ?  599  ILE A HG12 7  
ATOM 10548 H HG13 . ILE A 1 43 ? -4.013  -0.664  3.216   1.00 0.00 ?  599  ILE A HG13 7  
ATOM 10549 H HG21 . ILE A 1 43 ? -4.980  1.408   3.852   1.00 0.00 ?  599  ILE A HG21 7  
ATOM 10550 H HG22 . ILE A 1 43 ? -4.062  1.378   5.359   1.00 0.00 ?  599  ILE A HG22 7  
ATOM 10551 H HG23 . ILE A 1 43 ? -5.806  1.629   5.397   1.00 0.00 ?  599  ILE A HG23 7  
ATOM 10552 H HD11 . ILE A 1 43 ? -2.379  -0.231  5.052   1.00 0.00 ?  599  ILE A HD11 7  
ATOM 10553 H HD12 . ILE A 1 43 ? -2.109  -1.727  4.126   1.00 0.00 ?  599  ILE A HD12 7  
ATOM 10554 H HD13 . ILE A 1 43 ? -2.874  -1.811  5.706   1.00 0.00 ?  599  ILE A HD13 7  
ATOM 10555 N N    . GLN A 1 44 ? -7.636  -1.176  6.979   1.00 0.00 ?  600  GLN A N    7  
ATOM 10556 C CA   . GLN A 1 44 ? -9.000  -0.849  7.444   1.00 0.00 ?  600  GLN A CA   7  
ATOM 10557 C C    . GLN A 1 44 ? -9.159  -1.091  8.952   1.00 0.00 ?  600  GLN A C    7  
ATOM 10558 O O    . GLN A 1 44 ? -10.202 -0.810  9.541   1.00 0.00 ?  600  GLN A O    7  
ATOM 10559 C CB   . GLN A 1 44 ? -9.990  -1.643  6.599   1.00 0.00 ?  600  GLN A CB   7  
ATOM 10560 C CG   . GLN A 1 44 ? -11.464 -1.222  6.602   1.00 0.00 ?  600  GLN A CG   7  
ATOM 10561 C CD   . GLN A 1 44 ? -12.097 -1.394  5.228   1.00 0.00 ?  600  GLN A CD   7  
ATOM 10562 O OE1  . GLN A 1 44 ? -13.097 -0.751  4.914   1.00 0.00 ?  600  GLN A OE1  7  
ATOM 10563 N NE2  . GLN A 1 44 ? -11.429 -2.065  4.337   1.00 0.00 ?  600  GLN A NE2  7  
ATOM 10564 H H    . GLN A 1 44 ? -7.500  -2.036  6.523   1.00 0.00 ?  600  GLN A H    7  
ATOM 10565 H HA   . GLN A 1 44 ? -9.151  0.204   7.261   1.00 0.00 ?  600  GLN A HA   7  
ATOM 10566 H HB2  . GLN A 1 44 ? -9.631  -1.577  5.586   1.00 0.00 ?  600  GLN A HB2  7  
ATOM 10567 H HB3  . GLN A 1 44 ? -9.928  -2.678  6.903   1.00 0.00 ?  600  GLN A HB3  7  
ATOM 10568 H HG2  . GLN A 1 44 ? -12.054 -1.769  7.318   1.00 0.00 ?  600  GLN A HG2  7  
ATOM 10569 H HG3  . GLN A 1 44 ? -11.518 -0.160  6.798   1.00 0.00 ?  600  GLN A HG3  7  
ATOM 10570 H HE21 . GLN A 1 44 ? -10.548 -2.427  4.570   1.00 0.00 ?  600  GLN A HE21 7  
ATOM 10571 H HE22 . GLN A 1 44 ? -11.830 -2.173  3.454   1.00 0.00 ?  600  GLN A HE22 7  
ATOM 10572 N N    . SER A 1 45 ? -8.123  -1.623  9.570   1.00 0.00 ?  601  SER A N    7  
ATOM 10573 C CA   . SER A 1 45 ? -8.096  -1.770  11.005  1.00 0.00 ?  601  SER A CA   7  
ATOM 10574 C C    . SER A 1 45 ? -7.811  -0.394  11.641  1.00 0.00 ?  601  SER A C    7  
ATOM 10575 O O    . SER A 1 45 ? -8.046  -0.171  12.835  1.00 0.00 ?  601  SER A O    7  
ATOM 10576 C CB   . SER A 1 45 ? -7.029  -2.811  11.421  1.00 0.00 ?  601  SER A CB   7  
ATOM 10577 O OG   . SER A 1 45 ? -7.003  -3.020  12.836  1.00 0.00 ?  601  SER A OG   7  
ATOM 10578 H H    . SER A 1 45 ? -7.371  -1.960  9.036   1.00 0.00 ?  601  SER A H    7  
ATOM 10579 H HA   . SER A 1 45 ? -9.073  -2.104  11.322  1.00 0.00 ?  601  SER A HA   7  
ATOM 10580 H HB2  . SER A 1 45 ? -7.247  -3.752  10.938  1.00 0.00 ?  601  SER A HB2  7  
ATOM 10581 H HB3  . SER A 1 45 ? -6.057  -2.465  11.101  1.00 0.00 ?  601  SER A HB3  7  
ATOM 10582 H HG   . SER A 1 45 ? -7.703  -2.482  13.233  1.00 0.00 ?  601  SER A HG   7  
ATOM 10583 N N    . ARG A 1 46 ? -7.313  0.533   10.834  1.00 0.00 ?  602  ARG A N    7  
ATOM 10584 C CA   . ARG A 1 46 ? -7.021  1.870   11.317  1.00 0.00 ?  602  ARG A CA   7  
ATOM 10585 C C    . ARG A 1 46 ? -8.204  2.752   11.069  1.00 0.00 ?  602  ARG A C    7  
ATOM 10586 O O    . ARG A 1 46 ? -8.651  3.478   11.956  1.00 0.00 ?  602  ARG A O    7  
ATOM 10587 C CB   . ARG A 1 46 ? -5.801  2.439   10.638  1.00 0.00 ?  602  ARG A CB   7  
ATOM 10588 C CG   . ARG A 1 46 ? -4.614  1.529   10.721  1.00 0.00 ?  602  ARG A CG   7  
ATOM 10589 C CD   . ARG A 1 46 ? -3.402  2.158   10.119  1.00 0.00 ?  602  ARG A CD   7  
ATOM 10590 N NE   . ARG A 1 46 ? -2.884  3.255   10.921  1.00 0.00 ?  602  ARG A NE   7  
ATOM 10591 C CZ   . ARG A 1 46 ? -1.641  3.289   11.414  1.00 0.00 ?  602  ARG A CZ   7  
ATOM 10592 N NH1  . ARG A 1 46 ? -0.873  2.199   11.378  1.00 0.00 1  602  ARG A NH1  7  
ATOM 10593 N NH2  . ARG A 1 46 ? -1.203  4.380   12.009  1.00 0.00 ?  602  ARG A NH2  7  
ATOM 10594 H H    . ARG A 1 46 ? -7.151  0.305   9.892   1.00 0.00 ?  602  ARG A H    7  
ATOM 10595 H HA   . ARG A 1 46 ? -6.850  1.815   12.382  1.00 0.00 ?  602  ARG A HA   7  
ATOM 10596 H HB2  . ARG A 1 46 ? -6.029  2.611   9.597   1.00 0.00 ?  602  ARG A HB2  7  
ATOM 10597 H HB3  . ARG A 1 46 ? -5.541  3.377   11.104  1.00 0.00 ?  602  ARG A HB3  7  
ATOM 10598 H HG2  . ARG A 1 46 ? -4.410  1.306   11.757  1.00 0.00 ?  602  ARG A HG2  7  
ATOM 10599 H HG3  . ARG A 1 46 ? -4.837  0.614   10.191  1.00 0.00 ?  602  ARG A HG3  7  
ATOM 10600 H HD2  . ARG A 1 46 ? -2.639  1.400   10.026  1.00 0.00 ?  602  ARG A HD2  7  
ATOM 10601 H HD3  . ARG A 1 46 ? -3.657  2.528   9.138   1.00 0.00 ?  602  ARG A HD3  7  
ATOM 10602 H HE   . ARG A 1 46 ? -3.480  4.027   11.054  1.00 0.00 ?  602  ARG A HE   7  
ATOM 10603 H HH11 . ARG A 1 46 ? -1.179  1.310   11.000  1.00 0.00 ?  602  ARG A HH11 7  
ATOM 10604 H HH12 . ARG A 1 46 ? 0.065   2.210   11.728  1.00 0.00 ?  602  ARG A HH12 7  
ATOM 10605 H HH21 . ARG A 1 46 ? -1.794  5.184   12.104  1.00 0.00 ?  602  ARG A HH21 7  
ATOM 10606 H HH22 . ARG A 1 46 ? -0.272  4.477   12.370  1.00 0.00 ?  602  ARG A HH22 7  
ATOM 10607 N N    . GLU A 1 47 ? -8.709  2.698   9.865   1.00 0.00 ?  603  GLU A N    7  
ATOM 10608 C CA   . GLU A 1 47 ? -9.902  3.408   9.526   1.00 0.00 ?  603  GLU A CA   7  
ATOM 10609 C C    . GLU A 1 47 ? -10.949 2.399   9.108   1.00 0.00 ?  603  GLU A C    7  
ATOM 10610 O O    . GLU A 1 47 ? -10.867 1.854   8.022   1.00 0.00 ?  603  GLU A O    7  
ATOM 10611 C CB   . GLU A 1 47 ? -9.667  4.440   8.405   1.00 0.00 ?  603  GLU A CB   7  
ATOM 10612 C CG   . GLU A 1 47 ? -8.592  5.466   8.727   1.00 0.00 ?  603  GLU A CG   7  
ATOM 10613 C CD   . GLU A 1 47 ? -8.689  6.704   7.885   1.00 0.00 ?  603  GLU A CD   7  
ATOM 10614 O OE1  . GLU A 1 47 ? -9.654  7.468   8.055   1.00 0.00 ?  603  GLU A OE1  7  
ATOM 10615 O OE2  . GLU A 1 47 ? -7.784  6.985   7.097   1.00 0.00 -1 603  GLU A OE2  7  
ATOM 10616 H H    . GLU A 1 47 ? -8.278  2.158   9.170   1.00 0.00 ?  603  GLU A H    7  
ATOM 10617 H HA   . GLU A 1 47 ? -10.244 3.915   10.416  1.00 0.00 ?  603  GLU A HA   7  
ATOM 10618 H HB2  . GLU A 1 47 ? -9.375  3.916   7.506   1.00 0.00 ?  603  GLU A HB2  7  
ATOM 10619 H HB3  . GLU A 1 47 ? -10.591 4.965   8.213   1.00 0.00 ?  603  GLU A HB3  7  
ATOM 10620 H HG2  . GLU A 1 47 ? -8.649  5.755   9.765   1.00 0.00 ?  603  GLU A HG2  7  
ATOM 10621 H HG3  . GLU A 1 47 ? -7.628  5.018   8.528   1.00 0.00 ?  603  GLU A HG3  7  
ATOM 10622 N N    . PRO A 1 48 ? -11.910 2.074   9.992   1.00 0.00 ?  604  PRO A N    7  
ATOM 10623 C CA   . PRO A 1 48 ? -12.997 1.117   9.688   1.00 0.00 ?  604  PRO A CA   7  
ATOM 10624 C C    . PRO A 1 48 ? -13.836 1.541   8.479   1.00 0.00 ?  604  PRO A C    7  
ATOM 10625 O O    . PRO A 1 48 ? -14.458 0.724   7.839   1.00 0.00 ?  604  PRO A O    7  
ATOM 10626 C CB   . PRO A 1 48 ? -13.847 1.133   10.961  1.00 0.00 ?  604  PRO A CB   7  
ATOM 10627 C CG   . PRO A 1 48 ? -12.896 1.543   12.026  1.00 0.00 ?  604  PRO A CG   7  
ATOM 10628 C CD   . PRO A 1 48 ? -11.992 2.551   11.386  1.00 0.00 ?  604  PRO A CD   7  
ATOM 10629 H HA   . PRO A 1 48 ? -12.608 0.124   9.520   1.00 0.00 ?  604  PRO A HA   7  
ATOM 10630 H HB2  . PRO A 1 48 ? -14.649 1.848   10.845  1.00 0.00 ?  604  PRO A HB2  7  
ATOM 10631 H HB3  . PRO A 1 48 ? -14.252 0.150   11.147  1.00 0.00 ?  604  PRO A HB3  7  
ATOM 10632 H HG2  . PRO A 1 48 ? -13.433 1.983   12.852  1.00 0.00 ?  604  PRO A HG2  7  
ATOM 10633 H HG3  . PRO A 1 48 ? -12.325 0.688   12.358  1.00 0.00 ?  604  PRO A HG3  7  
ATOM 10634 H HD2  . PRO A 1 48 ? -12.425 3.538   11.446  1.00 0.00 ?  604  PRO A HD2  7  
ATOM 10635 H HD3  . PRO A 1 48 ? -11.020 2.529   11.858  1.00 0.00 ?  604  PRO A HD3  7  
ATOM 10636 N N    . SER A 1 49 ? -13.812 2.815   8.172   1.00 0.00 ?  605  SER A N    7  
ATOM 10637 C CA   . SER A 1 49 ? -14.543 3.362   7.053   1.00 0.00 ?  605  SER A CA   7  
ATOM 10638 C C    . SER A 1 49 ? -13.685 3.335   5.763   1.00 0.00 ?  605  SER A C    7  
ATOM 10639 O O    . SER A 1 49 ? -14.120 3.844   4.727   1.00 0.00 ?  605  SER A O    7  
ATOM 10640 C CB   . SER A 1 49 ? -15.043 4.787   7.370   1.00 0.00 ?  605  SER A CB   7  
ATOM 10641 O OG   . SER A 1 49 ? -15.881 5.291   6.337   1.00 0.00 ?  605  SER A OG   7  
ATOM 10642 H H    . SER A 1 49 ? -13.280 3.423   8.730   1.00 0.00 ?  605  SER A H    7  
ATOM 10643 H HA   . SER A 1 49 ? -15.398 2.720   6.895   1.00 0.00 ?  605  SER A HA   7  
ATOM 10644 H HB2  . SER A 1 49 ? -15.601 4.776   8.294   1.00 0.00 ?  605  SER A HB2  7  
ATOM 10645 H HB3  . SER A 1 49 ? -14.192 5.442   7.477   1.00 0.00 ?  605  SER A HB3  7  
ATOM 10646 H HG   . SER A 1 49 ? -15.352 5.316   5.529   1.00 0.00 ?  605  SER A HG   7  
ATOM 10647 N N    . LEU A 1 50 ? -12.459 2.762   5.862   1.00 0.00 ?  606  LEU A N    7  
ATOM 10648 C CA   . LEU A 1 50 ? -11.462 2.724   4.765   1.00 0.00 ?  606  LEU A CA   7  
ATOM 10649 C C    . LEU A 1 50 ? -12.077 2.440   3.413   1.00 0.00 ?  606  LEU A C    7  
ATOM 10650 O O    . LEU A 1 50 ? -12.165 3.336   2.575   1.00 0.00 ?  606  LEU A O    7  
ATOM 10651 C CB   . LEU A 1 50 ? -10.394 1.652   5.018   1.00 0.00 ?  606  LEU A CB   7  
ATOM 10652 C CG   . LEU A 1 50 ? -9.371  1.451   3.901   1.00 0.00 ?  606  LEU A CG   7  
ATOM 10653 C CD1  . LEU A 1 50 ? -8.426  2.574   3.833   1.00 0.00 ?  606  LEU A CD1  7  
ATOM 10654 C CD2  . LEU A 1 50 ? -8.636  0.145   4.025   1.00 0.00 ?  606  LEU A CD2  7  
ATOM 10655 H H    . LEU A 1 50 ? -12.210 2.346   6.718   1.00 0.00 ?  606  LEU A H    7  
ATOM 10656 H HA   . LEU A 1 50 ? -10.967 3.682   4.733   1.00 0.00 ?  606  LEU A HA   7  
ATOM 10657 H HB2  . LEU A 1 50 ? -9.865  1.898   5.925   1.00 0.00 ?  606  LEU A HB2  7  
ATOM 10658 H HB3  . LEU A 1 50 ? -10.905 0.712   5.159   1.00 0.00 ?  606  LEU A HB3  7  
ATOM 10659 H HG   . LEU A 1 50 ? -9.907  1.436   2.964   1.00 0.00 ?  606  LEU A HG   7  
ATOM 10660 H HD11 . LEU A 1 50 ? -7.755  2.341   3.022   1.00 0.00 ?  606  LEU A HD11 7  
ATOM 10661 H HD12 . LEU A 1 50 ? -7.908  2.599   4.777   1.00 0.00 ?  606  LEU A HD12 7  
ATOM 10662 H HD13 . LEU A 1 50 ? -8.976  3.480   3.638   1.00 0.00 ?  606  LEU A HD13 7  
ATOM 10663 H HD21 . LEU A 1 50 ? -9.333  -0.668  3.890   1.00 0.00 ?  606  LEU A HD21 7  
ATOM 10664 H HD22 . LEU A 1 50 ? -8.185  0.077   5.004   1.00 0.00 ?  606  LEU A HD22 7  
ATOM 10665 H HD23 . LEU A 1 50 ? -7.871  0.092   3.264   1.00 0.00 ?  606  LEU A HD23 7  
ATOM 10666 N N    . ARG A 1 51 ? -12.494 1.211   3.168   1.00 0.00 ?  607  ARG A N    7  
ATOM 10667 C CA   . ARG A 1 51 ? -13.019 0.948   1.877   1.00 0.00 ?  607  ARG A CA   7  
ATOM 10668 C C    . ARG A 1 51 ? -14.489 1.212   1.875   1.00 0.00 ?  607  ARG A C    7  
ATOM 10669 O O    . ARG A 1 51 ? -15.001 1.983   1.072   1.00 0.00 ?  607  ARG A O    7  
ATOM 10670 C CB   . ARG A 1 51 ? -12.714 -0.472  1.382   1.00 0.00 ?  607  ARG A CB   7  
ATOM 10671 C CG   . ARG A 1 51 ? -11.237 -0.811  1.362   1.00 0.00 ?  607  ARG A CG   7  
ATOM 10672 C CD   . ARG A 1 51 ? -10.434 0.198   0.572   1.00 0.00 ?  607  ARG A CD   7  
ATOM 10673 N NE   . ARG A 1 51 ? -8.987  -0.055  0.670   1.00 0.00 ?  607  ARG A NE   7  
ATOM 10674 C CZ   . ARG A 1 51 ? -8.046  0.909   0.595   1.00 0.00 ?  607  ARG A CZ   7  
ATOM 10675 N NH1  . ARG A 1 51 ? -8.393  2.175   0.344   1.00 0.00 1  607  ARG A NH1  7  
ATOM 10676 N NH2  . ARG A 1 51 ? -6.755  0.596   0.757   1.00 0.00 ?  607  ARG A NH2  7  
ATOM 10677 H H    . ARG A 1 51 ? -12.492 0.531   3.879   1.00 0.00 ?  607  ARG A H    7  
ATOM 10678 H HA   . ARG A 1 51 ? -12.459 1.654   1.300   1.00 0.00 ?  607  ARG A HA   7  
ATOM 10679 H HB2  . ARG A 1 51 ? -13.212 -1.175  2.033   1.00 0.00 ?  607  ARG A HB2  7  
ATOM 10680 H HB3  . ARG A 1 51 ? -13.105 -0.585  0.381   1.00 0.00 ?  607  ARG A HB3  7  
ATOM 10681 H HG2  . ARG A 1 51 ? -10.869 -0.828  2.376   1.00 0.00 ?  607  ARG A HG2  7  
ATOM 10682 H HG3  . ARG A 1 51 ? -11.113 -1.787  0.917   1.00 0.00 ?  607  ARG A HG3  7  
ATOM 10683 H HD2  . ARG A 1 51 ? -10.725 0.144   -0.466  1.00 0.00 ?  607  ARG A HD2  7  
ATOM 10684 H HD3  . ARG A 1 51 ? -10.627 1.192   0.944   1.00 0.00 ?  607  ARG A HD3  7  
ATOM 10685 H HE   . ARG A 1 51 ? -8.760  -0.999  0.813   1.00 0.00 ?  607  ARG A HE   7  
ATOM 10686 H HH11 . ARG A 1 51 ? -9.353  2.475   0.189   1.00 0.00 ?  607  ARG A HH11 7  
ATOM 10687 H HH12 . ARG A 1 51 ? -7.763  2.951   0.305   1.00 0.00 ?  607  ARG A HH12 7  
ATOM 10688 H HH21 . ARG A 1 51 ? -6.454  -0.342  0.935   1.00 0.00 ?  607  ARG A HH21 7  
ATOM 10689 H HH22 . ARG A 1 51 ? -6.037  1.293   0.709   1.00 0.00 ?  607  ARG A HH22 7  
ATOM 10690 N N    . ASP A 1 52 ? -15.133 0.595   2.807   1.00 0.00 ?  608  ASP A N    7  
ATOM 10691 C CA   . ASP A 1 52 ? -16.546 0.775   3.080   1.00 0.00 ?  608  ASP A CA   7  
ATOM 10692 C C    . ASP A 1 52 ? -16.735 0.539   4.537   1.00 0.00 ?  608  ASP A C    7  
ATOM 10693 O O    . ASP A 1 52 ? -17.317 1.341   5.263   1.00 0.00 ?  608  ASP A O    7  
ATOM 10694 C CB   . ASP A 1 52 ? -17.372 -0.254  2.289   1.00 0.00 ?  608  ASP A CB   7  
ATOM 10695 C CG   . ASP A 1 52 ? -18.824 -0.304  2.721   1.00 0.00 ?  608  ASP A CG   7  
ATOM 10696 O OD1  . ASP A 1 52 ? -19.638 0.511   2.217   1.00 0.00 ?  608  ASP A OD1  7  
ATOM 10697 O OD2  . ASP A 1 52 ? -19.165 -1.155  3.562   1.00 0.00 -1 608  ASP A OD2  7  
ATOM 10698 H H    . ASP A 1 52 ? -14.610 0.008   3.393   1.00 0.00 ?  608  ASP A H    7  
ATOM 10699 H HA   . ASP A 1 52 ? -16.848 1.777   2.809   1.00 0.00 ?  608  ASP A HA   7  
ATOM 10700 H HB2  . ASP A 1 52 ? -17.341 -0.003  1.238   1.00 0.00 ?  608  ASP A HB2  7  
ATOM 10701 H HB3  . ASP A 1 52 ? -16.938 -1.233  2.429   1.00 0.00 ?  608  ASP A HB3  7  
ATOM 10702 N N    . SER A 1 53 ? -16.109 -0.559  4.929   1.00 0.00 ?  609  SER A N    7  
ATOM 10703 C CA   . SER A 1 53 ? -16.070 -1.142  6.238   1.00 0.00 ?  609  SER A CA   7  
ATOM 10704 C C    . SER A 1 53 ? -15.769 -2.606  5.956   1.00 0.00 ?  609  SER A C    7  
ATOM 10705 O O    . SER A 1 53 ? -15.141 -3.315  6.745   1.00 0.00 ?  609  SER A O    7  
ATOM 10706 C CB   . SER A 1 53 ? -17.417 -1.028  6.966   1.00 0.00 ?  609  SER A CB   7  
ATOM 10707 O OG   . SER A 1 53 ? -17.263 -1.231  8.359   1.00 0.00 ?  609  SER A OG   7  
ATOM 10708 H H    . SER A 1 53 ? -15.601 -1.063  4.261   1.00 0.00 ?  609  SER A H    7  
ATOM 10709 H HA   . SER A 1 53 ? -15.265 -0.697  6.805   1.00 0.00 ?  609  SER A HA   7  
ATOM 10710 H HB2  . SER A 1 53 ? -17.839 -0.049  6.797   1.00 0.00 ?  609  SER A HB2  7  
ATOM 10711 H HB3  . SER A 1 53 ? -18.086 -1.780  6.576   1.00 0.00 ?  609  SER A HB3  7  
ATOM 10712 H HG   . SER A 1 53 ? -16.583 -1.906  8.482   1.00 0.00 ?  609  SER A HG   7  
ATOM 10713 N N    . ASN A 1 54 ? -16.245 -3.031  4.786   1.00 0.00 ?  610  ASN A N    7  
ATOM 10714 C CA   . ASN A 1 54 ? -16.024 -4.361  4.244   1.00 0.00 ?  610  ASN A CA   7  
ATOM 10715 C C    . ASN A 1 54 ? -14.563 -4.538  3.801   1.00 0.00 ?  610  ASN A C    7  
ATOM 10716 O O    . ASN A 1 54 ? -14.011 -3.670  3.107   1.00 0.00 ?  610  ASN A O    7  
ATOM 10717 C CB   . ASN A 1 54 ? -16.978 -4.586  3.057   1.00 0.00 ?  610  ASN A CB   7  
ATOM 10718 C CG   . ASN A 1 54 ? -16.834 -5.954  2.428   1.00 0.00 ?  610  ASN A CG   7  
ATOM 10719 O OD1  . ASN A 1 54 ? -16.086 -6.145  1.467   1.00 0.00 ?  610  ASN A OD1  7  
ATOM 10720 N ND2  . ASN A 1 54 ? -17.526 -6.910  2.968   1.00 0.00 ?  610  ASN A ND2  7  
ATOM 10721 H H    . ASN A 1 54 ? -16.820 -2.420  4.276   1.00 0.00 ?  610  ASN A H    7  
ATOM 10722 H HA   . ASN A 1 54 ? -16.255 -5.081  5.014   1.00 0.00 ?  610  ASN A HA   7  
ATOM 10723 H HB2  . ASN A 1 54 ? -17.999 -4.470  3.390   1.00 0.00 ?  610  ASN A HB2  7  
ATOM 10724 H HB3  . ASN A 1 54 ? -16.773 -3.840  2.301   1.00 0.00 ?  610  ASN A HB3  7  
ATOM 10725 H HD21 . ASN A 1 54 ? -18.094 -6.673  3.736   1.00 0.00 ?  610  ASN A HD21 7  
ATOM 10726 H HD22 . ASN A 1 54 ? -17.470 -7.833  2.638   1.00 0.00 ?  610  ASN A HD22 7  
ATOM 10727 N N    . PRO A 1 55 ? -13.914 -5.648  4.211   1.00 0.00 ?  611  PRO A N    7  
ATOM 10728 C CA   . PRO A 1 55 ? -12.511 -5.929  3.884   1.00 0.00 ?  611  PRO A CA   7  
ATOM 10729 C C    . PRO A 1 55 ? -12.311 -6.709  2.569   1.00 0.00 ?  611  PRO A C    7  
ATOM 10730 O O    . PRO A 1 55 ? -11.179 -6.970  2.172   1.00 0.00 ?  611  PRO A O    7  
ATOM 10731 C CB   . PRO A 1 55 ? -12.076 -6.792  5.058   1.00 0.00 ?  611  PRO A CB   7  
ATOM 10732 C CG   . PRO A 1 55 ? -13.287 -7.611  5.354   1.00 0.00 ?  611  PRO A CG   7  
ATOM 10733 C CD   . PRO A 1 55 ? -14.473 -6.710  5.096   1.00 0.00 ?  611  PRO A CD   7  
ATOM 10734 H HA   . PRO A 1 55 ? -11.915 -5.027  3.873   1.00 0.00 ?  611  PRO A HA   7  
ATOM 10735 H HB2  . PRO A 1 55 ? -11.236 -7.405  4.764   1.00 0.00 ?  611  PRO A HB2  7  
ATOM 10736 H HB3  . PRO A 1 55 ? -11.807 -6.167  5.895   1.00 0.00 ?  611  PRO A HB3  7  
ATOM 10737 H HG2  . PRO A 1 55 ? -13.317 -8.460  4.686   1.00 0.00 ?  611  PRO A HG2  7  
ATOM 10738 H HG3  . PRO A 1 55 ? -13.275 -7.944  6.380   1.00 0.00 ?  611  PRO A HG3  7  
ATOM 10739 H HD2  . PRO A 1 55 ? -15.259 -7.253  4.593   1.00 0.00 ?  611  PRO A HD2  7  
ATOM 10740 H HD3  . PRO A 1 55 ? -14.829 -6.288  6.023   1.00 0.00 ?  611  PRO A HD3  7  
ATOM 10741 N N    . ASP A 1 56 ? -13.388 -7.094  1.904   1.00 0.00 ?  612  ASP A N    7  
ATOM 10742 C CA   . ASP A 1 56 ? -13.239 -7.887  0.688   1.00 0.00 ?  612  ASP A CA   7  
ATOM 10743 C C    . ASP A 1 56 ? -12.975 -7.010  -0.515  1.00 0.00 ?  612  ASP A C    7  
ATOM 10744 O O    . ASP A 1 56 ? -12.086 -7.305  -1.322  1.00 0.00 ?  612  ASP A O    7  
ATOM 10745 C CB   . ASP A 1 56 ? -14.441 -8.789  0.418   1.00 0.00 ?  612  ASP A CB   7  
ATOM 10746 C CG   . ASP A 1 56 ? -14.210 -9.663  -0.802  1.00 0.00 ?  612  ASP A CG   7  
ATOM 10747 O OD1  . ASP A 1 56 ? -14.759 -9.368  -1.899  1.00 0.00 ?  612  ASP A OD1  7  
ATOM 10748 O OD2  . ASP A 1 56 ? -13.442 -10.641 -0.699  1.00 0.00 -1 612  ASP A OD2  7  
ATOM 10749 H H    . ASP A 1 56 ? -14.277 -6.832  2.223   1.00 0.00 ?  612  ASP A H    7  
ATOM 10750 H HA   . ASP A 1 56 ? -12.369 -8.508  0.837   1.00 0.00 ?  612  ASP A HA   7  
ATOM 10751 H HB2  . ASP A 1 56 ? -14.614 -9.420  1.277   1.00 0.00 ?  612  ASP A HB2  7  
ATOM 10752 H HB3  . ASP A 1 56 ? -15.310 -8.172  0.242   1.00 0.00 ?  612  ASP A HB3  7  
ATOM 10753 N N    . GLU A 1 57 ? -13.749 -5.942  -0.636  1.00 0.00 ?  613  GLU A N    7  
ATOM 10754 C CA   . GLU A 1 57 ? -13.599 -4.993  -1.730  1.00 0.00 ?  613  GLU A CA   7  
ATOM 10755 C C    . GLU A 1 57 ? -12.263 -4.301  -1.698  1.00 0.00 ?  613  GLU A C    7  
ATOM 10756 O O    . GLU A 1 57 ? -12.010 -3.420  -0.868  1.00 0.00 ?  613  GLU A O    7  
ATOM 10757 C CB   . GLU A 1 57 ? -14.732 -3.973  -1.765  1.00 0.00 ?  613  GLU A CB   7  
ATOM 10758 C CG   . GLU A 1 57 ? -15.860 -4.353  -2.699  1.00 0.00 ?  613  GLU A CG   7  
ATOM 10759 C CD   . GLU A 1 57 ? -15.397 -4.384  -4.144  1.00 0.00 ?  613  GLU A CD   7  
ATOM 10760 O OE1  . GLU A 1 57 ? -15.269 -3.307  -4.765  1.00 0.00 ?  613  GLU A OE1  7  
ATOM 10761 O OE2  . GLU A 1 57 ? -15.153 -5.483  -4.688  1.00 0.00 -1 613  GLU A OE2  7  
ATOM 10762 H H    . GLU A 1 57 ? -14.433 -5.785  0.047   1.00 0.00 ?  613  GLU A H    7  
ATOM 10763 H HA   . GLU A 1 57 ? -13.639 -5.572  -2.641  1.00 0.00 ?  613  GLU A HA   7  
ATOM 10764 H HB2  . GLU A 1 57 ? -15.135 -3.865  -0.769  1.00 0.00 ?  613  GLU A HB2  7  
ATOM 10765 H HB3  . GLU A 1 57 ? -14.332 -3.021  -2.086  1.00 0.00 ?  613  GLU A HB3  7  
ATOM 10766 H HG2  . GLU A 1 57 ? -16.214 -5.337  -2.429  1.00 0.00 ?  613  GLU A HG2  7  
ATOM 10767 H HG3  . GLU A 1 57 ? -16.660 -3.634  -2.604  1.00 0.00 ?  613  GLU A HG3  7  
ATOM 10768 N N    . ILE A 1 58 ? -11.405 -4.715  -2.579  1.00 0.00 ?  614  ILE A N    7  
ATOM 10769 C CA   . ILE A 1 58 ? -10.121 -4.136  -2.666  1.00 0.00 ?  614  ILE A CA   7  
ATOM 10770 C C    . ILE A 1 58 ? -10.099 -3.032  -3.703  1.00 0.00 ?  614  ILE A C    7  
ATOM 10771 O O    . ILE A 1 58 ? -10.074 -3.261  -4.916  1.00 0.00 ?  614  ILE A O    7  
ATOM 10772 C CB   . ILE A 1 58 ? -9.019  -5.199  -2.951  1.00 0.00 ?  614  ILE A CB   7  
ATOM 10773 C CG1  . ILE A 1 58 ? -7.648  -4.516  -3.096  1.00 0.00 ?  614  ILE A CG1  7  
ATOM 10774 C CG2  . ILE A 1 58 ? -9.373  -5.998  -4.211  1.00 0.00 ?  614  ILE A CG2  7  
ATOM 10775 C CD1  . ILE A 1 58 ? -6.456  -5.424  -2.926  1.00 0.00 ?  614  ILE A CD1  7  
ATOM 10776 H H    . ILE A 1 58 ? -11.663 -5.447  -3.176  1.00 0.00 ?  614  ILE A H    7  
ATOM 10777 H HA   . ILE A 1 58 ? -9.914  -3.690  -1.704  1.00 0.00 ?  614  ILE A HA   7  
ATOM 10778 H HB   . ILE A 1 58 ? -8.988  -5.888  -2.118  1.00 0.00 ?  614  ILE A HB   7  
ATOM 10779 H HG12 . ILE A 1 58 ? -7.589  -4.128  -4.102  1.00 0.00 ?  614  ILE A HG12 7  
ATOM 10780 H HG13 . ILE A 1 58 ? -7.550  -3.686  -2.414  1.00 0.00 ?  614  ILE A HG13 7  
ATOM 10781 H HG21 . ILE A 1 58 ? -8.601  -6.728  -4.403  1.00 0.00 ?  614  ILE A HG21 7  
ATOM 10782 H HG22 . ILE A 1 58 ? -9.467  -5.310  -5.050  1.00 0.00 ?  614  ILE A HG22 7  
ATOM 10783 H HG23 . ILE A 1 58 ? -10.317 -6.496  -4.043  1.00 0.00 ?  614  ILE A HG23 7  
ATOM 10784 H HD11 . ILE A 1 58 ? -5.558  -4.829  -3.003  1.00 0.00 ?  614  ILE A HD11 7  
ATOM 10785 H HD12 . ILE A 1 58 ? -6.414  -6.200  -3.678  1.00 0.00 ?  614  ILE A HD12 7  
ATOM 10786 H HD13 . ILE A 1 58 ? -6.482  -5.875  -1.946  1.00 0.00 ?  614  ILE A HD13 7  
ATOM 10787 N N    . GLU A 1 59 ? -10.141 -1.851  -3.235  1.00 0.00 ?  615  GLU A N    7  
ATOM 10788 C CA   . GLU A 1 59 ? -10.005 -0.738  -4.073  1.00 0.00 ?  615  GLU A CA   7  
ATOM 10789 C C    . GLU A 1 59 ? -9.233  0.275   -3.365  1.00 0.00 ?  615  GLU A C    7  
ATOM 10790 O O    . GLU A 1 59 ? -9.378  0.455   -2.189  1.00 0.00 ?  615  GLU A O    7  
ATOM 10791 C CB   . GLU A 1 59 ? -11.347 -0.331  -4.695  1.00 0.00 ?  615  GLU A CB   7  
ATOM 10792 C CG   . GLU A 1 59 ? -11.505 0.789   -5.647  1.00 0.00 ?  615  GLU A CG   7  
ATOM 10793 C CD   . GLU A 1 59 ? -11.210 2.128   -5.120  1.00 0.00 ?  615  GLU A CD   7  
ATOM 10794 O OE1  . GLU A 1 59 ? -12.121 2.785   -4.580  1.00 0.00 ?  615  GLU A OE1  7  
ATOM 10795 O OE2  . GLU A 1 59 ? -10.102 2.564   -5.274  1.00 0.00 -1 615  GLU A OE2  7  
ATOM 10796 H H    . GLU A 1 59 ? -10.283 -1.694  -2.278  1.00 0.00 ?  615  GLU A H    7  
ATOM 10797 H HA   . GLU A 1 59 ? -9.337  -1.072  -4.854  1.00 0.00 ?  615  GLU A HA   7  
ATOM 10798 H HB2  . GLU A 1 59 ? -11.037 -0.968  -5.500  1.00 0.00 ?  615  GLU A HB2  7  
ATOM 10799 H HB3  . GLU A 1 59 ? -12.299 -0.729  -4.388  1.00 0.00 ?  615  GLU A HB3  7  
ATOM 10800 H HG2  . GLU A 1 59 ? -10.970 0.564   -6.556  1.00 0.00 ?  615  GLU A HG2  7  
ATOM 10801 H HG3  . GLU A 1 59 ? -12.536 0.715   -5.931  1.00 0.00 ?  615  GLU A HG3  7  
ATOM 10802 N N    . ILE A 1 60 ? -8.387  0.881   -4.066  1.00 0.00 ?  616  ILE A N    7  
ATOM 10803 C CA   . ILE A 1 60 ? -7.388  1.725   -3.430  1.00 0.00 ?  616  ILE A CA   7  
ATOM 10804 C C    . ILE A 1 60 ? -7.517  3.242   -3.598  1.00 0.00 ?  616  ILE A C    7  
ATOM 10805 O O    . ILE A 1 60 ? -6.810  3.908   -4.315  1.00 0.00 ?  616  ILE A O    7  
ATOM 10806 C CB   . ILE A 1 60 ? -5.961  1.123   -3.475  1.00 0.00 ?  616  ILE A CB   7  
ATOM 10807 C CG1  . ILE A 1 60 ? -5.963  -0.017  -2.476  1.00 0.00 ?  616  ILE A CG1  7  
ATOM 10808 C CG2  . ILE A 1 60 ? -4.875  2.113   -3.095  1.00 0.00 ?  616  ILE A CG2  7  
ATOM 10809 C CD1  . ILE A 1 60 ? -4.751  -0.830  -2.494  1.00 0.00 ?  616  ILE A CD1  7  
ATOM 10810 H H    . ILE A 1 60 ? -8.615  0.780   -5.024  1.00 0.00 ?  616  ILE A H    7  
ATOM 10811 H HA   . ILE A 1 60 ? -7.698  1.564   -2.403  1.00 0.00 ?  616  ILE A HA   7  
ATOM 10812 H HB   . ILE A 1 60 ? -5.783  0.699   -4.454  1.00 0.00 ?  616  ILE A HB   7  
ATOM 10813 H HG12 . ILE A 1 60 ? -6.049  0.396   -1.481  1.00 0.00 ?  616  ILE A HG12 7  
ATOM 10814 H HG13 . ILE A 1 60 ? -6.810  -0.660  -2.656  1.00 0.00 ?  616  ILE A HG13 7  
ATOM 10815 H HG21 . ILE A 1 60 ? -3.910  1.630   -3.150  1.00 0.00 ?  616  ILE A HG21 7  
ATOM 10816 H HG22 . ILE A 1 60 ? -5.045  2.469   -2.090  1.00 0.00 ?  616  ILE A HG22 7  
ATOM 10817 H HG23 . ILE A 1 60 ? -4.900  2.944   -3.785  1.00 0.00 ?  616  ILE A HG23 7  
ATOM 10818 H HD11 . ILE A 1 60 ? -3.927  -0.158  -2.322  1.00 0.00 ?  616  ILE A HD11 7  
ATOM 10819 H HD12 . ILE A 1 60 ? -4.717  -1.288  -3.478  1.00 0.00 ?  616  ILE A HD12 7  
ATOM 10820 H HD13 . ILE A 1 60 ? -4.834  -1.571  -1.718  1.00 0.00 ?  616  ILE A HD13 7  
ATOM 10821 N N    . ASP A 1 61 ? -8.460  3.732   -2.902  1.00 0.00 ?  617  ASP A N    7  
ATOM 10822 C CA   . ASP A 1 61 ? -8.822  5.145   -2.723  1.00 0.00 ?  617  ASP A CA   7  
ATOM 10823 C C    . ASP A 1 61 ? -7.703  6.121   -2.318  1.00 0.00 ?  617  ASP A C    7  
ATOM 10824 O O    . ASP A 1 61 ? -7.936  7.323   -2.190  1.00 0.00 ?  617  ASP A O    7  
ATOM 10825 C CB   . ASP A 1 61 ? -10.102 5.320   -1.980  1.00 0.00 ?  617  ASP A CB   7  
ATOM 10826 C CG   . ASP A 1 61 ? -10.069 4.741   -0.584  1.00 0.00 ?  617  ASP A CG   7  
ATOM 10827 O OD1  . ASP A 1 61 ? -9.571  5.414   0.328   1.00 0.00 ?  617  ASP A OD1  7  
ATOM 10828 O OD2  . ASP A 1 61 ? -10.524 3.580   -0.384  1.00 0.00 -1 617  ASP A OD2  7  
ATOM 10829 H H    . ASP A 1 61 ? -9.047  3.082   -2.455  1.00 0.00 ?  617  ASP A H    7  
ATOM 10830 H HA   . ASP A 1 61 ? -9.010  5.465   -3.737  1.00 0.00 ?  617  ASP A HA   7  
ATOM 10831 H HB2  . ASP A 1 61 ? -10.330 6.376   -1.975  1.00 0.00 ?  617  ASP A HB2  7  
ATOM 10832 H HB3  . ASP A 1 61 ? -10.804 4.801   -2.618  1.00 0.00 ?  617  ASP A HB3  7  
ATOM 10833 N N    . PHE A 1 62 ? -6.498  5.588   -2.141  1.00 0.00 ?  618  PHE A N    7  
ATOM 10834 C CA   . PHE A 1 62 ? -5.316  6.210   -1.521  1.00 0.00 ?  618  PHE A CA   7  
ATOM 10835 C C    . PHE A 1 62 ? -4.979  7.603   -2.011  1.00 0.00 ?  618  PHE A C    7  
ATOM 10836 O O    . PHE A 1 62 ? -4.313  8.328   -1.294  1.00 0.00 ?  618  PHE A O    7  
ATOM 10837 C CB   . PHE A 1 62 ? -4.127  5.340   -1.891  1.00 0.00 ?  618  PHE A CB   7  
ATOM 10838 C CG   . PHE A 1 62 ? -3.670  4.385   -0.832  1.00 0.00 ?  618  PHE A CG   7  
ATOM 10839 C CD1  . PHE A 1 62 ? -4.585  3.761   0.002   1.00 0.00 ?  618  PHE A CD1  7  
ATOM 10840 C CD2  . PHE A 1 62 ? -2.331  4.093   -0.680  1.00 0.00 ?  618  PHE A CD2  7  
ATOM 10841 C CE1  . PHE A 1 62 ? -4.170  2.874   0.969   1.00 0.00 ?  618  PHE A CE1  7  
ATOM 10842 C CE2  . PHE A 1 62 ? -1.914  3.209   0.289   1.00 0.00 ?  618  PHE A CE2  7  
ATOM 10843 C CZ   . PHE A 1 62 ? -2.836  2.601   1.115   1.00 0.00 ?  618  PHE A CZ   7  
ATOM 10844 H H    . PHE A 1 62 ? -6.402  4.686   -2.512  1.00 0.00 ?  618  PHE A H    7  
ATOM 10845 H HA   . PHE A 1 62 ? -5.388  6.174   -0.444  1.00 0.00 ?  618  PHE A HA   7  
ATOM 10846 H HB2  . PHE A 1 62 ? -4.507  4.727   -2.698  1.00 0.00 ?  618  PHE A HB2  7  
ATOM 10847 H HB3  . PHE A 1 62 ? -3.310  5.905   -2.330  1.00 0.00 ?  618  PHE A HB3  7  
ATOM 10848 H HD1  . PHE A 1 62 ? -5.637  3.981   -0.108  1.00 0.00 ?  618  PHE A HD1  7  
ATOM 10849 H HD2  . PHE A 1 62 ? -1.597  4.556   -1.325  1.00 0.00 ?  618  PHE A HD2  7  
ATOM 10850 H HE1  . PHE A 1 62 ? -4.892  2.397   1.614   1.00 0.00 ?  618  PHE A HE1  7  
ATOM 10851 H HE2  . PHE A 1 62 ? -0.862  2.996   0.404   1.00 0.00 ?  618  PHE A HE2  7  
ATOM 10852 H HZ   . PHE A 1 62 ? -2.506  1.905   1.872   1.00 0.00 ?  618  PHE A HZ   7  
ATOM 10853 N N    . GLU A 1 63 ? -5.445  7.986   -3.182  1.00 0.00 ?  619  GLU A N    7  
ATOM 10854 C CA   . GLU A 1 63 ? -5.289  9.360   -3.659  1.00 0.00 ?  619  GLU A CA   7  
ATOM 10855 C C    . GLU A 1 63 ? -5.854  10.338  -2.604  1.00 0.00 ?  619  GLU A C    7  
ATOM 10856 O O    . GLU A 1 63 ? -5.218  11.340  -2.245  1.00 0.00 ?  619  GLU A O    7  
ATOM 10857 C CB   . GLU A 1 63 ? -6.107  9.550   -4.915  1.00 0.00 ?  619  GLU A CB   7  
ATOM 10858 C CG   . GLU A 1 63 ? -5.620  8.893   -6.180  1.00 0.00 ?  619  GLU A CG   7  
ATOM 10859 C CD   . GLU A 1 63 ? -6.655  9.038   -7.232  1.00 0.00 ?  619  GLU A CD   7  
ATOM 10860 O OE1  . GLU A 1 63 ? -6.755  10.110  -7.839  1.00 0.00 ?  619  GLU A OE1  7  
ATOM 10861 O OE2  . GLU A 1 63 ? -7.392  8.088   -7.461  1.00 0.00 -1 619  GLU A OE2  7  
ATOM 10862 H H    . GLU A 1 63 ? -5.936  7.334   -3.724  1.00 0.00 ?  619  GLU A H    7  
ATOM 10863 H HA   . GLU A 1 63 ? -4.250  9.569   -3.865  1.00 0.00 ?  619  GLU A HA   7  
ATOM 10864 H HB2  . GLU A 1 63 ? -7.070  9.105   -4.715  1.00 0.00 ?  619  GLU A HB2  7  
ATOM 10865 H HB3  . GLU A 1 63 ? -6.227  10.606  -5.094  1.00 0.00 ?  619  GLU A HB3  7  
ATOM 10866 H HG2  . GLU A 1 63 ? -4.716  9.361   -6.537  1.00 0.00 ?  619  GLU A HG2  7  
ATOM 10867 H HG3  . GLU A 1 63 ? -5.426  7.838   -6.076  1.00 0.00 ?  619  GLU A HG3  7  
ATOM 10868 N N    . THR A 1 64 ? -7.012  9.971   -2.078  1.00 0.00 ?  620  THR A N    7  
ATOM 10869 C CA   . THR A 1 64 ? -7.777  10.775  -1.154  1.00 0.00 ?  620  THR A CA   7  
ATOM 10870 C C    . THR A 1 64 ? -7.409  10.445  0.325   1.00 0.00 ?  620  THR A C    7  
ATOM 10871 O O    . THR A 1 64 ? -7.701  11.214  1.237   1.00 0.00 ?  620  THR A O    7  
ATOM 10872 C CB   . THR A 1 64 ? -9.276  10.444  -1.386  1.00 0.00 ?  620  THR A CB   7  
ATOM 10873 O OG1  . THR A 1 64 ? -9.522  10.360  -2.815  1.00 0.00 ?  620  THR A OG1  7  
ATOM 10874 C CG2  . THR A 1 64 ? -10.179 11.518  -0.793  1.00 0.00 ?  620  THR A CG2  7  
ATOM 10875 H H    . THR A 1 64 ? -7.405  9.103   -2.324  1.00 0.00 ?  620  THR A H    7  
ATOM 10876 H HA   . THR A 1 64 ? -7.628  11.825  -1.364  1.00 0.00 ?  620  THR A HA   7  
ATOM 10877 H HB   . THR A 1 64 ? -9.491  9.489   -0.930  1.00 0.00 ?  620  THR A HB   7  
ATOM 10878 H HG1  . THR A 1 64 ? -9.004  11.069  -3.219  1.00 0.00 ?  620  THR A HG1  7  
ATOM 10879 H HG21 . THR A 1 64 ? -11.213 11.250  -0.958  1.00 0.00 ?  620  THR A HG21 7  
ATOM 10880 H HG22 . THR A 1 64 ? -9.972  12.464  -1.270  1.00 0.00 ?  620  THR A HG22 7  
ATOM 10881 H HG23 . THR A 1 64 ? -9.992  11.600  0.268   1.00 0.00 ?  620  THR A HG23 7  
ATOM 10882 N N    . LEU A 1 65 ? -6.728  9.326   0.535   1.00 0.00 ?  621  LEU A N    7  
ATOM 10883 C CA   . LEU A 1 65 ? -6.460  8.829   1.891   1.00 0.00 ?  621  LEU A CA   7  
ATOM 10884 C C    . LEU A 1 65 ? -5.397  9.668   2.638   1.00 0.00 ?  621  LEU A C    7  
ATOM 10885 O O    . LEU A 1 65 ? -4.542  10.330  2.011   1.00 0.00 ?  621  LEU A O    7  
ATOM 10886 C CB   . LEU A 1 65 ? -6.056  7.346   1.857   1.00 0.00 ?  621  LEU A CB   7  
ATOM 10887 C CG   . LEU A 1 65 ? -5.971  6.640   3.215   1.00 0.00 ?  621  LEU A CG   7  
ATOM 10888 C CD1  . LEU A 1 65 ? -7.342  6.555   3.867   1.00 0.00 ?  621  LEU A CD1  7  
ATOM 10889 C CD2  . LEU A 1 65 ? -5.367  5.266   3.075   1.00 0.00 ?  621  LEU A CD2  7  
ATOM 10890 H H    . LEU A 1 65 ? -6.390  8.837   -0.242  1.00 0.00 ?  621  LEU A H    7  
ATOM 10891 H HA   . LEU A 1 65 ? -7.388  8.915   2.439   1.00 0.00 ?  621  LEU A HA   7  
ATOM 10892 H HB2  . LEU A 1 65 ? -6.774  6.816   1.249   1.00 0.00 ?  621  LEU A HB2  7  
ATOM 10893 H HB3  . LEU A 1 65 ? -5.088  7.279   1.382   1.00 0.00 ?  621  LEU A HB3  7  
ATOM 10894 H HG   . LEU A 1 65 ? -5.339  7.226   3.867   1.00 0.00 ?  621  LEU A HG   7  
ATOM 10895 H HD11 . LEU A 1 65 ? -7.257  6.049   4.817   1.00 0.00 ?  621  LEU A HD11 7  
ATOM 10896 H HD12 . LEU A 1 65 ? -8.011  5.997   3.228   1.00 0.00 ?  621  LEU A HD12 7  
ATOM 10897 H HD13 . LEU A 1 65 ? -7.735  7.549   4.024   1.00 0.00 ?  621  LEU A HD13 7  
ATOM 10898 H HD21 . LEU A 1 65 ? -4.366  5.350   2.676   1.00 0.00 ?  621  LEU A HD21 7  
ATOM 10899 H HD22 . LEU A 1 65 ? -5.971  4.675   2.403   1.00 0.00 ?  621  LEU A HD22 7  
ATOM 10900 H HD23 . LEU A 1 65 ? -5.331  4.782   4.039   1.00 0.00 ?  621  LEU A HD23 7  
ATOM 10901 N N    . LYS A 1 66 ? -5.444  9.589   3.975   1.00 0.00 ?  622  LYS A N    7  
ATOM 10902 C CA   . LYS A 1 66 ? -4.570  10.341  4.867   1.00 0.00 ?  622  LYS A CA   7  
ATOM 10903 C C    . LYS A 1 66 ? -3.236  9.610   5.076   1.00 0.00 ?  622  LYS A C    7  
ATOM 10904 O O    . LYS A 1 66 ? -3.196  8.368   5.045   1.00 0.00 ?  622  LYS A O    7  
ATOM 10905 C CB   . LYS A 1 66 ? -5.284  10.561  6.210   1.00 0.00 ?  622  LYS A CB   7  
ATOM 10906 C CG   . LYS A 1 66 ? -6.518  11.441  6.090   1.00 0.00 ?  622  LYS A CG   7  
ATOM 10907 C CD   . LYS A 1 66 ? -7.296  11.564  7.399   1.00 0.00 ?  622  LYS A CD   7  
ATOM 10908 C CE   . LYS A 1 66 ? -7.922  10.238  7.825   1.00 0.00 ?  622  LYS A CE   7  
ATOM 10909 N NZ   . LYS A 1 66 ? -8.888  9.706   6.822   1.00 0.00 1  622  LYS A NZ   7  
ATOM 10910 H H    . LYS A 1 66 ? -6.083  8.967   4.384   1.00 0.00 ?  622  LYS A H    7  
ATOM 10911 H HA   . LYS A 1 66 ? -4.392  11.302  4.409   1.00 0.00 ?  622  LYS A HA   7  
ATOM 10912 H HB2  . LYS A 1 66 ? -5.580  9.600   6.602   1.00 0.00 ?  622  LYS A HB2  7  
ATOM 10913 H HB3  . LYS A 1 66 ? -4.595  11.027  6.899   1.00 0.00 ?  622  LYS A HB3  7  
ATOM 10914 H HG2  . LYS A 1 66 ? -6.211  12.427  5.776   1.00 0.00 ?  622  LYS A HG2  7  
ATOM 10915 H HG3  . LYS A 1 66 ? -7.160  11.011  5.336   1.00 0.00 ?  622  LYS A HG3  7  
ATOM 10916 H HD2  . LYS A 1 66 ? -6.623  11.895  8.177   1.00 0.00 ?  622  LYS A HD2  7  
ATOM 10917 H HD3  . LYS A 1 66 ? -8.079  12.297  7.269   1.00 0.00 ?  622  LYS A HD3  7  
ATOM 10918 H HE2  . LYS A 1 66 ? -7.142  9.509   7.981   1.00 0.00 ?  622  LYS A HE2  7  
ATOM 10919 H HE3  . LYS A 1 66 ? -8.442  10.394  8.757   1.00 0.00 ?  622  LYS A HE3  7  
ATOM 10920 H HZ1  . LYS A 1 66 ? -8.452  9.568   5.892   1.00 0.00 ?  622  LYS A HZ1  7  
ATOM 10921 H HZ2  . LYS A 1 66 ? -9.706  10.328  6.672   1.00 0.00 ?  622  LYS A HZ2  7  
ATOM 10922 H HZ3  . LYS A 1 66 ? -9.235  8.771   7.138   1.00 0.00 ?  622  LYS A HZ3  7  
ATOM 10923 N N    . PRO A 1 67 ? -2.136  10.368  5.321   1.00 0.00 ?  623  PRO A N    7  
ATOM 10924 C CA   . PRO A 1 67 ? -0.778  9.813   5.452   1.00 0.00 ?  623  PRO A CA   7  
ATOM 10925 C C    . PRO A 1 67 ? -0.630  8.742   6.533   1.00 0.00 ?  623  PRO A C    7  
ATOM 10926 O O    . PRO A 1 67 ? 0.030   7.740   6.309   1.00 0.00 ?  623  PRO A O    7  
ATOM 10927 C CB   . PRO A 1 67 ? 0.095   11.019  5.792   1.00 0.00 ?  623  PRO A CB   7  
ATOM 10928 C CG   . PRO A 1 67 ? -0.678  12.200  5.347   1.00 0.00 ?  623  PRO A CG   7  
ATOM 10929 C CD   . PRO A 1 67 ? -2.127  11.841  5.478   1.00 0.00 ?  623  PRO A CD   7  
ATOM 10930 H HA   . PRO A 1 67 ? -0.453  9.398   4.510   1.00 0.00 ?  623  PRO A HA   7  
ATOM 10931 H HB2  . PRO A 1 67 ? 0.282   11.036  6.855   1.00 0.00 ?  623  PRO A HB2  7  
ATOM 10932 H HB3  . PRO A 1 67 ? 1.034   10.941  5.265   1.00 0.00 ?  623  PRO A HB3  7  
ATOM 10933 H HG2  . PRO A 1 67 ? -0.442  13.049  5.969   1.00 0.00 ?  623  PRO A HG2  7  
ATOM 10934 H HG3  . PRO A 1 67 ? -0.443  12.421  4.315   1.00 0.00 ?  623  PRO A HG3  7  
ATOM 10935 H HD2  . PRO A 1 67 ? -2.501  12.131  6.448   1.00 0.00 ?  623  PRO A HD2  7  
ATOM 10936 H HD3  . PRO A 1 67 ? -2.692  12.318  4.691   1.00 0.00 ?  623  PRO A HD3  7  
ATOM 10937 N N    . THR A 1 68 ? -1.255  8.940   7.677   1.00 0.00 ?  624  THR A N    7  
ATOM 10938 C CA   . THR A 1 68 ? -1.138  7.994   8.781   1.00 0.00 ?  624  THR A CA   7  
ATOM 10939 C C    . THR A 1 68 ? -1.686  6.589   8.385   1.00 0.00 ?  624  THR A C    7  
ATOM 10940 O O    . THR A 1 68 ? -1.146  5.560   8.784   1.00 0.00 ?  624  THR A O    7  
ATOM 10941 C CB   . THR A 1 68 ? -1.824  8.553   10.078  1.00 0.00 ?  624  THR A CB   7  
ATOM 10942 O OG1  . THR A 1 68 ? -1.559  7.722   11.221  1.00 0.00 ?  624  THR A OG1  7  
ATOM 10943 C CG2  . THR A 1 68 ? -3.328  8.710   9.896   1.00 0.00 ?  624  THR A CG2  7  
ATOM 10944 H H    . THR A 1 68 ? -1.782  9.757   7.795   1.00 0.00 ?  624  THR A H    7  
ATOM 10945 H HA   . THR A 1 68 ? -0.080  7.885   8.969   1.00 0.00 ?  624  THR A HA   7  
ATOM 10946 H HB   . THR A 1 68 ? -1.399  9.524   10.282  1.00 0.00 ?  624  THR A HB   7  
ATOM 10947 H HG1  . THR A 1 68 ? -2.375  7.254   11.441  1.00 0.00 ?  624  THR A HG1  7  
ATOM 10948 H HG21 . THR A 1 68 ? -3.526  9.405   9.094   1.00 0.00 ?  624  THR A HG21 7  
ATOM 10949 H HG22 . THR A 1 68 ? -3.774  9.071   10.810  1.00 0.00 ?  624  THR A HG22 7  
ATOM 10950 H HG23 . THR A 1 68 ? -3.752  7.749   9.646   1.00 0.00 ?  624  THR A HG23 7  
ATOM 10951 N N    . THR A 1 69 ? -2.712  6.567   7.556   1.00 0.00 ?  625  THR A N    7  
ATOM 10952 C CA   . THR A 1 69 ? -3.288  5.328   7.107   1.00 0.00 ?  625  THR A CA   7  
ATOM 10953 C C    . THR A 1 69 ? -2.484  4.809   5.893   1.00 0.00 ?  625  THR A C    7  
ATOM 10954 O O    . THR A 1 69 ? -2.316  3.603   5.699   1.00 0.00 ?  625  THR A O    7  
ATOM 10955 C CB   . THR A 1 69 ? -4.753  5.564   6.729   1.00 0.00 ?  625  THR A CB   7  
ATOM 10956 O OG1  . THR A 1 69 ? -5.346  6.426   7.727   1.00 0.00 ?  625  THR A OG1  7  
ATOM 10957 C CG2  . THR A 1 69 ? -5.517  4.250   6.710   1.00 0.00 ?  625  THR A CG2  7  
ATOM 10958 H H    . THR A 1 69 ? -3.115  7.400   7.239   1.00 0.00 ?  625  THR A H    7  
ATOM 10959 H HA   . THR A 1 69 ? -3.234  4.610   7.912   1.00 0.00 ?  625  THR A HA   7  
ATOM 10960 H HB   . THR A 1 69 ? -4.809  6.034   5.759   1.00 0.00 ?  625  THR A HB   7  
ATOM 10961 H HG1  . THR A 1 69 ? -6.254  6.617   7.422   1.00 0.00 ?  625  THR A HG1  7  
ATOM 10962 H HG21 . THR A 1 69 ? -6.543  4.427   6.423   1.00 0.00 ?  625  THR A HG21 7  
ATOM 10963 H HG22 . THR A 1 69 ? -5.493  3.807   7.695   1.00 0.00 ?  625  THR A HG22 7  
ATOM 10964 H HG23 . THR A 1 69 ? -5.055  3.578   6.003   1.00 0.00 ?  625  THR A HG23 7  
ATOM 10965 N N    . LEU A 1 70 ? -1.961  5.757   5.112   1.00 0.00 ?  626  LEU A N    7  
ATOM 10966 C CA   . LEU A 1 70 ? -1.099  5.492   3.955   1.00 0.00 ?  626  LEU A CA   7  
ATOM 10967 C C    . LEU A 1 70 ? 0.137   4.714   4.406   1.00 0.00 ?  626  LEU A C    7  
ATOM 10968 O O    . LEU A 1 70 ? 0.525   3.710   3.802   1.00 0.00 ?  626  LEU A O    7  
ATOM 10969 C CB   . LEU A 1 70 ? -0.656  6.846   3.363   1.00 0.00 ?  626  LEU A CB   7  
ATOM 10970 C CG   . LEU A 1 70 ? 0.328   6.833   2.189   1.00 0.00 ?  626  LEU A CG   7  
ATOM 10971 C CD1  . LEU A 1 70 ? -0.322  6.305   0.938   1.00 0.00 ?  626  LEU A CD1  7  
ATOM 10972 C CD2  . LEU A 1 70 ? 0.900   8.224   1.958   1.00 0.00 ?  626  LEU A CD2  7  
ATOM 10973 H H    . LEU A 1 70 ? -2.173  6.693   5.318   1.00 0.00 ?  626  LEU A H    7  
ATOM 10974 H HA   . LEU A 1 70 ? -1.650  4.940   3.208   1.00 0.00 ?  626  LEU A HA   7  
ATOM 10975 H HB2  . LEU A 1 70 ? -1.541  7.377   3.045   1.00 0.00 ?  626  LEU A HB2  7  
ATOM 10976 H HB3  . LEU A 1 70 ? -0.202  7.404   4.169   1.00 0.00 ?  626  LEU A HB3  7  
ATOM 10977 H HG   . LEU A 1 70 ? 1.148   6.175   2.435   1.00 0.00 ?  626  LEU A HG   7  
ATOM 10978 H HD11 . LEU A 1 70 ? -1.141  6.949   0.656   1.00 0.00 ?  626  LEU A HD11 7  
ATOM 10979 H HD12 . LEU A 1 70 ? -0.700  5.310   1.122   1.00 0.00 ?  626  LEU A HD12 7  
ATOM 10980 H HD13 . LEU A 1 70 ? 0.403   6.273   0.139   1.00 0.00 ?  626  LEU A HD13 7  
ATOM 10981 H HD21 . LEU A 1 70 ? 1.433   8.548   2.839   1.00 0.00 ?  626  LEU A HD21 7  
ATOM 10982 H HD22 . LEU A 1 70 ? 0.095   8.914   1.752   1.00 0.00 ?  626  LEU A HD22 7  
ATOM 10983 H HD23 . LEU A 1 70 ? 1.578   8.199   1.118   1.00 0.00 ?  626  LEU A HD23 7  
ATOM 10984 N N    . ARG A 1 71 ? 0.719   5.171   5.508   1.00 0.00 ?  627  ARG A N    7  
ATOM 10985 C CA   . ARG A 1 71 ? 1.931   4.588   6.052   1.00 0.00 ?  627  ARG A CA   7  
ATOM 10986 C C    . ARG A 1 71 ? 1.741   3.161   6.513   1.00 0.00 ?  627  ARG A C    7  
ATOM 10987 O O    . ARG A 1 71 ? 2.698   2.415   6.559   1.00 0.00 ?  627  ARG A O    7  
ATOM 10988 C CB   . ARG A 1 71 ? 2.561   5.446   7.154   1.00 0.00 ?  627  ARG A CB   7  
ATOM 10989 C CG   . ARG A 1 71 ? 2.961   6.845   6.701   1.00 0.00 ?  627  ARG A CG   7  
ATOM 10990 C CD   . ARG A 1 71 ? 3.905   6.813   5.504   1.00 0.00 ?  627  ARG A CD   7  
ATOM 10991 N NE   . ARG A 1 71 ? 4.214   8.160   5.024   1.00 0.00 ?  627  ARG A NE   7  
ATOM 10992 C CZ   . ARG A 1 71 ? 4.599   8.473   3.778   1.00 0.00 ?  627  ARG A CZ   7  
ATOM 10993 N NH1  . ARG A 1 71 ? 4.725   7.523   2.849   1.00 0.00 1  627  ARG A NH1  7  
ATOM 10994 N NH2  . ARG A 1 71 ? 4.844   9.739   3.459   1.00 0.00 ?  627  ARG A NH2  7  
ATOM 10995 H H    . ARG A 1 71 ? 0.313   5.945   5.959   1.00 0.00 ?  627  ARG A H    7  
ATOM 10996 H HA   . ARG A 1 71 ? 2.628   4.538   5.231   1.00 0.00 ?  627  ARG A HA   7  
ATOM 10997 H HB2  . ARG A 1 71 ? 1.845   5.541   7.957   1.00 0.00 ?  627  ARG A HB2  7  
ATOM 10998 H HB3  . ARG A 1 71 ? 3.441   4.943   7.529   1.00 0.00 ?  627  ARG A HB3  7  
ATOM 10999 H HG2  . ARG A 1 71 ? 2.068   7.387   6.424   1.00 0.00 ?  627  ARG A HG2  7  
ATOM 11000 H HG3  . ARG A 1 71 ? 3.447   7.351   7.522   1.00 0.00 ?  627  ARG A HG3  7  
ATOM 11001 H HD2  . ARG A 1 71 ? 4.825   6.323   5.790   1.00 0.00 ?  627  ARG A HD2  7  
ATOM 11002 H HD3  . ARG A 1 71 ? 3.439   6.263   4.701   1.00 0.00 ?  627  ARG A HD3  7  
ATOM 11003 H HE   . ARG A 1 71 ? 4.114   8.862   5.710   1.00 0.00 ?  627  ARG A HE   7  
ATOM 11004 H HH11 . ARG A 1 71 ? 4.548   6.556   3.030   1.00 0.00 ?  627  ARG A HH11 7  
ATOM 11005 H HH12 . ARG A 1 71 ? 4.997   7.738   1.904   1.00 0.00 ?  627  ARG A HH12 7  
ATOM 11006 H HH21 . ARG A 1 71 ? 4.746   10.487  4.124   1.00 0.00 ?  627  ARG A HH21 7  
ATOM 11007 H HH22 . ARG A 1 71 ? 5.156   9.993   2.538   1.00 0.00 ?  627  ARG A HH22 7  
ATOM 11008 N N    . GLU A 1 72 ? 0.514   2.775   6.839   1.00 0.00 ?  628  GLU A N    7  
ATOM 11009 C CA   . GLU A 1 72 ? 0.236   1.403   7.252   1.00 0.00 ?  628  GLU A CA   7  
ATOM 11010 C C    . GLU A 1 72 ? 0.619   0.433   6.130   1.00 0.00 ?  628  GLU A C    7  
ATOM 11011 O O    . GLU A 1 72 ? 1.253   -0.609  6.365   1.00 0.00 ?  628  GLU A O    7  
ATOM 11012 C CB   . GLU A 1 72 ? -1.235  1.231   7.603   1.00 0.00 ?  628  GLU A CB   7  
ATOM 11013 C CG   . GLU A 1 72 ? -1.581  -0.149  8.141   1.00 0.00 ?  628  GLU A CG   7  
ATOM 11014 C CD   . GLU A 1 72 ? -0.876  -0.458  9.438   1.00 0.00 ?  628  GLU A CD   7  
ATOM 11015 O OE1  . GLU A 1 72 ? 0.283   -0.884  9.413   1.00 0.00 ?  628  GLU A OE1  7  
ATOM 11016 O OE2  . GLU A 1 72 ? -1.479  -0.268  10.506  1.00 0.00 -1 628  GLU A OE2  7  
ATOM 11017 H H    . GLU A 1 72 ? -0.221  3.424   6.795   1.00 0.00 ?  628  GLU A H    7  
ATOM 11018 H HA   . GLU A 1 72 ? 0.840   1.186   8.120   1.00 0.00 ?  628  GLU A HA   7  
ATOM 11019 H HB2  . GLU A 1 72 ? -1.497  1.969   8.345   1.00 0.00 ?  628  GLU A HB2  7  
ATOM 11020 H HB3  . GLU A 1 72 ? -1.821  1.406   6.713   1.00 0.00 ?  628  GLU A HB3  7  
ATOM 11021 H HG2  . GLU A 1 72 ? -2.646  -0.207  8.309   1.00 0.00 ?  628  GLU A HG2  7  
ATOM 11022 H HG3  . GLU A 1 72 ? -1.292  -0.885  7.406   1.00 0.00 ?  628  GLU A HG3  7  
ATOM 11023 N N    . LEU A 1 73 ? 0.269   0.796   4.903   1.00 0.00 ?  629  LEU A N    7  
ATOM 11024 C CA   . LEU A 1 73 ? 0.625   -0.018  3.765   1.00 0.00 ?  629  LEU A CA   7  
ATOM 11025 C C    . LEU A 1 73 ? 2.125   0.047   3.521   1.00 0.00 ?  629  LEU A C    7  
ATOM 11026 O O    . LEU A 1 73 ? 2.727   -0.930  3.149   1.00 0.00 ?  629  LEU A O    7  
ATOM 11027 C CB   . LEU A 1 73 ? -0.188  0.343   2.504   1.00 0.00 ?  629  LEU A CB   7  
ATOM 11028 C CG   . LEU A 1 73 ? 0.147   -0.451  1.217   1.00 0.00 ?  629  LEU A CG   7  
ATOM 11029 C CD1  . LEU A 1 73 ? 0.067   -1.938  1.471   1.00 0.00 ?  629  LEU A CD1  7  
ATOM 11030 C CD2  . LEU A 1 73 ? -0.802  -0.091  0.093   1.00 0.00 ?  629  LEU A CD2  7  
ATOM 11031 H H    . LEU A 1 73 ? -0.222  1.638   4.778   1.00 0.00 ?  629  LEU A H    7  
ATOM 11032 H HA   . LEU A 1 73 ? 0.395   -1.034  4.052   1.00 0.00 ?  629  LEU A HA   7  
ATOM 11033 H HB2  . LEU A 1 73 ? -1.231  0.179   2.733   1.00 0.00 ?  629  LEU A HB2  7  
ATOM 11034 H HB3  . LEU A 1 73 ? -0.054  1.395   2.306   1.00 0.00 ?  629  LEU A HB3  7  
ATOM 11035 H HG   . LEU A 1 73 ? 1.153   -0.214  0.903   1.00 0.00 ?  629  LEU A HG   7  
ATOM 11036 H HD11 . LEU A 1 73 ? 0.240   -2.476  0.550   1.00 0.00 ?  629  LEU A HD11 7  
ATOM 11037 H HD12 . LEU A 1 73 ? -0.911  -2.168  1.863   1.00 0.00 ?  629  LEU A HD12 7  
ATOM 11038 H HD13 . LEU A 1 73 ? 0.816   -2.213  2.197   1.00 0.00 ?  629  LEU A HD13 7  
ATOM 11039 H HD21 . LEU A 1 73 ? -0.538  -0.641  -0.797  1.00 0.00 ?  629  LEU A HD21 7  
ATOM 11040 H HD22 . LEU A 1 73 ? -0.752  0.970   -0.099  1.00 0.00 ?  629  LEU A HD22 7  
ATOM 11041 H HD23 . LEU A 1 73 ? -1.808  -0.352  0.388   1.00 0.00 ?  629  LEU A HD23 7  
ATOM 11042 N N    . GLU A 1 74 ? 2.717   1.187   3.809   1.00 0.00 ?  630  GLU A N    7  
ATOM 11043 C CA   . GLU A 1 74 ? 4.158   1.381   3.657   1.00 0.00 ?  630  GLU A CA   7  
ATOM 11044 C C    . GLU A 1 74 ? 4.889   0.382   4.594   1.00 0.00 ?  630  GLU A C    7  
ATOM 11045 O O    . GLU A 1 74 ? 5.832   -0.294  4.183   1.00 0.00 ?  630  GLU A O    7  
ATOM 11046 C CB   . GLU A 1 74 ? 4.486   2.868   3.969   1.00 0.00 ?  630  GLU A CB   7  
ATOM 11047 C CG   . GLU A 1 74 ? 5.866   3.393   3.549   1.00 0.00 ?  630  GLU A CG   7  
ATOM 11048 C CD   . GLU A 1 74 ? 7.014   2.923   4.407   1.00 0.00 ?  630  GLU A CD   7  
ATOM 11049 O OE1  . GLU A 1 74 ? 7.193   3.447   5.516   1.00 0.00 ?  630  GLU A OE1  7  
ATOM 11050 O OE2  . GLU A 1 74 ? 7.809   2.071   3.962   1.00 0.00 -1 630  GLU A OE2  7  
ATOM 11051 H H    . GLU A 1 74 ? 2.159   1.922   4.139   1.00 0.00 ?  630  GLU A H    7  
ATOM 11052 H HA   . GLU A 1 74 ? 4.417   1.152   2.634   1.00 0.00 ?  630  GLU A HA   7  
ATOM 11053 H HB2  . GLU A 1 74 ? 3.749   3.485   3.479   1.00 0.00 ?  630  GLU A HB2  7  
ATOM 11054 H HB3  . GLU A 1 74 ? 4.383   3.012   5.035   1.00 0.00 ?  630  GLU A HB3  7  
ATOM 11055 H HG2  . GLU A 1 74 ? 6.059   3.068   2.538   1.00 0.00 ?  630  GLU A HG2  7  
ATOM 11056 H HG3  . GLU A 1 74 ? 5.837   4.473   3.569   1.00 0.00 ?  630  GLU A HG3  7  
ATOM 11057 N N    . ARG A 1 75 ? 4.369   0.250   5.826   1.00 0.00 ?  631  ARG A N    7  
ATOM 11058 C CA   . ARG A 1 75 ? 4.887   -0.706  6.828   1.00 0.00 ?  631  ARG A CA   7  
ATOM 11059 C C    . ARG A 1 75 ? 4.691   -2.125  6.324   1.00 0.00 ?  631  ARG A C    7  
ATOM 11060 O O    . ARG A 1 75 ? 5.586   -2.961  6.404   1.00 0.00 ?  631  ARG A O    7  
ATOM 11061 C CB   . ARG A 1 75 ? 4.112   -0.581  8.136   1.00 0.00 ?  631  ARG A CB   7  
ATOM 11062 C CG   . ARG A 1 75 ? 4.075   0.800   8.715   1.00 0.00 ?  631  ARG A CG   7  
ATOM 11063 C CD   . ARG A 1 75 ? 3.172   0.860   9.939   1.00 0.00 ?  631  ARG A CD   7  
ATOM 11064 N NE   . ARG A 1 75 ? 3.706   0.098   11.078  1.00 0.00 ?  631  ARG A NE   7  
ATOM 11065 C CZ   . ARG A 1 75 ? 2.965   -0.633  11.939  1.00 0.00 ?  631  ARG A CZ   7  
ATOM 11066 N NH1  . ARG A 1 75 ? 1.705   -0.968  11.649  1.00 0.00 1  631  ARG A NH1  7  
ATOM 11067 N NH2  . ARG A 1 75 ? 3.514   -1.088  13.056  1.00 0.00 ?  631  ARG A NH2  7  
ATOM 11068 H H    . ARG A 1 75 ? 3.615   0.835   6.067   1.00 0.00 ?  631  ARG A H    7  
ATOM 11069 H HA   . ARG A 1 75 ? 5.932   -0.511  7.008   1.00 0.00 ?  631  ARG A HA   7  
ATOM 11070 H HB2  . ARG A 1 75 ? 3.093   -0.890  7.959   1.00 0.00 ?  631  ARG A HB2  7  
ATOM 11071 H HB3  . ARG A 1 75 ? 4.551   -1.244  8.866   1.00 0.00 ?  631  ARG A HB3  7  
ATOM 11072 H HG2  . ARG A 1 75 ? 5.080   1.099   8.973   1.00 0.00 ?  631  ARG A HG2  7  
ATOM 11073 H HG3  . ARG A 1 75 ? 3.686   1.449   7.943   1.00 0.00 ?  631  ARG A HG3  7  
ATOM 11074 H HD2  . ARG A 1 75 ? 3.059   1.892   10.236  1.00 0.00 ?  631  ARG A HD2  7  
ATOM 11075 H HD3  . ARG A 1 75 ? 2.206   0.460   9.674   1.00 0.00 ?  631  ARG A HD3  7  
ATOM 11076 H HE   . ARG A 1 75 ? 4.672   0.225   11.223  1.00 0.00 ?  631  ARG A HE   7  
ATOM 11077 H HH11 . ARG A 1 75 ? 1.228   -0.708  10.793  1.00 0.00 ?  631  ARG A HH11 7  
ATOM 11078 H HH12 . ARG A 1 75 ? 1.154   -1.531  12.269  1.00 0.00 ?  631  ARG A HH12 7  
ATOM 11079 H HH21 . ARG A 1 75 ? 4.471   -0.914  13.293  1.00 0.00 ?  631  ARG A HH21 7  
ATOM 11080 H HH22 . ARG A 1 75 ? 2.994   -1.622  13.729  1.00 0.00 ?  631  ARG A HH22 7  
ATOM 11081 N N    . TYR A 1 76 ? 3.500   -2.370  5.797   1.00 0.00 ?  632  TYR A N    7  
ATOM 11082 C CA   . TYR A 1 76 ? 3.112   -3.658  5.269   1.00 0.00 ?  632  TYR A CA   7  
ATOM 11083 C C    . TYR A 1 76 ? 4.068   -4.085  4.154   1.00 0.00 ?  632  TYR A C    7  
ATOM 11084 O O    . TYR A 1 76 ? 4.580   -5.215  4.147   1.00 0.00 ?  632  TYR A O    7  
ATOM 11085 C CB   . TYR A 1 76 ? 1.681   -3.557  4.710   1.00 0.00 ?  632  TYR A CB   7  
ATOM 11086 C CG   . TYR A 1 76 ? 1.144   -4.839  4.128   1.00 0.00 ?  632  TYR A CG   7  
ATOM 11087 C CD1  . TYR A 1 76 ? 1.465   -5.198  2.839   1.00 0.00 ?  632  TYR A CD1  7  
ATOM 11088 C CD2  . TYR A 1 76 ? 0.341   -5.688  4.869   1.00 0.00 ?  632  TYR A CD2  7  
ATOM 11089 C CE1  . TYR A 1 76 ? 1.026   -6.355  2.289   1.00 0.00 ?  632  TYR A CE1  7  
ATOM 11090 C CE2  . TYR A 1 76 ? -0.125  -6.872  4.326   1.00 0.00 ?  632  TYR A CE2  7  
ATOM 11091 C CZ   . TYR A 1 76 ? 0.228   -7.207  3.033   1.00 0.00 ?  632  TYR A CZ   7  
ATOM 11092 O OH   . TYR A 1 76 ? -0.229  -8.386  2.478   1.00 0.00 ?  632  TYR A OH   7  
ATOM 11093 H H    . TYR A 1 76 ? 2.850   -1.634  5.760   1.00 0.00 ?  632  TYR A H    7  
ATOM 11094 H HA   . TYR A 1 76 ? 3.121   -4.387  6.064   1.00 0.00 ?  632  TYR A HA   7  
ATOM 11095 H HB2  . TYR A 1 76 ? 1.000   -3.213  5.473   1.00 0.00 ?  632  TYR A HB2  7  
ATOM 11096 H HB3  . TYR A 1 76 ? 1.732   -2.834  3.907   1.00 0.00 ?  632  TYR A HB3  7  
ATOM 11097 H HD1  . TYR A 1 76 ? 2.092   -4.529  2.268   1.00 0.00 ?  632  TYR A HD1  7  
ATOM 11098 H HD2  . TYR A 1 76 ? 0.069   -5.400  5.873   1.00 0.00 ?  632  TYR A HD2  7  
ATOM 11099 H HE1  . TYR A 1 76 ? 1.320   -6.552  1.267   1.00 0.00 ?  632  TYR A HE1  7  
ATOM 11100 H HE2  . TYR A 1 76 ? -0.747  -7.532  4.912   1.00 0.00 ?  632  TYR A HE2  7  
ATOM 11101 H HH   . TYR A 1 76 ? -1.186  -8.420  2.560   1.00 0.00 ?  632  TYR A HH   7  
ATOM 11102 N N    . VAL A 1 77 ? 4.304   -3.179  3.219   1.00 0.00 ?  633  VAL A N    7  
ATOM 11103 C CA   . VAL A 1 77 ? 5.134   -3.472  2.083   1.00 0.00 ?  633  VAL A CA   7  
ATOM 11104 C C    . VAL A 1 77 ? 6.579   -3.739  2.520   1.00 0.00 ?  633  VAL A C    7  
ATOM 11105 O O    . VAL A 1 77 ? 7.245   -4.554  1.911   1.00 0.00 ?  633  VAL A O    7  
ATOM 11106 C CB   . VAL A 1 77 ? 5.065   -2.370  0.981   1.00 0.00 ?  633  VAL A CB   7  
ATOM 11107 C CG1  . VAL A 1 77 ? 5.872   -2.780  -0.220  1.00 0.00 ?  633  VAL A CG1  7  
ATOM 11108 C CG2  . VAL A 1 77 ? 3.635   -2.145  0.539   1.00 0.00 ?  633  VAL A CG2  7  
ATOM 11109 H H    . VAL A 1 77 ? 3.899   -2.284  3.295   1.00 0.00 ?  633  VAL A H    7  
ATOM 11110 H HA   . VAL A 1 77 ? 4.751   -4.394  1.663   1.00 0.00 ?  633  VAL A HA   7  
ATOM 11111 H HB   . VAL A 1 77 ? 5.452   -1.443  1.377   1.00 0.00 ?  633  VAL A HB   7  
ATOM 11112 H HG11 . VAL A 1 77 ? 5.433   -3.692  -0.599  1.00 0.00 ?  633  VAL A HG11 7  
ATOM 11113 H HG12 . VAL A 1 77 ? 6.899   -2.947  0.066   1.00 0.00 ?  633  VAL A HG12 7  
ATOM 11114 H HG13 . VAL A 1 77 ? 5.797   -2.011  -0.973  1.00 0.00 ?  633  VAL A HG13 7  
ATOM 11115 H HG21 . VAL A 1 77 ? 3.044   -1.832  1.387   1.00 0.00 ?  633  VAL A HG21 7  
ATOM 11116 H HG22 . VAL A 1 77 ? 3.235   -3.065  0.140   1.00 0.00 ?  633  VAL A HG22 7  
ATOM 11117 H HG23 . VAL A 1 77 ? 3.605   -1.378  -0.221  1.00 0.00 ?  633  VAL A HG23 7  
ATOM 11118 N N    . LYS A 1 78 ? 7.036   -3.093  3.620   1.00 0.00 ?  634  LYS A N    7  
ATOM 11119 C CA   . LYS A 1 78 ? 8.389   -3.362  4.160   1.00 0.00 ?  634  LYS A CA   7  
ATOM 11120 C C    . LYS A 1 78 ? 8.533   -4.857  4.434   1.00 0.00 ?  634  LYS A C    7  
ATOM 11121 O O    . LYS A 1 78 ? 9.493   -5.491  4.007   1.00 0.00 ?  634  LYS A O    7  
ATOM 11122 C CB   . LYS A 1 78 ? 8.654   -2.639  5.488   1.00 0.00 ?  634  LYS A CB   7  
ATOM 11123 C CG   . LYS A 1 78 ? 8.561   -1.128  5.500   1.00 0.00 ?  634  LYS A CG   7  
ATOM 11124 C CD   . LYS A 1 78 ? 8.931   -0.623  6.890   1.00 0.00 ?  634  LYS A CD   7  
ATOM 11125 C CE   . LYS A 1 78 ? 8.713   0.868   7.074   1.00 0.00 ?  634  LYS A CE   7  
ATOM 11126 N NZ   . LYS A 1 78 ? 9.464   1.682   6.103   1.00 0.00 1  634  LYS A NZ   7  
ATOM 11127 H H    . LYS A 1 78 ? 6.461   -2.430  4.060   1.00 0.00 ?  634  LYS A H    7  
ATOM 11128 H HA   . LYS A 1 78 ? 9.119   -3.059  3.425   1.00 0.00 ?  634  LYS A HA   7  
ATOM 11129 H HB2  . LYS A 1 78 ? 7.938   -3.003  6.210   1.00 0.00 ?  634  LYS A HB2  7  
ATOM 11130 H HB3  . LYS A 1 78 ? 9.640   -2.921  5.825   1.00 0.00 ?  634  LYS A HB3  7  
ATOM 11131 H HG2  . LYS A 1 78 ? 9.249   -0.721  4.773   1.00 0.00 ?  634  LYS A HG2  7  
ATOM 11132 H HG3  . LYS A 1 78 ? 7.551   -0.823  5.271   1.00 0.00 ?  634  LYS A HG3  7  
ATOM 11133 H HD2  . LYS A 1 78 ? 8.331   -1.150  7.616   1.00 0.00 ?  634  LYS A HD2  7  
ATOM 11134 H HD3  . LYS A 1 78 ? 9.973   -0.851  7.066   1.00 0.00 ?  634  LYS A HD3  7  
ATOM 11135 H HE2  . LYS A 1 78 ? 7.662   1.085   6.960   1.00 0.00 ?  634  LYS A HE2  7  
ATOM 11136 H HE3  . LYS A 1 78 ? 9.021   1.139   8.073   1.00 0.00 ?  634  LYS A HE3  7  
ATOM 11137 H HZ1  . LYS A 1 78 ? 9.002   1.644   5.167   1.00 0.00 ?  634  LYS A HZ1  7  
ATOM 11138 H HZ2  . LYS A 1 78 ? 10.455  1.386   6.005   1.00 0.00 ?  634  LYS A HZ2  7  
ATOM 11139 H HZ3  . LYS A 1 78 ? 9.459   2.678   6.404   1.00 0.00 ?  634  LYS A HZ3  7  
ATOM 11140 N N    . SER A 1 79 ? 7.530   -5.412  5.101   1.00 0.00 ?  635  SER A N    7  
ATOM 11141 C CA   . SER A 1 79 ? 7.502   -6.815  5.458   1.00 0.00 ?  635  SER A CA   7  
ATOM 11142 C C    . SER A 1 79 ? 7.391   -7.704  4.213   1.00 0.00 ?  635  SER A C    7  
ATOM 11143 O O    . SER A 1 79 ? 7.900   -8.823  4.179   1.00 0.00 ?  635  SER A O    7  
ATOM 11144 C CB   . SER A 1 79 ? 6.342   -7.056  6.401   1.00 0.00 ?  635  SER A CB   7  
ATOM 11145 O OG   . SER A 1 79 ? 6.416   -6.159  7.501   1.00 0.00 ?  635  SER A OG   7  
ATOM 11146 H H    . SER A 1 79 ? 6.770   -4.853  5.377   1.00 0.00 ?  635  SER A H    7  
ATOM 11147 H HA   . SER A 1 79 ? 8.422   -7.047  5.974   1.00 0.00 ?  635  SER A HA   7  
ATOM 11148 H HB2  . SER A 1 79 ? 5.412   -6.895  5.874   1.00 0.00 ?  635  SER A HB2  7  
ATOM 11149 H HB3  . SER A 1 79 ? 6.382   -8.070  6.771   1.00 0.00 ?  635  SER A HB3  7  
ATOM 11150 H HG   . SER A 1 79 ? 7.311   -5.790  7.498   1.00 0.00 ?  635  SER A HG   7  
ATOM 11151 N N    . CYS A 1 80 ? 6.734   -7.196  3.193   1.00 0.00 ?  636  CYS A N    7  
ATOM 11152 C CA   . CYS A 1 80 ? 6.597   -7.907  1.943   1.00 0.00 ?  636  CYS A CA   7  
ATOM 11153 C C    . CYS A 1 80 ? 7.916   -7.865  1.148   1.00 0.00 ?  636  CYS A C    7  
ATOM 11154 O O    . CYS A 1 80 ? 8.115   -8.623  0.197   1.00 0.00 ?  636  CYS A O    7  
ATOM 11155 C CB   . CYS A 1 80 ? 5.450   -7.318  1.127   1.00 0.00 ?  636  CYS A CB   7  
ATOM 11156 S SG   . CYS A 1 80 ? 5.101   -8.207  -0.397  1.00 0.00 ?  636  CYS A SG   7  
ATOM 11157 H H    . CYS A 1 80 ? 6.319   -6.313  3.295   1.00 0.00 ?  636  CYS A H    7  
ATOM 11158 H HA   . CYS A 1 80 ? 6.370   -8.936  2.175   1.00 0.00 ?  636  CYS A HA   7  
ATOM 11159 H HB2  . CYS A 1 80 ? 4.553   -7.318  1.727   1.00 0.00 ?  636  CYS A HB2  7  
ATOM 11160 H HB3  . CYS A 1 80 ? 5.700   -6.301  0.867   1.00 0.00 ?  636  CYS A HB3  7  
ATOM 11161 H HG   . CYS A 1 80 ? 6.118   -9.042  -0.562  1.00 0.00 ?  636  CYS A HG   7  
ATOM 11162 N N    . LEU A 1 81 ? 8.810   -6.980  1.544   1.00 0.00 ?  637  LEU A N    7  
ATOM 11163 C CA   . LEU A 1 81 ? 10.108  -6.842  0.902   1.00 0.00 ?  637  LEU A CA   7  
ATOM 11164 C C    . LEU A 1 81 ? 11.141  -7.680  1.644   1.00 0.00 ?  637  LEU A C    7  
ATOM 11165 O O    . LEU A 1 81 ? 12.349  -7.590  1.390   1.00 0.00 ?  637  LEU A O    7  
ATOM 11166 C CB   . LEU A 1 81 ? 10.547  -5.370  0.878   1.00 0.00 ?  637  LEU A CB   7  
ATOM 11167 C CG   . LEU A 1 81 ? 9.654   -4.399  0.095   1.00 0.00 ?  637  LEU A CG   7  
ATOM 11168 C CD1  . LEU A 1 81 ? 10.122  -2.974  0.293   1.00 0.00 ?  637  LEU A CD1  7  
ATOM 11169 C CD2  . LEU A 1 81 ? 9.641   -4.745  -1.383  1.00 0.00 ?  637  LEU A CD2  7  
ATOM 11170 H H    . LEU A 1 81 ? 8.597   -6.384  2.297   1.00 0.00 ?  637  LEU A H    7  
ATOM 11171 H HA   . LEU A 1 81 ? 10.015  -7.202  -0.111  1.00 0.00 ?  637  LEU A HA   7  
ATOM 11172 H HB2  . LEU A 1 81 ? 10.602  -5.022  1.899   1.00 0.00 ?  637  LEU A HB2  7  
ATOM 11173 H HB3  . LEU A 1 81 ? 11.538  -5.328  0.453   1.00 0.00 ?  637  LEU A HB3  7  
ATOM 11174 H HG   . LEU A 1 81 ? 8.644   -4.473  0.471   1.00 0.00 ?  637  LEU A HG   7  
ATOM 11175 H HD11 . LEU A 1 81 ? 9.485   -2.305  -0.270  1.00 0.00 ?  637  LEU A HD11 7  
ATOM 11176 H HD12 . LEU A 1 81 ? 11.140  -2.888  -0.056  1.00 0.00 ?  637  LEU A HD12 7  
ATOM 11177 H HD13 . LEU A 1 81 ? 10.078  -2.720  1.341   1.00 0.00 ?  637  LEU A HD13 7  
ATOM 11178 H HD21 . LEU A 1 81 ? 10.648  -4.712  -1.771  1.00 0.00 ?  637  LEU A HD21 7  
ATOM 11179 H HD22 . LEU A 1 81 ? 9.033   -4.026  -1.910  1.00 0.00 ?  637  LEU A HD22 7  
ATOM 11180 H HD23 . LEU A 1 81 ? 9.228   -5.733  -1.521  1.00 0.00 ?  637  LEU A HD23 7  
ATOM 11181 N N    . GLN A 1 82 ? 10.662  -8.485  2.555   1.00 0.00 ?  638  GLN A N    7  
ATOM 11182 C CA   . GLN A 1 82 ? 11.510  -9.337  3.337   1.00 0.00 ?  638  GLN A CA   7  
ATOM 11183 C C    . GLN A 1 82 ? 11.429  -10.770 2.813   1.00 0.00 ?  638  GLN A C    7  
ATOM 11184 O O    . GLN A 1 82 ? 11.091  -11.005 1.641   1.00 0.00 ?  638  GLN A O    7  
ATOM 11185 C CB   . GLN A 1 82 ? 11.099  -9.300  4.804   1.00 0.00 ?  638  GLN A CB   7  
ATOM 11186 C CG   . GLN A 1 82 ? 11.152  -7.939  5.451   1.00 0.00 ?  638  GLN A CG   7  
ATOM 11187 C CD   . GLN A 1 82 ? 10.879  -8.032  6.927   1.00 0.00 ?  638  GLN A CD   7  
ATOM 11188 O OE1  . GLN A 1 82 ? 9.738   -7.954  7.374   1.00 0.00 ?  638  GLN A OE1  7  
ATOM 11189 N NE2  . GLN A 1 82 ? 11.912  -8.239  7.693   1.00 0.00 ?  638  GLN A NE2  7  
ATOM 11190 H H    . GLN A 1 82 ? 9.693   -8.519  2.696   1.00 0.00 ?  638  GLN A H    7  
ATOM 11191 H HA   . GLN A 1 82 ? 12.524  -8.980  3.246   1.00 0.00 ?  638  GLN A HA   7  
ATOM 11192 H HB2  . GLN A 1 82 ? 10.094  -9.679  4.903   1.00 0.00 ?  638  GLN A HB2  7  
ATOM 11193 H HB3  . GLN A 1 82 ? 11.769  -9.944  5.351   1.00 0.00 ?  638  GLN A HB3  7  
ATOM 11194 H HG2  . GLN A 1 82 ? 12.132  -7.511  5.295   1.00 0.00 ?  638  GLN A HG2  7  
ATOM 11195 H HG3  . GLN A 1 82 ? 10.402  -7.307  4.997   1.00 0.00 ?  638  GLN A HG3  7  
ATOM 11196 H HE21 . GLN A 1 82 ? 12.798  -8.325  7.275   1.00 0.00 ?  638  GLN A HE21 7  
ATOM 11197 H HE22 . GLN A 1 82 ? 11.773  -8.272  8.664   1.00 0.00 ?  638  GLN A HE22 7  
ATOM 11198 N N    . LYS A 1 83 ? 11.747  -11.708 3.672   1.00 0.00 ?  639  LYS A N    7  
ATOM 11199 C CA   . LYS A 1 83 ? 11.762  -13.105 3.342   1.00 0.00 ?  639  LYS A CA   7  
ATOM 11200 C C    . LYS A 1 83 ? 10.403  -13.718 3.666   1.00 0.00 ?  639  LYS A C    7  
ATOM 11201 O O    . LYS A 1 83 ? 9.503   -13.012 4.151   1.00 0.00 ?  639  LYS A O    7  
ATOM 11202 C CB   . LYS A 1 83 ? 12.872  -13.774 4.156   1.00 0.00 ?  639  LYS A CB   7  
ATOM 11203 C CG   . LYS A 1 83 ? 14.213  -13.094 3.958   1.00 0.00 ?  639  LYS A CG   7  
ATOM 11204 C CD   . LYS A 1 83 ? 15.320  -13.713 4.773   1.00 0.00 ?  639  LYS A CD   7  
ATOM 11205 C CE   . LYS A 1 83 ? 16.597  -12.890 4.650   1.00 0.00 ?  639  LYS A CE   7  
ATOM 11206 N NZ   . LYS A 1 83 ? 17.072  -12.772 3.250   1.00 0.00 1  639  LYS A NZ   7  
ATOM 11207 H H    . LYS A 1 83 ? 11.968  -11.467 4.596   1.00 0.00 ?  639  LYS A H    7  
ATOM 11208 H HA   . LYS A 1 83 ? 11.986  -13.209 2.291   1.00 0.00 ?  639  LYS A HA   7  
ATOM 11209 H HB2  . LYS A 1 83 ? 12.614  -13.705 5.202   1.00 0.00 ?  639  LYS A HB2  7  
ATOM 11210 H HB3  . LYS A 1 83 ? 12.965  -14.812 3.875   1.00 0.00 ?  639  LYS A HB3  7  
ATOM 11211 H HG2  . LYS A 1 83 ? 14.484  -13.169 2.916   1.00 0.00 ?  639  LYS A HG2  7  
ATOM 11212 H HG3  . LYS A 1 83 ? 14.104  -12.053 4.222   1.00 0.00 ?  639  LYS A HG3  7  
ATOM 11213 H HD2  . LYS A 1 83 ? 15.017  -13.750 5.809   1.00 0.00 ?  639  LYS A HD2  7  
ATOM 11214 H HD3  . LYS A 1 83 ? 15.510  -14.713 4.414   1.00 0.00 ?  639  LYS A HD3  7  
ATOM 11215 H HE2  . LYS A 1 83 ? 16.401  -11.898 5.028   1.00 0.00 ?  639  LYS A HE2  7  
ATOM 11216 H HE3  . LYS A 1 83 ? 17.368  -13.348 5.251   1.00 0.00 ?  639  LYS A HE3  7  
ATOM 11217 H HZ1  . LYS A 1 83 ? 17.258  -13.712 2.847   1.00 0.00 ?  639  LYS A HZ1  7  
ATOM 11218 H HZ2  . LYS A 1 83 ? 17.954  -12.222 3.231   1.00 0.00 ?  639  LYS A HZ2  7  
ATOM 11219 H HZ3  . LYS A 1 83 ? 16.380  -12.276 2.650   1.00 0.00 ?  639  LYS A HZ3  7  
ATOM 11220 N N    . LYS A 1 84 ? 10.246  -15.006 3.397   1.00 0.00 ?  640  LYS A N    7  
ATOM 11221 C CA   . LYS A 1 84 ? 9.008   -15.717 3.705   1.00 0.00 ?  640  LYS A CA   7  
ATOM 11222 C C    . LYS A 1 84 ? 8.735   -15.635 5.194   1.00 0.00 ?  640  LYS A C    7  
ATOM 11223 O O    . LYS A 1 84 ? 9.643   -15.833 6.008   1.00 0.00 ?  640  LYS A O    7  
ATOM 11224 C CB   . LYS A 1 84 ? 9.094   -17.192 3.280   1.00 0.00 ?  640  LYS A CB   7  
ATOM 11225 C CG   . LYS A 1 84 ? 9.310   -17.419 1.790   1.00 0.00 ?  640  LYS A CG   7  
ATOM 11226 C CD   . LYS A 1 84 ? 8.136   -16.929 0.957   1.00 0.00 ?  640  LYS A CD   7  
ATOM 11227 C CE   . LYS A 1 84 ? 8.412   -17.119 -0.524  1.00 0.00 ?  640  LYS A CE   7  
ATOM 11228 N NZ   . LYS A 1 84 ? 7.270   -16.718 -1.367  1.00 0.00 1  640  LYS A NZ   7  
ATOM 11229 H H    . LYS A 1 84 ? 10.994  -15.487 2.985   1.00 0.00 ?  640  LYS A H    7  
ATOM 11230 H HA   . LYS A 1 84 ? 8.200   -15.236 3.173   1.00 0.00 ?  640  LYS A HA   7  
ATOM 11231 H HB2  . LYS A 1 84 ? 9.911   -17.657 3.811   1.00 0.00 ?  640  LYS A HB2  7  
ATOM 11232 H HB3  . LYS A 1 84 ? 8.175   -17.682 3.567   1.00 0.00 ?  640  LYS A HB3  7  
ATOM 11233 H HG2  . LYS A 1 84 ? 10.197  -16.889 1.479   1.00 0.00 ?  640  LYS A HG2  7  
ATOM 11234 H HG3  . LYS A 1 84 ? 9.446   -18.477 1.617   1.00 0.00 ?  640  LYS A HG3  7  
ATOM 11235 H HD2  . LYS A 1 84 ? 7.251   -17.484 1.225   1.00 0.00 ?  640  LYS A HD2  7  
ATOM 11236 H HD3  . LYS A 1 84 ? 7.979   -15.879 1.152   1.00 0.00 ?  640  LYS A HD3  7  
ATOM 11237 H HE2  . LYS A 1 84 ? 9.271   -16.525 -0.798  1.00 0.00 ?  640  LYS A HE2  7  
ATOM 11238 H HE3  . LYS A 1 84 ? 8.631   -18.162 -0.702  1.00 0.00 ?  640  LYS A HE3  7  
ATOM 11239 H HZ1  . LYS A 1 84 ? 6.445   -17.322 -1.175  1.00 0.00 ?  640  LYS A HZ1  7  
ATOM 11240 H HZ2  . LYS A 1 84 ? 7.520   -16.793 -2.374  1.00 0.00 ?  640  LYS A HZ2  7  
ATOM 11241 H HZ3  . LYS A 1 84 ? 7.006   -15.734 -1.168  1.00 0.00 ?  640  LYS A HZ3  7  
ATOM 11242 N N    . GLN A 1 85 ? 7.524   -15.323 5.547   1.00 0.00 ?  641  GLN A N    7  
ATOM 11243 C CA   . GLN A 1 85 ? 7.166   -15.187 6.925   1.00 0.00 ?  641  GLN A CA   7  
ATOM 11244 C C    . GLN A 1 85 ? 6.908   -16.561 7.519   1.00 0.00 ?  641  GLN A C    7  
ATOM 11245 O O    . GLN A 1 85 ? 6.276   -17.422 6.880   1.00 0.00 ?  641  GLN A O    7  
ATOM 11246 C CB   . GLN A 1 85 ? 5.948   -14.264 7.080   1.00 0.00 ?  641  GLN A CB   7  
ATOM 11247 C CG   . GLN A 1 85 ? 5.581   -13.929 8.524   1.00 0.00 ?  641  GLN A CG   7  
ATOM 11248 C CD   . GLN A 1 85 ? 6.645   -13.113 9.255   1.00 0.00 ?  641  GLN A CD   7  
ATOM 11249 O OE1  . GLN A 1 85 ? 7.844   -13.216 8.977   1.00 0.00 ?  641  GLN A OE1  7  
ATOM 11250 N NE2  . GLN A 1 85 ? 6.221   -12.310 10.191  1.00 0.00 ?  641  GLN A NE2  7  
ATOM 11251 H H    . GLN A 1 85 ? 6.834   -15.201 4.860   1.00 0.00 ?  641  GLN A H    7  
ATOM 11252 H HA   . GLN A 1 85 ? 8.008   -14.746 7.438   1.00 0.00 ?  641  GLN A HA   7  
ATOM 11253 H HB2  . GLN A 1 85 ? 6.155   -13.337 6.565   1.00 0.00 ?  641  GLN A HB2  7  
ATOM 11254 H HB3  . GLN A 1 85 ? 5.098   -14.736 6.611   1.00 0.00 ?  641  GLN A HB3  7  
ATOM 11255 H HG2  . GLN A 1 85 ? 4.661   -13.364 8.525   1.00 0.00 ?  641  GLN A HG2  7  
ATOM 11256 H HG3  . GLN A 1 85 ? 5.429   -14.855 9.058   1.00 0.00 ?  641  GLN A HG3  7  
ATOM 11257 H HE21 . GLN A 1 85 ? 5.253   -12.282 10.360  1.00 0.00 ?  641  GLN A HE21 7  
ATOM 11258 H HE22 . GLN A 1 85 ? 6.878   -11.768 10.674  1.00 0.00 ?  641  GLN A HE22 7  
ATOM 11259 N N    . ARG A 1 86 ? 7.424   -16.777 8.707   1.00 0.00 ?  642  ARG A N    7  
ATOM 11260 C CA   . ARG A 1 86 ? 7.291   -18.046 9.382   1.00 0.00 ?  642  ARG A CA   7  
ATOM 11261 C C    . ARG A 1 86 ? 5.891   -18.267 9.897   1.00 0.00 ?  642  ARG A C    7  
ATOM 11262 O O    . ARG A 1 86 ? 5.073   -17.342 9.979   1.00 0.00 ?  642  ARG A O    7  
ATOM 11263 C CB   . ARG A 1 86 ? 8.246   -18.172 10.569  1.00 0.00 ?  642  ARG A CB   7  
ATOM 11264 C CG   . ARG A 1 86 ? 8.018   -17.132 11.658  1.00 0.00 ?  642  ARG A CG   7  
ATOM 11265 C CD   . ARG A 1 86 ? 8.476   -17.650 13.003  1.00 0.00 ?  642  ARG A CD   7  
ATOM 11266 N NE   . ARG A 1 86 ? 7.629   -18.762 13.465  1.00 0.00 ?  642  ARG A NE   7  
ATOM 11267 C CZ   . ARG A 1 86 ? 7.968   -19.669 14.379  1.00 0.00 ?  642  ARG A CZ   7  
ATOM 11268 N NH1  . ARG A 1 86 ? 9.139   -19.594 15.014  1.00 0.00 1  642  ARG A NH1  7  
ATOM 11269 N NH2  . ARG A 1 86 ? 7.115   -20.632 14.666  1.00 0.00 ?  642  ARG A NH2  7  
ATOM 11270 H H    . ARG A 1 86 ? 7.914   -16.051 9.144   1.00 0.00 ?  642  ARG A H    7  
ATOM 11271 H HA   . ARG A 1 86 ? 7.534   -18.823 8.674   1.00 0.00 ?  642  ARG A HA   7  
ATOM 11272 H HB2  . ARG A 1 86 ? 8.121   -19.148 11.011  1.00 0.00 ?  642  ARG A HB2  7  
ATOM 11273 H HB3  . ARG A 1 86 ? 9.261   -18.077 10.215  1.00 0.00 ?  642  ARG A HB3  7  
ATOM 11274 H HG2  . ARG A 1 86 ? 8.567   -16.235 11.415  1.00 0.00 ?  642  ARG A HG2  7  
ATOM 11275 H HG3  . ARG A 1 86 ? 6.962   -16.908 11.708  1.00 0.00 ?  642  ARG A HG3  7  
ATOM 11276 H HD2  . ARG A 1 86 ? 9.492   -18.003 12.912  1.00 0.00 ?  642  ARG A HD2  7  
ATOM 11277 H HD3  . ARG A 1 86 ? 8.432   -16.854 13.731  1.00 0.00 ?  642  ARG A HD3  7  
ATOM 11278 H HE   . ARG A 1 86 ? 6.735   -18.836 13.053  1.00 0.00 ?  642  ARG A HE   7  
ATOM 11279 H HH11 . ARG A 1 86 ? 9.801   -18.858 14.840  1.00 0.00 ?  642  ARG A HH11 7  
ATOM 11280 H HH12 . ARG A 1 86 ? 9.422   -20.279 15.690  1.00 0.00 ?  642  ARG A HH12 7  
ATOM 11281 H HH21 . ARG A 1 86 ? 6.222   -20.652 14.188  1.00 0.00 ?  642  ARG A HH21 7  
ATOM 11282 H HH22 . ARG A 1 86 ? 7.300   -21.375 15.313  1.00 0.00 ?  642  ARG A HH22 7  
ATOM 11283 N N    . LYS A 1 87 ? 5.646   -19.480 10.258  1.00 0.00 ?  643  LYS A N    7  
ATOM 11284 C CA   . LYS A 1 87 ? 4.433   -19.887 10.867  1.00 0.00 ?  643  LYS A CA   7  
ATOM 11285 C C    . LYS A 1 87 ? 4.821   -20.659 12.099  1.00 0.00 ?  643  LYS A C    7  
ATOM 11286 O O    . LYS A 1 87 ? 4.947   -20.050 13.166  1.00 0.00 ?  643  LYS A O    7  
ATOM 11287 C CB   . LYS A 1 87 ? 3.615   -20.755 9.907   1.00 0.00 ?  643  LYS A CB   7  
ATOM 11288 C CG   . LYS A 1 87 ? 3.133   -20.021 8.658   1.00 0.00 ?  643  LYS A CG   7  
ATOM 11289 C CD   . LYS A 1 87 ? 2.426   -20.948 7.662   1.00 0.00 ?  643  LYS A CD   7  
ATOM 11290 C CE   . LYS A 1 87 ? 3.393   -21.811 6.827   1.00 0.00 ?  643  LYS A CE   7  
ATOM 11291 N NZ   . LYS A 1 87 ? 4.214   -22.772 7.612   1.00 0.00 1  643  LYS A NZ   7  
ATOM 11292 O OXT  . LYS A 1 87 ? 5.113   -21.854 11.983  1.00 0.00 ?  643  LYS A OXT  7  
ATOM 11293 H H    . LYS A 1 87 ? 6.327   -20.171 10.118  1.00 0.00 ?  643  LYS A H    7  
ATOM 11294 H HA   . LYS A 1 87 ? 3.870   -19.008 11.146  1.00 0.00 ?  643  LYS A HA   7  
ATOM 11295 H HB2  . LYS A 1 87 ? 4.222   -21.594 9.601   1.00 0.00 ?  643  LYS A HB2  7  
ATOM 11296 H HB3  . LYS A 1 87 ? 2.749   -21.130 10.434  1.00 0.00 ?  643  LYS A HB3  7  
ATOM 11297 H HG2  . LYS A 1 87 ? 2.442   -19.247 8.957   1.00 0.00 ?  643  LYS A HG2  7  
ATOM 11298 H HG3  . LYS A 1 87 ? 3.985   -19.566 8.174   1.00 0.00 ?  643  LYS A HG3  7  
ATOM 11299 H HD2  . LYS A 1 87 ? 1.771   -21.608 8.210   1.00 0.00 ?  643  LYS A HD2  7  
ATOM 11300 H HD3  . LYS A 1 87 ? 1.833   -20.341 6.992   1.00 0.00 ?  643  LYS A HD3  7  
ATOM 11301 H HE2  . LYS A 1 87 ? 2.816   -22.374 6.110   1.00 0.00 ?  643  LYS A HE2  7  
ATOM 11302 H HE3  . LYS A 1 87 ? 4.053   -21.145 6.292   1.00 0.00 ?  643  LYS A HE3  7  
ATOM 11303 H HZ1  . LYS A 1 87 ? 3.619   -23.343 8.242   1.00 0.00 ?  643  LYS A HZ1  7  
ATOM 11304 H HZ2  . LYS A 1 87 ? 4.967   -22.298 8.151   1.00 0.00 ?  643  LYS A HZ2  7  
ATOM 11305 H HZ3  . LYS A 1 87 ? 4.683   -23.421 6.948   1.00 0.00 ?  643  LYS A HZ3  7  
ATOM 11306 N N    . ARG B 2 1  ? -0.010  9.982   -18.133 1.00 0.00 ?  1591 ARG B N    7  
ATOM 11307 C CA   . ARG B 2 1  ? 0.041   9.582   -16.739 1.00 0.00 ?  1591 ARG B CA   7  
ATOM 11308 C C    . ARG B 2 1  ? -1.358  9.426   -16.198 1.00 0.00 ?  1591 ARG B C    7  
ATOM 11309 O O    . ARG B 2 1  ? -2.146  10.362  -16.231 1.00 0.00 ?  1591 ARG B O    7  
ATOM 11310 C CB   . ARG B 2 1  ? 0.765   10.622  -15.883 1.00 0.00 ?  1591 ARG B CB   7  
ATOM 11311 C CG   . ARG B 2 1  ? 2.244   10.783  -16.144 1.00 0.00 ?  1591 ARG B CG   7  
ATOM 11312 C CD   . ARG B 2 1  ? 2.793   11.913  -15.295 1.00 0.00 ?  1591 ARG B CD   7  
ATOM 11313 N NE   . ARG B 2 1  ? 4.247   12.041  -15.389 1.00 0.00 ?  1591 ARG B NE   7  
ATOM 11314 C CZ   . ARG B 2 1  ? 4.911   13.202  -15.467 1.00 0.00 ?  1591 ARG B CZ   7  
ATOM 11315 N NH1  . ARG B 2 1  ? 4.261   14.331  -15.733 1.00 0.00 1  1591 ARG B NH1  7  
ATOM 11316 N NH2  . ARG B 2 1  ? 6.227   13.217  -15.333 1.00 0.00 ?  1591 ARG B NH2  7  
ATOM 11317 H H1   . ARG B 2 1  ? 0.933   10.082  -18.556 1.00 0.00 ?  1591 ARG B H1   7  
ATOM 11318 H HA   . ARG B 2 1  ? 0.567   8.643   -16.676 1.00 0.00 ?  1591 ARG B HA   7  
ATOM 11319 H HB2  . ARG B 2 1  ? 0.301   11.585  -16.034 1.00 0.00 ?  1591 ARG B HB2  7  
ATOM 11320 H HB3  . ARG B 2 1  ? 0.637   10.347  -14.847 1.00 0.00 ?  1591 ARG B HB3  7  
ATOM 11321 H HG2  . ARG B 2 1  ? 2.752   9.863   -15.889 1.00 0.00 ?  1591 ARG B HG2  7  
ATOM 11322 H HG3  . ARG B 2 1  ? 2.404   11.011  -17.187 1.00 0.00 ?  1591 ARG B HG3  7  
ATOM 11323 H HD2  . ARG B 2 1  ? 2.336   12.838  -15.611 1.00 0.00 ?  1591 ARG B HD2  7  
ATOM 11324 H HD3  . ARG B 2 1  ? 2.526   11.724  -14.266 1.00 0.00 ?  1591 ARG B HD3  7  
ATOM 11325 H HE   . ARG B 2 1  ? 4.734   11.187  -15.321 1.00 0.00 ?  1591 ARG B HE   7  
ATOM 11326 H HH11 . ARG B 2 1  ? 3.270   14.360  -15.889 1.00 0.00 ?  1591 ARG B HH11 7  
ATOM 11327 H HH12 . ARG B 2 1  ? 4.726   15.217  -15.805 1.00 0.00 ?  1591 ARG B HH12 7  
ATOM 11328 H HH21 . ARG B 2 1  ? 6.754   12.379  -15.173 1.00 0.00 ?  1591 ARG B HH21 7  
ATOM 11329 H HH22 . ARG B 2 1  ? 6.754   14.070  -15.374 1.00 0.00 ?  1591 ARG B HH22 7  
ATOM 11330 N N    . SER B 2 2  ? -1.680  8.267   -15.718 1.00 0.00 ?  1592 SER B N    7  
ATOM 11331 C CA   . SER B 2 2  ? -2.938  8.063   -15.067 1.00 0.00 ?  1592 SER B CA   7  
ATOM 11332 C C    . SER B 2 2  ? -2.692  8.161   -13.569 1.00 0.00 ?  1592 SER B C    7  
ATOM 11333 O O    . SER B 2 2  ? -2.185  7.221   -12.942 1.00 0.00 ?  1592 SER B O    7  
ATOM 11334 C CB   . SER B 2 2  ? -3.511  6.703   -15.444 1.00 0.00 ?  1592 SER B CB   7  
ATOM 11335 O OG   . SER B 2 2  ? -3.550  6.555   -16.862 1.00 0.00 ?  1592 SER B OG   7  
ATOM 11336 H H    . SER B 2 2  ? -1.059  7.510   -15.785 1.00 0.00 ?  1592 SER B H    7  
ATOM 11337 H HA   . SER B 2 2  ? -3.612  8.850   -15.376 1.00 0.00 ?  1592 SER B HA   7  
ATOM 11338 H HB2  . SER B 2 2  ? -2.900  5.921   -15.020 1.00 0.00 ?  1592 SER B HB2  7  
ATOM 11339 H HB3  . SER B 2 2  ? -4.517  6.621   -15.059 1.00 0.00 ?  1592 SER B HB3  7  
ATOM 11340 H HG   . SER B 2 2  ? -3.899  7.381   -17.223 1.00 0.00 ?  1592 SER B HG   7  
ATOM 11341 N N    . VAL B 2 3  ? -2.956  9.315   -13.012 1.00 0.00 ?  1593 VAL B N    7  
ATOM 11342 C CA   . VAL B 2 3  ? -2.686  9.538   -11.622 1.00 0.00 ?  1593 VAL B CA   7  
ATOM 11343 C C    . VAL B 2 3  ? -3.883  9.144   -10.782 1.00 0.00 ?  1593 VAL B C    7  
ATOM 11344 O O    . VAL B 2 3  ? -4.850  9.895   -10.659 1.00 0.00 ?  1593 VAL B O    7  
ATOM 11345 C CB   . VAL B 2 3  ? -2.257  11.003  -11.317 1.00 0.00 ?  1593 VAL B CB   7  
ATOM 11346 C CG1  . VAL B 2 3  ? -1.907  11.170  -9.842  1.00 0.00 ?  1593 VAL B CG1  7  
ATOM 11347 C CG2  . VAL B 2 3  ? -1.077  11.416  -12.191 1.00 0.00 ?  1593 VAL B CG2  7  
ATOM 11348 H H    . VAL B 2 3  ? -3.370  10.037  -13.535 1.00 0.00 ?  1593 VAL B H    7  
ATOM 11349 H HA   . VAL B 2 3  ? -1.870  8.882   -11.355 1.00 0.00 ?  1593 VAL B HA   7  
ATOM 11350 H HB   . VAL B 2 3  ? -3.088  11.656  -11.534 1.00 0.00 ?  1593 VAL B HB   7  
ATOM 11351 H HG11 . VAL B 2 3  ? -2.767  10.918  -9.239  1.00 0.00 ?  1593 VAL B HG11 7  
ATOM 11352 H HG12 . VAL B 2 3  ? -1.621  12.193  -9.651  1.00 0.00 ?  1593 VAL B HG12 7  
ATOM 11353 H HG13 . VAL B 2 3  ? -1.085  10.515  -9.592  1.00 0.00 ?  1593 VAL B HG13 7  
ATOM 11354 H HG21 . VAL B 2 3  ? -1.358  11.347  -13.231 1.00 0.00 ?  1593 VAL B HG21 7  
ATOM 11355 H HG22 . VAL B 2 3  ? -0.241  10.760  -12.002 1.00 0.00 ?  1593 VAL B HG22 7  
ATOM 11356 H HG23 . VAL B 2 3  ? -0.796  12.433  -11.962 1.00 0.00 ?  1593 VAL B HG23 7  
ATOM 11357 N N    . LYS B 2 4  ? -3.842  7.923   -10.315 1.00 0.00 ?  1594 LYS B N    7  
ATOM 11358 C CA   . LYS B 2 4  ? -4.814  7.366   -9.401  1.00 0.00 ?  1594 LYS B CA   7  
ATOM 11359 C C    . LYS B 2 4  ? -4.183  6.171   -8.757  1.00 0.00 ?  1594 LYS B C    7  
ATOM 11360 O O    . LYS B 2 4  ? -3.410  5.447   -9.390  1.00 0.00 ?  1594 LYS B O    7  
ATOM 11361 C CB   . LYS B 2 4  ? -6.129  6.960   -10.105 1.00 0.00 ?  1594 LYS B CB   7  
ATOM 11362 C CG   . LYS B 2 4  ? -6.008  5.868   -11.153 1.00 0.00 ?  1594 LYS B CG   7  
ATOM 11363 C CD   . LYS B 2 4  ? -7.380  5.418   -11.599 1.00 0.00 ?  1594 LYS B CD   7  
ATOM 11364 C CE   . LYS B 2 4  ? -7.306  4.299   -12.616 1.00 0.00 ?  1594 LYS B CE   7  
ATOM 11365 N NZ   . LYS B 2 4  ? -8.649  3.799   -12.966 1.00 0.00 1  1594 LYS B NZ   7  
ATOM 11366 H H    . LYS B 2 4  ? -3.118  7.331   -10.612 1.00 0.00 ?  1594 LYS B H    7  
ATOM 11367 H HA   . LYS B 2 4  ? -5.025  8.046   -8.580  1.00 0.00 ?  1594 LYS B HA   7  
ATOM 11368 H HB2  . LYS B 2 4  ? -6.826  6.620   -9.354  1.00 0.00 ?  1594 LYS B HB2  7  
ATOM 11369 H HB3  . LYS B 2 4  ? -6.544  7.839   -10.577 1.00 0.00 ?  1594 LYS B HB3  7  
ATOM 11370 H HG2  . LYS B 2 4  ? -5.465  6.254   -12.004 1.00 0.00 ?  1594 LYS B HG2  7  
ATOM 11371 H HG3  . LYS B 2 4  ? -5.476  5.027   -10.730 1.00 0.00 ?  1594 LYS B HG3  7  
ATOM 11372 H HD2  . LYS B 2 4  ? -7.931  5.070   -10.739 1.00 0.00 ?  1594 LYS B HD2  7  
ATOM 11373 H HD3  . LYS B 2 4  ? -7.894  6.263   -12.036 1.00 0.00 ?  1594 LYS B HD3  7  
ATOM 11374 H HE2  . LYS B 2 4  ? -6.825  4.678   -13.504 1.00 0.00 ?  1594 LYS B HE2  7  
ATOM 11375 H HE3  . LYS B 2 4  ? -6.720  3.491   -12.205 1.00 0.00 ?  1594 LYS B HE3  7  
ATOM 11376 H HZ1  . LYS B 2 4  ? -8.601  3.028   -13.663 1.00 0.00 ?  1594 LYS B HZ1  7  
ATOM 11377 H HZ2  . LYS B 2 4  ? -9.264  4.534   -13.367 1.00 0.00 ?  1594 LYS B HZ2  7  
ATOM 11378 H HZ3  . LYS B 2 4  ? -9.119  3.404   -12.125 1.00 0.00 ?  1594 LYS B HZ3  7  
ATOM 11379 N N    . VAL B 2 5  ? -4.467  5.981   -7.520  1.00 0.00 ?  1595 VAL B N    7  
ATOM 11380 C CA   . VAL B 2 5  ? -3.875  4.902   -6.774  1.00 0.00 ?  1595 VAL B CA   7  
ATOM 11381 C C    . VAL B 2 5  ? -4.927  3.787   -6.618  1.00 0.00 ?  1595 VAL B C    7  
ATOM 11382 O O    . VAL B 2 5  ? -4.639  2.713   -6.114  1.00 0.00 ?  1595 VAL B O    7  
ATOM 11383 C CB   . VAL B 2 5  ? -3.324  5.414   -5.371  1.00 0.00 ?  1595 VAL B CB   7  
ATOM 11384 C CG1  . VAL B 2 5  ? -2.459  4.372   -4.652  1.00 0.00 ?  1595 VAL B CG1  7  
ATOM 11385 C CG2  . VAL B 2 5  ? -2.551  6.749   -5.535  1.00 0.00 ?  1595 VAL B CG2  7  
ATOM 11386 H H    . VAL B 2 5  ? -5.116  6.577   -7.091  1.00 0.00 ?  1595 VAL B H    7  
ATOM 11387 H HA   . VAL B 2 5  ? -3.053  4.521   -7.364  1.00 0.00 ?  1595 VAL B HA   7  
ATOM 11388 H HB   . VAL B 2 5  ? -4.140  5.595   -4.683  1.00 0.00 ?  1595 VAL B HB   7  
ATOM 11389 H HG11 . VAL B 2 5  ? -2.209  4.755   -3.675  1.00 0.00 ?  1595 VAL B HG11 7  
ATOM 11390 H HG12 . VAL B 2 5  ? -1.549  4.197   -5.205  1.00 0.00 ?  1595 VAL B HG12 7  
ATOM 11391 H HG13 . VAL B 2 5  ? -2.932  3.402   -4.552  1.00 0.00 ?  1595 VAL B HG13 7  
ATOM 11392 H HG21 . VAL B 2 5  ? -1.810  6.714   -6.342  1.00 0.00 ?  1595 VAL B HG21 7  
ATOM 11393 H HG22 . VAL B 2 5  ? -2.083  6.965   -4.577  1.00 0.00 ?  1595 VAL B HG22 7  
ATOM 11394 H HG23 . VAL B 2 5  ? -3.259  7.537   -5.739  1.00 0.00 ?  1595 VAL B HG23 7  
ATOM 11395 N N    . LYS B 2 6  ? -6.144  4.077   -7.128  1.00 0.00 ?  1596 LYS B N    7  
ATOM 11396 C CA   . LYS B 2 6  ? -7.329  3.188   -7.046  1.00 0.00 ?  1596 LYS B CA   7  
ATOM 11397 C C    . LYS B 2 6  ? -6.974  1.802   -7.608  1.00 0.00 ?  1596 LYS B C    7  
ATOM 11398 O O    . LYS B 2 6  ? -6.750  1.646   -8.813  1.00 0.00 ?  1596 LYS B O    7  
ATOM 11399 C CB   . LYS B 2 6  ? -8.498  3.852   -7.812  1.00 0.00 ?  1596 LYS B CB   7  
ATOM 11400 C CG   . LYS B 2 6  ? -8.796  5.305   -7.345  1.00 0.00 ?  1596 LYS B CG   7  
ATOM 11401 C CD   . LYS B 2 6  ? -9.645  5.419   -6.054  1.00 0.00 ?  1596 LYS B CD   7  
ATOM 11402 C CE   . LYS B 2 6  ? -11.124 5.368   -6.361  1.00 0.00 ?  1596 LYS B CE   7  
ATOM 11403 N NZ   . LYS B 2 6  ? -11.922 5.369   -5.128  1.00 0.00 1  1596 LYS B NZ   7  
ATOM 11404 H H    . LYS B 2 6  ? -6.243  4.928   -7.598  1.00 0.00 ?  1596 LYS B H    7  
ATOM 11405 H HA   . LYS B 2 6  ? -7.590  3.084   -6.004  1.00 0.00 ?  1596 LYS B HA   7  
ATOM 11406 H HB2  . LYS B 2 6  ? -8.255  3.872   -8.864  1.00 0.00 ?  1596 LYS B HB2  7  
ATOM 11407 H HB3  . LYS B 2 6  ? -9.392  3.262   -7.665  1.00 0.00 ?  1596 LYS B HB3  7  
ATOM 11408 H HG2  . LYS B 2 6  ? -7.855  5.804   -7.165  1.00 0.00 ?  1596 LYS B HG2  7  
ATOM 11409 H HG3  . LYS B 2 6  ? -9.307  5.818   -8.147  1.00 0.00 ?  1596 LYS B HG3  7  
ATOM 11410 H HD2  . LYS B 2 6  ? -9.466  4.614   -5.351  1.00 0.00 ?  1596 LYS B HD2  7  
ATOM 11411 H HD3  . LYS B 2 6  ? -9.457  6.346   -5.533  1.00 0.00 ?  1596 LYS B HD3  7  
ATOM 11412 H HE2  . LYS B 2 6  ? -11.390 6.230   -6.955  1.00 0.00 ?  1596 LYS B HE2  7  
ATOM 11413 H HE3  . LYS B 2 6  ? -11.332 4.466   -6.916  1.00 0.00 ?  1596 LYS B HE3  7  
ATOM 11414 H HZ1  . LYS B 2 6  ? -11.628 6.151   -4.510  1.00 0.00 ?  1596 LYS B HZ1  7  
ATOM 11415 H HZ2  . LYS B 2 6  ? -11.812 4.448   -4.646  1.00 0.00 ?  1596 LYS B HZ2  7  
ATOM 11416 H HZ3  . LYS B 2 6  ? -12.932 5.487   -5.351  1.00 0.00 ?  1596 LYS B HZ3  7  
ATOM 11417 N N    . ILE B 2 7  ? -6.869  0.805   -6.722  1.00 0.00 ?  1597 ILE B N    7  
ATOM 11418 C CA   . ILE B 2 7  ? -6.340  -0.477  -7.128  1.00 0.00 ?  1597 ILE B CA   7  
ATOM 11419 C C    . ILE B 2 7  ? -7.312  -1.384  -7.949  1.00 0.00 ?  1597 ILE B C    7  
ATOM 11420 O O    . ILE B 2 7  ? -7.165  -1.490  -9.170  1.00 0.00 ?  1597 ILE B O    7  
ATOM 11421 C CB   . ILE B 2 7  ? -5.628  -1.283  -5.968  1.00 0.00 ?  1597 ILE B CB   7  
ATOM 11422 C CG1  . ILE B 2 7  ? -4.786  -2.382  -6.530  1.00 0.00 ?  1597 ILE B CG1  7  
ATOM 11423 C CG2  . ILE B 2 7  ? -6.606  -1.923  -5.003  1.00 0.00 ?  1597 ILE B CG2  7  
ATOM 11424 C CD1  . ILE B 2 7  ? -3.740  -1.934  -7.529  1.00 0.00 ?  1597 ILE B CD1  7  
ATOM 11425 H H    . ILE B 2 7  ? -7.101  0.994   -5.793  1.00 0.00 ?  1597 ILE B H    7  
ATOM 11426 H HA   . ILE B 2 7  ? -5.549  -0.124  -7.766  1.00 0.00 ?  1597 ILE B HA   7  
ATOM 11427 H HB   . ILE B 2 7  ? -4.968  -0.625  -5.420  1.00 0.00 ?  1597 ILE B HB   7  
ATOM 11428 H HG12 . ILE B 2 7  ? -4.282  -2.762  -5.651  1.00 0.00 ?  1597 ILE B HG12 7  
ATOM 11429 H HG13 . ILE B 2 7  ? -5.424  -3.136  -6.966  1.00 0.00 ?  1597 ILE B HG13 7  
ATOM 11430 H HG21 . ILE B 2 7  ? -6.103  -2.470  -4.220  1.00 0.00 ?  1597 ILE B HG21 7  
ATOM 11431 H HG22 . ILE B 2 7  ? -7.232  -2.611  -5.551  1.00 0.00 ?  1597 ILE B HG22 7  
ATOM 11432 H HG23 . ILE B 2 7  ? -7.231  -1.158  -4.566  1.00 0.00 ?  1597 ILE B HG23 7  
ATOM 11433 H HD11 . ILE B 2 7  ? -4.216  -1.499  -8.395  1.00 0.00 ?  1597 ILE B HD11 7  
ATOM 11434 H HD12 . ILE B 2 7  ? -3.169  -2.799  -7.833  1.00 0.00 ?  1597 ILE B HD12 7  
ATOM 11435 H HD13 . ILE B 2 7  ? -3.083  -1.210  -7.069  1.00 0.00 ?  1597 ILE B HD13 7  
ATOM 11436 N N    . LYS B 2 8  ? -8.329  -1.961  -7.264  1.00 0.00 ?  1598 LYS B N    7  
ATOM 11437 C CA   . LYS B 2 8  ? -9.176  -3.025  -7.773  1.00 0.00 ?  1598 LYS B CA   7  
ATOM 11438 C C    . LYS B 2 8  ? -8.307  -4.197  -8.225  1.00 0.00 ?  1598 LYS B C    7  
ATOM 11439 O O    . LYS B 2 8  ? -7.967  -4.312  -9.391  1.00 0.00 ?  1598 LYS B O    7  
ATOM 11440 C CB   . LYS B 2 8  ? -10.128 -2.541  -8.887  1.00 0.00 ?  1598 LYS B CB   7  
ATOM 11441 C CG   . LYS B 2 8  ? -11.182 -1.508  -8.460  1.00 0.00 ?  1598 LYS B CG   7  
ATOM 11442 C CD   . LYS B 2 8  ? -12.206 -2.108  -7.551  1.00 0.00 ?  1598 LYS B CD   7  
ATOM 11443 C CE   . LYS B 2 8  ? -13.483 -1.326  -7.516  1.00 0.00 ?  1598 LYS B CE   7  
ATOM 11444 N NZ   . LYS B 2 8  ? -14.638 -2.137  -7.053  1.00 0.00 1  1598 LYS B NZ   7  
ATOM 11445 H H    . LYS B 2 8  ? -8.513  -1.650  -6.357  1.00 0.00 ?  1598 LYS B H    7  
ATOM 11446 H HA   . LYS B 2 8  ? -9.743  -3.432  -6.941  1.00 0.00 ?  1598 LYS B HA   7  
ATOM 11447 H HB2  . LYS B 2 8  ? -9.534  -2.099  -9.672  1.00 0.00 ?  1598 LYS B HB2  7  
ATOM 11448 H HB3  . LYS B 2 8  ? -10.643 -3.402  -9.290  1.00 0.00 ?  1598 LYS B HB3  7  
ATOM 11449 H HG2  . LYS B 2 8  ? -10.675 -0.783  -7.837  1.00 0.00 ?  1598 LYS B HG2  7  
ATOM 11450 H HG3  . LYS B 2 8  ? -11.658 -1.049  -9.314  1.00 0.00 ?  1598 LYS B HG3  7  
ATOM 11451 H HD2  . LYS B 2 8  ? -12.354 -3.169  -7.618  1.00 0.00 ?  1598 LYS B HD2  7  
ATOM 11452 H HD3  . LYS B 2 8  ? -11.750 -1.834  -6.610  1.00 0.00 ?  1598 LYS B HD3  7  
ATOM 11453 H HE2  . LYS B 2 8  ? -13.245 -0.630  -6.725  1.00 0.00 ?  1598 LYS B HE2  7  
ATOM 11454 H HE3  . LYS B 2 8  ? -13.677 -0.823  -8.450  1.00 0.00 ?  1598 LYS B HE3  7  
ATOM 11455 H HZ1  . LYS B 2 8  ? -14.541 -2.539  -6.092  1.00 0.00 ?  1598 LYS B HZ1  7  
ATOM 11456 H HZ2  . LYS B 2 8  ? -14.793 -2.932  -7.703  1.00 0.00 ?  1598 LYS B HZ2  7  
ATOM 11457 H HZ3  . LYS B 2 8  ? -15.500 -1.557  -7.067  1.00 0.00 ?  1598 LYS B HZ3  7  
ATOM 11458 N N    . LEU B 2 9  ? -7.869  -5.009  -7.258  1.00 0.00 ?  1599 LEU B N    7  
ATOM 11459 C CA   . LEU B 2 9  ? -7.072  -6.188  -7.568  1.00 0.00 ?  1599 LEU B CA   7  
AT